data_1AVG
# 
_entry.id   1AVG 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1AVG         
WWPDB D_1000171306 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1AVG 
_pdbx_database_status.recvd_initial_deposition_date   1997-09-16 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    BNL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Fuentes-Prior, P.' 1 
'Huber, R.'         2 
'Bode, W.'          3 
# 
_citation.id                        primary 
_citation.title                     
'Structure of the thrombin complex with triabin, a lipocalin-like exosite-binding inhibitor derived from a triatomine bug.' 
_citation.journal_abbrev            Proc.Natl.Acad.Sci.USA 
_citation.journal_volume            94 
_citation.page_first                11845 
_citation.page_last                 11850 
_citation.year                      1997 
_citation.journal_id_ASTM           PNASA6 
_citation.country                   US 
_citation.journal_id_ISSN           0027-8424 
_citation.journal_id_CSD            0040 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   9342325 
_citation.pdbx_database_id_DOI      10.1073/pnas.94.22.11845 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Fuentes-Prior, P.'   1 
primary 'Noeske-Jungblut, C.' 2 
primary 'Donner, P.'          3 
primary 'Schleuning, W.D.'    4 
primary 'Huber, R.'           5 
primary 'Bode, W.'            6 
# 
_cell.entry_id           1AVG 
_cell.length_a           44.840 
_cell.length_b           67.230 
_cell.length_c           183.490 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1AVG 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer nat THROMBIN 4792.293  1   3.4.21.5 ? ? 
'THE C-TERMINAL SEGMENT OF THE L-CHAIN OF ONE THROMBIN MOLECULE IS INSERTED IN THE ACTIVE SITE OF A NEIGHBORING THROMBIN MOLECULE' 
2 polymer nat THROMBIN 29772.422 1   3.4.21.5 ? ? 
'THE C-TERMINAL SEGMENT OF THE L-CHAIN OF ONE THROMBIN MOLECULE IS INSERTED IN THE ACTIVE SITE OF A NEIGHBORING THROMBIN MOLECULE' 
3 polymer man TRIABIN  16039.603 1   ?        ? ? ? 
4 water   nat water    18.015    171 ?        ? ? ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no FFNEKTFGAGEADCGLRPLFEKKQVQDQTEKELFESYIEGR FFNEKTFGAGEADCGLRPLFEKKQVQDQTEKELFESYIEGR L ? 
2 'polypeptide(L)' no no 
;IVEGQDAEVGLSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPWDKNFTVDDLLVRIGKHSRTRYERKVEKISM
LDKIYIHPRYNWKENLDRDIALLKLKRPIELSDYIHPVCLPDKQTAAKLLHAGFKGRVTGWGNRRETWTTSVAEVQPSVL
QVVNLPLVERPVCKASTRIRITDNMFCAGYKPGEGKRGDACEGDSGGPFVMKSPYNNRWYQMGIVSWGEGCDRDGKYGFY
THVFRLKKWIQKVIDRLGS
;
;IVEGQDAEVGLSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPWDKNFTVDDLLVRIGKHSRTRYERKVEKISM
LDKIYIHPRYNWKENLDRDIALLKLKRPIELSDYIHPVCLPDKQTAAKLLHAGFKGRVTGWGNRRETWTTSVAEVQPSVL
QVVNLPLVERPVCKASTRIRITDNMFCAGYKPGEGKRGDACEGDSGGPFVMKSPYNNRWYQMGIVSWGEGCDRDGKYGFY
THVFRLKKWIQKVIDRLGS
;
H ? 
3 'polypeptide(L)' no no 
;AEGDDCSIEKAMGDFKPEEFFNGTWYLAHGPGVTSPAVCQKFTTSGSKGFTQIVEIGYNKFESNVKFQCNQVDNKNGEQY
SFKCKSSDNTEFEADFTFISVSYDNFALVCRSITFTSQPKEDRYLVFERTKSDTDPDAKEIC
;
;AEGDDCSIEKAMGDFKPEEFFNGTWYLAHGPGVTSPAVCQKFTTSGSKGFTQIVEIGYNKFESNVKFQCNQVDNKNGEQY
SFKCKSSDNTEFEADFTFISVSYDNFALVCRSITFTSQPKEDRYLVFERTKSDTDPDAKEIC
;
I ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   PHE n 
1 2   PHE n 
1 3   ASN n 
1 4   GLU n 
1 5   LYS n 
1 6   THR n 
1 7   PHE n 
1 8   GLY n 
1 9   ALA n 
1 10  GLY n 
1 11  GLU n 
1 12  ALA n 
1 13  ASP n 
1 14  CYS n 
1 15  GLY n 
1 16  LEU n 
1 17  ARG n 
1 18  PRO n 
1 19  LEU n 
1 20  PHE n 
1 21  GLU n 
1 22  LYS n 
1 23  LYS n 
1 24  GLN n 
1 25  VAL n 
1 26  GLN n 
1 27  ASP n 
1 28  GLN n 
1 29  THR n 
1 30  GLU n 
1 31  LYS n 
1 32  GLU n 
1 33  LEU n 
1 34  PHE n 
1 35  GLU n 
1 36  SER n 
1 37  TYR n 
1 38  ILE n 
1 39  GLU n 
1 40  GLY n 
1 41  ARG n 
2 1   ILE n 
2 2   VAL n 
2 3   GLU n 
2 4   GLY n 
2 5   GLN n 
2 6   ASP n 
2 7   ALA n 
2 8   GLU n 
2 9   VAL n 
2 10  GLY n 
2 11  LEU n 
2 12  SER n 
2 13  PRO n 
2 14  TRP n 
2 15  GLN n 
2 16  VAL n 
2 17  MET n 
2 18  LEU n 
2 19  PHE n 
2 20  ARG n 
2 21  LYS n 
2 22  SER n 
2 23  PRO n 
2 24  GLN n 
2 25  GLU n 
2 26  LEU n 
2 27  LEU n 
2 28  CYS n 
2 29  GLY n 
2 30  ALA n 
2 31  SER n 
2 32  LEU n 
2 33  ILE n 
2 34  SER n 
2 35  ASP n 
2 36  ARG n 
2 37  TRP n 
2 38  VAL n 
2 39  LEU n 
2 40  THR n 
2 41  ALA n 
2 42  ALA n 
2 43  HIS n 
2 44  CYS n 
2 45  LEU n 
2 46  LEU n 
2 47  TYR n 
2 48  PRO n 
2 49  PRO n 
2 50  TRP n 
2 51  ASP n 
2 52  LYS n 
2 53  ASN n 
2 54  PHE n 
2 55  THR n 
2 56  VAL n 
2 57  ASP n 
2 58  ASP n 
2 59  LEU n 
2 60  LEU n 
2 61  VAL n 
2 62  ARG n 
2 63  ILE n 
2 64  GLY n 
2 65  LYS n 
2 66  HIS n 
2 67  SER n 
2 68  ARG n 
2 69  THR n 
2 70  ARG n 
2 71  TYR n 
2 72  GLU n 
2 73  ARG n 
2 74  LYS n 
2 75  VAL n 
2 76  GLU n 
2 77  LYS n 
2 78  ILE n 
2 79  SER n 
2 80  MET n 
2 81  LEU n 
2 82  ASP n 
2 83  LYS n 
2 84  ILE n 
2 85  TYR n 
2 86  ILE n 
2 87  HIS n 
2 88  PRO n 
2 89  ARG n 
2 90  TYR n 
2 91  ASN n 
2 92  TRP n 
2 93  LYS n 
2 94  GLU n 
2 95  ASN n 
2 96  LEU n 
2 97  ASP n 
2 98  ARG n 
2 99  ASP n 
2 100 ILE n 
2 101 ALA n 
2 102 LEU n 
2 103 LEU n 
2 104 LYS n 
2 105 LEU n 
2 106 LYS n 
2 107 ARG n 
2 108 PRO n 
2 109 ILE n 
2 110 GLU n 
2 111 LEU n 
2 112 SER n 
2 113 ASP n 
2 114 TYR n 
2 115 ILE n 
2 116 HIS n 
2 117 PRO n 
2 118 VAL n 
2 119 CYS n 
2 120 LEU n 
2 121 PRO n 
2 122 ASP n 
2 123 LYS n 
2 124 GLN n 
2 125 THR n 
2 126 ALA n 
2 127 ALA n 
2 128 LYS n 
2 129 LEU n 
2 130 LEU n 
2 131 HIS n 
2 132 ALA n 
2 133 GLY n 
2 134 PHE n 
2 135 LYS n 
2 136 GLY n 
2 137 ARG n 
2 138 VAL n 
2 139 THR n 
2 140 GLY n 
2 141 TRP n 
2 142 GLY n 
2 143 ASN n 
2 144 ARG n 
2 145 ARG n 
2 146 GLU n 
2 147 THR n 
2 148 TRP n 
2 149 THR n 
2 150 THR n 
2 151 SER n 
2 152 VAL n 
2 153 ALA n 
2 154 GLU n 
2 155 VAL n 
2 156 GLN n 
2 157 PRO n 
2 158 SER n 
2 159 VAL n 
2 160 LEU n 
2 161 GLN n 
2 162 VAL n 
2 163 VAL n 
2 164 ASN n 
2 165 LEU n 
2 166 PRO n 
2 167 LEU n 
2 168 VAL n 
2 169 GLU n 
2 170 ARG n 
2 171 PRO n 
2 172 VAL n 
2 173 CYS n 
2 174 LYS n 
2 175 ALA n 
2 176 SER n 
2 177 THR n 
2 178 ARG n 
2 179 ILE n 
2 180 ARG n 
2 181 ILE n 
2 182 THR n 
2 183 ASP n 
2 184 ASN n 
2 185 MET n 
2 186 PHE n 
2 187 CYS n 
2 188 ALA n 
2 189 GLY n 
2 190 TYR n 
2 191 LYS n 
2 192 PRO n 
2 193 GLY n 
2 194 GLU n 
2 195 GLY n 
2 196 LYS n 
2 197 ARG n 
2 198 GLY n 
2 199 ASP n 
2 200 ALA n 
2 201 CYS n 
2 202 GLU n 
2 203 GLY n 
2 204 ASP n 
2 205 SER n 
2 206 GLY n 
2 207 GLY n 
2 208 PRO n 
2 209 PHE n 
2 210 VAL n 
2 211 MET n 
2 212 LYS n 
2 213 SER n 
2 214 PRO n 
2 215 TYR n 
2 216 ASN n 
2 217 ASN n 
2 218 ARG n 
2 219 TRP n 
2 220 TYR n 
2 221 GLN n 
2 222 MET n 
2 223 GLY n 
2 224 ILE n 
2 225 VAL n 
2 226 SER n 
2 227 TRP n 
2 228 GLY n 
2 229 GLU n 
2 230 GLY n 
2 231 CYS n 
2 232 ASP n 
2 233 ARG n 
2 234 ASP n 
2 235 GLY n 
2 236 LYS n 
2 237 TYR n 
2 238 GLY n 
2 239 PHE n 
2 240 TYR n 
2 241 THR n 
2 242 HIS n 
2 243 VAL n 
2 244 PHE n 
2 245 ARG n 
2 246 LEU n 
2 247 LYS n 
2 248 LYS n 
2 249 TRP n 
2 250 ILE n 
2 251 GLN n 
2 252 LYS n 
2 253 VAL n 
2 254 ILE n 
2 255 ASP n 
2 256 ARG n 
2 257 LEU n 
2 258 GLY n 
2 259 SER n 
3 1   ALA n 
3 2   GLU n 
3 3   GLY n 
3 4   ASP n 
3 5   ASP n 
3 6   CYS n 
3 7   SER n 
3 8   ILE n 
3 9   GLU n 
3 10  LYS n 
3 11  ALA n 
3 12  MET n 
3 13  GLY n 
3 14  ASP n 
3 15  PHE n 
3 16  LYS n 
3 17  PRO n 
3 18  GLU n 
3 19  GLU n 
3 20  PHE n 
3 21  PHE n 
3 22  ASN n 
3 23  GLY n 
3 24  THR n 
3 25  TRP n 
3 26  TYR n 
3 27  LEU n 
3 28  ALA n 
3 29  HIS n 
3 30  GLY n 
3 31  PRO n 
3 32  GLY n 
3 33  VAL n 
3 34  THR n 
3 35  SER n 
3 36  PRO n 
3 37  ALA n 
3 38  VAL n 
3 39  CYS n 
3 40  GLN n 
3 41  LYS n 
3 42  PHE n 
3 43  THR n 
3 44  THR n 
3 45  SER n 
3 46  GLY n 
3 47  SER n 
3 48  LYS n 
3 49  GLY n 
3 50  PHE n 
3 51  THR n 
3 52  GLN n 
3 53  ILE n 
3 54  VAL n 
3 55  GLU n 
3 56  ILE n 
3 57  GLY n 
3 58  TYR n 
3 59  ASN n 
3 60  LYS n 
3 61  PHE n 
3 62  GLU n 
3 63  SER n 
3 64  ASN n 
3 65  VAL n 
3 66  LYS n 
3 67  PHE n 
3 68  GLN n 
3 69  CYS n 
3 70  ASN n 
3 71  GLN n 
3 72  VAL n 
3 73  ASP n 
3 74  ASN n 
3 75  LYS n 
3 76  ASN n 
3 77  GLY n 
3 78  GLU n 
3 79  GLN n 
3 80  TYR n 
3 81  SER n 
3 82  PHE n 
3 83  LYS n 
3 84  CYS n 
3 85  LYS n 
3 86  SER n 
3 87  SER n 
3 88  ASP n 
3 89  ASN n 
3 90  THR n 
3 91  GLU n 
3 92  PHE n 
3 93  GLU n 
3 94  ALA n 
3 95  ASP n 
3 96  PHE n 
3 97  THR n 
3 98  PHE n 
3 99  ILE n 
3 100 SER n 
3 101 VAL n 
3 102 SER n 
3 103 TYR n 
3 104 ASP n 
3 105 ASN n 
3 106 PHE n 
3 107 ALA n 
3 108 LEU n 
3 109 VAL n 
3 110 CYS n 
3 111 ARG n 
3 112 SER n 
3 113 ILE n 
3 114 THR n 
3 115 PHE n 
3 116 THR n 
3 117 SER n 
3 118 GLN n 
3 119 PRO n 
3 120 LYS n 
3 121 GLU n 
3 122 ASP n 
3 123 ARG n 
3 124 TYR n 
3 125 LEU n 
3 126 VAL n 
3 127 PHE n 
3 128 GLU n 
3 129 ARG n 
3 130 THR n 
3 131 LYS n 
3 132 SER n 
3 133 ASP n 
3 134 THR n 
3 135 ASP n 
3 136 PRO n 
3 137 ASP n 
3 138 ALA n 
3 139 LYS n 
3 140 GLU n 
3 141 ILE n 
3 142 CYS n 
# 
_entity_src_gen.entity_id                          3 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Triatoma 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Triatoma pallidipennis' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     30077 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                BLOOD 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'INSECT CELLS' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     ? 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          BACULOVIRUS 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_entity_src_nat.entity_id 
_entity_src_nat.pdbx_src_id 
_entity_src_nat.pdbx_alt_source_flag 
_entity_src_nat.pdbx_beg_seq_num 
_entity_src_nat.pdbx_end_seq_num 
_entity_src_nat.common_name 
_entity_src_nat.pdbx_organism_scientific 
_entity_src_nat.pdbx_ncbi_taxonomy_id 
_entity_src_nat.genus 
_entity_src_nat.species 
_entity_src_nat.strain 
_entity_src_nat.tissue 
_entity_src_nat.tissue_fraction 
_entity_src_nat.pdbx_secretion 
_entity_src_nat.pdbx_fragment 
_entity_src_nat.pdbx_variant 
_entity_src_nat.pdbx_cell_line 
_entity_src_nat.pdbx_atcc 
_entity_src_nat.pdbx_cellular_location 
_entity_src_nat.pdbx_organ 
_entity_src_nat.pdbx_organelle 
_entity_src_nat.pdbx_cell 
_entity_src_nat.pdbx_plasmid_name 
_entity_src_nat.pdbx_plasmid_details 
_entity_src_nat.details 
1 1 sample ? ? cattle 'Bos taurus' 9913 Bos ? ? BLOOD ? BLOOD ? ? ? ? ? BLOOD ? ? ? ? 
'BOVINE THROMBIN WAS PURIFIED FROM FROM FRESH OX BLOOD ACCORDING TO REPORTED PROTOCOLS' 
2 1 sample ? ? cattle 'Bos taurus' 9913 Bos ? ? BLOOD ? BLOOD ? ? ? ? ? BLOOD ? ? ? ? 
'BOVINE THROMBIN WAS PURIFIED FROM FROM FRESH OX BLOOD ACCORDING TO REPORTED PROTOCOLS' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
_struct_ref.pdbx_seq_one_letter_code 
1 UNP THRB_BOVIN P00735 1 326 ? ? 
2 UNP THRB_BOVIN P00735 2 367 ? ? 
3 UNP TRIA_TRIPA Q27049 3 19  ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1AVG L 14 ? 41  ? P00735 326 ? 366 ? 1  15  
2 2 1AVG H 1  ? 259 ? P00735 367 ? 625 ? 16 247 
3 3 1AVG I 1  ? 142 ? Q27049 19  ? 160 ? 1  142 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
3 1AVG ARG I 123 ? UNP Q27049 ASP 141 CONFLICT 123 1 
3 1AVG PHE I 127 ? UNP Q27049 LEU 145 CONFLICT 127 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1AVG 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   2 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.5 
_exptl_crystal.density_percent_sol   50 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              4.6 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    '50 MM NA ACETATE, PH 4.6, 100 MM (NH4)2SO4, 16 % PEG 4,000' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           280 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   1996-06 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'NI FILTER' 
_diffrn_radiation.pdbx_diffrn_protocol             ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU RUH2R' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1AVG 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             19.92 
_reflns.d_resolution_high            2.60 
_reflns.number_obs                   16392 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         93.2 
_reflns.pdbx_Rmerge_I_obs            0.099 
_reflns.pdbx_Rsym_value              0.112 
_reflns.pdbx_netI_over_sigmaI        14.22 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              4.5 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.60 
_reflns_shell.d_res_low              2.67 
_reflns_shell.percent_possible_all   81.6 
_reflns_shell.Rmerge_I_obs           0.121 
_reflns_shell.pdbx_Rsym_value        0.148 
_reflns_shell.meanI_over_sigI_obs    2.65 
_reflns_shell.pdbx_redundancy        1.9 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1AVG 
_refine.ls_number_reflns_obs                     14627 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             10.00 
_refine.ls_d_res_high                            2.60 
_refine.ls_percent_reflns_obs                    93.2 
_refine.ls_R_factor_obs                          0.184 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.184 
_refine.ls_R_factor_R_free                       0.275 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'BOVINE THROMBIN' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4304 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             172 
_refine_hist.number_atoms_total               4476 
_refine_hist.d_res_high                       2.60 
_refine_hist.d_res_low                        10.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d                0.008 ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg             1.49  ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d      25.92 ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d      1.2   ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  1AVG 
_struct.title                     'THROMBIN INHIBITOR FROM TRIATOMA PALLIDIPENNIS' 
_struct.pdbx_descriptor           'THROMBIN, TRIABIN' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1AVG 
_struct_keywords.pdbx_keywords   'COMPLEX (BLOOD COAGULATION/INHIBITOR)' 
_struct_keywords.text            
'BOVINE THROMBIN, THROMBIN INHIBITOR, COMPLEX (BLOOD COAGULATION-INHIBITOR), COMPLEX (BLOOD COAGULATION-INHIBITOR) complex' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 4 ? 
F N N 4 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLU A 11  C ASP A 13  A GLU L 1   ASP L 1   5 ? 3  
HELX_P HELX_P2  2  GLU A 21  ? LYS A 23  ? GLU L 8   LYS L 10  5 ? 3  
HELX_P HELX_P3  3  GLU A 30  C TYR A 37  J GLU L 14  TYR L 14  1 ? 8  
HELX_P HELX_P4  4  ALA B 42  ? CYS B 44  ? ALA H 56  CYS H 58  5 ? 3  
HELX_P HELX_P5  5  PRO B 48  B TRP B 50  D PRO H 60  TRP H 60  5 ? 3  
HELX_P HELX_P6  6  LYS B 123 ? LEU B 129 C LYS H 126 LEU H 129 1 ? 7  
HELX_P HELX_P7  7  VAL B 152 C GLU B 154 E VAL H 149 GLU H 149 5 ? 3  
HELX_P HELX_P8  8  ARG B 170 ? ALA B 175 ? ARG H 165 ALA H 170 1 ? 6  
HELX_P HELX_P9  9  PHE B 244 ? ILE B 254 ? PHE H 232 ILE H 242 5 ? 11 
HELX_P HELX_P10 10 CYS C 6   ? ILE C 8   ? CYS I 6   ILE I 8   5 ? 3  
HELX_P HELX_P11 11 PRO C 17  ? PHE C 20  ? PRO I 17  PHE I 20  1 ? 4  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 14  SG ? ? ? 1_555 B CYS 119 SG ? ? L CYS 1   H CYS 122 1_555 ? ? ? ? ? ? ? 2.025 ? 
disulf2 disulf ? ? B CYS 28  SG ? ? ? 1_555 B CYS 44  SG ? ? H CYS 42  H CYS 58  1_555 ? ? ? ? ? ? ? 2.038 ? 
disulf3 disulf ? ? B CYS 173 SG ? ? ? 1_555 B CYS 187 SG ? ? H CYS 168 H CYS 182 1_555 ? ? ? ? ? ? ? 2.027 ? 
disulf4 disulf ? ? B CYS 201 SG ? ? ? 1_555 B CYS 231 SG ? ? H CYS 191 H CYS 220 1_555 ? ? ? ? ? ? ? 2.024 ? 
disulf5 disulf ? ? C CYS 6   SG ? ? ? 1_555 C CYS 110 SG ? ? I CYS 6   I CYS 110 1_555 ? ? ? ? ? ? ? 2.032 ? 
disulf6 disulf ? ? C CYS 39  SG ? ? ? 1_555 C CYS 142 SG ? ? I CYS 39  I CYS 142 1_555 ? ? ? ? ? ? ? 2.025 ? 
disulf7 disulf ? ? C CYS 69  SG ? ? ? 1_555 C CYS 84  SG ? ? I CYS 69  I CYS 84  1_555 ? ? ? ? ? ? ? 2.024 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 SER 22 B . A SER 36 H PRO 23 B ? PRO 37 H 1 0.06  
2 SER 35 C . ? SER 35 I PRO 36 C ? PRO 36 I 1 -0.31 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 3 ? 
C ? 2 ? 
D ? 4 ? 
E ? 8 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
E 1 2 ? parallel      
E 2 3 ? anti-parallel 
E 3 4 ? parallel      
E 4 5 ? anti-parallel 
E 5 6 ? anti-parallel 
E 6 7 ? anti-parallel 
E 7 8 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LYS B 77  ? SER B 79  ? LYS H 81  SER H 83  
A 2 LEU B 59  ? ILE B 63  ? LEU H 64  ILE H 68  
A 3 GLN B 15  ? ARG B 20  ? GLN H 30  ARG H 35  
A 4 GLU B 25  ? SER B 31  ? GLU H 39  SER H 45  
B 1 TRP B 37  ? THR B 40  ? TRP H 51  THR H 54  
B 2 ALA B 101 ? LEU B 105 ? ALA H 104 LEU H 108 
B 3 LEU B 81  ? ILE B 86  ? LEU H 85  ILE H 90  
C 1 LYS B 135 ? GLY B 140 ? LYS H 135 GLY H 140 
C 2 GLN B 161 ? PRO B 166 ? GLN H 156 PRO H 161 
D 1 MET B 185 ? ALA B 188 ? MET H 180 ALA H 183 
D 2 GLY B 238 ? HIS B 242 ? GLY H 226 HIS H 230 
D 3 TRP B 219 ? TRP B 227 ? TRP H 207 TRP H 215 
D 4 PRO B 208 ? LYS B 212 ? PRO H 198 LYS H 202 
E 1 THR C 24  ? ALA C 28  ? THR I 24  ALA I 28  
E 2 THR C 51  ? ILE C 56  ? THR I 51  ILE I 56  
E 3 ALA C 37  ? THR C 43  ? ALA I 37  THR I 43  
E 4 LYS C 66  ? GLN C 71  ? LYS I 66  GLN I 71  
E 5 TYR C 80  ? SER C 86  ? TYR I 80  SER I 86  
E 6 PHE C 92  ? VAL C 101 ? PHE I 92  VAL I 101 
E 7 PHE C 106 ? PHE C 115 ? PHE I 106 PHE I 115 
E 8 ASP C 122 ? GLU C 128 ? ASP I 122 GLU I 128 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O LYS B 77  ? O LYS H 81  N ILE B 63  ? N ILE H 68  
A 2 3 O LEU B 60  ? O LEU H 65  N PHE B 19  ? N PHE H 34  
A 3 4 O VAL B 16  ? O VAL H 31  N ALA B 30  ? N ALA H 44  
B 1 2 O VAL B 38  ? O VAL H 52  N LEU B 103 ? N LEU H 106 
B 2 3 O LEU B 102 ? O LEU H 105 N TYR B 85  ? N TYR H 89  
C 1 2 O GLY B 136 ? O GLY H 136 N LEU B 165 ? N LEU H 160 
D 1 2 O PHE B 186 ? O PHE H 181 N TYR B 240 ? N TYR H 228 
D 2 3 O PHE B 239 ? O PHE H 227 N TRP B 227 ? N TRP H 215 
D 3 4 O TYR B 220 ? O TYR H 208 N MET B 211 ? N MET H 201 
E 1 2 O TRP C 25  ? O TRP I 25  N GLN C 52  ? N GLN I 52  
E 2 3 O THR C 51  ? O THR I 51  N PHE C 42  ? N PHE I 42  
E 3 4 O CYS C 39  ? O CYS I 39  N PHE C 67  ? N PHE I 67  
E 4 5 O GLN C 68  ? O GLN I 68  N LYS C 85  ? N LYS I 85  
E 5 6 O TYR C 80  ? O TYR I 80  N PHE C 96  ? N PHE I 96  
E 6 7 O GLU C 93  ? O GLU I 93  N THR C 114 ? N THR I 114 
E 7 8 O ALA C 107 ? O ALA I 107 N PHE C 127 ? N PHE I 127 
# 
_struct_site.id                   ATE 
_struct_site.pdbx_evidence_code   Unknown 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    3 
_struct_site.details              'CATALYTIC TRIAD.' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 ATE 3 SER B 205 ? SER H 195 . ? 1_555 ? 
2 ATE 3 HIS B 43  ? HIS H 57  . ? 1_555 ? 
3 ATE 3 ASP B 99  ? ASP H 102 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1AVG 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1AVG 
_atom_sites.fract_transf_matrix[1][1]   0.022302 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.014874 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005450 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . PHE A 1 1   M 21.268  8.011   63.659  1.00 57.59  ? 1   PHE L N   1 
ATOM   2    C CA  . PHE A 1 1   M 21.409  9.255   62.840  1.00 57.71  ? 1   PHE L CA  1 
ATOM   3    C C   . PHE A 1 1   M 21.667  10.454  63.739  1.00 54.33  ? 1   PHE L C   1 
ATOM   4    O O   . PHE A 1 1   M 22.525  11.288  63.443  1.00 57.85  ? 1   PHE L O   1 
ATOM   5    C CB  . PHE A 1 1   M 20.160  9.500   61.980  1.00 60.81  ? 1   PHE L CB  1 
ATOM   6    C CG  . PHE A 1 1   M 20.093  8.643   60.742  1.00 69.94  ? 1   PHE L CG  1 
ATOM   7    C CD1 . PHE A 1 1   M 19.517  7.375   60.782  1.00 72.77  ? 1   PHE L CD1 1 
ATOM   8    C CD2 . PHE A 1 1   M 20.607  9.106   59.532  1.00 71.89  ? 1   PHE L CD2 1 
ATOM   9    C CE1 . PHE A 1 1   M 19.455  6.579   59.639  1.00 71.68  ? 1   PHE L CE1 1 
ATOM   10   C CE2 . PHE A 1 1   M 20.550  8.318   58.381  1.00 72.42  ? 1   PHE L CE2 1 
ATOM   11   C CZ  . PHE A 1 1   M 19.972  7.053   58.437  1.00 72.02  ? 1   PHE L CZ  1 
ATOM   12   N N   . PHE A 1 2   L 20.916  10.532  64.833  1.00 47.72  ? 1   PHE L N   1 
ATOM   13   C CA  . PHE A 1 2   L 21.062  11.610  65.801  1.00 40.01  ? 1   PHE L CA  1 
ATOM   14   C C   . PHE A 1 2   L 21.700  11.032  67.049  1.00 38.35  ? 1   PHE L C   1 
ATOM   15   O O   . PHE A 1 2   L 21.687  9.813   67.250  1.00 37.84  ? 1   PHE L O   1 
ATOM   16   C CB  . PHE A 1 2   L 19.698  12.196  66.168  1.00 36.16  ? 1   PHE L CB  1 
ATOM   17   C CG  . PHE A 1 2   L 18.924  12.692  64.996  1.00 29.60  ? 1   PHE L CG  1 
ATOM   18   C CD1 . PHE A 1 2   L 19.333  13.824  64.312  1.00 22.32  ? 1   PHE L CD1 1 
ATOM   19   C CD2 . PHE A 1 2   L 17.809  12.002  64.548  1.00 30.39  ? 1   PHE L CD2 1 
ATOM   20   C CE1 . PHE A 1 2   L 18.649  14.257  63.201  1.00 27.40  ? 1   PHE L CE1 1 
ATOM   21   C CE2 . PHE A 1 2   L 17.115  12.428  63.434  1.00 29.74  ? 1   PHE L CE2 1 
ATOM   22   C CZ  . PHE A 1 2   L 17.536  13.557  62.757  1.00 30.19  ? 1   PHE L CZ  1 
ATOM   23   N N   . ASN A 1 3   K 22.285  11.905  67.859  1.00 36.24  ? 1   ASN L N   1 
ATOM   24   C CA  . ASN A 1 3   K 22.913  11.503  69.103  1.00 37.08  ? 1   ASN L CA  1 
ATOM   25   C C   . ASN A 1 3   K 21.740  11.239  70.055  1.00 35.10  ? 1   ASN L C   1 
ATOM   26   O O   . ASN A 1 3   K 20.855  10.440  69.754  1.00 41.84  ? 1   ASN L O   1 
ATOM   27   C CB  . ASN A 1 3   K 23.810  12.649  69.598  1.00 46.68  ? 1   ASN L CB  1 
ATOM   28   C CG  . ASN A 1 3   K 24.666  12.267  70.801  1.00 52.80  ? 1   ASN L CG  1 
ATOM   29   O OD1 . ASN A 1 3   K 24.169  11.727  71.787  1.00 54.48  ? 1   ASN L OD1 1 
ATOM   30   N ND2 . ASN A 1 3   K 25.945  12.608  70.748  1.00 58.41  ? 1   ASN L ND2 1 
ATOM   31   N N   . GLU A 1 4   J 21.714  11.930  71.181  1.00 28.16  ? 1   GLU L N   1 
ATOM   32   C CA  . GLU A 1 4   J 20.652  11.800  72.163  1.00 30.75  ? 1   GLU L CA  1 
ATOM   33   C C   . GLU A 1 4   J 20.925  12.918  73.141  1.00 34.54  ? 1   GLU L C   1 
ATOM   34   O O   . GLU A 1 4   J 20.024  13.399  73.822  1.00 38.88  ? 1   GLU L O   1 
ATOM   35   C CB  . GLU A 1 4   J 20.676  10.446  72.876  1.00 30.01  ? 1   GLU L CB  1 
ATOM   36   C CG  . GLU A 1 4   J 19.536  10.294  73.893  1.00 34.15  ? 1   GLU L CG  1 
ATOM   37   C CD  . GLU A 1 4   J 19.490  8.942   74.605  1.00 32.21  ? 1   GLU L CD  1 
ATOM   38   O OE1 . GLU A 1 4   J 20.424  8.123   74.450  1.00 32.03  ? 1   GLU L OE1 1 
ATOM   39   O OE2 . GLU A 1 4   J 18.501  8.702   75.332  1.00 29.10  ? 1   GLU L OE2 1 
ATOM   40   N N   . LYS A 1 5   I 22.191  13.317  73.207  1.00 34.68  ? 1   LYS L N   1 
ATOM   41   C CA  . LYS A 1 5   I 22.614  14.413  74.054  1.00 34.32  ? 1   LYS L CA  1 
ATOM   42   C C   . LYS A 1 5   I 21.900  15.653  73.539  1.00 30.52  ? 1   LYS L C   1 
ATOM   43   O O   . LYS A 1 5   I 21.147  16.296  74.269  1.00 32.72  ? 1   LYS L O   1 
ATOM   44   C CB  . LYS A 1 5   I 24.123  14.618  73.924  1.00 45.46  ? 1   LYS L CB  1 
ATOM   45   C CG  . LYS A 1 5   I 24.925  14.316  75.175  1.00 55.64  ? 1   LYS L CG  1 
ATOM   46   C CD  . LYS A 1 5   I 26.388  14.650  74.935  1.00 68.91  ? 1   LYS L CD  1 
ATOM   47   C CE  . LYS A 1 5   I 27.265  14.201  76.091  1.00 77.44  ? 1   LYS L CE  1 
ATOM   48   N NZ  . LYS A 1 5   I 28.714  14.333  75.750  1.00 84.12  ? 1   LYS L NZ  1 
ATOM   49   N N   . THR A 1 6   H 22.129  15.963  72.265  1.00 27.80  ? 1   THR L N   1 
ATOM   50   C CA  . THR A 1 6   H 21.514  17.127  71.633  1.00 28.03  ? 1   THR L CA  1 
ATOM   51   C C   . THR A 1 6   H 20.092  16.874  71.145  1.00 27.27  ? 1   THR L C   1 
ATOM   52   O O   . THR A 1 6   H 19.232  17.747  71.239  1.00 30.49  ? 1   THR L O   1 
ATOM   53   C CB  . THR A 1 6   H 22.376  17.658  70.458  1.00 23.69  ? 1   THR L CB  1 
ATOM   54   O OG1 . THR A 1 6   H 22.748  16.579  69.585  1.00 20.54  ? 1   THR L OG1 1 
ATOM   55   C CG2 . THR A 1 6   H 23.622  18.310  70.990  1.00 25.37  ? 1   THR L CG2 1 
ATOM   56   N N   . PHE A 1 7   G 19.857  15.669  70.636  1.00 23.79  ? 1   PHE L N   1 
ATOM   57   C CA  . PHE A 1 7   G 18.559  15.272  70.102  1.00 20.38  ? 1   PHE L CA  1 
ATOM   58   C C   . PHE A 1 7   G 17.504  15.039  71.167  1.00 21.25  ? 1   PHE L C   1 
ATOM   59   O O   . PHE A 1 7   G 16.354  15.447  71.018  1.00 23.09  ? 1   PHE L O   1 
ATOM   60   C CB  . PHE A 1 7   G 18.723  13.993  69.286  1.00 19.42  ? 1   PHE L CB  1 
ATOM   61   C CG  . PHE A 1 7   G 17.509  13.607  68.504  1.00 17.23  ? 1   PHE L CG  1 
ATOM   62   C CD1 . PHE A 1 7   G 17.009  14.443  67.513  1.00 17.72  ? 1   PHE L CD1 1 
ATOM   63   C CD2 . PHE A 1 7   G 16.870  12.399  68.746  1.00 17.49  ? 1   PHE L CD2 1 
ATOM   64   C CE1 . PHE A 1 7   G 15.886  14.081  66.774  1.00 13.75  ? 1   PHE L CE1 1 
ATOM   65   C CE2 . PHE A 1 7   G 15.747  12.031  68.012  1.00 14.81  ? 1   PHE L CE2 1 
ATOM   66   C CZ  . PHE A 1 7   G 15.256  12.873  67.026  1.00 13.04  ? 1   PHE L CZ  1 
ATOM   67   N N   . GLY A 1 8   F 17.895  14.357  72.230  1.00 19.45  ? 1   GLY L N   1 
ATOM   68   C CA  . GLY A 1 8   F 16.960  14.052  73.286  1.00 20.68  ? 1   GLY L CA  1 
ATOM   69   C C   . GLY A 1 8   F 16.449  12.642  73.077  1.00 22.45  ? 1   GLY L C   1 
ATOM   70   O O   . GLY A 1 8   F 16.854  11.961  72.130  1.00 25.36  ? 1   GLY L O   1 
ATOM   71   N N   . ALA A 1 9   E 15.562  12.198  73.959  1.00 21.39  ? 1   ALA L N   1 
ATOM   72   C CA  . ALA A 1 9   E 15.001  10.862  73.864  1.00 22.91  ? 1   ALA L CA  1 
ATOM   73   C C   . ALA A 1 9   E 13.886  10.827  72.826  1.00 23.87  ? 1   ALA L C   1 
ATOM   74   O O   . ALA A 1 9   E 13.427  11.877  72.359  1.00 24.59  ? 1   ALA L O   1 
ATOM   75   C CB  . ALA A 1 9   E 14.470  10.428  75.217  1.00 27.90  ? 1   ALA L CB  1 
ATOM   76   N N   . GLY A 1 10  D 13.468  9.622   72.450  1.00 24.39  ? 1   GLY L N   1 
ATOM   77   C CA  . GLY A 1 10  D 12.391  9.496   71.488  1.00 24.60  ? 1   GLY L CA  1 
ATOM   78   C C   . GLY A 1 10  D 12.621  8.666   70.240  1.00 22.86  ? 1   GLY L C   1 
ATOM   79   O O   . GLY A 1 10  D 11.748  7.878   69.861  1.00 25.64  ? 1   GLY L O   1 
ATOM   80   N N   . GLU A 1 11  C 13.787  8.814   69.618  1.00 17.96  ? 1   GLU L N   1 
ATOM   81   C CA  . GLU A 1 11  C 14.105  8.102   68.374  1.00 22.08  ? 1   GLU L CA  1 
ATOM   82   C C   . GLU A 1 11  C 13.999  6.571   68.375  1.00 20.54  ? 1   GLU L C   1 
ATOM   83   O O   . GLU A 1 11  C 13.317  5.992   67.535  1.00 19.20  ? 1   GLU L O   1 
ATOM   84   C CB  . GLU A 1 11  C 15.492  8.523   67.840  1.00 26.10  ? 1   GLU L CB  1 
ATOM   85   C CG  . GLU A 1 11  C 15.738  8.114   66.370  1.00 27.64  ? 1   GLU L CG  1 
ATOM   86   C CD  . GLU A 1 11  C 17.156  8.372   65.860  1.00 29.33  ? 1   GLU L CD  1 
ATOM   87   O OE1 . GLU A 1 11  C 18.072  8.695   66.655  1.00 23.08  ? 1   GLU L OE1 1 
ATOM   88   O OE2 . GLU A 1 11  C 17.353  8.227   64.635  1.00 36.61  ? 1   GLU L OE2 1 
ATOM   89   N N   . ALA A 1 12  B 14.657  5.919   69.323  1.00 21.19  ? 1   ALA L N   1 
ATOM   90   C CA  . ALA A 1 12  B 14.650  4.465   69.378  1.00 20.72  ? 1   ALA L CA  1 
ATOM   91   C C   . ALA A 1 12  B 13.252  3.879   69.445  1.00 24.54  ? 1   ALA L C   1 
ATOM   92   O O   . ALA A 1 12  B 13.026  2.738   69.037  1.00 30.24  ? 1   ALA L O   1 
ATOM   93   C CB  . ALA A 1 12  B 15.479  3.986   70.552  1.00 17.84  ? 1   ALA L CB  1 
ATOM   94   N N   . ASP A 1 13  A 12.307  4.678   69.916  1.00 26.45  ? 1   ASP L N   1 
ATOM   95   C CA  . ASP A 1 13  A 10.939  4.220   70.062  1.00 23.58  ? 1   ASP L CA  1 
ATOM   96   C C   . ASP A 1 13  A 9.935   5.112   69.308  1.00 21.15  ? 1   ASP L C   1 
ATOM   97   O O   . ASP A 1 13  A 8.755   5.177   69.648  1.00 21.42  ? 1   ASP L O   1 
ATOM   98   C CB  . ASP A 1 13  A 10.617  4.170   71.549  1.00 24.14  ? 1   ASP L CB  1 
ATOM   99   C CG  . ASP A 1 13  A 9.432   3.315   71.847  1.00 32.73  ? 1   ASP L CG  1 
ATOM   100  O OD1 . ASP A 1 13  A 9.436   2.127   71.452  1.00 42.08  ? 1   ASP L OD1 1 
ATOM   101  O OD2 . ASP A 1 13  A 8.489   3.839   72.464  1.00 35.31  ? 1   ASP L OD2 1 
ATOM   102  N N   . CYS A 1 14  ? 10.403  5.761   68.253  1.00 17.67  ? 1   CYS L N   1 
ATOM   103  C CA  . CYS A 1 14  ? 9.568   6.654   67.473  1.00 13.36  ? 1   CYS L CA  1 
ATOM   104  C C   . CYS A 1 14  ? 8.623   5.899   66.568  1.00 15.09  ? 1   CYS L C   1 
ATOM   105  O O   . CYS A 1 14  ? 8.817   4.719   66.290  1.00 16.77  ? 1   CYS L O   1 
ATOM   106  C CB  . CYS A 1 14  ? 10.445  7.561   66.608  1.00 13.05  ? 1   CYS L CB  1 
ATOM   107  S SG  . CYS A 1 14  ? 11.487  6.682   65.387  1.00 17.52  ? 1   CYS L SG  1 
ATOM   108  N N   . GLY A 1 15  ? 7.574   6.587   66.136  1.00 16.76  ? 2   GLY L N   1 
ATOM   109  C CA  . GLY A 1 15  ? 6.625   6.004   65.207  1.00 15.69  ? 2   GLY L CA  1 
ATOM   110  C C   . GLY A 1 15  ? 5.608   5.006   65.696  1.00 14.96  ? 2   GLY L C   1 
ATOM   111  O O   . GLY A 1 15  ? 4.740   4.627   64.913  1.00 19.60  ? 2   GLY L O   1 
ATOM   112  N N   . LEU A 1 16  ? 5.723   4.556   66.945  1.00 14.32  ? 3   LEU L N   1 
ATOM   113  C CA  . LEU A 1 16  ? 4.780   3.595   67.528  1.00 10.22  ? 3   LEU L CA  1 
ATOM   114  C C   . LEU A 1 16  ? 3.844   4.313   68.492  1.00 9.32   ? 3   LEU L C   1 
ATOM   115  O O   . LEU A 1 16  ? 4.280   4.847   69.503  1.00 12.99  ? 3   LEU L O   1 
ATOM   116  C CB  . LEU A 1 16  ? 5.534   2.501   68.290  1.00 11.08  ? 3   LEU L CB  1 
ATOM   117  C CG  . LEU A 1 16  ? 6.574   1.667   67.535  1.00 14.75  ? 3   LEU L CG  1 
ATOM   118  C CD1 . LEU A 1 16  ? 7.313   0.746   68.508  1.00 3.24   ? 3   LEU L CD1 1 
ATOM   119  C CD2 . LEU A 1 16  ? 5.902   0.875   66.424  1.00 3.87   ? 3   LEU L CD2 1 
ATOM   120  N N   . ARG A 1 17  ? 2.557   4.323   68.189  1.00 7.13   ? 4   ARG L N   1 
ATOM   121  C CA  . ARG A 1 17  ? 1.590   4.987   69.050  1.00 7.49   ? 4   ARG L CA  1 
ATOM   122  C C   . ARG A 1 17  ? 1.186   4.123   70.253  1.00 11.80  ? 4   ARG L C   1 
ATOM   123  O O   . ARG A 1 17  ? 0.817   2.956   70.103  1.00 11.35  ? 4   ARG L O   1 
ATOM   124  C CB  . ARG A 1 17  ? 0.349   5.380   68.237  1.00 7.90   ? 4   ARG L CB  1 
ATOM   125  C CG  . ARG A 1 17  ? 0.637   6.320   67.073  1.00 2.00   ? 4   ARG L CG  1 
ATOM   126  C CD  . ARG A 1 17  ? -0.582  6.539   66.193  1.00 2.00   ? 4   ARG L CD  1 
ATOM   127  N NE  . ARG A 1 17  ? -0.948  5.345   65.431  1.00 11.00  ? 4   ARG L NE  1 
ATOM   128  C CZ  . ARG A 1 17  ? -1.988  5.261   64.602  1.00 8.16   ? 4   ARG L CZ  1 
ATOM   129  N NH1 . ARG A 1 17  ? -2.775  6.303   64.411  1.00 2.00   ? 4   ARG L NH1 1 
ATOM   130  N NH2 . ARG A 1 17  ? -2.250  4.129   63.966  1.00 6.68   ? 4   ARG L NH2 1 
ATOM   131  N N   . PRO A 1 18  ? 1.254   4.690   71.467  1.00 13.64  ? 5   PRO L N   1 
ATOM   132  C CA  . PRO A 1 18  ? 0.905   4.019   72.720  1.00 10.36  ? 5   PRO L CA  1 
ATOM   133  C C   . PRO A 1 18  ? -0.506  3.453   72.736  1.00 12.15  ? 5   PRO L C   1 
ATOM   134  O O   . PRO A 1 18  ? -0.746  2.376   73.286  1.00 17.18  ? 5   PRO L O   1 
ATOM   135  C CB  . PRO A 1 18  ? 1.035   5.146   73.737  1.00 9.40   ? 5   PRO L CB  1 
ATOM   136  C CG  . PRO A 1 18  ? 2.192   5.915   73.207  1.00 9.46   ? 5   PRO L CG  1 
ATOM   137  C CD  . PRO A 1 18  ? 1.821   6.023   71.746  1.00 14.73  ? 5   PRO L CD  1 
ATOM   138  N N   . LEU A 1 19  ? -1.434  4.194   72.140  1.00 8.20   ? 6   LEU L N   1 
ATOM   139  C CA  . LEU A 1 19  ? -2.834  3.805   72.103  1.00 2.32   ? 6   LEU L CA  1 
ATOM   140  C C   . LEU A 1 19  ? -3.236  2.915   70.942  1.00 7.96   ? 6   LEU L C   1 
ATOM   141  O O   . LEU A 1 19  ? -4.366  2.409   70.908  1.00 10.98  ? 6   LEU L O   1 
ATOM   142  C CB  . LEU A 1 19  ? -3.721  5.052   72.108  1.00 2.88   ? 6   LEU L CB  1 
ATOM   143  C CG  . LEU A 1 19  ? -3.723  5.930   73.362  1.00 6.33   ? 6   LEU L CG  1 
ATOM   144  C CD1 . LEU A 1 19  ? -4.770  7.025   73.216  1.00 3.79   ? 6   LEU L CD1 1 
ATOM   145  C CD2 . LEU A 1 19  ? -4.031  5.074   74.586  1.00 2.00   ? 6   LEU L CD2 1 
ATOM   146  N N   . PHE A 1 20  ? -2.336  2.742   69.977  1.00 11.43  ? 7   PHE L N   1 
ATOM   147  C CA  . PHE A 1 20  ? -2.633  1.919   68.813  1.00 7.66   ? 7   PHE L CA  1 
ATOM   148  C C   . PHE A 1 20  ? -1.614  0.822   68.595  1.00 12.41  ? 7   PHE L C   1 
ATOM   149  O O   . PHE A 1 20  ? -1.833  -0.305  69.026  1.00 17.91  ? 7   PHE L O   1 
ATOM   150  C CB  . PHE A 1 20  ? -2.776  2.778   67.565  1.00 2.00   ? 7   PHE L CB  1 
ATOM   151  C CG  . PHE A 1 20  ? -3.998  3.655   67.569  1.00 5.52   ? 7   PHE L CG  1 
ATOM   152  C CD1 . PHE A 1 20  ? -5.203  3.200   67.041  1.00 6.50   ? 7   PHE L CD1 1 
ATOM   153  C CD2 . PHE A 1 20  ? -3.937  4.953   68.049  1.00 5.46   ? 7   PHE L CD2 1 
ATOM   154  C CE1 . PHE A 1 20  ? -6.329  4.039   66.990  1.00 7.51   ? 7   PHE L CE1 1 
ATOM   155  C CE2 . PHE A 1 20  ? -5.064  5.796   67.998  1.00 4.60   ? 7   PHE L CE2 1 
ATOM   156  C CZ  . PHE A 1 20  ? -6.254  5.333   67.467  1.00 2.00   ? 7   PHE L CZ  1 
ATOM   157  N N   . GLU A 1 21  ? -0.497  1.133   67.949  1.00 17.71  ? 8   GLU L N   1 
ATOM   158  C CA  . GLU A 1 21  ? 0.519   0.112   67.708  1.00 19.90  ? 8   GLU L CA  1 
ATOM   159  C C   . GLU A 1 21  ? 0.892   -0.633  68.991  1.00 24.61  ? 8   GLU L C   1 
ATOM   160  O O   . GLU A 1 21  ? 0.770   -1.856  69.053  1.00 30.23  ? 8   GLU L O   1 
ATOM   161  C CB  . GLU A 1 21  ? 1.771   0.704   67.053  1.00 14.11  ? 8   GLU L CB  1 
ATOM   162  C CG  . GLU A 1 21  ? 1.657   0.923   65.553  1.00 12.10  ? 8   GLU L CG  1 
ATOM   163  C CD  . GLU A 1 21  ? 0.780   2.098   65.202  1.00 14.39  ? 8   GLU L CD  1 
ATOM   164  O OE1 . GLU A 1 21  ? 0.958   3.159   65.820  1.00 19.55  ? 8   GLU L OE1 1 
ATOM   165  O OE2 . GLU A 1 21  ? -0.090  1.966   64.318  1.00 20.90  ? 8   GLU L OE2 1 
ATOM   166  N N   . LYS A 1 22  ? 1.246   0.104   70.040  1.00 25.94  ? 9   LYS L N   1 
ATOM   167  C CA  . LYS A 1 22  ? 1.632   -0.510  71.316  1.00 26.99  ? 9   LYS L CA  1 
ATOM   168  C C   . LYS A 1 22  ? 0.512   -1.251  72.042  1.00 24.63  ? 9   LYS L C   1 
ATOM   169  O O   . LYS A 1 22  ? 0.768   -1.986  72.990  1.00 28.24  ? 9   LYS L O   1 
ATOM   170  C CB  . LYS A 1 22  ? 2.214   0.535   72.268  1.00 23.72  ? 9   LYS L CB  1 
ATOM   171  C CG  . LYS A 1 22  ? 3.618   0.975   71.939  1.00 22.50  ? 9   LYS L CG  1 
ATOM   172  C CD  . LYS A 1 22  ? 4.073   2.030   72.917  1.00 29.96  ? 9   LYS L CD  1 
ATOM   173  C CE  . LYS A 1 22  ? 5.443   2.573   72.566  1.00 30.00  ? 9   LYS L CE  1 
ATOM   174  N NZ  . LYS A 1 22  ? 5.822   3.660   73.518  1.00 39.02  ? 9   LYS L NZ  1 
ATOM   175  N N   . LYS A 1 23  ? -0.719  -1.076  71.585  1.00 25.97  ? 10  LYS L N   1 
ATOM   176  C CA  . LYS A 1 23  ? -1.869  -1.704  72.217  1.00 25.21  ? 10  LYS L CA  1 
ATOM   177  C C   . LYS A 1 23  ? -2.530  -2.715  71.271  1.00 31.38  ? 10  LYS L C   1 
ATOM   178  O O   . LYS A 1 23  ? -3.614  -3.234  71.552  1.00 34.34  ? 10  LYS L O   1 
ATOM   179  C CB  . LYS A 1 23  ? -2.848  -0.601  72.618  1.00 22.99  ? 10  LYS L CB  1 
ATOM   180  C CG  . LYS A 1 23  ? -3.891  -0.998  73.621  1.00 36.77  ? 10  LYS L CG  1 
ATOM   181  C CD  . LYS A 1 23  ? -4.319  0.201   74.452  1.00 41.76  ? 10  LYS L CD  1 
ATOM   182  C CE  . LYS A 1 23  ? -3.160  0.732   75.288  1.00 43.28  ? 10  LYS L CE  1 
ATOM   183  N NZ  . LYS A 1 23  ? -3.589  1.844   76.181  1.00 44.51  ? 10  LYS L NZ  1 
ATOM   184  N N   . GLN A 1 24  ? -1.859  -2.995  70.154  1.00 33.32  ? 11  GLN L N   1 
ATOM   185  C CA  . GLN A 1 24  ? -2.346  -3.934  69.138  1.00 35.07  ? 11  GLN L CA  1 
ATOM   186  C C   . GLN A 1 24  ? -3.689  -3.538  68.520  1.00 30.97  ? 11  GLN L C   1 
ATOM   187  O O   . GLN A 1 24  ? -4.422  -4.383  68.000  1.00 28.96  ? 11  GLN L O   1 
ATOM   188  C CB  . GLN A 1 24  ? -2.411  -5.355  69.702  1.00 45.18  ? 11  GLN L CB  1 
ATOM   189  C CG  . GLN A 1 24  ? -1.053  -5.937  70.079  1.00 63.34  ? 11  GLN L CG  1 
ATOM   190  C CD  . GLN A 1 24  ? -1.167  -7.277  70.788  1.00 74.77  ? 11  GLN L CD  1 
ATOM   191  O OE1 . GLN A 1 24  ? -1.052  -7.361  72.014  1.00 80.04  ? 11  GLN L OE1 1 
ATOM   192  N NE2 . GLN A 1 24  ? -1.396  -8.334  70.019  1.00 78.49  ? 11  GLN L NE2 1 
ATOM   193  N N   . VAL A 1 25  ? -3.969  -2.239  68.521  1.00 26.05  ? 12  VAL L N   1 
ATOM   194  C CA  . VAL A 1 25  ? -5.204  -1.702  67.970  1.00 21.86  ? 12  VAL L CA  1 
ATOM   195  C C   . VAL A 1 25  ? -4.872  -0.897  66.720  1.00 22.46  ? 12  VAL L C   1 
ATOM   196  O O   . VAL A 1 25  ? -3.794  -0.311  66.621  1.00 27.07  ? 12  VAL L O   1 
ATOM   197  C CB  . VAL A 1 25  ? -5.902  -0.765  68.980  1.00 20.52  ? 12  VAL L CB  1 
ATOM   198  C CG1 . VAL A 1 25  ? -7.203  -0.232  68.407  1.00 24.59  ? 12  VAL L CG1 1 
ATOM   199  C CG2 . VAL A 1 25  ? -6.164  -1.494  70.283  1.00 24.02  ? 12  VAL L CG2 1 
ATOM   200  N N   . GLN A 1 26  ? -5.771  -0.904  65.746  1.00 21.14  ? 13  GLN L N   1 
ATOM   201  C CA  . GLN A 1 26  ? -5.536  -0.135  64.541  1.00 23.50  ? 13  GLN L CA  1 
ATOM   202  C C   . GLN A 1 26  ? -6.642  0.898   64.352  1.00 19.43  ? 13  GLN L C   1 
ATOM   203  O O   . GLN A 1 26  ? -7.811  0.611   64.619  1.00 18.51  ? 13  GLN L O   1 
ATOM   204  C CB  . GLN A 1 26  ? -5.388  -1.045  63.315  1.00 29.80  ? 13  GLN L CB  1 
ATOM   205  C CG  . GLN A 1 26  ? -6.658  -1.676  62.773  1.00 34.73  ? 13  GLN L CG  1 
ATOM   206  C CD  . GLN A 1 26  ? -6.447  -2.248  61.372  1.00 41.30  ? 13  GLN L CD  1 
ATOM   207  O OE1 . GLN A 1 26  ? -5.421  -2.866  61.094  1.00 42.67  ? 13  GLN L OE1 1 
ATOM   208  N NE2 . GLN A 1 26  ? -7.402  -2.009  60.476  1.00 46.35  ? 13  GLN L NE2 1 
ATOM   209  N N   . ASP A 1 27  ? -6.268  2.110   63.940  1.00 13.51  ? 14  ASP L N   1 
ATOM   210  C CA  . ASP A 1 27  ? -7.253  3.155   63.744  1.00 12.22  ? 14  ASP L CA  1 
ATOM   211  C C   . ASP A 1 27  ? -8.242  2.877   62.599  1.00 17.01  ? 14  ASP L C   1 
ATOM   212  O O   . ASP A 1 27  ? -8.056  1.949   61.806  1.00 16.51  ? 14  ASP L O   1 
ATOM   213  C CB  . ASP A 1 27  ? -6.602  4.556   63.666  1.00 10.27  ? 14  ASP L CB  1 
ATOM   214  C CG  . ASP A 1 27  ? -5.826  4.816   62.372  1.00 14.63  ? 14  ASP L CG  1 
ATOM   215  O OD1 . ASP A 1 27  ? -6.466  5.029   61.320  1.00 12.81  ? 14  ASP L OD1 1 
ATOM   216  O OD2 . ASP A 1 27  ? -4.577  4.914   62.430  1.00 8.09   ? 14  ASP L OD2 1 
ATOM   217  N N   . GLN A 1 28  A -9.301  3.680   62.538  1.00 20.98  ? 14  GLN L N   1 
ATOM   218  C CA  . GLN A 1 28  A -10.363 3.541   61.539  1.00 21.18  ? 14  GLN L CA  1 
ATOM   219  C C   . GLN A 1 28  A -9.920  3.555   60.083  1.00 20.31  ? 14  GLN L C   1 
ATOM   220  O O   . GLN A 1 28  A -10.572 2.948   59.239  1.00 27.37  ? 14  GLN L O   1 
ATOM   221  C CB  . GLN A 1 28  A -11.412 4.647   61.725  1.00 28.06  ? 14  GLN L CB  1 
ATOM   222  C CG  . GLN A 1 28  A -11.870 4.886   63.158  1.00 42.44  ? 14  GLN L CG  1 
ATOM   223  C CD  . GLN A 1 28  A -12.930 3.910   63.626  1.00 52.68  ? 14  GLN L CD  1 
ATOM   224  O OE1 . GLN A 1 28  A -12.724 3.166   64.588  1.00 57.08  ? 14  GLN L OE1 1 
ATOM   225  N NE2 . GLN A 1 28  A -14.087 3.938   62.976  1.00 56.82  ? 14  GLN L NE2 1 
ATOM   226  N N   . THR A 1 29  B -8.814  4.222   59.778  1.00 16.83  ? 14  THR L N   1 
ATOM   227  C CA  . THR A 1 29  B -8.379  4.327   58.394  1.00 14.83  ? 14  THR L CA  1 
ATOM   228  C C   . THR A 1 29  B -7.041  3.725   57.955  1.00 15.69  ? 14  THR L C   1 
ATOM   229  O O   . THR A 1 29  B -6.621  3.964   56.828  1.00 22.02  ? 14  THR L O   1 
ATOM   230  C CB  . THR A 1 29  B -8.434  5.801   57.935  1.00 20.17  ? 14  THR L CB  1 
ATOM   231  O OG1 . THR A 1 29  B -7.767  6.632   58.896  1.00 34.82  ? 14  THR L OG1 1 
ATOM   232  C CG2 . THR A 1 29  B -9.872  6.265   57.801  1.00 16.78  ? 14  THR L CG2 1 
ATOM   233  N N   . GLU A 1 30  C -6.393  2.914   58.787  1.00 16.20  ? 14  GLU L N   1 
ATOM   234  C CA  . GLU A 1 30  C -5.105  2.312   58.405  1.00 13.14  ? 14  GLU L CA  1 
ATOM   235  C C   . GLU A 1 30  C -5.222  1.423   57.172  1.00 17.10  ? 14  GLU L C   1 
ATOM   236  O O   . GLU A 1 30  C -4.319  1.383   56.342  1.00 21.39  ? 14  GLU L O   1 
ATOM   237  C CB  . GLU A 1 30  C -4.531  1.454   59.531  1.00 16.94  ? 14  GLU L CB  1 
ATOM   238  C CG  . GLU A 1 30  C -4.038  2.198   60.752  1.00 14.28  ? 14  GLU L CG  1 
ATOM   239  C CD  . GLU A 1 30  C -3.245  1.305   61.687  1.00 10.10  ? 14  GLU L CD  1 
ATOM   240  O OE1 . GLU A 1 30  C -2.608  0.358   61.181  1.00 12.13  ? 14  GLU L OE1 1 
ATOM   241  O OE2 . GLU A 1 30  C -3.238  1.560   62.915  1.00 7.20   ? 14  GLU L OE2 1 
ATOM   242  N N   . LYS A 1 31  D -6.318  0.673   57.078  1.00 15.81  ? 14  LYS L N   1 
ATOM   243  C CA  . LYS A 1 31  D -6.546  -0.229  55.954  1.00 15.89  ? 14  LYS L CA  1 
ATOM   244  C C   . LYS A 1 31  D -6.386  0.491   54.619  1.00 14.68  ? 14  LYS L C   1 
ATOM   245  O O   . LYS A 1 31  D -5.844  -0.064  53.677  1.00 18.92  ? 14  LYS L O   1 
ATOM   246  C CB  . LYS A 1 31  D -7.946  -0.833  56.045  1.00 26.47  ? 14  LYS L CB  1 
ATOM   247  C CG  . LYS A 1 31  D -9.061  0.142   55.651  1.00 45.23  ? 14  LYS L CG  1 
ATOM   248  C CD  . LYS A 1 31  D -10.403 -0.190  56.291  1.00 50.18  ? 14  LYS L CD  1 
ATOM   249  C CE  . LYS A 1 31  D -11.500 0.743   55.783  1.00 54.98  ? 14  LYS L CE  1 
ATOM   250  N NZ  . LYS A 1 31  D -11.157 2.187   55.939  1.00 54.61  ? 14  LYS L NZ  1 
ATOM   251  N N   . GLU A 1 32  E -6.818  1.746   54.562  1.00 15.24  ? 14  GLU L N   1 
ATOM   252  C CA  . GLU A 1 32  E -6.730  2.555   53.343  1.00 17.82  ? 14  GLU L CA  1 
ATOM   253  C C   . GLU A 1 32  E -5.279  2.733   52.898  1.00 19.93  ? 14  GLU L C   1 
ATOM   254  O O   . GLU A 1 32  E -4.986  2.774   51.706  1.00 23.36  ? 14  GLU L O   1 
ATOM   255  C CB  . GLU A 1 32  E -7.374  3.920   53.594  1.00 22.49  ? 14  GLU L CB  1 
ATOM   256  C CG  . GLU A 1 32  E -7.423  4.849   52.404  1.00 22.22  ? 14  GLU L CG  1 
ATOM   257  C CD  . GLU A 1 32  E -8.222  6.116   52.677  1.00 31.66  ? 14  GLU L CD  1 
ATOM   258  O OE1 . GLU A 1 32  E -8.648  6.340   53.838  1.00 24.22  ? 14  GLU L OE1 1 
ATOM   259  O OE2 . GLU A 1 32  E -8.423  6.893   51.715  1.00 37.95  ? 14  GLU L OE2 1 
ATOM   260  N N   . LEU A 1 33  F -4.376  2.840   53.868  1.00 19.59  ? 14  LEU L N   1 
ATOM   261  C CA  . LEU A 1 33  F -2.953  3.002   53.597  1.00 13.36  ? 14  LEU L CA  1 
ATOM   262  C C   . LEU A 1 33  F -2.314  1.703   53.146  1.00 12.98  ? 14  LEU L C   1 
ATOM   263  O O   . LEU A 1 33  F -1.440  1.704   52.290  1.00 15.40  ? 14  LEU L O   1 
ATOM   264  C CB  . LEU A 1 33  F -2.240  3.482   54.851  1.00 10.31  ? 14  LEU L CB  1 
ATOM   265  C CG  . LEU A 1 33  F -2.050  4.982   55.029  1.00 15.28  ? 14  LEU L CG  1 
ATOM   266  C CD1 . LEU A 1 33  F -3.176  5.760   54.390  1.00 16.60  ? 14  LEU L CD1 1 
ATOM   267  C CD2 . LEU A 1 33  F -1.943  5.284   56.509  1.00 22.02  ? 14  LEU L CD2 1 
ATOM   268  N N   . PHE A 1 34  G -2.718  0.599   53.760  1.00 12.19  ? 14  PHE L N   1 
ATOM   269  C CA  . PHE A 1 34  G -2.167  -0.702  53.419  1.00 6.75   ? 14  PHE L CA  1 
ATOM   270  C C   . PHE A 1 34  G -2.606  -1.184  52.038  1.00 11.71  ? 14  PHE L C   1 
ATOM   271  O O   . PHE A 1 34  G -1.829  -1.796  51.302  1.00 12.71  ? 14  PHE L O   1 
ATOM   272  C CB  . PHE A 1 34  G -2.510  -1.719  54.506  1.00 6.38   ? 14  PHE L CB  1 
ATOM   273  C CG  . PHE A 1 34  G -1.743  -1.517  55.782  1.00 10.07  ? 14  PHE L CG  1 
ATOM   274  C CD1 . PHE A 1 34  G -0.364  -1.702  55.817  1.00 13.29  ? 14  PHE L CD1 1 
ATOM   275  C CD2 . PHE A 1 34  G -2.392  -1.129  56.945  1.00 9.67   ? 14  PHE L CD2 1 
ATOM   276  C CE1 . PHE A 1 34  G 0.356   -1.502  56.995  1.00 3.34   ? 14  PHE L CE1 1 
ATOM   277  C CE2 . PHE A 1 34  G -1.681  -0.927  58.128  1.00 5.19   ? 14  PHE L CE2 1 
ATOM   278  C CZ  . PHE A 1 34  G -0.307  -1.113  58.151  1.00 2.94   ? 14  PHE L CZ  1 
ATOM   279  N N   . GLU A 1 35  H -3.837  -0.883  51.657  1.00 15.09  ? 14  GLU L N   1 
ATOM   280  C CA  . GLU A 1 35  H -4.315  -1.301  50.345  1.00 16.50  ? 14  GLU L CA  1 
ATOM   281  C C   . GLU A 1 35  H -3.680  -0.474  49.251  1.00 15.24  ? 14  GLU L C   1 
ATOM   282  O O   . GLU A 1 35  H -3.564  -0.928  48.115  1.00 17.48  ? 14  GLU L O   1 
ATOM   283  C CB  . GLU A 1 35  H -5.834  -1.231  50.269  1.00 16.81  ? 14  GLU L CB  1 
ATOM   284  C CG  . GLU A 1 35  H -6.492  -2.255  51.150  1.00 16.70  ? 14  GLU L CG  1 
ATOM   285  C CD  . GLU A 1 35  H -7.978  -2.199  51.064  1.00 26.91  ? 14  GLU L CD  1 
ATOM   286  O OE1 . GLU A 1 35  H -8.525  -1.078  51.093  1.00 32.48  ? 14  GLU L OE1 1 
ATOM   287  O OE2 . GLU A 1 35  H -8.599  -3.277  50.967  1.00 38.87  ? 14  GLU L OE2 1 
ATOM   288  N N   . SER A 1 36  I -3.216  0.720   49.606  1.00 13.53  ? 14  SER L N   1 
ATOM   289  C CA  . SER A 1 36  I -2.561  1.578   48.629  1.00 14.10  ? 14  SER L CA  1 
ATOM   290  C C   . SER A 1 36  I -1.197  0.982   48.260  1.00 17.11  ? 14  SER L C   1 
ATOM   291  O O   . SER A 1 36  I -0.469  1.525   47.424  1.00 20.47  ? 14  SER L O   1 
ATOM   292  C CB  . SER A 1 36  I -2.426  3.015   49.156  1.00 14.60  ? 14  SER L CB  1 
ATOM   293  O OG  . SER A 1 36  I -1.358  3.170   50.076  1.00 13.27  ? 14  SER L OG  1 
ATOM   294  N N   . TYR A 1 37  J -0.857  -0.135  48.902  1.00 15.45  ? 14  TYR L N   1 
ATOM   295  C CA  . TYR A 1 37  J 0.391   -0.837  48.643  1.00 14.40  ? 14  TYR L CA  1 
ATOM   296  C C   . TYR A 1 37  J 0.165   -2.029  47.692  1.00 16.20  ? 14  TYR L C   1 
ATOM   297  O O   . TYR A 1 37  J 1.109   -2.744  47.354  1.00 13.49  ? 14  TYR L O   1 
ATOM   298  C CB  . TYR A 1 37  J 0.971   -1.339  49.966  1.00 16.67  ? 14  TYR L CB  1 
ATOM   299  C CG  . TYR A 1 37  J 1.344   -0.247  50.944  1.00 19.70  ? 14  TYR L CG  1 
ATOM   300  C CD1 . TYR A 1 37  J 1.764   1.003   50.499  1.00 25.39  ? 14  TYR L CD1 1 
ATOM   301  C CD2 . TYR A 1 37  J 1.314   -0.476  52.316  1.00 19.94  ? 14  TYR L CD2 1 
ATOM   302  C CE1 . TYR A 1 37  J 2.153   1.992   51.394  1.00 27.68  ? 14  TYR L CE1 1 
ATOM   303  C CE2 . TYR A 1 37  J 1.697   0.510   53.218  1.00 21.26  ? 14  TYR L CE2 1 
ATOM   304  C CZ  . TYR A 1 37  J 2.120   1.737   52.750  1.00 19.45  ? 14  TYR L CZ  1 
ATOM   305  O OH  . TYR A 1 37  J 2.555   2.700   53.626  1.00 19.65  ? 14  TYR L OH  1 
ATOM   306  N N   . ILE A 1 38  K -1.075  -2.189  47.221  1.00 17.46  ? 14  ILE L N   1 
ATOM   307  C CA  . ILE A 1 38  K -1.483  -3.284  46.339  1.00 20.27  ? 14  ILE L CA  1 
ATOM   308  C C   . ILE A 1 38  K -0.691  -3.690  45.095  1.00 26.54  ? 14  ILE L C   1 
ATOM   309  O O   . ILE A 1 38  K -0.635  -4.877  44.792  1.00 32.84  ? 14  ILE L O   1 
ATOM   310  C CB  . ILE A 1 38  K -2.981  -3.179  45.972  1.00 14.30  ? 14  ILE L CB  1 
ATOM   311  C CG1 . ILE A 1 38  K -3.775  -4.120  46.870  1.00 16.56  ? 14  ILE L CG1 1 
ATOM   312  C CG2 . ILE A 1 38  K -3.228  -3.482  44.499  1.00 18.92  ? 14  ILE L CG2 1 
ATOM   313  C CD1 . ILE A 1 38  K -4.992  -4.705  46.234  1.00 12.80  ? 14  ILE L CD1 1 
ATOM   314  N N   . GLU A 1 39  L -0.174  -2.731  44.332  1.00 25.51  ? 14  GLU L N   1 
ATOM   315  C CA  . GLU A 1 39  L 0.592   -3.034  43.109  1.00 27.91  ? 14  GLU L CA  1 
