data_1AX4
# 
_entry.id   1AX4 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1AX4         
WWPDB D_1000171363 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1AX4 
_pdbx_database_status.recvd_initial_deposition_date   1997-10-28 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    BNL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Isupov, M.N.'      1  
'Antson, A.A.'      2  
'Dodson, E.J.'      3  
'Dodson, G.G.'      4  
'Dementieva, I.S.'  5  
'Zakomirdina, L.N.' 6  
'Wilson, K.S.'      7  
'Dauter, Z.'        8  
'Lebedev, A.A.'     9  
'Harutyunyan, E.H.' 10 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Crystal structure of tryptophanase.'                                                                                  
J.Mol.Biol.                          276 603 623 1998 JMOBAK UK 0022-2836     0070 ?                                        
9551100 10.1006/jmbi.1997.1561 
1       'X-Ray Study of Tryptophanase at 2.1 Angstrom Resolution'                                                              
'Biochemistry of Vitamin B6 and Pqq' ?   183 ?   1994 ?      ?  3-7643-5067-9 2061 'Basel, Switzerland : Birkhauser Verlag' ? ? 
2       'Crystallization and Preliminary X-Ray Investigation of Holotryptophanases from Escherichia Coli and Proteus Vulgaris' 
J.Mol.Biol.                          235 783 ?   1994 JMOBAK UK 0022-2836     0070 ?                                        ? ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Isupov, M.N.'      1  
primary 'Antson, A.A.'      2  
primary 'Dodson, E.J.'      3  
primary 'Dodson, G.G.'      4  
primary 'Dementieva, I.S.'  5  
primary 'Zakomirdina, L.N.' 6  
primary 'Wilson, K.S.'      7  
primary 'Dauter, Z.'        8  
primary 'Lebedev, A.A.'     9  
primary 'Harutyunyan, E.H.' 10 
1       'Isupov, M.'        11 
1       'Dementieva, I.'    12 
1       'Zakomirdina, L.'   13 
1       'Wilson, K.S.'      14 
1       'Dauter, Z.'        15 
1       'Antson, A.A.'      16 
1       'Dodson, G.G.'      17 
1       'Harutyunyan, E.H.' 18 
2       'Dementieva, I.S.'  19 
2       'Zakomirdina, L.N.' 20 
2       'Sinitzina, N.I.'   21 
2       'Antson, A.A.'      22 
2       'Wilson, K.S.'      23 
2       'Isupov, M.N.'      24 
2       'Lebedev, A.A.'     25 
2       'Harutyunyan, E.H.' 26 
# 
loop_
_citation_editor.citation_id 
_citation_editor.name 
_citation_editor.ordinal 
1 'Marino, G.' 1 
1 'Sannia, G.' 2 
1 'Bossa, F.'  3 
# 
_cell.entry_id           1AX4 
_cell.length_a           114.990 
_cell.length_b           118.230 
_cell.length_c           153.680 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              16 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1AX4 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man TRYPTOPHANASE   52787.102 4   4.1.99.1 ? ? 
;PYRIDOXAL 5'-DEPENDENT ENZYME, REQUIRES MONOVALENT CATIONS FOR ACTIVITY, DEGRADES L-TRYPTOPHAN TO INDOLE, PYRUVATE AND AMMONIA
;
2 non-polymer syn 'POTASSIUM ION' 39.098    4   ?        ? ? ? 
3 water       nat water           18.015    940 ?        ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'TRYPTOPHAN INDOLE-LYASE' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   yes 
_entity_poly.pdbx_seq_one_letter_code       
;MAKRIVEPFRIKMVEKIRVPSREEREAALKEAGYNPFLLPSSAVYIDLLTDSGTNAMSDHQWAAMITGDEAYAGSRNYYD
LKDKAKELFNYDYIIPAHQGRGAENILFPVLLKYKQKEGKAKNPVFISNFHFDTTAAHVELNGCKAINIVTEKAFDSETY
DDWKGDFDIKKLKENIAQHGADNIVAIVSTVTCNSAGGQPVSMSNLKEVYEIAKQHGIFVVMDSARFCENAYFIKARDPK
YKNATIKEVIFDMYKYADALTMSAK(LLP)DPLLNIGGLVAIRDNEEIFTLARQRCVPMEGFVTYGGLAGRDMAAMVQGL
EEGTEEEYLHYRIGQVKYLGDRLREAGIPIQYPTGGHAVFVDCKKLVPQIPGDQFPAQAVINALYLESGVRAVEIGSFLL
GRDPATGEQKHADMEFMRLTIARRVYTNDHMDYIADALIGLKEKFATLKGLEFEYEPPVLRHFTARLKPIE
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MAKRIVEPFRIKMVEKIRVPSREEREAALKEAGYNPFLLPSSAVYIDLLTDSGTNAMSDHQWAAMITGDEAYAGSRNYYD
LKDKAKELFNYDYIIPAHQGRGAENILFPVLLKYKQKEGKAKNPVFISNFHFDTTAAHVELNGCKAINIVTEKAFDSETY
DDWKGDFDIKKLKENIAQHGADNIVAIVSTVTCNSAGGQPVSMSNLKEVYEIAKQHGIFVVMDSARFCENAYFIKARDPK
YKNATIKEVIFDMYKYADALTMSAKKDPLLNIGGLVAIRDNEEIFTLARQRCVPMEGFVTYGGLAGRDMAAMVQGLEEGT
EEEYLHYRIGQVKYLGDRLREAGIPIQYPTGGHAVFVDCKKLVPQIPGDQFPAQAVINALYLESGVRAVEIGSFLLGRDP
ATGEQKHADMEFMRLTIARRVYTNDHMDYIADALIGLKEKFATLKGLEFEYEPPVLRHFTARLKPIE
;
_entity_poly.pdbx_strand_id                 A,B,C,D 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ALA n 
1 3   LYS n 
1 4   ARG n 
1 5   ILE n 
1 6   VAL n 
1 7   GLU n 
1 8   PRO n 
1 9   PHE n 
1 10  ARG n 
1 11  ILE n 
1 12  LYS n 
1 13  MET n 
1 14  VAL n 
1 15  GLU n 
1 16  LYS n 
1 17  ILE n 
1 18  ARG n 
1 19  VAL n 
1 20  PRO n 
1 21  SER n 
1 22  ARG n 
1 23  GLU n 
1 24  GLU n 
1 25  ARG n 
1 26  GLU n 
1 27  ALA n 
1 28  ALA n 
1 29  LEU n 
1 30  LYS n 
1 31  GLU n 
1 32  ALA n 
1 33  GLY n 
1 34  TYR n 
1 35  ASN n 
1 36  PRO n 
1 37  PHE n 
1 38  LEU n 
1 39  LEU n 
1 40  PRO n 
1 41  SER n 
1 42  SER n 
1 43  ALA n 
1 44  VAL n 
1 45  TYR n 
1 46  ILE n 
1 47  ASP n 
1 48  LEU n 
1 49  LEU n 
1 50  THR n 
1 51  ASP n 
1 52  SER n 
1 53  GLY n 
1 54  THR n 
1 55  ASN n 
1 56  ALA n 
1 57  MET n 
1 58  SER n 
1 59  ASP n 
1 60  HIS n 
1 61  GLN n 
1 62  TRP n 
1 63  ALA n 
1 64  ALA n 
1 65  MET n 
1 66  ILE n 
1 67  THR n 
1 68  GLY n 
1 69  ASP n 
1 70  GLU n 
1 71  ALA n 
1 72  TYR n 
1 73  ALA n 
1 74  GLY n 
1 75  SER n 
1 76  ARG n 
1 77  ASN n 
1 78  TYR n 
1 79  TYR n 
1 80  ASP n 
1 81  LEU n 
1 82  LYS n 
1 83  ASP n 
1 84  LYS n 
1 85  ALA n 
1 86  LYS n 
1 87  GLU n 
1 88  LEU n 
1 89  PHE n 
1 90  ASN n 
1 91  TYR n 
1 92  ASP n 
1 93  TYR n 
1 94  ILE n 
1 95  ILE n 
1 96  PRO n 
1 97  ALA n 
1 98  HIS n 
1 99  GLN n 
1 100 GLY n 
1 101 ARG n 
1 102 GLY n 
1 103 ALA n 
1 104 GLU n 
1 105 ASN n 
1 106 ILE n 
1 107 LEU n 
1 108 PHE n 
1 109 PRO n 
1 110 VAL n 
1 111 LEU n 
1 112 LEU n 
1 113 LYS n 
1 114 TYR n 
1 115 LYS n 
1 116 GLN n 
1 117 LYS n 
1 118 GLU n 
1 119 GLY n 
1 120 LYS n 
1 121 ALA n 
1 122 LYS n 
1 123 ASN n 
1 124 PRO n 
1 125 VAL n 
1 126 PHE n 
1 127 ILE n 
1 128 SER n 
1 129 ASN n 
1 130 PHE n 
1 131 HIS n 
1 132 PHE n 
1 133 ASP n 
1 134 THR n 
1 135 THR n 
1 136 ALA n 
1 137 ALA n 
1 138 HIS n 
1 139 VAL n 
1 140 GLU n 
1 141 LEU n 
1 142 ASN n 
1 143 GLY n 
1 144 CYS n 
1 145 LYS n 
1 146 ALA n 
1 147 ILE n 
1 148 ASN n 
1 149 ILE n 
1 150 VAL n 
1 151 THR n 
1 152 GLU n 
1 153 LYS n 
1 154 ALA n 
1 155 PHE n 
1 156 ASP n 
1 157 SER n 
1 158 GLU n 
1 159 THR n 
1 160 TYR n 
1 161 ASP n 
1 162 ASP n 
1 163 TRP n 
1 164 LYS n 
1 165 GLY n 
1 166 ASP n 
1 167 PHE n 
1 168 ASP n 
1 169 ILE n 
1 170 LYS n 
1 171 LYS n 
1 172 LEU n 
1 173 LYS n 
1 174 GLU n 
1 175 ASN n 
1 176 ILE n 
1 177 ALA n 
1 178 GLN n 
1 179 HIS n 
1 180 GLY n 
1 181 ALA n 
1 182 ASP n 
1 183 ASN n 
1 184 ILE n 
1 185 VAL n 
1 186 ALA n 
1 187 ILE n 
1 188 VAL n 
1 189 SER n 
1 190 THR n 
1 191 VAL n 
1 192 THR n 
1 193 CYS n 
1 194 ASN n 
1 195 SER n 
1 196 ALA n 
1 197 GLY n 
1 198 GLY n 
1 199 GLN n 
1 200 PRO n 
1 201 VAL n 
1 202 SER n 
1 203 MET n 
1 204 SER n 
1 205 ASN n 
1 206 LEU n 
1 207 LYS n 
1 208 GLU n 
1 209 VAL n 
1 210 TYR n 
1 211 GLU n 
1 212 ILE n 
1 213 ALA n 
1 214 LYS n 
1 215 GLN n 
1 216 HIS n 
1 217 GLY n 
1 218 ILE n 
1 219 PHE n 
1 220 VAL n 
1 221 VAL n 
1 222 MET n 
1 223 ASP n 
1 224 SER n 
1 225 ALA n 
1 226 ARG n 
1 227 PHE n 
1 228 CYS n 
1 229 GLU n 
1 230 ASN n 
1 231 ALA n 
1 232 TYR n 
1 233 PHE n 
1 234 ILE n 
1 235 LYS n 
1 236 ALA n 
1 237 ARG n 
1 238 ASP n 
1 239 PRO n 
1 240 LYS n 
1 241 TYR n 
1 242 LYS n 
1 243 ASN n 
1 244 ALA n 
1 245 THR n 
1 246 ILE n 
1 247 LYS n 
1 248 GLU n 
1 249 VAL n 
1 250 ILE n 
1 251 PHE n 
1 252 ASP n 
1 253 MET n 
1 254 TYR n 
1 255 LYS n 
1 256 TYR n 
1 257 ALA n 
1 258 ASP n 
1 259 ALA n 
1 260 LEU n 
1 261 THR n 
1 262 MET n 
1 263 SER n 
1 264 ALA n 
1 265 LYS n 
1 266 LLP n 
1 267 ASP n 
1 268 PRO n 
1 269 LEU n 
1 270 LEU n 
1 271 ASN n 
1 272 ILE n 
1 273 GLY n 
1 274 GLY n 
1 275 LEU n 
1 276 VAL n 
1 277 ALA n 
1 278 ILE n 
1 279 ARG n 
1 280 ASP n 
1 281 ASN n 
1 282 GLU n 
1 283 GLU n 
1 284 ILE n 
1 285 PHE n 
1 286 THR n 
1 287 LEU n 
1 288 ALA n 
1 289 ARG n 
1 290 GLN n 
1 291 ARG n 
1 292 CYS n 
1 293 VAL n 
1 294 PRO n 
1 295 MET n 
1 296 GLU n 
1 297 GLY n 
1 298 PHE n 
1 299 VAL n 
1 300 THR n 
1 301 TYR n 
1 302 GLY n 
1 303 GLY n 
1 304 LEU n 
1 305 ALA n 
1 306 GLY n 
1 307 ARG n 
1 308 ASP n 
1 309 MET n 
1 310 ALA n 
1 311 ALA n 
1 312 MET n 
1 313 VAL n 
1 314 GLN n 
1 315 GLY n 
1 316 LEU n 
1 317 GLU n 
1 318 GLU n 
1 319 GLY n 
1 320 THR n 
1 321 GLU n 
1 322 GLU n 
1 323 GLU n 
1 324 TYR n 
1 325 LEU n 
1 326 HIS n 
1 327 TYR n 
1 328 ARG n 
1 329 ILE n 
1 330 GLY n 
1 331 GLN n 
1 332 VAL n 
1 333 LYS n 
1 334 TYR n 
1 335 LEU n 
1 336 GLY n 
1 337 ASP n 
1 338 ARG n 
1 339 LEU n 
1 340 ARG n 
1 341 GLU n 
1 342 ALA n 
1 343 GLY n 
1 344 ILE n 
1 345 PRO n 
1 346 ILE n 
1 347 GLN n 
1 348 TYR n 
1 349 PRO n 
1 350 THR n 
1 351 GLY n 
1 352 GLY n 
1 353 HIS n 
1 354 ALA n 
1 355 VAL n 
1 356 PHE n 
1 357 VAL n 
1 358 ASP n 
1 359 CYS n 
1 360 LYS n 
1 361 LYS n 
1 362 LEU n 
1 363 VAL n 
1 364 PRO n 
1 365 GLN n 
1 366 ILE n 
1 367 PRO n 
1 368 GLY n 
1 369 ASP n 
1 370 GLN n 
1 371 PHE n 
1 372 PRO n 
1 373 ALA n 
1 374 GLN n 
1 375 ALA n 
1 376 VAL n 
1 377 ILE n 
1 378 ASN n 
1 379 ALA n 
1 380 LEU n 
1 381 TYR n 
1 382 LEU n 
1 383 GLU n 
1 384 SER n 
1 385 GLY n 
1 386 VAL n 
1 387 ARG n 
1 388 ALA n 
1 389 VAL n 
1 390 GLU n 
1 391 ILE n 
1 392 GLY n 
1 393 SER n 
1 394 PHE n 
1 395 LEU n 
1 396 LEU n 
1 397 GLY n 
1 398 ARG n 
1 399 ASP n 
1 400 PRO n 
1 401 ALA n 
1 402 THR n 
1 403 GLY n 
1 404 GLU n 
1 405 GLN n 
1 406 LYS n 
1 407 HIS n 
1 408 ALA n 
1 409 ASP n 
1 410 MET n 
1 411 GLU n 
1 412 PHE n 
1 413 MET n 
1 414 ARG n 
1 415 LEU n 
1 416 THR n 
1 417 ILE n 
1 418 ALA n 
1 419 ARG n 
1 420 ARG n 
1 421 VAL n 
1 422 TYR n 
1 423 THR n 
1 424 ASN n 
1 425 ASP n 
1 426 HIS n 
1 427 MET n 
1 428 ASP n 
1 429 TYR n 
1 430 ILE n 
1 431 ALA n 
1 432 ASP n 
1 433 ALA n 
1 434 LEU n 
1 435 ILE n 
1 436 GLY n 
1 437 LEU n 
1 438 LYS n 
1 439 GLU n 
1 440 LYS n 
1 441 PHE n 
1 442 ALA n 
1 443 THR n 
1 444 LEU n 
1 445 LYS n 
1 446 GLY n 
1 447 LEU n 
1 448 GLU n 
1 449 PHE n 
1 450 GLU n 
1 451 TYR n 
1 452 GLU n 
1 453 PRO n 
1 454 PRO n 
1 455 VAL n 
1 456 LEU n 
1 457 ARG n 
1 458 HIS n 
1 459 PHE n 
1 460 THR n 
1 461 ALA n 
1 462 ARG n 
1 463 LEU n 
1 464 LYS n 
1 465 PRO n 
1 466 ILE n 
1 467 GLU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Proteus 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Proteus vulgaris' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     585 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    TNAA_PROVU 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P28796 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   
;MAKRIVEPFRIKMVEKIRVPSREEREAALKEAGYNPFLLPSSAVYIDLLTDSGTNAMSDHQWAAMITGDEAYAGSRNYYD
LKDKAKELFNYDYIIPAHQGRGAENILFPVLLKYKQKEGKAKNPVFISNFHFDTTAAHVELNGCKAINIVTEKAFDSETY
DDWKGDFDIKKLKENIAQHGADNIVAIVSTVTCNSAGGQPVSMSNLKEVYEIAKQHGIFVVMDSARFCENAYFIKARDPK
YKNATIKEVIFDMYKYADALTMSAKKDPLLNIGGLVAIRDNEEIFTLARQRCVPMEGFVTYGGLAGRDMAAMVQGLEEGT
EEEYLHYRIGQVKYLGDRLREAGIPIQYPTGGHAVFVDCKKLVPQIPGDQFPAQAVINALYLESGVRAVEIGSFLLGRDP
ATGEQKHADMEFMRLTIARRVYTNDHMDYIADALIGLKEKFATLKGLEFEYEPPVLRHFTARLKPIE
;
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1AX4 A 1 ? 467 ? P28796 1 ? 467 ? 1 467 
2 1 1AX4 B 1 ? 467 ? P28796 1 ? 467 ? 1 467 
3 1 1AX4 C 1 ? 467 ? P28796 1 ? 467 ? 1 467 
4 1 1AX4 D 1 ? 467 ? P28796 1 ? 467 ? 1 467 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1AX4 LLP A 266 ? UNP P28796 LYS 266 'MODIFIED RESIDUE' 266 1 
2 1AX4 LLP B 266 ? UNP P28796 LYS 266 'MODIFIED RESIDUE' 266 2 
3 1AX4 LLP C 266 ? UNP P28796 LYS 266 'MODIFIED RESIDUE' 266 3 
4 1AX4 LLP D 266 ? UNP P28796 LYS 266 'MODIFIED RESIDUE' 266 4 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                                                                                 
?                                      'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                                                                                                
?                                      'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                                                              
?                                      'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                                                         
?                                      'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                                                                                                
?                                      'C3 H7 N O2 S'    121.158 
GLN 'L-peptide linking' y GLUTAMINE                                                                                               
?                                      'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                                                         
?                                      'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                                                                                                 
?                                      'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                                                                                               
?                                      'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                                                                                   
?                                      'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                                                                              
?                                      'C6 H13 N O2'     131.173 
K   non-polymer         . 'POTASSIUM ION'                                                                                         
?                                      'K 1'             39.098  
LEU 'L-peptide linking' y LEUCINE                                                                                                 
?                                      'C6 H13 N O2'     131.173 
LLP 'L-peptide linking' n '(2S)-2-amino-6-[[3-hydroxy-2-methyl-5-(phosphonooxymethyl)pyridin-4-yl]methylideneamino]hexanoic acid' 
"N'-PYRIDOXYL-LYSINE-5'-MONOPHOSPHATE" 'C14 H22 N3 O7 P' 375.314 
LYS 'L-peptide linking' y LYSINE                                                                                                  
?                                      'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                                                                                              
?                                      'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                                                                                           
?                                      'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                                                                                                 
?                                      'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                                                                                                  
?                                      'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                                                                                               
?                                      'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                                                              
?                                      'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                                                                                                
?                                      'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                                                                                                  
?                                      'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          1AX4 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.49 
_exptl_crystal.density_percent_sol   51. 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.8 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    
;27 % PEG 4000, 0.1 M POTASSIUM PHOSPHATE BUFFER PH 7.8, 0.25 MM PYRIDOXAL 5'-PHOSPHATE, 5MM DTT, 0.1 M CSCL.
;
# 
_diffrn.id                     1 
_diffrn.ambient_temp           293 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   1994-01 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.95 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'EMBL/DESY, HAMBURG BEAMLINE BW7B' 
_diffrn_source.pdbx_synchrotron_site       'EMBL/DESY, Hamburg' 
_diffrn_source.pdbx_synchrotron_beamline   BW7B 
_diffrn_source.pdbx_wavelength             0.95 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1AX4 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             18. 
_reflns.d_resolution_high            2.1 
_reflns.number_obs                   397510 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         97.6 
_reflns.pdbx_Rmerge_I_obs            0.0980000 
_reflns.pdbx_Rsym_value              0.0980000 
_reflns.pdbx_netI_over_sigmaI        11.0 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              3.33 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.10 
_reflns_shell.d_res_low              2.17 
_reflns_shell.percent_possible_all   97.3 
_reflns_shell.Rmerge_I_obs           0.2730000 
_reflns_shell.pdbx_Rsym_value        0.2730000 
_reflns_shell.meanI_over_sigI_obs    3.2 
_reflns_shell.pdbx_redundancy        2.49 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1AX4 
_refine.ls_number_reflns_obs                     115498 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             18. 
_refine.ls_d_res_high                            2.1 
_refine.ls_percent_reflns_obs                    97.6 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.18688 
_refine.ls_R_factor_R_free                       0.22749 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 2. 
_refine.ls_number_reflns_R_free                  2364 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R' 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'TYROSINE PHENOL LYASE, PDB ENTRY 1TPL' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        14772 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         64 
_refine_hist.number_atoms_solvent             941 
_refine_hist.number_atoms_total               15777 
_refine_hist.d_res_high                       2.1 
_refine_hist.d_res_low                        18. 
# 
loop_
_struct_ncs_oper.id 
_struct_ncs_oper.code 
_struct_ncs_oper.details 
_struct_ncs_oper.matrix[1][1] 
_struct_ncs_oper.matrix[1][2] 
_struct_ncs_oper.matrix[1][3] 
_struct_ncs_oper.matrix[2][1] 
_struct_ncs_oper.matrix[2][2] 
_struct_ncs_oper.matrix[2][3] 
_struct_ncs_oper.matrix[3][1] 
_struct_ncs_oper.matrix[3][2] 
_struct_ncs_oper.matrix[3][3] 
_struct_ncs_oper.vector[1] 
_struct_ncs_oper.vector[2] 
_struct_ncs_oper.vector[3] 
1 given ? 0.010000  -0.212000 0.977000  -0.214000 -0.955000 -0.205000 0.977000  -0.208000 -0.055000 -46.10084 127.67617 75.14806 
2 given ? -0.009000 0.263000  -0.965000 0.229000  -0.939000 -0.257000 -0.973000 -0.223000 -0.052000 43.11463  129.55736 76.94052 
3 given ? -1.000000 -0.018000 0.002000  -0.015000 0.887000  0.462000  -0.010000 0.462000  -0.887000 2.05439   -21.19797 86.35860 
# 
_struct.entry_id                  1AX4 
_struct.title                     'TRYPTOPHANASE FROM PROTEUS VULGARIS' 
_struct.pdbx_descriptor           TRYPTOPHANASE 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1AX4 
_struct_keywords.pdbx_keywords   'TRYPTOPHAN BIOSYNTHESIS' 
_struct_keywords.text            
;TRYPTOPHAN BIOSYNTHESIS, TRYPTOPHAN INDOLE-LYASE, PYRIDOXAL 5'-PHOSPHATE, MONOVALENT CATION BINDING SITE
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 2 ? 
F N N 2 ? 
G N N 2 ? 
H N N 2 ? 
I N N 3 ? 
J N N 3 ? 
K N N 3 ? 
L N N 3 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ARG A 22  ? GLU A 31  ? ARG A 22  GLU A 31  1 ? 10 
HELX_P HELX_P2  2  PRO A 36  ? LEU A 38  ? PRO A 36  LEU A 38  5 ? 3  
HELX_P HELX_P3  3  SER A 41  ? ALA A 43  ? SER A 41  ALA A 43  5 ? 3  
HELX_P HELX_P4  4  ASP A 59  ? ILE A 66  ? ASP A 59  ILE A 66  1 ? 8  
HELX_P HELX_P5  5  ARG A 76  ? PHE A 89  ? ARG A 76  PHE A 89  1 ? 14 
HELX_P HELX_P6  6  GLY A 100 ? LYS A 117 ? GLY A 100 LYS A 117 1 ? 18 
HELX_P HELX_P7  7  ASP A 133 ? LEU A 141 ? ASP A 133 LEU A 141 1 ? 9  
HELX_P HELX_P8  8  GLU A 152 ? PHE A 155 ? GLU A 152 PHE A 155 5 ? 4  
HELX_P HELX_P9  9  ILE A 169 ? HIS A 179 ? ILE A 169 HIS A 179 1 ? 11 
HELX_P HELX_P10 10 ALA A 181 ? ASN A 183 ? ALA A 181 ASN A 183 5 ? 3  
HELX_P HELX_P11 11 MET A 203 ? HIS A 216 ? MET A 203 HIS A 216 1 ? 14 
HELX_P HELX_P12 12 PHE A 227 ? ARG A 237 ? PHE A 227 ARG A 237 1 ? 11 
HELX_P HELX_P13 13 PRO A 239 ? TYR A 241 ? PRO A 239 TYR A 241 5 ? 3  
HELX_P HELX_P14 14 ILE A 246 ? TYR A 256 ? ILE A 246 TYR A 256 1 ? 11 
HELX_P HELX_P15 15 GLU A 282 ? MET A 295 ? GLU A 282 MET A 295 1 ? 14 
HELX_P HELX_P16 16 GLY A 306 ? THR A 320 ? GLY A 306 THR A 320 1 ? 15 
HELX_P HELX_P17 17 GLU A 322 ? GLU A 341 ? GLU A 322 GLU A 341 1 ? 20 
HELX_P HELX_P18 18 GLY A 368 ? GLN A 370 ? GLY A 368 GLN A 370 5 ? 3  
HELX_P HELX_P19 19 PRO A 372 ? SER A 384 ? PRO A 372 SER A 384 1 ? 13 
HELX_P HELX_P20 20 SER A 393 ? LEU A 396 ? SER A 393 LEU A 396 1 ? 4  
HELX_P HELX_P21 21 ASN A 424 ? PHE A 441 ? ASN A 424 PHE A 441 1 ? 18 
HELX_P HELX_P22 22 ARG A 457 ? THR A 460 ? ARG A 457 THR A 460 1 ? 4  
HELX_P HELX_P23 23 ARG B 22  ? GLU B 31  ? ARG B 22  GLU B 31  1 ? 10 
HELX_P HELX_P24 24 PRO B 36  ? LEU B 38  ? PRO B 36  LEU B 38  5 ? 3  
HELX_P HELX_P25 25 SER B 41  ? ALA B 43  ? SER B 41  ALA B 43  5 ? 3  
HELX_P HELX_P26 26 ASP B 59  ? ILE B 66  ? ASP B 59  ILE B 66  1 ? 8  
HELX_P HELX_P27 27 ARG B 76  ? PHE B 89  ? ARG B 76  PHE B 89  1 ? 14 
HELX_P HELX_P28 28 GLY B 100 ? LYS B 117 ? GLY B 100 LYS B 117 1 ? 18 
HELX_P HELX_P29 29 ASP B 133 ? LEU B 141 ? ASP B 133 LEU B 141 1 ? 9  
HELX_P HELX_P30 30 GLU B 152 ? PHE B 155 ? GLU B 152 PHE B 155 5 ? 4  
HELX_P HELX_P31 31 ILE B 169 ? HIS B 179 ? ILE B 169 HIS B 179 1 ? 11 
HELX_P HELX_P32 32 ALA B 181 ? ASN B 183 ? ALA B 181 ASN B 183 5 ? 3  
HELX_P HELX_P33 33 MET B 203 ? GLN B 215 ? MET B 203 GLN B 215 1 ? 13 
HELX_P HELX_P34 34 PHE B 227 ? ARG B 237 ? PHE B 227 ARG B 237 1 ? 11 
HELX_P HELX_P35 35 PRO B 239 ? TYR B 241 ? PRO B 239 TYR B 241 5 ? 3  
HELX_P HELX_P36 36 ILE B 246 ? TYR B 256 ? ILE B 246 TYR B 256 1 ? 11 
HELX_P HELX_P37 37 GLU B 282 ? MET B 295 ? GLU B 282 MET B 295 1 ? 14 
HELX_P HELX_P38 38 GLY B 306 ? THR B 320 ? GLY B 306 THR B 320 1 ? 15 
HELX_P HELX_P39 39 GLU B 322 ? ALA B 342 ? GLU B 322 ALA B 342 1 ? 21 
HELX_P HELX_P40 40 CYS B 359 ? LEU B 362 ? CYS B 359 LEU B 362 1 ? 4  
HELX_P HELX_P41 41 GLY B 368 ? GLN B 370 ? GLY B 368 GLN B 370 5 ? 3  
HELX_P HELX_P42 42 PRO B 372 ? SER B 384 ? PRO B 372 SER B 384 1 ? 13 
HELX_P HELX_P43 43 SER B 393 ? LEU B 396 ? SER B 393 LEU B 396 1 ? 4  
HELX_P HELX_P44 44 ASN B 424 ? LEU B 437 ? ASN B 424 LEU B 437 1 ? 14 
HELX_P HELX_P45 45 ARG B 457 ? THR B 460 ? ARG B 457 THR B 460 1 ? 4  
HELX_P HELX_P46 46 ARG C 22  ? GLU C 31  ? ARG C 22  GLU C 31  1 ? 10 
HELX_P HELX_P47 47 PRO C 36  ? LEU C 38  ? PRO C 36  LEU C 38  5 ? 3  
HELX_P HELX_P48 48 SER C 41  ? ALA C 43  ? SER C 41  ALA C 43  5 ? 3  
HELX_P HELX_P49 49 ASP C 59  ? ILE C 66  ? ASP C 59  ILE C 66  1 ? 8  
HELX_P HELX_P50 50 ARG C 76  ? PHE C 89  ? ARG C 76  PHE C 89  1 ? 14 
HELX_P HELX_P51 51 GLY C 100 ? LYS C 117 ? GLY C 100 LYS C 117 1 ? 18 
HELX_P HELX_P52 52 ASP C 133 ? LEU C 141 ? ASP C 133 LEU C 141 1 ? 9  
HELX_P HELX_P53 53 GLU C 152 ? PHE C 155 ? GLU C 152 PHE C 155 5 ? 4  
HELX_P HELX_P54 54 ILE C 169 ? HIS C 179 ? ILE C 169 HIS C 179 1 ? 11 
HELX_P HELX_P55 55 ALA C 181 ? ASN C 183 ? ALA C 181 ASN C 183 5 ? 3  
HELX_P HELX_P56 56 MET C 203 ? HIS C 216 ? MET C 203 HIS C 216 1 ? 14 
HELX_P HELX_P57 57 PHE C 227 ? ARG C 237 ? PHE C 227 ARG C 237 1 ? 11 
HELX_P HELX_P58 58 PRO C 239 ? TYR C 241 ? PRO C 239 TYR C 241 5 ? 3  
HELX_P HELX_P59 59 ILE C 246 ? TYR C 256 ? ILE C 246 TYR C 256 1 ? 11 
HELX_P HELX_P60 60 GLU C 282 ? MET C 295 ? GLU C 282 MET C 295 1 ? 14 
HELX_P HELX_P61 61 GLY C 306 ? THR C 320 ? GLY C 306 THR C 320 1 ? 15 
HELX_P HELX_P62 62 GLU C 322 ? ALA C 342 ? GLU C 322 ALA C 342 1 ? 21 
HELX_P HELX_P63 63 GLY C 368 ? GLN C 370 ? GLY C 368 GLN C 370 5 ? 3  
HELX_P HELX_P64 64 PRO C 372 ? SER C 384 ? PRO C 372 SER C 384 1 ? 13 
HELX_P HELX_P65 65 SER C 393 ? LEU C 396 ? SER C 393 LEU C 396 1 ? 4  
HELX_P HELX_P66 66 ASN C 424 ? THR C 443 ? ASN C 424 THR C 443 1 ? 20 
HELX_P HELX_P67 67 ARG C 457 ? THR C 460 ? ARG C 457 THR C 460 1 ? 4  
HELX_P HELX_P68 68 ARG D 22  ? GLU D 31  ? ARG D 22  GLU D 31  1 ? 10 
HELX_P HELX_P69 69 PRO D 36  ? LEU D 38  ? PRO D 36  LEU D 38  5 ? 3  
HELX_P HELX_P70 70 SER D 41  ? ALA D 43  ? SER D 41  ALA D 43  5 ? 3  
HELX_P HELX_P71 71 ASP D 59  ? ILE D 66  ? ASP D 59  ILE D 66  1 ? 8  
HELX_P HELX_P72 72 ARG D 76  ? PHE D 89  ? ARG D 76  PHE D 89  1 ? 14 
HELX_P HELX_P73 73 GLY D 100 ? LYS D 117 ? GLY D 100 LYS D 117 1 ? 18 
HELX_P HELX_P74 74 ASP D 133 ? LEU D 141 ? ASP D 133 LEU D 141 1 ? 9  
HELX_P HELX_P75 75 GLU D 152 ? PHE D 155 ? GLU D 152 PHE D 155 5 ? 4  
HELX_P HELX_P76 76 ILE D 169 ? HIS D 179 ? ILE D 169 HIS D 179 1 ? 11 
HELX_P HELX_P77 77 ALA D 181 ? ASN D 183 ? ALA D 181 ASN D 183 5 ? 3  
HELX_P HELX_P78 78 MET D 203 ? GLN D 215 ? MET D 203 GLN D 215 1 ? 13 
HELX_P HELX_P79 79 PHE D 227 ? ARG D 237 ? PHE D 227 ARG D 237 1 ? 11 
HELX_P HELX_P80 80 PRO D 239 ? TYR D 241 ? PRO D 239 TYR D 241 5 ? 3  
HELX_P HELX_P81 81 ILE D 246 ? TYR D 256 ? ILE D 246 TYR D 256 1 ? 11 
HELX_P HELX_P82 82 GLU D 282 ? MET D 295 ? GLU D 282 MET D 295 1 ? 14 
HELX_P HELX_P83 83 GLY D 306 ? THR D 320 ? GLY D 306 THR D 320 1 ? 15 
HELX_P HELX_P84 84 GLU D 322 ? GLU D 341 ? GLU D 322 GLU D 341 1 ? 20 
HELX_P HELX_P85 85 LYS D 360 ? LEU D 362 ? LYS D 360 LEU D 362 5 ? 3  
HELX_P HELX_P86 86 GLY D 368 ? GLN D 370 ? GLY D 368 GLN D 370 5 ? 3  
HELX_P HELX_P87 87 PRO D 372 ? SER D 384 ? PRO D 372 SER D 384 1 ? 13 
HELX_P HELX_P88 88 SER D 393 ? LEU D 396 ? SER D 393 LEU D 396 1 ? 4  
HELX_P HELX_P89 89 ASN D 424 ? PHE D 441 ? ASN D 424 PHE D 441 1 ? 18 
HELX_P HELX_P90 90 ARG D 457 ? THR D 460 ? ARG D 457 THR D 460 1 ? 4  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1  covale ? ? A LLP 266 N ? ? ? 1_555 A LYS 265 C   ? ? A LLP 266 A LYS 265 1_555 ? ? ? ? ? ? ? 1.317 ? 
covale2  covale ? ? A LLP 266 C ? ? ? 1_555 A ASP 267 N   ? ? A LLP 266 A ASP 267 1_555 ? ? ? ? ? ? ? 1.309 ? 
covale3  covale ? ? B LLP 266 N ? ? ? 1_555 B LYS 265 C   ? ? B LLP 266 B LYS 265 1_555 ? ? ? ? ? ? ? 1.328 ? 
covale4  covale ? ? B LLP 266 C ? ? ? 1_555 B ASP 267 N   ? ? B LLP 266 B ASP 267 1_555 ? ? ? ? ? ? ? 1.339 ? 
covale5  covale ? ? C LLP 266 N ? ? ? 1_555 C LYS 265 C   ? ? C LLP 266 C LYS 265 1_555 ? ? ? ? ? ? ? 1.319 ? 
covale6  covale ? ? C LLP 266 C ? ? ? 1_555 C ASP 267 N   ? ? C LLP 266 C ASP 267 1_555 ? ? ? ? ? ? ? 1.322 ? 
covale7  covale ? ? D LLP 266 N ? ? ? 1_555 D LYS 265 C   ? ? D LLP 266 D LYS 265 1_555 ? ? ? ? ? ? ? 1.327 ? 
covale8  covale ? ? D LLP 266 C ? ? ? 1_555 D ASP 267 N   ? ? D LLP 266 D ASP 267 1_555 ? ? ? ? ? ? ? 1.334 ? 
metalc1  metalc ? ? E K   .   K ? ? ? 1_555 B GLU 70  OE1 ? ? A K   500 B GLU 70  1_555 ? ? ? ? ? ? ? 2.638 ? 
metalc2  metalc ? ? E K   .   K ? ? ? 1_555 A GLY 53  O   ? ? A K   500 A GLY 53  1_555 ? ? ? ? ? ? ? 2.819 ? 
metalc3  metalc ? ? E K   .   K ? ? ? 1_555 A ASN 271 O   ? ? A K   500 A ASN 271 1_555 ? ? ? ? ? ? ? 2.888 ? 
metalc4  metalc ? ? E K   .   K ? ? ? 1_555 I HOH .   O   ? ? A K   500 A HOH 544 1_555 ? ? ? ? ? ? ? 2.875 ? 
metalc5  metalc ? ? E K   .   K ? ? ? 1_555 I HOH .   O   ? ? A K   500 A HOH 542 1_555 ? ? ? ? ? ? ? 3.107 ? 
metalc6  metalc ? ? E K   .   K ? ? ? 1_555 J HOH .   O   ? ? A K   500 B HOH 515 1_555 ? ? ? ? ? ? ? 2.869 ? 
metalc7  metalc ? ? E K   .   K ? ? ? 1_555 B GLU 70  O   ? ? A K   500 B GLU 70  1_555 ? ? ? ? ? ? ? 3.425 ? 
metalc8  metalc ? ? F K   .   K ? ? ? 1_555 A GLU 70  O   ? ? B K   500 A GLU 70  1_555 ? ? ? ? ? ? ? 3.324 ? 
metalc9  metalc ? ? F K   .   K ? ? ? 1_555 B GLY 53  O   ? ? B K   500 B GLY 53  1_555 ? ? ? ? ? ? ? 2.902 ? 
metalc10 metalc ? ? F K   .   K ? ? ? 1_555 I HOH .   O   ? ? B K   500 A HOH 521 1_555 ? ? ? ? ? ? ? 2.660 ? 
metalc11 metalc ? ? F K   .   K ? ? ? 1_555 J HOH .   O   ? ? B K   500 B HOH 503 1_555 ? ? ? ? ? ? ? 2.928 ? 
metalc12 metalc ? ? F K   .   K ? ? ? 1_555 B ASN 271 O   ? ? B K   500 B ASN 271 1_555 ? ? ? ? ? ? ? 2.974 ? 
metalc13 metalc ? ? F K   .   K ? ? ? 1_555 A GLU 70  OE1 ? ? B K   500 A GLU 70  1_555 ? ? ? ? ? ? ? 2.727 ? 
metalc14 metalc ? ? F K   .   K ? ? ? 1_555 J HOH .   O   ? ? B K   500 B HOH 513 1_555 ? ? ? ? ? ? ? 2.827 ? 
metalc15 metalc ? ? G K   .   K ? ? ? 1_555 K HOH .   O   ? ? C K   500 C HOH 506 1_555 ? ? ? ? ? ? ? 2.842 ? 
metalc16 metalc ? ? G K   .   K ? ? ? 1_555 K HOH .   O   ? ? C K   500 C HOH 529 1_555 ? ? ? ? ? ? ? 2.971 ? 
metalc17 metalc ? ? G K   .   K ? ? ? 1_555 C GLY 53  O   ? ? C K   500 C GLY 53  1_555 ? ? ? ? ? ? ? 2.850 ? 
metalc18 metalc ? ? G K   .   K ? ? ? 1_555 C ASN 271 O   ? ? C K   500 C ASN 271 1_555 ? ? ? ? ? ? ? 2.919 ? 
metalc19 metalc ? ? G K   .   K ? ? ? 1_555 D GLU 70  OE1 ? ? C K   500 D GLU 70  1_555 ? ? ? ? ? ? ? 2.689 ? 
metalc20 metalc ? ? G K   .   K ? ? ? 1_555 L HOH .   O   ? ? C K   500 D HOH 509 1_555 ? ? ? ? ? ? ? 2.726 ? 
metalc21 metalc ? ? G K   .   K ? ? ? 1_555 D GLU 70  O   ? ? C K   500 D GLU 70  1_555 ? ? ? ? ? ? ? 3.363 ? 
metalc22 metalc ? ? H K   .   K ? ? ? 1_555 D ASN 271 O   ? ? D K   500 D ASN 271 1_555 ? ? ? ? ? ? ? 2.859 ? 
metalc23 metalc ? ? H K   .   K ? ? ? 1_555 C GLU 70  O   ? ? D K   500 C GLU 70  1_555 ? ? ? ? ? ? ? 3.420 ? 
metalc24 metalc ? ? H K   .   K ? ? ? 1_555 K HOH .   O   ? ? D K   500 C HOH 511 1_555 ? ? ? ? ? ? ? 2.824 ? 
metalc25 metalc ? ? H K   .   K ? ? ? 1_555 K HOH .   O   ? ? D K   500 C HOH 512 1_555 ? ? ? ? ? ? ? 2.853 ? 
metalc26 metalc ? ? H K   .   K ? ? ? 1_555 L HOH .   O   ? ? D K   500 D HOH 517 1_555 ? ? ? ? ? ? ? 3.024 ? 
metalc27 metalc ? ? H K   .   K ? ? ? 1_555 C GLU 70  OE1 ? ? D K   500 C GLU 70  1_555 ? ? ? ? ? ? ? 2.698 ? 
metalc28 metalc ? ? H K   .   K ? ? ? 1_555 D GLY 53  O   ? ? D K   500 D GLY 53  1_555 ? ? ? ? ? ? ? 2.899 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
covale ? ? 
metalc ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 VAL 191 A . ? VAL 191 A THR 192 A ? THR 192 A 1 -13.66 
2 TYR 348 A . ? TYR 348 A PRO 349 A ? PRO 349 A 1 -0.26  
3 VAL 191 B . ? VAL 191 B THR 192 B ? THR 192 B 1 -13.31 
4 TYR 348 B . ? TYR 348 B PRO 349 B ? PRO 349 B 1 2.14   
5 VAL 191 C . ? VAL 191 C THR 192 C ? THR 192 C 1 -15.74 
6 TYR 348 C . ? TYR 348 C PRO 349 C ? PRO 349 C 1 -2.04  
7 VAL 191 D . ? VAL 191 D THR 192 D ? THR 192 D 1 -17.52 
8 TYR 348 D . ? TYR 348 D PRO 349 D ? PRO 349 D 1 -4.34  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 7 ? 
B ? 3 ? 
C ? 2 ? 
D ? 7 ? 
E ? 3 ? 
F ? 2 ? 
G ? 7 ? 
H ? 3 ? 
I ? 2 ? 
J ? 7 ? 
K ? 3 ? 
L ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? parallel      
A 4 5 ? parallel      
A 5 6 ? parallel      
A 6 7 ? parallel      
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? parallel      
D 4 5 ? parallel      
D 5 6 ? parallel      
D 6 7 ? parallel      
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
F 1 2 ? anti-parallel 
G 1 2 ? anti-parallel 
G 2 3 ? anti-parallel 
G 3 4 ? parallel      
G 4 5 ? parallel      
G 5 6 ? parallel      
G 6 7 ? parallel      
H 1 2 ? anti-parallel 
H 2 3 ? anti-parallel 
I 1 2 ? anti-parallel 
J 1 2 ? anti-parallel 
J 2 3 ? anti-parallel 
J 3 4 ? parallel      
J 4 5 ? parallel      
J 5 6 ? parallel      
J 6 7 ? parallel      
K 1 2 ? anti-parallel 
K 2 3 ? anti-parallel 
L 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 TYR A 93  ? ALA A 97  ? TYR A 93  ALA A 97  
A 2 GLY A 274 ? ILE A 278 ? GLY A 274 ILE A 278 
A 3 ALA A 259 ? SER A 263 ? ALA A 259 SER A 263 
A 4 VAL A 220 ? ASP A 223 ? VAL A 220 ASP A 223 
A 5 ILE A 184 ? THR A 190 ? ILE A 184 THR A 190 
A 6 VAL A 125 ? SER A 128 ? VAL A 125 SER A 128 
A 7 LYS A 145 ? ASN A 148 ? LYS A 145 ASN A 148 
B 1 ALA A 354 ? ASP A 358 ? ALA A 354 ASP A 358 
B 2 PHE A 412 ? THR A 416 ? PHE A 412 THR A 416 
B 3 VAL A 389 ? ILE A 391 ? VAL A 389 ILE A 391 
C 1 LEU A 447 ? TYR A 451 ? LEU A 447 TYR A 451 
C 2 ARG A 462 ? PRO A 465 ? ARG A 462 PRO A 465 
D 1 TYR B 93  ? ALA B 97  ? TYR B 93  ALA B 97  
D 2 GLY B 274 ? ILE B 278 ? GLY B 274 ILE B 278 
D 3 ALA B 259 ? SER B 263 ? ALA B 259 SER B 263 
D 4 PHE B 219 ? ASP B 223 ? PHE B 219 ASP B 223 
D 5 ILE B 184 ? THR B 190 ? ILE B 184 THR B 190 
D 6 VAL B 125 ? SER B 128 ? VAL B 125 SER B 128 
D 7 LYS B 145 ? ASN B 148 ? LYS B 145 ASN B 148 
E 1 ALA B 354 ? ASP B 358 ? ALA B 354 ASP B 358 
E 2 PHE B 412 ? THR B 416 ? PHE B 412 THR B 416 
E 3 VAL B 389 ? ILE B 391 ? VAL B 389 ILE B 391 
F 1 LEU B 447 ? TYR B 451 ? LEU B 447 TYR B 451 
F 2 ARG B 462 ? PRO B 465 ? ARG B 462 PRO B 465 
G 1 TYR C 93  ? ALA C 97  ? TYR C 93  ALA C 97  
G 2 GLY C 274 ? ILE C 278 ? GLY C 274 ILE C 278 
G 3 ALA C 259 ? SER C 263 ? ALA C 259 SER C 263 
G 4 PHE C 219 ? ASP C 223 ? PHE C 219 ASP C 223 
G 5 ILE C 184 ? THR C 190 ? ILE C 184 THR C 190 
G 6 VAL C 125 ? SER C 128 ? VAL C 125 SER C 128 
G 7 LYS C 145 ? ASN C 148 ? LYS C 145 ASN C 148 
H 1 ALA C 354 ? ASP C 358 ? ALA C 354 ASP C 358 
H 2 PHE C 412 ? THR C 416 ? PHE C 412 THR C 416 
H 3 VAL C 389 ? ILE C 391 ? VAL C 389 ILE C 391 
I 1 LEU C 447 ? TYR C 451 ? LEU C 447 TYR C 451 
I 2 ARG C 462 ? PRO C 465 ? ARG C 462 PRO C 465 
J 1 TYR D 93  ? ALA D 97  ? TYR D 93  ALA D 97  
J 2 GLY D 274 ? ILE D 278 ? GLY D 274 ILE D 278 
J 3 ALA D 259 ? SER D 263 ? ALA D 259 SER D 263 
J 4 PHE D 219 ? ASP D 223 ? PHE D 219 ASP D 223 
J 5 ILE D 184 ? THR D 190 ? ILE D 184 THR D 190 
J 6 VAL D 125 ? SER D 128 ? VAL D 125 SER D 128 
J 7 LYS D 145 ? ASN D 148 ? LYS D 145 ASN D 148 
K 1 ALA D 354 ? ASP D 358 ? ALA D 354 ASP D 358 
K 2 PHE D 412 ? THR D 416 ? PHE D 412 THR D 416 
K 3 VAL D 389 ? ILE D 391 ? VAL D 389 ILE D 391 
L 1 LEU D 447 ? TYR D 451 ? LEU D 447 TYR D 451 
L 2 ARG D 462 ? PRO D 465 ? ARG D 462 PRO D 465 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O TYR A 93  ? O TYR A 93  N ILE A 278 ? N ILE A 278 
A 2 3 O LEU A 275 ? O LEU A 275 N MET A 262 ? N MET A 262 
A 3 4 O ALA A 259 ? O ALA A 259 N MET A 222 ? N MET A 222 
A 4 5 O VAL A 221 ? O VAL A 221 N ILE A 187 ? N ILE A 187 
A 5 6 O VAL A 185 ? O VAL A 185 N VAL A 125 ? N VAL A 125 
A 6 7 O PHE A 126 ? O PHE A 126 N LYS A 145 ? N LYS A 145 
B 1 2 O VAL A 355 ? O VAL A 355 N LEU A 415 ? N LEU A 415 
B 2 3 O PHE A 412 ? O PHE A 412 N ILE A 391 ? N ILE A 391 
C 1 2 O GLU A 448 ? O GLU A 448 N LYS A 464 ? N LYS A 464 
D 1 2 O TYR B 93  ? O TYR B 93  N ILE B 278 ? N ILE B 278 
D 2 3 O LEU B 275 ? O LEU B 275 N MET B 262 ? N MET B 262 
D 3 4 O ALA B 259 ? O ALA B 259 N MET B 222 ? N MET B 222 
D 4 5 O PHE B 219 ? O PHE B 219 N ILE B 187 ? N ILE B 187 
D 5 6 O VAL B 185 ? O VAL B 185 N VAL B 125 ? N VAL B 125 
D 6 7 O PHE B 126 ? O PHE B 126 N LYS B 145 ? N LYS B 145 
E 1 2 O VAL B 355 ? O VAL B 355 N LEU B 415 ? N LEU B 415 
E 2 3 O PHE B 412 ? O PHE B 412 N ILE B 391 ? N ILE B 391 
F 1 2 O GLU B 448 ? O GLU B 448 N LYS B 464 ? N LYS B 464 
G 1 2 O TYR C 93  ? O TYR C 93  N ILE C 278 ? N ILE C 278 
G 2 3 O LEU C 275 ? O LEU C 275 N MET C 262 ? N MET C 262 
G 3 4 O ALA C 259 ? O ALA C 259 N MET C 222 ? N MET C 222 
G 4 5 O PHE C 219 ? O PHE C 219 N ILE C 187 ? N ILE C 187 
G 5 6 O VAL C 185 ? O VAL C 185 N VAL C 125 ? N VAL C 125 
G 6 7 O PHE C 126 ? O PHE C 126 N LYS C 145 ? N LYS C 145 
H 1 2 O VAL C 355 ? O VAL C 355 N LEU C 415 ? N LEU C 415 
H 2 3 O PHE C 412 ? O PHE C 412 N ILE C 391 ? N ILE C 391 
I 1 2 O GLU C 448 ? O GLU C 448 N LYS C 464 ? N LYS C 464 
J 1 2 O TYR D 93  ? O TYR D 93  N ILE D 278 ? N ILE D 278 
J 2 3 O LEU D 275 ? O LEU D 275 N MET D 262 ? N MET D 262 
J 3 4 O ALA D 259 ? O ALA D 259 N MET D 222 ? N MET D 222 
J 4 5 O PHE D 219 ? O PHE D 219 N ILE D 187 ? N ILE D 187 
J 5 6 O VAL D 185 ? O VAL D 185 N VAL D 125 ? N VAL D 125 
J 6 7 O PHE D 126 ? O PHE D 126 N LYS D 145 ? N LYS D 145 
K 1 2 O VAL D 355 ? O VAL D 355 N LEU D 415 ? N LEU D 415 
K 2 3 O PHE D 412 ? O PHE D 412 N ILE D 391 ? N ILE D 391 
L 1 2 O GLU D 448 ? O GLU D 448 N LYS D 464 ? N LYS D 464 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
POA Unknown  ? ? ? ? 3  'POTASSIUM BINDING SITE.'              
POB Unknown  ? ? ? ? 3  'POTASSIUM BINDING SITE.'              
POC Unknown  ? ? ? ? 3  'POTASSIUM BINDING SITE.'              
POD Unknown  ? ? ? ? 3  'POTASSIUM BINDING SITE.'              
LPA Unknown  ? ? ? ? 14 
;PYRIDOXAL 5'-PHOSPHATE BINDING SITE.
;
LPB Unknown  ? ? ? ? 14 
;PYRIDOXAL 5'-PHOSPHATE BINDING SITE.
;
LPC Unknown  ? ? ? ? 14 
;PYRIDOXAL 5'-PHOSPHATE BINDING SITE.
;
LPD Unknown  ? ? ? ? 14 
;PYRIDOXAL 5'-PHOSPHATE BINDING SITE.
;
AC1 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE K A 500'     
AC2 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE K B 500'     
AC3 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE K C 500'     
AC4 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE K D 500'     
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  POA 3  GLU A 70  ? GLU A 70  . ? 1_555 ? 
2  POA 3  GLY B 53  ? GLY B 53  . ? 1_555 ? 
3  POA 3  ASN B 271 ? ASN B 271 . ? 1_555 ? 
4  POB 3  GLU B 70  ? GLU B 70  . ? 1_555 ? 
5  POB 3  GLY A 53  ? GLY A 53  . ? 1_555 ? 
6  POB 3  ASN A 271 ? ASN A 271 . ? 1_555 ? 
7  POC 3  GLU C 70  ? GLU C 70  . ? 1_555 ? 
8  POC 3  GLY D 53  ? GLY D 53  . ? 1_555 ? 
9  POC 3  ASN D 271 ? ASN D 271 . ? 1_555 ? 
10 POD 3  GLU D 70  ? GLU D 70  . ? 1_555 ? 
11 POD 3  GLY C 53  ? GLY C 53  . ? 1_555 ? 
12 POD 3  ASN C 271 ? ASN C 271 . ? 1_555 ? 
13 LPA 14 LLP A 266 ? LLP A 266 . ? 1_555 ? 
14 LPA 14 ARG A 226 ? ARG A 226 . ? 1_555 ? 
15 LPA 14 MET A 222 ? MET A 222 . ? 1_555 ? 
16 LPA 14 ASN A 194 ? ASN A 194 . ? 1_555 ? 
17 LPA 14 PHE A 132 ? PHE A 132 . ? 1_555 ? 
18 LPA 14 ALA A 225 ? ALA A 225 . ? 1_555 ? 
19 LPA 14 GLY A 100 ? GLY A 100 . ? 1_555 ? 
20 LPA 14 ARG A 101 ? ARG A 101 . ? 1_555 ? 
21 LPA 14 GLN A 99  ? GLN A 99  . ? 1_555 ? 
22 LPA 14 SER A 263 ? SER A 263 . ? 1_555 ? 
23 LPA 14 SER A 52  ? SER A 52  . ? 1_555 ? 
24 LPA 14 LYS A 265 ? LYS A 265 . ? 1_555 ? 
25 LPA 14 TYR B 72  ? TYR B 72  . ? 1_555 ? 
26 LPA 14 TYR B 301 ? TYR B 301 . ? 1_555 ? 
27 LPB 14 LLP B 266 ? LLP B 266 . ? 1_555 ? 
28 LPB 14 ARG B 226 ? ARG B 226 . ? 1_555 ? 
29 LPB 14 MET B 222 ? MET B 222 . ? 1_555 ? 
30 LPB 14 ASN B 194 ? ASN B 194 . ? 1_555 ? 
31 LPB 14 PHE B 132 ? PHE B 132 . ? 1_555 ? 
32 LPB 14 ALA B 225 ? ALA B 225 . ? 1_555 ? 
33 LPB 14 GLY B 100 ? GLY B 100 . ? 1_555 ? 
34 LPB 14 ARG B 101 ? ARG B 101 . ? 1_555 ? 
35 LPB 14 GLN B 99  ? GLN B 99  . ? 1_555 ? 
36 LPB 14 SER B 263 ? SER B 263 . ? 1_555 ? 
37 LPB 14 SER B 52  ? SER B 52  . ? 1_555 ? 
38 LPB 14 LYS B 265 ? LYS B 265 . ? 1_555 ? 
39 LPB 14 TYR A 72  ? TYR A 72  . ? 1_555 ? 
40 LPB 14 TYR A 301 ? TYR A 301 . ? 1_555 ? 
41 LPC 14 LLP C 266 ? LLP C 266 . ? 1_555 ? 
42 LPC 14 ARG C 226 ? ARG C 226 . ? 1_555 ? 
43 LPC 14 MET C 222 ? MET C 222 . ? 1_555 ? 
44 LPC 14 ASN C 194 ? ASN C 194 . ? 1_555 ? 
45 LPC 14 PHE C 132 ? PHE C 132 . ? 1_555 ? 
46 LPC 14 ALA C 225 ? ALA C 225 . ? 1_555 ? 
47 LPC 14 GLY C 100 ? GLY C 100 . ? 1_555 ? 
48 LPC 14 ARG C 101 ? ARG C 101 . ? 1_555 ? 
49 LPC 14 GLN C 99  ? GLN C 99  . ? 1_555 ? 
50 LPC 14 SER C 263 ? SER C 263 . ? 1_555 ? 
51 LPC 14 SER C 52  ? SER C 52  . ? 1_555 ? 
52 LPC 14 LYS C 265 ? LYS C 265 . ? 1_555 ? 
53 LPC 14 TYR D 72  ? TYR D 72  . ? 1_555 ? 
54 LPC 14 TYR D 301 ? TYR D 301 . ? 1_555 ? 
55 LPD 14 LLP D 266 ? LLP D 266 . ? 1_555 ? 
56 LPD 14 ARG D 226 ? ARG D 226 . ? 1_555 ? 
57 LPD 14 MET D 222 ? MET D 222 . ? 1_555 ? 
58 LPD 14 ASN D 194 ? ASN D 194 . ? 1_555 ? 
59 LPD 14 PHE D 132 ? PHE D 132 . ? 1_555 ? 
60 LPD 14 ALA D 225 ? ALA D 225 . ? 1_555 ? 
61 LPD 14 GLY D 100 ? GLY D 100 . ? 1_555 ? 
62 LPD 14 ARG D 101 ? ARG D 101 . ? 1_555 ? 
63 LPD 14 GLN D 99  ? GLN D 99  . ? 1_555 ? 
64 LPD 14 SER D 263 ? SER D 263 . ? 1_555 ? 
65 LPD 14 SER D 52  ? SER D 52  . ? 1_555 ? 
66 LPD 14 LYS D 265 ? LYS D 265 . ? 1_555 ? 
67 LPD 14 TYR C 72  ? TYR C 72  . ? 1_555 ? 
68 LPD 14 TYR C 301 ? TYR C 301 . ? 1_555 ? 
69 AC1 5  GLY A 53  ? GLY A 53  . ? 1_555 ? 
70 AC1 5  ASN A 271 ? ASN A 271 . ? 1_555 ? 
71 AC1 5  HOH I .   ? HOH A 544 . ? 1_555 ? 
72 AC1 5  GLU B 70  ? GLU B 70  . ? 1_555 ? 
73 AC1 5  HOH J .   ? HOH B 515 . ? 1_555 ? 
74 AC2 6  GLU A 70  ? GLU A 70  . ? 1_555 ? 
75 AC2 6  HOH I .   ? HOH A 521 . ? 1_555 ? 
76 AC2 6  GLY B 53  ? GLY B 53  . ? 1_555 ? 
77 AC2 6  ASN B 271 ? ASN B 271 . ? 1_555 ? 
78 AC2 6  HOH J .   ? HOH B 503 . ? 1_555 ? 
79 AC2 6  HOH J .   ? HOH B 513 . ? 1_555 ? 
80 AC3 6  GLY C 53  ? GLY C 53  . ? 1_555 ? 
81 AC3 6  ASN C 271 ? ASN C 271 . ? 1_555 ? 
82 AC3 6  HOH K .   ? HOH C 506 . ? 1_555 ? 
83 AC3 6  HOH K .   ? HOH C 529 . ? 1_555 ? 
84 AC3 6  GLU D 70  ? GLU D 70  . ? 1_555 ? 
85 AC3 6  HOH L .   ? HOH D 509 . ? 1_555 ? 
86 AC4 6  GLU C 70  ? GLU C 70  . ? 1_555 ? 
87 AC4 6  HOH K .   ? HOH C 511 . ? 1_555 ? 
88 AC4 6  HOH K .   ? HOH C 512 . ? 1_555 ? 
89 AC4 6  GLY D 53  ? GLY D 53  . ? 1_555 ? 
90 AC4 6  ASN D 271 ? ASN D 271 . ? 1_555 ? 
91 AC4 6  HOH L .   ? HOH D 517 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1AX4 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1AX4 
_atom_sites.fract_transf_matrix[1][1]   0.008696 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008458 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006507 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
K 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N     . ALA A 1 2   ? 33.275  60.126 37.933  1.00 25.09  ? 2   ALA A N     1 
ATOM   2     C CA    . ALA A 1 2   ? 32.231  60.094 39.019  1.00 21.25  ? 2   ALA A CA    1 
ATOM   3     C C     . ALA A 1 2   ? 30.935  59.612 38.353  1.00 25.55  ? 2   ALA A C     1 
ATOM   4     O O     . ALA A 1 2   ? 30.558  60.195 37.346  1.00 25.85  ? 2   ALA A O     1 
ATOM   5     C CB    . ALA A 1 2   ? 32.031  61.423 39.661  1.00 14.52  ? 2   ALA A CB    1 
ATOM   6     N N     . LYS A 1 3   ? 30.305  58.615 38.928  1.00 23.24  ? 3   LYS A N     1 
ATOM   7     C CA    . LYS A 1 3   ? 29.071  58.070 38.415  1.00 24.14  ? 3   LYS A CA    1 
ATOM   8     C C     . LYS A 1 3   ? 27.897  58.177 39.390  1.00 24.79  ? 3   LYS A C     1 
ATOM   9     O O     . LYS A 1 3   ? 27.969  57.702 40.526  1.00 20.10  ? 3   LYS A O     1 
ATOM   10    C CB    . LYS A 1 3   ? 29.352  56.599 38.128  1.00 24.66  ? 3   LYS A CB    1 
ATOM   11    C CG    . LYS A 1 3   ? 28.201  55.789 37.596  1.00 47.16  ? 3   LYS A CG    1 
ATOM   12    C CD    . LYS A 1 3   ? 28.550  54.311 37.485  1.00 58.61  ? 3   LYS A CD    1 
ATOM   13    C CE    . LYS A 1 3   ? 28.896  53.697 38.835  1.00 66.76  ? 3   LYS A CE    1 
ATOM   14    N NZ    . LYS A 1 3   ? 28.533  52.256 38.909  1.00 75.39  ? 3   LYS A NZ    1 
ATOM   15    N N     . ARG A 1 4   ? 26.798  58.756 38.928  1.00 21.11  ? 4   ARG A N     1 
ATOM   16    C CA    . ARG A 1 4   ? 25.576  58.931 39.702  1.00 19.93  ? 4   ARG A CA    1 
ATOM   17    C C     . ARG A 1 4   ? 24.727  57.674 39.588  1.00 20.74  ? 4   ARG A C     1 
ATOM   18    O O     . ARG A 1 4   ? 24.639  57.002 38.548  1.00 17.64  ? 4   ARG A O     1 
ATOM   19    C CB    . ARG A 1 4   ? 24.757  60.118 39.229  1.00 18.45  ? 4   ARG A CB    1 
ATOM   20    C CG    . ARG A 1 4   ? 25.425  61.424 39.513  1.00 19.47  ? 4   ARG A CG    1 
ATOM   21    C CD    . ARG A 1 4   ? 24.874  62.612 38.750  1.00 27.55  ? 4   ARG A CD    1 
ATOM   22    N NE    . ARG A 1 4   ? 23.667  63.131 39.302  1.00 36.15  ? 4   ARG A NE    1 
ATOM   23    C CZ    . ARG A 1 4   ? 23.352  64.252 39.920  1.00 38.74  ? 4   ARG A CZ    1 
ATOM   24    N NH1   . ARG A 1 4   ? 24.187  65.228 40.212  1.00 25.61  ? 4   ARG A NH1   1 
ATOM   25    N NH2   . ARG A 1 4   ? 22.076  64.419 40.288  1.00 40.28  ? 4   ARG A NH2   1 
ATOM   26    N N     . ILE A 1 5   ? 24.269  57.188 40.734  1.00 14.94  ? 5   ILE A N     1 
ATOM   27    C CA    . ILE A 1 5   ? 23.455  55.966 40.728  1.00 14.40  ? 5   ILE A CA    1 
ATOM   28    C C     . ILE A 1 5   ? 22.022  56.399 41.039  1.00 18.71  ? 5   ILE A C     1 
ATOM   29    O O     . ILE A 1 5   ? 21.808  57.247 41.906  1.00 19.08  ? 5   ILE A O     1 
ATOM   30    C CB    . ILE A 1 5   ? 24.022  54.931 41.696  1.00 21.54  ? 5   ILE A CB    1 
ATOM   31    C CG1   . ILE A 1 5   ? 25.407  54.491 41.155  1.00 27.17  ? 5   ILE A CG1   1 
ATOM   32    C CG2   . ILE A 1 5   ? 23.040  53.756 41.798  1.00 11.63  ? 5   ILE A CG2   1 
ATOM   33    C CD1   . ILE A 1 5   ? 26.123  53.457 41.964  1.00 34.20  ? 5   ILE A CD1   1 
ATOM   34    N N     . VAL A 1 6   ? 21.042  55.909 40.311  1.00 15.25  ? 6   VAL A N     1 
ATOM   35    C CA    . VAL A 1 6   ? 19.663  56.345 40.499  1.00 14.90  ? 6   VAL A CA    1 
ATOM   36    C C     . VAL A 1 6   ? 18.997  55.620 41.693  1.00 10.47  ? 6   VAL A C     1 
ATOM   37    O O     . VAL A 1 6   ? 19.255  54.462 41.971  1.00 9.05   ? 6   VAL A O     1 
ATOM   38    C CB    . VAL A 1 6   ? 18.824  56.078 39.228  1.00 17.04  ? 6   VAL A CB    1 
ATOM   39    C CG1   . VAL A 1 6   ? 18.699  54.584 38.998  1.00 17.96  ? 6   VAL A CG1   1 
ATOM   40    C CG2   . VAL A 1 6   ? 17.415  56.667 39.313  1.00 16.06  ? 6   VAL A CG2   1 
ATOM   41    N N     . GLU A 1 7   ? 18.124  56.317 42.366  1.00 12.48  ? 7   GLU A N     1 
ATOM   42    C CA    . GLU A 1 7   ? 17.456  55.789 43.550  1.00 11.45  ? 7   GLU A CA    1 
ATOM   43    C C     . GLU A 1 7   ? 16.573  54.610 43.169  1.00 11.22  ? 7   GLU A C     1 
ATOM   44    O O     . GLU A 1 7   ? 15.758  54.742 42.265  1.00 11.83  ? 7   GLU A O     1 
ATOM   45    C CB    . GLU A 1 7   ? 16.539  56.849 44.159  1.00 12.35  ? 7   GLU A CB    1 
ATOM   46    C CG    . GLU A 1 7   ? 17.205  58.019 44.831  1.00 9.14   ? 7   GLU A CG    1 
ATOM   47    C CD    . GLU A 1 7   ? 17.770  59.078 43.898  1.00 17.87  ? 7   GLU A CD    1 
ATOM   48    O OE1   . GLU A 1 7   ? 17.527  59.016 42.685  1.00 13.29  ? 7   GLU A OE1   1 
ATOM   49    O OE2   . GLU A 1 7   ? 18.451  60.006 44.430  1.00 13.36  ? 7   GLU A OE2   1 
ATOM   50    N N     . PRO A 1 8   ? 16.612  53.515 43.916  1.00 12.58  ? 8   PRO A N     1 
ATOM   51    C CA    . PRO A 1 8   ? 15.710  52.399 43.778  1.00 9.92   ? 8   PRO A CA    1 
ATOM   52    C C     . PRO A 1 8   ? 14.410  52.656 44.587  1.00 11.27  ? 8   PRO A C     1 
ATOM   53    O O     . PRO A 1 8   ? 13.799  51.760 45.155  1.00 8.17   ? 8   PRO A O     1 
ATOM   54    C CB    . PRO A 1 8   ? 16.470  51.216 44.387  1.00 11.02  ? 8   PRO A CB    1 
ATOM   55    C CG    . PRO A 1 8   ? 17.347  51.864 45.431  1.00 9.53   ? 8   PRO A CG    1 
ATOM   56    C CD    . PRO A 1 8   ? 17.579  53.317 45.029  1.00 11.55  ? 8   PRO A CD    1 
ATOM   57    N N     . PHE A 1 9   ? 13.929  53.862 44.685  1.00 7.50   ? 9   PHE A N     1 
ATOM   58    C CA    . PHE A 1 9   ? 12.728  54.225 45.390  1.00 13.25  ? 9   PHE A CA    1 
ATOM   59    C C     . PHE A 1 9   ? 12.287  55.570 44.798  1.00 12.77  ? 9   PHE A C     1 
ATOM   60    O O     . PHE A 1 9   ? 13.067  56.179 44.077  1.00 12.71  ? 9   PHE A O     1 
ATOM   61    C CB    . PHE A 1 9   ? 12.921  54.447 46.920  1.00 6.53   ? 9   PHE A CB    1 
ATOM   62    C CG    . PHE A 1 9   ? 14.076  55.346 47.315  1.00 9.60   ? 9   PHE A CG    1 
ATOM   63    C CD1   . PHE A 1 9   ? 13.963  56.703 47.316  1.00 9.15   ? 9   PHE A CD1   1 
ATOM   64    C CD2   . PHE A 1 9   ? 15.287  54.807 47.702  1.00 11.37  ? 9   PHE A CD2   1 
ATOM   65    C CE1   . PHE A 1 9   ? 15.011  57.547 47.676  1.00 14.70  ? 9   PHE A CE1   1 
ATOM   66    C CE2   . PHE A 1 9   ? 16.351  55.613 48.102  1.00 11.29  ? 9   PHE A CE2   1 
ATOM   67    C CZ    . PHE A 1 9   ? 16.224  56.984 48.081  1.00 10.03  ? 9   PHE A CZ    1 
ATOM   68    N N     . ARG A 1 10  ? 11.097  56.027 45.178  1.00 9.27   ? 10  ARG A N     1 
ATOM   69    C CA    . ARG A 1 10  ? 10.748  57.391 44.825  1.00 8.17   ? 10  ARG A CA    1 
ATOM   70    C C     . ARG A 1 10  ? 10.315  58.064 46.134  1.00 9.57   ? 10  ARG A C     1 
ATOM   71    O O     . ARG A 1 10  ? 10.192  57.409 47.164  1.00 9.86   ? 10  ARG A O     1 
ATOM   72    C CB    . ARG A 1 10  ? 9.721   57.454 43.708  1.00 15.09  ? 10  ARG A CB    1 
ATOM   73    C CG    . ARG A 1 10  ? 8.438   56.730 44.021  1.00 15.96  ? 10  ARG A CG    1 
ATOM   74    C CD    . ARG A 1 10  ? 7.407   56.877 42.899  1.00 19.85  ? 10  ARG A CD    1 
ATOM   75    N NE    . ARG A 1 10  ? 6.237   56.075 43.196  1.00 15.27  ? 10  ARG A NE    1 
ATOM   76    C CZ    . ARG A 1 10  ? 5.567   55.262 42.405  1.00 24.47  ? 10  ARG A CZ    1 
ATOM   77    N NH1   . ARG A 1 10  ? 5.898   55.098 41.127  1.00 24.91  ? 10  ARG A NH1   1 
ATOM   78    N NH2   . ARG A 1 10  ? 4.560   54.594 42.941  1.00 21.12  ? 10  ARG A NH2   1 
ATOM   79    N N     . ILE A 1 11  ? 10.108  59.349 46.064  1.00 7.98   ? 11  ILE A N     1 
ATOM   80    C CA    . ILE A 1 11  ? 9.819   60.183 47.208  1.00 10.96  ? 11  ILE A CA    1 
ATOM   81    C C     . ILE A 1 11  ? 8.321   60.196 47.505  1.00 15.68  ? 11  ILE A C     1 
ATOM   82    O O     . ILE A 1 11  ? 7.499   60.312 46.574  1.00 11.82  ? 11  ILE A O     1 
ATOM   83    C CB    . ILE A 1 11  ? 10.315  61.599 46.920  1.00 7.49   ? 11  ILE A CB    1 
ATOM   84    C CG1   . ILE A 1 11  ? 11.812  61.553 46.532  1.00 11.78  ? 11  ILE A CG1   1 
ATOM   85    C CG2   . ILE A 1 11  ? 10.030  62.530 48.093  1.00 7.04   ? 11  ILE A CG2   1 
ATOM   86    C CD1   . ILE A 1 11  ? 12.291  62.931 46.135  1.00 9.86   ? 11  ILE A CD1   1 
ATOM   87    N N     . LYS A 1 12  ? 8.009   59.962 48.794  1.00 10.74  ? 12  LYS A N     1 
ATOM   88    C CA    . LYS A 1 12  ? 6.603   59.932 49.184  1.00 10.81  ? 12  LYS A CA    1 
ATOM   89    C C     . LYS A 1 12  ? 6.304   61.047 50.164  1.00 9.83   ? 12  LYS A C     1 
ATOM   90    O O     . LYS A 1 12  ? 5.209   61.556 50.263  1.00 12.61  ? 12  LYS A O     1 
ATOM   91    C CB    . LYS A 1 12  ? 6.248   58.555 49.757  1.00 13.99  ? 12  LYS A CB    1 
ATOM   92    C CG    . LYS A 1 12  ? 4.735   58.431 49.987  1.00 20.00  ? 12  LYS A CG    1 
ATOM   93    C CD    . LYS A 1 12  ? 4.338   56.978 49.957  1.00 16.95  ? 12  LYS A CD    1 
ATOM   94    C CE    . LYS A 1 12  ? 2.876   56.621 50.088  1.00 15.48  ? 12  LYS A CE    1 
ATOM   95    N NZ    . LYS A 1 12  ? 2.775   55.114 49.904  1.00 15.37  ? 12  LYS A NZ    1 
ATOM   96    N N     . MET A 1 13  ? 7.323   61.562 50.841  1.00 5.80   ? 13  MET A N     1 
ATOM   97    C CA    . MET A 1 13  ? 7.111   62.688 51.738  1.00 8.31   ? 13  MET A CA    1 
ATOM   98    C C     . MET A 1 13  ? 8.361   63.532 51.779  1.00 6.92   ? 13  MET A C     1 
ATOM   99    O O     . MET A 1 13  ? 9.455   62.972 51.906  1.00 6.72   ? 13  MET A O     1 
ATOM   100   C CB    . MET A 1 13  ? 6.692   62.217 53.173  1.00 7.58   ? 13  MET A CB    1 
ATOM   101   C CG    . MET A 1 13  ? 6.162   63.388 54.009  1.00 10.77  ? 13  MET A CG    1 
ATOM   102   S SD    . MET A 1 13  ? 6.046   62.946 55.813  1.00 20.04  ? 13  MET A SD    1 
ATOM   103   C CE    . MET A 1 13  ? 4.740   61.758 55.728  1.00 18.46  ? 13  MET A CE    1 
ATOM   104   N N     . VAL A 1 14  ? 8.168   64.843 51.699  1.00 8.23   ? 14  VAL A N     1 
ATOM   105   C CA    . VAL A 1 14  ? 9.314   65.708 51.767  1.00 10.16  ? 14  VAL A CA    1 
ATOM   106   C C     . VAL A 1 14  ? 9.306   66.531 53.054  1.00 11.59  ? 14  VAL A C     1 
ATOM   107   O O     . VAL A 1 14  ? 8.328   66.714 53.754  1.00 10.04  ? 14  VAL A O     1 
ATOM   108   C CB    . VAL A 1 14  ? 9.405   66.662 50.544  1.00 9.60   ? 14  VAL A CB    1 
ATOM   109   C CG1   . VAL A 1 14  ? 9.398   65.843 49.244  1.00 10.61  ? 14  VAL A CG1   1 
ATOM   110   C CG2   . VAL A 1 14  ? 8.292   67.707 50.518  1.00 9.40   ? 14  VAL A CG2   1 
ATOM   111   N N     . GLU A 1 15  ? 10.459  67.055 53.370  1.00 5.97   ? 15  GLU A N     1 
ATOM   112   C CA    . GLU A 1 15  ? 10.681  67.997 54.455  1.00 11.11  ? 15  GLU A CA    1 
ATOM   113   C C     . GLU A 1 15  ? 11.383  69.219 53.914  1.00 9.09   ? 15  GLU A C     1 
ATOM   114   O O     . GLU A 1 15  ? 12.467  69.077 53.336  1.00 13.17  ? 15  GLU A O     1 
ATOM   115   C CB    . GLU A 1 15  ? 11.577  67.232 55.494  1.00 9.04   ? 15  GLU A CB    1 
ATOM   116   C CG    . GLU A 1 15  ? 11.968  68.179 56.627  1.00 15.28  ? 15  GLU A CG    1 
ATOM   117   C CD    . GLU A 1 15  ? 12.919  67.441 57.569  1.00 24.18  ? 15  GLU A CD    1 
ATOM   118   O OE1   . GLU A 1 15  ? 13.529  66.408 57.256  1.00 23.09  ? 15  GLU A OE1   1 
ATOM   119   O OE2   . GLU A 1 15  ? 13.079  67.964 58.670  1.00 27.88  ? 15  GLU A OE2   1 
ATOM   120   N N     . LYS A 1 16  ? 10.851  70.402 54.013  1.00 13.85  ? 16  LYS A N     1 
ATOM   121   C CA    . LYS A 1 16  ? 11.480  71.589 53.459  1.00 18.42  ? 16  LYS A CA    1 
ATOM   122   C C     . LYS A 1 16  ? 12.793  71.964 54.137  1.00 23.17  ? 16  LYS A C     1 
ATOM   123   O O     . LYS A 1 16  ? 12.877  71.944 55.356  1.00 18.72  ? 16  LYS A O     1 
ATOM   124   C CB    . LYS A 1 16  ? 10.503  72.753 53.580  1.00 23.26  ? 16  LYS A CB    1 
ATOM   125   C CG    . LYS A 1 16  ? 11.149  74.103 53.254  1.00 41.39  ? 16  LYS A CG    1 
ATOM   126   C CD    . LYS A 1 16  ? 10.293  75.229 53.825  1.00 48.84  ? 16  LYS A CD    1 
ATOM   127   C CE    . LYS A 1 16  ? 9.858   76.207 52.759  1.00 53.28  ? 16  LYS A CE    1 
ATOM   128   N NZ    . LYS A 1 16  ? 8.789   77.128 53.244  1.00 57.70  ? 16  LYS A NZ    1 
ATOM   129   N N     . ILE A 1 17  ? 13.811  72.368 53.363  1.00 18.23  ? 17  ILE A N     1 
ATOM   130   C CA    . ILE A 1 17  ? 15.058  72.809 53.973  1.00 21.54  ? 17  ILE A CA    1 
ATOM   131   C C     . ILE A 1 17  ? 15.371  74.156 53.307  1.00 23.88  ? 17  ILE A C     1 
ATOM   132   O O     . ILE A 1 17  ? 14.861  74.366 52.196  1.00 23.02  ? 17  ILE A O     1 
ATOM   133   C CB    . ILE A 1 17  ? 16.251  71.875 53.819  1.00 21.59  ? 17  ILE A CB    1 
ATOM   134   C CG1   . ILE A 1 17  ? 16.408  71.398 52.384  1.00 27.62  ? 17  ILE A CG1   1 
ATOM   135   C CG2   . ILE A 1 17  ? 16.127  70.717 54.801  1.00 27.74  ? 17  ILE A CG2   1 
ATOM   136   C CD1   . ILE A 1 17  ? 17.467  70.336 52.178  1.00 34.09  ? 17  ILE A CD1   1 
ATOM   137   N N     . ARG A 1 18  ? 16.109  75.025 53.974  1.00 24.97  ? 18  ARG A N     1 
ATOM   138   C CA    . ARG A 1 18  ? 16.337  76.316 53.307  1.00 28.73  ? 18  ARG A CA    1 
ATOM   139   C C     . ARG A 1 18  ? 17.804  76.674 53.498  1.00 29.99  ? 18  ARG A C     1 
ATOM   140   O O     . ARG A 1 18  ? 18.439  76.076 54.378  1.00 24.98  ? 18  ARG A O     1 
ATOM   141   C CB    . ARG A 1 18  ? 15.439  77.411 53.826  1.00 31.43  ? 18  ARG A CB    1 
ATOM   142   C CG    . ARG A 1 18  ? 15.574  77.651 55.322  1.00 48.08  ? 18  ARG A CG    1 
ATOM   143   C CD    . ARG A 1 18  ? 15.019  79.040 55.687  1.00 56.66  ? 18  ARG A CD    1 
ATOM   144   N NE    . ARG A 1 18  ? 15.777  79.533 56.833  1.00 67.15  ? 18  ARG A NE    1 
ATOM   145   C CZ    . ARG A 1 18  ? 16.463  80.665 56.885  1.00 66.58  ? 18  ARG A CZ    1 
ATOM   146   N NH1   . ARG A 1 18  ? 16.469  81.469 55.829  1.00 67.05  ? 18  ARG A NH1   1 
ATOM   147   N NH2   . ARG A 1 18  ? 17.123  80.966 57.999  1.00 68.45  ? 18  ARG A NH2   1 
ATOM   148   N N     . VAL A 1 19  ? 18.295  77.499 52.580  1.00 27.80  ? 19  VAL A N     1 
ATOM   149   C CA    . VAL A 1 19  ? 19.700  77.903 52.675  1.00 28.46  ? 19  VAL A CA    1 
ATOM   150   C C     . VAL A 1 19  ? 19.625  79.255 53.357  1.00 27.37  ? 19  VAL A C     1 
ATOM   151   O O     . VAL A 1 19  ? 19.043  80.169 52.772  1.00 31.19  ? 19  VAL A O     1 
ATOM   152   C CB    . VAL A 1 19  ? 20.348  78.130 51.303  1.00 34.19  ? 19  VAL A CB    1 
ATOM   153   C CG1   . VAL A 1 19  ? 21.788  78.610 51.553  1.00 35.06  ? 19  VAL A CG1   1 
ATOM   154   C CG2   . VAL A 1 19  ? 20.298  76.882 50.436  1.00 32.29  ? 19  VAL A CG2   1 
ATOM   155   N N     . PRO A 1 20  ? 20.072  79.375 54.578  1.00 26.79  ? 20  PRO A N     1 
ATOM   156   C CA    . PRO A 1 20  ? 19.953  80.681 55.197  1.00 30.13  ? 20  PRO A CA    1 
ATOM   157   C C     . PRO A 1 20  ? 20.711  81.633 54.274  1.00 34.71  ? 20  PRO A C     1 
ATOM   158   O O     . PRO A 1 20  ? 21.571  81.208 53.479  1.00 33.60  ? 20  PRO A O     1 
ATOM   159   C CB    . PRO A 1 20  ? 20.552  80.484 56.573  1.00 27.97  ? 20  PRO A CB    1 
ATOM   160   C CG    . PRO A 1 20  ? 21.113  79.112 56.649  1.00 28.53  ? 20  PRO A CG    1 
ATOM   161   C CD    . PRO A 1 20  ? 20.762  78.373 55.387  1.00 26.57  ? 20  PRO A CD    1 
ATOM   162   N N     . SER A 1 21  ? 20.469  82.927 54.370  1.00 34.91  ? 21  SER A N     1 
ATOM   163   C CA    . SER A 1 21  ? 21.211  83.929 53.615  1.00 36.28  ? 21  SER A CA    1 
ATOM   164   C C     . SER A 1 21  ? 22.656  84.006 54.093  1.00 36.10  ? 21  SER A C     1 
ATOM   165   O O     . SER A 1 21  ? 22.903  83.710 55.275  1.00 33.84  ? 21  SER A O     1 
ATOM   166   C CB    . SER A 1 21  ? 20.565  85.302 53.920  1.00 30.05  ? 21  SER A CB    1 
ATOM   167   O OG    . SER A 1 21  ? 21.273  85.846 55.066  1.00 38.76  ? 21  SER A OG    1 
ATOM   168   N N     . ARG A 1 22  ? 23.582  84.578 53.299  1.00 37.97  ? 22  ARG A N     1 
ATOM   169   C CA    . ARG A 1 22  ? 24.926  84.724 53.842  1.00 38.06  ? 22  ARG A CA    1 
ATOM   170   C C     . ARG A 1 22  ? 24.869  85.444 55.195  1.00 35.74  ? 22  ARG A C     1 
ATOM   171   O O     . ARG A 1 22  ? 25.464  85.052 56.215  1.00 32.65  ? 22  ARG A O     1 
ATOM   172   C CB    . ARG A 1 22  ? 25.926  85.501 52.960  1.00 46.34  ? 22  ARG A CB    1 
ATOM   173   C CG    . ARG A 1 22  ? 27.274  85.435 53.696  1.00 44.76  ? 22  ARG A CG    1 
ATOM   174   C CD    . ARG A 1 22  ? 28.478  85.938 52.927  1.00 53.95  ? 22  ARG A CD    1 
ATOM   175   N NE    . ARG A 1 22  ? 29.664  85.212 53.406  1.00 62.08  ? 22  ARG A NE    1 
ATOM   176   C CZ    . ARG A 1 22  ? 30.170  84.152 52.785  1.00 62.38  ? 22  ARG A CZ    1 
ATOM   177   N NH1   . ARG A 1 22  ? 29.623  83.700 51.660  1.00 63.52  ? 22  ARG A NH1   1 
ATOM   178   N NH2   . ARG A 1 22  ? 31.234  83.551 53.292  1.00 65.74  ? 22  ARG A NH2   1 
ATOM   179   N N     . GLU A 1 23  ? 24.170  86.584 55.168  1.00 36.11  ? 23  GLU A N     1 
ATOM   180   C CA    . GLU A 1 23  ? 23.988  87.403 56.362  1.00 43.45  ? 23  GLU A CA    1 
ATOM   181   C C     . GLU A 1 23  ? 23.639  86.523 57.561  1.00 42.97  ? 23  GLU A C     1 
ATOM   182   O O     . GLU A 1 23  ? 24.346  86.387 58.559  1.00 42.03  ? 23  GLU A O     1 
ATOM   183   C CB    . GLU A 1 23  ? 22.829  88.385 56.124  1.00 56.31  ? 23  GLU A CB    1 
ATOM   184   C CG    . GLU A 1 23  ? 22.709  88.862 54.689  1.00 71.23  ? 23  GLU A CG    1 
ATOM   185   C CD    . GLU A 1 23  ? 21.710  89.986 54.506  1.00 81.16  ? 23  GLU A CD    1 
ATOM   186   O OE1   . GLU A 1 23  ? 20.857  90.215 55.390  1.00 85.62  ? 23  GLU A OE1   1 
ATOM   187   O OE2   . GLU A 1 23  ? 21.781  90.656 53.449  1.00 85.63  ? 23  GLU A OE2   1 
ATOM   188   N N     . GLU A 1 24  ? 22.506  85.828 57.367  1.00 41.02  ? 24  GLU A N     1 
ATOM   189   C CA    . GLU A 1 24  ? 21.992  84.912 58.382  1.00 38.91  ? 24  GLU A CA    1 
ATOM   190   C C     . GLU A 1 24  ? 23.062  83.903 58.751  1.00 34.25  ? 24  GLU A C     1 
ATOM   191   O O     . GLU A 1 24  ? 23.345  83.647 59.913  1.00 33.63  ? 24  GLU A O     1 
ATOM   192   C CB    . GLU A 1 24  ? 20.786  84.176 57.802  1.00 44.61  ? 24  GLU A CB    1 
ATOM   193   C CG    . GLU A 1 24  ? 19.644  85.097 57.376  1.00 54.13  ? 24  GLU A CG    1 
ATOM   194   C CD    . GLU A 1 24  ? 18.447  84.218 57.034  1.00 59.34  ? 24  GLU A CD    1 
ATOM   195   O OE1   . GLU A 1 24  ? 17.918  83.651 58.016  1.00 67.67  ? 24  GLU A OE1   1 
ATOM   196   O OE2   . GLU A 1 24  ? 18.098  84.105 55.841  1.00 56.30  ? 24  GLU A OE2   1 
ATOM   197   N N     . ARG A 1 25  ? 23.646  83.319 57.676  1.00 31.69  ? 25  ARG A N     1 
ATOM   198   C CA    . ARG A 1 25  ? 24.700  82.325 57.915  1.00 34.01  ? 25  ARG A CA    1 
ATOM   199   C C     . ARG A 1 25  ? 25.749  82.895 58.861  1.00 36.16  ? 25  ARG A C     1 
ATOM   200   O O     . ARG A 1 25  ? 26.078  82.338 59.923  1.00 33.24  ? 25  ARG A O     1 
ATOM   201   C CB    . ARG A 1 25  ? 25.151  81.950 56.512  1.00 30.71  ? 25  ARG A CB    1 
ATOM   202   C CG    . ARG A 1 25  ? 24.304  80.860 55.840  1.00 34.17  ? 25  ARG A CG    1 
ATOM   203   C CD    . ARG A 1 25  ? 25.230  79.989 54.986  1.00 38.87  ? 25  ARG A CD    1 
ATOM   204   N NE    . ARG A 1 25  ? 25.772  80.712 53.848  1.00 35.36  ? 25  ARG A NE    1 
ATOM   205   C CZ    . ARG A 1 25  ? 25.177  81.055 52.714  1.00 43.58  ? 25  ARG A CZ    1 
ATOM   206   N NH1   . ARG A 1 25  ? 23.909  80.793 52.397  1.00 38.49  ? 25  ARG A NH1   1 
ATOM   207   N NH2   . ARG A 1 25  ? 25.889  81.711 51.790  1.00 41.17  ? 25  ARG A NH2   1 
ATOM   208   N N     . GLU A 1 26  ? 26.304  84.065 58.503  1.00 35.94  ? 26  GLU A N     1 
ATOM   209   C CA    . GLU A 1 26  ? 27.282  84.752 59.340  1.00 39.06  ? 26  GLU A CA    1 
ATOM   210   C C     . GLU A 1 26  ? 26.764  85.019 60.747  1.00 35.59  ? 26  GLU A C     1 
ATOM   211   O O     . GLU A 1 26  ? 27.392  84.636 61.754  1.00 34.29  ? 26  GLU A O     1 
ATOM   212   C CB    . GLU A 1 26  ? 27.686  86.070 58.663  1.00 51.21  ? 26  GLU A CB    1 
ATOM   213   C CG    . GLU A 1 26  ? 29.015  86.074 57.927  1.00 62.44  ? 26  GLU A CG    1 
ATOM   214   C CD    . GLU A 1 26  ? 29.007  86.871 56.633  1.00 68.53  ? 26  GLU A CD    1 
ATOM   215   O OE1   . GLU A 1 26  ? 28.349  87.937 56.554  1.00 72.44  ? 26  GLU A OE1   1 
ATOM   216   O OE2   . GLU A 1 26  ? 29.679  86.449 55.658  1.00 71.92  ? 26  GLU A OE2   1 
ATOM   217   N N     . ALA A 1 27  ? 25.585  85.620 60.861  1.00 31.89  ? 27  ALA A N     1 
ATOM   218   C CA    . ALA A 1 27  ? 25.032  85.912 62.185  1.00 35.97  ? 27  ALA A CA    1 
ATOM   219   C C     . ALA A 1 27  ? 24.962  84.668 63.063  1.00 37.58  ? 27  ALA A C     1 
ATOM   220   O O     . ALA A 1 27  ? 25.496  84.586 64.192  1.00 38.65  ? 27  ALA A O     1 
ATOM   221   C CB    . ALA A 1 27  ? 23.662  86.567 62.070  1.00 36.12  ? 27  ALA A CB    1 
ATOM   222   N N     . ALA A 1 28  ? 24.351  83.622 62.468  1.00 36.83  ? 28  ALA A N     1 
ATOM   223   C CA    . ALA A 1 28  ? 24.147  82.367 63.181  1.00 35.36  ? 28  ALA A CA    1 
ATOM   224   C C     . ALA A 1 28  ? 25.427  81.736 63.681  1.00 32.78  ? 28  ALA A C     1 
ATOM   225   O O     . ALA A 1 28  ? 25.549  81.218 64.786  1.00 28.99  ? 28  ALA A O     1 
ATOM   226   C CB    . ALA A 1 28  ? 23.367  81.427 62.260  1.00 34.49  ? 28  ALA A CB    1 
ATOM   227   N N     . LEU A 1 29  ? 26.442  81.726 62.812  1.00 33.76  ? 29  LEU A N     1 
ATOM   228   C CA    . LEU A 1 29  ? 27.717  81.079 63.155  1.00 35.72  ? 29  LEU A CA    1 
ATOM   229   C C     . LEU A 1 29  ? 28.402  81.859 64.278  1.00 36.62  ? 29  LEU A C     1 
ATOM   230   O O     . LEU A 1 29  ? 28.950  81.306 65.253  1.00 32.41  ? 29  LEU A O     1 
ATOM   231   C CB    . LEU A 1 29  ? 28.472  80.969 61.824  1.00 30.07  ? 29  LEU A CB    1 
ATOM   232   C CG    . LEU A 1 29  ? 29.926  80.498 61.926  1.00 36.13  ? 29  LEU A CG    1 
ATOM   233   C CD1   . LEU A 1 29  ? 30.027  79.108 62.538  1.00 30.01  ? 29  LEU A CD1   1 
ATOM   234   C CD2   . LEU A 1 29  ? 30.604  80.550 60.559  1.00 39.31  ? 29  LEU A CD2   1 
ATOM   235   N N     . LYS A 1 30  ? 28.341  83.194 64.125  1.00 38.79  ? 30  LYS A N     1 
ATOM   236   C CA    . LYS A 1 30  ? 28.837  84.086 65.178  1.00 47.00  ? 30  LYS A CA    1 
ATOM   237   C C     . LYS A 1 30  ? 28.189  83.722 66.513  1.00 46.61  ? 30  LYS A C     1 
ATOM   238   O O     . LYS A 1 30  ? 28.804  83.179 67.444  1.00 46.35  ? 30  LYS A O     1 
ATOM   239   C CB    . LYS A 1 30  ? 28.499  85.528 64.797  1.00 59.08  ? 30  LYS A CB    1 
ATOM   240   C CG    . LYS A 1 30  ? 29.082  86.612 65.687  1.00 71.16  ? 30  LYS A CG    1 
ATOM   241   C CD    . LYS A 1 30  ? 28.006  87.603 66.105  1.00 83.72  ? 30  LYS A CD    1 
ATOM   242   C CE    . LYS A 1 30  ? 28.557  89.009 66.266  1.00 90.17  ? 30  LYS A CE    1 
ATOM   243   N NZ    . LYS A 1 30  ? 27.487  89.988 66.625  1.00 94.43  ? 30  LYS A NZ    1 
ATOM   244   N N     . GLU A 1 31  ? 26.861  83.836 66.551  1.00 44.84  ? 31  GLU A N     1 
ATOM   245   C CA    . GLU A 1 31  ? 26.015  83.558 67.699  1.00 45.28  ? 31  GLU A CA    1 
ATOM   246   C C     . GLU A 1 31  ? 26.247  82.217 68.366  1.00 40.48  ? 31  GLU A C     1 
ATOM   247   O O     . GLU A 1 31  ? 26.182  82.003 69.580  1.00 37.39  ? 31  GLU A O     1 
ATOM   248   C CB    . GLU A 1 31  ? 24.538  83.602 67.264  1.00 58.90  ? 31  GLU A CB    1 
ATOM   249   C CG    . GLU A 1 31  ? 23.861  84.954 67.410  1.00 78.19  ? 31  GLU A CG    1 
ATOM   250   C CD    . GLU A 1 31  ? 22.348  84.790 67.364  1.00 89.56  ? 31  GLU A CD    1 
ATOM   251   O OE1   . GLU A 1 31  ? 21.776  84.810 66.253  1.00 94.68  ? 31  GLU A OE1   1 
ATOM   252   O OE2   . GLU A 1 31  ? 21.755  84.625 68.452  1.00 95.09  ? 31  GLU A OE2   1 
ATOM   253   N N     . ALA A 1 32  ? 26.575  81.235 67.532  1.00 36.07  ? 32  ALA A N     1 
ATOM   254   C CA    . ALA A 1 32  ? 26.899  79.882 67.925  1.00 34.91  ? 32  ALA A CA    1 
ATOM   255   C C     . ALA A 1 32  ? 28.294  79.758 68.518  1.00 37.63  ? 32  ALA A C     1 
ATOM   256   O O     . ALA A 1 32  ? 28.642  78.650 68.952  1.00 36.38  ? 32  ALA A O     1 
ATOM   257   C CB    . ALA A 1 32  ? 26.814  79.047 66.645  1.00 31.23  ? 32  ALA A CB    1 
ATOM   258   N N     . GLY A 1 33  ? 29.088  80.839 68.491  1.00 39.27  ? 33  GLY A N     1 
ATOM   259   C CA    . GLY A 1 33  ? 30.459  80.787 68.999  1.00 37.85  ? 33  GLY A CA    1 
ATOM   260   C C     . GLY A 1 33  ? 31.393  80.128 67.993  1.00 38.18  ? 33  GLY A C     1 
ATOM   261   O O     . GLY A 1 33  ? 32.237  79.283 68.353  1.00 36.84  ? 33  GLY A O     1 
ATOM   262   N N     . TYR A 1 34  ? 31.179  80.336 66.682  1.00 38.34  ? 34  TYR A N     1 
ATOM   263   C CA    . TYR A 1 34  ? 32.023  79.697 65.673  1.00 39.68  ? 34  TYR A CA    1 
ATOM   264   C C     . TYR A 1 34  ? 32.121  78.183 65.763  1.00 39.72  ? 34  TYR A C     1 
ATOM   265   O O     . TYR A 1 34  ? 33.111  77.592 65.273  1.00 38.02  ? 34  TYR A O     1 
ATOM   266   C CB    . TYR A 1 34  ? 33.453  80.345 65.699  1.00 41.51  ? 34  TYR A CB    1 
ATOM   267   C CG    . TYR A 1 34  ? 33.254  81.749 65.143  1.00 43.92  ? 34  TYR A CG    1 
ATOM   268   C CD1   . TYR A 1 34  ? 33.089  81.948 63.779  1.00 46.30  ? 34  TYR A CD1   1 
ATOM   269   C CD2   . TYR A 1 34  ? 33.155  82.844 65.982  1.00 45.42  ? 34  TYR A CD2   1 
ATOM   270   C CE1   . TYR A 1 34  ? 32.846  83.205 63.256  1.00 49.45  ? 34  TYR A CE1   1 
ATOM   271   C CE2   . TYR A 1 34  ? 32.922  84.107 65.471  1.00 49.12  ? 34  TYR A CE2   1 
ATOM   272   C CZ    . TYR A 1 34  ? 32.770  84.280 64.110  1.00 52.84  ? 34  TYR A CZ    1 
ATOM   273   O OH    . TYR A 1 34  ? 32.551  85.549 63.618  1.00 58.98  ? 34  TYR A OH    1 
ATOM   274   N N     . ASN A 1 35  ? 31.121  77.514 66.352  1.00 36.74  ? 35  ASN A N     1 
ATOM   275   C CA    . ASN A 1 35  ? 31.136  76.067 66.479  1.00 36.81  ? 35  ASN A CA    1 
ATOM   276   C C     . ASN A 1 35  ? 29.789  75.515 66.002  1.00 39.04  ? 35  ASN A C     1 
ATOM   277   O O     . ASN A 1 35  ? 28.745  75.853 66.555  1.00 38.36  ? 35  ASN A O     1 
ATOM   278   C CB    . ASN A 1 35  ? 31.373  75.621 67.922  1.00 24.88  ? 35  ASN A CB    1 
ATOM   279   C CG    . ASN A 1 35  ? 31.378  74.119 68.084  1.00 28.97  ? 35  ASN A CG    1 
ATOM   280   O OD1   . ASN A 1 35  ? 30.970  73.385 67.161  1.00 34.52  ? 35  ASN A OD1   1 
ATOM   281   N ND2   . ASN A 1 35  ? 31.828  73.620 69.234  1.00 30.01  ? 35  ASN A ND2   1 
ATOM   282   N N     . PRO A 1 36  ? 29.823  74.659 64.992  1.00 39.94  ? 36  PRO A N     1 
ATOM   283   C CA    . PRO A 1 36  ? 28.628  74.065 64.401  1.00 37.21  ? 36  PRO A CA    1 
ATOM   284   C C     . PRO A 1 36  ? 27.955  73.017 65.254  1.00 33.30  ? 36  PRO A C     1 
ATOM   285   O O     . PRO A 1 36  ? 26.738  72.804 65.092  1.00 28.49  ? 36  PRO A O     1 
ATOM   286   C CB    . PRO A 1 36  ? 29.095  73.558 63.030  1.00 38.36  ? 36  PRO A CB    1 
ATOM   287   C CG    . PRO A 1 36  ? 30.456  74.170 62.804  1.00 39.17  ? 36  PRO A CG    1 
ATOM   288   C CD    . PRO A 1 36  ? 31.042  74.264 64.220  1.00 40.06  ? 36  PRO A CD    1 
ATOM   289   N N     . PHE A 1 37  ? 28.521  72.395 66.282  1.00 30.39  ? 37  PHE A N     1 
ATOM   290   C CA    . PHE A 1 37  ? 27.760  71.461 67.117  1.00 30.02  ? 37  PHE A CA    1 
ATOM   291   C C     . PHE A 1 37  ? 26.747  72.140 68.057  1.00 27.36  ? 37  PHE A C     1 
ATOM   292   O O     . PHE A 1 37  ? 25.885  71.453 68.623  1.00 27.86  ? 37  PHE A O     1 
ATOM   293   C CB    . PHE A 1 37  ? 28.606  70.542 67.954  1.00 25.38  ? 37  PHE A CB    1 
ATOM   294   C CG    . PHE A 1 37  ? 28.361  69.077 67.819  1.00 28.84  ? 37  PHE A CG    1 
ATOM   295   C CD1   . PHE A 1 37  ? 27.151  68.525 68.182  1.00 27.67  ? 37  PHE A CD1   1 
ATOM   296   C CD2   . PHE A 1 37  ? 29.364  68.226 67.363  1.00 28.71  ? 37  PHE A CD2   1 
ATOM   297   C CE1   . PHE A 1 37  ? 26.927  67.164 68.078  1.00 25.99  ? 37  PHE A CE1   1 
ATOM   298   C CE2   . PHE A 1 37  ? 29.148  66.869 67.234  1.00 31.50  ? 37  PHE A CE2   1 
ATOM   299   C CZ    . PHE A 1 37  ? 27.924  66.334 67.587  1.00 30.96  ? 37  PHE A CZ    1 
ATOM   300   N N     . LEU A 1 38  ? 26.702  73.448 68.090  1.00 26.46  ? 38  LEU A N     1 
ATOM   301   C CA    . LEU A 1 38  ? 25.871  74.280 68.926  1.00 27.08  ? 38  LEU A CA    1 
ATOM   302   C C     . LEU A 1 38  ? 25.009  75.131 68.032  1.00 24.97  ? 38  LEU A C     1 
ATOM   303   O O     . LEU A 1 38  ? 24.354  76.060 68.521  1.00 27.63  ? 38  LEU A O     1 
ATOM   304   C CB    . LEU A 1 38  ? 26.721  75.337 69.694  1.00 32.08  ? 38  LEU A CB    1 
ATOM   305   C CG    . LEU A 1 38  ? 27.674  74.751 70.734  1.00 40.50  ? 38  LEU A CG    1 
ATOM   306   C CD1   . LEU A 1 38  ? 28.614  75.834 71.250  1.00 44.97  ? 38  LEU A CD1   1 
ATOM   307   C CD2   . LEU A 1 38  ? 26.865  74.120 71.865  1.00 40.96  ? 38  LEU A CD2   1 
ATOM   308   N N     . LEU A 1 39  ? 25.076  74.832 66.724  1.00 20.75  ? 39  LEU A N     1 
ATOM   309   C CA    . LEU A 1 39  ? 24.123  75.628 65.911  1.00 20.88  ? 39  LEU A CA    1 
ATOM   310   C C     . LEU A 1 39  ? 22.790  74.892 66.071  1.00 19.36  ? 39  LEU A C     1 
ATOM   311   O O     . LEU A 1 39  ? 22.751  73.646 66.249  1.00 18.72  ? 39  LEU A O     1 
ATOM   312   C CB    . LEU A 1 39  ? 24.588  75.533 64.458  1.00 26.76  ? 39  LEU A CB    1 
ATOM   313   C CG    . LEU A 1 39  ? 25.648  76.474 63.881  1.00 29.01  ? 39  LEU A CG    1 
ATOM   314   C CD1   . LEU A 1 39  ? 25.890  76.184 62.391  1.00 26.62  ? 39  LEU A CD1   1 
ATOM   315   C CD2   . LEU A 1 39  ? 25.200  77.924 63.978  1.00 20.93  ? 39  LEU A CD2   1 
ATOM   316   N N     . PRO A 1 40  ? 21.700  75.608 65.934  1.00 20.74  ? 40  PRO A N     1 
ATOM   317   C CA    . PRO A 1 40  ? 20.385  74.996 65.914  1.00 20.33  ? 40  PRO A CA    1 
ATOM   318   C C     . PRO A 1 40  ? 20.220  74.397 64.520  1.00 22.99  ? 40  PRO A C     1 
ATOM   319   O O     . PRO A 1 40  ? 20.699  75.049 63.575  1.00 20.86  ? 40  PRO A O     1 
ATOM   320   C CB    . PRO A 1 40  ? 19.445  76.199 65.990  1.00 20.92  ? 40  PRO A CB    1 
ATOM   321   C CG    . PRO A 1 40  ? 20.194  77.357 65.447  1.00 24.67  ? 40  PRO A CG    1 
ATOM   322   C CD    . PRO A 1 40  ? 21.645  77.081 65.753  1.00 20.17  ? 40  PRO A CD    1 
ATOM   323   N N     . SER A 1 41  ? 19.401  73.381 64.300  1.00 17.14  ? 41  SER A N     1 
ATOM   324   C CA    . SER A 1 41  ? 19.164  72.831 62.967  1.00 15.38  ? 41  SER A CA    1 
ATOM   325   C C     . SER A 1 41  ? 18.569  73.871 62.037  1.00 15.55  ? 41  SER A C     1 
ATOM   326   O O     . SER A 1 41  ? 18.680  73.766 60.787  1.00 18.51  ? 41  SER A O     1 
ATOM   327   C CB    . SER A 1 41  ? 18.121  71.686 63.121  1.00 15.74  ? 41  SER A CB    1 
ATOM   328   O OG    . SER A 1 41  ? 16.831  72.336 63.299  1.00 17.76  ? 41  SER A OG    1 
ATOM   329   N N     . SER A 1 42  ? 17.901  74.918 62.523  1.00 15.73  ? 42  SER A N     1 
ATOM   330   C CA    . SER A 1 42  ? 17.291  75.869 61.609  1.00 18.35  ? 42  SER A CA    1 
ATOM   331   C C     . SER A 1 42  ? 18.311  76.758 60.875  1.00 22.93  ? 42  SER A C     1 
ATOM   332   O O     . SER A 1 42  ? 17.894  77.426 59.928  1.00 22.69  ? 42  SER A O     1 
ATOM   333   C CB    . SER A 1 42  ? 16.383  76.879 62.326  1.00 18.83  ? 42  SER A CB    1 
ATOM   334   O OG    . SER A 1 42  ? 17.249  77.427 63.335  1.00 25.28  ? 42  SER A OG    1 
ATOM   335   N N     . ALA A 1 43  ? 19.564  76.799 61.285  1.00 20.28  ? 43  ALA A N     1 
ATOM   336   C CA    . ALA A 1 43  ? 20.545  77.594 60.547  1.00 23.86  ? 43  ALA A CA    1 
ATOM   337   C C     . ALA A 1 43  ? 21.295  76.712 59.541  1.00 24.76  ? 43  ALA A C     1 
ATOM   338   O O     . ALA A 1 43  ? 22.304  77.150 58.978  1.00 25.40  ? 43  ALA A O     1 
ATOM   339   C CB    . ALA A 1 43  ? 21.583  78.106 61.548  1.00 19.28  ? 43  ALA A CB    1 
ATOM   340   N N     . VAL A 1 44  ? 20.937  75.429 59.426  1.00 20.37  ? 44  VAL A N     1 
ATOM   341   C CA    . VAL A 1 44  ? 21.670  74.520 58.570  1.00 16.89  ? 44  VAL A CA    1 
ATOM   342   C C     . VAL A 1 44  ? 20.878  74.133 57.340  1.00 21.91  ? 44  VAL A C     1 
ATOM   343   O O     . VAL A 1 44  ? 19.688  73.801 57.389  1.00 18.31  ? 44  VAL A O     1 
ATOM   344   C CB    . VAL A 1 44  ? 22.016  73.236 59.330  1.00 20.27  ? 44  VAL A CB    1 
ATOM   345   C CG1   . VAL A 1 44  ? 22.786  72.285 58.417  1.00 13.63  ? 44  VAL A CG1   1 
ATOM   346   C CG2   . VAL A 1 44  ? 22.824  73.589 60.563  1.00 16.84  ? 44  VAL A CG2   1 
ATOM   347   N N     . TYR A 1 45  ? 21.600  74.160 56.202  1.00 20.08  ? 45  TYR A N     1 
ATOM   348   C CA    . TYR A 1 45  ? 20.880  73.782 54.969  1.00 20.15  ? 45  TYR A CA    1 
ATOM   349   C C     . TYR A 1 45  ? 20.978  72.269 54.792  1.00 19.97  ? 45  TYR A C     1 
ATOM   350   O O     . TYR A 1 45  ? 20.016  71.530 54.921  1.00 24.45  ? 45  TYR A O     1 
ATOM   351   C CB    . TYR A 1 45  ? 21.493  74.574 53.801  1.00 23.02  ? 45  TYR A CB    1 
ATOM   352   C CG    . TYR A 1 45  ? 21.028  74.124 52.430  1.00 25.49  ? 45  TYR A CG    1 
ATOM   353   C CD1   . TYR A 1 45  ? 19.701  73.834 52.189  1.00 25.14  ? 45  TYR A CD1   1 
ATOM   354   C CD2   . TYR A 1 45  ? 21.909  73.986 51.366  1.00 28.93  ? 45  TYR A CD2   1 
ATOM   355   C CE1   . TYR A 1 45  ? 19.259  73.419 50.953  1.00 30.02  ? 45  TYR A CE1   1 
ATOM   356   C CE2   . TYR A 1 45  ? 21.476  73.583 50.114  1.00 27.11  ? 45  TYR A CE2   1 
ATOM   357   C CZ    . TYR A 1 45  ? 20.168  73.300 49.908  1.00 32.42  ? 45  TYR A CZ    1 
ATOM   358   O OH    . TYR A 1 45  ? 19.648  72.884 48.682  1.00 36.12  ? 45  TYR A OH    1 
ATOM   359   N N     . ILE A 1 46  ? 22.202  71.769 54.522  1.00 17.91  ? 46  ILE A N     1 
ATOM   360   C CA    . ILE A 1 46  ? 22.414  70.339 54.356  1.00 14.12  ? 46  ILE A CA    1 
ATOM   361   C C     . ILE A 1 46  ? 23.193  69.892 55.605  1.00 17.61  ? 46  ILE A C     1 
ATOM   362   O O     . ILE A 1 46  ? 24.234  70.504 55.897  1.00 14.51  ? 46  ILE A O     1 
ATOM   363   C CB    . ILE A 1 46  ? 23.114  69.963 53.059  1.00 17.65  ? 46  ILE A CB    1 
ATOM   364   C CG1   . ILE A 1 46  ? 22.188  70.266 51.865  1.00 15.92  ? 46  ILE A CG1   1 
ATOM   365   C CG2   . ILE A 1 46  ? 23.517  68.489 53.034  1.00 10.90  ? 46  ILE A CG2   1 
ATOM   366   C CD1   . ILE A 1 46  ? 22.916  70.345 50.538  1.00 16.87  ? 46  ILE A CD1   1 
ATOM   367   N N     . ASP A 1 47  ? 22.694  68.887 56.314  1.00 13.37  ? 47  ASP A N     1 
ATOM   368   C CA    . ASP A 1 47  ? 23.317  68.527 57.593  1.00 13.36  ? 47  ASP A CA    1 
ATOM   369   C C     . ASP A 1 47  ? 24.119  67.246 57.436  1.00 10.43  ? 47  ASP A C     1 
ATOM   370   O O     . ASP A 1 47  ? 23.541  66.198 57.215  1.00 12.80  ? 47  ASP A O     1 
ATOM   371   C CB    . ASP A 1 47  ? 22.281  68.359 58.705  1.00 14.87  ? 47  ASP A CB    1 
ATOM   372   C CG    . ASP A 1 47  ? 22.836  68.686 60.098  1.00 22.52  ? 47  ASP A CG    1 
ATOM   373   O OD1   . ASP A 1 47  ? 24.060  68.845 60.322  1.00 17.59  ? 47  ASP A OD1   1 
ATOM   374   O OD2   . ASP A 1 47  ? 21.999  68.799 61.031  1.00 14.95  ? 47  ASP A OD2   1 
ATOM   375   N N     . LEU A 1 48  ? 25.431  67.369 57.579  1.00 10.53  ? 48  LEU A N     1 
ATOM   376   C CA    . LEU A 1 48  ? 26.317  66.204 57.431  1.00 13.22  ? 48  LEU A CA    1 
ATOM   377   C C     . LEU A 1 48  ? 27.053  65.911 58.727  1.00 12.20  ? 48  LEU A C     1 
ATOM   378   O O     . LEU A 1 48  ? 28.066  65.195 58.779  1.00 14.61  ? 48  LEU A O     1 
ATOM   379   C CB    . LEU A 1 48  ? 27.312  66.482 56.296  1.00 13.97  ? 48  LEU A CB    1 
ATOM   380   C CG    . LEU A 1 48  ? 26.740  66.946 54.937  1.00 15.93  ? 48  LEU A CG    1 
ATOM   381   C CD1   . LEU A 1 48  ? 27.899  67.241 53.990  1.00 16.90  ? 48  LEU A CD1   1 
ATOM   382   C CD2   . LEU A 1 48  ? 25.840  65.888 54.334  1.00 10.21  ? 48  LEU A CD2   1 
ATOM   383   N N     . LEU A 1 49  ? 26.445  66.330 59.823  1.00 12.44  ? 49  LEU A N     1 
ATOM   384   C CA    . LEU A 1 49  ? 27.029  66.085 61.166  1.00 14.13  ? 49  LEU A CA    1 
ATOM   385   C C     . LEU A 1 49  ? 27.175  64.622 61.415  1.00 14.21  ? 49  LEU A C     1 
ATOM   386   O O     . LEU A 1 49  ? 28.204  64.133 61.881  1.00 12.90  ? 49  LEU A O     1 
ATOM   387   C CB    . LEU A 1 49  ? 26.194  66.778 62.235  1.00 13.69  ? 49  LEU A CB    1 
ATOM   388   C CG    . LEU A 1 49  ? 26.862  66.984 63.606  1.00 28.84  ? 49  LEU A CG    1 
ATOM   389   C CD1   . LEU A 1 49  ? 28.000  67.993 63.503  1.00 25.49  ? 49  LEU A CD1   1 
ATOM   390   C CD2   . LEU A 1 49  ? 25.799  67.496 64.614  1.00 28.86  ? 49  LEU A CD2   1 
ATOM   391   N N     . THR A 1 50  ? 26.153  63.845 61.026  1.00 8.91   ? 50  THR A N     1 
ATOM   392   C CA    . THR A 1 50  ? 26.221  62.423 61.276  1.00 7.31   ? 50  THR A CA    1 
ATOM   393   C C     . THR A 1 50  ? 25.280  61.632 60.381  1.00 9.30   ? 50  THR A C     1 
ATOM   394   O O     . THR A 1 50  ? 24.422  62.276 59.771  1.00 13.60  ? 50  THR A O     1 
ATOM   395   C CB    . THR A 1 50  ? 25.756  62.228 62.762  1.00 16.77  ? 50  THR A CB    1 
ATOM   396   O OG1   . THR A 1 50  ? 25.877  60.859 63.031  1.00 20.47  ? 50  THR A OG1   1 
ATOM   397   C CG2   . THR A 1 50  ? 24.294  62.587 62.899  1.00 13.84  ? 50  THR A CG2   1 
ATOM   398   N N     . ASP A 1 51  ? 25.417  60.320 60.392  1.00 8.68   ? 51  ASP A N     1 
ATOM   399   C CA    . ASP A 1 51  ? 24.461  59.472 59.697  1.00 8.97   ? 51  ASP A CA    1 
ATOM   400   C C     . ASP A 1 51  ? 23.604  58.745 60.742  1.00 8.08   ? 51  ASP A C     1 
ATOM   401   O O     . ASP A 1 51  ? 22.978  57.723 60.496  1.00 11.75  ? 51  ASP A O     1 
ATOM   402   C CB    . ASP A 1 51  ? 25.123  58.444 58.751  1.00 6.69   ? 51  ASP A CB    1 
ATOM   403   C CG    . ASP A 1 51  ? 25.887  57.387 59.540  1.00 8.95   ? 51  ASP A CG    1 
ATOM   404   O OD1   . ASP A 1 51  ? 26.494  57.839 60.509  1.00 10.80  ? 51  ASP A OD1   1 
ATOM   405   O OD2   . ASP A 1 51  ? 25.953  56.189 59.237  1.00 11.27  ? 51  ASP A OD2   1 
ATOM   406   N N     . SER A 1 52  ? 23.571  59.247 61.968  1.00 9.80   ? 52  SER A N     1 
ATOM   407   C CA    . SER A 1 52  ? 22.876  58.565 63.057  1.00 10.38  ? 52  SER A CA    1 
ATOM   408   C C     . SER A 1 52  ? 21.486  59.133 63.313  1.00 7.11   ? 52  SER A C     1 
ATOM   409   O O     . SER A 1 52  ? 21.384  60.269 63.816  1.00 8.85   ? 52  SER A O     1 
ATOM   410   C CB    . SER A 1 52  ? 23.663  58.853 64.390  1.00 12.06  ? 52  SER A CB    1 
ATOM   411   O OG    . SER A 1 52  ? 23.114  58.001 65.398  1.00 16.56  ? 52  SER A OG    1 
ATOM   412   N N     . GLY A 1 53  ? 20.465  58.353 63.094  1.00 9.39   ? 53  GLY A N     1 
ATOM   413   C CA    . GLY A 1 53  ? 19.081  58.740 63.413  1.00 10.25  ? 53  GLY A CA    1 
ATOM   414   C C     . GLY A 1 53  ? 18.474  59.830 62.569  1.00 12.88  ? 53  GLY A C     1 
ATOM   415   O O     . GLY A 1 53  ? 17.380  60.333 62.896  1.00 7.66   ? 53  GLY A O     1 
ATOM   416   N N     . THR A 1 54  ? 19.078  60.206 61.452  1.00 7.92   ? 54  THR A N     1 
ATOM   417   C CA    . THR A 1 54  ? 18.558  61.250 60.563  1.00 9.33   ? 54  THR A CA    1 
ATOM   418   C C     . THR A 1 54  ? 18.025  60.642 59.256  1.00 9.60   ? 54  THR A C     1 
ATOM   419   O O     . THR A 1 54  ? 17.575  61.345 58.336  1.00 12.64  ? 54  THR A O     1 
ATOM   420   C CB    . THR A 1 54  ? 19.631  62.283 60.197  1.00 12.09  ? 54  THR A CB    1 
ATOM   421   O OG1   . THR A 1 54  ? 20.808  61.557 59.795  1.00 13.49  ? 54  THR A OG1   1 
ATOM   422   C CG2   . THR A 1 54  ? 20.002  63.147 61.393  1.00 11.46  ? 54  THR A CG2   1 
ATOM   423   N N     . ASN A 1 55  ? 18.053  59.338 59.178  1.00 5.51   ? 55  ASN A N     1 
ATOM   424   C CA    . ASN A 1 55  ? 17.611  58.623 57.990  1.00 7.01   ? 55  ASN A CA    1 
ATOM   425   C C     . ASN A 1 55  ? 16.133  58.833 57.664  1.00 11.91  ? 55  ASN A C     1 
ATOM   426   O O     . ASN A 1 55  ? 15.314  59.081 58.551  1.00 8.55   ? 55  ASN A O     1 
ATOM   427   C CB    . ASN A 1 55  ? 17.755  57.122 58.274  1.00 5.37   ? 55  ASN A CB    1 
ATOM   428   C CG    . ASN A 1 55  ? 19.162  56.792 58.747  1.00 20.31  ? 55  ASN A CG    1 
ATOM   429   O OD1   . ASN A 1 55  ? 20.162  57.039 58.059  1.00 11.48  ? 55  ASN A OD1   1 
ATOM   430   N ND2   . ASN A 1 55  ? 19.302  56.201 59.926  1.00 8.76   ? 55  ASN A ND2   1 
ATOM   431   N N     . ALA A 1 56  ? 15.793  58.569 56.397  1.00 7.47   ? 56  ALA A N     1 
ATOM   432   C CA    . ALA A 1 56  ? 14.389  58.650 55.985  1.00 7.81   ? 56  ALA A CA    1 
ATOM   433   C C     . ALA A 1 56  ? 13.856  57.236 56.011  1.00 7.50   ? 56  ALA A C     1 
ATOM   434   O O     . ALA A 1 56  ? 14.453  56.326 55.466  1.00 9.53   ? 56  ALA A O     1 
ATOM   435   C CB    . ALA A 1 56  ? 14.265  59.185 54.566  1.00 8.55   ? 56  ALA A CB    1 
ATOM   436   N N     . MET A 1 57  ? 12.690  57.058 56.626  1.00 6.09   ? 57  MET A N     1 
ATOM   437   C CA    . MET A 1 57  ? 12.086  55.731 56.686  1.00 8.17   ? 57  MET A CA    1 
ATOM   438   C C     . MET A 1 57  ? 11.166  55.512 55.476  1.00 7.31   ? 57  MET A C     1 
ATOM   439   O O     . MET A 1 57  ? 10.809  56.505 54.829  1.00 7.88   ? 57  MET A O     1 
ATOM   440   C CB    . MET A 1 57  ? 11.217  55.679 57.973  1.00 6.58   ? 57  MET A CB    1 
ATOM   441   C CG    . MET A 1 57  ? 12.131  55.685 59.236  1.00 8.68   ? 57  MET A CG    1 
ATOM   442   S SD    . MET A 1 57  ? 11.223  54.936 60.625  1.00 10.42  ? 57  MET A SD    1 
ATOM   443   C CE    . MET A 1 57  ? 10.122  56.267 60.984  1.00 8.92   ? 57  MET A CE    1 
ATOM   444   N N     . SER A 1 58  ? 10.755  54.307 55.215  1.00 5.35   ? 58  SER A N     1 
ATOM   445   C CA    . SER A 1 58  ? 9.807   54.052 54.144  1.00 8.81   ? 58  SER A CA    1 
ATOM   446   C C     . SER A 1 58  ? 8.383   54.163 54.697  1.00 14.41  ? 58  SER A C     1 
ATOM   447   O O     . SER A 1 58  ? 8.138   54.313 55.924  1.00 8.35   ? 58  SER A O     1 
ATOM   448   C CB    . SER A 1 58  ? 10.072  52.633 53.628  1.00 6.99   ? 58  SER A CB    1 
ATOM   449   O OG    . SER A 1 58  ? 9.745   51.681 54.657  1.00 10.17  ? 58  SER A OG    1 
ATOM   450   N N     . ASP A 1 59  ? 7.438   54.050 53.789  1.00 10.00  ? 59  ASP A N     1 
ATOM   451   C CA    . ASP A 1 59  ? 6.013   54.006 54.086  1.00 12.38  ? 59  ASP A CA    1 
ATOM   452   C C     . ASP A 1 59  ? 5.705   52.736 54.883  1.00 7.23   ? 59  ASP A C     1 
ATOM   453   O O     . ASP A 1 59  ? 4.931   52.806 55.862  1.00 7.87   ? 59  ASP A O     1 
ATOM   454   C CB    . ASP A 1 59  ? 5.169   54.120 52.825  1.00 6.60   ? 59  ASP A CB    1 
ATOM   455   C CG    . ASP A 1 59  ? 5.496   53.102 51.752  1.00 12.49  ? 59  ASP A CG    1 
ATOM   456   O OD1   . ASP A 1 59  ? 6.463   52.303 51.785  1.00 11.32  ? 59  ASP A OD1   1 
ATOM   457   O OD2   . ASP A 1 59  ? 4.709   53.167 50.775  1.00 16.69  ? 59  ASP A OD2   1 
ATOM   458   N N     . HIS A 1 60  ? 6.284   51.594 54.543  1.00 4.83   ? 60  HIS A N     1 
ATOM   459   C CA    . HIS A 1 60  ? 6.153   50.392 55.316  1.00 8.42   ? 60  HIS A CA    1 
ATOM   460   C C     . HIS A 1 60  ? 6.661   50.561 56.781  1.00 9.68   ? 60  HIS A C     1 
ATOM   461   O O     . HIS A 1 60  ? 6.018   49.991 57.678  1.00 10.06  ? 60  HIS A O     1 
ATOM   462   C CB    . HIS A 1 60  ? 6.901   49.197 54.700  1.00 10.94  ? 60  HIS A CB    1 
ATOM   463   C CG    . HIS A 1 60  ? 6.106   48.797 53.474  1.00 21.80  ? 60  HIS A CG    1 
ATOM   464   N ND1   . HIS A 1 60  ? 5.105   47.859 53.477  1.00 27.11  ? 60  HIS A ND1   1 
ATOM   465   C CD2   . HIS A 1 60  ? 6.144   49.276 52.224  1.00 28.63  ? 60  HIS A CD2   1 
ATOM   466   C CE1   . HIS A 1 60  ? 4.576   47.736 52.282  1.00 26.19  ? 60  HIS A CE1   1 
ATOM   467   N NE2   . HIS A 1 60  ? 5.204   48.586 51.518  1.00 25.82  ? 60  HIS A NE2   1 
ATOM   468   N N     . GLN A 1 61  ? 7.726   51.288 57.016  1.00 8.33   ? 61  GLN A N     1 
ATOM   469   C CA    . GLN A 1 61  ? 8.202   51.546 58.381  1.00 11.07  ? 61  GLN A CA    1 
ATOM   470   C C     . GLN A 1 61  ? 7.171   52.400 59.111  1.00 11.02  ? 61  GLN A C     1 
ATOM   471   O O     . GLN A 1 61  ? 6.781   52.074 60.257  1.00 9.42   ? 61  GLN A O     1 
ATOM   472   C CB    . GLN A 1 61  ? 9.579   52.266 58.347  1.00 4.05   ? 61  GLN A CB    1 
ATOM   473   C CG    . GLN A 1 61  ? 10.689  51.219 58.086  1.00 6.08   ? 61  GLN A CG    1 
ATOM   474   C CD    . GLN A 1 61  ? 12.022  51.914 57.971  1.00 11.78  ? 61  GLN A CD    1 
ATOM   475   O OE1   . GLN A 1 61  ? 12.222  52.757 57.088  1.00 10.46  ? 61  GLN A OE1   1 
ATOM   476   N NE2   . GLN A 1 61  ? 12.920  51.611 58.911  1.00 7.92   ? 61  GLN A NE2   1 
ATOM   477   N N     . TRP A 1 62  ? 6.687   53.473 58.520  1.00 5.86   ? 62  TRP A N     1 
ATOM   478   C CA    . TRP A 1 62  ? 5.692   54.325 59.161  1.00 7.92   ? 62  TRP A CA    1 
ATOM   479   C C     . TRP A 1 62  ? 4.420   53.536 59.452  1.00 10.96  ? 62  TRP A C     1 
ATOM   480   O O     . TRP A 1 62  ? 3.822   53.726 60.531  1.00 11.71  ? 62  TRP A O     1 
ATOM   481   C CB    . TRP A 1 62  ? 5.343   55.598 58.378  1.00 6.64   ? 62  TRP A CB    1 
ATOM   482   C CG    . TRP A 1 62  ? 6.334   56.686 58.625  1.00 14.16  ? 62  TRP A CG    1 
ATOM   483   C CD1   . TRP A 1 62  ? 7.505   56.879 57.961  1.00 9.92   ? 62  TRP A CD1   1 
ATOM   484   C CD2   . TRP A 1 62  ? 6.292   57.672 59.668  1.00 18.05  ? 62  TRP A CD2   1 
ATOM   485   N NE1   . TRP A 1 62  ? 8.167   57.966 58.505  1.00 15.41  ? 62  TRP A NE1   1 
ATOM   486   C CE2   . TRP A 1 62  ? 7.451   58.465 59.543  1.00 16.82  ? 62  TRP A CE2   1 
ATOM   487   C CE3   . TRP A 1 62  ? 5.361   57.968 60.674  1.00 21.00  ? 62  TRP A CE3   1 
ATOM   488   C CZ2   . TRP A 1 62  ? 7.734   59.541 60.402  1.00 19.94  ? 62  TRP A CZ2   1 
ATOM   489   C CZ3   . TRP A 1 62  ? 5.628   59.049 61.494  1.00 24.92  ? 62  TRP A CZ3   1 
ATOM   490   C CH2   . TRP A 1 62  ? 6.794   59.805 61.372  1.00 23.86  ? 62  TRP A CH2   1 
ATOM   491   N N     . ALA A 1 63  ? 3.981   52.679 58.529  1.00 10.36  ? 63  ALA A N     1 
ATOM   492   C CA    . ALA A 1 63  ? 2.792   51.898 58.738  1.00 14.10  ? 63  ALA A CA    1 
ATOM   493   C C     . ALA A 1 63  ? 3.010   50.981 59.961  1.00 15.38  ? 63  ALA A C     1 
ATOM   494   O O     . ALA A 1 63  ? 2.138   50.811 60.780  1.00 10.94  ? 63  ALA A O     1 
ATOM   495   C CB    . ALA A 1 63  ? 2.434   51.041 57.549  1.00 5.62   ? 63  ALA A CB    1 
ATOM   496   N N     . ALA A 1 64  ? 4.149   50.315 60.042  1.00 10.22  ? 64  ALA A N     1 
ATOM   497   C CA    . ALA A 1 64  ? 4.490   49.449 61.134  1.00 10.30  ? 64  ALA A CA    1 
ATOM   498   C C     . ALA A 1 64  ? 4.433   50.229 62.461  1.00 9.52   ? 64  ALA A C     1 
ATOM   499   O O     . ALA A 1 64  ? 3.951   49.674 63.465  1.00 8.95   ? 64  ALA A O     1 
ATOM   500   C CB    . ALA A 1 64  ? 5.865   48.820 60.888  1.00 11.49  ? 64  ALA A CB    1 
ATOM   501   N N     . MET A 1 65  ? 4.827   51.512 62.476  1.00 7.75   ? 65  MET A N     1 
ATOM   502   C CA    . MET A 1 65  ? 4.742   52.286 63.690  1.00 10.90  ? 65  MET A CA    1 
ATOM   503   C C     . MET A 1 65  ? 3.283   52.457 64.138  1.00 17.73  ? 65  MET A C     1 
ATOM   504   O O     . MET A 1 65  ? 2.955   52.383 65.349  1.00 9.01   ? 65  MET A O     1 
ATOM   505   C CB    . MET A 1 65  ? 5.346   53.680 63.513  1.00 5.16   ? 65  MET A CB    1 
ATOM   506   C CG    . MET A 1 65  ? 6.904   53.638 63.335  1.00 12.23  ? 65  MET A CG    1 
ATOM   507   S SD    . MET A 1 65  ? 7.703   55.060 64.063  1.00 18.26  ? 65  MET A SD    1 
ATOM   508   C CE    . MET A 1 65  ? 6.949   56.465 63.337  1.00 17.44  ? 65  MET A CE    1 
ATOM   509   N N     . ILE A 1 66  ? 2.383   52.741 63.175  1.00 10.78  ? 66  ILE A N     1 
ATOM   510   C CA    . ILE A 1 66  ? 0.984   52.996 63.505  1.00 11.91  ? 66  ILE A CA    1 
ATOM   511   C C     . ILE A 1 66  ? 0.339   51.799 64.193  1.00 6.02   ? 66  ILE A C     1 
ATOM   512   O O     . ILE A 1 66  ? -0.507  51.956 65.065  1.00 10.40  ? 66  ILE A O     1 
ATOM   513   C CB    . ILE A 1 66  ? 0.165   53.368 62.244  1.00 15.15  ? 66  ILE A CB    1 
ATOM   514   C CG1   . ILE A 1 66  ? 0.699   54.663 61.590  1.00 19.52  ? 66  ILE A CG1   1 
ATOM   515   C CG2   . ILE A 1 66  ? -1.313  53.529 62.585  1.00 14.48  ? 66  ILE A CG2   1 
ATOM   516   C CD1   . ILE A 1 66  ? 0.545   55.873 62.458  1.00 38.08  ? 66  ILE A CD1   1 
ATOM   517   N N     . THR A 1 67  ? 0.654   50.584 63.795  1.00 6.27   ? 67  THR A N     1 
ATOM   518   C CA    . THR A 1 67  ? 0.092   49.412 64.420  1.00 9.97   ? 67  THR A CA    1 
ATOM   519   C C     . THR A 1 67  ? 1.035   48.841 65.489  1.00 10.73  ? 67  THR A C     1 
ATOM   520   O O     . THR A 1 67  ? 0.751   47.747 65.965  1.00 10.49  ? 67  THR A O     1 
ATOM   521   C CB    . THR A 1 67  ? -0.269  48.352 63.363  1.00 13.56  ? 67  THR A CB    1 
ATOM   522   O OG1   . THR A 1 67  ? 0.915   47.911 62.699  1.00 15.22  ? 67  THR A OG1   1 
ATOM   523   C CG2   . THR A 1 67  ? -1.270  48.942 62.347  1.00 11.71  ? 67  THR A CG2   1 
ATOM   524   N N     . GLY A 1 68  ? 2.083   49.523 65.901  1.00 13.03  ? 68  GLY A N     1 
ATOM   525   C CA    . GLY A 1 68  ? 2.983   48.981 66.922  1.00 12.76  ? 68  GLY A CA    1 
ATOM   526   C C     . GLY A 1 68  ? 2.252   48.830 68.281  1.00 13.56  ? 68  GLY A C     1 
ATOM   527   O O     . GLY A 1 68  ? 1.364   49.603 68.637  1.00 11.66  ? 68  GLY A O     1 
ATOM   528   N N     . ASP A 1 69  ? 2.597   47.793 68.983  1.00 11.85  ? 69  ASP A N     1 
ATOM   529   C CA    . ASP A 1 69  ? 2.023   47.417 70.273  1.00 8.09   ? 69  ASP A CA    1 
ATOM   530   C C     . ASP A 1 69  ? 2.787   48.055 71.437  1.00 10.41  ? 69  ASP A C     1 
ATOM   531   O O     . ASP A 1 69  ? 3.942   47.749 71.744  1.00 10.35  ? 69  ASP A O     1 
ATOM   532   C CB    . ASP A 1 69  ? 2.077   45.895 70.338  1.00 7.43   ? 69  ASP A CB    1 
ATOM   533   C CG    . ASP A 1 69  ? 1.493   45.275 71.602  1.00 10.64  ? 69  ASP A CG    1 
ATOM   534   O OD1   . ASP A 1 69  ? 1.007   46.009 72.460  1.00 7.98   ? 69  ASP A OD1   1 
ATOM   535   O OD2   . ASP A 1 69  ? 1.562   44.059 71.748  1.00 9.30   ? 69  ASP A OD2   1 
ATOM   536   N N     . GLU A 1 70  ? 2.154   49.005 72.116  1.00 5.14   ? 70  GLU A N     1 
ATOM   537   C CA    . GLU A 1 70  ? 2.739   49.711 73.212  1.00 5.10   ? 70  GLU A CA    1 
ATOM   538   C C     . GLU A 1 70  ? 2.710   48.970 74.579  1.00 8.73   ? 70  GLU A C     1 
ATOM   539   O O     . GLU A 1 70  ? 3.117   49.575 75.570  1.00 10.77  ? 70  GLU A O     1 
ATOM   540   C CB    . GLU A 1 70  ? 2.121   51.099 73.322  1.00 6.91   ? 70  GLU A CB    1 
ATOM   541   C CG    . GLU A 1 70  ? 2.383   51.994 72.084  1.00 10.42  ? 70  GLU A CG    1 
ATOM   542   C CD    . GLU A 1 70  ? 3.863   52.225 71.842  1.00 20.64  ? 70  GLU A CD    1 
ATOM   543   O OE1   . GLU A 1 70  ? 4.684   52.065 72.787  1.00 9.15   ? 70  GLU A OE1   1 
ATOM   544   O OE2   . GLU A 1 70  ? 4.274   52.563 70.697  1.00 10.71  ? 70  GLU A OE2   1 
ATOM   545   N N     . ALA A 1 71  ? 2.308   47.713 74.616  1.00 8.70   ? 71  ALA A N     1 
ATOM   546   C CA    . ALA A 1 71  ? 2.255   46.955 75.839  1.00 12.69  ? 71  ALA A CA    1 
ATOM   547   C C     . ALA A 1 71  ? 3.594   47.031 76.589  1.00 15.41  ? 71  ALA A C     1 
ATOM   548   O O     . ALA A 1 71  ? 4.715   46.873 76.091  1.00 13.61  ? 71  ALA A O     1 
ATOM   549   C CB    . ALA A 1 71  ? 1.933   45.500 75.533  1.00 10.13  ? 71  ALA A CB    1 
ATOM   550   N N     . TYR A 1 72  ? 3.476   47.225 77.886  1.00 14.13  ? 72  TYR A N     1 
ATOM   551   C CA    . TYR A 1 72  ? 4.595   47.326 78.796  1.00 15.17  ? 72  TYR A CA    1 
ATOM   552   C C     . TYR A 1 72  ? 5.403   46.046 78.815  1.00 14.37  ? 72  TYR A C     1 
ATOM   553   O O     . TYR A 1 72  ? 6.629   46.082 78.812  1.00 16.83  ? 72  TYR A O     1 
ATOM   554   C CB    . TYR A 1 72  ? 4.089   47.651 80.216  1.00 15.41  ? 72  TYR A CB    1 
ATOM   555   C CG    . TYR A 1 72  ? 5.304   48.178 80.970  1.00 13.94  ? 72  TYR A CG    1 
ATOM   556   C CD1   . TYR A 1 72  ? 5.610   49.521 80.803  1.00 15.64  ? 72  TYR A CD1   1 
ATOM   557   C CD2   . TYR A 1 72  ? 6.094   47.369 81.751  1.00 13.87  ? 72  TYR A CD2   1 
ATOM   558   C CE1   . TYR A 1 72  ? 6.701   50.042 81.434  1.00 19.21  ? 72  TYR A CE1   1 
ATOM   559   C CE2   . TYR A 1 72  ? 7.196   47.909 82.405  1.00 17.57  ? 72  TYR A CE2   1 
ATOM   560   C CZ    . TYR A 1 72  ? 7.496   49.232 82.230  1.00 20.02  ? 72  TYR A CZ    1 
ATOM   561   O OH    . TYR A 1 72  ? 8.581   49.823 82.815  1.00 20.98  ? 72  TYR A OH    1 
ATOM   562   N N     . ALA A 1 73  ? 4.716   44.921 78.801  1.00 13.39  ? 73  ALA A N     1 
ATOM   563   C CA    . ALA A 1 73  ? 5.337   43.621 78.811  1.00 14.96  ? 73  ALA A CA    1 
ATOM   564   C C     . ALA A 1 73  ? 4.708   42.742 77.723  1.00 13.29  ? 73  ALA A C     1 
ATOM   565   O O     . ALA A 1 73  ? 3.487   42.674 77.629  1.00 15.05  ? 73  ALA A O     1 
ATOM   566   C CB    . ALA A 1 73  ? 5.059   42.999 80.203  1.00 14.93  ? 73  ALA A CB    1 
ATOM   567   N N     . GLY A 1 74  ? 5.547   42.045 76.985  1.00 12.76  ? 74  GLY A N     1 
ATOM   568   C CA    . GLY A 1 74  ? 5.097   41.089 75.988  1.00 11.66  ? 74  GLY A CA    1 
ATOM   569   C C     . GLY A 1 74  ? 4.569   41.743 74.707  1.00 10.32  ? 74  GLY A C     1 
ATOM   570   O O     . GLY A 1 74  ? 3.725   41.144 74.084  1.00 10.16  ? 74  GLY A O     1 
ATOM   571   N N     . SER A 1 75  ? 4.998   42.920 74.335  1.00 11.57  ? 75  SER A N     1 
ATOM   572   C CA    . SER A 1 75  ? 4.639   43.566 73.071  1.00 11.63  ? 75  SER A CA    1 
ATOM   573   C C     . SER A 1 75  ? 4.824   42.575 71.909  1.00 11.82  ? 75  SER A C     1 
ATOM   574   O O     . SER A 1 75  ? 5.841   41.906 71.826  1.00 9.90   ? 75  SER A O     1 
ATOM   575   C CB    . SER A 1 75  ? 5.575   44.691 72.698  1.00 12.14  ? 75  SER A CB    1 
ATOM   576   O OG    . SER A 1 75  ? 5.335   45.349 71.467  1.00 14.89  ? 75  SER A OG    1 
ATOM   577   N N     . ARG A 1 76  ? 3.865   42.538 71.009  1.00 13.17  ? 76  ARG A N     1 
ATOM   578   C CA    . ARG A 1 76  ? 3.991   41.700 69.785  1.00 11.82  ? 76  ARG A CA    1 
ATOM   579   C C     . ARG A 1 76  ? 5.320   42.012 69.055  1.00 7.61   ? 76  ARG A C     1 
ATOM   580   O O     . ARG A 1 76  ? 5.955   41.155 68.476  1.00 11.06  ? 76  ARG A O     1 
ATOM   581   C CB    . ARG A 1 76  ? 2.957   42.140 68.733  1.00 18.65  ? 76  ARG A CB    1 
ATOM   582   C CG    . ARG A 1 76  ? 1.547   41.660 68.707  1.00 38.85  ? 76  ARG A CG    1 
ATOM   583   C CD    . ARG A 1 76  ? 0.910   42.011 67.354  1.00 38.07  ? 76  ARG A CD    1 
ATOM   584   N NE    . ARG A 1 76  ? 0.688   43.429 67.141  1.00 36.70  ? 76  ARG A NE    1 
ATOM   585   C CZ    . ARG A 1 76  ? -0.063  44.245 67.871  1.00 37.24  ? 76  ARG A CZ    1 
ATOM   586   N NH1   . ARG A 1 76  ? -0.732  43.814 68.951  1.00 36.81  ? 76  ARG A NH1   1 
ATOM   587   N NH2   . ARG A 1 76  ? -0.158  45.529 67.536  1.00 35.86  ? 76  ARG A NH2   1 
ATOM   588   N N     . ASN A 1 77  ? 5.679   43.279 69.000  1.00 6.47   ? 77  ASN A N     1 
ATOM   589   C CA    . ASN A 1 77  ? 6.885   43.712 68.264  1.00 14.00  ? 77  ASN A CA    1 
ATOM   590   C C     . ASN A 1 77  ? 8.169   43.198 68.857  1.00 15.71  ? 77  ASN A C     1 
ATOM   591   O O     . ASN A 1 77  ? 9.133   42.960 68.107  1.00 13.76  ? 77  ASN A O     1 
ATOM   592   C CB    . ASN A 1 77  ? 6.868   45.232 68.150  1.00 9.14   ? 77  ASN A CB    1 
ATOM   593   C CG    . ASN A 1 77  ? 5.507   45.692 67.583  1.00 18.63  ? 77  ASN A CG    1 
ATOM   594   O OD1   . ASN A 1 77  ? 4.750   46.317 68.323  1.00 15.77  ? 77  ASN A OD1   1 
ATOM   595   N ND2   . ASN A 1 77  ? 5.219   45.380 66.327  1.00 9.35   ? 77  ASN A ND2   1 
ATOM   596   N N     . TYR A 1 78  ? 8.175   42.979 70.185  1.00 11.88  ? 78  TYR A N     1 
ATOM   597   C CA    . TYR A 1 78  ? 9.327   42.358 70.836  1.00 11.45  ? 78  TYR A CA    1 
ATOM   598   C C     . TYR A 1 78  ? 9.529   40.967 70.267  1.00 13.05  ? 78  TYR A C     1 
ATOM   599   O O     . TYR A 1 78  ? 10.641  40.592 69.897  1.00 11.80  ? 78  TYR A O     1 
ATOM   600   C CB    . TYR A 1 78  ? 9.176   42.390 72.384  1.00 11.89  ? 78  TYR A CB    1 
ATOM   601   C CG    . TYR A 1 78  ? 10.119  41.374 73.008  1.00 13.58  ? 78  TYR A CG    1 
ATOM   602   C CD1   . TYR A 1 78  ? 11.439  41.739 73.246  1.00 15.30  ? 78  TYR A CD1   1 
ATOM   603   C CD2   . TYR A 1 78  ? 9.713   40.079 73.293  1.00 12.89  ? 78  TYR A CD2   1 
ATOM   604   C CE1   . TYR A 1 78  ? 12.327  40.833 73.797  1.00 15.71  ? 78  TYR A CE1   1 
ATOM   605   C CE2   . TYR A 1 78  ? 10.601  39.171 73.855  1.00 18.23  ? 78  TYR A CE2   1 
ATOM   606   C CZ    . TYR A 1 78  ? 11.910  39.569 74.105  1.00 17.34  ? 78  TYR A CZ    1 
ATOM   607   O OH    . TYR A 1 78  ? 12.814  38.689 74.627  1.00 16.78  ? 78  TYR A OH    1 
ATOM   608   N N     . TYR A 1 79  ? 8.473   40.142 70.180  1.00 11.27  ? 79  TYR A N     1 
ATOM   609   C CA    . TYR A 1 79  ? 8.640   38.816 69.605  1.00 9.88   ? 79  TYR A CA    1 
ATOM   610   C C     . TYR A 1 79  ? 9.060   38.867 68.131  1.00 13.02  ? 79  TYR A C     1 
ATOM   611   O O     . TYR A 1 79  ? 9.842   38.035 67.685  1.00 12.33  ? 79  TYR A O     1 
ATOM   612   C CB    . TYR A 1 79  ? 7.366   37.983 69.785  1.00 13.35  ? 79  TYR A CB    1 
ATOM   613   C CG    . TYR A 1 79  ? 7.024   37.856 71.264  1.00 15.61  ? 79  TYR A CG    1 
ATOM   614   C CD1   . TYR A 1 79  ? 7.691   36.931 72.072  1.00 18.10  ? 79  TYR A CD1   1 
ATOM   615   C CD2   . TYR A 1 79  ? 6.068   38.673 71.831  1.00 16.31  ? 79  TYR A CD2   1 
ATOM   616   C CE1   . TYR A 1 79  ? 7.353   36.797 73.415  1.00 18.89  ? 79  TYR A CE1   1 
ATOM   617   C CE2   . TYR A 1 79  ? 5.758   38.575 73.181  1.00 21.23  ? 79  TYR A CE2   1 
ATOM   618   C CZ    . TYR A 1 79  ? 6.398   37.629 73.951  1.00 23.77  ? 79  TYR A CZ    1 
ATOM   619   O OH    . TYR A 1 79  ? 6.074   37.563 75.275  1.00 32.28  ? 79  TYR A OH    1 
ATOM   620   N N     . ASP A 1 80  ? 8.546   39.796 67.347  1.00 11.46  ? 80  ASP A N     1 
ATOM   621   C CA    . ASP A 1 80  ? 8.908   39.931 65.927  1.00 11.84  ? 80  ASP A CA    1 
ATOM   622   C C     . ASP A 1 80  ? 10.405  40.245 65.810  1.00 10.45  ? 80  ASP A C     1 
ATOM   623   O O     . ASP A 1 80  ? 11.088  39.722 64.922  1.00 10.05  ? 80  ASP A O     1 
ATOM   624   C CB    . ASP A 1 80  ? 8.149   41.083 65.256  1.00 10.77  ? 80  ASP A CB    1 
ATOM   625   C CG    . ASP A 1 80  ? 6.690   40.732 64.969  1.00 18.54  ? 80  ASP A CG    1 
ATOM   626   O OD1   . ASP A 1 80  ? 6.282   39.569 65.068  1.00 14.58  ? 80  ASP A OD1   1 
ATOM   627   O OD2   . ASP A 1 80  ? 5.917   41.653 64.643  1.00 17.22  ? 80  ASP A OD2   1 
ATOM   628   N N     . LEU A 1 81  ? 10.889  41.133 66.669  1.00 6.53   ? 81  LEU A N     1 
ATOM   629   C CA    . LEU A 1 81  ? 12.287  41.531 66.697  1.00 9.00   ? 81  LEU A CA    1 
ATOM   630   C C     . LEU A 1 81  ? 13.190  40.373 67.076  1.00 13.43  ? 81  LEU A C     1 
ATOM   631   O O     . LEU A 1 81  ? 14.265  40.109 66.531  1.00 12.06  ? 81  LEU A O     1 
ATOM   632   C CB    . LEU A 1 81  ? 12.443  42.704 67.660  1.00 9.40   ? 81  LEU A CB    1 
ATOM   633   C CG    . LEU A 1 81  ? 13.832  43.335 67.765  1.00 16.07  ? 81  LEU A CG    1 
ATOM   634   C CD1   . LEU A 1 81  ? 14.259  43.830 66.377  1.00 12.20  ? 81  LEU A CD1   1 
ATOM   635   C CD2   . LEU A 1 81  ? 13.789  44.486 68.775  1.00 12.57  ? 81  LEU A CD2   1 
ATOM   636   N N     . LYS A 1 82  ? 12.742  39.573 68.053  1.00 13.06  ? 82  LYS A N     1 
ATOM   637   C CA    . LYS A 1 82  ? 13.480  38.404 68.480  1.00 14.55  ? 82  LYS A CA    1 
ATOM   638   C C     . LYS A 1 82  ? 13.597  37.463 67.255  1.00 13.97  ? 82  LYS A C     1 
ATOM   639   O O     . LYS A 1 82  ? 14.668  36.925 66.990  1.00 13.49  ? 82  LYS A O     1 
ATOM   640   C CB    . LYS A 1 82  ? 12.787  37.717 69.656  1.00 14.02  ? 82  LYS A CB    1 
ATOM   641   C CG    . LYS A 1 82  ? 13.402  36.404 70.122  1.00 18.17  ? 82  LYS A CG    1 
ATOM   642   C CD    . LYS A 1 82  ? 12.792  36.059 71.503  1.00 21.20  ? 82  LYS A CD    1 
ATOM   643   C CE    . LYS A 1 82  ? 13.542  34.875 72.115  1.00 23.93  ? 82  LYS A CE    1 
ATOM   644   N NZ    . LYS A 1 82  ? 13.516  33.723 71.176  1.00 25.33  ? 82  LYS A NZ    1 
ATOM   645   N N     . ASP A 1 83  ? 12.477  37.201 66.560  1.00 13.22  ? 83  ASP A N     1 
ATOM   646   C CA    . ASP A 1 83  ? 12.570  36.322 65.384  1.00 13.01  ? 83  ASP A CA    1 
ATOM   647   C C     . ASP A 1 83  ? 13.476  36.927 64.303  1.00 10.88  ? 83  ASP A C     1 
ATOM   648   O O     . ASP A 1 83  ? 14.218  36.201 63.669  1.00 12.80  ? 83  ASP A O     1 
ATOM   649   C CB    . ASP A 1 83  ? 11.194  36.133 64.711  1.00 22.32  ? 83  ASP A CB    1 
ATOM   650   C CG    . ASP A 1 83  ? 10.240  35.346 65.614  1.00 25.68  ? 83  ASP A CG    1 
ATOM   651   O OD1   . ASP A 1 83  ? 10.724  34.619 66.493  1.00 22.56  ? 83  ASP A OD1   1 
ATOM   652   O OD2   . ASP A 1 83  ? 9.035   35.524 65.403  1.00 23.87  ? 83  ASP A OD2   1 
ATOM   653   N N     . LYS A 1 84  ? 13.396  38.223 64.134  1.00 10.58  ? 84  LYS A N     1 
ATOM   654   C CA    . LYS A 1 84  ? 14.212  38.895 63.105  1.00 15.56  ? 84  LYS A CA    1 
ATOM   655   C C     . LYS A 1 84  ? 15.695  38.723 63.392  1.00 16.97  ? 84  LYS A C     1 
ATOM   656   O O     . LYS A 1 84  ? 16.483  38.360 62.521  1.00 17.16  ? 84  LYS A O     1 
ATOM   657   C CB    . LYS A 1 84  ? 13.826  40.374 62.971  1.00 12.01  ? 84  LYS A CB    1 
ATOM   658   C CG    . LYS A 1 84  ? 14.419  40.987 61.683  1.00 19.22  ? 84  LYS A CG    1 
ATOM   659   C CD    . LYS A 1 84  ? 13.783  40.343 60.456  1.00 20.63  ? 84  LYS A CD    1 
ATOM   660   C CE    . LYS A 1 84  ? 14.176  40.983 59.140  1.00 24.27  ? 84  LYS A CE    1 
ATOM   661   N NZ    . LYS A 1 84  ? 13.384  40.309 58.048  1.00 21.69  ? 84  LYS A NZ    1 
ATOM   662   N N     . ALA A 1 85  ? 16.139  38.901 64.641  1.00 15.55  ? 85  ALA A N     1 
ATOM   663   C CA    . ALA A 1 85  ? 17.538  38.697 65.027  1.00 14.29  ? 85  ALA A CA    1 
ATOM   664   C C     . ALA A 1 85  ? 17.924  37.234 64.852  1.00 14.97  ? 85  ALA A C     1 
ATOM   665   O O     . ALA A 1 85  ? 19.031  36.906 64.431  1.00 15.86  ? 85  ALA A O     1 
ATOM   666   C CB    . ALA A 1 85  ? 17.770  39.138 66.477  1.00 12.67  ? 85  ALA A CB    1 
ATOM   667   N N     . LYS A 1 86  ? 17.005  36.280 65.112  1.00 15.25  ? 86  LYS A N     1 
ATOM   668   C CA    . LYS A 1 86  ? 17.346  34.884 64.871  1.00 14.29  ? 86  LYS A CA    1 
ATOM   669   C C     . LYS A 1 86  ? 17.572  34.657 63.369  1.00 18.15  ? 86  LYS A C     1 
ATOM   670   O O     . LYS A 1 86  ? 18.480  33.955 62.930  1.00 15.35  ? 86  LYS A O     1 
ATOM   671   C CB    . LYS A 1 86  ? 16.216  34.000 65.392  1.00 17.84  ? 86  LYS A CB    1 
ATOM   672   C CG    . LYS A 1 86  ? 16.396  32.519 65.096  1.00 18.46  ? 86  LYS A CG    1 
ATOM   673   C CD    . LYS A 1 86  ? 17.649  32.030 65.855  1.00 20.02  ? 86  LYS A CD    1 
ATOM   674   C CE    . LYS A 1 86  ? 17.833  30.534 65.698  1.00 23.23  ? 86  LYS A CE    1 
ATOM   675   N NZ    . LYS A 1 86  ? 19.073  30.008 66.315  1.00 22.31  ? 86  LYS A NZ    1 
ATOM   676   N N     . GLU A 1 87  ? 16.665  35.211 62.536  1.00 15.89  ? 87  GLU A N     1 
ATOM   677   C CA    . GLU A 1 87  ? 16.751  35.037 61.086  1.00 18.09  ? 87  GLU A CA    1 
ATOM   678   C C     . GLU A 1 87  ? 18.034  35.622 60.499  1.00 15.28  ? 87  GLU A C     1 
ATOM   679   O O     . GLU A 1 87  ? 18.704  34.982 59.710  1.00 15.23  ? 87  GLU A O     1 
ATOM   680   C CB    . GLU A 1 87  ? 15.528  35.720 60.459  1.00 23.36  ? 87  GLU A CB    1 
ATOM   681   C CG    . GLU A 1 87  ? 15.445  35.635 58.941  1.00 33.25  ? 87  GLU A CG    1 
ATOM   682   C CD    . GLU A 1 87  ? 14.740  36.806 58.263  1.00 37.97  ? 87  GLU A CD    1 
ATOM   683   O OE1   . GLU A 1 87  ? 13.667  37.241 58.719  1.00 37.60  ? 87  GLU A OE1   1 
ATOM   684   O OE2   . GLU A 1 87  ? 15.240  37.351 57.253  1.00 41.97  ? 87  GLU A OE2   1 
ATOM   685   N N     . LEU A 1 88  ? 18.408  36.832 60.857  1.00 12.82  ? 88  LEU A N     1 
ATOM   686   C CA    . LEU A 1 88  ? 19.553  37.523 60.326  1.00 14.16  ? 88  LEU A CA    1 
ATOM   687   C C     . LEU A 1 88  ? 20.882  37.023 60.853  1.00 17.10  ? 88  LEU A C     1 
ATOM   688   O O     . LEU A 1 88  ? 21.795  36.869 60.053  1.00 16.05  ? 88  LEU A O     1 
ATOM   689   C CB    . LEU A 1 88  ? 19.515  39.020 60.649  1.00 13.60  ? 88  LEU A CB    1 
ATOM   690   C CG    . LEU A 1 88  ? 18.462  39.827 59.885  1.00 20.54  ? 88  LEU A CG    1 
ATOM   691   C CD1   . LEU A 1 88  ? 18.449  41.278 60.350  1.00 15.49  ? 88  LEU A CD1   1 
ATOM   692   C CD2   . LEU A 1 88  ? 18.722  39.724 58.383  1.00 20.91  ? 88  LEU A CD2   1 
ATOM   693   N N     . PHE A 1 89  ? 21.025  36.882 62.172  1.00 15.73  ? 89  PHE A N     1 
ATOM   694   C CA    . PHE A 1 89  ? 22.324  36.581 62.772  1.00 16.09  ? 89  PHE A CA    1 
ATOM   695   C C     . PHE A 1 89  ? 22.418  35.165 63.300  1.00 17.21  ? 89  PHE A C     1 
ATOM   696   O O     . PHE A 1 89  ? 23.513  34.736 63.674  1.00 17.67  ? 89  PHE A O     1 
ATOM   697   C CB    . PHE A 1 89  ? 22.538  37.537 63.971  1.00 11.07  ? 89  PHE A CB    1 
ATOM   698   C CG    . PHE A 1 89  ? 22.172  38.962 63.661  1.00 15.12  ? 89  PHE A CG    1 
ATOM   699   C CD1   . PHE A 1 89  ? 22.912  39.693 62.741  1.00 16.52  ? 89  PHE A CD1   1 
ATOM   700   C CD2   . PHE A 1 89  ? 21.129  39.586 64.306  1.00 15.72  ? 89  PHE A CD2   1 
ATOM   701   C CE1   . PHE A 1 89  ? 22.627  41.018 62.452  1.00 19.44  ? 89  PHE A CE1   1 
ATOM   702   C CE2   . PHE A 1 89  ? 20.832  40.913 64.007  1.00 14.92  ? 89  PHE A CE2   1 
ATOM   703   C CZ    . PHE A 1 89  ? 21.560  41.624 63.083  1.00 15.58  ? 89  PHE A CZ    1 
ATOM   704   N N     . ASN A 1 90  ? 21.267  34.503 63.483  1.00 15.57  ? 90  ASN A N     1 
ATOM   705   C CA    . ASN A 1 90  ? 21.219  33.192 64.106  1.00 15.57  ? 90  ASN A CA    1 
ATOM   706   C C     . ASN A 1 90  ? 21.503  33.303 65.620  1.00 18.24  ? 90  ASN A C     1 
ATOM   707   O O     . ASN A 1 90  ? 21.991  32.372 66.240  1.00 18.31  ? 90  ASN A O     1 
ATOM   708   C CB    . ASN A 1 90  ? 22.209  32.225 63.475  1.00 19.11  ? 90  ASN A CB    1 
ATOM   709   C CG    . ASN A 1 90  ? 21.788  30.782 63.666  1.00 27.51  ? 90  ASN A CG    1 
ATOM   710   O OD1   . ASN A 1 90  ? 20.646  30.463 64.003  1.00 23.61  ? 90  ASN A OD1   1 
ATOM   711   N ND2   . ASN A 1 90  ? 22.730  29.877 63.454  1.00 27.58  ? 90  ASN A ND2   1 
ATOM   712   N N     . TYR A 1 91  ? 21.207  34.428 66.247  1.00 15.32  ? 91  TYR A N     1 
ATOM   713   C CA    . TYR A 1 91  ? 21.401  34.659 67.672  1.00 17.40  ? 91  TYR A CA    1 
ATOM   714   C C     . TYR A 1 91  ? 20.070  34.428 68.381  1.00 19.98  ? 91  TYR A C     1 
ATOM   715   O O     . TYR A 1 91  ? 18.988  34.796 67.896  1.00 16.53  ? 91  TYR A O     1 
ATOM   716   C CB    . TYR A 1 91  ? 22.014  36.038 67.929  1.00 15.11  ? 91  TYR A CB    1 
ATOM   717   C CG    . TYR A 1 91  ? 23.470  36.265 67.542  1.00 15.33  ? 91  TYR A CG    1 
ATOM   718   C CD1   . TYR A 1 91  ? 24.174  35.357 66.763  1.00 13.88  ? 91  TYR A CD1   1 
ATOM   719   C CD2   . TYR A 1 91  ? 24.147  37.393 67.992  1.00 10.78  ? 91  TYR A CD2   1 
ATOM   720   C CE1   . TYR A 1 91  ? 25.488  35.533 66.393  1.00 15.33  ? 91  TYR A CE1   1 
ATOM   721   C CE2   . TYR A 1 91  ? 25.474  37.605 67.613  1.00 13.68  ? 91  TYR A CE2   1 
ATOM   722   C CZ    . TYR A 1 91  ? 26.134  36.675 66.833  1.00 15.40  ? 91  TYR A CZ    1 
ATOM   723   O OH    . TYR A 1 91  ? 27.441  36.876 66.467  1.00 19.16  ? 91  TYR A OH    1 
ATOM   724   N N     . ASP A 1 92  ? 20.134  33.749 69.523  1.00 16.94  ? 92  ASP A N     1 
ATOM   725   C CA    . ASP A 1 92  ? 18.939  33.321 70.232  1.00 17.31  ? 92  ASP A CA    1 
ATOM   726   C C     . ASP A 1 92  ? 18.367  34.265 71.258  1.00 14.17  ? 92  ASP A C     1 
ATOM   727   O O     . ASP A 1 92  ? 17.275  33.996 71.749  1.00 16.01  ? 92  ASP A O     1 
ATOM   728   C CB    . ASP A 1 92  ? 19.233  31.999 70.943  1.00 17.64  ? 92  ASP A CB    1 
ATOM   729   C CG    . ASP A 1 92  ? 19.381  30.852 69.957  1.00 27.14  ? 92  ASP A CG    1 
ATOM   730   O OD1   . ASP A 1 92  ? 18.823  30.900 68.859  1.00 27.16  ? 92  ASP A OD1   1 
ATOM   731   O OD2   . ASP A 1 92  ? 20.078  29.868 70.266  1.00 31.96  ? 92  ASP A OD2   1 
ATOM   732   N N     . TYR A 1 93  ? 19.064  35.305 71.661  1.00 13.44  ? 93  TYR A N     1 
ATOM   733   C CA    . TYR A 1 93  ? 18.597  36.182 72.730  1.00 15.00  ? 93  TYR A CA    1 
ATOM   734   C C     . TYR A 1 93  ? 18.753  37.634 72.325  1.00 17.57  ? 93  TYR A C     1 
ATOM   735   O O     . TYR A 1 93  ? 19.801  38.047 71.802  1.00 13.21  ? 93  TYR A O     1 
ATOM   736   C CB    . TYR A 1 93  ? 19.428  36.021 74.031  1.00 14.88  ? 93  TYR A CB    1 
ATOM   737   C CG    . TYR A 1 93  ? 19.479  34.589 74.523  1.00 20.32  ? 93  TYR A CG    1 
ATOM   738   C CD1   . TYR A 1 93  ? 18.381  34.042 75.162  1.00 22.88  ? 93  TYR A CD1   1 
ATOM   739   C CD2   . TYR A 1 93  ? 20.597  33.785 74.326  1.00 22.44  ? 93  TYR A CD2   1 
ATOM   740   C CE1   . TYR A 1 93  ? 18.394  32.729 75.616  1.00 25.93  ? 93  TYR A CE1   1 
ATOM   741   C CE2   . TYR A 1 93  ? 20.624  32.474 74.775  1.00 24.77  ? 93  TYR A CE2   1 
ATOM   742   C CZ    . TYR A 1 93  ? 19.515  31.956 75.423  1.00 26.44  ? 93  TYR A CZ    1 
ATOM   743   O OH    . TYR A 1 93  ? 19.542  30.649 75.855  1.00 28.33  ? 93  TYR A OH    1 
ATOM   744   N N     . ILE A 1 94  ? 17.712  38.417 72.618  1.00 11.68  ? 94  ILE A N     1 
ATOM   745   C CA    . ILE A 1 94  ? 17.849  39.848 72.344  1.00 13.92  ? 94  ILE A CA    1 
ATOM   746   C C     . ILE A 1 94  ? 17.416  40.629 73.574  1.00 12.44  ? 94  ILE A C     1 
ATOM   747   O O     . ILE A 1 94  ? 16.590  40.202 74.373  1.00 14.29  ? 94  ILE A O     1 
ATOM   748   C CB    . ILE A 1 94  ? 16.960  40.320 71.178  1.00 16.01  ? 94  ILE A CB    1 
ATOM   749   C CG1   . ILE A 1 94  ? 15.472  40.035 71.460  1.00 16.54  ? 94  ILE A CG1   1 
ATOM   750   C CG2   . ILE A 1 94  ? 17.382  39.578 69.891  1.00 9.34   ? 94  ILE A CG2   1 
ATOM   751   C CD1   . ILE A 1 94  ? 14.549  40.955 70.667  1.00 17.15  ? 94  ILE A CD1   1 
ATOM   752   N N     . ILE A 1 95  ? 17.908  41.832 73.647  1.00 10.41  ? 95  ILE A N     1 
ATOM   753   C CA    . ILE A 1 95  ? 17.521  42.845 74.596  1.00 12.14  ? 95  ILE A CA    1 
ATOM   754   C C     . ILE A 1 95  ? 17.505  44.145 73.812  1.00 15.09  ? 95  ILE A C     1 
ATOM   755   O O     . ILE A 1 95  ? 18.534  44.606 73.395  1.00 13.36  ? 95  ILE A O     1 
ATOM   756   C CB    . ILE A 1 95  ? 18.464  43.033 75.817  1.00 14.62  ? 95  ILE A CB    1 
ATOM   757   C CG1   . ILE A 1 95  ? 18.737  41.703 76.521  1.00 15.24  ? 95  ILE A CG1   1 
ATOM   758   C CG2   . ILE A 1 95  ? 17.865  44.048 76.781  1.00 12.68  ? 95  ILE A CG2   1 
ATOM   759   C CD1   . ILE A 1 95  ? 19.928  41.719 77.442  1.00 25.35  ? 95  ILE A CD1   1 
ATOM   760   N N     . PRO A 1 96  ? 16.338  44.717 73.627  1.00 17.02  ? 96  PRO A N     1 
ATOM   761   C CA    . PRO A 1 96  ? 16.231  45.995 72.923  1.00 16.30  ? 96  PRO A CA    1 
ATOM   762   C C     . PRO A 1 96  ? 16.883  47.058 73.792  1.00 14.24  ? 96  PRO A C     1 
ATOM   763   O O     . PRO A 1 96  ? 16.935  46.879 75.025  1.00 15.32  ? 96  PRO A O     1 
ATOM   764   C CB    . PRO A 1 96  ? 14.752  46.261 72.771  1.00 16.50  ? 96  PRO A CB    1 
ATOM   765   C CG    . PRO A 1 96  ? 14.071  45.196 73.548  1.00 20.72  ? 96  PRO A CG    1 
ATOM   766   C CD    . PRO A 1 96  ? 15.028  44.202 74.093  1.00 15.07  ? 96  PRO A CD    1 
ATOM   767   N N     . ALA A 1 97  ? 17.332  48.139 73.189  1.00 11.03  ? 97  ALA A N     1 
ATOM   768   C CA    . ALA A 1 97  ? 17.938  49.216 73.943  1.00 11.31  ? 97  ALA A CA    1 
ATOM   769   C C     . ALA A 1 97  ? 17.511  50.513 73.272  1.00 12.00  ? 97  ALA A C     1 
ATOM   770   O O     . ALA A 1 97  ? 17.234  50.427 72.074  1.00 11.46  ? 97  ALA A O     1 
ATOM   771   C CB    . ALA A 1 97  ? 19.443  49.118 74.012  1.00 13.59  ? 97  ALA A CB    1 
ATOM   772   N N     . HIS A 1 98  ? 17.525  51.622 73.999  1.00 8.27   ? 98  HIS A N     1 
ATOM   773   C CA    . HIS A 1 98  ? 17.046  52.847 73.362  1.00 11.19  ? 98  HIS A CA    1 
ATOM   774   C C     . HIS A 1 98  ? 17.984  53.301 72.238  1.00 15.54  ? 98  HIS A C     1 
ATOM   775   O O     . HIS A 1 98  ? 17.476  53.913 71.293  1.00 10.25  ? 98  HIS A O     1 
ATOM   776   C CB    . HIS A 1 98  ? 16.746  53.975 74.325  1.00 8.90   ? 98  HIS A CB    1 
ATOM   777   C CG    . HIS A 1 98  ? 17.944  54.749 74.757  1.00 14.41  ? 98  HIS A CG    1 
ATOM   778   N ND1   . HIS A 1 98  ? 18.829  54.275 75.700  1.00 11.48  ? 98  HIS A ND1   1 
ATOM   779   C CD2   . HIS A 1 98  ? 18.399  55.965 74.402  1.00 12.57  ? 98  HIS A CD2   1 
ATOM   780   C CE1   . HIS A 1 98  ? 19.782  55.173 75.922  1.00 12.40  ? 98  HIS A CE1   1 
ATOM   781   N NE2   . HIS A 1 98  ? 19.542  56.220 75.125  1.00 16.52  ? 98  HIS A NE2   1 
ATOM   782   N N     . GLN A 1 99  ? 19.285  53.046 72.308  1.00 11.67  ? 99  GLN A N     1 
ATOM   783   C CA    . GLN A 1 99  ? 20.192  53.292 71.196  1.00 13.60  ? 99  GLN A CA    1 
ATOM   784   C C     . GLN A 1 99  ? 21.496  52.531 71.453  1.00 15.61  ? 99  GLN A C     1 
ATOM   785   O O     . GLN A 1 99  ? 21.581  51.771 72.449  1.00 11.00  ? 99  GLN A O     1 
ATOM   786   C CB    . GLN A 1 99  ? 20.370  54.729 70.798  1.00 9.45   ? 99  GLN A CB    1 
ATOM   787   C CG    . GLN A 1 99  ? 21.033  55.635 71.838  1.00 12.86  ? 99  GLN A CG    1 
ATOM   788   C CD    . GLN A 1 99  ? 21.090  57.064 71.318  1.00 20.53  ? 99  GLN A CD    1 
ATOM   789   O OE1   . GLN A 1 99  ? 20.036  57.650 71.122  1.00 12.61  ? 99  GLN A OE1   1 
ATOM   790   N NE2   . GLN A 1 99  ? 22.274  57.635 71.079  1.00 12.14  ? 99  GLN A NE2   1 
ATOM   791   N N     . GLY A 1 100 ? 22.483  52.639 70.566  1.00 10.25  ? 100 GLY A N     1 
ATOM   792   C CA    . GLY A 1 100 ? 23.685  51.835 70.643  1.00 8.62   ? 100 GLY A CA    1 
ATOM   793   C C     . GLY A 1 100 ? 24.472  52.019 71.950  1.00 10.05  ? 100 GLY A C     1 
ATOM   794   O O     . GLY A 1 100 ? 24.935  51.031 72.503  1.00 11.03  ? 100 GLY A O     1 
ATOM   795   N N     . ARG A 1 101 ? 24.595  53.256 72.437  1.00 9.61   ? 101 ARG A N     1 
ATOM   796   C CA    . ARG A 1 101 ? 25.315  53.421 73.722  1.00 12.85  ? 101 ARG A CA    1 
ATOM   797   C C     . ARG A 1 101 ? 24.538  52.851 74.904  1.00 16.90  ? 101 ARG A C     1 
ATOM   798   O O     . ARG A 1 101 ? 25.119  52.425 75.896  1.00 14.45  ? 101 ARG A O     1 
ATOM   799   C CB    . ARG A 1 101 ? 25.690  54.868 73.948  1.00 7.24   ? 101 ARG A CB    1 
ATOM   800   C CG    . ARG A 1 101 ? 24.580  55.861 74.216  1.00 10.28  ? 101 ARG A CG    1 
ATOM   801   C CD    . ARG A 1 101 ? 25.132  57.269 73.918  1.00 13.68  ? 101 ARG A CD    1 
ATOM   802   N NE    . ARG A 1 101 ? 25.235  57.472 72.477  1.00 14.04  ? 101 ARG A NE    1 
ATOM   803   C CZ    . ARG A 1 101 ? 25.610  58.617 71.924  1.00 16.35  ? 101 ARG A CZ    1 
ATOM   804   N NH1   . ARG A 1 101 ? 25.918  59.665 72.687  1.00 9.59   ? 101 ARG A NH1   1 
ATOM   805   N NH2   . ARG A 1 101 ? 25.645  58.669 70.596  1.00 13.62  ? 101 ARG A NH2   1 
ATOM   806   N N     . GLY A 1 102 ? 23.216  52.688 74.751  1.00 13.94  ? 102 GLY A N     1 
ATOM   807   C CA    . GLY A 1 102 ? 22.417  52.050 75.785  1.00 9.64   ? 102 GLY A CA    1 
ATOM   808   C C     . GLY A 1 102 ? 22.744  50.570 75.800  1.00 13.32  ? 102 GLY A C     1 
ATOM   809   O O     . GLY A 1 102 ? 22.943  49.930 76.854  1.00 12.92  ? 102 GLY A O     1 
ATOM   810   N N     . ALA A 1 103 ? 22.816  49.984 74.592  1.00 7.77   ? 103 ALA A N     1 
ATOM   811   C CA    . ALA A 1 103 ? 23.225  48.611 74.438  1.00 12.06  ? 103 ALA A CA    1 
ATOM   812   C C     . ALA A 1 103 ? 24.651  48.412 75.020  1.00 14.55  ? 103 ALA A C     1 
ATOM   813   O O     . ALA A 1 103 ? 24.877  47.393 75.686  1.00 11.74  ? 103 ALA A O     1 
ATOM   814   C CB    . ALA A 1 103 ? 23.247  48.198 72.961  1.00 10.36  ? 103 ALA A CB    1 
ATOM   815   N N     . GLU A 1 104 ? 25.568  49.339 74.813  1.00 12.05  ? 104 GLU A N     1 
ATOM   816   C CA    . GLU A 1 104 ? 26.917  49.224 75.370  1.00 17.65  ? 104 GLU A CA    1 
ATOM   817   C C     . GLU A 1 104 ? 26.858  49.256 76.916  1.00 18.34  ? 104 GLU A C     1 
ATOM   818   O O     . GLU A 1 104 ? 27.505  48.474 77.616  1.00 17.33  ? 104 GLU A O     1 
ATOM   819   C CB    . GLU A 1 104 ? 27.863  50.339 74.861  1.00 9.89   ? 104 GLU A CB    1 
ATOM   820   C CG    . GLU A 1 104 ? 28.192  50.120 73.367  1.00 16.01  ? 104 GLU A CG    1 
ATOM   821   C CD    . GLU A 1 104 ? 28.675  51.346 72.606  1.00 15.17  ? 104 GLU A CD    1 
ATOM   822   O OE1   . GLU A 1 104 ? 28.624  52.489 73.127  1.00 12.92  ? 104 GLU A OE1   1 
ATOM   823   O OE2   . GLU A 1 104 ? 29.094  51.132 71.411  1.00 15.88  ? 104 GLU A OE2   1 
ATOM   824   N N     . ASN A 1 105 ? 26.060  50.183 77.431  1.00 14.47  ? 105 ASN A N     1 
ATOM   825   C CA    . ASN A 1 105 ? 25.901  50.336 78.877  1.00 16.67  ? 105 ASN A CA    1 
ATOM   826   C C     . ASN A 1 105 ? 25.354  49.075 79.527  1.00 16.67  ? 105 ASN A C     1 
ATOM   827   O O     . ASN A 1 105 ? 25.680  48.747 80.666  1.00 19.28  ? 105 ASN A O     1 
ATOM   828   C CB    . ASN A 1 105 ? 25.032  51.531 79.231  1.00 15.22  ? 105 ASN A CB    1 
ATOM   829   C CG    . ASN A 1 105 ? 24.998  51.766 80.736  1.00 24.99  ? 105 ASN A CG    1 
ATOM   830   O OD1   . ASN A 1 105 ? 25.969  51.511 81.434  1.00 19.80  ? 105 ASN A OD1   1 
ATOM   831   N ND2   . ASN A 1 105 ? 23.889  52.239 81.269  1.00 14.98  ? 105 ASN A ND2   1 
ATOM   832   N N     . ILE A 1 106 ? 24.479  48.346 78.869  1.00 15.62  ? 106 ILE A N     1 
ATOM   833   C CA    . ILE A 1 106 ? 23.921  47.107 79.321  1.00 17.98  ? 106 ILE A CA    1 
ATOM   834   C C     . ILE A 1 106 ? 24.957  45.985 79.286  1.00 20.91  ? 106 ILE A C     1 
ATOM   835   O O     . ILE A 1 106 ? 25.028  45.227 80.238  1.00 20.07  ? 106 ILE A O     1 
ATOM   836   C CB    . ILE A 1 106 ? 22.743  46.669 78.436  1.00 15.59  ? 106 ILE A CB    1 
ATOM   837   C CG1   . ILE A 1 106 ? 21.502  47.509 78.760  1.00 23.37  ? 106 ILE A CG1   1 
ATOM   838   C CG2   . ILE A 1 106 ? 22.428  45.193 78.544  1.00 16.67  ? 106 ILE A CG2   1 
ATOM   839   C CD1   . ILE A 1 106 ? 20.401  47.236 77.700  1.00 20.23  ? 106 ILE A CD1   1 