ATOM   316  C C   . GLU A 1 39  L 0.058   -4.074  42.094  1.00 31.22  ? 14  GLU L C   1 
ATOM   317  O O   . GLU A 1 39  L 0.226   -5.292  42.256  1.00 27.85  ? 14  GLU L O   1 
ATOM   318  C CB  . GLU A 1 39  L 2.048   -3.358  43.437  1.00 18.85  ? 14  GLU L CB  1 
ATOM   319  C CG  . GLU A 1 39  L 2.891   -2.128  43.671  1.00 33.52  ? 14  GLU L CG  1 
ATOM   320  C CD  . GLU A 1 39  L 4.335   -2.444  44.027  1.00 42.03  ? 14  GLU L CD  1 
ATOM   321  O OE1 . GLU A 1 39  L 4.693   -3.642  44.100  1.00 48.25  ? 14  GLU L OE1 1 
ATOM   322  O OE2 . GLU A 1 39  L 5.112   -1.485  44.240  1.00 43.26  ? 14  GLU L OE2 1 
ATOM   323  N N   . GLY A 1 40  M -0.565  -3.569  41.030  1.00 34.97  ? 14  GLY L N   1 
ATOM   324  C CA  . GLY A 1 40  M -1.067  -4.432  39.973  1.00 31.67  ? 14  GLY L CA  1 
ATOM   325  C C   . GLY A 1 40  M 0.114   -4.795  39.079  1.00 28.66  ? 14  GLY L C   1 
ATOM   326  O O   . GLY A 1 40  M 1.001   -3.975  38.847  1.00 29.71  ? 14  GLY L O   1 
ATOM   327  N N   . ARG A 1 41  ? 0.132   -6.014  38.567  1.00 25.82  ? 15  ARG L N   1 
ATOM   328  C CA  . ARG A 1 41  ? 1.230   -6.452  37.732  1.00 23.80  ? 15  ARG L CA  1 
ATOM   329  C C   . ARG A 1 41  ? 1.013   -6.182  36.238  1.00 31.80  ? 15  ARG L C   1 
ATOM   330  O O   . ARG A 1 41  ? 0.292   -5.208  35.919  1.00 36.45  ? 15  ARG L O   1 
ATOM   331  C CB  . ARG A 1 41  ? 1.517   -7.922  38.043  1.00 16.59  ? 15  ARG L CB  1 
ATOM   332  C CG  . ARG A 1 41  ? 2.175   -8.064  39.396  1.00 8.90   ? 15  ARG L CG  1 
ATOM   333  C CD  . ARG A 1 41  ? 1.907   -9.383  40.058  1.00 13.67  ? 15  ARG L CD  1 
ATOM   334  N NE  . ARG A 1 41  ? 2.713   -9.531  41.276  1.00 15.87  ? 15  ARG L NE  1 
ATOM   335  C CZ  . ARG A 1 41  ? 2.885   -10.681 41.926  1.00 13.78  ? 15  ARG L CZ  1 
ATOM   336  N NH1 . ARG A 1 41  ? 2.306   -11.795 41.496  1.00 15.24  ? 15  ARG L NH1 1 
ATOM   337  N NH2 . ARG A 1 41  ? 3.676   -10.733 42.981  1.00 4.20   ? 15  ARG L NH2 1 
ATOM   338  O OXT . ARG A 1 41  ? 1.545   -6.933  35.389  1.00 36.38  ? 15  ARG L OXT 1 
ATOM   339  N N   . ILE B 2 1   ? -8.277  20.805  56.950  1.00 10.03  ? 16  ILE H N   1 
ATOM   340  C CA  . ILE B 2 1   ? -8.253  19.611  56.067  1.00 10.50  ? 16  ILE H CA  1 
ATOM   341  C C   . ILE B 2 1   ? -9.573  19.572  55.315  1.00 11.42  ? 16  ILE H C   1 
ATOM   342  O O   . ILE B 2 1   ? -10.642 19.699  55.926  1.00 8.66   ? 16  ILE H O   1 
ATOM   343  C CB  . ILE B 2 1   ? -8.130  18.304  56.896  1.00 13.14  ? 16  ILE H CB  1 
ATOM   344  C CG1 . ILE B 2 1   ? -6.804  18.272  57.650  1.00 9.23   ? 16  ILE H CG1 1 
ATOM   345  C CG2 . ILE B 2 1   ? -8.244  17.081  55.999  1.00 12.42  ? 16  ILE H CG2 1 
ATOM   346  C CD1 . ILE B 2 1   ? -5.614  18.147  56.751  1.00 8.69   ? 16  ILE H CD1 1 
ATOM   347  N N   . VAL B 2 2   ? -9.493  19.395  54.000  1.00 10.59  ? 17  VAL H N   1 
ATOM   348  C CA  . VAL B 2 2   ? -10.677 19.329  53.150  1.00 12.62  ? 17  VAL H CA  1 
ATOM   349  C C   . VAL B 2 2   ? -11.028 17.870  52.863  1.00 11.96  ? 17  VAL H C   1 
ATOM   350  O O   . VAL B 2 2   ? -10.170 17.088  52.461  1.00 14.32  ? 17  VAL H O   1 
ATOM   351  C CB  . VAL B 2 2   ? -10.456 20.088  51.815  1.00 14.84  ? 17  VAL H CB  1 
ATOM   352  C CG1 . VAL B 2 2   ? -11.671 19.941  50.913  1.00 12.11  ? 17  VAL H CG1 1 
ATOM   353  C CG2 . VAL B 2 2   ? -10.178 21.557  52.087  1.00 6.67   ? 17  VAL H CG2 1 
ATOM   354  N N   . GLU B 2 3   ? -12.291 17.514  53.089  1.00 17.69  ? 18  GLU H N   1 
ATOM   355  C CA  . GLU B 2 3   ? -12.800 16.153  52.871  1.00 21.89  ? 18  GLU H CA  1 
ATOM   356  C C   . GLU B 2 3   ? -12.151 15.077  53.747  1.00 23.03  ? 18  GLU H C   1 
ATOM   357  O O   . GLU B 2 3   ? -11.828 13.984  53.277  1.00 29.52  ? 18  GLU H O   1 
ATOM   358  C CB  . GLU B 2 3   ? -12.715 15.759  51.387  1.00 23.46  ? 18  GLU H CB  1 
ATOM   359  C CG  . GLU B 2 3   ? -13.828 16.335  50.508  1.00 30.45  ? 18  GLU H CG  1 
ATOM   360  C CD  . GLU B 2 3   ? -15.218 15.813  50.874  1.00 31.68  ? 18  GLU H CD  1 
ATOM   361  O OE1 . GLU B 2 3   ? -15.440 14.584  50.799  1.00 32.61  ? 18  GLU H OE1 1 
ATOM   362  O OE2 . GLU B 2 3   ? -16.090 16.636  51.225  1.00 32.05  ? 18  GLU H OE2 1 
ATOM   363  N N   . GLY B 2 4   ? -11.994 15.379  55.030  1.00 22.16  ? 19  GLY H N   1 
ATOM   364  C CA  . GLY B 2 4   ? -11.403 14.424  55.949  1.00 19.67  ? 19  GLY H CA  1 
ATOM   365  C C   . GLY B 2 4   ? -12.420 14.115  57.023  1.00 17.97  ? 19  GLY H C   1 
ATOM   366  O O   . GLY B 2 4   ? -13.558 14.570  56.938  1.00 17.72  ? 19  GLY H O   1 
ATOM   367  N N   . GLN B 2 5   ? -12.017 13.371  58.046  1.00 21.81  ? 20  GLN H N   1 
ATOM   368  C CA  . GLN B 2 5   ? -12.921 13.019  59.144  1.00 22.24  ? 20  GLN H CA  1 
ATOM   369  C C   . GLN B 2 5   ? -12.296 13.257  60.520  1.00 22.18  ? 20  GLN H C   1 
ATOM   370  O O   . GLN B 2 5   ? -11.072 13.358  60.649  1.00 19.56  ? 20  GLN H O   1 
ATOM   371  C CB  . GLN B 2 5   ? -13.364 11.555  59.017  1.00 22.16  ? 20  GLN H CB  1 
ATOM   372  C CG  . GLN B 2 5   ? -12.237 10.531  59.045  1.00 28.20  ? 20  GLN H CG  1 
ATOM   373  C CD  . GLN B 2 5   ? -12.683 9.167   58.542  1.00 38.64  ? 20  GLN H CD  1 
ATOM   374  O OE1 . GLN B 2 5   ? -12.509 8.841   57.368  1.00 46.79  ? 20  GLN H OE1 1 
ATOM   375  N NE2 . GLN B 2 5   ? -13.251 8.360   59.430  1.00 42.36  ? 20  GLN H NE2 1 
ATOM   376  N N   . ASP B 2 6   ? -13.139 13.359  61.543  1.00 20.83  ? 21  ASP H N   1 
ATOM   377  C CA  . ASP B 2 6   ? -12.654 13.563  62.903  1.00 21.24  ? 21  ASP H CA  1 
ATOM   378  C C   . ASP B 2 6   ? -11.658 12.467  63.270  1.00 19.93  ? 21  ASP H C   1 
ATOM   379  O O   . ASP B 2 6   ? -11.924 11.278  63.074  1.00 19.96  ? 21  ASP H O   1 
ATOM   380  C CB  . ASP B 2 6   ? -13.815 13.556  63.894  1.00 22.24  ? 21  ASP H CB  1 
ATOM   381  C CG  . ASP B 2 6   ? -14.701 14.767  63.759  1.00 22.97  ? 21  ASP H CG  1 
ATOM   382  O OD1 . ASP B 2 6   ? -14.204 15.828  63.325  1.00 21.83  ? 21  ASP H OD1 1 
ATOM   383  O OD2 . ASP B 2 6   ? -15.899 14.656  64.092  1.00 30.68  ? 21  ASP H OD2 1 
ATOM   384  N N   . ALA B 2 7   ? -10.503 12.877  63.778  1.00 18.39  ? 22  ALA H N   1 
ATOM   385  C CA  . ALA B 2 7   ? -9.459  11.941  64.155  1.00 15.64  ? 22  ALA H CA  1 
ATOM   386  C C   . ALA B 2 7   ? -9.730  11.404  65.547  1.00 17.73  ? 22  ALA H C   1 
ATOM   387  O O   . ALA B 2 7   ? -10.175 12.140  66.432  1.00 19.66  ? 22  ALA H O   1 
ATOM   388  C CB  . ALA B 2 7   ? -8.088  12.632  64.110  1.00 5.58   ? 22  ALA H CB  1 
ATOM   389  N N   . GLU B 2 8   ? -9.479  10.117  65.743  1.00 15.14  ? 23  GLU H N   1 
ATOM   390  C CA  . GLU B 2 8   ? -9.671  9.525   67.054  1.00 14.20  ? 23  GLU H CA  1 
ATOM   391  C C   . GLU B 2 8   ? -8.679  10.163  68.010  1.00 13.66  ? 23  GLU H C   1 
ATOM   392  O O   . GLU B 2 8   ? -7.691  10.782  67.589  1.00 15.79  ? 23  GLU H O   1 
ATOM   393  C CB  . GLU B 2 8   ? -9.427  8.021   67.020  1.00 17.03  ? 23  GLU H CB  1 
ATOM   394  C CG  . GLU B 2 8   ? -10.355 7.269   66.106  1.00 15.66  ? 23  GLU H CG  1 
ATOM   395  C CD  . GLU B 2 8   ? -9.598  6.534   65.049  1.00 20.98  ? 23  GLU H CD  1 
ATOM   396  O OE1 . GLU B 2 8   ? -9.225  5.369   65.315  1.00 21.17  ? 23  GLU H OE1 1 
ATOM   397  O OE2 . GLU B 2 8   ? -9.362  7.134   63.970  1.00 18.85  ? 23  GLU H OE2 1 
ATOM   398  N N   . VAL B 2 9   ? -8.946  10.021  69.299  1.00 10.78  ? 24  VAL H N   1 
ATOM   399  C CA  . VAL B 2 9   ? -8.064  10.588  70.296  1.00 16.79  ? 24  VAL H CA  1 
ATOM   400  C C   . VAL B 2 9   ? -6.744  9.802   70.222  1.00 15.73  ? 24  VAL H C   1 
ATOM   401  O O   . VAL B 2 9   ? -6.745  8.588   70.007  1.00 19.21  ? 24  VAL H O   1 
ATOM   402  C CB  . VAL B 2 9   ? -8.723  10.536  71.720  1.00 20.00  ? 24  VAL H CB  1 
ATOM   403  C CG1 . VAL B 2 9   ? -8.697  9.121   72.287  1.00 25.84  ? 24  VAL H CG1 1 
ATOM   404  C CG2 . VAL B 2 9   ? -8.054  11.514  72.660  1.00 23.07  ? 24  VAL H CG2 1 
ATOM   405  N N   . GLY B 2 10  ? -5.626  10.516  70.285  1.00 13.45  ? 25  GLY H N   1 
ATOM   406  C CA  . GLY B 2 10  ? -4.327  9.876   70.233  1.00 9.62   ? 25  GLY H CA  1 
ATOM   407  C C   . GLY B 2 10  ? -3.929  9.337   68.874  1.00 14.53  ? 25  GLY H C   1 
ATOM   408  O O   . GLY B 2 10  ? -2.956  8.591   68.788  1.00 16.01  ? 25  GLY H O   1 
ATOM   409  N N   . LEU B 2 11  ? -4.622  9.754   67.811  1.00 15.47  ? 26  LEU H N   1 
ATOM   410  C CA  . LEU B 2 11  ? -4.334  9.272   66.460  1.00 12.06  ? 26  LEU H CA  1 
ATOM   411  C C   . LEU B 2 11  ? -2.904  9.586   66.032  1.00 14.39  ? 26  LEU H C   1 
ATOM   412  O O   . LEU B 2 11  ? -2.233  8.754   65.421  1.00 8.81   ? 26  LEU H O   1 
ATOM   413  C CB  . LEU B 2 11  ? -5.320  9.865   65.447  1.00 11.94  ? 26  LEU H CB  1 
ATOM   414  C CG  . LEU B 2 11  ? -5.201  9.280   64.029  1.00 11.93  ? 26  LEU H CG  1 
ATOM   415  C CD1 . LEU B 2 11  ? -5.771  7.876   64.018  1.00 2.00   ? 26  LEU H CD1 1 
ATOM   416  C CD2 . LEU B 2 11  ? -5.897  10.163  62.989  1.00 5.67   ? 26  LEU H CD2 1 
ATOM   417  N N   . SER B 2 12  ? -2.460  10.806  66.305  1.00 14.70  ? 27  SER H N   1 
ATOM   418  C CA  . SER B 2 12  ? -1.106  11.202  65.965  1.00 13.64  ? 27  SER H CA  1 
ATOM   419  C C   . SER B 2 12  ? -0.513  12.029  67.097  1.00 10.23  ? 27  SER H C   1 
ATOM   420  O O   . SER B 2 12  ? -0.544  13.259  67.068  1.00 9.84   ? 27  SER H O   1 
ATOM   421  C CB  . SER B 2 12  ? -1.067  11.951  64.620  1.00 16.58  ? 27  SER H CB  1 
ATOM   422  O OG  . SER B 2 12  ? -2.122  12.882  64.491  1.00 18.98  ? 27  SER H OG  1 
ATOM   423  N N   . PRO B 2 13  ? 0.079   11.349  68.099  1.00 8.92   ? 28  PRO H N   1 
ATOM   424  C CA  . PRO B 2 13  ? 0.692   11.990  69.262  1.00 7.38   ? 28  PRO H CA  1 
ATOM   425  C C   . PRO B 2 13  ? 1.872   12.917  68.965  1.00 11.28  ? 28  PRO H C   1 
ATOM   426  O O   . PRO B 2 13  ? 2.468   13.471  69.885  1.00 15.82  ? 28  PRO H O   1 
ATOM   427  C CB  . PRO B 2 13  ? 1.091   10.795  70.129  1.00 10.34  ? 28  PRO H CB  1 
ATOM   428  C CG  . PRO B 2 13  ? 1.328   9.703   69.145  1.00 3.44   ? 28  PRO H CG  1 
ATOM   429  C CD  . PRO B 2 13  ? 0.177   9.882   68.209  1.00 8.60   ? 28  PRO H CD  1 
ATOM   430  N N   . TRP B 2 14  ? 2.209   13.078  67.689  1.00 9.92   ? 29  TRP H N   1 
ATOM   431  C CA  . TRP B 2 14  ? 3.306   13.951  67.268  1.00 6.17   ? 29  TRP H CA  1 
ATOM   432  C C   . TRP B 2 14  ? 2.793   15.270  66.689  1.00 3.98   ? 29  TRP H C   1 
ATOM   433  O O   . TRP B 2 14  ? 3.576   16.107  66.264  1.00 9.82   ? 29  TRP H O   1 
ATOM   434  C CB  . TRP B 2 14  ? 4.188   13.245  66.227  1.00 10.38  ? 29  TRP H CB  1 
ATOM   435  C CG  . TRP B 2 14  ? 3.422   12.416  65.229  1.00 6.35   ? 29  TRP H CG  1 
ATOM   436  C CD1 . TRP B 2 14  ? 2.658   12.870  64.181  1.00 7.08   ? 29  TRP H CD1 1 
ATOM   437  C CD2 . TRP B 2 14  ? 3.296   10.989  65.230  1.00 2.46   ? 29  TRP H CD2 1 
ATOM   438  N NE1 . TRP B 2 14  ? 2.054   11.808  63.547  1.00 5.00   ? 29  TRP H NE1 1 
ATOM   439  C CE2 . TRP B 2 14  ? 2.431   10.644  64.166  1.00 3.43   ? 29  TRP H CE2 1 
ATOM   440  C CE3 . TRP B 2 14  ? 3.826   9.968   66.034  1.00 4.70   ? 29  TRP H CE3 1 
ATOM   441  C CZ2 . TRP B 2 14  ? 2.086   9.320   63.882  1.00 2.60   ? 29  TRP H CZ2 1 
ATOM   442  C CZ3 . TRP B 2 14  ? 3.483   8.650   65.751  1.00 4.67   ? 29  TRP H CZ3 1 
ATOM   443  C CH2 . TRP B 2 14  ? 2.619   8.340   64.681  1.00 2.00   ? 29  TRP H CH2 1 
ATOM   444  N N   . GLN B 2 15  ? 1.477   15.414  66.608  1.00 2.08   ? 30  GLN H N   1 
ATOM   445  C CA  . GLN B 2 15  ? 0.858   16.622  66.082  1.00 2.00   ? 30  GLN H CA  1 
ATOM   446  C C   . GLN B 2 15  ? 1.017   17.739  67.106  1.00 5.07   ? 30  GLN H C   1 
ATOM   447  O O   . GLN B 2 15  ? 0.460   17.668  68.203  1.00 9.30   ? 30  GLN H O   1 
ATOM   448  C CB  . GLN B 2 15  ? -0.633  16.363  65.840  1.00 4.02   ? 30  GLN H CB  1 
ATOM   449  C CG  . GLN B 2 15  ? -1.419  17.536  65.270  1.00 5.82   ? 30  GLN H CG  1 
ATOM   450  C CD  . GLN B 2 15  ? -1.113  17.809  63.813  1.00 3.04   ? 30  GLN H CD  1 
ATOM   451  O OE1 . GLN B 2 15  ? -0.978  16.890  63.009  1.00 2.62   ? 30  GLN H OE1 1 
ATOM   452  N NE2 . GLN B 2 15  ? -1.024  19.078  63.459  1.00 7.14   ? 30  GLN H NE2 1 
ATOM   453  N N   . VAL B 2 16  ? 1.816   18.741  66.768  1.00 5.42   ? 31  VAL H N   1 
ATOM   454  C CA  . VAL B 2 16  ? 2.043   19.893  67.638  1.00 2.77   ? 31  VAL H CA  1 
ATOM   455  C C   . VAL B 2 16  ? 1.239   21.051  67.051  1.00 9.77   ? 31  VAL H C   1 
ATOM   456  O O   . VAL B 2 16  ? 0.884   21.032  65.864  1.00 15.26  ? 31  VAL H O   1 
ATOM   457  C CB  . VAL B 2 16  ? 3.550   20.254  67.674  1.00 2.00   ? 31  VAL H CB  1 
ATOM   458  C CG1 . VAL B 2 16  ? 3.792   21.672  68.180  1.00 2.00   ? 31  VAL H CG1 1 
ATOM   459  C CG2 . VAL B 2 16  ? 4.286   19.252  68.524  1.00 3.85   ? 31  VAL H CG2 1 
ATOM   460  N N   . MET B 2 17  ? 0.900   22.029  67.880  1.00 10.13  ? 32  MET H N   1 
ATOM   461  C CA  . MET B 2 17  ? 0.152   23.184  67.408  1.00 8.57   ? 32  MET H CA  1 
ATOM   462  C C   . MET B 2 17  ? 0.950   24.463  67.684  1.00 7.53   ? 32  MET H C   1 
ATOM   463  O O   . MET B 2 17  ? 1.386   24.696  68.810  1.00 9.35   ? 32  MET H O   1 
ATOM   464  C CB  . MET B 2 17  ? -1.207  23.238  68.115  1.00 2.00   ? 32  MET H CB  1 
ATOM   465  C CG  . MET B 2 17  ? -2.180  24.238  67.529  1.00 7.38   ? 32  MET H CG  1 
ATOM   466  S SD  . MET B 2 17  ? -3.433  24.793  68.716  1.00 12.02  ? 32  MET H SD  1 
ATOM   467  C CE  . MET B 2 17  ? -4.794  23.727  68.349  1.00 12.95  ? 32  MET H CE  1 
ATOM   468  N N   . LEU B 2 18  ? 1.214   25.252  66.648  1.00 7.17   ? 33  LEU H N   1 
ATOM   469  C CA  . LEU B 2 18  ? 1.936   26.505  66.834  1.00 7.57   ? 33  LEU H CA  1 
ATOM   470  C C   . LEU B 2 18  ? 0.888   27.497  67.276  1.00 11.19  ? 33  LEU H C   1 
ATOM   471  O O   . LEU B 2 18  ? -0.106  27.731  66.575  1.00 11.93  ? 33  LEU H O   1 
ATOM   472  C CB  . LEU B 2 18  ? 2.598   26.971  65.544  1.00 14.32  ? 33  LEU H CB  1 
ATOM   473  C CG  . LEU B 2 18  ? 4.093   26.677  65.436  1.00 17.94  ? 33  LEU H CG  1 
ATOM   474  C CD1 . LEU B 2 18  ? 4.591   27.059  64.054  1.00 21.58  ? 33  LEU H CD1 1 
ATOM   475  C CD2 . LEU B 2 18  ? 4.843   27.447  66.517  1.00 20.25  ? 33  LEU H CD2 1 
ATOM   476  N N   . PHE B 2 19  ? 1.111   28.084  68.438  1.00 8.99   ? 34  PHE H N   1 
ATOM   477  C CA  . PHE B 2 19  ? 0.152   28.998  69.001  1.00 5.46   ? 34  PHE H CA  1 
ATOM   478  C C   . PHE B 2 19  ? 0.821   30.325  69.288  1.00 7.95   ? 34  PHE H C   1 
ATOM   479  O O   . PHE B 2 19  ? 1.998   30.367  69.663  1.00 5.91   ? 34  PHE H O   1 
ATOM   480  C CB  . PHE B 2 19  ? -0.381  28.370  70.287  1.00 2.00   ? 34  PHE H CB  1 
ATOM   481  C CG  . PHE B 2 19  ? -1.722  28.864  70.702  1.00 5.13   ? 34  PHE H CG  1 
ATOM   482  C CD1 . PHE B 2 19  ? -2.865  28.422  70.057  1.00 5.97   ? 34  PHE H CD1 1 
ATOM   483  C CD2 . PHE B 2 19  ? -1.852  29.729  71.780  1.00 8.30   ? 34  PHE H CD2 1 
ATOM   484  C CE1 . PHE B 2 19  ? -4.124  28.828  70.480  1.00 6.23   ? 34  PHE H CE1 1 
ATOM   485  C CE2 . PHE B 2 19  ? -3.104  30.141  72.209  1.00 4.85   ? 34  PHE H CE2 1 
ATOM   486  C CZ  . PHE B 2 19  ? -4.245  29.684  71.554  1.00 5.71   ? 34  PHE H CZ  1 
ATOM   487  N N   . ARG B 2 20  ? 0.073   31.405  69.077  1.00 11.59  ? 35  ARG H N   1 
ATOM   488  C CA  . ARG B 2 20  ? 0.562   32.757  69.326  1.00 15.26  ? 35  ARG H CA  1 
ATOM   489  C C   . ARG B 2 20  ? 0.110   33.207  70.712  1.00 16.13  ? 35  ARG H C   1 
ATOM   490  O O   . ARG B 2 20  ? -1.071  33.102  71.043  1.00 13.64  ? 35  ARG H O   1 
ATOM   491  C CB  . ARG B 2 20  ? 0.047   33.727  68.256  1.00 11.36  ? 35  ARG H CB  1 
ATOM   492  C CG  . ARG B 2 20  ? 0.173   35.173  68.653  1.00 15.91  ? 35  ARG H CG  1 
ATOM   493  C CD  . ARG B 2 20  ? 0.613   36.052  67.528  1.00 27.12  ? 35  ARG H CD  1 
ATOM   494  N NE  . ARG B 2 20  ? -0.459  36.357  66.590  1.00 38.23  ? 35  ARG H NE  1 
ATOM   495  C CZ  . ARG B 2 20  ? -0.462  37.424  65.796  1.00 45.19  ? 35  ARG H CZ  1 
ATOM   496  N NH1 . ARG B 2 20  ? 0.548   38.288  65.833  1.00 43.37  ? 35  ARG H NH1 1 
ATOM   497  N NH2 . ARG B 2 20  ? -1.467  37.627  64.955  1.00 51.32  ? 35  ARG H NH2 1 
ATOM   498  N N   . LYS B 2 21  ? 1.048   33.742  71.495  1.00 18.78  ? 36  LYS H N   1 
ATOM   499  C CA  . LYS B 2 21  ? 0.771   34.198  72.855  1.00 16.03  ? 36  LYS H CA  1 
ATOM   500  C C   . LYS B 2 21  ? -0.309  35.252  72.939  1.00 18.43  ? 36  LYS H C   1 
ATOM   501  O O   . LYS B 2 21  ? -1.262  35.111  73.707  1.00 21.21  ? 36  LYS H O   1 
ATOM   502  C CB  . LYS B 2 21  ? 2.032   34.749  73.519  1.00 6.18   ? 36  LYS H CB  1 
ATOM   503  C CG  . LYS B 2 21  ? 3.118   33.728  73.796  1.00 2.00   ? 36  LYS H CG  1 
ATOM   504  C CD  . LYS B 2 21  ? 4.262   34.388  74.525  1.00 2.00   ? 36  LYS H CD  1 
ATOM   505  C CE  . LYS B 2 21  ? 5.419   33.456  74.727  1.00 2.00   ? 36  LYS H CE  1 
ATOM   506  N NZ  . LYS B 2 21  ? 6.551   34.170  75.395  1.00 4.89   ? 36  LYS H NZ  1 
ATOM   507  N N   . SER B 2 22  A -0.159  36.318  72.164  1.00 20.24  ? 36  SER H N   1 
ATOM   508  C CA  . SER B 2 22  A -1.128  37.399  72.206  1.00 23.33  ? 36  SER H CA  1 
ATOM   509  C C   . SER B 2 22  A -1.179  38.190  70.909  1.00 25.98  ? 36  SER H C   1 
ATOM   510  O O   . SER B 2 22  A -0.210  38.864  70.549  1.00 26.94  ? 36  SER H O   1 
ATOM   511  C CB  . SER B 2 22  A -0.803  38.335  73.373  1.00 23.95  ? 36  SER H CB  1 
ATOM   512  O OG  . SER B 2 22  A -1.790  39.338  73.513  1.00 32.84  ? 36  SER H OG  1 
ATOM   513  N N   . PRO B 2 23  ? -2.348  38.195  70.235  1.00 26.90  ? 37  PRO H N   1 
ATOM   514  C CA  . PRO B 2 23  ? -3.569  37.498  70.659  1.00 24.02  ? 37  PRO H CA  1 
ATOM   515  C C   . PRO B 2 23  ? -3.432  35.985  70.550  1.00 24.81  ? 37  PRO H C   1 
ATOM   516  O O   . PRO B 2 23  ? -2.580  35.493  69.813  1.00 32.04  ? 37  PRO H O   1 
ATOM   517  C CB  . PRO B 2 23  ? -4.621  38.044  69.690  1.00 22.05  ? 37  PRO H CB  1 
ATOM   518  C CG  . PRO B 2 23  ? -3.830  38.323  68.450  1.00 19.86  ? 37  PRO H CG  1 
ATOM   519  C CD  . PRO B 2 23  ? -2.600  38.984  69.014  1.00 26.29  ? 37  PRO H CD  1 
ATOM   520  N N   . GLN B 2 24  ? -4.234  35.255  71.321  1.00 21.82  ? 38  GLN H N   1 
ATOM   521  C CA  . GLN B 2 24  ? -4.307  33.805  71.186  1.00 17.69  ? 38  GLN H CA  1 
ATOM   522  C C   . GLN B 2 24  ? -4.874  33.522  69.811  1.00 19.97  ? 38  GLN H C   1 
ATOM   523  O O   . GLN B 2 24  ? -5.923  34.052  69.445  1.00 26.11  ? 38  GLN H O   1 
ATOM   524  C CB  . GLN B 2 24  ? -5.176  33.192  72.287  1.00 16.89  ? 38  GLN H CB  1 
ATOM   525  C CG  . GLN B 2 24  ? -4.571  33.343  73.685  1.00 21.76  ? 38  GLN H CG  1 
ATOM   526  C CD  . GLN B 2 24  ? -5.197  32.421  74.711  1.00 24.02  ? 38  GLN H CD  1 
ATOM   527  O OE1 . GLN B 2 24  ? -6.357  32.035  74.591  1.00 28.70  ? 38  GLN H OE1 1 
ATOM   528  N NE2 . GLN B 2 24  ? -4.424  32.050  75.721  1.00 25.33  ? 38  GLN H NE2 1 
ATOM   529  N N   . GLU B 2 25  ? -4.180  32.681  69.056  1.00 22.47  ? 39  GLU H N   1 
ATOM   530  C CA  . GLU B 2 25  ? -4.568  32.372  67.689  1.00 19.10  ? 39  GLU H CA  1 
ATOM   531  C C   . GLU B 2 25  ? -3.770  31.155  67.234  1.00 15.12  ? 39  GLU H C   1 
ATOM   532  O O   . GLU B 2 25  ? -2.601  31.021  67.586  1.00 15.59  ? 39  GLU H O   1 
ATOM   533  C CB  . GLU B 2 25  ? -4.177  33.583  66.838  1.00 24.13  ? 39  GLU H CB  1 
ATOM   534  C CG  . GLU B 2 25  ? -4.632  33.609  65.407  1.00 35.22  ? 39  GLU H CG  1 
ATOM   535  C CD  . GLU B 2 25  ? -3.871  34.653  64.610  1.00 43.05  ? 39  GLU H CD  1 
ATOM   536  O OE1 . GLU B 2 25  ? -3.501  35.695  65.190  1.00 39.40  ? 39  GLU H OE1 1 
ATOM   537  O OE2 . GLU B 2 25  ? -3.616  34.421  63.408  1.00 54.54  ? 39  GLU H OE2 1 
ATOM   538  N N   . LEU B 2 26  ? -4.408  30.249  66.503  1.00 14.54  ? 40  LEU H N   1 
ATOM   539  C CA  . LEU B 2 26  ? -3.721  29.067  65.994  1.00 14.56  ? 40  LEU H CA  1 
ATOM   540  C C   . LEU B 2 26  ? -2.968  29.550  64.773  1.00 19.77  ? 40  LEU H C   1 
ATOM   541  O O   . LEU B 2 26  ? -3.566  30.147  63.873  1.00 28.71  ? 40  LEU H O   1 
ATOM   542  C CB  . LEU B 2 26  ? -4.734  27.985  65.606  1.00 19.04  ? 40  LEU H CB  1 
ATOM   543  C CG  . LEU B 2 26  ? -4.265  26.661  64.985  1.00 15.75  ? 40  LEU H CG  1 
ATOM   544  C CD1 . LEU B 2 26  ? -5.198  25.578  65.447  1.00 24.97  ? 40  LEU H CD1 1 
ATOM   545  C CD2 . LEU B 2 26  ? -4.249  26.714  63.456  1.00 15.18  ? 40  LEU H CD2 1 
ATOM   546  N N   . LEU B 2 27  ? -1.661  29.321  64.741  1.00 18.84  ? 41  LEU H N   1 
ATOM   547  C CA  . LEU B 2 27  ? -0.851  29.766  63.616  1.00 8.27   ? 41  LEU H CA  1 
ATOM   548  C C   . LEU B 2 27  ? -0.562  28.681  62.601  1.00 12.96  ? 41  LEU H C   1 
ATOM   549  O O   . LEU B 2 27  ? -0.658  28.914  61.399  1.00 19.48  ? 41  LEU H O   1 
ATOM   550  C CB  . LEU B 2 27  ? 0.470   30.336  64.108  1.00 5.10   ? 41  LEU H CB  1 
ATOM   551  C CG  . LEU B 2 27  ? 0.409   31.546  65.034  1.00 10.96  ? 41  LEU H CG  1 
ATOM   552  C CD1 . LEU B 2 27  ? 1.781   31.778  65.609  1.00 10.38  ? 41  LEU H CD1 1 
ATOM   553  C CD2 . LEU B 2 27  ? -0.089  32.775  64.298  1.00 2.00   ? 41  LEU H CD2 1 
ATOM   554  N N   . CYS B 2 28  ? -0.195  27.497  63.074  1.00 11.07  ? 42  CYS H N   1 
ATOM   555  C CA  . CYS B 2 28  ? 0.153   26.397  62.177  1.00 10.77  ? 42  CYS H CA  1 
ATOM   556  C C   . CYS B 2 28  ? 0.233   25.088  62.937  1.00 10.86  ? 42  CYS H C   1 
ATOM   557  O O   . CYS B 2 28  ? 0.039   25.031  64.149  1.00 13.99  ? 42  CYS H O   1 
ATOM   558  C CB  . CYS B 2 28  ? 1.549   26.628  61.580  1.00 14.69  ? 42  CYS H CB  1 
ATOM   559  S SG  . CYS B 2 28  ? 1.734   27.647  60.085  1.00 14.56  ? 42  CYS H SG  1 
ATOM   560  N N   . GLY B 2 29  ? 0.601   24.045  62.211  1.00 10.52  ? 43  GLY H N   1 
ATOM   561  C CA  . GLY B 2 29  ? 0.765   22.746  62.814  1.00 11.52  ? 43  GLY H CA  1 
ATOM   562  C C   . GLY B 2 29  ? 2.263   22.516  62.891  1.00 11.88  ? 43  GLY H C   1 
ATOM   563  O O   . GLY B 2 29  ? 3.052   23.345  62.428  1.00 11.51  ? 43  GLY H O   1 
ATOM   564  N N   . ALA B 2 30  ? 2.659   21.403  63.485  1.00 6.29   ? 44  ALA H N   1 
ATOM   565  C CA  . ALA B 2 30  ? 4.063   21.068  63.611  1.00 3.90   ? 44  ALA H CA  1 
ATOM   566  C C   . ALA B 2 30  ? 4.103   19.600  63.930  1.00 2.00   ? 44  ALA H C   1 
ATOM   567  O O   . ALA B 2 30  ? 3.057   18.977  64.092  1.00 2.00   ? 44  ALA H O   1 
ATOM   568  C CB  . ALA B 2 30  ? 4.710   21.876  64.716  1.00 6.74   ? 44  ALA H CB  1 
ATOM   569  N N   . SER B 2 31  ? 5.305   19.068  64.072  1.00 4.29   ? 45  SER H N   1 
ATOM   570  C CA  . SER B 2 31  ? 5.513   17.652  64.338  1.00 6.77   ? 45  SER H CA  1 
ATOM   571  C C   . SER B 2 31  ? 6.571   17.438  65.428  1.00 10.02  ? 45  SER H C   1 
ATOM   572  O O   . SER B 2 31  ? 7.620   18.085  65.425  1.00 9.50   ? 45  SER H O   1 
ATOM   573  C CB  . SER B 2 31  ? 5.976   16.990  63.041  1.00 5.20   ? 45  SER H CB  1 
ATOM   574  O OG  . SER B 2 31  ? 6.273   15.629  63.234  1.00 21.11  ? 45  SER H OG  1 
ATOM   575  N N   . LEU B 2 32  ? 6.314   16.508  66.341  1.00 9.25   ? 46  LEU H N   1 
ATOM   576  C CA  . LEU B 2 32  ? 7.252   16.220  67.417  1.00 3.31   ? 46  LEU H CA  1 
ATOM   577  C C   . LEU B 2 32  ? 8.221   15.153  66.931  1.00 4.42   ? 46  LEU H C   1 
ATOM   578  O O   . LEU B 2 32  ? 7.797   14.029  66.652  1.00 4.20   ? 46  LEU H O   1 
ATOM   579  C CB  . LEU B 2 32  ? 6.498   15.718  68.655  1.00 2.00   ? 46  LEU H CB  1 
ATOM   580  C CG  . LEU B 2 32  ? 7.304   15.591  69.960  1.00 11.11  ? 46  LEU H CG  1 
ATOM   581  C CD1 . LEU B 2 32  ? 7.581   16.973  70.547  1.00 3.37   ? 46  LEU H CD1 1 
ATOM   582  C CD2 . LEU B 2 32  ? 6.558   14.734  70.973  1.00 12.36  ? 46  LEU H CD2 1 
ATOM   583  N N   . ILE B 2 33  ? 9.506   15.492  66.817  1.00 4.49   ? 47  ILE H N   1 
ATOM   584  C CA  . ILE B 2 33  ? 10.498  14.514  66.363  1.00 8.45   ? 47  ILE H CA  1 
ATOM   585  C C   . ILE B 2 33  ? 11.304  13.858  67.484  1.00 12.72  ? 47  ILE H C   1 
ATOM   586  O O   . ILE B 2 33  ? 11.890  12.789  67.292  1.00 17.59  ? 47  ILE H O   1 
ATOM   587  C CB  . ILE B 2 33  ? 11.442  15.058  65.248  1.00 5.77   ? 47  ILE H CB  1 
ATOM   588  C CG1 . ILE B 2 33  ? 12.133  16.357  65.660  1.00 4.55   ? 47  ILE H CG1 1 
ATOM   589  C CG2 . ILE B 2 33  ? 10.661  15.265  63.985  1.00 8.60   ? 47  ILE H CG2 1 
ATOM   590  C CD1 . ILE B 2 33  ? 13.176  16.847  64.656  1.00 2.00   ? 47  ILE H CD1 1 
ATOM   591  N N   . SER B 2 34  ? 11.316  14.494  68.651  1.00 14.64  ? 48  SER H N   1 
ATOM   592  C CA  . SER B 2 34  ? 12.005  13.983  69.843  1.00 13.01  ? 48  SER H CA  1 
ATOM   593  C C   . SER B 2 34  ? 11.331  14.697  71.004  1.00 11.53  ? 48  SER H C   1 
ATOM   594  O O   . SER B 2 34  ? 10.395  15.474  70.784  1.00 13.09  ? 48  SER H O   1 
ATOM   595  C CB  . SER B 2 34  ? 13.503  14.316  69.819  1.00 13.59  ? 48  SER H CB  1 
ATOM   596  O OG  . SER B 2 34  ? 13.747  15.706  70.007  1.00 16.67  ? 48  SER H OG  1 
ATOM   597  N N   . ASP B 2 35  ? 11.791  14.463  72.228  1.00 7.48   ? 49  ASP H N   1 
ATOM   598  C CA  . ASP B 2 35  ? 11.171  15.129  73.365  1.00 8.16   ? 49  ASP H CA  1 
ATOM   599  C C   . ASP B 2 35  ? 11.511  16.614  73.466  1.00 11.62  ? 49  ASP H C   1 
ATOM   600  O O   . ASP B 2 35  ? 10.915  17.323  74.267  1.00 12.28  ? 49  ASP H O   1 
ATOM   601  C CB  . ASP B 2 35  ? 11.470  14.402  74.689  1.00 13.74  ? 49  ASP H CB  1 
ATOM   602  C CG  . ASP B 2 35  ? 12.951  14.361  75.041  1.00 20.36  ? 49  ASP H CG  1 
ATOM   603  O OD1 . ASP B 2 35  ? 13.788  14.877  74.275  1.00 25.44  ? 49  ASP H OD1 1 
ATOM   604  O OD2 . ASP B 2 35  ? 13.283  13.803  76.108  1.00 25.96  ? 49  ASP H OD2 1 
ATOM   605  N N   . ARG B 2 36  ? 12.456  17.089  72.654  1.00 15.27  ? 50  ARG H N   1 
ATOM   606  C CA  . ARG B 2 36  ? 12.827  18.504  72.688  1.00 12.71  ? 50  ARG H CA  1 
ATOM   607  C C   . ARG B 2 36  ? 12.970  19.164  71.316  1.00 12.80  ? 50  ARG H C   1 
ATOM   608  O O   . ARG B 2 36  ? 13.383  20.321  71.225  1.00 14.10  ? 50  ARG H O   1 
ATOM   609  C CB  . ARG B 2 36  ? 14.086  18.730  73.533  1.00 10.83  ? 50  ARG H CB  1 
ATOM   610  C CG  . ARG B 2 36  ? 15.357  18.148  72.962  1.00 12.90  ? 50  ARG H CG  1 
ATOM   611  C CD  . ARG B 2 36  ? 16.383  17.954  74.055  1.00 20.07  ? 50  ARG H CD  1 
ATOM   612  N NE  . ARG B 2 36  ? 15.963  16.922  75.008  1.00 28.65  ? 50  ARG H NE  1 
ATOM   613  C CZ  . ARG B 2 36  ? 16.673  16.530  76.065  1.00 29.04  ? 50  ARG H CZ  1 
ATOM   614  N NH1 . ARG B 2 36  ? 17.854  17.079  76.328  1.00 31.56  ? 50  ARG H NH1 1 
ATOM   615  N NH2 . ARG B 2 36  ? 16.213  15.560  76.844  1.00 31.82  ? 50  ARG H NH2 1 
ATOM   616  N N   . TRP B 2 37  ? 12.603  18.450  70.257  1.00 9.81   ? 51  TRP H N   1 
ATOM   617  C CA  . TRP B 2 37  ? 12.681  19.016  68.917  1.00 8.44   ? 51  TRP H CA  1 
ATOM   618  C C   . TRP B 2 37  ? 11.375  18.875  68.176  1.00 8.51   ? 51  TRP H C   1 
ATOM   619  O O   . TRP B 2 37  ? 10.771  17.803  68.153  1.00 11.06  ? 51  TRP H O   1 
ATOM   620  C CB  . TRP B 2 37  ? 13.818  18.395  68.113  1.00 9.64   ? 51  TRP H CB  1 
ATOM   621  C CG  . TRP B 2 37  ? 15.173  18.864  68.553  1.00 8.99   ? 51  TRP H CG  1 
ATOM   622  C CD1 . TRP B 2 37  ? 16.026  18.211  69.395  1.00 7.05   ? 51  TRP H CD1 1 
ATOM   623  C CD2 . TRP B 2 37  ? 15.843  20.069  68.153  1.00 2.00   ? 51  TRP H CD2 1 
ATOM   624  N NE1 . TRP B 2 37  ? 17.182  18.933  69.540  1.00 10.96  ? 51  TRP H NE1 1 
ATOM   625  C CE2 . TRP B 2 37  ? 17.100  20.077  68.786  1.00 4.56   ? 51  TRP H CE2 1 
ATOM   626  C CE3 . TRP B 2 37  ? 15.507  21.138  67.312  1.00 6.40   ? 51  TRP H CE3 1 
ATOM   627  C CZ2 . TRP B 2 37  ? 18.032  21.113  68.602  1.00 3.26   ? 51  TRP H CZ2 1 
ATOM   628  C CZ3 . TRP B 2 37  ? 16.438  22.171  67.126  1.00 3.28   ? 51  TRP H CZ3 1 
ATOM   629  C CH2 . TRP B 2 37  ? 17.682  22.146  67.768  1.00 3.69   ? 51  TRP H CH2 1 
ATOM   630  N N   . VAL B 2 38  ? 10.936  19.972  67.577  1.00 8.64   ? 52  VAL H N   1 
ATOM   631  C CA  . VAL B 2 38  ? 9.688   19.993  66.840  1.00 7.28   ? 52  VAL H CA  1 
ATOM   632  C C   . VAL B 2 38  ? 9.947   20.574  65.455  1.00 7.20   ? 52  VAL H C   1 
ATOM   633  O O   . VAL B 2 38  ? 10.672  21.548  65.305  1.00 9.92   ? 52  VAL H O   1 
ATOM   634  C CB  . VAL B 2 38  ? 8.603   20.771  67.625  1.00 7.57   ? 52  VAL H CB  1 
ATOM   635  C CG1 . VAL B 2 38  ? 9.131   22.098  68.085  1.00 18.17  ? 52  VAL H CG1 1 
ATOM   636  C CG2 . VAL B 2 38  ? 7.386   20.971  66.782  1.00 16.07  ? 52  VAL H CG2 1 
ATOM   637  N N   . LEU B 2 39  ? 9.402   19.909  64.444  1.00 7.27   ? 53  LEU H N   1 
ATOM   638  C CA  . LEU B 2 39  ? 9.566   20.280  63.046  1.00 5.55   ? 53  LEU H CA  1 
ATOM   639  C C   . LEU B 2 39  ? 8.360   21.002  62.475  1.00 4.77   ? 53  LEU H C   1 
ATOM   640  O O   . LEU B 2 39  ? 7.221   20.658  62.783  1.00 8.26   ? 53  LEU H O   1 
ATOM   641  C CB  . LEU B 2 39  ? 9.800   19.013  62.234  1.00 7.42   ? 53  LEU H CB  1 
ATOM   642  C CG  . LEU B 2 39  ? 10.420  19.158  60.852  1.00 5.99   ? 53  LEU H CG  1 
ATOM   643  C CD1 . LEU B 2 39  ? 11.799  19.807  60.997  1.00 2.00   ? 53  LEU H CD1 1 
ATOM   644  C CD2 . LEU B 2 39  ? 10.526  17.791  60.198  1.00 2.00   ? 53  LEU H CD2 1 
ATOM   645  N N   . THR B 2 40  ? 8.605   21.988  61.622  1.00 7.69   ? 54  THR H N   1 
ATOM   646  C CA  . THR B 2 40  ? 7.516   22.738  61.002  1.00 4.86   ? 54  THR H CA  1 
ATOM   647  C C   . THR B 2 40  ? 7.967   23.393  59.687  1.00 4.87   ? 54  THR H C   1 
ATOM   648  O O   . THR B 2 40  ? 9.073   23.131  59.196  1.00 12.53  ? 54  THR H O   1 
ATOM   649  C CB  . THR B 2 40  ? 6.926   23.771  61.985  1.00 2.00   ? 54  THR H CB  1 
ATOM   650  O OG1 . THR B 2 40  ? 5.699   24.283  61.460  1.00 9.53   ? 54  THR H OG1 1 
ATOM   651  C CG2 . THR B 2 40  ? 7.886   24.906  62.218  1.00 2.00   ? 54  THR H CG2 1 
ATOM   652  N N   . ALA B 2 41  ? 7.106   24.209  59.095  1.00 5.66   ? 55  ALA H N   1 
ATOM   653  C CA  . ALA B 2 41  ? 7.424   24.884  57.838  1.00 3.55   ? 55  ALA H CA  1 
ATOM   654  C C   . ALA B 2 41  ? 7.943   26.280  58.120  1.00 6.82   ? 55  ALA H C   1 
ATOM   655  O O   . ALA B 2 41  ? 7.484   26.954  59.041  1.00 10.56  ? 55  ALA H O   1 
ATOM   656  C CB  . ALA B 2 41  ? 6.201   24.943  56.936  1.00 2.00   ? 55  ALA H CB  1 
ATOM   657  N N   . ALA B 2 42  ? 8.867   26.738  57.288  1.00 9.02   ? 56  ALA H N   1 
ATOM   658  C CA  . ALA B 2 42  ? 9.465   28.044  57.475  1.00 3.67   ? 56  ALA H CA  1 
ATOM   659  C C   . ALA B 2 42  ? 8.499   29.202  57.390  1.00 7.02   ? 56  ALA H C   1 
ATOM   660  O O   . ALA B 2 42  ? 8.542   30.100  58.221  1.00 11.00  ? 56  ALA H O   1 
ATOM   661  C CB  . ALA B 2 42  ? 10.586  28.231  56.513  1.00 12.17  ? 56  ALA H CB  1 
ATOM   662  N N   . HIS B 2 43  ? 7.570   29.156  56.442  1.00 12.47  ? 57  HIS H N   1 
ATOM   663  C CA  . HIS B 2 43  ? 6.614   30.254  56.265  1.00 10.30  ? 57  HIS H CA  1 
ATOM   664  C C   . HIS B 2 43  ? 5.620   30.519  57.394  1.00 12.89  ? 57  HIS H C   1 
ATOM   665  O O   . HIS B 2 43  ? 4.851   31.478  57.328  1.00 17.03  ? 57  HIS H O   1 
ATOM   666  C CB  . HIS B 2 43  ? 5.904   30.150  54.916  1.00 2.38   ? 57  HIS H CB  1 
ATOM   667  C CG  . HIS B 2 43  ? 4.652   29.333  54.934  1.00 3.20   ? 57  HIS H CG  1 
ATOM   668  N ND1 . HIS B 2 43  ? 4.641   27.987  54.642  1.00 3.57   ? 57  HIS H ND1 1 
ATOM   669  C CD2 . HIS B 2 43  ? 3.360   29.682  55.146  1.00 5.30   ? 57  HIS H CD2 1 
ATOM   670  C CE1 . HIS B 2 43  ? 3.398   27.541  54.670  1.00 2.00   ? 57  HIS H CE1 1 
ATOM   671  N NE2 . HIS B 2 43  ? 2.601   28.548  54.975  1.00 6.25   ? 57  HIS H NE2 1 
ATOM   672  N N   . CYS B 2 44  ? 5.618   29.662  58.412  1.00 12.54  ? 58  CYS H N   1 
ATOM   673  C CA  . CYS B 2 44  ? 4.731   29.834  59.562  1.00 12.44  ? 58  CYS H CA  1 
ATOM   674  C C   . CYS B 2 44  ? 5.340   30.873  60.501  1.00 15.35  ? 58  CYS H C   1 
ATOM   675  O O   . CYS B 2 44  ? 4.666   31.441  61.360  1.00 16.86  ? 58  CYS H O   1 
ATOM   676  C CB  . CYS B 2 44  ? 4.609   28.520  60.332  1.00 10.25  ? 58  CYS H CB  1 
ATOM   677  S SG  . CYS B 2 44  ? 3.644   27.232  59.508  1.00 11.07  ? 58  CYS H SG  1 
ATOM   678  N N   . LEU B 2 45  ? 6.635   31.093  60.328  1.00 16.11  ? 59  LEU H N   1 
ATOM   679  C CA  . LEU B 2 45  ? 7.393   32.004  61.156  1.00 11.26  ? 59  LEU H CA  1 
ATOM   680  C C   . LEU B 2 45  ? 7.893   33.206  60.355  1.00 14.34  ? 59  LEU H C   1 
ATOM   681  O O   . LEU B 2 45  ? 7.684   34.358  60.753  1.00 15.08  ? 59  LEU H O   1 
ATOM   682  C CB  . LEU B 2 45  ? 8.574   31.221  61.732  1.00 9.58   ? 59  LEU H CB  1 
ATOM   683  C CG  . LEU B 2 45  ? 8.117   29.942  62.444  1.00 7.10   ? 59  LEU H CG  1 
ATOM   684  C CD1 . LEU B 2 45  ? 9.226   28.908  62.522  1.00 11.40  ? 59  LEU H CD1 1 
ATOM   685  C CD2 . LEU B 2 45  ? 7.621   30.316  63.829  1.00 6.99   ? 59  LEU H CD2 1 
ATOM   686  N N   . LEU B 2 46  ? 8.520   32.926  59.214  1.00 14.62  ? 60  LEU H N   1 
ATOM   687  C CA  . LEU B 2 46  ? 9.093   33.952  58.350  1.00 11.42  ? 60  LEU H CA  1 
ATOM   688  C C   . LEU B 2 46  ? 8.414   34.020  57.000  1.00 14.48  ? 60  LEU H C   1 
ATOM   689  O O   . LEU B 2 46  ? 8.543   33.108  56.179  1.00 16.34  ? 60  LEU H O   1 
ATOM   690  C CB  . LEU B 2 46  ? 10.584  33.680  58.121  1.00 8.41   ? 60  LEU H CB  1 
ATOM   691  C CG  . LEU B 2 46  ? 11.367  34.738  57.336  1.00 8.66   ? 60  LEU H CG  1 
ATOM   692  C CD1 . LEU B 2 46  ? 11.471  36.001  58.159  1.00 2.00   ? 60  LEU H CD1 1 
ATOM   693  C CD2 . LEU B 2 46  ? 12.746  34.235  57.004  1.00 8.17   ? 60  LEU H CD2 1 
ATOM   694  N N   . TYR B 2 47  A 7.722   35.121  56.757  1.00 12.90  ? 60  TYR H N   1 
ATOM   695  C CA  . TYR B 2 47  A 7.057   35.327  55.492  1.00 11.60  ? 60  TYR H CA  1 
ATOM   696  C C   . TYR B 2 47  A 6.716   36.804  55.388  1.00 15.61  ? 60  TYR H C   1 
ATOM   697  O O   . TYR B 2 47  A 5.572   37.209  55.592  1.00 14.46  ? 60  TYR H O   1 
ATOM   698  C CB  . TYR B 2 47  A 5.807   34.463  55.385  1.00 13.08  ? 60  TYR H CB  1 
ATOM   699  C CG  . TYR B 2 47  A 5.341   34.312  53.964  1.00 20.10  ? 60  TYR H CG  1 
ATOM   700  C CD1 . TYR B 2 47  A 6.186   33.781  52.985  1.00 22.88  ? 60  TYR H CD1 1 
ATOM   701  C CD2 . TYR B 2 47  A 4.079   34.737  53.578  1.00 26.54  ? 60  TYR H CD2 1 
ATOM   702  C CE1 . TYR B 2 47  A 5.780   33.686  51.655  1.00 21.54  ? 60  TYR H CE1 1 
ATOM   703  C CE2 . TYR B 2 47  A 3.661   34.644  52.251  1.00 30.49  ? 60  TYR H CE2 1 
ATOM   704  C CZ  . TYR B 2 47  A 4.515   34.122  51.296  1.00 25.31  ? 60  TYR H CZ  1 
ATOM   705  O OH  . TYR B 2 47  A 4.103   34.061  49.984  1.00 28.91  ? 60  TYR H OH  1 
ATOM   706  N N   . PRO B 2 48  B 7.712   37.626  55.020  1.00 18.59  ? 60  PRO H N   1 
ATOM   707  C CA  . PRO B 2 48  B 7.615   39.083  54.862  1.00 21.36  ? 60  PRO H CA  1 
ATOM   708  C C   . PRO B 2 48  B 6.377   39.599  54.119  1.00 25.24  ? 60  PRO H C   1 
ATOM   709  O O   . PRO B 2 48  B 5.786   40.594  54.538  1.00 30.25  ? 60  PRO H O   1 
ATOM   710  C CB  . PRO B 2 48  B 8.919   39.431  54.146  1.00 20.77  ? 60  PRO H CB  1 
ATOM   711  C CG  . PRO B 2 48  B 9.863   38.424  54.693  1.00 19.10  ? 60  PRO H CG  1 
ATOM   712  C CD  . PRO B 2 48  B 9.046   37.157  54.613  1.00 19.42  ? 60  PRO H CD  1 
ATOM   713  N N   . PRO B 2 49  C 5.973   38.950  53.008  1.00 25.51  ? 60  PRO H N   1 
ATOM   714  C CA  . PRO B 2 49  C 4.793   39.390  52.257  1.00 27.34  ? 60  PRO H CA  1 
ATOM   715  C C   . PRO B 2 49  C 3.520   39.553  53.094  1.00 31.82  ? 60  PRO H C   1 
ATOM   716  O O   . PRO B 2 49  C 2.652   40.344  52.734  1.00 34.30  ? 60  PRO H O   1 
ATOM   717  C CB  . PRO B 2 49  C 4.631   38.286  51.216  1.00 23.04  ? 60  PRO H CB  1 
ATOM   718  C CG  . PRO B 2 49  C 6.036   37.957  50.889  1.00 19.91  ? 60  PRO H CG  1 
ATOM   719  C CD  . PRO B 2 49  C 6.690   37.900  52.252  1.00 25.31  ? 60  PRO H CD  1 
ATOM   720  N N   . TRP B 2 50  D 3.396   38.772  54.170  1.00 38.37  ? 60  TRP H N   1 
ATOM   721  C CA  . TRP B 2 50  D 2.235   38.834  55.076  1.00 40.81  ? 60  TRP H CA  1 
ATOM   722  C C   . TRP B 2 50  D 2.590   39.559  56.369  1.00 40.30  ? 60  TRP H C   1 
ATOM   723  O O   . TRP B 2 50  D 1.741   39.693  57.254  1.00 40.58  ? 60  TRP H O   1 
ATOM   724  C CB  . TRP B 2 50  D 1.757   37.431  55.482  1.00 45.73  ? 60  TRP H CB  1 
ATOM   725  C CG  . TRP B 2 50  D 1.004   36.669  54.452  1.00 57.84  ? 60  TRP H CG  1 
ATOM   726  C CD1 . TRP B 2 50  D 0.450   37.157  53.305  1.00 64.44  ? 60  TRP H CD1 1 
ATOM   727  C CD2 . TRP B 2 50  D 0.732   35.261  54.464  1.00 65.18  ? 60  TRP H CD2 1 
ATOM   728  N NE1 . TRP B 2 50  D -0.146  36.140  52.599  1.00 70.27  ? 60  TRP H NE1 1 
ATOM   729  C CE2 . TRP B 2 50  D 0.011   34.965  53.287  1.00 69.26  ? 60  TRP H CE2 1 
ATOM   730  C CE3 . TRP B 2 50  D 1.031   34.220  55.354  1.00 68.31  ? 60  TRP H CE3 1 
ATOM   731  C CZ2 . TRP B 2 50  D -0.418  33.667  52.975  1.00 70.21  ? 60  TRP H CZ2 1 
ATOM   732  C CZ3 . TRP B 2 50  D 0.604   32.928  55.044  1.00 70.64  ? 60  TRP H CZ3 1 
ATOM   733  C CH2 . TRP B 2 50  D -0.112  32.666  53.862  1.00 69.29  ? 60  TRP H CH2 1 
ATOM   734  N N   . ASP B 2 51  E 3.851   39.972  56.488  1.00 39.88  ? 60  ASP H N   1 
ATOM   735  C CA  . ASP B 2 51  E 4.375   40.649  57.678  1.00 44.33  ? 60  ASP H CA  1 
ATOM   736  C C   . ASP B 2 51  E 4.703   39.647  58.790  1.00 42.76  ? 60  ASP H C   1 
ATOM   737  O O   . ASP B 2 51  E 4.833   40.026  59.955  1.00 47.84  ? 60  ASP H O   1 
ATOM   738  C CB  . ASP B 2 51  E 3.399   41.716  58.212  1.00 52.40  ? 60  ASP H CB  1 
ATOM   739  C CG  . ASP B 2 51  E 3.246   42.909  57.275  1.00 62.20  ? 60  ASP H CG  1 
ATOM   740  O OD1 . ASP B 2 51  E 4.277   43.402  56.762  1.00 69.71  ? 60  ASP H OD1 1 
ATOM   741  O OD2 . ASP B 2 51  E 2.097   43.370  57.073  1.00 61.84  ? 60  ASP H OD2 1 
ATOM   742  N N   . LYS B 2 52  F 4.838   38.372  58.431  1.00 37.80  ? 60  LYS H N   1 
ATOM   743  C CA  . LYS B 2 52  F 5.161   37.330  59.406  1.00 27.46  ? 60  LYS H CA  1 
ATOM   744  C C   . LYS B 2 52  F 6.643   37.301  59.724  1.00 24.01  ? 60  LYS H C   1 
ATOM   745  O O   . LYS B 2 52  F 7.474   37.142  58.829  1.00 22.92  ? 60  LYS H O   1 
ATOM   746  C CB  . LYS B 2 52  F 4.765   35.942  58.899  1.00 22.41  ? 60  LYS H CB  1 
ATOM   747  C CG  . LYS B 2 52  F 3.322   35.566  59.107  1.00 20.59  ? 60  LYS H CG  1 
ATOM   748  C CD  . LYS B 2 52  F 3.081   34.115  58.729  1.00 20.64  ? 60  LYS H CD  1 
ATOM   749  C CE  . LYS B 2 52  F 1.600   33.787  58.804  1.00 29.43  ? 60  LYS H CE  1 
ATOM   750  N NZ  . LYS B 2 52  F 0.998   34.149  60.128  1.00 39.36  ? 60  LYS H NZ  1 
ATOM   751  N N   . ASN B 2 53  G 6.963   37.421  61.003  1.00 22.76  ? 60  ASN H N   1 
ATOM   752  C CA  . ASN B 2 53  G 8.341   37.376  61.451  1.00 23.73  ? 60  ASN H CA  1 
ATOM   753  C C   . ASN B 2 53  G 8.332   37.089  62.937  1.00 19.34  ? 60  ASN H C   1 
ATOM   754  O O   . ASN B 2 53  G 8.698   37.925  63.749  1.00 19.06  ? 60  ASN H O   1 
ATOM   755  C CB  . ASN B 2 53  G 9.057   38.691  61.163  1.00 26.50  ? 60  ASN H CB  1 
ATOM   756  C CG  . ASN B 2 53  G 10.541  38.607  61.438  1.00 40.77  ? 60  ASN H CG  1 
ATOM   757  O OD1 . ASN B 2 53  G 11.102  37.516  61.573  1.00 42.02  ? 60  ASN H OD1 1 
ATOM   758  N ND2 . ASN B 2 53  G 11.192  39.761  61.521  1.00 52.21  ? 60  ASN H ND2 1 
ATOM   759  N N   . PHE B 2 54  H 7.884   35.896  63.288  1.00 17.61  ? 60  PHE H N   1 
ATOM   760  C CA  . PHE B 2 54  H 7.803   35.506  64.683  1.00 17.35  ? 60  PHE H CA  1 
ATOM   761  C C   . PHE B 2 54  H 9.126   35.133  65.326  1.00 15.52  ? 60  PHE H C   1 
ATOM   762  O O   . PHE B 2 54  H 10.048  34.641  64.669  1.00 15.36  ? 60  PHE H O   1 
ATOM   763  C CB  . PHE B 2 54  H 6.797   34.368  64.856  1.00 15.29  ? 60  PHE H CB  1 
ATOM   764  C CG  . PHE B 2 54  H 5.387   34.770  64.556  1.00 15.78  ? 60  PHE H CG  1 
ATOM   765  C CD1 . PHE B 2 54  H 4.753   35.741  65.322  1.00 19.28  ? 60  PHE H CD1 1 
ATOM   766  C CD2 . PHE B 2 54  H 4.704   34.211  63.489  1.00 16.86  ? 60  PHE H CD2 1 
ATOM   767  C CE1 . PHE B 2 54  H 3.465   36.150  65.030  1.00 16.39  ? 60  PHE H CE1 1 
ATOM   768  C CE2 . PHE B 2 54  H 3.416   34.613  63.188  1.00 16.04  ? 60  PHE H CE2 1 
ATOM   769  C CZ  . PHE B 2 54  H 2.794   35.585  63.961  1.00 17.12  ? 60  PHE H CZ  1 
ATOM   770  N N   . THR B 2 55  I 9.217   35.393  66.622  1.00 15.53  ? 60  THR H N   1 
ATOM   771  C CA  . THR B 2 55  I 10.407  35.056  67.388  1.00 18.24  ? 60  THR H CA  1 
ATOM   772  C C   . THR B 2 55  I 10.009  34.074  68.487  1.00 14.72  ? 60  THR H C   1 
ATOM   773  O O   . THR B 2 55  I 8.819   33.847  68.716  1.00 15.17  ? 60  THR H O   1 
ATOM   774  C CB  . THR B 2 55  I 11.074  36.304  67.985  1.00 14.79  ? 60  THR H CB  1 
ATOM   775  O OG1 . THR B 2 55  I 10.073  37.247  68.377  1.00 18.93  ? 60  THR H OG1 1 
ATOM   776  C CG2 . THR B 2 55  I 11.975  36.940  66.972  1.00 18.18  ? 60  THR H CG2 1 
ATOM   777  N N   . VAL B 2 56  ? 10.996  33.493  69.160  1.00 14.57  ? 61  VAL H N   1 
ATOM   778  C CA  . VAL B 2 56  ? 10.730  32.530  70.227  1.00 13.61  ? 61  VAL H CA  1 
ATOM   779  C C   . VAL B 2 56  ? 9.843   33.117  71.314  1.00 14.93  ? 61  VAL H C   1 
ATOM   780  O O   . VAL B 2 56  ? 9.163   32.379  72.021  1.00 24.66  ? 61  VAL H O   1 
ATOM   781  C CB  . VAL B 2 56  ? 12.036  32.004  70.886  1.00 10.24  ? 61  VAL H CB  1 
ATOM   782  C CG1 . VAL B 2 56  ? 12.975  31.457  69.848  1.00 7.19   ? 61  VAL H CG1 1 
ATOM   783  C CG2 . VAL B 2 56  ? 12.713  33.090  71.682  1.00 10.95  ? 61  VAL H CG2 1 
ATOM   784  N N   . ASP B 2 57  ? 9.836   34.442  71.426  1.00 14.39  ? 62  ASP H N   1 
ATOM   785  C CA  . ASP B 2 57  ? 9.045   35.133  72.432  1.00 16.78  ? 62  ASP H CA  1 
ATOM   786  C C   . ASP B 2 57  ? 7.605   35.432  72.042  1.00 20.69  ? 62  ASP H C   1 
ATOM   787  O O   . ASP B 2 57  ? 6.833   35.915  72.866  1.00 26.76  ? 62  ASP H O   1 
ATOM   788  C CB  . ASP B 2 57  ? 9.743   36.428  72.840  1.00 26.43  ? 62  ASP H CB  1 
ATOM   789  C CG  . ASP B 2 57  ? 11.033  36.175  73.603  1.00 44.91  ? 62  ASP H CG  1 
ATOM   790  O OD1 . ASP B 2 57  ? 10.962  35.815  74.802  1.00 47.35  ? 62  ASP H OD1 1 
ATOM   791  O OD2 . ASP B 2 57  ? 12.121  36.325  73.001  1.00 54.56  ? 62  ASP H OD2 1 
ATOM   792  N N   . ASP B 2 58  ? 7.234   35.133  70.802  1.00 20.85  ? 63  ASP H N   1 
ATOM   793  C CA  . ASP B 2 58  ? 5.879   35.396  70.321  1.00 20.67  ? 63  ASP H CA  1 
ATOM   794  C C   . ASP B 2 58  ? 4.984   34.156  70.337  1.00 19.66  ? 63  ASP H C   1 
ATOM   795  O O   . ASP B 2 58  ? 3.757   34.265  70.321  1.00 19.10  ? 63  ASP H O   1 
ATOM   796  C CB  . ASP B 2 58  ? 5.927   35.921  68.875  1.00 23.90  ? 63  ASP H CB  1 
ATOM   797  C CG  . ASP B 2 58  ? 6.719   37.211  68.730  1.00 23.88  ? 63  ASP H CG  1 
ATOM   798  O OD1 . ASP B 2 58  ? 6.602   38.098  69.600  1.00 31.01  ? 63  ASP H OD1 1 
ATOM   799  O OD2 . ASP B 2 58  ? 7.443   37.347  67.722  1.00 26.12  ? 63  ASP H OD2 1 
ATOM   800  N N   . LEU B 2 59  ? 5.597   32.980  70.381  1.00 19.14  ? 64  LEU H N   1 
ATOM   801  C CA  . LEU B 2 59  ? 4.833   31.743  70.323  1.00 19.82  ? 64  LEU H CA  1 
ATOM   802  C C   . LEU B 2 59  ? 5.069   30.763  71.455  1.00 17.45  ? 64  LEU H C   1 
ATOM   803  O O   . LEU B 2 59  ? 5.956   30.942  72.292  1.00 16.73  ? 64  LEU H O   1 
ATOM   804  C CB  . LEU B 2 59  ? 5.148   31.014  69.013  1.00 21.79  ? 64  LEU H CB  1 
ATOM   805  C CG  . LEU B 2 59  ? 5.938   31.791  67.967  1.00 21.11  ? 64  LEU H CG  1 
ATOM   806  C CD1 . LEU B 2 59  ? 6.951   30.898  67.278  1.00 22.12  ? 64  LEU H CD1 1 
ATOM   807  C CD2 . LEU B 2 59  ? 4.973   32.396  66.990  1.00 23.95  ? 64  LEU H CD2 1 
ATOM   808  N N   . LEU B 2 60  ? 4.251   29.713  71.440  1.00 14.58  ? 65  LEU H N   1 
ATOM   809  C CA  . LEU B 2 60  ? 4.318   28.612  72.385  1.00 14.71  ? 65  LEU H CA  1 
ATOM   810  C C   . LEU B 2 60  ? 3.717   27.406  71.680  1.00 16.17  ? 65  LEU H C   1 
ATOM   811  O O   . LEU B 2 60  ? 2.881   27.566  70.790  1.00 19.94  ? 65  LEU H O   1 
ATOM   812  C CB  . LEU B 2 60  ? 3.582   28.944  73.694  1.00 18.36  ? 65  LEU H CB  1 
ATOM   813  C CG  . LEU B 2 60  ? 2.149   29.479  73.757  1.00 15.06  ? 65  LEU H CG  1 
ATOM   814  C CD1 . LEU B 2 60  ? 1.166   28.337  73.593  1.00 21.56  ? 65  LEU H CD1 1 
ATOM   815  C CD2 . LEU B 2 60  ? 1.923   30.166  75.105  1.00 3.12   ? 65  LEU H CD2 1 
ATOM   816  N N   . VAL B 2 61  ? 4.219   26.213  71.989  1.00 15.65  ? 66  VAL H N   1 
ATOM   817  C CA  . VAL B 2 61  ? 3.710   24.991  71.368  1.00 10.88  ? 66  VAL H CA  1 
ATOM   818  C C   . VAL B 2 61  ? 2.783   24.234  72.302  1.00 8.48   ? 66  VAL H C   1 
ATOM   819  O O   . VAL B 2 61  ? 3.095   24.056  73.468  1.00 14.59  ? 66  VAL H O   1 
ATOM   820  C CB  . VAL B 2 61  ? 4.845   24.049  70.905  1.00 7.39   ? 66  VAL H CB  1 
ATOM   821  C CG1 . VAL B 2 61  ? 5.473   24.567  69.635  1.00 19.61  ? 66  VAL H CG1 1 
ATOM   822  C CG2 . VAL B 2 61  ? 5.888   23.929  71.946  1.00 9.34   ? 66  VAL H CG2 1 
ATOM   823  N N   . ARG B 2 62  ? 1.612   23.862  71.807  1.00 4.83   ? 67  ARG H N   1 
ATOM   824  C CA  . ARG B 2 62  ? 0.646   23.108  72.590  1.00 2.00   ? 67  ARG H CA  1 
ATOM   825  C C   . ARG B 2 62  ? 0.657   21.708  71.986  1.00 4.53   ? 67  ARG H C   1 
ATOM   826  O O   . ARG B 2 62  ? 0.370   21.526  70.797  1.00 4.61   ? 67  ARG H O   1 
ATOM   827  C CB  . ARG B 2 62  ? -0.728  23.744  72.477  1.00 2.00   ? 67  ARG H CB  1 
ATOM   828  C CG  . ARG B 2 62  ? -0.730  25.218  72.824  1.00 3.61   ? 67  ARG H CG  1 
ATOM   829  C CD  . ARG B 2 62  ? -1.984  25.589  73.572  1.00 7.07   ? 67  ARG H CD  1 
ATOM   830  N NE  . ARG B 2 62  ? -3.087  26.040  72.730  1.00 8.55   ? 67  ARG H NE  1 
ATOM   831  C CZ  . ARG B 2 62  ? -4.369  25.794  72.996  1.00 9.79   ? 67  ARG H CZ  1 
ATOM   832  N NH1 . ARG B 2 62  ? -4.700  25.080  74.061  1.00 2.00   ? 67  ARG H NH1 1 
ATOM   833  N NH2 . ARG B 2 62  ? -5.328  26.343  72.258  1.00 11.64  ? 67  ARG H NH2 1 
ATOM   834  N N   . ILE B 2 63  ? 1.057   20.736  72.796  1.00 2.00   ? 68  ILE H N   1 
ATOM   835  C CA  . ILE B 2 63  ? 1.186   19.349  72.366  1.00 2.27   ? 68  ILE H CA  1 
ATOM   836  C C   . ILE B 2 63  ? 0.188   18.451  73.096  1.00 5.30   ? 68  ILE H C   1 
ATOM   837  O O   . ILE B 2 63  ? -0.192  18.741  74.233  1.00 8.28   ? 68  ILE H O   1 
ATOM   838  C CB  . ILE B 2 63  ? 2.613   18.838  72.689  1.00 4.75   ? 68  ILE H CB  1 
ATOM   839  C CG1 . ILE B 2 63  ? 3.638   19.939  72.420  1.00 6.70   ? 68  ILE H CG1 1 
ATOM   840  C CG2 . ILE B 2 63  ? 2.957   17.609  71.849  1.00 9.43   ? 68  ILE H CG2 1 
ATOM   841  C CD1 . ILE B 2 63  ? 5.024   19.603  72.868  1.00 5.86   ? 68  ILE H CD1 1 
ATOM   842  N N   . GLY B 2 64  ? -0.220  17.362  72.445  1.00 4.29   ? 69  GLY H N   1 
ATOM   843  C CA  . GLY B 2 64  ? -1.152  16.415  73.040  1.00 3.28   ? 69  GLY H CA  1 
ATOM   844  C C   . GLY B 2 64  ? -2.626  16.711  72.830  1.00 10.63  ? 69  GLY H C   1 
ATOM   845  O O   . GLY B 2 64  ? -3.480  15.915  73.236  1.00 12.68  ? 69  GLY H O   1 
ATOM   846  N N   . LYS B 2 65  ? -2.928  17.798  72.121  1.00 9.95   ? 70  LYS H N   1 