ATOM   840   N N     . LEU A 1 107 ? 25.652  45.820 78.170  1.00 14.81  ? 107 LEU A N     1 
ATOM   841   C CA    . LEU A 1 107 ? 26.481  44.652 77.992  1.00 16.42  ? 107 LEU A CA    1 
ATOM   842   C C     . LEU A 1 107 ? 27.891  44.758 78.582  1.00 17.74  ? 107 LEU A C     1 
ATOM   843   O O     . LEU A 1 107 ? 28.324  43.760 79.146  1.00 15.39  ? 107 LEU A O     1 
ATOM   844   C CB    . LEU A 1 107 ? 26.605  44.341 76.465  1.00 17.76  ? 107 LEU A CB    1 
ATOM   845   C CG    . LEU A 1 107 ? 27.326  43.039 76.122  1.00 19.96  ? 107 LEU A CG    1 
ATOM   846   C CD1   . LEU A 1 107 ? 26.656  41.818 76.736  1.00 19.26  ? 107 LEU A CD1   1 
ATOM   847   C CD2   . LEU A 1 107 ? 27.399  42.903 74.597  1.00 18.31  ? 107 LEU A CD2   1 
ATOM   848   N N     . PHE A 1 108 ? 28.594  45.863 78.404  1.00 15.57  ? 108 PHE A N     1 
ATOM   849   C CA    . PHE A 1 108 ? 29.989  45.961 78.811  1.00 20.14  ? 108 PHE A CA    1 
ATOM   850   C C     . PHE A 1 108 ? 30.252  45.725 80.289  1.00 21.89  ? 108 PHE A C     1 
ATOM   851   O O     . PHE A 1 108 ? 31.099  44.875 80.605  1.00 22.40  ? 108 PHE A O     1 
ATOM   852   C CB    . PHE A 1 108 ? 30.634  47.226 78.240  1.00 18.80  ? 108 PHE A CB    1 
ATOM   853   C CG    . PHE A 1 108 ? 30.855  47.229 76.742  1.00 24.18  ? 108 PHE A CG    1 
ATOM   854   C CD1   . PHE A 1 108 ? 30.345  46.239 75.906  1.00 22.89  ? 108 PHE A CD1   1 
ATOM   855   C CD2   . PHE A 1 108 ? 31.544  48.263 76.140  1.00 26.89  ? 108 PHE A CD2   1 
ATOM   856   C CE1   . PHE A 1 108 ? 30.554  46.256 74.533  1.00 26.64  ? 108 PHE A CE1   1 
ATOM   857   C CE2   . PHE A 1 108 ? 31.755  48.283 74.765  1.00 30.84  ? 108 PHE A CE2   1 
ATOM   858   C CZ    . PHE A 1 108 ? 31.262  47.289 73.941  1.00 21.44  ? 108 PHE A CZ    1 
ATOM   859   N N     . PRO A 1 109 ? 29.506  46.322 81.211  1.00 21.25  ? 109 PRO A N     1 
ATOM   860   C CA    . PRO A 1 109 ? 29.691  46.114 82.633  1.00 20.01  ? 109 PRO A CA    1 
ATOM   861   C C     . PRO A 1 109 ? 29.460  44.649 82.963  1.00 21.81  ? 109 PRO A C     1 
ATOM   862   O O     . PRO A 1 109 ? 30.163  44.034 83.754  1.00 21.65  ? 109 PRO A O     1 
ATOM   863   C CB    . PRO A 1 109 ? 28.672  47.051 83.318  1.00 21.27  ? 109 PRO A CB    1 
ATOM   864   C CG    . PRO A 1 109 ? 28.457  48.140 82.293  1.00 18.49  ? 109 PRO A CG    1 
ATOM   865   C CD    . PRO A 1 109 ? 28.489  47.372 80.970  1.00 18.13  ? 109 PRO A CD    1 
ATOM   866   N N     . VAL A 1 110 ? 28.517  44.017 82.279  1.00 19.15  ? 110 VAL A N     1 
ATOM   867   C CA    . VAL A 1 110 ? 28.201  42.623 82.444  1.00 19.24  ? 110 VAL A CA    1 
ATOM   868   C C     . VAL A 1 110 ? 29.337  41.729 81.982  1.00 23.73  ? 110 VAL A C     1 
ATOM   869   O O     . VAL A 1 110 ? 29.599  40.737 82.666  1.00 23.57  ? 110 VAL A O     1 
ATOM   870   C CB    . VAL A 1 110 ? 26.879  42.289 81.725  1.00 23.80  ? 110 VAL A CB    1 
ATOM   871   C CG1   . VAL A 1 110 ? 26.761  40.803 81.500  1.00 19.28  ? 110 VAL A CG1   1 
ATOM   872   C CG2   . VAL A 1 110 ? 25.724  42.851 82.547  1.00 22.69  ? 110 VAL A CG2   1 
ATOM   873   N N     . LEU A 1 111 ? 30.021  42.041 80.905  1.00 19.96  ? 111 LEU A N     1 
ATOM   874   C CA    . LEU A 1 111 ? 31.142  41.235 80.422  1.00 22.75  ? 111 LEU A CA    1 
ATOM   875   C C     . LEU A 1 111 ? 32.317  41.339 81.424  1.00 19.73  ? 111 LEU A C     1 
ATOM   876   O O     . LEU A 1 111 ? 33.008  40.353 81.660  1.00 20.87  ? 111 LEU A O     1 
ATOM   877   C CB    . LEU A 1 111 ? 31.594  41.634 79.012  1.00 16.90  ? 111 LEU A CB    1 
ATOM   878   C CG    . LEU A 1 111 ? 30.588  41.418 77.868  1.00 21.43  ? 111 LEU A CG    1 
ATOM   879   C CD1   . LEU A 1 111 ? 31.111  42.034 76.562  1.00 16.06  ? 111 LEU A CD1   1 
ATOM   880   C CD2   . LEU A 1 111 ? 30.250  39.946 77.684  1.00 19.41  ? 111 LEU A CD2   1 
ATOM   881   N N     . LEU A 1 112 ? 32.540  42.526 81.961  1.00 16.75  ? 112 LEU A N     1 
ATOM   882   C CA    . LEU A 1 112 ? 33.584  42.769 82.930  1.00 22.05  ? 112 LEU A CA    1 
ATOM   883   C C     . LEU A 1 112 ? 33.344  41.903 84.180  1.00 27.99  ? 112 LEU A C     1 
ATOM   884   O O     . LEU A 1 112 ? 34.124  41.038 84.558  1.00 23.54  ? 112 LEU A O     1 
ATOM   885   C CB    . LEU A 1 112 ? 33.648  44.232 83.353  1.00 19.22  ? 112 LEU A CB    1 
ATOM   886   C CG    . LEU A 1 112 ? 34.653  44.573 84.479  1.00 25.94  ? 112 LEU A CG    1 
ATOM   887   C CD1   . LEU A 1 112 ? 36.062  44.135 84.123  1.00 21.21  ? 112 LEU A CD1   1 
ATOM   888   C CD2   . LEU A 1 112 ? 34.618  46.055 84.796  1.00 18.57  ? 112 LEU A CD2   1 
ATOM   889   N N     . LYS A 1 113 ? 32.172  42.086 84.773  1.00 28.55  ? 113 LYS A N     1 
ATOM   890   C CA    . LYS A 1 113 ? 31.755  41.327 85.945  1.00 29.74  ? 113 LYS A CA    1 
ATOM   891   C C     . LYS A 1 113 ? 31.863  39.832 85.711  1.00 30.57  ? 113 LYS A C     1 
ATOM   892   O O     . LYS A 1 113 ? 32.350  39.106 86.570  1.00 30.31  ? 113 LYS A O     1 
ATOM   893   C CB    . LYS A 1 113 ? 30.345  41.710 86.369  1.00 38.46  ? 113 LYS A CB    1 
ATOM   894   C CG    . LYS A 1 113 ? 29.861  40.987 87.612  1.00 55.12  ? 113 LYS A CG    1 
ATOM   895   C CD    . LYS A 1 113 ? 28.435  41.364 87.964  1.00 71.35  ? 113 LYS A CD    1 
ATOM   896   C CE    . LYS A 1 113 ? 27.625  40.164 88.440  1.00 77.86  ? 113 LYS A CE    1 
ATOM   897   N NZ    . LYS A 1 113 ? 26.273  40.579 88.918  1.00 82.47  ? 113 LYS A NZ    1 
ATOM   898   N N     . TYR A 1 114 ? 31.403  39.302 84.583  1.00 27.11  ? 114 TYR A N     1 
ATOM   899   C CA    . TYR A 1 114 ? 31.513  37.905 84.240  1.00 29.14  ? 114 TYR A CA    1 
ATOM   900   C C     . TYR A 1 114 ? 32.955  37.409 84.167  1.00 33.24  ? 114 TYR A C     1 
ATOM   901   O O     . TYR A 1 114 ? 33.217  36.253 84.532  1.00 34.51  ? 114 TYR A O     1 
ATOM   902   C CB    . TYR A 1 114 ? 30.830  37.729 82.880  1.00 28.96  ? 114 TYR A CB    1 
ATOM   903   C CG    . TYR A 1 114 ? 30.725  36.327 82.352  1.00 30.28  ? 114 TYR A CG    1 
ATOM   904   C CD1   . TYR A 1 114 ? 29.747  35.458 82.809  1.00 30.63  ? 114 TYR A CD1   1 
ATOM   905   C CD2   . TYR A 1 114 ? 31.606  35.873 81.377  1.00 31.92  ? 114 TYR A CD2   1 
ATOM   906   C CE1   . TYR A 1 114 ? 29.650  34.161 82.318  1.00 29.94  ? 114 TYR A CE1   1 
ATOM   907   C CE2   . TYR A 1 114 ? 31.516  34.593 80.875  1.00 33.66  ? 114 TYR A CE2   1 
ATOM   908   C CZ    . TYR A 1 114 ? 30.541  33.745 81.353  1.00 35.22  ? 114 TYR A CZ    1 
ATOM   909   O OH    . TYR A 1 114 ? 30.447  32.463 80.828  1.00 38.48  ? 114 TYR A OH    1 
ATOM   910   N N     . LYS A 1 115 ? 33.886  38.192 83.688  1.00 33.44  ? 115 LYS A N     1 
ATOM   911   C CA    . LYS A 1 115 ? 35.290  37.794 83.588  1.00 37.73  ? 115 LYS A CA    1 
ATOM   912   C C     . LYS A 1 115 ? 35.890  37.846 85.002  1.00 40.44  ? 115 LYS A C     1 
ATOM   913   O O     . LYS A 1 115 ? 36.613  36.936 85.401  1.00 40.04  ? 115 LYS A O     1 
ATOM   914   C CB    . LYS A 1 115 ? 36.034  38.661 82.596  1.00 33.69  ? 115 LYS A CB    1 
ATOM   915   C CG    . LYS A 1 115 ? 37.427  38.235 82.179  1.00 36.35  ? 115 LYS A CG    1 
ATOM   916   C CD    . LYS A 1 115 ? 37.474  37.322 80.976  1.00 32.62  ? 115 LYS A CD    1 
ATOM   917   C CE    . LYS A 1 115 ? 38.880  37.152 80.449  1.00 30.93  ? 115 LYS A CE    1 
ATOM   918   N NZ    . LYS A 1 115 ? 39.004  36.530 79.122  1.00 27.12  ? 115 LYS A NZ    1 
ATOM   919   N N     . GLN A 1 116 ? 35.524  38.853 85.790  1.00 39.27  ? 116 GLN A N     1 
ATOM   920   C CA    . GLN A 1 116 ? 35.986  39.005 87.155  1.00 43.33  ? 116 GLN A CA    1 
ATOM   921   C C     . GLN A 1 116 ? 35.474  37.914 88.091  1.00 50.02  ? 116 GLN A C     1 
ATOM   922   O O     . GLN A 1 116 ? 36.171  37.426 88.992  1.00 48.40  ? 116 GLN A O     1 
ATOM   923   C CB    . GLN A 1 116 ? 35.554  40.349 87.743  1.00 31.15  ? 116 GLN A CB    1 
ATOM   924   C CG    . GLN A 1 116 ? 36.414  41.532 87.308  1.00 30.06  ? 116 GLN A CG    1 
ATOM   925   C CD    . GLN A 1 116 ? 35.792  42.827 87.810  1.00 31.89  ? 116 GLN A CD    1 
ATOM   926   O OE1   . GLN A 1 116 ? 34.615  42.837 88.177  1.00 38.89  ? 116 GLN A OE1   1 
ATOM   927   N NE2   . GLN A 1 116 ? 36.567  43.900 87.811  1.00 38.47  ? 116 GLN A NE2   1 
ATOM   928   N N     . LYS A 1 117 ? 34.248  37.464 87.881  1.00 55.82  ? 117 LYS A N     1 
ATOM   929   C CA    . LYS A 1 117 ? 33.629  36.414 88.674  1.00 63.62  ? 117 LYS A CA    1 
ATOM   930   C C     . LYS A 1 117 ? 34.550  35.204 88.755  1.00 68.35  ? 117 LYS A C     1 
ATOM   931   O O     . LYS A 1 117 ? 34.730  34.651 89.844  1.00 69.70  ? 117 LYS A O     1 
ATOM   932   C CB    . LYS A 1 117 ? 32.255  36.056 88.135  1.00 74.87  ? 117 LYS A CB    1 
ATOM   933   C CG    . LYS A 1 117 ? 32.067  34.685 87.524  1.00 85.30  ? 117 LYS A CG    1 
ATOM   934   C CD    . LYS A 1 117 ? 30.757  34.535 86.772  1.00 93.54  ? 117 LYS A CD    1 
ATOM   935   C CE    . LYS A 1 117 ? 29.564  34.634 87.714  1.00 98.95  ? 117 LYS A CE    1 
ATOM   936   N NZ    . LYS A 1 117 ? 28.560  35.614 87.215  1.00 101.59 ? 117 LYS A NZ    1 
ATOM   937   N N     . GLU A 1 118 ? 35.178  34.828 87.649  1.00 69.40  ? 118 GLU A N     1 
ATOM   938   C CA    . GLU A 1 118 ? 36.148  33.765 87.579  1.00 71.61  ? 118 GLU A CA    1 
ATOM   939   C C     . GLU A 1 118 ? 37.474  34.059 88.266  1.00 69.18  ? 118 GLU A C     1 
ATOM   940   O O     . GLU A 1 118 ? 38.295  33.146 88.370  1.00 71.25  ? 118 GLU A O     1 
ATOM   941   C CB    . GLU A 1 118 ? 36.436  33.422 86.106  1.00 81.93  ? 118 GLU A CB    1 
ATOM   942   C CG    . GLU A 1 118 ? 35.202  33.060 85.307  1.00 94.02  ? 118 GLU A CG    1 
ATOM   943   C CD    . GLU A 1 118 ? 35.335  33.316 83.821  1.00 101.31 ? 118 GLU A CD    1 
ATOM   944   O OE1   . GLU A 1 118 ? 36.308  33.975 83.397  1.00 106.40 ? 118 GLU A OE1   1 
ATOM   945   O OE2   . GLU A 1 118 ? 34.453  32.858 83.061  1.00 103.96 ? 118 GLU A OE2   1 
ATOM   946   N N     . GLY A 1 119 ? 37.748  35.275 88.695  1.00 67.26  ? 119 GLY A N     1 
ATOM   947   C CA    . GLY A 1 119 ? 39.003  35.616 89.354  1.00 64.35  ? 119 GLY A CA    1 
ATOM   948   C C     . GLY A 1 119 ? 39.974  36.268 88.376  1.00 62.22  ? 119 GLY A C     1 
ATOM   949   O O     . GLY A 1 119 ? 41.093  36.642 88.730  1.00 62.40  ? 119 GLY A O     1 
ATOM   950   N N     . LYS A 1 120 ? 39.508  36.428 87.132  1.00 56.50  ? 120 LYS A N     1 
ATOM   951   C CA    . LYS A 1 120 ? 40.312  37.045 86.089  1.00 48.92  ? 120 LYS A CA    1 
ATOM   952   C C     . LYS A 1 120 ? 40.030  38.529 85.993  1.00 44.76  ? 120 LYS A C     1 
ATOM   953   O O     . LYS A 1 120 ? 39.450  39.108 86.905  1.00 40.85  ? 120 LYS A O     1 
ATOM   954   C CB    . LYS A 1 120 ? 40.014  36.335 84.769  1.00 51.57  ? 120 LYS A CB    1 
ATOM   955   C CG    . LYS A 1 120 ? 40.117  34.825 84.912  1.00 57.65  ? 120 LYS A CG    1 
ATOM   956   C CD    . LYS A 1 120 ? 39.876  34.108 83.601  1.00 60.30  ? 120 LYS A CD    1 
ATOM   957   C CE    . LYS A 1 120 ? 40.213  32.634 83.720  1.00 65.25  ? 120 LYS A CE    1 
ATOM   958   N NZ    . LYS A 1 120 ? 39.351  31.811 82.830  1.00 75.22  ? 120 LYS A NZ    1 
ATOM   959   N N     . ALA A 1 121 ? 40.460  39.154 84.908  1.00 41.85  ? 121 ALA A N     1 
ATOM   960   C CA    . ALA A 1 121 ? 40.283  40.575 84.677  1.00 39.73  ? 121 ALA A CA    1 
ATOM   961   C C     . ALA A 1 121 ? 40.818  41.490 85.766  1.00 37.81  ? 121 ALA A C     1 
ATOM   962   O O     . ALA A 1 121 ? 40.145  42.488 86.058  1.00 35.58  ? 121 ALA A O     1 
ATOM   963   C CB    . ALA A 1 121 ? 38.797  40.859 84.438  1.00 39.76  ? 121 ALA A CB    1 
ATOM   964   N N     . LYS A 1 122 ? 42.032  41.261 86.238  1.00 37.00  ? 122 LYS A N     1 
ATOM   965   C CA    . LYS A 1 122 ? 42.654  42.119 87.242  1.00 33.90  ? 122 LYS A CA    1 
ATOM   966   C C     . LYS A 1 122 ? 43.121  43.430 86.662  1.00 31.98  ? 122 LYS A C     1 
ATOM   967   O O     . LYS A 1 122 ? 43.032  44.453 87.367  1.00 32.45  ? 122 LYS A O     1 
ATOM   968   C CB    . LYS A 1 122 ? 43.844  41.420 87.922  1.00 47.03  ? 122 LYS A CB    1 
ATOM   969   C CG    . LYS A 1 122 ? 43.391  40.337 88.892  1.00 54.40  ? 122 LYS A CG    1 
ATOM   970   C CD    . LYS A 1 122 ? 44.585  39.602 89.480  1.00 70.14  ? 122 LYS A CD    1 
ATOM   971   C CE    . LYS A 1 122 ? 44.401  38.090 89.456  1.00 73.11  ? 122 LYS A CE    1 
ATOM   972   N NZ    . LYS A 1 122 ? 45.731  37.403 89.527  1.00 79.25  ? 122 LYS A NZ    1 
ATOM   973   N N     . ASN A 1 123 ? 43.637  43.450 85.439  1.00 29.08  ? 123 ASN A N     1 
ATOM   974   C CA    . ASN A 1 123 ? 44.025  44.707 84.774  1.00 32.87  ? 123 ASN A CA    1 
ATOM   975   C C     . ASN A 1 123 ? 43.279  44.585 83.419  1.00 31.15  ? 123 ASN A C     1 
ATOM   976   O O     . ASN A 1 123 ? 43.835  44.078 82.465  1.00 25.61  ? 123 ASN A O     1 
ATOM   977   C CB    . ASN A 1 123 ? 45.521  44.846 84.596  1.00 37.96  ? 123 ASN A CB    1 
ATOM   978   C CG    . ASN A 1 123 ? 46.279  44.942 85.908  1.00 49.35  ? 123 ASN A CG    1 
ATOM   979   O OD1   . ASN A 1 123 ? 46.667  43.907 86.466  1.00 44.74  ? 123 ASN A OD1   1 
ATOM   980   N ND2   . ASN A 1 123 ? 46.457  46.167 86.397  1.00 46.06  ? 123 ASN A ND2   1 
ATOM   981   N N     . PRO A 1 124 ? 41.984  44.826 83.473  1.00 27.98  ? 124 PRO A N     1 
ATOM   982   C CA    . PRO A 1 124 ? 41.082  44.517 82.368  1.00 26.84  ? 124 PRO A CA    1 
ATOM   983   C C     . PRO A 1 124 ? 41.194  45.411 81.174  1.00 20.91  ? 124 PRO A C     1 
ATOM   984   O O     . PRO A 1 124 ? 41.320  46.610 81.341  1.00 19.50  ? 124 PRO A O     1 
ATOM   985   C CB    . PRO A 1 124 ? 39.680  44.589 82.987  1.00 25.80  ? 124 PRO A CB    1 
ATOM   986   C CG    . PRO A 1 124 ? 39.868  45.721 83.962  1.00 29.67  ? 124 PRO A CG    1 
ATOM   987   C CD    . PRO A 1 124 ? 41.219  45.415 84.597  1.00 26.24  ? 124 PRO A CD    1 
ATOM   988   N N     . VAL A 1 125 ? 41.216  44.786 79.986  1.00 21.53  ? 125 VAL A N     1 
ATOM   989   C CA    . VAL A 1 125 ? 41.287  45.599 78.770  1.00 22.94  ? 125 VAL A CA    1 
ATOM   990   C C     . VAL A 1 125 ? 40.213  45.098 77.779  1.00 21.18  ? 125 VAL A C     1 
ATOM   991   O O     . VAL A 1 125 ? 39.818  43.922 77.827  1.00 17.97  ? 125 VAL A O     1 
ATOM   992   C CB    . VAL A 1 125 ? 42.641  45.620 78.040  1.00 27.45  ? 125 VAL A CB    1 
ATOM   993   C CG1   . VAL A 1 125 ? 43.838  45.838 78.960  1.00 32.05  ? 125 VAL A CG1   1 
ATOM   994   C CG2   . VAL A 1 125 ? 42.888  44.339 77.271  1.00 24.11  ? 125 VAL A CG2   1 
ATOM   995   N N     . PHE A 1 126 ? 39.936  45.973 76.829  1.00 18.82  ? 126 PHE A N     1 
ATOM   996   C CA    . PHE A 1 126 ? 39.091  45.649 75.692  1.00 21.07  ? 126 PHE A CA    1 
ATOM   997   C C     . PHE A 1 126 ? 39.983  45.908 74.463  1.00 16.87  ? 126 PHE A C     1 
ATOM   998   O O     . PHE A 1 126 ? 40.706  46.903 74.450  1.00 17.38  ? 126 PHE A O     1 
ATOM   999   C CB    . PHE A 1 126 ? 37.845  46.526 75.588  1.00 19.82  ? 126 PHE A CB    1 
ATOM   1000  C CG    . PHE A 1 126 ? 36.674  46.124 76.444  1.00 22.67  ? 126 PHE A CG    1 
ATOM   1001  C CD1   . PHE A 1 126 ? 36.692  46.338 77.818  1.00 23.39  ? 126 PHE A CD1   1 
ATOM   1002  C CD2   . PHE A 1 126 ? 35.526  45.594 75.878  1.00 24.90  ? 126 PHE A CD2   1 
ATOM   1003  C CE1   . PHE A 1 126 ? 35.617  45.996 78.606  1.00 22.61  ? 126 PHE A CE1   1 
ATOM   1004  C CE2   . PHE A 1 126 ? 34.443  45.245 76.663  1.00 23.68  ? 126 PHE A CE2   1 
ATOM   1005  C CZ    . PHE A 1 126 ? 34.490  45.424 78.032  1.00 23.93  ? 126 PHE A CZ    1 
ATOM   1006  N N     . ILE A 1 127 ? 39.893  45.050 73.474  1.00 17.63  ? 127 ILE A N     1 
ATOM   1007  C CA    . ILE A 1 127 ? 40.649  45.249 72.253  1.00 22.92  ? 127 ILE A CA    1 
ATOM   1008  C C     . ILE A 1 127 ? 39.670  45.380 71.077  1.00 21.31  ? 127 ILE A C     1 
ATOM   1009  O O     . ILE A 1 127 ? 38.756  44.563 70.985  1.00 21.58  ? 127 ILE A O     1 
ATOM   1010  C CB    . ILE A 1 127 ? 41.611  44.067 72.029  1.00 21.98  ? 127 ILE A CB    1 
ATOM   1011  C CG1   . ILE A 1 127 ? 42.708  44.035 73.121  1.00 28.15  ? 127 ILE A CG1   1 
ATOM   1012  C CG2   . ILE A 1 127 ? 42.260  44.160 70.646  1.00 16.92  ? 127 ILE A CG2   1 
ATOM   1013  C CD1   . ILE A 1 127 ? 43.541  42.771 73.094  1.00 24.69  ? 127 ILE A CD1   1 
ATOM   1014  N N     . SER A 1 128 ? 39.906  46.319 70.186  1.00 21.24  ? 128 SER A N     1 
ATOM   1015  C CA    . SER A 1 128 ? 39.064  46.473 68.991  1.00 20.26  ? 128 SER A CA    1 
ATOM   1016  C C     . SER A 1 128 ? 39.931  46.850 67.793  1.00 20.83  ? 128 SER A C     1 
ATOM   1017  O O     . SER A 1 128 ? 41.033  47.414 67.979  1.00 18.19  ? 128 SER A O     1 
ATOM   1018  C CB    . SER A 1 128 ? 38.063  47.630 69.219  1.00 22.16  ? 128 SER A CB    1 
ATOM   1019  O OG    . SER A 1 128 ? 37.060  47.639 68.197  1.00 18.48  ? 128 SER A OG    1 
ATOM   1020  N N     . ASN A 1 129 ? 39.388  46.658 66.580  1.00 16.28  ? 129 ASN A N     1 
ATOM   1021  C CA    . ASN A 1 129 ? 40.047  47.217 65.380  1.00 17.21  ? 129 ASN A CA    1 
ATOM   1022  C C     . ASN A 1 129 ? 40.036  48.733 65.588  1.00 20.11  ? 129 ASN A C     1 
ATOM   1023  O O     . ASN A 1 129 ? 41.029  49.448 65.418  1.00 21.39  ? 129 ASN A O     1 
ATOM   1024  C CB    . ASN A 1 129 ? 39.424  46.832 64.052  1.00 20.52  ? 129 ASN A CB    1 
ATOM   1025  C CG    . ASN A 1 129 ? 37.904  46.905 63.951  1.00 23.35  ? 129 ASN A CG    1 
ATOM   1026  O OD1   . ASN A 1 129 ? 37.197  46.945 64.959  1.00 15.26  ? 129 ASN A OD1   1 
ATOM   1027  N ND2   . ASN A 1 129 ? 37.387  46.924 62.712  1.00 13.52  ? 129 ASN A ND2   1 
ATOM   1028  N N     . PHE A 1 130 ? 38.946  49.272 66.108  1.00 17.58  ? 130 PHE A N     1 
ATOM   1029  C CA    . PHE A 1 130 ? 38.841  50.664 66.484  1.00 17.99  ? 130 PHE A CA    1 
ATOM   1030  C C     . PHE A 1 130 ? 37.555  50.944 67.265  1.00 23.97  ? 130 PHE A C     1 
ATOM   1031  O O     . PHE A 1 130 ? 36.452  50.826 66.727  1.00 19.53  ? 130 PHE A O     1 
ATOM   1032  C CB    . PHE A 1 130 ? 38.976  51.630 65.303  1.00 18.51  ? 130 PHE A CB    1 
ATOM   1033  C CG    . PHE A 1 130 ? 39.742  52.862 65.738  1.00 24.22  ? 130 PHE A CG    1 
ATOM   1034  C CD1   . PHE A 1 130 ? 39.269  53.683 66.733  1.00 23.03  ? 130 PHE A CD1   1 
ATOM   1035  C CD2   . PHE A 1 130 ? 40.963  53.180 65.129  1.00 30.83  ? 130 PHE A CD2   1 
ATOM   1036  C CE1   . PHE A 1 130 ? 39.945  54.825 67.122  1.00 28.58  ? 130 PHE A CE1   1 
ATOM   1037  C CE2   . PHE A 1 130 ? 41.659  54.304 65.535  1.00 32.69  ? 130 PHE A CE2   1 
ATOM   1038  C CZ    . PHE A 1 130 ? 41.155  55.136 66.520  1.00 34.38  ? 130 PHE A CZ    1 
ATOM   1039  N N     . HIS A 1 131 ? 37.685  51.241 68.555  1.00 22.56  ? 131 HIS A N     1 
ATOM   1040  C CA    . HIS A 1 131 ? 36.513  51.491 69.395  1.00 21.63  ? 131 HIS A CA    1 
ATOM   1041  C C     . HIS A 1 131 ? 35.821  52.785 68.965  1.00 22.20  ? 131 HIS A C     1 
ATOM   1042  O O     . HIS A 1 131 ? 36.509  53.802 68.892  1.00 17.70  ? 131 HIS A O     1 
ATOM   1043  C CB    . HIS A 1 131 ? 36.903  51.744 70.877  1.00 22.26  ? 131 HIS A CB    1 
ATOM   1044  C CG    . HIS A 1 131 ? 37.319  50.493 71.595  1.00 27.14  ? 131 HIS A CG    1 
ATOM   1045  N ND1   . HIS A 1 131 ? 38.606  50.018 71.582  1.00 24.35  ? 131 HIS A ND1   1 
ATOM   1046  C CD2   . HIS A 1 131 ? 36.580  49.620 72.324  1.00 25.31  ? 131 HIS A CD2   1 
ATOM   1047  C CE1   . HIS A 1 131 ? 38.657  48.894 72.305  1.00 21.92  ? 131 HIS A CE1   1 
ATOM   1048  N NE2   . HIS A 1 131 ? 37.440  48.632 72.749  1.00 27.88  ? 131 HIS A NE2   1 
ATOM   1049  N N     . PHE A 1 132 ? 34.508  52.746 68.753  1.00 20.20  ? 132 PHE A N     1 
ATOM   1050  C CA    . PHE A 1 132 ? 33.822  54.022 68.433  1.00 17.79  ? 132 PHE A CA    1 
ATOM   1051  C C     . PHE A 1 132 ? 33.897  54.876 69.701  1.00 15.37  ? 132 PHE A C     1 
ATOM   1052  O O     . PHE A 1 132 ? 34.173  54.349 70.780  1.00 16.65  ? 132 PHE A O     1 
ATOM   1053  C CB    . PHE A 1 132 ? 32.383  53.671 68.019  1.00 19.24  ? 132 PHE A CB    1 
ATOM   1054  C CG    . PHE A 1 132 ? 31.561  54.909 67.814  1.00 26.75  ? 132 PHE A CG    1 
ATOM   1055  C CD1   . PHE A 1 132 ? 31.877  55.803 66.792  1.00 27.22  ? 132 PHE A CD1   1 
ATOM   1056  C CD2   . PHE A 1 132 ? 30.498  55.195 68.655  1.00 21.82  ? 132 PHE A CD2   1 
ATOM   1057  C CE1   . PHE A 1 132 ? 31.139  56.969 66.605  1.00 29.65  ? 132 PHE A CE1   1 
ATOM   1058  C CE2   . PHE A 1 132 ? 29.761  56.348 68.461  1.00 27.15  ? 132 PHE A CE2   1 
ATOM   1059  C CZ    . PHE A 1 132 ? 30.070  57.226 67.433  1.00 32.70  ? 132 PHE A CZ    1 
ATOM   1060  N N     . ASP A 1 133 ? 33.631  56.146 69.700  1.00 13.51  ? 133 ASP A N     1 
ATOM   1061  C CA    . ASP A 1 133 ? 33.714  57.048 70.822  1.00 20.35  ? 133 ASP A CA    1 
ATOM   1062  C C     . ASP A 1 133 ? 32.884  56.633 72.040  1.00 23.69  ? 133 ASP A C     1 
ATOM   1063  O O     . ASP A 1 133 ? 33.408  56.596 73.162  1.00 19.57  ? 133 ASP A O     1 
ATOM   1064  C CB    . ASP A 1 133 ? 33.298  58.463 70.432  1.00 28.43  ? 133 ASP A CB    1 
ATOM   1065  C CG    . ASP A 1 133 ? 33.980  59.023 69.216  1.00 46.44  ? 133 ASP A CG    1 
ATOM   1066  O OD1   . ASP A 1 133 ? 34.702  58.293 68.498  1.00 51.71  ? 133 ASP A OD1   1 
ATOM   1067  O OD2   . ASP A 1 133 ? 33.796  60.232 68.948  1.00 59.42  ? 133 ASP A OD2   1 
ATOM   1068  N N     . THR A 1 134 ? 31.607  56.292 71.863  1.00 18.00  ? 134 THR A N     1 
ATOM   1069  C CA    . THR A 1 134 ? 30.797  55.883 73.011  1.00 18.19  ? 134 THR A CA    1 
ATOM   1070  C C     . THR A 1 134 ? 31.311  54.569 73.557  1.00 15.55  ? 134 THR A C     1 
ATOM   1071  O O     . THR A 1 134 ? 31.327  54.312 74.763  1.00 18.49  ? 134 THR A O     1 
ATOM   1072  C CB    . THR A 1 134 ? 29.286  55.736 72.690  1.00 16.45  ? 134 THR A CB    1 
ATOM   1073  O OG1   . THR A 1 134 ? 29.134  54.683 71.747  1.00 15.00  ? 134 THR A OG1   1 
ATOM   1074  C CG2   . THR A 1 134 ? 28.751  57.050 72.131  1.00 9.79   ? 134 THR A CG2   1 
ATOM   1075  N N     . THR A 1 135 ? 31.698  53.671 72.661  1.00 13.95  ? 135 THR A N     1 
ATOM   1076  C CA    . THR A 1 135 ? 32.163  52.336 73.019  1.00 18.71  ? 135 THR A CA    1 
ATOM   1077  C C     . THR A 1 135 ? 33.385  52.447 73.944  1.00 21.30  ? 135 THR A C     1 
ATOM   1078  O O     . THR A 1 135 ? 33.436  51.772 74.965  1.00 19.19  ? 135 THR A O     1 
ATOM   1079  C CB    . THR A 1 135 ? 32.532  51.557 71.740  1.00 19.27  ? 135 THR A CB    1 
ATOM   1080  O OG1   . THR A 1 135 ? 31.559  51.848 70.707  1.00 15.64  ? 135 THR A OG1   1 
ATOM   1081  C CG2   . THR A 1 135 ? 32.576  50.073 71.988  1.00 17.12  ? 135 THR A CG2   1 
ATOM   1082  N N     . ALA A 1 136 ? 34.337  53.309 73.597  1.00 20.68  ? 136 ALA A N     1 
ATOM   1083  C CA    . ALA A 1 136 ? 35.556  53.517 74.358  1.00 22.32  ? 136 ALA A CA    1 
ATOM   1084  C C     . ALA A 1 136 ? 35.206  54.167 75.701  1.00 22.29  ? 136 ALA A C     1 
ATOM   1085  O O     . ALA A 1 136 ? 35.781  53.810 76.732  1.00 20.61  ? 136 ALA A O     1 
ATOM   1086  C CB    . ALA A 1 136 ? 36.551  54.384 73.612  1.00 16.41  ? 136 ALA A CB    1 
ATOM   1087  N N     . ALA A 1 137 ? 34.259  55.092 75.679  1.00 19.26  ? 137 ALA A N     1 
ATOM   1088  C CA    . ALA A 1 137 ? 33.795  55.742 76.891  1.00 20.40  ? 137 ALA A CA    1 
ATOM   1089  C C     . ALA A 1 137 ? 33.248  54.704 77.852  1.00 22.28  ? 137 ALA A C     1 
ATOM   1090  O O     . ALA A 1 137 ? 33.614  54.742 79.031  1.00 19.52  ? 137 ALA A O     1 
ATOM   1091  C CB    . ALA A 1 137 ? 32.756  56.825 76.613  1.00 20.18  ? 137 ALA A CB    1 
ATOM   1092  N N     . HIS A 1 138 ? 32.409  53.743 77.432  1.00 19.34  ? 138 HIS A N     1 
ATOM   1093  C CA    . HIS A 1 138 ? 31.895  52.747 78.336  1.00 21.44  ? 138 HIS A CA    1 
ATOM   1094  C C     . HIS A 1 138 ? 33.025  51.849 78.837  1.00 24.73  ? 138 HIS A C     1 
ATOM   1095  O O     . HIS A 1 138 ? 32.997  51.354 79.975  1.00 21.20  ? 138 HIS A O     1 
ATOM   1096  C CB    . HIS A 1 138 ? 30.738  51.928 77.709  1.00 17.39  ? 138 HIS A CB    1 
ATOM   1097  C CG    . HIS A 1 138 ? 29.498  52.776 77.741  1.00 25.47  ? 138 HIS A CG    1 
ATOM   1098  N ND1   . HIS A 1 138 ? 28.833  53.026 78.916  1.00 19.84  ? 138 HIS A ND1   1 
ATOM   1099  C CD2   . HIS A 1 138 ? 28.853  53.484 76.773  1.00 21.63  ? 138 HIS A CD2   1 
ATOM   1100  C CE1   . HIS A 1 138 ? 27.813  53.853 78.681  1.00 28.72  ? 138 HIS A CE1   1 
ATOM   1101  N NE2   . HIS A 1 138 ? 27.805  54.146 77.390  1.00 25.32  ? 138 HIS A NE2   1 
ATOM   1102  N N     . VAL A 1 139 ? 34.007  51.553 77.977  1.00 22.04  ? 139 VAL A N     1 
ATOM   1103  C CA    . VAL A 1 139 ? 35.139  50.732 78.391  1.00 24.75  ? 139 VAL A CA    1 
ATOM   1104  C C     . VAL A 1 139 ? 35.886  51.440 79.530  1.00 22.67  ? 139 VAL A C     1 
ATOM   1105  O O     . VAL A 1 139 ? 36.100  50.853 80.598  1.00 23.47  ? 139 VAL A O     1 
ATOM   1106  C CB    . VAL A 1 139 ? 36.075  50.433 77.211  1.00 25.60  ? 139 VAL A CB    1 
ATOM   1107  C CG1   . VAL A 1 139 ? 37.438  49.931 77.680  1.00 26.69  ? 139 VAL A CG1   1 
ATOM   1108  C CG2   . VAL A 1 139 ? 35.427  49.423 76.265  1.00 21.86  ? 139 VAL A CG2   1 
ATOM   1109  N N     . GLU A 1 140 ? 36.180  52.716 79.362  1.00 21.29  ? 140 GLU A N     1 
ATOM   1110  C CA    . GLU A 1 140 ? 36.894  53.508 80.329  1.00 27.54  ? 140 GLU A CA    1 
ATOM   1111  C C     . GLU A 1 140 ? 36.112  53.793 81.602  1.00 32.48  ? 140 GLU A C     1 
ATOM   1112  O O     . GLU A 1 140 ? 36.709  53.686 82.683  1.00 30.71  ? 140 GLU A O     1 
ATOM   1113  C CB    . GLU A 1 140 ? 37.422  54.806 79.716  1.00 24.78  ? 140 GLU A CB    1 
ATOM   1114  C CG    . GLU A 1 140 ? 38.560  54.459 78.756  1.00 37.84  ? 140 GLU A CG    1 
ATOM   1115  C CD    . GLU A 1 140 ? 38.992  55.593 77.853  1.00 48.79  ? 140 GLU A CD    1 
ATOM   1116  O OE1   . GLU A 1 140 ? 38.560  56.749 78.052  1.00 51.88  ? 140 GLU A OE1   1 
ATOM   1117  O OE2   . GLU A 1 140 ? 39.793  55.296 76.938  1.00 50.94  ? 140 GLU A OE2   1 
ATOM   1118  N N     . LEU A 1 141 ? 34.809  54.020 81.492  1.00 28.00  ? 141 LEU A N     1 
ATOM   1119  C CA    . LEU A 1 141 ? 33.963  54.270 82.639  1.00 29.17  ? 141 LEU A CA    1 
ATOM   1120  C C     . LEU A 1 141 ? 33.902  53.040 83.540  1.00 27.58  ? 141 LEU A C     1 
ATOM   1121  O O     . LEU A 1 141 ? 33.677  53.157 84.752  1.00 25.49  ? 141 LEU A O     1 
ATOM   1122  C CB    . LEU A 1 141 ? 32.539  54.667 82.256  1.00 33.40  ? 141 LEU A CB    1 
ATOM   1123  C CG    . LEU A 1 141 ? 32.288  56.053 81.667  1.00 44.47  ? 141 LEU A CG    1 
ATOM   1124  C CD1   . LEU A 1 141 ? 30.885  56.119 81.071  1.00 42.66  ? 141 LEU A CD1   1 
ATOM   1125  C CD2   . LEU A 1 141 ? 32.457  57.132 82.730  1.00 45.44  ? 141 LEU A CD2   1 
ATOM   1126  N N     . ASN A 1 142 ? 34.062  51.847 82.989  1.00 22.95  ? 142 ASN A N     1 
ATOM   1127  C CA    . ASN A 1 142 ? 34.096  50.640 83.786  1.00 26.45  ? 142 ASN A CA    1 
ATOM   1128  C C     . ASN A 1 142 ? 35.502  50.278 84.256  1.00 25.10  ? 142 ASN A C     1 
ATOM   1129  O O     . ASN A 1 142 ? 35.812  49.133 84.583  1.00 26.93  ? 142 ASN A O     1 
ATOM   1130  C CB    . ASN A 1 142 ? 33.419  49.515 82.967  1.00 25.80  ? 142 ASN A CB    1 
ATOM   1131  C CG    . ASN A 1 142 ? 31.918  49.799 82.929  1.00 34.64  ? 142 ASN A CG    1 
ATOM   1132  O OD1   . ASN A 1 142 ? 31.270  49.480 83.922  1.00 33.91  ? 142 ASN A OD1   1 
ATOM   1133  N ND2   . ASN A 1 142 ? 31.371  50.411 81.870  1.00 22.99  ? 142 ASN A ND2   1 
ATOM   1134  N N     . GLY A 1 143 ? 36.438  51.208 84.254  1.00 27.23  ? 143 GLY A N     1 
ATOM   1135  C CA    . GLY A 1 143 ? 37.796  51.026 84.702  1.00 30.77  ? 143 GLY A CA    1 
ATOM   1136  C C     . GLY A 1 143 ? 38.668  50.211 83.765  1.00 32.47  ? 143 GLY A C     1 
ATOM   1137  O O     . GLY A 1 143 ? 39.679  49.656 84.218  1.00 33.09  ? 143 GLY A O     1 
ATOM   1138  N N     . CYS A 1 144 ? 38.325  50.053 82.488  1.00 28.17  ? 144 CYS A N     1 
ATOM   1139  C CA    . CYS A 1 144 ? 39.145  49.222 81.627  1.00 23.30  ? 144 CYS A CA    1 
ATOM   1140  C C     . CYS A 1 144 ? 39.914  50.110 80.652  1.00 25.67  ? 144 CYS A C     1 
ATOM   1141  O O     . CYS A 1 144 ? 39.590  51.283 80.508  1.00 26.20  ? 144 CYS A O     1 
ATOM   1142  C CB    . CYS A 1 144 ? 38.328  48.168 80.922  1.00 23.62  ? 144 CYS A CB    1 
ATOM   1143  S SG    . CYS A 1 144 ? 37.240  47.108 81.903  1.00 25.20  ? 144 CYS A SG    1 
ATOM   1144  N N     . LYS A 1 145 ? 40.886  49.495 79.999  1.00 25.92  ? 145 LYS A N     1 
ATOM   1145  C CA    . LYS A 1 145 ? 41.634  50.171 78.951  1.00 28.03  ? 145 LYS A CA    1 
ATOM   1146  C C     . LYS A 1 145 ? 41.062  49.741 77.580  1.00 21.84  ? 145 LYS A C     1 
ATOM   1147  O O     . LYS A 1 145 ? 40.799  48.557 77.372  1.00 23.13  ? 145 LYS A O     1 
ATOM   1148  C CB    . LYS A 1 145 ? 43.120  49.822 78.980  1.00 38.31  ? 145 LYS A CB    1 
ATOM   1149  C CG    . LYS A 1 145 ? 43.941  50.529 80.026  1.00 58.40  ? 145 LYS A CG    1 
ATOM   1150  C CD    . LYS A 1 145 ? 45.282  49.850 80.281  1.00 73.86  ? 145 LYS A CD    1 
ATOM   1151  C CE    . LYS A 1 145 ? 45.235  48.971 81.521  1.00 81.23  ? 145 LYS A CE    1 
ATOM   1152  N NZ    . LYS A 1 145 ? 46.254  47.888 81.548  1.00 80.43  ? 145 LYS A NZ    1 
ATOM   1153  N N     . ALA A 1 146 ? 40.930  50.712 76.707  1.00 22.93  ? 146 ALA A N     1 
ATOM   1154  C CA    . ALA A 1 146 ? 40.472  50.461 75.337  1.00 27.97  ? 146 ALA A CA    1 
ATOM   1155  C C     . ALA A 1 146 ? 41.675  50.462 74.394  1.00 26.60  ? 146 ALA A C     1 
ATOM   1156  O O     . ALA A 1 146 ? 42.293  51.524 74.230  1.00 29.20  ? 146 ALA A O     1 
ATOM   1157  C CB    . ALA A 1 146 ? 39.495  51.565 74.926  1.00 24.21  ? 146 ALA A CB    1 
ATOM   1158  N N     . ILE A 1 147 ? 42.006  49.344 73.781  1.00 25.62  ? 147 ILE A N     1 
ATOM   1159  C CA    . ILE A 1 147 ? 43.117  49.303 72.829  1.00 25.01  ? 147 ILE A CA    1 
ATOM   1160  C C     . ILE A 1 147 ? 42.632  49.174 71.386  1.00 24.41  ? 147 ILE A C     1 
ATOM   1161  O O     . ILE A 1 147 ? 41.783  48.319 71.100  1.00 22.24  ? 147 ILE A O     1 
ATOM   1162  C CB    . ILE A 1 147 ? 44.019  48.114 73.205  1.00 27.84  ? 147 ILE A CB    1 
ATOM   1163  C CG1   . ILE A 1 147 ? 44.645  48.363 74.591  1.00 31.27  ? 147 ILE A CG1   1 
ATOM   1164  C CG2   . ILE A 1 147 ? 45.118  47.905 72.186  1.00 26.64  ? 147 ILE A CG2   1 
ATOM   1165  C CD1   . ILE A 1 147 ? 45.160  47.116 75.285  1.00 32.86  ? 147 ILE A CD1   1 
ATOM   1166  N N     . ASN A 1 148 ? 43.113  50.012 70.483  1.00 19.93  ? 148 ASN A N     1 
ATOM   1167  C CA    . ASN A 1 148 ? 42.726  49.977 69.067  1.00 20.41  ? 148 ASN A CA    1 
ATOM   1168  C C     . ASN A 1 148 ? 43.865  49.468 68.186  1.00 22.01  ? 148 ASN A C     1 
ATOM   1169  O O     . ASN A 1 148 ? 44.952  50.053 68.262  1.00 22.52  ? 148 ASN A O     1 
ATOM   1170  C CB    . ASN A 1 148 ? 42.391  51.408 68.637  1.00 16.26  ? 148 ASN A CB    1 
ATOM   1171  C CG    . ASN A 1 148 ? 41.204  51.932 69.439  1.00 21.48  ? 148 ASN A CG    1 
ATOM   1172  O OD1   . ASN A 1 148 ? 40.195  51.265 69.701  1.00 18.04  ? 148 ASN A OD1   1 
ATOM   1173  N ND2   . ASN A 1 148 ? 41.342  53.170 69.886  1.00 18.16  ? 148 ASN A ND2   1 
ATOM   1174  N N     . ILE A 1 149 ? 43.674  48.429 67.390  1.00 19.57  ? 149 ILE A N     1 
ATOM   1175  C CA    . ILE A 1 149 ? 44.731  47.847 66.599  1.00 21.68  ? 149 ILE A CA    1 
ATOM   1176  C C     . ILE A 1 149 ? 44.341  47.695 65.119  1.00 21.68  ? 149 ILE A C     1 
ATOM   1177  O O     . ILE A 1 149 ? 44.582  46.671 64.496  1.00 23.46  ? 149 ILE A O     1 
ATOM   1178  C CB    . ILE A 1 149 ? 45.168  46.502 67.213  1.00 25.84  ? 149 ILE A CB    1 
ATOM   1179  C CG1   . ILE A 1 149 ? 43.979  45.603 67.464  1.00 18.64  ? 149 ILE A CG1   1 
ATOM   1180  C CG2   . ILE A 1 149 ? 45.920  46.711 68.541  1.00 24.97  ? 149 ILE A CG2   1 
ATOM   1181  C CD1   . ILE A 1 149 ? 44.232  44.118 67.504  1.00 20.36  ? 149 ILE A CD1   1 
ATOM   1182  N N     . VAL A 1 150 ? 43.776  48.765 64.543  1.00 22.07  ? 150 VAL A N     1 
ATOM   1183  C CA    . VAL A 1 150 ? 43.397  48.717 63.129  1.00 23.99  ? 150 VAL A CA    1 
ATOM   1184  C C     . VAL A 1 150 ? 44.662  48.622 62.261  1.00 22.73  ? 150 VAL A C     1 
ATOM   1185  O O     . VAL A 1 150 ? 45.707  49.171 62.605  1.00 19.81  ? 150 VAL A O     1 
ATOM   1186  C CB    . VAL A 1 150 ? 42.546  49.940 62.771  1.00 21.35  ? 150 VAL A CB    1 
ATOM   1187  C CG1   . VAL A 1 150 ? 43.360  51.219 62.849  1.00 25.62  ? 150 VAL A CG1   1 
ATOM   1188  C CG2   . VAL A 1 150 ? 41.923  49.800 61.389  1.00 21.58  ? 150 VAL A CG2   1 
ATOM   1189  N N     . THR A 1 151 ? 44.599  47.929 61.140  1.00 23.69  ? 151 THR A N     1 
ATOM   1190  C CA    . THR A 1 151 ? 45.711  47.817 60.215  1.00 25.84  ? 151 THR A CA    1 
ATOM   1191  C C     . THR A 1 151 ? 46.307  49.191 59.938  1.00 27.60  ? 151 THR A C     1 
ATOM   1192  O O     . THR A 1 151 ? 45.590  50.191 59.838  1.00 25.91  ? 151 THR A O     1 
ATOM   1193  C CB    . THR A 1 151 ? 45.268  47.191 58.875  1.00 34.70  ? 151 THR A CB    1 
ATOM   1194  O OG1   . THR A 1 151 ? 46.370  47.241 57.971  1.00 32.03  ? 151 THR A OG1   1 
ATOM   1195  C CG2   . THR A 1 151 ? 44.085  47.943 58.252  1.00 22.30  ? 151 THR A CG2   1 
ATOM   1196  N N     . GLU A 1 152 ? 47.613  49.260 59.688  1.00 27.91  ? 152 GLU A N     1 
ATOM   1197  C CA    . GLU A 1 152 ? 48.268  50.522 59.385  1.00 31.55  ? 152 GLU A CA    1 
ATOM   1198  C C     . GLU A 1 152 ? 47.883  51.029 57.993  1.00 24.18  ? 152 GLU A C     1 
ATOM   1199  O O     . GLU A 1 152 ? 47.934  52.243 57.778  1.00 25.56  ? 152 GLU A O     1 
ATOM   1200  C CB    . GLU A 1 152 ? 49.789  50.490 59.498  1.00 45.38  ? 152 GLU A CB    1 
ATOM   1201  C CG    . GLU A 1 152 ? 50.479  49.163 59.303  1.00 71.06  ? 152 GLU A CG    1 
ATOM   1202  C CD    . GLU A 1 152 ? 51.816  49.119 60.037  1.00 84.32  ? 152 GLU A CD    1 
ATOM   1203  O OE1   . GLU A 1 152 ? 51.856  49.539 61.218  1.00 89.35  ? 152 GLU A OE1   1 
ATOM   1204  O OE2   . GLU A 1 152 ? 52.814  48.671 59.429  1.00 88.93  ? 152 GLU A OE2   1 
ATOM   1205  N N     . LYS A 1 153 ? 47.372  50.157 57.126  1.00 26.63  ? 153 LYS A N     1 
ATOM   1206  C CA    . LYS A 1 153 ? 46.862  50.563 55.816  1.00 30.78  ? 153 LYS A CA    1 
ATOM   1207  C C     . LYS A 1 153 ? 45.804  51.653 55.915  1.00 31.70  ? 153 LYS A C     1 
ATOM   1208  O O     . LYS A 1 153 ? 45.713  52.530 55.046  1.00 32.33  ? 153 LYS A O     1 
ATOM   1209  C CB    . LYS A 1 153 ? 46.313  49.348 55.075  1.00 33.37  ? 153 LYS A CB    1 
ATOM   1210  C CG    . LYS A 1 153 ? 47.414  48.394 54.613  1.00 43.96  ? 153 LYS A CG    1 
ATOM   1211  C CD    . LYS A 1 153 ? 46.791  47.089 54.135  1.00 57.41  ? 153 LYS A CD    1 
ATOM   1212  C CE    . LYS A 1 153 ? 47.725  46.348 53.190  1.00 67.40  ? 153 LYS A CE    1 
ATOM   1213  N NZ    . LYS A 1 153 ? 47.188  45.016 52.782  1.00 72.89  ? 153 LYS A NZ    1 
ATOM   1214  N N     . ALA A 1 154 ? 45.041  51.692 56.998  1.00 28.70  ? 154 ALA A N     1 
ATOM   1215  C CA    . ALA A 1 154 ? 44.054  52.700 57.282  1.00 31.34  ? 154 ALA A CA    1 
ATOM   1216  C C     . ALA A 1 154 ? 44.632  54.099 57.375  1.00 33.27  ? 154 ALA A C     1 
ATOM   1217  O O     . ALA A 1 154 ? 43.916  55.052 57.087  1.00 36.43  ? 154 ALA A O     1 
ATOM   1218  C CB    . ALA A 1 154 ? 43.308  52.389 58.584  1.00 23.40  ? 154 ALA A CB    1 
ATOM   1219  N N     . PHE A 1 155 ? 45.882  54.263 57.794  1.00 38.17  ? 155 PHE A N     1 
ATOM   1220  C CA    . PHE A 1 155 ? 46.467  55.599 57.954  1.00 41.53  ? 155 PHE A CA    1 
ATOM   1221  C C     . PHE A 1 155 ? 47.103  56.135 56.682  1.00 41.19  ? 155 PHE A C     1 
ATOM   1222  O O     . PHE A 1 155 ? 47.580  57.269 56.626  1.00 41.83  ? 155 PHE A O     1 
ATOM   1223  C CB    . PHE A 1 155 ? 47.452  55.564 59.129  1.00 55.76  ? 155 PHE A CB    1 
ATOM   1224  C CG    . PHE A 1 155 ? 46.773  55.064 60.384  1.00 64.15  ? 155 PHE A CG    1 
ATOM   1225  C CD1   . PHE A 1 155 ? 45.714  55.761 60.938  1.00 68.66  ? 155 PHE A CD1   1 
ATOM   1226  C CD2   . PHE A 1 155 ? 47.188  53.892 60.994  1.00 67.33  ? 155 PHE A CD2   1 
ATOM   1227  C CE1   . PHE A 1 155 ? 45.084  55.300 62.081  1.00 72.32  ? 155 PHE A CE1   1 
ATOM   1228  C CE2   . PHE A 1 155 ? 46.562  53.434 62.140  1.00 68.97  ? 155 PHE A CE2   1 
ATOM   1229  C CZ    . PHE A 1 155 ? 45.507  54.133 62.688  1.00 69.33  ? 155 PHE A CZ    1 
ATOM   1230  N N     . ASP A 1 156 ? 47.118  55.335 55.629  1.00 38.74  ? 156 ASP A N     1 
ATOM   1231  C CA    . ASP A 1 156 ? 47.628  55.746 54.322  1.00 36.96  ? 156 ASP A CA    1 
ATOM   1232  C C     . ASP A 1 156 ? 46.419  56.186 53.496  1.00 33.45  ? 156 ASP A C     1 
ATOM   1233  O O     . ASP A 1 156 ? 45.862  55.414 52.712  1.00 30.66  ? 156 ASP A O     1 
ATOM   1234  C CB    . ASP A 1 156 ? 48.385  54.586 53.686  1.00 39.10  ? 156 ASP A CB    1 
ATOM   1235  C CG    . ASP A 1 156 ? 49.186  54.966 52.460  1.00 48.83  ? 156 ASP A CG    1 
ATOM   1236  O OD1   . ASP A 1 156 ? 49.124  56.141 52.025  1.00 47.73  ? 156 ASP A OD1   1 
ATOM   1237  O OD2   . ASP A 1 156 ? 49.871  54.073 51.907  1.00 56.08  ? 156 ASP A OD2   1 
ATOM   1238  N N     . SER A 1 157 ? 45.943  57.395 53.724  1.00 34.44  ? 157 SER A N     1 
ATOM   1239  C CA    . SER A 1 157 ? 44.750  57.955 53.129  1.00 38.75  ? 157 SER A CA    1 
ATOM   1240  C C     . SER A 1 157 ? 44.548  57.743 51.638  1.00 39.78  ? 157 SER A C     1 
ATOM   1241  O O     . SER A 1 157 ? 43.538  57.216 51.190  1.00 38.54  ? 157 SER A O     1 
ATOM   1242  C CB    . SER A 1 157 ? 44.747  59.483 53.314  1.00 42.79  ? 157 SER A CB    1 
ATOM   1243  O OG    . SER A 1 157 ? 44.223  59.798 54.583  1.00 55.30  ? 157 SER A OG    1 
ATOM   1244  N N     . GLU A 1 158 ? 45.515  58.166 50.833  1.00 41.89  ? 158 GLU A N     1 
ATOM   1245  C CA    . GLU A 1 158 ? 45.390  58.136 49.381  1.00 43.34  ? 158 GLU A CA    1 
ATOM   1246  C C     . GLU A 1 158 ? 45.668  56.797 48.745  1.00 40.62  ? 158 GLU A C     1 
ATOM   1247  O O     . GLU A 1 158 ? 45.240  56.589 47.602  1.00 39.81  ? 158 GLU A O     1 
ATOM   1248  C CB    . GLU A 1 158 ? 46.251  59.275 48.809  1.00 56.36  ? 158 GLU A CB    1 
ATOM   1249  C CG    . GLU A 1 158 ? 45.605  60.609 49.192  1.00 73.39  ? 158 GLU A CG    1 
ATOM   1250  C CD    . GLU A 1 158 ? 46.510  61.809 49.066  1.00 83.11  ? 158 GLU A CD    1 
ATOM   1251  O OE1   . GLU A 1 158 ? 47.746  61.640 48.983  1.00 91.94  ? 158 GLU A OE1   1 
ATOM   1252  O OE2   . GLU A 1 158 ? 45.981  62.944 49.058  1.00 88.75  ? 158 GLU A OE2   1 
ATOM   1253  N N     . THR A 1 159 ? 46.282  55.866 49.481  1.00 37.16  ? 159 THR A N     1 
ATOM   1254  C CA    . THR A 1 159 ? 46.534  54.564 48.885  1.00 36.85  ? 159 THR A CA    1 
ATOM   1255  C C     . THR A 1 159 ? 45.333  53.636 49.044  1.00 38.34  ? 159 THR A C     1 
ATOM   1256  O O     . THR A 1 159 ? 44.861  53.358 50.139  1.00 37.27  ? 159 THR A O     1 
ATOM   1257  C CB    . THR A 1 159 ? 47.790  53.940 49.507  1.00 39.21  ? 159 THR A CB    1 
ATOM   1258  O OG1   . THR A 1 159 ? 48.813  54.913 49.319  1.00 39.50  ? 159 THR A OG1   1 
ATOM   1259  C CG2   . THR A 1 159 ? 48.157  52.614 48.893  1.00 35.75  ? 159 THR A CG2   1 
ATOM   1260  N N     . TYR A 1 160 ? 44.883  53.117 47.902  1.00 35.93  ? 160 TYR A N     1 
ATOM   1261  C CA    . TYR A 1 160 ? 43.768  52.211 47.866  1.00 32.35  ? 160 TYR A CA    1 
ATOM   1262  C C     . TYR A 1 160 ? 44.113  50.922 48.593  1.00 33.94  ? 160 TYR A C     1 
ATOM   1263  O O     . TYR A 1 160 ? 45.181  50.365 48.373  1.00 34.27  ? 160 TYR A O     1 
ATOM   1264  C CB    . TYR A 1 160 ? 43.371  51.901 46.397  1.00 31.05  ? 160 TYR A CB    1 
ATOM   1265  C CG    . TYR A 1 160 ? 42.202  50.927 46.365  1.00 28.44  ? 160 TYR A CG    1 
ATOM   1266  C CD1   . TYR A 1 160 ? 42.423  49.560 46.471  1.00 24.53  ? 160 TYR A CD1   1 
ATOM   1267  C CD2   . TYR A 1 160 ? 40.899  51.403 46.289  1.00 29.18  ? 160 TYR A CD2   1 
ATOM   1268  C CE1   . TYR A 1 160 ? 41.347  48.685 46.515  1.00 28.74  ? 160 TYR A CE1   1 
ATOM   1269  C CE2   . TYR A 1 160 ? 39.829  50.523 46.304  1.00 29.56  ? 160 TYR A CE2   1 
ATOM   1270  C CZ    . TYR A 1 160 ? 40.056  49.173 46.418  1.00 30.06  ? 160 TYR A CZ    1 
ATOM   1271  O OH    . TYR A 1 160 ? 38.997  48.296 46.446  1.00 28.64  ? 160 TYR A OH    1 
ATOM   1272  N N     . ASP A 1 161 ? 43.169  50.368 49.335  1.00 30.09  ? 161 ASP A N     1 
ATOM   1273  C CA    . ASP A 1 161 ? 43.257  49.049 49.933  1.00 24.40  ? 161 ASP A CA    1 
ATOM   1274  C C     . ASP A 1 161 ? 41.806  48.558 50.083  1.00 21.96  ? 161 ASP A C     1 
ATOM   1275  O O     . ASP A 1 161 ? 40.902  49.348 50.382  1.00 22.89  ? 161 ASP A O     1 
ATOM   1276  C CB    . ASP A 1 161 ? 43.982  48.987 51.269  1.00 26.31  ? 161 ASP A CB    1 
ATOM   1277  C CG    . ASP A 1 161 ? 44.135  47.522 51.690  1.00 35.08  ? 161 ASP A CG    1 
ATOM   1278  O OD1   . ASP A 1 161 ? 45.045  46.838 51.174  1.00 39.84  ? 161 ASP A OD1   1 
ATOM   1279  O OD2   . ASP A 1 161 ? 43.346  47.034 52.527  1.00 37.54  ? 161 ASP A OD2   1 
ATOM   1280  N N     . ASP A 1 162 ? 41.566  47.296 49.809  1.00 16.93  ? 162 ASP A N     1 
ATOM   1281  C CA    . ASP A 1 162 ? 40.212  46.788 49.884  1.00 21.44  ? 162 ASP A CA    1 
ATOM   1282  C C     . ASP A 1 162 ? 39.640  46.773 51.299  1.00 24.75  ? 162 ASP A C     1 
ATOM   1283  O O     . ASP A 1 162 ? 38.436  46.624 51.411  1.00 21.30  ? 162 ASP A O     1 
ATOM   1284  C CB    . ASP A 1 162 ? 40.158  45.306 49.449  1.00 23.12  ? 162 ASP A CB    1 
ATOM   1285  C CG    . ASP A 1 162 ? 40.152  45.182 47.923  1.00 29.27  ? 162 ASP A CG    1 
ATOM   1286  O OD1   . ASP A 1 162 ? 39.679  46.091 47.214  1.00 31.76  ? 162 ASP A OD1   1 
ATOM   1287  O OD2   . ASP A 1 162 ? 40.631  44.129 47.469  1.00 29.12  ? 162 ASP A OD2   1 
ATOM   1288  N N     . TRP A 1 163 ? 40.520  46.579 52.299  1.00 20.05  ? 163 TRP A N     1 
ATOM   1289  C CA    . TRP A 1 163 ? 40.112  46.294 53.652  1.00 19.98  ? 163 TRP A CA    1 
ATOM   1290  C C     . TRP A 1 163 ? 40.787  47.159 54.705  1.00 18.84  ? 163 TRP A C     1 
ATOM   1291  O O     . TRP A 1 163 ? 41.382  46.654 55.648  1.00 19.09  ? 163 TRP A O     1 
ATOM   1292  C CB    . TRP A 1 163 ? 40.322  44.821 53.975  1.00 18.62  ? 163 TRP A CB    1 
ATOM   1293  C CG    . TRP A 1 163 ? 39.865  43.850 52.926  1.00 23.13  ? 163 TRP A CG    1 
ATOM   1294  C CD1   . TRP A 1 163 ? 40.667  43.088 52.133  1.00 22.87  ? 163 TRP A CD1   1 
ATOM   1295  C CD2   . TRP A 1 163 ? 38.520  43.565 52.525  1.00 22.88  ? 163 TRP A CD2   1 
ATOM   1296  N NE1   . TRP A 1 163 ? 39.913  42.323 51.282  1.00 22.04  ? 163 TRP A NE1   1 
ATOM   1297  C CE2   . TRP A 1 163 ? 38.586  42.621 51.490  1.00 22.53  ? 163 TRP A CE2   1 
ATOM   1298  C CE3   . TRP A 1 163 ? 37.265  44.002 52.968  1.00 22.06  ? 163 TRP A CE3   1 
ATOM   1299  C CZ2   . TRP A 1 163 ? 37.452  42.080 50.881  1.00 22.37  ? 163 TRP A CZ2   1 
ATOM   1300  C CZ3   . TRP A 1 163 ? 36.136  43.483 52.345  1.00 20.44  ? 163 TRP A CZ3   1 
ATOM   1301  C CH2   . TRP A 1 163 ? 36.241  42.530 51.322  1.00 21.41  ? 163 TRP A CH2   1 
ATOM   1302  N N     . LYS A 1 164 ? 40.579  48.482 54.624  1.00 16.92  ? 164 LYS A N     1 
ATOM   1303  C CA    . LYS A 1 164 ? 41.187  49.325 55.645  1.00 17.17  ? 164 LYS A CA    1 
ATOM   1304  C C     . LYS A 1 164 ? 40.586  49.238 57.028  1.00 17.91  ? 164 LYS A C     1 
ATOM   1305  O O     . LYS A 1 164 ? 41.087  50.002 57.877  1.00 19.63  ? 164 LYS A O     1 
ATOM   1306  C CB    . LYS A 1 164 ? 41.197  50.786 55.166  1.00 20.34  ? 164 LYS A CB    1 
ATOM   1307  C CG    . LYS A 1 164 ? 42.034  50.990 53.902  1.00 20.69  ? 164 LYS A CG    1 
ATOM   1308  C CD    . LYS A 1 164 ? 42.152  52.467 53.592  1.00 19.41  ? 164 LYS A CD    1 
ATOM   1309  C CE    . LYS A 1 164 ? 43.358  52.748 52.689  1.00 19.44  ? 164 LYS A CE    1 
ATOM   1310  N NZ    . LYS A 1 164 ? 43.398  54.235 52.393  1.00 20.31  ? 164 LYS A NZ    1 
ATOM   1311  N N     . GLY A 1 165 ? 39.581  48.431 57.324  1.00 17.21  ? 165 GLY A N     1 
ATOM   1312  C CA    . GLY A 1 165 ? 39.044  48.388 58.702  1.00 16.50  ? 165 GLY A CA    1 
ATOM   1313  C C     . GLY A 1 165 ? 39.556  47.154 59.434  1.00 17.55  ? 165 GLY A C     1 
ATOM   1314  O O     . GLY A 1 165 ? 39.207  46.942 60.601  1.00 15.11  ? 165 GLY A O     1 
ATOM   1315  N N     . ASP A 1 166 ? 40.359  46.337 58.770  1.00 13.74  ? 166 ASP A N     1 
ATOM   1316  C CA    . ASP A 1 166 ? 40.863  45.098 59.312  1.00 16.84  ? 166 ASP A CA    1 
ATOM   1317  C C     . ASP A 1 166 ? 41.686  45.278 60.601  1.00 15.54  ? 166 ASP A C     1 
ATOM   1318  O O     . ASP A 1 166 ? 42.311  46.318 60.810  1.00 12.75  ? 166 ASP A O     1 
ATOM   1319  C CB    . ASP A 1 166 ? 41.822  44.440 58.300  1.00 19.88  ? 166 ASP A CB    1 
ATOM   1320  C CG    . ASP A 1 166 ? 41.087  43.544 57.318  1.00 22.00  ? 166 ASP A CG    1 
ATOM   1321  O OD1   . ASP A 1 166 ? 39.848  43.499 57.376  1.00 22.91  ? 166 ASP A OD1   1 
ATOM   1322  O OD2   . ASP A 1 166 ? 41.736  42.880 56.523  1.00 23.13  ? 166 ASP A OD2   1 
ATOM   1323  N N     . PHE A 1 167 ? 41.558  44.249 61.441  1.00 16.98  ? 167 PHE A N     1 
ATOM   1324  C CA    . PHE A 1 167 ? 42.414  44.240 62.632  1.00 18.91  ? 167 PHE A CA    1 
ATOM   1325  C C     . PHE A 1 167 ? 43.857  43.941 62.168  1.00 20.77  ? 167 PHE A C     1 
ATOM   1326  O O     . PHE A 1 167 ? 44.039  43.124 61.248  1.00 18.06  ? 167 PHE A O     1 
ATOM   1327  C CB    . PHE A 1 167 ? 42.058  43.081 63.532  1.00 19.05  ? 167 PHE A CB    1 
ATOM   1328  C CG    . PHE A 1 167 ? 40.851  43.188 64.399  1.00 19.92  ? 167 PHE A CG    1 
ATOM   1329  C CD1   . PHE A 1 167 ? 39.579  43.008 63.868  1.00 21.08  ? 167 PHE A CD1   1 
ATOM   1330  C CD2   . PHE A 1 167 ? 40.989  43.382 65.765  1.00 19.90  ? 167 PHE A CD2   1 
ATOM   1331  C CE1   . PHE A 1 167 ? 38.460  43.044 64.686  1.00 20.13  ? 167 PHE A CE1   1 
ATOM   1332  C CE2   . PHE A 1 167 ? 39.874  43.438 66.588  1.00 23.94  ? 167 PHE A CE2   1 
ATOM   1333  C CZ    . PHE A 1 167 ? 38.624  43.276 66.054  1.00 19.29  ? 167 PHE A CZ    1 
ATOM   1334  N N     . ASP A 1 168 ? 44.831  44.530 62.821  1.00 19.29  ? 168 ASP A N     1 
ATOM   1335  C CA    . ASP A 1 168 ? 46.221  44.091 62.569  1.00 19.39  ? 168 ASP A CA    1 
ATOM   1336  C C     . ASP A 1 168 ? 46.410  42.817 63.403  1.00 17.84  ? 168 ASP A C     1 
ATOM   1337  O O     . ASP A 1 168 ? 46.503  42.897 64.629  1.00 18.57  ? 168 ASP A O     1 
ATOM   1338  C CB    . ASP A 1 168 ? 47.161  45.196 62.999  1.00 21.94  ? 168 ASP A CB    1 
ATOM   1339  C CG    . ASP A 1 168 ? 48.632  44.856 62.838  1.00 23.14  ? 168 ASP A CG    1 
ATOM   1340  O OD1   . ASP A 1 168 ? 49.038  43.697 62.921  1.00 23.59  ? 168 ASP A OD1   1 
ATOM   1341  O OD2   . ASP A 1 168 ? 49.350  45.841 62.638  1.00 26.50  ? 168 ASP A OD2   1 
ATOM   1342  N N     . ILE A 1 169 ? 46.405  41.643 62.824  1.00 17.23  ? 169 ILE A N     1 
ATOM   1343  C CA    . ILE A 1 169 ? 46.537  40.387 63.532  1.00 25.13  ? 169 ILE A CA    1 
ATOM   1344  C C     . ILE A 1 169 ? 47.815  40.266 64.358  1.00 30.92  ? 169 ILE A C     1 
ATOM   1345  O O     . ILE A 1 169 ? 47.806  39.679 65.452  1.00 28.99  ? 169 ILE A O     1 
ATOM   1346  C CB    . ILE A 1 169 ? 46.436  39.198 62.547  1.00 24.26  ? 169 ILE A CB    1 
ATOM   1347  C CG1   . ILE A 1 169 ? 45.111  39.255 61.758  1.00 33.46  ? 169 ILE A CG1   1 
ATOM   1348  C CG2   . ILE A 1 169 ? 46.613  37.875 63.288  1.00 26.16  ? 169 ILE A CG2   1 
ATOM   1349  C CD1   . ILE A 1 169 ? 43.880  39.031 62.608  1.00 25.76  ? 169 ILE A CD1   1 
ATOM   1350  N N     . LYS A 1 170 ? 48.931  40.786 63.877  1.00 29.97  ? 170 LYS A N     1 
ATOM   1351  C CA    . LYS A 1 170 ? 50.181  40.737 64.634  1.00 33.00  ? 170 LYS A CA    1 
ATOM   1352  C C     . LYS A 1 170 ? 50.008  41.519 65.938  1.00 31.18  ? 170 LYS A C     1 
ATOM   1353  O O     . LYS A 1 170 ? 50.325  41.022 67.018  1.00 28.06  ? 170 LYS A O     1 
ATOM   1354  C CB    . LYS A 1 170 ? 51.349  41.316 63.841  1.00 43.70  ? 170 LYS A CB    1 
ATOM   1355  C CG    . LYS A 1 170 ? 52.138  40.346 63.002  1.00 63.90  ? 170 LYS A CG    1 
ATOM   1356  C CD    . LYS A 1 170 ? 51.313  39.414 62.135  1.00 75.57  ? 170 LYS A CD    1 
ATOM   1357  C CE    . LYS A 1 170 ? 50.518  40.129 61.051  1.00 82.55  ? 170 LYS A CE    1 
ATOM   1358  N NZ    . LYS A 1 170 ? 49.491  39.239 60.438  1.00 84.45  ? 170 LYS A NZ    1 
ATOM   1359  N N     . LYS A 1 171 ? 49.456  42.728 65.880  1.00 25.10  ? 171 LYS A N     1 
ATOM   1360  C CA    . LYS A 1 171 ? 49.218  43.492 67.102  1.00 27.05  ? 171 LYS A CA    1 
ATOM   1361  C C     . LYS A 1 171 ? 48.222  42.791 68.012  1.00 26.93  ? 171 LYS A C     1 
ATOM   1362  O O     . LYS A 1 171 ? 48.285  42.925 69.237  1.00 29.47  ? 171 LYS A O     1 
ATOM   1363  C CB    . LYS A 1 171 ? 48.769  44.920 66.819  1.00 26.92  ? 171 LYS A CB    1 
ATOM   1364  C CG    . LYS A 1 171 ? 49.813  45.818 66.172  1.00 33.74  ? 171 LYS A CG    1 
ATOM   1365  C CD    . LYS A 1 171 ? 49.427  47.282 66.325  1.00 36.94  ? 171 LYS A CD    1 
ATOM   1366  C CE    . LYS A 1 171 ? 50.220  48.182 65.391  1.00 46.68  ? 171 LYS A CE    1 
ATOM   1367  N NZ    . LYS A 1 171 ? 49.496  48.381 64.102  1.00 65.81  ? 171 LYS A NZ    1 
ATOM   1368  N N     . LEU A 1 172 ? 47.256  42.045 67.475  1.00 25.15  ? 172 LEU A N     1 
ATOM   1369  C CA    . LEU A 1 172 ? 46.308  41.312 68.286  1.00 25.73  ? 172 LEU A CA    1 
ATOM   1370  C C     . LEU A 1 172 ? 47.052  40.279 69.149  1.00 27.67  ? 172 LEU A C     1 
ATOM   1371  O O     . LEU A 1 172 ? 46.872  40.245 70.359  1.00 23.95  ? 172 LEU A O     1 
ATOM   1372  C CB    . LEU A 1 172 ? 45.237  40.600 67.458  1.00 16.39  ? 172 LEU A CB    1 
ATOM   1373  C CG    . LEU A 1 172 ? 44.233  39.752 68.268  1.00 25.06  ? 172 LEU A CG    1 
ATOM   1374  C CD1   . LEU A 1 172 ? 43.511  40.599 69.313  1.00 21.22  ? 172 LEU A CD1   1 
ATOM   1375  C CD2   . LEU A 1 172 ? 43.242  39.079 67.342  1.00 18.38  ? 172 LEU A CD2   1 
ATOM   1376  N N     . LYS A 1 173 ? 47.840  39.446 68.502  1.00 27.11  ? 173 LYS A N     1 
ATOM   1377  C CA    . LYS A 1 173 ? 48.629  38.422 69.163  1.00 30.50  ? 173 LYS A CA    1 
ATOM   1378  C C     . LYS A 1 173 ? 49.583  39.043 70.183  1.00 30.51  ? 173 LYS A C     1 
ATOM   1379  O O     . LYS A 1 173 ? 49.639  38.584 71.328  1.00 30.67  ? 173 LYS A O     1 
ATOM   1380  C CB    . LYS A 1 173 ? 49.375  37.589 68.124  1.00 31.61  ? 173 LYS A CB    1 
ATOM   1381  C CG    . LYS A 1 173 ? 48.466  36.603 67.388  1.00 34.70  ? 173 LYS A CG    1 
ATOM   1382  C CD    . LYS A 1 173 ? 49.171  36.056 66.153  1.00 41.02  ? 173 LYS A CD    1 
ATOM   1383  C CE    . LYS A 1 173 ? 48.680  34.670 65.817  1.00 45.13  ? 173 LYS A CE    1 
ATOM   1384  N NZ    . LYS A 1 173 ? 48.919  34.310 64.392  1.00 59.54  ? 173 LYS A NZ    1 
ATOM   1385  N N     . GLU A 1 174 ? 50.237  40.141 69.830  1.00 27.49  ? 174 GLU A N     1 
ATOM   1386  C CA    . GLU A 1 174 ? 51.140  40.807 70.765  1.00 32.15  ? 174 GLU A CA    1 
ATOM   1387  C C     . GLU A 1 174 ? 50.387  41.306 71.984  1.00 36.11  ? 174 GLU A C     1 
ATOM   1388  O O     . GLU A 1 174 ? 50.854  41.169 73.113  1.00 34.14  ? 174 GLU A O     1 
ATOM   1389  C CB    . GLU A 1 174 ? 51.873  41.976 70.111  1.00 34.48  ? 174 GLU A CB    1 
ATOM   1390  C CG    . GLU A 1 174 ? 52.913  41.515 69.102  1.00 56.14  ? 174 GLU A CG    1 
ATOM   1391  C CD    . GLU A 1 174 ? 53.518  42.629 68.275  1.00 65.71  ? 174 GLU A CD    1 
ATOM   1392  O OE1   . GLU A 1 174 ? 53.135  43.809 68.424  1.00 71.61  ? 174 GLU A OE1   1 
ATOM   1393  O OE2   . GLU A 1 174 ? 54.403  42.308 67.454  1.00 70.89  ? 174 GLU A OE2   1 
ATOM   1394  N N     . ASN A 1 175 ? 49.207  41.903 71.788  1.00 31.61  ? 175 ASN A N     1 
ATOM   1395  C CA    . ASN A 1 175 ? 48.441  42.409 72.913  1.00 26.51  ? 175 ASN A CA    1 
ATOM   1396  C C     . ASN A 1 175 ? 47.940  41.303 73.818  1.00 23.46  ? 175 ASN A C     1 
ATOM   1397  O O     . ASN A 1 175 ? 47.907  41.519 75.027  1.00 27.09  ? 175 ASN A O     1 
ATOM   1398  C CB    . ASN A 1 175 ? 47.266  43.266 72.419  1.00 29.53  ? 175 ASN A CB    1 
ATOM   1399  C CG    . ASN A 1 175 ? 47.776  44.693 72.288  1.00 26.73  ? 175 ASN A CG    1 
ATOM   1400  O OD1   . ASN A 1 175 ? 47.744  45.409 73.276  1.00 32.45  ? 175 ASN A OD1   1 
ATOM   1401  N ND2   . ASN A 1 175 ? 48.271  45.070 71.138  1.00 28.01  ? 175 ASN A ND2   1 
ATOM   1402  N N     . ILE A 1 176 ? 47.576  40.157 73.252  1.00 22.24  ? 176 ILE A N     1 
ATOM   1403  C CA    . ILE A 1 176 ? 47.123  39.045 74.067  1.00 28.07  ? 176 ILE A CA    1 
ATOM   1404  C C     . ILE A 1 176 ? 48.290  38.543 74.943  1.00 33.96  ? 176 ILE A C     1 
ATOM   1405  O O     . ILE A 1 176 ? 48.104  38.278 76.121  1.00 33.31  ? 176 ILE A O     1 
ATOM   1406  C CB    . ILE A 1 176 ? 46.536  37.921 73.201  1.00 29.04  ? 176 ILE A CB    1 
ATOM   1407  C CG1   . ILE A 1 176 ? 45.259  38.424 72.503  1.00 30.74  ? 176 ILE A CG1   1 
ATOM   1408  C CG2   . ILE A 1 176 ? 46.241  36.680 74.050  1.00 27.74  ? 176 ILE A CG2   1 
ATOM   1409  C CD1   . ILE A 1 176 ? 44.620  37.441 71.541  1.00 25.00  ? 176 ILE A CD1   1 
ATOM   1410  N N     . ALA A 1 177 ? 49.472  38.433 74.363  1.00 33.49  ? 177 ALA A N     1 
ATOM   1411  C CA    . ALA A 1 177 ? 50.663  37.981 75.070  1.00 35.30  ? 177 ALA A CA    1 
ATOM   1412  C C     . ALA A 1 177 ? 51.035  38.994 76.150  1.00 32.87  ? 177 ALA A C     1 
ATOM   1413  O O     . ALA A 1 177 ? 51.293  38.602 77.273  1.00 35.90  ? 177 ALA A O     1 
ATOM   1414  C CB    . ALA A 1 177 ? 51.836  37.796 74.120  1.00 35.40  ? 177 ALA A CB    1 
ATOM   1415  N N     . GLN A 1 178 ? 50.985  40.272 75.813  1.00 30.02  ? 178 GLN A N     1 
ATOM   1416  C CA    . GLN A 1 178 ? 51.367  41.301 76.763  1.00 32.53  ? 178 GLN A CA    1 
ATOM   1417  C C     . GLN A 1 178 ? 50.410  41.425 77.928  1.00 37.81  ? 178 GLN A C     1 
ATOM   1418  O O     . GLN A 1 178 ? 50.855  41.573 79.070  1.00 37.59  ? 178 GLN A O     1 
ATOM   1419  C CB    . GLN A 1 178 ? 51.514  42.651 76.065  1.00 30.50  ? 178 GLN A CB    1 
ATOM   1420  C CG    . GLN A 1 178 ? 51.799  43.819 76.972  1.00 46.15  ? 178 GLN A CG    1 
ATOM   1421  C CD    . GLN A 1 178 ? 51.606  45.164 76.299  1.00 56.98  ? 178 GLN A CD    1 
ATOM   1422  O OE1   . GLN A 1 178 ? 51.676  45.302 75.080  1.00 65.51  ? 178 GLN A OE1   1 
ATOM   1423  N NE2   . GLN A 1 178 ? 51.352  46.193 77.102  1.00 61.26  ? 178 GLN A NE2   1 
ATOM   1424  N N     . HIS A 1 179 ? 49.112  41.450 77.679  1.00 34.41  ? 179 HIS A N     1 
ATOM   1425  C CA    . HIS A 1 179 ? 48.162  41.650 78.765  1.00 30.20  ? 179 HIS A CA    1 
ATOM   1426  C C     . HIS A 1 179 ? 47.737  40.333 79.386  1.00 27.90  ? 179 HIS A C     1 
ATOM   1427  O O     . HIS A 1 179 ? 47.332  40.343 80.546  1.00 29.43  ? 179 HIS A O     1 
ATOM   1428  C CB    . HIS A 1 179 ? 46.911  42.413 78.273  1.00 27.17  ? 179 HIS A CB    1 
ATOM   1429  C CG    . HIS A 1 179 ? 47.279  43.803 77.859  1.00 23.95  ? 179 HIS A CG    1 
ATOM   1430  N ND1   . HIS A 1 179 ? 47.344  44.833 78.757  1.00 25.96  ? 179 HIS A ND1   1 
ATOM   1431  C CD2   . HIS A 1 179 ? 47.627  44.307 76.645  1.00 23.74  ? 179 HIS A CD2   1 
ATOM   1432  C CE1   . HIS A 1 179 ? 47.718  45.938 78.129  1.00 24.13  ? 179 HIS A CE1   1 
ATOM   1433  N NE2   . HIS A 1 179 ? 47.882  45.643 76.855  1.00 23.36  ? 179 HIS A NE2   1 
ATOM   1434  N N     . GLY A 1 180 ? 47.789  39.257 78.620  1.00 26.55  ? 180 GLY A N     1 
ATOM   1435  C CA    . GLY A 1 180 ? 47.315  37.970 79.105  1.00 25.48  ? 180 GLY A CA    1 
ATOM   1436  C C     . GLY A 1 180 ? 45.839  37.801 78.737  1.00 27.93  ? 180 GLY A C     1 
ATOM   1437  O O     . GLY A 1 180 ? 45.060  38.731 78.918  1.00 29.83  ? 180 GLY A O     1 
ATOM   1438  N N     . ALA A 1 181 ? 45.431  36.620 78.302  1.00 27.52  ? 181 ALA A N     1 
ATOM   1439  C CA    . ALA A 1 181 ? 44.041  36.342 77.945  1.00 32.31  ? 181 ALA A CA    1 
ATOM   1440  C C     . ALA A 1 181 ? 43.081  36.620 79.086  1.00 35.55  ? 181 ALA A C     1 
ATOM   1441  O O     . ALA A 1 181 ? 41.976  37.122 78.904  1.00 34.10  ? 181 ALA A O     1 
ATOM   1442  C CB    . ALA A 1 181 ? 43.905  34.898 77.503  1.00 26.91  ? 181 ALA A CB    1 
ATOM   1443  N N     . ASP A 1 182 ? 43.515  36.326 80.314  1.00 32.87  ? 182 ASP A N     1 
ATOM   1444  C CA    . ASP A 1 182 ? 42.750  36.592 81.519  1.00 30.64  ? 182 ASP A CA    1 
ATOM   1445  C C     . ASP A 1 182 ? 42.405  38.064 81.701  1.00 26.12  ? 182 ASP A C     1 
ATOM   1446  O O     . ASP A 1 182 ? 41.374  38.319 82.327  1.00 28.83  ? 182 ASP A O     1 
ATOM   1447  C CB    . ASP A 1 182 ? 43.522  36.151 82.764  1.00 45.34  ? 182 ASP A CB    1 
ATOM   1448  C CG    . ASP A 1 182 ? 43.560  34.642 82.891  1.00 53.70  ? 182 ASP A CG    1 
ATOM   1449  O OD1   . ASP A 1 182 ? 42.928  33.934 82.082  1.00 63.41  ? 182 ASP A OD1   1 
ATOM   1450  O OD2   . ASP A 1 182 ? 44.243  34.187 83.830  1.00 70.29  ? 182 ASP A OD2   1 
ATOM   1451  N N     . ASN A 1 183 ? 43.192  39.003 81.202  1.00 19.44  ? 183 ASN A N     1 
ATOM   1452  C CA    . ASN A 1 183 ? 42.825  40.401 81.319  1.00 23.43  ? 183 ASN A CA    1 
ATOM   1453  C C     . ASN A 1 183 ? 41.968  40.954 80.166  1.00 20.20  ? 183 ASN A C     1 
ATOM   1454  O O     . ASN A 1 183 ? 41.588  42.118 80.255  1.00 22.04  ? 183 ASN A O     1 
ATOM   1455  C CB    . ASN A 1 183 ? 44.118  41.233 81.457  1.00 26.34  ? 183 ASN A CB    1 
ATOM   1456  C CG    . ASN A 1 183 ? 44.681  41.016 82.866  1.00 41.37  ? 183 ASN A CG    1 
ATOM   1457  O OD1   . ASN A 1 183 ? 43.941  41.076 83.855  1.00 30.14  ? 183 ASN A OD1   1 
ATOM   1458  N ND2   . ASN A 1 183 ? 45.973  40.741 82.958  1.00 33.31  ? 183 ASN A ND2   1 
ATOM   1459  N N     . ILE A 1 184 ? 41.729  40.155 79.130  1.00 20.08  ? 184 ILE A N     1 
ATOM   1460  C CA    . ILE A 1 184 ? 41.007  40.645 77.951  1.00 21.63  ? 184 ILE A CA    1 
ATOM   1461  C C     . ILE A 1 184 ? 39.531  40.368 78.175  1.00 16.03  ? 184 ILE A C     1 
ATOM   1462  O O     . ILE A 1 184 ? 39.089  39.218 78.050  1.00 18.11  ? 184 ILE A O     1 
ATOM   1463  C CB    . ILE A 1 184 ? 41.415  40.020 76.613  1.00 24.28  ? 184 ILE A CB    1 
ATOM   1464  C CG1   . ILE A 1 184 ? 42.932  39.905 76.440  1.00 27.21  ? 184 ILE A CG1   1 
ATOM   1465  C CG2   . ILE A 1 184 ? 40.809  40.786 75.422  1.00 23.90  ? 184 ILE A CG2   1 
ATOM   1466  C CD1   . ILE A 1 184 ? 43.691  41.205 76.445  1.00 27.79  ? 184 ILE A CD1   1 
ATOM   1467  N N     . VAL A 1 185 ? 38.806  41.408 78.537  1.00 18.64  ? 185 VAL A N     1 
ATOM   1468  C CA    . VAL A 1 185 ? 37.367  41.262 78.824  1.00 20.12  ? 185 VAL A CA    1 
ATOM   1469  C C     . VAL A 1 185 ? 36.615  40.824 77.570  1.00 17.53  ? 185 VAL A C     1 
ATOM   1470  O O     . VAL A 1 185 ? 35.755  39.940 77.622  1.00 17.04  ? 185 VAL A O     1 
ATOM   1471  C CB    . VAL A 1 185 ? 36.789  42.569 79.377  1.00 23.83  ? 185 VAL A CB    1 
ATOM   1472  C CG1   . VAL A 1 185 ? 35.310  42.448 79.681  1.00 22.08  ? 185 VAL A CG1   1 
ATOM   1473  C CG2   . VAL A 1 185 ? 37.547  43.036 80.611  1.00 22.63  ? 185 VAL A CG2   1 
ATOM   1474  N N     . ALA A 1 186 ? 36.931  41.454 76.442  1.00 20.35  ? 186 ALA A N     1 
ATOM   1475  C CA    . ALA A 1 186 ? 36.333  41.117 75.164  1.00 22.08  ? 186 ALA A CA    1 
ATOM   1476  C C     . ALA A 1 186 ? 37.104  41.752 74.004  1.00 17.34  ? 186 ALA A C     1 
ATOM   1477  O O     . ALA A 1 186 ? 37.819  42.734 74.153  1.00 17.69  ? 186 ALA A O     1 
ATOM   1478  C CB    . ALA A 1 186 ? 34.899  41.651 75.033  1.00 18.52  ? 186 ALA A CB    1 
ATOM   1479  N N     . ILE A 1 187 ? 36.892  41.136 72.840  1.00 16.79  ? 187 ILE A N     1 
ATOM   1480  C CA    . ILE A 1 187 ? 37.373  41.751 71.606  1.00 18.28  ? 187 ILE A CA    1 
ATOM   1481  C C     . ILE A 1 187 ? 36.141  42.423 70.992  1.00 18.68  ? 187 ILE A C     1 
ATOM   1482  O O     . ILE A 1 187 ? 35.094  41.772 70.960  1.00 16.07  ? 187 ILE A O     1 
ATOM   1483  C CB    . ILE A 1 187 ? 38.036  40.746 70.683  1.00 24.21  ? 187 ILE A CB    1 
ATOM   1484  C CG1   . ILE A 1 187 ? 39.426  40.395 71.284  1.00 21.30  ? 187 ILE A CG1   1 
ATOM   1485  C CG2   . ILE A 1 187 ? 38.180  41.305 69.265  1.00 20.78  ? 187 ILE A CG2   1 
ATOM   1486  C CD1   . ILE A 1 187 ? 39.987  39.119 70.679  1.00 23.35  ? 187 ILE A CD1   1 
ATOM   1487  N N     . VAL A 1 188 ? 36.248  43.648 70.520  1.00 17.42  ? 188 VAL A N     1 
ATOM   1488  C CA    . VAL A 1 188 ? 35.081  44.284 69.882  1.00 18.52  ? 188 VAL A CA    1 
ATOM   1489  C C     . VAL A 1 188 ? 35.394  44.479 68.375  1.00 17.80  ? 188 VAL A C     1 
ATOM   1490  O O     . VAL A 1 188 ? 36.231  45.305 68.030  1.00 16.63  ? 188 VAL A O     1 
ATOM   1491  C CB    . VAL A 1 188 ? 34.808  45.664 70.481  1.00 19.57  ? 188 VAL A CB    1 
ATOM   1492  C CG1   . VAL A 1 188 ? 33.680  46.383 69.761  1.00 16.52  ? 188 VAL A CG1   1 
ATOM   1493  C CG2   . VAL A 1 188 ? 34.567  45.594 71.995  1.00 17.93  ? 188 VAL A CG2   1 
ATOM   1494  N N     . SER A 1 189 ? 34.684  43.768 67.522  1.00 16.35  ? 189 SER A N     1 
ATOM   1495  C CA    . SER A 1 189 ? 34.883  43.902 66.070  1.00 16.75  ? 189 SER A CA    1 
ATOM   1496  C C     . SER A 1 189 ? 33.940  44.961 65.528  1.00 17.31  ? 189 SER A C     1 
ATOM   1497  O O     . SER A 1 189 ? 32.735  44.699 65.570  1.00 14.29  ? 189 SER A O     1 
ATOM   1498  C CB    . SER A 1 189 ? 34.621  42.601 65.345  1.00 15.44  ? 189 SER A CB    1 
ATOM   1499  O OG    . SER A 1 189 ? 35.446  41.553 65.736  1.00 21.85  ? 189 SER A OG    1 
ATOM   1500  N N     . THR A 1 190 ? 34.450  46.101 65.126  1.00 12.10  ? 190 THR A N     1 
ATOM   1501  C CA    . THR A 1 190 ? 33.561  47.162 64.650  1.00 15.75  ? 190 THR A CA    1 
ATOM   1502  C C     . THR A 1 190 ? 33.388  47.107 63.147  1.00 18.21  ? 190 THR A C     1 
ATOM   1503  O O     . THR A 1 190 ? 34.360  47.237 62.384  1.00 14.44  ? 190 THR A O     1 
ATOM   1504  C CB    . THR A 1 190 ? 34.166  48.516 65.077  1.00 15.08  ? 190 THR A CB    1 
ATOM   1505  O OG1   . THR A 1 190 ? 34.394  48.389 66.480  1.00 16.97  ? 190 THR A OG1   1 
ATOM   1506  C CG2   . THR A 1 190 ? 33.223  49.654 64.783  1.00 12.87  ? 190 THR A CG2   1 
ATOM   1507  N N     . VAL A 1 191 ? 32.175  46.884 62.681  1.00 13.89  ? 191 VAL A N     1 
ATOM   1508  C CA    . VAL A 1 191 ? 31.887  46.776 61.233  1.00 15.57  ? 191 VAL A CA    1 
ATOM   1509  C C     . VAL A 1 191 ? 30.811  47.775 60.820  1.00 19.17  ? 191 VAL A C     1 
ATOM   1510  O O     . VAL A 1 191 ? 29.723  47.937 61.359  1.00 12.09  ? 191 VAL A O     1 
ATOM   1511  C CB    . VAL A 1 191 ? 31.450  45.354 60.880  1.00 17.46  ? 191 VAL A CB    1 
ATOM   1512  C CG1   . VAL A 1 191 ? 32.534  44.308 60.991  1.00 14.72  ? 191 VAL A CG1   1 
ATOM   1513  C CG2   . VAL A 1 191 ? 30.255  44.888 61.739  1.00 9.18   ? 191 VAL A CG2   1 
ATOM   1514  N N     . THR A 1 192 ? 31.060  48.578 59.783  1.00 15.87  ? 192 THR A N     1 
ATOM   1515  C CA    . THR A 1 192 ? 32.339  48.787 59.187  1.00 14.68  ? 192 THR A CA    1 
ATOM   1516  C C     . THR A 1 192 ? 33.165  49.502 60.291  1.00 13.78  ? 192 THR A C     1 
ATOM   1517  O O     . THR A 1 192 ? 32.647  49.884 61.354  1.00 12.56  ? 192 THR A O     1 
ATOM   1518  C CB    . THR A 1 192 ? 32.255  49.821 58.032  1.00 12.10  ? 192 THR A CB    1 
ATOM   1519  O OG1   . THR A 1 192 ? 31.587  50.992 58.533  1.00 11.03  ? 192 THR A OG1   1 
ATOM   1520  C CG2   . THR A 1 192 ? 31.468  49.265 56.833  1.00 7.75   ? 192 THR A CG2   1 
ATOM   1521  N N     . CYS A 1 193 ? 34.446  49.659 60.065  1.00 16.48  ? 193 CYS A N     1 
ATOM   1522  C CA    . CYS A 1 193 ? 35.334  50.329 60.986  1.00 13.60  ? 193 CYS A CA    1 
ATOM   1523  C C     . CYS A 1 193 ? 35.166  51.840 60.875  1.00 17.38  ? 193 CYS A C     1 
ATOM   1524  O O     . CYS A 1 193 ? 35.698  52.582 60.050  1.00 16.00  ? 193 CYS A O     1 
ATOM   1525  C CB    . CYS A 1 193 ? 36.794  49.902 60.792  1.00 18.44  ? 193 CYS A CB    1 
ATOM   1526  S SG    . CYS A 1 193 ? 37.785  50.694 62.075  1.00 18.53  ? 193 CYS A SG    1 
ATOM   1527  N N     . ASN A 1 194 ? 34.319  52.332 61.764  1.00 19.15  ? 194 ASN A N     1 
ATOM   1528  C CA    . ASN A 1 194 ? 33.850  53.701 61.753  1.00 20.91  ? 194 ASN A CA    1 
ATOM   1529  C C     . ASN A 1 194 ? 34.967  54.726 61.798  1.00 24.68  ? 194 ASN A C     1 
ATOM   1530  O O     . ASN A 1 194 ? 35.097  55.629 60.960  1.00 20.49  ? 194 ASN A O     1 
ATOM   1531  C CB    . ASN A 1 194 ? 32.896  53.936 62.955  1.00 29.93  ? 194 ASN A CB    1 
ATOM   1532  C CG    . ASN A 1 194 ? 32.418  55.375 62.886  1.00 41.29  ? 194 ASN A CG    1 
ATOM   1533  O OD1   . ASN A 1 194 ? 31.909  55.837 61.863  1.00 47.10  ? 194 ASN A OD1   1 
ATOM   1534  N ND2   . ASN A 1 194 ? 32.702  56.100 63.957  1.00 57.54  ? 194 ASN A ND2   1 
ATOM   1535  N N     . SER A 1 195 ? 35.772  54.616 62.860  1.00 25.11  ? 195 SER A N     1 
ATOM   1536  C CA    . SER A 1 195 ? 36.859  55.539 63.119  1.00 29.51  ? 195 SER A CA    1 
ATOM   1537  C C     . SER A 1 195 ? 37.947  55.514 62.062  1.00 29.11  ? 195 SER A C     1 
ATOM   1538  O O     . SER A 1 195 ? 38.592  56.543 61.869  1.00 32.79  ? 195 SER A O     1 
ATOM   1539  C CB    . SER A 1 195 ? 37.454  55.343 64.513  1.00 32.04  ? 195 SER A CB    1 
ATOM   1540  O OG    . SER A 1 195 ? 36.425  55.345 65.488  1.00 33.15  ? 195 SER A OG    1 
ATOM   1541  N N     . ALA A 1 196 ? 38.082  54.441 61.289  1.00 27.74  ? 196 ALA A N     1 
ATOM   1542  C CA    . ALA A 1 196 ? 39.016  54.422 60.182  1.00 28.66  ? 196 ALA A CA    1 
ATOM   1543  C C     . ALA A 1 196 ? 38.388  55.008 58.906  1.00 28.46  ? 196 ALA A C     1 
ATOM   1544  O O     . ALA A 1 196 ? 39.048  54.948 57.864  1.00 31.31  ? 196 ALA A O     1 
ATOM   1545  C CB    . ALA A 1 196 ? 39.514  53.019 59.895  1.00 25.84  ? 196 ALA A CB    1 
ATOM   1546  N N     . GLY A 1 197 ? 37.200  55.581 58.956  1.00 23.79  ? 197 GLY A N     1 
ATOM   1547  C CA    . GLY A 1 197 ? 36.574  56.185 57.799  1.00 23.05  ? 197 GLY A CA    1 
ATOM   1548  C C     . GLY A 1 197 ? 35.441  55.334 57.220  1.00 24.06  ? 197 GLY A C     1 
ATOM   1549  O O     . GLY A 1 197 ? 35.184  55.404 56.011  1.00 28.09  ? 197 GLY A O     1 
ATOM   1550  N N     . GLY A 1 198 ? 34.775  54.498 58.021  1.00 20.07  ? 198 GLY A N     1 
ATOM   1551  C CA    . GLY A 1 198 ? 33.768  53.600 57.538  1.00 14.93  ? 198 GLY A CA    1 
ATOM   1552  C C     . GLY A 1 198 ? 34.350  52.556 56.581  1.00 18.52  ? 198 GLY A C     1 
ATOM   1553  O O     . GLY A 1 198 ? 33.646  52.151 55.656  1.00 12.07  ? 198 GLY A O     1 
ATOM   1554  N N     . GLN A 1 199 ? 35.539  52.035 56.847  1.00 15.15  ? 199 GLN A N     1 
ATOM   1555  C CA    . GLN A 1 199 ? 36.180  51.040 56.002  1.00 14.70  ? 199 GLN A CA    1 
ATOM   1556  C C     . GLN A 1 199 ? 35.830  49.637 56.433  1.00 13.30  ? 199 GLN A C     1 
ATOM   1557  O O     . GLN A 1 199 ? 35.718  49.357 57.634  1.00 15.15  ? 199 GLN A O     1 
ATOM   1558  C CB    . GLN A 1 199 ? 37.711  51.259 55.999  1.00 12.88  ? 199 GLN A CB    1 
ATOM   1559  C CG    . GLN A 1 199 ? 38.026  52.708 55.632  1.00 11.88  ? 199 GLN A CG    1 
ATOM   1560  C CD    . GLN A 1 199 ? 37.842  52.947 54.134  1.00 14.67  ? 199 GLN A CD    1 
ATOM   1561  O OE1   . GLN A 1 199 ? 38.044  52.026 53.322  1.00 15.37  ? 199 GLN A OE1   1 
ATOM   1562  N NE2   . GLN A 1 199 ? 37.483  54.162 53.775  1.00 16.95  ? 199 GLN A NE2   1 
ATOM   1563  N N     . PRO A 1 200 ? 35.583  48.762 55.460  1.00 12.13  ? 200 PRO A N     1 
ATOM   1564  C CA    . PRO A 1 200 ? 35.137  47.433 55.750  1.00 13.73  ? 200 PRO A CA    1 
ATOM   1565  C C     . PRO A 1 200 ? 36.199  46.568 56.402  1.00 19.63  ? 200 PRO A C     1 
ATOM   1566  O O     . PRO A 1 200 ? 37.399  46.753 56.183  1.00 18.16  ? 200 PRO A O     1 
ATOM   1567  C CB    . PRO A 1 200 ? 34.799  46.814 54.382  1.00 11.48  ? 200 PRO A CB    1 
ATOM   1568  C CG    . PRO A 1 200 ? 35.549  47.679 53.410  1.00 11.54  ? 200 PRO A CG    1 
ATOM   1569  C CD    . PRO A 1 200 ? 35.657  49.044 54.002  1.00 11.65  ? 200 PRO A CD    1 
ATOM   1570  N N     . VAL A 1 201 ? 35.719  45.584 57.101  1.00 14.38  ? 201 VAL A N     1 
ATOM   1571  C CA    . VAL A 1 201 ? 36.528  44.538 57.699  1.00 15.69  ? 201 VAL A CA    1 
ATOM   1572  C C     . VAL A 1 201 ? 36.256  43.307 56.831  1.00 17.60  ? 201 VAL A C     1 
ATOM   1573  O O     . VAL A 1 201 ? 35.067  43.009 56.605  1.00 15.55  ? 201 VAL A O     1 
ATOM   1574  C CB    . VAL A 1 201 ? 36.114  44.262 59.172  1.00 14.89  ? 201 VAL A CB    1 
ATOM   1575  C CG1   . VAL A 1 201 ? 37.036  43.236 59.788  1.00 13.59  ? 201 VAL A CG1   1 
ATOM   1576  C CG2   . VAL A 1 201 ? 36.142  45.609 59.894  1.00 7.71   ? 201 VAL A CG2   1 
ATOM   1577  N N     . SER A 1 202 ? 37.267  42.618 56.338  1.00 12.57  ? 202 SER A N     1 
ATOM   1578  C CA    . SER A 1 202 ? 37.028  41.445 55.523  1.00 14.00  ? 202 SER A CA    1 
ATOM   1579  C C     . SER A 1 202 ? 36.486  40.278 56.325  1.00 15.58  ? 202 SER A C     1 
ATOM   1580  O O     . SER A 1 202 ? 36.714  40.167 57.527  1.00 16.15  ? 202 SER A O     1 
ATOM   1581  C CB    . SER A 1 202 ? 38.336  41.052 54.802  1.00 21.54  ? 202 SER A CB    1 
ATOM   1582  O OG    . SER A 1 202 ? 39.250  40.446 55.696  1.00 20.52  ? 202 SER A OG    1 
ATOM   1583  N N     . MET A 1 203 ? 35.808  39.345 55.646  1.00 12.26  ? 203 MET A N     1 
ATOM   1584  C CA    . MET A 1 203 ? 35.326  38.143 56.269  1.00 15.90  ? 203 MET A CA    1 
ATOM   1585  C C     . MET A 1 203 ? 36.486  37.336 56.887  1.00 22.67  ? 203 MET A C     1 
ATOM   1586  O O     . MET A 1 203 ? 36.353  36.775 57.976  1.00 16.96  ? 203 MET A O     1 
ATOM   1587  C CB    . MET A 1 203 ? 34.583  37.256 55.262  1.00 11.92  ? 203 MET A CB    1 
ATOM   1588  C CG    . MET A 1 203 ? 33.865  36.073 55.905  1.00 20.03  ? 203 MET A CG    1 
ATOM   1589  S SD    . MET A 1 203 ? 32.456  36.689 56.904  1.00 20.52  ? 203 MET A SD    1 
ATOM   1590  C CE    . MET A 1 203 ? 31.241  37.037 55.636  1.00 19.80  ? 203 MET A CE    1 
ATOM   1591  N N     . SER A 1 204 ? 37.597  37.239 56.136  1.00 19.70  ? 204 SER A N     1 
ATOM   1592  C CA    . SER A 1 204 ? 38.716  36.423 56.574  1.00 22.21  ? 204 SER A CA    1 
ATOM   1593  C C     . SER A 1 204 ? 39.388  37.044 57.792  1.00 15.93  ? 204 SER A C     1 
ATOM   1594  O O     . SER A 1 204 ? 39.792  36.290 58.673  1.00 19.17  ? 204 SER A O     1 
ATOM   1595  C CB    . SER A 1 204 ? 39.688  36.127 55.410  1.00 22.40  ? 204 SER A CB    1 
ATOM   1596  O OG    . SER A 1 204 ? 40.330  37.348 55.115  1.00 34.15  ? 204 SER A OG    1 
ATOM   1597  N N     . ASN A 1 205 ? 39.418  38.356 57.918  1.00 15.02  ? 205 ASN A N     1 
ATOM   1598  C CA    . ASN A 1 205 ? 39.945  39.018 59.098  1.00 16.24  ? 205 ASN A CA    1 
ATOM   1599  C C     . ASN A 1 205 ? 39.028  38.755 60.296  1.00 24.37  ? 205 ASN A C     1 
ATOM   1600  O O     . ASN A 1 205 ? 39.430  38.320 61.371  1.00 20.01  ? 205 ASN A O     1 
ATOM   1601  C CB    . ASN A 1 205 ? 40.105  40.501 58.837  1.00 15.51  ? 205 ASN A CB    1 
ATOM   1602  C CG    . ASN A 1 205 ? 40.877  41.220 59.929  1.00 22.50  ? 205 ASN A CG    1 
ATOM   1603  O OD1   . ASN A 1 205 ? 40.340  42.002 60.722  1.00 20.80  ? 205 ASN A OD1   1 
ATOM   1604  N ND2   . ASN A 1 205 ? 42.181  40.995 59.956  1.00 22.05  ? 205 ASN A ND2   1 
ATOM   1605  N N     . LEU A 1 206 ? 37.725  38.916 60.144  1.00 21.72  ? 206 LEU A N     1 
ATOM   1606  C CA    . LEU A 1 206 ? 36.739  38.620 61.183  1.00 19.09  ? 206 LEU A CA    1 
ATOM   1607  C C     . LEU A 1 206 ? 36.892  37.172 61.650  1.00 18.11  ? 206 LEU A C     1 
ATOM   1608  O O     . LEU A 1 206 ? 36.865  36.905 62.853  1.00 16.36  ? 206 LEU A O     1 
ATOM   1609  C CB    . LEU A 1 206 ? 35.303  38.768 60.684  1.00 11.91  ? 206 LEU A CB    1 
ATOM   1610  C CG    . LEU A 1 206 ? 34.840  40.206 60.418  1.00 14.60  ? 206 LEU A CG    1 
ATOM   1611  C CD1   . LEU A 1 206 ? 33.474  40.221 59.733  1.00 16.69  ? 206 LEU A CD1   1 
ATOM   1612  C CD2   . LEU A 1 206 ? 34.838  41.006 61.715  1.00 15.00  ? 206 LEU A CD2   1 
ATOM   1613  N N     . LYS A 1 207 ? 37.050  36.253 60.713  1.00 18.14  ? 207 LYS A N     1 
ATOM   1614  C CA    . LYS A 1 207 ? 37.186  34.847 61.028  1.00 18.60  ? 207 LYS A CA    1 
ATOM   1615  C C     . LYS A 1 207 ? 38.475  34.576 61.841  1.00 23.71  ? 207 LYS A C     1 
ATOM   1616  O O     . LYS A 1 207 ? 38.437  33.882 62.852  1.00 21.26  ? 207 LYS A O     1 
ATOM   1617  C CB    . LYS A 1 207 ? 37.218  34.052 59.735  1.00 21.50  ? 207 LYS A CB    1 
ATOM   1618  C CG    . LYS A 1 207 ? 37.417  32.566 59.895  1.00 24.77  ? 207 LYS A CG    1 
ATOM   1619  C CD    . LYS A 1 207 ? 37.103  31.860 58.576  1.00 37.71  ? 207 LYS A CD    1 
ATOM   1620  C CE    . LYS A 1 207 ? 37.340  30.361 58.662  1.00 41.64  ? 207 LYS A CE    1 
ATOM   1621  N NZ    . LYS A 1 207 ? 38.795  30.065 58.604  1.00 51.46  ? 207 LYS A NZ    1 
ATOM   1622  N N     . GLU A 1 208 ? 39.578  35.152 61.400  1.00 19.75  ? 208 GLU A N     1 
ATOM   1623  C CA    . GLU A 1 208 ? 40.869  34.937 62.024  1.00 24.93  ? 208 GLU A CA    1 
ATOM   1624  C C     . GLU A 1 208 ? 40.869  35.502 63.449  1.00 24.84  ? 208 GLU A C     1 
ATOM   1625  O O     . GLU A 1 208 ? 41.314  34.835 64.364  1.00 21.06  ? 208 GLU A O     1 
ATOM   1626  C CB    . GLU A 1 208 ? 42.024  35.543 61.228  1.00 29.06  ? 208 GLU A CB    1 
ATOM   1627  C CG    . GLU A 1 208 ? 43.367  35.260 61.883  1.00 41.76  ? 208 GLU A CG    1 
ATOM   1628  C CD    . GLU A 1 208 ? 44.528  35.228 60.920  1.00 45.15  ? 208 GLU A CD    1 
ATOM   1629  O OE1   . GLU A 1 208 ? 44.520  35.897 59.877  1.00 45.57  ? 208 GLU A OE1   1 
ATOM   1630  O OE2   . GLU A 1 208 ? 45.486  34.499 61.221  1.00 51.73  ? 208 GLU A OE2   1 
ATOM   1631  N N     . VAL A 1 209 ? 40.335  36.698 63.617  1.00 23.16  ? 209 VAL A N     1 
ATOM   1632  C CA    . VAL A 1 209 ? 40.190  37.314 64.930  1.00 22.22  ? 209 VAL A CA    1 
ATOM   1633  C C     . VAL A 1 209 ? 39.355  36.433 65.857  1.00 23.40  ? 209 VAL A C     1 
ATOM   1634  O O     . VAL A 1 209 ? 39.743  36.198 66.985  1.00 22.64  ? 209 VAL A O     1 
ATOM   1635  C CB    . VAL A 1 209 ? 39.571  38.710 64.854  1.00 22.51  ? 209 VAL A CB    1 
ATOM   1636  C CG1   . VAL A 1 209 ? 39.153  39.212 66.229  1.00 20.97  ? 209 VAL A CG1   1 
ATOM   1637  C CG2   . VAL A 1 209 ? 40.529  39.684 64.188  1.00 19.87  ? 209 VAL A CG2   1 
ATOM   1638  N N     . TYR A 1 210 ? 38.220  35.929 65.393  1.00 22.09  ? 210 TYR A N     1 
ATOM   1639  C CA    . TYR A 1 210 ? 37.394  35.059 66.195  1.00 20.35  ? 210 TYR A CA    1 
ATOM   1640  C C     . TYR A 1 210 ? 38.090  33.751 66.587  1.00 24.02  ? 210 TYR A C     1 
ATOM   1641  O O     . TYR A 1 210 ? 37.897  33.297 67.700  1.00 22.07  ? 210 TYR A O     1 
ATOM   1642  C CB    . TYR A 1 210 ? 36.097  34.721 65.449  1.00 17.57  ? 210 TYR A CB    1 
ATOM   1643  C CG    . TYR A 1 210 ? 35.107  33.963 66.271  1.00 16.20  ? 210 TYR A CG    1 
ATOM   1644  C CD1   . TYR A 1 210 ? 34.477  34.638 67.319  1.00 20.00  ? 210 TYR A CD1   1 
ATOM   1645  C CD2   . TYR A 1 210 ? 34.802  32.628 66.054  1.00 15.88  ? 210 TYR A CD2   1 
ATOM   1646  C CE1   . TYR A 1 210 ? 33.522  34.023 68.116  1.00 18.44  ? 210 TYR A CE1   1 
ATOM   1647  C CE2   . TYR A 1 210 ? 33.841  31.987 66.867  1.00 19.30  ? 210 TYR A CE2   1 
ATOM   1648  C CZ    . TYR A 1 210 ? 33.236  32.690 67.868  1.00 20.29  ? 210 TYR A CZ    1 
ATOM   1649  O OH    . TYR A 1 210 ? 32.315  32.087 68.690  1.00 27.86  ? 210 TYR A OH    1 
ATOM   1650  N N     . GLU A 1 211 ? 38.780  33.101 65.649  1.00 22.18  ? 211 GLU A N     1 
ATOM   1651  C CA    . GLU A 1 211 ? 39.484  31.854 65.889  1.00 26.96  ? 211 GLU A CA    1 
ATOM   1652  C C     . GLU A 1 211 ? 40.528  32.030 66.998  1.00 25.34  ? 211 GLU A C     1 
ATOM   1653  O O     . GLU A 1 211 ? 40.636  31.191 67.895  1.00 24.16  ? 211 GLU A O     1 
ATOM   1654  C CB    . GLU A 1 211 ? 40.179  31.396 64.598  1.00 20.09  ? 211 GLU A CB    1 
ATOM   1655  C CG    . GLU A 1 211 ? 39.231  30.602 63.709  1.00 39.17  ? 211 GLU A CG    1 
ATOM   1656  C CD    . GLU A 1 211 ? 39.718  30.377 62.291  1.00 41.70  ? 211 GLU A CD    1 
ATOM   1657  O OE1   . GLU A 1 211 ? 40.763  30.905 61.854  1.00 47.44  ? 211 GLU A OE1   1 
ATOM   1658  O OE2   . GLU A 1 211 ? 39.011  29.633 61.579  1.00 49.29  ? 211 GLU A OE2   1 
ATOM   1659  N N     . ILE A 1 212 ? 41.305  33.105 66.889  1.00 22.41  ? 212 ILE A N     1 
ATOM   1660  C CA    . ILE A 1 212 ? 42.302  33.443 67.896  1.00 25.32  ? 212 ILE A CA    1 
ATOM   1661  C C     . ILE A 1 212 ? 41.619  33.674 69.233  1.00 28.04  ? 212 ILE A C     1 
ATOM   1662  O O     . ILE A 1 212 ? 42.039  33.150 70.258  1.00 26.37  ? 212 ILE A O     1 
ATOM   1663  C CB    . ILE A 1 212 ? 43.107  34.683 67.469  1.00 24.00  ? 212 ILE A CB    1 
ATOM   1664  C CG1   . ILE A 1 212 ? 44.075  34.295 66.331  1.00 25.23  ? 212 ILE A CG1   1 
ATOM   1665  C CG2   . ILE A 1 212 ? 43.872  35.331 68.605  1.00 25.19  ? 212 ILE A CG2   1 
ATOM   1666  C CD1   . ILE A 1 212 ? 44.663  35.516 65.649  1.00 23.02  ? 212 ILE A CD1   1 
ATOM   1667  N N     . ALA A 1 213 ? 40.523  34.435 69.269  1.00 25.14  ? 213 ALA A N     1 
ATOM   1668  C CA    . ALA A 1 213 ? 39.779  34.689 70.470  1.00 24.37  ? 213 ALA A CA    1 
ATOM   1669  C C     . ALA A 1 213 ? 39.285  33.392 71.113  1.00 23.20  ? 213 ALA A C     1 
ATOM   1670  O O     . ALA A 1 213 ? 39.362  33.249 72.341  1.00 22.30  ? 213 ALA A O     1 
ATOM   1671  C CB    . ALA A 1 213 ? 38.559  35.575 70.280  1.00 23.91  ? 213 ALA A CB    1 
ATOM   1672  N N     . LYS A 1 214 ? 38.702  32.499 70.319  1.00 21.63  ? 214 LYS A N     1 
ATOM   1673  C CA    . LYS A 1 214 ? 38.150  31.281 70.881  1.00 27.35  ? 214 LYS A CA    1 
ATOM   1674  C C     . LYS A 1 214 ? 39.240  30.383 71.476  1.00 30.02  ? 214 LYS A C     1 
ATOM   1675  O O     . LYS A 1 214 ? 38.999  29.692 72.451  1.00 30.53  ? 214 LYS A O     1 
ATOM   1676  C CB    . LYS A 1 214 ? 37.325  30.524 69.852  1.00 25.05  ? 214 LYS A CB    1 
ATOM   1677  C CG    . LYS A 1 214 ? 36.084  31.273 69.381  1.00 39.55  ? 214 LYS A CG    1 
ATOM   1678  C CD    . LYS A 1 214 ? 35.136  31.633 70.524  1.00 37.87  ? 214 LYS A CD    1 
ATOM   1679  C CE    . LYS A 1 214 ? 35.263  33.123 70.877  1.00 38.29  ? 214 LYS A CE    1 
ATOM   1680  N NZ    . LYS A 1 214 ? 34.506  33.438 72.125  1.00 25.26  ? 214 LYS A NZ    1 
ATOM   1681  N N     . GLN A 1 215 ? 40.423  30.409 70.924  1.00 29.15  ? 215 GLN A N     1 
ATOM   1682  C CA    . GLN A 1 215 ? 41.564  29.624 71.381  1.00 32.93  ? 215 GLN A CA    1 
ATOM   1683  C C     . GLN A 1 215 ? 41.959  30.115 72.768  1.00 30.22  ? 215 GLN A C     1 
ATOM   1684  O O     . GLN A 1 215 ? 42.324  29.319 73.614  1.00 30.33  ? 215 GLN A O     1 
ATOM   1685  C CB    . GLN A 1 215 ? 42.735  29.710 70.411  1.00 36.78  ? 215 GLN A CB    1 
ATOM   1686  C CG    . GLN A 1 215 ? 42.768  28.687 69.306  1.00 53.54  ? 215 GLN A CG    1 
ATOM   1687  C CD    . GLN A 1 215 ? 43.498  27.414 69.696  1.00 63.84  ? 215 GLN A CD    1 
ATOM   1688  O OE1   . GLN A 1 215 ? 44.720  27.369 69.777  1.00 67.98  ? 215 GLN A OE1   1 
ATOM   1689  N NE2   . GLN A 1 215 ? 42.736  26.354 69.928  1.00 69.99  ? 215 GLN A NE2   1 
ATOM   1690  N N     . HIS A 1 216 ? 41.813  31.410 73.015  1.00 26.73  ? 216 HIS A N     1 
ATOM   1691  C CA    . HIS A 1 216 ? 42.134  31.978 74.305  1.00 26.66  ? 216 HIS A CA    1 
ATOM   1692  C C     . HIS A 1 216 ? 40.932  32.083 75.231  1.00 27.73  ? 216 HIS A C     1 
ATOM   1693  O O     . HIS A 1 216 ? 41.069  32.530 76.371  1.00 26.92  ? 216 HIS A O     1 
ATOM   1694  C CB    . HIS A 1 216 ? 42.783  33.345 74.131  1.00 26.07  ? 216 HIS A CB    1 
ATOM   1695  C CG    . HIS A 1 216 ? 44.222  33.304 73.729  1.00 41.34  ? 216 HIS A CG    1 
ATOM   1696  N ND1   . HIS A 1 216 ? 44.642  33.495 72.430  1.00 42.50  ? 216 HIS A ND1   1 
ATOM   1697  C CD2   . HIS A 1 216 ? 45.344  33.116 74.456  1.00 36.98  ? 216 HIS A CD2   1 
ATOM   1698  C CE1   . HIS A 1 216 ? 45.951  33.421 72.362  1.00 45.88  ? 216 HIS A CE1   1 
ATOM   1699  N NE2   . HIS A 1 216 ? 46.397  33.195 73.584  1.00 42.04  ? 216 HIS A NE2   1 
ATOM   1700  N N     . GLY A 1 217 ? 39.755  31.705 74.763  1.00 27.52  ? 217 GLY A N     1 
ATOM   1701  C CA    . GLY A 1 217 ? 38.550  31.839 75.569  1.00 27.10  ? 217 GLY A CA    1 
ATOM   1702  C C     . GLY A 1 217 ? 38.090  33.285 75.680  1.00 26.72  ? 217 GLY A C     1 
ATOM   1703  O O     . GLY A 1 217 ? 37.458  33.663 76.679  1.00 27.67  ? 217 GLY A O     1 
ATOM   1704  N N     . ILE A 1 218 ? 38.428  34.156 74.744  1.00 22.76  ? 218 ILE A N     1 
ATOM   1705  C CA    . ILE A 1 218 ? 38.035  35.560 74.800  1.00 22.80  ? 218 ILE A CA    1 
ATOM   1706  C C     . ILE A 1 218 ? 36.681  35.753 74.102  1.00 23.46  ? 218 ILE A C     1 
ATOM   1707  O O     . ILE A 1 218 ? 36.419  35.204 73.030  1.00 21.03  ? 218 ILE A O     1 
ATOM   1708  C CB    . ILE A 1 218 ? 39.088  36.483 74.190  1.00 26.03  ? 218 ILE A CB    1 
ATOM   1709  C CG1   . ILE A 1 218 ? 40.407  36.343 74.986  1.00 29.24  ? 218 ILE A CG1   1 
ATOM   1710  C CG2   . ILE A 1 218 ? 38.614  37.933 74.206  1.00 20.07  ? 218 ILE A CG2   1 
ATOM   1711  C CD1   . ILE A 1 218 ? 41.629  36.868 74.291  1.00 20.24  ? 218 ILE A CD1   1 
ATOM   1712  N N     . PHE A 1 219 ? 35.777  36.451 74.775  1.00 22.82  ? 219 PHE A N     1 
ATOM   1713  C CA    . PHE A 1 219 ? 34.455  36.774 74.251  1.00 21.86  ? 219 PHE A CA    1 
ATOM   1714  C C     . PHE A 1 219 ? 34.543  37.832 73.140  1.00 18.87  ? 219 PHE A C     1 
ATOM   1715  O O     . PHE A 1 219 ? 35.303  38.810 73.226  1.00 19.34  ? 219 PHE A O     1 
ATOM   1716  C CB    . PHE A 1 219 ? 33.585  37.329 75.370  1.00 19.32  ? 219 PHE A CB    1 
ATOM   1717  C CG    . PHE A 1 219 ? 32.109  37.293 75.117  1.00 23.12  ? 219 PHE A CG    1 
ATOM   1718  C CD1   . PHE A 1 219 ? 31.378  36.156 75.350  1.00 19.56  ? 219 PHE A CD1   1 
ATOM   1719  C CD2   . PHE A 1 219 ? 31.440  38.399 74.606  1.00 20.70  ? 219 PHE A CD2   1 
ATOM   1720  C CE1   . PHE A 1 219 ? 30.014  36.108 75.139  1.00 22.43  ? 219 PHE A CE1   1 
ATOM   1721  C CE2   . PHE A 1 219 ? 30.081  38.379 74.393  1.00 19.06  ? 219 PHE A CE2   1 
ATOM   1722  C CZ    . PHE A 1 219 ? 29.364  37.238 74.680  1.00 17.01  ? 219 PHE A CZ    1 
ATOM   1723  N N     . VAL A 1 220 ? 33.800  37.610 72.045  1.00 17.92  ? 220 VAL A N     1 
ATOM   1724  C CA    . VAL A 1 220 ? 33.836  38.579 70.939  1.00 17.92  ? 220 VAL A CA    1 
ATOM   1725  C C     . VAL A 1 220 ? 32.462  39.233 70.730  1.00 15.55  ? 220 VAL A C     1 
ATOM   1726  O O     . VAL A 1 220 ? 31.425  38.581 70.593  1.00 15.22  ? 220 VAL A O     1 
ATOM   1727  C CB    . VAL A 1 220 ? 34.318  37.939 69.629  1.00 19.45  ? 220 VAL A CB    1 
ATOM   1728  C CG1   . VAL A 1 220 ? 34.289  38.936 68.458  1.00 15.45  ? 220 VAL A CG1   1 
ATOM   1729  C CG2   . VAL A 1 220 ? 35.744  37.373 69.837  1.00 15.87  ? 220 VAL A CG2   1 
ATOM   1730  N N     . VAL A 1 221 ? 32.502  40.542 70.669  1.00 15.60  ? 221 VAL A N     1 
ATOM   1731  C CA    . VAL A 1 221 ? 31.335  41.383 70.508  1.00 17.40  ? 221 VAL A CA    1 
ATOM   1732  C C     . VAL A 1 221 ? 31.471  42.067 69.128  1.00 17.24  ? 221 VAL A C     1 
ATOM   1733  O O     . VAL A 1 221 ? 32.468  42.708 68.892  1.00 15.24  ? 221 VAL A O     1 
ATOM   1734  C CB    . VAL A 1 221 ? 31.173  42.511 71.557  1.00 20.24  ? 221 VAL A CB    1 
ATOM   1735  C CG1   . VAL A 1 221 ? 29.906  43.330 71.256  1.00 19.55  ? 221 VAL A CG1   1 
ATOM   1736  C CG2   . VAL A 1 221 ? 31.103  41.972 72.972  1.00 20.64  ? 221 VAL A CG2   1 
ATOM   1737  N N     . MET A 1 222 ? 30.454  41.966 68.314  1.00 13.78  ? 222 MET A N     1 
ATOM   1738  C CA    . MET A 1 222 ? 30.422  42.646 67.018  1.00 11.90  ? 222 MET A CA    1 
ATOM   1739  C C     . MET A 1 222 ? 29.669  43.967 67.154  1.00 12.27  ? 222 MET A C     1 
ATOM   1740  O O     . MET A 1 222 ? 28.463  43.959 67.385  1.00 13.81  ? 222 MET A O     1 
ATOM   1741  C CB    . MET A 1 222 ? 29.691  41.798 65.967  1.00 8.22   ? 222 MET A CB    1 
ATOM   1742  C CG    . MET A 1 222 ? 29.867  42.410 64.563  1.00 19.51  ? 222 MET A CG    1 
ATOM   1743  S SD    . MET A 1 222 ? 31.175  41.593 63.643  1.00 22.49  ? 222 MET A SD    1 
ATOM   1744  C CE    . MET A 1 222 ? 30.575  39.993 63.328  1.00 15.19  ? 222 MET A CE    1 
ATOM   1745  N N     . ASP A 1 223 ? 30.347  45.088 67.086  1.00 8.47   ? 223 ASP A N     1 
ATOM   1746  C CA    . ASP A 1 223 ? 29.722  46.406 67.126  1.00 11.92  ? 223 ASP A CA    1 
ATOM   1747  C C     . ASP A 1 223 ? 29.155  46.568 65.700  1.00 16.82  ? 223 ASP A C     1 
ATOM   1748  O O     . ASP A 1 223 ? 29.866  46.688 64.700  1.00 13.82  ? 223 ASP A O     1 
ATOM   1749  C CB    . ASP A 1 223 ? 30.702  47.503 67.533  1.00 10.33  ? 223 ASP A CB    1 
ATOM   1750  C CG    . ASP A 1 223 ? 30.086  48.883 67.443  1.00 15.64  ? 223 ASP A CG    1 
ATOM   1751  O OD1   . ASP A 1 223 ? 29.228  49.151 66.556  1.00 15.70  ? 223 ASP A OD1   1 
ATOM   1752  O OD2   . ASP A 1 223 ? 30.430  49.790 68.222  1.00 13.46  ? 223 ASP A OD2   1 
ATOM   1753  N N     . SER A 1 224 ? 27.829  46.525 65.607  1.00 13.49  ? 224 SER A N     1 
ATOM   1754  C CA    . SER A 1 224 ? 27.102  46.371 64.379  1.00 14.56  ? 224 SER A CA    1 
ATOM   1755  C C     . SER A 1 224 ? 26.324  47.544 63.818  1.00 11.22  ? 224 SER A C     1 
ATOM   1756  O O     . SER A 1 224 ? 25.437  47.306 63.009  1.00 13.74  ? 224 SER A O     1 
ATOM   1757  C CB    . SER A 1 224 ? 26.140  45.183 64.601  1.00 12.49  ? 224 SER A CB    1 
ATOM   1758  O OG    . SER A 1 224 ? 26.862  44.041 64.942  1.00 10.30  ? 224 SER A OG    1 
ATOM   1759  N N     . ALA A 1 225 ? 26.620  48.768 64.178  1.00 10.19  ? 225 ALA A N     1 
ATOM   1760  C CA    . ALA A 1 225 ? 25.904  49.895 63.652  1.00 12.85  ? 225 ALA A CA    1 
ATOM   1761  C C     . ALA A 1 225 ? 25.854  49.815 62.106  1.00 15.90  ? 225 ALA A C     1 
ATOM   1762  O O     . ALA A 1 225 ? 24.812  50.165 61.547  1.00 13.57  ? 225 ALA A O     1 
ATOM   1763  C CB    . ALA A 1 225 ? 26.537  51.219 64.065  1.00 8.86   ? 225 ALA A CB    1 
ATOM   1764  N N     . ARG A 1 226 ? 26.957  49.491 61.433  1.00 13.21  ? 226 ARG A N     1 
ATOM   1765  C CA    . ARG A 1 226 ? 26.959  49.514 59.969  1.00 10.14  ? 226 ARG A CA    1 
ATOM   1766  C C     . ARG A 1 226 ? 27.306  48.173 59.394  1.00 9.82   ? 226 ARG A C     1 
ATOM   1767  O O     . ARG A 1 226 ? 28.114  48.090 58.447  1.00 11.16  ? 226 ARG A O     1 
ATOM   1768  C CB    . ARG A 1 226 ? 27.892  50.611 59.459  1.00 6.16   ? 226 ARG A CB    1 
ATOM   1769  C CG    . ARG A 1 226 ? 27.498  51.990 59.858  1.00 7.79   ? 226 ARG A CG    1 
ATOM   1770  C CD    . ARG A 1 226 ? 28.357  53.160 59.485  1.00 7.86   ? 226 ARG A CD    1 
ATOM   1771  N NE    . ARG A 1 226 ? 27.996  54.413 60.134  1.00 7.01   ? 226 ARG A NE    1 
ATOM   1772  C CZ    . ARG A 1 226 ? 28.448  54.696 61.388  1.00 15.97  ? 226 ARG A CZ    1 
ATOM   1773  N NH1   . ARG A 1 226 ? 29.241  53.848 62.054  1.00 12.07  ? 226 ARG A NH1   1 
ATOM   1774  N NH2   . ARG A 1 226 ? 28.109  55.827 61.984  1.00 6.85   ? 226 ARG A NH2   1 
ATOM   1775  N N     . PHE A 1 227 ? 26.641  47.139 59.941  1.00 7.98   ? 227 PHE A N     1 
ATOM   1776  C CA    . PHE A 1 227 ? 26.887  45.808 59.507  1.00 9.42   ? 227 PHE A CA    1 
ATOM   1777  C C     . PHE A 1 227 ? 26.489  45.587 58.014  1.00 12.53  ? 227 PHE A C     1 
ATOM   1778  O O     . PHE A 1 227 ? 27.053  44.672 57.427  1.00 8.75   ? 227 PHE A O     1 
ATOM   1779  C CB    . PHE A 1 227 ? 26.225  44.746 60.370  1.00 8.33   ? 227 PHE A CB    1 
ATOM   1780  C CG    . PHE A 1 227 ? 24.702  44.651 60.285  1.00 12.13  ? 227 PHE A CG    1 
ATOM   1781  C CD1   . PHE A 1 227 ? 23.868  45.659 60.706  1.00 13.32  ? 227 PHE A CD1   1 
ATOM   1782  C CD2   . PHE A 1 227 ? 24.135  43.504 59.781  1.00 11.55  ? 227 PHE A CD2   1 
ATOM   1783  C CE1   . PHE A 1 227 ? 22.489  45.546 60.645  1.00 12.24  ? 227 PHE A CE1   1 
ATOM   1784  C CE2   . PHE A 1 227 ? 22.754  43.368 59.692  1.00 13.22  ? 227 PHE A CE2   1 
ATOM   1785  C CZ    . PHE A 1 227 ? 21.917  44.395 60.123  1.00 9.63   ? 227 PHE A CZ    1 
ATOM   1786  N N     . CYS A 1 228 ? 25.437  46.264 57.544  1.00 11.50  ? 228 CYS A N     1 
ATOM   1787  C CA    . CYS A 1 228 ? 24.978  46.066 56.161  1.00 11.66  ? 228 CYS A CA    1 
ATOM   1788  C C     . CYS A 1 228 ? 25.937  46.705 55.150  1.00 8.82   ? 228 CYS A C     1 
ATOM   1789  O O     . CYS A 1 228 ? 26.246  46.120 54.128  1.00 8.97   ? 228 CYS A O     1 
ATOM   1790  C CB    . CYS A 1 228 ? 23.591  46.713 56.007  1.00 8.81   ? 228 CYS A CB    1 
ATOM   1791  S SG    . CYS A 1 228 ? 22.364  45.710 56.880  1.00 12.40  ? 228 CYS A SG    1 
ATOM   1792  N N     . GLU A 1 229 ? 26.443  47.904 55.489  1.00 7.85   ? 229 GLU A N     1 
ATOM   1793  C CA    . GLU A 1 229 ? 27.458  48.515 54.644  1.00 11.13  ? 229 GLU A CA    1 
ATOM   1794  C C     . GLU A 1 229 ? 28.691  47.614 54.587  1.00 13.99  ? 229 GLU A C     1 
ATOM   1795  O O     . GLU A 1 229 ? 29.189  47.388 53.474  1.00 14.67  ? 229 GLU A O     1 
ATOM   1796  C CB    . GLU A 1 229 ? 27.748  49.948 55.075  1.00 7.47   ? 229 GLU A CB    1 
ATOM   1797  C CG    . GLU A 1 229 ? 26.474  50.773 54.992  1.00 9.76   ? 229 GLU A CG    1 
ATOM   1798  C CD    . GLU A 1 229 ? 26.590  52.176 55.494  1.00 12.44  ? 229 GLU A CD    1 
ATOM   1799  O OE1   . GLU A 1 229 ? 27.646  52.572 56.043  1.00 16.31  ? 229 GLU A OE1   1 
ATOM   1800  O OE2   . GLU A 1 229 ? 25.601  52.937 55.367  1.00 18.54  ? 229 GLU A OE2   1 
ATOM   1801  N N     . ASN A 1 230 ? 29.084  46.973 55.694  1.00 13.28  ? 230 ASN A N     1 
ATOM   1802  C CA    . ASN A 1 230 ? 30.202  46.072 55.721  1.00 13.33  ? 230 ASN A CA    1 
ATOM   1803  C C     . ASN A 1 230 ? 29.903  44.864 54.820  1.00 15.30  ? 230 ASN A C     1 
ATOM   1804  O O     . ASN A 1 230 ? 30.801  44.434 54.082  1.00 14.12  ? 230 ASN A O     1 
ATOM   1805  C CB    . ASN A 1 230 ? 30.537  45.500 57.119  1.00 12.06  ? 230 ASN A CB    1 
ATOM   1806  C CG    . ASN A 1 230 ? 32.006  45.058 57.151  1.00 14.34  ? 230 ASN A CG    1 
ATOM   1807  O OD1   . ASN A 1 230 ? 32.854  45.888 57.377  1.00 10.86  ? 230 ASN A OD1   1 
ATOM   1808  N ND2   . ASN A 1 230 ? 32.303  43.805 56.919  1.00 10.32  ? 230 ASN A ND2   1 
ATOM   1809  N N     . ALA A 1 231 ? 28.707  44.281 54.958  1.00 11.44  ? 231 ALA A N     1 
ATOM   1810  C CA    . ALA A 1 231 ? 28.351  43.128 54.154  1.00 12.59  ? 231 ALA A CA    1 
ATOM   1811  C C     . ALA A 1 231 ? 28.368  43.485 52.640  1.00 13.29  ? 231 ALA A C     1 
ATOM   1812  O O     . ALA A 1 231 ? 28.831  42.667 51.843  1.00 12.06  ? 231 ALA A O     1 
ATOM   1813  C CB    . ALA A 1 231 ? 26.989  42.558 54.471  1.00 10.55  ? 231 ALA A CB    1 
ATOM   1814  N N     . TYR A 1 232 ? 27.910  44.658 52.276  1.00 12.35  ? 232 TYR A N     1 
ATOM   1815  C CA    . TYR A 1 232 ? 27.960  45.066 50.890  1.00 15.01  ? 232 TYR A CA    1 
ATOM   1816  C C     . TYR A 1 232 ? 29.397  45.031 50.350  1.00 16.22  ? 232 TYR A C     1 
ATOM   1817  O O     . TYR A 1 232 ? 29.703  44.488 49.289  1.00 14.29  ? 232 TYR A O     1 
ATOM   1818  C CB    . TYR A 1 232 ? 27.433  46.492 50.736  1.00 11.89  ? 232 TYR A CB    1 
ATOM   1819  C CG    . TYR A 1 232 ? 27.514  46.899 49.254  1.00 19.93  ? 232 TYR A CG    1 
ATOM   1820  C CD1   . TYR A 1 232 ? 26.538  46.547 48.333  1.00 19.31  ? 232 TYR A CD1   1 
ATOM   1821  C CD2   . TYR A 1 232 ? 28.608  47.646 48.823  1.00 21.34  ? 232 TYR A CD2   1 
ATOM   1822  C CE1   . TYR A 1 232 ? 26.644  46.954 47.004  1.00 21.24  ? 232 TYR A CE1   1 
ATOM   1823  C CE2   . TYR A 1 232 ? 28.724  48.037 47.520  1.00 21.61  ? 232 TYR A CE2   1 
ATOM   1824  C CZ    . TYR A 1 232 ? 27.736  47.687 46.615  1.00 24.19  ? 232 TYR A CZ    1 
ATOM   1825  O OH    . TYR A 1 232 ? 27.888  48.120 45.313  1.00 28.28  ? 232 TYR A OH    1 
ATOM   1826  N N     . PHE A 1 233 ? 30.321  45.617 51.114  1.00 12.52  ? 233 PHE A N     1 
ATOM   1827  C CA    . PHE A 1 233 ? 31.723  45.660 50.718  1.00 15.71  ? 233 PHE A CA    1 
ATOM   1828  C C     . PHE A 1 233 ? 32.304  44.270 50.639  1.00 18.26  ? 233 PHE A C     1 
ATOM   1829  O O     . PHE A 1 233 ? 33.124  44.017 49.731  1.00 18.39  ? 233 PHE A O     1 
ATOM   1830  C CB    . PHE A 1 233 ? 32.560  46.530 51.625  1.00 8.86   ? 233 PHE A CB    1 
ATOM   1831  C CG    . PHE A 1 233 ? 32.381  47.992 51.430  1.00 11.59  ? 233 PHE A CG    1 
ATOM   1832  C CD1   . PHE A 1 233 ? 32.635  48.544 50.171  1.00 15.06  ? 233 PHE A CD1   1 
ATOM   1833  C CD2   . PHE A 1 233 ? 31.976  48.799 52.461  1.00 12.41  ? 233 PHE A CD2   1 
ATOM   1834  C CE1   . PHE A 1 233 ? 32.491  49.918 49.974  1.00 17.92  ? 233 PHE A CE1   1 
ATOM   1835  C CE2   . PHE A 1 233 ? 31.845  50.160 52.260  1.00 12.90  ? 233 PHE A CE2   1 
ATOM   1836  C CZ    . PHE A 1 233 ? 32.108  50.721 51.028  1.00 16.47  ? 233 PHE A CZ    1 
ATOM   1837  N N     . ILE A 1 234 ? 31.892  43.371 51.519  1.00 14.93  ? 234 ILE A N     1 
ATOM   1838  C CA    . ILE A 1 234 ? 32.437  42.023 51.399  1.00 15.06  ? 234 ILE A CA    1 
ATOM   1839  C C     . ILE A 1 234 ? 31.990  41.414 50.059  1.00 20.97  ? 234 ILE A C     1 
ATOM   1840  O O     . ILE A 1 234 ? 32.729  40.711 49.347  1.00 17.45  ? 234 ILE A O     1 
ATOM   1841  C CB    . ILE A 1 234 ? 32.051  41.129 52.571  1.00 12.41  ? 234 ILE A CB    1 
ATOM   1842  C CG1   . ILE A 1 234 ? 32.861  41.535 53.821  1.00 18.21  ? 234 ILE A CG1   1 
ATOM   1843  C CG2   . ILE A 1 234 ? 32.240  39.656 52.280  1.00 11.92  ? 234 ILE A CG2   1 
ATOM   1844  C CD1   . ILE A 1 234 ? 32.355  40.921 55.124  1.00 16.18  ? 234 ILE A CD1   1 
ATOM   1845  N N     . LYS A 1 235 ? 30.715  41.633 49.712  1.00 20.05  ? 235 LYS A N     1 
ATOM   1846  C CA    . LYS A 1 235 ? 30.182  41.042 48.493  1.00 19.44  ? 235 LYS A CA    1 
ATOM   1847  C C     . LYS A 1 235 ? 30.850  41.681 47.264  1.00 21.09  ? 235 LYS A C     1 
ATOM   1848  O O     . LYS A 1 235 ? 31.171  41.005 46.303  1.00 19.86  ? 235 LYS A O     1 
ATOM   1849  C CB    . LYS A 1 235 ? 28.666  41.230 48.400  1.00 21.30  ? 235 LYS A CB    1 
ATOM   1850  C CG    . LYS A 1 235 ? 28.128  40.832 47.053  1.00 22.40  ? 235 LYS A CG    1 
ATOM   1851  C CD    . LYS A 1 235 ? 26.630  40.696 46.963  1.00 32.52  ? 235 LYS A CD    1 
ATOM   1852  C CE    . LYS A 1 235 ? 26.274  40.512 45.466  1.00 25.81  ? 235 LYS A CE    1 
ATOM   1853  N NZ    . LYS A 1 235 ? 25.210  39.489 45.364  1.00 29.06  ? 235 LYS A NZ    1 
ATOM   1854  N N     . ALA A 1 236 ? 31.107  42.968 47.308  1.00 18.06  ? 236 ALA A N     1 
ATOM   1855  C CA    . ALA A 1 236 ? 31.730  43.696 46.251  1.00 23.79  ? 236 ALA A CA    1 
ATOM   1856  C C     . ALA A 1 236 ? 33.216  43.367 46.064  1.00 28.23  ? 236 ALA A C     1 
ATOM   1857  O O     . ALA A 1 236 ? 33.667  43.396 44.911  1.00 27.84  ? 236 ALA A O     1 
ATOM   1858  C CB    . ALA A 1 236 ? 31.673  45.187 46.492  1.00 14.86  ? 236 ALA A CB    1 
ATOM   1859  N N     . ARG A 1 237 ? 33.963  43.110 47.125  1.00 25.50  ? 237 ARG A N     1 
ATOM   1860  C CA    . ARG A 1 237 ? 35.400  42.951 46.994  1.00 23.72  ? 237 ARG A CA    1 
ATOM   1861  C C     . ARG A 1 237 ? 35.939  41.572 47.279  1.00 27.13  ? 237 ARG A C     1 
ATOM   1862  O O     . ARG A 1 237 ? 37.101  41.335 46.949  1.00 30.29  ? 237 ARG A O     1 
ATOM   1863  C CB    . ARG A 1 237 ? 36.133  43.928 47.927  1.00 15.13  ? 237 ARG A CB    1 
ATOM   1864  C CG    . ARG A 1 237 ? 35.837  45.374 47.611  1.00 16.90  ? 237 ARG A CG    1 
ATOM   1865  C CD    . ARG A 1 237 ? 36.420  46.293 48.656  1.00 16.23  ? 237 ARG A CD    1 
ATOM   1866  N NE    . ARG A 1 237 ? 35.989  47.655 48.356  1.00 16.13  ? 237 ARG A NE    1 
ATOM   1867  C CZ    . ARG A 1 237 ? 36.163  48.698 49.126  1.00 21.96  ? 237 ARG A CZ    1 
ATOM   1868  N NH1   . ARG A 1 237 ? 36.742  48.622 50.313  1.00 18.31  ? 237 ARG A NH1   1 
ATOM   1869  N NH2   . ARG A 1 237 ? 35.712  49.864 48.681  1.00 16.32  ? 237 ARG A NH2   1 
ATOM   1870  N N     . ASP A 1 238 ? 35.170  40.700 47.894  1.00 24.84  ? 238 ASP A N     1 
ATOM   1871  C CA    . ASP A 1 238 ? 35.687  39.364 48.174  1.00 23.00  ? 238 ASP A CA    1 
ATOM   1872  C C     . ASP A 1 238 ? 35.132  38.399 47.143  1.00 26.43  ? 238 ASP A C     1 
ATOM   1873  O O     . ASP A 1 238 ? 33.973  38.005 47.151  1.00 24.90  ? 238 ASP A O     1 
ATOM   1874  C CB    . ASP A 1 238 ? 35.331  38.972 49.607  1.00 22.88  ? 238 ASP A CB    1 
ATOM   1875  C CG    . ASP A 1 238 ? 35.901  37.640 50.035  1.00 29.24  ? 238 ASP A CG    1 
ATOM   1876  O OD1   . ASP A 1 238 ? 36.233  36.787 49.185  1.00 27.41  ? 238 ASP A OD1   1 
ATOM   1877  O OD2   . ASP A 1 238 ? 36.003  37.443 51.267  1.00 25.00  ? 238 ASP A OD2   1 
ATOM   1878  N N     . PRO A 1 239 ? 36.017  37.822 46.325  1.00 28.55  ? 239 PRO A N     1 
ATOM   1879  C CA    . PRO A 1 239 ? 35.643  36.894 45.273  1.00 27.35  ? 239 PRO A CA    1 
ATOM   1880  C C     . PRO A 1 239 ? 34.850  35.722 45.783  1.00 27.42  ? 239 PRO A C     1 
ATOM   1881  O O     . PRO A 1 239 ? 33.996  35.218 45.053  1.00 26.95  ? 239 PRO A O     1 
ATOM   1882  C CB    . PRO A 1 239 ? 36.956  36.389 44.692  1.00 30.64  ? 239 PRO A CB    1 
ATOM   1883  C CG    . PRO A 1 239 ? 38.042  37.087 45.417  1.00 31.31  ? 239 PRO A CG    1 
ATOM   1884  C CD    . PRO A 1 239 ? 37.452  38.184 46.247  1.00 29.18  ? 239 PRO A CD    1 
ATOM   1885  N N     . LYS A 1 240 ? 35.087  35.309 47.030  1.00 25.84  ? 240 LYS A N     1 
ATOM   1886  C CA    . LYS A 1 240 ? 34.305  34.232 47.612  1.00 27.46  ? 240 LYS A CA    1 
ATOM   1887  C C     . LYS A 1 240 ? 32.826  34.590 47.737  1.00 26.55  ? 240 LYS A C     1 
ATOM   1888  O O     . LYS A 1 240 ? 32.012  33.673 47.648  1.00 26.74  ? 240 LYS A O     1 
ATOM   1889  C CB    . LYS A 1 240 ? 34.903  33.832 48.959  1.00 36.86  ? 240 LYS A CB    1 
ATOM   1890  C CG    . LYS A 1 240 ? 34.174  32.712 49.671  1.00 53.54  ? 240 LYS A CG    1 
ATOM   1891  C CD    . LYS A 1 240 ? 34.634  32.566 51.113  1.00 64.19  ? 240 LYS A CD    1 
ATOM   1892  C CE    . LYS A 1 240 ? 33.947  31.378 51.771  1.00 69.90  ? 240 LYS A CE    1 
ATOM   1893  N NZ    . LYS A 1 240 ? 33.639  31.625 53.204  1.00 77.93  ? 240 LYS A NZ    1 
ATOM   1894  N N     . TYR A 1 241 ? 32.456  35.844 47.892  1.00 24.35  ? 241 TYR A N     1 
ATOM   1895  C CA    . TYR A 1 241 ? 31.067  36.226 48.094  1.00 27.52  ? 241 TYR A CA    1 
ATOM   1896  C C     . TYR A 1 241 ? 30.446  36.943 46.917  1.00 28.80  ? 241 TYR A C     1 
ATOM   1897  O O     . TYR A 1 241 ? 29.385  37.534 46.968  1.00 26.63  ? 241 TYR A O     1 
ATOM   1898  C CB    . TYR A 1 241 ? 30.987  37.109 49.375  1.00 22.40  ? 241 TYR A CB    1 
ATOM   1899  C CG    . TYR A 1 241 ? 31.212  36.236 50.613  1.00 20.80  ? 241 TYR A CG    1 
ATOM   1900  C CD1   . TYR A 1 241 ? 30.177  35.469 51.130  1.00 21.68  ? 241 TYR A CD1   1 
ATOM   1901  C CD2   . TYR A 1 241 ? 32.442  36.172 51.233  1.00 20.60  ? 241 TYR A CD2   1 
ATOM   1902  C CE1   . TYR A 1 241 ? 30.368  34.662 52.235  1.00 22.62  ? 241 TYR A CE1   1 
ATOM   1903  C CE2   . TYR A 1 241 ? 32.647  35.385 52.361  1.00 22.97  ? 241 TYR A CE2   1 
ATOM   1904  C CZ    . TYR A 1 241 ? 31.605  34.626 52.845  1.00 25.31  ? 241 TYR A CZ    1 
ATOM   1905  O OH    . TYR A 1 241 ? 31.773  33.842 53.955  1.00 24.64  ? 241 TYR A OH    1 
ATOM   1906  N N     . LYS A 1 242 ? 31.093  36.867 45.763  1.00 29.98  ? 242 LYS A N     1 
ATOM   1907  C CA    . LYS A 1 242 ? 30.633  37.492 44.531  1.00 29.96  ? 242 LYS A CA    1 
ATOM   1908  C C     . LYS A 1 242 ? 29.201  37.139 44.140  1.00 25.54  ? 242 LYS A C     1 
ATOM   1909  O O     . LYS A 1 242 ? 28.511  38.056 43.714  1.00 26.99  ? 242 LYS A O     1 
ATOM   1910  C CB    . LYS A 1 242 ? 31.532  37.078 43.356  1.00 40.96  ? 242 LYS A CB    1 
ATOM   1911  C CG    . LYS A 1 242 ? 31.400  38.022 42.181  1.00 57.45  ? 242 LYS A CG    1 
ATOM   1912  C CD    . LYS A 1 242 ? 31.303  37.274 40.863  1.00 72.02  ? 242 LYS A CD    1 
ATOM   1913  C CE    . LYS A 1 242 ? 30.829  38.219 39.757  1.00 81.00  ? 242 LYS A CE    1 
ATOM   1914  N NZ    . LYS A 1 242 ? 29.699  37.642 38.968  1.00 85.36  ? 242 LYS A NZ    1 
ATOM   1915  N N     . ASN A 1 243 ? 28.786  35.904 44.282  1.00 24.16  ? 243 ASN A N     1 
ATOM   1916  C CA    . ASN A 1 243 ? 27.416  35.513 43.959  1.00 30.01  ? 243 ASN A CA    1 
ATOM   1917  C C     . ASN A 1 243 ? 26.540  35.282 45.186  1.00 30.28  ? 243 ASN A C     1 
ATOM   1918  O O     . ASN A 1 243 ? 25.486  34.641 45.065  1.00 33.61  ? 243 ASN A O     1 
ATOM   1919  C CB    . ASN A 1 243 ? 27.475  34.211 43.132  1.00 35.18  ? 243 ASN A CB    1 
ATOM   1920  C CG    . ASN A 1 243 ? 28.241  34.439 41.837  1.00 50.92  ? 243 ASN A CG    1 
ATOM   1921  O OD1   . ASN A 1 243 ? 28.105  35.458 41.158  1.00 48.14  ? 243 ASN A OD1   1 
ATOM   1922  N ND2   . ASN A 1 243 ? 29.087  33.481 41.473  1.00 57.94  ? 243 ASN A ND2   1 
ATOM   1923  N N     . ALA A 1 244 ? 26.979  35.737 46.362  1.00 27.77  ? 244 ALA A N     1 
ATOM   1924  C CA    . ALA A 1 244 ? 26.168  35.492 47.564  1.00 25.75  ? 244 ALA A CA    1 
ATOM   1925  C C     . ALA A 1 244 ? 25.163  36.629 47.717  1.00 21.00  ? 244 ALA A C     1 
ATOM   1926  O O     . ALA A 1 244 ? 25.416  37.701 47.172  1.00 20.32  ? 244 ALA A O     1 
ATOM   1927  C CB    . ALA A 1 244 ? 27.095  35.375 48.767  1.00 22.18  ? 244 ALA A CB    1 
ATOM   1928  N N     . THR A 1 245 ? 24.076  36.413 48.426  1.00 17.58  ? 245 THR A N     1 
ATOM   1929  C CA    . THR A 1 245 ? 23.144  37.504 48.680  1.00 17.40  ? 245 THR A CA    1 
ATOM   1930  C C     . THR A 1 245 ? 23.736  38.275 49.876  1.00 15.87  ? 245 THR A C     1 
ATOM   1931  O O     . THR A 1 245 ? 24.608  37.715 50.568  1.00 17.10  ? 245 THR A O     1 
ATOM   1932  C CB    . THR A 1 245 ? 21.766  36.954 49.068  1.00 21.84  ? 245 THR A CB    1 
ATOM   1933  O OG1   . THR A 1 245 ? 21.909  36.211 50.284  1.00 19.78  ? 245 THR A OG1   1 
ATOM   1934  C CG2   . THR A 1 245 ? 21.243  35.967 48.022  1.00 23.58  ? 245 THR A CG2   1 
ATOM   1935  N N     . ILE A 1 246 ? 23.260  39.468 50.136  1.00 14.54  ? 246 ILE A N     1 
ATOM   1936  C CA    . ILE A 1 246 ? 23.668  40.227 51.301  1.00 17.77  ? 246 ILE A CA    1 
ATOM   1937  C C     . ILE A 1 246 ? 23.367  39.434 52.583  1.00 17.75  ? 246 ILE A C     1 
ATOM   1938  O O     . ILE A 1 246 ? 24.203  39.410 53.455  1.00 14.69  ? 246 ILE A O     1 
ATOM   1939  C CB    . ILE A 1 246 ? 22.962  41.604 51.319  1.00 18.14  ? 246 ILE A CB    1 
ATOM   1940  C CG1   . ILE A 1 246 ? 23.432  42.374 50.075  1.00 15.29  ? 246 ILE A CG1   1 
ATOM   1941  C CG2   . ILE A 1 246 ? 23.255  42.373 52.607  1.00 15.41  ? 246 ILE A CG2   1 
ATOM   1942  C CD1   . ILE A 1 246 ? 24.878  42.819 50.123  1.00 21.14  ? 246 ILE A CD1   1 
ATOM   1943  N N     . LYS A 1 247 ? 22.220  38.791 52.703  1.00 15.43  ? 247 LYS A N     1 
ATOM   1944  C CA    . LYS A 1 247 ? 21.836  38.037 53.874  1.00 19.38  ? 247 LYS A CA    1 
ATOM   1945  C C     . LYS A 1 247 ? 22.799  36.873 54.093  1.00 18.87  ? 247 LYS A C     1 
ATOM   1946  O O     . LYS A 1 247 ? 23.077  36.510 55.224  1.00 16.66  ? 247 LYS A O     1 
ATOM   1947  C CB    . LYS A 1 247 ? 20.378  37.570 53.813  1.00 13.70  ? 247 LYS A CB    1 
ATOM   1948  C CG    . LYS A 1 247 ? 19.439  38.745 54.145  1.00 17.25  ? 247 LYS A CG    1 
ATOM   1949  C CD    . LYS A 1 247 ? 18.002  38.280 54.173  1.00 21.21  ? 247 LYS A CD    1 
ATOM   1950  C CE    . LYS A 1 247 ? 17.031  39.400 54.498  1.00 17.53  ? 247 LYS A CE    1 
ATOM   1951  N NZ    . LYS A 1 247 ? 15.671  38.836 54.645  1.00 24.73  ? 247 LYS A NZ    1 
ATOM   1952  N N     . GLU A 1 248 ? 23.287  36.237 53.023  1.00 16.03  ? 248 GLU A N     1 
ATOM   1953  C CA    . GLU A 1 248 ? 24.250  35.169 53.201  1.00 17.65  ? 248 GLU A CA    1 
ATOM   1954  C C     . GLU A 1 248 ? 25.579  35.673 53.824  1.00 16.72  ? 248 GLU A C     1 
ATOM   1955  O O     . GLU A 1 248 ? 26.153  35.026 54.716  1.00 17.89  ? 248 GLU A O     1 
ATOM   1956  C CB    . GLU A 1 248 ? 24.600  34.473 51.880  1.00 16.32  ? 248 GLU A CB    1 
ATOM   1957  C CG    . GLU A 1 248 ? 23.453  33.577 51.428  1.00 24.98  ? 248 GLU A CG    1 
ATOM   1958  C CD    . GLU A 1 248 ? 23.725  33.168 49.995  1.00 28.58  ? 248 GLU A CD    1 
ATOM   1959  O OE1   . GLU A 1 248 ? 23.730  33.843 48.954  1.00 33.51  ? 248 GLU A OE1   1 
ATOM   1960  O OE2   . GLU A 1 248 ? 23.998  31.981 49.842  1.00 40.40  ? 248 GLU A OE2   1 
ATOM   1961  N N     . VAL A 1 249 ? 26.022  36.823 53.327  1.00 13.92  ? 249 VAL A N     1 
ATOM   1962  C CA    . VAL A 1 249 ? 27.213  37.453 53.826  1.00 15.97  ? 249 VAL A CA    1 
ATOM   1963  C C     . VAL A 1 249 ? 27.021  37.800 55.324  1.00 18.59  ? 249 VAL A C     1 
ATOM   1964  O O     . VAL A 1 249 ? 27.874  37.497 56.141  1.00 15.23  ? 249 VAL A O     1 
ATOM   1965  C CB    . VAL A 1 249 ? 27.526  38.763 53.074  1.00 15.61  ? 249 VAL A CB    1 
ATOM   1966  C CG1   . VAL A 1 249 ? 28.684  39.492 53.744  1.00 13.13  ? 249 VAL A CG1   1 
ATOM   1967  C CG2   . VAL A 1 249 ? 27.885  38.465 51.621  1.00 17.74  ? 249 VAL A CG2   1 
ATOM   1968  N N     . ILE A 1 250 ? 25.887  38.413 55.647  1.00 16.09  ? 250 ILE A N     1 
ATOM   1969  C CA    . ILE A 1 250 ? 25.567  38.783 57.016  1.00 14.04  ? 250 ILE A CA    1 
ATOM   1970  C C     . ILE A 1 250 ? 25.601  37.518 57.862  1.00 13.65  ? 250 ILE A C     1 
ATOM   1971  O O     . ILE A 1 250 ? 26.152  37.497 58.957  1.00 15.82  ? 250 ILE A O     1 
ATOM   1972  C CB    . ILE A 1 250 ? 24.217  39.503 57.147  1.00 13.72  ? 250 ILE A CB    1 
ATOM   1973  C CG1   . ILE A 1 250 ? 24.311  40.916 56.532  1.00 11.69  ? 250 ILE A CG1   1 
ATOM   1974  C CG2   . ILE A 1 250 ? 23.776  39.681 58.611  1.00 10.31  ? 250 ILE A CG2   1 
ATOM   1975  C CD1   . ILE A 1 250 ? 22.952  41.522 56.266  1.00 14.29  ? 250 ILE A CD1   1 
ATOM   1976  N N     . PHE A 1 251 ? 24.931  36.453 57.422  1.00 13.36  ? 251 PHE A N     1 
ATOM   1977  C CA    . PHE A 1 251 ? 24.861  35.227 58.213  1.00 17.96  ? 251 PHE A CA    1 
ATOM   1978  C C     . PHE A 1 251 ? 26.261  34.720 58.563  1.00 21.92  ? 251 PHE A C     1 
ATOM   1979  O O     . PHE A 1 251 ? 26.535  34.294 59.679  1.00 17.82  ? 251 PHE A O     1 
ATOM   1980  C CB    . PHE A 1 251 ? 24.070  34.151 57.473  1.00 18.22  ? 251 PHE A CB    1 
ATOM   1981  C CG    . PHE A 1 251 ? 23.575  33.054 58.352  1.00 20.36  ? 251 PHE A CG    1 
ATOM   1982  C CD1   . PHE A 1 251 ? 22.380  33.162 59.038  1.00 26.15  ? 251 PHE A CD1   1 
ATOM   1983  C CD2   . PHE A 1 251 ? 24.298  31.892 58.496  1.00 23.07  ? 251 PHE A CD2   1 
ATOM   1984  C CE1   . PHE A 1 251 ? 21.925  32.149 59.859  1.00 34.66  ? 251 PHE A CE1   1 
ATOM   1985  C CE2   . PHE A 1 251 ? 23.868  30.846 59.295  1.00 26.26  ? 251 PHE A CE2   1 
ATOM   1986  C CZ    . PHE A 1 251 ? 22.674  30.999 59.977  1.00 29.38  ? 251 PHE A CZ    1 
ATOM   1987  N N     . ASP A 1 252 ? 27.195  34.766 57.619  1.00 17.46  ? 252 ASP A N     1 
ATOM   1988  C CA    . ASP A 1 252 ? 28.552  34.305 57.819  1.00 19.14  ? 252 ASP A CA    1 
ATOM   1989  C C     . ASP A 1 252 ? 29.330  35.216 58.770  1.00 15.47  ? 252 ASP A C     1 
ATOM   1990  O O     . ASP A 1 252 ? 30.059  34.724 59.625  1.00 16.05  ? 252 ASP A O     1 
ATOM   1991  C CB    . ASP A 1 252 ? 29.339  34.199 56.518  1.00 19.37  ? 252 ASP A CB    1 
ATOM   1992  C CG    . ASP A 1 252 ? 29.141  32.878 55.806  1.00 21.98  ? 252 ASP A CG    1 
ATOM   1993  O OD1   . ASP A 1 252 ? 28.300  32.069 56.225  1.00 20.67  ? 252 ASP A OD1   1 
ATOM   1994  O OD2   . ASP A 1 252 ? 29.829  32.699 54.783  1.00 26.86  ? 252 ASP A OD2   1 
ATOM   1995  N N     . MET A 1 253 ? 29.177  36.507 58.614  1.00 13.25  ? 253 MET A N     1 
ATOM   1996  C CA    . MET A 1 253 ? 29.800  37.487 59.459  1.00 14.39  ? 253 MET A CA    1 
ATOM   1997  C C     . MET A 1 253 ? 29.532  37.192 60.957  1.00 16.81  ? 253 MET A C     1 
ATOM   1998  O O     . MET A 1 253 ? 30.472  37.248 61.726  1.00 16.92  ? 253 MET A O     1 
ATOM   1999  C CB    . MET A 1 253 ? 29.313  38.900 59.239  1.00 15.12  ? 253 MET A CB    1 
ATOM   2000  C CG    . MET A 1 253 ? 29.914  39.597 58.040  1.00 19.07  ? 253 MET A CG    1 
ATOM   2001  S SD    . MET A 1 253 ? 29.122  41.162 57.682  1.00 17.60  ? 253 MET A SD    1 
ATOM   2002  C CE    . MET A 1 253 ? 29.498  42.161 59.099  1.00 16.64  ? 253 MET A CE    1 
ATOM   2003  N N     . TYR A 1 254 ? 28.276  36.879 61.283  1.00 14.31  ? 254 TYR A N     1 
ATOM   2004  C CA    . TYR A 1 254 ? 27.904  36.688 62.696  1.00 14.85  ? 254 TYR A CA    1 
ATOM   2005  C C     . TYR A 1 254 ? 28.280  35.330 63.208  1.00 15.22  ? 254 TYR A C     1 
ATOM   2006  O O     . TYR A 1 254 ? 28.105  35.047 64.383  1.00 16.50  ? 254 TYR A O     1 
ATOM   2007  C CB    . TYR A 1 254 ? 26.412  37.099 62.905  1.00 10.57  ? 254 TYR A CB    1 
ATOM   2008  C CG    . TYR A 1 254 ? 26.398  38.603 62.905  1.00 13.38  ? 254 TYR A CG    1 
ATOM   2009  C CD1   . TYR A 1 254 ? 26.314  39.268 61.664  1.00 11.02  ? 254 TYR A CD1   1 
ATOM   2010  C CD2   . TYR A 1 254 ? 26.581  39.359 64.061  1.00 10.20  ? 254 TYR A CD2   1 
ATOM   2011  C CE1   . TYR A 1 254 ? 26.375  40.650 61.615  1.00 11.65  ? 254 TYR A CE1   1 
ATOM   2012  C CE2   . TYR A 1 254 ? 26.594  40.746 63.995  1.00 10.86  ? 254 TYR A CE2   1 
ATOM   2013  C CZ    . TYR A 1 254 ? 26.524  41.380 62.769  1.00 12.30  ? 254 TYR A CZ    1 
ATOM   2014  O OH    . TYR A 1 254 ? 26.584  42.740 62.657  1.00 13.79  ? 254 TYR A OH    1 
ATOM   2015  N N     . LYS A 1 255 ? 28.853  34.447 62.383  1.00 13.63  ? 255 LYS A N     1 
ATOM   2016  C CA    . LYS A 1 255 ? 29.480  33.227 62.836  1.00 19.48  ? 255 LYS A CA    1 
ATOM   2017  C C     . LYS A 1 255 ? 30.739  33.584 63.674  1.00 17.78  ? 255 LYS A C     1 
ATOM   2018  O O     . LYS A 1 255 ? 31.263  32.786 64.470  1.00 18.56  ? 255 LYS A O     1 
ATOM   2019  C CB    . LYS A 1 255 ? 29.956  32.390 61.628  1.00 21.93  ? 255 LYS A CB    1 
ATOM   2020  C CG    . LYS A 1 255 ? 28.878  31.542 60.971  1.00 22.74  ? 255 LYS A CG    1 
ATOM   2021  C CD    . LYS A 1 255 ? 29.383  30.844 59.698  1.00 29.40  ? 255 LYS A CD    1 
ATOM   2022  C CE    . LYS A 1 255 ? 28.204  30.219 58.960  1.00 38.00  ? 255 LYS A CE    1 
ATOM   2023  N NZ    . LYS A 1 255 ? 28.549  29.615 57.643  1.00 43.38  ? 255 LYS A NZ    1 
ATOM   2024  N N     . TYR A 1 256 ? 31.305  34.757 63.434  1.00 14.59  ? 256 TYR A N     1 
ATOM   2025  C CA    . TYR A 1 256 ? 32.531  35.225 64.046  1.00 15.69  ? 256 TYR A CA    1 
ATOM   2026  C C     . TYR A 1 256 ? 32.343  36.244 65.154  1.00 17.02  ? 256 TYR A C     1 
ATOM   2027  O O     . TYR A 1 256 ? 33.182  37.125 65.320  1.00 17.68  ? 256 TYR A O     1 
ATOM   2028  C CB    . TYR A 1 256 ? 33.487  35.782 62.933  1.00 16.96  ? 256 TYR A CB    1 
ATOM   2029  C CG    . TYR A 1 256 ? 33.575  34.751 61.818  1.00 18.78  ? 256 TYR A CG    1 
ATOM   2030  C CD1   . TYR A 1 256 ? 33.961  33.461 62.149  1.00 21.28  ? 256 TYR A CD1   1 
ATOM   2031  C CD2   . TYR A 1 256 ? 33.220  35.017 60.503  1.00 20.23  ? 256 TYR A CD2   1 
ATOM   2032  C CE1   . TYR A 1 256 ? 33.994  32.462 61.205  1.00 24.92  ? 256 TYR A CE1   1 
ATOM   2033  C CE2   . TYR A 1 256 ? 33.275  34.030 59.552  1.00 22.58  ? 256 TYR A CE2   1 
ATOM   2034  C CZ    . TYR A 1 256 ? 33.665  32.763 59.887  1.00 24.28  ? 256 TYR A CZ    1 
ATOM   2035  O OH    . TYR A 1 256 ? 33.719  31.744 58.986  1.00 30.95  ? 256 TYR A OH    1 
ATOM   2036  N N     . ALA A 1 257 ? 31.311  36.036 65.997  1.00 15.01  ? 257 ALA A N     1 
ATOM   2037  C CA    . ALA A 1 257 ? 31.133  36.842 67.202  1.00 14.39  ? 257 ALA A CA    1 
ATOM   2038  C C     . ALA A 1 257 ? 30.271  36.065 68.185  1.00 14.12  ? 257 ALA A C     1 
ATOM   2039  O O     . ALA A 1 257 ? 29.615  35.089 67.798  1.00 14.23  ? 257 ALA A O     1 
ATOM   2040  C CB    . ALA A 1 257 ? 30.611  38.246 66.979  1.00 13.29  ? 257 ALA A CB    1 
ATOM   2041  N N     . ASP A 1 258 ? 30.257  36.456 69.456  1.00 15.90  ? 258 ASP A N     1 
ATOM   2042  C CA    . ASP A 1 258 ? 29.459  35.745 70.457  1.00 15.72  ? 258 ASP A CA    1 
ATOM   2043  C C     . ASP A 1 258 ? 28.228  36.578 70.796  1.00 17.52  ? 258 ASP A C     1 
ATOM   2044  O O     . ASP A 1 258 ? 27.313  36.136 71.480  1.00 14.59  ? 258 ASP A O     1 
ATOM   2045  C CB    . ASP A 1 258 ? 30.293  35.558 71.749  1.00 16.51  ? 258 ASP A CB    1 
ATOM   2046  C CG    . ASP A 1 258 ? 31.494  34.665 71.419  1.00 15.78  ? 258 ASP A CG    1 
ATOM   2047  O OD1   . ASP A 1 258 ? 31.238  33.535 70.968  1.00 19.92  ? 258 ASP A OD1   1 
ATOM   2048  O OD2   . ASP A 1 258 ? 32.620  35.158 71.552  1.00 16.62  ? 258 ASP A OD2   1 
ATOM   2049  N N     . ALA A 1 259 ? 28.262  37.845 70.401  1.00 14.43  ? 259 ALA A N     1 
ATOM   2050  C CA    . ALA A 1 259 ? 27.198  38.767 70.694  1.00 17.67  ? 259 ALA A CA    1 
ATOM   2051  C C     . ALA A 1 259 ? 27.349  40.008 69.813  1.00 15.89  ? 259 ALA A C     1 
ATOM   2052  O O     . ALA A 1 259 ? 28.417  40.196 69.266  1.00 16.08  ? 259 ALA A O     1 
ATOM   2053  C CB    . ALA A 1 259 ? 27.248  39.249 72.171  1.00 11.44  ? 259 ALA A CB    1 
ATOM   2054  N N     . LEU A 1 260 ? 26.332  40.844 69.798  1.00 11.81  ? 260 LEU A N     1 
ATOM   2055  C CA    . LEU A 1 260 ? 26.422  42.089 69.072  1.00 11.20  ? 260 LEU A CA    1 
ATOM   2056  C C     . LEU A 1 260 ? 25.824  43.200 69.916  1.00 9.87   ? 260 LEU A C     1 
ATOM   2057  O O     . LEU A 1 260 ? 24.906  42.992 70.712  1.00 12.22  ? 260 LEU A O     1 
ATOM   2058  C CB    . LEU A 1 260 ? 25.740  42.011 67.684  1.00 9.15   ? 260 LEU A CB    1 
ATOM   2059  C CG    . LEU A 1 260 ? 24.220  41.816 67.644  1.00 15.12  ? 260 LEU A CG    1 
ATOM   2060  C CD1   . LEU A 1 260 ? 23.499  43.159 67.730  1.00 9.60   ? 260 LEU A CD1   1 
ATOM   2061  C CD2   . LEU A 1 260 ? 23.756  41.085 66.375  1.00 13.64  ? 260 LEU A CD2   1 
ATOM   2062  N N     . THR A 1 261 ? 26.324  44.387 69.691  1.00 7.66   ? 261 THR A N     1 
ATOM   2063  C CA    . THR A 1 261 ? 25.738  45.605 70.168  1.00 9.43   ? 261 THR A CA    1 
ATOM   2064  C C     . THR A 1 261 ? 25.395  46.377 68.884  1.00 14.96  ? 261 THR A C     1 
ATOM   2065  O O     . THR A 1 261 ? 26.140  46.278 67.894  1.00 12.75  ? 261 THR A O     1 
ATOM   2066  C CB    . THR A 1 261 ? 26.646  46.476 71.051  1.00 15.51  ? 261 THR A CB    1 
ATOM   2067  O OG1   . THR A 1 261 ? 27.906  46.574 70.394  1.00 16.95  ? 261 THR A OG1   1 
ATOM   2068  C CG2   . THR A 1 261 ? 26.773  45.816 72.415  1.00 14.23  ? 261 THR A CG2   1 
ATOM   2069  N N     . MET A 1 262 ? 24.296  47.103 68.880  1.00 12.11  ? 262 MET A N     1 
ATOM   2070  C CA    . MET A 1 262 ? 23.900  47.756 67.636  1.00 11.07  ? 262 MET A CA    1 
ATOM   2071  C C     . MET A 1 262 ? 23.195  49.073 67.870  1.00 11.42  ? 262 MET A C     1 
ATOM   2072  O O     . MET A 1 262 ? 22.206  49.093 68.593  1.00 12.32  ? 262 MET A O     1 
ATOM   2073  C CB    . MET A 1 262 ? 22.975  46.796 66.842  1.00 8.21   ? 262 MET A CB    1 
ATOM   2074  C CG    . MET A 1 262 ? 22.561  47.369 65.488  1.00 17.36  ? 262 MET A CG    1 
ATOM   2075  S SD    . MET A 1 262 ? 21.222  46.462 64.686  1.00 18.14  ? 262 MET A SD    1 
ATOM   2076  C CE    . MET A 1 262 ? 21.949  44.935 64.244  1.00 16.38  ? 262 MET A CE    1 
ATOM   2077  N N     . SER A 1 263 ? 23.676  50.098 67.180  1.00 9.89   ? 263 SER A N     1 
ATOM   2078  C CA    . SER A 1 263 ? 22.931  51.337 67.061  1.00 10.72  ? 263 SER A CA    1 
ATOM   2079  C C     . SER A 1 263 ? 22.008  51.096 65.844  1.00 15.62  ? 263 SER A C     1 
ATOM   2080  O O     . SER A 1 263 ? 22.504  50.924 64.717  1.00 13.03  ? 263 SER A O     1 
ATOM   2081  C CB    . SER A 1 263 ? 23.837  52.527 66.803  1.00 7.63   ? 263 SER A CB    1 
ATOM   2082  O OG    . SER A 1 263 ? 23.026  53.691 66.619  1.00 11.00  ? 263 SER A OG    1 
ATOM   2083  N N     . ALA A 1 264 ? 20.682  51.048 66.068  1.00 12.83  ? 264 ALA A N     1 
ATOM   2084  C CA    . ALA A 1 264 ? 19.762  50.823 64.946  1.00 11.40  ? 264 ALA A CA    1 
ATOM   2085  C C     . ALA A 1 264 ? 19.443  52.123 64.245  1.00 7.86   ? 264 ALA A C     1 
ATOM   2086  O O     . ALA A 1 264 ? 18.790  52.151 63.193  1.00 11.25  ? 264 ALA A O     1 
ATOM   2087  C CB    . ALA A 1 264 ? 18.478  50.095 65.346  1.00 10.87  ? 264 ALA A CB    1 
ATOM   2088  N N     . LYS A 1 265 ? 20.053  53.225 64.665  1.00 5.80   ? 265 LYS A N     1 
ATOM   2089  C CA    . LYS A 1 265 ? 19.993  54.533 64.105  1.00 9.02   ? 265 LYS A CA    1 
ATOM   2090  C C     . LYS A 1 265 ? 20.916  54.640 62.877  1.00 9.14   ? 265 LYS A C     1 
ATOM   2091  O O     . LYS A 1 265 ? 20.920  55.729 62.328  1.00 11.33  ? 265 LYS A O     1 
ATOM   2092  C CB    . LYS A 1 265 ? 20.462  55.589 65.143  1.00 8.36   ? 265 LYS A CB    1 
ATOM   2093  C CG    . LYS A 1 265 ? 19.510  55.565 66.393  1.00 10.21  ? 265 LYS A CG    1 
ATOM   2094  C CD    . LYS A 1 265 ? 20.109  56.458 67.488  1.00 9.69   ? 265 LYS A CD    1 
ATOM   2095  C CE    . LYS A 1 265 ? 19.970  57.948 67.201  1.00 9.57   ? 265 LYS A CE    1 
ATOM   2096  N NZ    . LYS A 1 265 ? 20.548  58.779 68.329  1.00 12.24  ? 265 LYS A NZ    1 
HETATM 2097  N N1    . LLP A 1 266 ? 29.352  52.090 67.829  1.00 14.47  ? 266 LLP A N1    1 
HETATM 2098  C C2    . LLP A 1 266 ? 29.402  52.483 66.511  1.00 14.59  ? 266 LLP A C2    1 
HETATM 2099  C "C2'" . LLP A 1 266 ? 30.411  51.813 65.541  1.00 16.80  ? 266 LLP A "C2'" 1 
HETATM 2100  C C3    . LLP A 1 266 ? 28.516  53.458 66.070  1.00 19.69  ? 266 LLP A C3    1 
HETATM 2101  O O3    . LLP A 1 266 ? 28.526  53.846 64.832  1.00 15.96  ? 266 LLP A O3    1 
HETATM 2102  C C4    . LLP A 1 266 ? 27.561  54.091 66.939  1.00 15.78  ? 266 LLP A C4    1 
HETATM 2103  C C5    . LLP A 1 266 ? 27.600  53.666 68.302  1.00 19.10  ? 266 LLP A C5    1 
HETATM 2104  C C6    . LLP A 1 266 ? 28.495  52.670 68.722  1.00 14.49  ? 266 LLP A C6    1 
HETATM 2105  C "C5'" . LLP A 1 266 ? 26.695  54.324 69.338  1.00 12.44  ? 266 LLP A "C5'" 1 
HETATM 2106  O OP4   . LLP A 1 266 ? 25.323  54.168 68.998  1.00 16.05  ? 266 LLP A OP4   1 
HETATM 2107  P P     . LLP A 1 266 ? 24.348  55.367 69.372  1.00 12.16  ? 266 LLP A P     1 
HETATM 2108  O OP1   . LLP A 1 266 ? 24.360  55.502 70.939  1.00 13.25  ? 266 LLP A OP1   1 
HETATM 2109  O OP2   . LLP A 1 266 ? 22.999  54.860 68.959  1.00 11.14  ? 266 LLP A OP2   1 
HETATM 2110  O OP3   . LLP A 1 266 ? 24.807  56.653 68.858  1.00 9.82   ? 266 LLP A OP3   1 
HETATM 2111  N N     . LLP A 1 266 ? 21.629  53.587 62.535  1.00 7.39   ? 266 LLP A N     1 
HETATM 2112  C CA    . LLP A 1 266 ? 22.537  53.631 61.361  1.00 12.10  ? 266 LLP A CA    1 
HETATM 2113  C CB    . LLP A 1 266 ? 23.969  53.196 61.710  1.00 10.72  ? 266 LLP A CB    1 
HETATM 2114  C CG    . LLP A 1 266 ? 24.817  54.336 62.322  1.00 8.71   ? 266 LLP A CG    1 
HETATM 2115  C CD    . LLP A 1 266 ? 24.288  54.730 63.705  1.00 7.25   ? 266 LLP A CD    1 
HETATM 2116  C CE    . LLP A 1 266 ? 25.285  55.722 64.377  1.00 11.90  ? 266 LLP A CE    1 
HETATM 2117  N NZ    . LLP A 1 266 ? 26.214  54.968 65.236  1.00 17.09  ? 266 LLP A NZ    1 
HETATM 2118  C C     . LLP A 1 266 ? 21.969  52.749 60.254  1.00 10.36  ? 266 LLP A C     1 
HETATM 2119  O O     . LLP A 1 266 ? 20.909  53.082 59.685  1.00 10.97  ? 266 LLP A O     1 
ATOM   2120  N N     . ASP A 1 267 ? 22.476  51.570 59.994  1.00 8.93   ? 267 ASP A N     1 
ATOM   2121  C CA    . ASP A 1 267 ? 22.050  50.721 58.885  1.00 7.13   ? 267 ASP A CA    1 
ATOM   2122  C C     . ASP A 1 267 ? 20.603  50.279 58.903  1.00 14.22  ? 267 ASP A C     1 
ATOM   2123  O O     . ASP A 1 267 ? 19.989  50.187 57.852  1.00 11.15  ? 267 ASP A O     1 
ATOM   2124  C CB    . ASP A 1 267 ? 22.987  49.531 58.733  1.00 4.96   ? 267 ASP A CB    1 
ATOM   2125  C CG    . ASP A 1 267 ? 24.259  49.871 57.951  1.00 8.71   ? 267 ASP A CG    1 
ATOM   2126  O OD1   . ASP A 1 267 ? 24.546  51.064 57.748  1.00 9.70   ? 267 ASP A OD1   1 
ATOM   2127  O OD2   . ASP A 1 267 ? 24.951  48.883 57.587  1.00 13.09  ? 267 ASP A OD2   1 
ATOM   2128  N N     . PRO A 1 268 ? 19.962  50.017 60.066  1.00 12.32  ? 268 PRO A N     1 
ATOM   2129  C CA    . PRO A 1 268 ? 18.552  49.653 60.124  1.00 10.12  ? 268 PRO A CA    1 
ATOM   2130  C C     . PRO A 1 268 ? 17.605  50.782 59.778  1.00 10.02  ? 268 PRO A C     1 