ATOM   847  C CA  . LYS B 2 65  ? -4.310  18.224  71.880  1.00 9.77   ? 70  LYS H CA  1 
ATOM   848  C C   . LYS B 2 65  ? -5.202  17.399  70.944  1.00 14.49  ? 70  LYS H C   1 
ATOM   849  O O   . LYS B 2 65  ? -4.738  16.561  70.167  1.00 15.61  ? 70  LYS H O   1 
ATOM   850  C CB  . LYS B 2 65  ? -4.324  19.659  71.375  1.00 5.83   ? 70  LYS H CB  1 
ATOM   851  C CG  . LYS B 2 65  ? -3.652  20.649  72.265  1.00 2.00   ? 70  LYS H CG  1 
ATOM   852  C CD  . LYS B 2 65  ? -3.798  22.019  71.675  1.00 2.00   ? 70  LYS H CD  1 
ATOM   853  C CE  . LYS B 2 65  ? -5.253  22.389  71.557  1.00 2.00   ? 70  LYS H CE  1 
ATOM   854  N NZ  . LYS B 2 65  ? -5.933  22.291  72.866  1.00 2.00   ? 70  LYS H NZ  1 
ATOM   855  N N   . HIS B 2 66  ? -6.495  17.711  70.995  1.00 18.63  ? 71  HIS H N   1 
ATOM   856  C CA  . HIS B 2 66  ? -7.505  17.072  70.164  1.00 12.78  ? 71  HIS H CA  1 
ATOM   857  C C   . HIS B 2 66  ? -8.473  18.155  69.679  1.00 10.94  ? 71  HIS H C   1 
ATOM   858  O O   . HIS B 2 66  ? -8.720  18.295  68.487  1.00 7.06   ? 71  HIS H O   1 
ATOM   859  C CB  . HIS B 2 66  ? -8.254  15.997  70.941  1.00 13.56  ? 71  HIS H CB  1 
ATOM   860  C CG  . HIS B 2 66  ? -9.085  15.114  70.066  1.00 20.41  ? 71  HIS H CG  1 
ATOM   861  N ND1 . HIS B 2 66  ? -10.460 15.144  70.069  1.00 16.37  ? 71  HIS H ND1 1 
ATOM   862  C CD2 . HIS B 2 66  ? -8.729  14.236  69.098  1.00 20.82  ? 71  HIS H CD2 1 
ATOM   863  C CE1 . HIS B 2 66  ? -10.918 14.330  69.134  1.00 19.81  ? 71  HIS H CE1 1 
ATOM   864  N NE2 . HIS B 2 66  ? -9.887  13.769  68.533  1.00 15.27  ? 71  HIS H NE2 1 
ATOM   865  N N   . SER B 2 67  ? -9.026  18.912  70.617  1.00 15.91  ? 72  SER H N   1 
ATOM   866  C CA  . SER B 2 67  ? -9.929  20.009  70.291  1.00 18.49  ? 72  SER H CA  1 
ATOM   867  C C   . SER B 2 67  ? -8.982  21.142  69.895  1.00 20.72  ? 72  SER H C   1 
ATOM   868  O O   . SER B 2 67  ? -7.834  21.149  70.332  1.00 25.97  ? 72  SER H O   1 
ATOM   869  C CB  . SER B 2 67  ? -10.725 20.398  71.538  1.00 19.50  ? 72  SER H CB  1 
ATOM   870  O OG  . SER B 2 67  ? -11.767 21.304  71.229  1.00 28.58  ? 72  SER H OG  1 
ATOM   871  N N   . ARG B 2 68  ? -9.428  22.086  69.074  1.00 19.23  ? 73  ARG H N   1 
ATOM   872  C CA  . ARG B 2 68  ? -8.536  23.177  68.677  1.00 24.02  ? 73  ARG H CA  1 
ATOM   873  C C   . ARG B 2 68  ? -8.624  24.474  69.479  1.00 26.90  ? 73  ARG H C   1 
ATOM   874  O O   . ARG B 2 68  ? -7.649  25.218  69.598  1.00 28.41  ? 73  ARG H O   1 
ATOM   875  C CB  . ARG B 2 68  ? -8.672  23.487  67.184  1.00 22.75  ? 73  ARG H CB  1 
ATOM   876  C CG  . ARG B 2 68  ? -10.061 23.801  66.710  1.00 21.60  ? 73  ARG H CG  1 
ATOM   877  C CD  . ARG B 2 68  ? -10.012 24.377  65.308  1.00 32.27  ? 73  ARG H CD  1 
ATOM   878  N NE  . ARG B 2 68  ? -9.541  25.757  65.303  1.00 39.29  ? 73  ARG H NE  1 
ATOM   879  C CZ  . ARG B 2 68  ? -10.330 26.817  65.465  1.00 45.53  ? 73  ARG H CZ  1 
ATOM   880  N NH1 . ARG B 2 68  ? -11.646 26.665  65.641  1.00 42.85  ? 73  ARG H NH1 1 
ATOM   881  N NH2 . ARG B 2 68  ? -9.795  28.034  65.474  1.00 41.93  ? 73  ARG H NH2 1 
ATOM   882  N N   . THR B 2 69  ? -9.802  24.764  69.998  1.00 29.73  ? 74  THR H N   1 
ATOM   883  C CA  . THR B 2 69  ? -10.001 25.980  70.759  1.00 36.01  ? 74  THR H CA  1 
ATOM   884  C C   . THR B 2 69  ? -9.920  25.725  72.258  1.00 37.16  ? 74  THR H C   1 
ATOM   885  O O   . THR B 2 69  ? -9.582  26.615  73.041  1.00 42.29  ? 74  THR H O   1 
ATOM   886  C CB  . THR B 2 69  ? -11.380 26.590  70.422  1.00 39.91  ? 74  THR H CB  1 
ATOM   887  O OG1 . THR B 2 69  ? -12.333 25.534  70.223  1.00 39.98  ? 74  THR H OG1 1 
ATOM   888  C CG2 . THR B 2 69  ? -11.300 27.439  69.154  1.00 44.98  ? 74  THR H CG2 1 
ATOM   889  N N   . ARG B 2 70  ? -10.150 24.479  72.641  1.00 33.29  ? 75  ARG H N   1 
ATOM   890  C CA  . ARG B 2 70  ? -10.185 24.112  74.039  1.00 28.21  ? 75  ARG H CA  1 
ATOM   891  C C   . ARG B 2 70  ? -8.875  23.659  74.680  1.00 25.16  ? 75  ARG H C   1 
ATOM   892  O O   . ARG B 2 70  ? -8.069  22.977  74.048  1.00 22.89  ? 75  ARG H O   1 
ATOM   893  C CB  . ARG B 2 70  ? -11.260 23.043  74.211  1.00 31.32  ? 75  ARG H CB  1 
ATOM   894  C CG  . ARG B 2 70  ? -11.981 23.067  75.534  1.00 43.43  ? 75  ARG H CG  1 
ATOM   895  C CD  . ARG B 2 70  ? -13.125 22.067  75.529  1.00 55.83  ? 75  ARG H CD  1 
ATOM   896  N NE  . ARG B 2 70  ? -12.715 20.757  75.020  1.00 69.58  ? 75  ARG H NE  1 
ATOM   897  C CZ  . ARG B 2 70  ? -11.913 19.903  75.657  1.00 73.34  ? 75  ARG H CZ  1 
ATOM   898  N NH1 . ARG B 2 70  ? -11.412 20.202  76.852  1.00 70.86  ? 75  ARG H NH1 1 
ATOM   899  N NH2 . ARG B 2 70  ? -11.603 18.743  75.088  1.00 76.37  ? 75  ARG H NH2 1 
ATOM   900  N N   . TYR B 2 71  ? -8.667  24.087  75.928  1.00 22.16  ? 76  TYR H N   1 
ATOM   901  C CA  . TYR B 2 71  ? -7.505  23.705  76.726  1.00 14.05  ? 76  TYR H CA  1 
ATOM   902  C C   . TYR B 2 71  ? -7.896  22.367  77.366  1.00 10.61  ? 76  TYR H C   1 
ATOM   903  O O   . TYR B 2 71  ? -8.855  22.289  78.119  1.00 16.10  ? 76  TYR H O   1 
ATOM   904  C CB  . TYR B 2 71  ? -7.214  24.748  77.824  1.00 13.75  ? 76  TYR H CB  1 
ATOM   905  C CG  . TYR B 2 71  ? -6.130  24.300  78.787  1.00 8.92   ? 76  TYR H CG  1 
ATOM   906  C CD1 . TYR B 2 71  ? -4.803  24.240  78.377  1.00 7.81   ? 76  TYR H CD1 1 
ATOM   907  C CD2 . TYR B 2 71  ? -6.447  23.798  80.055  1.00 5.42   ? 76  TYR H CD2 1 
ATOM   908  C CE1 . TYR B 2 71  ? -3.821  23.677  79.189  1.00 6.02   ? 76  TYR H CE1 1 
ATOM   909  C CE2 . TYR B 2 71  ? -5.471  23.229  80.873  1.00 2.00   ? 76  TYR H CE2 1 
ATOM   910  C CZ  . TYR B 2 71  ? -4.159  23.171  80.429  1.00 3.65   ? 76  TYR H CZ  1 
ATOM   911  O OH  . TYR B 2 71  ? -3.175  22.586  81.197  1.00 12.53  ? 76  TYR H OH  1 
ATOM   912  N N   . GLU B 2 72  ? -7.152  21.315  77.073  1.00 12.28  ? 77  GLU H N   1 
ATOM   913  C CA  . GLU B 2 72  ? -7.468  19.999  77.603  1.00 13.86  ? 77  GLU H CA  1 
ATOM   914  C C   . GLU B 2 72  ? -6.511  19.581  78.717  1.00 17.72  ? 77  GLU H C   1 
ATOM   915  O O   . GLU B 2 72  ? -5.468  18.988  78.468  1.00 21.21  ? 77  GLU H O   1 
ATOM   916  C CB  . GLU B 2 72  ? -7.469  18.996  76.456  1.00 12.81  ? 77  GLU H CB  1 
ATOM   917  C CG  . GLU B 2 72  ? -8.402  19.423  75.330  1.00 12.18  ? 77  GLU H CG  1 
ATOM   918  C CD  . GLU B 2 72  ? -7.930  18.988  73.963  1.00 11.94  ? 77  GLU H CD  1 
ATOM   919  O OE1 . GLU B 2 72  ? -7.164  19.745  73.329  1.00 14.26  ? 77  GLU H OE1 1 
ATOM   920  O OE2 . GLU B 2 72  ? -8.334  17.899  73.516  1.00 10.41  ? 77  GLU H OE2 1 
ATOM   921  N N   . ARG B 2 73  A -6.921  19.839  79.952  1.00 18.73  ? 77  ARG H N   1 
ATOM   922  C CA  . ARG B 2 73  A -6.135  19.541  81.145  1.00 14.15  ? 77  ARG H CA  1 
ATOM   923  C C   . ARG B 2 73  A -5.536  18.150  81.255  1.00 14.70  ? 77  ARG H C   1 
ATOM   924  O O   . ARG B 2 73  A -4.419  17.984  81.738  1.00 22.55  ? 77  ARG H O   1 
ATOM   925  C CB  . ARG B 2 73  A -6.979  19.784  82.397  1.00 9.27   ? 77  ARG H CB  1 
ATOM   926  C CG  . ARG B 2 73  A -6.178  19.643  83.661  1.00 18.28  ? 77  ARG H CG  1 
ATOM   927  C CD  . ARG B 2 73  A -7.051  19.369  84.846  1.00 22.78  ? 77  ARG H CD  1 
ATOM   928  N NE  . ARG B 2 73  A -7.924  20.492  85.132  1.00 23.41  ? 77  ARG H NE  1 
ATOM   929  C CZ  . ARG B 2 73  A -8.688  20.573  86.210  1.00 23.61  ? 77  ARG H CZ  1 
ATOM   930  N NH1 . ARG B 2 73  A -8.681  19.592  87.109  1.00 23.01  ? 77  ARG H NH1 1 
ATOM   931  N NH2 . ARG B 2 73  A -9.454  21.639  86.387  1.00 20.94  ? 77  ARG H NH2 1 
ATOM   932  N N   . LYS B 2 74  ? -6.294  17.144  80.849  1.00 16.28  ? 78  LYS H N   1 
ATOM   933  C CA  . LYS B 2 74  ? -5.839  15.766  80.969  1.00 18.40  ? 78  LYS H CA  1 
ATOM   934  C C   . LYS B 2 74  ? -4.838  15.272  79.956  1.00 17.55  ? 78  LYS H C   1 
ATOM   935  O O   . LYS B 2 74  ? -4.107  14.316  80.223  1.00 19.32  ? 78  LYS H O   1 
ATOM   936  C CB  . LYS B 2 74  ? -7.042  14.825  80.987  1.00 22.54  ? 78  LYS H CB  1 
ATOM   937  C CG  . LYS B 2 74  ? -7.932  15.017  82.206  1.00 35.53  ? 78  LYS H CG  1 
ATOM   938  C CD  . LYS B 2 74  ? -9.116  14.067  82.201  1.00 45.76  ? 78  LYS H CD  1 
ATOM   939  C CE  . LYS B 2 74  ? -9.906  14.183  80.911  1.00 57.47  ? 78  LYS H CE  1 
ATOM   940  N NZ  . LYS B 2 74  ? -10.251 15.600  80.591  1.00 69.45  ? 78  LYS H NZ  1 
ATOM   941  N N   . VAL B 2 75  ? -4.771  15.942  78.812  1.00 19.70  ? 79  VAL H N   1 
ATOM   942  C CA  . VAL B 2 75  ? -3.891  15.507  77.740  1.00 16.74  ? 79  VAL H CA  1 
ATOM   943  C C   . VAL B 2 75  ? -2.890  16.536  77.201  1.00 17.10  ? 79  VAL H C   1 
ATOM   944  O O   . VAL B 2 75  ? -1.807  16.164  76.743  1.00 18.94  ? 79  VAL H O   1 
ATOM   945  C CB  . VAL B 2 75  ? -4.744  14.965  76.557  1.00 14.07  ? 79  VAL H CB  1 
ATOM   946  C CG1 . VAL B 2 75  ? -5.587  13.794  77.008  1.00 15.82  ? 79  VAL H CG1 1 
ATOM   947  C CG2 . VAL B 2 75  ? -5.652  16.052  76.006  1.00 8.02   ? 79  VAL H CG2 1 
ATOM   948  N N   . GLU B 2 76  ? -3.237  17.817  77.291  1.00 12.93  ? 80  GLU H N   1 
ATOM   949  C CA  . GLU B 2 76  ? -2.416  18.903  76.761  1.00 12.39  ? 80  GLU H CA  1 
ATOM   950  C C   . GLU B 2 76  ? -1.269  19.372  77.627  1.00 13.74  ? 80  GLU H C   1 
ATOM   951  O O   . GLU B 2 76  ? -1.399  19.464  78.846  1.00 17.07  ? 80  GLU H O   1 
ATOM   952  C CB  . GLU B 2 76  ? -3.302  20.112  76.426  1.00 11.44  ? 80  GLU H CB  1 
ATOM   953  C CG  . GLU B 2 76  ? -2.570  21.286  75.834  1.00 2.00   ? 80  GLU H CG  1 
ATOM   954  C CD  . GLU B 2 76  ? -3.450  22.488  75.620  1.00 5.59   ? 80  GLU H CD  1 
ATOM   955  O OE1 . GLU B 2 76  ? -4.677  22.334  75.473  1.00 6.27   ? 80  GLU H OE1 1 
ATOM   956  O OE2 . GLU B 2 76  ? -2.907  23.609  75.600  1.00 14.06  ? 80  GLU H OE2 1 
ATOM   957  N N   . LYS B 2 77  ? -0.163  19.709  76.961  1.00 12.79  ? 81  LYS H N   1 
ATOM   958  C CA  . LYS B 2 77  ? 1.046   20.224  77.593  1.00 9.77   ? 81  LYS H CA  1 
ATOM   959  C C   . LYS B 2 77  ? 1.450   21.463  76.803  1.00 7.80   ? 81  LYS H C   1 
ATOM   960  O O   . LYS B 2 77  ? 1.436   21.439  75.581  1.00 8.43   ? 81  LYS H O   1 
ATOM   961  C CB  . LYS B 2 77  ? 2.179   19.190  77.542  1.00 10.74  ? 81  LYS H CB  1 
ATOM   962  C CG  . LYS B 2 77  ? 1.925   17.933  78.362  1.00 13.17  ? 81  LYS H CG  1 
ATOM   963  C CD  . LYS B 2 77  ? 2.061   18.214  79.855  1.00 22.42  ? 81  LYS H CD  1 
ATOM   964  C CE  . LYS B 2 77  ? 1.284   17.201  80.710  1.00 33.60  ? 81  LYS H CE  1 
ATOM   965  N NZ  . LYS B 2 77  ? -0.216  17.371  80.626  1.00 36.99  ? 81  LYS H NZ  1 
ATOM   966  N N   . ILE B 2 78  ? 1.713   22.565  77.500  1.00 11.57  ? 82  ILE H N   1 
ATOM   967  C CA  . ILE B 2 78  ? 2.131   23.808  76.859  1.00 9.39   ? 82  ILE H CA  1 
ATOM   968  C C   . ILE B 2 78  ? 3.628   23.943  77.100  1.00 15.07  ? 82  ILE H C   1 
ATOM   969  O O   . ILE B 2 78  ? 4.103   23.755  78.220  1.00 23.27  ? 82  ILE H O   1 
ATOM   970  C CB  . ILE B 2 78  ? 1.390   25.035  77.429  1.00 2.00   ? 82  ILE H CB  1 
ATOM   971  C CG1 . ILE B 2 78  ? -0.112  24.871  77.234  1.00 2.00   ? 82  ILE H CG1 1 
ATOM   972  C CG2 . ILE B 2 78  ? 1.843   26.294  76.725  1.00 2.41   ? 82  ILE H CG2 1 
ATOM   973  C CD1 . ILE B 2 78  ? -0.917  26.117  77.505  1.00 14.78  ? 82  ILE H CD1 1 
ATOM   974  N N   . SER B 2 79  ? 4.371   24.244  76.044  1.00 17.46  ? 83  SER H N   1 
ATOM   975  C CA  . SER B 2 79  ? 5.819   24.372  76.125  1.00 14.78  ? 83  SER H CA  1 
ATOM   976  C C   . SER B 2 79  ? 6.277   25.677  75.453  1.00 15.87  ? 83  SER H C   1 
ATOM   977  O O   . SER B 2 79  ? 5.518   26.312  74.709  1.00 16.33  ? 83  SER H O   1 
ATOM   978  C CB  . SER B 2 79  ? 6.446   23.145  75.444  1.00 17.76  ? 83  SER H CB  1 
ATOM   979  O OG  . SER B 2 79  ? 7.808   22.958  75.800  1.00 34.53  ? 83  SER H OG  1 
ATOM   980  N N   . MET B 2 80  ? 7.503   26.100  75.735  1.00 15.04  ? 84  MET H N   1 
ATOM   981  C CA  . MET B 2 80  ? 8.024   27.321  75.137  1.00 14.35  ? 84  MET H CA  1 
ATOM   982  C C   . MET B 2 80  ? 9.270   26.991  74.349  1.00 13.29  ? 84  MET H C   1 
ATOM   983  O O   . MET B 2 80  ? 9.917   25.980  74.605  1.00 17.79  ? 84  MET H O   1 
ATOM   984  C CB  . MET B 2 80  ? 8.325   28.362  76.213  1.00 15.21  ? 84  MET H CB  1 
ATOM   985  C CG  . MET B 2 80  ? 7.122   28.676  77.063  1.00 30.40  ? 84  MET H CG  1 
ATOM   986  S SD  . MET B 2 80  ? 7.376   30.056  78.128  1.00 47.81  ? 84  MET H SD  1 
ATOM   987  C CE  . MET B 2 80  ? 7.159   31.390  76.971  1.00 42.26  ? 84  MET H CE  1 
ATOM   988  N N   . LEU B 2 81  ? 9.612   27.843  73.394  1.00 13.57  ? 85  LEU H N   1 
ATOM   989  C CA  . LEU B 2 81  ? 10.784  27.615  72.565  1.00 9.59   ? 85  LEU H CA  1 
ATOM   990  C C   . LEU B 2 81  ? 12.007  28.298  73.108  1.00 11.04  ? 85  LEU H C   1 
ATOM   991  O O   . LEU B 2 81  ? 11.915  29.311  73.792  1.00 13.99  ? 85  LEU H O   1 
ATOM   992  C CB  . LEU B 2 81  ? 10.534  28.124  71.162  1.00 5.05   ? 85  LEU H CB  1 
ATOM   993  C CG  . LEU B 2 81  ? 9.210   27.682  70.585  1.00 2.00   ? 85  LEU H CG  1 
ATOM   994  C CD1 . LEU B 2 81  ? 9.027   28.355  69.249  1.00 12.30  ? 85  LEU H CD1 1 
ATOM   995  C CD2 . LEU B 2 81  ? 9.191   26.169  70.481  1.00 2.00   ? 85  LEU H CD2 1 
ATOM   996  N N   . ASP B 2 82  ? 13.161  27.735  72.792  1.00 15.80  ? 86  ASP H N   1 
ATOM   997  C CA  . ASP B 2 82  ? 14.425  28.295  73.221  1.00 21.08  ? 86  ASP H CA  1 
ATOM   998  C C   . ASP B 2 82  ? 15.145  28.815  71.991  1.00 27.85  ? 86  ASP H C   1 
ATOM   999  O O   . ASP B 2 82  ? 15.897  29.790  72.064  1.00 30.29  ? 86  ASP H O   1 
ATOM   1000 C CB  . ASP B 2 82  ? 15.279  27.233  73.898  1.00 20.97  ? 86  ASP H CB  1 
ATOM   1001 C CG  . ASP B 2 82  ? 16.519  27.811  74.519  1.00 23.66  ? 86  ASP H CG  1 
ATOM   1002 O OD1 . ASP B 2 82  ? 16.405  28.415  75.604  1.00 30.39  ? 86  ASP H OD1 1 
ATOM   1003 O OD2 . ASP B 2 82  ? 17.602  27.683  73.918  1.00 28.13  ? 86  ASP H OD2 1 
ATOM   1004 N N   . LYS B 2 83  ? 14.907  28.163  70.855  1.00 28.68  ? 87  LYS H N   1 
ATOM   1005 C CA  . LYS B 2 83  ? 15.543  28.566  69.613  1.00 27.36  ? 87  LYS H CA  1 
ATOM   1006 C C   . LYS B 2 83  ? 14.764  28.136  68.372  1.00 23.75  ? 87  LYS H C   1 
ATOM   1007 O O   . LYS B 2 83  ? 14.144  27.076  68.348  1.00 27.99  ? 87  LYS H O   1 
ATOM   1008 C CB  . LYS B 2 83  ? 16.970  28.021  69.567  1.00 34.22  ? 87  LYS H CB  1 
ATOM   1009 C CG  . LYS B 2 83  ? 17.921  28.907  68.789  1.00 50.58  ? 87  LYS H CG  1 
ATOM   1010 C CD  . LYS B 2 83  ? 19.367  28.636  69.161  1.00 62.37  ? 87  LYS H CD  1 
ATOM   1011 C CE  . LYS B 2 83  ? 20.317  29.514  68.349  1.00 69.93  ? 87  LYS H CE  1 
ATOM   1012 N NZ  . LYS B 2 83  ? 20.185  29.287  66.878  1.00 74.42  ? 87  LYS H NZ  1 
ATOM   1013 N N   . ILE B 2 84  ? 14.779  28.989  67.358  1.00 19.29  ? 88  ILE H N   1 
ATOM   1014 C CA  . ILE B 2 84  ? 14.098  28.732  66.100  1.00 15.28  ? 88  ILE H CA  1 
ATOM   1015 C C   . ILE B 2 84  ? 15.182  28.714  65.043  1.00 13.05  ? 88  ILE H C   1 
ATOM   1016 O O   . ILE B 2 84  ? 15.962  29.660  64.958  1.00 14.64  ? 88  ILE H O   1 
ATOM   1017 C CB  . ILE B 2 84  ? 13.134  29.886  65.755  1.00 13.34  ? 88  ILE H CB  1 
ATOM   1018 C CG1 . ILE B 2 84  ? 11.956  29.902  66.725  1.00 10.44  ? 88  ILE H CG1 1 
ATOM   1019 C CG2 . ILE B 2 84  ? 12.680  29.794  64.312  1.00 13.28  ? 88  ILE H CG2 1 
ATOM   1020 C CD1 . ILE B 2 84  ? 10.988  31.038  66.474  1.00 5.21   ? 88  ILE H CD1 1 
ATOM   1021 N N   . TYR B 2 85  ? 15.247  27.641  64.262  1.00 12.65  ? 89  TYR H N   1 
ATOM   1022 C CA  . TYR B 2 85  ? 16.239  27.511  63.191  1.00 8.54   ? 89  TYR H CA  1 
ATOM   1023 C C   . TYR B 2 85  ? 15.504  27.420  61.876  1.00 9.05   ? 89  TYR H C   1 
ATOM   1024 O O   . TYR B 2 85  ? 14.753  26.477  61.668  1.00 14.57  ? 89  TYR H O   1 
ATOM   1025 C CB  . TYR B 2 85  ? 17.046  26.221  63.340  1.00 12.80  ? 89  TYR H CB  1 
ATOM   1026 C CG  . TYR B 2 85  ? 17.951  26.163  64.538  1.00 19.87  ? 89  TYR H CG  1 
ATOM   1027 C CD1 . TYR B 2 85  ? 17.492  25.686  65.766  1.00 24.96  ? 89  TYR H CD1 1 
ATOM   1028 C CD2 . TYR B 2 85  ? 19.276  26.559  64.438  1.00 24.67  ? 89  TYR H CD2 1 
ATOM   1029 C CE1 . TYR B 2 85  ? 18.337  25.605  66.862  1.00 27.39  ? 89  TYR H CE1 1 
ATOM   1030 C CE2 . TYR B 2 85  ? 20.125  26.481  65.519  1.00 26.51  ? 89  TYR H CE2 1 
ATOM   1031 C CZ  . TYR B 2 85  ? 19.656  26.005  66.725  1.00 31.69  ? 89  TYR H CZ  1 
ATOM   1032 O OH  . TYR B 2 85  ? 20.530  25.916  67.783  1.00 46.63  ? 89  TYR H OH  1 
ATOM   1033 N N   . ILE B 2 86  ? 15.712  28.385  60.993  1.00 10.47  ? 90  ILE H N   1 
ATOM   1034 C CA  . ILE B 2 86  ? 15.068  28.375  59.687  1.00 10.32  ? 90  ILE H CA  1 
ATOM   1035 C C   . ILE B 2 86  ? 16.144  28.156  58.623  1.00 18.67  ? 90  ILE H C   1 
ATOM   1036 O O   . ILE B 2 86  ? 17.228  28.739  58.718  1.00 26.91  ? 90  ILE H O   1 
ATOM   1037 C CB  . ILE B 2 86  ? 14.321  29.692  59.441  1.00 8.24   ? 90  ILE H CB  1 
ATOM   1038 C CG1 . ILE B 2 86  ? 13.203  29.838  60.481  1.00 7.83   ? 90  ILE H CG1 1 
ATOM   1039 C CG2 . ILE B 2 86  ? 13.766  29.734  58.007  1.00 7.49   ? 90  ILE H CG2 1 
ATOM   1040 C CD1 . ILE B 2 86  ? 12.443  31.136  60.402  1.00 2.00   ? 90  ILE H CD1 1 
ATOM   1041 N N   . HIS B 2 87  ? 15.852  27.330  57.615  1.00 16.08  ? 91  HIS H N   1 
ATOM   1042 C CA  . HIS B 2 87  ? 16.818  27.014  56.557  1.00 13.31  ? 91  HIS H CA  1 
ATOM   1043 C C   . HIS B 2 87  ? 17.360  28.255  55.848  1.00 15.28  ? 91  HIS H C   1 
ATOM   1044 O O   . HIS B 2 87  ? 16.594  29.012  55.258  1.00 19.45  ? 91  HIS H O   1 
ATOM   1045 C CB  . HIS B 2 87  ? 16.193  26.059  55.534  1.00 12.66  ? 91  HIS H CB  1 
ATOM   1046 C CG  . HIS B 2 87  ? 17.199  25.240  54.779  1.00 14.19  ? 91  HIS H CG  1 
ATOM   1047 N ND1 . HIS B 2 87  ? 18.039  25.778  53.827  1.00 14.23  ? 91  HIS H ND1 1 
ATOM   1048 C CD2 . HIS B 2 87  ? 17.513  23.925  54.853  1.00 16.80  ? 91  HIS H CD2 1 
ATOM   1049 C CE1 . HIS B 2 87  ? 18.833  24.833  53.354  1.00 8.44   ? 91  HIS H CE1 1 
ATOM   1050 N NE2 . HIS B 2 87  ? 18.533  23.699  53.959  1.00 12.89  ? 91  HIS H NE2 1 
ATOM   1051 N N   . PRO B 2 88  ? 18.700  28.425  55.816  1.00 16.30  ? 92  PRO H N   1 
ATOM   1052 C CA  . PRO B 2 88  ? 19.371  29.566  55.179  1.00 15.03  ? 92  PRO H CA  1 
ATOM   1053 C C   . PRO B 2 88  ? 18.915  29.776  53.756  1.00 17.65  ? 92  PRO H C   1 
ATOM   1054 O O   . PRO B 2 88  ? 18.780  30.905  53.309  1.00 27.28  ? 92  PRO H O   1 
ATOM   1055 C CB  . PRO B 2 88  ? 20.841  29.164  55.203  1.00 13.00  ? 92  PRO H CB  1 
ATOM   1056 C CG  . PRO B 2 88  ? 20.935  28.315  56.407  1.00 16.36  ? 92  PRO H CG  1 
ATOM   1057 C CD  . PRO B 2 88  ? 19.701  27.463  56.310  1.00 18.72  ? 92  PRO H CD  1 
ATOM   1058 N N   . ARG B 2 89  ? 18.706  28.679  53.039  1.00 18.36  ? 93  ARG H N   1 
ATOM   1059 C CA  . ARG B 2 89  ? 18.263  28.728  51.648  1.00 18.77  ? 93  ARG H CA  1 
ATOM   1060 C C   . ARG B 2 89  ? 16.733  28.798  51.467  1.00 21.94  ? 93  ARG H C   1 
ATOM   1061 O O   . ARG B 2 89  ? 16.227  28.554  50.366  1.00 24.66  ? 93  ARG H O   1 
ATOM   1062 C CB  . ARG B 2 89  ? 18.814  27.517  50.885  1.00 18.16  ? 93  ARG H CB  1 
ATOM   1063 C CG  . ARG B 2 89  ? 20.076  27.752  50.073  1.00 18.06  ? 93  ARG H CG  1 
ATOM   1064 C CD  . ARG B 2 89  ? 21.283  27.992  50.931  1.00 33.69  ? 93  ARG H CD  1 
ATOM   1065 N NE  . ARG B 2 89  ? 21.535  26.906  51.879  1.00 53.50  ? 93  ARG H NE  1 
ATOM   1066 C CZ  . ARG B 2 89  ? 21.844  25.654  51.543  1.00 60.54  ? 93  ARG H CZ  1 
ATOM   1067 N NH1 . ARG B 2 89  ? 21.941  25.300  50.265  1.00 66.57  ? 93  ARG H NH1 1 
ATOM   1068 N NH2 . ARG B 2 89  ? 22.073  24.753  52.495  1.00 60.00  ? 93  ARG H NH2 1 
ATOM   1069 N N   . TYR B 2 90  ? 15.998  29.101  52.535  1.00 19.60  ? 94  TYR H N   1 
ATOM   1070 C CA  . TYR B 2 90  ? 14.539  29.193  52.456  1.00 19.29  ? 94  TYR H CA  1 
ATOM   1071 C C   . TYR B 2 90  ? 14.146  30.289  51.463  1.00 22.59  ? 94  TYR H C   1 
ATOM   1072 O O   . TYR B 2 90  ? 14.392  31.475  51.696  1.00 25.16  ? 94  TYR H O   1 
ATOM   1073 C CB  . TYR B 2 90  ? 13.952  29.468  53.840  1.00 13.53  ? 94  TYR H CB  1 
ATOM   1074 C CG  . TYR B 2 90  ? 12.510  29.924  53.846  1.00 6.06   ? 94  TYR H CG  1 
ATOM   1075 C CD1 . TYR B 2 90  ? 11.516  29.195  53.195  1.00 6.84   ? 94  TYR H CD1 1 
ATOM   1076 C CD2 . TYR B 2 90  ? 12.137  31.082  54.522  1.00 4.25   ? 94  TYR H CD2 1 
ATOM   1077 C CE1 . TYR B 2 90  ? 10.180  29.615  53.223  1.00 2.00   ? 94  TYR H CE1 1 
ATOM   1078 C CE2 . TYR B 2 90  ? 10.809  31.503  54.554  1.00 2.00   ? 94  TYR H CE2 1 
ATOM   1079 C CZ  . TYR B 2 90  ? 9.847   30.764  53.909  1.00 2.00   ? 94  TYR H CZ  1 
ATOM   1080 O OH  . TYR B 2 90  ? 8.544   31.165  53.981  1.00 9.37   ? 94  TYR H OH  1 
ATOM   1081 N N   . ASN B 2 91  ? 13.484  29.879  50.385  1.00 23.21  ? 95  ASN H N   1 
ATOM   1082 C CA  . ASN B 2 91  ? 13.078  30.780  49.310  1.00 20.90  ? 95  ASN H CA  1 
ATOM   1083 C C   . ASN B 2 91  ? 11.618  31.225  49.381  1.00 20.13  ? 95  ASN H C   1 
ATOM   1084 O O   . ASN B 2 91  ? 10.735  30.569  48.824  1.00 24.03  ? 95  ASN H O   1 
ATOM   1085 C CB  . ASN B 2 91  ? 13.349  30.086  47.966  1.00 26.68  ? 95  ASN H CB  1 
ATOM   1086 C CG  . ASN B 2 91  ? 13.185  31.009  46.767  1.00 27.96  ? 95  ASN H CG  1 
ATOM   1087 O OD1 . ASN B 2 91  ? 12.569  32.073  46.846  1.00 33.31  ? 95  ASN H OD1 1 
ATOM   1088 N ND2 . ASN B 2 91  ? 13.727  30.590  45.641  1.00 31.93  ? 95  ASN H ND2 1 
ATOM   1089 N N   . TRP B 2 92  ? 11.366  32.363  50.013  1.00 15.83  ? 96  TRP H N   1 
ATOM   1090 C CA  . TRP B 2 92  ? 10.003  32.873  50.120  1.00 19.57  ? 96  TRP H CA  1 
ATOM   1091 C C   . TRP B 2 92  ? 9.625   33.867  49.018  1.00 26.08  ? 96  TRP H C   1 
ATOM   1092 O O   . TRP B 2 92  ? 8.445   34.154  48.807  1.00 31.32  ? 96  TRP H O   1 
ATOM   1093 C CB  . TRP B 2 92  ? 9.755   33.496  51.502  1.00 23.42  ? 96  TRP H CB  1 
ATOM   1094 C CG  . TRP B 2 92  ? 10.747  34.555  51.897  1.00 24.50  ? 96  TRP H CG  1 
ATOM   1095 C CD1 . TRP B 2 92  ? 11.890  34.377  52.621  1.00 18.49  ? 96  TRP H CD1 1 
ATOM   1096 C CD2 . TRP B 2 92  ? 10.692  35.948  51.569  1.00 27.88  ? 96  TRP H CD2 1 
ATOM   1097 N NE1 . TRP B 2 92  ? 12.552  35.569  52.763  1.00 24.12  ? 96  TRP H NE1 1 
ATOM   1098 C CE2 . TRP B 2 92  ? 11.841  36.553  52.126  1.00 30.15  ? 96  TRP H CE2 1 
ATOM   1099 C CE3 . TRP B 2 92  ? 9.786   36.744  50.853  1.00 27.64  ? 96  TRP H CE3 1 
ATOM   1100 C CZ2 . TRP B 2 92  ? 12.111  37.920  51.989  1.00 29.99  ? 96  TRP H CZ2 1 
ATOM   1101 C CZ3 . TRP B 2 92  ? 10.051  38.102  50.715  1.00 26.50  ? 96  TRP H CZ3 1 
ATOM   1102 C CH2 . TRP B 2 92  ? 11.207  38.675  51.282  1.00 31.45  ? 96  TRP H CH2 1 
ATOM   1103 N N   . LYS B 2 93  ? 10.614  34.398  48.311  1.00 27.68  ? 97  LYS H N   1 
ATOM   1104 C CA  . LYS B 2 93  ? 10.310  35.352  47.255  1.00 30.45  ? 97  LYS H CA  1 
ATOM   1105 C C   . LYS B 2 93  ? 9.623   34.596  46.126  1.00 35.69  ? 97  LYS H C   1 
ATOM   1106 O O   . LYS B 2 93  ? 8.556   35.003  45.657  1.00 41.61  ? 97  LYS H O   1 
ATOM   1107 C CB  . LYS B 2 93  ? 11.573  36.040  46.707  1.00 30.79  ? 97  LYS H CB  1 
ATOM   1108 C CG  . LYS B 2 93  ? 12.613  36.480  47.727  1.00 36.64  ? 97  LYS H CG  1 
ATOM   1109 C CD  . LYS B 2 93  ? 13.556  35.325  48.046  1.00 49.37  ? 97  LYS H CD  1 
ATOM   1110 C CE  . LYS B 2 93  ? 14.627  35.720  49.046  1.00 57.36  ? 97  LYS H CE  1 
ATOM   1111 N NZ  . LYS B 2 93  ? 15.486  34.553  49.390  1.00 61.23  ? 97  LYS H NZ  1 
ATOM   1112 N N   . GLU B 2 94  A 10.208  33.458  45.749  1.00 32.29  ? 97  GLU H N   1 
ATOM   1113 C CA  . GLU B 2 94  A 9.698   32.644  44.655  1.00 29.64  ? 97  GLU H CA  1 
ATOM   1114 C C   . GLU B 2 94  A 8.663   31.561  44.967  1.00 29.70  ? 97  GLU H C   1 
ATOM   1115 O O   . GLU B 2 94  A 7.475   31.841  45.109  1.00 32.16  ? 97  GLU H O   1 
ATOM   1116 C CB  . GLU B 2 94  A 10.860  32.000  43.894  1.00 36.40  ? 97  GLU H CB  1 
ATOM   1117 C CG  . GLU B 2 94  A 11.853  32.959  43.272  1.00 42.19  ? 97  GLU H CG  1 
ATOM   1118 C CD  . GLU B 2 94  A 13.011  32.231  42.613  1.00 48.30  ? 97  GLU H CD  1 
ATOM   1119 O OE1 . GLU B 2 94  A 12.757  31.331  41.778  1.00 52.14  ? 97  GLU H OE1 1 
ATOM   1120 O OE2 . GLU B 2 94  A 14.176  32.550  42.939  1.00 50.22  ? 97  GLU H OE2 1 
ATOM   1121 N N   . ASN B 2 95  ? 9.139   30.325  45.103  1.00 28.21  ? 98  ASN H N   1 
ATOM   1122 C CA  . ASN B 2 95  ? 8.287   29.157  45.306  1.00 24.61  ? 98  ASN H CA  1 
ATOM   1123 C C   . ASN B 2 95  ? 8.224   28.450  46.667  1.00 23.60  ? 98  ASN H C   1 
ATOM   1124 O O   . ASN B 2 95  ? 7.736   27.317  46.736  1.00 24.83  ? 98  ASN H O   1 
ATOM   1125 C CB  . ASN B 2 95  ? 8.624   28.121  44.223  1.00 22.70  ? 98  ASN H CB  1 
ATOM   1126 C CG  . ASN B 2 95  ? 10.113  27.830  44.137  1.00 20.96  ? 98  ASN H CG  1 
ATOM   1127 O OD1 . ASN B 2 95  ? 10.918  28.412  44.869  1.00 23.23  ? 98  ASN H OD1 1 
ATOM   1128 N ND2 . ASN B 2 95  ? 10.487  26.930  43.246  1.00 20.32  ? 98  ASN H ND2 1 
ATOM   1129 N N   . LEU B 2 96  ? 8.665   29.101  47.742  1.00 17.97  ? 99  LEU H N   1 
ATOM   1130 C CA  . LEU B 2 96  ? 8.642   28.482  49.070  1.00 11.12  ? 99  LEU H CA  1 
ATOM   1131 C C   . LEU B 2 96  ? 9.490   27.220  49.055  1.00 10.92  ? 99  LEU H C   1 
ATOM   1132 O O   . LEU B 2 96  ? 9.108   26.172  49.576  1.00 13.59  ? 99  LEU H O   1 
ATOM   1133 C CB  . LEU B 2 96  ? 7.205   28.160  49.510  1.00 6.41   ? 99  LEU H CB  1 
ATOM   1134 C CG  . LEU B 2 96  ? 6.314   29.336  49.918  1.00 4.84   ? 99  LEU H CG  1 
ATOM   1135 C CD1 . LEU B 2 96  ? 4.947   28.854  50.333  1.00 2.00   ? 99  LEU H CD1 1 
ATOM   1136 C CD2 . LEU B 2 96  ? 6.964   30.066  51.058  1.00 9.51   ? 99  LEU H CD2 1 
ATOM   1137 N N   . ASP B 2 97  ? 10.632  27.325  48.395  1.00 14.03  ? 100 ASP H N   1 
ATOM   1138 C CA  . ASP B 2 97  ? 11.578  26.222  48.274  1.00 14.32  ? 100 ASP H CA  1 
ATOM   1139 C C   . ASP B 2 97  ? 12.225  26.051  49.653  1.00 9.12   ? 100 ASP H C   1 
ATOM   1140 O O   . ASP B 2 97  ? 12.462  27.042  50.344  1.00 10.70  ? 100 ASP H O   1 
ATOM   1141 C CB  . ASP B 2 97  ? 12.613  26.592  47.198  1.00 14.84  ? 100 ASP H CB  1 
ATOM   1142 C CG  . ASP B 2 97  ? 13.580  25.471  46.884  1.00 18.50  ? 100 ASP H CG  1 
ATOM   1143 O OD1 . ASP B 2 97  ? 13.182  24.292  46.891  1.00 14.71  ? 100 ASP H OD1 1 
ATOM   1144 O OD2 . ASP B 2 97  ? 14.753  25.781  46.596  1.00 24.72  ? 100 ASP H OD2 1 
ATOM   1145 N N   . ARG B 2 98  ? 12.495  24.807  50.050  1.00 7.05   ? 101 ARG H N   1 
ATOM   1146 C CA  . ARG B 2 98  ? 13.084  24.502  51.359  1.00 4.96   ? 101 ARG H CA  1 
ATOM   1147 C C   . ARG B 2 98  ? 12.301  25.201  52.457  1.00 8.49   ? 101 ARG H C   1 
ATOM   1148 O O   . ARG B 2 98  ? 12.851  25.932  53.281  1.00 13.43  ? 101 ARG H O   1 
ATOM   1149 C CB  . ARG B 2 98  ? 14.544  24.920  51.431  1.00 4.71   ? 101 ARG H CB  1 
ATOM   1150 C CG  . ARG B 2 98  ? 15.407  24.244  50.395  1.00 19.75  ? 101 ARG H CG  1 
ATOM   1151 C CD  . ARG B 2 98  ? 16.856  24.606  50.597  1.00 25.33  ? 101 ARG H CD  1 
ATOM   1152 N NE  . ARG B 2 98  ? 17.695  24.125  49.506  1.00 26.55  ? 101 ARG H NE  1 
ATOM   1153 C CZ  . ARG B 2 98  ? 18.013  24.859  48.447  1.00 33.24  ? 101 ARG H CZ  1 
ATOM   1154 N NH1 . ARG B 2 98  ? 17.557  26.104  48.345  1.00 32.11  ? 101 ARG H NH1 1 
ATOM   1155 N NH2 . ARG B 2 98  ? 18.782  24.351  47.492  1.00 34.37  ? 101 ARG H NH2 1 
ATOM   1156 N N   . ASP B 2 99  ? 10.991  25.030  52.403  1.00 7.28   ? 102 ASP H N   1 
ATOM   1157 C CA  . ASP B 2 99  ? 10.090  25.608  53.380  1.00 11.24  ? 102 ASP H CA  1 
ATOM   1158 C C   . ASP B 2 99  ? 10.160  24.719  54.619  1.00 15.76  ? 102 ASP H C   1 
ATOM   1159 O O   . ASP B 2 99  ? 9.301   23.855  54.819  1.00 13.59  ? 102 ASP H O   1 
ATOM   1160 C CB  . ASP B 2 99  ? 8.667   25.603  52.815  1.00 3.91   ? 102 ASP H CB  1 
ATOM   1161 C CG  . ASP B 2 99  ? 7.689   26.299  53.706  1.00 2.59   ? 102 ASP H CG  1 
ATOM   1162 O OD1 . ASP B 2 99  ? 8.115   27.125  54.538  1.00 14.02  ? 102 ASP H OD1 1 
ATOM   1163 O OD2 . ASP B 2 99  ? 6.484   26.037  53.563  1.00 2.00   ? 102 ASP H OD2 1 
ATOM   1164 N N   . ILE B 2 100 ? 11.173  24.931  55.454  1.00 15.17  ? 103 ILE H N   1 
ATOM   1165 C CA  . ILE B 2 100 ? 11.331  24.104  56.643  1.00 13.30  ? 103 ILE H CA  1 
ATOM   1166 C C   . ILE B 2 100 ? 11.974  24.863  57.796  1.00 10.72  ? 103 ILE H C   1 
ATOM   1167 O O   . ILE B 2 100 ? 12.789  25.760  57.574  1.00 9.36   ? 103 ILE H O   1 
ATOM   1168 C CB  . ILE B 2 100 ? 12.152  22.837  56.314  1.00 8.24   ? 103 ILE H CB  1 
ATOM   1169 C CG1 . ILE B 2 100 ? 12.072  21.839  57.465  1.00 11.60  ? 103 ILE H CG1 1 
ATOM   1170 C CG2 . ILE B 2 100 ? 13.592  23.201  55.995  1.00 2.00   ? 103 ILE H CG2 1 
ATOM   1171 C CD1 . ILE B 2 100 ? 12.663  20.486  57.131  1.00 8.92   ? 103 ILE H CD1 1 
ATOM   1172 N N   . ALA B 2 101 ? 11.545  24.531  59.013  1.00 7.62   ? 104 ALA H N   1 
ATOM   1173 C CA  . ALA B 2 101 ? 12.042  25.148  60.239  1.00 3.52   ? 104 ALA H CA  1 
ATOM   1174 C C   . ALA B 2 101 ? 12.104  24.087  61.313  1.00 4.57   ? 104 ALA H C   1 
ATOM   1175 O O   . ALA B 2 101 ? 11.301  23.147  61.332  1.00 7.78   ? 104 ALA H O   1 
ATOM   1176 C CB  . ALA B 2 101 ? 11.137  26.279  60.683  1.00 2.26   ? 104 ALA H CB  1 
ATOM   1177 N N   . LEU B 2 102 ? 13.053  24.255  62.213  1.00 2.00   ? 105 LEU H N   1 
ATOM   1178 C CA  . LEU B 2 102 ? 13.276  23.324  63.301  1.00 7.03   ? 105 LEU H CA  1 
ATOM   1179 C C   . LEU B 2 102 ? 13.200  24.186  64.563  1.00 12.18  ? 105 LEU H C   1 
ATOM   1180 O O   . LEU B 2 102 ? 13.830  25.244  64.638  1.00 16.27  ? 105 LEU H O   1 
ATOM   1181 C CB  . LEU B 2 102 ? 14.672  22.721  63.102  1.00 7.95   ? 105 LEU H CB  1 
ATOM   1182 C CG  . LEU B 2 102 ? 15.235  21.355  63.525  1.00 8.10   ? 105 LEU H CG  1 
ATOM   1183 C CD1 . LEU B 2 102 ? 14.220  20.227  63.546  1.00 3.35   ? 105 LEU H CD1 1 
ATOM   1184 C CD2 . LEU B 2 102 ? 16.343  21.034  62.543  1.00 4.62   ? 105 LEU H CD2 1 
ATOM   1185 N N   . LEU B 2 103 ? 12.342  23.797  65.499  1.00 14.78  ? 106 LEU H N   1 
ATOM   1186 C CA  . LEU B 2 103 ? 12.166  24.535  66.752  1.00 14.20  ? 106 LEU H CA  1 
ATOM   1187 C C   . LEU B 2 103 ? 12.643  23.704  67.940  1.00 13.08  ? 106 LEU H C   1 
ATOM   1188 O O   . LEU B 2 103 ? 12.369  22.503  68.007  1.00 14.77  ? 106 LEU H O   1 
ATOM   1189 C CB  . LEU B 2 103 ? 10.688  24.894  66.962  1.00 14.81  ? 106 LEU H CB  1 
ATOM   1190 C CG  . LEU B 2 103 ? 9.925   25.616  65.848  1.00 12.61  ? 106 LEU H CG  1 
ATOM   1191 C CD1 . LEU B 2 103 ? 8.507   25.926  66.299  1.00 11.95  ? 106 LEU H CD1 1 
ATOM   1192 C CD2 . LEU B 2 103 ? 10.640  26.892  65.491  1.00 17.41  ? 106 LEU H CD2 1 
ATOM   1193 N N   . LYS B 2 104 ? 13.341  24.349  68.874  1.00 13.24  ? 107 LYS H N   1 
ATOM   1194 C CA  . LYS B 2 104 ? 13.857  23.691  70.079  1.00 11.79  ? 107 LYS H CA  1 
ATOM   1195 C C   . LYS B 2 104 ? 13.091  24.152  71.299  1.00 10.69  ? 107 LYS H C   1 
ATOM   1196 O O   . LYS B 2 104 ? 12.981  25.348  71.541  1.00 12.68  ? 107 LYS H O   1 
ATOM   1197 C CB  . LYS B 2 104 ? 15.321  24.043  70.292  1.00 11.41  ? 107 LYS H CB  1 
ATOM   1198 C CG  . LYS B 2 104 ? 15.909  23.498  71.565  1.00 16.54  ? 107 LYS H CG  1 
ATOM   1199 C CD  . LYS B 2 104 ? 17.349  23.955  71.702  1.00 33.27  ? 107 LYS H CD  1 
ATOM   1200 C CE  . LYS B 2 104 ? 17.966  23.490  73.007  1.00 45.90  ? 107 LYS H CE  1 
ATOM   1201 N NZ  . LYS B 2 104 ? 17.981  22.004  73.106  1.00 58.27  ? 107 LYS H NZ  1 
ATOM   1202 N N   . LEU B 2 105 ? 12.583  23.206  72.073  1.00 12.01  ? 108 LEU H N   1 
ATOM   1203 C CA  . LEU B 2 105 ? 11.834  23.518  73.287  1.00 13.87  ? 108 LEU H CA  1 
ATOM   1204 C C   . LEU B 2 105 ? 12.815  23.892  74.410  1.00 16.29  ? 108 LEU H C   1 
ATOM   1205 O O   . LEU B 2 105 ? 13.960  23.433  74.410  1.00 15.93  ? 108 LEU H O   1 
ATOM   1206 C CB  . LEU B 2 105 ? 10.986  22.308  73.698  1.00 5.67   ? 108 LEU H CB  1 
ATOM   1207 C CG  . LEU B 2 105 ? 9.693   22.014  72.931  1.00 3.96   ? 108 LEU H CG  1 
ATOM   1208 C CD1 . LEU B 2 105 ? 9.781   22.543  71.533  1.00 10.35  ? 108 LEU H CD1 1 
ATOM   1209 C CD2 . LEU B 2 105 ? 9.409   20.516  72.937  1.00 2.00   ? 108 LEU H CD2 1 
ATOM   1210 N N   . LYS B 2 106 ? 12.379  24.743  75.338  1.00 14.09  ? 109 LYS H N   1 
ATOM   1211 C CA  . LYS B 2 106 ? 13.221  25.162  76.456  1.00 19.66  ? 109 LYS H CA  1 
ATOM   1212 C C   . LYS B 2 106 ? 13.655  24.008  77.345  1.00 24.64  ? 109 LYS H C   1 
ATOM   1213 O O   . LYS B 2 106 ? 14.781  23.986  77.838  1.00 31.11  ? 109 LYS H O   1 
ATOM   1214 C CB  . LYS B 2 106 ? 12.508  26.185  77.342  1.00 21.04  ? 109 LYS H CB  1 
ATOM   1215 C CG  . LYS B 2 106 ? 12.505  27.596  76.806  1.00 34.39  ? 109 LYS H CG  1 
ATOM   1216 C CD  . LYS B 2 106 ? 12.394  28.604  77.937  1.00 39.59  ? 109 LYS H CD  1 
ATOM   1217 C CE  . LYS B 2 106 ? 13.671  28.643  78.772  1.00 52.87  ? 109 LYS H CE  1 
ATOM   1218 N NZ  . LYS B 2 106 ? 14.857  29.182  78.027  1.00 56.70  ? 109 LYS H NZ  1 
ATOM   1219 N N   . ARG B 2 107 ? 12.732  23.088  77.590  1.00 25.18  ? 110 ARG H N   1 
ATOM   1220 C CA  . ARG B 2 107 ? 12.964  21.927  78.438  1.00 26.61  ? 110 ARG H CA  1 
ATOM   1221 C C   . ARG B 2 107 ? 12.186  20.785  77.790  1.00 25.69  ? 110 ARG H C   1 
ATOM   1222 O O   . ARG B 2 107 ? 11.133  21.024  77.184  1.00 30.52  ? 110 ARG H O   1 
ATOM   1223 C CB  . ARG B 2 107 ? 12.431  22.237  79.855  1.00 35.46  ? 110 ARG H CB  1 
ATOM   1224 C CG  . ARG B 2 107 ? 11.908  21.045  80.667  1.00 53.66  ? 110 ARG H CG  1 
ATOM   1225 C CD  . ARG B 2 107 ? 13.015  20.269  81.388  1.00 68.28  ? 110 ARG H CD  1 
ATOM   1226 N NE  . ARG B 2 107 ? 12.607  18.895  81.701  1.00 73.17  ? 110 ARG H NE  1 
ATOM   1227 C CZ  . ARG B 2 107 ? 12.345  18.438  82.922  1.00 71.33  ? 110 ARG H CZ  1 
ATOM   1228 N NH1 . ARG B 2 107 ? 12.444  19.238  83.976  1.00 72.41  ? 110 ARG H NH1 1 
ATOM   1229 N NH2 . ARG B 2 107 ? 11.972  17.175  83.083  1.00 69.36  ? 110 ARG H NH2 1 
ATOM   1230 N N   . PRO B 2 108 ? 12.726  19.549  77.824  1.00 20.24  ? 111 PRO H N   1 
ATOM   1231 C CA  . PRO B 2 108 ? 12.012  18.418  77.218  1.00 19.29  ? 111 PRO H CA  1 
ATOM   1232 C C   . PRO B 2 108 ? 10.604  18.208  77.774  1.00 22.28  ? 111 PRO H C   1 
ATOM   1233 O O   . PRO B 2 108 ? 10.373  18.323  78.980  1.00 25.00  ? 111 PRO H O   1 
ATOM   1234 C CB  . PRO B 2 108 ? 12.922  17.224  77.524  1.00 10.34  ? 111 PRO H CB  1 
ATOM   1235 C CG  . PRO B 2 108 ? 13.781  17.688  78.630  1.00 5.82   ? 111 PRO H CG  1 
ATOM   1236 C CD  . PRO B 2 108 ? 14.046  19.116  78.301  1.00 8.96   ? 111 PRO H CD  1 
ATOM   1237 N N   . ILE B 2 109 ? 9.651   17.965  76.879  1.00 24.53  ? 112 ILE H N   1 
ATOM   1238 C CA  . ILE B 2 109 ? 8.282   17.734  77.300  1.00 24.79  ? 112 ILE H CA  1 
ATOM   1239 C C   . ILE B 2 109 ? 8.186   16.335  77.873  1.00 25.99  ? 112 ILE H C   1 
ATOM   1240 O O   . ILE B 2 109 ? 9.104   15.527  77.745  1.00 24.59  ? 112 ILE H O   1 
ATOM   1241 C CB  . ILE B 2 109 ? 7.253   17.931  76.157  1.00 25.27  ? 112 ILE H CB  1 
ATOM   1242 C CG1 . ILE B 2 109 ? 7.699   17.205  74.894  1.00 24.47  ? 112 ILE H CG1 1 
ATOM   1243 C CG2 . ILE B 2 109 ? 7.032   19.416  75.887  1.00 28.61  ? 112 ILE H CG2 1 
ATOM   1244 C CD1 . ILE B 2 109 ? 7.367   15.752  74.876  1.00 27.36  ? 112 ILE H CD1 1 
ATOM   1245 N N   . GLU B 2 110 ? 7.050   16.051  78.483  1.00 29.74  ? 113 GLU H N   1 
ATOM   1246 C CA  . GLU B 2 110 ? 6.806   14.772  79.119  1.00 29.05  ? 113 GLU H CA  1 
ATOM   1247 C C   . GLU B 2 110 ? 6.010   13.931  78.134  1.00 22.36  ? 113 GLU H C   1 
ATOM   1248 O O   . GLU B 2 110 ? 4.915   14.324  77.721  1.00 20.80  ? 113 GLU H O   1 
ATOM   1249 C CB  . GLU B 2 110 ? 6.009   15.002  80.409  1.00 38.02  ? 113 GLU H CB  1 
ATOM   1250 C CG  . GLU B 2 110 ? 6.566   16.127  81.334  1.00 55.09  ? 113 GLU H CG  1 
ATOM   1251 C CD  . GLU B 2 110 ? 6.561   17.544  80.710  1.00 62.33  ? 113 GLU H CD  1 
ATOM   1252 O OE1 . GLU B 2 110 ? 5.476   18.058  80.356  1.00 64.59  ? 113 GLU H OE1 1 
ATOM   1253 O OE2 . GLU B 2 110 ? 7.653   18.146  80.571  1.00 66.39  ? 113 GLU H OE2 1 
ATOM   1254 N N   . LEU B 2 111 ? 6.603   12.830  77.684  1.00 14.90  ? 114 LEU H N   1 
ATOM   1255 C CA  . LEU B 2 111 ? 5.932   11.952  76.740  1.00 12.94  ? 114 LEU H CA  1 
ATOM   1256 C C   . LEU B 2 111 ? 4.837   11.222  77.505  1.00 16.11  ? 114 LEU H C   1 
ATOM   1257 O O   . LEU B 2 111 ? 4.935   11.063  78.720  1.00 18.45  ? 114 LEU H O   1 
ATOM   1258 C CB  . LEU B 2 111 ? 6.911   10.953  76.104  1.00 5.36   ? 114 LEU H CB  1 
ATOM   1259 C CG  . LEU B 2 111 ? 8.098   11.476  75.286  1.00 2.00   ? 114 LEU H CG  1 
ATOM   1260 C CD1 . LEU B 2 111 ? 8.706   10.335  74.504  1.00 2.00   ? 114 LEU H CD1 1 
ATOM   1261 C CD2 . LEU B 2 111 ? 7.667   12.551  74.332  1.00 2.00   ? 114 LEU H CD2 1 
ATOM   1262 N N   . SER B 2 112 ? 3.788   10.810  76.798  1.00 15.47  ? 115 SER H N   1 
ATOM   1263 C CA  . SER B 2 112 ? 2.658   10.113  77.401  1.00 9.15   ? 115 SER H CA  1 
ATOM   1264 C C   . SER B 2 112 ? 1.935   9.387   76.280  1.00 10.76  ? 115 SER H C   1 
ATOM   1265 O O   . SER B 2 112 ? 2.517   9.146   75.228  1.00 18.83  ? 115 SER H O   1 
ATOM   1266 C CB  . SER B 2 112 ? 1.717   11.129  78.033  1.00 8.66   ? 115 SER H CB  1 
ATOM   1267 O OG  . SER B 2 112 ? 1.081   11.907  77.032  1.00 12.93  ? 115 SER H OG  1 
ATOM   1268 N N   . ASP B 2 113 ? 0.671   9.037   76.489  1.00 9.55   ? 116 ASP H N   1 
ATOM   1269 C CA  . ASP B 2 113 ? -0.098  8.354   75.450  1.00 10.78  ? 116 ASP H CA  1 
ATOM   1270 C C   . ASP B 2 113 ? -0.551  9.352   74.389  1.00 13.50  ? 116 ASP H C   1 
ATOM   1271 O O   . ASP B 2 113 ? -0.947  8.964   73.294  1.00 14.87  ? 116 ASP H O   1 
ATOM   1272 C CB  . ASP B 2 113 ? -1.350  7.683   76.041  1.00 11.89  ? 116 ASP H CB  1 
ATOM   1273 C CG  . ASP B 2 113 ? -1.028  6.528   76.992  1.00 21.16  ? 116 ASP H CG  1 
ATOM   1274 O OD1 . ASP B 2 113 ? 0.142   6.072   77.055  1.00 24.70  ? 116 ASP H OD1 1 
ATOM   1275 O OD2 . ASP B 2 113 ? -1.968  6.069   77.679  1.00 16.09  ? 116 ASP H OD2 1 
ATOM   1276 N N   . TYR B 2 114 ? -0.488  10.637  74.717  1.00 12.03  ? 117 TYR H N   1 
ATOM   1277 C CA  . TYR B 2 114 ? -0.945  11.681  73.817  1.00 12.15  ? 117 TYR H CA  1 
ATOM   1278 C C   . TYR B 2 114 ? 0.174   12.432  73.147  1.00 13.83  ? 117 TYR H C   1 
ATOM   1279 O O   . TYR B 2 114 ? -0.048  13.140  72.160  1.00 18.79  ? 117 TYR H O   1 
ATOM   1280 C CB  . TYR B 2 114 ? -1.832  12.641  74.594  1.00 10.14  ? 117 TYR H CB  1 
ATOM   1281 C CG  . TYR B 2 114 ? -2.895  11.880  75.301  1.00 7.29   ? 117 TYR H CG  1 
ATOM   1282 C CD1 . TYR B 2 114 ? -3.858  11.197  74.580  1.00 10.08  ? 117 TYR H CD1 1 
ATOM   1283 C CD2 . TYR B 2 114 ? -2.869  11.729  76.676  1.00 15.56  ? 117 TYR H CD2 1 
ATOM   1284 C CE1 . TYR B 2 114 ? -4.759  10.369  75.196  1.00 13.07  ? 117 TYR H CE1 1 
ATOM   1285 C CE2 . TYR B 2 114 ? -3.771  10.899  77.311  1.00 16.68  ? 117 TYR H CE2 1 
ATOM   1286 C CZ  . TYR B 2 114 ? -4.711  10.217  76.560  1.00 15.04  ? 117 TYR H CZ  1 
ATOM   1287 O OH  . TYR B 2 114 ? -5.585  9.349   77.166  1.00 26.25  ? 117 TYR H OH  1 
ATOM   1288 N N   . ILE B 2 115 ? 1.371   12.281  73.696  1.00 12.65  ? 118 ILE H N   1 
ATOM   1289 C CA  . ILE B 2 115 ? 2.557   12.937  73.173  1.00 9.51   ? 118 ILE H CA  1 
ATOM   1290 C C   . ILE B 2 115 ? 3.618   11.875  72.900  1.00 12.75  ? 118 ILE H C   1 
ATOM   1291 O O   . ILE B 2 115 ? 4.008   11.134  73.800  1.00 13.94  ? 118 ILE H O   1 
ATOM   1292 C CB  . ILE B 2 115 ? 3.075   13.972  74.183  1.00 2.48   ? 118 ILE H CB  1 
ATOM   1293 C CG1 . ILE B 2 115 ? 1.959   14.966  74.514  1.00 2.00   ? 118 ILE H CG1 1 
ATOM   1294 C CG2 . ILE B 2 115 ? 4.272   14.707  73.631  1.00 2.00   ? 118 ILE H CG2 1 
ATOM   1295 C CD1 . ILE B 2 115 ? 2.303   15.939  75.610  1.00 4.55   ? 118 ILE H CD1 1 
ATOM   1296 N N   . HIS B 2 116 ? 4.066   11.788  71.652  1.00 16.31  ? 119 HIS H N   1 
ATOM   1297 C CA  . HIS B 2 116 ? 5.069   10.800  71.266  1.00 16.63  ? 119 HIS H CA  1 
ATOM   1298 C C   . HIS B 2 116 ? 5.635   11.168  69.891  1.00 15.53  ? 119 HIS H C   1 
ATOM   1299 O O   . HIS B 2 116 ? 4.878   11.543  68.987  1.00 19.45  ? 119 HIS H O   1 
ATOM   1300 C CB  . HIS B 2 116 ? 4.420   9.419   71.230  1.00 14.75  ? 119 HIS H CB  1 
ATOM   1301 C CG  . HIS B 2 116 ? 5.397   8.290   71.262  1.00 14.06  ? 119 HIS H CG  1 
ATOM   1302 N ND1 . HIS B 2 116 ? 5.404   7.284   70.323  1.00 17.60  ? 119 HIS H ND1 1 
ATOM   1303 C CD2 . HIS B 2 116 ? 6.388   7.993   72.135  1.00 19.03  ? 119 HIS H CD2 1 
ATOM   1304 C CE1 . HIS B 2 116 ? 6.355   6.417   70.612  1.00 19.55  ? 119 HIS H CE1 1 
ATOM   1305 N NE2 . HIS B 2 116 ? 6.966   6.825   71.708  1.00 20.07  ? 119 HIS H NE2 1 
ATOM   1306 N N   . PRO B 2 117 ? 6.969   11.081  69.720  1.00 9.40   ? 120 PRO H N   1 
ATOM   1307 C CA  . PRO B 2 117 ? 7.653   11.410  68.456  1.00 11.17  ? 120 PRO H CA  1 
ATOM   1308 C C   . PRO B 2 117 ? 7.484   10.472  67.252  1.00 13.36  ? 120 PRO H C   1 
ATOM   1309 O O   . PRO B 2 117 ? 7.436   9.242   67.393  1.00 20.38  ? 120 PRO H O   1 
ATOM   1310 C CB  . PRO B 2 117 ? 9.119   11.532  68.882  1.00 10.35  ? 120 PRO H CB  1 
ATOM   1311 C CG  . PRO B 2 117 ? 9.215   10.594  70.036  1.00 4.24   ? 120 PRO H CG  1 
ATOM   1312 C CD  . PRO B 2 117 ? 7.948   10.854  70.797  1.00 2.00   ? 120 PRO H CD  1 
ATOM   1313 N N   . VAL B 2 118 ? 7.376   11.071  66.068  1.00 14.15  ? 121 VAL H N   1 
ATOM   1314 C CA  . VAL B 2 118 ? 7.219   10.332  64.807  1.00 10.60  ? 121 VAL H CA  1 
ATOM   1315 C C   . VAL B 2 118 ? 8.630   10.041  64.317  1.00 9.56   ? 121 VAL H C   1 
ATOM   1316 O O   . VAL B 2 118 ? 9.566   10.749  64.695  1.00 7.49   ? 121 VAL H O   1 
ATOM   1317 C CB  . VAL B 2 118 ? 6.432   11.183  63.724  1.00 11.38  ? 121 VAL H CB  1 
ATOM   1318 C CG1 . VAL B 2 118 ? 7.232   12.407  63.284  1.00 2.00   ? 121 VAL H CG1 1 
ATOM   1319 C CG2 . VAL B 2 118 ? 6.069   10.337  62.521  1.00 10.75  ? 121 VAL H CG2 1 
ATOM   1320 N N   . CYS B 2 119 ? 8.806   8.999   63.510  1.00 11.92  ? 122 CYS H N   1 
ATOM   1321 C CA  . CYS B 2 119 ? 10.145  8.694   63.009  1.00 13.44  ? 122 CYS H CA  1 
ATOM   1322 C C   . CYS B 2 119 ? 10.473  9.523   61.779  1.00 15.55  ? 122 CYS H C   1 
ATOM   1323 O O   . CYS B 2 119 ? 9.576   9.947   61.040  1.00 16.02  ? 122 CYS H O   1 
ATOM   1324 C CB  . CYS B 2 119 ? 10.293  7.222   62.637  1.00 11.25  ? 122 CYS H CB  1 
ATOM   1325 S SG  . CYS B 2 119 ? 10.175  6.025   63.991  1.00 8.12   ? 122 CYS H SG  1 
ATOM   1326 N N   . LEU B 2 120 ? 11.761  9.776   61.579  1.00 19.49  ? 123 LEU H N   1 
ATOM   1327 C CA  . LEU B 2 120 ? 12.210  10.514  60.405  1.00 21.44  ? 123 LEU H CA  1 
ATOM   1328 C C   . LEU B 2 120 ? 12.658  9.455   59.394  1.00 24.59  ? 123 LEU H C   1 
ATOM   1329 O O   . LEU B 2 120 ? 13.281  8.454   59.769  1.00 28.99  ? 123 LEU H O   1 
ATOM   1330 C CB  . LEU B 2 120 ? 13.349  11.472  60.751  1.00 15.33  ? 123 LEU H CB  1 
ATOM   1331 C CG  . LEU B 2 120 ? 12.911  12.754  61.444  1.00 10.19  ? 123 LEU H CG  1 
ATOM   1332 C CD1 . LEU B 2 120 ? 14.097  13.685  61.555  1.00 11.96  ? 123 LEU H CD1 1 
ATOM   1333 C CD2 . LEU B 2 120 ? 11.804  13.416  60.642  1.00 10.98  ? 123 LEU H CD2 1 
ATOM   1334 N N   . PRO B 2 121 ? 12.324  9.647   58.110  1.00 20.64  ? 124 PRO H N   1 
ATOM   1335 C CA  . PRO B 2 121 ? 12.681  8.706   57.054  1.00 18.52  ? 124 PRO H CA  1 
ATOM   1336 C C   . PRO B 2 121 ? 14.151  8.338   56.962  1.00 20.33  ? 124 PRO H C   1 
ATOM   1337 O O   . PRO B 2 121 ? 15.048  9.142   57.206  1.00 21.90  ? 124 PRO H O   1 
ATOM   1338 C CB  . PRO B 2 121 ? 12.171  9.398   55.793  1.00 20.17  ? 124 PRO H CB  1 
ATOM   1339 C CG  . PRO B 2 121 ? 12.259  10.852  56.145  1.00 21.44  ? 124 PRO H CG  1 
ATOM   1340 C CD  . PRO B 2 121 ? 11.730  10.867  57.541  1.00 21.22  ? 124 PRO H CD  1 
ATOM   1341 N N   . ASP B 2 122 ? 14.357  7.086   56.588  1.00 28.87  ? 125 ASP H N   1 
ATOM   1342 C CA  . ASP B 2 122 ? 15.658  6.458   56.424  1.00 31.06  ? 125 ASP H CA  1 
ATOM   1343 C C   . ASP B 2 122 ? 15.940  6.362   54.918  1.00 35.35  ? 125 ASP H C   1 
ATOM   1344 O O   . ASP B 2 122 ? 15.031  6.549   54.107  1.00 38.23  ? 125 ASP H O   1 
ATOM   1345 C CB  . ASP B 2 122 ? 15.547  5.060   57.035  1.00 30.07  ? 125 ASP H CB  1 
ATOM   1346 C CG  . ASP B 2 122 ? 16.825  4.308   56.995  1.00 35.22  ? 125 ASP H CG  1 
ATOM   1347 O OD1 . ASP B 2 122 ? 17.770  4.726   57.691  1.00 40.68  ? 125 ASP H OD1 1 
ATOM   1348 O OD2 . ASP B 2 122 ? 16.880  3.291   56.275  1.00 46.00  ? 125 ASP H OD2 1 
ATOM   1349 N N   . LYS B 2 123 ? 17.176  6.046   54.539  1.00 37.81  ? 126 LYS H N   1 
ATOM   1350 C CA  . LYS B 2 123 ? 17.528  5.917   53.120  1.00 38.50  ? 126 LYS H CA  1 
ATOM   1351 C C   . LYS B 2 123 ? 16.758  4.774   52.461  1.00 35.90  ? 126 LYS H C   1 
ATOM   1352 O O   . LYS B 2 123 ? 16.362  4.876   51.300  1.00 37.91  ? 126 LYS H O   1 
ATOM   1353 C CB  . LYS B 2 123 ? 19.033  5.700   52.930  1.00 49.16  ? 126 LYS H CB  1 
ATOM   1354 C CG  . LYS B 2 123 ? 19.920  6.868   53.368  1.00 58.59  ? 126 LYS H CG  1 
ATOM   1355 C CD  . LYS B 2 123 ? 20.055  6.987   54.895  1.00 63.11  ? 126 LYS H CD  1 
ATOM   1356 C CE  . LYS B 2 123 ? 20.831  5.816   55.515  1.00 63.73  ? 126 LYS H CE  1 
ATOM   1357 N NZ  . LYS B 2 123 ? 20.053  4.545   55.618  1.00 60.73  ? 126 LYS H NZ  1 
ATOM   1358 N N   . GLN B 2 124 ? 16.543  3.691   53.206  1.00 31.84  ? 127 GLN H N   1 
ATOM   1359 C CA  . GLN B 2 124 ? 15.793  2.542   52.700  1.00 30.54  ? 127 GLN H CA  1 
ATOM   1360 C C   . GLN B 2 124 ? 14.286  2.801   52.794  1.00 26.23  ? 127 GLN H C   1 
ATOM   1361 O O   . GLN B 2 124 ? 13.529  2.447   51.899  1.00 25.49  ? 127 GLN H O   1 
ATOM   1362 C CB  . GLN B 2 124 ? 16.150  1.281   53.489  1.00 40.37  ? 127 GLN H CB  1 
ATOM   1363 C CG  . GLN B 2 124 ? 16.359  0.051   52.619  1.00 52.84  ? 127 GLN H CG  1 
ATOM   1364 C CD  . GLN B 2 124 ? 17.472  0.248   51.599  1.00 65.06  ? 127 GLN H CD  1 
ATOM   1365 O OE1 . GLN B 2 124 ? 17.211  0.466   50.413  1.00 66.90  ? 127 GLN H OE1 1 
ATOM   1366 N NE2 . GLN B 2 124 ? 18.721  0.188   52.061  1.00 67.67  ? 127 GLN H NE2 1 
ATOM   1367 N N   . THR B 2 125 ? 13.858  3.424   53.886  1.00 21.41  ? 128 THR H N   1 
ATOM   1368 C CA  . THR B 2 125 ? 12.452  3.738   54.085  1.00 18.31  ? 128 THR H CA  1 
ATOM   1369 C C   . THR B 2 125 ? 11.928  4.669   52.994  1.00 15.91  ? 128 THR H C   1 
ATOM   1370 O O   . THR B 2 125 ? 10.867  4.418   52.421  1.00 15.27  ? 128 THR H O   1 
ATOM   1371 C CB  . THR B 2 125 ? 12.213  4.383   55.466  1.00 18.35  ? 128 THR H CB  1 
ATOM   1372 O OG1 . THR B 2 125 ? 12.581  3.455   56.495  1.00 22.54  ? 128 THR H OG1 1 
ATOM   1373 C CG2 . THR B 2 125 ? 10.746  4.775   55.637  1.00 15.74  ? 128 THR H CG2 1 
ATOM   1374 N N   . ALA B 2 126 ? 12.654  5.754   52.732  1.00 12.25  ? 129 ALA H N   1 
ATOM   1375 C CA  . ALA B 2 126 ? 12.251  6.703   51.707  1.00 14.10  ? 129 ALA H CA  1 
ATOM   1376 C C   . ALA B 2 126 ? 12.131  5.978   50.364  1.00 17.04  ? 129 ALA H C   1 