ATOM   2131  O O     . PRO A 1 268 ? 16.382  50.606 59.861  1.00 10.58  ? 268 PRO A O     1 
ATOM   2132  C CB    . PRO A 1 268 ? 18.394  49.074 61.534  1.00 10.85  ? 268 PRO A CB    1 
ATOM   2133  C CG    . PRO A 1 268 ? 19.807  48.654 61.907  1.00 10.10  ? 268 PRO A CG    1 
ATOM   2134  C CD    . PRO A 1 268 ? 20.647  49.847 61.374  1.00 9.04   ? 268 PRO A CD    1 
ATOM   2135  N N     . LEU A 1 269 ? 18.062  51.984 59.458  1.00 8.23   ? 269 LEU A N     1 
ATOM   2136  C CA    . LEU A 1 269 ? 17.289  53.071 58.897  1.00 11.84  ? 269 LEU A CA    1 
ATOM   2137  C C     . LEU A 1 269 ? 16.295  53.690 59.840  1.00 15.88  ? 269 LEU A C     1 
ATOM   2138  O O     . LEU A 1 269 ? 15.165  53.983 59.446  1.00 14.16  ? 269 LEU A O     1 
ATOM   2139  C CB    . LEU A 1 269 ? 16.541  52.538 57.614  1.00 12.17  ? 269 LEU A CB    1 
ATOM   2140  C CG    . LEU A 1 269 ? 17.484  52.152 56.454  1.00 15.91  ? 269 LEU A CG    1 
ATOM   2141  C CD1   . LEU A 1 269 ? 16.837  51.090 55.578  1.00 10.53  ? 269 LEU A CD1   1 
ATOM   2142  C CD2   . LEU A 1 269 ? 17.802  53.341 55.565  1.00 13.76  ? 269 LEU A CD2   1 
ATOM   2143  N N     . LEU A 1 270 ? 16.706  53.864 61.118  1.00 9.70   ? 270 LEU A N     1 
ATOM   2144  C CA    . LEU A 1 270 ? 15.766  54.396 62.086  1.00 9.67   ? 270 LEU A CA    1 
ATOM   2145  C C     . LEU A 1 270 ? 16.212  55.758 62.585  1.00 9.03   ? 270 LEU A C     1 
ATOM   2146  O O     . LEU A 1 270 ? 17.306  56.191 62.303  1.00 6.92   ? 270 LEU A O     1 
ATOM   2147  C CB    . LEU A 1 270 ? 15.712  53.449 63.306  1.00 6.08   ? 270 LEU A CB    1 
ATOM   2148  C CG    . LEU A 1 270 ? 15.336  52.016 63.002  1.00 8.81   ? 270 LEU A CG    1 
ATOM   2149  C CD1   . LEU A 1 270 ? 15.284  51.160 64.292  1.00 9.60   ? 270 LEU A CD1   1 
ATOM   2150  C CD2   . LEU A 1 270 ? 13.963  51.947 62.273  1.00 4.82   ? 270 LEU A CD2   1 
ATOM   2151  N N     . ASN A 1 271 ? 15.291  56.388 63.315  1.00 6.49   ? 271 ASN A N     1 
ATOM   2152  C CA    . ASN A 1 271 ? 15.599  57.658 63.961  1.00 5.31   ? 271 ASN A CA    1 
ATOM   2153  C C     . ASN A 1 271 ? 16.012  57.423 65.431  1.00 6.78   ? 271 ASN A C     1 
ATOM   2154  O O     . ASN A 1 271 ? 16.445  58.382 66.080  1.00 10.53  ? 271 ASN A O     1 
ATOM   2155  C CB    . ASN A 1 271 ? 14.387  58.593 63.887  1.00 3.89   ? 271 ASN A CB    1 
ATOM   2156  C CG    . ASN A 1 271 ? 14.012  58.804 62.400  1.00 16.53  ? 271 ASN A CG    1 
ATOM   2157  O OD1   . ASN A 1 271 ? 12.885  58.475 62.044  1.00 9.08   ? 271 ASN A OD1   1 
ATOM   2158  N ND2   . ASN A 1 271 ? 14.911  59.275 61.545  1.00 9.81   ? 271 ASN A ND2   1 
ATOM   2159  N N     . ILE A 1 272 ? 15.772  56.211 65.942  1.00 8.00   ? 272 ILE A N     1 
ATOM   2160  C CA    . ILE A 1 272 ? 16.104  55.972 67.371  1.00 9.45   ? 272 ILE A CA    1 
ATOM   2161  C C     . ILE A 1 272 ? 16.157  54.466 67.490  1.00 10.63  ? 272 ILE A C     1 
ATOM   2162  O O     . ILE A 1 272 ? 15.532  53.780 66.653  1.00 8.97   ? 272 ILE A O     1 
ATOM   2163  C CB    . ILE A 1 272 ? 15.067  56.599 68.332  1.00 13.65  ? 272 ILE A CB    1 
ATOM   2164  C CG1   . ILE A 1 272 ? 15.524  56.592 69.786  1.00 12.31  ? 272 ILE A CG1   1 
ATOM   2165  C CG2   . ILE A 1 272 ? 13.690  55.886 68.247  1.00 8.64   ? 272 ILE A CG2   1 
ATOM   2166  C CD1   . ILE A 1 272 ? 16.800  57.413 70.054  1.00 12.14  ? 272 ILE A CD1   1 
ATOM   2167  N N     . GLY A 1 273 ? 16.869  53.898 68.479  1.00 6.88   ? 273 GLY A N     1 
ATOM   2168  C CA    . GLY A 1 273 ? 16.786  52.447 68.576  1.00 5.09   ? 273 GLY A CA    1 
ATOM   2169  C C     . GLY A 1 273 ? 18.166  51.786 68.631  1.00 11.67  ? 273 GLY A C     1 
ATOM   2170  O O     . GLY A 1 273 ? 19.152  52.218 68.038  1.00 11.71  ? 273 GLY A O     1 
ATOM   2171  N N     . GLY A 1 274 ? 18.174  50.685 69.356  1.00 10.89  ? 274 GLY A N     1 
ATOM   2172  C CA    . GLY A 1 274 ? 19.399  49.930 69.620  1.00 10.13  ? 274 GLY A CA    1 
ATOM   2173  C C     . GLY A 1 274 ? 19.017  48.498 69.923  1.00 12.31  ? 274 GLY A C     1 
ATOM   2174  O O     . GLY A 1 274 ? 17.832  48.189 70.158  1.00 12.00  ? 274 GLY A O     1 
ATOM   2175  N N     . LEU A 1 275 ? 20.057  47.661 69.974  1.00 8.71   ? 275 LEU A N     1 
ATOM   2176  C CA    . LEU A 1 275 ? 19.835  46.269 70.223  1.00 9.03   ? 275 LEU A CA    1 
ATOM   2177  C C     . LEU A 1 275 ? 21.070  45.565 70.774  1.00 13.42  ? 275 LEU A C     1 
ATOM   2178  O O     . LEU A 1 275 ? 22.184  45.869 70.362  1.00 10.85  ? 275 LEU A O     1 
ATOM   2179  C CB    . LEU A 1 275 ? 19.482  45.570 68.883  1.00 7.73   ? 275 LEU A CB    1 
ATOM   2180  C CG    . LEU A 1 275 ? 19.089  44.115 68.972  1.00 13.08  ? 275 LEU A CG    1 
ATOM   2181  C CD1   . LEU A 1 275 ? 17.768  43.935 69.726  1.00 12.59  ? 275 LEU A CD1   1 
ATOM   2182  C CD2   . LEU A 1 275 ? 18.904  43.536 67.555  1.00 14.05  ? 275 LEU A CD2   1 
ATOM   2183  N N     . VAL A 1 276 ? 20.826  44.640 71.680  1.00 12.19  ? 276 VAL A N     1 
ATOM   2184  C CA    . VAL A 1 276 ? 21.792  43.709 72.191  1.00 9.71   ? 276 VAL A CA    1 
ATOM   2185  C C     . VAL A 1 276 ? 21.315  42.355 71.716  1.00 10.48  ? 276 VAL A C     1 
ATOM   2186  O O     . VAL A 1 276 ? 20.153  42.063 71.954  1.00 13.39  ? 276 VAL A O     1 
ATOM   2187  C CB    . VAL A 1 276 ? 21.933  43.660 73.750  1.00 17.42  ? 276 VAL A CB    1 
ATOM   2188  C CG1   . VAL A 1 276 ? 22.903  42.563 74.169  1.00 13.53  ? 276 VAL A CG1   1 
ATOM   2189  C CG2   . VAL A 1 276 ? 22.490  44.996 74.230  1.00 11.51  ? 276 VAL A CG2   1 
ATOM   2190  N N     . ALA A 1 277 ? 22.124  41.558 71.102  1.00 9.28   ? 277 ALA A N     1 
ATOM   2191  C CA    . ALA A 1 277 ? 21.768  40.204 70.731  1.00 12.91  ? 277 ALA A CA    1 
ATOM   2192  C C     . ALA A 1 277 ? 22.940  39.328 71.181  1.00 15.37  ? 277 ALA A C     1 
ATOM   2193  O O     . ALA A 1 277 ? 24.109  39.677 71.061  1.00 11.76  ? 277 ALA A O     1 
ATOM   2194  C CB    . ALA A 1 277 ? 21.444  39.996 69.247  1.00 10.40  ? 277 ALA A CB    1 
ATOM   2195  N N     . ILE A 1 278 ? 22.598  38.207 71.771  1.00 15.24  ? 278 ILE A N     1 
ATOM   2196  C CA    . ILE A 1 278 ? 23.554  37.259 72.304  1.00 16.72  ? 278 ILE A CA    1 
ATOM   2197  C C     . ILE A 1 278 ? 23.356  35.934 71.597  1.00 17.46  ? 278 ILE A C     1 
ATOM   2198  O O     . ILE A 1 278 ? 22.247  35.448 71.485  1.00 16.70  ? 278 ILE A O     1 
ATOM   2199  C CB    . ILE A 1 278 ? 23.428  37.172 73.835  1.00 19.11  ? 278 ILE A CB    1 
ATOM   2200  C CG1   . ILE A 1 278 ? 23.891  38.525 74.448  1.00 18.33  ? 278 ILE A CG1   1 
ATOM   2201  C CG2   . ILE A 1 278 ? 24.259  36.021 74.398  1.00 20.27  ? 278 ILE A CG2   1 
ATOM   2202  C CD1   . ILE A 1 278 ? 23.109  38.891 75.696  1.00 22.59  ? 278 ILE A CD1   1 
ATOM   2203  N N     . ARG A 1 279 ? 24.437  35.399 71.064  1.00 14.50  ? 279 ARG A N     1 
ATOM   2204  C CA    . ARG A 1 279 ? 24.361  34.165 70.312  1.00 15.72  ? 279 ARG A CA    1 
ATOM   2205  C C     . ARG A 1 279 ? 23.820  32.986 71.103  1.00 18.98  ? 279 ARG A C     1 
ATOM   2206  O O     . ARG A 1 279 ? 22.799  32.438 70.654  1.00 16.55  ? 279 ARG A O     1 
ATOM   2207  C CB    . ARG A 1 279 ? 25.722  33.890 69.677  1.00 17.53  ? 279 ARG A CB    1 
ATOM   2208  C CG    . ARG A 1 279 ? 25.751  32.634 68.800  1.00 22.98  ? 279 ARG A CG    1 
ATOM   2209  C CD    . ARG A 1 279 ? 27.181  32.575 68.255  1.00 31.30  ? 279 ARG A CD    1 
ATOM   2210  N NE    . ARG A 1 279 ? 27.458  31.552 67.297  1.00 35.26  ? 279 ARG A NE    1 
ATOM   2211  C CZ    . ARG A 1 279 ? 28.585  31.427 66.586  1.00 42.25  ? 279 ARG A CZ    1 
ATOM   2212  N NH1   . ARG A 1 279 ? 29.593  32.280 66.728  1.00 31.77  ? 279 ARG A NH1   1 
ATOM   2213  N NH2   . ARG A 1 279 ? 28.676  30.405 65.726  1.00 41.08  ? 279 ARG A NH2   1 
ATOM   2214  N N     . ASP A 1 280 ? 24.451  32.621 72.228  1.00 18.83  ? 280 ASP A N     1 
ATOM   2215  C CA    . ASP A 1 280 ? 23.927  31.473 72.959  1.00 22.32  ? 280 ASP A CA    1 
ATOM   2216  C C     . ASP A 1 280 ? 24.314  31.433 74.431  1.00 22.80  ? 280 ASP A C     1 
ATOM   2217  O O     . ASP A 1 280 ? 23.961  30.448 75.065  1.00 25.38  ? 280 ASP A O     1 
ATOM   2218  C CB    . ASP A 1 280 ? 24.367  30.143 72.307  1.00 28.60  ? 280 ASP A CB    1 
ATOM   2219  C CG    . ASP A 1 280 ? 25.866  30.039 72.164  1.00 31.71  ? 280 ASP A CG    1 
ATOM   2220  O OD1   . ASP A 1 280 ? 26.612  30.701 72.899  1.00 34.30  ? 280 ASP A OD1   1 
ATOM   2221  O OD2   . ASP A 1 280 ? 26.341  29.294 71.286  1.00 45.45  ? 280 ASP A OD2   1 
ATOM   2222  N N     . ASN A 1 281 ? 24.989  32.436 74.956  1.00 19.84  ? 281 ASN A N     1 
ATOM   2223  C CA    . ASN A 1 281 ? 25.368  32.418 76.362  1.00 21.57  ? 281 ASN A CA    1 
ATOM   2224  C C     . ASN A 1 281 ? 24.199  32.938 77.197  1.00 22.46  ? 281 ASN A C     1 
ATOM   2225  O O     . ASN A 1 281 ? 23.945  34.140 77.357  1.00 19.98  ? 281 ASN A O     1 
ATOM   2226  C CB    . ASN A 1 281 ? 26.633  33.226 76.577  1.00 23.61  ? 281 ASN A CB    1 
ATOM   2227  C CG    . ASN A 1 281 ? 27.271  32.944 77.918  1.00 28.85  ? 281 ASN A CG    1 
ATOM   2228  O OD1   . ASN A 1 281 ? 26.554  32.982 78.917  1.00 25.32  ? 281 ASN A OD1   1 
ATOM   2229  N ND2   . ASN A 1 281 ? 28.576  32.697 77.961  1.00 24.01  ? 281 ASN A ND2   1 
ATOM   2230  N N     . GLU A 1 282 ? 23.462  31.977 77.774  1.00 22.24  ? 282 GLU A N     1 
ATOM   2231  C CA    . GLU A 1 282 ? 22.271  32.348 78.547  1.00 25.00  ? 282 GLU A CA    1 
ATOM   2232  C C     . GLU A 1 282 ? 22.586  33.133 79.806  1.00 23.06  ? 282 GLU A C     1 
ATOM   2233  O O     . GLU A 1 282 ? 21.830  34.002 80.217  1.00 22.65  ? 282 GLU A O     1 
ATOM   2234  C CB    . GLU A 1 282 ? 21.460  31.095 78.853  1.00 32.21  ? 282 GLU A CB    1 
ATOM   2235  C CG    . GLU A 1 282 ? 20.121  31.458 79.505  1.00 48.98  ? 282 GLU A CG    1 
ATOM   2236  C CD    . GLU A 1 282 ? 19.286  30.214 79.736  1.00 57.97  ? 282 GLU A CD    1 
ATOM   2237  O OE1   . GLU A 1 282 ? 19.725  29.364 80.536  1.00 64.81  ? 282 GLU A OE1   1 
ATOM   2238  O OE2   . GLU A 1 282 ? 18.222  30.108 79.100  1.00 66.07  ? 282 GLU A OE2   1 
ATOM   2239  N N     . GLU A 1 283 ? 23.744  32.864 80.406  1.00 25.30  ? 283 GLU A N     1 
ATOM   2240  C CA    . GLU A 1 283 ? 24.170  33.516 81.645  1.00 22.87  ? 283 GLU A CA    1 
ATOM   2241  C C     . GLU A 1 283 ? 24.466  34.965 81.375  1.00 22.38  ? 283 GLU A C     1 
ATOM   2242  O O     . GLU A 1 283 ? 24.083  35.846 82.146  1.00 20.92  ? 283 GLU A O     1 
ATOM   2243  C CB    . GLU A 1 283 ? 25.396  32.772 82.201  1.00 30.81  ? 283 GLU A CB    1 
ATOM   2244  C CG    . GLU A 1 283 ? 25.928  33.380 83.489  1.00 43.87  ? 283 GLU A CG    1 
ATOM   2245  C CD    . GLU A 1 283 ? 27.002  32.554 84.176  1.00 54.03  ? 283 GLU A CD    1 
ATOM   2246  O OE1   . GLU A 1 283 ? 27.242  31.393 83.783  1.00 55.59  ? 283 GLU A OE1   1 
ATOM   2247  O OE2   . GLU A 1 283 ? 27.617  33.085 85.128  1.00 58.23  ? 283 GLU A OE2   1 
ATOM   2248  N N     . ILE A 1 284 ? 25.129  35.276 80.254  1.00 20.56  ? 284 ILE A N     1 
ATOM   2249  C CA    . ILE A 1 284 ? 25.378  36.686 79.896  1.00 18.27  ? 284 ILE A CA    1 
ATOM   2250  C C     . ILE A 1 284 ? 24.048  37.404 79.675  1.00 12.71  ? 284 ILE A C     1 
ATOM   2251  O O     . ILE A 1 284 ? 23.775  38.516 80.115  1.00 15.52  ? 284 ILE A O     1 
ATOM   2252  C CB    . ILE A 1 284 ? 26.248  36.768 78.632  1.00 21.23  ? 284 ILE A CB    1 
ATOM   2253  C CG1   . ILE A 1 284 ? 27.635  36.162 78.910  1.00 27.91  ? 284 ILE A CG1   1 
ATOM   2254  C CG2   . ILE A 1 284 ? 26.367  38.195 78.106  1.00 12.85  ? 284 ILE A CG2   1 
ATOM   2255  C CD1   . ILE A 1 284 ? 28.458  36.917 79.904  1.00 35.32  ? 284 ILE A CD1   1 
ATOM   2256  N N     . PHE A 1 285 ? 23.155  36.718 78.952  1.00 17.72  ? 285 PHE A N     1 
ATOM   2257  C CA    . PHE A 1 285 ? 21.827  37.248 78.670  1.00 19.69  ? 285 PHE A CA    1 
ATOM   2258  C C     . PHE A 1 285 ? 21.086  37.604 79.959  1.00 21.35  ? 285 PHE A C     1 
ATOM   2259  O O     . PHE A 1 285 ? 20.565  38.700 80.122  1.00 18.91  ? 285 PHE A O     1 
ATOM   2260  C CB    . PHE A 1 285 ? 21.042  36.203 77.883  1.00 18.36  ? 285 PHE A CB    1 
ATOM   2261  C CG    . PHE A 1 285 ? 19.590  36.514 77.685  1.00 19.46  ? 285 PHE A CG    1 
ATOM   2262  C CD1   . PHE A 1 285 ? 19.207  37.666 77.019  1.00 18.55  ? 285 PHE A CD1   1 
ATOM   2263  C CD2   . PHE A 1 285 ? 18.622  35.662 78.200  1.00 18.93  ? 285 PHE A CD2   1 
ATOM   2264  C CE1   . PHE A 1 285 ? 17.866  37.942 76.834  1.00 17.24  ? 285 PHE A CE1   1 
ATOM   2265  C CE2   . PHE A 1 285 ? 17.269  35.922 78.024  1.00 23.05  ? 285 PHE A CE2   1 
ATOM   2266  C CZ    . PHE A 1 285 ? 16.912  37.077 77.333  1.00 19.52  ? 285 PHE A CZ    1 
ATOM   2267  N N     . THR A 1 286 ? 21.087  36.646 80.905  1.00 19.97  ? 286 THR A N     1 
ATOM   2268  C CA    . THR A 1 286 ? 20.390  36.864 82.193  1.00 19.50  ? 286 THR A CA    1 
ATOM   2269  C C     . THR A 1 286 ? 20.995  38.027 82.948  1.00 17.51  ? 286 THR A C     1 
ATOM   2270  O O     . THR A 1 286 ? 20.253  38.901 83.427  1.00 20.45  ? 286 THR A O     1 
ATOM   2271  C CB    . THR A 1 286 ? 20.449  35.581 83.043  1.00 22.44  ? 286 THR A CB    1 
ATOM   2272  O OG1   . THR A 1 286 ? 19.763  34.574 82.299  1.00 26.17  ? 286 THR A OG1   1 
ATOM   2273  C CG2   . THR A 1 286 ? 19.794  35.785 84.392  1.00 27.99  ? 286 THR A CG2   1 
ATOM   2274  N N     . LEU A 1 287 ? 22.321  38.088 82.981  1.00 17.73  ? 287 LEU A N     1 
ATOM   2275  C CA    . LEU A 1 287 ? 22.955  39.227 83.656  1.00 15.90  ? 287 LEU A CA    1 
ATOM   2276  C C     . LEU A 1 287 ? 22.648  40.532 82.930  1.00 16.02  ? 287 LEU A C     1 
ATOM   2277  O O     . LEU A 1 287 ? 22.492  41.578 83.551  1.00 15.60  ? 287 LEU A O     1 
ATOM   2278  C CB    . LEU A 1 287 ? 24.461  39.036 83.808  1.00 21.08  ? 287 LEU A CB    1 
ATOM   2279  C CG    . LEU A 1 287 ? 24.883  37.896 84.764  1.00 32.30  ? 287 LEU A CG    1 
ATOM   2280  C CD1   . LEU A 1 287 ? 26.348  37.517 84.621  1.00 28.08  ? 287 LEU A CD1   1 
ATOM   2281  C CD2   . LEU A 1 287 ? 24.626  38.303 86.221  1.00 25.10  ? 287 LEU A CD2   1 
ATOM   2282  N N     . ALA A 1 288 ? 22.665  40.501 81.600  1.00 16.06  ? 288 ALA A N     1 
ATOM   2283  C CA    . ALA A 1 288 ? 22.420  41.748 80.837  1.00 17.83  ? 288 ALA A CA    1 
ATOM   2284  C C     . ALA A 1 288 ? 20.980  42.198 81.064  1.00 15.13  ? 288 ALA A C     1 
ATOM   2285  O O     . ALA A 1 288 ? 20.729  43.390 81.245  1.00 15.22  ? 288 ALA A O     1 
ATOM   2286  C CB    . ALA A 1 288 ? 22.728  41.522 79.368  1.00 11.39  ? 288 ALA A CB    1 
ATOM   2287  N N     . ARG A 1 289 ? 20.057  41.235 81.149  1.00 13.25  ? 289 ARG A N     1 
ATOM   2288  C CA    . ARG A 1 289 ? 18.665  41.611 81.428  1.00 17.16  ? 289 ARG A CA    1 
ATOM   2289  C C     . ARG A 1 289 ? 18.527  42.295 82.792  1.00 21.01  ? 289 ARG A C     1 
ATOM   2290  O O     . ARG A 1 289 ? 17.719  43.205 82.928  1.00 18.36  ? 289 ARG A O     1 
ATOM   2291  C CB    . ARG A 1 289 ? 17.785  40.388 81.396  1.00 16.94  ? 289 ARG A CB    1 
ATOM   2292  C CG    . ARG A 1 289 ? 17.178  40.113 80.015  1.00 17.47  ? 289 ARG A CG    1 
ATOM   2293  C CD    . ARG A 1 289 ? 16.162  38.983 80.158  1.00 21.24  ? 289 ARG A CD    1 
ATOM   2294  N NE    . ARG A 1 289 ? 15.207  39.027 79.063  1.00 21.90  ? 289 ARG A NE    1 
ATOM   2295  C CZ    . ARG A 1 289 ? 14.119  38.304 78.902  1.00 29.26  ? 289 ARG A CZ    1 
ATOM   2296  N NH1   . ARG A 1 289 ? 13.775  37.410 79.797  1.00 22.62  ? 289 ARG A NH1   1 
ATOM   2297  N NH2   . ARG A 1 289 ? 13.346  38.474 77.829  1.00 20.15  ? 289 ARG A NH2   1 
ATOM   2298  N N     . GLN A 1 290 ? 19.319  41.869 83.786  1.00 19.21  ? 290 GLN A N     1 
ATOM   2299  C CA    . GLN A 1 290 ? 19.241  42.469 85.118  1.00 19.16  ? 290 GLN A CA    1 
ATOM   2300  C C     . GLN A 1 290 ? 19.742  43.895 85.090  1.00 17.53  ? 290 GLN A C     1 
ATOM   2301  O O     . GLN A 1 290 ? 19.205  44.774 85.746  1.00 20.48  ? 290 GLN A O     1 
ATOM   2302  C CB    . GLN A 1 290 ? 20.097  41.691 86.127  1.00 18.50  ? 290 GLN A CB    1 
ATOM   2303  C CG    . GLN A 1 290 ? 19.573  40.261 86.290  1.00 34.74  ? 290 GLN A CG    1 
ATOM   2304  C CD    . GLN A 1 290 ? 20.406  39.430 87.250  1.00 43.65  ? 290 GLN A CD    1 
ATOM   2305  O OE1   . GLN A 1 290 ? 21.359  39.924 87.874  1.00 43.42  ? 290 GLN A OE1   1 
ATOM   2306  N NE2   . GLN A 1 290 ? 20.008  38.164 87.352  1.00 37.97  ? 290 GLN A NE2   1 
ATOM   2307  N N     . ARG A 1 291 ? 20.760  44.156 84.246  1.00 15.75  ? 291 ARG A N     1 
ATOM   2308  C CA    . ARG A 1 291 ? 21.197  45.554 84.154  1.00 16.17  ? 291 ARG A CA    1 
ATOM   2309  C C     . ARG A 1 291 ? 20.236  46.361 83.270  1.00 14.04  ? 291 ARG A C     1 
ATOM   2310  O O     . ARG A 1 291 ? 20.103  47.574 83.489  1.00 14.02  ? 291 ARG A O     1 
ATOM   2311  C CB    . ARG A 1 291 ? 22.619  45.614 83.618  1.00 17.14  ? 291 ARG A CB    1 
ATOM   2312  C CG    . ARG A 1 291 ? 23.198  47.016 83.663  1.00 20.76  ? 291 ARG A CG    1 
ATOM   2313  C CD    . ARG A 1 291 ? 24.716  46.967 83.444  1.00 18.34  ? 291 ARG A CD    1 
ATOM   2314  N NE    . ARG A 1 291 ? 25.158  48.350 83.308  1.00 16.40  ? 291 ARG A NE    1 
ATOM   2315  C CZ    . ARG A 1 291 ? 25.521  49.139 84.305  1.00 24.35  ? 291 ARG A CZ    1 
ATOM   2316  N NH1   . ARG A 1 291 ? 25.515  48.639 85.540  1.00 23.55  ? 291 ARG A NH1   1 
ATOM   2317  N NH2   . ARG A 1 291 ? 25.874  50.390 84.057  1.00 15.82  ? 291 ARG A NH2   1 
ATOM   2318  N N     . CYS A 1 292 ? 19.598  45.715 82.308  1.00 13.94  ? 292 CYS A N     1 
ATOM   2319  C CA    . CYS A 1 292 ? 18.659  46.453 81.424  1.00 16.07  ? 292 CYS A CA    1 
ATOM   2320  C C     . CYS A 1 292 ? 17.543  47.158 82.200  1.00 13.93  ? 292 CYS A C     1 
ATOM   2321  O O     . CYS A 1 292 ? 17.166  48.297 81.963  1.00 14.74  ? 292 CYS A O     1 
ATOM   2322  C CB    . CYS A 1 292 ? 18.026  45.432 80.438  1.00 13.71  ? 292 CYS A CB    1 
ATOM   2323  S SG    . CYS A 1 292 ? 16.790  46.233 79.370  1.00 16.32  ? 292 CYS A SG    1 
ATOM   2324  N N     . VAL A 1 293 ? 16.979  46.446 83.190  1.00 15.76  ? 293 VAL A N     1 
ATOM   2325  C CA    . VAL A 1 293 ? 15.851  46.954 83.972  1.00 13.83  ? 293 VAL A CA    1 
ATOM   2326  C C     . VAL A 1 293 ? 16.068  48.338 84.541  1.00 14.65  ? 293 VAL A C     1 
ATOM   2327  O O     . VAL A 1 293 ? 15.295  49.246 84.215  1.00 16.92  ? 293 VAL A O     1 
ATOM   2328  C CB    . VAL A 1 293 ? 15.346  45.942 85.023  1.00 21.98  ? 293 VAL A CB    1 
ATOM   2329  C CG1   . VAL A 1 293 ? 14.233  46.554 85.872  1.00 19.41  ? 293 VAL A CG1   1 
ATOM   2330  C CG2   . VAL A 1 293 ? 14.830  44.686 84.322  1.00 12.11  ? 293 VAL A CG2   1 
ATOM   2331  N N     . PRO A 1 294 ? 17.059  48.601 85.383  1.00 14.92  ? 294 PRO A N     1 
ATOM   2332  C CA    . PRO A 1 294 ? 17.257  49.919 85.920  1.00 15.26  ? 294 PRO A CA    1 
ATOM   2333  C C     . PRO A 1 294 ? 17.753  50.948 84.918  1.00 15.77  ? 294 PRO A C     1 
ATOM   2334  O O     . PRO A 1 294 ? 17.494  52.127 85.094  1.00 13.91  ? 294 PRO A O     1 
ATOM   2335  C CB    . PRO A 1 294 ? 18.331  49.715 87.012  1.00 19.69  ? 294 PRO A CB    1 
ATOM   2336  C CG    . PRO A 1 294 ? 19.009  48.418 86.665  1.00 17.83  ? 294 PRO A CG    1 
ATOM   2337  C CD    . PRO A 1 294 ? 18.000  47.591 85.932  1.00 16.25  ? 294 PRO A CD    1 
ATOM   2338  N N     . MET A 1 295 ? 18.562  50.545 83.924  1.00 16.93  ? 295 MET A N     1 
ATOM   2339  C CA    . MET A 1 295 ? 19.145  51.547 83.024  1.00 16.95  ? 295 MET A CA    1 
ATOM   2340  C C     . MET A 1 295 ? 18.308  51.917 81.818  1.00 14.70  ? 295 MET A C     1 
ATOM   2341  O O     . MET A 1 295 ? 18.396  53.058 81.360  1.00 17.34  ? 295 MET A O     1 
ATOM   2342  C CB    . MET A 1 295 ? 20.485  50.996 82.476  1.00 17.46  ? 295 MET A CB    1 
ATOM   2343  C CG    . MET A 1 295 ? 21.479  50.725 83.613  1.00 18.37  ? 295 MET A CG    1 
ATOM   2344  S SD    . MET A 1 295 ? 22.040  52.301 84.321  1.00 21.17  ? 295 MET A SD    1 
ATOM   2345  C CE    . MET A 1 295 ? 22.714  51.627 85.857  1.00 26.58  ? 295 MET A CE    1 
ATOM   2346  N N     . GLU A 1 296 ? 17.608  50.948 81.256  1.00 12.92  ? 296 GLU A N     1 
ATOM   2347  C CA    . GLU A 1 296 ? 16.861  51.152 80.007  1.00 16.62  ? 296 GLU A CA    1 
ATOM   2348  C C     . GLU A 1 296 ? 15.345  51.019 80.130  1.00 14.50  ? 296 GLU A C     1 
ATOM   2349  O O     . GLU A 1 296 ? 14.582  51.893 79.722  1.00 15.07  ? 296 GLU A O     1 
ATOM   2350  C CB    . GLU A 1 296 ? 17.416  50.124 78.989  1.00 15.00  ? 296 GLU A CB    1 
ATOM   2351  C CG    . GLU A 1 296 ? 18.850  50.409 78.544  1.00 20.52  ? 296 GLU A CG    1 
ATOM   2352  C CD    . GLU A 1 296 ? 19.012  51.717 77.814  1.00 24.31  ? 296 GLU A CD    1 
ATOM   2353  O OE1   . GLU A 1 296 ? 18.249  52.039 76.919  1.00 21.95  ? 296 GLU A OE1   1 
ATOM   2354  O OE2   . GLU A 1 296 ? 19.867  52.568 78.084  1.00 35.03  ? 296 GLU A OE2   1 
ATOM   2355  N N     . GLY A 1 297 ? 14.897  49.892 80.681  1.00 13.51  ? 297 GLY A N     1 
ATOM   2356  C CA    . GLY A 1 297 ? 13.445  49.701 80.842  1.00 14.64  ? 297 GLY A CA    1 
ATOM   2357  C C     . GLY A 1 297 ? 13.230  48.205 81.034  1.00 15.92  ? 297 GLY A C     1 
ATOM   2358  O O     . GLY A 1 297 ? 14.225  47.497 81.112  1.00 16.08  ? 297 GLY A O     1 
ATOM   2359  N N     . PHE A 1 298 ? 11.983  47.802 81.075  1.00 13.04  ? 298 PHE A N     1 
ATOM   2360  C CA    . PHE A 1 298 ? 11.647  46.389 81.195  1.00 12.63  ? 298 PHE A CA    1 
ATOM   2361  C C     . PHE A 1 298 ? 12.184  45.679 79.967  1.00 15.68  ? 298 PHE A C     1 
ATOM   2362  O O     . PHE A 1 298 ? 12.323  46.272 78.902  1.00 16.25  ? 298 PHE A O     1 
ATOM   2363  C CB    . PHE A 1 298 ? 10.121  46.217 81.408  1.00 15.95  ? 298 PHE A CB    1 
ATOM   2364  C CG    . PHE A 1 298 ? 9.796   44.732 81.529  1.00 16.38  ? 298 PHE A CG    1 
ATOM   2365  C CD1   . PHE A 1 298 ? 10.262  44.017 82.619  1.00 19.36  ? 298 PHE A CD1   1 
ATOM   2366  C CD2   . PHE A 1 298 ? 9.096   44.076 80.522  1.00 11.02  ? 298 PHE A CD2   1 
ATOM   2367  C CE1   . PHE A 1 298 ? 9.996   42.663 82.707  1.00 15.97  ? 298 PHE A CE1   1 
ATOM   2368  C CE2   . PHE A 1 298 ? 8.823   42.728 80.608  1.00 19.11  ? 298 PHE A CE2   1 
ATOM   2369  C CZ    . PHE A 1 298 ? 9.281   42.029 81.732  1.00 17.63  ? 298 PHE A CZ    1 
ATOM   2370  N N     . VAL A 1 299 ? 12.519  44.417 80.058  1.00 12.86  ? 299 VAL A N     1 
ATOM   2371  C CA    . VAL A 1 299 ? 13.255  43.672 79.079  1.00 15.44  ? 299 VAL A CA    1 
ATOM   2372  C C     . VAL A 1 299 ? 12.542  43.394 77.760  1.00 18.03  ? 299 VAL A C     1 
ATOM   2373  O O     . VAL A 1 299 ? 13.260  42.897 76.881  1.00 15.14  ? 299 VAL A O     1 
ATOM   2374  C CB    . VAL A 1 299 ? 13.812  42.342 79.672  1.00 13.43  ? 299 VAL A CB    1 
ATOM   2375  C CG1   . VAL A 1 299 ? 14.639  42.633 80.918  1.00 18.21  ? 299 VAL A CG1   1 
ATOM   2376  C CG2   . VAL A 1 299 ? 12.717  41.341 79.979  1.00 17.14  ? 299 VAL A CG2   1 
ATOM   2377  N N     . THR A 1 300 ? 11.254  43.683 77.617  1.00 15.29  ? 300 THR A N     1 
ATOM   2378  C CA    . THR A 1 300 ? 10.583  43.442 76.330  1.00 15.42  ? 300 THR A CA    1 
ATOM   2379  C C     . THR A 1 300 ? 10.364  44.753 75.597  1.00 13.69  ? 300 THR A C     1 
ATOM   2380  O O     . THR A 1 300 ? 9.596   44.828 74.626  1.00 14.35  ? 300 THR A O     1 
ATOM   2381  C CB    . THR A 1 300 ? 9.263   42.652 76.497  1.00 14.63  ? 300 THR A CB    1 
ATOM   2382  O OG1   . THR A 1 300 ? 8.424   43.406 77.370  1.00 13.39  ? 300 THR A OG1   1 
ATOM   2383  C CG2   . THR A 1 300 ? 9.506   41.285 77.084  1.00 16.06  ? 300 THR A CG2   1 
ATOM   2384  N N     . TYR A 1 301 ? 10.927  45.869 76.118  1.00 12.29  ? 301 TYR A N     1 
ATOM   2385  C CA    . TYR A 1 301 ? 10.878  47.102 75.299  1.00 13.44  ? 301 TYR A CA    1 
ATOM   2386  C C     . TYR A 1 301 ? 12.220  47.832 75.360  1.00 15.13  ? 301 TYR A C     1 
ATOM   2387  O O     . TYR A 1 301 ? 12.607  48.637 74.496  1.00 13.81  ? 301 TYR A O     1 
ATOM   2388  C CB    . TYR A 1 301 ? 9.693   48.014 75.544  1.00 10.95  ? 301 TYR A CB    1 
ATOM   2389  C CG    . TYR A 1 301 ? 9.738   48.689 76.898  1.00 13.52  ? 301 TYR A CG    1 
ATOM   2390  C CD1   . TYR A 1 301 ? 10.419  49.892 77.059  1.00 9.83   ? 301 TYR A CD1   1 
ATOM   2391  C CD2   . TYR A 1 301 ? 9.133   48.069 77.988  1.00 16.32  ? 301 TYR A CD2   1 
ATOM   2392  C CE1   . TYR A 1 301 ? 10.496  50.481 78.315  1.00 13.94  ? 301 TYR A CE1   1 
ATOM   2393  C CE2   . TYR A 1 301 ? 9.198   48.666 79.245  1.00 13.87  ? 301 TYR A CE2   1 
ATOM   2394  C CZ    . TYR A 1 301 ? 9.890   49.836 79.397  1.00 14.51  ? 301 TYR A CZ    1 
ATOM   2395  O OH    . TYR A 1 301 ? 9.982   50.449 80.621  1.00 15.77  ? 301 TYR A OH    1 
ATOM   2396  N N     . GLY A 1 302 ? 12.963  47.644 76.454  1.00 15.32  ? 302 GLY A N     1 
ATOM   2397  C CA    . GLY A 1 302 ? 14.269  48.239 76.629  1.00 15.28  ? 302 GLY A CA    1 
ATOM   2398  C C     . GLY A 1 302 ? 14.475  49.696 76.354  1.00 14.61  ? 302 GLY A C     1 
ATOM   2399  O O     . GLY A 1 302 ? 15.466  50.118 75.733  1.00 16.07  ? 302 GLY A O     1 
ATOM   2400  N N     . GLY A 1 303 ? 13.596  50.580 76.793  1.00 7.91   ? 303 GLY A N     1 
ATOM   2401  C CA    . GLY A 1 303 ? 13.676  51.990 76.558  1.00 5.90   ? 303 GLY A CA    1 
ATOM   2402  C C     . GLY A 1 303 ? 13.157  52.426 75.166  1.00 9.95   ? 303 GLY A C     1 
ATOM   2403  O O     . GLY A 1 303 ? 13.296  53.615 74.863  1.00 9.71   ? 303 GLY A O     1 
ATOM   2404  N N     . LEU A 1 304 ? 12.491  51.523 74.436  1.00 8.72   ? 304 LEU A N     1 
ATOM   2405  C CA    . LEU A 1 304 ? 11.847  51.959 73.178  1.00 9.89   ? 304 LEU A CA    1 
ATOM   2406  C C     . LEU A 1 304 ? 10.331  51.913 73.228  1.00 12.55  ? 304 LEU A C     1 
ATOM   2407  O O     . LEU A 1 304 ? 9.805   50.960 73.785  1.00 11.74  ? 304 LEU A O     1 
ATOM   2408  C CB    . LEU A 1 304 ? 12.217  50.927 72.067  1.00 9.00   ? 304 LEU A CB    1 
ATOM   2409  C CG    . LEU A 1 304 ? 13.689  51.042 71.627  1.00 9.61   ? 304 LEU A CG    1 
ATOM   2410  C CD1   . LEU A 1 304 ? 14.056  49.962 70.600  1.00 11.23  ? 304 LEU A CD1   1 
ATOM   2411  C CD2   . LEU A 1 304 ? 14.011  52.415 71.064  1.00 9.99   ? 304 LEU A CD2   1 
ATOM   2412  N N     . ALA A 1 305 ? 9.642   52.815 72.527  1.00 11.51  ? 305 ALA A N     1 
ATOM   2413  C CA    . ALA A 1 305 ? 8.195   52.671 72.316  1.00 10.54  ? 305 ALA A CA    1 
ATOM   2414  C C     . ALA A 1 305 ? 7.988   51.401 71.501  1.00 8.71   ? 305 ALA A C     1 
ATOM   2415  O O     . ALA A 1 305 ? 8.897   51.024 70.715  1.00 7.43   ? 305 ALA A O     1 
ATOM   2416  C CB    . ALA A 1 305 ? 7.702   53.905 71.559  1.00 8.09   ? 305 ALA A CB    1 
ATOM   2417  N N     . GLY A 1 306 ? 6.814   50.780 71.598  1.00 7.01   ? 306 GLY A N     1 
ATOM   2418  C CA    . GLY A 1 306 ? 6.484   49.614 70.779  1.00 5.90   ? 306 GLY A CA    1 
ATOM   2419  C C     . GLY A 1 306 ? 6.583   49.960 69.270  1.00 8.14   ? 306 GLY A C     1 
ATOM   2420  O O     . GLY A 1 306 ? 7.049   49.172 68.449  1.00 9.73   ? 306 GLY A O     1 
ATOM   2421  N N     . ARG A 1 307 ? 6.169   51.148 68.869  1.00 6.48   ? 307 ARG A N     1 
ATOM   2422  C CA    . ARG A 1 307 ? 6.226   51.560 67.470  1.00 10.64  ? 307 ARG A CA    1 
ATOM   2423  C C     . ARG A 1 307 ? 7.672   51.566 66.955  1.00 13.26  ? 307 ARG A C     1 
ATOM   2424  O O     . ARG A 1 307 ? 7.891   51.317 65.768  1.00 10.36  ? 307 ARG A O     1 
ATOM   2425  C CB    . ARG A 1 307 ? 5.618   52.933 67.268  1.00 4.65   ? 307 ARG A CB    1 
ATOM   2426  C CG    . ARG A 1 307 ? 6.189   54.050 68.139  1.00 4.64   ? 307 ARG A CG    1 
ATOM   2427  C CD    . ARG A 1 307 ? 5.661   55.418 67.691  1.00 9.59   ? 307 ARG A CD    1 
ATOM   2428  N NE    . ARG A 1 307 ? 6.157   56.426 68.635  1.00 8.96   ? 307 ARG A NE    1 
ATOM   2429  C CZ    . ARG A 1 307 ? 5.461   56.829 69.713  1.00 11.81  ? 307 ARG A CZ    1 
ATOM   2430  N NH1   . ARG A 1 307 ? 4.245   56.371 69.957  1.00 10.61  ? 307 ARG A NH1   1 
ATOM   2431  N NH2   . ARG A 1 307 ? 6.024   57.699 70.509  1.00 6.26   ? 307 ARG A NH2   1 
ATOM   2432  N N     . ASP A 1 308 ? 8.663   51.863 67.825  1.00 11.46  ? 308 ASP A N     1 
ATOM   2433  C CA    . ASP A 1 308 ? 10.043  51.862 67.364  1.00 9.05   ? 308 ASP A CA    1 
ATOM   2434  C C     . ASP A 1 308 ? 10.572  50.464 67.239  1.00 8.71   ? 308 ASP A C     1 
ATOM   2435  O O     . ASP A 1 308 ? 11.361  50.223 66.337  1.00 9.18   ? 308 ASP A O     1 
ATOM   2436  C CB    . ASP A 1 308 ? 10.977  52.736 68.205  1.00 5.51   ? 308 ASP A CB    1 
ATOM   2437  C CG    . ASP A 1 308 ? 10.555  54.177 68.019  1.00 8.57   ? 308 ASP A CG    1 
ATOM   2438  O OD1   . ASP A 1 308 ? 10.618  54.572 66.825  1.00 12.19  ? 308 ASP A OD1   1 
ATOM   2439  O OD2   . ASP A 1 308 ? 10.132  54.875 68.982  1.00 8.69   ? 308 ASP A OD2   1 
ATOM   2440  N N     . MET A 1 309 ? 10.119  49.488 68.024  1.00 7.56   ? 309 MET A N     1 
ATOM   2441  C CA    . MET A 1 309 ? 10.534  48.132 67.777  1.00 7.42   ? 309 MET A CA    1 
ATOM   2442  C C     . MET A 1 309 ? 9.947   47.679 66.417  1.00 9.78   ? 309 MET A C     1 
ATOM   2443  O O     . MET A 1 309 ? 10.555  46.873 65.719  1.00 6.72   ? 309 MET A O     1 
ATOM   2444  C CB    . MET A 1 309 ? 10.100  47.161 68.910  1.00 6.44   ? 309 MET A CB    1 
ATOM   2445  C CG    . MET A 1 309 ? 10.938  47.394 70.216  1.00 11.27  ? 309 MET A CG    1 
ATOM   2446  S SD    . MET A 1 309 ? 10.543  46.141 71.485  1.00 13.85  ? 309 MET A SD    1 
ATOM   2447  C CE    . MET A 1 309 ? 8.936   46.680 72.022  1.00 8.30   ? 309 MET A CE    1 
ATOM   2448  N N     . ALA A 1 310 ? 8.704   48.105 66.162  1.00 8.77   ? 310 ALA A N     1 
ATOM   2449  C CA    . ALA A 1 310 ? 8.015   47.665 64.924  1.00 11.03  ? 310 ALA A CA    1 
ATOM   2450  C C     . ALA A 1 310 ? 8.762   48.206 63.687  1.00 5.01   ? 310 ALA A C     1 
ATOM   2451  O O     . ALA A 1 310 ? 9.038   47.470 62.776  1.00 9.22   ? 310 ALA A O     1 
ATOM   2452  C CB    . ALA A 1 310 ? 6.576   48.179 64.970  1.00 4.53   ? 310 ALA A CB    1 
ATOM   2453  N N     . ALA A 1 311 ? 9.186   49.434 63.739  1.00 4.83   ? 311 ALA A N     1 
ATOM   2454  C CA    . ALA A 1 311 ? 9.965   50.091 62.673  1.00 12.31  ? 311 ALA A CA    1 
ATOM   2455  C C     . ALA A 1 311 ? 11.311  49.425 62.516  1.00 13.83  ? 311 ALA A C     1 
ATOM   2456  O O     . ALA A 1 311 ? 11.850  49.265 61.402  1.00 11.92  ? 311 ALA A O     1 
ATOM   2457  C CB    . ALA A 1 311 ? 10.091  51.609 62.942  1.00 5.07   ? 311 ALA A CB    1 
ATOM   2458  N N     . MET A 1 312 ? 11.889  48.978 63.658  1.00 10.52  ? 312 MET A N     1 
ATOM   2459  C CA    . MET A 1 312 ? 13.181  48.331 63.634  1.00 9.96   ? 312 MET A CA    1 
ATOM   2460  C C     . MET A 1 312 ? 13.118  47.005 62.884  1.00 8.13   ? 312 MET A C     1 
ATOM   2461  O O     . MET A 1 312 ? 13.989  46.585 62.136  1.00 10.16  ? 312 MET A O     1 
ATOM   2462  C CB    . MET A 1 312 ? 13.743  48.052 65.035  1.00 10.79  ? 312 MET A CB    1 
ATOM   2463  C CG    . MET A 1 312 ? 15.188  47.532 65.010  1.00 14.56  ? 312 MET A CG    1 
ATOM   2464  S SD    . MET A 1 312 ? 15.828  47.239 66.697  1.00 17.37  ? 312 MET A SD    1 
ATOM   2465  C CE    . MET A 1 312 ? 15.636  48.809 67.463  1.00 9.09   ? 312 MET A CE    1 
ATOM   2466  N N     . VAL A 1 313 ? 12.043  46.259 63.126  1.00 6.52   ? 313 VAL A N     1 
ATOM   2467  C CA    . VAL A 1 313 ? 11.851  44.983 62.433  1.00 8.51   ? 313 VAL A CA    1 
ATOM   2468  C C     . VAL A 1 313 ? 11.847  45.201 60.900  1.00 10.05  ? 313 VAL A C     1 
ATOM   2469  O O     . VAL A 1 313 ? 12.503  44.468 60.213  1.00 9.70   ? 313 VAL A O     1 
ATOM   2470  C CB    . VAL A 1 313 ? 10.564  44.267 62.857  1.00 14.70  ? 313 VAL A CB    1 
ATOM   2471  C CG1   . VAL A 1 313 ? 10.328  43.000 62.008  1.00 9.59   ? 313 VAL A CG1   1 
ATOM   2472  C CG2   . VAL A 1 313 ? 10.719  43.873 64.326  1.00 13.22  ? 313 VAL A CG2   1 
ATOM   2473  N N     . GLN A 1 314 ? 11.189  46.235 60.425  1.00 9.44   ? 314 GLN A N     1 
ATOM   2474  C CA    . GLN A 1 314 ? 11.067  46.494 58.993  1.00 13.12  ? 314 GLN A CA    1 
ATOM   2475  C C     . GLN A 1 314 ? 12.388  47.101 58.490  1.00 11.34  ? 314 GLN A C     1 
ATOM   2476  O O     . GLN A 1 314 ? 12.794  46.806 57.385  1.00 9.69   ? 314 GLN A O     1 
ATOM   2477  C CB    . GLN A 1 314 ? 9.910   47.455 58.726  1.00 9.86   ? 314 GLN A CB    1 
ATOM   2478  C CG    . GLN A 1 314 ? 9.665   47.977 57.314  1.00 11.48  ? 314 GLN A CG    1 
ATOM   2479  C CD    . GLN A 1 314 ? 9.380   46.805 56.395  1.00 16.84  ? 314 GLN A CD    1 
ATOM   2480  O OE1   . GLN A 1 314 ? 8.814   45.831 56.856  1.00 12.71  ? 314 GLN A OE1   1 
ATOM   2481  N NE2   . GLN A 1 314 ? 9.788   46.909 55.126  1.00 12.58  ? 314 GLN A NE2   1 
ATOM   2482  N N     . GLY A 1 315 ? 12.988  47.989 59.277  1.00 9.42   ? 315 GLY A N     1 
ATOM   2483  C CA    . GLY A 1 315 ? 14.254  48.632 58.988  1.00 12.02  ? 315 GLY A CA    1 
ATOM   2484  C C     . GLY A 1 315 ? 15.395  47.623 58.805  1.00 13.30  ? 315 GLY A C     1 
ATOM   2485  O O     . GLY A 1 315 ? 16.234  47.753 57.900  1.00 13.46  ? 315 GLY A O     1 
ATOM   2486  N N     . LEU A 1 316 ? 15.481  46.602 59.625  1.00 8.16   ? 316 LEU A N     1 
ATOM   2487  C CA    . LEU A 1 316 ? 16.443  45.561 59.528  1.00 13.48  ? 316 LEU A CA    1 
ATOM   2488  C C     . LEU A 1 316 ? 16.339  44.820 58.185  1.00 14.83  ? 316 LEU A C     1 
ATOM   2489  O O     . LEU A 1 316 ? 17.368  44.458 57.646  1.00 18.04  ? 316 LEU A O     1 
ATOM   2490  C CB    . LEU A 1 316 ? 16.310  44.522 60.651  1.00 9.34   ? 316 LEU A CB    1 
ATOM   2491  C CG    . LEU A 1 316 ? 16.894  45.026 61.998  1.00 15.65  ? 316 LEU A CG    1 
ATOM   2492  C CD1   . LEU A 1 316 ? 16.369  44.159 63.144  1.00 9.09   ? 316 LEU A CD1   1 
ATOM   2493  C CD2   . LEU A 1 316 ? 18.416  45.022 61.901  1.00 13.24  ? 316 LEU A CD2   1 
ATOM   2494  N N     . GLU A 1 317 ? 15.137  44.625 57.665  1.00 10.36  ? 317 GLU A N     1 
ATOM   2495  C CA    . GLU A 1 317 ? 14.951  43.947 56.384  1.00 10.19  ? 317 GLU A CA    1 
ATOM   2496  C C     . GLU A 1 317 ? 15.359  44.940 55.274  1.00 11.46  ? 317 GLU A C     1 
ATOM   2497  O O     . GLU A 1 317 ? 16.261  44.605 54.513  1.00 11.13  ? 317 GLU A O     1 
ATOM   2498  C CB    . GLU A 1 317 ? 13.521  43.473 56.211  1.00 16.68  ? 317 GLU A CB    1 
ATOM   2499  C CG    . GLU A 1 317 ? 13.166  42.995 54.786  1.00 15.43  ? 317 GLU A CG    1 
ATOM   2500  C CD    . GLU A 1 317 ? 13.902  41.671 54.560  1.00 18.09  ? 317 GLU A CD    1 
ATOM   2501  O OE1   . GLU A 1 317 ? 14.311  40.978 55.515  1.00 19.45  ? 317 GLU A OE1   1 
ATOM   2502  O OE2   . GLU A 1 317 ? 14.074  41.303 53.399  1.00 30.66  ? 317 GLU A OE2   1 
ATOM   2503  N N     . GLU A 1 318 ? 14.857  46.161 55.248  1.00 9.89   ? 318 GLU A N     1 
ATOM   2504  C CA    . GLU A 1 318 ? 15.186  47.128 54.219  1.00 11.00  ? 318 GLU A CA    1 
ATOM   2505  C C     . GLU A 1 318 ? 16.665  47.471 54.139  1.00 15.65  ? 318 GLU A C     1 
ATOM   2506  O O     . GLU A 1 318 ? 17.182  47.690 53.025  1.00 10.75  ? 318 GLU A O     1 
ATOM   2507  C CB    . GLU A 1 318 ? 14.456  48.476 54.373  1.00 11.17  ? 318 GLU A CB    1 
ATOM   2508  C CG    . GLU A 1 318 ? 12.927  48.302 54.247  1.00 12.45  ? 318 GLU A CG    1 
ATOM   2509  C CD    . GLU A 1 318 ? 12.151  49.587 54.323  1.00 9.22   ? 318 GLU A CD    1 
ATOM   2510  O OE1   . GLU A 1 318 ? 12.644  50.717 54.214  1.00 10.32  ? 318 GLU A OE1   1 
ATOM   2511  O OE2   . GLU A 1 318 ? 10.914  49.511 54.547  1.00 12.90  ? 318 GLU A OE2   1 
ATOM   2512  N N     . GLY A 1 319 ? 17.396  47.486 55.254  1.00 10.45  ? 319 GLY A N     1 
ATOM   2513  C CA    . GLY A 1 319 ? 18.792  47.849 55.285  1.00 11.38  ? 319 GLY A CA    1 
ATOM   2514  C C     . GLY A 1 319 ? 19.676  46.773 54.640  1.00 9.25   ? 319 GLY A C     1 
ATOM   2515  O O     . GLY A 1 319 ? 20.840  47.022 54.324  1.00 12.70  ? 319 GLY A O     1 
ATOM   2516  N N     . THR A 1 320 ? 19.171  45.560 54.469  1.00 8.69   ? 320 THR A N     1 
ATOM   2517  C CA    . THR A 1 320 ? 19.850  44.486 53.809  1.00 10.89  ? 320 THR A CA    1 
ATOM   2518  C C     . THR A 1 320 ? 19.695  44.462 52.272  1.00 16.16  ? 320 THR A C     1 
ATOM   2519  O O     . THR A 1 320 ? 20.325  43.568 51.682  1.00 13.76  ? 320 THR A O     1 
ATOM   2520  C CB    . THR A 1 320 ? 19.400  43.099 54.308  1.00 15.50  ? 320 THR A CB    1 
ATOM   2521  O OG1   . THR A 1 320 ? 18.067  42.821 53.901  1.00 13.37  ? 320 THR A OG1   1 
ATOM   2522  C CG2   . THR A 1 320 ? 19.547  43.042 55.832  1.00 10.39  ? 320 THR A CG2   1 
ATOM   2523  N N     . GLU A 1 321 ? 18.797  45.244 51.696  1.00 11.03  ? 321 GLU A N     1 
ATOM   2524  C CA    . GLU A 1 321 ? 18.477  45.197 50.278  1.00 16.74  ? 321 GLU A CA    1 
ATOM   2525  C C     . GLU A 1 321 ? 19.596  45.688 49.360  1.00 9.62   ? 321 GLU A C     1 
ATOM   2526  O O     . GLU A 1 321 ? 20.070  46.800 49.480  1.00 8.54   ? 321 GLU A O     1 
ATOM   2527  C CB    . GLU A 1 321 ? 17.177  45.976 49.994  1.00 14.38  ? 321 GLU A CB    1 
ATOM   2528  C CG    . GLU A 1 321 ? 16.001  45.186 50.600  1.00 25.65  ? 321 GLU A CG    1 
ATOM   2529  C CD    . GLU A 1 321 ? 14.663  45.905 50.492  1.00 32.27  ? 321 GLU A CD    1 
ATOM   2530  O OE1   . GLU A 1 321 ? 14.584  47.070 50.040  1.00 30.63  ? 321 GLU A OE1   1 
ATOM   2531  O OE2   . GLU A 1 321 ? 13.687  45.248 50.914  1.00 35.81  ? 321 GLU A OE2   1 
ATOM   2532  N N     . GLU A 1 322 ? 20.058  44.703 48.543  1.00 10.86  ? 322 GLU A N     1 
ATOM   2533  C CA    . GLU A 1 322 ? 21.271  45.026 47.756  1.00 12.81  ? 322 GLU A CA    1 
ATOM   2534  C C     . GLU A 1 322 ? 21.150  46.230 46.882  1.00 10.01  ? 322 GLU A C     1 
ATOM   2535  O O     . GLU A 1 322 ? 22.018  47.075 46.826  1.00 11.64  ? 322 GLU A O     1 
ATOM   2536  C CB    . GLU A 1 322 ? 21.682  43.771 46.958  1.00 18.53  ? 322 GLU A CB    1 
ATOM   2537  C CG    . GLU A 1 322 ? 22.969  44.083 46.209  1.00 28.16  ? 322 GLU A CG    1 
ATOM   2538  C CD    . GLU A 1 322 ? 23.636  42.865 45.613  1.00 29.25  ? 322 GLU A CD    1 
ATOM   2539  O OE1   . GLU A 1 322 ? 23.252  41.704 45.854  1.00 28.76  ? 322 GLU A OE1   1 
ATOM   2540  O OE2   . GLU A 1 322 ? 24.597  43.128 44.866  1.00 37.28  ? 322 GLU A OE2   1 
ATOM   2541  N N     . GLU A 1 323 ? 20.011  46.434 46.193  1.00 12.47  ? 323 GLU A N     1 
ATOM   2542  C CA    . GLU A 1 323 ? 19.789  47.598 45.344  1.00 13.36  ? 323 GLU A CA    1 
ATOM   2543  C C     . GLU A 1 323 ? 19.878  48.874 46.129  1.00 13.33  ? 323 GLU A C     1 
ATOM   2544  O O     . GLU A 1 323 ? 20.437  49.863 45.660  1.00 11.46  ? 323 GLU A O     1 
ATOM   2545  C CB    . GLU A 1 323 ? 18.435  47.577 44.569  1.00 17.24  ? 323 GLU A CB    1 
ATOM   2546  C CG    . GLU A 1 323 ? 17.959  46.164 44.255  1.00 46.98  ? 323 GLU A CG    1 
ATOM   2547  C CD    . GLU A 1 323 ? 17.357  45.517 45.506  1.00 58.59  ? 323 GLU A CD    1 
ATOM   2548  O OE1   . GLU A 1 323 ? 16.447  46.158 46.093  1.00 69.83  ? 323 GLU A OE1   1 
ATOM   2549  O OE2   . GLU A 1 323 ? 17.802  44.422 45.919  1.00 56.68  ? 323 GLU A OE2   1 
ATOM   2550  N N     . TYR A 1 324 ? 19.294  48.897 47.342  1.00 11.65  ? 324 TYR A N     1 
ATOM   2551  C CA    . TYR A 1 324 ? 19.404  50.085 48.191  1.00 8.51   ? 324 TYR A CA    1 
ATOM   2552  C C     . TYR A 1 324 ? 20.861  50.346 48.576  1.00 6.07   ? 324 TYR A C     1 
ATOM   2553  O O     . TYR A 1 324 ? 21.370  51.469 48.515  1.00 7.38   ? 324 TYR A O     1 
ATOM   2554  C CB    . TYR A 1 324 ? 18.494  49.905 49.464  1.00 9.93   ? 324 TYR A CB    1 
ATOM   2555  C CG    . TYR A 1 324 ? 19.087  50.739 50.603  1.00 8.93   ? 324 TYR A CG    1 
ATOM   2556  C CD1   . TYR A 1 324 ? 18.965  52.120 50.597  1.00 5.80   ? 324 TYR A CD1   1 
ATOM   2557  C CD2   . TYR A 1 324 ? 19.836  50.093 51.588  1.00 11.49  ? 324 TYR A CD2   1 
ATOM   2558  C CE1   . TYR A 1 324 ? 19.584  52.886 51.593  1.00 8.96   ? 324 TYR A CE1   1 
ATOM   2559  C CE2   . TYR A 1 324 ? 20.411  50.859 52.608  1.00 8.77   ? 324 TYR A CE2   1 
ATOM   2560  C CZ    . TYR A 1 324 ? 20.281  52.216 52.601  1.00 7.79   ? 324 TYR A CZ    1 
ATOM   2561  O OH    . TYR A 1 324 ? 20.913  52.941 53.555  1.00 9.92   ? 324 TYR A OH    1 
ATOM   2562  N N     . LEU A 1 325 ? 21.550  49.294 49.016  1.00 7.46   ? 325 LEU A N     1 
ATOM   2563  C CA    . LEU A 1 325 ? 22.944  49.451 49.497  1.00 12.81  ? 325 LEU A CA    1 
ATOM   2564  C C     . LEU A 1 325 ? 23.888  49.942 48.386  1.00 12.73  ? 325 LEU A C     1 
ATOM   2565  O O     . LEU A 1 325 ? 24.754  50.779 48.527  1.00 10.26  ? 325 LEU A O     1 
ATOM   2566  C CB    . LEU A 1 325 ? 23.408  48.078 50.015  1.00 11.44  ? 325 LEU A CB    1 
ATOM   2567  C CG    . LEU A 1 325 ? 22.901  47.739 51.456  1.00 13.71  ? 325 LEU A CG    1 
ATOM   2568  C CD1   . LEU A 1 325 ? 23.178  46.274 51.754  1.00 10.05  ? 325 LEU A CD1   1 
ATOM   2569  C CD2   . LEU A 1 325 ? 23.520  48.641 52.516  1.00 12.53  ? 325 LEU A CD2   1 
ATOM   2570  N N     . HIS A 1 326 ? 23.676  49.375 47.182  1.00 15.17  ? 326 HIS A N     1 
ATOM   2571  C CA    . HIS A 1 326 ? 24.456  49.770 46.000  1.00 14.28  ? 326 HIS A CA    1 
ATOM   2572  C C     . HIS A 1 326 ? 24.295  51.246 45.709  1.00 14.87  ? 326 HIS A C     1 
ATOM   2573  O O     . HIS A 1 326 ? 25.247  51.969 45.439  1.00 12.69  ? 326 HIS A O     1 
ATOM   2574  C CB    . HIS A 1 326 ? 23.978  48.855 44.852  1.00 14.62  ? 326 HIS A CB    1 
ATOM   2575  C CG    . HIS A 1 326 ? 24.681  49.228 43.579  1.00 28.18  ? 326 HIS A CG    1 
ATOM   2576  N ND1   . HIS A 1 326 ? 26.022  48.940 43.397  1.00 28.68  ? 326 HIS A ND1   1 
ATOM   2577  C CD2   . HIS A 1 326 ? 24.242  49.862 42.469  1.00 25.17  ? 326 HIS A CD2   1 
ATOM   2578  C CE1   . HIS A 1 326 ? 26.379  49.380 42.198  1.00 30.42  ? 326 HIS A CE1   1 
ATOM   2579  N NE2   . HIS A 1 326 ? 25.330  49.938 41.624  1.00 30.31  ? 326 HIS A NE2   1 
ATOM   2580  N N     . TYR A 1 327 ? 23.063  51.763 45.837  1.00 9.65   ? 327 TYR A N     1 
ATOM   2581  C CA    . TYR A 1 327 ? 22.747  53.160 45.618  1.00 9.57   ? 327 TYR A CA    1 
ATOM   2582  C C     . TYR A 1 327 ? 23.342  54.041 46.700  1.00 10.55  ? 327 TYR A C     1 
ATOM   2583  O O     . TYR A 1 327 ? 23.854  55.131 46.498  1.00 11.05  ? 327 TYR A O     1 
ATOM   2584  C CB    . TYR A 1 327 ? 21.182  53.356 45.656  1.00 9.42   ? 327 TYR A CB    1 
ATOM   2585  C CG    . TYR A 1 327 ? 20.772  54.742 46.101  1.00 11.75  ? 327 TYR A CG    1 
ATOM   2586  C CD1   . TYR A 1 327 ? 20.875  55.760 45.197  1.00 16.09  ? 327 TYR A CD1   1 
ATOM   2587  C CD2   . TYR A 1 327 ? 20.287  55.045 47.378  1.00 13.13  ? 327 TYR A CD2   1 
ATOM   2588  C CE1   . TYR A 1 327 ? 20.559  57.070 45.544  1.00 19.20  ? 327 TYR A CE1   1 
ATOM   2589  C CE2   . TYR A 1 327 ? 19.940  56.358 47.717  1.00 13.26  ? 327 TYR A CE2   1 
ATOM   2590  C CZ    . TYR A 1 327 ? 20.118  57.349 46.810  1.00 20.16  ? 327 TYR A CZ    1 
ATOM   2591  O OH    . TYR A 1 327 ? 19.802  58.702 46.948  1.00 25.35  ? 327 TYR A OH    1 
ATOM   2592  N N     . ARG A 1 328 ? 23.121  53.582 47.948  1.00 10.99  ? 328 ARG A N     1 
ATOM   2593  C CA    . ARG A 1 328 ? 23.551  54.346 49.116  1.00 9.64   ? 328 ARG A CA    1 
ATOM   2594  C C     . ARG A 1 328 ? 25.080  54.519 49.098  1.00 6.45   ? 328 ARG A C     1 
ATOM   2595  O O     . ARG A 1 328 ? 25.593  55.628 49.205  1.00 9.31   ? 328 ARG A O     1 
ATOM   2596  C CB    . ARG A 1 328 ? 23.100  53.554 50.373  1.00 9.25   ? 328 ARG A CB    1 
ATOM   2597  C CG    . ARG A 1 328 ? 23.293  54.316 51.674  1.00 9.99   ? 328 ARG A CG    1 
ATOM   2598  C CD    . ARG A 1 328 ? 24.756  54.407 52.093  1.00 9.73   ? 328 ARG A CD    1 
ATOM   2599  N NE    . ARG A 1 328 ? 24.928  54.761 53.520  1.00 7.26   ? 328 ARG A NE    1 
ATOM   2600  C CZ    . ARG A 1 328 ? 24.842  55.940 54.065  1.00 12.75  ? 328 ARG A CZ    1 
ATOM   2601  N NH1   . ARG A 1 328 ? 24.527  57.051 53.391  1.00 7.43   ? 328 ARG A NH1   1 
ATOM   2602  N NH2   . ARG A 1 328 ? 25.074  56.071 55.389  1.00 13.26  ? 328 ARG A NH2   1 
ATOM   2603  N N     . ILE A 1 329 ? 25.764  53.417 48.989  1.00 10.02  ? 329 ILE A N     1 
ATOM   2604  C CA    . ILE A 1 329 ? 27.244  53.416 48.981  1.00 12.67  ? 329 ILE A CA    1 
ATOM   2605  C C     . ILE A 1 329 ? 27.789  54.071 47.704  1.00 14.89  ? 329 ILE A C     1 
ATOM   2606  O O     . ILE A 1 329 ? 28.752  54.808 47.768  1.00 13.44  ? 329 ILE A O     1 
ATOM   2607  C CB    . ILE A 1 329 ? 27.740  51.979 49.129  1.00 19.96  ? 329 ILE A CB    1 
ATOM   2608  C CG1   . ILE A 1 329 ? 27.493  51.497 50.573  1.00 14.24  ? 329 ILE A CG1   1 
ATOM   2609  C CG2   . ILE A 1 329 ? 29.231  51.810 48.811  1.00 16.79  ? 329 ILE A CG2   1 
ATOM   2610  C CD1   . ILE A 1 329 ? 27.413  50.006 50.692  1.00 18.59  ? 329 ILE A CD1   1 
ATOM   2611  N N     . GLY A 1 330 ? 27.045  53.942 46.600  1.00 10.24  ? 330 GLY A N     1 
ATOM   2612  C CA    . GLY A 1 330 ? 27.441  54.573 45.341  1.00 11.83  ? 330 GLY A CA    1 
ATOM   2613  C C     . GLY A 1 330 ? 27.296  56.067 45.421  1.00 11.87  ? 330 GLY A C     1 
ATOM   2614  O O     . GLY A 1 330 ? 27.997  56.840 44.811  1.00 12.45  ? 330 GLY A O     1 
ATOM   2615  N N     . GLN A 1 331 ? 26.350  56.541 46.244  1.00 10.50  ? 331 GLN A N     1 
ATOM   2616  C CA    . GLN A 1 331 ? 26.174  57.975 46.394  1.00 7.95   ? 331 GLN A CA    1 
ATOM   2617  C C     . GLN A 1 331 ? 27.343  58.607 47.173  1.00 11.09  ? 331 GLN A C     1 
ATOM   2618  O O     . GLN A 1 331 ? 27.801  59.721 46.925  1.00 11.50  ? 331 GLN A O     1 
ATOM   2619  C CB    . GLN A 1 331 ? 24.870  58.285 47.108  1.00 9.45   ? 331 GLN A CB    1 
ATOM   2620  C CG    . GLN A 1 331 ? 24.793  59.749 47.495  1.00 4.87   ? 331 GLN A CG    1 
ATOM   2621  C CD    . GLN A 1 331 ? 23.443  60.135 48.085  1.00 22.02  ? 331 GLN A CD    1 
ATOM   2622  O OE1   . GLN A 1 331 ? 23.127  59.776 49.213  1.00 11.97  ? 331 GLN A OE1   1 
ATOM   2623  N NE2   . GLN A 1 331 ? 22.635  60.908 47.375  1.00 12.15  ? 331 GLN A NE2   1 
ATOM   2624  N N     . VAL A 1 332 ? 27.801  57.873 48.196  1.00 10.59  ? 332 VAL A N     1 
ATOM   2625  C CA    . VAL A 1 332 ? 28.946  58.381 48.965  1.00 10.06  ? 332 VAL A CA    1 
ATOM   2626  C C     . VAL A 1 332 ? 30.231  58.436 48.050  1.00 2.75   ? 332 VAL A C     1 
ATOM   2627  O O     . VAL A 1 332 ? 30.997  59.373 48.137  1.00 11.19  ? 332 VAL A O     1 
ATOM   2628  C CB    . VAL A 1 332 ? 29.162  57.444 50.163  1.00 17.20  ? 332 VAL A CB    1 
ATOM   2629  C CG1   . VAL A 1 332 ? 30.494  57.789 50.836  1.00 13.09  ? 332 VAL A CG1   1 
ATOM   2630  C CG2   . VAL A 1 332 ? 27.965  57.530 51.140  1.00 12.97  ? 332 VAL A CG2   1 
ATOM   2631  N N     . LYS A 1 333 ? 30.366  57.355 47.278  1.00 8.82   ? 333 LYS A N     1 
ATOM   2632  C CA    . LYS A 1 333 ? 31.456  57.242 46.301  1.00 14.57  ? 333 LYS A CA    1 
ATOM   2633  C C     . LYS A 1 333 ? 31.409  58.348 45.256  1.00 17.78  ? 333 LYS A C     1 
ATOM   2634  O O     . LYS A 1 333 ? 32.400  59.060 45.012  1.00 19.65  ? 333 LYS A O     1 
ATOM   2635  C CB    . LYS A 1 333 ? 31.374  55.853 45.647  1.00 12.44  ? 333 LYS A CB    1 
ATOM   2636  C CG    . LYS A 1 333 ? 32.487  55.617 44.587  1.00 19.40  ? 333 LYS A CG    1 
ATOM   2637  C CD    . LYS A 1 333 ? 32.405  54.198 44.077  1.00 19.89  ? 333 LYS A CD    1 
ATOM   2638  C CE    . LYS A 1 333 ? 33.419  53.807 43.026  1.00 35.54  ? 333 LYS A CE    1 
ATOM   2639  N NZ    . LYS A 1 333 ? 34.120  54.948 42.407  1.00 26.21  ? 333 LYS A NZ    1 
ATOM   2640  N N     . TYR A 1 334 ? 30.183  58.681 44.799  1.00 15.71  ? 334 TYR A N     1 
ATOM   2641  C CA    . TYR A 1 334 ? 29.946  59.819 43.937  1.00 12.06  ? 334 TYR A CA    1 
ATOM   2642  C C     . TYR A 1 334 ? 30.460  61.093 44.518  1.00 14.07  ? 334 TYR A C     1 
ATOM   2643  O O     . TYR A 1 334 ? 31.190  61.879 43.888  1.00 14.00  ? 334 TYR A O     1 
ATOM   2644  C CB    . TYR A 1 334 ? 28.436  60.007 43.613  1.00 12.82  ? 334 TYR A CB    1 
ATOM   2645  C CG    . TYR A 1 334 ? 28.224  61.175 42.691  1.00 12.96  ? 334 TYR A CG    1 
ATOM   2646  C CD1   . TYR A 1 334 ? 28.691  61.150 41.377  1.00 11.13  ? 334 TYR A CD1   1 
ATOM   2647  C CD2   . TYR A 1 334 ? 27.597  62.310 43.159  1.00 12.08  ? 334 TYR A CD2   1 
ATOM   2648  C CE1   . TYR A 1 334 ? 28.501  62.287 40.573  1.00 11.84  ? 334 TYR A CE1   1 
ATOM   2649  C CE2   . TYR A 1 334 ? 27.387  63.419 42.380  1.00 13.85  ? 334 TYR A CE2   1 
ATOM   2650  C CZ    . TYR A 1 334 ? 27.861  63.384 41.053  1.00 16.31  ? 334 TYR A CZ    1 
ATOM   2651  O OH    . TYR A 1 334 ? 27.620  64.488 40.278  1.00 14.10  ? 334 TYR A OH    1 
ATOM   2652  N N     . LEU A 1 335 ? 30.033  61.415 45.758  1.00 10.87  ? 335 LEU A N     1 
ATOM   2653  C CA    . LEU A 1 335 ? 30.584  62.589 46.427  1.00 10.16  ? 335 LEU A CA    1 
ATOM   2654  C C     . LEU A 1 335 ? 32.122  62.495 46.564  1.00 15.20  ? 335 LEU A C     1 
ATOM   2655  O O     . LEU A 1 335 ? 32.806  63.472 46.262  1.00 12.68  ? 335 LEU A O     1 
ATOM   2656  C CB    . LEU A 1 335 ? 29.956  62.747 47.811  1.00 13.05  ? 335 LEU A CB    1 
ATOM   2657  C CG    . LEU A 1 335 ? 30.529  63.885 48.675  1.00 14.55  ? 335 LEU A CG    1 
ATOM   2658  C CD1   . LEU A 1 335 ? 30.358  65.238 48.017  1.00 14.95  ? 335 LEU A CD1   1 
ATOM   2659  C CD2   . LEU A 1 335 ? 29.835  63.900 50.042  1.00 15.91  ? 335 LEU A CD2   1 
ATOM   2660  N N     . GLY A 1 336 ? 32.655  61.321 46.939  1.00 10.88  ? 336 GLY A N     1 
ATOM   2661  C CA    . GLY A 1 336 ? 34.130  61.253 47.077  1.00 17.74  ? 336 GLY A CA    1 
ATOM   2662  C C     . GLY A 1 336 ? 34.805  61.428 45.686  1.00 19.05  ? 336 GLY A C     1 
ATOM   2663  O O     . GLY A 1 336 ? 35.814  62.097 45.592  1.00 17.02  ? 336 GLY A O     1 
ATOM   2664  N N     . ASP A 1 337 ? 34.294  60.790 44.630  1.00 17.15  ? 337 ASP A N     1 
ATOM   2665  C CA    . ASP A 1 337 ? 34.865  60.881 43.287  1.00 18.85  ? 337 ASP A CA    1 
ATOM   2666  C C     . ASP A 1 337 ? 34.831  62.311 42.801  1.00 21.27  ? 337 ASP A C     1 
ATOM   2667  O O     . ASP A 1 337 ? 35.787  62.784 42.227  1.00 20.70  ? 337 ASP A O     1 
ATOM   2668  C CB    . ASP A 1 337 ? 34.137  59.987 42.256  1.00 11.68  ? 337 ASP A CB    1 
ATOM   2669  C CG    . ASP A 1 337 ? 34.623  58.576 42.468  1.00 12.62  ? 337 ASP A CG    1 
ATOM   2670  O OD1   . ASP A 1 337 ? 35.668  58.417 43.142  1.00 19.40  ? 337 ASP A OD1   1 
ATOM   2671  O OD2   . ASP A 1 337 ? 33.992  57.625 41.981  1.00 18.03  ? 337 ASP A OD2   1 
ATOM   2672  N N     . ARG A 1 338 ? 33.783  63.093 43.049  1.00 16.52  ? 338 ARG A N     1 
ATOM   2673  C CA    . ARG A 1 338 ? 33.751  64.471 42.644  1.00 18.46  ? 338 ARG A CA    1 
ATOM   2674  C C     . ARG A 1 338 ? 34.882  65.226 43.338  1.00 21.84  ? 338 ARG A C     1 
ATOM   2675  O O     . ARG A 1 338 ? 35.477  66.132 42.740  1.00 19.30  ? 338 ARG A O     1 
ATOM   2676  C CB    . ARG A 1 338 ? 32.424  65.135 42.928  1.00 18.14  ? 338 ARG A CB    1 
ATOM   2677  C CG    . ARG A 1 338 ? 31.206  64.565 42.240  1.00 23.87  ? 338 ARG A CG    1 
ATOM   2678  C CD    . ARG A 1 338 ? 30.881  65.231 40.910  1.00 24.30  ? 338 ARG A CD    1 
ATOM   2679  N NE    . ARG A 1 338 ? 31.335  66.572 40.838  1.00 20.47  ? 338 ARG A NE    1 
ATOM   2680  C CZ    . ARG A 1 338 ? 30.999  67.804 41.076  1.00 26.42  ? 338 ARG A CZ    1 
ATOM   2681  N NH1   . ARG A 1 338 ? 29.830  68.218 41.534  1.00 22.32  ? 338 ARG A NH1   1 
ATOM   2682  N NH2   . ARG A 1 338 ? 31.929  68.732 40.805  1.00 23.77  ? 338 ARG A NH2   1 
ATOM   2683  N N     . LEU A 1 339 ? 35.102  64.938 44.634  1.00 19.06  ? 339 LEU A N     1 
ATOM   2684  C CA    . LEU A 1 339 ? 36.154  65.699 45.341  1.00 20.75  ? 339 LEU A CA    1 
ATOM   2685  C C     . LEU A 1 339 ? 37.534  65.298 44.811  1.00 19.63  ? 339 LEU A C     1 
ATOM   2686  O O     . LEU A 1 339 ? 38.312  66.174 44.512  1.00 19.85  ? 339 LEU A O     1 
ATOM   2687  C CB    . LEU A 1 339 ? 36.075  65.534 46.858  1.00 18.81  ? 339 LEU A CB    1 
ATOM   2688  C CG    . LEU A 1 339 ? 34.748  66.058 47.479  1.00 22.21  ? 339 LEU A CG    1 
ATOM   2689  C CD1   . LEU A 1 339 ? 34.680  65.755 48.990  1.00 18.51  ? 339 LEU A CD1   1 
ATOM   2690  C CD2   . LEU A 1 339 ? 34.595  67.536 47.177  1.00 15.32  ? 339 LEU A CD2   1 
ATOM   2691  N N     . ARG A 1 340 ? 37.827  64.021 44.743  1.00 18.26  ? 340 ARG A N     1 
ATOM   2692  C CA    . ARG A 1 340 ? 39.080  63.467 44.311  1.00 23.94  ? 340 ARG A CA    1 
ATOM   2693  C C     . ARG A 1 340 ? 39.408  63.882 42.872  1.00 29.17  ? 340 ARG A C     1 
ATOM   2694  O O     . ARG A 1 340 ? 40.454  64.482 42.629  1.00 26.02  ? 340 ARG A O     1 
ATOM   2695  C CB    . ARG A 1 340 ? 39.008  61.956 44.434  1.00 18.37  ? 340 ARG A CB    1 
ATOM   2696  C CG    . ARG A 1 340 ? 40.385  61.312 44.426  1.00 29.74  ? 340 ARG A CG    1 
ATOM   2697  C CD    . ARG A 1 340 ? 40.267  59.807 44.536  1.00 33.31  ? 340 ARG A CD    1 
ATOM   2698  N NE    . ARG A 1 340 ? 41.571  59.177 44.370  1.00 35.71  ? 340 ARG A NE    1 
ATOM   2699  C CZ    . ARG A 1 340 ? 41.843  58.368 43.350  1.00 43.49  ? 340 ARG A CZ    1 
ATOM   2700  N NH1   . ARG A 1 340 ? 40.861  58.129 42.468  1.00 39.41  ? 340 ARG A NH1   1 
ATOM   2701  N NH2   . ARG A 1 340 ? 43.055  57.833 43.233  1.00 43.68  ? 340 ARG A NH2   1 
ATOM   2702  N N     . GLU A 1 341 ? 38.445  63.785 41.941  1.00 25.76  ? 341 GLU A N     1 
ATOM   2703  C CA    . GLU A 1 341 ? 38.604  64.238 40.568  1.00 24.23  ? 341 GLU A CA    1 
ATOM   2704  C C     . GLU A 1 341 ? 38.941  65.710 40.550  1.00 26.00  ? 341 GLU A C     1 
ATOM   2705  O O     . GLU A 1 341 ? 39.671  66.165 39.659  1.00 31.51  ? 341 GLU A O     1 
ATOM   2706  C CB    . GLU A 1 341 ? 37.368  63.968 39.670  1.00 19.68  ? 341 GLU A CB    1 
ATOM   2707  C CG    . GLU A 1 341 ? 37.226  62.452 39.481  1.00 24.72  ? 341 GLU A CG    1 
ATOM   2708  C CD    . GLU A 1 341 ? 35.906  62.043 38.849  1.00 28.94  ? 341 GLU A CD    1 
ATOM   2709  O OE1   . GLU A 1 341 ? 35.161  62.919 38.398  1.00 30.99  ? 341 GLU A OE1   1 
ATOM   2710  O OE2   . GLU A 1 341 ? 35.633  60.830 38.815  1.00 25.44  ? 341 GLU A OE2   1 
ATOM   2711  N N     . ALA A 1 342 ? 38.531  66.493 41.542  1.00 20.73  ? 342 ALA A N     1 
ATOM   2712  C CA    . ALA A 1 342 ? 38.907  67.899 41.577  1.00 22.01  ? 342 ALA A CA    1 
ATOM   2713  C C     . ALA A 1 342 ? 40.209  68.144 42.366  1.00 22.35  ? 342 ALA A C     1 
ATOM   2714  O O     . ALA A 1 342 ? 40.549  69.284 42.670  1.00 23.39  ? 342 ALA A O     1 
ATOM   2715  C CB    . ALA A 1 342 ? 37.767  68.702 42.199  1.00 27.07  ? 342 ALA A CB    1 
ATOM   2716  N N     . GLY A 1 343 ? 40.924  67.098 42.749  1.00 22.71  ? 343 GLY A N     1 
ATOM   2717  C CA    . GLY A 1 343 ? 42.146  67.369 43.529  1.00 29.72  ? 343 GLY A CA    1 
ATOM   2718  C C     . GLY A 1 343 ? 41.949  67.584 45.015  1.00 33.22  ? 343 GLY A C     1 
ATOM   2719  O O     . GLY A 1 343 ? 42.883  68.071 45.674  1.00 31.27  ? 343 GLY A O     1 
ATOM   2720  N N     . ILE A 1 344 ? 40.800  67.250 45.605  1.00 29.56  ? 344 ILE A N     1 
ATOM   2721  C CA    . ILE A 1 344 ? 40.649  67.335 47.073  1.00 25.22  ? 344 ILE A CA    1 
ATOM   2722  C C     . ILE A 1 344 ? 41.089  66.014 47.658  1.00 24.26  ? 344 ILE A C     1 
ATOM   2723  O O     . ILE A 1 344 ? 40.634  64.947 47.217  1.00 26.26  ? 344 ILE A O     1 
ATOM   2724  C CB    . ILE A 1 344 ? 39.197  67.657 47.441  1.00 31.92  ? 344 ILE A CB    1 
ATOM   2725  C CG1   . ILE A 1 344 ? 38.875  69.090 46.980  1.00 27.15  ? 344 ILE A CG1   1 
ATOM   2726  C CG2   . ILE A 1 344 ? 38.882  67.533 48.923  1.00 28.23  ? 344 ILE A CG2   1 
ATOM   2727  C CD1   . ILE A 1 344 ? 39.736  70.113 47.699  1.00 28.51  ? 344 ILE A CD1   1 
ATOM   2728  N N     . PRO A 1 345 ? 41.994  66.000 48.641  1.00 23.22  ? 345 PRO A N     1 
ATOM   2729  C CA    . PRO A 1 345 ? 42.458  64.754 49.213  1.00 23.03  ? 345 PRO A CA    1 
ATOM   2730  C C     . PRO A 1 345 ? 41.453  64.151 50.179  1.00 20.17  ? 345 PRO A C     1 
ATOM   2731  O O     . PRO A 1 345 ? 41.000  64.770 51.133  1.00 20.56  ? 345 PRO A O     1 
ATOM   2732  C CB    . PRO A 1 345 ? 43.783  65.104 49.871  1.00 23.81  ? 345 PRO A CB    1 
ATOM   2733  C CG    . PRO A 1 345 ? 43.678  66.567 50.141  1.00 25.56  ? 345 PRO A CG    1 
ATOM   2734  C CD    . PRO A 1 345 ? 42.660  67.175 49.212  1.00 23.98  ? 345 PRO A CD    1 
ATOM   2735  N N     . ILE A 1 346 ? 41.124  62.880 50.020  1.00 19.58  ? 346 ILE A N     1 
ATOM   2736  C CA    . ILE A 1 346 ? 40.155  62.200 50.828  1.00 22.76  ? 346 ILE A CA    1 
ATOM   2737  C C     . ILE A 1 346 ? 40.716  60.849 51.220  1.00 26.11  ? 346 ILE A C     1 
ATOM   2738  O O     . ILE A 1 346 ? 41.647  60.387 50.541  1.00 25.64  ? 346 ILE A O     1 
ATOM   2739  C CB    . ILE A 1 346 ? 38.835  61.910 50.027  1.00 19.80  ? 346 ILE A CB    1 
ATOM   2740  C CG1   . ILE A 1 346 ? 39.125  61.031 48.809  1.00 20.94  ? 346 ILE A CG1   1 
ATOM   2741  C CG2   . ILE A 1 346 ? 38.132  63.173 49.580  1.00 19.64  ? 346 ILE A CG2   1 
ATOM   2742  C CD1   . ILE A 1 346 ? 37.921  60.373 48.167  1.00 25.47  ? 346 ILE A CD1   1 
ATOM   2743  N N     . GLN A 1 347 ? 40.092  60.211 52.201  1.00 22.43  ? 347 GLN A N     1 
ATOM   2744  C CA    . GLN A 1 347 ? 40.493  58.851 52.529  1.00 22.73  ? 347 GLN A CA    1 
ATOM   2745  C C     . GLN A 1 347 ? 39.974  58.064 51.331  1.00 24.27  ? 347 GLN A C     1 
ATOM   2746  O O     . GLN A 1 347 ? 38.821  58.288 50.919  1.00 24.50  ? 347 GLN A O     1 
ATOM   2747  C CB    . GLN A 1 347 ? 39.946  58.379 53.871  1.00 22.21  ? 347 GLN A CB    1 
ATOM   2748  C CG    . GLN A 1 347 ? 39.863  56.879 54.082  1.00 30.47  ? 347 GLN A CG    1 
ATOM   2749  C CD    . GLN A 1 347 ? 41.074  56.141 54.586  1.00 47.69  ? 347 GLN A CD    1 
ATOM   2750  O OE1   . GLN A 1 347 ? 42.080  55.971 53.892  1.00 50.35  ? 347 GLN A OE1   1 
ATOM   2751  N NE2   . GLN A 1 347 ? 41.057  55.600 55.823  1.00 41.44  ? 347 GLN A NE2   1 
ATOM   2752  N N     . TYR A 1 348 ? 40.758  57.175 50.742  1.00 21.87  ? 348 TYR A N     1 
ATOM   2753  C CA    . TYR A 1 348 ? 40.360  56.472 49.532  1.00 20.31  ? 348 TYR A CA    1 
ATOM   2754  C C     . TYR A 1 348 ? 40.719  55.024 49.640  1.00 19.92  ? 348 TYR A C     1 
ATOM   2755  O O     . TYR A 1 348 ? 41.811  54.684 50.100  1.00 30.82  ? 348 TYR A O     1 
ATOM   2756  C CB    . TYR A 1 348 ? 41.127  57.150 48.351  1.00 23.58  ? 348 TYR A CB    1 
ATOM   2757  C CG    . TYR A 1 348 ? 40.698  56.584 47.013  1.00 26.95  ? 348 TYR A CG    1 
ATOM   2758  C CD1   . TYR A 1 348 ? 39.512  56.987 46.404  1.00 28.99  ? 348 TYR A CD1   1 
ATOM   2759  C CD2   . TYR A 1 348 ? 41.472  55.645 46.366  1.00 32.48  ? 348 TYR A CD2   1 
ATOM   2760  C CE1   . TYR A 1 348 ? 39.106  56.445 45.202  1.00 30.29  ? 348 TYR A CE1   1 
ATOM   2761  C CE2   . TYR A 1 348 ? 41.111  55.117 45.135  1.00 33.36  ? 348 TYR A CE2   1 
ATOM   2762  C CZ    . TYR A 1 348 ? 39.918  55.518 44.575  1.00 33.69  ? 348 TYR A CZ    1 
ATOM   2763  O OH    . TYR A 1 348 ? 39.549  54.976 43.366  1.00 37.15  ? 348 TYR A OH    1 
ATOM   2764  N N     . PRO A 1 349 ? 39.832  54.112 49.289  1.00 21.28  ? 349 PRO A N     1 
ATOM   2765  C CA    . PRO A 1 349 ? 38.497  54.413 48.798  1.00 20.98  ? 349 PRO A CA    1 
ATOM   2766  C C     . PRO A 1 349 ? 37.524  54.878 49.871  1.00 24.26  ? 349 PRO A C     1 
ATOM   2767  O O     . PRO A 1 349 ? 37.862  54.786 51.067  1.00 19.19  ? 349 PRO A O     1 
ATOM   2768  C CB    . PRO A 1 349 ? 37.966  53.052 48.346  1.00 20.46  ? 349 PRO A CB    1 
ATOM   2769  C CG    . PRO A 1 349 ? 38.681  52.059 49.199  1.00 21.23  ? 349 PRO A CG    1 
ATOM   2770  C CD    . PRO A 1 349 ? 40.021  52.654 49.468  1.00 17.40  ? 349 PRO A CD    1 
ATOM   2771  N N     . THR A 1 350 ? 36.377  55.394 49.434  1.00 19.12  ? 350 THR A N     1 
ATOM   2772  C CA    . THR A 1 350 ? 35.404  55.943 50.375  1.00 17.09  ? 350 THR A CA    1 
ATOM   2773  C C     . THR A 1 350 ? 34.743  54.808 51.160  1.00 12.63  ? 350 THR A C     1 
ATOM   2774  O O     . THR A 1 350 ? 34.591  53.714 50.622  1.00 11.96  ? 350 THR A O     1 
ATOM   2775  C CB    . THR A 1 350 ? 34.265  56.744 49.678  1.00 20.96  ? 350 THR A CB    1 
ATOM   2776  O OG1   . THR A 1 350 ? 33.737  56.000 48.558  1.00 15.87  ? 350 THR A OG1   1 
ATOM   2777  C CG2   . THR A 1 350 ? 34.805  58.075 49.225  1.00 16.89  ? 350 THR A CG2   1 
ATOM   2778  N N     . GLY A 1 351 ? 34.372  55.141 52.403  1.00 14.90  ? 351 GLY A N     1 
ATOM   2779  C CA    . GLY A 1 351 ? 33.723  54.060 53.178  1.00 18.16  ? 351 GLY A CA    1 
ATOM   2780  C C     . GLY A 1 351 ? 32.220  54.031 52.877  1.00 19.95  ? 351 GLY A C     1 
ATOM   2781  O O     . GLY A 1 351 ? 31.754  54.534 51.849  1.00 16.01  ? 351 GLY A O     1 
ATOM   2782  N N     . GLY A 1 352 ? 31.465  53.369 53.741  1.00 15.09  ? 352 GLY A N     1 
ATOM   2783  C CA    . GLY A 1 352 ? 30.043  53.184 53.532  1.00 12.87  ? 352 GLY A CA    1 
ATOM   2784  C C     . GLY A 1 352 ? 29.175  54.391 53.763  1.00 12.32  ? 352 GLY A C     1 
ATOM   2785  O O     . GLY A 1 352 ? 28.105  54.481 53.159  1.00 13.95  ? 352 GLY A O     1 
ATOM   2786  N N     . HIS A 1 353 ? 29.564  55.322 54.644  1.00 10.23  ? 353 HIS A N     1 
ATOM   2787  C CA    . HIS A 1 353 ? 28.580  56.307 55.067  1.00 14.20  ? 353 HIS A CA    1 
ATOM   2788  C C     . HIS A 1 353 ? 29.056  57.711 55.102  1.00 13.27  ? 353 HIS A C     1 
ATOM   2789  O O     . HIS A 1 353 ? 28.289  58.555 55.527  1.00 12.77  ? 353 HIS A O     1 
ATOM   2790  C CB    . HIS A 1 353 ? 28.124  55.922 56.524  1.00 13.74  ? 353 HIS A CB    1 
ATOM   2791  C CG    . HIS A 1 353 ? 29.242  56.136 57.499  1.00 7.93   ? 353 HIS A CG    1 
ATOM   2792  N ND1   . HIS A 1 353 ? 30.381  55.337 57.502  1.00 11.56  ? 353 HIS A ND1   1 
ATOM   2793  C CD2   . HIS A 1 353 ? 29.398  57.056 58.496  1.00 15.52  ? 353 HIS A CD2   1 
ATOM   2794  C CE1   . HIS A 1 353 ? 31.181  55.763 58.486  1.00 14.07  ? 353 HIS A CE1   1 
ATOM   2795  N NE2   . HIS A 1 353 ? 30.600  56.791 59.105  1.00 13.06  ? 353 HIS A NE2   1 
ATOM   2796  N N     . ALA A 1 354 ? 30.308  57.897 54.702  1.00 14.71  ? 354 ALA A N     1 
ATOM   2797  C CA    . ALA A 1 354 ? 30.830  59.252 54.806  1.00 13.79  ? 354 ALA A CA    1 
ATOM   2798  C C     . ALA A 1 354 ? 32.096  59.413 53.948  1.00 17.08  ? 354 ALA A C     1 
ATOM   2799  O O     . ALA A 1 354 ? 32.743  58.428 53.674  1.00 12.39  ? 354 ALA A O     1 
ATOM   2800  C CB    . ALA A 1 354 ? 31.259  59.421 56.262  1.00 8.52   ? 354 ALA A CB    1 
ATOM   2801  N N     . VAL A 1 355 ? 32.428  60.655 53.690  1.00 16.47  ? 355 VAL A N     1 
ATOM   2802  C CA    . VAL A 1 355 ? 33.648  60.994 52.985  1.00 19.17  ? 355 VAL A CA    1 
ATOM   2803  C C     . VAL A 1 355 ? 34.519  61.759 54.001  1.00 17.41  ? 355 VAL A C     1 
ATOM   2804  O O     . VAL A 1 355 ? 34.030  62.670 54.647  1.00 15.65  ? 355 VAL A O     1 
ATOM   2805  C CB    . VAL A 1 355 ? 33.364  61.860 51.749  1.00 20.40  ? 355 VAL A CB    1 
ATOM   2806  C CG1   . VAL A 1 355 ? 34.655  62.373 51.125  1.00 21.04  ? 355 VAL A CG1   1 
ATOM   2807  C CG2   . VAL A 1 355 ? 32.616  61.046 50.676  1.00 14.81  ? 355 VAL A CG2   1 
ATOM   2808  N N     . PHE A 1 356 ? 35.778  61.320 54.129  1.00 15.84  ? 356 PHE A N     1 
ATOM   2809  C CA    . PHE A 1 356 ? 36.690  62.071 55.041  1.00 17.75  ? 356 PHE A CA    1 
ATOM   2810  C C     . PHE A 1 356 ? 37.652  62.879 54.214  1.00 17.78  ? 356 PHE A C     1 
ATOM   2811  O O     . PHE A 1 356 ? 38.303  62.242 53.377  1.00 21.70  ? 356 PHE A O     1 
ATOM   2812  C CB    . PHE A 1 356 ? 37.454  61.021 55.871  1.00 20.99  ? 356 PHE A CB    1 
ATOM   2813  C CG    . PHE A 1 356 ? 36.577  60.353 56.895  1.00 26.12  ? 356 PHE A CG    1 
ATOM   2814  C CD1   . PHE A 1 356 ? 35.622  59.424 56.569  1.00 26.56  ? 356 PHE A CD1   1 
ATOM   2815  C CD2   . PHE A 1 356 ? 36.752  60.675 58.244  1.00 34.59  ? 356 PHE A CD2   1 
ATOM   2816  C CE1   . PHE A 1 356 ? 34.826  58.832 57.529  1.00 36.41  ? 356 PHE A CE1   1 
ATOM   2817  C CE2   . PHE A 1 356 ? 35.986  60.053 59.202  1.00 28.13  ? 356 PHE A CE2   1 
ATOM   2818  C CZ    . PHE A 1 356 ? 35.041  59.123 58.851  1.00 23.81  ? 356 PHE A CZ    1 
ATOM   2819  N N     . VAL A 1 357 ? 37.752  64.157 54.338  1.00 15.93  ? 357 VAL A N     1 
ATOM   2820  C CA    . VAL A 1 357 ? 38.604  65.078 53.644  1.00 25.75  ? 357 VAL A CA    1 
ATOM   2821  C C     . VAL A 1 357 ? 39.770  65.494 54.552  1.00 33.31  ? 357 VAL A C     1 
ATOM   2822  O O     . VAL A 1 357 ? 39.636  65.452 55.793  1.00 30.64  ? 357 VAL A O     1 
ATOM   2823  C CB    . VAL A 1 357 ? 37.760  66.303 53.265  1.00 28.21  ? 357 VAL A CB    1 
ATOM   2824  C CG1   . VAL A 1 357 ? 38.574  67.440 52.688  1.00 26.32  ? 357 VAL A CG1   1 
ATOM   2825  C CG2   . VAL A 1 357 ? 36.661  65.857 52.261  1.00 23.41  ? 357 VAL A CG2   1 
ATOM   2826  N N     . ASP A 1 358 ? 40.902  65.837 53.954  1.00 33.67  ? 358 ASP A N     1 
ATOM   2827  C CA    . ASP A 1 358 ? 42.132  66.219 54.682  1.00 32.80  ? 358 ASP A CA    1 
ATOM   2828  C C     . ASP A 1 358 ? 42.304  67.732 54.601  1.00 32.56  ? 358 ASP A C     1 
ATOM   2829  O O     . ASP A 1 358 ? 42.657  68.283 53.551  1.00 35.30  ? 358 ASP A O     1 
ATOM   2830  C CB    . ASP A 1 358 ? 43.346  65.583 54.034  1.00 39.68  ? 358 ASP A CB    1 
ATOM   2831  C CG    . ASP A 1 358 ? 44.513  65.419 54.991  1.00 52.61  ? 358 ASP A CG    1 
ATOM   2832  O OD1   . ASP A 1 358 ? 44.810  66.421 55.689  1.00 55.96  ? 358 ASP A OD1   1 
ATOM   2833  O OD2   . ASP A 1 358 ? 45.083  64.300 55.046  1.00 49.44  ? 358 ASP A OD2   1 
ATOM   2834  N N     . CYS A 1 359 ? 42.033  68.433 55.707  1.00 33.74  ? 359 CYS A N     1 
ATOM   2835  C CA    . CYS A 1 359 ? 42.129  69.892 55.685  1.00 37.88  ? 359 CYS A CA    1 
ATOM   2836  C C     . CYS A 1 359 ? 43.542  70.345 56.024  1.00 40.77  ? 359 CYS A C     1 
ATOM   2837  O O     . CYS A 1 359 ? 43.823  71.552 55.968  1.00 43.26  ? 359 CYS A O     1 
ATOM   2838  C CB    . CYS A 1 359 ? 41.117  70.504 56.661  1.00 41.20  ? 359 CYS A CB    1 
ATOM   2839  S SG    . CYS A 1 359 ? 39.415  69.951 56.285  1.00 45.61  ? 359 CYS A SG    1 
ATOM   2840  N N     . LYS A 1 360 ? 44.400  69.382 56.357  1.00 39.72  ? 360 LYS A N     1 
ATOM   2841  C CA    . LYS A 1 360 ? 45.770  69.766 56.679  1.00 51.87  ? 360 LYS A CA    1 
ATOM   2842  C C     . LYS A 1 360 ? 46.466  70.233 55.398  1.00 53.32  ? 360 LYS A C     1 
ATOM   2843  O O     . LYS A 1 360 ? 47.263  71.176 55.449  1.00 54.30  ? 360 LYS A O     1 
ATOM   2844  C CB    . LYS A 1 360 ? 46.585  68.667 57.366  1.00 56.98  ? 360 LYS A CB    1 
ATOM   2845  C CG    . LYS A 1 360 ? 47.569  69.270 58.374  1.00 66.33  ? 360 LYS A CG    1 
ATOM   2846  C CD    . LYS A 1 360 ? 47.640  68.467 59.657  1.00 71.39  ? 360 LYS A CD    1 
ATOM   2847  C CE    . LYS A 1 360 ? 49.039  68.458 60.258  1.00 76.62  ? 360 LYS A CE    1 
ATOM   2848  N NZ    . LYS A 1 360 ? 49.224  67.331 61.219  1.00 79.13  ? 360 LYS A NZ    1 
ATOM   2849  N N     . LYS A 1 361 ? 46.092  69.575 54.291  1.00 52.97  ? 361 LYS A N     1 
ATOM   2850  C CA    . LYS A 1 361 ? 46.700  69.877 53.006  1.00 51.21  ? 361 LYS A CA    1 
ATOM   2851  C C     . LYS A 1 361 ? 45.978  71.011 52.300  1.00 51.39  ? 361 LYS A C     1 
ATOM   2852  O O     . LYS A 1 361 ? 46.513  71.550 51.324  1.00 54.57  ? 361 LYS A O     1 
ATOM   2853  C CB    . LYS A 1 361 ? 46.766  68.633 52.124  1.00 45.46  ? 361 LYS A CB    1 
ATOM   2854  C CG    . LYS A 1 361 ? 46.941  67.338 52.899  1.00 53.20  ? 361 LYS A CG    1 
ATOM   2855  C CD    . LYS A 1 361 ? 46.586  66.120 52.072  1.00 58.38  ? 361 LYS A CD    1 
ATOM   2856  C CE    . LYS A 1 361 ? 47.729  65.120 51.981  1.00 65.35  ? 361 LYS A CE    1 
ATOM   2857  N NZ    . LYS A 1 361 ? 47.225  63.714 52.042  1.00 71.51  ? 361 LYS A NZ    1 
ATOM   2858  N N     . LEU A 1 362 ? 44.796  71.380 52.775  1.00 48.36  ? 362 LEU A N     1 
ATOM   2859  C CA    . LEU A 1 362 ? 44.062  72.441 52.080  1.00 48.47  ? 362 LEU A CA    1 
ATOM   2860  C C     . LEU A 1 362 ? 44.424  73.811 52.620  1.00 47.89  ? 362 LEU A C     1 
ATOM   2861  O O     . LEU A 1 362 ? 44.279  74.831 51.944  1.00 46.81  ? 362 LEU A O     1 
ATOM   2862  C CB    . LEU A 1 362 ? 42.545  72.237 52.139  1.00 45.84  ? 362 LEU A CB    1 
ATOM   2863  C CG    . LEU A 1 362 ? 42.049  70.783 52.191  1.00 47.48  ? 362 LEU A CG    1 
ATOM   2864  C CD1   . LEU A 1 362 ? 40.528  70.754 52.188  1.00 38.93  ? 362 LEU A CD1   1 
ATOM   2865  C CD2   . LEU A 1 362 ? 42.619  69.940 51.064  1.00 42.49  ? 362 LEU A CD2   1 
ATOM   2866  N N     . VAL A 1 363 ? 44.852  73.849 53.881  1.00 48.60  ? 363 VAL A N     1 
ATOM   2867  C CA    . VAL A 1 363 ? 45.240  75.096 54.536  1.00 50.27  ? 363 VAL A CA    1 
ATOM   2868  C C     . VAL A 1 363 ? 46.454  74.885 55.437  1.00 52.94  ? 363 VAL A C     1 
ATOM   2869  O O     . VAL A 1 363 ? 46.410  75.098 56.659  1.00 50.57  ? 363 VAL A O     1 
ATOM   2870  C CB    . VAL A 1 363 ? 44.070  75.645 55.378  1.00 49.76  ? 363 VAL A CB    1 
ATOM   2871  C CG1   . VAL A 1 363 ? 43.135  76.492 54.536  1.00 48.57  ? 363 VAL A CG1   1 
ATOM   2872  C CG2   . VAL A 1 363 ? 43.335  74.491 56.063  1.00 39.53  ? 363 VAL A CG2   1 
ATOM   2873  N N     . PRO A 1 364 ? 47.615  74.605 54.846  1.00 53.93  ? 364 PRO A N     1 
ATOM   2874  C CA    . PRO A 1 364 ? 48.853  74.340 55.557  1.00 54.54  ? 364 PRO A CA    1 
ATOM   2875  C C     . PRO A 1 364 ? 49.312  75.432 56.503  1.00 52.86  ? 364 PRO A C     1 
ATOM   2876  O O     . PRO A 1 364 ? 49.991  75.170 57.496  1.00 53.36  ? 364 PRO A O     1 
ATOM   2877  C CB    . PRO A 1 364 ? 49.900  74.058 54.489  1.00 55.61  ? 364 PRO A CB    1 
ATOM   2878  C CG    . PRO A 1 364 ? 49.232  74.115 53.167  1.00 56.05  ? 364 PRO A CG    1 
ATOM   2879  C CD    . PRO A 1 364 ? 47.777  74.391 53.384  1.00 55.32  ? 364 PRO A CD    1 
ATOM   2880  N N     . GLN A 1 365 ? 48.852  76.648 56.290  1.00 53.17  ? 365 GLN A N     1 
ATOM   2881  C CA    . GLN A 1 365 ? 49.084  77.833 57.071  1.00 55.07  ? 365 GLN A CA    1 
ATOM   2882  C C     . GLN A 1 365 ? 48.306  77.923 58.378  1.00 57.53  ? 365 GLN A C     1 
ATOM   2883  O O     . GLN A 1 365 ? 48.290  78.991 59.013  1.00 59.33  ? 365 GLN A O     1 
ATOM   2884  C CB    . GLN A 1 365 ? 48.792  79.044 56.165  1.00 57.06  ? 365 GLN A CB    1 
ATOM   2885  C CG    . GLN A 1 365 ? 47.381  79.575 56.149  1.00 61.04  ? 365 GLN A CG    1 
ATOM   2886  C CD    . GLN A 1 365 ? 46.460  78.964 55.110  1.00 58.57  ? 365 GLN A CD    1 
ATOM   2887  O OE1   . GLN A 1 365 ? 46.796  77.982 54.447  1.00 57.93  ? 365 GLN A OE1   1 
ATOM   2888  N NE2   . GLN A 1 365 ? 45.286  79.572 54.977  1.00 55.67  ? 365 GLN A NE2   1 
ATOM   2889  N N     . ILE A 1 366 ? 47.652  76.857 58.823  1.00 56.14  ? 366 ILE A N     1 
ATOM   2890  C CA    . ILE A 1 366 ? 46.952  76.760 60.087  1.00 53.56  ? 366 ILE A CA    1 
ATOM   2891  C C     . ILE A 1 366 ? 47.469  75.540 60.868  1.00 53.86  ? 366 ILE A C     1 
ATOM   2892  O O     . ILE A 1 366 ? 47.237  74.376 60.534  1.00 52.65  ? 366 ILE A O     1 
ATOM   2893  C CB    . ILE A 1 366 ? 45.418  76.700 60.008  1.00 52.13  ? 366 ILE A CB    1 
ATOM   2894  C CG1   . ILE A 1 366 ? 44.823  78.086 59.742  1.00 46.63  ? 366 ILE A CG1   1 
ATOM   2895  C CG2   . ILE A 1 366 ? 44.792  76.199 61.313  1.00 54.66  ? 366 ILE A CG2   1 
ATOM   2896  C CD1   . ILE A 1 366 ? 44.306  78.329 58.344  1.00 50.83  ? 366 ILE A CD1   1 
ATOM   2897  N N     . PRO A 1 367 ? 48.194  75.820 61.952  1.00 54.21  ? 367 PRO A N     1 
ATOM   2898  C CA    . PRO A 1 367 ? 48.709  74.778 62.826  1.00 54.72  ? 367 PRO A CA    1 
ATOM   2899  C C     . PRO A 1 367 ? 47.561  73.962 63.413  1.00 55.63  ? 367 PRO A C     1 
ATOM   2900  O O     . PRO A 1 367 ? 46.427  74.464 63.448  1.00 55.75  ? 367 PRO A O     1 
ATOM   2901  C CB    . PRO A 1 367 ? 49.440  75.516 63.935  1.00 54.75  ? 367 PRO A CB    1 
ATOM   2902  C CG    . PRO A 1 367 ? 49.194  76.967 63.748  1.00 54.53  ? 367 PRO A CG    1 
ATOM   2903  C CD    . PRO A 1 367 ? 48.507  77.186 62.434  1.00 54.04  ? 367 PRO A CD    1 
ATOM   2904  N N     . GLY A 1 368 ? 47.833  72.763 63.921  1.00 54.78  ? 368 GLY A N     1 
ATOM   2905  C CA    . GLY A 1 368 ? 46.785  71.948 64.535  1.00 55.15  ? 368 GLY A CA    1 
ATOM   2906  C C     . GLY A 1 368 ? 46.022  72.664 65.639  1.00 56.76  ? 368 GLY A C     1 
ATOM   2907  O O     . GLY A 1 368 ? 44.781  72.696 65.716  1.00 58.03  ? 368 GLY A O     1 
ATOM   2908  N N     . ASP A 1 369 ? 46.736  73.335 66.536  1.00 55.53  ? 369 ASP A N     1 
ATOM   2909  C CA    . ASP A 1 369 ? 46.173  74.053 67.654  1.00 54.75  ? 369 ASP A CA    1 
ATOM   2910  C C     . ASP A 1 369 ? 45.283  75.216 67.244  1.00 51.69  ? 369 ASP A C     1 
ATOM   2911  O O     . ASP A 1 369 ? 44.529  75.704 68.101  1.00 54.92  ? 369 ASP A O     1 
ATOM   2912  C CB    . ASP A 1 369 ? 47.283  74.546 68.596  1.00 63.13  ? 369 ASP A CB    1 
ATOM   2913  C CG    . ASP A 1 369 ? 48.377  75.313 67.884  1.00 64.27  ? 369 ASP A CG    1 
ATOM   2914  O OD1   . ASP A 1 369 ? 48.087  76.217 67.074  1.00 68.32  ? 369 ASP A OD1   1 
ATOM   2915  O OD2   . ASP A 1 369 ? 49.557  74.992 68.150  1.00 71.69  ? 369 ASP A OD2   1 
ATOM   2916  N N     . GLN A 1 370 ? 45.340  75.704 66.017  1.00 48.00  ? 370 GLN A N     1 
ATOM   2917  C CA    . GLN A 1 370 ? 44.440  76.771 65.593  1.00 45.84  ? 370 GLN A CA    1 
ATOM   2918  C C     . GLN A 1 370 ? 43.272  76.238 64.756  1.00 42.82  ? 370 GLN A C     1 
ATOM   2919  O O     . GLN A 1 370 ? 42.459  77.010 64.257  1.00 39.94  ? 370 GLN A O     1 
ATOM   2920  C CB    . GLN A 1 370 ? 45.164  77.869 64.833  1.00 55.00  ? 370 GLN A CB    1 
ATOM   2921  C CG    . GLN A 1 370 ? 46.412  78.443 65.473  1.00 63.14  ? 370 GLN A CG    1 
ATOM   2922  C CD    . GLN A 1 370 ? 47.047  79.506 64.594  1.00 69.41  ? 370 GLN A CD    1 
ATOM   2923  O OE1   . GLN A 1 370 ? 46.489  79.888 63.558  1.00 69.97  ? 370 GLN A OE1   1 
ATOM   2924  N NE2   . GLN A 1 370 ? 48.214  79.993 65.007  1.00 72.14  ? 370 GLN A NE2   1 
ATOM   2925  N N     . PHE A 1 371 ? 43.106  74.941 64.650  1.00 38.71  ? 371 PHE A N     1 
ATOM   2926  C CA    . PHE A 1 371 ? 42.018  74.216 64.031  1.00 45.07  ? 371 PHE A CA    1 
ATOM   2927  C C     . PHE A 1 371 ? 41.800  74.308 62.534  1.00 42.76  ? 371 PHE A C     1 
ATOM   2928  O O     . PHE A 1 371 ? 40.817  74.810 61.980  1.00 43.12  ? 371 PHE A O     1 
ATOM   2929  C CB    . PHE A 1 371 ? 40.705  74.487 64.836  1.00 43.77  ? 371 PHE A CB    1 
ATOM   2930  C CG    . PHE A 1 371 ? 40.937  74.281 66.321  1.00 46.55  ? 371 PHE A CG    1 
ATOM   2931  C CD1   . PHE A 1 371 ? 41.436  73.091 66.812  1.00 48.59  ? 371 PHE A CD1   1 
ATOM   2932  C CD2   . PHE A 1 371 ? 40.707  75.316 67.214  1.00 47.85  ? 371 PHE A CD2   1 
ATOM   2933  C CE1   . PHE A 1 371 ? 41.679  72.911 68.160  1.00 47.53  ? 371 PHE A CE1   1 
ATOM   2934  C CE2   . PHE A 1 371 ? 40.952  75.155 68.567  1.00 52.71  ? 371 PHE A CE2   1 
ATOM   2935  C CZ    . PHE A 1 371 ? 41.446  73.952 69.039  1.00 49.61  ? 371 PHE A CZ    1 
ATOM   2936  N N     . PRO A 1 372 ? 42.739  73.744 61.766  1.00 42.86  ? 372 PRO A N     1 
ATOM   2937  C CA    . PRO A 1 372 ? 42.676  73.641 60.315  1.00 40.78  ? 372 PRO A CA    1 
ATOM   2938  C C     . PRO A 1 372 ? 41.389  73.026 59.764  1.00 36.93  ? 372 PRO A C     1 
ATOM   2939  O O     . PRO A 1 372 ? 40.800  73.680 58.883  1.00 40.58  ? 372 PRO A O     1 
ATOM   2940  C CB    . PRO A 1 372 ? 43.878  72.769 59.938  1.00 40.02  ? 372 PRO A CB    1 
ATOM   2941  C CG    . PRO A 1 372 ? 44.107  71.961 61.181  1.00 39.42  ? 372 PRO A CG    1 
ATOM   2942  C CD    . PRO A 1 372 ? 43.946  73.021 62.276  1.00 41.62  ? 372 PRO A CD    1 
ATOM   2943  N N     . ALA A 1 373 ? 40.964  71.834 60.174  1.00 28.99  ? 373 ALA A N     1 
ATOM   2944  C CA    . ALA A 1 373 ? 39.680  71.311 59.679  1.00 34.44  ? 373 ALA A CA    1 
ATOM   2945  C C     . ALA A 1 373 ? 38.478  72.184 60.034  1.00 34.96  ? 373 ALA A C     1 
ATOM   2946  O O     . ALA A 1 373 ? 37.661  72.526 59.152  1.00 35.85  ? 373 ALA A O     1 
ATOM   2947  C CB    . ALA A 1 373 ? 39.386  69.890 60.134  1.00 22.36  ? 373 ALA A CB    1 
ATOM   2948  N N     . GLN A 1 374 ? 38.393  72.686 61.275  1.00 35.44  ? 374 GLN A N     1 
ATOM   2949  C CA    . GLN A 1 374 ? 37.258  73.523 61.677  1.00 29.94  ? 374 GLN A CA    1 
ATOM   2950  C C     . GLN A 1 374 ? 37.189  74.815 60.890  1.00 36.34  ? 374 GLN A C     1 
ATOM   2951  O O     . GLN A 1 374 ? 36.067  75.356 60.743  1.00 37.91  ? 374 GLN A O     1 
ATOM   2952  C CB    . GLN A 1 374 ? 37.302  73.796 63.165  1.00 35.85  ? 374 GLN A CB    1 
ATOM   2953  C CG    . GLN A 1 374 ? 36.067  74.247 63.907  1.00 36.27  ? 374 GLN A CG    1 
ATOM   2954  C CD    . GLN A 1 374 ? 34.835  73.372 63.678  1.00 35.35  ? 374 GLN A CD    1 
ATOM   2955  O OE1   . GLN A 1 374 ? 33.874  73.934 63.120  1.00 26.66  ? 374 GLN A OE1   1 
ATOM   2956  N NE2   . GLN A 1 374 ? 34.883  72.111 64.087  1.00 21.76  ? 374 GLN A NE2   1 
ATOM   2957  N N     . ALA A 1 375 ? 38.318  75.283 60.321  1.00 33.46  ? 375 ALA A N     1 
ATOM   2958  C CA    . ALA A 1 375 ? 38.222  76.524 59.535  1.00 32.36  ? 375 ALA A CA    1 
ATOM   2959  C C     . ALA A 1 375 ? 37.722  76.153 58.147  1.00 26.16  ? 375 ALA A C     1 
ATOM   2960  O O     . ALA A 1 375 ? 37.059  76.959 57.466  1.00 33.28  ? 375 ALA A O     1 
ATOM   2961  C CB    . ALA A 1 375 ? 39.513  77.330 59.523  1.00 35.79  ? 375 ALA A CB    1 
ATOM   2962  N N     . VAL A 1 376 ? 37.963  74.911 57.734  1.00 29.30  ? 376 VAL A N     1 
ATOM   2963  C CA    . VAL A 1 376 ? 37.376  74.532 56.426  1.00 31.14  ? 376 VAL A CA    1 
ATOM   2964  C C     . VAL A 1 376 ? 35.865  74.404 56.656  1.00 26.64  ? 376 VAL A C     1 
ATOM   2965  O O     . VAL A 1 376 ? 35.019  75.169 56.119  1.00 29.51  ? 376 VAL A O     1 
ATOM   2966  C CB    . VAL A 1 376 ? 38.041  73.271 55.890  1.00 37.67  ? 376 VAL A CB    1 
ATOM   2967  C CG1   . VAL A 1 376 ? 37.526  73.021 54.468  1.00 31.00  ? 376 VAL A CG1   1 
ATOM   2968  C CG2   . VAL A 1 376 ? 39.556  73.415 55.927  1.00 38.66  ? 376 VAL A CG2   1 
ATOM   2969  N N     . ILE A 1 377 ? 35.523  73.573 57.620  1.00 24.95  ? 377 ILE A N     1 
ATOM   2970  C CA    . ILE A 1 377 ? 34.066  73.465 57.988  1.00 25.19  ? 377 ILE A CA    1 
ATOM   2971  C C     . ILE A 1 377 ? 33.285  74.741 58.102  1.00 26.00  ? 377 ILE A C     1 
ATOM   2972  O O     . ILE A 1 377 ? 32.241  74.972 57.450  1.00 26.37  ? 377 ILE A O     1 
ATOM   2973  C CB    . ILE A 1 377 ? 33.973  72.765 59.347  1.00 27.08  ? 377 ILE A CB    1 
ATOM   2974  C CG1   . ILE A 1 377 ? 34.530  71.366 59.058  1.00 21.44  ? 377 ILE A CG1   1 
ATOM   2975  C CG2   . ILE A 1 377 ? 32.537  72.751 59.866  1.00 31.47  ? 377 ILE A CG2   1 
ATOM   2976  C CD1   . ILE A 1 377 ? 34.693  70.440 60.232  1.00 22.35  ? 377 ILE A CD1   1 
ATOM   2977  N N     . ASN A 1 378 ? 33.825  75.664 58.924  1.00 28.54  ? 378 ASN A N     1 
ATOM   2978  C CA    . ASN A 1 378 ? 33.198  76.958 59.117  1.00 23.00  ? 378 ASN A CA    1 
ATOM   2979  C C     . ASN A 1 378 ? 33.066  77.701 57.796  1.00 30.91  ? 378 ASN A C     1 
ATOM   2980  O O     . ASN A 1 378 ? 31.997  78.331 57.593  1.00 32.08  ? 378 ASN A O     1 
ATOM   2981  C CB    . ASN A 1 378 ? 34.031  77.793 60.085  1.00 34.37  ? 378 ASN A CB    1 
ATOM   2982  C CG    . ASN A 1 378 ? 33.788  77.489 61.557  1.00 37.95  ? 378 ASN A CG    1 
ATOM   2983  O OD1   . ASN A 1 378 ? 33.570  78.465 62.291  1.00 36.89  ? 378 ASN A OD1   1 
ATOM   2984  N ND2   . ASN A 1 378 ? 33.809  76.229 61.974  1.00 33.83  ? 378 ASN A ND2   1 
ATOM   2985  N N     . ALA A 1 379 ? 34.117  77.611 56.938  1.00 30.68  ? 379 ALA A N     1 
ATOM   2986  C CA    . ALA A 1 379 ? 33.975  78.408 55.701  1.00 29.90  ? 379 ALA A CA    1 
ATOM   2987  C C     . ALA A 1 379 ? 33.024  77.649 54.813  1.00 22.54  ? 379 ALA A C     1 
ATOM   2988  O O     . ALA A 1 379 ? 32.214  78.271 54.104  1.00 31.37  ? 379 ALA A O     1 
ATOM   2989  C CB    . ALA A 1 379 ? 35.253  78.746 54.951  1.00 31.26  ? 379 ALA A CB    1 
ATOM   2990  N N     . LEU A 1 380 ? 33.161  76.325 54.888  1.00 27.05  ? 380 LEU A N     1 
ATOM   2991  C CA    . LEU A 1 380 ? 32.178  75.489 54.137  1.00 24.29  ? 380 LEU A CA    1 
ATOM   2992  C C     . LEU A 1 380 ? 30.807  75.949 54.590  1.00 22.78  ? 380 LEU A C     1 
ATOM   2993  O O     . LEU A 1 380 ? 29.977  76.440 53.787  1.00 26.79  ? 380 LEU A O     1 
ATOM   2994  C CB    . LEU A 1 380 ? 32.414  74.001 54.366  1.00 25.43  ? 380 LEU A CB    1 
ATOM   2995  C CG    . LEU A 1 380 ? 31.503  73.027 53.589  1.00 23.72  ? 380 LEU A CG    1 
ATOM   2996  C CD1   . LEU A 1 380 ? 31.595  73.249 52.080  1.00 28.02  ? 380 LEU A CD1   1 
ATOM   2997  C CD2   . LEU A 1 380 ? 31.810  71.584 53.938  1.00 20.26  ? 380 LEU A CD2   1 
ATOM   2998  N N     . TYR A 1 381 ? 30.574  75.938 55.915  1.00 26.08  ? 381 TYR A N     1 
ATOM   2999  C CA    . TYR A 1 381 ? 29.271  76.417 56.408  1.00 21.89  ? 381 TYR A CA    1 
ATOM   3000  C C     . TYR A 1 381 ? 28.978  77.807 55.923  1.00 24.32  ? 381 TYR A C     1 
ATOM   3001  O O     . TYR A 1 381 ? 27.874  78.073 55.423  1.00 29.82  ? 381 TYR A O     1 
ATOM   3002  C CB    . TYR A 1 381 ? 29.164  76.392 57.952  1.00 27.50  ? 381 TYR A CB    1 
ATOM   3003  C CG    . TYR A 1 381 ? 27.842  77.030 58.358  1.00 28.64  ? 381 TYR A CG    1 
ATOM   3004  C CD1   . TYR A 1 381 ? 26.658  76.299 58.243  1.00 29.06  ? 381 TYR A CD1   1 
ATOM   3005  C CD2   . TYR A 1 381 ? 27.767  78.345 58.796  1.00 30.56  ? 381 TYR A CD2   1 
ATOM   3006  C CE1   . TYR A 1 381 ? 25.438  76.870 58.562  1.00 28.84  ? 381 TYR A CE1   1 
ATOM   3007  C CE2   . TYR A 1 381 ? 26.547  78.917 59.124  1.00 33.96  ? 381 TYR A CE2   1 
ATOM   3008  C CZ    . TYR A 1 381 ? 25.385  78.169 59.014  1.00 32.08  ? 381 TYR A CZ    1 
ATOM   3009  O OH    . TYR A 1 381 ? 24.169  78.734 59.336  1.00 30.50  ? 381 TYR A OH    1 
ATOM   3010  N N     . LEU A 1 382 ? 29.912  78.765 56.044  1.00 31.68  ? 382 LEU A N     1 
ATOM   3011  C CA    . LEU A 1 382 ? 29.626  80.150 55.630  1.00 27.42  ? 382 LEU A CA    1 
ATOM   3012  C C     . LEU A 1 382 ? 29.341  80.318 54.159  1.00 30.75  ? 382 LEU A C     1 
ATOM   3013  O O     . LEU A 1 382 ? 28.508  81.185 53.789  1.00 32.84  ? 382 LEU A O     1 
ATOM   3014  C CB    . LEU A 1 382 ? 30.791  81.038 56.038  1.00 39.94  ? 382 LEU A CB    1 
ATOM   3015  C CG    . LEU A 1 382 ? 30.479  82.180 57.002  1.00 42.19  ? 382 LEU A CG    1 
ATOM   3016  C CD1   . LEU A 1 382 ? 31.638  82.420 57.949  1.00 45.82  ? 382 LEU A CD1   1 
ATOM   3017  C CD2   . LEU A 1 382 ? 30.177  83.448 56.200  1.00 44.85  ? 382 LEU A CD2   1 
ATOM   3018  N N     . GLU A 1 383 ? 29.938  79.468 53.309  1.00 29.12  ? 383 GLU A N     1 
ATOM   3019  C CA    . GLU A 1 383 ? 29.666  79.597 51.885  1.00 29.98  ? 383 GLU A CA    1 
ATOM   3020  C C     . GLU A 1 383 ? 28.458  78.812 51.421  1.00 35.02  ? 383 GLU A C     1 
ATOM   3021  O O     . GLU A 1 383 ? 27.887  79.166 50.373  1.00 32.04  ? 383 GLU A O     1 
ATOM   3022  C CB    . GLU A 1 383 ? 30.900  79.090 51.118  1.00 38.48  ? 383 GLU A CB    1 
ATOM   3023  C CG    . GLU A 1 383 ? 31.706  80.155 50.381  1.00 47.57  ? 383 GLU A CG    1 
ATOM   3024  C CD    . GLU A 1 383 ? 32.198  81.321 51.211  1.00 52.44  ? 383 GLU A CD    1 
ATOM   3025  O OE1   . GLU A 1 383 ? 32.966  81.207 52.204  1.00 50.84  ? 383 GLU A OE1   1 
ATOM   3026  O OE2   . GLU A 1 383 ? 31.775  82.442 50.838  1.00 54.72  ? 383 GLU A OE2   1 
ATOM   3027  N N     . SER A 1 384 ? 28.138  77.706 52.128  1.00 32.14  ? 384 SER A N     1 
ATOM   3028  C CA    . SER A 1 384 ? 27.073  76.851 51.586  1.00 30.08  ? 384 SER A CA    1 
ATOM   3029  C C     . SER A 1 384 ? 25.916  76.560 52.530  1.00 28.74  ? 384 SER A C     1 
ATOM   3030  O O     . SER A 1 384 ? 24.836  76.268 52.007  1.00 23.16  ? 384 SER A O     1 
ATOM   3031  C CB    . SER A 1 384 ? 27.767  75.513 51.238  1.00 24.98  ? 384 SER A CB    1 
ATOM   3032  O OG    . SER A 1 384 ? 28.433  75.040 52.417  1.00 30.73  ? 384 SER A OG    1 
ATOM   3033  N N     . GLY A 1 385 ? 26.143  76.563 53.851  1.00 25.52  ? 385 GLY A N     1 
ATOM   3034  C CA    . GLY A 1 385 ? 25.012  76.307 54.752  1.00 25.65  ? 385 GLY A CA    1 
ATOM   3035  C C     . GLY A 1 385 ? 25.014  74.824 55.119  1.00 26.83  ? 385 GLY A C     1 
ATOM   3036  O O     . GLY A 1 385 ? 24.092  74.293 55.729  1.00 28.68  ? 385 GLY A O     1 
ATOM   3037  N N     . VAL A 1 386 ? 26.073  74.148 54.704  1.00 23.14  ? 386 VAL A N     1 
ATOM   3038  C CA    . VAL A 1 386 ? 26.373  72.774 54.941  1.00 20.70  ? 386 VAL A CA    1 
ATOM   3039  C C     . VAL A 1 386 ? 27.122  72.675 56.263  1.00 23.46  ? 386 VAL A C     1 
ATOM   3040  O O     . VAL A 1 386 ? 28.099  73.378 56.490  1.00 26.79  ? 386 VAL A O     1 
ATOM   3041  C CB    . VAL A 1 386 ? 27.229  72.123 53.833  1.00 21.60  ? 386 VAL A CB    1 
ATOM   3042  C CG1   . VAL A 1 386 ? 27.569  70.705 54.229  1.00 13.93  ? 386 VAL A CG1   1 
ATOM   3043  C CG2   . VAL A 1 386 ? 26.487  72.165 52.493  1.00 16.56  ? 386 VAL A CG2   1 
ATOM   3044  N N     . ARG A 1 387 ? 26.653  71.752 57.103  1.00 21.48  ? 387 ARG A N     1 
ATOM   3045  C CA    . ARG A 1 387 ? 27.266  71.525 58.401  1.00 17.64  ? 387 ARG A CA    1 
ATOM   3046  C C     . ARG A 1 387 ? 28.008  70.221 58.445  1.00 16.66  ? 387 ARG A C     1 
ATOM   3047  O O     . ARG A 1 387 ? 27.417  69.149 58.301  1.00 18.74  ? 387 ARG A O     1 
ATOM   3048  C CB    . ARG A 1 387 ? 26.198  71.493 59.525  1.00 17.64  ? 387 ARG A CB    1 
ATOM   3049  C CG    . ARG A 1 387 ? 26.775  70.925 60.826  1.00 20.87  ? 387 ARG A CG    1 
ATOM   3050  C CD    . ARG A 1 387 ? 25.965  71.383 62.049  1.00 21.57  ? 387 ARG A CD    1 
ATOM   3051  N NE    . ARG A 1 387 ? 24.746  70.558 62.199  1.00 17.65  ? 387 ARG A NE    1 
ATOM   3052  C CZ    . ARG A 1 387 ? 23.838  70.866 63.133  1.00 23.14  ? 387 ARG A CZ    1 
ATOM   3053  N NH1   . ARG A 1 387 ? 24.043  71.865 63.989  1.00 19.84  ? 387 ARG A NH1   1 
ATOM   3054  N NH2   . ARG A 1 387 ? 22.722  70.186 63.288  1.00 16.08  ? 387 ARG A NH2   1 
ATOM   3055  N N     . ALA A 1 388 ? 29.318  70.284 58.702  1.00 18.16  ? 388 ALA A N     1 
ATOM   3056  C CA    . ALA A 1 388 ? 30.041  69.016 58.801  1.00 16.61  ? 388 ALA A CA    1 
ATOM   3057  C C     . ALA A 1 388 ? 30.686  68.973 60.187  1.00 19.02  ? 388 ALA A C     1 
ATOM   3058  O O     . ALA A 1 388 ? 30.507  69.924 60.918  1.00 23.84  ? 388 ALA A O     1 
ATOM   3059  C CB    . ALA A 1 388 ? 31.038  68.799 57.687  1.00 19.00  ? 388 ALA A CB    1 
ATOM   3060  N N     . VAL A 1 389 ? 31.336  67.886 60.465  1.00 21.65  ? 389 VAL A N     1 
ATOM   3061  C CA    . VAL A 1 389 ? 31.972  67.636 61.723  1.00 25.98  ? 389 VAL A CA    1 
ATOM   3062  C C     . VAL A 1 389 ? 33.472  67.406 61.524  1.00 32.31  ? 389 VAL A C     1 
ATOM   3063  O O     . VAL A 1 389 ? 33.974  66.675 60.659  1.00 30.21  ? 389 VAL A O     1 
ATOM   3064  C CB    . VAL A 1 389 ? 31.241  66.444 62.360  1.00 19.33  ? 389 VAL A CB    1 
ATOM   3065  C CG1   . VAL A 1 389 ? 31.505  65.128 61.689  1.00 17.02  ? 389 VAL A CG1   1 
ATOM   3066  C CG2   . VAL A 1 389 ? 31.517  66.335 63.862  1.00 22.64  ? 389 VAL A CG2   1 
ATOM   3067  N N     . GLU A 1 390 ? 34.235  68.176 62.310  1.00 32.73  ? 390 GLU A N     1 
ATOM   3068  C CA    . GLU A 1 390 ? 35.675  68.166 62.411  1.00 32.53  ? 390 GLU A CA    1 
ATOM   3069  C C     . GLU A 1 390 ? 36.178  66.954 63.178  1.00 32.80  ? 390 GLU A C     1 
ATOM   3070  O O     . GLU A 1 390 ? 35.756  66.692 64.289  1.00 31.12  ? 390 GLU A O     1 
ATOM   3071  C CB    . GLU A 1 390 ? 36.186  69.357 63.256  1.00 35.14  ? 390 GLU A CB    1 
ATOM   3072  C CG    . GLU A 1 390 ? 37.708  69.432 63.229  1.00 43.17  ? 390 GLU A CG    1 
ATOM   3073  C CD    . GLU A 1 390 ? 38.416  69.016 64.491  1.00 42.98  ? 390 GLU A CD    1 
ATOM   3074  O OE1   . GLU A 1 390 ? 38.140  67.982 65.133  1.00 39.65  ? 390 GLU A OE1   1 
ATOM   3075  O OE2   . GLU A 1 390 ? 39.369  69.733 64.879  1.00 45.39  ? 390 GLU A OE2   1 
ATOM   3076  N N     . ILE A 1 391 ? 37.052  66.151 62.609  1.00 33.82  ? 391 ILE A N     1 
ATOM   3077  C CA    . ILE A 1 391 ? 37.612  64.991 63.288  1.00 36.75  ? 391 ILE A CA    1 
ATOM   3078  C C     . ILE A 1 391 ? 39.127  65.270 63.273  1.00 42.25  ? 391 ILE A C     1 
ATOM   3079  O O     . ILE A 1 391 ? 39.800  64.954 62.287  1.00 39.52  ? 391 ILE A O     1 
ATOM   3080  C CB    . ILE A 1 391 ? 37.207  63.660 62.699  1.00 27.21  ? 391 ILE A CB    1 
ATOM   3081  C CG1   . ILE A 1 391 ? 35.699  63.423 62.709  1.00 39.85  ? 391 ILE A CG1   1 
ATOM   3082  C CG2   . ILE A 1 391 ? 37.848  62.490 63.434  1.00 29.94  ? 391 ILE A CG2   1 
ATOM   3083  C CD1   . ILE A 1 391 ? 35.000  63.764 64.003  1.00 39.95  ? 391 ILE A CD1   1 
ATOM   3084  N N     . GLY A 1 392 ? 39.564  65.992 64.321  1.00 42.48  ? 392 GLY A N     1 
ATOM   3085  C CA    . GLY A 1 392 ? 40.971  66.388 64.347  1.00 44.94  ? 392 GLY A CA    1 
ATOM   3086  C C     . GLY A 1 392 ? 41.433  66.950 65.680  1.00 47.94  ? 392 GLY A C     1 
ATOM   3087  O O     . GLY A 1 392 ? 41.012  66.494 66.742  1.00 47.59  ? 392 GLY A O     1 
ATOM   3088  N N     . SER A 1 393 ? 42.272  67.987 65.633  1.00 47.63  ? 393 SER A N     1 
ATOM   3089  C CA    . SER A 1 393 ? 42.836  68.580 66.847  1.00 50.12  ? 393 SER A CA    1 
ATOM   3090  C C     . SER A 1 393 ? 41.780  69.123 67.796  1.00 48.86  ? 393 SER A C     1 
ATOM   3091  O O     . SER A 1 393 ? 41.872  68.843 69.004  1.00 46.66  ? 393 SER A O     1 
ATOM   3092  C CB    . SER A 1 393 ? 43.893  69.636 66.499  1.00 52.35  ? 393 SER A CB    1 
ATOM   3093  O OG    . SER A 1 393 ? 43.253  70.878 66.252  1.00 57.06  ? 393 SER A OG    1 
ATOM   3094  N N     . PHE A 1 394 ? 40.748  69.786 67.270  1.00 46.36  ? 394 PHE A N     1 
ATOM   3095  C CA    . PHE A 1 394 ? 39.646  70.259 68.114  1.00 43.02  ? 394 PHE A CA    1 
ATOM   3096  C C     . PHE A 1 394 ? 38.928  69.091 68.768  1.00 42.69  ? 394 PHE A C     1 
ATOM   3097  O O     . PHE A 1 394 ? 38.565  69.227 69.952  1.00 45.38  ? 394 PHE A O     1 
ATOM   3098  C CB    . PHE A 1 394 ? 38.683  71.158 67.370  1.00 46.01  ? 394 PHE A CB    1 
ATOM   3099  C CG    . PHE A 1 394 ? 37.671  71.947 68.133  1.00 50.91  ? 394 PHE A CG    1 
ATOM   3100  C CD1   . PHE A 1 394 ? 37.892  72.390 69.427  1.00 51.25  ? 394 PHE A CD1   1 
ATOM   3101  C CD2   . PHE A 1 394 ? 36.450  72.248 67.526  1.00 50.59  ? 394 PHE A CD2   1 
ATOM   3102  C CE1   . PHE A 1 394 ? 36.924  73.119 70.099  1.00 48.57  ? 394 PHE A CE1   1 
ATOM   3103  C CE2   . PHE A 1 394 ? 35.481  72.973 68.196  1.00 50.72  ? 394 PHE A CE2   1 
ATOM   3104  C CZ    . PHE A 1 394 ? 35.726  73.416 69.487  1.00 51.22  ? 394 PHE A CZ    1 
ATOM   3105  N N     . LEU A 1 395 ? 38.785  67.951 68.098  1.00 38.73  ? 395 LEU A N     1 
ATOM   3106  C CA    . LEU A 1 395 ? 38.191  66.798 68.730  1.00 40.23  ? 395 LEU A CA    1 
ATOM   3107  C C     . LEU A 1 395 ? 39.173  66.180 69.734  1.00 43.65  ? 395 LEU A C     1 
ATOM   3108  O O     . LEU A 1 395 ? 38.800  65.768 70.835  1.00 41.71  ? 395 LEU A O     1 
ATOM   3109  C CB    . LEU A 1 395 ? 37.855  65.601 67.815  1.00 36.25  ? 395 LEU A CB    1 
ATOM   3110  C CG    . LEU A 1 395 ? 37.350  64.370 68.583  1.00 33.78  ? 395 LEU A CG    1 
ATOM   3111  C CD1   . LEU A 1 395 ? 36.086  64.755 69.359  1.00 41.96  ? 395 LEU A CD1   1 
ATOM   3112  C CD2   . LEU A 1 395 ? 37.053  63.153 67.725  1.00 32.97  ? 395 LEU A CD2   1 
ATOM   3113  N N     . LEU A 1 396 ? 40.390  66.016 69.213  1.00 47.18  ? 396 LEU A N     1 
ATOM   3114  C CA    . LEU A 1 396 ? 41.430  65.327 69.970  1.00 48.15  ? 396 LEU A CA    1 
ATOM   3115  C C     . LEU A 1 396 ? 41.542  65.787 71.416  1.00 48.70  ? 396 LEU A C     1 
ATOM   3116  O O     . LEU A 1 396 ? 41.451  64.915 72.299  1.00 49.10  ? 396 LEU A O     1 
ATOM   3117  C CB    . LEU A 1 396 ? 42.732  65.328 69.183  1.00 56.54  ? 396 LEU A CB    1 
ATOM   3118  C CG    . LEU A 1 396 ? 43.527  64.013 69.230  1.00 64.78  ? 396 LEU A CG    1 
ATOM   3119  C CD1   . LEU A 1 396 ? 42.633  62.778 69.199  1.00 64.13  ? 396 LEU A CD1   1 
ATOM   3120  C CD2   . LEU A 1 396 ? 44.524  63.969 68.080  1.00 65.05  ? 396 LEU A CD2   1 
ATOM   3121  N N     . GLY A 1 397 ? 41.675  67.072 71.709  1.00 49.39  ? 397 GLY A N     1 
ATOM   3122  C CA    . GLY A 1 397 ? 41.725  67.533 73.078  1.00 54.48  ? 397 GLY A CA    1 
ATOM   3123  C C     . GLY A 1 397 ? 43.086  67.951 73.611  1.00 58.57  ? 397 GLY A C     1 
ATOM   3124  O O     . GLY A 1 397 ? 43.863  68.722 73.047  1.00 57.20  ? 397 GLY A O     1 
ATOM   3125  N N     . ARG A 1 398 ? 43.344  67.494 74.836  1.00 61.65  ? 398 ARG A N     1 
ATOM   3126  C CA    . ARG A 1 398 ? 44.559  67.765 75.586  1.00 63.82  ? 398 ARG A CA    1 
ATOM   3127  C C     . ARG A 1 398 ? 45.008  66.450 76.225  1.00 69.36  ? 398 ARG A C     1 
ATOM   3128  O O     . ARG A 1 398 ? 44.168  65.615 76.603  1.00 69.52  ? 398 ARG A O     1 
ATOM   3129  C CB    . ARG A 1 398 ? 44.309  68.871 76.609  1.00 52.39  ? 398 ARG A CB    1 
ATOM   3130  C CG    . ARG A 1 398 ? 44.414  70.289 76.076  1.00 48.04  ? 398 ARG A CG    1 
ATOM   3131  C CD    . ARG A 1 398 ? 43.549  71.266 76.826  1.00 55.06  ? 398 ARG A CD    1 
ATOM   3132  N NE    . ARG A 1 398 ? 43.389  72.604 76.297  1.00 56.69  ? 398 ARG A NE    1 
ATOM   3133  C CZ    . ARG A 1 398 ? 44.290  73.471 75.868  1.00 61.68  ? 398 ARG A CZ    1 
ATOM   3134  N NH1   . ARG A 1 398 ? 45.585  73.149 75.862  1.00 65.03  ? 398 ARG A NH1   1 
ATOM   3135  N NH2   . ARG A 1 398 ? 43.935  74.680 75.431  1.00 60.25  ? 398 ARG A NH2   1 
ATOM   3136  N N     . ASP A 1 399 ? 46.324  66.230 76.250  1.00 74.91  ? 399 ASP A N     1 
ATOM   3137  C CA    . ASP A 1 399 ? 46.856  64.993 76.863  1.00 79.49  ? 399 ASP A CA    1 
ATOM   3138  C C     . ASP A 1 399 ? 46.652  65.139 78.368  1.00 80.53  ? 399 ASP A C     1 
ATOM   3139  O O     . ASP A 1 399 ? 46.851  66.230 78.913  1.00 79.59  ? 399 ASP A O     1 
ATOM   3140  C CB    . ASP A 1 399 ? 48.282  64.801 76.418  1.00 85.29  ? 399 ASP A CB    1 
ATOM   3141  C CG    . ASP A 1 399 ? 49.070  63.617 76.891  1.00 90.24  ? 399 ASP A CG    1 
ATOM   3142  O OD1   . ASP A 1 399 ? 48.592  62.777 77.675  1.00 91.77  ? 399 ASP A OD1   1 
ATOM   3143  O OD2   . ASP A 1 399 ? 50.247  63.475 76.469  1.00 94.57  ? 399 ASP A OD2   1 
ATOM   3144  N N     . PRO A 1 400 ? 46.195  64.082 79.036  1.00 81.89  ? 400 PRO A N     1 
ATOM   3145  C CA    . PRO A 1 400 ? 45.848  64.101 80.437  1.00 83.74  ? 400 PRO A CA    1 
ATOM   3146  C C     . PRO A 1 400 ? 46.961  64.470 81.401  1.00 84.68  ? 400 PRO A C     1 
ATOM   3147  O O     . PRO A 1 400 ? 46.713  65.010 82.482  1.00 85.12  ? 400 PRO A O     1 
ATOM   3148  C CB    . PRO A 1 400 ? 45.354  62.692 80.759  1.00 83.59  ? 400 PRO A CB    1 
ATOM   3149  C CG    . PRO A 1 400 ? 45.636  61.851 79.576  1.00 83.78  ? 400 PRO A CG    1 
ATOM   3150  C CD    . PRO A 1 400 ? 45.876  62.770 78.417  1.00 83.02  ? 400 PRO A CD    1 
ATOM   3151  N N     . ALA A 1 401 ? 48.186  64.147 81.026  1.00 84.82  ? 401 ALA A N     1 
ATOM   3152  C CA    . ALA A 1 401 ? 49.357  64.381 81.839  1.00 85.53  ? 401 ALA A CA    1 
ATOM   3153  C C     . ALA A 1 401 ? 50.227  65.525 81.355  1.00 85.67  ? 401 ALA A C     1 
ATOM   3154  O O     . ALA A 1 401 ? 51.171  65.906 82.053  1.00 86.87  ? 401 ALA A O     1 
ATOM   3155  C CB    . ALA A 1 401 ? 50.169  63.078 81.799  1.00 84.61  ? 401 ALA A CB    1 
ATOM   3156  N N     . THR A 1 402 ? 49.976  65.996 80.141  1.00 84.75  ? 402 THR A N     1 
ATOM   3157  C CA    . THR A 1 402 ? 50.780  67.087 79.581  1.00 84.20  ? 402 THR A CA    1 
ATOM   3158  C C     . THR A 1 402 ? 49.916  68.342 79.608  1.00 83.57  ? 402 THR A C     1 
ATOM   3159  O O     . THR A 1 402 ? 50.343  69.432 79.981  1.00 82.16  ? 402 THR A O     1 
ATOM   3160  C CB    . THR A 1 402 ? 51.327  66.753 78.190  1.00 85.28  ? 402 THR A CB    1 
ATOM   3161  O OG1   . THR A 1 402 ? 50.274  66.696 77.226  1.00 85.16  ? 402 THR A OG1   1 
ATOM   3162  C CG2   . THR A 1 402 ? 52.049  65.406 78.204  1.00 84.95  ? 402 THR A CG2   1 
ATOM   3163  N N     . GLY A 1 403 ? 48.644  68.164 79.227  1.00 83.65  ? 403 GLY A N     1 
ATOM   3164  C CA    . GLY A 1 403 ? 47.659  69.228 79.228  1.00 82.74  ? 403 GLY A CA    1 
ATOM   3165  C C     . GLY A 1 403 ? 47.782  70.226 78.088  1.00 82.78  ? 403 GLY A C     1 
ATOM   3166  O O     . GLY A 1 403 ? 47.133  71.282 78.104  1.00 82.44  ? 403 GLY A O     1 
ATOM   3167  N N     . GLU A 1 404 ? 48.614  69.928 77.092  1.00 81.64  ? 404 GLU A N     1 
ATOM   3168  C CA    . GLU A 1 404 ? 48.768  70.841 75.959  1.00 81.43  ? 404 GLU A CA    1 
ATOM   3169  C C     . GLU A 1 404 ? 47.952  70.278 74.796  1.00 79.62  ? 404 GLU A C     1 
ATOM   3170  O O     . GLU A 1 404 ? 47.522  69.119 74.863  1.00 78.60  ? 404 GLU A O     1 
ATOM   3171  C CB    . GLU A 1 404 ? 50.233  71.009 75.580  1.00 86.24  ? 404 GLU A CB    1 
ATOM   3172  C CG    . GLU A 1 404 ? 50.980  72.115 76.308  1.00 93.26  ? 404 GLU A CG    1 
ATOM   3173  C CD    . GLU A 1 404 ? 52.439  72.218 75.897  1.00 98.25  ? 404 GLU A CD    1 
ATOM   3174  O OE1   . GLU A 1 404 ? 52.768  71.850 74.745  1.00 99.89  ? 404 GLU A OE1   1 
ATOM   3175  O OE2   . GLU A 1 404 ? 53.281  72.669 76.709  1.00 98.97  ? 404 GLU A OE2   1 
ATOM   3176  N N     . GLN A 1 405 ? 47.722  71.093 73.776  1.00 77.89  ? 405 GLN A N     1 
ATOM   3177  C CA    . GLN A 1 405 ? 46.985  70.619 72.605  1.00 75.74  ? 405 GLN A CA    1 
ATOM   3178  C C     . GLN A 1 405 ? 47.587  69.292 72.152  1.00 75.97  ? 405 GLN A C     1 
ATOM   3179  O O     . GLN A 1 405 ? 48.767  69.268 71.770  1.00 77.87  ? 405 GLN A O     1 
ATOM   3180  C CB    . GLN A 1 405 ? 47.084  71.660 71.492  1.00 72.17  ? 405 GLN A CB    1 
ATOM   3181  C CG    . GLN A 1 405 ? 45.798  72.413 71.185  1.00 67.10  ? 405 GLN A CG    1 
ATOM   3182  C CD    . GLN A 1 405 ? 44.797  71.543 70.434  1.00 58.44  ? 405 GLN A CD    1 
ATOM   3183  O OE1   . GLN A 1 405 ? 43.848  71.037 71.044  1.00 55.58  ? 405 GLN A OE1   1 
ATOM   3184  N NE2   . GLN A 1 405 ? 45.030  71.380 69.133  1.00 44.19  ? 405 GLN A NE2   1 
ATOM   3185  N N     . LYS A 1 406 ? 46.832  68.205 72.234  1.00 74.60  ? 406 LYS A N     1 
ATOM   3186  C CA    . LYS A 1 406 ? 47.366  66.901 71.836  1.00 75.17  ? 406 LYS A CA    1 
ATOM   3187  C C     . LYS A 1 406 ? 47.629  66.881 70.331  1.00 77.10  ? 406 LYS A C     1 
ATOM   3188  O O     . LYS A 1 406 ? 46.980  67.566 69.539  1.00 76.22  ? 406 LYS A O     1 
ATOM   3189  C CB    . LYS A 1 406 ? 46.460  65.769 72.305  1.00 70.79  ? 406 LYS A CB    1 
ATOM   3190  C CG    . LYS A 1 406 ? 47.020  64.371 72.102  1.00 72.25  ? 406 LYS A CG    1 
ATOM   3191  C CD    . LYS A 1 406 ? 46.393  63.369 73.057  1.00 73.46  ? 406 LYS A CD    1 
ATOM   3192  C CE    . LYS A 1 406 ? 46.260  61.988 72.435  1.00 74.88  ? 406 LYS A CE    1 
ATOM   3193  N NZ    . LYS A 1 406 ? 45.049  61.257 72.905  1.00 76.53  ? 406 LYS A NZ    1 
ATOM   3194  N N     . HIS A 1 407 ? 48.666  66.140 69.932  1.00 79.87  ? 407 HIS A N     1 
ATOM   3195  C CA    . HIS A 1 407 ? 49.075  66.046 68.541  1.00 80.31  ? 407 HIS A CA    1 
ATOM   3196  C C     . HIS A 1 407 ? 48.023  65.311 67.711  1.00 78.13  ? 407 HIS A C     1 
ATOM   3197  O O     . HIS A 1 407 ? 47.775  64.134 67.975  1.00 78.10  ? 407 HIS A O     1 
ATOM   3198  C CB    . HIS A 1 407 ? 50.411  65.316 68.362  1.00 89.08  ? 407 HIS A CB    1 
ATOM   3199  C CG    . HIS A 1 407 ? 50.703  64.906 66.945  1.00 94.67  ? 407 HIS A CG    1 
ATOM   3200  N ND1   . HIS A 1 407 ? 50.838  63.589 66.558  1.00 96.21  ? 407 HIS A ND1   1 
ATOM   3201  C CD2   . HIS A 1 407 ? 50.872  65.643 65.819  1.00 96.19  ? 407 HIS A CD2   1 
ATOM   3202  C CE1   . HIS A 1 407 ? 51.088  63.529 65.265  1.00 95.95  ? 407 HIS A CE1   1 
ATOM   3203  N NE2   . HIS A 1 407 ? 51.112  64.761 64.793  1.00 97.04  ? 407 HIS A NE2   1 
ATOM   3204  N N     . ALA A 1 408 ? 47.506  66.002 66.696  1.00 75.35  ? 408 ALA A N     1 
ATOM   3205  C CA    . ALA A 1 408 ? 46.550  65.342 65.806  1.00 72.91  ? 408 ALA A CA    1 
ATOM   3206  C C     . ALA A 1 408 ? 47.265  64.853 64.548  1.00 70.52  ? 408 ALA A C     1 
ATOM   3207  O O     . ALA A 1 408 ? 47.773  65.599 63.715  1.00 68.58  ? 408 ALA A O     1 
ATOM   3208  C CB    . ALA A 1 408 ? 45.364  66.224 65.491  1.00 68.47  ? 408 ALA A CB    1 
ATOM   3209  N N     . ASP A 1 409 ? 47.285  63.528 64.408  1.00 69.10  ? 409 ASP A N     1 
ATOM   3210  C CA    . ASP A 1 409 ? 47.852  62.876 63.237  1.00 69.31  ? 409 ASP A CA    1 
ATOM   3211  C C     . ASP A 1 409 ? 47.158  63.435 61.991  1.00 68.18  ? 409 ASP A C     1 
ATOM   3212  O O     . ASP A 1 409 ? 47.783  63.829 61.017  1.00 68.43  ? 409 ASP A O     1 
ATOM   3213  C CB    . ASP A 1 409 ? 47.642  61.365 63.279  1.00 78.55  ? 409 ASP A CB    1 
ATOM   3214  C CG    . ASP A 1 409 ? 47.705  60.743 64.654  1.00 86.09  ? 409 ASP A CG    1 
ATOM   3215  O OD1   . ASP A 1 409 ? 46.890  61.093 65.538  1.00 90.78  ? 409 ASP A OD1   1 
ATOM   3216  O OD2   . ASP A 1 409 ? 48.590  59.879 64.860  1.00 89.06  ? 409 ASP A OD2   1 
ATOM   3217  N N     . MET A 1 410 ? 45.827  63.443 62.052  1.00 65.27  ? 410 MET A N     1 
ATOM   3218  C CA    . MET A 1 410 ? 44.939  63.918 61.023  1.00 59.26  ? 410 MET A CA    1 
ATOM   3219  C C     . MET A 1 410 ? 44.156  65.163 61.423  1.00 53.07  ? 410 MET A C     1 
ATOM   3220  O O     . MET A 1 410 ? 43.953  65.514 62.585  1.00 54.83  ? 410 MET A O     1 
ATOM   3221  C CB    . MET A 1 410 ? 43.902  62.831 60.682  1.00 62.95  ? 410 MET A CB    1 
ATOM   3222  C CG    . MET A 1 410 ? 44.463  61.643 59.928  1.00 71.64  ? 410 MET A CG    1 
ATOM   3223  S SD    . MET A 1 410 ? 45.450  62.098 58.476  1.00 79.82  ? 410 MET A SD    1 
ATOM   3224  C CE    . MET A 1 410 ? 46.129  60.473 58.084  1.00 74.31  ? 410 MET A CE    1 
ATOM   3225  N N     . GLU A 1 411 ? 43.733  65.872 60.395  1.00 45.45  ? 411 GLU A N     1 
ATOM   3226  C CA    . GLU A 1 411 ? 42.891  67.057 60.466  1.00 43.67  ? 411 GLU A CA    1 
ATOM   3227  C C     . GLU A 1 411 ? 41.780  66.857 59.412  1.00 43.17  ? 411 GLU A C     1 
ATOM   3228  O O     . GLU A 1 411 ? 41.705  67.521 58.381  1.00 42.45  ? 411 GLU A O     1 
ATOM   3229  C CB    . GLU A 1 411 ? 43.642  68.355 60.253  1.00 40.78  ? 411 GLU A CB    1 
ATOM   3230  C CG    . GLU A 1 411 ? 44.656  68.748 61.306  1.00 47.98  ? 411 GLU A CG    1 
ATOM   3231  C CD    . GLU A 1 411 ? 44.137  68.951 62.707  1.00 51.71  ? 411 GLU A CD    1 
ATOM   3232  O OE1   . GLU A 1 411 ? 43.003  68.571 63.081  1.00 53.54  ? 411 GLU A OE1   1 
ATOM   3233  O OE2   . GLU A 1 411 ? 44.905  69.538 63.498  1.00 54.16  ? 411 GLU A OE2   1 
ATOM   3234  N N     . PHE A 1 412 ? 40.967  65.840 59.675  1.00 40.18  ? 412 PHE A N     1 
ATOM   3235  C CA    . PHE A 1 412 ? 39.875  65.343 58.864  1.00 38.67  ? 412 PHE A CA    1 
ATOM   3236  C C     . PHE A 1 412 ? 38.524  66.030 58.997  1.00 37.54  ? 412 PHE A C     1 
ATOM   3237  O O     . PHE A 1 412 ? 38.075  66.262 60.135  1.00 37.91  ? 412 PHE A O     1 
ATOM   3238  C CB    . PHE A 1 412 ? 39.631  63.873 59.285  1.00 29.21  ? 412 PHE A CB    1 
ATOM   3239  C CG    . PHE A 1 412 ? 40.314  62.821 58.471  1.00 41.04  ? 412 PHE A CG    1 
ATOM   3240  C CD1   . PHE A 1 412 ? 40.912  63.087 57.237  1.00 42.29  ? 412 PHE A CD1   1 
ATOM   3241  C CD2   . PHE A 1 412 ? 40.347  61.514 58.929  1.00 39.68  ? 412 PHE A CD2   1 
ATOM   3242  C CE1   . PHE A 1 412 ? 41.529  62.086 56.516  1.00 44.57  ? 412 PHE A CE1   1 
ATOM   3243  C CE2   . PHE A 1 412 ? 40.964  60.508 58.201  1.00 47.45  ? 412 PHE A CE2   1 
ATOM   3244  C CZ    . PHE A 1 412 ? 41.559  60.789 56.987  1.00 45.08  ? 412 PHE A CZ    1 
ATOM   3245  N N     . MET A 1 413 ? 37.871  66.345 57.880  1.00 32.30  ? 413 MET A N     1 
ATOM   3246  C CA    . MET A 1 413 ? 36.516  66.911 57.882  1.00 23.95  ? 413 MET A CA    1 
ATOM   3247  C C     . MET A 1 413 ? 35.653  65.726 57.447  1.00 27.56  ? 413 MET A C     1 
ATOM   3248  O O     . MET A 1 413 ? 36.043  65.010 56.498  1.00 27.43  ? 413 MET A O     1 
ATOM   3249  C CB    . MET A 1 413 ? 36.328  68.120 57.008  1.00 29.38  ? 413 MET A CB    1 
ATOM   3250  C CG    . MET A 1 413 ? 34.886  68.539 56.726  1.00 11.15  ? 413 MET A CG    1 
ATOM   3251  S SD    . MET A 1 413 ? 34.689  69.920 55.654  1.00 29.65  ? 413 MET A SD    1 
ATOM   3252  C CE    . MET A 1 413 ? 35.500  69.245 54.187  1.00 24.61  ? 413 MET A CE    1 
ATOM   3253  N N     . ARG A 1 414 ? 34.669  65.318 58.244  1.00 24.01  ? 414 ARG A N     1 
ATOM   3254  C CA    . ARG A 1 414 ? 33.883  64.133 57.938  1.00 18.72  ? 414 ARG A CA    1 
ATOM   3255  C C     . ARG A 1 414 ? 32.550  64.617 57.319  1.00 21.00  ? 414 ARG A C     1 
ATOM   3256  O O     . ARG A 1 414 ? 31.862  65.471 57.899  1.00 18.95  ? 414 ARG A O     1 
ATOM   3257  C CB    . ARG A 1 414 ? 33.628  63.220 59.128  1.00 17.23  ? 414 ARG A CB    1 
ATOM   3258  C CG    . ARG A 1 414 ? 32.979  61.909 58.810  1.00 16.18  ? 414 ARG A CG    1 
ATOM   3259  C CD    . ARG A 1 414 ? 32.527  61.017 59.951  1.00 21.02  ? 414 ARG A CD    1 
ATOM   3260  N NE    . ARG A 1 414 ? 31.368  61.597 60.631  1.00 26.23  ? 414 ARG A NE    1 
ATOM   3261  C CZ    . ARG A 1 414 ? 31.091  61.493 61.928  1.00 27.54  ? 414 ARG A CZ    1 
ATOM   3262  N NH1   . ARG A 1 414 ? 31.947  60.801 62.679  1.00 21.96  ? 414 ARG A NH1   1 
ATOM   3263  N NH2   . ARG A 1 414 ? 30.010  62.075 62.428  1.00 18.43  ? 414 ARG A NH2   1 
ATOM   3264  N N     . LEU A 1 415 ? 32.295  64.143 56.103  1.00 16.26  ? 415 LEU A N     1 
ATOM   3265  C CA    . LEU A 1 415 ? 31.032  64.551 55.415  1.00 17.05  ? 415 LEU A CA    1 
ATOM   3266  C C     . LEU A 1 415 ? 30.108  63.343 55.543  1.00 14.48  ? 415 LEU A C     1 
ATOM   3267  O O     . LEU A 1 415 ? 30.313  62.365 54.820  1.00 14.05  ? 415 LEU A O     1 
ATOM   3268  C CB    . LEU A 1 415 ? 31.263  64.934 53.976  1.00 13.51  ? 415 LEU A CB    1 
ATOM   3269  C CG    . LEU A 1 415 ? 32.285  66.022 53.666  1.00 13.11  ? 415 LEU A CG    1 
ATOM   3270  C CD1   . LEU A 1 415 ? 32.602  66.048 52.177  1.00 19.45  ? 415 LEU A CD1   1 
ATOM   3271  C CD2   . LEU A 1 415 ? 31.756  67.371 54.128  1.00 16.83  ? 415 LEU A CD2   1 
ATOM   3272  N N     . THR A 1 416 ? 29.281  63.362 56.607  1.00 8.19   ? 416 THR A N     1 
ATOM   3273  C CA    . THR A 1 416 ? 28.522  62.148 56.943  1.00 10.51  ? 416 THR A CA    1 
ATOM   3274  C C     . THR A 1 416 ? 27.138  62.182 56.276  1.00 6.83   ? 416 THR A C     1 
ATOM   3275  O O     . THR A 1 416 ? 26.428  63.179 56.401  1.00 8.21   ? 416 THR A O     1 
ATOM   3276  C CB    . THR A 1 416 ? 28.312  62.026 58.495  1.00 13.58  ? 416 THR A CB    1 
ATOM   3277  O OG1   . THR A 1 416 ? 29.213  62.861 59.200  1.00 15.41  ? 416 THR A OG1   1 
ATOM   3278  C CG2   . THR A 1 416 ? 28.467  60.600 58.943  1.00 7.74   ? 416 THR A CG2   1 
ATOM   3279  N N     . ILE A 1 417 ? 26.787  61.051 55.659  1.00 9.27   ? 417 ILE A N     1 
ATOM   3280  C CA    . ILE A 1 417 ? 25.588  61.029 54.834  1.00 10.36  ? 417 ILE A CA    1 
ATOM   3281  C C     . ILE A 1 417 ? 24.461  60.168 55.392  1.00 6.83   ? 417 ILE A C     1 
ATOM   3282  O O     . ILE A 1 417 ? 24.641  58.962 55.448  1.00 9.42   ? 417 ILE A O     1 
ATOM   3283  C CB    . ILE A 1 417 ? 25.894  60.520 53.385  1.00 11.83  ? 417 ILE A CB    1 
ATOM   3284  C CG1   . ILE A 1 417 ? 27.088  61.229 52.729  1.00 14.85  ? 417 ILE A CG1   1 
ATOM   3285  C CG2   . ILE A 1 417 ? 24.630  60.694 52.516  1.00 9.04   ? 417 ILE A CG2   1 
ATOM   3286  C CD1   . ILE A 1 417 ? 27.041  62.738 52.660  1.00 16.37  ? 417 ILE A CD1   1 
ATOM   3287  N N     . ALA A 1 418 ? 23.345  60.842 55.700  1.00 11.31  ? 418 ALA A N     1 
ATOM   3288  C CA    . ALA A 1 418 ? 22.156  60.132 56.209  1.00 10.97  ? 418 ALA A CA    1 
ATOM   3289  C C     . ALA A 1 418 ? 21.577  59.248 55.117  1.00 11.92  ? 418 ALA A C     1 
ATOM   3290  O O     . ALA A 1 418 ? 21.868  59.550 53.942  1.00 11.95  ? 418 ALA A O     1 
ATOM   3291  C CB    . ALA A 1 418 ? 21.095  61.173 56.603  1.00 6.13   ? 418 ALA A CB    1 
ATOM   3292  N N     . ARG A 1 419 ? 20.873  58.177 55.436  1.00 5.63   ? 419 ARG A N     1 
ATOM   3293  C CA    . ARG A 1 419 ? 20.358  57.265 54.413  1.00 11.15  ? 419 ARG A CA    1 
ATOM   3294  C C     . ARG A 1 419 ? 19.043  57.720 53.820  1.00 10.82  ? 419 ARG A C     1 
ATOM   3295  O O     . ARG A 1 419 ? 18.090  58.078 54.525  1.00 9.43   ? 419 ARG A O     1 
ATOM   3296  C CB    . ARG A 1 419 ? 20.230  55.848 55.008  1.00 8.71   ? 419 ARG A CB    1 
ATOM   3297  C CG    . ARG A 1 419 ? 21.597  55.371 55.515  1.00 9.99   ? 419 ARG A CG    1 
ATOM   3298  C CD    . ARG A 1 419 ? 21.367  54.238 56.542  1.00 10.06  ? 419 ARG A CD    1 
ATOM   3299  N NE    . ARG A 1 419 ? 22.699  53.840 57.027  1.00 6.56   ? 419 ARG A NE    1 
ATOM   3300  C CZ    . ARG A 1 419 ? 23.433  54.583 57.869  1.00 4.48   ? 419 ARG A CZ    1 
ATOM   3301  N NH1   . ARG A 1 419 ? 22.957  55.703 58.382  1.00 3.95   ? 419 ARG A NH1   1 
ATOM   3302  N NH2   . ARG A 1 419 ? 24.644  54.120 58.183  1.00 9.07   ? 419 ARG A NH2   1 
ATOM   3303  N N     . ARG A 1 420 ? 18.979  57.726 52.474  1.00 12.15  ? 420 ARG A N     1 
ATOM   3304  C CA    . ARG A 1 420 ? 17.768  58.054 51.699  1.00 6.90   ? 420 ARG A CA    1 
ATOM   3305  C C     . ARG A 1 420 ? 17.238  59.435 51.957  1.00 6.60   ? 420 ARG A C     1 
ATOM   3306  O O     . ARG A 1 420 ? 16.030  59.678 51.886  1.00 10.46  ? 420 ARG A O     1 
ATOM   3307  C CB    . ARG A 1 420 ? 16.651  57.025 52.017  1.00 5.24   ? 420 ARG A CB    1 
ATOM   3308  C CG    . ARG A 1 420 ? 17.089  55.596 51.899  1.00 6.56   ? 420 ARG A CG    1 
ATOM   3309  C CD    . ARG A 1 420 ? 15.988  54.540 51.862  1.00 11.13  ? 420 ARG A CD    1 
ATOM   3310  N NE    . ARG A 1 420 ? 15.269  54.542 53.174  1.00 9.79   ? 420 ARG A NE    1 
ATOM   3311  C CZ    . ARG A 1 420 ? 14.594  53.469 53.535  1.00 9.70   ? 420 ARG A CZ    1 
ATOM   3312  N NH1   . ARG A 1 420 ? 14.479  52.382 52.759  1.00 4.61   ? 420 ARG A NH1   1 
ATOM   3313  N NH2   . ARG A 1 420 ? 13.988  53.509 54.716  1.00 7.80   ? 420 ARG A NH2   1 
ATOM   3314  N N     . VAL A 1 421 ? 18.080  60.425 52.255  1.00 5.20   ? 421 VAL A N     1 
ATOM   3315  C CA    . VAL A 1 421 ? 17.582  61.743 52.582  1.00 5.19   ? 421 VAL A CA    1 
ATOM   3316  C C     . VAL A 1 421 ? 17.932  62.778 51.523  1.00 11.47  ? 421 VAL A C     1 
ATOM   3317  O O     . VAL A 1 421 ? 17.121  63.649 51.278  1.00 8.62   ? 421 VAL A O     1 
ATOM   3318  C CB    . VAL A 1 421 ? 18.213  62.251 53.908  1.00 10.07  ? 421 VAL A CB    1 
ATOM   3319  C CG1   . VAL A 1 421 ? 17.843  63.678 54.261  1.00 7.35   ? 421 VAL A CG1   1 
ATOM   3320  C CG2   . VAL A 1 421 ? 17.773  61.303 55.047  1.00 11.73  ? 421 VAL A CG2   1 
ATOM   3321  N N     . TYR A 1 422 ? 19.144  62.683 50.979  1.00 10.44  ? 422 TYR A N     1 
ATOM   3322  C CA    . TYR A 1 422 ? 19.657  63.707 50.068  1.00 12.12  ? 422 TYR A CA    1 
ATOM   3323  C C     . TYR A 1 422 ? 19.852  63.082 48.698  1.00 6.27   ? 422 TYR A C     1 
ATOM   3324  O O     . TYR A 1 422 ? 20.129  61.898 48.596  1.00 7.39   ? 422 TYR A O     1 
ATOM   3325  C CB    . TYR A 1 422 ? 21.031  64.257 50.547  1.00 12.07  ? 422 TYR A CB    1 
ATOM   3326  C CG    . TYR A 1 422 ? 20.869  65.019 51.864  1.00 11.83  ? 422 TYR A CG    1 
ATOM   3327  C CD1   . TYR A 1 422 ? 20.246  66.240 51.929  1.00 9.91   ? 422 TYR A CD1   1 
ATOM   3328  C CD2   . TYR A 1 422 ? 21.330  64.403 53.049  1.00 11.50  ? 422 TYR A CD2   1 
ATOM   3329  C CE1   . TYR A 1 422 ? 20.076  66.932 53.132  1.00 8.10   ? 422 TYR A CE1   1 
ATOM   3330  C CE2   . TYR A 1 422 ? 21.190  65.081 54.260  1.00 11.76  ? 422 TYR A CE2   1 
ATOM   3331  C CZ    . TYR A 1 422 ? 20.558  66.302 54.292  1.00 9.85   ? 422 TYR A CZ    1 
ATOM   3332  O OH    . TYR A 1 422 ? 20.411  66.921 55.516  1.00 12.63  ? 422 TYR A OH    1 
ATOM   3333  N N     . THR A 1 423 ? 19.691  63.913 47.664  1.00 9.70   ? 423 THR A N     1 
ATOM   3334  C CA    . THR A 1 423 ? 19.880  63.394 46.308  1.00 10.78  ? 423 THR A CA    1 
ATOM   3335  C C     . THR A 1 423 ? 21.329  63.613 45.855  1.00 11.38  ? 423 THR A C     1 
ATOM   3336  O O     . THR A 1 423 ? 22.107  64.290 46.522  1.00 12.39  ? 423 THR A O     1 
ATOM   3337  C CB    . THR A 1 423 ? 18.906  64.076 45.333  1.00 9.09   ? 423 THR A CB    1 
ATOM   3338  O OG1   . THR A 1 423 ? 19.297  65.423 45.149  1.00 9.33   ? 423 THR A OG1   1 
ATOM   3339  C CG2   . THR A 1 423 ? 17.478  64.147 45.886  1.00 4.35   ? 423 THR A CG2   1 
ATOM   3340  N N     . ASN A 1 424 ? 21.673  63.143 44.660  1.00 12.33  ? 424 ASN A N     1 
ATOM   3341  C CA    . ASN A 1 424 ? 23.002  63.339 44.062  1.00 13.05  ? 424 ASN A CA    1 
ATOM   3342  C C     . ASN A 1 424 ? 23.177  64.793 43.697  1.00 9.99   ? 424 ASN A C     1 
ATOM   3343  O O     . ASN A 1 424 ? 24.304  65.294 43.713  1.00 14.51  ? 424 ASN A O     1 
ATOM   3344  C CB    . ASN A 1 424 ? 23.197  62.396 42.861  1.00 9.35   ? 424 ASN A CB    1 
ATOM   3345  C CG    . ASN A 1 424 ? 23.371  60.963 43.288  1.00 12.90  ? 424 ASN A CG    1 
ATOM   3346  O OD1   . ASN A 1 424 ? 23.936  60.750 44.343  1.00 13.37  ? 424 ASN A OD1   1 
ATOM   3347  N ND2   . ASN A 1 424 ? 22.906  59.949 42.550  1.00 13.93  ? 424 ASN A ND2   1 
ATOM   3348  N N     . ASP A 1 425 ? 22.102  65.572 43.535  1.00 8.16   ? 425 ASP A N     1 
ATOM   3349  C CA    . ASP A 1 425 ? 22.255  67.010 43.322  1.00 8.70   ? 425 ASP A CA    1 
ATOM   3350  C C     . ASP A 1 425 ? 22.622  67.717 44.613  1.00 11.54  ? 425 ASP A C     1 
ATOM   3351  O O     . ASP A 1 425 ? 23.225  68.793 44.575  1.00 9.86   ? 425 ASP A O     1 
ATOM   3352  C CB    . ASP A 1 425 ? 21.009  67.665 42.708  1.00 11.20  ? 425 ASP A CB    1 
ATOM   3353  C CG    . ASP A 1 425 ? 20.776  67.182 41.273  1.00 16.20  ? 425 ASP A CG    1 
ATOM   3354  O OD1   . ASP A 1 425 ? 21.775  66.987 40.529  1.00 20.30  ? 425 ASP A OD1   1 
ATOM   3355  O OD2   . ASP A 1 425 ? 19.637  67.002 40.808  1.00 18.22  ? 425 ASP A OD2   1 
ATOM   3356  N N     . HIS A 1 426 ? 22.209  67.154 45.780  1.00 12.50  ? 426 HIS A N     1 
ATOM   3357  C CA    . HIS A 1 426 ? 22.652  67.745 47.047  1.00 8.98   ? 426 HIS A CA    1 
ATOM   3358  C C     . HIS A 1 426 ? 24.156  67.387 47.179  1.00 6.80   ? 426 HIS A C     1 
ATOM   3359  O O     . HIS A 1 426 ? 24.913  68.156 47.691  1.00 10.58  ? 426 HIS A O     1 
ATOM   3360  C CB    . HIS A 1 426 ? 21.910  67.098 48.214  1.00 12.64  ? 426 HIS A CB    1 
ATOM   3361  C CG    . HIS A 1 426 ? 20.484  67.551 48.363  1.00 7.92   ? 426 HIS A CG    1 
ATOM   3362  N ND1   . HIS A 1 426 ? 19.437  66.659 48.360  1.00 9.44   ? 426 HIS A ND1   1 
ATOM   3363  C CD2   . HIS A 1 426 ? 19.952  68.799 48.481  1.00 5.20   ? 426 HIS A CD2   1 
ATOM   3364  C CE1   . HIS A 1 426 ? 18.334  67.327 48.518  1.00 7.19   ? 426 HIS A CE1   1 
ATOM   3365  N NE2   . HIS A 1 426 ? 18.600  68.619 48.573  1.00 7.04   ? 426 HIS A NE2   1 
ATOM   3366  N N     . MET A 1 427 ? 24.560  66.203 46.722  1.00 7.40   ? 427 MET A N     1 
ATOM   3367  C CA    . MET A 1 427 ? 25.956  65.797 46.753  1.00 9.00   ? 427 MET A CA    1 
ATOM   3368  C C     . MET A 1 427 ? 26.753  66.785 45.879  1.00 17.05  ? 427 MET A C     1 
ATOM   3369  O O     . MET A 1 427 ? 27.766  67.353 46.328  1.00 13.83  ? 427 MET A O     1 
ATOM   3370  C CB    . MET A 1 427 ? 26.079  64.358 46.291  1.00 9.37   ? 427 MET A CB    1 
ATOM   3371  C CG    . MET A 1 427 ? 25.640  63.170 47.115  1.00 8.25   ? 427 MET A CG    1 
ATOM   3372  S SD    . MET A 1 427 ? 26.015  63.378 48.876  1.00 14.74  ? 427 MET A SD    1 
ATOM   3373  C CE    . MET A 1 427 ? 24.430  64.028 49.418  1.00 15.21  ? 427 MET A CE    1 
ATOM   3374  N N     . ASP A 1 428 ? 26.275  67.096 44.637  1.00 13.12  ? 428 ASP A N     1 
ATOM   3375  C CA    . ASP A 1 428 ? 26.981  68.092 43.834  1.00 15.48  ? 428 ASP A CA    1 
ATOM   3376  C C     . ASP A 1 428 ? 27.096  69.439 44.515  1.00 14.31  ? 428 ASP A C     1 
ATOM   3377  O O     . ASP A 1 428 ? 28.102  70.146 44.442  1.00 14.76  ? 428 ASP A O     1 
ATOM   3378  C CB    . ASP A 1 428 ? 26.365  68.400 42.444  1.00 13.34  ? 428 ASP A CB    1 
ATOM   3379  C CG    . ASP A 1 428 ? 26.549  67.221 41.530  1.00 15.27  ? 428 ASP A CG    1 
ATOM   3380  O OD1   . ASP A 1 428 ? 27.506  66.413 41.612  1.00 13.26  ? 428 ASP A OD1   1 
ATOM   3381  O OD2   . ASP A 1 428 ? 25.664  67.078 40.669  1.00 20.69  ? 428 ASP A OD2   1 
ATOM   3382  N N     . TYR A 1 429 ? 26.023  69.861 45.191  1.00 12.79  ? 429 TYR A N     1 
ATOM   3383  C CA    . TYR A 1 429 ? 26.011  71.153 45.873  1.00 12.00  ? 429 TYR A CA    1 
ATOM   3384  C C     . TYR A 1 429 ? 27.113  71.214 46.920  1.00 14.87  ? 429 TYR A C     1 
ATOM   3385  O O     . TYR A 1 429 ? 27.797  72.210 47.105  1.00 15.79  ? 429 TYR A O     1 
ATOM   3386  C CB    . TYR A 1 429 ? 24.628  71.311 46.532  1.00 16.78  ? 429 TYR A CB    1 
ATOM   3387  C CG    . TYR A 1 429 ? 24.546  72.607 47.333  1.00 18.58  ? 429 TYR A CG    1 
ATOM   3388  C CD1   . TYR A 1 429 ? 25.019  72.678 48.630  1.00 20.78  ? 429 TYR A CD1   1 
ATOM   3389  C CD2   . TYR A 1 429 ? 23.979  73.736 46.756  1.00 21.93  ? 429 TYR A CD2   1 
ATOM   3390  C CE1   . TYR A 1 429 ? 24.965  73.848 49.348  1.00 24.28  ? 429 TYR A CE1   1 
ATOM   3391  C CE2   . TYR A 1 429 ? 23.908  74.921 47.462  1.00 20.65  ? 429 TYR A CE2   1 
ATOM   3392  C CZ    . TYR A 1 429 ? 24.392  74.965 48.738  1.00 27.76  ? 429 TYR A CZ    1 
ATOM   3393  O OH    . TYR A 1 429 ? 24.286  76.131 49.465  1.00 29.57  ? 429 TYR A OH    1 
ATOM   3394  N N     . ILE A 1 430 ? 27.307  70.116 47.653  1.00 12.82  ? 430 ILE A N     1 
ATOM   3395  C CA    . ILE A 1 430 ? 28.355  69.995 48.647  1.00 13.73  ? 430 ILE A CA    1 
ATOM   3396  C C     . ILE A 1 430 ? 29.725  69.974 47.936  1.00 16.13  ? 430 ILE A C     1 
ATOM   3397  O O     . ILE A 1 430 ? 30.629  70.682 48.365  1.00 16.76  ? 430 ILE A O     1 
ATOM   3398  C CB    . ILE A 1 430 ? 28.177  68.694 49.444  1.00 14.80  ? 430 ILE A CB    1 
ATOM   3399  C CG1   . ILE A 1 430 ? 26.854  68.753 50.262  1.00 12.21  ? 430 ILE A CG1   1 
ATOM   3400  C CG2   . ILE A 1 430 ? 29.335  68.418 50.388  1.00 15.60  ? 430 ILE A CG2   1 
ATOM   3401  C CD1   . ILE A 1 430 ? 26.351  67.311 50.439  1.00 11.23  ? 430 ILE A CD1   1 
ATOM   3402  N N     . ALA A 1 431 ? 29.918  69.126 46.932  1.00 14.46  ? 431 ALA A N     1 
ATOM   3403  C CA    . ALA A 1 431 ? 31.177  69.055 46.190  1.00 18.64  ? 431 ALA A CA    1 
ATOM   3404  C C     . ALA A 1 431 ? 31.516  70.421 45.603  1.00 18.10  ? 431 ALA A C     1 
ATOM   3405  O O     . ALA A 1 431 ? 32.625  70.906 45.868  1.00 21.12  ? 431 ALA A O     1 
ATOM   3406  C CB    . ALA A 1 431 ? 31.183  68.003 45.083  1.00 11.39  ? 431 ALA A CB    1 
ATOM   3407  N N     . ASP A 1 432 ? 30.581  71.123 44.986  1.00 14.42  ? 432 ASP A N     1 
ATOM   3408  C CA    . ASP A 1 432 ? 30.848  72.407 44.405  1.00 20.46  ? 432 ASP A CA    1 
ATOM   3409  C C     . ASP A 1 432 ? 31.258  73.428 45.433  1.00 25.81  ? 432 ASP A C     1 
ATOM   3410  O O     . ASP A 1 432 ? 32.172  74.195 45.126  1.00 29.86  ? 432 ASP A O     1 
ATOM   3411  C CB    . ASP A 1 432 ? 29.688  72.977 43.576  1.00 21.17  ? 432 ASP A CB    1 
ATOM   3412  C CG    . ASP A 1 432 ? 29.463  72.109 42.356  1.00 22.61  ? 432 ASP A CG    1 
ATOM   3413  O OD1   . ASP A 1 432 ? 30.372  71.329 41.999  1.00 28.77  ? 432 ASP A OD1   1 
ATOM   3414  O OD2   . ASP A 1 432 ? 28.356  72.215 41.782  1.00 31.96  ? 432 ASP A OD2   1 
ATOM   3415  N N     . ALA A 1 433 ? 30.589  73.480 46.574  1.00 25.97  ? 433 ALA A N     1 
ATOM   3416  C CA    . ALA A 1 433 ? 30.857  74.409 47.653  1.00 24.11  ? 433 ALA A CA    1 
ATOM   3417  C C     . ALA A 1 433 ? 32.309  74.259 48.111  1.00 22.83  ? 433 ALA A C     1 
ATOM   3418  O O     . ALA A 1 433 ? 33.015  75.253 48.160  1.00 28.46  ? 433 ALA A O     1 
ATOM   3419  C CB    . ALA A 1 433 ? 29.946  74.188 48.860  1.00 23.08  ? 433 ALA A CB    1 
ATOM   3420  N N     . LEU A 1 434 ? 32.779  73.072 48.373  1.00 22.00  ? 434 LEU A N     1 