ATOM   1377 O O   . ALA B 2 126 ? 11.123  6.110   49.669  1.00 17.87  ? 129 ALA H O   1 
ATOM   1378 C CB  . ALA B 2 126 ? 13.255  7.837   51.616  1.00 10.75  ? 129 ALA H CB  1 
ATOM   1379 N N   . ALA B 2 127 A 13.114  5.128   50.075  1.00 18.87  ? 129 ALA H N   1 
ATOM   1380 C CA  . ALA B 2 127 A 13.180  4.345   48.842  1.00 15.74  ? 129 ALA H CA  1 
ATOM   1381 C C   . ALA B 2 127 A 12.012  3.391   48.620  1.00 16.47  ? 129 ALA H C   1 
ATOM   1382 O O   . ALA B 2 127 A 11.456  3.323   47.521  1.00 21.92  ? 129 ALA H O   1 
ATOM   1383 C CB  . ALA B 2 127 A 14.486  3.572   48.798  1.00 17.21  ? 129 ALA H CB  1 
ATOM   1384 N N   . LYS B 2 128 B 11.670  2.621   49.646  1.00 14.82  ? 129 LYS H N   1 
ATOM   1385 C CA  . LYS B 2 128 B 10.573  1.665   49.559  1.00 17.32  ? 129 LYS H CA  1 
ATOM   1386 C C   . LYS B 2 128 B 9.168   2.277   49.665  1.00 20.84  ? 129 LYS H C   1 
ATOM   1387 O O   . LYS B 2 128 B 8.196   1.659   49.214  1.00 25.52  ? 129 LYS H O   1 
ATOM   1388 C CB  . LYS B 2 128 B 10.707  0.593   50.650  1.00 16.97  ? 129 LYS H CB  1 
ATOM   1389 C CG  . LYS B 2 128 B 12.100  -0.005  50.833  1.00 26.29  ? 129 LYS H CG  1 
ATOM   1390 C CD  . LYS B 2 128 B 12.583  -0.831  49.635  1.00 37.95  ? 129 LYS H CD  1 
ATOM   1391 C CE  . LYS B 2 128 B 11.942  -2.221  49.545  1.00 42.09  ? 129 LYS H CE  1 
ATOM   1392 N NZ  . LYS B 2 128 B 10.553  -2.220  48.998  1.00 42.97  ? 129 LYS H NZ  1 
ATOM   1393 N N   . LEU B 2 129 C 9.054   3.476   50.245  1.00 22.69  ? 129 LEU H N   1 
ATOM   1394 C CA  . LEU B 2 129 C 7.742   4.109   50.455  1.00 17.13  ? 129 LEU H CA  1 
ATOM   1395 C C   . LEU B 2 129 C 7.308   5.282   49.586  1.00 15.23  ? 129 LEU H C   1 
ATOM   1396 O O   . LEU B 2 129 C 6.106   5.488   49.396  1.00 13.84  ? 129 LEU H O   1 
ATOM   1397 C CB  . LEU B 2 129 C 7.585   4.508   51.923  1.00 16.17  ? 129 LEU H CB  1 
ATOM   1398 C CG  . LEU B 2 129 C 7.798   3.398   52.949  1.00 18.64  ? 129 LEU H CG  1 
ATOM   1399 C CD1 . LEU B 2 129 C 7.640   3.958   54.352  1.00 14.59  ? 129 LEU H CD1 1 
ATOM   1400 C CD2 . LEU B 2 129 C 6.804   2.264   52.683  1.00 23.52  ? 129 LEU H CD2 1 
ATOM   1401 N N   . LEU B 2 130 ? 8.259   6.074   49.097  1.00 14.41  ? 130 LEU H N   1 
ATOM   1402 C CA  . LEU B 2 130 ? 7.929   7.227   48.258  1.00 14.33  ? 130 LEU H CA  1 
ATOM   1403 C C   . LEU B 2 130 ? 7.644   6.797   46.832  1.00 15.49  ? 130 LEU H C   1 
ATOM   1404 O O   . LEU B 2 130 ? 8.456   7.028   45.928  1.00 16.53  ? 130 LEU H O   1 
ATOM   1405 C CB  . LEU B 2 130 ? 9.063   8.264   48.289  1.00 14.63  ? 130 LEU H CB  1 
ATOM   1406 C CG  . LEU B 2 130 ? 9.238   9.084   49.575  1.00 11.67  ? 130 LEU H CG  1 
ATOM   1407 C CD1 . LEU B 2 130 ? 10.509  9.878   49.484  1.00 14.36  ? 130 LEU H CD1 1 
ATOM   1408 C CD2 . LEU B 2 130 ? 8.044   10.015  49.814  1.00 5.34   ? 130 LEU H CD2 1 
ATOM   1409 N N   . HIS B 2 131 ? 6.482   6.183   46.625  1.00 19.03  ? 131 HIS H N   1 
ATOM   1410 C CA  . HIS B 2 131 ? 6.116   5.701   45.303  1.00 18.95  ? 131 HIS H CA  1 
ATOM   1411 C C   . HIS B 2 131 ? 4.713   6.133   44.938  1.00 19.37  ? 131 HIS H C   1 
ATOM   1412 O O   . HIS B 2 131 ? 3.772   5.889   45.686  1.00 22.55  ? 131 HIS H O   1 
ATOM   1413 C CB  . HIS B 2 131 ? 6.220   4.179   45.249  1.00 26.33  ? 131 HIS H CB  1 
ATOM   1414 C CG  . HIS B 2 131 ? 6.299   3.631   43.856  1.00 53.02  ? 131 HIS H CG  1 
ATOM   1415 N ND1 . HIS B 2 131 ? 5.225   3.036   43.224  1.00 62.53  ? 131 HIS H ND1 1 
ATOM   1416 C CD2 . HIS B 2 131 ? 7.318   3.613   42.963  1.00 60.64  ? 131 HIS H CD2 1 
ATOM   1417 C CE1 . HIS B 2 131 ? 5.578   2.679   42.001  1.00 64.05  ? 131 HIS H CE1 1 
ATOM   1418 N NE2 . HIS B 2 131 ? 6.842   3.017   41.817  1.00 63.58  ? 131 HIS H NE2 1 
ATOM   1419 N N   . ALA B 2 132 ? 4.584   6.750   43.766  1.00 21.61  ? 132 ALA H N   1 
ATOM   1420 C CA  . ALA B 2 132 ? 3.308   7.248   43.246  1.00 18.68  ? 132 ALA H CA  1 
ATOM   1421 C C   . ALA B 2 132 ? 2.210   6.215   43.373  1.00 18.15  ? 132 ALA H C   1 
ATOM   1422 O O   . ALA B 2 132 ? 2.269   5.160   42.743  1.00 23.17  ? 132 ALA H O   1 
ATOM   1423 C CB  . ALA B 2 132 ? 3.462   7.657   41.791  1.00 17.38  ? 132 ALA H CB  1 
ATOM   1424 N N   . GLY B 2 133 ? 1.214   6.525   44.191  1.00 14.43  ? 133 GLY H N   1 
ATOM   1425 C CA  . GLY B 2 133 ? 0.113   5.611   44.399  1.00 13.54  ? 133 GLY H CA  1 
ATOM   1426 C C   . GLY B 2 133 ? -0.051  5.301   45.868  1.00 20.69  ? 133 GLY H C   1 
ATOM   1427 O O   . GLY B 2 133 ? -1.178  5.234   46.368  1.00 24.97  ? 133 GLY H O   1 
ATOM   1428 N N   . PHE B 2 134 ? 1.071   5.117   46.564  1.00 19.69  ? 134 PHE H N   1 
ATOM   1429 C CA  . PHE B 2 134 ? 1.051   4.827   47.992  1.00 16.53  ? 134 PHE H CA  1 
ATOM   1430 C C   . PHE B 2 134 ? 0.481   6.050   48.700  1.00 18.04  ? 134 PHE H C   1 
ATOM   1431 O O   . PHE B 2 134 ? 0.711   7.177   48.267  1.00 19.99  ? 134 PHE H O   1 
ATOM   1432 C CB  . PHE B 2 134 ? 2.465   4.521   48.491  1.00 13.23  ? 134 PHE H CB  1 
ATOM   1433 C CG  . PHE B 2 134 ? 3.029   3.241   47.950  1.00 10.04  ? 134 PHE H CG  1 
ATOM   1434 C CD1 . PHE B 2 134 ? 2.364   2.537   46.954  1.00 9.73   ? 134 PHE H CD1 1 
ATOM   1435 C CD2 . PHE B 2 134 ? 4.210   2.723   48.453  1.00 14.80  ? 134 PHE H CD2 1 
ATOM   1436 C CE1 . PHE B 2 134 ? 2.864   1.339   46.470  1.00 10.51  ? 134 PHE H CE1 1 
ATOM   1437 C CE2 . PHE B 2 134 ? 4.723   1.521   47.974  1.00 13.77  ? 134 PHE H CE2 1 
ATOM   1438 C CZ  . PHE B 2 134 ? 4.045   0.827   46.978  1.00 10.20  ? 134 PHE H CZ  1 
ATOM   1439 N N   . LYS B 2 135 ? -0.330  5.831   49.728  1.00 14.78  ? 135 LYS H N   1 
ATOM   1440 C CA  . LYS B 2 135 ? -0.931  6.938   50.453  1.00 7.86   ? 135 LYS H CA  1 
ATOM   1441 C C   . LYS B 2 135 ? -0.203  7.331   51.712  1.00 9.45   ? 135 LYS H C   1 
ATOM   1442 O O   . LYS B 2 135 ? 0.603   6.584   52.264  1.00 12.01  ? 135 LYS H O   1 
ATOM   1443 C CB  . LYS B 2 135 ? -2.387  6.641   50.789  1.00 5.62   ? 135 LYS H CB  1 
ATOM   1444 C CG  . LYS B 2 135 ? -3.242  6.389   49.571  1.00 2.00   ? 135 LYS H CG  1 
ATOM   1445 C CD  . LYS B 2 135 ? -4.688  6.268   49.947  1.00 6.00   ? 135 LYS H CD  1 
ATOM   1446 C CE  . LYS B 2 135 ? -5.506  5.746   48.784  1.00 8.70   ? 135 LYS H CE  1 
ATOM   1447 N NZ  . LYS B 2 135 ? -6.952  5.739   49.113  1.00 12.42  ? 135 LYS H NZ  1 
ATOM   1448 N N   . GLY B 2 136 ? -0.505  8.537   52.153  1.00 13.32  ? 136 GLY H N   1 
ATOM   1449 C CA  . GLY B 2 136 ? 0.075   9.080   53.356  1.00 8.35   ? 136 GLY H CA  1 
ATOM   1450 C C   . GLY B 2 136 ? -1.073  9.741   54.076  1.00 9.87   ? 136 GLY H C   1 
ATOM   1451 O O   . GLY B 2 136 ? -2.174  9.833   53.529  1.00 6.46   ? 136 GLY H O   1 
ATOM   1452 N N   . ARG B 2 137 ? -0.816  10.222  55.284  1.00 10.69  ? 137 ARG H N   1 
ATOM   1453 C CA  . ARG B 2 137 ? -1.839  10.851  56.092  1.00 9.52   ? 137 ARG H CA  1 
ATOM   1454 C C   . ARG B 2 137 ? -1.441  12.257  56.476  1.00 8.43   ? 137 ARG H C   1 
ATOM   1455 O O   . ARG B 2 137 ? -0.273  12.525  56.770  1.00 7.29   ? 137 ARG H O   1 
ATOM   1456 C CB  . ARG B 2 137 ? -2.083  10.006  57.347  1.00 12.62  ? 137 ARG H CB  1 
ATOM   1457 C CG  . ARG B 2 137 ? -3.011  10.617  58.387  1.00 2.00   ? 137 ARG H CG  1 
ATOM   1458 C CD  . ARG B 2 137 ? -3.245  9.641   59.520  1.00 2.00   ? 137 ARG H CD  1 
ATOM   1459 N NE  . ARG B 2 137 ? -3.945  8.441   59.061  1.00 6.75   ? 137 ARG H NE  1 
ATOM   1460 C CZ  . ARG B 2 137 ? -4.023  7.308   59.756  1.00 15.98  ? 137 ARG H CZ  1 
ATOM   1461 N NH1 . ARG B 2 137 ? -3.440  7.210   60.945  1.00 11.66  ? 137 ARG H NH1 1 
ATOM   1462 N NH2 . ARG B 2 137 ? -4.686  6.269   59.268  1.00 13.50  ? 137 ARG H NH2 1 
ATOM   1463 N N   . VAL B 2 138 ? -2.422  13.151  56.435  1.00 8.92   ? 138 VAL H N   1 
ATOM   1464 C CA  . VAL B 2 138 ? -2.240  14.550  56.789  1.00 8.23   ? 138 VAL H CA  1 
ATOM   1465 C C   . VAL B 2 138 ? -3.269  14.827  57.885  1.00 7.20   ? 138 VAL H C   1 
ATOM   1466 O O   . VAL B 2 138 ? -4.409  14.370  57.798  1.00 3.64   ? 138 VAL H O   1 
ATOM   1467 C CB  . VAL B 2 138 ? -2.515  15.488  55.578  1.00 6.96   ? 138 VAL H CB  1 
ATOM   1468 C CG1 . VAL B 2 138 ? -2.196  16.927  55.939  1.00 8.25   ? 138 VAL H CG1 1 
ATOM   1469 C CG2 . VAL B 2 138 ? -1.680  15.077  54.378  1.00 4.69   ? 138 VAL H CG2 1 
ATOM   1470 N N   . THR B 2 139 ? -2.846  15.531  58.931  1.00 11.80  ? 139 THR H N   1 
ATOM   1471 C CA  . THR B 2 139 ? -3.710  15.881  60.061  1.00 8.46   ? 139 THR H CA  1 
ATOM   1472 C C   . THR B 2 139 ? -3.568  17.368  60.379  1.00 8.80   ? 139 THR H C   1 
ATOM   1473 O O   . THR B 2 139 ? -2.492  17.945  60.185  1.00 11.54  ? 139 THR H O   1 
ATOM   1474 C CB  . THR B 2 139 ? -3.336  15.061  61.314  1.00 3.10   ? 139 THR H CB  1 
ATOM   1475 O OG1 . THR B 2 139 ? -1.906  14.965  61.415  1.00 8.59   ? 139 THR H OG1 1 
ATOM   1476 C CG2 . THR B 2 139 ? -3.936  13.667  61.241  1.00 2.00   ? 139 THR H CG2 1 
ATOM   1477 N N   . GLY B 2 140 ? -4.651  18.000  60.823  1.00 6.43   ? 140 GLY H N   1 
ATOM   1478 C CA  . GLY B 2 140 ? -4.581  19.415  61.154  1.00 4.24   ? 140 GLY H CA  1 
ATOM   1479 C C   . GLY B 2 140 ? -5.899  20.034  61.579  1.00 6.08   ? 140 GLY H C   1 
ATOM   1480 O O   . GLY B 2 140 ? -6.963  19.423  61.424  1.00 7.74   ? 140 GLY H O   1 
ATOM   1481 N N   . TRP B 2 141 ? -5.821  21.254  62.105  1.00 4.92   ? 141 TRP H N   1 
ATOM   1482 C CA  . TRP B 2 141 ? -6.992  22.007  62.565  1.00 7.31   ? 141 TRP H CA  1 
ATOM   1483 C C   . TRP B 2 141 ? -7.234  23.188  61.622  1.00 7.94   ? 141 TRP H C   1 
ATOM   1484 O O   . TRP B 2 141 ? -7.756  24.226  62.020  1.00 5.60   ? 141 TRP H O   1 
ATOM   1485 C CB  . TRP B 2 141 ? -6.758  22.553  63.973  1.00 4.15   ? 141 TRP H CB  1 
ATOM   1486 C CG  . TRP B 2 141 ? -6.471  21.524  64.999  1.00 6.65   ? 141 TRP H CG  1 
ATOM   1487 C CD1 . TRP B 2 141 ? -7.384  20.798  65.700  1.00 8.82   ? 141 TRP H CD1 1 
ATOM   1488 C CD2 . TRP B 2 141 ? -5.180  21.157  65.512  1.00 9.41   ? 141 TRP H CD2 1 
ATOM   1489 N NE1 . TRP B 2 141 ? -6.747  20.009  66.635  1.00 15.52  ? 141 TRP H NE1 1 
ATOM   1490 C CE2 . TRP B 2 141 ? -5.394  20.210  66.541  1.00 12.25  ? 141 TRP H CE2 1 
ATOM   1491 C CE3 . TRP B 2 141 ? -3.863  21.536  65.202  1.00 5.61   ? 141 TRP H CE3 1 
ATOM   1492 C CZ2 . TRP B 2 141 ? -4.341  19.634  67.266  1.00 7.39   ? 141 TRP H CZ2 1 
ATOM   1493 C CZ3 . TRP B 2 141 ? -2.816  20.960  65.920  1.00 8.68   ? 141 TRP H CZ3 1 
ATOM   1494 C CH2 . TRP B 2 141 ? -3.065  20.018  66.944  1.00 3.11   ? 141 TRP H CH2 1 
ATOM   1495 N N   . GLY B 2 142 ? -6.804  23.040  60.379  1.00 9.63   ? 142 GLY H N   1 
ATOM   1496 C CA  . GLY B 2 142 ? -6.987  24.099  59.413  1.00 8.98   ? 142 GLY H CA  1 
ATOM   1497 C C   . GLY B 2 142 ? -8.367  23.966  58.821  1.00 12.70  ? 142 GLY H C   1 
ATOM   1498 O O   . GLY B 2 142 ? -9.081  23.000  59.111  1.00 12.85  ? 142 GLY H O   1 
ATOM   1499 N N   . ASN B 2 143 ? -8.701  24.886  57.926  1.00 12.30  ? 143 ASN H N   1 
ATOM   1500 C CA  . ASN B 2 143 ? -10.001 24.915  57.275  1.00 16.84  ? 143 ASN H CA  1 
ATOM   1501 C C   . ASN B 2 143 ? -10.452 23.632  56.580  1.00 20.35  ? 143 ASN H C   1 
ATOM   1502 O O   . ASN B 2 143 ? -9.648  22.918  55.964  1.00 22.10  ? 143 ASN H O   1 
ATOM   1503 C CB  . ASN B 2 143 ? -10.051 26.055  56.266  1.00 23.66  ? 143 ASN H CB  1 
ATOM   1504 C CG  . ASN B 2 143 ? -9.791  27.400  56.889  1.00 16.41  ? 143 ASN H CG  1 
ATOM   1505 O OD1 . ASN B 2 143 ? -9.342  28.317  56.208  1.00 26.52  ? 143 ASN H OD1 1 
ATOM   1506 N ND2 . ASN B 2 143 ? -10.066 27.533  58.183  1.00 19.47  ? 143 ASN H ND2 1 
ATOM   1507 N N   . ARG B 2 144 ? -11.759 23.382  56.675  1.00 21.18  ? 144 ARG H N   1 
ATOM   1508 C CA  . ARG B 2 144 ? -12.434 22.234  56.077  1.00 18.18  ? 144 ARG H CA  1 
ATOM   1509 C C   . ARG B 2 144 ? -12.899 22.540  54.645  1.00 21.63  ? 144 ARG H C   1 
ATOM   1510 O O   . ARG B 2 144 ? -13.468 21.673  53.974  1.00 28.05  ? 144 ARG H O   1 
ATOM   1511 C CB  . ARG B 2 144 ? -13.674 21.875  56.897  1.00 17.71  ? 144 ARG H CB  1 
ATOM   1512 C CG  . ARG B 2 144 ? -13.449 21.694  58.384  1.00 28.98  ? 144 ARG H CG  1 
ATOM   1513 C CD  . ARG B 2 144 ? -14.775 21.513  59.137  1.00 36.71  ? 144 ARG H CD  1 
ATOM   1514 N NE  . ARG B 2 144 ? -15.222 20.124  59.171  1.00 42.17  ? 144 ARG H NE  1 
ATOM   1515 C CZ  . ARG B 2 144 ? -15.540 19.464  60.283  1.00 50.54  ? 144 ARG H CZ  1 
ATOM   1516 N NH1 . ARG B 2 144 ? -15.468 20.064  61.466  1.00 56.30  ? 144 ARG H NH1 1 
ATOM   1517 N NH2 . ARG B 2 144 ? -15.906 18.188  60.217  1.00 55.59  ? 144 ARG H NH2 1 
ATOM   1518 N N   . ARG B 2 145 ? -12.668 23.764  54.177  1.00 18.68  ? 145 ARG H N   1 
ATOM   1519 C CA  . ARG B 2 145 ? -13.096 24.159  52.840  1.00 17.80  ? 145 ARG H CA  1 
ATOM   1520 C C   . ARG B 2 145 ? -12.391 25.460  52.474  1.00 18.41  ? 145 ARG H C   1 
ATOM   1521 O O   . ARG B 2 145 ? -12.088 26.273  53.339  1.00 21.79  ? 145 ARG H O   1 
ATOM   1522 C CB  . ARG B 2 145 ? -14.615 24.343  52.845  1.00 27.63  ? 145 ARG H CB  1 
ATOM   1523 C CG  . ARG B 2 145 ? -15.267 24.688  51.529  1.00 40.50  ? 145 ARG H CG  1 
ATOM   1524 C CD  . ARG B 2 145 ? -16.787 24.787  51.712  1.00 54.13  ? 145 ARG H CD  1 
ATOM   1525 N NE  . ARG B 2 145 ? -17.179 25.871  52.615  1.00 63.05  ? 145 ARG H NE  1 
ATOM   1526 C CZ  . ARG B 2 145 ? -18.199 25.823  53.471  1.00 68.75  ? 145 ARG H CZ  1 
ATOM   1527 N NH1 . ARG B 2 145 ? -18.955 24.735  53.563  1.00 71.28  ? 145 ARG H NH1 1 
ATOM   1528 N NH2 . ARG B 2 145 ? -18.468 26.875  54.236  1.00 70.04  ? 145 ARG H NH2 1 
ATOM   1529 N N   . GLU B 2 146 ? -12.117 25.637  51.191  1.00 16.64  ? 146 GLU H N   1 
ATOM   1530 C CA  . GLU B 2 146 ? -11.433 26.817  50.691  1.00 16.23  ? 146 GLU H CA  1 
ATOM   1531 C C   . GLU B 2 146 ? -12.134 28.152  50.963  1.00 23.67  ? 146 GLU H C   1 
ATOM   1532 O O   . GLU B 2 146 ? -11.481 29.194  51.012  1.00 22.31  ? 146 GLU H O   1 
ATOM   1533 C CB  . GLU B 2 146 ? -11.212 26.661  49.191  1.00 15.61  ? 146 GLU H CB  1 
ATOM   1534 C CG  . GLU B 2 146 ? -10.326 27.726  48.567  1.00 19.84  ? 146 GLU H CG  1 
ATOM   1535 C CD  . GLU B 2 146 ? -10.113 27.516  47.074  1.00 21.82  ? 146 GLU H CD  1 
ATOM   1536 O OE1 . GLU B 2 146 ? -10.247 26.366  46.610  1.00 25.47  ? 146 GLU H OE1 1 
ATOM   1537 O OE2 . GLU B 2 146 ? -9.800  28.497  46.362  1.00 22.78  ? 146 GLU H OE2 1 
ATOM   1538 N N   . THR B 2 147 ? -13.456 28.140  51.112  1.00 29.17  ? 147 THR H N   1 
ATOM   1539 C CA  . THR B 2 147 ? -14.189 29.385  51.347  1.00 36.67  ? 147 THR H CA  1 
ATOM   1540 C C   . THR B 2 147 ? -15.355 29.252  52.313  1.00 40.03  ? 147 THR H C   1 
ATOM   1541 O O   . THR B 2 147 ? -15.650 28.167  52.804  1.00 42.53  ? 147 THR H O   1 
ATOM   1542 C CB  . THR B 2 147 ? -14.741 29.980  50.024  1.00 44.81  ? 147 THR H CB  1 
ATOM   1543 O OG1 . THR B 2 147 ? -15.152 28.918  49.150  1.00 52.68  ? 147 THR H OG1 1 
ATOM   1544 C CG2 . THR B 2 147 ? -13.696 30.851  49.330  1.00 50.52  ? 147 THR H CG2 1 
ATOM   1545 N N   . TRP B 2 148 ? -16.016 30.376  52.567  1.00 41.77  ? 148 TRP H N   1 
ATOM   1546 C CA  . TRP B 2 148 ? -17.167 30.442  53.455  1.00 40.99  ? 148 TRP H CA  1 
ATOM   1547 C C   . TRP B 2 148 ? -18.106 31.513  52.927  1.00 39.83  ? 148 TRP H C   1 
ATOM   1548 O O   . TRP B 2 148 ? -17.667 32.496  52.329  1.00 38.81  ? 148 TRP H O   1 
ATOM   1549 C CB  . TRP B 2 148 ? -16.736 30.788  54.879  1.00 40.61  ? 148 TRP H CB  1 
ATOM   1550 C CG  . TRP B 2 148 ? -15.825 31.973  54.972  1.00 42.75  ? 148 TRP H CG  1 
ATOM   1551 C CD1 . TRP B 2 148 ? -16.183 33.285  55.140  1.00 42.78  ? 148 TRP H CD1 1 
ATOM   1552 C CD2 . TRP B 2 148 ? -14.396 31.946  54.942  1.00 42.95  ? 148 TRP H CD2 1 
ATOM   1553 N NE1 . TRP B 2 148 ? -15.060 34.072  55.225  1.00 43.96  ? 148 TRP H NE1 1 
ATOM   1554 C CE2 . TRP B 2 148 ? -13.950 33.276  55.105  1.00 42.57  ? 148 TRP H CE2 1 
ATOM   1555 C CE3 . TRP B 2 148 ? -13.446 30.924  54.793  1.00 39.26  ? 148 TRP H CE3 1 
ATOM   1556 C CZ2 . TRP B 2 148 ? -12.595 33.610  55.125  1.00 43.93  ? 148 TRP H CZ2 1 
ATOM   1557 C CZ3 . TRP B 2 148 ? -12.098 31.257  54.811  1.00 41.10  ? 148 TRP H CZ3 1 
ATOM   1558 C CH2 . TRP B 2 148 ? -11.686 32.589  54.975  1.00 44.97  ? 148 TRP H CH2 1 
ATOM   1559 N N   . THR B 2 149 ? -19.398 31.312  53.141  1.00 39.94  ? 149 THR H N   1 
ATOM   1560 C CA  . THR B 2 149 ? -20.393 32.259  52.676  1.00 38.17  ? 149 THR H CA  1 
ATOM   1561 C C   . THR B 2 149 ? -20.443 33.470  53.592  1.00 39.36  ? 149 THR H C   1 
ATOM   1562 O O   . THR B 2 149 ? -20.216 34.595  53.157  1.00 37.44  ? 149 THR H O   1 
ATOM   1563 C CB  . THR B 2 149 ? -21.779 31.603  52.612  1.00 35.43  ? 149 THR H CB  1 
ATOM   1564 O OG1 . THR B 2 149 ? -21.662 30.309  52.006  1.00 33.76  ? 149 THR H OG1 1 
ATOM   1565 C CG2 . THR B 2 149 ? -22.726 32.449  51.781  1.00 35.03  ? 149 THR H CG2 1 
ATOM   1566 N N   . THR B 2 150 A -20.710 33.228  54.870  1.00 43.44  ? 149 THR H N   1 
ATOM   1567 C CA  . THR B 2 150 A -20.807 34.306  55.840  1.00 46.99  ? 149 THR H CA  1 
ATOM   1568 C C   . THR B 2 150 A -19.551 34.470  56.705  1.00 48.30  ? 149 THR H C   1 
ATOM   1569 O O   . THR B 2 150 A -18.918 35.527  56.670  1.00 51.72  ? 149 THR H O   1 
ATOM   1570 C CB  . THR B 2 150 A -22.068 34.131  56.722  1.00 50.33  ? 149 THR H CB  1 
ATOM   1571 O OG1 . THR B 2 150 A -23.183 33.790  55.887  1.00 50.17  ? 149 THR H OG1 1 
ATOM   1572 C CG2 . THR B 2 150 A -22.397 35.422  57.468  1.00 53.17  ? 149 THR H CG2 1 
ATOM   1573 N N   . SER B 2 151 B -19.165 33.430  57.444  1.00 46.78  ? 149 SER H N   1 
ATOM   1574 C CA  . SER B 2 151 B -17.986 33.520  58.306  1.00 48.81  ? 149 SER H CA  1 
ATOM   1575 C C   . SER B 2 151 B -17.046 32.314  58.242  1.00 47.78  ? 149 SER H C   1 
ATOM   1576 O O   . SER B 2 151 B -17.466 31.205  57.907  1.00 49.82  ? 149 SER H O   1 
ATOM   1577 C CB  . SER B 2 151 B -18.412 33.757  59.762  1.00 52.49  ? 149 SER H CB  1 
ATOM   1578 O OG  . SER B 2 151 B -19.113 32.641  60.294  1.00 54.81  ? 149 SER H OG  1 
ATOM   1579 N N   . VAL B 2 152 C -15.781 32.533  58.599  1.00 44.44  ? 149 VAL H N   1 
ATOM   1580 C CA  . VAL B 2 152 C -14.772 31.474  58.603  1.00 37.68  ? 149 VAL H CA  1 
ATOM   1581 C C   . VAL B 2 152 C -15.161 30.352  59.568  1.00 34.88  ? 149 VAL H C   1 
ATOM   1582 O O   . VAL B 2 152 C -14.740 29.207  59.413  1.00 35.45  ? 149 VAL H O   1 
ATOM   1583 C CB  . VAL B 2 152 C -13.373 32.030  58.971  1.00 36.81  ? 149 VAL H CB  1 
ATOM   1584 C CG1 . VAL B 2 152 C -13.316 32.433  60.440  1.00 37.37  ? 149 VAL H CG1 1 
ATOM   1585 C CG2 . VAL B 2 152 C -12.295 31.016  58.633  1.00 37.04  ? 149 VAL H CG2 1 
ATOM   1586 N N   . ALA B 2 153 D -15.997 30.686  60.544  1.00 32.45  ? 149 ALA H N   1 
ATOM   1587 C CA  . ALA B 2 153 D -16.475 29.730  61.534  1.00 33.00  ? 149 ALA H CA  1 
ATOM   1588 C C   . ALA B 2 153 D -17.049 28.482  60.871  1.00 33.69  ? 149 ALA H C   1 
ATOM   1589 O O   . ALA B 2 153 D -16.903 27.376  61.383  1.00 36.60  ? 149 ALA H O   1 
ATOM   1590 C CB  . ALA B 2 153 D -17.545 30.381  62.399  1.00 31.81  ? 149 ALA H CB  1 
ATOM   1591 N N   . GLU B 2 154 E -17.707 28.685  59.734  1.00 33.36  ? 149 GLU H N   1 
ATOM   1592 C CA  . GLU B 2 154 E -18.340 27.616  58.968  1.00 33.34  ? 149 GLU H CA  1 
ATOM   1593 C C   . GLU B 2 154 E -17.345 26.553  58.536  1.00 32.55  ? 149 GLU H C   1 
ATOM   1594 O O   . GLU B 2 154 E -17.678 25.371  58.433  1.00 36.51  ? 149 GLU H O   1 
ATOM   1595 C CB  . GLU B 2 154 E -18.986 28.194  57.704  1.00 33.49  ? 149 GLU H CB  1 
ATOM   1596 C CG  . GLU B 2 154 E -19.910 29.376  57.939  1.00 36.83  ? 149 GLU H CG  1 
ATOM   1597 C CD  . GLU B 2 154 E -20.277 30.109  56.658  1.00 42.60  ? 149 GLU H CD  1 
ATOM   1598 O OE1 . GLU B 2 154 E -19.793 29.721  55.568  1.00 39.44  ? 149 GLU H OE1 1 
ATOM   1599 O OE2 . GLU B 2 154 E -21.051 31.085  56.748  1.00 42.09  ? 149 GLU H OE2 1 
ATOM   1600 N N   . VAL B 2 155 ? -16.129 26.985  58.244  1.00 30.39  ? 150 VAL H N   1 
ATOM   1601 C CA  . VAL B 2 155 ? -15.117 26.062  57.783  1.00 25.41  ? 150 VAL H CA  1 
ATOM   1602 C C   . VAL B 2 155 ? -14.124 25.609  58.840  1.00 26.14  ? 150 VAL H C   1 
ATOM   1603 O O   . VAL B 2 155 ? -13.334 24.708  58.587  1.00 31.27  ? 150 VAL H O   1 
ATOM   1604 C CB  . VAL B 2 155 ? -14.394 26.632  56.557  1.00 15.69  ? 150 VAL H CB  1 
ATOM   1605 C CG1 . VAL B 2 155 ? -15.406 26.914  55.477  1.00 12.39  ? 150 VAL H CG1 1 
ATOM   1606 C CG2 . VAL B 2 155 ? -13.653 27.899  56.916  1.00 11.96  ? 150 VAL H CG2 1 
ATOM   1607 N N   . GLN B 2 156 ? -14.140 26.233  60.010  1.00 26.92  ? 151 GLN H N   1 
ATOM   1608 C CA  . GLN B 2 156 ? -13.221 25.842  61.076  1.00 26.85  ? 151 GLN H CA  1 
ATOM   1609 C C   . GLN B 2 156 ? -13.768 24.637  61.833  1.00 26.98  ? 151 GLN H C   1 
ATOM   1610 O O   . GLN B 2 156 ? -14.938 24.628  62.224  1.00 29.90  ? 151 GLN H O   1 
ATOM   1611 C CB  . GLN B 2 156 ? -12.992 26.993  62.043  1.00 25.31  ? 151 GLN H CB  1 
ATOM   1612 C CG  . GLN B 2 156 ? -12.383 28.210  61.403  1.00 29.51  ? 151 GLN H CG  1 
ATOM   1613 C CD  . GLN B 2 156 ? -12.110 29.307  62.411  1.00 37.51  ? 151 GLN H CD  1 
ATOM   1614 O OE1 . GLN B 2 156 ? -11.047 29.926  62.395  1.00 37.25  ? 151 GLN H OE1 1 
ATOM   1615 N NE2 . GLN B 2 156 ? -13.066 29.549  63.303  1.00 42.31  ? 151 GLN H NE2 1 
ATOM   1616 N N   . PRO B 2 157 ? -12.940 23.587  62.006  1.00 24.47  ? 152 PRO H N   1 
ATOM   1617 C CA  . PRO B 2 157 ? -13.327 22.360  62.712  1.00 19.86  ? 152 PRO H CA  1 
ATOM   1618 C C   . PRO B 2 157 ? -13.203 22.523  64.228  1.00 22.06  ? 152 PRO H C   1 
ATOM   1619 O O   . PRO B 2 157 ? -12.670 23.525  64.709  1.00 24.99  ? 152 PRO H O   1 
ATOM   1620 C CB  . PRO B 2 157 ? -12.317 21.346  62.179  1.00 20.30  ? 152 PRO H CB  1 
ATOM   1621 C CG  . PRO B 2 157 ? -11.072 22.174  62.060  1.00 17.65  ? 152 PRO H CG  1 
ATOM   1622 C CD  . PRO B 2 157 ? -11.584 23.454  61.430  1.00 21.93  ? 152 PRO H CD  1 
ATOM   1623 N N   . SER B 2 158 ? -13.709 21.554  64.982  1.00 18.52  ? 153 SER H N   1 
ATOM   1624 C CA  . SER B 2 158 ? -13.616 21.620  66.434  1.00 17.26  ? 153 SER H CA  1 
ATOM   1625 C C   . SER B 2 158 ? -12.508 20.705  66.949  1.00 15.23  ? 153 SER H C   1 
ATOM   1626 O O   . SER B 2 158 ? -11.886 20.984  67.976  1.00 18.18  ? 153 SER H O   1 
ATOM   1627 C CB  . SER B 2 158 ? -14.961 21.246  67.074  1.00 22.21  ? 153 SER H CB  1 
ATOM   1628 O OG  . SER B 2 158 ? -15.479 20.052  66.511  1.00 24.96  ? 153 SER H OG  1 
ATOM   1629 N N   . VAL B 2 159 ? -12.279 19.604  66.238  1.00 11.33  ? 154 VAL H N   1 
ATOM   1630 C CA  . VAL B 2 159 ? -11.253 18.639  66.613  1.00 12.30  ? 154 VAL H CA  1 
ATOM   1631 C C   . VAL B 2 159 ? -10.270 18.416  65.467  1.00 17.53  ? 154 VAL H C   1 
ATOM   1632 O O   . VAL B 2 159 ? -10.455 18.938  64.363  1.00 21.54  ? 154 VAL H O   1 
ATOM   1633 C CB  . VAL B 2 159 ? -11.858 17.256  67.000  1.00 6.90   ? 154 VAL H CB  1 
ATOM   1634 C CG1 . VAL B 2 159 ? -12.833 17.391  68.149  1.00 5.83   ? 154 VAL H CG1 1 
ATOM   1635 C CG2 . VAL B 2 159 ? -12.533 16.636  65.820  1.00 4.40   ? 154 VAL H CG2 1 
ATOM   1636 N N   . LEU B 2 160 ? -9.236  17.627  65.740  1.00 16.57  ? 155 LEU H N   1 
ATOM   1637 C CA  . LEU B 2 160 ? -8.213  17.298  64.763  1.00 12.18  ? 155 LEU H CA  1 
ATOM   1638 C C   . LEU B 2 160 ? -8.821  16.456  63.647  1.00 10.82  ? 155 LEU H C   1 
ATOM   1639 O O   . LEU B 2 160 ? -9.568  15.524  63.922  1.00 12.86  ? 155 LEU H O   1 
ATOM   1640 C CB  . LEU B 2 160 ? -7.093  16.524  65.447  1.00 7.68   ? 155 LEU H CB  1 
ATOM   1641 C CG  . LEU B 2 160 ? -5.873  16.278  64.573  1.00 4.43   ? 155 LEU H CG  1 
ATOM   1642 C CD1 . LEU B 2 160 ? -5.314  17.613  64.162  1.00 2.00   ? 155 LEU H CD1 1 
ATOM   1643 C CD2 . LEU B 2 160 ? -4.838  15.464  65.322  1.00 2.00   ? 155 LEU H CD2 1 
ATOM   1644 N N   . GLN B 2 161 ? -8.500  16.794  62.400  1.00 8.86   ? 156 GLN H N   1 
ATOM   1645 C CA  . GLN B 2 161 ? -9.008  16.096  61.216  1.00 4.07   ? 156 GLN H CA  1 
ATOM   1646 C C   . GLN B 2 161 ? -7.953  15.181  60.605  1.00 7.67   ? 156 GLN H C   1 
ATOM   1647 O O   . GLN B 2 161 ? -6.762  15.414  60.762  1.00 12.19  ? 156 GLN H O   1 
ATOM   1648 C CB  . GLN B 2 161 ? -9.414  17.111  60.153  1.00 7.25   ? 156 GLN H CB  1 
ATOM   1649 C CG  . GLN B 2 161 ? -10.413 18.150  60.609  1.00 3.93   ? 156 GLN H CG  1 
ATOM   1650 C CD  . GLN B 2 161 ? -11.744 17.543  60.954  1.00 11.75  ? 156 GLN H CD  1 
ATOM   1651 O OE1 . GLN B 2 161 ? -12.458 17.046  60.087  1.00 19.32  ? 156 GLN H OE1 1 
ATOM   1652 N NE2 . GLN B 2 161 ? -12.089 17.571  62.231  1.00 19.87  ? 156 GLN H NE2 1 
ATOM   1653 N N   . VAL B 2 162 ? -8.396  14.173  59.861  1.00 12.83  ? 157 VAL H N   1 
ATOM   1654 C CA  . VAL B 2 162 ? -7.486  13.234  59.212  1.00 10.42  ? 157 VAL H CA  1 
ATOM   1655 C C   . VAL B 2 162 ? -7.944  12.902  57.789  1.00 13.66  ? 157 VAL H C   1 
ATOM   1656 O O   . VAL B 2 162 ? -9.128  12.653  57.544  1.00 18.77  ? 157 VAL H O   1 
ATOM   1657 C CB  . VAL B 2 162 ? -7.332  11.913  60.037  1.00 13.03  ? 157 VAL H CB  1 
ATOM   1658 C CG1 . VAL B 2 162 ? -8.631  11.109  60.080  1.00 11.35  ? 157 VAL H CG1 1 
ATOM   1659 C CG2 . VAL B 2 162 ? -6.241  11.077  59.465  1.00 14.58  ? 157 VAL H CG2 1 
ATOM   1660 N N   . VAL B 2 163 ? -7.009  12.955  56.847  1.00 13.73  ? 158 VAL H N   1 
ATOM   1661 C CA  . VAL B 2 163 ? -7.284  12.645  55.449  1.00 9.95   ? 158 VAL H CA  1 
ATOM   1662 C C   . VAL B 2 163 ? -6.070  11.855  54.968  1.00 5.96   ? 158 VAL H C   1 
ATOM   1663 O O   . VAL B 2 163 ? -4.960  12.113  55.422  1.00 5.18   ? 158 VAL H O   1 
ATOM   1664 C CB  . VAL B 2 163 ? -7.477  13.953  54.605  1.00 10.20  ? 158 VAL H CB  1 
ATOM   1665 C CG1 . VAL B 2 163 ? -6.154  14.666  54.371  1.00 10.48  ? 158 VAL H CG1 1 
ATOM   1666 C CG2 . VAL B 2 163 ? -8.168  13.656  53.295  1.00 2.00   ? 158 VAL H CG2 1 
ATOM   1667 N N   . ASN B 2 164 ? -6.298  10.840  54.138  1.00 10.55  ? 159 ASN H N   1 
ATOM   1668 C CA  . ASN B 2 164 ? -5.219  10.005  53.590  1.00 12.66  ? 159 ASN H CA  1 
ATOM   1669 C C   . ASN B 2 164 ? -5.142  10.327  52.110  1.00 9.92   ? 159 ASN H C   1 
ATOM   1670 O O   . ASN B 2 164 ? -6.123  10.155  51.394  1.00 12.31  ? 159 ASN H O   1 
ATOM   1671 C CB  . ASN B 2 164 ? -5.518  8.509   53.764  1.00 17.45  ? 159 ASN H CB  1 
ATOM   1672 C CG  . ASN B 2 164 ? -5.660  8.100   55.224  1.00 20.29  ? 159 ASN H CG  1 
ATOM   1673 O OD1 . ASN B 2 164 ? -5.060  8.701   56.112  1.00 21.49  ? 159 ASN H OD1 1 
ATOM   1674 N ND2 . ASN B 2 164 ? -6.447  7.057   55.472  1.00 16.25  ? 159 ASN H ND2 1 
ATOM   1675 N N   . LEU B 2 165 ? -3.981  10.792  51.661  1.00 8.64   ? 160 LEU H N   1 
ATOM   1676 C CA  . LEU B 2 165 ? -3.781  11.188  50.273  1.00 8.44   ? 160 LEU H CA  1 
ATOM   1677 C C   . LEU B 2 165 ? -2.699  10.376  49.589  1.00 7.47   ? 160 LEU H C   1 
ATOM   1678 O O   . LEU B 2 165 ? -1.695  10.021  50.200  1.00 14.15  ? 160 LEU H O   1 
ATOM   1679 C CB  . LEU B 2 165 ? -3.422  12.678  50.208  1.00 8.50   ? 160 LEU H CB  1 
ATOM   1680 C CG  . LEU B 2 165 ? -4.443  13.666  50.788  1.00 11.88  ? 160 LEU H CG  1 
ATOM   1681 C CD1 . LEU B 2 165 ? -3.877  15.066  50.812  1.00 8.86   ? 160 LEU H CD1 1 
ATOM   1682 C CD2 . LEU B 2 165 ? -5.727  13.630  49.975  1.00 12.75  ? 160 LEU H CD2 1 
ATOM   1683 N N   . PRO B 2 166 ? -2.895  10.044  48.316  1.00 5.23   ? 161 PRO H N   1 
ATOM   1684 C CA  . PRO B 2 166 ? -1.876  9.262   47.625  1.00 2.00   ? 161 PRO H CA  1 
ATOM   1685 C C   . PRO B 2 166 ? -0.765  10.107  47.031  1.00 2.00   ? 161 PRO H C   1 
ATOM   1686 O O   . PRO B 2 166 ? -0.955  11.278  46.725  1.00 6.40   ? 161 PRO H O   1 
ATOM   1687 C CB  . PRO B 2 166 ? -2.678  8.564   46.535  1.00 2.00   ? 161 PRO H CB  1 
ATOM   1688 C CG  . PRO B 2 166 ? -3.684  9.534   46.192  1.00 2.00   ? 161 PRO H CG  1 
ATOM   1689 C CD  . PRO B 2 166 ? -4.142  10.070  47.531  1.00 9.48   ? 161 PRO H CD  1 
ATOM   1690 N N   . LEU B 2 167 ? 0.410   9.513   46.918  1.00 4.14   ? 162 LEU H N   1 
ATOM   1691 C CA  . LEU B 2 167 ? 1.546   10.181  46.329  1.00 10.67  ? 162 LEU H CA  1 
ATOM   1692 C C   . LEU B 2 167 ? 1.304   10.212  44.817  1.00 18.32  ? 162 LEU H C   1 
ATOM   1693 O O   . LEU B 2 167 ? 0.857   9.220   44.221  1.00 19.31  ? 162 LEU H O   1 
ATOM   1694 C CB  . LEU B 2 167 ? 2.816   9.395   46.632  1.00 12.29  ? 162 LEU H CB  1 
ATOM   1695 C CG  . LEU B 2 167 ? 3.208   9.276   48.096  1.00 13.08  ? 162 LEU H CG  1 
ATOM   1696 C CD1 . LEU B 2 167 ? 4.309   8.247   48.227  1.00 14.80  ? 162 LEU H CD1 1 
ATOM   1697 C CD2 . LEU B 2 167 ? 3.654   10.633  48.617  1.00 13.25  ? 162 LEU H CD2 1 
ATOM   1698 N N   . VAL B 2 168 ? 1.612   11.343  44.198  1.00 18.40  ? 163 VAL H N   1 
ATOM   1699 C CA  . VAL B 2 168 ? 1.424   11.502  42.767  1.00 16.53  ? 163 VAL H CA  1 
ATOM   1700 C C   . VAL B 2 168 ? 2.795   11.595  42.109  1.00 16.68  ? 163 VAL H C   1 
ATOM   1701 O O   . VAL B 2 168 ? 3.770   11.984  42.747  1.00 16.49  ? 163 VAL H O   1 
ATOM   1702 C CB  . VAL B 2 168 ? 0.599   12.775  42.473  1.00 18.32  ? 163 VAL H CB  1 
ATOM   1703 C CG1 . VAL B 2 168 ? 0.412   12.961  40.987  1.00 17.02  ? 163 VAL H CG1 1 
ATOM   1704 C CG2 . VAL B 2 168 ? -0.756  12.694  43.171  1.00 11.03  ? 163 VAL H CG2 1 
ATOM   1705 N N   . GLU B 2 169 ? 2.878   11.199  40.843  1.00 21.82  ? 164 GLU H N   1 
ATOM   1706 C CA  . GLU B 2 169 ? 4.142   11.250  40.121  1.00 21.03  ? 164 GLU H CA  1 
ATOM   1707 C C   . GLU B 2 169 ? 4.577   12.670  39.834  1.00 17.71  ? 164 GLU H C   1 
ATOM   1708 O O   . GLU B 2 169 ? 3.771   13.525  39.472  1.00 18.91  ? 164 GLU H O   1 
ATOM   1709 C CB  . GLU B 2 169 ? 4.103   10.437  38.823  1.00 22.52  ? 164 GLU H CB  1 
ATOM   1710 C CG  . GLU B 2 169 ? 2.765   10.360  38.118  1.00 32.85  ? 164 GLU H CG  1 
ATOM   1711 C CD  . GLU B 2 169 ? 1.892   9.249   38.658  1.00 39.95  ? 164 GLU H CD  1 
ATOM   1712 O OE1 . GLU B 2 169 ? 2.265   8.068   38.496  1.00 51.18  ? 164 GLU H OE1 1 
ATOM   1713 O OE2 . GLU B 2 169 ? 0.834   9.556   39.244  1.00 37.76  ? 164 GLU H OE2 1 
ATOM   1714 N N   . ARG B 2 170 ? 5.875   12.902  39.953  1.00 18.80  ? 165 ARG H N   1 
ATOM   1715 C CA  . ARG B 2 170 ? 6.434   14.222  39.726  1.00 24.20  ? 165 ARG H CA  1 
ATOM   1716 C C   . ARG B 2 170 ? 6.000   14.905  38.413  1.00 23.73  ? 165 ARG H C   1 
ATOM   1717 O O   . ARG B 2 170 ? 5.696   16.102  38.419  1.00 22.87  ? 165 ARG H O   1 
ATOM   1718 C CB  . ARG B 2 170 ? 7.953   14.177  39.881  1.00 26.35  ? 165 ARG H CB  1 
ATOM   1719 C CG  . ARG B 2 170 ? 8.615   15.538  39.873  1.00 40.25  ? 165 ARG H CG  1 
ATOM   1720 C CD  . ARG B 2 170 ? 10.050  15.448  40.354  1.00 47.66  ? 165 ARG H CD  1 
ATOM   1721 N NE  . ARG B 2 170 ? 10.109  15.140  41.780  1.00 46.40  ? 165 ARG H NE  1 
ATOM   1722 C CZ  . ARG B 2 170 ? 10.105  16.061  42.736  1.00 37.67  ? 165 ARG H CZ  1 
ATOM   1723 N NH1 . ARG B 2 170 ? 10.048  17.350  42.417  1.00 33.44  ? 165 ARG H NH1 1 
ATOM   1724 N NH2 . ARG B 2 170 ? 10.168  15.689  44.007  1.00 31.30  ? 165 ARG H NH2 1 
ATOM   1725 N N   . PRO B 2 171 ? 5.965   14.161  37.280  1.00 21.98  ? 166 PRO H N   1 
ATOM   1726 C CA  . PRO B 2 171 ? 5.552   14.756  36.001  1.00 18.22  ? 166 PRO H CA  1 
ATOM   1727 C C   . PRO B 2 171 ? 4.145   15.346  36.073  1.00 19.67  ? 166 PRO H C   1 
ATOM   1728 O O   . PRO B 2 171 ? 3.880   16.393  35.486  1.00 23.95  ? 166 PRO H O   1 
ATOM   1729 C CB  . PRO B 2 171 ? 5.613   13.573  35.044  1.00 18.02  ? 166 PRO H CB  1 
ATOM   1730 C CG  . PRO B 2 171 ? 6.776   12.806  35.573  1.00 19.64  ? 166 PRO H CG  1 
ATOM   1731 C CD  . PRO B 2 171 ? 6.501   12.805  37.058  1.00 19.98  ? 166 PRO H CD  1 
ATOM   1732 N N   . VAL B 2 172 ? 3.250   14.692  36.807  1.00 16.05  ? 167 VAL H N   1 
ATOM   1733 C CA  . VAL B 2 172 ? 1.888   15.198  36.962  1.00 17.08  ? 167 VAL H CA  1 
ATOM   1734 C C   . VAL B 2 172 ? 1.916   16.475  37.803  1.00 17.46  ? 167 VAL H C   1 
ATOM   1735 O O   . VAL B 2 172 ? 1.295   17.474  37.451  1.00 19.84  ? 167 VAL H O   1 
ATOM   1736 C CB  . VAL B 2 172 ? 0.975   14.154  37.632  1.00 22.16  ? 167 VAL H CB  1 
ATOM   1737 C CG1 . VAL B 2 172 ? -0.384  14.771  37.995  1.00 18.85  ? 167 VAL H CG1 1 
ATOM   1738 C CG2 . VAL B 2 172 ? 0.792   12.961  36.702  1.00 17.27  ? 167 VAL H CG2 1 
ATOM   1739 N N   . CYS B 2 173 ? 2.675   16.441  38.895  1.00 22.37  ? 168 CYS H N   1 
ATOM   1740 C CA  . CYS B 2 173 ? 2.813   17.594  39.783  1.00 20.97  ? 168 CYS H CA  1 
ATOM   1741 C C   . CYS B 2 173 ? 3.352   18.787  39.020  1.00 18.21  ? 168 CYS H C   1 
ATOM   1742 O O   . CYS B 2 173 ? 2.948   19.921  39.264  1.00 24.94  ? 168 CYS H O   1 
ATOM   1743 C CB  . CYS B 2 173 ? 3.779   17.291  40.928  1.00 17.18  ? 168 CYS H CB  1 
ATOM   1744 S SG  . CYS B 2 173 ? 3.293   15.921  42.016  1.00 9.59   ? 168 CYS H SG  1 
ATOM   1745 N N   . LYS B 2 174 ? 4.282   18.522  38.113  1.00 15.26  ? 169 LYS H N   1 
ATOM   1746 C CA  . LYS B 2 174 ? 4.900   19.564  37.316  1.00 18.51  ? 169 LYS H CA  1 
ATOM   1747 C C   . LYS B 2 174 ? 3.963   20.114  36.265  1.00 17.08  ? 169 LYS H C   1 
ATOM   1748 O O   . LYS B 2 174 ? 3.986   21.309  35.976  1.00 21.10  ? 169 LYS H O   1 
ATOM   1749 C CB  . LYS B 2 174 ? 6.181   19.043  36.659  1.00 25.02  ? 169 LYS H CB  1 
ATOM   1750 C CG  . LYS B 2 174 ? 7.443   19.691  37.215  1.00 39.61  ? 169 LYS H CG  1 
ATOM   1751 C CD  . LYS B 2 174 ? 8.711   18.980  36.767  1.00 47.73  ? 169 LYS H CD  1 
ATOM   1752 C CE  . LYS B 2 174 ? 8.796   17.586  37.365  1.00 57.51  ? 169 LYS H CE  1 
ATOM   1753 N NZ  . LYS B 2 174 ? 10.041  16.846  36.991  1.00 59.91  ? 169 LYS H NZ  1 
ATOM   1754 N N   . ALA B 2 175 ? 3.111   19.250  35.727  1.00 12.73  ? 170 ALA H N   1 
ATOM   1755 C CA  . ALA B 2 175 ? 2.175   19.652  34.687  1.00 12.22  ? 170 ALA H CA  1 
ATOM   1756 C C   . ALA B 2 175 ? 0.919   20.314  35.221  1.00 17.18  ? 170 ALA H C   1 
ATOM   1757 O O   . ALA B 2 175 ? 0.100   20.806  34.441  1.00 25.81  ? 170 ALA H O   1 
ATOM   1758 C CB  . ALA B 2 175 ? 1.802   18.453  33.812  1.00 3.07   ? 170 ALA H CB  1 
ATOM   1759 N N   . SER B 2 176 ? 0.754   20.326  36.540  1.00 13.95  ? 171 SER H N   1 
ATOM   1760 C CA  . SER B 2 176 ? -0.435  20.925  37.132  1.00 9.94   ? 171 SER H CA  1 
ATOM   1761 C C   . SER B 2 176 ? -0.267  22.392  37.465  1.00 8.45   ? 171 SER H C   1 
ATOM   1762 O O   . SER B 2 176 ? -1.241  23.058  37.804  1.00 13.68  ? 171 SER H O   1 
ATOM   1763 C CB  . SER B 2 176 ? -0.835  20.177  38.404  1.00 13.79  ? 171 SER H CB  1 
ATOM   1764 O OG  . SER B 2 176 ? 0.128   20.356  39.441  1.00 19.43  ? 171 SER H OG  1 
ATOM   1765 N N   . THR B 2 177 ? 0.950   22.910  37.361  1.00 6.57   ? 172 THR H N   1 
ATOM   1766 C CA  . THR B 2 177 ? 1.192   24.300  37.725  1.00 10.91  ? 172 THR H CA  1 
ATOM   1767 C C   . THR B 2 177 ? 2.096   25.051  36.777  1.00 17.08  ? 172 THR H C   1 
ATOM   1768 O O   . THR B 2 177 ? 2.794   24.451  35.968  1.00 25.58  ? 172 THR H O   1 
ATOM   1769 C CB  . THR B 2 177 ? 1.903   24.383  39.084  1.00 12.66  ? 172 THR H CB  1 
ATOM   1770 O OG1 . THR B 2 177 ? 2.156   23.064  39.600  1.00 15.27  ? 172 THR H OG1 1 
ATOM   1771 C CG2 . THR B 2 177 ? 1.108   25.206  40.052  1.00 15.63  ? 172 THR H CG2 1 
ATOM   1772 N N   . ARG B 2 178 ? 2.087   26.376  36.885  1.00 18.48  ? 173 ARG H N   1 
ATOM   1773 C CA  . ARG B 2 178 ? 2.982   27.194  36.084  1.00 24.69  ? 173 ARG H CA  1 
ATOM   1774 C C   . ARG B 2 178 ? 4.024   27.767  37.048  1.00 26.89  ? 173 ARG H C   1 
ATOM   1775 O O   . ARG B 2 178 ? 4.777   28.689  36.721  1.00 29.45  ? 173 ARG H O   1 
ATOM   1776 C CB  . ARG B 2 178 ? 2.222   28.285  35.329  1.00 32.79  ? 173 ARG H CB  1 
ATOM   1777 C CG  . ARG B 2 178 ? 1.443   27.737  34.138  1.00 47.40  ? 173 ARG H CG  1 
ATOM   1778 C CD  . ARG B 2 178 ? 0.849   28.834  33.263  1.00 61.26  ? 173 ARG H CD  1 
ATOM   1779 N NE  . ARG B 2 178 ? 1.875   29.616  32.572  1.00 71.53  ? 173 ARG H NE  1 
ATOM   1780 C CZ  . ARG B 2 178 ? 1.774   30.044  31.316  1.00 77.24  ? 173 ARG H CZ  1 
ATOM   1781 N NH1 . ARG B 2 178 ? 0.692   29.768  30.595  1.00 78.26  ? 173 ARG H NH1 1 
ATOM   1782 N NH2 . ARG B 2 178 ? 2.750   30.767  30.779  1.00 76.55  ? 173 ARG H NH2 1 
ATOM   1783 N N   . ILE B 2 179 ? 4.069   27.165  38.236  1.00 26.34  ? 174 ILE H N   1 
ATOM   1784 C CA  . ILE B 2 179 ? 4.988   27.536  39.301  1.00 24.29  ? 174 ILE H CA  1 
ATOM   1785 C C   . ILE B 2 179 ? 6.112   26.502  39.299  1.00 27.86  ? 174 ILE H C   1 
ATOM   1786 O O   . ILE B 2 179 ? 5.873   25.318  39.056  1.00 22.79  ? 174 ILE H O   1 
ATOM   1787 C CB  . ILE B 2 179 ? 4.287   27.486  40.675  1.00 17.62  ? 174 ILE H CB  1 
ATOM   1788 C CG1 . ILE B 2 179 ? 3.096   28.433  40.698  1.00 14.60  ? 174 ILE H CG1 1 
ATOM   1789 C CG2 . ILE B 2 179 ? 5.257   27.864  41.786  1.00 21.85  ? 174 ILE H CG2 1 
ATOM   1790 C CD1 . ILE B 2 179 ? 2.303   28.359  41.989  1.00 14.14  ? 174 ILE H CD1 1 
ATOM   1791 N N   . ARG B 2 180 ? 7.329   26.959  39.580  1.00 31.54  ? 175 ARG H N   1 
ATOM   1792 C CA  . ARG B 2 180 ? 8.507   26.102  39.623  1.00 31.72  ? 175 ARG H CA  1 
ATOM   1793 C C   . ARG B 2 180 ? 8.477   25.072  40.750  1.00 29.29  ? 175 ARG H C   1 
ATOM   1794 O O   . ARG B 2 180 ? 8.445   25.438  41.924  1.00 32.11  ? 175 ARG H O   1 
ATOM   1795 C CB  . ARG B 2 180 ? 9.750   26.957  39.835  1.00 39.83  ? 175 ARG H CB  1 
ATOM   1796 C CG  . ARG B 2 180 ? 10.097  27.912  38.718  1.00 58.72  ? 175 ARG H CG  1 
ATOM   1797 C CD  . ARG B 2 180 ? 11.025  29.014  39.242  1.00 69.92  ? 175 ARG H CD  1 
ATOM   1798 N NE  . ARG B 2 180 ? 12.013  28.512  40.200  1.00 76.14  ? 175 ARG H NE  1 
ATOM   1799 C CZ  . ARG B 2 180 ? 13.040  27.729  39.880  1.00 81.77  ? 175 ARG H CZ  1 
ATOM   1800 N NH1 . ARG B 2 180 ? 13.226  27.353  38.620  1.00 85.60  ? 175 ARG H NH1 1 
ATOM   1801 N NH2 . ARG B 2 180 ? 13.871  27.302  40.822  1.00 82.35  ? 175 ARG H NH2 1 
ATOM   1802 N N   . ILE B 2 181 ? 8.536   23.794  40.391  1.00 29.00  ? 176 ILE H N   1 
ATOM   1803 C CA  . ILE B 2 181 ? 8.581   22.699  41.365  1.00 24.26  ? 176 ILE H CA  1 
ATOM   1804 C C   . ILE B 2 181 ? 10.068  22.321  41.497  1.00 22.67  ? 176 ILE H C   1 
ATOM   1805 O O   . ILE B 2 181 ? 10.803  22.309  40.507  1.00 24.45  ? 176 ILE H O   1 
ATOM   1806 C CB  . ILE B 2 181 ? 7.743   21.472  40.889  1.00 19.06  ? 176 ILE H CB  1 
ATOM   1807 C CG1 . ILE B 2 181 ? 6.261   21.848  40.786  1.00 23.40  ? 176 ILE H CG1 1 
ATOM   1808 C CG2 . ILE B 2 181 ? 7.925   20.286  41.812  1.00 21.52  ? 176 ILE H CG2 1 
ATOM   1809 C CD1 . ILE B 2 181 ? 5.742   22.700  41.929  1.00 19.17  ? 176 ILE H CD1 1 
ATOM   1810 N N   . THR B 2 182 ? 10.524  22.081  42.720  1.00 21.81  ? 177 THR H N   1 
ATOM   1811 C CA  . THR B 2 182 ? 11.922  21.730  42.950  1.00 19.53  ? 177 THR H CA  1 
ATOM   1812 C C   . THR B 2 182 ? 11.999  20.362  43.619  1.00 19.94  ? 177 THR H C   1 
ATOM   1813 O O   . THR B 2 182 ? 10.993  19.854  44.105  1.00 23.70  ? 177 THR H O   1 
ATOM   1814 C CB  . THR B 2 182 ? 12.614  22.752  43.865  1.00 17.63  ? 177 THR H CB  1 
ATOM   1815 O OG1 . THR B 2 182 ? 12.102  22.612  45.193  1.00 23.45  ? 177 THR H OG1 1 
ATOM   1816 C CG2 . THR B 2 182 ? 12.365  24.174  43.380  1.00 15.17  ? 177 THR H CG2 1 
ATOM   1817 N N   . ASP B 2 183 ? 13.203  19.805  43.707  1.00 19.17  ? 178 ASP H N   1 
ATOM   1818 C CA  . ASP B 2 183 ? 13.405  18.494  44.315  1.00 19.68  ? 178 ASP H CA  1 
ATOM   1819 C C   . ASP B 2 183 ? 13.058  18.457  45.788  1.00 16.49  ? 178 ASP H C   1 
ATOM   1820 O O   . ASP B 2 183 ? 12.810  17.391  46.345  1.00 20.78  ? 178 ASP H O   1 
ATOM   1821 C CB  . ASP B 2 183 ? 14.853  18.034  44.124  1.00 26.37  ? 178 ASP H CB  1 
ATOM   1822 C CG  . ASP B 2 183 ? 15.153  17.617  42.688  1.00 36.90  ? 178 ASP H CG  1 
ATOM   1823 O OD1 . ASP B 2 183 ? 14.198  17.388  41.907  1.00 43.89  ? 178 ASP H OD1 1 
ATOM   1824 O OD2 . ASP B 2 183 ? 16.347  17.507  42.339  1.00 40.27  ? 178 ASP H OD2 1 
ATOM   1825 N N   . ASN B 2 184 ? 13.000  19.631  46.401  1.00 9.56   ? 179 ASN H N   1 
ATOM   1826 C CA  . ASN B 2 184 ? 12.708  19.737  47.815  1.00 7.29   ? 179 ASN H CA  1 
ATOM   1827 C C   . ASN B 2 184 ? 11.206  19.755  48.087  1.00 9.99   ? 179 ASN H C   1 
ATOM   1828 O O   . ASN B 2 184 ? 10.768  20.197  49.154  1.00 10.95  ? 179 ASN H O   1 
ATOM   1829 C CB  . ASN B 2 184 ? 13.362  20.990  48.413  1.00 9.13   ? 179 ASN H CB  1 
ATOM   1830 C CG  . ASN B 2 184 ? 14.847  21.109  48.074  1.00 9.34   ? 179 ASN H CG  1 
ATOM   1831 O OD1 . ASN B 2 184 ? 15.581  20.130  48.051  1.00 13.55  ? 179 ASN H OD1 1 
ATOM   1832 N ND2 . ASN B 2 184 ? 15.284  22.321  47.793  1.00 16.03  ? 179 ASN H ND2 1 
ATOM   1833 N N   . MET B 2 185 ? 10.409  19.283  47.134  1.00 5.55   ? 180 MET H N   1 
ATOM   1834 C CA  . MET B 2 185 ? 8.967   19.232  47.331  1.00 4.92   ? 180 MET H CA  1 
ATOM   1835 C C   . MET B 2 185 ? 8.329   18.123  46.527  1.00 9.30   ? 180 MET H C   1 
ATOM   1836 O O   . MET B 2 185 ? 8.937   17.607  45.591  1.00 10.54  ? 180 MET H O   1 
ATOM   1837 C CB  . MET B 2 185 ? 8.290   20.582  47.037  1.00 3.03   ? 180 MET H CB  1 
ATOM   1838 C CG  . MET B 2 185 ? 8.531   21.196  45.677  1.00 8.18   ? 180 MET H CG  1 
ATOM   1839 S SD  . MET B 2 185 ? 7.883   22.907  45.577  1.00 11.99  ? 180 MET H SD  1 
ATOM   1840 C CE  . MET B 2 185 ? 9.350   23.829  45.882  1.00 2.11   ? 180 MET H CE  1 
ATOM   1841 N N   . PHE B 2 186 ? 7.170   17.663  46.984  1.00 5.78   ? 181 PHE H N   1 
ATOM   1842 C CA  . PHE B 2 186 ? 6.438   16.631  46.275  1.00 5.19   ? 181 PHE H CA  1 
ATOM   1843 C C   . PHE B 2 186 ? 4.970   16.942  46.427  1.00 10.13  ? 181 PHE H C   1 
ATOM   1844 O O   . PHE B 2 186 ? 4.595   17.700  47.313  1.00 16.84  ? 181 PHE H O   1 
ATOM   1845 C CB  . PHE B 2 186 ? 6.795   15.210  46.758  1.00 10.26  ? 181 PHE H CB  1 
ATOM   1846 C CG  . PHE B 2 186 ? 6.389   14.891  48.177  1.00 5.08   ? 181 PHE H CG  1 
ATOM   1847 C CD1 . PHE B 2 186 ? 5.117   14.408  48.459  1.00 5.16   ? 181 PHE H CD1 1 
ATOM   1848 C CD2 . PHE B 2 186 ? 7.303   15.001  49.219  1.00 2.00   ? 181 PHE H CD2 1 
ATOM   1849 C CE1 . PHE B 2 186 ? 4.762   14.038  49.753  1.00 5.79   ? 181 PHE H CE1 1 
ATOM   1850 C CE2 . PHE B 2 186 ? 6.960   14.631  50.517  1.00 2.00   ? 181 PHE H CE2 1 
ATOM   1851 C CZ  . PHE B 2 186 ? 5.684   14.148  50.784  1.00 5.11   ? 181 PHE H CZ  1 
ATOM   1852 N N   . CYS B 2 187 ? 4.136   16.412  45.543  1.00 12.77  ? 182 CYS H N   1 
ATOM   1853 C CA  . CYS B 2 187 ? 2.713   16.696  45.633  1.00 6.12   ? 182 CYS H CA  1 
ATOM   1854 C C   . CYS B 2 187 ? 1.922   15.430  45.820  1.00 3.20   ? 182 CYS H C   1 
ATOM   1855 O O   . CYS B 2 187 ? 2.409   14.344  45.528  1.00 6.71   ? 182 CYS H O   1 
ATOM   1856 C CB  . CYS B 2 187 ? 2.233   17.491  44.410  1.00 4.90   ? 182 CYS H CB  1 
ATOM   1857 S SG  . CYS B 2 187 ? 1.626   16.582  42.960  1.00 8.85   ? 182 CYS H SG  1 
ATOM   1858 N N   . ALA B 2 188 ? 0.738   15.575  46.399  1.00 5.93   ? 183 ALA H N   1 
ATOM   1859 C CA  . ALA B 2 188 ? -0.161  14.452  46.648  1.00 3.58   ? 183 ALA H CA  1 
ATOM   1860 C C   . ALA B 2 188 ? -1.603  14.926  46.496  1.00 6.06   ? 183 ALA H C   1 
ATOM   1861 O O   . ALA B 2 188 ? -1.905  16.123  46.606  1.00 6.15   ? 183 ALA H O   1 
ATOM   1862 C CB  . ALA B 2 188 ? 0.058   13.894  48.029  1.00 2.00   ? 183 ALA H CB  1 
ATOM   1863 N N   . GLY B 2 189 A -2.486  13.988  46.204  1.00 2.61   ? 184 GLY H N   1 
ATOM   1864 C CA  . GLY B 2 189 A -3.879  14.327  46.033  1.00 3.19   ? 184 GLY H CA  1 
ATOM   1865 C C   . GLY B 2 189 A -4.484  13.409  45.000  1.00 8.31   ? 184 GLY H C   1 
ATOM   1866 O O   . GLY B 2 189 A -3.777  12.635  44.342  1.00 6.96   ? 184 GLY H O   1 
ATOM   1867 N N   . TYR B 2 190 ? -5.798  13.480  44.861  1.00 12.04  ? 184 TYR H N   1 
ATOM   1868 C CA  . TYR B 2 190 ? -6.486  12.653  43.890  1.00 13.85  ? 184 TYR H CA  1 
ATOM   1869 C C   . TYR B 2 190 ? -6.519  13.280  42.506  1.00 12.23  ? 184 TYR H C   1 
ATOM   1870 O O   . TYR B 2 190 ? -6.683  14.490  42.357  1.00 14.47  ? 184 TYR H O   1 
ATOM   1871 C CB  . TYR B 2 190 ? -7.902  12.351  44.368  1.00 14.81  ? 184 TYR H CB  1 
ATOM   1872 C CG  . TYR B 2 190 ? -7.928  11.339  45.476  1.00 13.22  ? 184 TYR H CG  1 
ATOM   1873 C CD1 . TYR B 2 190 ? -7.717  9.993   45.206  1.00 16.22  ? 184 TYR H CD1 1 
ATOM   1874 C CD2 . TYR B 2 190 ? -8.105  11.728  46.797  1.00 12.86  ? 184 TYR H CD2 1 
ATOM   1875 C CE1 . TYR B 2 190 ? -7.676  9.061   46.223  1.00 20.14  ? 184 TYR H CE1 1 
ATOM   1876 C CE2 . TYR B 2 190 ? -8.067  10.807  47.820  1.00 12.43  ? 184 TYR H CE2 1 
ATOM   1877 C CZ  . TYR B 2 190 ? -7.851  9.475   47.528  1.00 16.92  ? 184 TYR H CZ  1 
ATOM   1878 O OH  . TYR B 2 190 ? -7.800  8.552   48.544  1.00 24.50  ? 184 TYR H OH  1 
ATOM   1879 N N   . LYS B 2 191 ? -6.305  12.452  41.495  1.00 11.62  ? 185 LYS H N   1 
ATOM   1880 C CA  . LYS B 2 191 ? -6.354  12.918  40.124  1.00 19.45  ? 185 LYS H CA  1 
ATOM   1881 C C   . LYS B 2 191 ? -7.839  13.119  39.869  1.00 23.70  ? 185 LYS H C   1 
ATOM   1882 O O   . LYS B 2 191 ? -8.663  12.434  40.475  1.00 27.54  ? 185 LYS H O   1 
ATOM   1883 C CB  . LYS B 2 191 ? -5.802  11.849  39.182  1.00 25.81  ? 185 LYS H CB  1 
ATOM   1884 C CG  . LYS B 2 191 ? -4.372  11.450  39.471  1.00 28.01  ? 185 LYS H CG  1 
ATOM   1885 C CD  . LYS B 2 191 ? -3.859  10.488  38.421  1.00 30.98  ? 185 LYS H CD  1 
ATOM   1886 C CE  . LYS B 2 191 ? -2.493  9.959   38.803  1.00 33.81  ? 185 LYS H CE  1 
ATOM   1887 N NZ  . LYS B 2 191 ? -1.585  11.082  39.141  1.00 37.83  ? 185 LYS H NZ  1 
ATOM   1888 N N   . PRO B 2 192 ? -8.206  14.036  38.960  1.00 25.63  ? 186 PRO H N   1 
ATOM   1889 C CA  . PRO B 2 192 ? -9.630  14.261  38.688  1.00 25.68  ? 186 PRO H CA  1 
ATOM   1890 C C   . PRO B 2 192 ? -10.426 12.996  38.317  1.00 32.04  ? 186 PRO H C   1 
ATOM   1891 O O   . PRO B 2 192 ? -11.609 12.879  38.654  1.00 34.52  ? 186 PRO H O   1 
ATOM   1892 C CB  . PRO B 2 192 ? -9.600  15.300  37.564  1.00 24.09  ? 186 PRO H CB  1 
ATOM   1893 C CG  . PRO B 2 192 ? -8.255  15.085  36.908  1.00 23.70  ? 186 PRO H CG  1 
ATOM   1894 C CD  . PRO B 2 192 ? -7.361  14.870  38.086  1.00 21.72  ? 186 PRO H CD  1 
ATOM   1895 N N   . GLY B 2 193 A -9.758  12.032  37.683  1.00 35.50  ? 186 GLY H N   1 
ATOM   1896 C CA  . GLY B 2 193 A -10.410 10.791  37.285  1.00 39.58  ? 186 GLY H CA  1 
ATOM   1897 C C   . GLY B 2 193 A -10.741 9.794   38.390  1.00 41.38  ? 186 GLY H C   1 
ATOM   1898 O O   . GLY B 2 193 A -11.410 8.787   38.138  1.00 44.66  ? 186 GLY H O   1 
ATOM   1899 N N   . GLU B 2 194 B -10.258 10.046  39.604  1.00 41.09  ? 186 GLU H N   1 
ATOM   1900 C CA  . GLU B 2 194 B -10.519 9.165   40.743  1.00 35.03  ? 186 GLU H CA  1 
ATOM   1901 C C   . GLU B 2 194 B -11.693 9.751   41.513  1.00 31.47  ? 186 GLU H C   1 
ATOM   1902 O O   . GLU B 2 194 B -11.697 10.930  41.858  1.00 34.26  ? 186 GLU H O   1 
ATOM   1903 C CB  . GLU B 2 194 B -9.279  9.075   41.621  1.00 29.85  ? 186 GLU H CB  1 
ATOM   1904 C CG  . GLU B 2 194 B -8.016  8.812   40.823  1.00 26.75  ? 186 GLU H CG  1 
ATOM   1905 C CD  . GLU B 2 194 B -6.813  8.582   41.701  1.00 32.80  ? 186 GLU H CD  1 
ATOM   1906 O OE1 . GLU B 2 194 B -6.763  7.519   42.359  1.00 36.20  ? 186 GLU H OE1 1 
ATOM   1907 O OE2 . GLU B 2 194 B -5.924  9.463   41.735  1.00 34.66  ? 186 GLU H OE2 1 