ATOM   3421  C CA    . LEU A 1 434 ? 34.129  72.783 48.790  1.00 26.65  ? 434 LEU A CA    1 
ATOM   3422  C C     . LEU A 1 434 ? 35.171  73.003 47.692  1.00 31.91  ? 434 LEU A C     1 
ATOM   3423  O O     . LEU A 1 434 ? 36.239  73.578 47.938  1.00 30.58  ? 434 LEU A O     1 
ATOM   3424  C CB    . LEU A 1 434 ? 34.173  71.337 49.295  1.00 20.81  ? 434 LEU A CB    1 
ATOM   3425  C CG    . LEU A 1 434 ? 35.422  70.949 50.077  1.00 29.95  ? 434 LEU A CG    1 
ATOM   3426  C CD1   . LEU A 1 434 ? 35.685  71.932 51.216  1.00 30.26  ? 434 LEU A CD1   1 
ATOM   3427  C CD2   . LEU A 1 434 ? 35.340  69.518 50.580  1.00 32.89  ? 434 LEU A CD2   1 
ATOM   3428  N N     . ILE A 1 435 ? 34.851  72.667 46.443  1.00 30.76  ? 435 ILE A N     1 
ATOM   3429  C CA    . ILE A 1 435 ? 35.733  72.859 45.316  1.00 32.25  ? 435 ILE A CA    1 
ATOM   3430  C C     . ILE A 1 435 ? 35.910  74.354 45.047  1.00 34.83  ? 435 ILE A C     1 
ATOM   3431  O O     . ILE A 1 435 ? 37.004  74.806 44.720  1.00 38.99  ? 435 ILE A O     1 
ATOM   3432  C CB    . ILE A 1 435 ? 35.246  72.221 44.002  1.00 27.44  ? 435 ILE A CB    1 
ATOM   3433  C CG1   . ILE A 1 435 ? 35.272  70.690 44.043  1.00 24.07  ? 435 ILE A CG1   1 
ATOM   3434  C CG2   . ILE A 1 435 ? 36.068  72.701 42.811  1.00 31.26  ? 435 ILE A CG2   1 
ATOM   3435  C CD1   . ILE A 1 435 ? 34.216  70.123 43.091  1.00 18.73  ? 435 ILE A CD1   1 
ATOM   3436  N N     . GLY A 1 436 ? 34.861  75.137 45.197  1.00 36.23  ? 436 GLY A N     1 
ATOM   3437  C CA    . GLY A 1 436 ? 34.865  76.568 44.922  1.00 35.57  ? 436 GLY A CA    1 
ATOM   3438  C C     . GLY A 1 436 ? 35.566  77.399 45.980  1.00 37.65  ? 436 GLY A C     1 
ATOM   3439  O O     . GLY A 1 436 ? 35.702  78.627 45.883  1.00 37.80  ? 436 GLY A O     1 
ATOM   3440  N N     . LEU A 1 437 ? 35.980  76.740 47.052  1.00 38.53  ? 437 LEU A N     1 
ATOM   3441  C CA    . LEU A 1 437 ? 36.718  77.298 48.152  1.00 38.45  ? 437 LEU A CA    1 
ATOM   3442  C C     . LEU A 1 437 ? 38.207  77.231 47.808  1.00 39.95  ? 437 LEU A C     1 
ATOM   3443  O O     . LEU A 1 437 ? 39.020  77.802 48.532  1.00 38.23  ? 437 LEU A O     1 
ATOM   3444  C CB    . LEU A 1 437 ? 36.522  76.427 49.406  1.00 38.41  ? 437 LEU A CB    1 
ATOM   3445  C CG    . LEU A 1 437 ? 35.310  76.624 50.326  1.00 39.10  ? 437 LEU A CG    1 
ATOM   3446  C CD1   . LEU A 1 437 ? 35.593  76.030 51.707  1.00 39.29  ? 437 LEU A CD1   1 
ATOM   3447  C CD2   . LEU A 1 437 ? 34.910  78.078 50.488  1.00 42.19  ? 437 LEU A CD2   1 
ATOM   3448  N N     . LYS A 1 438 ? 38.580  76.424 46.819  1.00 40.43  ? 438 LYS A N     1 
ATOM   3449  C CA    . LYS A 1 438 ? 39.979  76.189 46.472  1.00 47.03  ? 438 LYS A CA    1 
ATOM   3450  C C     . LYS A 1 438 ? 40.859  77.438 46.499  1.00 49.10  ? 438 LYS A C     1 
ATOM   3451  O O     . LYS A 1 438 ? 41.787  77.536 47.305  1.00 48.76  ? 438 LYS A O     1 
ATOM   3452  C CB    . LYS A 1 438 ? 40.139  75.476 45.127  1.00 41.23  ? 438 LYS A CB    1 
ATOM   3453  C CG    . LYS A 1 438 ? 40.577  74.022 45.331  1.00 44.67  ? 438 LYS A CG    1 
ATOM   3454  C CD    . LYS A 1 438 ? 39.949  73.164 44.239  1.00 46.37  ? 438 LYS A CD    1 
ATOM   3455  C CE    . LYS A 1 438 ? 40.877  73.105 43.032  1.00 48.52  ? 438 LYS A CE    1 
ATOM   3456  N NZ    . LYS A 1 438 ? 40.601  71.906 42.195  1.00 55.00  ? 438 LYS A NZ    1 
ATOM   3457  N N     . GLU A 1 439 ? 40.502  78.408 45.671  1.00 53.45  ? 439 GLU A N     1 
ATOM   3458  C CA    . GLU A 1 439 ? 41.236  79.675 45.652  1.00 59.61  ? 439 GLU A CA    1 
ATOM   3459  C C     . GLU A 1 439 ? 41.268  80.264 47.055  1.00 59.82  ? 439 GLU A C     1 
ATOM   3460  O O     . GLU A 1 439 ? 42.320  80.436 47.679  1.00 61.32  ? 439 GLU A O     1 
ATOM   3461  C CB    . GLU A 1 439 ? 40.572  80.604 44.629  1.00 73.30  ? 439 GLU A CB    1 
ATOM   3462  C CG    . GLU A 1 439 ? 40.282  79.896 43.313  1.00 86.66  ? 439 GLU A CG    1 
ATOM   3463  C CD    . GLU A 1 439 ? 39.479  80.686 42.306  1.00 96.15  ? 439 GLU A CD    1 
ATOM   3464  O OE1   . GLU A 1 439 ? 39.402  81.931 42.433  1.00 101.25 ? 439 GLU A OE1   1 
ATOM   3465  O OE2   . GLU A 1 439 ? 38.919  80.060 41.372  1.00 99.70  ? 439 GLU A OE2   1 
ATOM   3466  N N     . LYS A 1 440 ? 40.095  80.472 47.637  1.00 57.96  ? 440 LYS A N     1 
ATOM   3467  C CA    . LYS A 1 440 ? 39.864  81.032 48.948  1.00 53.21  ? 440 LYS A CA    1 
ATOM   3468  C C     . LYS A 1 440 ? 40.523  80.381 50.151  1.00 49.25  ? 440 LYS A C     1 
ATOM   3469  O O     . LYS A 1 440 ? 40.597  81.010 51.216  1.00 48.61  ? 440 LYS A O     1 
ATOM   3470  C CB    . LYS A 1 440 ? 38.337  81.001 49.184  1.00 58.23  ? 440 LYS A CB    1 
ATOM   3471  C CG    . LYS A 1 440 ? 37.832  82.054 50.152  1.00 65.75  ? 440 LYS A CG    1 
ATOM   3472  C CD    . LYS A 1 440 ? 36.441  82.547 49.787  1.00 69.56  ? 440 LYS A CD    1 
ATOM   3473  C CE    . LYS A 1 440 ? 36.413  83.274 48.449  1.00 72.87  ? 440 LYS A CE    1 
ATOM   3474  N NZ    . LYS A 1 440 ? 35.085  83.155 47.780  1.00 71.97  ? 440 LYS A NZ    1 
ATOM   3475  N N     . PHE A 1 441 ? 40.986  79.151 50.073  1.00 46.60  ? 441 PHE A N     1 
ATOM   3476  C CA    . PHE A 1 441 ? 41.578  78.445 51.188  1.00 50.51  ? 441 PHE A CA    1 
ATOM   3477  C C     . PHE A 1 441 ? 42.799  79.134 51.771  1.00 55.47  ? 441 PHE A C     1 
ATOM   3478  O O     . PHE A 1 441 ? 42.963  79.236 52.982  1.00 53.39  ? 441 PHE A O     1 
ATOM   3479  C CB    . PHE A 1 441 ? 41.998  77.049 50.724  1.00 49.26  ? 441 PHE A CB    1 
ATOM   3480  C CG    . PHE A 1 441 ? 40.898  76.032 50.668  1.00 55.95  ? 441 PHE A CG    1 
ATOM   3481  C CD1   . PHE A 1 441 ? 40.030  75.846 51.732  1.00 55.98  ? 441 PHE A CD1   1 
ATOM   3482  C CD2   . PHE A 1 441 ? 40.748  75.235 49.544  1.00 55.01  ? 441 PHE A CD2   1 
ATOM   3483  C CE1   . PHE A 1 441 ? 39.034  74.885 51.678  1.00 57.74  ? 441 PHE A CE1   1 
ATOM   3484  C CE2   . PHE A 1 441 ? 39.752  74.289 49.480  1.00 55.51  ? 441 PHE A CE2   1 
ATOM   3485  C CZ    . PHE A 1 441 ? 38.895  74.106 50.549  1.00 55.47  ? 441 PHE A CZ    1 
ATOM   3486  N N     . ALA A 1 442 ? 43.675  79.581 50.873  1.00 59.62  ? 442 ALA A N     1 
ATOM   3487  C CA    . ALA A 1 442 ? 44.926  80.251 51.183  1.00 63.60  ? 442 ALA A CA    1 
ATOM   3488  C C     . ALA A 1 442 ? 44.793  81.386 52.188  1.00 65.46  ? 442 ALA A C     1 
ATOM   3489  O O     . ALA A 1 442 ? 45.583  81.482 53.134  1.00 67.75  ? 442 ALA A O     1 
ATOM   3490  C CB    . ALA A 1 442 ? 45.533  80.783 49.882  1.00 64.84  ? 442 ALA A CB    1 
ATOM   3491  N N     . THR A 1 443 ? 43.770  82.218 52.052  1.00 65.15  ? 443 THR A N     1 
ATOM   3492  C CA    . THR A 1 443 ? 43.472  83.312 52.948  1.00 66.47  ? 443 THR A CA    1 
ATOM   3493  C C     . THR A 1 443 ? 42.906  82.899 54.301  1.00 67.28  ? 443 THR A C     1 
ATOM   3494  O O     . THR A 1 443 ? 42.720  83.813 55.121  1.00 69.06  ? 443 THR A O     1 
ATOM   3495  C CB    . THR A 1 443 ? 42.432  84.263 52.303  1.00 71.47  ? 443 THR A CB    1 
ATOM   3496  O OG1   . THR A 1 443 ? 41.107  83.708 52.450  1.00 76.01  ? 443 THR A OG1   1 
ATOM   3497  C CG2   . THR A 1 443 ? 42.703  84.461 50.824  1.00 71.71  ? 443 THR A CG2   1 
ATOM   3498  N N     . LEU A 1 444 ? 42.584  81.634 54.567  1.00 65.30  ? 444 LEU A N     1 
ATOM   3499  C CA    . LEU A 1 444 ? 42.021  81.274 55.866  1.00 65.34  ? 444 LEU A CA    1 
ATOM   3500  C C     . LEU A 1 444 ? 43.004  81.520 57.015  1.00 65.56  ? 444 LEU A C     1 
ATOM   3501  O O     . LEU A 1 444 ? 44.184  81.200 56.889  1.00 63.41  ? 444 LEU A O     1 
ATOM   3502  C CB    . LEU A 1 444 ? 41.566  79.827 55.928  1.00 59.43  ? 444 LEU A CB    1 
ATOM   3503  C CG    . LEU A 1 444 ? 40.294  79.386 55.220  1.00 57.18  ? 444 LEU A CG    1 
ATOM   3504  C CD1   . LEU A 1 444 ? 39.780  78.139 55.926  1.00 57.35  ? 444 LEU A CD1   1 
ATOM   3505  C CD2   . LEU A 1 444 ? 39.224  80.465 55.142  1.00 51.22  ? 444 LEU A CD2   1 
ATOM   3506  N N     . LYS A 1 445 ? 42.479  81.981 58.147  1.00 66.00  ? 445 LYS A N     1 
ATOM   3507  C CA    . LYS A 1 445 ? 43.261  82.341 59.307  1.00 67.76  ? 445 LYS A CA    1 
ATOM   3508  C C     . LYS A 1 445 ? 43.523  81.301 60.386  1.00 66.59  ? 445 LYS A C     1 
ATOM   3509  O O     . LYS A 1 445 ? 44.693  81.118 60.775  1.00 70.49  ? 445 LYS A O     1 
ATOM   3510  C CB    . LYS A 1 445 ? 42.608  83.542 60.031  1.00 75.87  ? 445 LYS A CB    1 
ATOM   3511  C CG    . LYS A 1 445 ? 41.676  84.397 59.198  1.00 84.35  ? 445 LYS A CG    1 
ATOM   3512  C CD    . LYS A 1 445 ? 41.431  85.752 59.850  1.00 90.69  ? 445 LYS A CD    1 
ATOM   3513  C CE    . LYS A 1 445 ? 41.396  86.854 58.797  1.00 92.95  ? 445 LYS A CE    1 
ATOM   3514  N NZ    . LYS A 1 445 ? 41.667  88.197 59.378  1.00 93.55  ? 445 LYS A NZ    1 
ATOM   3515  N N     . GLY A 1 446 ? 42.501  80.646 60.918  1.00 60.52  ? 446 GLY A N     1 
ATOM   3516  C CA    . GLY A 1 446 ? 42.709  79.700 62.024  1.00 54.22  ? 446 GLY A CA    1 
ATOM   3517  C C     . GLY A 1 446 ? 41.845  80.196 63.187  1.00 49.96  ? 446 GLY A C     1 
ATOM   3518  O O     . GLY A 1 446 ? 41.308  81.309 63.080  1.00 49.20  ? 446 GLY A O     1 
ATOM   3519  N N     . LEU A 1 447 ? 41.645  79.416 64.244  1.00 45.56  ? 447 LEU A N     1 
ATOM   3520  C CA    . LEU A 1 447 ? 40.760  79.850 65.309  1.00 49.74  ? 447 LEU A CA    1 
ATOM   3521  C C     . LEU A 1 447 ? 41.293  79.552 66.711  1.00 51.45  ? 447 LEU A C     1 
ATOM   3522  O O     . LEU A 1 447 ? 41.933  78.540 66.984  1.00 51.94  ? 447 LEU A O     1 
ATOM   3523  C CB    . LEU A 1 447 ? 39.383  79.163 65.268  1.00 48.63  ? 447 LEU A CB    1 
ATOM   3524  C CG    . LEU A 1 447 ? 38.564  79.140 63.985  1.00 48.94  ? 447 LEU A CG    1 
ATOM   3525  C CD1   . LEU A 1 447 ? 37.916  77.784 63.766  1.00 46.10  ? 447 LEU A CD1   1 
ATOM   3526  C CD2   . LEU A 1 447 ? 37.515  80.244 64.000  1.00 46.12  ? 447 LEU A CD2   1 
ATOM   3527  N N     . GLU A 1 448 ? 40.863  80.417 67.615  1.00 53.80  ? 448 GLU A N     1 
ATOM   3528  C CA    . GLU A 1 448 ? 41.190  80.267 69.028  1.00 60.08  ? 448 GLU A CA    1 
ATOM   3529  C C     . GLU A 1 448 ? 39.873  80.112 69.796  1.00 60.65  ? 448 GLU A C     1 
ATOM   3530  O O     . GLU A 1 448 ? 38.805  80.337 69.237  1.00 58.93  ? 448 GLU A O     1 
ATOM   3531  C CB    . GLU A 1 448 ? 41.934  81.498 69.561  1.00 63.79  ? 448 GLU A CB    1 
ATOM   3532  C CG    . GLU A 1 448 ? 41.279  82.806 69.129  1.00 71.93  ? 448 GLU A CG    1 
ATOM   3533  C CD    . GLU A 1 448 ? 42.177  84.008 69.352  1.00 77.95  ? 448 GLU A CD    1 
ATOM   3534  O OE1   . GLU A 1 448 ? 43.061  83.913 70.233  1.00 77.80  ? 448 GLU A OE1   1 
ATOM   3535  O OE2   . GLU A 1 448 ? 41.996  85.029 68.653  1.00 81.70  ? 448 GLU A OE2   1 
ATOM   3536  N N     . PHE A 1 449 ? 40.000  79.856 71.088  1.00 61.84  ? 449 PHE A N     1 
ATOM   3537  C CA    . PHE A 1 449 ? 38.890  79.712 72.000  1.00 60.95  ? 449 PHE A CA    1 
ATOM   3538  C C     . PHE A 1 449 ? 38.415  81.002 72.653  1.00 63.03  ? 449 PHE A C     1 
ATOM   3539  O O     . PHE A 1 449 ? 39.205  81.685 73.303  1.00 63.97  ? 449 PHE A O     1 
ATOM   3540  C CB    . PHE A 1 449 ? 39.345  78.811 73.170  1.00 50.14  ? 449 PHE A CB    1 
ATOM   3541  C CG    . PHE A 1 449 ? 39.464  77.357 72.807  1.00 51.90  ? 449 PHE A CG    1 
ATOM   3542  C CD1   . PHE A 1 449 ? 38.328  76.612 72.539  1.00 52.03  ? 449 PHE A CD1   1 
ATOM   3543  C CD2   . PHE A 1 449 ? 40.698  76.732 72.733  1.00 46.66  ? 449 PHE A CD2   1 
ATOM   3544  C CE1   . PHE A 1 449 ? 38.429  75.273 72.210  1.00 53.98  ? 449 PHE A CE1   1 
ATOM   3545  C CE2   . PHE A 1 449 ? 40.811  75.401 72.422  1.00 47.81  ? 449 PHE A CE2   1 
ATOM   3546  C CZ    . PHE A 1 449 ? 39.667  74.669 72.151  1.00 54.13  ? 449 PHE A CZ    1 
ATOM   3547  N N     . GLU A 1 450 ? 37.117  81.274 72.582  1.00 64.96  ? 450 GLU A N     1 
ATOM   3548  C CA    . GLU A 1 450 ? 36.494  82.384 73.289  1.00 65.72  ? 450 GLU A CA    1 
ATOM   3549  C C     . GLU A 1 450 ? 36.090  81.858 74.677  1.00 65.72  ? 450 GLU A C     1 
ATOM   3550  O O     . GLU A 1 450 ? 36.114  82.546 75.692  1.00 65.82  ? 450 GLU A O     1 
ATOM   3551  C CB    . GLU A 1 450 ? 35.256  82.926 72.591  1.00 75.98  ? 450 GLU A CB    1 
ATOM   3552  C CG    . GLU A 1 450 ? 34.546  84.014 73.379  1.00 86.08  ? 450 GLU A CG    1 
ATOM   3553  C CD    . GLU A 1 450 ? 33.046  84.057 73.203  1.00 92.97  ? 450 GLU A CD    1 
ATOM   3554  O OE1   . GLU A 1 450 ? 32.575  84.093 72.042  1.00 96.63  ? 450 GLU A OE1   1 
ATOM   3555  O OE2   . GLU A 1 450 ? 32.330  84.069 74.230  1.00 96.14  ? 450 GLU A OE2   1 
ATOM   3556  N N     . TYR A 1 451 ? 35.729  80.582 74.691  1.00 64.31  ? 451 TYR A N     1 
ATOM   3557  C CA    . TYR A 1 451 ? 35.376  79.869 75.906  1.00 64.84  ? 451 TYR A CA    1 
ATOM   3558  C C     . TYR A 1 451 ? 35.666  78.385 75.703  1.00 63.05  ? 451 TYR A C     1 
ATOM   3559  O O     . TYR A 1 451 ? 35.031  77.781 74.830  1.00 63.92  ? 451 TYR A O     1 
ATOM   3560  C CB    . TYR A 1 451 ? 33.909  80.107 76.304  1.00 68.93  ? 451 TYR A CB    1 
ATOM   3561  C CG    . TYR A 1 451 ? 33.388  78.983 77.177  1.00 76.74  ? 451 TYR A CG    1 
ATOM   3562  C CD1   . TYR A 1 451 ? 33.957  78.730 78.421  1.00 79.92  ? 451 TYR A CD1   1 
ATOM   3563  C CD2   . TYR A 1 451 ? 32.371  78.148 76.734  1.00 80.01  ? 451 TYR A CD2   1 
ATOM   3564  C CE1   . TYR A 1 451 ? 33.514  77.688 79.211  1.00 81.60  ? 451 TYR A CE1   1 
ATOM   3565  C CE2   . TYR A 1 451 ? 31.926  77.103 77.525  1.00 83.38  ? 451 TYR A CE2   1 
ATOM   3566  C CZ    . TYR A 1 451 ? 32.498  76.879 78.758  1.00 84.00  ? 451 TYR A CZ    1 
ATOM   3567  O OH    . TYR A 1 451 ? 32.049  75.838 79.541  1.00 86.50  ? 451 TYR A OH    1 
ATOM   3568  N N     . GLU A 1 452 ? 36.543  77.790 76.495  1.00 60.57  ? 452 GLU A N     1 
ATOM   3569  C CA    . GLU A 1 452 ? 36.828  76.368 76.344  1.00 62.25  ? 452 GLU A CA    1 
ATOM   3570  C C     . GLU A 1 452 ? 36.470  75.551 77.574  1.00 64.43  ? 452 GLU A C     1 
ATOM   3571  O O     . GLU A 1 452 ? 37.161  75.596 78.590  1.00 67.85  ? 452 GLU A O     1 
ATOM   3572  C CB    . GLU A 1 452 ? 38.309  76.150 76.004  1.00 58.33  ? 452 GLU A CB    1 
ATOM   3573  C CG    . GLU A 1 452 ? 38.852  74.744 76.216  1.00 54.31  ? 452 GLU A CG    1 
ATOM   3574  C CD    . GLU A 1 452 ? 40.329  74.615 75.907  1.00 55.04  ? 452 GLU A CD    1 
ATOM   3575  O OE1   . GLU A 1 452 ? 41.011  75.662 75.829  1.00 54.59  ? 452 GLU A OE1   1 
ATOM   3576  O OE2   . GLU A 1 452 ? 40.834  73.480 75.741  1.00 51.38  ? 452 GLU A OE2   1 
ATOM   3577  N N     . PRO A 1 453 ? 35.433  74.735 77.477  1.00 66.44  ? 453 PRO A N     1 
ATOM   3578  C CA    . PRO A 1 453 ? 35.031  73.849 78.559  1.00 66.85  ? 453 PRO A CA    1 
ATOM   3579  C C     . PRO A 1 453 ? 36.040  72.719 78.729  1.00 66.04  ? 453 PRO A C     1 
ATOM   3580  O O     . PRO A 1 453 ? 36.722  72.307 77.795  1.00 64.30  ? 453 PRO A O     1 
ATOM   3581  C CB    . PRO A 1 453 ? 33.646  73.354 78.183  1.00 66.90  ? 453 PRO A CB    1 
ATOM   3582  C CG    . PRO A 1 453 ? 33.319  73.931 76.860  1.00 67.24  ? 453 PRO A CG    1 
ATOM   3583  C CD    . PRO A 1 453 ? 34.547  74.597 76.301  1.00 66.30  ? 453 PRO A CD    1 
ATOM   3584  N N     . PRO A 1 454 ? 36.147  72.199 79.952  1.00 68.00  ? 454 PRO A N     1 
ATOM   3585  C CA    . PRO A 1 454 ? 37.068  71.155 80.319  1.00 67.94  ? 454 PRO A CA    1 
ATOM   3586  C C     . PRO A 1 454 ? 37.031  69.842 79.575  1.00 67.05  ? 454 PRO A C     1 
ATOM   3587  O O     . PRO A 1 454 ? 38.106  69.355 79.191  1.00 67.66  ? 454 PRO A O     1 
ATOM   3588  C CB    . PRO A 1 454 ? 36.769  70.849 81.791  1.00 68.79  ? 454 PRO A CB    1 
ATOM   3589  C CG    . PRO A 1 454 ? 35.939  71.963 82.297  1.00 69.26  ? 454 PRO A CG    1 
ATOM   3590  C CD    . PRO A 1 454 ? 35.376  72.700 81.123  1.00 68.34  ? 454 PRO A CD    1 
ATOM   3591  N N     . VAL A 1 455 ? 35.894  69.152 79.532  1.00 66.61  ? 455 VAL A N     1 
ATOM   3592  C CA    . VAL A 1 455 ? 35.842  67.833 78.870  1.00 65.04  ? 455 VAL A CA    1 
ATOM   3593  C C     . VAL A 1 455 ? 34.667  67.809 77.899  1.00 64.15  ? 455 VAL A C     1 
ATOM   3594  O O     . VAL A 1 455 ? 34.536  66.865 77.097  1.00 63.63  ? 455 VAL A O     1 
ATOM   3595  C CB    . VAL A 1 455 ? 35.917  66.666 79.853  1.00 66.04  ? 455 VAL A CB    1 
ATOM   3596  C CG1   . VAL A 1 455 ? 35.528  65.305 79.287  1.00 69.24  ? 455 VAL A CG1   1 
ATOM   3597  C CG2   . VAL A 1 455 ? 37.345  66.466 80.381  1.00 68.77  ? 455 VAL A CG2   1 
ATOM   3598  N N     . LEU A 1 456 ? 33.866  68.887 77.841  1.00 61.53  ? 456 LEU A N     1 
ATOM   3599  C CA    . LEU A 1 456 ? 32.831  68.939 76.805  1.00 62.47  ? 456 LEU A CA    1 
ATOM   3600  C C     . LEU A 1 456 ? 33.241  69.998 75.769  1.00 60.25  ? 456 LEU A C     1 
ATOM   3601  O O     . LEU A 1 456 ? 32.568  70.950 75.387  1.00 61.17  ? 456 LEU A O     1 
ATOM   3602  C CB    . LEU A 1 456 ? 31.405  69.172 77.295  1.00 64.24  ? 456 LEU A CB    1 
ATOM   3603  C CG    . LEU A 1 456 ? 30.375  68.376 76.470  1.00 62.06  ? 456 LEU A CG    1 
ATOM   3604  C CD1   . LEU A 1 456 ? 30.262  66.948 76.991  1.00 63.23  ? 456 LEU A CD1   1 
ATOM   3605  C CD2   . LEU A 1 456 ? 29.033  69.068 76.448  1.00 62.86  ? 456 LEU A CD2   1 
ATOM   3606  N N     . ARG A 1 457 ? 34.459  69.824 75.276  1.00 55.69  ? 457 ARG A N     1 
ATOM   3607  C CA    . ARG A 1 457 ? 35.124  70.756 74.389  1.00 47.71  ? 457 ARG A CA    1 
ATOM   3608  C C     . ARG A 1 457 ? 34.390  71.044 73.093  1.00 41.93  ? 457 ARG A C     1 
ATOM   3609  O O     . ARG A 1 457 ? 33.785  72.116 72.968  1.00 38.48  ? 457 ARG A O     1 
ATOM   3610  C CB    . ARG A 1 457 ? 36.535  70.189 74.168  1.00 49.33  ? 457 ARG A CB    1 
ATOM   3611  C CG    . ARG A 1 457 ? 37.609  71.245 73.957  1.00 58.28  ? 457 ARG A CG    1 
ATOM   3612  C CD    . ARG A 1 457 ? 38.823  70.612 73.272  1.00 51.32  ? 457 ARG A CD    1 
ATOM   3613  N NE    . ARG A 1 457 ? 39.800  71.652 72.988  1.00 56.50  ? 457 ARG A NE    1 
ATOM   3614  C CZ    . ARG A 1 457 ? 40.965  71.454 72.378  1.00 60.36  ? 457 ARG A CZ    1 
ATOM   3615  N NH1   . ARG A 1 457 ? 41.349  70.264 71.931  1.00 55.68  ? 457 ARG A NH1   1 
ATOM   3616  N NH2   . ARG A 1 457 ? 41.782  72.493 72.200  1.00 57.34  ? 457 ARG A NH2   1 
ATOM   3617  N N     . HIS A 1 458 ? 34.432  70.103 72.164  1.00 38.30  ? 458 HIS A N     1 
ATOM   3618  C CA    . HIS A 1 458 ? 33.931  70.213 70.802  1.00 43.19  ? 458 HIS A CA    1 
ATOM   3619  C C     . HIS A 1 458 ? 32.454  70.506 70.605  1.00 40.53  ? 458 HIS A C     1 
ATOM   3620  O O     . HIS A 1 458 ? 32.001  71.267 69.750  1.00 39.42  ? 458 HIS A O     1 
ATOM   3621  C CB    . HIS A 1 458 ? 34.248  68.907 70.044  1.00 48.39  ? 458 HIS A CB    1 
ATOM   3622  C CG    . HIS A 1 458 ? 33.853  67.706 70.843  1.00 59.13  ? 458 HIS A CG    1 
ATOM   3623  N ND1   . HIS A 1 458 ? 34.716  67.043 71.685  1.00 64.36  ? 458 HIS A ND1   1 
ATOM   3624  C CD2   . HIS A 1 458 ? 32.670  67.066 70.936  1.00 62.68  ? 458 HIS A CD2   1 
ATOM   3625  C CE1   . HIS A 1 458 ? 34.084  66.034 72.260  1.00 69.51  ? 458 HIS A CE1   1 
ATOM   3626  N NE2   . HIS A 1 458 ? 32.831  66.022 71.821  1.00 68.69  ? 458 HIS A NE2   1 
ATOM   3627  N N     . PHE A 1 459 ? 31.647  69.918 71.475  1.00 41.75  ? 459 PHE A N     1 
ATOM   3628  C CA    . PHE A 1 459 ? 30.205  70.152 71.466  1.00 40.24  ? 459 PHE A CA    1 
ATOM   3629  C C     . PHE A 1 459 ? 29.947  71.555 71.994  1.00 41.98  ? 459 PHE A C     1 
ATOM   3630  O O     . PHE A 1 459 ? 29.070  72.265 71.523  1.00 44.35  ? 459 PHE A O     1 
ATOM   3631  C CB    . PHE A 1 459 ? 29.532  69.122 72.349  1.00 27.18  ? 459 PHE A CB    1 
ATOM   3632  C CG    . PHE A 1 459 ? 29.628  67.673 72.040  1.00 29.91  ? 459 PHE A CG    1 
ATOM   3633  C CD1   . PHE A 1 459 ? 29.347  67.174 70.775  1.00 36.10  ? 459 PHE A CD1   1 
ATOM   3634  C CD2   . PHE A 1 459 ? 29.945  66.765 73.018  1.00 32.44  ? 459 PHE A CD2   1 
ATOM   3635  C CE1   . PHE A 1 459 ? 29.409  65.811 70.507  1.00 34.62  ? 459 PHE A CE1   1 
ATOM   3636  C CE2   . PHE A 1 459 ? 29.993  65.411 72.760  1.00 33.44  ? 459 PHE A CE2   1 
ATOM   3637  C CZ    . PHE A 1 459 ? 29.737  64.907 71.503  1.00 33.38  ? 459 PHE A CZ    1 
ATOM   3638  N N     . THR A 1 460 ? 30.726  71.978 73.000  1.00 45.25  ? 460 THR A N     1 
ATOM   3639  C CA    . THR A 1 460 ? 30.473  73.253 73.655  1.00 42.34  ? 460 THR A CA    1 
ATOM   3640  C C     . THR A 1 460 ? 31.398  74.429 73.446  1.00 44.08  ? 460 THR A C     1 
ATOM   3641  O O     . THR A 1 460 ? 30.863  75.549 73.583  1.00 40.92  ? 460 THR A O     1 
ATOM   3642  C CB    . THR A 1 460 ? 30.551  72.958 75.183  1.00 42.47  ? 460 THR A CB    1 
ATOM   3643  O OG1   . THR A 1 460 ? 30.248  71.569 75.320  1.00 47.55  ? 460 THR A OG1   1 
ATOM   3644  C CG2   . THR A 1 460 ? 29.602  73.798 76.000  1.00 44.47  ? 460 THR A CG2   1 
ATOM   3645  N N     . ALA A 1 461 ? 32.699  74.246 73.186  1.00 41.51  ? 461 ALA A N     1 
ATOM   3646  C CA    . ALA A 1 461 ? 33.530  75.452 73.137  1.00 40.62  ? 461 ALA A CA    1 
ATOM   3647  C C     . ALA A 1 461 ? 33.089  76.535 72.168  1.00 44.22  ? 461 ALA A C     1 
ATOM   3648  O O     . ALA A 1 461 ? 32.746  76.365 70.995  1.00 44.11  ? 461 ALA A O     1 
ATOM   3649  C CB    . ALA A 1 461 ? 34.989  75.114 72.902  1.00 46.08  ? 461 ALA A CB    1 
ATOM   3650  N N     . ARG A 1 462 ? 33.105  77.768 72.693  1.00 43.49  ? 462 ARG A N     1 
ATOM   3651  C CA    . ARG A 1 462 ? 32.855  78.954 71.853  1.00 44.53  ? 462 ARG A CA    1 
ATOM   3652  C C     . ARG A 1 462 ? 34.243  79.371 71.360  1.00 45.97  ? 462 ARG A C     1 
ATOM   3653  O O     . ARG A 1 462 ? 35.236  79.202 72.079  1.00 46.29  ? 462 ARG A O     1 
ATOM   3654  C CB    . ARG A 1 462 ? 32.146  80.057 72.621  1.00 47.50  ? 462 ARG A CB    1 
ATOM   3655  C CG    . ARG A 1 462 ? 31.136  79.478 73.614  1.00 50.14  ? 462 ARG A CG    1 
ATOM   3656  C CD    . ARG A 1 462 ? 29.813  80.200 73.534  1.00 47.48  ? 462 ARG A CD    1 
ATOM   3657  N NE    . ARG A 1 462 ? 29.945  81.564 73.024  1.00 49.66  ? 462 ARG A NE    1 
ATOM   3658  C CZ    . ARG A 1 462 ? 29.088  82.057 72.127  1.00 54.80  ? 462 ARG A CZ    1 
ATOM   3659  N NH1   . ARG A 1 462 ? 28.081  81.302 71.674  1.00 53.23  ? 462 ARG A NH1   1 
ATOM   3660  N NH2   . ARG A 1 462 ? 29.227  83.297 71.670  1.00 51.22  ? 462 ARG A NH2   1 
ATOM   3661  N N     . LEU A 1 463 ? 34.382  79.691 70.088  1.00 45.07  ? 463 LEU A N     1 
ATOM   3662  C CA    . LEU A 1 463 ? 35.675  79.978 69.504  1.00 45.23  ? 463 LEU A CA    1 
ATOM   3663  C C     . LEU A 1 463 ? 35.574  81.247 68.658  1.00 47.23  ? 463 LEU A C     1 
ATOM   3664  O O     . LEU A 1 463 ? 34.492  81.704 68.303  1.00 49.01  ? 463 LEU A O     1 
ATOM   3665  C CB    . LEU A 1 463 ? 36.218  78.858 68.649  1.00 45.61  ? 463 LEU A CB    1 
ATOM   3666  C CG    . LEU A 1 463 ? 36.103  77.363 68.678  1.00 42.55  ? 463 LEU A CG    1 
ATOM   3667  C CD1   . LEU A 1 463 ? 37.188  76.718 67.803  1.00 45.31  ? 463 LEU A CD1   1 
ATOM   3668  C CD2   . LEU A 1 463 ? 36.227  76.714 70.050  1.00 50.78  ? 463 LEU A CD2   1 
ATOM   3669  N N     . LYS A 1 464 ? 36.745  81.800 68.348  1.00 50.00  ? 464 LYS A N     1 
ATOM   3670  C CA    . LYS A 1 464 ? 36.815  82.966 67.471  1.00 51.43  ? 464 LYS A CA    1 
ATOM   3671  C C     . LYS A 1 464 ? 37.999  82.763 66.524  1.00 51.21  ? 464 LYS A C     1 
ATOM   3672  O O     . LYS A 1 464 ? 38.884  81.939 66.767  1.00 49.21  ? 464 LYS A O     1 
ATOM   3673  C CB    . LYS A 1 464 ? 36.875  84.272 68.245  1.00 61.62  ? 464 LYS A CB    1 
ATOM   3674  C CG    . LYS A 1 464 ? 38.094  84.484 69.121  1.00 70.12  ? 464 LYS A CG    1 
ATOM   3675  C CD    . LYS A 1 464 ? 37.795  85.409 70.295  1.00 77.90  ? 464 LYS A CD    1 
ATOM   3676  C CE    . LYS A 1 464 ? 38.924  85.387 71.315  1.00 82.46  ? 464 LYS A CE    1 
ATOM   3677  N NZ    . LYS A 1 464 ? 38.446  85.230 72.716  1.00 84.77  ? 464 LYS A NZ    1 
ATOM   3678  N N     . PRO A 1 465 ? 37.942  83.424 65.378  1.00 52.74  ? 465 PRO A N     1 
ATOM   3679  C CA    . PRO A 1 465 ? 38.986  83.384 64.371  1.00 56.63  ? 465 PRO A CA    1 
ATOM   3680  C C     . PRO A 1 465 ? 40.206  84.206 64.779  1.00 58.39  ? 465 PRO A C     1 
ATOM   3681  O O     . PRO A 1 465 ? 40.058  85.310 65.314  1.00 58.23  ? 465 PRO A O     1 
ATOM   3682  C CB    . PRO A 1 465 ? 38.347  84.010 63.132  1.00 57.30  ? 465 PRO A CB    1 
ATOM   3683  C CG    . PRO A 1 465 ? 36.978  84.456 63.503  1.00 55.13  ? 465 PRO A CG    1 
ATOM   3684  C CD    . PRO A 1 465 ? 36.895  84.413 65.007  1.00 54.11  ? 465 PRO A CD    1 
ATOM   3685  N N     . ILE A 1 466 ? 41.395  83.670 64.550  1.00 60.93  ? 466 ILE A N     1 
ATOM   3686  C CA    . ILE A 1 466 ? 42.646  84.341 64.884  1.00 62.67  ? 466 ILE A CA    1 
ATOM   3687  C C     . ILE A 1 466 ? 42.908  85.491 63.922  1.00 65.62  ? 466 ILE A C     1 
ATOM   3688  O O     . ILE A 1 466 ? 41.966  86.225 63.549  1.00 67.87  ? 466 ILE A O     1 
ATOM   3689  C CB    . ILE A 1 466 ? 43.824  83.352 64.876  1.00 62.58  ? 466 ILE A CB    1 
ATOM   3690  C CG1   . ILE A 1 466 ? 43.821  82.518 66.160  1.00 60.22  ? 466 ILE A CG1   1 
ATOM   3691  C CG2   . ILE A 1 466 ? 45.172  84.047 64.726  1.00 68.67  ? 466 ILE A CG2   1 
ATOM   3692  C CD1   . ILE A 1 466 ? 44.669  81.269 66.094  1.00 58.03  ? 466 ILE A CD1   1 
ATOM   3693  N N     . ALA B 1 2   ? -21.253 55.229 93.121  1.00 32.80  ? 2   ALA B N     1 
ATOM   3694  C CA    . ALA B 1 2   ? -20.124 55.465 92.140  1.00 27.69  ? 2   ALA B CA    1 
ATOM   3695  C C     . ALA B 1 2   ? -20.635 56.326 90.998  1.00 27.28  ? 2   ALA B C     1 
ATOM   3696  O O     . ALA B 1 2   ? -21.734 56.098 90.468  1.00 33.08  ? 2   ALA B O     1 
ATOM   3697  C CB    . ALA B 1 2   ? -19.612 54.103 91.716  1.00 16.33  ? 2   ALA B CB    1 
ATOM   3698  N N     . LYS B 1 3   ? -19.934 57.360 90.603  1.00 23.58  ? 3   LYS B N     1 
ATOM   3699  C CA    . LYS B 1 3   ? -20.322 58.302 89.579  1.00 23.89  ? 3   LYS B CA    1 
ATOM   3700  C C     . LYS B 1 3   ? -19.408 58.216 88.357  1.00 24.97  ? 3   LYS B C     1 
ATOM   3701  O O     . LYS B 1 3   ? -18.186 58.334 88.499  1.00 20.60  ? 3   LYS B O     1 
ATOM   3702  C CB    . LYS B 1 3   ? -20.235 59.711 90.171  1.00 24.51  ? 3   LYS B CB    1 
ATOM   3703  C CG    . LYS B 1 3   ? -20.623 60.854 89.260  1.00 47.18  ? 3   LYS B CG    1 
ATOM   3704  C CD    . LYS B 1 3   ? -20.419 62.217 89.912  1.00 58.56  ? 3   LYS B CD    1 
ATOM   3705  C CE    . LYS B 1 3   ? -18.983 62.472 90.333  1.00 66.73  ? 3   LYS B CE    1 
ATOM   3706  N NZ    . LYS B 1 3   ? -18.581 63.900 90.226  1.00 75.37  ? 3   LYS B NZ    1 
ATOM   3707  N N     . ARG B 1 4   ? -20.008 58.010 87.183  1.00 21.19  ? 4   ARG B N     1 
ATOM   3708  C CA    . ARG B 1 4   ? -19.268 57.961 85.926  1.00 20.07  ? 4   ARG B CA    1 
ATOM   3709  C C     . ARG B 1 4   ? -19.082 59.364 85.394  1.00 20.58  ? 4   ARG B C     1 
ATOM   3710  O O     . ARG B 1 4   ? -19.985 60.203 85.456  1.00 18.76  ? 4   ARG B O     1 
ATOM   3711  C CB    . ARG B 1 4   ? -20.025 57.137 84.881  1.00 18.44  ? 4   ARG B CB    1 
ATOM   3712  C CG    . ARG B 1 4   ? -19.963 55.672 85.264  1.00 19.63  ? 4   ARG B CG    1 
ATOM   3713  C CD    . ARG B 1 4   ? -20.984 54.822 84.533  1.00 27.50  ? 4   ARG B CD    1 
ATOM   3714  N NE    . ARG B 1 4   ? -20.577 54.518 83.193  1.00 36.10  ? 4   ARG B NE    1 
ATOM   3715  C CZ    . ARG B 1 4   ? -20.264 53.371 82.626  1.00 38.60  ? 4   ARG B CZ    1 
ATOM   3716  N NH1   . ARG B 1 4   ? -20.255 52.229 83.292  1.00 25.49  ? 4   ARG B NH1   1 
ATOM   3717  N NH2   . ARG B 1 4   ? -19.958 53.342 81.332  1.00 40.10  ? 4   ARG B NH2   1 
ATOM   3718  N N     . ILE B 1 5   ? -17.861 59.708 85.001  1.00 15.42  ? 5   ILE B N     1 
ATOM   3719  C CA    . ILE B 1 5   ? -17.640 61.060 84.467  1.00 14.84  ? 5   ILE B CA    1 
ATOM   3720  C C     . ILE B 1 5   ? -17.379 60.921 82.958  1.00 18.63  ? 5   ILE B C     1 
ATOM   3721  O O     . ILE B 1 5   ? -16.612 60.051 82.551  1.00 19.13  ? 5   ILE B O     1 
ATOM   3722  C CB    . ILE B 1 5   ? -16.479 61.722 85.217  1.00 21.44  ? 5   ILE B CB    1 
ATOM   3723  C CG1   . ILE B 1 5   ? -16.926 61.923 86.685  1.00 27.39  ? 5   ILE B CG1   1 
ATOM   3724  C CG2   . ILE B 1 5   ? -16.136 63.078 84.632  1.00 11.83  ? 5   ILE B CG2   1 
ATOM   3725  C CD1   . ILE B 1 5   ? -15.858 62.495 87.575  1.00 34.13  ? 5   ILE B CD1   1 
ATOM   3726  N N     . VAL B 1 6   ? -18.001 61.746 82.136  1.00 16.60  ? 6   VAL B N     1 
ATOM   3727  C CA    . VAL B 1 6   ? -17.926 61.640 80.682  1.00 14.75  ? 6   VAL B CA    1 
ATOM   3728  C C     . VAL B 1 6   ? -16.599 62.128 80.144  1.00 11.06  ? 6   VAL B C     1 
ATOM   3729  O O     . VAL B 1 6   ? -15.992 63.126 80.566  1.00 9.99   ? 6   VAL B O     1 
ATOM   3730  C CB    . VAL B 1 6   ? -19.135 62.347 80.041  1.00 17.01  ? 6   VAL B CB    1 
ATOM   3731  C CG1   . VAL B 1 6   ? -19.058 63.849 80.213  1.00 18.02  ? 6   VAL B CG1   1 
ATOM   3732  C CG2   . VAL B 1 6   ? -19.257 62.035 78.544  1.00 16.18  ? 6   VAL B CG2   1 
ATOM   3733  N N     . GLU B 1 7   ? -16.148 61.478 79.058  1.00 13.20  ? 7   GLU B N     1 
ATOM   3734  C CA    . GLU B 1 7   ? -14.868 61.923 78.446  1.00 11.52  ? 7   GLU B CA    1 
ATOM   3735  C C     . GLU B 1 7   ? -14.960 63.308 77.878  1.00 11.33  ? 7   GLU B C     1 
ATOM   3736  O O     . GLU B 1 7   ? -15.845 63.610 77.086  1.00 12.40  ? 7   GLU B O     1 
ATOM   3737  C CB    . GLU B 1 7   ? -14.542 60.981 77.288  1.00 12.60  ? 7   GLU B CB    1 
ATOM   3738  C CG    . GLU B 1 7   ? -14.144 59.616 77.759  1.00 9.14   ? 7   GLU B CG    1 
ATOM   3739  C CD    . GLU B 1 7   ? -15.288 58.706 78.093  1.00 17.47  ? 7   GLU B CD    1 
ATOM   3740  O OE1   . GLU B 1 7   ? -16.466 59.039 77.885  1.00 14.20  ? 7   GLU B OE1   1 
ATOM   3741  O OE2   . GLU B 1 7   ? -14.984 57.599 78.557  1.00 13.16  ? 7   GLU B OE2   1 
ATOM   3742  N N     . PRO B 1 8   ? -14.003 64.184 78.134  1.00 13.25  ? 8   PRO B N     1 
ATOM   3743  C CA    . PRO B 1 8   ? -13.957 65.501 77.497  1.00 10.34  ? 8   PRO B CA    1 
ATOM   3744  C C     . PRO B 1 8   ? -13.245 65.397 76.124  1.00 11.36  ? 8   PRO B C     1 
ATOM   3745  O O     . PRO B 1 8   ? -12.494 66.257 75.693  1.00 9.13   ? 8   PRO B O     1 
ATOM   3746  C CB    . PRO B 1 8   ? -13.078 66.314 78.445  1.00 10.95  ? 8   PRO B CB    1 
ATOM   3747  C CG    . PRO B 1 8   ? -12.241 65.302 79.176  1.00 9.17   ? 8   PRO B CG    1 
ATOM   3748  C CD    . PRO B 1 8   ? -12.889 63.934 79.094  1.00 11.44  ? 8   PRO B CD    1 
ATOM   3749  N N     . PHE B 1 9   ? -13.433 64.329 75.368  1.00 9.22   ? 9   PHE B N     1 
ATOM   3750  C CA    . PHE B 1 9   ? -12.785 64.105 74.090  1.00 13.53  ? 9   PHE B CA    1 
ATOM   3751  C C     . PHE B 1 9   ? -13.609 63.039 73.397  1.00 13.00  ? 9   PHE B C     1 
ATOM   3752  O O     . PHE B 1 9   ? -14.470 62.424 74.050  1.00 13.56  ? 9   PHE B O     1 
ATOM   3753  C CB    . PHE B 1 9   ? -11.328 63.579 74.219  1.00 6.99   ? 9   PHE B CB    1 
ATOM   3754  C CG    . PHE B 1 9   ? -11.144 62.339 75.067  1.00 9.93   ? 9   PHE B CG    1 
ATOM   3755  C CD1   . PHE B 1 9   ? -11.351 61.062 74.616  1.00 9.08   ? 9   PHE B CD1   1 
ATOM   3756  C CD2   . PHE B 1 9   ? -10.680 62.492 76.369  1.00 11.84  ? 9   PHE B CD2   1 
ATOM   3757  C CE1   . PHE B 1 9   ? -11.176 59.961 75.437  1.00 14.88  ? 9   PHE B CE1   1 
ATOM   3758  C CE2   . PHE B 1 9   ? -10.496 61.392 77.184  1.00 11.90  ? 9   PHE B CE2   1 
ATOM   3759  C CZ    . PHE B 1 9   ? -10.741 60.122 76.744  1.00 10.07  ? 9   PHE B CZ    1 
ATOM   3760  N N     . ARG B 1 10  ? -13.319 62.784 72.129  1.00 9.74   ? 10  ARG B N     1 
ATOM   3761  C CA    . ARG B 1 10  ? -14.033 61.621 71.532  1.00 8.15   ? 10  ARG B CA    1 
ATOM   3762  C C     . ARG B 1 10  ? -12.966 60.752 70.888  1.00 9.17   ? 10  ARG B C     1 
ATOM   3763  O O     . ARG B 1 10  ? -11.801 61.131 70.899  1.00 10.70  ? 10  ARG B O     1 
ATOM   3764  C CB    . ARG B 1 10  ? -15.124 62.078 70.582  1.00 15.44  ? 10  ARG B CB    1 
ATOM   3765  C CG    . ARG B 1 10  ? -14.661 62.989 69.488  1.00 15.70  ? 10  ARG B CG    1 
ATOM   3766  C CD    . ARG B 1 10  ? -15.822 63.363 68.547  1.00 19.95  ? 10  ARG B CD    1 
ATOM   3767  N NE    . ARG B 1 10  ? -15.332 64.317 67.582  1.00 15.84  ? 10  ARG B NE    1 
ATOM   3768  C CZ    . ARG B 1 10  ? -15.888 65.450 67.171  1.00 24.78  ? 10  ARG B CZ    1 
ATOM   3769  N NH1   . ARG B 1 10  ? -17.057 65.852 67.642  1.00 25.09  ? 10  ARG B NH1   1 
ATOM   3770  N NH2   . ARG B 1 10  ? -15.259 66.194 66.274  1.00 21.08  ? 10  ARG B NH2   1 
ATOM   3771  N N     . ILE B 1 11  ? -13.322 59.584 70.410  1.00 7.83   ? 11  ILE B N     1 
ATOM   3772  C CA    . ILE B 1 11  ? -12.353 58.643 69.885  1.00 10.78  ? 11  ILE B CA    1 
ATOM   3773  C C     . ILE B 1 11  ? -12.033 58.947 68.440  1.00 14.91  ? 11  ILE B C     1 
ATOM   3774  O O     . ILE B 1 11  ? -12.958 59.248 67.654  1.00 12.71  ? 11  ILE B O     1 
ATOM   3775  C CB    . ILE B 1 11  ? -12.947 57.246 70.054  1.00 7.53   ? 11  ILE B CB    1 
ATOM   3776  C CG1   . ILE B 1 11  ? -13.318 57.078 71.548  1.00 12.34  ? 11  ILE B CG1   1 
ATOM   3777  C CG2   . ILE B 1 11  ? -12.051 56.172 69.499  1.00 6.78   ? 11  ILE B CG2   1 
ATOM   3778  C CD1   . ILE B 1 11  ? -13.971 55.725 71.831  1.00 10.46  ? 11  ILE B CD1   1 
ATOM   3779  N N     . LYS B 1 12  ? -10.772 58.898 68.073  1.00 11.18  ? 12  LYS B N     1 
ATOM   3780  C CA    . LYS B 1 12  ? -10.369 59.176 66.678  1.00 11.17  ? 12  LYS B CA    1 
ATOM   3781  C C     . LYS B 1 12  ? -9.700  57.954 66.088  1.00 10.64  ? 12  LYS B C     1 
ATOM   3782  O O     . LYS B 1 12  ? -9.639  57.781 64.873  1.00 12.33  ? 12  LYS B O     1 
ATOM   3783  C CB    . LYS B 1 12  ? -9.435  60.391 66.606  1.00 14.48  ? 12  LYS B CB    1 
ATOM   3784  C CG    . LYS B 1 12  ? -9.261  60.869 65.156  1.00 19.67  ? 12  LYS B CG    1 
ATOM   3785  C CD    . LYS B 1 12  ? -9.082  62.355 65.086  1.00 16.73  ? 12  LYS B CD    1 
ATOM   3786  C CE    . LYS B 1 12  ? -8.632  62.903 63.729  1.00 16.15  ? 12  LYS B CE    1 
ATOM   3787  N NZ    . LYS B 1 12  ? -8.545  64.403 63.785  1.00 14.94  ? 12  LYS B NZ    1 
ATOM   3788  N N     . MET B 1 13  ? -9.139  57.077 66.954  1.00 5.71   ? 13  MET B N     1 
ATOM   3789  C CA    . MET B 1 13  ? -8.502  55.892 66.419  1.00 7.76   ? 13  MET B CA    1 
ATOM   3790  C C     . MET B 1 13  ? -8.668  54.797 67.443  1.00 7.86   ? 13  MET B C     1 
ATOM   3791  O O     . MET B 1 13  ? -8.455  55.050 68.637  1.00 7.26   ? 13  MET B O     1 
ATOM   3792  C CB    . MET B 1 13  ? -7.021  56.152 66.053  1.00 7.46   ? 13  MET B CB    1 
ATOM   3793  C CG    . MET B 1 13  ? -6.453  54.982 65.237  1.00 10.87  ? 13  MET B CG    1 
ATOM   3794  S SD    . MET B 1 13  ? -4.635  55.059 64.989  1.00 19.44  ? 13  MET B SD    1 
ATOM   3795  C CE    . MET B 1 13  ? -4.501  56.449 63.929  1.00 18.33  ? 13  MET B CE    1 
ATOM   3796  N N     . VAL B 1 14  ? -9.027  53.606 66.973  1.00 8.67   ? 14  VAL B N     1 
ATOM   3797  C CA    . VAL B 1 14  ? -9.185  52.493 67.869  1.00 10.10  ? 14  VAL B CA    1 
ATOM   3798  C C     . VAL B 1 14  ? -8.132  51.437 67.610  1.00 11.63  ? 14  VAL B C     1 
ATOM   3799  O O     . VAL B 1 14  ? -7.508  51.312 66.584  1.00 9.36   ? 14  VAL B O     1 
ATOM   3800  C CB    . VAL B 1 14  ? -10.578 51.852 67.822  1.00 9.43   ? 14  VAL B CB    1 
ATOM   3801  C CG1   . VAL B 1 14  ? -11.624 52.959 68.018  1.00 10.29  ? 14  VAL B CG1   1 
ATOM   3802  C CG2   . VAL B 1 14  ? -10.867 51.084 66.550  1.00 9.47   ? 14  VAL B CG2   1 
ATOM   3803  N N     . GLU B 1 15  ? -8.027  50.549 68.593  1.00 6.64   ? 15  GLU B N     1 
ATOM   3804  C CA    . GLU B 1 15  ? -7.136  49.408 68.541  1.00 11.08  ? 15  GLU B CA    1 
ATOM   3805  C C     . GLU B 1 15  ? -7.955  48.229 68.999  1.00 9.78   ? 15  GLU B C     1 
ATOM   3806  O O     . GLU B 1 15  ? -8.501  48.318 70.097  1.00 13.39  ? 15  GLU B O     1 
ATOM   3807  C CB    . GLU B 1 15  ? -5.961  49.731 69.516  1.00 8.56   ? 15  GLU B CB    1 
ATOM   3808  C CG    . GLU B 1 15  ? -4.993  48.553 69.609  1.00 15.45  ? 15  GLU B CG    1 
ATOM   3809  C CD    . GLU B 1 15  ? -3.896  48.878 70.664  1.00 24.67  ? 15  GLU B CD    1 
ATOM   3810  O OE1   . GLU B 1 15  ? -4.027  49.852 71.451  1.00 22.94  ? 15  GLU B OE1   1 
ATOM   3811  O OE2   . GLU B 1 15  ? -2.901  48.135 70.666  1.00 27.51  ? 15  GLU B OE2   1 
ATOM   3812  N N     . LYS B 1 16  ? -8.123  47.165 68.237  1.00 13.52  ? 16  LYS B N     1 
ATOM   3813  C CA    . LYS B 1 16  ? -8.875  46.008 68.582  1.00 18.24  ? 16  LYS B CA    1 
ATOM   3814  C C     . LYS B 1 16  ? -8.317  45.294 69.822  1.00 22.69  ? 16  LYS B C     1 
ATOM   3815  O O     . LYS B 1 16  ? -7.111  45.205 69.994  1.00 17.70  ? 16  LYS B O     1 
ATOM   3816  C CB    . LYS B 1 16  ? -8.894  45.041 67.401  1.00 22.82  ? 16  LYS B CB    1 
ATOM   3817  C CG    . LYS B 1 16  ? -9.841  43.883 67.634  1.00 41.08  ? 16  LYS B CG    1 
ATOM   3818  C CD    . LYS B 1 16  ? -9.546  42.769 66.645  1.00 48.83  ? 16  LYS B CD    1 
ATOM   3819  C CE    . LYS B 1 16  ? -10.541 42.806 65.491  1.00 53.36  ? 16  LYS B CE    1 
ATOM   3820  N NZ    . LYS B 1 16  ? -10.807 41.405 65.040  1.00 57.67  ? 16  LYS B NZ    1 
ATOM   3821  N N     . ILE B 1 17  ? -9.195  44.798 70.691  1.00 17.79  ? 17  ILE B N     1 
ATOM   3822  C CA    . ILE B 1 17  ? -8.723  44.048 71.857  1.00 21.47  ? 17  ILE B CA    1 
ATOM   3823  C C     . ILE B 1 17  ? -9.615  42.804 71.886  1.00 23.57  ? 17  ILE B C     1 
ATOM   3824  O O     . ILE B 1 17  ? -10.687 42.863 71.316  1.00 22.05  ? 17  ILE B O     1 
ATOM   3825  C CB    . ILE B 1 17  ? -8.789  44.731 73.222  1.00 21.67  ? 17  ILE B CB    1 
ATOM   3826  C CG1   . ILE B 1 17  ? -10.201 45.220 73.565  1.00 27.68  ? 17  ILE B CG1   1 
ATOM   3827  C CG2   . ILE B 1 17  ? -7.780  45.857 73.333  1.00 27.70  ? 17  ILE B CG2   1 
ATOM   3828  C CD1   . ILE B 1 17  ? -10.327 45.851 74.937  1.00 34.02  ? 17  ILE B CD1   1 
ATOM   3829  N N     . ARG B 1 18  ? -9.161  41.755 72.516  1.00 24.91  ? 18  ARG B N     1 
ATOM   3830  C CA    . ARG B 1 18  ? -9.916  40.508 72.513  1.00 28.86  ? 18  ARG B CA    1 
ATOM   3831  C C     . ARG B 1 18  ? -9.818  39.774 73.845  1.00 29.80  ? 18  ARG B C     1 
ATOM   3832  O O     . ARG B 1 18  ? -8.822  39.889 74.570  1.00 23.86  ? 18  ARG B O     1 
ATOM   3833  C CB    . ARG B 1 18  ? -9.382  39.715 71.319  1.00 31.05  ? 18  ARG B CB    1 
ATOM   3834  C CG    . ARG B 1 18  ? -9.438  38.224 71.344  1.00 47.92  ? 18  ARG B CG    1 
ATOM   3835  C CD    . ARG B 1 18  ? -8.463  37.630 70.340  1.00 56.58  ? 18  ARG B CD    1 
ATOM   3836  N NE    . ARG B 1 18  ? -7.343  36.991 71.020  1.00 67.10  ? 18  ARG B NE    1 
ATOM   3837  C CZ    . ARG B 1 18  ? -7.354  35.743 71.477  1.00 66.47  ? 18  ARG B CZ    1 
ATOM   3838  N NH1   . ARG B 1 18  ? -8.438  34.997 71.317  1.00 66.94  ? 18  ARG B NH1   1 
ATOM   3839  N NH2   . ARG B 1 18  ? -6.267  35.276 72.075  1.00 68.43  ? 18  ARG B NH2   1 
ATOM   3840  N N     . VAL B 1 19  ? -10.923 39.064 74.148  1.00 27.22  ? 19  VAL B N     1 
ATOM   3841  C CA    . VAL B 1 19  ? -10.925 38.265 75.355  1.00 28.27  ? 19  VAL B CA    1 
ATOM   3842  C C     . VAL B 1 19  ? -10.481 36.861 74.939  1.00 26.92  ? 19  VAL B C     1 
ATOM   3843  O O     . VAL B 1 19  ? -11.174 36.209 74.198  1.00 29.96  ? 19  VAL B O     1 
ATOM   3844  C CB    . VAL B 1 19  ? -12.281 38.219 76.082  1.00 34.11  ? 19  VAL B CB    1 
ATOM   3845  C CG1   . VAL B 1 19  ? -12.159 37.430 77.378  1.00 34.51  ? 19  VAL B CG1   1 
ATOM   3846  C CG2   . VAL B 1 19  ? -12.830 39.615 76.374  1.00 32.15  ? 19  VAL B CG2   1 
ATOM   3847  N N     . PRO B 1 20  ? -9.298  36.445 75.362  1.00 26.49  ? 20  PRO B N     1 
ATOM   3848  C CA    . PRO B 1 20  ? -8.836  35.098 75.091  1.00 29.83  ? 20  PRO B CA    1 
ATOM   3849  C C     . PRO B 1 20  ? -9.747  34.157 75.902  1.00 34.15  ? 20  PRO B C     1 
ATOM   3850  O O     . PRO B 1 20  ? -10.268 34.552 76.937  1.00 31.78  ? 20  PRO B O     1 
ATOM   3851  C CB    . PRO B 1 20  ? -7.397  35.082 75.559  1.00 27.77  ? 20  PRO B CB    1 
ATOM   3852  C CG    . PRO B 1 20  ? -7.175  36.328 76.338  1.00 28.14  ? 20  PRO B CG    1 
ATOM   3853  C CD    . PRO B 1 20  ? -8.411  37.185 76.284  1.00 26.00  ? 20  PRO B CD    1 
ATOM   3854  N N     . SER B 1 21  ? -9.971  32.963 75.417  1.00 33.93  ? 21  SER B N     1 
ATOM   3855  C CA    . SER B 1 21  ? -10.817 31.986 76.066  1.00 35.82  ? 21  SER B CA    1 
ATOM   3856  C C     . SER B 1 21  ? -10.188 31.551 77.387  1.00 35.81  ? 21  SER B C     1 
ATOM   3857  O O     . SER B 1 21  ? -8.999  31.771 77.619  1.00 32.92  ? 21  SER B O     1 
ATOM   3858  C CB    . SER B 1 21  ? -11.051 30.779 75.173  1.00 29.47  ? 21  SER B CB    1 
ATOM   3859  O OG    . SER B 1 21  ? -9.944  29.928 75.073  1.00 37.80  ? 21  SER B OG    1 
ATOM   3860  N N     . ARG B 1 22  ? -10.996 30.860 78.192  1.00 37.42  ? 22  ARG B N     1 
ATOM   3861  C CA    . ARG B 1 22  ? -10.486 30.330 79.451  1.00 37.73  ? 22  ARG B CA    1 
ATOM   3862  C C     . ARG B 1 22  ? -9.340  29.358 79.160  1.00 34.95  ? 22  ARG B C     1 
ATOM   3863  O O     . ARG B 1 22  ? -8.309  29.397 79.806  1.00 31.39  ? 22  ARG B O     1 
ATOM   3864  C CB    . ARG B 1 22  ? -11.591 29.705 80.296  1.00 46.10  ? 22  ARG B CB    1 
ATOM   3865  C CG    . ARG B 1 22  ? -11.128 29.028 81.561  1.00 44.24  ? 22  ARG B CG    1 
ATOM   3866  C CD    . ARG B 1 22  ? -10.531 30.004 82.546  1.00 53.58  ? 22  ARG B CD    1 
ATOM   3867  N NE    . ARG B 1 22  ? -10.054 29.337 83.734  1.00 61.78  ? 22  ARG B NE    1 
ATOM   3868  C CZ    . ARG B 1 22  ? -10.351 29.636 84.987  1.00 62.15  ? 22  ARG B CZ    1 
ATOM   3869  N NH1   . ARG B 1 22  ? -11.161 30.627 85.293  1.00 63.18  ? 22  ARG B NH1   1 
ATOM   3870  N NH2   . ARG B 1 22  ? -9.810  28.905 85.942  1.00 65.59  ? 22  ARG B NH2   1 
ATOM   3871  N N     . GLU B 1 23  ? -9.520  28.508 78.180  1.00 35.42  ? 23  GLU B N     1 
ATOM   3872  C CA    . GLU B 1 23  ? -8.535  27.552 77.705  1.00 43.25  ? 23  GLU B CA    1 
ATOM   3873  C C     . GLU B 1 23  ? -7.245  28.257 77.289  1.00 42.60  ? 23  GLU B C     1 
ATOM   3874  O O     . GLU B 1 23  ? -6.182  27.826 77.711  1.00 41.20  ? 23  GLU B O     1 
ATOM   3875  C CB    . GLU B 1 23  ? -9.171  26.768 76.579  1.00 56.02  ? 23  GLU B CB    1 
ATOM   3876  C CG    . GLU B 1 23  ? -8.293  25.987 75.644  1.00 71.20  ? 23  GLU B CG    1 
ATOM   3877  C CD    . GLU B 1 23  ? -9.078  24.869 74.970  1.00 81.04  ? 23  GLU B CD    1 
ATOM   3878  O OE1   . GLU B 1 23  ? -10.242 25.095 74.588  1.00 85.45  ? 23  GLU B OE1   1 
ATOM   3879  O OE2   . GLU B 1 23  ? -8.503  23.774 74.840  1.00 85.47  ? 23  GLU B OE2   1 
ATOM   3880  N N     . GLU B 1 24  ? -7.311  29.374 76.562  1.00 40.58  ? 24  GLU B N     1 
ATOM   3881  C CA    . GLU B 1 24  ? -6.070  30.080 76.217  1.00 38.70  ? 24  GLU B CA    1 
ATOM   3882  C C     . GLU B 1 24  ? -5.409  30.714 77.432  1.00 33.62  ? 24  GLU B C     1 
ATOM   3883  O O     . GLU B 1 24  ? -4.191  30.693 77.587  1.00 32.71  ? 24  GLU B O     1 
ATOM   3884  C CB    . GLU B 1 24  ? -6.309  31.134 75.153  1.00 44.19  ? 24  GLU B CB    1 
ATOM   3885  C CG    . GLU B 1 24  ? -6.878  30.663 73.823  1.00 53.96  ? 24  GLU B CG    1 
ATOM   3886  C CD    . GLU B 1 24  ? -7.339  31.857 73.004  1.00 58.99  ? 24  GLU B CD    1 
ATOM   3887  O OE1   . GLU B 1 24  ? -6.491  32.734 72.751  1.00 67.36  ? 24  GLU B OE1   1 
ATOM   3888  O OE2   . GLU B 1 24  ? -8.520  31.935 72.636  1.00 56.02  ? 24  GLU B OE2   1 
ATOM   3889  N N     . ARG B 1 25  ? -6.208  31.311 78.319  1.00 31.18  ? 25  ARG B N     1 
ATOM   3890  C CA    . ARG B 1 25  ? -5.677  31.969 79.510  1.00 33.73  ? 25  ARG B CA    1 
ATOM   3891  C C     . ARG B 1 25  ? -4.983  30.973 80.437  1.00 35.50  ? 25  ARG B C     1 
ATOM   3892  O O     . ARG B 1 25  ? -3.964  31.292 81.036  1.00 32.13  ? 25  ARG B O     1 
ATOM   3893  C CB    . ARG B 1 25  ? -6.752  32.774 80.245  1.00 30.10  ? 25  ARG B CB    1 
ATOM   3894  C CG    . ARG B 1 25  ? -7.533  33.770 79.428  1.00 33.74  ? 25  ARG B CG    1 
ATOM   3895  C CD    . ARG B 1 25  ? -8.464  34.629 80.231  1.00 38.71  ? 25  ARG B CD    1 
ATOM   3896  N NE    . ARG B 1 25  ? -9.508  34.000 81.005  1.00 35.21  ? 25  ARG B NE    1 
ATOM   3897  C CZ    . ARG B 1 25  ? -10.803 33.885 80.738  1.00 43.33  ? 25  ARG B CZ    1 
ATOM   3898  N NH1   . ARG B 1 25  ? -11.301 34.359 79.616  1.00 37.79  ? 25  ARG B NH1   1 
ATOM   3899  N NH2   . ARG B 1 25  ? -11.633 33.282 81.592  1.00 40.70  ? 25  ARG B NH2   1 
ATOM   3900  N N     . GLU B 1 26  ? -5.505  29.764 80.564  1.00 35.37  ? 26  GLU B N     1 
ATOM   3901  C CA    . GLU B 1 26  ? -4.895  28.747 81.408  1.00 38.82  ? 26  GLU B CA    1 
ATOM   3902  C C     . GLU B 1 26  ? -3.518  28.389 80.834  1.00 35.46  ? 26  GLU B C     1 
ATOM   3903  O O     . GLU B 1 26  ? -2.515  28.384 81.509  1.00 33.07  ? 26  GLU B O     1 
ATOM   3904  C CB    . GLU B 1 26  ? -5.733  27.465 81.422  1.00 51.05  ? 26  GLU B CB    1 
ATOM   3905  C CG    . GLU B 1 26  ? -7.065  27.570 82.140  1.00 62.43  ? 26  GLU B CG    1 
ATOM   3906  C CD    . GLU B 1 26  ? -6.936  27.318 83.626  1.00 68.23  ? 26  GLU B CD    1 
ATOM   3907  O OE1   . GLU B 1 26  ? -5.856  26.919 84.096  1.00 72.25  ? 26  GLU B OE1   1 
ATOM   3908  O OE2   . GLU B 1 26  ? -7.948  27.534 84.310  1.00 71.77  ? 26  GLU B OE2   1 
ATOM   3909  N N     . ALA B 1 27  ? -3.561  28.088 79.533  1.00 31.91  ? 27  ALA B N     1 
ATOM   3910  C CA    . ALA B 1 27  ? -2.343  27.724 78.808  1.00 35.83  ? 27  ALA B CA    1 
ATOM   3911  C C     . ALA B 1 27  ? -1.310  28.833 78.925  1.00 36.96  ? 27  ALA B C     1 
ATOM   3912  O O     . ALA B 1 27  ? -0.185  28.553 79.337  1.00 38.01  ? 27  ALA B O     1 
ATOM   3913  C CB    . ALA B 1 27  ? -2.696  27.385 77.372  1.00 35.99  ? 27  ALA B CB    1 
ATOM   3914  N N     . ALA B 1 28  ? -1.687  30.080 78.685  1.00 36.14  ? 28  ALA B N     1 
ATOM   3915  C CA    . ALA B 1 28  ? -0.719  31.173 78.765  1.00 35.26  ? 28  ALA B CA    1 
ATOM   3916  C C     . ALA B 1 28  ? -0.097  31.380 80.137  1.00 32.69  ? 28  ALA B C     1 
ATOM   3917  O O     . ALA B 1 28  ? 1.127   31.569 80.268  1.00 27.92  ? 28  ALA B O     1 
ATOM   3918  C CB    . ALA B 1 28  ? -1.346  32.465 78.250  1.00 34.04  ? 28  ALA B CB    1 
ATOM   3919  N N     . LEU B 1 29  ? -0.949  31.391 81.174  1.00 33.30  ? 29  LEU B N     1 
ATOM   3920  C CA    . LEU B 1 29  ? -0.459  31.624 82.533  1.00 35.54  ? 29  LEU B CA    1 
ATOM   3921  C C     . LEU B 1 29  ? 0.516   30.531 82.953  1.00 36.05  ? 29  LEU B C     1 
ATOM   3922  O O     . LEU B 1 29  ? 1.523   30.797 83.579  1.00 31.78  ? 29  LEU B O     1 
ATOM   3923  C CB    . LEU B 1 29  ? -1.584  31.797 83.561  1.00 30.06  ? 29  LEU B CB    1 
ATOM   3924  C CG    . LEU B 1 29  ? -1.118  32.132 84.984  1.00 35.97  ? 29  LEU B CG    1 
ATOM   3925  C CD1   . LEU B 1 29  ? -0.384  33.454 85.061  1.00 29.79  ? 29  LEU B CD1   1 
ATOM   3926  C CD2   . LEU B 1 29  ? -2.281  32.122 85.966  1.00 39.20  ? 29  LEU B CD2   1 
ATOM   3927  N N     . LYS B 1 30  ? 0.223   29.298 82.600  1.00 38.54  ? 30  LYS B N     1 
ATOM   3928  C CA    . LYS B 1 30  ? 1.078   28.143 82.804  1.00 46.91  ? 30  LYS B CA    1 
ATOM   3929  C C     . LYS B 1 30  ? 2.423   28.377 82.109  1.00 46.39  ? 30  LYS B C     1 
ATOM   3930  O O     . LYS B 1 30  ? 3.489   28.355 82.724  1.00 46.01  ? 30  LYS B O     1 
ATOM   3931  C CB    . LYS B 1 30  ? 0.373   26.925 82.210  1.00 59.05  ? 30  LYS B CB    1 
ATOM   3932  C CG    . LYS B 1 30  ? 0.802   25.544 82.647  1.00 71.12  ? 30  LYS B CG    1 
ATOM   3933  C CD    . LYS B 1 30  ? 0.317   24.509 81.639  1.00 83.74  ? 30  LYS B CD    1 
ATOM   3934  C CE    . LYS B 1 30  ? 0.674   23.091 82.051  1.00 90.17  ? 30  LYS B CE    1 
ATOM   3935  N NZ    . LYS B 1 30  ? -0.508  22.182 81.999  1.00 94.42  ? 30  LYS B NZ    1 
ATOM   3936  N N     . GLU B 1 31  ? 2.372   28.722 80.825  1.00 44.54  ? 31  GLU B N     1 
ATOM   3937  C CA    . GLU B 1 31  ? 3.575   29.020 80.051  1.00 45.22  ? 31  GLU B CA    1 
ATOM   3938  C C     . GLU B 1 31  ? 4.380   30.174 80.620  1.00 40.07  ? 31  GLU B C     1 
ATOM   3939  O O     . GLU B 1 31  ? 5.605   30.178 80.602  1.00 36.61  ? 31  GLU B O     1 
ATOM   3940  C CB    . GLU B 1 31  ? 3.241   29.282 78.580  1.00 58.71  ? 31  GLU B CB    1 
ATOM   3941  C CG    . GLU B 1 31  ? 4.481   29.372 77.711  1.00 78.19  ? 31  GLU B CG    1 
ATOM   3942  C CD    . GLU B 1 31  ? 4.223   29.061 76.254  1.00 89.50  ? 31  GLU B CD    1 
ATOM   3943  O OE1   . GLU B 1 31  ? 3.082   28.690 75.914  1.00 95.08  ? 31  GLU B OE1   1 
ATOM   3944  O OE2   . GLU B 1 31  ? 5.161   29.192 75.441  1.00 94.63  ? 31  GLU B OE2   1 
ATOM   3945  N N     . ALA B 1 32  ? 3.729   31.152 81.247  1.00 35.69  ? 32  ALA B N     1 
ATOM   3946  C CA    . ALA B 1 32  ? 4.404   32.267 81.870  1.00 34.48  ? 32  ALA B CA    1 
ATOM   3947  C C     . ALA B 1 32  ? 4.790   31.968 83.310  1.00 37.15  ? 32  ALA B C     1 
ATOM   3948  O O     . ALA B 1 32  ? 5.117   32.876 84.072  1.00 35.52  ? 32  ALA B O     1 
ATOM   3949  C CB    . ALA B 1 32  ? 3.572   33.521 81.746  1.00 31.18  ? 32  ALA B CB    1 
ATOM   3950  N N     . GLY B 1 33  ? 4.764   30.697 83.705  1.00 38.86  ? 33  GLY B N     1 
ATOM   3951  C CA    . GLY B 1 33  ? 5.130   30.255 85.039  1.00 37.90  ? 33  GLY B CA    1 
ATOM   3952  C C     . GLY B 1 33  ? 4.370   30.983 86.136  1.00 37.98  ? 33  GLY B C     1 
ATOM   3953  O O     . GLY B 1 33  ? 4.953   31.573 87.056  1.00 36.31  ? 33  GLY B O     1 
ATOM   3954  N N     . TYR B 1 34  ? 3.050   31.129 85.959  1.00 38.22  ? 34  TYR B N     1 
ATOM   3955  C CA    . TYR B 1 34  ? 2.206   31.816 86.940  1.00 39.59  ? 34  TYR B CA    1 
ATOM   3956  C C     . TYR B 1 34  ? 2.650   33.211 87.297  1.00 39.30  ? 34  TYR B C     1 
ATOM   3957  O O     . TYR B 1 34  ? 2.379   33.756 88.363  1.00 37.28  ? 34  TYR B O     1 
ATOM   3958  C CB    . TYR B 1 34  ? 2.045   30.884 88.181  1.00 41.41  ? 34  TYR B CB    1 
ATOM   3959  C CG    . TYR B 1 34  ? 1.260   29.677 87.671  1.00 43.73  ? 34  TYR B CG    1 
ATOM   3960  C CD1   . TYR B 1 34  ? -0.116  29.778 87.532  1.00 46.14  ? 34  TYR B CD1   1 
ATOM   3961  C CD2   . TYR B 1 34  ? 1.891   28.513 87.269  1.00 45.17  ? 34  TYR B CD2   1 
ATOM   3962  C CE1   . TYR B 1 34  ? -0.846  28.718 87.034  1.00 49.49  ? 34  TYR B CE1   1 
ATOM   3963  C CE2   . TYR B 1 34  ? 1.171   27.444 86.776  1.00 48.85  ? 34  TYR B CE2   1 
ATOM   3964  C CZ    . TYR B 1 34  ? -0.199  27.555 86.668  1.00 52.81  ? 34  TYR B CZ    1 
ATOM   3965  O OH    . TYR B 1 34  ? -0.950  26.512 86.165  1.00 58.92  ? 34  TYR B OH    1 
ATOM   3966  N N     . ASN B 1 35  ? 3.276   33.875 86.311  1.00 36.54  ? 35  ASN B N     1 
ATOM   3967  C CA    . ASN B 1 35  ? 3.756   35.236 86.487  1.00 36.46  ? 35  ASN B CA    1 
ATOM   3968  C C     . ASN B 1 35  ? 3.278   36.074 85.311  1.00 38.77  ? 35  ASN B C     1 
ATOM   3969  O O     . ASN B 1 35  ? 3.849   36.040 84.221  1.00 38.04  ? 35  ASN B O     1 
ATOM   3970  C CB    . ASN B 1 35  ? 5.295   35.257 86.571  1.00 24.94  ? 35  ASN B CB    1 
ATOM   3971  C CG    . ASN B 1 35  ? 5.842   36.630 86.858  1.00 28.37  ? 35  ASN B CG    1 
ATOM   3972  O OD1   . ASN B 1 35  ? 5.082   37.607 86.905  1.00 33.76  ? 35  ASN B OD1   1 
ATOM   3973  N ND2   . ASN B 1 35  ? 7.157   36.724 87.089  1.00 30.21  ? 35  ASN B ND2   1 
ATOM   3974  N N     . PRO B 1 36  ? 2.264   36.894 85.527  1.00 39.54  ? 36  PRO B N     1 
ATOM   3975  C CA    . PRO B 1 36  ? 1.684   37.747 84.512  1.00 37.03  ? 36  PRO B CA    1 
ATOM   3976  C C     . PRO B 1 36  ? 2.656   38.664 83.802  1.00 33.50  ? 36  PRO B C     1 
ATOM   3977  O O     . PRO B 1 36  ? 2.390   38.984 82.641  1.00 27.47  ? 36  PRO B O     1 
ATOM   3978  C CB    . PRO B 1 36  ? 0.602   38.539 85.262  1.00 38.29  ? 36  PRO B CB    1 
ATOM   3979  C CG    . PRO B 1 36  ? 0.148   37.517 86.269  1.00 38.94  ? 36  PRO B CG    1 
ATOM   3980  C CD    . PRO B 1 36  ? 1.464   36.957 86.784  1.00 39.74  ? 36  PRO B CD    1 
ATOM   3981  N N     . PHE B 1 37  ? 3.775   39.055 84.413  1.00 29.84  ? 37  PHE B N     1 
ATOM   3982  C CA    . PHE B 1 37  ? 4.786   39.875 83.794  1.00 29.60  ? 37  PHE B CA    1 
ATOM   3983  C C     . PHE B 1 37  ? 5.398   39.174 82.584  1.00 26.83  ? 37  PHE B C     1 
ATOM   3984  O O     . PHE B 1 37  ? 5.928   39.814 81.698  1.00 27.39  ? 37  PHE B O     1 
ATOM   3985  C CB    . PHE B 1 37  ? 5.951   40.201 84.783  1.00 25.61  ? 37  PHE B CB    1 
ATOM   3986  C CG    . PHE B 1 37  ? 6.008   41.686 84.988  1.00 28.76  ? 37  PHE B CG    1 
ATOM   3987  C CD1   . PHE B 1 37  ? 6.440   42.502 83.950  1.00 27.03  ? 37  PHE B CD1   1 
ATOM   3988  C CD2   . PHE B 1 37  ? 5.611   42.256 86.181  1.00 28.37  ? 37  PHE B CD2   1 
ATOM   3989  C CE1   . PHE B 1 37  ? 6.455   43.861 84.131  1.00 25.85  ? 37  PHE B CE1   1 
ATOM   3990  C CE2   . PHE B 1 37  ? 5.627   43.622 86.338  1.00 31.31  ? 37  PHE B CE2   1 
ATOM   3991  C CZ    . PHE B 1 37  ? 6.044   44.444 85.311  1.00 30.72  ? 37  PHE B CZ    1 
ATOM   3992  N N     . LEU B 1 38  ? 5.380   37.865 82.541  1.00 25.74  ? 38  LEU B N     1 
ATOM   3993  C CA    . LEU B 1 38  ? 5.875   37.060 81.463  1.00 26.75  ? 38  LEU B CA    1 
ATOM   3994  C C     . LEU B 1 38  ? 4.810   36.722 80.435  1.00 23.96  ? 38  LEU B C     1 
ATOM   3995  O O     . LEU B 1 38  ? 5.168   35.972 79.542  1.00 26.49  ? 38  LEU B O     1 
ATOM   3996  C CB    . LEU B 1 38  ? 6.524   35.764 81.983  1.00 31.70  ? 38  LEU B CB    1 
ATOM   3997  C CG    . LEU B 1 38  ? 7.820   35.916 82.788  1.00 40.44  ? 38  LEU B CG    1 
ATOM   3998  C CD1   . LEU B 1 38  ? 8.447   34.549 83.046  1.00 44.70  ? 38  LEU B CD1   1 
ATOM   3999  C CD2   . LEU B 1 38  ? 8.816   36.848 82.136  1.00 40.59  ? 38  LEU B CD2   1 
ATOM   4000  N N     . LEU B 1 39  ? 3.579   37.212 80.514  1.00 19.98  ? 39  LEU B N     1 
ATOM   4001  C CA    . LEU B 1 39  ? 2.586   36.938 79.487  1.00 21.07  ? 39  LEU B CA    1 
ATOM   4002  C C     . LEU B 1 39  ? 2.811   37.833 78.248  1.00 18.70  ? 39  LEU B C     1 
ATOM   4003  O O     . LEU B 1 39  ? 3.107   39.018 78.374  1.00 17.61  ? 39  LEU B O     1 
ATOM   4004  C CB    . LEU B 1 39  ? 1.138   37.201 79.925  1.00 25.97  ? 39  LEU B CB    1 
ATOM   4005  C CG    . LEU B 1 39  ? 0.584   36.334 81.065  1.00 28.81  ? 39  LEU B CG    1 
ATOM   4006  C CD1   . LEU B 1 39  ? -0.571  37.026 81.777  1.00 26.32  ? 39  LEU B CD1   1 
ATOM   4007  C CD2   . LEU B 1 39  ? 0.175   34.980 80.546  1.00 20.51  ? 39  LEU B CD2   1 
ATOM   4008  N N     . PRO B 1 40  ? 2.591   37.271 77.079  1.00 20.08  ? 40  PRO B N     1 
ATOM   4009  C CA    . PRO B 1 40  ? 2.578   38.075 75.861  1.00 19.69  ? 40  PRO B CA    1 
ATOM   4010  C C     . PRO B 1 40  ? 1.352   38.960 75.928  1.00 22.34  ? 40  PRO B C     1 
ATOM   4011  O O     . PRO B 1 40  ? 0.321   38.570 76.521  1.00 19.10  ? 40  PRO B O     1 
ATOM   4012  C CB    . PRO B 1 40  ? 2.570   37.028 74.771  1.00 20.87  ? 40  PRO B CB    1 
ATOM   4013  C CG    . PRO B 1 40  ? 2.013   35.784 75.342  1.00 24.63  ? 40  PRO B CG    1 
ATOM   4014  C CD    . PRO B 1 40  ? 2.119   35.891 76.844  1.00 19.75  ? 40  PRO B CD    1 
ATOM   4015  N N     . SER B 1 41  ? 1.384   40.159 75.359  1.00 16.23  ? 41  SER B N     1 
ATOM   4016  C CA    . SER B 1 41  ? 0.247   41.075 75.324  1.00 14.70  ? 41  SER B CA    1 
ATOM   4017  C C     . SER B 1 41  ? -0.941  40.411 74.602  1.00 15.24  ? 41  SER B C     1 
ATOM   4018  O O     . SER B 1 41  ? -2.102  40.734 74.833  1.00 17.51  ? 41  SER B O     1 
ATOM   4019  C CB    . SER B 1 41  ? 0.486   42.394 74.583  1.00 15.13  ? 41  SER B CB    1 
ATOM   4020  O OG    . SER B 1 41  ? 0.693   42.052 73.186  1.00 17.20  ? 41  SER B OG    1 
ATOM   4021  N N     . SER B 1 42  ? -0.696  39.458 73.725  1.00 15.14  ? 42  SER B N     1 
ATOM   4022  C CA    . SER B 1 42  ? -1.745  38.754 73.015  1.00 18.67  ? 42  SER B CA    1 
ATOM   4023  C C     . SER B 1 42  ? -2.614  37.895 73.933  1.00 22.52  ? 42  SER B C     1 
ATOM   4024  O O     . SER B 1 42  ? -3.758  37.600 73.606  1.00 22.07  ? 42  SER B O     1 
ATOM   4025  C CB    . SER B 1 42  ? -1.146  37.893 71.878  1.00 18.31  ? 42  SER B CB    1 
ATOM   4026  O OG    . SER B 1 42  ? -0.293  36.889 72.362  1.00 24.12  ? 42  SER B OG    1 
ATOM   4027  N N     . ALA B 1 43  ? -2.180  37.484 75.104  1.00 19.95  ? 43  ALA B N     1 
ATOM   4028  C CA    . ALA B 1 43  ? -2.979  36.692 76.024  1.00 23.29  ? 43  ALA B CA    1 
ATOM   4029  C C     . ALA B 1 43  ? -3.724  37.598 77.015  1.00 23.90  ? 43  ALA B C     1 
ATOM   4030  O O     . ALA B 1 43  ? -4.261  37.113 77.987  1.00 23.84  ? 43  ALA B O     1 
ATOM   4031  C CB    . ALA B 1 43  ? -2.106  35.690 76.773  1.00 18.18  ? 43  ALA B CB    1 
ATOM   4032  N N     . VAL B 1 44  ? -3.689  38.906 76.827  1.00 19.06  ? 44  VAL B N     1 
ATOM   4033  C CA    . VAL B 1 44  ? -4.299  39.849 77.747  1.00 16.95  ? 44  VAL B CA    1 
ATOM   4034  C C     . VAL B 1 44  ? -5.472  40.610 77.160  1.00 21.48  ? 44  VAL B C     1 
ATOM   4035  O O     . VAL B 1 44  ? -5.370  41.034 76.005  1.00 17.62  ? 44  VAL B O     1 
ATOM   4036  C CB    . VAL B 1 44  ? -3.226  40.826 78.257  1.00 19.90  ? 44  VAL B CB    1 
ATOM   4037  C CG1   . VAL B 1 44  ? -3.836  41.884 79.164  1.00 13.28  ? 44  VAL B CG1   1 
ATOM   4038  C CG2   . VAL B 1 44  ? -2.090  40.076 78.940  1.00 16.88  ? 44  VAL B CG2   1 
ATOM   4039  N N     . TYR B 1 45  ? -6.581  40.768 77.880  1.00 20.06  ? 45  TYR B N     1 
ATOM   4040  C CA    . TYR B 1 45  ? -7.740  41.521 77.372  1.00 19.96  ? 45  TYR B CA    1 
ATOM   4041  C C     . TYR B 1 45  ? -7.558  42.971 77.765  1.00 19.86  ? 45  TYR B C     1 
ATOM   4042  O O     . TYR B 1 45  ? -7.332  43.850 76.954  1.00 24.95  ? 45  TYR B O     1 
ATOM   4043  C CB    . TYR B 1 45  ? -9.082  40.935 77.863  1.00 22.18  ? 45  TYR B CB    1 
ATOM   4044  C CG    . TYR B 1 45  ? -10.325 41.752 77.564  1.00 25.33  ? 45  TYR B CG    1 
ATOM   4045  C CD1   . TYR B 1 45  ? -10.546 42.375 76.338  1.00 24.84  ? 45  TYR B CD1   1 
ATOM   4046  C CD2   . TYR B 1 45  ? -11.318 41.906 78.532  1.00 28.67  ? 45  TYR B CD2   1 
ATOM   4047  C CE1   . TYR B 1 45  ? -11.673 43.112 76.092  1.00 29.84  ? 45  TYR B CE1   1 
ATOM   4048  C CE2   . TYR B 1 45  ? -12.466 42.648 78.294  1.00 27.39  ? 45  TYR B CE2   1 
ATOM   4049  C CZ    . TYR B 1 45  ? -12.646 43.243 77.072  1.00 32.41  ? 45  TYR B CZ    1 
ATOM   4050  O OH    . TYR B 1 45  ? -13.782 43.981 76.846  1.00 36.07  ? 45  TYR B OH    1 
ATOM   4051  N N     . ILE B 1 46  ? -7.723  43.298 79.045  1.00 17.87  ? 46  ILE B N     1 
ATOM   4052  C CA    . ILE B 1 46  ? -7.579  44.663 79.554  1.00 14.10  ? 46  ILE B CA    1 
ATOM   4053  C C     . ILE B 1 46  ? -6.258  44.630 80.338  1.00 17.31  ? 46  ILE B C     1 
ATOM   4054  O O     . ILE B 1 46  ? -6.030  43.713 81.140  1.00 13.45  ? 46  ILE B O     1 
ATOM   4055  C CB    . ILE B 1 46  ? -8.776  45.144 80.375  1.00 18.14  ? 46  ILE B CB    1 
ATOM   4056  C CG1   . ILE B 1 46  ? -10.017 45.389 79.489  1.00 15.95  ? 46  ILE B CG1   1 
ATOM   4057  C CG2   . ILE B 1 46  ? -8.456  46.446 81.113  1.00 11.35  ? 46  ILE B CG2   1 
ATOM   4058  C CD1   . ILE B 1 46  ? -11.317 45.388 80.268  1.00 16.77  ? 46  ILE B CD1   1 
ATOM   4059  N N     . ASP B 1 47  ? -5.363  45.555 80.032  1.00 13.57  ? 47  ASP B N     1 
ATOM   4060  C CA    . ASP B 1 47  ? -4.022  45.471 80.651  1.00 13.42  ? 47  ASP B CA    1 
ATOM   4061  C C     . ASP B 1 47  ? -3.903  46.533 81.715  1.00 10.72  ? 47  ASP B C     1 
ATOM   4062  O O     . ASP B 1 47  ? -4.043  47.690 81.391  1.00 12.81  ? 47  ASP B O     1 
ATOM   4063  C CB    . ASP B 1 47  ? -2.893  45.637 79.643  1.00 15.31  ? 47  ASP B CB    1 
ATOM   4064  C CG    . ASP B 1 47  ? -1.624  44.920 80.033  1.00 22.34  ? 47  ASP B CG    1 
ATOM   4065  O OD1   . ASP B 1 47  ? -1.408  44.500 81.210  1.00 18.19  ? 47  ASP B OD1   1 