ATOM   1908 N N   . GLY B 2 195 C -12.698 8.934   41.776  1.00 32.14  ? 186 GLY H N   1 
ATOM   1909 C CA  . GLY B 2 195 C -13.877 9.434   42.461  1.00 37.70  ? 186 GLY H CA  1 
ATOM   1910 C C   . GLY B 2 195 C -13.710 9.875   43.902  1.00 39.86  ? 186 GLY H C   1 
ATOM   1911 O O   . GLY B 2 195 C -14.652 9.773   44.698  1.00 44.27  ? 186 GLY H O   1 
ATOM   1912 N N   . LYS B 2 196 D -12.539 10.395  44.244  1.00 34.52  ? 186 LYS H N   1 
ATOM   1913 C CA  . LYS B 2 196 D -12.273 10.828  45.601  1.00 25.31  ? 186 LYS H CA  1 
ATOM   1914 C C   . LYS B 2 196 D -11.574 12.165  45.575  1.00 24.17  ? 186 LYS H C   1 
ATOM   1915 O O   . LYS B 2 196 D -11.151 12.640  44.518  1.00 20.86  ? 186 LYS H O   1 
ATOM   1916 C CB  . LYS B 2 196 D -11.411 9.789   46.325  1.00 26.70  ? 186 LYS H CB  1 
ATOM   1917 C CG  . LYS B 2 196 D -12.158 8.500   46.654  1.00 34.75  ? 186 LYS H CG  1 
ATOM   1918 C CD  . LYS B 2 196 D -11.250 7.393   47.169  1.00 42.99  ? 186 LYS H CD  1 
ATOM   1919 C CE  . LYS B 2 196 D -10.569 7.749   48.489  1.00 48.71  ? 186 LYS H CE  1 
ATOM   1920 N NZ  . LYS B 2 196 D -11.484 8.099   49.616  1.00 54.71  ? 186 LYS H NZ  1 
ATOM   1921 N N   . ARG B 2 197 ? -11.498 12.787  46.745  1.00 26.20  ? 187 ARG H N   1 
ATOM   1922 C CA  . ARG B 2 197 ? -10.847 14.075  46.906  1.00 21.52  ? 187 ARG H CA  1 
ATOM   1923 C C   . ARG B 2 197 ? -10.434 14.299  48.361  1.00 14.13  ? 187 ARG H C   1 
ATOM   1924 O O   . ARG B 2 197 ? -10.785 13.512  49.246  1.00 13.94  ? 187 ARG H O   1 
ATOM   1925 C CB  . ARG B 2 197 ? -11.740 15.204  46.376  1.00 22.14  ? 187 ARG H CB  1 
ATOM   1926 C CG  . ARG B 2 197 ? -13.129 15.327  46.992  1.00 20.70  ? 187 ARG H CG  1 
ATOM   1927 C CD  . ARG B 2 197 ? -14.044 16.151  46.078  1.00 25.42  ? 187 ARG H CD  1 
ATOM   1928 N NE  . ARG B 2 197 ? -13.351 17.303  45.493  1.00 33.79  ? 187 ARG H NE  1 
ATOM   1929 C CZ  . ARG B 2 197 ? -13.174 17.502  44.187  1.00 32.94  ? 187 ARG H CZ  1 
ATOM   1930 N NH1 . ARG B 2 197 ? -13.645 16.631  43.305  1.00 33.12  ? 187 ARG H NH1 1 
ATOM   1931 N NH2 . ARG B 2 197 ? -12.476 18.550  43.758  1.00 28.83  ? 187 ARG H NH2 1 
ATOM   1932 N N   . GLY B 2 198 ? -9.625  15.327  48.578  1.00 7.74   ? 188 GLY H N   1 
ATOM   1933 C CA  . GLY B 2 198 ? -9.143  15.644  49.907  1.00 5.39   ? 188 GLY H CA  1 
ATOM   1934 C C   . GLY B 2 198 ? -7.905  16.491  49.742  1.00 5.82   ? 188 GLY H C   1 
ATOM   1935 O O   . GLY B 2 198 ? -7.195  16.341  48.750  1.00 9.59   ? 188 GLY H O   1 
ATOM   1936 N N   . ASP B 2 199 ? -7.627  17.365  50.702  1.00 7.81   ? 189 ASP H N   1 
ATOM   1937 C CA  . ASP B 2 199 ? -6.461  18.235  50.612  1.00 8.24   ? 189 ASP H CA  1 
ATOM   1938 C C   . ASP B 2 199 ? -6.210  18.896  51.952  1.00 8.42   ? 189 ASP H C   1 
ATOM   1939 O O   . ASP B 2 199 ? -7.029  18.797  52.863  1.00 14.35  ? 189 ASP H O   1 
ATOM   1940 C CB  . ASP B 2 199 ? -6.738  19.329  49.574  1.00 8.42   ? 189 ASP H CB  1 
ATOM   1941 C CG  . ASP B 2 199 ? -5.475  20.068  49.111  1.00 14.76  ? 189 ASP H CG  1 
ATOM   1942 O OD1 . ASP B 2 199 ? -4.343  19.628  49.410  1.00 10.20  ? 189 ASP H OD1 1 
ATOM   1943 O OD2 . ASP B 2 199 ? -5.627  21.094  48.411  1.00 13.97  ? 189 ASP H OD2 1 
ATOM   1944 N N   . ALA B 2 200 ? -5.047  19.519  52.084  1.00 7.32   ? 190 ALA H N   1 
ATOM   1945 C CA  . ALA B 2 200 ? -4.697  20.272  53.272  1.00 8.92   ? 190 ALA H CA  1 
ATOM   1946 C C   . ALA B 2 200 ? -5.154  21.687  52.901  1.00 9.84   ? 190 ALA H C   1 
ATOM   1947 O O   . ALA B 2 200 ? -5.383  21.968  51.734  1.00 10.47  ? 190 ALA H O   1 
ATOM   1948 C CB  . ALA B 2 200 ? -3.199  20.232  53.494  1.00 8.25   ? 190 ALA H CB  1 
ATOM   1949 N N   . CYS B 2 201 ? -5.326  22.572  53.869  1.00 12.64  ? 191 CYS H N   1 
ATOM   1950 C CA  . CYS B 2 201 ? -5.773  23.920  53.544  1.00 14.24  ? 191 CYS H CA  1 
ATOM   1951 C C   . CYS B 2 201 ? -5.154  24.885  54.550  1.00 20.36  ? 191 CYS H C   1 
ATOM   1952 O O   . CYS B 2 201 ? -4.293  24.493  55.342  1.00 19.65  ? 191 CYS H O   1 
ATOM   1953 C CB  . CYS B 2 201 ? -7.312  23.996  53.554  1.00 16.82  ? 191 CYS H CB  1 
ATOM   1954 S SG  . CYS B 2 201 ? -8.073  25.388  52.631  1.00 10.44  ? 191 CYS H SG  1 
ATOM   1955 N N   . GLU B 2 202 ? -5.597  26.137  54.522  1.00 21.81  ? 192 GLU H N   1 
ATOM   1956 C CA  . GLU B 2 202 ? -5.064  27.167  55.399  1.00 22.53  ? 192 GLU H CA  1 
ATOM   1957 C C   . GLU B 2 202 ? -5.236  26.852  56.878  1.00 19.38  ? 192 GLU H C   1 
ATOM   1958 O O   . GLU B 2 202 ? -6.346  26.641  57.359  1.00 23.75  ? 192 GLU H O   1 
ATOM   1959 C CB  . GLU B 2 202 ? -5.648  28.532  55.011  1.00 29.74  ? 192 GLU H CB  1 
ATOM   1960 C CG  . GLU B 2 202 ? -4.940  29.201  53.782  1.00 42.13  ? 192 GLU H CG  1 
ATOM   1961 C CD  . GLU B 2 202 ? -4.977  28.385  52.461  1.00 41.66  ? 192 GLU H CD  1 
ATOM   1962 O OE1 . GLU B 2 202 ? -5.951  27.642  52.221  1.00 49.45  ? 192 GLU H OE1 1 
ATOM   1963 O OE2 . GLU B 2 202 ? -4.039  28.513  51.640  1.00 29.63  ? 192 GLU H OE2 1 
ATOM   1964 N N   . GLY B 2 203 ? -4.108  26.762  57.576  1.00 18.74  ? 193 GLY H N   1 
ATOM   1965 C CA  . GLY B 2 203 ? -4.104  26.436  58.993  1.00 14.73  ? 193 GLY H CA  1 
ATOM   1966 C C   . GLY B 2 203 ? -3.443  25.094  59.280  1.00 9.27   ? 193 GLY H C   1 
ATOM   1967 O O   . GLY B 2 203 ? -3.313  24.692  60.438  1.00 2.00   ? 193 GLY H O   1 
ATOM   1968 N N   . ASP B 2 204 ? -3.019  24.405  58.221  1.00 11.41  ? 194 ASP H N   1 
ATOM   1969 C CA  . ASP B 2 204 ? -2.375  23.099  58.326  1.00 10.15  ? 194 ASP H CA  1 
ATOM   1970 C C   . ASP B 2 204 ? -0.886  23.115  58.010  1.00 12.47  ? 194 ASP H C   1 
ATOM   1971 O O   . ASP B 2 204 ? -0.204  22.135  58.282  1.00 14.25  ? 194 ASP H O   1 
ATOM   1972 C CB  . ASP B 2 204 ? -3.033  22.103  57.371  1.00 11.62  ? 194 ASP H CB  1 
ATOM   1973 C CG  . ASP B 2 204 ? -4.455  21.774  57.746  1.00 11.44  ? 194 ASP H CG  1 
ATOM   1974 O OD1 . ASP B 2 204 ? -4.814  21.937  58.917  1.00 23.07  ? 194 ASP H OD1 1 
ATOM   1975 O OD2 . ASP B 2 204 ? -5.218  21.337  56.868  1.00 14.88  ? 194 ASP H OD2 1 
ATOM   1976 N N   . SER B 2 205 ? -0.382  24.243  57.514  1.00 13.84  ? 195 SER H N   1 
ATOM   1977 C CA  . SER B 2 205 ? 1.012   24.412  57.093  1.00 14.59  ? 195 SER H CA  1 
ATOM   1978 C C   . SER B 2 205 ? 2.271   23.896  57.783  1.00 18.77  ? 195 SER H C   1 
ATOM   1979 O O   . SER B 2 205 ? 3.376   24.197  57.331  1.00 28.08  ? 195 SER H O   1 
ATOM   1980 C CB  . SER B 2 205 ? 1.267   25.855  56.724  1.00 11.93  ? 195 SER H CB  1 
ATOM   1981 O OG  . SER B 2 205 ? 1.352   25.966  55.320  1.00 20.85  ? 195 SER H OG  1 
ATOM   1982 N N   . GLY B 2 206 ? 2.159   23.150  58.863  1.00 16.73  ? 196 GLY H N   1 
ATOM   1983 C CA  . GLY B 2 206 ? 3.376   22.649  59.478  1.00 9.90   ? 196 GLY H CA  1 
ATOM   1984 C C   . GLY B 2 206 ? 3.175   21.194  59.799  1.00 8.46   ? 196 GLY H C   1 
ATOM   1985 O O   . GLY B 2 206 ? 4.124   20.476  60.089  1.00 9.70   ? 196 GLY H O   1 
ATOM   1986 N N   . GLY B 2 207 ? 1.921   20.761  59.718  1.00 6.63   ? 197 GLY H N   1 
ATOM   1987 C CA  . GLY B 2 207 ? 1.576   19.390  60.011  1.00 9.12   ? 197 GLY H CA  1 
ATOM   1988 C C   . GLY B 2 207 ? 2.362   18.423  59.160  1.00 13.23  ? 197 GLY H C   1 
ATOM   1989 O O   . GLY B 2 207 ? 2.780   18.759  58.034  1.00 7.61   ? 197 GLY H O   1 
ATOM   1990 N N   . PRO B 2 208 ? 2.576   17.204  59.680  1.00 11.62  ? 198 PRO H N   1 
ATOM   1991 C CA  . PRO B 2 208 ? 3.312   16.135  59.021  1.00 11.69  ? 198 PRO H CA  1 
ATOM   1992 C C   . PRO B 2 208 ? 2.476   15.327  58.036  1.00 12.21  ? 198 PRO H C   1 
ATOM   1993 O O   . PRO B 2 208 ? 1.268   15.177  58.210  1.00 9.13   ? 198 PRO H O   1 
ATOM   1994 C CB  . PRO B 2 208 ? 3.739   15.261  60.198  1.00 9.73   ? 198 PRO H CB  1 
ATOM   1995 C CG  . PRO B 2 208 ? 2.566   15.323  61.076  1.00 3.72   ? 198 PRO H CG  1 
ATOM   1996 C CD  . PRO B 2 208 ? 2.187   16.796  61.044  1.00 10.24  ? 198 PRO H CD  1 
ATOM   1997 N N   . PHE B 2 209 ? 3.130   14.886  56.964  1.00 13.01  ? 199 PHE H N   1 
ATOM   1998 C CA  . PHE B 2 209 ? 2.523   14.018  55.969  1.00 8.56   ? 199 PHE H CA  1 
ATOM   1999 C C   . PHE B 2 209 ? 3.293   12.763  56.323  1.00 7.47   ? 199 PHE H C   1 
ATOM   2000 O O   . PHE B 2 209 ? 4.505   12.705  56.113  1.00 5.42   ? 199 PHE H O   1 
ATOM   2001 C CB  . PHE B 2 209 ? 2.872   14.434  54.539  1.00 8.73   ? 199 PHE H CB  1 
ATOM   2002 C CG  . PHE B 2 209 ? 2.364   13.470  53.486  1.00 10.44  ? 199 PHE H CG  1 
ATOM   2003 C CD1 . PHE B 2 209 ? 3.142   12.395  53.070  1.00 6.27   ? 199 PHE H CD1 1 
ATOM   2004 C CD2 . PHE B 2 209 ? 1.102   13.632  52.923  1.00 10.00  ? 199 PHE H CD2 1 
ATOM   2005 C CE1 . PHE B 2 209 ? 2.669   11.502  52.115  1.00 10.33  ? 199 PHE H CE1 1 
ATOM   2006 C CE2 . PHE B 2 209 ? 0.622   12.743  51.968  1.00 5.06   ? 199 PHE H CE2 1 
ATOM   2007 C CZ  . PHE B 2 209 ? 1.407   11.677  51.563  1.00 10.03  ? 199 PHE H CZ  1 
ATOM   2008 N N   . VAL B 2 210 ? 2.614   11.806  56.941  1.00 4.48   ? 200 VAL H N   1 
ATOM   2009 C CA  . VAL B 2 210 ? 3.254   10.572  57.362  1.00 4.13   ? 200 VAL H CA  1 
ATOM   2010 C C   . VAL B 2 210 ? 2.754   9.358   56.597  1.00 8.44   ? 200 VAL H C   1 
ATOM   2011 O O   . VAL B 2 210 ? 1.695   9.393   55.985  1.00 8.77   ? 200 VAL H O   1 
ATOM   2012 C CB  . VAL B 2 210 ? 3.061   10.314  58.881  1.00 2.00   ? 200 VAL H CB  1 
ATOM   2013 C CG1 . VAL B 2 210 ? 3.752   11.385  59.698  1.00 4.03   ? 200 VAL H CG1 1 
ATOM   2014 C CG2 . VAL B 2 210 ? 1.582   10.258  59.235  1.00 3.42   ? 200 VAL H CG2 1 
ATOM   2015 N N   . MET B 2 211 ? 3.535   8.286   56.655  1.00 10.17  ? 201 MET H N   1 
ATOM   2016 C CA  . MET B 2 211 ? 3.211   7.029   56.013  1.00 9.20   ? 201 MET H CA  1 
ATOM   2017 C C   . MET B 2 211 ? 3.611   5.918   56.977  1.00 16.03  ? 201 MET H C   1 
ATOM   2018 O O   . MET B 2 211 ? 4.659   6.008   57.632  1.00 16.33  ? 201 MET H O   1 
ATOM   2019 C CB  . MET B 2 211 ? 3.997   6.897   54.719  1.00 11.16  ? 201 MET H CB  1 
ATOM   2020 C CG  . MET B 2 211 ? 3.595   7.876   53.649  1.00 10.94  ? 201 MET H CG  1 
ATOM   2021 S SD  . MET B 2 211 ? 4.560   7.594   52.166  1.00 14.83  ? 201 MET H SD  1 
ATOM   2022 C CE  . MET B 2 211 ? 3.596   6.316   51.358  1.00 19.67  ? 201 MET H CE  1 
ATOM   2023 N N   . LYS B 2 212 ? 2.759   4.903   57.111  1.00 18.67  ? 202 LYS H N   1 
ATOM   2024 C CA  . LYS B 2 212 ? 3.054   3.783   58.007  1.00 16.00  ? 202 LYS H CA  1 
ATOM   2025 C C   . LYS B 2 212 ? 3.793   2.687   57.242  1.00 18.07  ? 202 LYS H C   1 
ATOM   2026 O O   . LYS B 2 212 ? 3.310   2.213   56.205  1.00 17.08  ? 202 LYS H O   1 
ATOM   2027 C CB  . LYS B 2 212 ? 1.774   3.215   58.633  1.00 10.54  ? 202 LYS H CB  1 
ATOM   2028 C CG  . LYS B 2 212 ? 2.042   2.091   59.616  1.00 2.36   ? 202 LYS H CG  1 
ATOM   2029 C CD  . LYS B 2 212 ? 0.795   1.583   60.290  1.00 2.88   ? 202 LYS H CD  1 
ATOM   2030 C CE  . LYS B 2 212 ? 1.154   0.540   61.348  1.00 6.99   ? 202 LYS H CE  1 
ATOM   2031 N NZ  . LYS B 2 212 ? 0.018   0.207   62.278  1.00 9.12   ? 202 LYS H NZ  1 
ATOM   2032 N N   . SER B 2 213 ? 4.967   2.308   57.746  1.00 17.76  ? 203 SER H N   1 
ATOM   2033 C CA  . SER B 2 213 ? 5.794   1.282   57.115  1.00 15.70  ? 203 SER H CA  1 
ATOM   2034 C C   . SER B 2 213 ? 5.270   -0.136  57.304  1.00 15.69  ? 203 SER H C   1 
ATOM   2035 O O   . SER B 2 213 ? 5.082   -0.586  58.430  1.00 18.40  ? 203 SER H O   1 
ATOM   2036 C CB  . SER B 2 213 ? 7.228   1.374   57.628  1.00 13.64  ? 203 SER H CB  1 
ATOM   2037 O OG  . SER B 2 213 ? 8.032   0.323   57.121  1.00 14.22  ? 203 SER H OG  1 
ATOM   2038 N N   . PRO B 2 214 ? 5.070   -0.872  56.195  1.00 18.51  ? 204 PRO H N   1 
ATOM   2039 C CA  . PRO B 2 214 ? 4.575   -2.255  56.166  1.00 21.03  ? 204 PRO H CA  1 
ATOM   2040 C C   . PRO B 2 214 ? 5.636   -3.217  56.699  1.00 26.99  ? 204 PRO H C   1 
ATOM   2041 O O   . PRO B 2 214 ? 5.338   -4.361  57.056  1.00 31.08  ? 204 PRO H O   1 
ATOM   2042 C CB  . PRO B 2 214 ? 4.376   -2.526  54.668  1.00 17.08  ? 204 PRO H CB  1 
ATOM   2043 C CG  . PRO B 2 214 ? 4.375   -1.190  54.031  1.00 13.57  ? 204 PRO H CG  1 
ATOM   2044 C CD  . PRO B 2 214 ? 5.352   -0.403  54.827  1.00 17.26  ? 204 PRO H CD  1 
ATOM   2045 N N   . TYR B 2 215 A 6.881   -2.748  56.705  1.00 28.39  ? 204 TYR H N   1 
ATOM   2046 C CA  . TYR B 2 215 A 8.018   -3.538  57.150  1.00 26.07  ? 204 TYR H CA  1 
ATOM   2047 C C   . TYR B 2 215 A 8.196   -3.561  58.665  1.00 27.80  ? 204 TYR H C   1 
ATOM   2048 O O   . TYR B 2 215 A 8.372   -4.624  59.255  1.00 33.22  ? 204 TYR H O   1 
ATOM   2049 C CB  . TYR B 2 215 A 9.297   -3.019  56.480  1.00 27.65  ? 204 TYR H CB  1 
ATOM   2050 C CG  . TYR B 2 215 A 9.173   -2.861  54.977  1.00 29.04  ? 204 TYR H CG  1 
ATOM   2051 C CD1 . TYR B 2 215 A 9.140   -3.975  54.139  1.00 29.10  ? 204 TYR H CD1 1 
ATOM   2052 C CD2 . TYR B 2 215 A 9.031   -1.603  54.399  1.00 27.43  ? 204 TYR H CD2 1 
ATOM   2053 C CE1 . TYR B 2 215 A 8.959   -3.839  52.758  1.00 30.31  ? 204 TYR H CE1 1 
ATOM   2054 C CE2 . TYR B 2 215 A 8.850   -1.457  53.025  1.00 33.51  ? 204 TYR H CE2 1 
ATOM   2055 C CZ  . TYR B 2 215 A 8.810   -2.581  52.210  1.00 34.67  ? 204 TYR H CZ  1 
ATOM   2056 O OH  . TYR B 2 215 A 8.577   -2.447  50.858  1.00 42.42  ? 204 TYR H OH  1 
ATOM   2057 N N   . ASN B 2 216 B 8.132   -2.401  59.307  1.00 24.42  ? 204 ASN H N   1 
ATOM   2058 C CA  . ASN B 2 216 B 8.332   -2.363  60.743  1.00 21.93  ? 204 ASN H CA  1 
ATOM   2059 C C   . ASN B 2 216 B 7.208   -1.765  61.565  1.00 22.15  ? 204 ASN H C   1 
ATOM   2060 O O   . ASN B 2 216 B 7.357   -1.605  62.779  1.00 21.58  ? 204 ASN H O   1 
ATOM   2061 C CB  . ASN B 2 216 B 9.643   -1.653  61.064  1.00 25.43  ? 204 ASN H CB  1 
ATOM   2062 C CG  . ASN B 2 216 B 9.637   -0.209  60.643  1.00 30.39  ? 204 ASN H CG  1 
ATOM   2063 O OD1 . ASN B 2 216 B 8.650   0.291   60.099  1.00 34.81  ? 204 ASN H OD1 1 
ATOM   2064 N ND2 . ASN B 2 216 B 10.738  0.477   60.894  1.00 28.95  ? 204 ASN H ND2 1 
ATOM   2065 N N   . ASN B 2 217 ? 6.111   -1.400  60.906  1.00 23.53  ? 205 ASN H N   1 
ATOM   2066 C CA  . ASN B 2 217 ? 4.935   -0.832  61.574  1.00 20.79  ? 205 ASN H CA  1 
ATOM   2067 C C   . ASN B 2 217 ? 5.114   0.533   62.225  1.00 19.18  ? 205 ASN H C   1 
ATOM   2068 O O   . ASN B 2 217 ? 4.338   0.919   63.101  1.00 16.55  ? 205 ASN H O   1 
ATOM   2069 C CB  . ASN B 2 217 ? 4.378   -1.815  62.601  1.00 23.21  ? 205 ASN H CB  1 
ATOM   2070 C CG  . ASN B 2 217 ? 3.119   -2.491  62.126  1.00 36.97  ? 205 ASN H CG  1 
ATOM   2071 O OD1 . ASN B 2 217 ? 3.105   -3.156  61.082  1.00 40.51  ? 205 ASN H OD1 1 
ATOM   2072 N ND2 . ASN B 2 217 ? 2.034   -2.305  62.876  1.00 39.92  ? 205 ASN H ND2 1 
ATOM   2073 N N   . ARG B 2 218 ? 6.117   1.277   61.778  1.00 19.84  ? 206 ARG H N   1 
ATOM   2074 C CA  . ARG B 2 218 ? 6.375   2.594   62.327  1.00 16.92  ? 206 ARG H CA  1 
ATOM   2075 C C   . ARG B 2 218 ? 5.963   3.708   61.385  1.00 16.94  ? 206 ARG H C   1 
ATOM   2076 O O   . ARG B 2 218 ? 6.046   3.579   60.157  1.00 17.35  ? 206 ARG H O   1 
ATOM   2077 C CB  . ARG B 2 218 ? 7.849   2.731   62.684  1.00 11.44  ? 206 ARG H CB  1 
ATOM   2078 C CG  . ARG B 2 218 ? 8.281   1.772   63.770  1.00 12.24  ? 206 ARG H CG  1 
ATOM   2079 C CD  . ARG B 2 218 ? 9.727   1.986   64.128  1.00 15.33  ? 206 ARG H CD  1 
ATOM   2080 N NE  . ARG B 2 218 ? 10.189  1.075   65.174  1.00 18.61  ? 206 ARG H NE  1 
ATOM   2081 C CZ  . ARG B 2 218 ? 10.930  1.455   66.210  1.00 15.15  ? 206 ARG H CZ  1 
ATOM   2082 N NH1 . ARG B 2 218 ? 11.287  2.723   66.346  1.00 19.49  ? 206 ARG H NH1 1 
ATOM   2083 N NH2 . ARG B 2 218 ? 11.326  0.568   67.107  1.00 19.36  ? 206 ARG H NH2 1 
ATOM   2084 N N   . TRP B 2 219 ? 5.473   4.789   61.974  1.00 16.51  ? 207 TRP H N   1 
ATOM   2085 C CA  . TRP B 2 219 ? 5.049   5.953   61.219  1.00 11.44  ? 207 TRP H CA  1 
ATOM   2086 C C   . TRP B 2 219 ? 6.241   6.869   60.962  1.00 11.23  ? 207 TRP H C   1 
ATOM   2087 O O   . TRP B 2 219 ? 6.963   7.251   61.894  1.00 9.27   ? 207 TRP H O   1 
ATOM   2088 C CB  . TRP B 2 219 ? 3.954   6.702   61.984  1.00 15.57  ? 207 TRP H CB  1 
ATOM   2089 C CG  . TRP B 2 219 ? 2.619   5.989   62.005  1.00 4.62   ? 207 TRP H CG  1 
ATOM   2090 C CD1 . TRP B 2 219 ? 2.204   5.047   62.898  1.00 2.00   ? 207 TRP H CD1 1 
ATOM   2091 C CD2 . TRP B 2 219 ? 1.541   6.169   61.077  1.00 4.76   ? 207 TRP H CD2 1 
ATOM   2092 N NE1 . TRP B 2 219 ? 0.931   4.629   62.586  1.00 5.71   ? 207 TRP H NE1 1 
ATOM   2093 C CE2 . TRP B 2 219 ? 0.501   5.303   61.472  1.00 2.18   ? 207 TRP H CE2 1 
ATOM   2094 C CE3 . TRP B 2 219 ? 1.357   6.976   59.942  1.00 2.00   ? 207 TRP H CE3 1 
ATOM   2095 C CZ2 . TRP B 2 219 ? -0.702  5.216   60.776  1.00 5.64   ? 207 TRP H CZ2 1 
ATOM   2096 C CZ3 . TRP B 2 219 ? 0.170   6.889   59.247  1.00 2.00   ? 207 TRP H CZ3 1 
ATOM   2097 C CH2 . TRP B 2 219 ? -0.850  6.016   59.666  1.00 10.57  ? 207 TRP H CH2 1 
ATOM   2098 N N   . TYR B 2 220 ? 6.475   7.168   59.687  1.00 13.29  ? 208 TYR H N   1 
ATOM   2099 C CA  . TYR B 2 220 ? 7.567   8.046   59.264  1.00 10.11  ? 208 TYR H CA  1 
ATOM   2100 C C   . TYR B 2 220 ? 6.984   9.315   58.678  1.00 7.81   ? 208 TYR H C   1 
ATOM   2101 O O   . TYR B 2 220 ? 5.953   9.261   58.015  1.00 11.72  ? 208 TYR H O   1 
ATOM   2102 C CB  . TYR B 2 220 ? 8.423   7.358   58.191  1.00 11.23  ? 208 TYR H CB  1 
ATOM   2103 C CG  . TYR B 2 220 ? 9.243   6.215   58.723  1.00 7.02   ? 208 TYR H CG  1 
ATOM   2104 C CD1 . TYR B 2 220 ? 8.681   4.955   58.911  1.00 10.59  ? 208 TYR H CD1 1 
ATOM   2105 C CD2 . TYR B 2 220 ? 10.570  6.406   59.082  1.00 3.27   ? 208 TYR H CD2 1 
ATOM   2106 C CE1 . TYR B 2 220 ? 9.430   3.909   59.451  1.00 13.68  ? 208 TYR H CE1 1 
ATOM   2107 C CE2 . TYR B 2 220 ? 11.326  5.378   59.621  1.00 7.80   ? 208 TYR H CE2 1 
ATOM   2108 C CZ  . TYR B 2 220 ? 10.756  4.131   59.804  1.00 14.01  ? 208 TYR H CZ  1 
ATOM   2109 O OH  . TYR B 2 220 ? 11.525  3.111   60.327  1.00 17.36  ? 208 TYR H OH  1 
ATOM   2110 N N   . GLN B 2 221 ? 7.598   10.459  58.966  1.00 6.24   ? 209 GLN H N   1 
ATOM   2111 C CA  . GLN B 2 221 ? 7.131   11.718  58.402  1.00 2.00   ? 209 GLN H CA  1 
ATOM   2112 C C   . GLN B 2 221 ? 7.860   11.876  57.090  1.00 3.07   ? 209 GLN H C   1 
ATOM   2113 O O   . GLN B 2 221 ? 9.079   11.993  57.067  1.00 7.83   ? 209 GLN H O   1 
ATOM   2114 C CB  . GLN B 2 221 ? 7.465   12.912  59.297  1.00 6.25   ? 209 GLN H CB  1 
ATOM   2115 C CG  . GLN B 2 221 ? 6.898   14.204  58.722  1.00 2.00   ? 209 GLN H CG  1 
ATOM   2116 C CD  . GLN B 2 221 ? 7.077   15.397  59.619  1.00 11.41  ? 209 GLN H CD  1 
ATOM   2117 O OE1 . GLN B 2 221 ? 7.331   15.261  60.812  1.00 14.05  ? 209 GLN H OE1 1 
ATOM   2118 N NE2 . GLN B 2 221 ? 6.906   16.584  59.057  1.00 12.36  ? 209 GLN H NE2 1 
ATOM   2119 N N   . MET B 2 222 ? 7.131   11.881  55.990  1.00 4.24   ? 210 MET H N   1 
ATOM   2120 C CA  . MET B 2 222 ? 7.777   12.005  54.697  1.00 8.41   ? 210 MET H CA  1 
ATOM   2121 C C   . MET B 2 222 ? 7.728   13.436  54.188  1.00 11.27  ? 210 MET H C   1 
ATOM   2122 O O   . MET B 2 222 ? 8.575   13.833  53.381  1.00 15.19  ? 210 MET H O   1 
ATOM   2123 C CB  . MET B 2 222 ? 7.132   11.056  53.674  1.00 7.21   ? 210 MET H CB  1 
ATOM   2124 C CG  . MET B 2 222 ? 7.024   9.591   54.109  1.00 3.33   ? 210 MET H CG  1 
ATOM   2125 S SD  . MET B 2 222 ? 8.594   8.779   54.545  1.00 9.71   ? 210 MET H SD  1 
ATOM   2126 C CE  . MET B 2 222 ? 9.348   8.626   52.994  1.00 8.34   ? 210 MET H CE  1 
ATOM   2127 N N   . GLY B 2 223 ? 6.754   14.211  54.664  1.00 10.09  ? 211 GLY H N   1 
ATOM   2128 C CA  . GLY B 2 223 ? 6.623   15.585  54.207  1.00 9.96   ? 211 GLY H CA  1 
ATOM   2129 C C   . GLY B 2 223 ? 6.055   16.553  55.224  1.00 8.69   ? 211 GLY H C   1 
ATOM   2130 O O   . GLY B 2 223 ? 5.695   16.146  56.336  1.00 9.21   ? 211 GLY H O   1 
ATOM   2131 N N   . ILE B 2 224 ? 5.989   17.828  54.834  1.00 3.83   ? 212 ILE H N   1 
ATOM   2132 C CA  . ILE B 2 224 ? 5.484   18.933  55.659  1.00 3.09   ? 212 ILE H CA  1 
ATOM   2133 C C   . ILE B 2 224 ? 4.511   19.726  54.787  1.00 7.31   ? 212 ILE H C   1 
ATOM   2134 O O   . ILE B 2 224 ? 4.857   20.086  53.657  1.00 11.02  ? 212 ILE H O   1 
ATOM   2135 C CB  . ILE B 2 224 ? 6.652   19.871  56.074  1.00 2.00   ? 212 ILE H CB  1 
ATOM   2136 C CG1 . ILE B 2 224 ? 7.640   19.122  56.971  1.00 2.29   ? 212 ILE H CG1 1 
ATOM   2137 C CG2 . ILE B 2 224 ? 6.135   21.107  56.767  1.00 2.00   ? 212 ILE H CG2 1 
ATOM   2138 C CD1 . ILE B 2 224 ? 8.913   19.877  57.258  1.00 2.37   ? 212 ILE H CD1 1 
ATOM   2139 N N   . VAL B 2 225 ? 3.296   19.973  55.276  1.00 8.58   ? 213 VAL H N   1 
ATOM   2140 C CA  . VAL B 2 225 ? 2.301   20.716  54.490  1.00 5.04   ? 213 VAL H CA  1 
ATOM   2141 C C   . VAL B 2 225 ? 2.865   22.079  54.151  1.00 7.90   ? 213 VAL H C   1 
ATOM   2142 O O   . VAL B 2 225 ? 3.077   22.896  55.031  1.00 13.07  ? 213 VAL H O   1 
ATOM   2143 C CB  . VAL B 2 225 ? 0.975   20.903  55.238  1.00 6.28   ? 213 VAL H CB  1 
ATOM   2144 C CG1 . VAL B 2 225 ? -0.025  21.614  54.341  1.00 5.70   ? 213 VAL H CG1 1 
ATOM   2145 C CG2 . VAL B 2 225 ? 0.422   19.559  55.695  1.00 8.63   ? 213 VAL H CG2 1 
ATOM   2146 N N   . SER B 2 226 ? 3.052   22.348  52.869  1.00 6.50   ? 214 SER H N   1 
ATOM   2147 C CA  . SER B 2 226 ? 3.647   23.602  52.476  1.00 3.77   ? 214 SER H CA  1 
ATOM   2148 C C   . SER B 2 226 ? 2.751   24.588  51.732  1.00 8.66   ? 214 SER H C   1 
ATOM   2149 O O   . SER B 2 226 ? 2.399   25.637  52.286  1.00 9.62   ? 214 SER H O   1 
ATOM   2150 C CB  . SER B 2 226 ? 4.911   23.306  51.674  1.00 6.05   ? 214 SER H CB  1 
ATOM   2151 O OG  . SER B 2 226 ? 5.679   24.471  51.462  1.00 14.04  ? 214 SER H OG  1 
ATOM   2152 N N   . TRP B 2 227 ? 2.372   24.266  50.493  1.00 9.31   ? 215 TRP H N   1 
ATOM   2153 C CA  . TRP B 2 227 ? 1.566   25.188  49.690  1.00 11.97  ? 215 TRP H CA  1 
ATOM   2154 C C   . TRP B 2 227 ? 0.664   24.535  48.657  1.00 14.63  ? 215 TRP H C   1 
ATOM   2155 O O   . TRP B 2 227 ? 0.652   23.312  48.517  1.00 16.61  ? 215 TRP H O   1 
ATOM   2156 C CB  . TRP B 2 227 ? 2.479   26.195  48.970  1.00 8.00   ? 215 TRP H CB  1 
ATOM   2157 C CG  . TRP B 2 227 ? 3.341   25.596  47.891  1.00 4.79   ? 215 TRP H CG  1 
ATOM   2158 C CD1 . TRP B 2 227 ? 4.568   25.027  48.050  1.00 2.65   ? 215 TRP H CD1 1 
ATOM   2159 C CD2 . TRP B 2 227 ? 3.042   25.520  46.480  1.00 10.82  ? 215 TRP H CD2 1 
ATOM   2160 N NE1 . TRP B 2 227 ? 5.055   24.602  46.831  1.00 9.09   ? 215 TRP H NE1 1 
ATOM   2161 C CE2 . TRP B 2 227 ? 4.140   24.894  45.853  1.00 9.39   ? 215 TRP H CE2 1 
ATOM   2162 C CE3 . TRP B 2 227 ? 1.949   25.919  45.688  1.00 13.17  ? 215 TRP H CE3 1 
ATOM   2163 C CZ2 . TRP B 2 227 ? 4.181   24.658  44.466  1.00 12.01  ? 215 TRP H CZ2 1 
ATOM   2164 C CZ3 . TRP B 2 227 ? 1.989   25.679  44.310  1.00 9.00   ? 215 TRP H CZ3 1 
ATOM   2165 C CH2 . TRP B 2 227 ? 3.097   25.056  43.716  1.00 6.45   ? 215 TRP H CH2 1 
ATOM   2166 N N   . GLY B 2 228 ? -0.062  25.379  47.924  1.00 14.54  ? 216 GLY H N   1 
ATOM   2167 C CA  . GLY B 2 228 ? -0.964  24.933  46.878  1.00 11.52  ? 216 GLY H CA  1 
ATOM   2168 C C   . GLY B 2 228 ? -1.644  26.157  46.296  1.00 11.96  ? 216 GLY H C   1 
ATOM   2169 O O   . GLY B 2 228 ? -1.277  27.274  46.615  1.00 12.38  ? 216 GLY H O   1 
ATOM   2170 N N   . GLU B 2 229 ? -2.580  25.965  45.382  1.00 11.70  ? 217 GLU H N   1 
ATOM   2171 C CA  . GLU B 2 229 ? -3.310  27.088  44.815  1.00 12.07  ? 217 GLU H CA  1 
ATOM   2172 C C   . GLU B 2 229 ? -4.729  26.770  45.183  1.00 12.01  ? 217 GLU H C   1 
ATOM   2173 O O   . GLU B 2 229 ? -5.369  25.932  44.546  1.00 18.24  ? 217 GLU H O   1 
ATOM   2174 C CB  . GLU B 2 229 ? -3.123  27.152  43.302  1.00 16.45  ? 217 GLU H CB  1 
ATOM   2175 C CG  . GLU B 2 229 ? -1.839  27.869  42.898  1.00 21.27  ? 217 GLU H CG  1 
ATOM   2176 C CD  . GLU B 2 229 ? -1.318  27.448  41.545  1.00 23.17  ? 217 GLU H CD  1 
ATOM   2177 O OE1 . GLU B 2 229 ? -1.339  26.239  41.249  1.00 23.68  ? 217 GLU H OE1 1 
ATOM   2178 O OE2 . GLU B 2 229 ? -0.872  28.325  40.783  1.00 32.16  ? 217 GLU H OE2 1 
ATOM   2179 N N   . GLY B 2 230 ? -5.188  27.377  46.268  1.00 8.14   ? 219 GLY H N   1 
ATOM   2180 C CA  . GLY B 2 230 ? -6.522  27.096  46.760  1.00 12.84  ? 219 GLY H CA  1 
ATOM   2181 C C   . GLY B 2 230 ? -6.467  25.821  47.606  1.00 14.74  ? 219 GLY H C   1 
ATOM   2182 O O   . GLY B 2 230 ? -5.423  25.504  48.190  1.00 11.05  ? 219 GLY H O   1 
ATOM   2183 N N   . CYS B 2 231 ? -7.576  25.090  47.682  1.00 12.09  ? 220 CYS H N   1 
ATOM   2184 C CA  . CYS B 2 231 ? -7.617  23.857  48.452  1.00 9.77   ? 220 CYS H CA  1 
ATOM   2185 C C   . CYS B 2 231 ? -8.633  22.931  47.832  1.00 15.17  ? 220 CYS H C   1 
ATOM   2186 O O   . CYS B 2 231 ? -9.794  23.292  47.717  1.00 21.85  ? 220 CYS H O   1 
ATOM   2187 C CB  . CYS B 2 231 ? -8.060  24.109  49.890  1.00 5.58   ? 220 CYS H CB  1 
ATOM   2188 S SG  . CYS B 2 231 ? -7.141  25.353  50.835  1.00 13.12  ? 220 CYS H SG  1 
ATOM   2189 N N   . ASP B 2 232 ? -8.184  21.754  47.408  1.00 18.52  ? 221 ASP H N   1 
ATOM   2190 C CA  . ASP B 2 232 ? -9.048  20.724  46.835  1.00 17.34  ? 221 ASP H CA  1 
ATOM   2191 C C   . ASP B 2 232 ? -9.636  21.046  45.464  1.00 22.29  ? 221 ASP H C   1 
ATOM   2192 O O   . ASP B 2 232 ? -10.730 20.582  45.130  1.00 22.83  ? 221 ASP H O   1 
ATOM   2193 C CB  . ASP B 2 232 ? -10.156 20.361  47.836  1.00 16.26  ? 221 ASP H CB  1 
ATOM   2194 C CG  . ASP B 2 232 ? -10.779 19.006  47.565  1.00 19.49  ? 221 ASP H CG  1 
ATOM   2195 O OD1 . ASP B 2 232 ? -10.052 18.058  47.189  1.00 26.21  ? 221 ASP H OD1 1 
ATOM   2196 O OD2 . ASP B 2 232 ? -12.006 18.884  47.745  1.00 24.39  ? 221 ASP H OD2 1 
ATOM   2197 N N   . ARG B 2 233 A -8.910  21.832  44.668  1.00 21.45  ? 221 ARG H N   1 
ATOM   2198 C CA  . ARG B 2 233 A -9.365  22.168  43.323  1.00 20.14  ? 221 ARG H CA  1 
ATOM   2199 C C   . ARG B 2 233 A -9.057  20.982  42.413  1.00 21.56  ? 221 ARG H C   1 
ATOM   2200 O O   . ARG B 2 233 A -8.045  20.296  42.601  1.00 22.43  ? 221 ARG H O   1 
ATOM   2201 C CB  . ARG B 2 233 A -8.655  23.418  42.802  1.00 22.87  ? 221 ARG H CB  1 
ATOM   2202 C CG  . ARG B 2 233 A -8.986  24.698  43.543  1.00 21.16  ? 221 ARG H CG  1 
ATOM   2203 C CD  . ARG B 2 233 A -8.404  25.905  42.828  1.00 29.85  ? 221 ARG H CD  1 
ATOM   2204 N NE  . ARG B 2 233 A -8.524  27.134  43.613  1.00 32.11  ? 221 ARG H NE  1 
ATOM   2205 C CZ  . ARG B 2 233 A -7.868  28.260  43.346  1.00 32.79  ? 221 ARG H CZ  1 
ATOM   2206 N NH1 . ARG B 2 233 A -7.045  28.325  42.306  1.00 32.37  ? 221 ARG H NH1 1 
ATOM   2207 N NH2 . ARG B 2 233 A -8.004  29.311  44.145  1.00 35.30  ? 221 ARG H NH2 1 
ATOM   2208 N N   . ASP B 2 234 ? -9.925  20.725  41.438  1.00 22.16  ? 222 ASP H N   1 
ATOM   2209 C CA  . ASP B 2 234 ? -9.714  19.608  40.514  1.00 22.68  ? 222 ASP H CA  1 
ATOM   2210 C C   . ASP B 2 234 ? -8.531  19.893  39.609  1.00 19.60  ? 222 ASP H C   1 
ATOM   2211 O O   . ASP B 2 234 ? -8.455  20.958  38.995  1.00 22.41  ? 222 ASP H O   1 
ATOM   2212 C CB  . ASP B 2 234 ? -10.959 19.352  39.660  1.00 25.64  ? 222 ASP H CB  1 
ATOM   2213 C CG  . ASP B 2 234 ? -12.161 18.991  40.491  1.00 33.89  ? 222 ASP H CG  1 
ATOM   2214 O OD1 . ASP B 2 234 ? -12.840 19.919  40.972  1.00 44.30  ? 222 ASP H OD1 1 
ATOM   2215 O OD2 . ASP B 2 234 ? -12.417 17.786  40.684  1.00 35.15  ? 222 ASP H OD2 1 
ATOM   2216 N N   . GLY B 2 235 ? -7.611  18.938  39.533  1.00 19.23  ? 223 GLY H N   1 
ATOM   2217 C CA  . GLY B 2 235 ? -6.432  19.096  38.698  1.00 17.48  ? 223 GLY H CA  1 
ATOM   2218 C C   . GLY B 2 235 ? -5.290  19.746  39.454  1.00 18.09  ? 223 GLY H C   1 
ATOM   2219 O O   . GLY B 2 235 ? -4.200  19.947  38.911  1.00 19.51  ? 223 GLY H O   1 
ATOM   2220 N N   . LYS B 2 236 ? -5.547  20.072  40.716  1.00 15.46  ? 224 LYS H N   1 
ATOM   2221 C CA  . LYS B 2 236 ? -4.566  20.696  41.582  1.00 11.95  ? 224 LYS H CA  1 
ATOM   2222 C C   . LYS B 2 236 ? -4.155  19.720  42.701  1.00 15.18  ? 224 LYS H C   1 
ATOM   2223 O O   . LYS B 2 236 ? -4.939  18.850  43.106  1.00 15.36  ? 224 LYS H O   1 
ATOM   2224 C CB  . LYS B 2 236 ? -5.154  21.984  42.168  1.00 14.26  ? 224 LYS H CB  1 
ATOM   2225 C CG  . LYS B 2 236 ? -5.428  23.067  41.140  1.00 9.91   ? 224 LYS H CG  1 
ATOM   2226 C CD  . LYS B 2 236 ? -4.121  23.521  40.525  1.00 17.22  ? 224 LYS H CD  1 
ATOM   2227 C CE  . LYS B 2 236 ? -4.311  24.633  39.526  1.00 18.33  ? 224 LYS H CE  1 
ATOM   2228 N NZ  . LYS B 2 236 ? -2.996  25.085  38.995  1.00 21.00  ? 224 LYS H NZ  1 
ATOM   2229 N N   . TYR B 2 237 ? -2.909  19.835  43.154  1.00 11.47  ? 225 TYR H N   1 
ATOM   2230 C CA  . TYR B 2 237 ? -2.387  18.986  44.213  1.00 6.61   ? 225 TYR H CA  1 
ATOM   2231 C C   . TYR B 2 237 ? -1.740  19.835  45.298  1.00 10.34  ? 225 TYR H C   1 
ATOM   2232 O O   . TYR B 2 237 ? -1.490  21.037  45.111  1.00 17.80  ? 225 TYR H O   1 
ATOM   2233 C CB  . TYR B 2 237 ? -1.355  18.003  43.660  1.00 10.69  ? 225 TYR H CB  1 
ATOM   2234 C CG  . TYR B 2 237 ? -1.867  17.188  42.507  1.00 8.06   ? 225 TYR H CG  1 
ATOM   2235 C CD1 . TYR B 2 237 ? -2.614  16.039  42.724  1.00 10.96  ? 225 TYR H CD1 1 
ATOM   2236 C CD2 . TYR B 2 237 ? -1.664  17.607  41.195  1.00 7.11   ? 225 TYR H CD2 1 
ATOM   2237 C CE1 . TYR B 2 237 ? -3.154  15.328  41.658  1.00 16.50  ? 225 TYR H CE1 1 
ATOM   2238 C CE2 . TYR B 2 237 ? -2.200  16.910  40.127  1.00 8.23   ? 225 TYR H CE2 1 
ATOM   2239 C CZ  . TYR B 2 237 ? -2.947  15.774  40.363  1.00 11.60  ? 225 TYR H CZ  1 
ATOM   2240 O OH  . TYR B 2 237 ? -3.507  15.109  39.303  1.00 18.67  ? 225 TYR H OH  1 
ATOM   2241 N N   . GLY B 2 238 ? -1.505  19.213  46.444  1.00 3.75   ? 226 GLY H N   1 
ATOM   2242 C CA  . GLY B 2 238 ? -0.884  19.909  47.545  1.00 2.00   ? 226 GLY H CA  1 
ATOM   2243 C C   . GLY B 2 238 ? 0.582   19.579  47.503  1.00 4.83   ? 226 GLY H C   1 
ATOM   2244 O O   . GLY B 2 238 ? 0.957   18.446  47.174  1.00 3.47   ? 226 GLY H O   1 
ATOM   2245 N N   . PHE B 2 239 ? 1.412   20.576  47.790  1.00 10.40  ? 227 PHE H N   1 
ATOM   2246 C CA  . PHE B 2 239 ? 2.856   20.400  47.783  1.00 12.34  ? 227 PHE H CA  1 
ATOM   2247 C C   . PHE B 2 239 ? 3.399   20.389  49.191  1.00 15.60  ? 227 PHE H C   1 
ATOM   2248 O O   . PHE B 2 239 ? 3.066   21.261  50.008  1.00 20.13  ? 227 PHE H O   1 
ATOM   2249 C CB  . PHE B 2 239 ? 3.526   21.458  46.903  1.00 2.00   ? 227 PHE H CB  1 
ATOM   2250 C CG  . PHE B 2 239 ? 3.329   21.201  45.440  1.00 5.43   ? 227 PHE H CG  1 
ATOM   2251 C CD1 . PHE B 2 239 ? 2.098   21.445  44.839  1.00 3.48   ? 227 PHE H CD1 1 
ATOM   2252 C CD2 . PHE B 2 239 ? 4.330   20.593  44.688  1.00 9.84   ? 227 PHE H CD2 1 
ATOM   2253 C CE1 . PHE B 2 239 ? 1.862   21.079  43.522  1.00 9.44   ? 227 PHE H CE1 1 
ATOM   2254 C CE2 . PHE B 2 239 ? 4.102   20.220  43.364  1.00 10.13  ? 227 PHE H CE2 1 
ATOM   2255 C CZ  . PHE B 2 239 ? 2.864   20.462  42.781  1.00 9.08   ? 227 PHE H CZ  1 
ATOM   2256 N N   . TYR B 2 240 ? 4.158   19.340  49.487  1.00 10.66  ? 228 TYR H N   1 
ATOM   2257 C CA  . TYR B 2 240 ? 4.757   19.131  50.795  1.00 6.20   ? 228 TYR H CA  1 
ATOM   2258 C C   . TYR B 2 240 ? 6.258   19.216  50.676  1.00 8.43   ? 228 TYR H C   1 
ATOM   2259 O O   . TYR B 2 240 ? 6.822   18.875  49.639  1.00 11.06  ? 228 TYR H O   1 
ATOM   2260 C CB  . TYR B 2 240 ? 4.379   17.745  51.330  1.00 2.18   ? 228 TYR H CB  1 
ATOM   2261 C CG  . TYR B 2 240 ? 2.892   17.513  51.378  1.00 6.01   ? 228 TYR H CG  1 
ATOM   2262 C CD1 . TYR B 2 240 ? 2.165   17.305  50.205  1.00 2.00   ? 228 TYR H CD1 1 
ATOM   2263 C CD2 . TYR B 2 240 ? 2.197   17.615  52.577  1.00 2.51   ? 228 TYR H CD2 1 
ATOM   2264 C CE1 . TYR B 2 240 ? 0.786   17.218  50.226  1.00 4.99   ? 228 TYR H CE1 1 
ATOM   2265 C CE2 . TYR B 2 240 ? 0.812   17.532  52.607  1.00 8.44   ? 228 TYR H CE2 1 
ATOM   2266 C CZ  . TYR B 2 240 ? 0.112   17.341  51.426  1.00 9.11   ? 228 TYR H CZ  1 
ATOM   2267 O OH  . TYR B 2 240 ? -1.267  17.323  51.441  1.00 13.13  ? 228 TYR H OH  1 
ATOM   2268 N N   . THR B 2 241 ? 6.904   19.699  51.726  1.00 8.88   ? 229 THR H N   1 
ATOM   2269 C CA  . THR B 2 241 ? 8.351   19.793  51.741  1.00 7.27   ? 229 THR H CA  1 
ATOM   2270 C C   . THR B 2 241 ? 8.891   18.384  51.873  1.00 9.49   ? 229 THR H C   1 
ATOM   2271 O O   . THR B 2 241 ? 8.446   17.607  52.730  1.00 8.46   ? 229 THR H O   1 
ATOM   2272 C CB  . THR B 2 241 ? 8.827   20.604  52.922  1.00 8.81   ? 229 THR H CB  1 
ATOM   2273 O OG1 . THR B 2 241 ? 8.193   21.887  52.889  1.00 17.48  ? 229 THR H OG1 1 
ATOM   2274 C CG2 . THR B 2 241 ? 10.335  20.753  52.891  1.00 2.63   ? 229 THR H CG2 1 
ATOM   2275 N N   . HIS B 2 242 ? 9.829   18.051  50.997  1.00 11.92  ? 230 HIS H N   1 
ATOM   2276 C CA  . HIS B 2 242 ? 10.437  16.732  50.977  1.00 13.06  ? 230 HIS H CA  1 
ATOM   2277 C C   . HIS B 2 242 ? 11.350  16.651  52.178  1.00 13.19  ? 230 HIS H C   1 
ATOM   2278 O O   . HIS B 2 242 ? 12.501  17.088  52.113  1.00 14.86  ? 230 HIS H O   1 
ATOM   2279 C CB  . HIS B 2 242 ? 11.250  16.559  49.695  1.00 11.38  ? 230 HIS H CB  1 
ATOM   2280 C CG  . HIS B 2 242 ? 11.413  15.139  49.259  1.00 4.79   ? 230 HIS H CG  1 
ATOM   2281 N ND1 . HIS B 2 242 ? 12.183  14.228  49.950  1.00 8.55   ? 230 HIS H ND1 1 
ATOM   2282 C CD2 . HIS B 2 242 ? 10.943  14.485  48.172  1.00 4.29   ? 230 HIS H CD2 1 
ATOM   2283 C CE1 . HIS B 2 242 ? 12.185  13.076  49.305  1.00 7.43   ? 230 HIS H CE1 1 
ATOM   2284 N NE2 . HIS B 2 242 ? 11.440  13.206  48.222  1.00 13.79  ? 230 HIS H NE2 1 
ATOM   2285 N N   . VAL B 2 243 ? 10.849  16.079  53.267  1.00 8.16   ? 231 VAL H N   1 
ATOM   2286 C CA  . VAL B 2 243 ? 11.648  15.975  54.477  1.00 10.15  ? 231 VAL H CA  1 
ATOM   2287 C C   . VAL B 2 243 ? 12.918  15.157  54.268  1.00 9.73   ? 231 VAL H C   1 
ATOM   2288 O O   . VAL B 2 243 ? 14.006  15.625  54.574  1.00 14.13  ? 231 VAL H O   1 
ATOM   2289 C CB  . VAL B 2 243 ? 10.810  15.458  55.685  1.00 6.42   ? 231 VAL H CB  1 
ATOM   2290 C CG1 . VAL B 2 243 ? 11.699  14.858  56.748  1.00 8.69   ? 231 VAL H CG1 1 
ATOM   2291 C CG2 . VAL B 2 243 ? 10.042  16.604  56.300  1.00 2.00   ? 231 VAL H CG2 1 
ATOM   2292 N N   . PHE B 2 244 ? 12.812  13.988  53.657  1.00 8.83   ? 232 PHE H N   1 
ATOM   2293 C CA  . PHE B 2 244 ? 14.000  13.181  53.478  1.00 12.28  ? 232 PHE H CA  1 
ATOM   2294 C C   . PHE B 2 244 ? 15.122  13.888  52.728  1.00 21.95  ? 232 PHE H C   1 
ATOM   2295 O O   . PHE B 2 244 ? 16.294  13.661  53.011  1.00 28.14  ? 232 PHE H O   1 
ATOM   2296 C CB  . PHE B 2 244 ? 13.686  11.856  52.798  1.00 15.04  ? 232 PHE H CB  1 
ATOM   2297 C CG  . PHE B 2 244 ? 14.878  10.958  52.693  1.00 18.91  ? 232 PHE H CG  1 
ATOM   2298 C CD1 . PHE B 2 244 ? 15.494  10.473  53.845  1.00 16.77  ? 232 PHE H CD1 1 
ATOM   2299 C CD2 . PHE B 2 244 ? 15.438  10.662  51.457  1.00 20.58  ? 232 PHE H CD2 1 
ATOM   2300 C CE1 . PHE B 2 244 ? 16.649  9.714   53.770  1.00 11.05  ? 232 PHE H CE1 1 
ATOM   2301 C CE2 . PHE B 2 244 ? 16.598  9.903   51.367  1.00 18.06  ? 232 PHE H CE2 1 
ATOM   2302 C CZ  . PHE B 2 244 ? 17.206  9.428   52.529  1.00 17.67  ? 232 PHE H CZ  1 
ATOM   2303 N N   . ARG B 2 245 ? 14.766  14.792  51.824  1.00 25.26  ? 233 ARG H N   1 
ATOM   2304 C CA  . ARG B 2 245 ? 15.756  15.514  51.019  1.00 25.54  ? 233 ARG H CA  1 
ATOM   2305 C C   . ARG B 2 245 ? 16.550  16.521  51.865  1.00 24.84  ? 233 ARG H C   1 
ATOM   2306 O O   . ARG B 2 245 ? 17.713  16.798  51.577  1.00 27.20  ? 233 ARG H O   1 
ATOM   2307 C CB  . ARG B 2 245 ? 15.048  16.202  49.837  1.00 35.31  ? 233 ARG H CB  1 
ATOM   2308 C CG  . ARG B 2 245 ? 15.946  16.857  48.793  1.00 42.87  ? 233 ARG H CG  1 
ATOM   2309 C CD  . ARG B 2 245 ? 16.676  15.852  47.933  1.00 50.24  ? 233 ARG H CD  1 
ATOM   2310 N NE  . ARG B 2 245 ? 15.813  15.205  46.951  1.00 60.17  ? 233 ARG H NE  1 
ATOM   2311 C CZ  . ARG B 2 245 ? 15.695  13.886  46.817  1.00 67.13  ? 233 ARG H CZ  1 
ATOM   2312 N NH1 . ARG B 2 245 ? 16.372  13.065  47.616  1.00 66.83  ? 233 ARG H NH1 1 
ATOM   2313 N NH2 . ARG B 2 245 ? 14.973  13.382  45.825  1.00 65.84  ? 233 ARG H NH2 1 
ATOM   2314 N N   . LEU B 2 246 ? 15.925  17.047  52.920  1.00 23.25  ? 234 LEU H N   1 
ATOM   2315 C CA  . LEU B 2 246 ? 16.570  18.007  53.820  1.00 17.70  ? 234 LEU H CA  1 
ATOM   2316 C C   . LEU B 2 246 ? 16.976  17.336  55.136  1.00 17.21  ? 234 LEU H C   1 
ATOM   2317 O O   . LEU B 2 246 ? 17.138  18.005  56.156  1.00 20.77  ? 234 LEU H O   1 
ATOM   2318 C CB  . LEU B 2 246 ? 15.626  19.172  54.146  1.00 13.81  ? 234 LEU H CB  1 
ATOM   2319 C CG  . LEU B 2 246 ? 15.174  20.200  53.105  1.00 7.06   ? 234 LEU H CG  1 
ATOM   2320 C CD1 . LEU B 2 246 ? 16.365  20.673  52.327  1.00 3.99   ? 234 LEU H CD1 1 
ATOM   2321 C CD2 . LEU B 2 246 ? 14.110  19.638  52.193  1.00 2.00   ? 234 LEU H CD2 1 
ATOM   2322 N N   . LYS B 2 247 ? 17.152  16.020  55.109  1.00 19.82  ? 235 LYS H N   1 
ATOM   2323 C CA  . LYS B 2 247 ? 17.520  15.243  56.294  1.00 16.13  ? 235 LYS H CA  1 
ATOM   2324 C C   . LYS B 2 247 ? 18.900  15.615  56.799  1.00 19.07  ? 235 LYS H C   1 
ATOM   2325 O O   . LYS B 2 247 ? 19.096  15.795  58.003  1.00 24.82  ? 235 LYS H O   1 
ATOM   2326 C CB  . LYS B 2 247 ? 17.467  13.748  55.968  1.00 18.27  ? 235 LYS H CB  1 
ATOM   2327 C CG  . LYS B 2 247 ? 17.906  12.799  57.076  1.00 23.67  ? 235 LYS H CG  1 
ATOM   2328 C CD  . LYS B 2 247 ? 16.856  12.616  58.149  1.00 19.39  ? 235 LYS H CD  1 
ATOM   2329 C CE  . LYS B 2 247 ? 17.255  11.502  59.100  1.00 20.48  ? 235 LYS H CE  1 
ATOM   2330 N NZ  . LYS B 2 247 ? 17.432  10.196  58.398  1.00 19.74  ? 235 LYS H NZ  1 
ATOM   2331 N N   . LYS B 2 248 ? 19.856  15.749  55.884  1.00 20.68  ? 236 LYS H N   1 
ATOM   2332 C CA  . LYS B 2 248 ? 21.218  16.100  56.270  1.00 20.19  ? 236 LYS H CA  1 
ATOM   2333 C C   . LYS B 2 248 ? 21.291  17.454  56.966  1.00 18.47  ? 236 LYS H C   1 
ATOM   2334 O O   . LYS B 2 248 ? 22.056  17.617  57.914  1.00 28.01  ? 236 LYS H O   1 
ATOM   2335 C CB  . LYS B 2 248 ? 22.164  16.048  55.070  1.00 21.85  ? 236 LYS H CB  1 
ATOM   2336 C CG  . LYS B 2 248 ? 22.340  14.651  54.512  0.00 30.58  ? 236 LYS H CG  1 
ATOM   2337 C CD  . LYS B 2 248 ? 22.877  13.712  55.579  0.00 38.43  ? 236 LYS H CD  1 
ATOM   2338 C CE  . LYS B 2 248 ? 22.653  12.264  55.200  1.00 47.60  ? 236 LYS H CE  1 
ATOM   2339 N NZ  . LYS B 2 248 ? 21.198  11.931  55.107  1.00 53.16  ? 236 LYS H NZ  1 
ATOM   2340 N N   . TRP B 2 249 ? 20.476  18.412  56.531  1.00 12.84  ? 237 TRP H N   1 
ATOM   2341 C CA  . TRP B 2 249 ? 20.463  19.740  57.152  1.00 10.79  ? 237 TRP H CA  1 
ATOM   2342 C C   . TRP B 2 249 ? 19.940  19.653  58.599  1.00 14.08  ? 237 TRP H C   1 
ATOM   2343 O O   . TRP B 2 249 ? 20.520  20.231  59.529  1.00 13.52  ? 237 TRP H O   1 
ATOM   2344 C CB  . TRP B 2 249 ? 19.621  20.713  56.314  1.00 5.76   ? 237 TRP H CB  1 
ATOM   2345 C CG  . TRP B 2 249 ? 19.206  21.933  57.059  1.00 13.76  ? 237 TRP H CG  1 
ATOM   2346 C CD1 . TRP B 2 249 ? 19.938  23.071  57.246  1.00 14.24  ? 237 TRP H CD1 1 
ATOM   2347 C CD2 . TRP B 2 249 ? 17.989  22.109  57.801  1.00 12.37  ? 237 TRP H CD2 1 
ATOM   2348 N NE1 . TRP B 2 249 ? 19.260  23.938  58.074  1.00 14.60  ? 237 TRP H NE1 1 
ATOM   2349 C CE2 . TRP B 2 249 ? 18.061  23.373  58.428  1.00 13.69  ? 237 TRP H CE2 1 
ATOM   2350 C CE3 . TRP B 2 249 ? 16.849  21.318  58.002  1.00 13.78  ? 237 TRP H CE3 1 
ATOM   2351 C CZ2 . TRP B 2 249 ? 17.037  23.863  59.250  1.00 11.22  ? 237 TRP H CZ2 1 
ATOM   2352 C CZ3 . TRP B 2 249 ? 15.832  21.802  58.816  1.00 5.48   ? 237 TRP H CZ3 1 
ATOM   2353 C CH2 . TRP B 2 249 ? 15.937  23.064  59.432  1.00 7.20   ? 237 TRP H CH2 1 
ATOM   2354 N N   . ILE B 2 250 ? 18.844  18.921  58.775  1.00 14.08  ? 238 ILE H N   1 
ATOM   2355 C CA  . ILE B 2 250 ? 18.230  18.723  60.080  1.00 11.49  ? 238 ILE H CA  1 
ATOM   2356 C C   . ILE B 2 250 ? 19.311  18.252  61.033  1.00 15.59  ? 238 ILE H C   1 
ATOM   2357 O O   . ILE B 2 250 ? 19.562  18.893  62.052  1.00 20.63  ? 238 ILE H O   1 
ATOM   2358 C CB  . ILE B 2 250 ? 17.093  17.670  59.995  1.00 11.03  ? 238 ILE H CB  1 
ATOM   2359 C CG1 . ILE B 2 250 ? 15.989  18.179  59.076  1.00 7.01   ? 238 ILE H CG1 1 
ATOM   2360 C CG2 . ILE B 2 250 ? 16.506  17.384  61.363  1.00 12.78  ? 238 ILE H CG2 1 
ATOM   2361 C CD1 . ILE B 2 250 ? 14.917  17.186  58.811  1.00 9.72   ? 238 ILE H CD1 1 
ATOM   2362 N N   . GLN B 2 251 ? 19.992  17.171  60.667  1.00 16.78  ? 239 GLN H N   1 
ATOM   2363 C CA  . GLN B 2 251 ? 21.062  16.619  61.494  1.00 21.62  ? 239 GLN H CA  1 
ATOM   2364 C C   . GLN B 2 251 ? 22.128  17.653  61.812  1.00 23.36  ? 239 GLN H C   1 
ATOM   2365 O O   . GLN B 2 251 ? 22.707  17.644  62.900  1.00 21.23  ? 239 GLN H O   1 
ATOM   2366 C CB  . GLN B 2 251 ? 21.739  15.446  60.797  1.00 30.72  ? 239 GLN H CB  1 
ATOM   2367 C CG  . GLN B 2 251 ? 20.867  14.212  60.626  1.00 42.54  ? 239 GLN H CG  1 
ATOM   2368 C CD  . GLN B 2 251 ? 21.682  12.942  60.405  1.00 45.25  ? 239 GLN H CD  1 
ATOM   2369 O OE1 . GLN B 2 251 ? 21.147  11.924  59.947  1.00 39.48  ? 239 GLN H OE1 1 
ATOM   2370 N NE2 . GLN B 2 251 ? 22.977  12.985  60.760  1.00 38.94  ? 239 GLN H NE2 1 
ATOM   2371 N N   . LYS B 2 252 ? 22.393  18.529  60.849  1.00 25.71  ? 240 LYS H N   1 
ATOM   2372 C CA  . LYS B 2 252 ? 23.388  19.577  60.999  1.00 26.41  ? 240 LYS H CA  1 
ATOM   2373 C C   . LYS B 2 252 ? 23.033  20.616  62.076  1.00 29.29  ? 240 LYS H C   1 
ATOM   2374 O O   . LYS B 2 252 ? 23.919  21.091  62.774  1.00 33.39  ? 240 LYS H O   1 
ATOM   2375 C CB  . LYS B 2 252 ? 23.622  20.273  59.653  1.00 33.92  ? 240 LYS H CB  1 
ATOM   2376 C CG  . LYS B 2 252 ? 24.841  21.191  59.612  1.00 40.56  ? 240 LYS H CG  1 
ATOM   2377 C CD  . LYS B 2 252 ? 24.766  22.201  58.466  1.00 45.99  ? 240 LYS H CD  1 
ATOM   2378 C CE  . LYS B 2 252 ? 24.581  21.531  57.105  1.00 52.69  ? 240 LYS H CE  1 
ATOM   2379 N NZ  . LYS B 2 252 ? 25.720  20.644  56.719  1.00 58.50  ? 240 LYS H NZ  1 
ATOM   2380 N N   . VAL B 2 253 ? 21.767  21.010  62.205  1.00 27.16  ? 241 VAL H N   1 
ATOM   2381 C CA  . VAL B 2 253 ? 21.441  22.003  63.232  1.00 26.04  ? 241 VAL H CA  1 
ATOM   2382 C C   . VAL B 2 253 ? 21.152  21.365  64.586  1.00 25.04  ? 241 VAL H C   1 
ATOM   2383 O O   . VAL B 2 253 ? 21.243  22.017  65.622  1.00 26.43  ? 241 VAL H O   1 
ATOM   2384 C CB  . VAL B 2 253 ? 20.286  22.968  62.815  1.00 28.69  ? 241 VAL H CB  1 
ATOM   2385 C CG1 . VAL B 2 253 ? 20.092  22.957  61.315  1.00 25.98  ? 241 VAL H CG1 1 
ATOM   2386 C CG2 . VAL B 2 253 ? 18.999  22.654  63.554  1.00 28.72  ? 241 VAL H CG2 1 
ATOM   2387 N N   . ILE B 2 254 ? 20.759  20.099  64.569  1.00 26.05  ? 242 ILE H N   1 
ATOM   2388 C CA  . ILE B 2 254 ? 20.475  19.380  65.799  1.00 27.50  ? 242 ILE H CA  1 
ATOM   2389 C C   . ILE B 2 254 ? 21.781  19.091  66.516  1.00 29.97  ? 242 ILE H C   1 
ATOM   2390 O O   . ILE B 2 254 ? 21.935  19.434  67.686  1.00 28.96  ? 242 ILE H O   1 
ATOM   2391 C CB  . ILE B 2 254 ? 19.729  18.053  65.519  1.00 27.56  ? 242 ILE H CB  1 
ATOM   2392 C CG1 . ILE B 2 254 ? 18.280  18.353  65.116  1.00 24.12  ? 242 ILE H CG1 1 
ATOM   2393 C CG2 . ILE B 2 254 ? 19.803  17.125  66.732  1.00 26.62  ? 242 ILE H CG2 1 
ATOM   2394 C CD1 . ILE B 2 254 ? 17.428  17.126  64.901  1.00 23.35  ? 242 ILE H CD1 1 
ATOM   2395 N N   . ASP B 2 255 ? 22.717  18.469  65.803  1.00 36.29  ? 243 ASP H N   1 
ATOM   2396 C CA  . ASP B 2 255 ? 24.022  18.126  66.361  1.00 44.28  ? 243 ASP H CA  1 
ATOM   2397 C C   . ASP B 2 255 ? 24.987  19.307  66.353  1.00 46.94  ? 243 ASP H C   1 
ATOM   2398 O O   . ASP B 2 255 ? 25.905  19.369  65.542  1.00 46.86  ? 243 ASP H O   1 
ATOM   2399 C CB  . ASP B 2 255 ? 24.628  16.938  65.612  1.00 47.07  ? 243 ASP H CB  1 
ATOM   2400 C CG  . ASP B 2 255 ? 23.871  15.647  65.859  1.00 56.46  ? 243 ASP H CG  1 
ATOM   2401 O OD1 . ASP B 2 255 ? 23.882  15.165  67.014  1.00 61.04  ? 243 ASP H OD1 1 
ATOM   2402 O OD2 . ASP B 2 255 ? 23.266  15.116  64.901  1.00 56.57  ? 243 ASP H OD2 1 
ATOM   2403 N N   . ARG B 2 256 ? 24.754  20.257  67.253  1.00 53.18  ? 244 ARG H N   1 
ATOM   2404 C CA  . ARG B 2 256 ? 25.601  21.435  67.359  1.00 62.05  ? 244 ARG H CA  1 
ATOM   2405 C C   . ARG B 2 256 ? 25.970  21.721  68.813  1.00 67.30  ? 244 ARG H C   1 
ATOM   2406 O O   . ARG B 2 256 ? 25.697  22.811  69.321  1.00 69.79  ? 244 ARG H O   1 
ATOM   2407 C CB  . ARG B 2 256 ? 24.909  22.663  66.751  1.00 66.27  ? 244 ARG H CB  1 
ATOM   2408 C CG  . ARG B 2 256 ? 24.829  22.694  65.228  1.00 80.60  ? 244 ARG H CG  1 
ATOM   2409 C CD  . ARG B 2 256 ? 26.198  22.880  64.559  1.00 93.37  ? 244 ARG H CD  1 
ATOM   2410 N NE  . ARG B 2 256 ? 26.082  23.397  63.190  1.00 99.60  ? 244 ARG H NE  1 
ATOM   2411 C CZ  . ARG B 2 256 ? 27.007  23.251  62.243  1.00 99.57  ? 244 ARG H CZ  1 
ATOM   2412 N NH1 . ARG B 2 256 ? 28.119  22.573  62.489  1.00 101.72 ? 244 ARG H NH1 1 
ATOM   2413 N NH2 . ARG B 2 256 ? 26.808  23.765  61.036  1.00 98.34  ? 244 ARG H NH2 1 
ATOM   2414 N N   . LEU B 2 257 ? 26.588  20.749  69.483  1.00 69.88  ? 245 LEU H N   1 
ATOM   2415 C CA  . LEU B 2 257 ? 27.007  20.925  70.874  1.00 71.44  ? 245 LEU H CA  1 
ATOM   2416 C C   . LEU B 2 257 ? 27.801  19.725  71.382  1.00 72.97  ? 245 LEU H C   1 
ATOM   2417 O O   . LEU B 2 257 ? 27.228  18.724  71.817  1.00 74.14  ? 245 LEU H O   1 
ATOM   2418 C CB  . LEU B 2 257 ? 25.798  21.181  71.783  1.00 70.33  ? 245 LEU H CB  1 
ATOM   2419 C CG  . LEU B 2 257 ? 26.086  21.608  73.226  0.00 70.14  ? 245 LEU H CG  1 
ATOM   2420 C CD1 . LEU B 2 257 ? 26.883  22.906  73.242  0.00 69.70  ? 245 LEU H CD1 1 
ATOM   2421 C CD2 . LEU B 2 257 ? 24.778  21.779  73.982  0.00 69.76  ? 245 LEU H CD2 1 
ATOM   2422 N N   . GLY B 2 258 ? 29.126  19.825  71.299  1.00 73.23  ? 246 GLY H N   1 
ATOM   2423 C CA  . GLY B 2 258 ? 29.993  18.749  71.751  1.00 71.07  ? 246 GLY H CA  1 
ATOM   2424 C C   . GLY B 2 258 ? 29.860  17.499  70.903  1.00 70.08  ? 246 GLY H C   1 
ATOM   2425 O O   . GLY B 2 258 ? 30.593  16.527  71.096  1.00 69.68  ? 246 GLY H O   1 
ATOM   2426 N N   . SER B 2 259 ? 28.930  17.543  69.957  0.00 68.61  ? 247 SER H N   1 
ATOM   2427 C CA  . SER B 2 259 ? 28.640  16.454  69.040  0.00 67.43  ? 247 SER H CA  1 
ATOM   2428 C C   . SER B 2 259 ? 27.861  17.069  67.875  0.00 67.45  ? 247 SER H C   1 
ATOM   2429 O O   . SER B 2 259 ? 27.345  18.198  68.044  0.00 67.01  ? 247 SER H O   1 
ATOM   2430 C CB  . SER B 2 259 ? 27.784  15.390  69.738  0.00 67.00  ? 247 SER H CB  1 
ATOM   2431 O OG  . SER B 2 259 ? 27.482  14.311  68.868  0.00 65.91  ? 247 SER H OG  1 
ATOM   2432 O OXT . SER B 2 259 ? 27.780  16.425  66.810  1.00 67.50  ? 247 SER H OXT 1 
ATOM   2433 N N   . ALA C 3 1   ? 8.474   25.379  87.980  1.00 69.54  ? 1   ALA I N   1 
ATOM   2434 C CA  . ALA C 3 1   ? 9.393   24.286  88.398  1.00 67.90  ? 1   ALA I CA  1 
ATOM   2435 C C   . ALA C 3 1   ? 10.794  24.866  88.484  1.00 68.87  ? 1   ALA I C   1 
ATOM   2436 O O   . ALA C 3 1   ? 11.048  25.945  87.944  1.00 67.52  ? 1   ALA I O   1 
ATOM   2437 C CB  . ALA C 3 1   ? 9.357   23.151  87.389  1.00 65.95  ? 1   ALA I CB  1 
ATOM   2438 N N   . GLU C 3 2   ? 11.699  24.143  89.138  1.00 71.00  ? 2   GLU I N   1 
ATOM   2439 C CA  . GLU C 3 2   ? 13.081  24.590  89.297  1.00 73.70  ? 2   GLU I CA  1 
ATOM   2440 C C   . GLU C 3 2   ? 13.729  24.921  87.955  1.00 74.61  ? 2   GLU I C   1 
ATOM   2441 O O   . GLU C 3 2   ? 14.039  24.030  87.162  1.00 76.43  ? 2   GLU I O   1 
ATOM   2442 C CB  . GLU C 3 2   ? 13.901  23.534  90.038  0.50 73.21  ? 2   GLU I CB  1 
ATOM   2443 C CG  . GLU C 3 2   ? 13.482  23.346  91.486  0.50 74.08  ? 2   GLU I CG  1 
ATOM   2444 C CD  . GLU C 3 2   ? 14.303  22.297  92.209  0.50 75.73  ? 2   GLU I CD  1 
ATOM   2445 O OE1 . GLU C 3 2   ? 15.496  22.123  91.875  0.50 77.66  ? 2   GLU I OE1 1 
ATOM   2446 O OE2 . GLU C 3 2   ? 13.751  21.646  93.121  0.50 76.31  ? 2   GLU I OE2 1 
ATOM   2447 N N   . GLY C 3 3   ? 13.895  26.215  87.705  1.00 74.30  ? 3   GLY I N   1 
ATOM   2448 C CA  . GLY C 3 3   ? 14.486  26.678  86.464  1.00 72.64  ? 3   GLY I CA  1 
ATOM   2449 C C   . GLY C 3 3   ? 13.677  27.839  85.921  1.00 71.88  ? 3   GLY I C   1 
ATOM   2450 O O   . GLY C 3 3   ? 14.210  28.737  85.265  1.00 73.22  ? 3   GLY I O   1 
ATOM   2451 N N   . ASP C 3 4   ? 12.380  27.824  86.218  1.00 68.28  ? 4   ASP I N   1 
ATOM   2452 C CA  . ASP C 3 4   ? 11.464  28.866  85.773  1.00 63.53  ? 4   ASP I CA  1 
ATOM   2453 C C   . ASP C 3 4   ? 11.695  30.137  86.590  1.00 64.96  ? 4   ASP I C   1 
ATOM   2454 O O   . ASP C 3 4   ? 11.951  30.071  87.795  1.00 65.41  ? 4   ASP I O   1 
ATOM   2455 C CB  . ASP C 3 4   ? 10.020  28.386  85.935  0.50 56.09  ? 4   ASP I CB  1 
ATOM   2456 C CG  . ASP C 3 4   ? 9.751   27.066  85.220  0.50 48.82  ? 4   ASP I CG  1 
ATOM   2457 O OD1 . ASP C 3 4   ? 10.621  26.574  84.469  0.50 43.36  ? 4   ASP I OD1 1 
ATOM   2458 O OD2 . ASP C 3 4   ? 8.646   26.523  85.404  0.50 46.20  ? 4   ASP I OD2 1 
ATOM   2459 N N   . ASP C 3 5   ? 11.593  31.292  85.939  1.00 64.13  ? 5   ASP I N   1 
ATOM   2460 C CA  . ASP C 3 5   ? 11.806  32.561  86.623  1.00 60.78  ? 5   ASP I CA  1 
ATOM   2461 C C   . ASP C 3 5   ? 10.865  33.624  86.063  1.00 56.51  ? 5   ASP I C   1 
ATOM   2462 O O   . ASP C 3 5   ? 11.168  34.280  85.067  1.00 55.99  ? 5   ASP I O   1 
ATOM   2463 C CB  . ASP C 3 5   ? 13.271  32.995  86.476  1.00 65.16  ? 5   ASP I CB  1 
ATOM   2464 C CG  . ASP C 3 5   ? 13.722  33.936  87.583  1.00 70.01  ? 5   ASP I CG  1 
ATOM   2465 O OD1 . ASP C 3 5   ? 13.867  33.480  88.740  1.00 71.88  ? 5   ASP I OD1 1 
ATOM   2466 O OD2 . ASP C 3 5   ? 13.947  35.129  87.294  1.00 71.14  ? 5   ASP I OD2 1 
ATOM   2467 N N   . CYS C 3 6   ? 9.726   33.791  86.726  1.00 51.77  ? 6   CYS I N   1 
ATOM   2468 C CA  . CYS C 3 6   ? 8.713   34.761  86.327  1.00 49.27  ? 6   CYS I CA  1 
ATOM   2469 C C   . CYS C 3 6   ? 9.279   36.169  86.240  1.00 53.32  ? 6   CYS I C   1 
ATOM   2470 O O   . CYS C 3 6   ? 8.795   36.995  85.469  1.00 53.13  ? 6   CYS I O   1 
ATOM   2471 C CB  . CYS C 3 6   ? 7.554   34.745  87.323  1.00 38.76  ? 6   CYS I CB  1 
ATOM   2472 S SG  . CYS C 3 6   ? 6.865   33.083  87.564  1.00 29.81  ? 6   CYS I SG  1 
ATOM   2473 N N   . SER C 3 7   ? 10.311  36.430  87.036  1.00 59.15  ? 7   SER I N   1 
ATOM   2474 C CA  . SER C 3 7   ? 10.959  37.736  87.073  1.00 64.02  ? 7   SER I CA  1 
ATOM   2475 C C   . SER C 3 7   ? 11.510  38.137  85.700  1.00 64.65  ? 7   SER I C   1 
ATOM   2476 O O   . SER C 3 7   ? 11.291  39.261  85.236  1.00 64.36  ? 7   SER I O   1 
ATOM   2477 C CB  . SER C 3 7   ? 12.093  37.724  88.107  1.00 66.96  ? 7   SER I CB  1 
ATOM   2478 O OG  . SER C 3 7   ? 11.751  36.948  89.247  1.00 70.05  ? 7   SER I OG  1 
ATOM   2479 N N   . ILE C 3 8   ? 12.203  37.205  85.047  1.00 63.38  ? 8   ILE I N   1 
ATOM   2480 C CA  . ILE C 3 8   ? 12.790  37.473  83.739  1.00 61.25  ? 8   ILE I CA  1 
ATOM   2481 C C   . ILE C 3 8   ? 11.866  37.088  82.587  1.00 57.45  ? 8   ILE I C   1 
ATOM   2482 O O   . ILE C 3 8   ? 12.324  36.775  81.490  1.00 59.14  ? 8   ILE I O   1 
ATOM   2483 C CB  . ILE C 3 8   ? 14.186  36.794  83.572  1.00 63.97  ? 8   ILE I CB  1 
ATOM   2484 C CG1 . ILE C 3 8   ? 14.065  35.269  83.592  1.00 65.88  ? 8   ILE I CG1 1 
ATOM   2485 C CG2 . ILE C 3 8   ? 15.133  37.247  84.684  1.00 62.31  ? 8   ILE I CG2 1 
ATOM   2486 C CD1 . ILE C 3 8   ? 15.403  34.552  83.460  1.00 65.62  ? 8   ILE I CD1 1 
ATOM   2487 N N   . GLU C 3 9   ? 10.564  37.093  82.845  1.00 54.91  ? 9   GLU I N   1 
ATOM   2488 C CA  . GLU C 3 9   ? 9.587   36.772  81.815  1.00 51.86  ? 9   GLU I CA  1 
ATOM   2489 C C   . GLU C 3 9   ? 9.124   38.070  81.162  1.00 51.87  ? 9   GLU I C   1 
ATOM   2490 O O   . GLU C 3 9   ? 9.670   39.141  81.428  1.00 55.90  ? 9   GLU I O   1 
ATOM   2491 C CB  . GLU C 3 9   ? 8.390   36.019  82.409  1.00 49.52  ? 9   GLU I CB  1 
ATOM   2492 C CG  . GLU C 3 9   ? 8.451   34.501  82.249  1.00 48.40  ? 9   GLU I CG  1 
ATOM   2493 C CD  . GLU C 3 9   ? 8.284   34.040  80.804  1.00 54.18  ? 9   GLU I CD  1 
ATOM   2494 O OE1 . GLU C 3 9   ? 7.698   34.788  79.989  1.00 57.37  ? 9   GLU I OE1 1 
ATOM   2495 O OE2 . GLU C 3 9   ? 8.736   32.919  80.481  1.00 56.91  ? 9   GLU I OE2 1 
ATOM   2496 N N   . LYS C 3 10  ? 8.110   37.977  80.315  1.00 50.43  ? 10  LYS I N   1 
ATOM   2497 C CA  . LYS C 3 10  ? 7.587   39.147  79.634  1.00 49.25  ? 10  LYS I CA  1 
ATOM   2498 C C   . LYS C 3 10  ? 6.066   39.053  79.618  1.00 44.61  ? 10  LYS I C   1 
ATOM   2499 O O   . LYS C 3 10  ? 5.505   38.071  79.130  1.00 46.03  ? 10  LYS I O   1 
ATOM   2500 C CB  . LYS C 3 10  ? 8.142   39.197  78.209  1.00 56.70  ? 10  LYS I CB  1 
ATOM   2501 C CG  . LYS C 3 10  ? 7.921   40.514  77.492  1.00 64.47  ? 10  LYS I CG  1 
ATOM   2502 C CD  . LYS C 3 10  ? 8.612   40.513  76.143  1.00 67.51  ? 10  LYS I CD  1 
ATOM   2503 C CE  . LYS C 3 10  ? 8.534   41.876  75.487  1.00 68.98  ? 10  LYS I CE  1 
ATOM   2504 N NZ  . LYS C 3 10  ? 9.312   41.893  74.220  1.00 75.51  ? 10  LYS I NZ  1 
ATOM   2505 N N   . ALA C 3 11  ? 5.405   40.046  80.202  1.00 40.74  ? 11  ALA I N   1 
ATOM   2506 C CA  . ALA C 3 11  ? 3.947   40.061  80.256  1.00 40.46  ? 11  ALA I CA  1 
ATOM   2507 C C   . ALA C 3 11  ? 3.379   40.300  78.866  1.00 41.47  ? 11  ALA I C   1 
ATOM   2508 O O   . ALA C 3 11  ? 4.097   40.738  77.969  1.00 44.32  ? 11  ALA I O   1 
ATOM   2509 C CB  . ALA C 3 11  ? 3.457   41.124  81.223  1.00 38.67  ? 11  ALA I CB  1 
ATOM   2510 N N   . MET C 3 12  ? 2.087   40.044  78.698  1.00 38.78  ? 12  MET I N   1 
ATOM   2511 C CA  . MET C 3 12  ? 1.443   40.202  77.405  1.00 40.01  ? 12  MET I CA  1 
ATOM   2512 C C   . MET C 3 12  ? 1.119   41.617  76.933  1.00 46.38  ? 12  MET I C   1 
ATOM   2513 O O   . MET C 3 12  ? 0.626   41.794  75.819  1.00 49.71  ? 12  MET I O   1 
ATOM   2514 C CB  . MET C 3 12  ? 0.195   39.327  77.322  1.00 37.30  ? 12  MET I CB  1 
ATOM   2515 C CG  . MET C 3 12  ? -0.970  39.800  78.146  1.00 30.57  ? 12  MET I CG  1 
ATOM   2516 S SD  . MET C 3 12  ? -2.347  38.709  77.873  1.00 35.80  ? 12  MET I SD  1 
ATOM   2517 C CE  . MET C 3 12  ? -3.438  39.697  76.853  1.00 23.17  ? 12  MET I CE  1 
ATOM   2518 N N   . GLY C 3 13  ? 1.351   42.622  77.768  1.00 48.04  ? 13  GLY I N   1 
ATOM   2519 C CA  . GLY C 3 13  ? 1.078   43.991  77.349  1.00 51.35  ? 13  GLY I CA  1 
ATOM   2520 C C   . GLY C 3 13  ? -0.385  44.389  77.198  1.00 51.50  ? 13  GLY I C   1 
ATOM   2521 O O   . GLY C 3 13  ? -0.882  45.207  77.970  1.00 56.92  ? 13  GLY I O   1 
ATOM   2522 N N   . ASP C 3 14  ? -1.086  43.811  76.230  1.00 45.37  ? 14  ASP I N   1 
ATOM   2523 C CA  . ASP C 3 14  ? -2.496  44.133  76.004  1.00 45.53  ? 14  ASP I CA  1 
ATOM   2524 C C   . ASP C 3 14  ? -3.450  43.552  77.054  1.00 45.54  ? 14  ASP I C   1 
ATOM   2525 O O   . ASP C 3 14  ? -4.659  43.442  76.815  1.00 47.72  ? 14  ASP I O   1 
ATOM   2526 C CB  . ASP C 3 14  ? -2.926  43.666  74.604  1.00 53.36  ? 14  ASP I CB  1 
ATOM   2527 C CG  . ASP C 3 14  ? -2.704  42.172  74.381  1.00 57.55  ? 14  ASP I CG  1 
ATOM   2528 O OD1 . ASP C 3 14  ? -1.531  41.750  74.330  1.00 55.89  ? 14  ASP I OD1 1 
ATOM   2529 O OD2 . ASP C 3 14  ? -3.702  41.425  74.242  1.00 59.43  ? 14  ASP I OD2 1 
ATOM   2530 N N   . PHE C 3 15  ? -2.916  43.212  78.220  1.00 42.16  ? 15  PHE I N   1 
ATOM   2531 C CA  . PHE C 3 15  ? -3.709  42.617  79.285  1.00 40.80  ? 15  PHE I CA  1 
ATOM   2532 C C   . PHE C 3 15  ? -4.654  43.614  79.945  1.00 40.01  ? 15  PHE I C   1 
ATOM   2533 O O   . PHE C 3 15  ? -4.222  44.647  80.455  1.00 43.67  ? 15  PHE I O   1 
ATOM   2534 C CB  . PHE C 3 15  ? -2.780  41.993  80.338  1.00 41.41  ? 15  PHE I CB  1 
ATOM   2535 C CG  . PHE C 3 15  ? -3.500  41.224  81.413  1.00 36.93  ? 15  PHE I CG  1 
ATOM   2536 C CD1 . PHE C 3 15  ? -4.230  40.083  81.103  1.00 35.29  ? 15  PHE I CD1 1 
ATOM   2537 C CD2 . PHE C 3 15  ? -3.449  41.644  82.736  1.00 35.27  ? 15  PHE I CD2 1 
ATOM   2538 C CE1 . PHE C 3 15  ? -4.897  39.374  82.095  1.00 36.05  ? 15  PHE I CE1 1 
ATOM   2539 C CE2 . PHE C 3 15  ? -4.114  40.941  83.733  1.00 35.57  ? 15  PHE I CE2 1 
ATOM   2540 C CZ  . PHE C 3 15  ? -4.839  39.805  83.413  1.00 34.61  ? 15  PHE I CZ  1 
ATOM   2541 N N   . LYS C 3 16  ? -5.945  43.306  79.919  1.00 33.92  ? 16  LYS I N   1 
ATOM   2542 C CA  . LYS C 3 16  ? -6.941  44.153  80.546  1.00 34.49  ? 16  LYS I CA  1 
ATOM   2543 C C   . LYS C 3 16  ? -7.287  43.475  81.876  1.00 37.54  ? 16  LYS I C   1 
ATOM   2544 O O   . LYS C 3 16  ? -8.185  42.625  81.948  1.00 38.30  ? 16  LYS I O   1 
ATOM   2545 C CB  . LYS C 3 16  ? -8.176  44.280  79.652  1.00 35.92  ? 16  LYS I CB  1 
ATOM   2546 C CG  . LYS C 3 16  ? -7.896  44.902  78.292  0.00 34.87  ? 16  LYS I CG  1 
ATOM   2547 C CD  . LYS C 3 16  ? -7.400  46.335  78.425  0.00 34.54  ? 16  LYS I CD  1 
ATOM   2548 C CE  . LYS C 3 16  ? -6.993  46.908  77.077  0.00 34.48  ? 16  LYS I CE  1 
ATOM   2549 N NZ  . LYS C 3 16  ? -5.826  46.188  76.494  0.00 34.18  ? 16  LYS I NZ  1 
ATOM   2550 N N   . PRO C 3 17  ? -6.609  43.889  82.962  1.00 37.41  ? 17  PRO I N   1 
ATOM   2551 C CA  . PRO C 3 17  ? -6.771  43.369  84.322  1.00 33.87  ? 17  PRO I CA  1 
ATOM   2552 C C   . PRO C 3 17  ? -8.188  43.166  84.831  1.00 33.42  ? 17  PRO I C   1 
ATOM   2553 O O   . PRO C 3 17  ? -8.453  42.197  85.538  1.00 33.39  ? 17  PRO I O   1 
ATOM   2554 C CB  . PRO C 3 17  ? -6.000  44.386  85.165  1.00 33.37  ? 17  PRO I CB  1 
ATOM   2555 C CG  . PRO C 3 17  ? -6.106  45.635  84.375  1.00 35.33  ? 17  PRO I CG  1 
ATOM   2556 C CD  . PRO C 3 17  ? -5.824  45.131  82.993  1.00 37.88  ? 17  PRO I CD  1 
ATOM   2557 N N   . GLU C 3 18  ? -9.113  44.036  84.455  1.00 37.02  ? 18  GLU I N   1 
ATOM   2558 C CA  . GLU C 3 18  ? -10.476 43.874  84.940  1.00 42.05  ? 18  GLU I CA  1 
ATOM   2559 C C   . GLU C 3 18  ? -11.314 42.823  84.218  1.00 40.73  ? 18  GLU I C   1 
ATOM   2560 O O   . GLU C 3 18  ? -12.393 42.464  84.687  1.00 41.08  ? 18  GLU I O   1 
ATOM   2561 C CB  . GLU C 3 18  ? -11.207 45.213  85.012  1.00 51.52  ? 18  GLU I CB  1 
ATOM   2562 C CG  . GLU C 3 18  ? -12.257 45.264  86.136  1.00 65.88  ? 18  GLU I CG  1 
ATOM   2563 C CD  . GLU C 3 18  ? -11.713 44.822  87.505  1.00 74.67  ? 18  GLU I CD  1 
ATOM   2564 O OE1 . GLU C 3 18  ? -10.577 45.205  87.871  1.00 80.67  ? 18  GLU I OE1 1 
ATOM   2565 O OE2 . GLU C 3 18  ? -12.431 44.087  88.219  1.00 74.70  ? 18  GLU I OE2 1 
ATOM   2566 N N   . GLU C 3 19  ? -10.851 42.355  83.064  1.00 39.70  ? 19  GLU I N   1 
ATOM   2567 C CA  . GLU C 3 19  ? -11.582 41.311  82.354  1.00 37.06  ? 19  GLU I CA  1 
ATOM   2568 C C   . GLU C 3 19  ? -11.162 40.005  83.008  1.00 33.49  ? 19  GLU I C   1 
ATOM   2569 O O   . GLU C 3 19  ? -11.912 39.028  83.024  1.00 33.49  ? 19  GLU I O   1 
ATOM   2570 C CB  . GLU C 3 19  ? -11.241 41.291  80.862  1.00 43.80  ? 19  GLU I CB  1 
ATOM   2571 C CG  . GLU C 3 19  ? -12.063 42.254  80.014  1.00 53.34  ? 19  GLU I CG  1 
ATOM   2572 C CD  . GLU C 3 19  ? -11.908 42.001  78.519  1.00 60.55  ? 19  GLU I CD  1 
ATOM   2573 O OE1 . GLU C 3 19  ? -10.833 42.312  77.961  1.00 63.58  ? 19  GLU I OE1 1 
ATOM   2574 O OE2 . GLU C 3 19  ? -12.866 41.492  77.900  1.00 61.88  ? 19  GLU I OE2 1 
ATOM   2575 N N   . PHE C 3 20  ? -9.949  39.999  83.551  1.00 29.44  ? 20  PHE I N   1 
ATOM   2576 C CA  . PHE C 3 20  ? -9.454  38.820  84.221  1.00 29.08  ? 20  PHE I CA  1 
ATOM   2577 C C   . PHE C 3 20  ? -9.932  38.760  85.659  1.00 27.57  ? 20  PHE I C   1 
ATOM   2578 O O   . PHE C 3 20  ? -10.490 37.752  86.078  1.00 32.45  ? 20  PHE I O   1 
ATOM   2579 C CB  . PHE C 3 20  ? -7.933  38.748  84.203  1.00 27.85  ? 20  PHE I CB  1 
ATOM   2580 C CG  . PHE C 3 20  ? -7.402  37.523  84.885  1.00 33.03  ? 20  PHE I CG  1 
ATOM   2581 C CD1 . PHE C 3 20  ? -7.269  37.483  86.275  1.00 32.82  ? 20  PHE I CD1 1 
ATOM   2582 C CD2 . PHE C 3 20  ? -7.117  36.378  84.153  1.00 32.88  ? 20  PHE I CD2 1 
ATOM   2583 C CE1 . PHE C 3 20  ? -6.869  36.322  86.921  1.00 30.12  ? 20  PHE I CE1 1 
ATOM   2584 C CE2 . PHE C 3 20  ? -6.714  35.210  84.793  1.00 30.89  ? 20  PHE I CE2 1 
ATOM   2585 C CZ  . PHE C 3 20  ? -6.592  35.185  86.182  1.00 31.31  ? 20  PHE I CZ  1 
ATOM   2586 N N   . PHE C 3 21  ? -9.638  39.798  86.436  1.00 25.25  ? 21  PHE I N   1 
ATOM   2587 C CA  . PHE C 3 21  ? -10.052 39.827  87.834  1.00 24.46  ? 21  PHE I CA  1 
ATOM   2588 C C   . PHE C 3 21  ? -11.534 40.111  87.959  1.00 27.15  ? 21  PHE I C   1 
ATOM   2589 O O   . PHE C 3 21  ? -11.965 41.165  88.437  1.00 25.39  ? 21  PHE I O   1 
ATOM   2590 C CB  . PHE C 3 21  ? -9.220  40.815  88.641  1.00 17.35  ? 21  PHE I CB  1 
ATOM   2591 C CG  . PHE C 3 21  ? -7.787  40.440  88.715  1.00 20.68  ? 21  PHE I CG  1 
ATOM   2592 C CD1 . PHE C 3 21  ? -7.392  39.319  89.436  1.00 25.69  ? 21  PHE I CD1 1 
ATOM   2593 C CD2 . PHE C 3 21  ? -6.828  41.171  88.029  1.00 18.89  ? 21  PHE I CD2 1 
ATOM   2594 C CE1 . PHE C 3 21  ? -6.057  38.930  89.469  1.00 29.36  ? 21  PHE I CE1 1 
ATOM   2595 C CE2 . PHE C 3 21  ? -5.491  40.791  88.055  1.00 20.72  ? 21  PHE I CE2 1 
ATOM   2596 C CZ  . PHE C 3 21  ? -5.103  39.669  88.775  1.00 25.80  ? 21  PHE I CZ  1 
ATOM   2597 N N   . ASN C 3 22  ? -12.302 39.121  87.534  1.00 28.93  ? 22  ASN I N   1 
ATOM   2598 C CA  . ASN C 3 22  ? -13.745 39.168  87.551  1.00 32.41  ? 22  ASN I CA  1 
ATOM   2599 C C   . ASN C 3 22  ? -14.179 37.730  87.339  1.00 30.76  ? 22  ASN I C   1 
ATOM   2600 O O   . ASN C 3 22  ? -13.676 37.055  86.444  1.00 30.75  ? 22  ASN I O   1 
ATOM   2601 C CB  . ASN C 3 22  ? -14.249 40.047  86.404  1.00 39.70  ? 22  ASN I CB  1 
ATOM   2602 C CG  . ASN C 3 22  ? -15.762 40.072  86.304  1.00 48.05  ? 22  ASN I CG  1 
ATOM   2603 O OD1 . ASN C 3 22  ? -16.467 40.123  87.318  1.00 54.64  ? 22  ASN I OD1 1 
ATOM   2604 N ND2 . ASN C 3 22  ? -16.271 40.045  85.077  1.00 49.60  ? 22  ASN I ND2 1 
ATOM   2605 N N   . GLY C 3 23  ? -15.043 37.233  88.213  1.00 32.64  ? 23  GLY I N   1 
ATOM   2606 C CA  . GLY C 3 23  ? -15.520 35.868  88.073  1.00 32.53  ? 23  GLY I CA  1 
ATOM   2607 C C   . GLY C 3 23  ? -14.733 34.792  88.800  1.00 29.87  ? 23  GLY I C   1 
ATOM   2608 O O   . GLY C 3 23  ? -14.059 35.048  89.802  1.00 27.17  ? 23  GLY I O   1 
ATOM   2609 N N   . THR C 3 24  ? -14.830 33.575  88.279  1.00 30.14  ? 24  THR I N   1 
ATOM   2610 C CA  . THR C 3 24  ? -14.165 32.421  88.860  1.00 28.49  ? 24  THR I CA  1 
ATOM   2611 C C   . THR C 3 24  ? -13.270 31.712  87.845  1.00 27.91  ? 24  THR I C   1 
ATOM   2612 O O   . THR C 3 24  ? -13.645 31.521  86.690  1.00 26.57  ? 24  THR I O   1 
ATOM   2613 C CB  . THR C 3 24  ? -15.207 31.406  89.405  1.00 25.63  ? 24  THR I CB  1 
ATOM   2614 O OG1 . THR C 3 24  ? -16.103 32.071  90.312  1.00 29.97  ? 24  THR I OG1 1 
ATOM   2615 C CG2 . THR C 3 24  ? -14.517 30.253  90.126  1.00 15.31  ? 24  THR I CG2 1 
ATOM   2616 N N   . TRP C 3 25  ? -12.072 31.357  88.295  1.00 30.23  ? 25  TRP I N   1 
ATOM   2617 C CA  . TRP C 3 25  ? -11.096 30.641  87.488  1.00 27.28  ? 25  TRP I CA  1 
ATOM   2618 C C   . TRP C 3 25  ? -10.740 29.422  88.313  1.00 27.69  ? 25  TRP I C   1 
ATOM   2619 O O   . TRP C 3 25  ? -10.644 29.504  89.537  1.00 29.93  ? 25  TRP I O   1 
ATOM   2620 C CB  . TRP C 3 25  ? -9.828  31.467  87.289  1.00 24.61  ? 25  TRP I CB  1 
ATOM   2621 C CG  . TRP C 3 25  ? -9.979  32.664  86.405  1.00 28.99  ? 25  TRP I CG  1 
ATOM   2622 C CD1 . TRP C 3 25  ? -10.138 33.963  86.802  1.00 30.14  ? 25  TRP I CD1 1 
ATOM   2623 C CD2 . TRP C 3 25  ? -9.885  32.692  84.973  1.00 27.41  ? 25  TRP I CD2 1 
ATOM   2624 N NE1 . TRP C 3 25  ? -10.135 34.797  85.708  1.00 27.77  ? 25  TRP I NE1 1 
ATOM   2625 C CE2 . TRP C 3 25  ? -9.977  34.042  84.574  1.00 31.02  ? 25  TRP I CE2 1 
ATOM   2626 C CE3 . TRP C 3 25  ? -9.723  31.708  83.990  1.00 26.90  ? 25  TRP I CE3 1 
ATOM   2627 C CZ2 . TRP C 3 25  ? -9.907  34.430  83.230  1.00 30.43  ? 25  TRP I CZ2 1 
ATOM   2628 C CZ3 . TRP C 3 25  ? -9.655  32.096  82.657  1.00 19.76  ? 25  TRP I CZ3 1 
ATOM   2629 C CH2 . TRP C 3 25  ? -9.745  33.444  82.292  1.00 18.80  ? 25  TRP I CH2 1 
ATOM   2630 N N   . TYR C 3 26  ? -10.593 28.286  87.653  1.00 26.21  ? 26  TYR I N   1 
ATOM   2631 C CA  . TYR C 3 26  ? -10.224 27.046  88.318  1.00 18.49  ? 26  TYR I CA  1 
ATOM   2632 C C   . TYR C 3 26  ? -8.802  26.729  87.893  1.00 13.76  ? 26  TYR I C   1 
ATOM   2633 O O   . TYR C 3 26  ? -8.459  26.860  86.730  1.00 14.05  ? 26  TYR I O   1 
ATOM   2634 C CB  . TYR C 3 26  ? -11.175 25.927  87.912  1.00 12.74  ? 26  TYR I CB  1 
ATOM   2635 C CG  . TYR C 3 26  ? -12.560 26.080  88.487  1.00 7.06   ? 26  TYR I CG  1 
ATOM   2636 C CD1 . TYR C 3 26  ? -13.529 26.831  87.831  1.00 10.66  ? 26  TYR I CD1 1 
ATOM   2637 C CD2 . TYR C 3 26  ? -12.907 25.449  89.677  1.00 8.48   ? 26  TYR I CD2 1 
ATOM   2638 C CE1 . TYR C 3 26  ? -14.818 26.946  88.346  1.00 12.19  ? 26  TYR I CE1 1 
ATOM   2639 C CE2 . TYR C 3 26  ? -14.180 25.552  90.201  1.00 10.58  ? 26  TYR I CE2 1 
ATOM   2640 C CZ  . TYR C 3 26  ? -15.135 26.298  89.532  1.00 17.99  ? 26  TYR I CZ  1 
ATOM   2641 O OH  . TYR C 3 26  ? -16.417 26.355  90.039  1.00 25.11  ? 26  TYR I OH  1 
ATOM   2642 N N   . LEU C 3 27  ? -7.976  26.314  88.838  1.00 15.86  ? 27  LEU I N   1 
ATOM   2643 C CA  . LEU C 3 27  ? -6.583  26.023  88.555  1.00 20.14  ? 27  LEU I CA  1 
ATOM   2644 C C   . LEU C 3 27  ? -6.135  24.696  89.178  1.00 25.24  ? 27  LEU I C   1 
ATOM   2645 O O   . LEU C 3 27  ? -6.041  24.579  90.398  1.00 27.69  ? 27  LEU I O   1 
ATOM   2646 C CB  . LEU C 3 27  ? -5.741  27.198  89.064  1.00 11.23  ? 27  LEU I CB  1 
ATOM   2647 C CG  . LEU C 3 27  ? -4.261  27.087  89.405  1.00 7.33   ? 27  LEU I CG  1 
ATOM   2648 C CD1 . LEU C 3 27  ? -3.435  26.721  88.197  1.00 9.93   ? 27  LEU I CD1 1 
ATOM   2649 C CD2 . LEU C 3 27  ? -3.820  28.426  89.946  1.00 14.65  ? 27  LEU I CD2 1 
ATOM   2650 N N   . ALA C 3 28  ? -5.893  23.692  88.336  1.00 24.65  ? 28  ALA I N   1 
ATOM   2651 C CA  . ALA C 3 28  ? -5.455  22.380  88.803  1.00 21.99  ? 28  ALA I CA  1 
ATOM   2652 C C   . ALA C 3 28  ? -3.977  22.231  88.530  1.00 22.92  ? 28  ALA I C   1 
ATOM   2653 O O   . ALA C 3 28  ? -3.451  22.798  87.570  1.00 26.06  ? 28  ALA I O   1 
ATOM   2654 C CB  . ALA C 3 28  ? -6.221  21.281  88.106  1.00 21.06  ? 28  ALA I CB  1 
ATOM   2655 N N   . HIS C 3 29  ? -3.304  21.464  89.378  1.00 25.25  ? 29  HIS I N   1 
ATOM   2656 C CA  . HIS C 3 29  ? -1.868  21.254  89.215  1.00 28.55  ? 29  HIS I CA  1 
ATOM   2657 C C   . HIS C 3 29  ? -1.533  19.962  88.494  1.00 33.48  ? 29  HIS I C   1 
ATOM   2658 O O   . HIS C 3 29  ? -0.370  19.592  88.375  1.00 38.38  ? 29  HIS I O   1 
ATOM   2659 C CB  . HIS C 3 29  ? -1.155  21.322  90.570  1.00 21.99  ? 29  HIS I CB  1 
ATOM   2660 C CG  . HIS C 3 29  ? -0.977  22.715  91.083  1.00 8.25   ? 29  HIS I CG  1 
ATOM   2661 N ND1 . HIS C 3 29  ? 0.260   23.294  91.248  1.00 13.87  ? 29  HIS I ND1 1 
ATOM   2662 C CD2 . HIS C 3 29  ? -1.881  23.654  91.453  1.00 8.88   ? 29  HIS I CD2 1 
ATOM   2663 C CE1 . HIS C 3 29  ? 0.116   24.527  91.700  1.00 11.87  ? 29  HIS I CE1 1 
ATOM   2664 N NE2 . HIS C 3 29  ? -1.176  24.769  91.831  1.00 5.44   ? 29  HIS I NE2 1 
ATOM   2665 N N   . GLY C 3 30  ? -2.566  19.304  87.987  1.00 39.51  ? 30  GLY I N   1 
ATOM   2666 C CA  . GLY C 3 30  ? -2.391  18.054  87.272  1.00 41.52  ? 30  GLY I CA  1 
ATOM   2667 C C   . GLY C 3 30  ? -3.752  17.520  86.885  1.00 43.88  ? 30  GLY I C   1 
ATOM   2668 O O   . GLY C 3 30  ? -4.752  17.908  87.489  1.00 47.58  ? 30  GLY I O   1 
ATOM   2669 N N   . PRO C 3 31  ? -3.827  16.629  85.889  1.00 45.49  ? 31  PRO I N   1 
ATOM   2670 C CA  . PRO C 3 31  ? -5.105  16.063  85.448  1.00 49.64  ? 31  PRO I CA  1 
ATOM   2671 C C   . PRO C 3 31  ? -5.874  15.392  86.584  1.00 54.72  ? 31  PRO I C   1 
ATOM   2672 O O   . PRO C 3 31  ? -7.024  15.743  86.864  1.00 57.62  ? 31  PRO I O   1 
ATOM   2673 C CB  . PRO C 3 31  ? -4.673  15.036  84.405  1.00 49.00  ? 31  PRO I CB  1 
ATOM   2674 C CG  . PRO C 3 31  ? -3.411  15.636  83.841  1.00 48.18  ? 31  PRO I CG  1 
ATOM   2675 C CD  . PRO C 3 31  ? -2.710  16.109  85.082  1.00 46.68  ? 31  PRO I CD  1 
ATOM   2676 N N   . GLY C 3 32  ? -5.204  14.458  87.257  1.00 54.97  ? 32  GLY I N   1 
ATOM   2677 C CA  . GLY C 3 32  ? -5.816  13.709  88.342  1.00 54.30  ? 32  GLY I CA  1 
ATOM   2678 C C   . GLY C 3 32  ? -6.089  14.406  89.661  1.00 52.92  ? 32  GLY I C   1 
ATOM   2679 O O   . GLY C 3 32  ? -7.226  14.384  90.137  1.00 51.88  ? 32  GLY I O   1 
ATOM   2680 N N   . VAL C 3 33  ? -5.052  14.977  90.274  1.00 50.71  ? 33  VAL I N   1 
ATOM   2681 C CA  . VAL C 3 33  ? -5.187  15.657  91.566  1.00 49.85  ? 33  VAL I CA  1 
ATOM   2682 C C   . VAL C 3 33  ? -6.494  16.406  91.763  1.00 48.68  ? 33  VAL I C   1 
ATOM   2683 O O   . VAL C 3 33  ? -6.908  17.205  90.925  1.00 49.56  ? 33  VAL I O   1 
ATOM   2684 C CB  . VAL C 3 33  ? -4.034  16.642  91.846  1.00 48.69  ? 33  VAL I CB  1 
ATOM   2685 C CG1 . VAL C 3 33  ? -2.797  15.893  92.337  1.00 46.92  ? 33  VAL I CG1 1 
ATOM   2686 C CG2 . VAL C 3 33  ? -3.731  17.465  90.600  1.00 47.84  ? 33  VAL I CG2 1 
ATOM   2687 N N   . THR C 3 34  ? -7.125  16.147  92.898  1.00 47.41  ? 34  THR I N   1 
ATOM   2688 C CA  . THR C 3 34  ? -8.382  16.789  93.228  1.00 46.72  ? 34  THR I CA  1 
ATOM   2689 C C   . THR C 3 34  ? -8.374  17.216  94.693  1.00 44.43  ? 34  THR I C   1 
ATOM   2690 O O   . THR C 3 34  ? -9.340  17.797  95.192  1.00 43.11  ? 34  THR I O   1 
ATOM   2691 C CB  . THR C 3 34  ? -9.557  15.844  92.949  1.00 48.93  ? 34  THR I CB  1 
ATOM   2692 O OG1 . THR C 3 34  ? -10.785 16.488  93.306  1.00 58.49  ? 34  THR I OG1 1 
ATOM   2693 C CG2 . THR C 3 34  ? -9.400  14.549  93.732  1.00 50.01  ? 34  THR I CG2 1 
ATOM   2694 N N   . SER C 3 35  ? -7.242  16.998  95.354  1.00 42.51  ? 35  SER I N   1 
ATOM   2695 C CA  . SER C 3 35  ? -7.103  17.344  96.759  1.00 40.00  ? 35  SER I CA  1 
ATOM   2696 C C   . SER C 3 35  ? -5.667  17.771  97.022  1.00 36.83  ? 35  SER I C   1 
ATOM   2697 O O   . SER C 3 35  ? -4.734  17.165  96.489  1.00 37.70  ? 35  SER I O   1 
ATOM   2698 C CB  . SER C 3 35  ? -7.432  16.120  97.620  1.00 47.11  ? 35  SER I CB  1 
ATOM   2699 O OG  . SER C 3 35  ? -8.585  15.440  97.140  1.00 55.93  ? 35  SER I OG  1 
ATOM   2700 N N   . PRO C 3 36  ? -5.469  18.853  97.798  1.00 31.78  ? 36  PRO I N   1 
ATOM   2701 C CA  . PRO C 3 36  ? -6.515  19.674  98.417  1.00 30.09  ? 36  PRO I CA  1 
ATOM   2702 C C   . PRO C 3 36  ? -7.136  20.649  97.424  1.00 29.40  ? 36  PRO I C   1 
ATOM   2703 O O   . PRO C 3 36  ? -6.474  21.077  96.480  1.00 32.75  ? 36  PRO I O   1 
ATOM   2704 C CB  . PRO C 3 36  ? -5.749  20.418  99.511  1.00 27.38  ? 36  PRO I CB  1 
ATOM   2705 C CG  . PRO C 3 36  ? -4.407  20.581  98.928  1.00 25.38  ? 36  PRO I CG  1 
ATOM   2706 C CD  . PRO C 3 36  ? -4.144  19.226  98.328  1.00 26.24  ? 36  PRO I CD  1 
ATOM   2707 N N   . ALA C 3 37  ? -8.404  20.992  97.628  1.00 25.71  ? 37  ALA I N   1 
ATOM   2708 C CA  . ALA C 3 37  ? -8.952  22.219  97.055  1.00 25.23  ? 37  ALA I CA  1 
ATOM   2709 C C   . ALA C 3 37  ? -8.864  23.397  98.043  1.00 28.91  ? 37  ALA I C   1 
ATOM   2710 O O   . ALA C 3 37  ? -9.018  23.217  99.253  1.00 34.82  ? 37  ALA I O   1 
ATOM   2711 C CB  . ALA C 3 37  ? -10.387 21.994  96.601  1.00 16.52  ? 37  ALA I CB  1 
ATOM   2712 N N   . VAL C 3 38  ? -8.598  24.593  97.520  1.00 25.02  ? 38  VAL I N   1 
ATOM   2713 C CA  . VAL C 3 38  ? -8.477  25.808  98.324  1.00 17.05  ? 38  VAL I CA  1 
ATOM   2714 C C   . VAL C 3 38  ? -9.069  27.005  97.546  1.00 19.64  ? 38  VAL I C   1 
ATOM   2715 O O   . VAL C 3 38  ? -8.763  27.190  96.374  1.00 24.55  ? 38  VAL I O   1 
ATOM   2716 C CB  . VAL C 3 38  ? -6.980  26.032  98.677  1.00 13.71  ? 38  VAL I CB  1 
ATOM   2717 C CG1 . VAL C 3 38  ? -6.502  27.398  98.259  1.00 21.56  ? 38  VAL I CG1 1 
ATOM   2718 C CG2 . VAL C 3 38  ? -6.748  25.822  100.153 1.00 10.97  ? 38  VAL I CG2 1 
ATOM   2719 N N   . CYS C 3 39  ? -9.972  27.765  98.156  1.00 20.18  ? 39  CYS I N   1 
ATOM   2720 C CA  . CYS C 3 39  ? -10.552 28.916  97.467  1.00 22.79  ? 39  CYS I CA  1 
ATOM   2721 C C   . CYS C 3 39  ? -9.880  30.211  97.894  1.00 26.48  ? 39  CYS I C   1 
ATOM   2722 O O   . CYS C 3 39  ? -9.781  30.512  99.086  1.00 27.13  ? 39  CYS I O   1 
ATOM   2723 C CB  . CYS C 3 39  ? -12.056 29.039  97.716  1.00 29.71  ? 39  CYS I CB  1 
ATOM   2724 S SG  . CYS C 3 39  ? -12.767 30.555  96.981  1.00 26.56  ? 39  CYS I SG  1 
ATOM   2725 N N   . GLN C 3 40  ? -9.434  30.982  96.909  1.00 27.09  ? 40  GLN I N   1 
ATOM   2726 C CA  . GLN C 3 40  ? -8.765  32.253  97.150  1.00 22.83  ? 40  GLN I CA  1 
ATOM   2727 C C   . GLN C 3 40  ? -9.617  33.355  96.555  1.00 27.00  ? 40  GLN I C   1 
ATOM   2728 O O   . GLN C 3 40  ? -9.993  33.281  95.387  1.00 33.53  ? 40  GLN I O   1 
ATOM   2729 C CB  . GLN C 3 40  ? -7.391  32.258  96.479  1.00 10.96  ? 40  GLN I CB  1 
ATOM   2730 C CG  . GLN C 3 40  ? -6.458  31.177  96.988  1.00 6.80   ? 40  GLN I CG  1 
ATOM   2731 C CD  . GLN C 3 40  ? -5.398  30.781  95.982  1.00 17.50  ? 40  GLN I CD  1 
ATOM   2732 O OE1 . GLN C 3 40  ? -4.818  29.702  96.077  1.00 31.31  ? 40  GLN I OE1 1 
ATOM   2733 N NE2 . GLN C 3 40  ? -5.131  31.649  95.018  1.00 17.50  ? 40  GLN I NE2 1 
ATOM   2734 N N   . LYS C 3 41  ? -9.947  34.357  97.358  1.00 25.63  ? 41  LYS I N   1 
ATOM   2735 C CA  . LYS C 3 41  ? -10.742 35.474  96.882  1.00 26.13  ? 41  LYS I CA  1 
ATOM   2736 C C   . LYS C 3 41  ? -9.821  36.653  96.674  1.00 26.78  ? 41  LYS I C   1 
ATOM   2737 O O   . LYS C 3 41  ? -9.113  37.069  97.586  1.00 28.57  ? 41  LYS I O   1 
ATOM   2738 C CB  . LYS C 3 41  ? -11.855 35.790  97.872  1.00 28.89  ? 41  LYS I CB  1 
ATOM   2739 C CG  . LYS C 3 41  ? -12.882 34.676  97.903  1.00 37.41  ? 41  LYS I CG  1 
ATOM   2740 C CD  . LYS C 3 41  ? -13.747 34.661  99.149  1.00 40.80  ? 41  LYS I CD  1 
ATOM   2741 C CE  . LYS C 3 41  ? -14.689 33.465  99.087  1.00 44.40  ? 41  LYS I CE  1 
ATOM   2742 N NZ  . LYS C 3 41  ? -15.560 33.310  100.277 1.00 42.47  ? 41  LYS I NZ  1 
ATOM   2743 N N   . PHE C 3 42  ? -9.752  37.111  95.431  1.00 30.32  ? 42  PHE I N   1 
ATOM   2744 C CA  . PHE C 3 42  ? -8.899  38.228  95.058  1.00 32.95  ? 42  PHE I CA  1 
ATOM   2745 C C   . PHE C 3 42  ? -9.677  39.526  94.920  1.00 37.72  ? 42  PHE I C   1 
ATOM   2746 O O   . PHE C 3 42  ? -10.826 39.546  94.468  1.00 36.84  ? 42  PHE I O   1 
ATOM   2747 C CB  . PHE C 3 42  ? -8.164  37.937  93.738  1.00 25.92  ? 42  PHE I CB  1 
ATOM   2748 C CG  . PHE C 3 42  ? -7.020  36.976  93.873  1.00 19.40  ? 42  PHE I CG  1 
ATOM   2749 C CD1 . PHE C 3 42  ? -7.244  35.630  94.151  1.00 20.06  ? 42  PHE I CD1 1 
ATOM   2750 C CD2 . PHE C 3 42  ? -5.716  37.414  93.733  1.00 18.13  ? 42  PHE I CD2 1 
ATOM   2751 C CE1 . PHE C 3 42  ? -6.180  34.737  94.291  1.00 15.30  ? 42  PHE I CE1 1 
ATOM   2752 C CE2 . PHE C 3 42  ? -4.646  36.529  93.871  1.00 20.55  ? 42  PHE I CE2 1 
ATOM   2753 C CZ  . PHE C 3 42  ? -4.881  35.185  94.152  1.00 11.73  ? 42  PHE I CZ  1 
ATOM   2754 N N   . THR C 3 43  ? -9.034  40.607  95.327  1.00 41.83  ? 43  THR I N   1 
ATOM   2755 C CA  . THR C 3 43  ? -9.613  41.925  95.230  1.00 46.96  ? 43  THR I CA  1 
ATOM   2756 C C   . THR C 3 43  ? -8.527  42.860  94.689  1.00 51.74  ? 43  THR I C   1 
ATOM   2757 O O   . THR C 3 43  ? -7.445  43.014  95.279  1.00 50.46  ? 43  THR I O   1 
ATOM   2758 C CB  . THR C 3 43  ? -10.227 42.378  96.592  1.00 47.84  ? 43  THR I CB  1 
ATOM   2759 O OG1 . THR C 3 43  ? -10.377 43.802  96.629  1.00 51.80  ? 43  THR I OG1 1 
ATOM   2760 C CG2 . THR C 3 43  ? -9.385  41.909  97.758  1.00 51.66  ? 43  THR I CG2 1 
ATOM   2761 N N   . THR C 3 44  ? -8.780  43.364  93.485  1.00 59.65  ? 44  THR I N   1 
ATOM   2762 C CA  . THR C 3 44  ? -7.866  44.265  92.798  1.00 65.85  ? 44  THR I CA  1 
ATOM   2763 C C   . THR C 3 44  ? -8.009  45.660  93.390  1.00 70.33  ? 44  THR I C   1 
ATOM   2764 O O   . THR C 3 44  ? -9.126  46.151  93.589  1.00 70.32  ? 44  THR I O   1 
ATOM   2765 C CB  . THR C 3 44  ? -8.154  44.299  91.268  1.00 66.87  ? 44  THR I CB  1 
ATOM   2766 O OG1 . THR C 3 44  ? -7.240  45.189  90.612  1.00 71.05  ? 44  THR I OG1 1 
ATOM   2767 C CG2 . THR C 3 44  ? -9.582  44.750  90.987  1.00 65.91  ? 44  THR I CG2 1 
ATOM   2768 N N   . SER C 3 45  ? -6.878  46.283  93.699  1.00 76.37  ? 45  SER I N   1 
ATOM   2769 C CA  . SER C 3 45  ? -6.877  47.622  94.266  1.00 81.84  ? 45  SER I CA  1 
ATOM   2770 C C   . SER C 3 45  ? -7.378  48.594  93.203  1.00 86.22  ? 45  SER I C   1 
ATOM   2771 O O   . SER C 3 45  ? -6.601  49.149  92.424  1.00 86.80  ? 45  SER I O   1 
ATOM   2772 C CB  . SER C 3 45  ? -5.473  47.996  94.747  1.00 79.75  ? 45  SER I CB  1 
ATOM   2773 O OG  . SER C 3 45  ? -5.029  47.068  95.724  0.00 80.57  ? 45  SER I OG  1 
ATOM   2774 N N   . GLY C 3 46  ? -8.700  48.724  93.142  1.00 91.91  ? 46  GLY I N   1 
ATOM   2775 C CA  . GLY C 3 46  ? -9.338  49.604  92.182  1.00 96.35  ? 46  GLY I CA  1 
ATOM   2776 C C   . GLY C 3 46  ? -10.825 49.318  92.077  1.00 98.42  ? 46  GLY I C   1 
ATOM   2777 O O   . GLY C 3 46  ? -11.597 49.655  92.979  1.00 99.71  ? 46  GLY I O   1 
ATOM   2778 N N   . SER C 3 47  ? -11.219 48.644  91.003  0.00 98.97  ? 47  SER I N   1 
ATOM   2779 C CA  . SER C 3 47  ? -12.618 48.311  90.763  0.00 99.31  ? 47  SER I CA  1 
ATOM   2780 C C   . SER C 3 47  ? -13.079 46.986  91.381  0.00 99.26  ? 47  SER I C   1 
ATOM   2781 O O   . SER C 3 47  ? -13.745 46.183  90.722  0.00 99.32  ? 47  SER I O   1 
ATOM   2782 C CB  . SER C 3 47  ? -12.898 48.330  89.257  0.00 99.11  ? 47  SER I CB  1 
ATOM   2783 O OG  . SER C 3 47  ? -11.785 47.837  88.527  0.00 99.02  ? 47  SER I OG  1 
ATOM   2784 N N   . LYS C 3 48  ? -12.744 46.776  92.652  0.00 99.80  ? 48  LYS I N   1 
ATOM   2785 C CA  . LYS C 3 48  ? -13.123 45.564  93.384  0.00 99.91  ? 48  LYS I CA  1 
ATOM   2786 C C   . LYS C 3 48  ? -12.584 44.282  92.744  0.00 99.31  ? 48  LYS I C   1 
ATOM   2787 O O   . LYS C 3 48  ? -11.557 43.755  93.171  0.00 99.49  ? 48  LYS I O   1 
ATOM   2788 C CB  . LYS C 3 48  ? -14.649 45.484  93.523  0.00 101.11 ? 48  LYS I CB  1 
ATOM   2789 C CG  . LYS C 3 48  ? -15.155 44.328  94.374  0.00 102.87 ? 48  LYS I CG  1 
ATOM   2790 C CD  . LYS C 3 48  ? -16.659 44.148  94.216  0.00 104.57 ? 48  LYS I CD  1 
ATOM   2791 C CE  . LYS C 3 48  ? -17.424 45.406  94.604  0.00 105.60 ? 48  LYS I CE  1 
ATOM   2792 N NZ  . LYS C 3 48  ? -18.880 45.275  94.326  0.00 106.06 ? 48  LYS I NZ  1 
ATOM   2793 N N   . GLY C 3 49  ? -13.286 43.784  91.729  1.00 98.54  ? 49  GLY I N   1 
ATOM   2794 C CA  . GLY C 3 49  ? -12.866 42.569  91.048  1.00 96.48  ? 49  GLY I CA  1 
ATOM   2795 C C   . GLY C 3 49  ? -12.724 41.346  91.937  1.00 93.47  ? 49  GLY I C   1 
ATOM   2796 O O   . GLY C 3 49  ? -11.688 40.675  91.921  1.00 94.62  ? 49  GLY I O   1 
ATOM   2797 N N   . PHE C 3 50  ? -13.773 41.049  92.700  1.00 88.76  ? 50  PHE I N   1 
ATOM   2798 C CA  . PHE C 3 50  ? -13.798 39.901  93.607  1.00 80.34  ? 50  PHE I CA  1 
ATOM   2799 C C   . PHE C 3 50  ? -13.731 38.614  92.784  1.00 72.19  ? 50  PHE I C   1 
ATOM   2800 O O   . PHE C 3 50  ? -14.757 38.020  92.443  1.00 73.59  ? 50  PHE I O   1 
ATOM   2801 C CB  . PHE C 3 50  ? -15.082 39.944  94.442  1.00 83.68  ? 50  PHE I CB  1 
ATOM   2802 C CG  . PHE C 3 50  ? -15.171 38.877  95.494  0.50 86.33  ? 50  PHE I CG  1 
ATOM   2803 C CD1 . PHE C 3 50  ? -14.453 38.989  96.681  0.50 87.81  ? 50  PHE I CD1 1 
ATOM   2804 C CD2 . PHE C 3 50  ? -16.017 37.783  95.322  0.50 88.13  ? 50  PHE I CD2 1 
ATOM   2805 C CE1 . PHE C 3 50  ? -14.580 38.030  97.683  0.50 89.03  ? 50  PHE I CE1 1 
ATOM   2806 C CE2 . PHE C 3 50  ? -16.151 36.819  96.317  0.50 89.28  ? 50  PHE I CE2 1 
ATOM   2807 C CZ  . PHE C 3 50  ? -15.433 36.944  97.499  0.50 89.47  ? 50  PHE I CZ  1 
ATOM   2808 N N   . THR C 3 51  ? -12.513 38.208  92.450  1.00 62.17  ? 51  THR I N   1 
ATOM   2809 C CA  . THR C 3 51  ? -12.284 37.011  91.652  1.00 49.14  ? 51  THR I CA  1 
ATOM   2810 C C   . THR C 3 51  ? -12.025 35.819  92.549  1.00 43.66  ? 51  THR I C   1 
ATOM   2811 O O   . THR C 3 51  ? -11.271 35.917  93.515  1.00 41.68  ? 51  THR I O   1 
ATOM   2812 C CB  . THR C 3 51  ? -11.066 37.185  90.762  1.00 44.24  ? 51  THR I CB  1 
ATOM   2813 O OG1 . THR C 3 51  ? -11.050 38.519  90.244  1.00 41.35  ? 51  THR I OG1 1 
ATOM   2814 C CG2 . THR C 3 51  ? -11.113 36.196  89.610  1.00 45.28  ? 51  THR I CG2 1 
ATOM   2815 N N   . GLN C 3 52  ? -12.648 34.693  92.234  1.00 38.80  ? 52  GLN I N   1 
ATOM   2816 C CA  . GLN C 3 52  ? -12.457 33.488  93.023  1.00 33.88  ? 52  GLN I CA  1 
ATOM   2817 C C   . GLN C 3 52  ? -11.597 32.514  92.236  1.00 32.68  ? 52  GLN I C   1 
ATOM   2818 O O   . GLN C 3 52  ? -11.982 32.073  91.149  1.00 34.02  ? 52  GLN I O   1 
ATOM   2819 C CB  . GLN C 3 52  ? -13.795 32.832  93.348  1.00 34.23  ? 52  GLN I CB  1 
ATOM   2820 C CG  . GLN C 3 52  ? -14.812 33.757  93.980  1.00 38.72  ? 52  GLN I CG  1 
ATOM   2821 C CD  . GLN C 3 52  ? -16.145 33.075  94.186  1.00 43.77  ? 52  GLN I CD  1 
ATOM   2822 O OE1 . GLN C 3 52  ? -16.671 32.419  93.284  1.00 46.68  ? 52  GLN I OE1 1 
ATOM   2823 N NE2 . GLN C 3 52  ? -16.695 33.213  95.382  1.00 51.49  ? 52  GLN I NE2 1 
ATOM   2824 N N   . ILE C 3 53  ? -10.402 32.244  92.745  1.00 27.47  ? 53  ILE I N   1 
ATOM   2825 C CA  . ILE C 3 53  ? -9.496  31.309  92.103  1.00 23.39  ? 53  ILE I CA  1 
ATOM   2826 C C   . ILE C 3 53  ? -9.591  30.052  92.955  1.00 24.47  ? 53  ILE I C   1 
ATOM   2827 O O   . ILE C 3 53  ? -9.353  30.097  94.159  1.00 27.86  ? 53  ILE I O   1 
ATOM   2828 C CB  . ILE C 3 53  ? -8.027  31.796  92.127  1.00 23.52  ? 53  ILE I CB  1 
ATOM   2829 C CG1 . ILE C 3 53  ? -7.900  33.225  91.573  1.00 25.91  ? 53  ILE I CG1 1 
ATOM   2830 C CG2 . ILE C 3 53  ? -7.145  30.826  91.353  1.00 26.51  ? 53  ILE I CG2 1 
ATOM   2831 C CD1 . ILE C 3 53  ? -7.673  33.332  90.088  1.00 25.49  ? 53  ILE I CD1 1 
ATOM   2832 N N   . VAL C 3 54  ? -10.046 28.962  92.358  1.00 22.56  ? 54  VAL I N   1 
ATOM   2833 C CA  . VAL C 3 54  ? -10.148 27.701  93.066  1.00 15.40  ? 54  VAL I CA  1 
ATOM   2834 C C   . VAL C 3 54  ? -8.921  26.914  92.626  1.00 15.88  ? 54  VAL I C   1 
ATOM   2835 O O   . VAL C 3 54  ? -8.812  26.550  91.460  1.00 16.56  ? 54  VAL I O   1 
ATOM   2836 C CB  . VAL C 3 54  ? -11.441 26.952  92.686  1.00 9.55   ? 54  VAL I CB  1 
ATOM   2837 C CG1 . VAL C 3 54  ? -11.463 25.577  93.307  1.00 10.04  ? 54  VAL I CG1 1 
ATOM   2838 C CG2 . VAL C 3 54  ? -12.648 27.740  93.148  1.00 6.41   ? 54  VAL I CG2 1 
ATOM   2839 N N   . GLU C 3 55  ? -7.969  26.729  93.537  1.00 11.47  ? 55  GLU I N   1 
ATOM   2840 C CA  . GLU C 3 55  ? -6.741  26.004  93.235  1.00 9.70   ? 55  GLU I CA  1 
ATOM   2841 C C   . GLU C 3 55  ? -6.813  24.567  93.729  1.00 13.33  ? 55  GLU I C   1 
ATOM   2842 O O   . GLU C 3 55  ? -7.168  24.321  94.876  1.00 19.05  ? 55  GLU I O   1 
ATOM   2843 C CB  . GLU C 3 55  ? -5.540  26.719  93.849  1.00 2.31   ? 55  GLU I CB  1 
ATOM   2844 C CG  . GLU C 3 55  ? -4.206  26.104  93.464  1.00 5.59   ? 55  GLU I CG  1 
ATOM   2845 C CD  . GLU C 3 55  ? -3.043  27.048  93.664  1.00 8.88   ? 55  GLU I CD  1 
ATOM   2846 O OE1 . GLU C 3 55  ? -3.272  28.248  93.899  1.00 6.88   ? 55  GLU I OE1 1 
ATOM   2847 O OE2 . GLU C 3 55  ? -1.887  26.594  93.581  1.00 12.18  ? 55  GLU I OE2 1 
ATOM   2848 N N   . ILE C 3 56  ? -6.418  23.626  92.879  1.00 15.51  ? 56  ILE I N   1 
ATOM   2849 C CA  . ILE C 3 56  ? -6.470  22.203  93.204  1.00 14.57  ? 56  ILE I CA  1 
ATOM   2850 C C   . ILE C 3 56  ? -5.127  21.504  93.023  1.00 16.19  ? 56  ILE I C   1 
ATOM   2851 O O   . ILE C 3 56  ? -4.374  21.823  92.096  1.00 22.18  ? 56  ILE I O   1 
ATOM   2852 C CB  . ILE C 3 56  ? -7.467  21.495  92.279  1.00 13.82  ? 56  ILE I CB  1 
ATOM   2853 C CG1 . ILE C 3 56  ? -8.815  22.211  92.308  1.00 16.42  ? 56  ILE I CG1 1 
ATOM   2854 C CG2 . ILE C 3 56  ? -7.639  20.058  92.697  1.00 16.89  ? 56  ILE I CG2 1 
ATOM   2855 C CD1 . ILE C 3 56  ? -9.479  22.326  90.951  1.00 15.29  ? 56  ILE I CD1 1 
ATOM   2856 N N   . GLY C 3 57  ? -4.832  20.567  93.920  1.00 14.94  ? 57  GLY I N   1 
ATOM   2857 C CA  . GLY C 3 57  ? -3.610  19.775  93.848  1.00 16.02  ? 57  GLY I CA  1 
ATOM   2858 C C   . GLY C 3 57  ? -2.313  20.364  94.369  1.00 20.72  ? 57  GLY I C   1 
ATOM   2859 O O   . GLY C 3 57  ? -1.236  19.769  94.184  1.00 18.55  ? 57  GLY I O   1 
ATOM   2860 N N   . TYR C 3 58  ? -2.396  21.522  95.020  1.00 23.71  ? 58  TYR I N   1 
ATOM   2861 C CA  . TYR C 3 58  ? -1.202  22.167  95.545  1.00 27.41  ? 58  TYR I CA  1 
ATOM   2862 C C   . TYR C 3 58  ? -0.946  21.685  96.960  1.00 32.95  ? 58  TYR I C   1 
ATOM   2863 O O   . TYR C 3 58  ? -1.505  22.202  97.921  1.00 37.34  ? 58  TYR I O   1 
ATOM   2864 C CB  . TYR C 3 58  ? -1.349  23.686  95.511  1.00 28.01  ? 58  TYR I CB  1 
ATOM   2865 C CG  . TYR C 3 58  ? -0.049  24.440  95.673  1.00 25.45  ? 58  TYR I CG  1 
ATOM   2866 C CD1 . TYR C 3 58  ? 1.105   24.036  95.008  1.00 24.04  ? 58  TYR I CD1 1 
ATOM   2867 C CD2 . TYR C 3 58  ? 0.020   25.570  96.484  1.00 28.45  ? 58  TYR I CD2 1 
ATOM   2868 C CE1 . TYR C 3 58  ? 2.296   24.739  95.146  1.00 29.92  ? 58  TYR I CE1 1 
ATOM   2869 C CE2 . TYR C 3 58  ? 1.200   26.280  96.631  1.00 33.43  ? 58  TYR I CE2 1 
ATOM   2870 C CZ  . TYR C 3 58  ? 2.335   25.862  95.961  1.00 35.80  ? 58  TYR I CZ  1 
ATOM   2871 O OH  . TYR C 3 58  ? 3.507   26.565  96.118  1.00 43.16  ? 58  TYR I OH  1 
ATOM   2872 N N   . ASN C 3 59  ? -0.067  20.699  97.068  1.00 37.59  ? 59  ASN I N   1 
ATOM   2873 C CA  . ASN C 3 59  ? 0.314   20.078  98.336  1.00 39.14  ? 59  ASN I CA  1 
ATOM   2874 C C   . ASN C 3 59  ? 0.727   21.007  99.477  1.00 38.61  ? 59  ASN I C   1 
ATOM   2875 O O   . ASN C 3 59  ? 0.821   20.565  100.621 1.00 42.86  ? 59  ASN I O   1 
ATOM   2876 C CB  . ASN C 3 59  ? 1.428   19.056  98.087  1.00 42.55  ? 59  ASN I CB  1 
ATOM   2877 C CG  . ASN C 3 59  ? 2.505   19.586  97.151  1.00 49.28  ? 59  ASN I CG  1 
ATOM   2878 O OD1 . ASN C 3 59  ? 3.138   20.610  97.422  1.00 51.88  ? 59  ASN I OD1 1 
ATOM   2879 N ND2 . ASN C 3 59  ? 2.680   18.918  96.020  1.00 51.20  ? 59  ASN I ND2 1 
ATOM   2880 N N   . LYS C 3 60  ? 0.977   22.279  99.182  1.00 36.97  ? 60  LYS I N   1 
ATOM   2881 C CA  . LYS C 3 60  ? 1.382   23.228  100.219 1.00 37.55  ? 60  LYS I CA  1 
ATOM   2882 C C   . LYS C 3 60  ? 0.200   23.814  101.005 1.00 38.83  ? 60  LYS I C   1 
ATOM   2883 O O   . LYS C 3 60  ? 0.398   24.385  102.079 1.00 44.49  ? 60  LYS I O   1 
ATOM   2884 C CB  . LYS C 3 60  ? 2.207   24.365  99.609  1.00 37.67  ? 60  LYS I CB  1 
ATOM   2885 C CG  . LYS C 3 60  ? 3.365   23.898  98.742  1.00 49.72  ? 60  LYS I CG  1 
ATOM   2886 C CD  . LYS C 3 60  ? 4.666   23.774  99.513  1.00 58.70  ? 60  LYS I CD  1 
ATOM   2887 C CE  . LYS C 3 60  ? 5.289   25.144  99.767  1.00 64.49  ? 60  LYS I CE  1 
ATOM   2888 N NZ  . LYS C 3 60  ? 6.631   25.051  100.416 1.00 67.37  ? 60  LYS I NZ  1 
ATOM   2889 N N   . PHE C 3 61  ? -1.017  23.659  100.481 1.00 34.02  ? 61  PHE I N   1 
ATOM   2890 C CA  . PHE C 3 61  ? -2.223  24.188  101.121 1.00 31.72  ? 61  PHE I CA  1 
ATOM   2891 C C   . PHE C 3 61  ? -3.047  23.138  101.871 1.00 34.39  ? 61  PHE I C   1 
ATOM   2892 O O   . PHE C 3 61  ? -3.104  21.975  101.481 1.00 36.97  ? 61  PHE I O   1 
ATOM   2893 C CB  . PHE C 3 61  ? -3.139  24.847  100.078 1.00 28.04  ? 61  PHE I CB  1 
ATOM   2894 C CG  . PHE C 3 61  ? -2.569  26.086  99.445  1.00 23.55  ? 61  PHE I CG  1 
ATOM   2895 C CD1 . PHE C 3 61  ? -1.701  26.914  100.142 1.00 24.51  ? 61  PHE I CD1 1 
ATOM   2896 C CD2 . PHE C 3 61  ? -2.906  26.421  98.142  1.00 23.91  ? 61  PHE I CD2 1 
ATOM   2897 C CE1 . PHE C 3 61  ? -1.178  28.056  99.546  1.00 26.23  ? 61  PHE I CE1 1 
ATOM   2898 C CE2 . PHE C 3 61  ? -2.389  27.561  97.540  1.00 24.68  ? 61  PHE I CE2 1 
ATOM   2899 C CZ  . PHE C 3 61  ? -1.523  28.378  98.243  1.00 25.30  ? 61  PHE I CZ  1 
ATOM   2900 N N   . GLU C 3 62  ? -3.715  23.562  102.936 1.00 32.21  ? 62  GLU I N   1 
ATOM   2901 C CA  . GLU C 3 62  ? -4.558  22.657  103.690 1.00 30.54  ? 62  GLU I CA  1 
ATOM   2902 C C   . GLU C 3 62  ? -5.921  22.645  102.997 1.00 28.95  ? 62  GLU I C   1 
ATOM   2903 O O   . GLU C 3 62  ? -6.380  23.677  102.520 1.00 27.34  ? 62  GLU I O   1 
ATOM   2904 C CB  . GLU C 3 62  ? -4.681  23.130  105.138 1.00 33.75  ? 62  GLU I CB  1 
ATOM   2905 C CG  . GLU C 3 62  ? -4.445  22.028  106.154 1.00 36.44  ? 62  GLU I CG  1 
ATOM   2906 C CD  . GLU C 3 62  ? -3.124  21.330  105.929 1.00 42.53  ? 62  GLU I CD  1 
ATOM   2907 O OE1 . GLU C 3 62  ? -2.095  22.033  105.834 1.00 45.12  ? 62  GLU I OE1 1 
ATOM   2908 O OE2 . GLU C 3 62  ? -3.115  20.082  105.828 1.00 47.03  ? 62  GLU I OE2 1 
ATOM   2909 N N   . SER C 3 63  ? -6.564  21.483  102.978 1.00 31.03  ? 63  SER I N   1 
ATOM   2910 C CA  . SER C 3 63  ? -7.861  21.273  102.328 1.00 34.96  ? 63  SER I CA  1 
ATOM   2911 C C   . SER C 3 63  ? -9.059  22.139  102.710 1.00 38.19  ? 63  SER I C   1 
ATOM   2912 O O   . SER C 3 63  ? -9.925  22.406  101.869 1.00 41.77  ? 63  SER I O   1 
ATOM   2913 C CB  . SER C 3 63  ? -8.268  19.809  102.469 1.00 39.35  ? 63  SER I CB  1 
ATOM   2914 O OG  . SER C 3 63  ? -8.231  19.419  103.832 1.00 55.67  ? 63  SER I OG  1 
ATOM   2915 N N   . ASN C 3 64  ? -9.165  22.513  103.980 1.00 36.32  ? 64  ASN I N   1 
ATOM   2916 C CA  . ASN C 3 64  ? -10.301 23.323  104.423 1.00 33.46  ? 64  ASN I CA  1 
ATOM   2917 C C   . ASN C 3 64  ? -9.924  24.751  104.781 1.00 35.26  ? 64  ASN I C   1 
ATOM   2918 O O   . ASN C 3 64  ? -10.401 25.285  105.785 1.00 39.38  ? 64  ASN I O   1 
ATOM   2919 C CB  . ASN C 3 64  ? -10.973 22.668  105.627 1.00 30.75  ? 64  ASN I CB  1 
ATOM   2920 C CG  . ASN C 3 64  ? -11.886 21.538  105.238 1.00 29.09  ? 64  ASN I CG  1 
ATOM   2921 O OD1 . ASN C 3 64  ? -12.976 21.761  104.708 1.00 31.44  ? 64  ASN I OD1 1 
ATOM   2922 N ND2 . ASN C 3 64  ? -11.452 20.315  105.496 1.00 31.72  ? 64  ASN I ND2 1 
ATOM   2923 N N   . VAL C 3 65  ? -9.094  25.379  103.952 1.00 34.87  ? 65  VAL I N   1 
ATOM   2924 C CA  . VAL C 3 65  ? -8.637  26.743  104.210 1.00 29.45  ? 65  VAL I CA  1 
ATOM   2925 C C   . VAL C 3 65  ? -9.009  27.743  103.110 1.00 31.34  ? 65  VAL I C   1 
ATOM   2926 O O   . VAL C 3 65  ? -8.951  27.429  101.923 1.00 34.32  ? 65  VAL I O   1 
ATOM   2927 C CB  . VAL C 3 65  ? -7.112  26.765  104.420 1.00 19.08  ? 65  VAL I CB  1 
ATOM   2928 C CG1 . VAL C 3 65  ? -6.636  28.170  104.661 1.00 18.97  ? 65  VAL I CG1 1 
ATOM   2929 C CG2 . VAL C 3 65  ? -6.733  25.876  105.594 1.00 17.40  ? 65  VAL I CG2 1 
ATOM   2930 N N   . LYS C 3 66  ? -9.407  28.944  103.523 1.00 30.81  ? 66  LYS I N   1 
ATOM   2931 C CA  . LYS C 3 66  ? -9.777  30.011  102.598 1.00 26.09  ? 66  LYS I CA  1 
ATOM   2932 C C   . LYS C 3 66  ? -8.765  31.147  102.702 1.00 24.67  ? 66  LYS I C   1 
ATOM   2933 O O   . LYS C 3 66  ? -8.273  31.436  103.793 1.00 26.01  ? 66  LYS I O   1 
ATOM   2934 C CB  . LYS C 3 66  ? -11.155 30.549  102.946 1.00 23.03  ? 66  LYS I CB  1 
ATOM   2935 C CG  . LYS C 3 66  ? -12.280 29.564  102.766 1.00 26.91  ? 66  LYS I CG  1 
ATOM   2936 C CD  . LYS C 3 66  ? -13.603 30.289  102.821 1.00 37.44  ? 66  LYS I CD  1 
ATOM   2937 C CE  . LYS C 3 66  ? -13.754 31.237  101.629 1.00 50.37  ? 66  LYS I CE  1 
ATOM   2938 N NZ  . LYS C 3 66  ? -12.811 32.403  101.566 1.00 51.54  ? 66  LYS I NZ  1 
ATOM   2939 N N   . PHE C 3 67  ? -8.464  31.791  101.575 1.00 22.62  ? 67  PHE I N   1 
ATOM   2940 C CA  . PHE C 3 67  ? -7.512  32.900  101.540 1.00 13.98  ? 67  PHE I CA  1 
ATOM   2941 C C   . PHE C 3 67  ? -8.137  34.175  101.011 1.00 15.14  ? 67  PHE I C   1 
ATOM   2942 O O   . PHE C 3 67  ? -8.894  34.143  100.041 1.00 17.43  ? 67  PHE I O   1 
ATOM   2943 C CB  . PHE C 3 67  ? -6.324  32.570  100.645 1.00 5.90   ? 67  PHE I CB  1 
ATOM   2944 C CG  . PHE C 3 67  ? -5.509  31.420  101.123 1.00 10.52  ? 67  PHE I CG  1 
ATOM   2945 C CD1 . PHE C 3 67  ? -5.841  30.123  100.759 1.00 15.30  ? 67  PHE I CD1 1 
ATOM   2946 C CD2 . PHE C 3 67  ? -4.415  31.627  101.945 1.00 9.28   ? 67  PHE I CD2 1 
ATOM   2947 C CE1 . PHE C 3 67  ? -5.094  29.051  101.211 1.00 19.42  ? 67  PHE I CE1 1 
ATOM   2948 C CE2 . PHE C 3 67  ? -3.666  30.564  102.400 1.00 8.19   ? 67  PHE I CE2 1 
ATOM   2949 C CZ  . PHE C 3 67  ? -4.004  29.271  102.035 1.00 13.49  ? 67  PHE I CZ  1 
ATOM   2950 N N   . GLN C 3 68  ? -7.847  35.288  101.676 1.00 18.42  ? 68  GLN I N   1 
ATOM   2951 C CA  . GLN C 3 68  ? -8.329  36.595  101.246 1.00 25.14  ? 68  GLN I CA  1 
ATOM   2952 C C   . GLN C 3 68  ? -7.091  37.331  100.749 1.00 25.49  ? 68  GLN I C   1 
ATOM   2953 O O   . GLN C 3 68  ? -6.162  37.582  101.525 1.00 23.22  ? 68  GLN I O   1 
ATOM   2954 C CB  . GLN C 3 68  ? -9.000  37.356  102.393 1.00 34.50  ? 68  GLN I CB  1 
ATOM   2955 C CG  . GLN C 3 68  ? -10.532 37.264  102.401 1.00 49.86  ? 68  GLN I CG  1 
ATOM   2956 C CD  . GLN C 3 68  ? -11.189 37.912  101.174 1.00 59.32  ? 68  GLN I CD  1 
ATOM   2957 O OE1 . GLN C 3 68  ? -10.572 38.709  100.462 1.00 62.16  ? 68  GLN I OE1 1 
ATOM   2958 N NE2 . GLN C 3 68  ? -12.453 37.578  100.938 1.00 60.35  ? 68  GLN I NE2 1 
ATOM   2959 N N   . CYS C 3 69  ? -7.050  37.591  99.443  1.00 23.22  ? 69  CYS I N   1 
ATOM   2960 C CA  . CYS C 3 69  ? -5.918  38.253  98.819  1.00 22.62  ? 69  CYS I CA  1 
ATOM   2961 C C   . CYS C 3 69  ? -6.248  39.669  98.410  1.00 25.98  ? 69  CYS I C   1 
ATOM   2962 O O   . CYS C 3 69  ? -7.220  39.904  97.700  1.00 30.72  ? 69  CYS I O   1 
ATOM   2963 C CB  . CYS C 3 69  ? -5.477  37.481  97.581  1.00 21.96  ? 69  CYS I CB  1 
ATOM   2964 S SG  . CYS C 3 69  ? -5.111  35.724  97.865  1.00 20.40  ? 69  CYS I SG  1 
ATOM   2965 N N   . ASN C 3 70  ? -5.393  40.602  98.803  1.00 28.01  ? 70  ASN I N   1 
ATOM   2966 C CA  . ASN C 3 70  ? -5.588  42.003  98.475  1.00 31.81  ? 70  ASN I CA  1 
ATOM   2967 C C   . ASN C 3 70  ? -4.384  42.479  97.685  1.00 32.28  ? 70  ASN I C   1 
ATOM   2968 O O   . ASN C 3 70  ? -3.242  42.151  98.027  1.00 26.98  ? 70  ASN I O   1 
ATOM   2969 C CB  . ASN C 3 70  ? -5.740  42.832  99.749  1.00 41.00  ? 70  ASN I CB  1 
ATOM   2970 C CG  . ASN C 3 70  ? -7.039  43.616  99.781  1.00 53.81  ? 70  ASN I CG  1 
ATOM   2971 O OD1 . ASN C 3 70  ? -7.785  43.556  100.760 1.00 58.82  ? 70  ASN I OD1 1 
ATOM   2972 N ND2 . ASN C 3 70  ? -7.314  44.367  98.713  1.00 58.22  ? 70  ASN I ND2 1 
ATOM   2973 N N   . GLN C 3 71  ? -4.643  43.204  96.601  1.00 35.37  ? 71  GLN I N   1 
ATOM   2974 C CA  . GLN C 3 71  ? -3.575  43.715  95.752  1.00 39.99  ? 71  GLN I CA  1 
ATOM   2975 C C   . GLN C 3 71  ? -2.692  44.764  96.416  1.00 43.54  ? 71  GLN I C   1 
ATOM   2976 O O   . GLN C 3 71  ? -3.177  45.658  97.117  1.00 43.14  ? 71  GLN I O   1 
ATOM   2977 C CB  . GLN C 3 71  ? -4.139  44.272  94.447  1.00 41.77  ? 71  GLN I CB  1 
ATOM   2978 C CG  . GLN C 3 71  ? -3.063  44.645  93.438  1.00 42.02  ? 71  GLN I CG  1 
ATOM   2979 C CD  . GLN C 3 71  ? -3.622  45.189  92.140  1.00 48.00  ? 71  GLN I CD  1 
ATOM   2980 O OE1 . GLN C 3 71  ? -4.806  45.527  92.040  1.00 50.15  ? 71  GLN I OE1 1 
ATOM   2981 N NE2 . GLN C 3 71  ? -2.765  45.286  91.135  1.00 52.52  ? 71  GLN I NE2 1 
ATOM   2982 N N   . VAL C 3 72  ? -1.392  44.654  96.160  1.00 48.15  ? 72  VAL I N   1 
ATOM   2983 C CA  . VAL C 3 72  ? -0.400  45.568  96.706  1.00 52.53  ? 72  VAL I CA  1 
ATOM   2984 C C   . VAL C 3 72  ? 0.335   46.286  95.569  1.00 60.09  ? 72  VAL I C   1 
ATOM   2985 O O   . VAL C 3 72  ? 0.117   45.982  94.395  1.00 60.95  ? 72  VAL I O   1 
ATOM   2986 C CB  . VAL C 3 72  ? 0.610   44.819  97.610  1.00 50.78  ? 72  VAL I CB  1 
ATOM   2987 C CG1 . VAL C 3 72  ? -0.114  44.167  98.763  1.00 46.04  ? 72  VAL I CG1 1 
ATOM   2988 C CG2 . VAL C 3 72  ? 1.370   43.775  96.819  1.00 49.75  ? 72  VAL I CG2 1 
ATOM   2989 N N   . ASP C 3 73  ? 1.191   47.246  95.919  1.00 68.00  ? 73  ASP I N   1 
ATOM   2990 C CA  . ASP C 3 73  ? 1.947   48.020  94.933  1.00 72.78  ? 73  ASP I CA  1 
ATOM   2991 C C   . ASP C 3 73  ? 3.341   47.458  94.673  1.00 77.86  ? 73  ASP I C   1 
ATOM   2992 O O   . ASP C 3 73  ? 4.125   48.040  93.917  1.00 80.13  ? 73  ASP I O   1 
ATOM   2993 C CB  . ASP C 3 73  ? 2.052   49.486  95.373  0.50 72.00  ? 73  ASP I CB  1 
ATOM   2994 C CG  . ASP C 3 73  ? 1.178   50.416  94.541  0.50 73.27  ? 73  ASP I CG  1 
ATOM   2995 O OD1 . ASP C 3 73  ? 0.073   50.003  94.124  0.50 73.04  ? 73  ASP I OD1 1 
ATOM   2996 O OD2 . ASP C 3 73  ? 1.600   51.569  94.306  0.50 72.94  ? 73  ASP I OD2 1 
ATOM   2997 N N   . ASN C 3 74  ? 3.650   46.333  95.306  0.00 81.94  ? 74  ASN I N   1 
ATOM   2998 C CA  . ASN C 3 74  ? 4.951   45.696  95.145  0.00 85.96  ? 74  ASN I CA  1 
ATOM   2999 C C   . ASN C 3 74  ? 5.112   45.152  93.731  0.00 89.04  ? 74  ASN I C   1 
ATOM   3000 O O   . ASN C 3 74  ? 4.131   44.797  93.079  0.00 89.15  ? 74  ASN I O   1 
ATOM   3001 C CB  . ASN C 3 74  ? 5.116   44.562  96.161  0.00 86.35  ? 74  ASN I CB  1 
ATOM   3002 C CG  . ASN C 3 74  ? 4.962   45.036  97.594  0.00 86.80  ? 74  ASN I CG  1 
ATOM   3003 O OD1 . ASN C 3 74  ? 3.990   45.712  97.935  0.00 87.11  ? 74  ASN I OD1 1 
ATOM   3004 N ND2 . ASN C 3 74  ? 5.914   44.677  98.442  0.00 86.91  ? 74  ASN I ND2 1 
ATOM   3005 N N   . LYS C 3 75  ? 6.357   45.120  93.260  0.50 92.16  ? 75  LYS I N   1 
ATOM   3006 C CA  . LYS C 3 75  ? 6.694   44.617  91.929  0.50 95.51  ? 75  LYS I CA  1 
ATOM   3007 C C   . LYS C 3 75  ? 5.982   45.377  90.809  0.00 97.44  ? 75  LYS I C   1 
ATOM   3008 O O   . LYS C 3 75  ? 5.345   44.780  89.941  0.00 97.94  ? 75  LYS I O   1 
ATOM   3009 C CB  . LYS C 3 75  ? 6.392   43.117  91.834  0.50 96.18  ? 75  LYS I CB  1 
ATOM   3010 C CG  . LYS C 3 75  ? 7.044   42.277  92.926  0.00 98.34  ? 75  LYS I CG  1 
ATOM   3011 C CD  . LYS C 3 75  ? 8.558   42.425  92.922  0.00 100.07 ? 75  LYS I CD  1 
ATOM   3012 C CE  . LYS C 3 75  ? 9.181   41.740  94.128  0.00 101.31 ? 75  LYS I CE  1 
ATOM   3013 N NZ  . LYS C 3 75  ? 8.709   42.339  95.410  0.00 101.90 ? 75  LYS I NZ  1 
ATOM   3014 N N   . ASN C 3 76  ? 6.171   46.693  90.796  1.00 100.09 ? 76  ASN I N   1 
ATOM   3015 C CA  . ASN C 3 76  ? 5.554   47.572  89.803  1.00 102.10 ? 76  ASN I CA  1 
ATOM   3016 C C   . ASN C 3 76  ? 5.821   47.212  88.338  1.00 102.14 ? 76  ASN I C   1 
ATOM   3017 O O   . ASN C 3 76  ? 4.994   47.494  87.464  1.00 103.48 ? 76  ASN I O   1 
ATOM   3018 C CB  . ASN C 3 76  ? 5.961   49.030  90.059  0.00 102.00 ? 76  ASN I CB  1 
ATOM   3019 C CG  . ASN C 3 76  ? 7.470   49.231  90.059  0.00 102.39 ? 76  ASN I CG  1 
ATOM   3020 O OD1 . ASN C 3 76  ? 8.224   48.393  89.564  0.00 102.95 ? 76  ASN I OD1 1 
ATOM   3021 N ND2 . ASN C 3 76  ? 7.917   50.337  90.634  0.00 102.72 ? 76  ASN I ND2 1 
ATOM   3022 N N   . GLY C 3 77  ? 6.967   46.593  88.069  1.00 101.62 ? 77  GLY I N   1 
ATOM   3023 C CA  . GLY C 3 77  ? 7.315   46.227  86.704  1.00 99.79  ? 77  GLY I CA  1 
ATOM   3024 C C   . GLY C 3 77  ? 6.513   45.104  86.064  1.00 96.06  ? 77  GLY I C   1 
ATOM   3025 O O   . GLY C 3 77  ? 6.822   43.929  86.278  1.00 97.93  ? 77  GLY I O   1 
ATOM   3026 N N   . GLU C 3 78  ? 5.503   45.466  85.268  1.00 89.89  ? 78  GLU I N   1 
ATOM   3027 C CA  . GLU C 3 78  ? 4.638   44.512  84.557  1.00 84.24  ? 78  GLU I CA  1 
ATOM   3028 C C   . GLU C 3 78  ? 4.254   43.276  85.381  1.00 75.56  ? 78  GLU I C   1 
ATOM   3029 O O   . GLU C 3 78  ? 4.212   42.159  84.863  1.00 73.71  ? 78  GLU I O   1 
ATOM   3030 C CB  . GLU C 3 78  ? 5.287   44.088  83.220  1.00 91.84  ? 78  GLU I CB  1 
ATOM   3031 C CG  . GLU C 3 78  ? 6.673   43.408  83.333  1.00 97.44  ? 78  GLU I CG  1 
ATOM   3032 C CD  . GLU C 3 78  ? 7.261   42.953  81.992  1.00 100.95 ? 78  GLU I CD  1 
ATOM   3033 O OE1 . GLU C 3 78  ? 6.954   43.565  80.942  1.00 102.14 ? 78  GLU I OE1 1 
ATOM   3034 O OE2 . GLU C 3 78  ? 8.049   41.980  81.997  1.00 100.81 ? 78  GLU I OE2 1 
ATOM   3035 N N   . GLN C 3 79  ? 3.910   43.491  86.645  1.00 69.43  ? 79  GLN I N   1 
ATOM   3036 C CA  . GLN C 3 79  ? 3.565   42.391  87.535  1.00 60.66  ? 79  GLN I CA  1 
ATOM   3037 C C   . GLN C 3 79  ? 2.465   42.800  88.510  1.00 54.13  ? 79  GLN I C   1 
ATOM   3038 O O   . GLN C 3 79  ? 2.424   43.940  88.979  1.00 53.64  ? 79  GLN I O   1 
ATOM   3039 C CB  . GLN C 3 79  ? 4.824   41.967  88.297  1.00 59.25  ? 79  GLN I CB  1 
ATOM   3040 C CG  . GLN C 3 79  ? 4.828   40.554  88.837  1.00 62.90  ? 79  GLN I CG  1 
ATOM   3041 C CD  . GLN C 3 79  ? 6.228   40.078  89.215  1.00 67.75  ? 79  GLN I CD  1 
ATOM   3042 O OE1 . GLN C 3 79  ? 6.515   38.879  89.206  1.00 71.00  ? 79  GLN I OE1 1 
ATOM   3043 N NE2 . GLN C 3 79  ? 7.104   41.017  89.555  1.00 67.67  ? 79  GLN I NE2 1 
ATOM   3044 N N   . TYR C 3 80  ? 1.538   41.881  88.756  1.00 47.90  ? 80  TYR I N   1 
ATOM   3045 C CA  . TYR C 3 80  ? 0.434   42.118  89.677  1.00 42.10  ? 80  TYR I CA  1 
ATOM   3046 C C   . TYR C 3 80  ? 0.701   41.284  90.919  1.00 40.56  ? 80  TYR I C   1 
ATOM   3047 O O   . TYR C 3 80  ? 0.724   40.057  90.848  1.00 42.07  ? 80  TYR I O   1 
ATOM   3048 C CB  . TYR C 3 80  ? -0.893  41.730  89.023  1.00 38.53  ? 80  TYR I CB  1 
ATOM   3049 C CG  . TYR C 3 80  ? -1.236  42.603  87.837  1.00 41.93  ? 80  TYR I CG  1 
ATOM   3050 C CD1 . TYR C 3 80  ? -0.437  42.603  86.694  1.00 42.93  ? 80  TYR I CD1 1 
ATOM   3051 C CD2 . TYR C 3 80  ? -2.325  43.468  87.876  1.00 40.54  ? 80  TYR I CD2 1 
ATOM   3052 C CE1 . TYR C 3 80  ? -0.706  43.445  85.623  1.00 41.43  ? 80  TYR I CE1 1 
ATOM   3053 C CE2 . TYR C 3 80  ? -2.607  44.316  86.809  1.00 45.55  ? 80  TYR I CE2 1 
ATOM   3054 C CZ  . TYR C 3 80  ? -1.791  44.300  85.684  1.00 46.08  ? 80  TYR I CZ  1 
ATOM   3055 O OH  . TYR C 3 80  ? -2.058  45.143  84.626  1.00 48.22  ? 80  TYR I OH  1 
ATOM   3056 N N   . SER C 3 81  ? 0.980   41.954  92.032  1.00 39.32  ? 81  SER I N   1 
ATOM   3057 C CA  . SER C 3 81  ? 1.285   41.281  93.289  1.00 39.40  ? 81  SER I CA  1 
ATOM   3058 C C   . SER C 3 81  ? 0.128   41.292  94.283  1.00 37.88  ? 81  SER I C   1 
ATOM   3059 O O   . SER C 3 81  ? -0.576  42.294  94.413  1.00 38.74  ? 81  SER I O   1 
ATOM   3060 C CB  . SER C 3 81  ? 2.515   41.928  93.922  1.00 40.08  ? 81  SER I CB  1 
ATOM   3061 O OG  . SER C 3 81  ? 3.593   41.968  93.002  1.00 42.99  ? 81  SER I OG  1 
ATOM   3062 N N   . PHE C 3 82  ? -0.056  40.181  94.991  1.00 36.17  ? 82  PHE I N   1 
ATOM   3063 C CA  . PHE C 3 82  ? -1.124  40.052  95.978  1.00 31.00  ? 82  PHE I CA  1 
ATOM   3064 C C   . PHE C 3 82  ? -0.617  39.434  97.273  1.00 33.67  ? 82  PHE I C   1 
ATOM   3065 O O   . PHE C 3 82  ? 0.259   38.564  97.254  1.00 34.47  ? 82  PHE I O   1 
ATOM   3066 C CB  . PHE C 3 82  ? -2.251  39.168  95.442  1.00 21.78  ? 82  PHE I CB  1 
ATOM   3067 C CG  . PHE C 3 82  ? -2.919  39.710  94.219  1.00 23.17  ? 82  PHE I CG  1 
ATOM   3068 C CD1 . PHE C 3 82  ? -2.367  39.504  92.960  1.00 23.74  ? 82  PHE I CD1 1 
ATOM   3069 C CD2 . PHE C 3 82  ? -4.106  40.430  94.321  1.00 22.49  ? 82  PHE I CD2 1 
ATOM   3070 C CE1 . PHE C 3 82  ? -2.989  40.010  91.813  1.00 23.64  ? 82  PHE I CE1 1 
ATOM   3071 C CE2 . PHE C 3 82  ? -4.734  40.939  93.183  1.00 20.51  ? 82  PHE I CE2 1 
ATOM   3072 C CZ  . PHE C 3 82  ? -4.173  40.729  91.925  1.00 16.66  ? 82  PHE I CZ  1 
ATOM   3073 N N   . LYS C 3 83  ? -1.133  39.929  98.395  1.00 35.72  ? 83  LYS I N   1 
ATOM   3074 C CA  . LYS C 3 83  ? -0.790  39.395  99.708  1.00 33.46  ? 83  LYS I CA  1 
ATOM   3075 C C   . LYS C 3 83  ? -2.018  38.605  100.105 1.00 27.78  ? 83  LYS I C   1 
ATOM   3076 O O   . LYS C 3 83  ? -3.137  39.115  100.043 1.00 23.81  ? 83  LYS I O   1 
ATOM   3077 C CB  . LYS C 3 83  ? -0.526  40.503  100.737 1.00 42.74  ? 83  LYS I CB  1 
ATOM   3078 C CG  . LYS C 3 83  ? 0.782   41.264  100.521 1.00 51.34  ? 83  LYS I CG  1 
ATOM   3079 C CD  . LYS C 3 83  ? 1.183   42.057  101.762 1.00 56.17  ? 83  LYS I CD  1 
ATOM   3080 C CE  . LYS C 3 83  ? 1.719   41.145  102.850 1.00 59.54  ? 83  LYS I CE  1 
ATOM   3081 N NZ  . LYS C 3 83  ? 2.995   40.500  102.426 1.00 61.54  ? 83  LYS I NZ  1 
ATOM   3082 N N   . CYS C 3 84  ? -1.814  37.343  100.448 1.00 27.15  ? 84  CYS I N   1 
ATOM   3083 C CA  . CYS C 3 84  ? -2.917  36.482  100.820 1.00 26.07  ? 84  CYS I CA  1 
ATOM   3084 C C   . CYS C 3 84  ? -2.838  36.079  102.285 1.00 25.65  ? 84  CYS I C   1 
ATOM   3085 O O   . CYS C 3 84  ? -1.752  35.835  102.802 1.00 23.46  ? 84  CYS I O   1 
ATOM   3086 C CB  . CYS C 3 84  ? -2.929  35.260  99.902  1.00 25.64  ? 84  CYS I CB  1 
ATOM   3087 S SG  . CYS C 3 84  ? -3.105  35.675  98.126  1.00 17.32  ? 84  CYS I SG  1 
ATOM   3088 N N   . LYS C 3 85  ? -3.991  36.080  102.955 1.00 26.35  ? 85  LYS I N   1 
ATOM   3089 C CA  . LYS C 3 85  ? -4.117  35.725  104.374 1.00 28.42  ? 85  LYS I CA  1 
ATOM   3090 C C   . LYS C 3 85  ? -5.179  34.635  104.509 1.00 23.25  ? 85  LYS I C   1 
ATOM   3091 O O   . LYS C 3 85  ? -6.186  34.662  103.808 1.00 21.85  ? 85  LYS I O   1 
ATOM   3092 C CB  . LYS C 3 85  ? -4.532  36.964  105.179 1.00 38.95  ? 85  LYS I CB  1 
ATOM   3093 C CG  . LYS C 3 85  ? -3.508  38.107  105.134 1.00 49.55  ? 85  LYS I CG  1 
ATOM   3094 C CD  . LYS C 3 85  ? -4.093  39.443  105.591 1.00 56.43  ? 85  LYS I CD  1 
ATOM   3095 C CE  . LYS C 3 85  ? -4.657  40.265  104.422 1.00 63.47  ? 85  LYS I CE  1 
ATOM   3096 N NZ  . LYS C 3 85  ? -5.843  39.661  103.733 1.00 60.47  ? 85  LYS I NZ  1 
ATOM   3097 N N   . SER C 3 86  ? -5.006  33.721  105.451 1.00 21.91  ? 86  SER I N   1 
ATOM   3098 C CA  . SER C 3 86  ? -5.963  32.630  105.575 1.00 23.39  ? 86  SER I CA  1 
ATOM   3099 C C   . SER C 3 86  ? -6.640  32.358  106.910 1.00 23.01  ? 86  SER I C   1 
ATOM   3100 O O   . SER C 3 86  ? -6.288  32.945  107.929 1.00 24.11  ? 86  SER I O   1 
ATOM   3101 C CB  . SER C 3 86  ? -5.318  31.352  105.064 1.00 27.50  ? 86  SER I CB  1 
ATOM   3102 O OG  . SER C 3 86  ? -3.940  31.322  105.390 0.00 27.05  ? 86  SER I OG  1 
ATOM   3103 N N   . SER C 3 87  ? -7.609  31.442  106.881 1.00 24.21  ? 87  SER I N   1 
ATOM   3104 C CA  . SER C 3 87  ? -8.381  31.035  108.057 1.00 28.08  ? 87  SER I CA  1 
ATOM   3105 C C   . SER C 3 87  ? -7.473  30.538  109.161 1.00 30.46  ? 87  SER I C   1 
ATOM   3106 O O   . SER C 3 87  ? -7.819  30.606  110.338 1.00 34.82  ? 87  SER I O   1 
ATOM   3107 C CB  . SER C 3 87  ? -9.341  29.914  107.690 1.00 27.60  ? 87  SER I CB  1 
ATOM   3108 O OG  . SER C 3 87  ? -9.933  30.163  106.434 1.00 37.59  ? 87  SER I OG  1 
ATOM   3109 N N   . ASP C 3 88  ? -6.346  29.968  108.752 1.00 30.30  ? 88  ASP I N   1 
ATOM   3110 C CA  . ASP C 3 88  ? -5.344  29.443  109.666 1.00 33.46  ? 88  ASP I CA  1 
ATOM   3111 C C   . ASP C 3 88  ? -4.234  30.479  109.856 1.00 37.67  ? 88  ASP I C   1 
ATOM   3112 O O   . ASP C 3 88  ? -3.249  30.227  110.547 1.00 39.96  ? 88  ASP I O   1 
ATOM   3113 C CB  . ASP C 3 88  ? -4.771  28.119  109.127 1.00 35.74  ? 88  ASP I CB  1 
ATOM   3114 C CG  . ASP C 3 88  ? -4.122  28.257  107.746 1.00 32.76  ? 88  ASP I CG  1 
ATOM   3115 O OD1 . ASP C 3 88  ? -4.341  29.270  107.057 1.00 30.39  ? 88  ASP I OD1 1 
ATOM   3116 O OD2 . ASP C 3 88  ? -3.384  27.340  107.338 1.00 27.41  ? 88  ASP I OD2 1 
ATOM   3117 N N   . ASN C 3 89  ? -4.420  31.646  109.238 1.00 39.19  ? 89  ASN I N   1 
ATOM   3118 C CA  . ASN C 3 89  ? -3.478  32.766  109.293 1.00 37.35  ? 89  ASN I CA  1 
ATOM   3119 C C   . ASN C 3 89  ? -2.118  32.395  108.721 1.00 35.83  ? 89  ASN I C   1 
ATOM   3120 O O   . ASN C 3 89  ? -1.093  32.623  109.364 1.00 33.88  ? 89  ASN I O   1 
ATOM   3121 C CB  . ASN C 3 89  ? -3.321  33.250  110.734 1.00 40.37  ? 89  ASN I CB  1 
ATOM   3122 C CG  . ASN C 3 89  ? -4.649  33.370  111.449 1.00 46.19  ? 89  ASN I CG  1 
ATOM   3123 O OD1 . ASN C 3 89  ? -5.494  34.187  111.085 1.00 52.77  ? 89  ASN I OD1 1 
ATOM   3124 N ND2 . ASN C 3 89  ? -4.854  32.529  112.452 1.00 44.84  ? 89  ASN I ND2 1 
ATOM   3125 N N   . THR C 3 90  ? -2.112  31.847  107.507 1.00 35.67  ? 90  THR I N   1 
ATOM   3126 C CA  . THR C 3 90  ? -0.873  31.430  106.861 1.00 40.34  ? 90  THR I CA  1 
ATOM   3127 C C   . THR C 3 90  ? -0.064  32.590  106.279 1.00 44.04  ? 90  THR I C   1 
ATOM   3128 O O   . THR C 3 90  ? 1.068   32.845  106.711 1.00 49.55  ? 90  THR I O   1 
ATOM   3129 C CB  . THR C 3 90  ? -1.129  30.367  105.757 1.00 40.78  ? 90  THR I CB  1 
ATOM   3130 O OG1 . THR C 3 90  ? -1.715  29.197  106.338 1.00 38.60  ? 90  THR I OG1 1 
ATOM   3131 C CG2 . THR C 3 90  ? 0.167   29.966  105.075 1.00 44.95  ? 90  THR I CG2 1 
ATOM   3132 N N   . GLU C 3 91  ? -0.635  33.273  105.290 1.00 42.10  ? 91  GLU I N   1 
ATOM   3133 C CA  . GLU C 3 91  ? 0.025   34.401  104.629 1.00 41.30  ? 91  GLU I CA  1 
ATOM   3134 C C   . GLU C 3 91  ? 1.221   34.065  103.728 1.00 37.92  ? 91  GLU I C   1 
ATOM   3135 O O   . GLU C 3 91  ? 2.123   33.301  104.088 1.00 39.88  ? 91  GLU I O   1 
ATOM   3136 C CB  . GLU C 3 91  ? 0.406   35.475  105.647 1.00 46.76  ? 91  GLU I CB  1 
ATOM   3137 C CG  . GLU C 3 91  ? -0.798  35.978  106.439 1.00 65.04  ? 91  GLU I CG  1 
ATOM   3138 C CD  . GLU C 3 91  ? -0.492  37.157  107.347 1.00 72.55  ? 91  GLU I CD  1 
ATOM   3139 O OE1 . GLU C 3 91  ? 0.685   37.588  107.412 1.00 76.80  ? 91  GLU I OE1 1 
ATOM   3140 O OE2 . GLU C 3 91  ? -1.445  37.655  107.993 1.00 74.94  ? 91  GLU I OE2 1 
ATOM   3141 N N   . PHE C 3 92  ? 1.201   34.654  102.540 1.00 34.10  ? 92  PHE I N   1 
ATOM   3142 C CA  . PHE C 3 92  ? 2.239   34.473  101.533 1.00 28.77  ? 92  PHE I CA  1 
ATOM   3143 C C   . PHE C 3 92  ? 1.951   35.490  100.442 1.00 27.81  ? 92  PHE I C   1 
ATOM   3144 O O   . PHE C 3 92  ? 0.842   36.014  100.352 1.00 26.80  ? 92  PHE I O   1 
ATOM   3145 C CB  . PHE C 3 92  ? 2.170   33.058  100.931 1.00 28.82  ? 92  PHE I CB  1 
ATOM   3146 C CG  . PHE C 3 92  ? 0.908   32.783  100.135 1.00 20.67  ? 92  PHE I CG  1 
ATOM   3147 C CD1 . PHE C 3 92  ? 0.825   33.126  98.789  1.00 24.90  ? 92  PHE I CD1 1 
ATOM   3148 C CD2 . PHE C 3 92  ? -0.201  32.207  100.740 1.00 22.64  ? 92  PHE I CD2 1 
ATOM   3149 C CE1 . PHE C 3 92  ? -0.343  32.905  98.060  1.00 26.18  ? 92  PHE I CE1 1 
ATOM   3150 C CE2 . PHE C 3 92  ? -1.377  31.980  100.017 1.00 23.28  ? 92  PHE I CE2 1 
ATOM   3151 C CZ  . PHE C 3 92  ? -1.445  32.332  98.677  1.00 21.30  ? 92  PHE I CZ  1 
ATOM   3152 N N   . GLU C 3 93  ? 2.942   35.789  99.621  1.00 29.61  ? 93  GLU I N   1 
ATOM   3153 C CA  . GLU C 3 93  ? 2.713   36.719  98.533  1.00 32.17  ? 93  GLU I CA  1 
ATOM   3154 C C   . GLU C 3 93  ? 2.654   35.924  97.235  1.00 29.03  ? 93  GLU I C   1 
ATOM   3155 O O   . GLU C 3 93  ? 3.336   34.900  97.080  1.00 24.47  ? 93  GLU I O   1 
ATOM   3156 C CB  . GLU C 3 93  ? 3.818   37.773  98.449  1.00 40.72  ? 93  GLU I CB  1 
ATOM   3157 C CG  . GLU C 3 93  ? 3.548   38.839  97.380  1.00 55.10  ? 93  GLU I CG  1 
ATOM   3158 C CD  . GLU C 3 93  ? 4.783   39.637  96.976  1.00 63.63  ? 93  GLU I CD  1 
ATOM   3159 O OE1 . GLU C 3 93  ? 5.808   39.019  96.604  1.00 67.97  ? 93  GLU I OE1 1 
ATOM   3160 O OE2 . GLU C 3 93  ? 4.716   40.886  97.001  1.00 67.51  ? 93  GLU I OE2 1 
ATOM   3161 N N   . ALA C 3 94  ? 1.807   36.384  96.326  1.00 25.70  ? 94  ALA I N   1 
ATOM   3162 C CA  . ALA C 3 94  ? 1.647   35.755  95.029  1.00 30.03  ? 94  ALA I CA  1 
ATOM   3163 C C   . ALA C 3 94  ? 1.760   36.841  93.968  1.00 30.22  ? 94  ALA I C   1 
ATOM   3164 O O   . ALA C 3 94  ? 1.075   37.865  94.043  1.00 28.05  ? 94  ALA I O   1 
ATOM   3165 C CB  . ALA C 3 94  ? 0.289   35.064  94.937  1.00 31.91  ? 94  ALA I CB  1 
ATOM   3166 N N   . ASP C 3 95  ? 2.686   36.651  93.034  1.00 29.31  ? 95  ASP I N   1 
ATOM   3167 C CA  . ASP C 3 95  ? 2.891   37.600  91.945  1.00 28.87  ? 95  ASP I CA  1 
ATOM   3168 C C   . ASP C 3 95  ? 2.496   36.903  90.654  1.00 26.63  ? 95  ASP I C   1 
ATOM   3169 O O   . ASP C 3 95  ? 2.831   35.732  90.468  1.00 30.10  ? 95  ASP I O   1 
ATOM   3170 C CB  . ASP C 3 95  ? 4.360   38.034  91.887  1.00 27.45  ? 95  ASP I CB  1 
ATOM   3171 C CG  . ASP C 3 95  ? 4.846   38.636  93.202  1.00 28.83  ? 95  ASP I CG  1 
ATOM   3172 O OD1 . ASP C 3 95  ? 4.039   39.273  93.903  1.00 30.26  ? 95  ASP I OD1 1 
ATOM   3173 O OD2 . ASP C 3 95  ? 6.034   38.471  93.544  1.00 31.41  ? 95  ASP I OD2 1 
ATOM   3174 N N   . PHE C 3 96  ? 1.714   37.581  89.815  1.00 25.41  ? 96  PHE I N   1 
ATOM   3175 C CA  . PHE C 3 96  ? 1.271   37.019  88.534  1.00 26.37  ? 96  PHE I CA  1 
ATOM   3176 C C   . PHE C 3 96  ? 1.857   37.762  87.334  1.00 26.43  ? 96  PHE I C   1 
ATOM   3177 O O   . PHE C 3 96  ? 1.739   38.988  87.247  1.00 23.55  ? 96  PHE I O   1 
ATOM   3178 C CB  . PHE C 3 96  ? -0.248  37.111  88.385  1.00 31.80  ? 96  PHE I CB  1 
ATOM   3179 C CG  . PHE C 3 96  ? -1.027  36.396  89.441  1.00 39.33  ? 96  PHE I CG  1 
ATOM   3180 C CD1 . PHE C 3 96  ? -0.535  35.246  90.045  1.00 42.28  ? 96  PHE I CD1 1 
ATOM   3181 C CD2 . PHE C 3 96  ? -2.282  36.871  89.815  1.00 42.89  ? 96  PHE I CD2 1 
ATOM   3182 C CE1 . PHE C 3 96  ? -1.285  34.579  91.007  1.00 46.47  ? 96  PHE I CE1 1 
ATOM   3183 C CE2 . PHE C 3 96  ? -3.039  36.215  90.772  1.00 43.09  ? 96  PHE I CE2 1 
ATOM   3184 C CZ  . PHE C 3 96  ? -2.540  35.064  91.372  1.00 45.97  ? 96  PHE I CZ  1 
ATOM   3185 N N   . THR C 3 97  ? 2.490   37.027  86.423  1.00 27.41  ? 97  THR I N   1 
ATOM   3186 C CA  . THR C 3 97  ? 3.036   37.601  85.188  1.00 25.00  ? 97  THR I CA  1 
ATOM   3187 C C   . THR C 3 97  ? 2.198   36.925  84.110  1.00 24.85  ? 97  THR I C   1 
ATOM   3188 O O   . THR C 3 97  ? 2.351   35.727  83.856  1.00 28.77  ? 97  THR I O   1 
ATOM   3189 C CB  . THR C 3 97  ? 4.520   37.234  84.974  1.00 24.81  ? 97  THR I CB  1 
ATOM   3190 O OG1 . THR C 3 97  ? 5.315   37.779  86.032  1.00 28.91  ? 97  THR I OG1 1 
ATOM   3191 C CG2 . THR C 3 97  ? 5.020   37.781  83.647  1.00 24.61  ? 97  THR I CG2 1 
ATOM   3192 N N   . PHE C 3 98  ? 1.254   37.657  83.539  1.00 17.94  ? 98  PHE I N   1 
ATOM   3193 C CA  . PHE C 3 98  ? 0.393   37.068  82.534  1.00 15.32  ? 98  PHE I CA  1 
ATOM   3194 C C   . PHE C 3 98  ? 1.103   36.928  81.204  1.00 19.79  ? 98  PHE I C   1 
ATOM   3195 O O   . PHE C 3 98  ? 1.552   37.916  80.634  1.00 26.35  ? 98  PHE I O   1 
ATOM   3196 C CB  . PHE C 3 98  ? -0.885  37.882  82.407  1.00 12.79  ? 98  PHE I CB  1 
ATOM   3197 C CG  . PHE C 3 98  ? -1.703  37.908  83.670  1.00 18.18  ? 98  PHE I CG  1 
ATOM   3198 C CD1 . PHE C 3 98  ? -1.450  38.853  84.663  1.00 21.94  ? 98  PHE I CD1 1 
ATOM   3199 C CD2 . PHE C 3 98  ? -2.696  36.961  83.891  1.00 16.20  ? 98  PHE I CD2 1 
ATOM   3200 C CE1 . PHE C 3 98  ? -2.171  38.852  85.862  1.00 18.63  ? 98  PHE I CE1 1 
ATOM   3201 C CE2 . PHE C 3 98  ? -3.421  36.952  85.084  1.00 23.15  ? 98  PHE I CE2 1 
ATOM   3202 C CZ  . PHE C 3 98  ? -3.154  37.902  86.074  1.00 17.36  ? 98  PHE I CZ  1 
ATOM   3203 N N   . ILE C 3 99  ? 1.205   35.692  80.724  1.00 22.49  ? 99  ILE I N   1 
ATOM   3204 C CA  . ILE C 3 99  ? 1.871   35.374  79.455  1.00 22.87  ? 99  ILE I CA  1 
ATOM   3205 C C   . ILE C 3 99  ? 0.901   35.435  78.253  1.00 19.48  ? 99  ILE I C   1 
ATOM   3206 O O   . ILE C 3 99  ? 1.133   36.162  77.286  1.00 16.34  ? 99  ILE I O   1 
ATOM   3207 C CB  . ILE C 3 99  ? 2.497   33.936  79.489  1.00 22.28  ? 99  ILE I CB  1 
ATOM   3208 C CG1 . ILE C 3 99  ? 3.182   33.649  80.834  1.00 20.67  ? 99  ILE I CG1 1 
ATOM   3209 C CG2 . ILE C 3 99  ? 3.476   33.752  78.344  1.00 24.04  ? 99  ILE I CG2 1 
ATOM   3210 C CD1 . ILE C 3 99  ? 4.370   34.517  81.153  1.00 21.61  ? 99  ILE I CD1 1 
ATOM   3211 N N   . SER C 3 100 ? -0.192  34.680  78.342  1.00 15.89  ? 100 SER I N   1 
ATOM   3212 C CA  . SER C 3 100 ? -1.194  34.587  77.284  1.00 14.79  ? 100 SER I CA  1 
ATOM   3213 C C   . SER C 3 100 ? -2.516  34.311  77.965  1.00 13.77  ? 100 SER I C   1 
ATOM   3214 O O   . SER C 3 100 ? -2.594  33.440  78.823  1.00 17.46  ? 100 SER I O   1 
ATOM   3215 C CB  . SER C 3 100 ? -0.857  33.411  76.360  1.00 20.08  ? 100 SER I CB  1 
ATOM   3216 O OG  . SER C 3 100 ? -1.897  33.122  75.438  1.00 17.37  ? 100 SER I OG  1 
ATOM   3217 N N   . VAL C 3 101 ? -3.565  35.005  77.551  1.00 13.72  ? 101 VAL I N   1 
ATOM   3218 C CA  . VAL C 3 101 ? -4.861  34.825  78.175  1.00 17.60  ? 101 VAL I CA  1 
ATOM   3219 C C   . VAL C 3 101 ? -6.056  35.183  77.306  1.00 18.90  ? 101 VAL I C   1 
ATOM   3220 O O   . VAL C 3 101 ? -6.018  36.123  76.521  1.00 23.45  ? 101 VAL I O   1 
ATOM   3221 C CB  . VAL C 3 101 ? -4.947  35.616  79.555  1.00 22.34  ? 101 VAL I CB  1 
ATOM   3222 C CG1 . VAL C 3 101 ? -4.225  36.936  79.473  1.00 19.54  ? 101 VAL I CG1 1 
ATOM   3223 C CG2 . VAL C 3 101 ? -6.401  35.860  79.976  1.00 18.12  ? 101 VAL I CG2 1 
ATOM   3224 N N   . SER C 3 102 ? -7.086  34.359  77.397  1.00 16.99  ? 102 SER I N   1 
ATOM   3225 C CA  . SER C 3 102 ? -8.324  34.604  76.708  1.00 16.09  ? 102 SER I CA  1 
ATOM   3226 C C   . SER C 3 102 ? -9.244  34.648  77.907  1.00 18.82  ? 102 SER I C   1 
ATOM   3227 O O   . SER C 3 102 ? -9.570  33.621  78.495  1.00 20.18  ? 102 SER I O   1 
ATOM   3228 C CB  . SER C 3 102 ? -8.684  33.452  75.782  1.00 19.30  ? 102 SER I CB  1 
ATOM   3229 O OG  . SER C 3 102 ? -8.593  32.214  76.456  1.00 34.41  ? 102 SER I OG  1 
ATOM   3230 N N   . TYR C 3 103 ? -9.614  35.855  78.301  1.00 21.73  ? 103 TYR I N   1 
ATOM   3231 C CA  . TYR C 3 103 ? -10.466 36.081  79.465  1.00 19.95  ? 103 TYR I CA  1 
ATOM   3232 C C   . TYR C 3 103 ? -11.730 35.231  79.579  1.00 18.47  ? 103 TYR I C   1 
ATOM   3233 O O   . TYR C 3 103 ? -12.382 35.246  80.616  1.00 21.15  ? 103 TYR I O   1 
ATOM   3234 C CB  . TYR C 3 103 ? -10.840 37.558  79.546  1.00 17.80  ? 103 TYR I CB  1 
ATOM   3235 C CG  . TYR C 3 103 ? -9.687  38.486  79.268  1.00 9.93   ? 103 TYR I CG  1 
ATOM   3236 C CD1 . TYR C 3 103 ? -8.640  38.615  80.166  1.00 14.20  ? 103 TYR I CD1 1 
ATOM   3237 C CD2 . TYR C 3 103 ? -9.627  39.205  78.081  1.00 19.17  ? 103 TYR I CD2 1 
ATOM   3238 C CE1 . TYR C 3 103 ? -7.549  39.436  79.883  1.00 24.18  ? 103 TYR I CE1 1 
ATOM   3239 C CE2 . TYR C 3 103 ? -8.546  40.030  77.787  1.00 22.05  ? 103 TYR I CE2 1 
ATOM   3240 C CZ  . TYR C 3 103 ? -7.511  40.138  78.689  1.00 24.47  ? 103 TYR I CZ  1 
ATOM   3241 O OH  . TYR C 3 103 ? -6.429  40.928  78.388  1.00 32.24  ? 103 TYR I OH  1 
ATOM   3242 N N   . ASP C 3 104 ? -12.067 34.476  78.541  1.00 16.83  ? 104 ASP I N   1 
ATOM   3243 C CA  . ASP C 3 104 ? -13.271 33.654  78.577  1.00 23.68  ? 104 ASP I CA  1 
ATOM   3244 C C   . ASP C 3 104 ? -12.991 32.174  78.380  1.00 25.14  ? 104 ASP I C   1 
ATOM   3245 O O   . ASP C 3 104 ? -13.918 31.369  78.329  1.00 25.29  ? 104 ASP I O   1 
ATOM   3246 C CB  . ASP C 3 104 ? -14.275 34.125  77.518  1.00 30.35  ? 104 ASP I CB  1 
ATOM   3247 C CG  . ASP C 3 104 ? -13.721 34.053  76.099  1.00 39.81  ? 104 ASP I CG  1 
ATOM   3248 O OD1 . ASP C 3 104 ? -12.499 34.259  75.905  1.00 46.11  ? 104 ASP I OD1 1 
ATOM   3249 O OD2 . ASP C 3 104 ? -14.516 33.800  75.169  1.00 47.69  ? 104 ASP I OD2 1 
ATOM   3250 N N   . ASN C 3 105 ? -11.715 31.813  78.308  1.00 23.13  ? 105 ASN I N   1 
ATOM   3251 C CA  . ASN C 3 105 ? -11.333 30.430  78.087  1.00 22.63  ? 105 ASN I CA  1 
ATOM   3252 C C   . ASN C 3 105 ? -10.261 29.966  79.075  1.00 23.53  ? 105 ASN I C   1 
ATOM   3253 O O   . ASN C 3 105 ? -10.580 29.305  80.066  1.00 26.18  ? 105 ASN I O   1 
ATOM   3254 C CB  . ASN C 3 105 ? -10.855 30.276  76.642  1.00 28.63  ? 105 ASN I CB  1 
ATOM   3255 C CG  . ASN C 3 105 ? -10.540 28.846  76.270  1.00 32.68  ? 105 ASN I CG  1 
ATOM   3256 O OD1 . ASN C 3 105 ? -11.082 27.896  76.839  1.00 36.89  ? 105 ASN I OD1 1 
ATOM   3257 N ND2 . ASN C 3 105 ? -9.647  28.685  75.308  1.00 38.52  ? 105 ASN I ND2 1 
ATOM   3258 N N   . PHE C 3 106 ? -9.002  30.317  78.823  1.00 16.83  ? 106 PHE I N   1 
ATOM   3259 C CA  . PHE C 3 106 ? -7.918  29.923  79.712  1.00 12.03  ? 106 PHE I CA  1 
ATOM   3260 C C   . PHE C 3 106 ? -6.828  30.982  79.705  1.00 13.29  ? 106 PHE I C   1 
ATOM   3261 O O   . PHE C 3 106 ? -6.829  31.876  78.858  1.00 10.98  ? 106 PHE I O   1 
ATOM   3262 C CB  . PHE C 3 106 ? -7.349  28.548  79.316  1.00 16.67  ? 106 PHE I CB  1 
ATOM   3263 C CG  . PHE C 3 106 ? -6.440  28.573  78.107  1.00 18.26  ? 106 PHE I CG  1 
ATOM   3264 C CD1 . PHE C 3 106 ? -5.077  28.850  78.242  1.00 10.80  ? 106 PHE I CD1 1 
ATOM   3265 C CD2 . PHE C 3 106 ? -6.942  28.315  76.840  1.00 10.19  ? 106 PHE I CD2 1 
ATOM   3266 C CE1 . PHE C 3 106 ? -4.236  28.871  77.139  1.00 8.15   ? 106 PHE I CE1 1 
ATOM   3267 C CE2 . PHE C 3 106 ? -6.102  28.335  75.733  1.00 6.98   ? 106 PHE I CE2 1 
ATOM   3268 C CZ  . PHE C 3 106 ? -4.749  28.614  75.885  1.00 3.69   ? 106 PHE I CZ  1 
ATOM   3269 N N   . ALA C 3 107 ? -5.890  30.877  80.641  1.00 16.76  ? 107 ALA I N   1 
ATOM   3270 C CA  . ALA C 3 107 ? -4.803  31.838  80.741  1.00 13.47  ? 107 ALA I CA  1 
ATOM   3271 C C   . ALA C 3 107 ? -3.547  31.181  81.260  1.00 13.16  ? 107 ALA I C   1 
ATOM   3272 O O   . ALA C 3 107 ? -3.589  30.481  82.270  1.00 14.77  ? 107 ALA I O   1 
ATOM   3273 C CB  . ALA C 3 107 ? -5.202  32.969  81.669  1.00 17.51  ? 107 ALA I CB  1 
ATOM   3274 N N   . LEU C 3 108 ? -2.445  31.378  80.544  1.00 11.33  ? 108 LEU I N   1 
ATOM   3275 C CA  . LEU C 3 108 ? -1.149  30.841  80.934  1.00 13.50  ? 108 LEU I CA  1 
ATOM   3276 C C   . LEU C 3 108 ? -0.559  31.975  81.770  1.00 17.68  ? 108 LEU I C   1 
ATOM   3277 O O   . LEU C 3 108 ? -0.617  33.133  81.359  1.00 20.92  ? 108 LEU I O   1 
ATOM   3278 C CB  . LEU C 3 108 ? -0.307  30.565  79.687  1.00 10.09  ? 108 LEU I CB  1 
ATOM   3279 C CG  . LEU C 3 108 ? 0.927   29.650  79.741  1.00 12.57  ? 108 LEU I CG  1 
ATOM   3280 C CD1 . LEU C 3 108 ? 2.166   30.416  79.313  1.00 8.96   ? 108 LEU I CD1 1 
ATOM   3281 C CD2 . LEU C 3 108 ? 1.122   29.013  81.115  1.00 12.73  ? 108 LEU I CD2 1 
ATOM   3282 N N   . VAL C 3 109 ? -0.014  31.658  82.940  1.00 18.35  ? 109 VAL I N   1 
ATOM   3283 C CA  . VAL C 3 109 ? 0.517   32.674  83.852  1.00 17.62  ? 109 VAL I CA  1 
ATOM   3284 C C   . VAL C 3 109 ? 1.741   32.165  84.623  1.00 18.92  ? 109 VAL I C   1 
ATOM   3285 O O   . VAL C 3 109 ? 1.816   30.991  84.970  1.00 22.12  ? 109 VAL I O   1 
ATOM   3286 C CB  . VAL C 3 109 ? -0.600  33.082  84.897  1.00 15.27  ? 109 VAL I CB  1 
ATOM   3287 C CG1 . VAL C 3 109 ? -0.045  33.977  85.978  1.00 19.89  ? 109 VAL I CG1 1 
ATOM   3288 C CG2 . VAL C 3 109 ? -1.760  33.780  84.209  1.00 11.53  ? 109 VAL I CG2 1 
ATOM   3289 N N   . CYS C 3 110 ? 2.722   33.031  84.849  1.00 18.15  ? 110 CYS I N   1 
ATOM   3290 C CA  . CYS C 3 110 ? 3.887   32.627  85.625  1.00 17.81  ? 110 CYS I CA  1 
ATOM   3291 C C   . CYS C 3 110 ? 3.619   33.171  87.020  1.00 20.25  ? 110 CYS I C   1 
ATOM   3292 O O   . CYS C 3 110 ? 3.357   34.360  87.176  1.00 19.71  ? 110 CYS I O   1 
ATOM   3293 C CB  . CYS C 3 110 ? 5.168   33.221  85.057  1.00 16.67  ? 110 CYS I CB  1 
ATOM   3294 S SG  . CYS C 3 110 ? 6.673   32.393  85.662  1.00 22.68  ? 110 CYS I SG  1 
ATOM   3295 N N   . ARG C 3 111 ? 3.619   32.290  88.014  1.00 24.41  ? 111 ARG I N   1 
ATOM   3296 C CA  . ARG C 3 111 ? 3.341   32.662  89.392  1.00 19.73  ? 111 ARG I CA  1 
ATOM   3297 C C   . ARG C 3 111 ? 4.502   32.460  90.351  1.00 23.94  ? 111 ARG I C   1 
ATOM   3298 O O   . ARG C 3 111 ? 5.198   31.443  90.309  1.00 25.76  ? 111 ARG I O   1 
ATOM   3299 C CB  . ARG C 3 111 ? 2.141   31.862  89.867  1.00 21.84  ? 111 ARG I CB  1 
ATOM   3300 C CG  . ARG C 3 111 ? 1.752   32.001  91.326  1.00 25.21  ? 111 ARG I CG  1 
ATOM   3301 C CD  . ARG C 3 111 ? 0.261   31.720  91.410  1.00 27.48  ? 111 ARG I CD  1 
ATOM   3302 N NE  . ARG C 3 111 ? -0.195  30.839  92.486  1.00 26.12  ? 111 ARG I NE  1 
ATOM   3303 C CZ  . ARG C 3 111 ? 0.386   29.707  92.861  1.00 21.72  ? 111 ARG I CZ  1 
ATOM   3304 N NH1 . ARG C 3 111 ? 1.503   29.283  92.284  1.00 23.47  ? 111 ARG I NH1 1 
ATOM   3305 N NH2 . ARG C 3 111 ? -0.251  28.907  93.702  1.00 18.18  ? 111 ARG I NH2 1 
ATOM   3306 N N   . SER C 3 112 ? 4.729   33.460  91.188  1.00 24.18  ? 112 SER I N   1 
ATOM   3307 C CA  . SER C 3 112 ? 5.769   33.389  92.194  1.00 27.05  ? 112 SER I CA  1 
ATOM   3308 C C   . SER C 3 112 ? 5.067   33.437  93.532  1.00 28.60  ? 112 SER I C   1 
ATOM   3309 O O   . SER C 3 112 ? 4.364   34.408  93.829  1.00 29.87  ? 112 SER I O   1 
ATOM   3310 C CB  . SER C 3 112 ? 6.722   34.570  92.079  1.00 26.50  ? 112 SER I CB  1 
ATOM   3311 O OG  . SER C 3 112 ? 7.421   34.512  90.858  1.00 39.66  ? 112 SER I OG  1 
ATOM   3312 N N   . ILE C 3 113 ? 5.154   32.347  94.283  1.00 29.71  ? 113 ILE I N   1 
ATOM   3313 C CA  . ILE C 3 113 ? 4.534   32.310  95.597  1.00 33.89  ? 113 ILE I CA  1 
ATOM   3314 C C   . ILE C 3 113 ? 5.693   32.423  96.561  1.00 36.15  ? 113 ILE I C   1 
ATOM   3315 O O   . ILE C 3 113 ? 6.760   31.828  96.350  1.00 33.35  ? 113 ILE I O   1 
ATOM   3316 C CB  . ILE C 3 113 ? 3.731   30.994  95.901  1.00 33.93  ? 113 ILE I CB  1 
ATOM   3317 C CG1 . ILE C 3 113 ? 3.481   30.172  94.638  1.00 40.48  ? 113 ILE I CG1 1 
ATOM   3318 C CG2 . ILE C 3 113 ? 2.380   31.334  96.511  1.00 26.81  ? 113 ILE I CG2 1 
ATOM   3319 C CD1 . ILE C 3 113 ? 4.539   29.125  94.350  1.00 43.67  ? 113 ILE I CD1 1 
ATOM   3320 N N   . THR C 3 114 ? 5.500   33.234  97.586  1.00 38.61  ? 114 THR I N   1 
ATOM   3321 C CA  . THR C 3 114 ? 6.524   33.437  98.592  1.00 43.58  ? 114 THR I CA  1 
ATOM   3322 C C   . THR C 3 114 ? 5.892   33.308  99.977  1.00 48.05  ? 114 THR I C   1 
ATOM   3323 O O   . THR C 3 114 ? 5.316   34.265  100.510 1.00 49.31  ? 114 THR I O   1 
ATOM   3324 C CB  . THR C 3 114 ? 7.162   34.827  98.434  1.00 39.10  ? 114 THR I CB  1 
ATOM   3325 O OG1 . THR C 3 114 ? 7.575   35.013  97.073  1.00 35.93  ? 114 THR I OG1 1 
ATOM   3326 C CG2 . THR C 3 114 ? 8.360   34.958  99.340  1.00 36.74  ? 114 THR I CG2 1 
ATOM   3327 N N   . PHE C 3 115 ? 5.924   32.099  100.523 1.00 50.07  ? 115 PHE I N   1 
ATOM   3328 C CA  . PHE C 3 115 ? 5.363   31.870  101.845 1.00 51.66  ? 115 PHE I CA  1 
ATOM   3329 C C   . PHE C 3 115 ? 6.308   32.502  102.838 1.00 58.99  ? 115 PHE I C   1 
ATOM   3330 O O   . PHE C 3 115 ? 7.514   32.571  102.587 1.00 60.69  ? 115 PHE I O   1 
ATOM   3331 C CB  . PHE C 3 115 ? 5.217   30.376  102.122 1.00 41.44  ? 115 PHE I CB  1 
ATOM   3332 C CG  . PHE C 3 115 ? 4.216   29.704  101.240 1.00 31.94  ? 115 PHE I CG  1 
ATOM   3333 C CD1 . PHE C 3 115 ? 4.580   29.250  99.976  1.00 32.06  ? 115 PHE I CD1 1 
ATOM   3334 C CD2 . PHE C 3 115 ? 2.900   29.557  101.653 1.00 27.41  ? 115 PHE I CD2 1 
ATOM   3335 C CE1 . PHE C 3 115 ? 3.646   28.661  99.132  1.00 33.53  ? 115 PHE I CE1 1 
ATOM   3336 C CE2 . PHE C 3 115 ? 1.959   28.971  100.821 1.00 33.00  ? 115 PHE I CE2 1 
ATOM   3337 C CZ  . PHE C 3 115 ? 2.332   28.521  99.553  1.00 35.00  ? 115 PHE I CZ  1 
ATOM   3338 N N   . THR C 3 116 ? 5.758   32.997  103.942 1.00 65.90  ? 116 THR I N   1 
ATOM   3339 C CA  . THR C 3 116 ? 6.558   33.632  104.985 1.00 69.81  ? 116 THR I CA  1 
ATOM   3340 C C   . THR C 3 116 ? 7.692   32.698  105.418 1.00 75.08  ? 116 THR I C   1 
ATOM   3341 O O   . THR C 3 116 ? 8.776   33.146  105.811 1.00 74.96  ? 116 THR I O   1 
ATOM   3342 C CB  . THR C 3 116 ? 5.669   33.997  106.188 1.00 68.29  ? 116 THR I CB  1 
ATOM   3343 O OG1 . THR C 3 116 ? 4.773   32.911  106.467 1.00 71.76  ? 116 THR I OG1 1 
ATOM   3344 C CG2 . THR C 3 116 ? 4.856   35.250  105.883 1.00 65.15  ? 116 THR I CG2 1 
ATOM   3345 N N   . SER C 3 117 ? 7.429   31.398  105.286 1.00 79.76  ? 117 SER I N   1 
ATOM   3346 C CA  . SER C 3 117 ? 8.367   30.336  105.628 1.00 83.01  ? 117 SER I CA  1 
ATOM   3347 C C   . SER C 3 117 ? 9.512   30.239  104.606 1.00 83.77  ? 117 SER I C   1 
ATOM   3348 O O   . SER C 3 117 ? 10.516  30.947  104.724 1.00 83.62  ? 117 SER I O   1 
ATOM   3349 C CB  . SER C 3 117 ? 7.608   29.005  105.712 1.00 84.86  ? 117 SER I CB  1 
ATOM   3350 O OG  . SER C 3 117 ? 6.347   29.177  106.344 1.00 85.07  ? 117 SER I OG  1 
ATOM   3351 N N   . GLN C 3 118 ? 9.372   29.342  103.628 1.00 82.56  ? 118 GLN I N   1 
ATOM   3352 C CA  . GLN C 3 118 ? 10.387  29.162  102.591 1.00 82.55  ? 118 GLN I CA  1 
ATOM   3353 C C   . GLN C 3 118 ? 9.996   30.013  101.387 1.00 84.05  ? 118 GLN I C   1 
ATOM   3354 O O   . GLN C 3 118 ? 9.018   29.713  100.695 1.00 89.43  ? 118 GLN I O   1 
ATOM   3355 C CB  . GLN C 3 118 ? 10.492  27.689  102.187 0.00 79.53  ? 118 GLN I CB  1 
ATOM   3356 C CG  . GLN C 3 118 ? 10.991  26.775  103.295 0.00 75.60  ? 118 GLN I CG  1 
ATOM   3357 C CD  . GLN C 3 118 ? 11.116  25.331  102.851 0.00 73.07  ? 118 GLN I CD  1 
ATOM   3358 O OE1 . GLN C 3 118 ? 10.272  24.497  103.169 0.00 71.81  ? 118 GLN I OE1 1 
ATOM   3359 N NE2 . GLN C 3 118 ? 12.178  25.026  102.118 0.00 71.61  ? 118 GLN I NE2 1 
ATOM   3360 N N   . PRO C 3 119 ? 10.730  31.110  101.147 1.00 80.32  ? 119 PRO I N   1 
ATOM   3361 C CA  . PRO C 3 119 ? 10.471  32.027  100.035 1.00 78.41  ? 119 PRO I CA  1 
ATOM   3362 C C   . PRO C 3 119 ? 10.959  31.580  98.651  1.00 76.54  ? 119 PRO I C   1 
ATOM   3363 O O   . PRO C 3 119 ? 11.788  30.675  98.529  1.00 75.55  ? 119 PRO I O   1 
ATOM   3364 C CB  . PRO C 3 119 ? 11.180  33.297  100.491 1.00 77.54  ? 119 PRO I CB  1 
ATOM   3365 C CG  . PRO C 3 119 ? 12.376  32.755  101.175 1.00 81.16  ? 119 PRO I CG  1 
ATOM   3366 C CD  . PRO C 3 119 ? 11.805  31.631  102.009 1.00 79.38  ? 119 PRO I CD  1 
ATOM   3367 N N   . LYS C 3 120 ? 10.435  32.257  97.626  1.00 73.65  ? 120 LYS I N   1 
ATOM   3368 C CA  . LYS C 3 120 ? 10.759  32.028  96.220  1.00 69.06  ? 120 LYS I CA  1 
ATOM   3369 C C   . LYS C 3 120 ? 10.276  30.697  95.651  1.00 65.66  ? 120 LYS I C   1 
ATOM   3370 O O   . LYS C 3 120 ? 10.750  29.634  96.041  1.00 67.42  ? 120 LYS I O   1 
ATOM   3371 C CB  . LYS C 3 120 ? 12.267  32.185  95.978  1.00 74.24  ? 120 LYS I CB  1 
ATOM   3372 C CG  . LYS C 3 120 ? 12.675  32.198  94.500  1.00 81.08  ? 120 LYS I CG  1 
ATOM   3373 C CD  . LYS C 3 120 ? 12.283  33.512  93.812  1.00 82.23  ? 120 LYS I CD  1 
ATOM   3374 C CE  . LYS C 3 120 ? 12.548  33.491  92.300  1.00 80.59  ? 120 LYS I CE  1 
ATOM   3375 N NZ  . LYS C 3 120 ? 13.943  33.140  91.905  1.00 76.66  ? 120 LYS I NZ  1 
ATOM   3376 N N   . GLU C 3 121 ? 9.344   30.768  94.704  1.00 60.85  ? 121 GLU I N   1 
ATOM   3377 C CA  . GLU C 3 121 ? 8.811   29.577  94.047  1.00 54.62  ? 121 GLU I CA  1 
ATOM   3378 C C   . GLU C 3 121 ? 8.072   30.003  92.772  1.00 46.75  ? 121 GLU I C   1 
ATOM   3379 O O   . GLU C 3 121 ? 7.050   30.688  92.835  1.00 43.52  ? 121 GLU I O   1 
ATOM   3380 C CB  . GLU C 3 121 ? 7.885   28.821  94.996  1.00 61.42  ? 121 GLU I CB  1 
ATOM   3381 C CG  . GLU C 3 121 ? 7.806   27.329  94.723  1.00 70.65  ? 121 GLU I CG  1 
ATOM   3382 C CD  . GLU C 3 121 ? 6.872   26.602  95.676  1.00 80.67  ? 121 GLU I CD  1 
ATOM   3383 O OE1 . GLU C 3 121 ? 7.035   26.745  96.912  1.00 83.86  ? 121 GLU I OE1 1 
ATOM   3384 O OE2 . GLU C 3 121 ? 5.976   25.880  95.182  1.00 85.94  ? 121 GLU I OE2 1 
ATOM   3385 N N   . ASP C 3 122 ? 8.621   29.623  91.620  1.00 40.52  ? 122 ASP I N   1 
ATOM   3386 C CA  . ASP C 3 122 ? 8.057   29.993  90.323  1.00 36.18  ? 122 ASP I CA  1 
ATOM   3387 C C   . ASP C 3 122 ? 7.529   28.808  89.551  1.00 32.55  ? 122 ASP I C   1 
ATOM   3388 O O   . ASP C 3 122 ? 8.197   27.780  89.432  1.00 33.95  ? 122 ASP I O   1 
ATOM   3389 C CB  . ASP C 3 122 ? 9.112   30.675  89.452  1.00 42.32  ? 122 ASP I CB  1 
ATOM   3390 C CG  . ASP C 3 122 ? 9.740   31.877  90.117  1.00 48.68  ? 122 ASP I CG  1 
ATOM   3391 O OD1 . ASP C 3 122 ? 10.366  31.709  91.182  1.00 55.49  ? 122 ASP I OD1 1 
ATOM   3392 O OD2 . ASP C 3 122 ? 9.626   32.987  89.560  1.00 49.69  ? 122 ASP I OD2 1 
ATOM   3393 N N   . ARG C 3 123 ? 6.369   28.985  88.940  1.00 28.87  ? 123 ARG I N   1 
ATOM   3394 C CA  . ARG C 3 123 ? 5.776   27.914  88.169  1.00 26.45  ? 123 ARG I CA  1 
ATOM   3395 C C   . ARG C 3 123 ? 4.767   28.463  87.160  1.00 21.85  ? 123 ARG I C   1 
ATOM   3396 O O   . ARG C 3 123 ? 4.019   29.398  87.453  1.00 22.23  ? 123 ARG I O   1 
ATOM   3397 C CB  . ARG C 3 123 ? 5.140   26.905  89.132  1.00 33.26  ? 123 ARG I CB  1 
ATOM   3398 C CG  . ARG C 3 123 ? 4.623   25.619  88.508  1.00 47.82  ? 123 ARG I CG  1 
ATOM   3399 C CD  . ARG C 3 123 ? 4.280   24.614  89.604  1.00 62.16  ? 123 ARG I CD  1 
ATOM   3400 N NE  . ARG C 3 123 ? 3.406   23.533  89.145  1.00 69.93  ? 123 ARG I NE  1 
ATOM   3401 C CZ  . ARG C 3 123 ? 2.969   22.543  89.921  1.00 71.68  ? 123 ARG I CZ  1 
ATOM   3402 N NH1 . ARG C 3 123 ? 3.320   22.485  91.203  1.00 70.21  ? 123 ARG I NH1 1 
ATOM   3403 N NH2 . ARG C 3 123 ? 2.174   21.607  89.418  1.00 70.73  ? 123 ARG I NH2 1 
ATOM   3404 N N   . TYR C 3 124 ? 4.830   27.939  85.939  1.00 19.12  ? 124 TYR I N   1 
ATOM   3405 C CA  . TYR C 3 124 ? 3.924   28.339  84.868  1.00 17.51  ? 124 TYR I CA  1 
ATOM   3406 C C   . TYR C 3 124 ? 2.630   27.565  85.070  1.00 17.38  ? 124 TYR I C   1 
ATOM   3407 O O   . TYR C 3 124 ? 2.626   26.333  85.052  1.00 18.08  ? 124 TYR I O   1 
ATOM   3408 C CB  . TYR C 3 124 ? 4.542   28.027  83.498  1.00 19.37  ? 124 TYR I CB  1 
ATOM   3409 C CG  . TYR C 3 124 ? 5.815   28.809  83.199  1.00 16.30  ? 124 TYR I CG  1 
ATOM   3410 C CD1 . TYR C 3 124 ? 5.760   30.109  82.693  1.00 7.72   ? 124 TYR I CD1 1 
ATOM   3411 C CD2 . TYR C 3 124 ? 7.068   28.251  83.431  1.00 19.48  ? 124 TYR I CD2 1 
ATOM   3412 C CE1 . TYR C 3 124 ? 6.929   30.832  82.432  1.00 17.93  ? 124 TYR I CE1 1 
ATOM   3413 C CE2 . TYR C 3 124 ? 8.240   28.962  83.169  1.00 24.29  ? 124 TYR I CE2 1 
ATOM   3414 C CZ  . TYR C 3 124 ? 8.168   30.250  82.673  1.00 24.56  ? 124 TYR I CZ  1 
ATOM   3415 O OH  . TYR C 3 124 ? 9.339   30.945  82.426  1.00 28.81  ? 124 TYR I OH  1 
ATOM   3416 N N   . LEU C 3 125 ? 1.540   28.291  85.284  1.00 18.13  ? 125 LEU I N   1 
ATOM   3417 C CA  . LEU C 3 125 ? 0.240   27.686  85.545  1.00 16.47  ? 125 LEU I CA  1 
ATOM   3418 C C   . LEU C 3 125 ? -0.796  28.081  84.501  1.00 15.53  ? 125 LEU I C   1 
ATOM   3419 O O   . LEU C 3 125 ? -0.633  29.082  83.803  1.00 18.44  ? 125 LEU I O   1 
ATOM   3420 C CB  . LEU C 3 125 ? -0.254  28.123  86.927  1.00 15.50  ? 125 LEU I CB  1 
ATOM   3421 C CG  . LEU C 3 125 ? 0.690   27.979  88.122  1.00 15.45  ? 125 LEU I CG  1 
ATOM   3422 C CD1 . LEU C 3 125 ? 0.117   28.756  89.300  1.00 8.85   ? 125 LEU I CD1 1 
ATOM   3423 C CD2 . LEU C 3 125 ? 0.885   26.522  88.477  1.00 12.62  ? 125 LEU I CD2 1 
ATOM   3424 N N   . VAL C 3 126 ? -1.869  27.297  84.416  1.00 12.06  ? 126 VAL I N   1 
ATOM   3425 C CA  . VAL C 3 126 ? -2.949  27.546  83.475  1.00 12.22  ? 126 VAL I CA  1 
ATOM   3426 C C   . VAL C 3 126 ? -4.285  27.677  84.207  1.00 16.17  ? 126 VAL I C   1 
ATOM   3427 O O   . VAL C 3 126 ? -4.778  26.703  84.782  1.00 18.73  ? 126 VAL I O   1 
ATOM   3428 C CB  . VAL C 3 126 ? -3.055  26.410  82.435  1.00 8.02   ? 126 VAL I CB  1 
ATOM   3429 C CG1 . VAL C 3 126 ? -4.340  26.549  81.626  1.00 9.56   ? 126 VAL I CG1 1 
ATOM   3430 C CG2 . VAL C 3 126 ? -1.858  26.432  81.517  1.00 2.71   ? 126 VAL I CG2 1 
ATOM   3431 N N   . PHE C 3 127 ? -4.857  28.879  84.191  1.00 14.43  ? 127 PHE I N   1 
ATOM   3432 C CA  . PHE C 3 127 ? -6.137  29.140  84.843  1.00 14.96  ? 127 PHE I CA  1 
ATOM   3433 C C   . PHE C 3 127 ? -7.247  28.840  83.848  1.00 18.08  ? 127 PHE I C   1 
ATOM   3434 O O   . PHE C 3 127 ? -7.259  29.375  82.742  1.00 24.06  ? 127 PHE I O   1 
ATOM   3435 C CB  . PHE C 3 127 ? -6.245  30.608  85.278  1.00 19.28  ? 127 PHE I CB  1 
ATOM   3436 C CG  . PHE C 3 127 ? -5.252  31.026  86.344  1.00 24.35  ? 127 PHE I CG  1 
ATOM   3437 C CD1 . PHE C 3 127 ? -3.937  31.340  86.012  1.00 27.28  ? 127 PHE I CD1 1 
ATOM   3438 C CD2 . PHE C 3 127 ? -5.655  31.177  87.672  1.00 28.96  ? 127 PHE I CD2 1 
ATOM   3439 C CE1 . PHE C 3 127 ? -3.045  31.806  86.985  1.00 26.90  ? 127 PHE I CE1 1 
ATOM   3440 C CE2 . PHE C 3 127 ? -4.766  31.643  88.650  1.00 23.13  ? 127 PHE I CE2 1 
ATOM   3441 C CZ  . PHE C 3 127 ? -3.467  31.957  88.304  1.00 21.77  ? 127 PHE I CZ  1 
ATOM   3442 N N   . GLU C 3 128 ? -8.175  27.980  84.231  1.00 20.45  ? 128 GLU I N   1 
ATOM   3443 C CA  . GLU C 3 128 ? -9.285  27.626  83.364  1.00 22.11  ? 128 GLU I CA  1 
ATOM   3444 C C   . GLU C 3 128 ? -10.539 28.388  83.736  1.00 25.08  ? 128 GLU I C   1 
ATOM   3445 O O   . GLU C 3 128 ? -10.782 28.655  84.907  1.00 31.26  ? 128 GLU I O   1 
ATOM   3446 C CB  . GLU C 3 128 ? -9.568  26.136  83.457  1.00 16.76  ? 128 GLU I CB  1 
ATOM   3447 C CG  . GLU C 3 128 ? -8.512  25.305  82.805  1.00 20.76  ? 128 GLU I CG  1 
ATOM   3448 C CD  . GLU C 3 128 ? -8.864  23.849  82.800  1.00 25.27  ? 128 GLU I CD  1 
ATOM   3449 O OE1 . GLU C 3 128 ? -9.870  23.477  82.151  1.00 27.36  ? 128 GLU I OE1 1 
ATOM   3450 O OE2 . GLU C 3 128 ? -8.132  23.076  83.452  1.00 34.50  ? 128 GLU I OE2 1 
ATOM   3451 N N   . ARG C 3 129 ? -11.328 28.751  82.738  1.00 24.24  ? 129 ARG I N   1 
ATOM   3452 C CA  . ARG C 3 129 ? -12.562 29.467  82.987  1.00 25.76  ? 129 ARG I CA  1 
ATOM   3453 C C   . ARG C 3 129 ? -13.675 28.440  83.178  1.00 31.63  ? 129 ARG I C   1 
ATOM   3454 O O   . ARG C 3 129 ? -14.670 28.708  83.847  1.00 34.67  ? 129 ARG I O   1 
ATOM   3455 C CB  . ARG C 3 129 ? -12.863 30.403  81.816  1.00 20.60  ? 129 ARG I CB  1 
ATOM   3456 C CG  . ARG C 3 129 ? -13.716 31.607  82.160  1.00 19.38  ? 129 ARG I CG  1 
ATOM   3457 C CD  . ARG C 3 129 ? -13.151 32.366  83.342  1.00 21.91  ? 129 ARG I CD  1 
ATOM   3458 N NE  . ARG C 3 129 ? -13.066 33.808  83.113  1.00 25.76  ? 129 ARG I NE  1 
ATOM   3459 C CZ  . ARG C 3 129 ? -13.189 34.734  84.064  1.00 26.55  ? 129 ARG I CZ  1 
ATOM   3460 N NH1 . ARG C 3 129 ? -13.414 34.389  85.324  1.00 21.84  ? 129 ARG I NH1 1 
ATOM   3461 N NH2 . ARG C 3 129 ? -13.029 36.013  83.763  1.00 32.62  ? 129 ARG I NH2 1 
ATOM   3462 N N   . THR C 3 130 ? -13.478 27.247  82.621  1.00 36.36  ? 130 THR I N   1 
ATOM   3463 C CA  . THR C 3 130 ? -14.456 26.164  82.725  1.00 37.96  ? 130 THR I CA  1 
ATOM   3464 C C   . THR C 3 130 ? -14.022 25.090  83.733  1.00 38.33  ? 130 THR I C   1 
ATOM   3465 O O   . THR C 3 130 ? -12.863 24.654  83.736  1.00 37.21  ? 130 THR I O   1 
ATOM   3466 C CB  . THR C 3 130 ? -14.743 25.544  81.315  1.00 42.30  ? 130 THR I CB  1 
ATOM   3467 O OG1 . THR C 3 130 ? -16.107 25.796  80.949  1.00 42.85  ? 130 THR I OG1 1 
ATOM   3468 C CG2 . THR C 3 130 ? -14.463 24.031  81.272  1.00 44.20  ? 130 THR I CG2 1 
ATOM   3469 N N   . LYS C 3 131 ? -14.955 24.676  84.590  1.00 36.91  ? 131 LYS I N   1 
ATOM   3470 C CA  . LYS C 3 131 ? -14.681 23.661  85.598  1.00 36.87  ? 131 LYS I CA  1 
ATOM   3471 C C   . LYS C 3 131 ? -14.560 22.272  84.989  1.00 37.89  ? 131 LYS I C   1 
ATOM   3472 O O   . LYS C 3 131 ? -15.443 21.812  84.268  1.00 40.21  ? 131 LYS I O   1 
ATOM   3473 C CB  . LYS C 3 131 ? -15.767 23.660  86.668  1.00 35.51  ? 131 LYS I CB  1 
ATOM   3474 C CG  . LYS C 3 131 ? -15.581 22.568  87.706  1.00 43.22  ? 131 LYS I CG  1 
ATOM   3475 C CD  . LYS C 3 131 ? -16.530 22.738  88.880  1.00 50.94  ? 131 LYS I CD  1 
ATOM   3476 C CE  . LYS C 3 131 ? -17.972 22.617  88.448  1.00 52.89  ? 131 LYS I CE  1 
ATOM   3477 N NZ  . LYS C 3 131 ? -18.872 22.971  89.566  1.00 56.59  ? 131 LYS I NZ  1 
ATOM   3478 N N   . SER C 3 132 ? -13.482 21.585  85.326  1.00 41.64  ? 132 SER I N   1 
ATOM   3479 C CA  . SER C 3 132 ? -13.232 20.249  84.807  1.00 46.21  ? 132 SER I CA  1 
ATOM   3480 C C   . SER C 3 132 ? -14.006 19.174  85.571  1.00 48.12  ? 132 SER I C   1 
ATOM   3481 O O   . SER C 3 132 ? -13.418 18.193  86.011  1.00 51.34  ? 132 SER I O   1 
ATOM   3482 C CB  . SER C 3 132 ? -11.721 19.962  84.847  1.00 47.45  ? 132 SER I CB  1 
ATOM   3483 O OG  . SER C 3 132 ? -11.357 18.812  84.103  1.00 50.97  ? 132 SER I OG  1 
ATOM   3484 N N   . ASP C 3 133 ? -15.314 19.370  85.739  1.00 50.02  ? 133 ASP I N   1 
ATOM   3485 C CA  . ASP C 3 133 ? -16.191 18.416  86.434  1.00 56.30  ? 133 ASP I CA  1 
ATOM   3486 C C   . ASP C 3 133 ? -15.748 17.945  87.824  1.00 57.35  ? 133 ASP I C   1 
ATOM   3487 O O   . ASP C 3 133 ? -16.395 18.267  88.818  1.00 63.00  ? 133 ASP I O   1 
ATOM   3488 C CB  . ASP C 3 133 ? -16.491 17.206  85.539  1.00 63.77  ? 133 ASP I CB  1 
ATOM   3489 C CG  . ASP C 3 133 ? -17.341 17.565  84.319  1.00 73.68  ? 133 ASP I CG  1 
ATOM   3490 O OD1 . ASP C 3 133 ? -17.815 18.722  84.215  1.00 75.69  ? 133 ASP I OD1 1 
ATOM   3491 O OD2 . ASP C 3 133 ? -17.537 16.676  83.460  1.00 77.02  ? 133 ASP I OD2 1 
ATOM   3492 N N   . THR C 3 134 ? -14.676 17.158  87.888  1.00 54.85  ? 134 THR I N   1 
ATOM   3493 C CA  . THR C 3 134 ? -14.135 16.647  89.152  1.00 48.66  ? 134 THR I CA  1 
ATOM   3494 C C   . THR C 3 134 ? -13.859 17.784  90.145  1.00 43.59  ? 134 THR I C   1 
ATOM   3495 O O   . THR C 3 134 ? -13.805 17.566  91.354  1.00 42.34  ? 134 THR I O   1 
ATOM   3496 C CB  . THR C 3 134 ? -12.816 15.867  88.910  1.00 48.77  ? 134 THR I CB  1 
ATOM   3497 O OG1 . THR C 3 134 ? -12.986 14.972  87.806  1.00 51.31  ? 134 THR I OG1 1 
ATOM   3498 C CG2 . THR C 3 134 ? -12.435 15.052  90.134  1.00 52.51  ? 134 THR I CG2 1 
ATOM   3499 N N   . ASP C 3 135 ? -13.675 18.993  89.626  1.00 41.22  ? 135 ASP I N   1 
ATOM   3500 C CA  . ASP C 3 135 ? -13.406 20.151  90.470  1.00 35.64  ? 135 ASP I CA  1 
ATOM   3501 C C   . ASP C 3 135 ? -14.594 20.485  91.350  1.00 33.57  ? 135 ASP I C   1 
ATOM   3502 O O   . ASP C 3 135 ? -15.753 20.345  90.947  1.00 29.30  ? 135 ASP I O   1 
ATOM   3503 C CB  . ASP C 3 135 ? -13.087 21.403  89.639  1.00 29.94  ? 135 ASP I CB  1 
ATOM   3504 C CG  . ASP C 3 135 ? -11.914 21.220  88.699  1.00 22.48  ? 135 ASP I CG  1 
ATOM   3505 O OD1 . ASP C 3 135 ? -11.018 20.399  88.985  1.00 16.99  ? 135 ASP I OD1 1 
ATOM   3506 O OD2 . ASP C 3 135 ? -11.890 21.923  87.665  1.00 19.10  ? 135 ASP I OD2 1 
ATOM   3507 N N   . PRO C 3 136 ? -14.316 20.923  92.580  1.00 36.04  ? 136 PRO I N   1 
ATOM   3508 C CA  . PRO C 3 136 ? -15.396 21.282  93.492  1.00 38.03  ? 136 PRO I CA  1 
ATOM   3509 C C   . PRO C 3 136 ? -16.025 22.541  92.906  1.00 42.93  ? 136 PRO I C   1 
ATOM   3510 O O   . PRO C 3 136 ? -15.344 23.325  92.237  1.00 46.32  ? 136 PRO I O   1 
ATOM   3511 C CB  . PRO C 3 136 ? -14.645 21.620  94.778  1.00 33.85  ? 136 PRO I CB  1 
ATOM   3512 C CG  . PRO C 3 136 ? -13.387 20.805  94.678  1.00 32.19  ? 136 PRO I CG  1 
ATOM   3513 C CD  . PRO C 3 136 ? -13.008 21.000  93.253  1.00 34.03  ? 136 PRO I CD  1 
ATOM   3514 N N   . ASP C 3 137 ? -17.321 22.724  93.106  1.00 45.16  ? 137 ASP I N   1 
ATOM   3515 C CA  . ASP C 3 137 ? -17.966 23.928  92.600  1.00 46.49  ? 137 ASP I CA  1 
ATOM   3516 C C   . ASP C 3 137 ? -17.451 25.067  93.469  1.00 42.70  ? 137 ASP I C   1 
ATOM   3517 O O   . ASP C 3 137 ? -17.348 24.921  94.685  1.00 42.45  ? 137 ASP I O   1 
ATOM   3518 C CB  . ASP C 3 137 ? -19.492 23.814  92.718  1.00 51.47  ? 137 ASP I CB  1 
ATOM   3519 C CG  . ASP C 3 137 ? -20.225 25.039  92.182  1.00 55.13  ? 137 ASP I CG  1 
ATOM   3520 O OD1 . ASP C 3 137 ? -19.752 25.650  91.200  1.00 55.24  ? 137 ASP I OD1 1 
ATOM   3521 O OD2 . ASP C 3 137 ? -21.293 25.379  92.737  1.00 60.22  ? 137 ASP I OD2 1 
ATOM   3522 N N   . ALA C 3 138 ? -17.093 26.186  92.852  1.00 42.85  ? 138 ALA I N   1 
ATOM   3523 C CA  . ALA C 3 138 ? -16.599 27.332  93.600  1.00 43.07  ? 138 ALA I CA  1 
ATOM   3524 C C   . ALA C 3 138 ? -17.593 27.703  94.698  1.00 46.10  ? 138 ALA I C   1 
ATOM   3525 O O   . ALA C 3 138 ? -17.193 28.051  95.799  1.00 46.22  ? 138 ALA I O   1 
ATOM   3526 C CB  . ALA C 3 138 ? -16.364 28.508  92.673  1.00 39.82  ? 138 ALA I CB  1 
ATOM   3527 N N   . LYS C 3 139 ? -18.884 27.555  94.411  1.00 48.13  ? 139 LYS I N   1 
ATOM   3528 C CA  . LYS C 3 139 ? -19.943 27.871  95.370  1.00 50.06  ? 139 LYS I CA  1 
ATOM   3529 C C   . LYS C 3 139 ? -19.886 26.983  96.624  1.00 54.41  ? 139 LYS I C   1 
ATOM   3530 O O   . LYS C 3 139 ? -20.285 27.399  97.712  1.00 57.10  ? 139 LYS I O   1 
ATOM   3531 C CB  . LYS C 3 139 ? -21.313 27.760  94.689  1.00 43.34  ? 139 LYS I CB  1 
ATOM   3532 C CG  . LYS C 3 139 ? -22.501 28.077  95.584  0.00 45.22  ? 139 LYS I CG  1 
ATOM   3533 C CD  . LYS C 3 139 ? -23.815 27.859  94.849  0.00 45.11  ? 139 LYS I CD  1 
ATOM   3534 C CE  . LYS C 3 139 ? -25.012 28.114  95.754  0.00 45.10  ? 139 LYS I CE  1 
ATOM   3535 N NZ  . LYS C 3 139 ? -25.073 29.523  96.230  0.00 45.49  ? 139 LYS I NZ  1 
ATOM   3536 N N   . GLU C 3 140 ? -19.401 25.757  96.468  1.00 54.90  ? 140 GLU I N   1 
ATOM   3537 C CA  . GLU C 3 140 ? -19.297 24.835  97.590  1.00 57.28  ? 140 GLU I CA  1 
ATOM   3538 C C   . GLU C 3 140 ? -18.072 25.160  98.437  1.00 58.06  ? 140 GLU I C   1 
ATOM   3539 O O   . GLU C 3 140 ? -18.158 25.233  99.659  1.00 61.67  ? 140 GLU I O   1 
ATOM   3540 C CB  . GLU C 3 140 ? -19.180 23.388  97.094  1.00 64.23  ? 140 GLU I CB  1 
ATOM   3541 C CG  . GLU C 3 140 ? -20.374 22.871  96.293  1.00 75.90  ? 140 GLU I CG  1 
ATOM   3542 C CD  . GLU C 3 140 ? -20.061 21.600  95.500  1.00 79.61  ? 140 GLU I CD  1 
ATOM   3543 O OE1 . GLU C 3 140 ? -19.051 20.920  95.796  1.00 79.89  ? 140 GLU I OE1 1 
ATOM   3544 O OE2 . GLU C 3 140 ? -20.828 21.285  94.564  1.00 82.77  ? 140 GLU I OE2 1 
ATOM   3545 N N   . ILE C 3 141 ? -16.931 25.332  97.773  1.00 55.78  ? 141 ILE I N   1 
ATOM   3546 C CA  . ILE C 3 141 ? -15.649 25.610  98.430  1.00 51.18  ? 141 ILE I CA  1 
ATOM   3547 C C   . ILE C 3 141 ? -15.403 27.049  98.905  1.00 44.76  ? 141 ILE I C   1 
ATOM   3548 O O   . ILE C 3 141 ? -14.691 27.267  99.891  1.00 40.22  ? 141 ILE I O   1 
ATOM   3549 C CB  . ILE C 3 141 ? -14.465 25.173  97.516  1.00 52.89  ? 141 ILE I CB  1 
ATOM   3550 C CG1 . ILE C 3 141 ? -13.123 25.538  98.151  1.00 55.22  ? 141 ILE I CG1 1 
ATOM   3551 C CG2 . ILE C 3 141 ? -14.586 25.810  96.128  1.00 52.90  ? 141 ILE I CG2 1 
ATOM   3552 C CD1 . ILE C 3 141 ? -11.961 25.369  97.212  1.00 60.40  ? 141 ILE I CD1 1 
ATOM   3553 N N   . CYS C 3 142 ? -15.932 28.016  98.166  1.00 40.48  ? 142 CYS I N   1 
ATOM   3554 C CA  . CYS C 3 142 ? -15.751 29.418  98.495  1.00 41.88  ? 142 CYS I CA  1 
ATOM   3555 C C   . CYS C 3 142 ? -16.796 29.917  99.484  1.00 44.37  ? 142 CYS I C   1 
ATOM   3556 O O   . CYS C 3 142 ? -16.424 30.132  100.653 1.00 45.47  ? 142 CYS I O   1 
ATOM   3557 C CB  . CYS C 3 142 ? -15.777 30.269  97.225  1.00 38.89  ? 142 CYS I CB  1 
ATOM   3558 S SG  . CYS C 3 142 ? -14.443 29.922  96.037  1.00 31.85  ? 142 CYS I SG  1 
ATOM   3559 O OXT . CYS C 3 142 ? -17.969 30.089  99.081  1.00 49.90  ? 142 CYS I OXT 1 
HETATM 3560 O O   . HOH D 4 .   ? -15.537 -8.558  85.195  1.00 60.97  ? 508 HOH L O   1 
HETATM 3561 O O   . HOH D 4 .   ? -7.486  1.803   73.658  1.00 68.58  ? 543 HOH L O   1 
HETATM 3562 O O   . HOH D 4 .   ? -17.686 5.232   62.360  1.00 46.88  ? 555 HOH L O   1 
HETATM 3563 O O   . HOH D 4 .   ? -2.718  3.630   20.357  1.00 60.29  ? 576 HOH L O   1 
HETATM 3564 O O   . HOH D 4 .   ? -12.052 -16.112 67.222  1.00 59.44  ? 592 HOH L O   1 
HETATM 3565 O O   . HOH D 4 .   ? -14.103 -16.157 74.636  1.00 48.04  ? 593 HOH L O   1 
HETATM 3566 O O   . HOH D 4 .   ? -16.600 -25.041 82.900  1.00 37.51  ? 594 HOH L O   1 
HETATM 3567 O O   . HOH D 4 .   ? 9.430   -0.806  77.494  1.00 35.58  ? 595 HOH L O   1 
HETATM 3568 O O   . HOH D 4 .   ? -17.726 -3.135  55.855  1.00 36.22  ? 602 HOH L O   1 
HETATM 3569 O O   . HOH D 4 .   ? 26.285  3.328   77.669  1.00 53.21  ? 609 HOH L O   1 
HETATM 3570 O O   . HOH D 4 .   ? -3.725  -8.963  83.916  1.00 87.46  ? 611 HOH L O   1 
HETATM 3571 O O   . HOH D 4 .   ? -9.389  3.836   78.959  1.00 73.80  ? 614 HOH L O   1 
HETATM 3572 O O   . HOH D 4 .   ? -14.099 6.726   62.829  1.00 34.24  ? 625 HOH L O   1 
HETATM 3573 O O   . HOH D 4 .   ? 4.754   -19.391 63.359  1.00 45.96  ? 642 HOH L O   1 
HETATM 3574 O O   . HOH D 4 .   ? -9.648  1.934   66.269  1.00 48.70  ? 651 HOH L O   1 
HETATM 3575 O O   . HOH D 4 .   ? -5.738  0.432   46.556  1.00 27.33  ? 655 HOH L O   1 
HETATM 3576 O O   . HOH D 4 .   ? 20.257  6.601   70.946  1.00 59.92  ? 662 HOH L O   1 
HETATM 3577 O O   . HOH D 4 .   ? 21.983  -7.811  73.051  1.00 52.81  ? 665 HOH L O   1 
HETATM 3578 O O   . HOH D 4 .   ? 13.999  6.706   73.115  1.00 48.33  ? 670 HOH L O   1 
HETATM 3579 O O   . HOH D 4 .   ? 4.226   -3.297  47.605  1.00 33.86  ? 671 HOH L O   1 
HETATM 3580 O O   . HOH D 4 .   ? -20.748 2.208   56.252  1.00 54.72  ? 672 HOH L O   1 
HETATM 3581 O O   . HOH E 4 .   ? -30.616 47.526  54.302  1.00 65.50  ? 502 HOH H O   1 
HETATM 3582 O O   . HOH E 4 .   ? -5.623  36.856  57.644  1.00 60.49  ? 503 HOH H O   1 
HETATM 3583 O O   . HOH E 4 .   ? -1.738  29.151  58.550  1.00 22.81  ? 504 HOH H O   1 
HETATM 3584 O O   . HOH E 4 .   ? -29.432 42.652  44.415  1.00 43.34  ? 505 HOH H O   1 
HETATM 3585 O O   . HOH E 4 .   ? 6.609   23.075  37.266  1.00 27.54  ? 506 HOH H O   1 
HETATM 3586 O O   . HOH E 4 .   ? -1.313  23.557  43.745  1.00 65.84  ? 507 HOH H O   1 
HETATM 3587 O O   . HOH E 4 .   ? -5.615  11.223  80.359  1.00 47.57  ? 509 HOH H O   1 
HETATM 3588 O O   . HOH E 4 .   ? 1.764   22.565  80.747  1.00 34.23  ? 510 HOH H O   1 
HETATM 3589 O O   . HOH E 4 .   ? 10.197  15.634  87.775  1.00 37.91  ? 511 HOH H O   1 
HETATM 3590 O O   . HOH E 4 .   ? 8.596   64.639  65.372  1.00 41.38  ? 516 HOH H O   1 
HETATM 3591 O O   . HOH E 4 .   ? 6.753   36.292  42.155  1.00 23.61  ? 518 HOH H O   1 
HETATM 3592 O O   . HOH E 4 .   ? 0.329   20.698  50.780  1.00 27.39  ? 519 HOH H O   1 
HETATM 3593 O O   . HOH E 4 .   ? -1.585  9.137   62.571  1.00 16.22  ? 520 HOH H O   1 
HETATM 3594 O O   . HOH E 4 .   ? -0.093  11.389  61.724  1.00 9.28   ? 521 HOH H O   1 
HETATM 3595 O O   . HOH E 4 .   ? -0.376  12.993  59.707  1.00 12.26  ? 522 HOH H O   1 
HETATM 3596 O O   . HOH E 4 .   ? -1.144  20.545  60.411  1.00 15.70  ? 523 HOH H O   1 
HETATM 3597 O O   . HOH E 4 .   ? -2.893  22.490  62.076  1.00 3.49   ? 524 HOH H O   1 
HETATM 3598 O O   . HOH E 4 .   ? 1.042   4.991   54.584  1.00 7.22   ? 525 HOH H O   1 
HETATM 3599 O O   . HOH E 4 .   ? 15.247  6.581   61.067  1.00 20.06  ? 526 HOH H O   1 
HETATM 3600 O O   . HOH E 4 .   ? 1.337   2.564   41.868  1.00 52.02  ? 530 HOH H O   1 
HETATM 3601 O O   . HOH E 4 .   ? -2.767  17.464  49.160  1.00 3.97   ? 531 HOH H O   1 
HETATM 3602 O O   . HOH E 4 .   ? 8.076   23.379  49.839  1.00 12.65  ? 532 HOH H O   1 
HETATM 3603 O O   . HOH E 4 .   ? -7.483  35.630  64.398  1.00 50.58  ? 535 HOH H O   1 
HETATM 3604 O O   . HOH E 4 .   ? -11.400 7.059   69.857  1.00 49.18  ? 537 HOH H O   1 
HETATM 3605 O O   . HOH E 4 .   ? 6.534   18.904  60.453  1.00 2.16   ? 538 HOH H O   1 
HETATM 3606 O O   . HOH E 4 .   ? -18.999 8.324   48.518  1.00 58.40  ? 539 HOH H O   1 
HETATM 3607 O O   . HOH E 4 .   ? 0.401   29.878  38.825  1.00 25.01  ? 540 HOH H O   1 
HETATM 3608 O O   . HOH E 4 .   ? -9.502  24.457  39.387  1.00 31.53  ? 541 HOH H O   1 
HETATM 3609 O O   . HOH E 4 .   ? -12.632 24.303  45.395  1.00 33.55  ? 542 HOH H O   1 
HETATM 3610 O O   . HOH E 4 .   ? 5.572   7.413   38.736  1.00 44.65  ? 545 HOH H O   1 
HETATM 3611 O O   . HOH E 4 .   ? 11.195  4.405   30.215  1.00 75.74  ? 547 HOH H O   1 
HETATM 3612 O O   . HOH E 4 .   ? 23.966  28.152  53.711  1.00 40.15  ? 548 HOH H O   1 
HETATM 3613 O O   . HOH E 4 .   ? -15.394 35.698  58.699  1.00 31.18  ? 549 HOH H O   1 
HETATM 3614 O O   . HOH E 4 .   ? -19.785 11.288  47.057  1.00 73.74  ? 550 HOH H O   1 
HETATM 3615 O O   . HOH E 4 .   ? -5.987  23.337  45.444  1.00 14.63  ? 551 HOH H O   1 
HETATM 3616 O O   . HOH E 4 .   ? -6.923  18.355  44.746  1.00 24.83  ? 552 HOH H O   1 
HETATM 3617 O O   . HOH E 4 .   ? -7.327  15.613  46.007  1.00 37.94  ? 553 HOH H O   1 
HETATM 3618 O O   . HOH E 4 .   ? -21.738 11.639  32.646  1.00 68.75  ? 554 HOH H O   1 
HETATM 3619 O O   . HOH E 4 .   ? -44.417 42.826  11.983  1.00 12.37  ? 556 HOH H O   1 
HETATM 3620 O O   . HOH E 4 .   ? -21.178 25.390  64.691  1.00 48.07  ? 558 HOH H O   1 
HETATM 3621 O O   . HOH E 4 .   ? -13.525 29.570  72.214  1.00 66.86  ? 560 HOH H O   1 
HETATM 3622 O O   . HOH E 4 .   ? 13.034  -2.450  55.072  1.00 61.87  ? 561 HOH H O   1 
HETATM 3623 O O   . HOH E 4 .   ? -20.129 26.103  70.240  1.00 46.72  ? 562 HOH H O   1 
HETATM 3624 O O   . HOH E 4 .   ? -13.465 21.672  26.765  1.00 44.15  ? 563 HOH H O   1 
HETATM 3625 O O   . HOH E 4 .   ? -31.627 28.536  43.159  1.00 39.99  ? 564 HOH H O   1 
HETATM 3626 O O   . HOH E 4 .   ? -3.508  26.880  49.498  1.00 24.49  ? 565 HOH H O   1 
HETATM 3627 O O   . HOH E 4 .   ? -38.614 33.087  12.567  1.00 62.84  ? 566 HOH H O   1 
HETATM 3628 O O   . HOH E 4 .   ? -8.361  36.096  46.058  1.00 10.15  ? 568 HOH H O   1 
HETATM 3629 O O   . HOH E 4 .   ? -10.903 14.096  10.990  1.00 84.05  ? 569 HOH H O   1 
HETATM 3630 O O   . HOH E 4 .   ? 22.255  41.107  25.717  1.00 80.15  ? 570 HOH H O   1 
HETATM 3631 O O   . HOH E 4 .   ? 23.309  36.361  38.455  1.00 64.72  ? 571 HOH H O   1 
HETATM 3632 O O   . HOH E 4 .   ? 32.239  20.053  35.815  1.00 44.43  ? 572 HOH H O   1 
HETATM 3633 O O   . HOH E 4 .   ? 27.167  8.803   59.192  1.00 67.35  ? 573 HOH H O   1 
HETATM 3634 O O   . HOH E 4 .   ? 5.796   3.762   25.389  1.00 52.23  ? 574 HOH H O   1 
HETATM 3635 O O   . HOH E 4 .   ? 8.800   12.951  44.947  1.00 30.92  ? 575 HOH H O   1 
HETATM 3636 O O   . HOH E 4 .   ? 10.856  11.357  22.947  1.00 70.04  ? 578 HOH H O   1 
HETATM 3637 O O   . HOH E 4 .   ? -12.745 27.650  29.123  1.00 72.32  ? 579 HOH H O   1 
HETATM 3638 O O   . HOH E 4 .   ? 13.606  24.501  23.569  1.00 41.83  ? 580 HOH H O   1 
HETATM 3639 O O   . HOH E 4 .   ? 14.321  14.025  56.783  1.00 46.06  ? 581 HOH H O   1 
HETATM 3640 O O   . HOH E 4 .   ? -11.179 8.725   62.056  1.00 44.09  ? 583 HOH H O   1 
HETATM 3641 O O   . HOH E 4 .   ? -8.485  20.492  59.490  1.00 16.71  ? 585 HOH H O   1 
HETATM 3642 O O   . HOH E 4 .   ? -1.196  19.343  69.515  1.00 25.88  ? 586 HOH H O   1 
HETATM 3643 O O   . HOH E 4 .   ? -4.314  12.938  70.030  1.00 49.25  ? 587 HOH H O   1 
HETATM 3644 O O   . HOH E 4 .   ? -10.155 16.058  73.699  1.00 43.58  ? 588 HOH H O   1 
HETATM 3645 O O   . HOH E 4 .   ? -2.635  15.035  68.391  1.00 23.67  ? 589 HOH H O   1 
HETATM 3646 O O   . HOH E 4 .   ? -0.353  14.136  77.630  1.00 20.87  ? 590 HOH H O   1 
HETATM 3647 O O   . HOH E 4 .   ? -12.479 16.943  72.926  1.00 46.14  ? 596 HOH H O   1 
HETATM 3648 O O   . HOH E 4 .   ? -5.844  14.457  72.293  1.00 21.46  ? 597 HOH H O   1 
HETATM 3649 O O   . HOH E 4 .   ? -1.496  7.315   71.166  1.00 12.48  ? 598 HOH H O   1 
HETATM 3650 O O   . HOH E 4 .   ? -6.705  33.681  62.659  1.00 78.04  ? 599 HOH H O   1 
HETATM 3651 O O   . HOH E 4 .   ? -51.186 58.717  68.342  1.00 44.15  ? 601 HOH H O   1 
HETATM 3652 O O   . HOH E 4 .   ? 11.822  0.044   45.715  1.00 51.41  ? 607 HOH H O   1 
HETATM 3653 O O   . HOH E 4 .   ? 22.118  21.709  69.071  1.00 31.59  ? 610 HOH H O   1 
HETATM 3654 O O   . HOH E 4 .   ? 0.308   15.835  70.359  1.00 20.89  ? 612 HOH H O   1 
HETATM 3655 O O   . HOH E 4 .   ? 12.953  14.423  44.707  1.00 28.17  ? 616 HOH H O   1 
HETATM 3656 O O   . HOH E 4 .   ? -8.537  32.697  66.567  1.00 71.06  ? 617 HOH H O   1 
HETATM 3657 O O   . HOH E 4 .   ? -6.776  22.952  24.995  1.00 43.30  ? 618 HOH H O   1 
HETATM 3658 O O   . HOH E 4 .   ? 24.897  0.844   58.691  1.00 75.67  ? 620 HOH H O   1 
HETATM 3659 O O   . HOH E 4 .   ? -10.734 31.922  51.061  1.00 30.78  ? 622 HOH H O   1 
HETATM 3660 O O   . HOH E 4 .   ? -8.974  26.556  61.007  1.00 54.29  ? 623 HOH H O   1 
HETATM 3661 O O   . HOH E 4 .   ? -23.926 11.919  38.453  1.00 54.90  ? 626 HOH H O   1 
HETATM 3662 O O   . HOH E 4 .   ? -16.884 22.443  56.959  1.00 52.31  ? 627 HOH H O   1 
HETATM 3663 O O   . HOH E 4 .   ? -33.957 23.780  24.649  1.00 68.35  ? 628 HOH H O   1 
HETATM 3664 O O   . HOH E 4 .   ? -16.210 3.913   38.750  1.00 51.28  ? 629 HOH H O   1 
HETATM 3665 O O   . HOH E 4 .   ? 32.966  -25.735 75.225  1.00 55.32  ? 630 HOH H O   1 
HETATM 3666 O O   . HOH E 4 .   ? 10.561  22.574  49.870  1.00 5.70   ? 631 HOH H O   1 
HETATM 3667 O O   . HOH E 4 .   ? -26.371 5.003   39.902  1.00 71.50  ? 633 HOH H O   1 
HETATM 3668 O O   . HOH E 4 .   ? 11.752  33.881  62.868  1.00 25.79  ? 634 HOH H O   1 
HETATM 3669 O O   . HOH E 4 .   ? 29.612  52.846  66.117  1.00 103.03 ? 635 HOH H O   1 
HETATM 3670 O O   . HOH E 4 .   ? 12.886  40.829  69.088  1.00 52.10  ? 636 HOH H O   1 
HETATM 3671 O O   . HOH E 4 .   ? 21.479  42.308  71.424  1.00 58.82  ? 637 HOH H O   1 
HETATM 3672 O O   . HOH E 4 .   ? 0.999   38.200  60.482  1.00 46.09  ? 638 HOH H O   1 
HETATM 3673 O O   . HOH E 4 .   ? -7.166  30.492  65.584  1.00 27.00  ? 639 HOH H O   1 
HETATM 3674 O O   . HOH E 4 .   ? 7.694   43.332  56.092  1.00 39.54  ? 640 HOH H O   1 
HETATM 3675 O O   . HOH E 4 .   ? -19.653 42.977  65.294  1.00 38.79  ? 645 HOH H O   1 
HETATM 3676 O O   . HOH E 4 .   ? -25.485 30.304  59.565  1.00 51.84  ? 647 HOH H O   1 
HETATM 3677 O O   . HOH E 4 .   ? -20.631 37.551  60.022  1.00 82.33  ? 648 HOH H O   1 
HETATM 3678 O O   . HOH E 4 .   ? -14.369 5.099   72.379  1.00 56.44  ? 649 HOH H O   1 
HETATM 3679 O O   . HOH E 4 .   ? -23.228 14.609  68.158  1.00 69.12  ? 650 HOH H O   1 
HETATM 3680 O O   . HOH E 4 .   ? -9.248  42.341  63.436  1.00 50.67  ? 652 HOH H O   1 
HETATM 3681 O O   . HOH E 4 .   ? -9.231  17.216  44.579  1.00 27.76  ? 653 HOH H O   1 
HETATM 3682 O O   . HOH E 4 .   ? -4.254  11.469  32.538  1.00 41.32  ? 654 HOH H O   1 
HETATM 3683 O O   . HOH E 4 .   ? 17.774  14.693  79.793  1.00 43.75  ? 657 HOH H O   1 
HETATM 3684 O O   . HOH E 4 .   ? 10.873  12.692  52.194  1.00 16.21  ? 659 HOH H O   1 
HETATM 3685 O O   . HOH E 4 .   ? 8.840   24.229  78.007  1.00 53.82  ? 660 HOH H O   1 
HETATM 3686 O O   . HOH E 4 .   ? 18.992  37.903  26.564  1.00 51.64  ? 661 HOH H O   1 
HETATM 3687 O O   . HOH E 4 .   ? -25.400 13.598  53.256  1.00 22.61  ? 666 HOH H O   1 
HETATM 3688 O O   . HOH E 4 .   ? -8.905  23.323  16.640  1.00 76.92  ? 667 HOH H O   1 
HETATM 3689 O O   . HOH F 4 .   ? -24.245 47.365  70.430  1.00 65.73  ? 501 HOH I O   1 
HETATM 3690 O O   . HOH F 4 .   ? -3.288  22.662  84.568  1.00 9.31   ? 512 HOH I O   1 
HETATM 3691 O O   . HOH F 4 .   ? -5.542  24.027  85.159  1.00 13.71  ? 513 HOH I O   1 
HETATM 3692 O O   . HOH F 4 .   ? -18.951 41.501  74.386  1.00 74.44  ? 514 HOH I O   1 
HETATM 3693 O O   . HOH F 4 .   ? -9.626  65.339  85.102  1.00 49.09  ? 515 HOH I O   1 
HETATM 3694 O O   . HOH F 4 .   ? -4.287  23.410  96.028  1.00 10.45  ? 517 HOH I O   1 
HETATM 3695 O O   . HOH F 4 .   ? -13.342 21.144  101.763 1.00 48.82  ? 527 HOH I O   1 
HETATM 3696 O O   . HOH F 4 .   ? -17.491 25.158  108.746 1.00 10.18  ? 528 HOH I O   1 
HETATM 3697 O O   . HOH F 4 .   ? -32.425 53.253  73.577  1.00 90.33  ? 529 HOH I O   1 
HETATM 3698 O O   . HOH F 4 .   ? 4.252   25.447  103.198 1.00 55.44  ? 533 HOH I O   1 
HETATM 3699 O O   . HOH F 4 .   ? -11.811 26.051  80.032  1.00 30.92  ? 534 HOH I O   1 
HETATM 3700 O O   . HOH F 4 .   ? -28.475 36.035  88.772  1.00 58.31  ? 536 HOH I O   1 
HETATM 3701 O O   . HOH F 4 .   ? -10.275 26.797  108.295 1.00 39.43  ? 544 HOH I O   1 
HETATM 3702 O O   . HOH F 4 .   ? 25.358  43.273  88.279  1.00 58.65  ? 546 HOH I O   1 
HETATM 3703 O O   . HOH F 4 .   ? -11.823 32.807  107.979 1.00 49.08  ? 557 HOH I O   1 
HETATM 3704 O O   . HOH F 4 .   ? -21.503 10.308  77.503  1.00 66.72  ? 559 HOH I O   1 
HETATM 3705 O O   . HOH F 4 .   ? 0.053   43.729  81.556  1.00 57.94  ? 567 HOH I O   1 
HETATM 3706 O O   . HOH F 4 .   ? -27.136 33.340  87.827  1.00 54.70  ? 577 HOH I O   1 
HETATM 3707 O O   . HOH F 4 .   ? 10.650  44.203  83.851  1.00 55.39  ? 582 HOH I O   1 
HETATM 3708 O O   . HOH F 4 .   ? 17.949  38.568  94.746  1.00 53.29  ? 584 HOH I O   1 
HETATM 3709 O O   . HOH F 4 .   ? -25.170 34.901  85.367  1.00 49.56  ? 591 HOH I O   1 
HETATM 3710 O O   . HOH F 4 .   ? 2.461   42.915  72.650  1.00 48.40  ? 600 HOH I O   1 
HETATM 3711 O O   . HOH F 4 .   ? 6.378   52.670  90.743  1.00 68.62  ? 603 HOH I O   1 
HETATM 3712 O O   . HOH F 4 .   ? -14.380 19.907  98.839  1.00 60.96  ? 604 HOH I O   1 
HETATM 3713 O O   . HOH F 4 .   ? -20.732 14.087  79.703  1.00 52.94  ? 605 HOH I O   1 
HETATM 3714 O O   . HOH F 4 .   ? -19.168 7.658   90.970  1.00 42.58  ? 606 HOH I O   1 
HETATM 3715 O O   . HOH F 4 .   ? 13.340  23.324  108.046 1.00 37.82  ? 608 HOH I O   1 
HETATM 3716 O O   . HOH F 4 .   ? 4.563   17.337  93.217  1.00 73.20  ? 613 HOH I O   1 
HETATM 3717 O O   . HOH F 4 .   ? 5.793   37.100  102.040 1.00 47.27  ? 615 HOH I O   1 
HETATM 3718 O O   . HOH F 4 .   ? 15.210  42.927  109.257 1.00 54.46  ? 619 HOH I O   1 
HETATM 3719 O O   . HOH F 4 .   ? -19.518 31.034  91.799  1.00 42.56  ? 621 HOH I O   1 
HETATM 3720 O O   . HOH F 4 .   ? -17.720 25.868  85.159  1.00 29.05  ? 624 HOH I O   1 
HETATM 3721 O O   . HOH F 4 .   ? 17.680  37.532  90.656  1.00 45.40  ? 632 HOH I O   1 
HETATM 3722 O O   . HOH F 4 .   ? -2.755  5.071   104.854 1.00 52.24  ? 641 HOH I O   1 
HETATM 3723 O O   . HOH F 4 .   ? -11.189 50.728  74.087  1.00 78.19  ? 643 HOH I O   1 
HETATM 3724 O O   . HOH F 4 .   ? -29.126 32.344  75.417  1.00 83.99  ? 646 HOH I O   1 
HETATM 3725 O O   . HOH F 4 .   ? -2.877  31.794  93.252  1.00 25.30  ? 656 HOH I O   1 
HETATM 3726 O O   . HOH F 4 .   ? -9.111  46.991  82.179  1.00 51.30  ? 658 HOH I O   1 
HETATM 3727 O O   . HOH F 4 .   ? 11.284  53.743  86.947  1.00 66.36  ? 663 HOH I O   1 
HETATM 3728 O O   . HOH F 4 .   ? 6.488   25.105  86.148  1.00 75.18  ? 664 HOH I O   1 
HETATM 3729 O O   . HOH F 4 .   ? -24.386 14.987  80.641  1.00 37.31  ? 668 HOH I O   1 
HETATM 3730 O O   . HOH F 4 .   ? -2.809  64.591  83.675  1.00 41.10  ? 669 HOH I O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   PHE 1   1   1   PHE PHE L M n 
A 1 2   PHE 2   1   1   PHE PHE L L n 
A 1 3   ASN 3   1   1   ASN ASN L K n 
A 1 4   GLU 4   1   1   GLU GLU L J n 
A 1 5   LYS 5   1   1   LYS LYS L I n 
A 1 6   THR 6   1   1   THR THR L H n 
A 1 7   PHE 7   1   1   PHE PHE L G n 
A 1 8   GLY 8   1   1   GLY GLY L F n 
A 1 9   ALA 9   1   1   ALA ALA L E n 
A 1 10  GLY 10  1   1   GLY GLY L D n 
A 1 11  GLU 11  1   1   GLU GLU L C n 
A 1 12  ALA 12  1   1   ALA ALA L B n 
A 1 13  ASP 13  1   1   ASP ASP L A n 
A 1 14  CYS 14  1   1   CYS CYS L . n 
A 1 15  GLY 15  2   2   GLY GLY L . n 
A 1 16  LEU 16  3   3   LEU LEU L . n 
A 1 17  ARG 17  4   4   ARG ARG L . n 
A 1 18  PRO 18  5   5   PRO PRO L . n 
A 1 19  LEU 19  6   6   LEU LEU L . n 
A 1 20  PHE 20  7   7   PHE PHE L . n 
A 1 21  GLU 21  8   8   GLU GLU L . n 
A 1 22  LYS 22  9   9   LYS LYS L . n 
A 1 23  LYS 23  10  10  LYS LYS L . n 
A 1 24  GLN 24  11  11  GLN GLN L . n 
A 1 25  VAL 25  12  12  VAL VAL L . n 
A 1 26  GLN 26  13  13  GLN GLN L . n 
A 1 27  ASP 27  14  14  ASP ASP L . n 
A 1 28  GLN 28  14  14  GLN GLN L A n 
A 1 29  THR 29  14  14  THR THR L B n 
A 1 30  GLU 30  14  14  GLU GLU L C n 
A 1 31  LYS 31  14  14  LYS LYS L D n 
A 1 32  GLU 32  14  14  GLU GLU L E n 
A 1 33  LEU 33  14  14  LEU LEU L F n 
A 1 34  PHE 34  14  14  PHE PHE L G n 
A 1 35  GLU 35  14  14  GLU GLU L H n 
A 1 36  SER 36  14  14  SER SER L I n 
A 1 37  TYR 37  14  14  TYR TYR L J n 
A 1 38  ILE 38  14  14  ILE ILE L K n 
A 1 39  GLU 39  14  14  GLU GLU L L n 
A 1 40  GLY 40  14  14  GLY GLY L M n 
A 1 41  ARG 41  15  15  ARG ARG L . n 
B 2 1   ILE 1   16  16  ILE ILE H . n 
B 2 2   VAL 2   17  17  VAL VAL H . n 
B 2 3   GLU 3   18  18  GLU GLU H . n 
B 2 4   GLY 4   19  19  GLY GLY H . n 
B 2 5   GLN 5   20  20  GLN GLN H . n 
B 2 6   ASP 6   21  21  ASP ASP H . n 
B 2 7   ALA 7   22  22  ALA ALA H . n 
B 2 8   GLU 8   23  23  GLU GLU H . n 
B 2 9   VAL 9   24  24  VAL VAL H . n 
B 2 10  GLY 10  25  25  GLY GLY H . n 
B 2 11  LEU 11  26  26  LEU LEU H . n 
B 2 12  SER 12  27  27  SER SER H . n 
B 2 13  PRO 13  28  28  PRO PRO H . n 
B 2 14  TRP 14  29  29  TRP TRP H . n 
B 2 15  GLN 15  30  30  GLN GLN H . n 
B 2 16  VAL 16  31  31  VAL VAL H . n 
B 2 17  MET 17  32  32  MET MET H . n 
B 2 18  LEU 18  33  33  LEU LEU H . n 
B 2 19  PHE 19  34  34  PHE PHE H . n 
B 2 20  ARG 20  35  35  ARG ARG H . n 
B 2 21  LYS 21  36  36  LYS LYS H . n 
B 2 22  SER 22  36  36  SER SER H A n 
B 2 23  PRO 23  37  37  PRO PRO H . n 
B 2 24  GLN 24  38  38  GLN GLN H . n 
B 2 25  GLU 25  39  39  GLU GLU H . n 
B 2 26  LEU 26  40  40  LEU LEU H . n 
B 2 27  LEU 27  41  41  LEU LEU H . n 
B 2 28  CYS 28  42  42  CYS CYS H . n 
B 2 29  GLY 29  43  43  GLY GLY H . n 
B 2 30  ALA 30  44  44  ALA ALA H . n 
B 2 31  SER 31  45  45  SER SER H . n 
B 2 32  LEU 32  46  46  LEU LEU H . n 
B 2 33  ILE 33  47  47  ILE ILE H . n 
B 2 34  SER 34  48  48  SER SER H . n 
B 2 35  ASP 35  49  49  ASP ASP H . n 
B 2 36  ARG 36  50  50  ARG ARG H . n 
B 2 37  TRP 37  51  51  TRP TRP H . n 
B 2 38  VAL 38  52  52  VAL VAL H . n 
B 2 39  LEU 39  53  53  LEU LEU H . n 
B 2 40  THR 40  54  54  THR THR H . n 
B 2 41  ALA 41  55  55  ALA ALA H . n 
B 2 42  ALA 42  56  56  ALA ALA H . n 
B 2 43  HIS 43  57  57  HIS HIS H . n 
B 2 44  CYS 44  58  58  CYS CYS H . n 
B 2 45  LEU 45  59  59  LEU LEU H . n 
B 2 46  LEU 46  60  60  LEU LEU H . n 
B 2 47  TYR 47  60  60  TYR TYR H A n 
B 2 48  PRO 48  60  60  PRO PRO H B n 
B 2 49  PRO 49  60  60  PRO PRO H C n 
B 2 50  TRP 50  60  60  TRP TRP H D n 
B 2 51  ASP 51  60  60  ASP ASP H E n 
B 2 52  LYS 52  60  60  LYS LYS H F n 
B 2 53  ASN 53  60  60  ASN ASN H G n 
B 2 54  PHE 54  60  60  PHE PHE H H n 
B 2 55  THR 55  60  60  THR THR H I n 
B 2 56  VAL 56  61  61  VAL VAL H . n 
B 2 57  ASP 57  62  62  ASP ASP H . n 
B 2 58  ASP 58  63  63  ASP ASP H . n 
B 2 59  LEU 59  64  64  LEU LEU H . n 
B 2 60  LEU 60  65  65  LEU LEU H . n 
B 2 61  VAL 61  66  66  VAL VAL H . n 
B 2 62  ARG 62  67  67  ARG ARG H . n 
B 2 63  ILE 63  68  68  ILE ILE H . n 
B 2 64  GLY 64  69  69  GLY GLY H . n 
B 2 65  LYS 65  70  70  LYS LYS H . n 
B 2 66  HIS 66  71  71  HIS HIS H . n 
B 2 67  SER 67  72  72  SER SER H . n 
B 2 68  ARG 68  73  73  ARG ARG H . n 
B 2 69  THR 69  74  74  THR THR H . n 
B 2 70  ARG 70  75  75  ARG ARG H . n 
B 2 71  TYR 71  76  76  TYR TYR H . n 
B 2 72  GLU 72  77  77  GLU GLU H . n 
B 2 73  ARG 73  77  77  ARG ARG H A n 
B 2 74  LYS 74  78  78  LYS LYS H . n 
B 2 75  VAL 75  79  79  VAL VAL H . n 
B 2 76  GLU 76  80  80  GLU GLU H . n 
B 2 77  LYS 77  81  81  LYS LYS H . n 
B 2 78  ILE 78  82  82  ILE ILE H . n 
B 2 79  SER 79  83  83  SER SER H . n 
B 2 80  MET 80  84  84  MET MET H . n 
B 2 81  LEU 81  85  85  LEU LEU H . n 
B 2 82  ASP 82  86  86  ASP ASP H . n 
B 2 83  LYS 83  87  87  LYS LYS H . n 
B 2 84  ILE 84  88  88  ILE ILE H . n 
B 2 85  TYR 85  89  89  TYR TYR H . n 
B 2 86  ILE 86  90  90  ILE ILE H . n 
B 2 87  HIS 87  91  91  HIS HIS H . n 
B 2 88  PRO 88  92  92  PRO PRO H . n 
B 2 89  ARG 89  93  93  ARG ARG H . n 
B 2 90  TYR 90  94  94  TYR TYR H . n 
B 2 91  ASN 91  95  95  ASN ASN H . n 
B 2 92  TRP 92  96  96  TRP TRP H . n 
B 2 93  LYS 93  97  97  LYS LYS H . n 
B 2 94  GLU 94  97  97  GLU GLU H A n 
B 2 95  ASN 95  98  98  ASN ASN H . n 
B 2 96  LEU 96  99  99  LEU LEU H . n 
B 2 97  ASP 97  100 100 ASP ASP H . n 
B 2 98  ARG 98  101 101 ARG ARG H . n 
B 2 99  ASP 99  102 102 ASP ASP H . n 
B 2 100 ILE 100 103 103 ILE ILE H . n 
B 2 101 ALA 101 104 104 ALA ALA H . n 
B 2 102 LEU 102 105 105 LEU LEU H . n 
B 2 103 LEU 103 106 106 LEU LEU H . n 
B 2 104 LYS 104 107 107 LYS LYS H . n 
B 2 105 LEU 105 108 108 LEU LEU H . n 
B 2 106 LYS 106 109 109 LYS LYS H . n 
B 2 107 ARG 107 110 110 ARG ARG H . n 
B 2 108 PRO 108 111 111 PRO PRO H . n 
B 2 109 ILE 109 112 112 ILE ILE H . n 
B 2 110 GLU 110 113 113 GLU GLU H . n 
B 2 111 LEU 111 114 114 LEU LEU H . n 
B 2 112 SER 112 115 115 SER SER H . n 
B 2 113 ASP 113 116 116 ASP ASP H . n 
B 2 114 TYR 114 117 117 TYR TYR H . n 
B 2 115 ILE 115 118 118 ILE ILE H . n 
B 2 116 HIS 116 119 119 HIS HIS H . n 
B 2 117 PRO 117 120 120 PRO PRO H . n 
B 2 118 VAL 118 121 121 VAL VAL H . n 
B 2 119 CYS 119 122 122 CYS CYS H . n 
B 2 120 LEU 120 123 123 LEU LEU H . n 
B 2 121 PRO 121 124 124 PRO PRO H . n 
B 2 122 ASP 122 125 125 ASP ASP H . n 
B 2 123 LYS 123 126 126 LYS LYS H . n 
B 2 124 GLN 124 127 127 GLN GLN H . n 
B 2 125 THR 125 128 128 THR THR H . n 
B 2 126 ALA 126 129 129 ALA ALA H . n 
B 2 127 ALA 127 129 129 ALA ALA H A n 
B 2 128 LYS 128 129 129 LYS LYS H B n 
B 2 129 LEU 129 129 129 LEU LEU H C n 
B 2 130 LEU 130 130 130 LEU LEU H . n 
B 2 131 HIS 131 131 131 HIS HIS H . n 
B 2 132 ALA 132 132 132 ALA ALA H . n 
B 2 133 GLY 133 133 133 GLY GLY H . n 
B 2 134 PHE 134 134 134 PHE PHE H . n 
B 2 135 LYS 135 135 135 LYS LYS H . n 
B 2 136 GLY 136 136 136 GLY GLY H . n 
B 2 137 ARG 137 137 137 ARG ARG H . n 
B 2 138 VAL 138 138 138 VAL VAL H . n 
B 2 139 THR 139 139 139 THR THR H . n 
B 2 140 GLY 140 140 140 GLY GLY H . n 
B 2 141 TRP 141 141 141 TRP TRP H . n 
B 2 142 GLY 142 142 142 GLY GLY H . n 
B 2 143 ASN 143 143 143 ASN ASN H . n 
B 2 144 ARG 144 144 144 ARG ARG H . n 
B 2 145 ARG 145 145 145 ARG ARG H . n 
B 2 146 GLU 146 146 146 GLU GLU H . n 
B 2 147 THR 147 147 147 THR THR H . n 
B 2 148 TRP 148 148 148 TRP TRP H . n 
B 2 149 THR 149 149 149 THR THR H . n 
B 2 150 THR 150 149 149 THR THR H A n 
B 2 151 SER 151 149 149 SER SER H B n 
B 2 152 VAL 152 149 149 VAL VAL H C n 
B 2 153 ALA 153 149 149 ALA ALA H D n 
B 2 154 GLU 154 149 149 GLU GLU H E n 
B 2 155 VAL 155 150 150 VAL VAL H . n 
B 2 156 GLN 156 151 151 GLN GLN H . n 
B 2 157 PRO 157 152 152 PRO PRO H . n 
B 2 158 SER 158 153 153 SER SER H . n 
B 2 159 VAL 159 154 154 VAL VAL H . n 
B 2 160 LEU 160 155 155 LEU LEU H . n 
B 2 161 GLN 161 156 156 GLN GLN H . n 
B 2 162 VAL 162 157 157 VAL VAL H . n 
B 2 163 VAL 163 158 158 VAL VAL H . n 
B 2 164 ASN 164 159 159 ASN ASN H . n 
B 2 165 LEU 165 160 160 LEU LEU H . n 
B 2 166 PRO 166 161 161 PRO PRO H . n 
B 2 167 LEU 167 162 162 LEU LEU H . n 
B 2 168 VAL 168 163 163 VAL VAL H . n 
B 2 169 GLU 169 164 164 GLU GLU H . n 
B 2 170 ARG 170 165 165 ARG ARG H . n 
B 2 171 PRO 171 166 166 PRO PRO H . n 
B 2 172 VAL 172 167 167 VAL VAL H . n 
B 2 173 CYS 173 168 168 CYS CYS H . n 
B 2 174 LYS 174 169 169 LYS LYS H . n 
B 2 175 ALA 175 170 170 ALA ALA H . n 
B 2 176 SER 176 171 171 SER SER H . n 
B 2 177 THR 177 172 172 THR THR H . n 
B 2 178 ARG 178 173 173 ARG ARG H . n 
B 2 179 ILE 179 174 174 ILE ILE H . n 
B 2 180 ARG 180 175 175 ARG ARG H . n 
B 2 181 ILE 181 176 176 ILE ILE H . n 
B 2 182 THR 182 177 177 THR THR H . n 
B 2 183 ASP 183 178 178 ASP ASP H . n 
B 2 184 ASN 184 179 179 ASN ASN H . n 
B 2 185 MET 185 180 180 MET MET H . n 
B 2 186 PHE 186 181 181 PHE PHE H . n 
B 2 187 CYS 187 182 182 CYS CYS H . n 
B 2 188 ALA 188 183 183 ALA ALA H . n 
B 2 189 GLY 189 184 184 GLY GLY H A n 
B 2 190 TYR 190 184 184 TYR TYR H . n 
B 2 191 LYS 191 185 185 LYS LYS H . n 
B 2 192 PRO 192 186 186 PRO PRO H . n 
B 2 193 GLY 193 186 186 GLY GLY H A n 
B 2 194 GLU 194 186 186 GLU GLU H B n 
B 2 195 GLY 195 186 186 GLY GLY H C n 
B 2 196 LYS 196 186 186 LYS LYS H D n 
B 2 197 ARG 197 187 187 ARG ARG H . n 
B 2 198 GLY 198 188 188 GLY GLY H . n 
B 2 199 ASP 199 189 189 ASP ASP H . n 
B 2 200 ALA 200 190 190 ALA ALA H . n 
B 2 201 CYS 201 191 191 CYS CYS H . n 
B 2 202 GLU 202 192 192 GLU GLU H . n 
B 2 203 GLY 203 193 193 GLY GLY H . n 
B 2 204 ASP 204 194 194 ASP ASP H . n 
B 2 205 SER 205 195 195 SER SER H . n 
B 2 206 GLY 206 196 196 GLY GLY H . n 
B 2 207 GLY 207 197 197 GLY GLY H . n 
B 2 208 PRO 208 198 198 PRO PRO H . n 
B 2 209 PHE 209 199 199 PHE PHE H . n 
B 2 210 VAL 210 200 200 VAL VAL H . n 
B 2 211 MET 211 201 201 MET MET H . n 
B 2 212 LYS 212 202 202 LYS LYS H . n 
B 2 213 SER 213 203 203 SER SER H . n 
B 2 214 PRO 214 204 204 PRO PRO H . n 
B 2 215 TYR 215 204 204 TYR TYR H A n 
B 2 216 ASN 216 204 204 ASN ASN H B n 
B 2 217 ASN 217 205 205 ASN ASN H . n 
B 2 218 ARG 218 206 206 ARG ARG H . n 
B 2 219 TRP 219 207 207 TRP TRP H . n 
B 2 220 TYR 220 208 208 TYR TYR H . n 
B 2 221 GLN 221 209 209 GLN GLN H . n 
B 2 222 MET 222 210 210 MET MET H . n 
B 2 223 GLY 223 211 211 GLY GLY H . n 
B 2 224 ILE 224 212 212 ILE ILE H . n 
B 2 225 VAL 225 213 213 VAL VAL H . n 
B 2 226 SER 226 214 214 SER SER H . n 
B 2 227 TRP 227 215 215 TRP TRP H . n 
B 2 228 GLY 228 216 216 GLY GLY H . n 
B 2 229 GLU 229 217 217 GLU GLU H . n 
B 2 230 GLY 230 219 219 GLY GLY H . n 
B 2 231 CYS 231 220 220 CYS CYS H . n 
B 2 232 ASP 232 221 221 ASP ASP H . n 
B 2 233 ARG 233 221 221 ARG ARG H A n 
B 2 234 ASP 234 222 222 ASP ASP H . n 
B 2 235 GLY 235 223 223 GLY GLY H . n 
B 2 236 LYS 236 224 224 LYS LYS H . n 
B 2 237 TYR 237 225 225 TYR TYR H . n 
B 2 238 GLY 238 226 226 GLY GLY H . n 
B 2 239 PHE 239 227 227 PHE PHE H . n 
B 2 240 TYR 240 228 228 TYR TYR H . n 
B 2 241 THR 241 229 229 THR THR H . n 
B 2 242 HIS 242 230 230 HIS HIS H . n 
B 2 243 VAL 243 231 231 VAL VAL H . n 
B 2 244 PHE 244 232 232 PHE PHE H . n 
B 2 245 ARG 245 233 233 ARG ARG H . n 
B 2 246 LEU 246 234 234 LEU LEU H . n 
B 2 247 LYS 247 235 235 LYS LYS H . n 
B 2 248 LYS 248 236 236 LYS LYS H . n 
B 2 249 TRP 249 237 237 TRP TRP H . n 
B 2 250 ILE 250 238 238 ILE ILE H . n 
B 2 251 GLN 251 239 239 GLN GLN H . n 
B 2 252 LYS 252 240 240 LYS LYS H . n 
B 2 253 VAL 253 241 241 VAL VAL H . n 
B 2 254 ILE 254 242 242 ILE ILE H . n 
B 2 255 ASP 255 243 243 ASP ASP H . n 
B 2 256 ARG 256 244 244 ARG ARG H . n 
B 2 257 LEU 257 245 245 LEU LEU H . n 
B 2 258 GLY 258 246 246 GLY GLY H . n 
B 2 259 SER 259 247 247 SER SER H . n 
C 3 1   ALA 1   1   1   ALA ALA I . n 
C 3 2   GLU 2   2   2   GLU GLU I . n 
C 3 3   GLY 3   3   3   GLY GLY I . n 
C 3 4   ASP 4   4   4   ASP ASP I . n 
C 3 5   ASP 5   5   5   ASP ASP I . n 
C 3 6   CYS 6   6   6   CYS CYS I . n 
C 3 7   SER 7   7   7   SER SER I . n 
C 3 8   ILE 8   8   8   ILE ILE I . n 
C 3 9   GLU 9   9   9   GLU GLU I . n 
C 3 10  LYS 10  10  10  LYS LYS I . n 
C 3 11  ALA 11  11  11  ALA ALA I . n 
C 3 12  MET 12  12  12  MET MET I . n 
C 3 13  GLY 13  13  13  GLY GLY I . n 
C 3 14  ASP 14  14  14  ASP ASP I . n 
C 3 15  PHE 15  15  15  PHE PHE I . n 
C 3 16  LYS 16  16  16  LYS LYS I . n 
C 3 17  PRO 17  17  17  PRO PRO I . n 
C 3 18  GLU 18  18  18  GLU GLU I . n 
C 3 19  GLU 19  19  19  GLU GLU I . n 
C 3 20  PHE 20  20  20  PHE PHE I . n 
C 3 21  PHE 21  21  21  PHE PHE I . n 
C 3 22  ASN 22  22  22  ASN ASN I . n 
C 3 23  GLY 23  23  23  GLY GLY I . n 
C 3 24  THR 24  24  24  THR THR I . n 
C 3 25  TRP 25  25  25  TRP TRP I . n 
C 3 26  TYR 26  26  26  TYR TYR I . n 
C 3 27  LEU 27  27  27  LEU LEU I . n 
C 3 28  ALA 28  28  28  ALA ALA I . n 
C 3 29  HIS 29  29  29  HIS HIS I . n 
C 3 30  GLY 30  30  30  GLY GLY I . n 
C 3 31  PRO 31  31  31  PRO PRO I . n 
C 3 32  GLY 32  32  32  GLY GLY I . n 
C 3 33  VAL 33  33  33  VAL VAL I . n 
C 3 34  THR 34  34  34  THR THR I . n 
C 3 35  SER 35  35  35  SER SER I . n 
C 3 36  PRO 36  36  36  PRO PRO I . n 
C 3 37  ALA 37  37  37  ALA ALA I . n 
C 3 38  VAL 38  38  38  VAL VAL I . n 
C 3 39  CYS 39  39  39  CYS CYS I . n 
C 3 40  GLN 40  40  40  GLN GLN I . n 
C 3 41  LYS 41  41  41  LYS LYS I . n 
C 3 42  PHE 42  42  42  PHE PHE I . n 
C 3 43  THR 43  43  43  THR THR I . n 
C 3 44  THR 44  44  44  THR THR I . n 
C 3 45  SER 45  45  45  SER SER I . n 
C 3 46  GLY 46  46  46  GLY GLY I . n 
C 3 47  SER 47  47  47  SER SER I . n 
C 3 48  LYS 48  48  48  LYS LYS I . n 
C 3 49  GLY 49  49  49  GLY GLY I . n 
C 3 50  PHE 50  50  50  PHE PHE I . n 
C 3 51  THR 51  51  51  THR THR I . n 
C 3 52  GLN 52  52  52  GLN GLN I . n 
C 3 53  ILE 53  53  53  ILE ILE I . n 
C 3 54  VAL 54  54  54  VAL VAL I . n 
C 3 55  GLU 55  55  55  GLU GLU I . n 
C 3 56  ILE 56  56  56  ILE ILE I . n 
C 3 57  GLY 57  57  57  GLY GLY I . n 
C 3 58  TYR 58  58  58  TYR TYR I . n 
C 3 59  ASN 59  59  59  ASN ASN I . n 
C 3 60  LYS 60  60  60  LYS LYS I . n 
C 3 61  PHE 61  61  61  PHE PHE I . n 
C 3 62  GLU 62  62  62  GLU GLU I . n 
C 3 63  SER 63  63  63  SER SER I . n 
C 3 64  ASN 64  64  64  ASN ASN I . n 
C 3 65  VAL 65  65  65  VAL VAL I . n 
C 3 66  LYS 66  66  66  LYS LYS I . n 
C 3 67  PHE 67  67  67  PHE PHE I . n 
C 3 68  GLN 68  68  68  GLN GLN I . n 
C 3 69  CYS 69  69  69  CYS CYS I . n 
C 3 70  ASN 70  70  70  ASN ASN I . n 
C 3 71  GLN 71  71  71  GLN GLN I . n 
C 3 72  VAL 72  72  72  VAL VAL I . n 
C 3 73  ASP 73  73  73  ASP ASP I . n 
C 3 74  ASN 74  74  74  ASN ASN I . n 
C 3 75  LYS 75  75  75  LYS LYS I . n 
C 3 76  ASN 76  76  76  ASN ASN I . n 
C 3 77  GLY 77  77  77  GLY GLY I . n 
C 3 78  GLU 78  78  78  GLU GLU I . n 
C 3 79  GLN 79  79  79  GLN GLN I . n 
C 3 80  TYR 80  80  80  TYR TYR I . n 
C 3 81  SER 81  81  81  SER SER I . n 
C 3 82  PHE 82  82  82  PHE PHE I . n 
C 3 83  LYS 83  83  83  LYS LYS I . n 
C 3 84  CYS 84  84  84  CYS CYS I . n 
C 3 85  LYS 85  85  85  LYS LYS I . n 
C 3 86  SER 86  86  86  SER SER I . n 
C 3 87  SER 87  87  87  SER SER I . n 
C 3 88  ASP 88  88  88  ASP ASP I . n 
C 3 89  ASN 89  89  89  ASN ASN I . n 
C 3 90  THR 90  90  90  THR THR I . n 
C 3 91  GLU 91  91  91  GLU GLU I . n 
C 3 92  PHE 92  92  92  PHE PHE I . n 
C 3 93  GLU 93  93  93  GLU GLU I . n 
C 3 94  ALA 94  94  94  ALA ALA I . n 
C 3 95  ASP 95  95  95  ASP ASP I . n 
C 3 96  PHE 96  96  96  PHE PHE I . n 
C 3 97  THR 97  97  97  THR THR I . n 
C 3 98  PHE 98  98  98  PHE PHE I . n 
C 3 99  ILE 99  99  99  ILE ILE I . n 
C 3 100 SER 100 100 100 SER SER I . n 
C 3 101 VAL 101 101 101 VAL VAL I . n 
C 3 102 SER 102 102 102 SER SER I . n 
C 3 103 TYR 103 103 103 TYR TYR I . n 
C 3 104 ASP 104 104 104 ASP ASP I . n 
C 3 105 ASN 105 105 105 ASN ASN I . n 
C 3 106 PHE 106 106 106 PHE PHE I . n 
C 3 107 ALA 107 107 107 ALA ALA I . n 
C 3 108 LEU 108 108 108 LEU LEU I . n 
C 3 109 VAL 109 109 109 VAL VAL I . n 
C 3 110 CYS 110 110 110 CYS CYS I . n 
C 3 111 ARG 111 111 111 ARG ARG I . n 
C 3 112 SER 112 112 112 SER SER I . n 
C 3 113 ILE 113 113 113 ILE ILE I . n 
C 3 114 THR 114 114 114 THR THR I . n 
C 3 115 PHE 115 115 115 PHE PHE I . n 
C 3 116 THR 116 116 116 THR THR I . n 
C 3 117 SER 117 117 117 SER SER I . n 
C 3 118 GLN 118 118 118 GLN GLN I . n 
C 3 119 PRO 119 119 119 PRO PRO I . n 
C 3 120 LYS 120 120 120 LYS LYS I . n 
C 3 121 GLU 121 121 121 GLU GLU I . n 
C 3 122 ASP 122 122 122 ASP ASP I . n 
C 3 123 ARG 123 123 123 ARG ARG I . n 
C 3 124 TYR 124 124 124 TYR TYR I . n 
C 3 125 LEU 125 125 125 LEU LEU I . n 
C 3 126 VAL 126 126 126 VAL VAL I . n 
C 3 127 PHE 127 127 127 PHE PHE I . n 
C 3 128 GLU 128 128 128 GLU GLU I . n 
C 3 129 ARG 129 129 129 ARG ARG I . n 
C 3 130 THR 130 130 130 THR THR I . n 
C 3 131 LYS 131 131 131 LYS LYS I . n 
C 3 132 SER 132 132 132 SER SER I . n 
C 3 133 ASP 133 133 133 ASP ASP I . n 
C 3 134 THR 134 134 134 THR THR I . n 
C 3 135 ASP 135 135 135 ASP ASP I . n 
C 3 136 PRO 136 136 136 PRO PRO I . n 
C 3 137 ASP 137 137 137 ASP ASP I . n 
C 3 138 ALA 138 138 138 ALA ALA I . n 
C 3 139 LYS 139 139 139 LYS LYS I . n 
C 3 140 GLU 140 140 140 GLU GLU I . n 
C 3 141 ILE 141 141 141 ILE ILE I . n 
C 3 142 CYS 142 142 142 CYS CYS I . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1998-12-30 
2 'Structure model' 1 1 2008-03-25 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
MOSFLM      'data reduction' .           ? 1 
ROTAVATA    'data reduction' .           ? 2 
AGROVATA    'data reduction' .           ? 3 
AMoRE       phasing          .           ? 4 
X-PLOR      refinement       3.842       ? 5 
CCP4        'data scaling'   '(AGROVATA' ? 6 
'ROTAVATA)' 'data scaling'   .           ? 7 
# 
_pdbx_entry_details.entry_id             1AVG 
_pdbx_entry_details.compound_details     
;ARG 15 A IS INSERTED IN THE ACTIVE SITE OF A NEIGHBORING
MOLECULE.
;
_pdbx_entry_details.source_details       ? 
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.sequence_details     ? 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 CA H LEU 105 ? ? CB H LEU 105 ? ? CG H LEU 105 ? ? 130.33 115.30 15.03 2.30 N 
2 1 N  H SER 195 ? ? CA H SER 195 ? ? C  H SER 195 ? ? 128.01 111.00 17.01 2.70 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ASN L 1   K ? -75.59  -122.56 
2  1 GLU L 1   J ? -171.18 -25.59  
3  1 PHE L 7   ? ? -125.12 -83.23  
4  1 GLU L 14  L ? 46.10   99.24   
5  1 PRO H 28  ? ? -62.00  1.51    
6  1 TYR H 60  A ? -163.83 79.92   
7  1 ASN H 60  G ? -161.87 66.39   
8  1 HIS H 71  ? ? -138.80 -53.93  
9  1 GLU H 97  A ? -89.43  -97.86  
10 1 SER H 115 ? ? -160.27 -159.36 
11 1 SER H 195 ? ? -41.04  3.34    
12 1 LEU H 245 ? ? -174.88 94.97   
13 1 GLU I 2   ? ? -54.33  106.34  
14 1 ASP I 14  ? ? -73.42  20.43   
15 1 VAL I 33  ? ? -35.73  130.15  
16 1 SER I 45  ? ? -67.63  85.93   
17 1 SER I 47  ? ? -88.35  47.44   
18 1 LYS I 48  ? ? 59.57   -82.29  
19 1 PHE I 50  ? ? -65.21  85.09   
20 1 ASN I 64  ? ? -109.81 43.71   
21 1 GLU I 91  ? ? 70.56   132.87  
22 1 TYR I 103 ? ? -47.89  -8.72   
23 1 ASN I 105 ? ? -131.60 -79.77  
24 1 SER I 117 ? ? -72.89  -95.79  
25 1 LYS I 120 ? ? 68.24   114.26  
26 1 GLU I 121 ? ? -164.43 112.77  
27 1 ASP I 133 ? ? 51.35   -69.08  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 0 H LYS 236 ? CG  ? B LYS 248 CG  
2  1 Y 0 H LYS 236 ? CD  ? B LYS 248 CD  
3  1 Y 0 H LEU 245 ? CG  ? B LEU 257 CG  
4  1 Y 0 H LEU 245 ? CD1 ? B LEU 257 CD1 
5  1 Y 0 H LEU 245 ? CD2 ? B LEU 257 CD2 
6  1 Y 0 H SER 247 ? N   ? B SER 259 N   
7  1 Y 0 H SER 247 ? CA  ? B SER 259 CA  
8  1 Y 0 H SER 247 ? C   ? B SER 259 C   
9  1 Y 0 H SER 247 ? O   ? B SER 259 O   
10 1 Y 0 H SER 247 ? CB  ? B SER 259 CB  
11 1 Y 0 H SER 247 ? OG  ? B SER 259 OG  
12 1 Y 0 I LYS 16  ? CG  ? C LYS 16  CG  
13 1 Y 0 I LYS 16  ? CD  ? C LYS 16  CD  
14 1 Y 0 I LYS 16  ? CE  ? C LYS 16  CE  
15 1 Y 0 I LYS 16  ? NZ  ? C LYS 16  NZ  
16 1 Y 0 I SER 45  ? OG  ? C SER 45  OG  
17 1 Y 0 I LYS 75  ? C   ? C LYS 75  C   
18 1 Y 0 I LYS 75  ? O   ? C LYS 75  O   
19 1 Y 0 I LYS 75  ? CG  ? C LYS 75  CG  
20 1 Y 0 I LYS 75  ? CD  ? C LYS 75  CD  
21 1 Y 0 I LYS 75  ? CE  ? C LYS 75  CE  
22 1 Y 0 I LYS 75  ? NZ  ? C LYS 75  NZ  
23 1 Y 0 I ASN 76  ? CB  ? C ASN 76  CB  
24 1 Y 0 I ASN 76  ? CG  ? C ASN 76  CG  
25 1 Y 0 I ASN 76  ? OD1 ? C ASN 76  OD1 
26 1 Y 0 I ASN 76  ? ND2 ? C ASN 76  ND2 
27 1 Y 0 I SER 86  ? OG  ? C SER 86  OG  
28 1 Y 0 I GLN 118 ? CB  ? C GLN 118 CB  
29 1 Y 0 I GLN 118 ? CG  ? C GLN 118 CG  
30 1 Y 0 I GLN 118 ? CD  ? C GLN 118 CD  
31 1 Y 0 I GLN 118 ? OE1 ? C GLN 118 OE1 
32 1 Y 0 I GLN 118 ? NE2 ? C GLN 118 NE2 
33 1 Y 0 I LYS 139 ? CG  ? C LYS 139 CG  
34 1 Y 0 I LYS 139 ? CD  ? C LYS 139 CD  
35 1 Y 0 I LYS 139 ? CE  ? C LYS 139 CE  
36 1 Y 0 I LYS 139 ? NZ  ? C LYS 139 NZ  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 0 I SER 47 ? C SER 47 
2 1 Y 0 I LYS 48 ? C LYS 48 
3 1 Y 0 I ASN 74 ? C ASN 74 
# 
_pdbx_entity_nonpoly.entity_id   4 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 4 HOH 1   508 508 HOH HOH L . 
D 4 HOH 2   543 543 HOH HOH L . 
D 4 HOH 3   555 555 HOH HOH L . 
D 4 HOH 4   576 576 HOH HOH L . 
D 4 HOH 5   592 592 HOH HOH L . 
D 4 HOH 6   593 593 HOH HOH L . 
D 4 HOH 7   594 594 HOH HOH L . 
D 4 HOH 8   595 595 HOH HOH L . 
D 4 HOH 9   602 602 HOH HOH L . 
D 4 HOH 10  609 609 HOH HOH L . 
D 4 HOH 11  611 611 HOH HOH L . 
D 4 HOH 12  614 614 HOH HOH L . 
D 4 HOH 13  625 625 HOH HOH L . 
D 4 HOH 14  642 642 HOH HOH L . 
D 4 HOH 15  651 651 HOH HOH L . 
D 4 HOH 16  655 655 HOH HOH L . 
D 4 HOH 17  662 662 HOH HOH L . 
D 4 HOH 18  665 665 HOH HOH L . 
D 4 HOH 19  670 670 HOH HOH L . 
D 4 HOH 20  671 671 HOH HOH L . 
D 4 HOH 21  672 672 HOH HOH L . 
E 4 HOH 1   502 502 HOH HOH H . 
E 4 HOH 2   503 503 HOH HOH H . 
E 4 HOH 3   504 504 HOH HOH H . 
E 4 HOH 4   505 505 HOH HOH H . 
E 4 HOH 5   506 506 HOH HOH H . 
E 4 HOH 6   507 507 HOH HOH H . 
E 4 HOH 7   509 509 HOH HOH H . 
E 4 HOH 8   510 510 HOH HOH H . 
E 4 HOH 9   511 511 HOH HOH H . 
E 4 HOH 10  516 516 HOH HOH H . 
E 4 HOH 11  518 518 HOH HOH H . 
E 4 HOH 12  519 519 HOH HOH H . 
E 4 HOH 13  520 520 HOH HOH H . 
E 4 HOH 14  521 521 HOH HOH H . 
E 4 HOH 15  522 522 HOH HOH H . 
E 4 HOH 16  523 523 HOH HOH H . 
E 4 HOH 17  524 524 HOH HOH H . 
E 4 HOH 18  525 525 HOH HOH H . 
E 4 HOH 19  526 526 HOH HOH H . 
E 4 HOH 20  530 530 HOH HOH H . 
E 4 HOH 21  531 531 HOH HOH H . 
E 4 HOH 22  532 532 HOH HOH H . 
E 4 HOH 23  535 535 HOH HOH H . 
E 4 HOH 24  537 537 HOH HOH H . 
E 4 HOH 25  538 538 HOH HOH H . 
E 4 HOH 26  539 539 HOH HOH H . 
E 4 HOH 27  540 540 HOH HOH H . 
E 4 HOH 28  541 541 HOH HOH H . 
E 4 HOH 29  542 542 HOH HOH H . 
E 4 HOH 30  545 545 HOH HOH H . 
E 4 HOH 31  547 547 HOH HOH H . 
E 4 HOH 32  548 548 HOH HOH H . 
E 4 HOH 33  549 549 HOH HOH H . 
E 4 HOH 34  550 550 HOH HOH H . 
E 4 HOH 35  551 551 HOH HOH H . 
E 4 HOH 36  552 552 HOH HOH H . 
E 4 HOH 37  553 553 HOH HOH H . 
E 4 HOH 38  554 554 HOH HOH H . 
E 4 HOH 39  556 556 HOH HOH H . 
E 4 HOH 40  558 558 HOH HOH H . 
E 4 HOH 41  560 560 HOH HOH H . 
E 4 HOH 42  561 561 HOH HOH H . 
E 4 HOH 43  562 562 HOH HOH H . 
E 4 HOH 44  563 563 HOH HOH H . 
E 4 HOH 45  564 564 HOH HOH H . 
E 4 HOH 46  565 565 HOH HOH H . 
E 4 HOH 47  566 566 HOH HOH H . 
E 4 HOH 48  568 568 HOH HOH H . 
E 4 HOH 49  569 569 HOH HOH H . 
E 4 HOH 50  570 570 HOH HOH H . 
E 4 HOH 51  571 571 HOH HOH H . 
E 4 HOH 52  572 572 HOH HOH H . 
E 4 HOH 53  573 573 HOH HOH H . 
E 4 HOH 54  574 574 HOH HOH H . 
E 4 HOH 55  575 575 HOH HOH H . 
E 4 HOH 56  578 578 HOH HOH H . 
E 4 HOH 57  579 579 HOH HOH H . 
E 4 HOH 58  580 580 HOH HOH H . 
E 4 HOH 59  581 581 HOH HOH H . 
E 4 HOH 60  583 583 HOH HOH H . 
E 4 HOH 61  585 585 HOH HOH H . 
E 4 HOH 62  586 586 HOH HOH H . 
E 4 HOH 63  587 587 HOH HOH H . 
E 4 HOH 64  588 588 HOH HOH H . 
E 4 HOH 65  589 589 HOH HOH H . 
E 4 HOH 66  590 590 HOH HOH H . 
E 4 HOH 67  596 596 HOH HOH H . 
E 4 HOH 68  597 597 HOH HOH H . 
E 4 HOH 69  598 598 HOH HOH H . 
E 4 HOH 70  599 599 HOH HOH H . 
E 4 HOH 71  601 601 HOH HOH H . 
E 4 HOH 72  607 607 HOH HOH H . 
E 4 HOH 73  610 610 HOH HOH H . 
E 4 HOH 74  612 612 HOH HOH H . 
E 4 HOH 75  616 616 HOH HOH H . 
E 4 HOH 76  617 617 HOH HOH H . 
E 4 HOH 77  618 618 HOH HOH H . 
E 4 HOH 78  620 620 HOH HOH H . 
E 4 HOH 79  622 622 HOH HOH H . 
E 4 HOH 80  623 623 HOH HOH H . 
E 4 HOH 81  626 626 HOH HOH H . 
E 4 HOH 82  627 627 HOH HOH H . 
E 4 HOH 83  628 628 HOH HOH H . 
E 4 HOH 84  629 629 HOH HOH H . 
E 4 HOH 85  630 630 HOH HOH H . 
E 4 HOH 86  631 631 HOH HOH H . 
E 4 HOH 87  633 633 HOH HOH H . 
E 4 HOH 88  634 634 HOH HOH H . 
E 4 HOH 89  635 635 HOH HOH H . 
E 4 HOH 90  636 636 HOH HOH H . 
E 4 HOH 91  637 637 HOH HOH H . 
E 4 HOH 92  638 638 HOH HOH H . 
E 4 HOH 93  639 639 HOH HOH H . 
E 4 HOH 94  640 640 HOH HOH H . 
E 4 HOH 95  645 645 HOH HOH H . 
E 4 HOH 96  647 647 HOH HOH H . 
E 4 HOH 97  648 648 HOH HOH H . 
E 4 HOH 98  649 649 HOH HOH H . 
E 4 HOH 99  650 650 HOH HOH H . 
E 4 HOH 100 652 652 HOH HOH H . 
E 4 HOH 101 653 653 HOH HOH H . 
E 4 HOH 102 654 654 HOH HOH H . 
E 4 HOH 103 657 657 HOH HOH H . 
E 4 HOH 104 659 659 HOH HOH H . 
E 4 HOH 105 660 660 HOH HOH H . 
E 4 HOH 106 661 661 HOH HOH H . 
E 4 HOH 107 666 666 HOH HOH H . 
E 4 HOH 108 667 667 HOH HOH H . 
F 4 HOH 1   501 501 HOH HOH I . 
F 4 HOH 2   512 512 HOH HOH I . 
F 4 HOH 3   513 513 HOH HOH I . 
F 4 HOH 4   514 514 HOH HOH I . 
F 4 HOH 5   515 515 HOH HOH I . 
F 4 HOH 6   517 517 HOH HOH I . 
F 4 HOH 7   527 527 HOH HOH I . 
F 4 HOH 8   528 528 HOH HOH I . 
F 4 HOH 9   529 529 HOH HOH I . 
F 4 HOH 10  533 533 HOH HOH I . 
F 4 HOH 11  534 534 HOH HOH I . 
F 4 HOH 12  536 536 HOH HOH I . 
F 4 HOH 13  544 544 HOH HOH I . 
F 4 HOH 14  546 546 HOH HOH I . 
F 4 HOH 15  557 557 HOH HOH I . 
F 4 HOH 16  559 559 HOH HOH I . 
F 4 HOH 17  567 567 HOH HOH I . 
F 4 HOH 18  577 577 HOH HOH I . 
F 4 HOH 19  582 582 HOH HOH I . 
F 4 HOH 20  584 584 HOH HOH I . 
F 4 HOH 21  591 591 HOH HOH I . 
F 4 HOH 22  600 600 HOH HOH I . 
F 4 HOH 23  603 603 HOH HOH I . 
F 4 HOH 24  604 604 HOH HOH I . 
F 4 HOH 25  605 605 HOH HOH I . 
F 4 HOH 26  606 606 HOH HOH I . 
F 4 HOH 27  608 608 HOH HOH I . 
F 4 HOH 28  613 613 HOH HOH I . 
F 4 HOH 29  615 615 HOH HOH I . 
F 4 HOH 30  619 619 HOH HOH I . 
F 4 HOH 31  621 621 HOH HOH I . 
F 4 HOH 32  624 624 HOH HOH I . 
F 4 HOH 33  632 632 HOH HOH I . 
F 4 HOH 34  641 641 HOH HOH I . 
F 4 HOH 35  643 643 HOH HOH I . 
F 4 HOH 36  646 646 HOH HOH I . 
F 4 HOH 37  656 656 HOH HOH I . 
F 4 HOH 38  658 658 HOH HOH I . 
F 4 HOH 39  663 663 HOH HOH I . 
F 4 HOH 40  664 664 HOH HOH I . 
F 4 HOH 41  668 668 HOH HOH I . 
F 4 HOH 42  669 669 HOH HOH I . 
#