ATOM   4066  O OD2   . ASP B 1 47  ? -0.758  44.765 79.161  1.00 14.37  ? 47  ASP B OD2   1 
ATOM   4067  N N     . LEU B 1 48  ? -3.751  46.084 82.976  1.00 10.63  ? 48  LEU B N     1 
ATOM   4068  C CA    . LEU B 1 48  ? -3.662  47.094 84.063  1.00 12.91  ? 48  LEU B CA    1 
ATOM   4069  C C     . LEU B 1 48  ? -2.330  46.968 84.773  1.00 13.14  ? 48  LEU B C     1 
ATOM   4070  O O     . LEU B 1 48  ? -2.129  47.321 85.948  1.00 15.24  ? 48  LEU B O     1 
ATOM   4071  C CB    . LEU B 1 48  ? -4.819  46.838 85.052  1.00 13.99  ? 48  LEU B CB    1 
ATOM   4072  C CG    . LEU B 1 48  ? -6.250  46.813 84.514  1.00 15.96  ? 48  LEU B CG    1 
ATOM   4073  C CD1   . LEU B 1 48  ? -7.251  46.533 85.646  1.00 16.92  ? 48  LEU B CD1   1 
ATOM   4074  C CD2   . LEU B 1 48  ? -6.556  48.137 83.815  1.00 10.89  ? 48  LEU B CD2   1 
ATOM   4075  N N     . LEU B 1 49  ? -1.342  46.409 84.067  1.00 12.68  ? 49  LEU B N     1 
ATOM   4076  C CA    . LEU B 1 49  ? -0.002  46.209 84.567  1.00 14.55  ? 49  LEU B CA    1 
ATOM   4077  C C     . LEU B 1 49  ? 0.635   47.528 84.997  1.00 14.53  ? 49  LEU B C     1 
ATOM   4078  O O     . LEU B 1 49  ? 1.266   47.646 86.062  1.00 13.25  ? 49  LEU B O     1 
ATOM   4079  C CB    . LEU B 1 49  ? 0.916   45.517 83.576  1.00 13.80  ? 49  LEU B CB    1 
ATOM   4080  C CG    . LEU B 1 49  ? 2.179   44.861 84.121  1.00 28.54  ? 49  LEU B CG    1 
ATOM   4081  C CD1   . LEU B 1 49  ? 1.870   43.621 84.946  1.00 25.48  ? 49  LEU B CD1   1 
ATOM   4082  C CD2   . LEU B 1 49  ? 3.071   44.434 82.953  1.00 29.24  ? 49  LEU B CD2   1 
ATOM   4083  N N     . THR B 1 50  ? 0.372   48.564 84.234  1.00 8.95   ? 50  THR B N     1 
ATOM   4084  C CA    . THR B 1 50  ? 0.979   49.844 84.609  1.00 7.04   ? 50  THR B CA    1 
ATOM   4085  C C     . THR B 1 50  ? 0.283   50.974 83.917  1.00 9.91   ? 50  THR B C     1 
ATOM   4086  O O     . THR B 1 50  ? -0.410  50.716 82.913  1.00 14.25  ? 50  THR B O     1 
ATOM   4087  C CB    . THR B 1 50  ? 2.469   49.796 84.140  1.00 17.52  ? 50  THR B CB    1 
ATOM   4088  O OG1   . THR B 1 50  ? 3.046   51.044 84.533  1.00 21.29  ? 50  THR B OG1   1 
ATOM   4089  C CG2   . THR B 1 50  ? 2.519   49.800 82.591  1.00 14.78  ? 50  THR B CG2   1 
ATOM   4090  N N     . ASP B 1 51  ? 0.580   52.214 84.262  1.00 9.50   ? 51  ASP B N     1 
ATOM   4091  C CA    . ASP B 1 51  ? 0.016   53.354 83.551  1.00 8.66   ? 51  ASP B CA    1 
ATOM   4092  C C     . ASP B 1 51  ? 1.207   54.020 82.845  1.00 8.14   ? 51  ASP B C     1 
ATOM   4093  O O     . ASP B 1 51  ? 1.240   55.206 82.565  1.00 12.40  ? 51  ASP B O     1 
ATOM   4094  C CB    . ASP B 1 51  ? -0.620  54.388 84.511  1.00 7.14   ? 51  ASP B CB    1 
ATOM   4095  C CG    . ASP B 1 51  ? 0.373   55.038 85.452  1.00 8.60   ? 51  ASP B CG    1 
ATOM   4096  O OD1   . ASP B 1 51  ? 1.251   54.277 85.856  1.00 10.12  ? 51  ASP B OD1   1 
ATOM   4097  O OD2   . ASP B 1 51  ? 0.358   56.223 85.810  1.00 11.88  ? 51  ASP B OD2   1 
ATOM   4098  N N     . SER B 1 52  ? 2.273   53.255 82.603  1.00 10.10  ? 52  SER B N     1 
ATOM   4099  C CA    . SER B 1 52  ? 3.480   53.836 82.026  1.00 10.92  ? 52  SER B CA    1 
ATOM   4100  C C     . SER B 1 52  ? 3.595   53.554 80.522  1.00 7.63   ? 52  SER B C     1 
ATOM   4101  O O     . SER B 1 52  ? 3.793   52.382 80.190  1.00 8.56   ? 52  SER B O     1 
ATOM   4102  C CB    . SER B 1 52  ? 4.728   53.145 82.664  1.00 11.99  ? 52  SER B CB    1 
ATOM   4103  O OG    . SER B 1 52  ? 5.859   53.910 82.212  1.00 16.91  ? 52  SER B OG    1 
ATOM   4104  N N     . GLY B 1 53  ? 3.601   54.582 79.706  1.00 9.75   ? 53  GLY B N     1 
ATOM   4105  C CA    . GLY B 1 53  ? 3.837   54.434 78.255  1.00 10.33  ? 53  GLY B CA    1 
ATOM   4106  C C     . GLY B 1 53  ? 2.717   53.774 77.455  1.00 13.47  ? 53  GLY B C     1 
ATOM   4107  O O     . GLY B 1 53  ? 2.894   53.477 76.248  1.00 7.15   ? 53  GLY B O     1 
ATOM   4108  N N     . THR B 1 54  ? 1.551   53.532 78.059  1.00 7.57   ? 54  THR B N     1 
ATOM   4109  C CA    . THR B 1 54  ? 0.464   52.821 77.376  1.00 9.02   ? 54  THR B CA    1 
ATOM   4110  C C     . THR B 1 54  ? -0.688  53.769 77.094  1.00 9.44   ? 54  THR B C     1 
ATOM   4111  O O     . THR B 1 54  ? -1.757  53.349 76.626  1.00 12.58  ? 54  THR B O     1 
ATOM   4112  C CB    . THR B 1 54  ? -0.082  51.629 78.211  1.00 12.70  ? 54  THR B CB    1 
ATOM   4113  O OG1   . THR B 1 54  ? -0.212  52.073 79.587  1.00 13.90  ? 54  THR B OG1   1 
ATOM   4114  C CG2   . THR B 1 54  ? 0.902   50.475 78.195  1.00 10.99  ? 54  THR B CG2   1 
ATOM   4115  N N     . ASN B 1 55  ? -0.461  55.046 77.343  1.00 5.78   ? 55  ASN B N     1 
ATOM   4116  C CA    . ASN B 1 55  ? -1.464  56.074 77.161  1.00 6.89   ? 55  ASN B CA    1 
ATOM   4117  C C     . ASN B 1 55  ? -1.839  56.257 75.689  1.00 12.00  ? 55  ASN B C     1 
ATOM   4118  O O     . ASN B 1 55  ? -1.053  55.965 74.781  1.00 9.54   ? 55  ASN B O     1 
ATOM   4119  C CB    . ASN B 1 55  ? -0.875  57.426 77.604  1.00 4.86   ? 55  ASN B CB    1 
ATOM   4120  C CG    . ASN B 1 55  ? -0.336  57.314 79.057  1.00 20.51  ? 55  ASN B CG    1 
ATOM   4121  O OD1   . ASN B 1 55  ? -1.044  56.988 80.015  1.00 10.64  ? 55  ASN B OD1   1 
ATOM   4122  N ND2   . ASN B 1 55  ? 0.959   57.574 79.226  1.00 9.09   ? 55  ASN B ND2   1 
ATOM   4123  N N     . ALA B 1 56  ? -2.950  56.907 75.451  1.00 7.89   ? 56  ALA B N     1 
ATOM   4124  C CA    . ALA B 1 56  ? -3.448  57.217 74.124  1.00 8.39   ? 56  ALA B CA    1 
ATOM   4125  C C     . ALA B 1 56  ? -3.138  58.693 73.914  1.00 8.06   ? 56  ALA B C     1 
ATOM   4126  O O     . ALA B 1 56  ? -3.446  59.575 74.728  1.00 9.81   ? 56  ALA B O     1 
ATOM   4127  C CB    . ALA B 1 56  ? -4.966  57.030 74.017  1.00 8.72   ? 56  ALA B CB    1 
ATOM   4128  N N     . MET B 1 57  ? -2.383  58.930 72.814  1.00 6.53   ? 57  MET B N     1 
ATOM   4129  C CA    . MET B 1 57  ? -2.069  60.335 72.480  1.00 7.56   ? 57  MET B CA    1 
ATOM   4130  C C     . MET B 1 57  ? -3.210  60.985 71.725  1.00 7.08   ? 57  MET B C     1 
ATOM   4131  O O     . MET B 1 57  ? -4.142  60.298 71.280  1.00 7.89   ? 57  MET B O     1 
ATOM   4132  C CB    . MET B 1 57  ? -0.817  60.342 71.598  1.00 6.90   ? 57  MET B CB    1 
ATOM   4133  C CG    . MET B 1 57  ? 0.424   59.874 72.348  1.00 8.54   ? 57  MET B CG    1 
ATOM   4134  S SD    . MET B 1 57  ? 1.944   60.454 71.550  1.00 11.66  ? 57  MET B SD    1 
ATOM   4135  C CE    . MET B 1 57  ? 2.010   59.296 70.193  1.00 9.07   ? 57  MET B CE    1 
ATOM   4136  N N     . SER B 1 58  ? -3.183  62.286 71.536  1.00 5.31   ? 58  SER B N     1 
ATOM   4137  C CA    . SER B 1 58  ? -4.195  62.981 70.774  1.00 9.20   ? 58  SER B CA    1 
ATOM   4138  C C     . SER B 1 58  ? -3.717  63.095 69.299  1.00 14.34  ? 58  SER B C     1 
ATOM   4139  O O     . SER B 1 58  ? -2.604  62.736 68.951  1.00 8.19   ? 58  SER B O     1 
ATOM   4140  C CB    . SER B 1 58  ? -4.379  64.413 71.255  1.00 7.10   ? 58  SER B CB    1 
ATOM   4141  O OG    . SER B 1 58  ? -3.149  65.116 71.172  1.00 10.32  ? 58  SER B OG    1 
ATOM   4142  N N     . ASP B 1 59  ? -4.593  63.634 68.483  1.00 10.51  ? 59  ASP B N     1 
ATOM   4143  C CA    . ASP B 1 59  ? -4.292  63.881 67.064  1.00 12.67  ? 59  ASP B CA    1 
ATOM   4144  C C     . ASP B 1 59  ? -3.232  64.966 67.015  1.00 8.16   ? 59  ASP B C     1 
ATOM   4145  O O     . ASP B 1 59  ? -2.296  64.848 66.209  1.00 9.20   ? 59  ASP B O     1 
ATOM   4146  C CB    . ASP B 1 59  ? -5.568  64.176 66.294  1.00 6.92   ? 59  ASP B CB    1 
ATOM   4147  C CG    . ASP B 1 59  ? -6.417  65.306 66.842  1.00 12.76  ? 59  ASP B CG    1 
ATOM   4148  O OD1   . ASP B 1 59  ? -6.144  65.821 67.946  1.00 12.14  ? 59  ASP B OD1   1 
ATOM   4149  O OD2   . ASP B 1 59  ? -7.348  65.693 66.089  1.00 15.91  ? 59  ASP B OD2   1 
ATOM   4150  N N     . HIS B 1 60  ? -3.253  65.999 67.844  1.00 5.63   ? 60  HIS B N     1 
ATOM   4151  C CA    . HIS B 1 60  ? -2.209  67.010 67.907  1.00 7.95   ? 60  HIS B CA    1 
ATOM   4152  C C     . HIS B 1 60  ? -0.862  66.418 68.318  1.00 9.70   ? 60  HIS B C     1 
ATOM   4153  O O     . HIS B 1 60  ? 0.165   66.894 67.798  1.00 10.45  ? 60  HIS B O     1 
ATOM   4154  C CB    . HIS B 1 60  ? -2.599  68.107 68.915  1.00 10.43  ? 60  HIS B CB    1 
ATOM   4155  C CG    . HIS B 1 60  ? -3.696  68.954 68.353  1.00 21.88  ? 60  HIS B CG    1 
ATOM   4156  N ND1   . HIS B 1 60  ? -3.490  70.120 67.646  1.00 26.74  ? 60  HIS B ND1   1 
ATOM   4157  C CD2   . HIS B 1 60  ? -5.038  68.774 68.393  1.00 28.72  ? 60  HIS B CD2   1 
ATOM   4158  C CE1   . HIS B 1 60  ? -4.642  70.624 67.266  1.00 26.34  ? 60  HIS B CE1   1 
ATOM   4159  N NE2   . HIS B 1 60  ? -5.599  69.823 67.715  1.00 25.89  ? 60  HIS B NE2   1 
ATOM   4160  N N     . GLN B 1 61  ? -0.831  65.401 69.188  1.00 8.39   ? 61  GLN B N     1 
ATOM   4161  C CA    . GLN B 1 61  ? 0.417   64.761 69.530  1.00 10.88  ? 61  GLN B CA    1 
ATOM   4162  C C     . GLN B 1 61  ? 0.983   64.013 68.316  1.00 10.67  ? 61  GLN B C     1 
ATOM   4163  O O     . GLN B 1 61  ? 2.173   64.085 68.033  1.00 8.70   ? 61  GLN B O     1 
ATOM   4164  C CB    . GLN B 1 61  ? 0.283   63.802 70.723  1.00 4.52   ? 61  GLN B CB    1 
ATOM   4165  C CG    . GLN B 1 61  ? 0.203   64.630 72.053  1.00 6.83   ? 61  GLN B CG    1 
ATOM   4166  C CD    . GLN B 1 61  ? -0.016  63.689 73.213  1.00 11.20  ? 61  GLN B CD    1 
ATOM   4167  O OE1   . GLN B 1 61  ? -1.079  63.063 73.360  1.00 10.47  ? 61  GLN B OE1   1 
ATOM   4168  N NE2   . GLN B 1 61  ? 1.006   63.542 74.004  1.00 8.06   ? 61  GLN B NE2   1 
ATOM   4169  N N     . TRP B 1 62  ? 0.159   63.242 67.623  1.00 6.75   ? 62  TRP B N     1 
ATOM   4170  C CA    . TRP B 1 62  ? 0.657   62.515 66.430  1.00 7.85   ? 62  TRP B CA    1 
ATOM   4171  C C     . TRP B 1 62  ? 1.053   63.481 65.335  1.00 10.23  ? 62  TRP B C     1 
ATOM   4172  O O     . TRP B 1 62  ? 1.987   63.175 64.572  1.00 11.75  ? 62  TRP B O     1 
ATOM   4173  C CB    . TRP B 1 62  ? -0.442  61.589 65.920  1.00 6.66   ? 62  TRP B CB    1 
ATOM   4174  C CG    . TRP B 1 62  ? -0.440  60.269 66.595  1.00 13.92  ? 62  TRP B CG    1 
ATOM   4175  C CD1   . TRP B 1 62  ? -1.130  59.937 67.723  1.00 10.20  ? 62  TRP B CD1   1 
ATOM   4176  C CD2   . TRP B 1 62  ? 0.312   59.111 66.247  1.00 18.01  ? 62  TRP B CD2   1 
ATOM   4177  N NE1   . TRP B 1 62  ? -0.893  58.637 68.061  1.00 14.97  ? 62  TRP B NE1   1 
ATOM   4178  C CE2   . TRP B 1 62  ? 0.004   58.107 67.184  1.00 16.70  ? 62  TRP B CE2   1 
ATOM   4179  C CE3   . TRP B 1 62  ? 1.239   58.842 65.213  1.00 21.14  ? 62  TRP B CE3   1 
ATOM   4180  C CZ2   . TRP B 1 62  ? 0.576   56.840 67.137  1.00 19.87  ? 62  TRP B CZ2   1 
ATOM   4181  C CZ3   . TRP B 1 62  ? 1.787   57.567 65.181  1.00 25.03  ? 62  TRP B CZ3   1 
ATOM   4182  C CH2   . TRP B 1 62  ? 1.477   56.590 66.133  1.00 23.73  ? 62  TRP B CH2   1 
ATOM   4183  N N     . ALA B 1 63  ? 0.370   64.593 65.126  1.00 10.33  ? 63  ALA B N     1 
ATOM   4184  C CA    . ALA B 1 63  ? 0.693   65.606 64.146  1.00 13.76  ? 63  ALA B CA    1 
ATOM   4185  C C     . ALA B 1 63  ? 2.089   66.170 64.489  1.00 15.74  ? 63  ALA B C     1 
ATOM   4186  O O     . ALA B 1 63  ? 2.949   66.283 63.614  1.00 10.99  ? 63  ALA B O     1 
ATOM   4187  C CB    . ALA B 1 63  ? -0.279  66.782 64.180  1.00 5.64   ? 63  ALA B CB    1 
ATOM   4188  N N     . ALA B 1 64  ? 2.314   66.438 65.799  1.00 10.38  ? 64  ALA B N     1 
ATOM   4189  C CA    . ALA B 1 64  ? 3.602   66.964 66.243  1.00 10.29  ? 64  ALA B CA    1 
ATOM   4190  C C     . ALA B 1 64  ? 4.719   65.974 65.938  1.00 9.32   ? 64  ALA B C     1 
ATOM   4191  O O     . ALA B 1 64  ? 5.800   66.390 65.543  1.00 8.81   ? 64  ALA B O     1 
ATOM   4192  C CB    . ALA B 1 64  ? 3.585   67.347 67.741  1.00 11.36  ? 64  ALA B CB    1 
ATOM   4193  N N     . MET B 1 65  ? 4.466   64.672 66.021  1.00 7.36   ? 65  MET B N     1 
ATOM   4194  C CA    . MET B 1 65  ? 5.465   63.688 65.687  1.00 11.65  ? 65  MET B CA    1 
ATOM   4195  C C     . MET B 1 65  ? 5.831   63.712 64.182  1.00 17.23  ? 65  MET B C     1 
ATOM   4196  O O     . MET B 1 65  ? 7.002   63.589 63.830  1.00 8.62   ? 65  MET B O     1 
ATOM   4197  C CB    . MET B 1 65  ? 4.972   62.267 65.992  1.00 6.68   ? 65  MET B CB    1 
ATOM   4198  C CG    . MET B 1 65  ? 4.796   61.967 67.492  1.00 11.79  ? 65  MET B CG    1 
ATOM   4199  S SD    . MET B 1 65  ? 5.200   60.287 67.874  1.00 18.32  ? 65  MET B SD    1 
ATOM   4200  C CE    . MET B 1 65  ? 3.992   59.314 67.042  1.00 18.10  ? 65  MET B CE    1 
ATOM   4201  N N     . ILE B 1 66  ? 4.836   63.901 63.310  1.00 10.74  ? 66  ILE B N     1 
ATOM   4202  C CA    . ILE B 1 66  ? 5.088   63.903 61.852  1.00 11.61  ? 66  ILE B CA    1 
ATOM   4203  C C     . ILE B 1 66  ? 5.993   65.029 61.444  1.00 5.95   ? 66  ILE B C     1 
ATOM   4204  O O     . ILE B 1 66  ? 6.842   64.870 60.558  1.00 10.78  ? 66  ILE B O     1 
ATOM   4205  C CB    . ILE B 1 66  ? 3.747   64.020 61.073  1.00 15.07  ? 66  ILE B CB    1 
ATOM   4206  C CG1   . ILE B 1 66  ? 2.838   62.814 61.374  1.00 19.69  ? 66  ILE B CG1   1 
ATOM   4207  C CG2   . ILE B 1 66  ? 3.949   64.151 59.572  1.00 14.60  ? 66  ILE B CG2   1 
ATOM   4208  C CD1   . ILE B 1 66  ? 3.478   61.496 61.016  1.00 38.02  ? 66  ILE B CD1   1 
ATOM   4209  N N     . THR B 1 67  ? 5.875   66.234 62.057  1.00 6.02   ? 67  THR B N     1 
ATOM   4210  C CA    . THR B 1 67  ? 6.779   67.320 61.695  1.00 9.70   ? 67  THR B CA    1 
ATOM   4211  C C     . THR B 1 67  ? 7.982   67.402 62.642  1.00 10.99  ? 67  THR B C     1 
ATOM   4212  O O     . THR B 1 67  ? 8.639   68.442 62.646  1.00 9.94   ? 67  THR B O     1 
ATOM   4213  C CB    . THR B 1 67  ? 6.019   68.654 61.719  1.00 13.42  ? 67  THR B CB    1 
ATOM   4214  O OG1   . THR B 1 67  ? 5.369   68.745 63.002  1.00 15.55  ? 67  THR B OG1   1 
ATOM   4215  C CG2   . THR B 1 67  ? 4.852   68.636 60.708  1.00 11.53  ? 67  THR B CG2   1 
ATOM   4216  N N     . GLY B 1 68  ? 8.195   66.384 63.490  1.00 13.66  ? 68  GLY B N     1 
ATOM   4217  C CA    . GLY B 1 68  ? 9.315   66.504 64.440  1.00 12.52  ? 68  GLY B CA    1 
ATOM   4218  C C     . GLY B 1 68  ? 10.644  66.592 63.710  1.00 13.58  ? 68  GLY B C     1 
ATOM   4219  O O     . GLY B 1 68  ? 10.886  65.894 62.710  1.00 11.88  ? 68  GLY B O     1 
ATOM   4220  N N     . ASP B 1 69  ? 11.550  67.376 64.221  1.00 12.20  ? 69  ASP B N     1 
ATOM   4221  C CA    . ASP B 1 69  ? 12.920  67.544 63.704  1.00 8.05   ? 69  ASP B CA    1 
ATOM   4222  C C     . ASP B 1 69  ? 13.849  66.497 64.237  1.00 10.30  ? 69  ASP B C     1 
ATOM   4223  O O     . ASP B 1 69  ? 14.202  66.455 65.439  1.00 11.30  ? 69  ASP B O     1 
ATOM   4224  C CB    . ASP B 1 69  ? 13.339  68.966 64.130  1.00 8.04   ? 69  ASP B CB    1 
ATOM   4225  C CG    . ASP B 1 69  ? 14.680  69.422 63.566  1.00 10.88  ? 69  ASP B CG    1 
ATOM   4226  O OD1   . ASP B 1 69  ? 15.358  68.652 62.850  1.00 8.36   ? 69  ASP B OD1   1 
ATOM   4227  O OD2   . ASP B 1 69  ? 15.094  70.547 63.853  1.00 8.94   ? 69  ASP B OD2   1 
ATOM   4228  N N     . GLU B 1 70  ? 14.370  65.617 63.383  1.00 5.40   ? 70  GLU B N     1 
ATOM   4229  C CA    . GLU B 1 70  ? 15.297  64.562 63.757  1.00 5.23   ? 70  GLU B CA    1 
ATOM   4230  C C     . GLU B 1 70  ? 16.751  64.988 63.797  1.00 8.38   ? 70  GLU B C     1 
ATOM   4231  O O     . GLU B 1 70  ? 17.603  64.112 63.913  1.00 11.71  ? 70  GLU B O     1 
ATOM   4232  C CB    . GLU B 1 70  ? 15.103  63.333 62.850  1.00 7.58   ? 70  GLU B CB    1 
ATOM   4233  C CG    . GLU B 1 70  ? 13.687  62.706 62.972  1.00 9.77   ? 70  GLU B CG    1 
ATOM   4234  C CD    . GLU B 1 70  ? 13.409  62.194 64.365  1.00 20.10  ? 70  GLU B CD    1 
ATOM   4235  O OE1   . GLU B 1 70  ? 14.346  61.882 65.126  1.00 9.11   ? 70  GLU B OE1   1 
ATOM   4236  O OE2   . GLU B 1 70  ? 12.228  62.066 64.728  1.00 10.92  ? 70  GLU B OE2   1 
ATOM   4237  N N     . ALA B 1 71  ? 17.061  66.253 63.687  1.00 8.77   ? 71  ALA B N     1 
ATOM   4238  C CA    . ALA B 1 71  ? 18.449  66.716 63.727  1.00 12.42  ? 71  ALA B CA    1 
ATOM   4239  C C     . ALA B 1 71  ? 19.188  66.210 64.954  1.00 15.36  ? 71  ALA B C     1 
ATOM   4240  O O     . ALA B 1 71  ? 18.662  66.135 66.092  1.00 14.35  ? 71  ALA B O     1 
ATOM   4241  C CB    . ALA B 1 71  ? 18.466  68.240 63.701  1.00 9.95   ? 71  ALA B CB    1 
ATOM   4242  N N     . TYR B 1 72  ? 20.435  65.814 64.734  1.00 14.71  ? 72  TYR B N     1 
ATOM   4243  C CA    . TYR B 1 72  ? 21.285  65.234 65.783  1.00 15.56  ? 72  TYR B CA    1 
ATOM   4244  C C     . TYR B 1 72  ? 21.578  66.276 66.855  1.00 14.46  ? 72  TYR B C     1 
ATOM   4245  O O     . TYR B 1 72  ? 21.595  65.986 68.056  1.00 17.00  ? 72  TYR B O     1 
ATOM   4246  C CB    . TYR B 1 72  ? 22.610  64.704 65.237  1.00 15.38  ? 72  TYR B CB    1 
ATOM   4247  C CG    . TYR B 1 72  ? 23.218  63.732 66.227  1.00 14.23  ? 72  TYR B CG    1 
ATOM   4248  C CD1   . TYR B 1 72  ? 22.756  62.431 66.234  1.00 15.92  ? 72  TYR B CD1   1 
ATOM   4249  C CD2   . TYR B 1 72  ? 24.199  64.122 67.122  1.00 13.79  ? 72  TYR B CD2   1 
ATOM   4250  C CE1   . TYR B 1 72  ? 23.260  61.502 67.120  1.00 19.13  ? 72  TYR B CE1   1 
ATOM   4251  C CE2   . TYR B 1 72  ? 24.715  63.204 68.012  1.00 17.54  ? 72  TYR B CE2   1 
ATOM   4252  C CZ    . TYR B 1 72  ? 24.221  61.907 68.021  1.00 20.46  ? 72  TYR B CZ    1 
ATOM   4253  O OH    . TYR B 1 72  ? 24.679  60.967 68.897  1.00 21.25  ? 72  TYR B OH    1 
ATOM   4254  N N     . ALA B 1 73  ? 21.821  67.484 66.391  1.00 13.71  ? 73  ALA B N     1 
ATOM   4255  C CA    . ALA B 1 73  ? 22.138  68.585 67.283  1.00 15.51  ? 73  ALA B CA    1 
ATOM   4256  C C     . ALA B 1 73  ? 21.294  69.780 66.941  1.00 13.47  ? 73  ALA B C     1 
ATOM   4257  O O     . ALA B 1 73  ? 21.213  70.157 65.777  1.00 15.41  ? 73  ALA B O     1 
ATOM   4258  C CB    . ALA B 1 73  ? 23.610  69.030 67.100  1.00 15.17  ? 73  ALA B CB    1 
ATOM   4259  N N     . GLY B 1 74  ? 20.666  70.391 67.949  1.00 13.76  ? 74  GLY B N     1 
ATOM   4260  C CA    . GLY B 1 74  ? 19.951  71.642 67.607  1.00 11.39  ? 74  GLY B CA    1 
ATOM   4261  C C     . GLY B 1 74  ? 18.519  71.364 67.129  1.00 10.87  ? 74  GLY B C     1 
ATOM   4262  O O     . GLY B 1 74  ? 17.966  72.300 66.566  1.00 10.95  ? 74  GLY B O     1 
ATOM   4263  N N     . SER B 1 75  ? 17.931  70.217 67.382  1.00 11.78  ? 75  SER B N     1 
ATOM   4264  C CA    . SER B 1 75  ? 16.533  70.010 66.992  1.00 11.59  ? 75  SER B CA    1 
ATOM   4265  C C     . SER B 1 75  ? 15.658  71.159 67.409  1.00 13.07  ? 75  SER B C     1 
ATOM   4266  O O     . SER B 1 75  ? 15.702  71.664 68.558  1.00 12.65  ? 75  SER B O     1 
ATOM   4267  C CB    . SER B 1 75  ? 15.994  68.739 67.616  1.00 12.28  ? 75  SER B CB    1 
ATOM   4268  O OG    . SER B 1 75  ? 14.564  68.656 67.383  1.00 16.36  ? 75  SER B OG    1 
ATOM   4269  N N     . ARG B 1 76  ? 14.732  71.584 66.557  1.00 13.56  ? 76  ARG B N     1 
ATOM   4270  C CA    . ARG B 1 76  ? 13.741  72.596 66.911  1.00 12.30  ? 76  ARG B CA    1 
ATOM   4271  C C     . ARG B 1 76  ? 12.944  72.186 68.163  1.00 8.99   ? 76  ARG B C     1 
ATOM   4272  O O     . ARG B 1 76  ? 12.533  73.007 68.973  1.00 11.91  ? 76  ARG B O     1 
ATOM   4273  C CB    . ARG B 1 76  ? 12.621  72.572 65.847  1.00 18.95  ? 76  ARG B CB    1 
ATOM   4274  C CG    . ARG B 1 76  ? 12.692  73.394 64.612  1.00 38.92  ? 76  ARG B CG    1 
ATOM   4275  C CD    . ARG B 1 76  ? 11.285  73.528 64.024  1.00 38.13  ? 76  ARG B CD    1 
ATOM   4276  N NE    . ARG B 1 76  ? 10.743  72.294 63.492  1.00 36.76  ? 76  ARG B NE    1 
ATOM   4277  C CZ    . ARG B 1 76  ? 11.271  71.544 62.527  1.00 37.18  ? 76  ARG B CZ    1 
ATOM   4278  N NH1   . ARG B 1 76  ? 12.425  71.883 61.962  1.00 37.11  ? 76  ARG B NH1   1 
ATOM   4279  N NH2   . ARG B 1 76  ? 10.662  70.437 62.134  1.00 35.92  ? 76  ARG B NH2   1 
ATOM   4280  N N     . ASN B 1 77  ? 12.645  70.882 68.263  1.00 7.08   ? 77  ASN B N     1 
ATOM   4281  C CA    . ASN B 1 77  ? 11.827  70.408 69.370  1.00 14.30  ? 77  ASN B CA    1 
ATOM   4282  C C     . ASN B 1 77  ? 12.548  70.434 70.715  1.00 15.61  ? 77  ASN B C     1 
ATOM   4283  O O     . ASN B 1 77  ? 11.878  70.449 71.735  1.00 13.92  ? 77  ASN B O     1 
ATOM   4284  C CB    . ASN B 1 77  ? 11.356  69.002 69.037  1.00 9.27   ? 77  ASN B CB    1 
ATOM   4285  C CG    . ASN B 1 77  ? 10.725  68.964 67.655  1.00 18.33  ? 77  ASN B CG    1 
ATOM   4286  O OD1   . ASN B 1 77  ? 11.303  68.385 66.749  1.00 15.85  ? 77  ASN B OD1   1 
ATOM   4287  N ND2   . ASN B 1 77  ? 9.564   69.554 67.515  1.00 9.87   ? 77  ASN B ND2   1 
ATOM   4288  N N     . TYR B 1 78  ? 13.882  70.410 70.707  1.00 12.27  ? 78  TYR B N     1 
ATOM   4289  C CA    . TYR B 1 78  ? 14.663  70.555 71.914  1.00 11.61  ? 78  TYR B CA    1 
ATOM   4290  C C     . TYR B 1 78  ? 14.433  71.978 72.421  1.00 13.26  ? 78  TYR B C     1 
ATOM   4291  O O     . TYR B 1 78  ? 14.172  72.185 73.611  1.00 12.62  ? 78  TYR B O     1 
ATOM   4292  C CB    . TYR B 1 78  ? 16.162  70.272 71.683  1.00 12.56  ? 78  TYR B CB    1 
ATOM   4293  C CG    . TYR B 1 78  ? 17.031  70.843 72.801  1.00 13.78  ? 78  TYR B CG    1 
ATOM   4294  C CD1   . TYR B 1 78  ? 17.183  70.156 74.000  1.00 15.79  ? 78  TYR B CD1   1 
ATOM   4295  C CD2   . TYR B 1 78  ? 17.622  72.076 72.661  1.00 13.21  ? 78  TYR B CD2   1 
ATOM   4296  C CE1   . TYR B 1 78  ? 17.959  70.679 75.028  1.00 15.76  ? 78  TYR B CE1   1 
ATOM   4297  C CE2   . TYR B 1 78  ? 18.393  72.632 73.683  1.00 18.63  ? 78  TYR B CE2   1 
ATOM   4298  C CZ    . TYR B 1 78  ? 18.543  71.902 74.866  1.00 17.46  ? 78  TYR B CZ    1 
ATOM   4299  O OH    . TYR B 1 78  ? 19.293  72.447 75.886  1.00 17.43  ? 78  TYR B OH    1 
ATOM   4300  N N     . TYR B 1 79  ? 14.491  72.982 71.549  1.00 11.43  ? 79  TYR B N     1 
ATOM   4301  C CA    . TYR B 1 79  ? 14.245  74.355 72.028  1.00 10.60  ? 79  TYR B CA    1 
ATOM   4302  C C     . TYR B 1 79  ? 12.817  74.559 72.512  1.00 13.44  ? 79  TYR B C     1 
ATOM   4303  O O     . TYR B 1 79  ? 12.545  75.309 73.460  1.00 13.05  ? 79  TYR B O     1 
ATOM   4304  C CB    . TYR B 1 79  ? 14.580  75.406 70.951  1.00 13.44  ? 79  TYR B CB    1 
ATOM   4305  C CG    . TYR B 1 79  ? 16.045  75.283 70.579  1.00 16.01  ? 79  TYR B CG    1 
ATOM   4306  C CD1   . TYR B 1 79  ? 17.040  75.794 71.403  1.00 18.59  ? 79  TYR B CD1   1 
ATOM   4307  C CD2   . TYR B 1 79  ? 16.423  74.630 69.415  1.00 16.51  ? 79  TYR B CD2   1 
ATOM   4308  C CE1   . TYR B 1 79  ? 18.401  75.666 71.087  1.00 19.27  ? 79  TYR B CE1   1 
ATOM   4309  C CE2   . TYR B 1 79  ? 17.760  74.514 69.089  1.00 21.45  ? 79  TYR B CE2   1 
ATOM   4310  C CZ    . TYR B 1 79  ? 18.734  75.028 69.916  1.00 24.27  ? 79  TYR B CZ    1 
ATOM   4311  O OH    . TYR B 1 79  ? 20.062  74.883 69.563  1.00 32.56  ? 79  TYR B OH    1 
ATOM   4312  N N     . ASP B 1 80  ? 11.808  73.993 71.853  1.00 11.61  ? 80  ASP B N     1 
ATOM   4313  C CA    . ASP B 1 80  ? 10.430  74.061 72.306  1.00 11.81  ? 80  ASP B CA    1 
ATOM   4314  C C     . ASP B 1 80  ? 10.283  73.408 73.697  1.00 10.88  ? 80  ASP B C     1 
ATOM   4315  O O     . ASP B 1 80  ? 9.525   73.877 74.550  1.00 10.78  ? 80  ASP B O     1 
ATOM   4316  C CB    . ASP B 1 80  ? 9.502   73.265 71.374  1.00 11.54  ? 80  ASP B CB    1 
ATOM   4317  C CG    . ASP B 1 80  ? 9.280   73.960 70.027  1.00 18.86  ? 80  ASP B CG    1 
ATOM   4318  O OD1   . ASP B 1 80  ? 9.585   75.140 69.829  1.00 15.21  ? 80  ASP B OD1   1 
ATOM   4319  O OD2   . ASP B 1 80  ? 8.767   73.239 69.154  1.00 18.06  ? 80  ASP B OD2   1 
ATOM   4320  N N     . LEU B 1 81  ? 10.962  72.284 73.920  1.00 7.38   ? 81  LEU B N     1 
ATOM   4321  C CA    . LEU B 1 81  ? 10.853  71.577 75.192  1.00 9.11   ? 81  LEU B CA    1 
ATOM   4322  C C     . LEU B 1 81  ? 11.480  72.404 76.303  1.00 13.65  ? 81  LEU B C     1 
ATOM   4323  O O     . LEU B 1 81  ? 10.962  72.518 77.424  1.00 13.10  ? 81  LEU B O     1 
ATOM   4324  C CB    . LEU B 1 81  ? 11.497  70.217 75.054  1.00 9.88   ? 81  LEU B CB    1 
ATOM   4325  C CG    . LEU B 1 81  ? 11.501  69.285 76.259  1.00 16.16  ? 81  LEU B CG    1 
ATOM   4326  C CD1   . LEU B 1 81  ? 10.069  68.979 76.698  1.00 12.50  ? 81  LEU B CD1   1 
ATOM   4327  C CD2   . LEU B 1 81  ? 12.224  67.991 75.866  1.00 13.31  ? 81  LEU B CD2   1 
ATOM   4328  N N     . LYS B 1 82  ? 12.588  73.049 75.992  1.00 13.16  ? 82  LYS B N     1 
ATOM   4329  C CA    . LYS B 1 82  ? 13.274  73.932 76.927  1.00 14.63  ? 82  LYS B CA    1 
ATOM   4330  C C     . LYS B 1 82  ? 12.331  75.059 77.323  1.00 14.50  ? 82  LYS B C     1 
ATOM   4331  O O     . LYS B 1 82  ? 12.232  75.421 78.514  1.00 14.69  ? 82  LYS B O     1 
ATOM   4332  C CB    . LYS B 1 82  ? 14.556  74.499 76.290  1.00 14.64  ? 82  LYS B CB    1 
ATOM   4333  C CG    . LYS B 1 82  ? 15.321  75.512 77.151  1.00 18.55  ? 82  LYS B CG    1 
ATOM   4334  C CD    . LYS B 1 82  ? 16.764  75.633 76.632  1.00 21.39  ? 82  LYS B CD    1 
ATOM   4335  C CE    . LYS B 1 82  ? 17.610  76.481 77.575  1.00 23.86  ? 82  LYS B CE    1 
ATOM   4336  N NZ    . LYS B 1 82  ? 17.040  77.837 77.770  1.00 25.08  ? 82  LYS B NZ    1 
ATOM   4337  N N     . ASP B 1 83  ? 11.694  75.705 76.346  1.00 13.52  ? 83  ASP B N     1 
ATOM   4338  C CA    . ASP B 1 83  ? 10.754  76.778 76.660  1.00 13.08  ? 83  ASP B CA    1 
ATOM   4339  C C     . ASP B 1 83  ? 9.544   76.226 77.443  1.00 11.78  ? 83  ASP B C     1 
ATOM   4340  O O     . ASP B 1 83  ? 9.054   76.916 78.342  1.00 13.30  ? 83  ASP B O     1 
ATOM   4341  C CB    . ASP B 1 83  ? 10.160  77.413 75.405  1.00 22.57  ? 83  ASP B CB    1 
ATOM   4342  C CG    . ASP B 1 83  ? 11.209  78.166 74.617  1.00 25.78  ? 83  ASP B CG    1 
ATOM   4343  O OD1   . ASP B 1 83  ? 12.239  78.517 75.217  1.00 22.78  ? 83  ASP B OD1   1 
ATOM   4344  O OD2   . ASP B 1 83  ? 10.986  78.389 73.414  1.00 24.48  ? 83  ASP B OD2   1 
ATOM   4345  N N     . LYS B 1 84  ? 9.087   75.020 77.088  1.00 10.98  ? 84  LYS B N     1 
ATOM   4346  C CA    . LYS B 1 84  ? 7.933   74.477 77.833  1.00 15.41  ? 84  LYS B CA    1 
ATOM   4347  C C     . LYS B 1 84  ? 8.299   74.275 79.318  1.00 17.34  ? 84  LYS B C     1 
ATOM   4348  O O     . LYS B 1 84  ? 7.494   74.547 80.188  1.00 17.44  ? 84  LYS B O     1 
ATOM   4349  C CB    . LYS B 1 84  ? 7.494   73.123 77.263  1.00 12.21  ? 84  LYS B CB    1 
ATOM   4350  C CG    . LYS B 1 84  ? 6.093   72.727 77.743  1.00 19.00  ? 84  LYS B CG    1 
ATOM   4351  C CD    . LYS B 1 84  ? 5.055   73.728 77.217  1.00 21.04  ? 84  LYS B CD    1 
ATOM   4352  C CE    . LYS B 1 84  ? 3.629   73.334 77.567  1.00 24.03  ? 84  LYS B CE    1 
ATOM   4353  N NZ    . LYS B 1 84  ? 2.728   74.428 77.032  1.00 22.01  ? 84  LYS B NZ    1 
ATOM   4354  N N     . ALA B 1 85  ? 9.488   73.747 79.638  1.00 15.43  ? 85  ALA B N     1 
ATOM   4355  C CA    . ALA B 1 85  ? 9.901   73.513 81.018  1.00 14.58  ? 85  ALA B CA    1 
ATOM   4356  C C     . ALA B 1 85  ? 10.059  74.830 81.774  1.00 15.66  ? 85  ALA B C     1 
ATOM   4357  O O     . ALA B 1 85  ? 9.770   74.967 82.982  1.00 16.49  ? 85  ALA B O     1 
ATOM   4358  C CB    . ALA B 1 85  ? 11.217  72.736 81.066  1.00 12.50  ? 85  ALA B CB    1 
ATOM   4359  N N     . LYS B 1 86  ? 10.487  75.868 81.068  1.00 15.64  ? 86  LYS B N     1 
ATOM   4360  C CA    . LYS B 1 86  ? 10.597  77.188 81.663  1.00 14.47  ? 86  LYS B CA    1 
ATOM   4361  C C     . LYS B 1 86  ? 9.198   77.694 82.009  1.00 18.33  ? 86  LYS B C     1 
ATOM   4362  O O     . LYS B 1 86  ? 8.946   78.198 83.119  1.00 16.31  ? 86  LYS B O     1 
ATOM   4363  C CB    . LYS B 1 86  ? 11.312  78.157 80.747  1.00 18.22  ? 86  LYS B CB    1 
ATOM   4364  C CG    . LYS B 1 86  ? 11.400  79.604 81.237  1.00 19.09  ? 86  LYS B CG    1 
ATOM   4365  C CD    . LYS B 1 86  ? 12.228  79.641 82.538  1.00 20.10  ? 86  LYS B CD    1 
ATOM   4366  C CE    . LYS B 1 86  ? 12.366  81.082 83.031  1.00 23.34  ? 86  LYS B CE    1 
ATOM   4367  N NZ    . LYS B 1 86  ? 13.077  81.090 84.368  1.00 22.95  ? 86  LYS B NZ    1 
ATOM   4368  N N     . GLU B 1 87  ? 8.228   77.535 81.106  1.00 16.45  ? 87  GLU B N     1 
ATOM   4369  C CA    . GLU B 1 87  ? 6.864   77.965 81.303  1.00 17.91  ? 87  GLU B CA    1 
ATOM   4370  C C     . GLU B 1 87  ? 6.161   77.247 82.444  1.00 15.63  ? 87  GLU B C     1 
ATOM   4371  O O     . GLU B 1 87  ? 5.514   77.809 83.332  1.00 15.09  ? 87  GLU B O     1 
ATOM   4372  C CB    . GLU B 1 87  ? 6.084   77.692 79.997  1.00 23.78  ? 87  GLU B CB    1 
ATOM   4373  C CG    . GLU B 1 87  ? 4.623   78.104 80.087  1.00 33.21  ? 87  GLU B CG    1 
ATOM   4374  C CD    . GLU B 1 87  ? 3.692   77.377 79.129  1.00 37.86  ? 87  GLU B CD    1 
ATOM   4375  O OE1   . GLU B 1 87  ? 4.090   77.157 77.975  1.00 37.68  ? 87  GLU B OE1   1 
ATOM   4376  O OE2   . GLU B 1 87  ? 2.556   77.038 79.511  1.00 41.77  ? 87  GLU B OE2   1 
ATOM   4377  N N     . LEU B 1 88  ? 6.269   75.928 82.487  1.00 13.35  ? 88  LEU B N     1 
ATOM   4378  C CA    . LEU B 1 88  ? 5.585   75.160 83.513  1.00 14.56  ? 88  LEU B CA    1 
ATOM   4379  C C     . LEU B 1 88  ? 6.228   75.211 84.895  1.00 17.32  ? 88  LEU B C     1 
ATOM   4380  O O     . LEU B 1 88  ? 5.515   75.328 85.896  1.00 16.72  ? 88  LEU B O     1 
ATOM   4381  C CB    . LEU B 1 88  ? 5.538   73.682 83.109  1.00 13.85  ? 88  LEU B CB    1 
ATOM   4382  C CG    . LEU B 1 88  ? 4.583   73.354 81.945  1.00 20.58  ? 88  LEU B CG    1 
ATOM   4383  C CD1   . LEU B 1 88  ? 4.650   71.883 81.576  1.00 15.82  ? 88  LEU B CD1   1 
ATOM   4384  C CD2   . LEU B 1 88  ? 3.153   73.733 82.345  1.00 20.98  ? 88  LEU B CD2   1 
ATOM   4385  N N     . PHE B 1 89  ? 7.541   75.046 84.963  1.00 16.02  ? 89  PHE B N     1 
ATOM   4386  C CA    . PHE B 1 89  ? 8.241   74.903 86.233  1.00 16.47  ? 89  PHE B CA    1 
ATOM   4387  C C     . PHE B 1 89  ? 9.095   76.094 86.623  1.00 17.38  ? 89  PHE B C     1 
ATOM   4388  O O     . PHE B 1 89  ? 9.583   76.164 87.766  1.00 18.04  ? 89  PHE B O     1 
ATOM   4389  C CB    . PHE B 1 89  ? 9.156   73.674 86.172  1.00 11.27  ? 89  PHE B CB    1 
ATOM   4390  C CG    . PHE B 1 89  ? 8.509   72.481 85.549  1.00 15.19  ? 89  PHE B CG    1 
ATOM   4391  C CD1   . PHE B 1 89  ? 7.443   71.846 86.151  1.00 16.33  ? 89  PHE B CD1   1 
ATOM   4392  C CD2   . PHE B 1 89  ? 8.958   71.992 84.324  1.00 16.05  ? 89  PHE B CD2   1 
ATOM   4393  C CE1   . PHE B 1 89  ? 6.827   70.754 85.572  1.00 19.68  ? 89  PHE B CE1   1 
ATOM   4394  C CE2   . PHE B 1 89  ? 8.386   70.885 83.758  1.00 14.19  ? 89  PHE B CE2   1 
ATOM   4395  C CZ    . PHE B 1 89  ? 7.316   70.260 84.367  1.00 15.72  ? 89  PHE B CZ    1 
ATOM   4396  N N     . ASN B 1 90  ? 9.337   76.971 85.662  1.00 16.12  ? 90  ASN B N     1 
ATOM   4397  C CA    . ASN B 1 90  ? 10.243  78.090 85.825  1.00 16.00  ? 90  ASN B CA    1 
ATOM   4398  C C     . ASN B 1 90  ? 11.683  77.602 85.974  1.00 18.49  ? 90  ASN B C     1 
ATOM   4399  O O     . ASN B 1 90  ? 12.501  78.313 86.545  1.00 19.29  ? 90  ASN B O     1 
ATOM   4400  C CB    . ASN B 1 90  ? 9.850   78.929 87.049  1.00 19.64  ? 90  ASN B CB    1 
ATOM   4401  C CG    . ASN B 1 90  ? 10.390  80.332 86.983  1.00 27.54  ? 90  ASN B CG    1 
ATOM   4402  O OD1   . ASN B 1 90  ? 10.836  80.805 85.946  1.00 23.91  ? 90  ASN B OD1   1 
ATOM   4403  N ND2   . ASN B 1 90  ? 10.392  81.042 88.118  1.00 27.79  ? 90  ASN B ND2   1 
ATOM   4404  N N     . TYR B 1 91  ? 12.051  76.422 85.490  1.00 15.96  ? 91  TYR B N     1 
ATOM   4405  C CA    . TYR B 1 91  ? 13.394  75.877 85.557  1.00 17.25  ? 91  TYR B CA    1 
ATOM   4406  C C     . TYR B 1 91  ? 14.138  76.250 84.270  1.00 20.45  ? 91  TYR B C     1 
ATOM   4407  O O     . TYR B 1 91  ? 13.557  76.335 83.177  1.00 17.34  ? 91  TYR B O     1 
ATOM   4408  C CB    . TYR B 1 91  ? 13.399  74.397 85.860  1.00 14.88  ? 91  TYR B CB    1 
ATOM   4409  C CG    . TYR B 1 91  ? 12.960  73.947 87.242  1.00 15.41  ? 91  TYR B CG    1 
ATOM   4410  C CD1   . TYR B 1 91  ? 12.388  74.812 88.164  1.00 14.03  ? 91  TYR B CD1   1 
ATOM   4411  C CD2   . TYR B 1 91  ? 13.126  72.626 87.635  1.00 11.13  ? 91  TYR B CD2   1 
ATOM   4412  C CE1   . TYR B 1 91  ? 11.962  74.411 89.414  1.00 15.27  ? 91  TYR B CE1   1 
ATOM   4413  C CE2   . TYR B 1 91  ? 12.685  72.187 88.883  1.00 13.61  ? 91  TYR B CE2   1 
ATOM   4414  C CZ    . TYR B 1 91  ? 12.141  73.093 89.768  1.00 15.48  ? 91  TYR B CZ    1 
ATOM   4415  O OH    . TYR B 1 91  ? 11.717  72.650 91.000  1.00 19.58  ? 91  TYR B OH    1 
ATOM   4416  N N     . ASP B 1 92  ? 15.405  76.604 84.388  1.00 17.07  ? 92  ASP B N     1 
ATOM   4417  C CA    . ASP B 1 92  ? 16.148  77.147 83.258  1.00 17.88  ? 92  ASP B CA    1 
ATOM   4418  C C     . ASP B 1 92  ? 16.972  76.136 82.481  1.00 13.95  ? 92  ASP B C     1 
ATOM   4419  O O     . ASP B 1 92  ? 17.506  76.555 81.462  1.00 16.41  ? 92  ASP B O     1 
ATOM   4420  C CB    . ASP B 1 92  ? 17.134  78.217 83.736  1.00 17.86  ? 92  ASP B CB    1 
ATOM   4421  C CG    . ASP B 1 92  ? 16.451  79.458 84.239  1.00 27.22  ? 92  ASP B CG    1 
ATOM   4422  O OD1   . ASP B 1 92  ? 15.381  79.809 83.715  1.00 27.24  ? 92  ASP B OD1   1 
ATOM   4423  O OD2   . ASP B 1 92  ? 16.976  80.087 85.175  1.00 31.87  ? 92  ASP B OD2   1 
ATOM   4424  N N     . TYR B 1 93  ? 17.140  74.926 82.947  1.00 13.72  ? 93  TYR B N     1 
ATOM   4425  C CA    . TYR B 1 93  ? 17.997  73.983 82.223  1.00 15.04  ? 93  TYR B CA    1 
ATOM   4426  C C     . TYR B 1 93  ? 17.244  72.669 82.047  1.00 18.15  ? 93  TYR B C     1 
ATOM   4427  O O     . TYR B 1 93  ? 16.595  72.224 83.012  1.00 14.86  ? 93  TYR B O     1 
ATOM   4428  C CB    . TYR B 1 93  ? 19.272  73.638 83.013  1.00 15.06  ? 93  TYR B CB    1 
ATOM   4429  C CG    . TYR B 1 93  ? 20.105  74.885 83.293  1.00 20.61  ? 93  TYR B CG    1 
ATOM   4430  C CD1   . TYR B 1 93  ? 20.828  75.506 82.284  1.00 23.08  ? 93  TYR B CD1   1 
ATOM   4431  C CD2   . TYR B 1 93  ? 20.095  75.466 84.557  1.00 22.99  ? 93  TYR B CD2   1 
ATOM   4432  C CE1   . TYR B 1 93  ? 21.550  76.655 82.542  1.00 26.23  ? 93  TYR B CE1   1 
ATOM   4433  C CE2   . TYR B 1 93  ? 20.821  76.621 84.831  1.00 24.72  ? 93  TYR B CE2   1 
ATOM   4434  C CZ    . TYR B 1 93  ? 21.552  77.198 83.826  1.00 26.71  ? 93  TYR B CZ    1 
ATOM   4435  O OH    . TYR B 1 93  ? 22.279  78.349 84.065  1.00 28.35  ? 93  TYR B OH    1 
ATOM   4436  N N     . ILE B 1 94  ? 17.406  72.065 80.871  1.00 12.08  ? 94  ILE B N     1 
ATOM   4437  C CA    . ILE B 1 94  ? 16.798  70.759 80.668  1.00 14.08  ? 94  ILE B CA    1 
ATOM   4438  C C     . ILE B 1 94  ? 17.798  69.835 79.988  1.00 12.51  ? 94  ILE B C     1 
ATOM   4439  O O     . ILE B 1 94  ? 18.724  70.204 79.268  1.00 14.43  ? 94  ILE B O     1 
ATOM   4440  C CB    . ILE B 1 94  ? 15.539  70.782 79.769  1.00 16.14  ? 94  ILE B CB    1 
ATOM   4441  C CG1   . ILE B 1 94  ? 15.903  71.297 78.369  1.00 16.72  ? 94  ILE B CG1   1 
ATOM   4442  C CG2   . ILE B 1 94  ? 14.443  71.653 80.376  1.00 9.63   ? 94  ILE B CG2   1 
ATOM   4443  C CD1   . ILE B 1 94  ? 14.945  70.750 77.302  1.00 17.37  ? 94  ILE B CD1   1 
ATOM   4444  N N     . ILE B 1 95  ? 17.597  68.567 80.238  1.00 10.66  ? 95  ILE B N     1 
ATOM   4445  C CA    . ILE B 1 95  ? 18.272  67.460 79.625  1.00 11.96  ? 95  ILE B CA    1 
ATOM   4446  C C     . ILE B 1 95  ? 17.188  66.408 79.371  1.00 15.76  ? 95  ILE B C     1 
ATOM   4447  O O     . ILE B 1 95  ? 16.704  65.772 80.304  1.00 13.67  ? 95  ILE B O     1 
ATOM   4448  C CB    . ILE B 1 95  ? 19.414  66.822 80.420  1.00 14.62  ? 95  ILE B CB    1 
ATOM   4449  C CG1   . ILE B 1 95  ? 20.427  67.858 80.908  1.00 15.43  ? 95  ILE B CG1   1 
ATOM   4450  C CG2   . ILE B 1 95  ? 20.143  65.775 79.573  1.00 12.79  ? 95  ILE B CG2   1 
ATOM   4451  C CD1   . ILE B 1 95  ? 21.356  67.375 81.997  1.00 25.32  ? 95  ILE B CD1   1 
ATOM   4452  N N     . PRO B 1 96  ? 16.865  66.174 78.097  1.00 16.86  ? 96  PRO B N     1 
ATOM   4453  C CA    . PRO B 1 96  ? 15.925  65.115 77.751  1.00 16.42  ? 96  PRO B CA    1 
ATOM   4454  C C     . PRO B 1 96  ? 16.549  63.782 78.124  1.00 14.08  ? 96  PRO B C     1 
ATOM   4455  O O     . PRO B 1 96  ? 17.764  63.679 78.195  1.00 14.79  ? 96  PRO B O     1 
ATOM   4456  C CB    . PRO B 1 96  ? 15.731  65.186 76.230  1.00 16.71  ? 96  PRO B CB    1 
ATOM   4457  C CG    . PRO B 1 96  ? 16.639  66.269 75.761  1.00 20.73  ? 96  PRO B CG    1 
ATOM   4458  C CD    . PRO B 1 96  ? 17.403  66.843 76.919  1.00 15.27  ? 96  PRO B CD    1 
ATOM   4459  N N     . ALA B 1 97  ? 15.718  62.772 78.354  1.00 11.49  ? 97  ALA B N     1 
ATOM   4460  C CA    . ALA B 1 97  ? 16.200  61.438 78.640  1.00 10.94  ? 97  ALA B CA    1 
ATOM   4461  C C     . ALA B 1 97  ? 15.231  60.485 77.970  1.00 11.68  ? 97  ALA B C     1 
ATOM   4462  O O     . ALA B 1 97  ? 14.088  60.857 77.702  1.00 11.21  ? 97  ALA B O     1 
ATOM   4463  C CB    . ALA B 1 97  ? 16.323  61.201 80.143  1.00 13.92  ? 97  ALA B CB    1 
ATOM   4464  N N     . HIS B 1 98  ? 15.658  59.256 77.725  1.00 8.79   ? 98  HIS B N     1 
ATOM   4465  C CA    . HIS B 1 98  ? 14.755  58.340 77.011  1.00 11.32  ? 98  HIS B CA    1 
ATOM   4466  C C     . HIS B 1 98  ? 13.566  57.951 77.875  1.00 15.31  ? 98  HIS B C     1 
ATOM   4467  O O     . HIS B 1 98  ? 12.490  57.754 77.312  1.00 9.34   ? 98  HIS B O     1 
ATOM   4468  C CB    . HIS B 1 98  ? 15.516  57.142 76.477  1.00 8.22   ? 98  HIS B CB    1 
ATOM   4469  C CG    . HIS B 1 98  ? 15.731  56.029 77.460  1.00 14.04  ? 98  HIS B CG    1 
ATOM   4470  N ND1   . HIS B 1 98  ? 16.770  56.042 78.341  1.00 11.34  ? 98  HIS B ND1   1 
ATOM   4471  C CD2   . HIS B 1 98  ? 15.076  54.877 77.692  1.00 12.40  ? 98  HIS B CD2   1 
ATOM   4472  C CE1   . HIS B 1 98  ? 16.759  54.947 79.089  1.00 12.95  ? 98  HIS B CE1   1 
ATOM   4473  N NE2   . HIS B 1 98  ? 15.722  54.193 78.691  1.00 16.56  ? 98  HIS B NE2   1 
ATOM   4474  N N     . GLN B 1 99  ? 13.685  57.892 79.188  1.00 12.10  ? 99  GLN B N     1 
ATOM   4475  C CA    . GLN B 1 99  ? 12.572  57.669 80.118  1.00 13.72  ? 99  GLN B CA    1 
ATOM   4476  C C     . GLN B 1 99  ? 13.026  58.033 81.552  1.00 15.29  ? 99  GLN B C     1 
ATOM   4477  O O     . GLN B 1 99  ? 14.126  58.587 81.691  1.00 11.26  ? 99  GLN B O     1 
ATOM   4478  C CB    . GLN B 1 99  ? 11.847  56.361 80.042  1.00 8.90   ? 99  GLN B CB    1 
ATOM   4479  C CG    . GLN B 1 99  ? 12.634  55.115 80.399  1.00 12.27  ? 99  GLN B CG    1 
ATOM   4480  C CD    . GLN B 1 99  ? 11.873  53.842 80.202  1.00 20.38  ? 99  GLN B CD    1 
ATOM   4481  O OE1   . GLN B 1 99  ? 11.515  53.580 79.043  1.00 13.41  ? 99  GLN B OE1   1 
ATOM   4482  N NE2   . GLN B 1 99  ? 11.584  52.968 81.188  1.00 11.96  ? 99  GLN B NE2   1 
ATOM   4483  N N     . GLY B 1 100 ? 12.152  57.860 82.531  1.00 10.49  ? 100 GLY B N     1 
ATOM   4484  C CA    . GLY B 1 100 ? 12.424  58.353 83.889  1.00 9.07   ? 100 GLY B CA    1 
ATOM   4485  C C     . GLY B 1 100 ? 13.634  57.741 84.584  1.00 9.40   ? 100 GLY B C     1 
ATOM   4486  O O     . GLY B 1 100 ? 14.402  58.485 85.191  1.00 11.63  ? 100 GLY B O     1 
ATOM   4487  N N     . ARG B 1 101 ? 13.890  56.451 84.440  1.00 9.76   ? 101 ARG B N     1 
ATOM   4488  C CA    . ARG B 1 101 ? 15.075  55.829 85.046  1.00 12.70  ? 101 ARG B CA    1 
ATOM   4489  C C     . ARG B 1 101 ? 16.329  56.275 84.302  1.00 17.29  ? 101 ARG B C     1 
ATOM   4490  O O     . ARG B 1 101 ? 17.443  56.294 84.847  1.00 14.83  ? 101 ARG B O     1 
ATOM   4491  C CB    . ARG B 1 101 ? 14.942  54.321 85.143  1.00 7.04   ? 101 ARG B CB    1 
ATOM   4492  C CG    . ARG B 1 101 ? 14.987  53.584 83.804  1.00 10.52  ? 101 ARG B CG    1 
ATOM   4493  C CD    . ARG B 1 101 ? 14.401  52.172 83.902  1.00 13.59  ? 101 ARG B CD    1 
ATOM   4494  N NE    . ARG B 1 101 ? 12.942  52.278 84.106  1.00 13.86  ? 101 ARG B NE    1 
ATOM   4495  C CZ    . ARG B 1 101 ? 12.132  51.236 84.243  1.00 15.97  ? 101 ARG B CZ    1 
ATOM   4496  N NH1   . ARG B 1 101 ? 12.662  50.030 84.215  1.00 8.74   ? 101 ARG B NH1   1 
ATOM   4497  N NH2   . ARG B 1 101 ? 10.820  51.436 84.360  1.00 13.13  ? 101 ARG B NH2   1 
ATOM   4498  N N     . GLY B 1 102 ? 16.181  56.784 83.058  1.00 13.69  ? 102 GLY B N     1 
ATOM   4499  C CA    . GLY B 1 102 ? 17.331  57.318 82.368  1.00 9.13   ? 102 GLY B CA    1 
ATOM   4500  C C     . GLY B 1 102 ? 17.626  58.673 82.987  1.00 12.78  ? 102 GLY B C     1 
ATOM   4501  O O     . GLY B 1 102 ? 18.795  59.040 83.133  1.00 13.71  ? 102 GLY B O     1 
ATOM   4502  N N     . ALA B 1 103 ? 16.588  59.422 83.341  1.00 7.89   ? 103 ALA B N     1 
ATOM   4503  C CA    . ALA B 1 103 ? 16.805  60.714 83.980  1.00 11.93  ? 103 ALA B CA    1 
ATOM   4504  C C     . ALA B 1 103 ? 17.444  60.519 85.381  1.00 14.55  ? 103 ALA B C     1 
ATOM   4505  O O     . ALA B 1 103 ? 18.310  61.286 85.763  1.00 12.03  ? 103 ALA B O     1 
ATOM   4506  C CB    . ALA B 1 103 ? 15.530  61.501 84.107  1.00 9.87   ? 103 ALA B CB    1 
ATOM   4507  N N     . GLU B 1 104 ? 17.062  59.468 86.096  1.00 13.31  ? 104 GLU B N     1 
ATOM   4508  C CA    . GLU B 1 104 ? 17.627  59.122 87.395  1.00 17.71  ? 104 GLU B CA    1 
ATOM   4509  C C     . GLU B 1 104 ? 19.106  58.774 87.218  1.00 18.85  ? 104 GLU B C     1 
ATOM   4510  O O     . GLU B 1 104 ? 19.971  59.225 88.007  1.00 17.84  ? 104 GLU B O     1 
ATOM   4511  C CB    . GLU B 1 104 ? 16.863  57.950 88.043  1.00 9.92   ? 104 GLU B CB    1 
ATOM   4512  C CG    . GLU B 1 104 ? 15.480  58.419 88.541  1.00 16.03  ? 104 GLU B CG    1 
ATOM   4513  C CD    . GLU B 1 104 ? 14.478  57.326 88.821  1.00 14.84  ? 104 GLU B CD    1 
ATOM   4514  O OE1   . GLU B 1 104 ? 14.668  56.118 88.534  1.00 13.50  ? 104 GLU B OE1   1 
ATOM   4515  O OE2   . GLU B 1 104 ? 13.382  57.655 89.364  1.00 16.16  ? 104 GLU B OE2   1 
ATOM   4516  N N     . ASN B 1 105 ? 19.389  57.961 86.180  1.00 14.98  ? 105 ASN B N     1 
ATOM   4517  C CA    . ASN B 1 105 ? 20.765  57.548 85.931  1.00 16.49  ? 105 ASN B CA    1 
ATOM   4518  C C     . ASN B 1 105 ? 21.690  58.694 85.597  1.00 16.41  ? 105 ASN B C     1 
ATOM   4519  O O     . ASN B 1 105 ? 22.872  58.618 85.846  1.00 18.61  ? 105 ASN B O     1 
ATOM   4520  C CB    . ASN B 1 105 ? 20.843  56.459 84.838  1.00 15.62  ? 105 ASN B CB    1 
ATOM   4521  C CG    . ASN B 1 105 ? 22.226  55.918 84.623  1.00 24.95  ? 105 ASN B CG    1 
ATOM   4522  O OD1   . ASN B 1 105 ? 22.971  55.783 85.593  1.00 20.00  ? 105 ASN B OD1   1 
ATOM   4523  N ND2   . ASN B 1 105 ? 22.589  55.614 83.384  1.00 14.70  ? 105 ASN B ND2   1 
ATOM   4524  N N     . ILE B 1 106 ? 21.227  59.761 85.013  1.00 16.01  ? 106 ILE B N     1 
ATOM   4525  C CA    . ILE B 1 106 ? 21.962  60.961 84.688  1.00 17.98  ? 106 ILE B CA    1 
ATOM   4526  C C     . ILE B 1 106 ? 22.174  61.780 85.961  1.00 21.15  ? 106 ILE B C     1 
ATOM   4527  O O     . ILE B 1 106 ? 23.253  62.311 86.222  1.00 20.26  ? 106 ILE B O     1 
ATOM   4528  C CB    . ILE B 1 106 ? 21.180  61.824 83.675  1.00 16.27  ? 106 ILE B CB    1 
ATOM   4529  C CG1   . ILE B 1 106 ? 21.301  61.277 82.219  1.00 23.25  ? 106 ILE B CG1   1 
ATOM   4530  C CG2   . ILE B 1 106 ? 21.586  63.297 83.656  1.00 16.28  ? 106 ILE B CG2   1 
ATOM   4531  C CD1   . ILE B 1 106 ? 20.241  61.986 81.339  1.00 19.91  ? 106 ILE B CD1   1 
ATOM   4532  N N     . LEU B 1 107 ? 21.072  62.021 86.696  1.00 15.77  ? 107 LEU B N     1 
ATOM   4533  C CA    . LEU B 1 107 ? 21.143  62.974 87.791  1.00 16.47  ? 107 LEU B CA    1 
ATOM   4534  C C     . LEU B 1 107 ? 21.704  62.430 89.110  1.00 17.66  ? 107 LEU B C     1 
ATOM   4535  O O     . LEU B 1 107 ? 22.458  63.137 89.756  1.00 15.80  ? 107 LEU B O     1 
ATOM   4536  C CB    . LEU B 1 107 ? 19.759  63.592 88.062  1.00 17.51  ? 107 LEU B CB    1 
ATOM   4537  C CG    . LEU B 1 107 ? 19.772  64.754 89.074  1.00 19.93  ? 107 LEU B CG    1 
ATOM   4538  C CD1   . LEU B 1 107 ? 20.601  65.913 88.564  1.00 19.10  ? 107 LEU B CD1   1 
ATOM   4539  C CD2   . LEU B 1 107 ? 18.341  65.212 89.358  1.00 18.44  ? 107 LEU B CD2   1 
ATOM   4540  N N     . PHE B 1 108 ? 21.303  61.267 89.554  1.00 15.77  ? 108 PHE B N     1 
ATOM   4541  C CA    . PHE B 1 108 ? 21.684  60.752 90.864  1.00 20.73  ? 108 PHE B CA    1 
ATOM   4542  C C     . PHE B 1 108 ? 23.179  60.626 91.078  1.00 21.97  ? 108 PHE B C     1 
ATOM   4543  O O     . PHE B 1 108 ? 23.701  61.305 91.969  1.00 22.58  ? 108 PHE B O     1 
ATOM   4544  C CB    . PHE B 1 108 ? 20.855  59.504 91.187  1.00 19.02  ? 108 PHE B CB    1 
ATOM   4545  C CG    . PHE B 1 108 ? 19.397  59.812 91.498  1.00 24.35  ? 108 PHE B CG    1 
ATOM   4546  C CD1   . PHE B 1 108 ? 18.796  61.032 91.262  1.00 22.98  ? 108 PHE B CD1   1 
ATOM   4547  C CD2   . PHE B 1 108 ? 18.606  58.814 92.054  1.00 26.98  ? 108 PHE B CD2   1 
ATOM   4548  C CE1   . PHE B 1 108 ? 17.481  61.308 91.545  1.00 26.10  ? 108 PHE B CE1   1 
ATOM   4549  C CE2   . PHE B 1 108 ? 17.274  59.076 92.361  1.00 30.78  ? 108 PHE B CE2   1 
ATOM   4550  C CZ    . PHE B 1 108 ? 16.706  60.311 92.097  1.00 21.58  ? 108 PHE B CZ    1 
ATOM   4551  N N     . PRO B 1 109 ? 23.932  60.023 90.156  1.00 22.25  ? 109 PRO B N     1 
ATOM   4552  C CA    . PRO B 1 109 ? 25.387  59.898 90.284  1.00 19.65  ? 109 PRO B CA    1 
ATOM   4553  C C     . PRO B 1 109 ? 25.997  61.259 90.402  1.00 21.75  ? 109 PRO B C     1 
ATOM   4554  O O     . PRO B 1 109 ? 26.909  61.500 91.208  1.00 22.07  ? 109 PRO B O     1 
ATOM   4555  C CB    . PRO B 1 109 ? 25.803  59.152 89.017  1.00 21.53  ? 109 PRO B CB    1 
ATOM   4556  C CG    . PRO B 1 109 ? 24.599  58.342 88.654  1.00 18.28  ? 109 PRO B CG    1 
ATOM   4557  C CD    . PRO B 1 109 ? 23.416  59.227 89.005  1.00 18.05  ? 109 PRO B CD    1 
ATOM   4558  N N     . VAL B 1 110 ? 25.430  62.225 89.675  1.00 19.01  ? 110 VAL B N     1 
ATOM   4559  C CA    . VAL B 1 110 ? 25.976  63.572 89.652  1.00 19.35  ? 110 VAL B CA    1 
ATOM   4560  C C     . VAL B 1 110 ? 25.767  64.280 90.988  1.00 23.86  ? 110 VAL B C     1 
ATOM   4561  O O     . VAL B 1 110 ? 26.603  65.087 91.408  1.00 23.32  ? 110 VAL B O     1 
ATOM   4562  C CB    . VAL B 1 110 ? 25.365  64.366 88.475  1.00 24.09  ? 110 VAL B CB    1 
ATOM   4563  C CG1   . VAL B 1 110 ? 25.458  65.855 88.688  1.00 19.05  ? 110 VAL B CG1   1 
ATOM   4564  C CG2   . VAL B 1 110 ? 26.022  63.961 87.152  1.00 22.72  ? 110 VAL B CG2   1 
ATOM   4565  N N     . LEU B 1 111 ? 24.621  64.055 91.615  1.00 20.19  ? 111 LEU B N     1 
ATOM   4566  C CA    . LEU B 1 111 ? 24.351  64.703 92.920  1.00 23.09  ? 111 LEU B CA    1 
ATOM   4567  C C     . LEU B 1 111 ? 25.287  64.109 93.978  1.00 19.44  ? 111 LEU B C     1 
ATOM   4568  O O     . LEU B 1 111 ? 25.758  64.861 94.821  1.00 21.26  ? 111 LEU B O     1 
ATOM   4569  C CB    . LEU B 1 111 ? 22.887  64.524 93.346  1.00 17.27  ? 111 LEU B CB    1 
ATOM   4570  C CG    . LEU B 1 111 ? 21.829  65.210 92.460  1.00 21.58  ? 111 LEU B CG    1 
ATOM   4571  C CD1   . LEU B 1 111 ? 20.442  64.788 92.884  1.00 16.08  ? 111 LEU B CD1   1 
ATOM   4572  C CD2   . LEU B 1 111 ? 21.996  66.721 92.443  1.00 19.37  ? 111 LEU B CD2   1 
ATOM   4573  N N     . LEU B 1 112 ? 25.547  62.813 93.948  1.00 16.66  ? 112 LEU B N     1 
ATOM   4574  C CA    . LEU B 1 112 ? 26.439  62.163 94.874  1.00 21.80  ? 112 LEU B CA    1 
ATOM   4575  C C     . LEU B 1 112 ? 27.841  62.757 94.724  1.00 28.34  ? 112 LEU B C     1 
ATOM   4576  O O     . LEU B 1 112 ? 28.431  63.295 95.674  1.00 24.28  ? 112 LEU B O     1 
ATOM   4577  C CB    . LEU B 1 112 ? 26.512  60.657 94.670  1.00 18.91  ? 112 LEU B CB    1 
ATOM   4578  C CG    . LEU B 1 112 ? 27.570  59.859 95.419  1.00 25.67  ? 112 LEU B CG    1 
ATOM   4579  C CD1   . LEU B 1 112 ? 27.431  60.009 96.937  1.00 21.47  ? 112 LEU B CD1   1 
ATOM   4580  C CD2   . LEU B 1 112 ? 27.551  58.386 95.029  1.00 18.73  ? 112 LEU B CD2   1 
ATOM   4581  N N     . LYS B 1 113 ? 28.341  62.757 93.485  1.00 28.71  ? 113 LYS B N     1 
ATOM   4582  C CA    . LYS B 1 113 ? 29.678  63.274 93.204  1.00 29.89  ? 113 LYS B CA    1 
ATOM   4583  C C     . LYS B 1 113 ? 29.799  64.706 93.695  1.00 30.31  ? 113 LYS B C     1 
ATOM   4584  O O     . LYS B 1 113 ? 30.790  65.090 94.326  1.00 29.76  ? 113 LYS B O     1 
ATOM   4585  C CB    . LYS B 1 113 ? 30.040  63.127 91.734  1.00 38.50  ? 113 LYS B CB    1 
ATOM   4586  C CG    . LYS B 1 113 ? 31.399  63.685 91.352  1.00 55.08  ? 113 LYS B CG    1 
ATOM   4587  C CD    . LYS B 1 113 ? 31.667  63.534 89.860  1.00 71.41  ? 113 LYS B CD    1 
ATOM   4588  C CE    . LYS B 1 113 ? 32.393  64.743 89.287  1.00 77.82  ? 113 LYS B CE    1 
ATOM   4589  N NZ    . LYS B 1 113 ? 32.809  64.517 87.873  1.00 82.52  ? 113 LYS B NZ    1 
ATOM   4590  N N     . TYR B 1 114 ? 28.779  65.517 93.424  1.00 27.05  ? 114 TYR B N     1 
ATOM   4591  C CA    . TYR B 1 114 ? 28.767  66.908 93.828  1.00 29.01  ? 114 TYR B CA    1 
ATOM   4592  C C     . TYR B 1 114 ? 28.840  67.098 95.354  1.00 33.16  ? 114 TYR B C     1 
ATOM   4593  O O     . TYR B 1 114 ? 29.428  68.059 95.831  1.00 33.85  ? 114 TYR B O     1 
ATOM   4594  C CB    . TYR B 1 114 ? 27.501  67.525 93.278  1.00 28.56  ? 114 TYR B CB    1 
ATOM   4595  C CG    . TYR B 1 114 ? 27.316  69.006 93.483  1.00 30.08  ? 114 TYR B CG    1 
ATOM   4596  C CD1   . TYR B 1 114 ? 27.956  69.948 92.699  1.00 30.30  ? 114 TYR B CD1   1 
ATOM   4597  C CD2   . TYR B 1 114 ? 26.484  69.457 94.494  1.00 31.90  ? 114 TYR B CD2   1 
ATOM   4598  C CE1   . TYR B 1 114 ? 27.767  71.295 92.902  1.00 29.67  ? 114 TYR B CE1   1 
ATOM   4599  C CE2   . TYR B 1 114 ? 26.282  70.807 94.701  1.00 33.80  ? 114 TYR B CE2   1 
ATOM   4600  C CZ    . TYR B 1 114 ? 26.932  71.721 93.903  1.00 35.12  ? 114 TYR B CZ    1 
ATOM   4601  O OH    . TYR B 1 114 ? 26.711  73.064 94.122  1.00 38.49  ? 114 TYR B OH    1 
ATOM   4602  N N     . LYS B 1 115 ? 28.185  66.244 96.119  1.00 33.42  ? 115 LYS B N     1 
ATOM   4603  C CA    . LYS B 1 115 ? 28.183  66.305 97.569  1.00 37.56  ? 115 LYS B CA    1 
ATOM   4604  C C     . LYS B 1 115 ? 29.540  65.805 98.088  1.00 40.41  ? 115 LYS B C     1 
ATOM   4605  O O     . LYS B 1 115 ? 30.097  66.406 99.002  1.00 40.27  ? 115 LYS B O     1 
ATOM   4606  C CB    . LYS B 1 115 ? 27.019  65.501 98.129  1.00 33.69  ? 115 LYS B CB    1 
ATOM   4607  C CG    . LYS B 1 115 ? 26.704  65.667 99.604  1.00 36.38  ? 115 LYS B CG    1 
ATOM   4608  C CD    . LYS B 1 115 ? 25.841  66.869 99.939  1.00 32.49  ? 115 LYS B CD    1 
ATOM   4609  C CE    . LYS B 1 115 ? 25.382  66.799 101.387 1.00 30.87  ? 115 LYS B CE    1 
ATOM   4610  N NZ    . LYS B 1 115 ? 24.124  67.520 101.693 1.00 27.14  ? 115 LYS B NZ    1 
ATOM   4611  N N     . GLN B 1 116 ? 30.106  64.773 97.473  1.00 39.17  ? 116 GLN B N     1 
ATOM   4612  C CA    . GLN B 1 116 ? 31.406  64.242 97.810  1.00 43.32  ? 116 GLN B CA    1 
ATOM   4613  C C     . GLN B 1 116 ? 32.553  65.191 97.482  1.00 49.87  ? 116 GLN B C     1 
ATOM   4614  O O     . GLN B 1 116 ? 33.528  65.289 98.225  1.00 48.33  ? 116 GLN B O     1 
ATOM   4615  C CB    . GLN B 1 116 ? 31.670  62.944 97.057  1.00 31.26  ? 116 GLN B CB    1 
ATOM   4616  C CG    . GLN B 1 116 ? 30.984  61.714 97.618  1.00 30.30  ? 116 GLN B CG    1 
ATOM   4617  C CD    . GLN B 1 116 ? 31.227  60.524 96.711  1.00 31.78  ? 116 GLN B CD    1 
ATOM   4618  O OE1   . GLN B 1 116 ? 31.556  60.758 95.554  1.00 38.62  ? 116 GLN B OE1   1 
ATOM   4619  N NE2   . GLN B 1 116 ? 31.025  59.318 97.212  1.00 38.45  ? 116 GLN B NE2   1 
ATOM   4620  N N     . LYS B 1 117 ? 32.447  65.954 96.407  1.00 55.91  ? 117 LYS B N     1 
ATOM   4621  C CA    . LYS B 1 117 ? 33.468  66.895 95.972  1.00 63.67  ? 117 LYS B CA    1 
ATOM   4622  C C     . LYS B 1 117 ? 33.854  67.808 97.129  1.00 68.38  ? 117 LYS B C     1 
ATOM   4623  O O     . LYS B 1 117 ? 35.041  68.057 97.371  1.00 69.66  ? 117 LYS B O     1 
ATOM   4624  C CB    . LYS B 1 117 ? 33.033  67.673 94.737  1.00 74.86  ? 117 LYS B CB    1 
ATOM   4625  C CG    . LYS B 1 117 ? 32.790  69.162 94.885  1.00 85.26  ? 117 LYS B CG    1 
ATOM   4626  C CD    . LYS B 1 117 ? 32.101  69.757 93.671  1.00 93.58  ? 117 LYS B CD    1 
ATOM   4627  C CE    . LYS B 1 117 ? 32.980  69.689 92.430  1.00 98.95  ? 117 LYS B CE    1 
ATOM   4628  N NZ    . LYS B 1 117 ? 32.251  69.128 91.256  1.00 101.60 ? 117 LYS B NZ    1 
ATOM   4629  N N     . GLU B 1 118 ? 32.861  68.261 97.885  1.00 69.53  ? 118 GLU B N     1 
ATOM   4630  C CA    . GLU B 1 118 ? 33.054  69.093 99.053  1.00 71.58  ? 118 GLU B CA    1 
ATOM   4631  C C     . GLU B 1 118 ? 33.662  68.380 100.249 1.00 69.30  ? 118 GLU B C     1 
ATOM   4632  O O     . GLU B 1 118 ? 34.018  69.035 101.235 1.00 71.38  ? 118 GLU B O     1 
ATOM   4633  C CB    . GLU B 1 118 ? 31.696  69.687 99.465  1.00 82.02  ? 118 GLU B CB    1 
ATOM   4634  C CG    . GLU B 1 118 ? 31.016  70.485 98.365  1.00 94.07  ? 118 GLU B CG    1 
ATOM   4635  C CD    . GLU B 1 118 ? 29.506  70.522 98.500  1.00 101.32 ? 118 GLU B CD    1 
ATOM   4636  O OE1   . GLU B 1 118 ? 28.948  69.749 99.308  1.00 106.39 ? 118 GLU B OE1   1 
ATOM   4637  O OE2   . GLU B 1 118 ? 28.868  71.324 97.783  1.00 103.98 ? 118 GLU B OE2   1 
ATOM   4638  N N     . GLY B 1 119 ? 33.786  67.068 100.237 1.00 67.32  ? 119 GLY B N     1 
ATOM   4639  C CA    . GLY B 1 119 ? 34.363  66.299 101.332 1.00 64.37  ? 119 GLY B CA    1 
ATOM   4640  C C     . GLY B 1 119 ? 33.265  65.651 102.174 1.00 62.14  ? 119 GLY B C     1 
ATOM   4641  O O     . GLY B 1 119 ? 33.522  64.957 103.153 1.00 62.41  ? 119 GLY B O     1 
ATOM   4642  N N     . LYS B 1 120 ? 32.012  65.893 101.800 1.00 56.47  ? 120 LYS B N     1 
ATOM   4643  C CA    . LYS B 1 120 ? 30.868  65.354 102.521 1.00 48.86  ? 120 LYS B CA    1 
ATOM   4644  C C     . LYS B 1 120 ? 30.449  64.007 101.966 1.00 44.83  ? 120 LYS B C     1 
ATOM   4645  O O     . LYS B 1 120 ? 31.221  63.332 101.291 1.00 40.94  ? 120 LYS B O     1 
ATOM   4646  C CB    . LYS B 1 120 ? 29.733  66.377 102.463 1.00 51.54  ? 120 LYS B CB    1 
ATOM   4647  C CG    . LYS B 1 120 ? 30.211  67.772 102.849 1.00 57.62  ? 120 LYS B CG    1 
ATOM   4648  C CD    . LYS B 1 120 ? 29.090  68.790 102.835 1.00 60.28  ? 120 LYS B CD    1 
ATOM   4649  C CE    . LYS B 1 120 ? 29.548  70.107 103.444 1.00 65.39  ? 120 LYS B CE    1 
ATOM   4650  N NZ    . LYS B 1 120 ? 28.881  71.277 102.797 1.00 75.24  ? 120 LYS B NZ    1 
ATOM   4651  N N     . ALA B 1 121 ? 29.237  63.573 102.268 1.00 41.67  ? 121 ALA B N     1 
ATOM   4652  C CA    . ALA B 1 121 ? 28.689  62.323 101.797 1.00 39.49  ? 121 ALA B CA    1 
ATOM   4653  C C     . ALA B 1 121 ? 29.544  61.098 102.060 1.00 37.96  ? 121 ALA B C     1 
ATOM   4654  O O     . ALA B 1 121 ? 29.577  60.203 101.210 1.00 35.79  ? 121 ALA B O     1 
ATOM   4655  C CB    . ALA B 1 121 ? 28.406  62.434 100.304 1.00 39.95  ? 121 ALA B CB    1 
ATOM   4656  N N     . LYS B 1 122 ? 30.102  60.964 103.271 1.00 36.98  ? 122 LYS B N     1 
ATOM   4657  C CA    . LYS B 1 122 ? 30.863  59.788 103.638 1.00 33.80  ? 122 LYS B CA    1 
ATOM   4658  C C     . LYS B 1 122 ? 30.000  58.575 103.835 1.00 31.83  ? 122 LYS B C     1 
ATOM   4659  O O     . LYS B 1 122 ? 30.470  57.498 103.489 1.00 32.10  ? 122 LYS B O     1 
ATOM   4660  C CB    . LYS B 1 122 ? 31.678  60.046 104.919 1.00 47.12  ? 122 LYS B CB    1 
ATOM   4661  C CG    . LYS B 1 122 ? 32.863  60.968 104.634 1.00 54.42  ? 122 LYS B CG    1 
ATOM   4662  C CD    . LYS B 1 122 ? 33.614  61.278 105.913 1.00 70.07  ? 122 LYS B CD    1 
ATOM   4663  C CE    . LYS B 1 122 ? 33.925  62.761 106.038 1.00 73.04  ? 122 LYS B CE    1 
ATOM   4664  N NZ    . LYS B 1 122 ? 34.181  63.119 107.463 1.00 79.11  ? 122 LYS B NZ    1 
ATOM   4665  N N     . ASN B 1 123 ? 28.784  58.696 104.381 1.00 29.28  ? 123 ASN B N     1 
ATOM   4666  C CA    . ASN B 1 123 ? 27.863  57.538 104.504 1.00 32.58  ? 123 ASN B CA    1 
ATOM   4667  C C     . ASN B 1 123 ? 26.565  58.101 103.882 1.00 31.40  ? 123 ASN B C     1 
ATOM   4668  O O     . ASN B 1 123 ? 25.753  58.707 104.571 1.00 25.76  ? 123 ASN B O     1 
ATOM   4669  C CB    . ASN B 1 123 ? 27.640  57.097 105.941 1.00 37.94  ? 123 ASN B CB    1 
ATOM   4670  C CG    . ASN B 1 123 ? 28.914  56.594 106.603 1.00 49.28  ? 123 ASN B CG    1 
ATOM   4671  O OD1   . ASN B 1 123 ? 29.694  57.393 107.130 1.00 44.66  ? 123 ASN B OD1   1 
ATOM   4672  N ND2   . ASN B 1 123 ? 29.165  55.293 106.549 1.00 46.05  ? 123 ASN B ND2   1 
ATOM   4673  N N     . PRO B 1 124 ? 26.538  58.119 102.551 1.00 27.94  ? 124 PRO B N     1 
ATOM   4674  C CA    . PRO B 1 124 ? 25.522  58.866 101.819 1.00 26.82  ? 124 PRO B CA    1 
ATOM   4675  C C     . PRO B 1 124 ? 24.159  58.257 101.824 1.00 21.03  ? 124 PRO B C     1 
ATOM   4676  O O     . PRO B 1 124 ? 23.980  57.034 101.790 1.00 19.70  ? 124 PRO B O     1 
ATOM   4677  C CB    . PRO B 1 124 ? 26.137  59.007 100.412 1.00 26.20  ? 124 PRO B CB    1 
ATOM   4678  C CG    . PRO B 1 124 ? 26.902  57.722 100.265 1.00 29.71  ? 124 PRO B CG    1 
ATOM   4679  C CD    . PRO B 1 124 ? 27.534  57.506 101.631 1.00 26.13  ? 124 PRO B CD    1 
ATOM   4680  N N     . VAL B 1 125 ? 23.147  59.117 102.005 1.00 21.38  ? 125 VAL B N     1 
ATOM   4681  C CA    . VAL B 1 125 ? 21.778  58.591 101.975 1.00 22.88  ? 125 VAL B CA    1 
ATOM   4682  C C     . VAL B 1 125 ? 20.909  59.510 101.101 1.00 21.10  ? 125 VAL B C     1 
ATOM   4683  O O     . VAL B 1 125 ? 21.200  60.685 100.905 1.00 17.47  ? 125 VAL B O     1 
ATOM   4684  C CB    . VAL B 1 125 ? 21.097  58.465 103.348 1.00 27.76  ? 125 VAL B CB    1 
ATOM   4685  C CG1   . VAL B 1 125 ? 21.941  57.775 104.423 1.00 31.67  ? 125 VAL B CG1   1 
ATOM   4686  C CG2   . VAL B 1 125 ? 20.698  59.846 103.861 1.00 24.16  ? 125 VAL B CG2   1 
ATOM   4687  N N     . PHE B 1 126 ? 19.784  58.904 100.714 1.00 19.37  ? 126 PHE B N     1 
ATOM   4688  C CA    . PHE B 1 126 ? 18.776  59.707 99.999  1.00 21.10  ? 126 PHE B CA    1 
ATOM   4689  C C     . PHE B 1 126 ? 17.517  59.542 100.873 1.00 16.07  ? 126 PHE B C     1 
ATOM   4690  O O     . PHE B 1 126 ? 17.263  58.425 101.324 1.00 17.14  ? 126 PHE B O     1 
ATOM   4691  C CB    . PHE B 1 126 ? 18.456  59.248 98.578  1.00 19.93  ? 126 PHE B CB    1 
ATOM   4692  C CG    . PHE B 1 126 ? 19.355  59.738 97.477  1.00 22.75  ? 126 PHE B CG    1 
ATOM   4693  C CD1   . PHE B 1 126 ? 20.644  59.216 97.371  1.00 23.65  ? 126 PHE B CD1   1 
ATOM   4694  C CD2   . PHE B 1 126 ? 18.933  60.667 96.543  1.00 24.84  ? 126 PHE B CD2   1 
ATOM   4695  C CE1   . PHE B 1 126 ? 21.494  59.614 96.352  1.00 22.86  ? 126 PHE B CE1   1 
ATOM   4696  C CE2   . PHE B 1 126 ? 19.784  61.069 95.511  1.00 23.82  ? 126 PHE B CE2   1 
ATOM   4697  C CZ    . PHE B 1 126 ? 21.063  60.553 95.425  1.00 24.07  ? 126 PHE B CZ    1 
ATOM   4698  N N     . ILE B 1 127 ? 16.790  60.615 101.034 1.00 17.87  ? 127 ILE B N     1 
ATOM   4699  C CA    . ILE B 1 127 ? 15.534  60.525 101.777 1.00 23.28  ? 127 ILE B CA    1 
ATOM   4700  C C     . ILE B 1 127 ? 14.348  60.889 100.873 1.00 21.35  ? 127 ILE B C     1 
ATOM   4701  O O     . ILE B 1 127 ? 14.341  61.928 100.227 1.00 21.81  ? 127 ILE B O     1 
ATOM   4702  C CB    . ILE B 1 127 ? 15.575  61.482 102.994 1.00 22.25  ? 127 ILE B CB    1 
ATOM   4703  C CG1   . ILE B 1 127 ? 16.596  60.980 104.035 1.00 28.07  ? 127 ILE B CG1   1 
ATOM   4704  C CG2   . ILE B 1 127 ? 14.198  61.588 103.633 1.00 16.69  ? 127 ILE B CG2   1 
ATOM   4705  C CD1   . ILE B 1 127 ? 16.946  62.093 105.042 1.00 24.91  ? 127 ILE B CD1   1 
ATOM   4706  N N     . SER B 1 128 ? 13.309  60.084 100.879 1.00 21.01  ? 128 SER B N     1 
ATOM   4707  C CA    . SER B 1 128 ? 12.083  60.416 100.181 1.00 20.34  ? 128 SER B CA    1 
ATOM   4708  C C     . SER B 1 128 ? 10.831  60.145 101.005 1.00 20.65  ? 128 SER B C     1 
ATOM   4709  O O     . SER B 1 128 ? 10.855  59.238 101.852 1.00 18.84  ? 128 SER B O     1 
ATOM   4710  C CB    . SER B 1 128 ? 11.987  59.504 98.915  1.00 22.39  ? 128 SER B CB    1 
ATOM   4711  O OG    . SER B 1 128 ? 10.987  60.005 98.032  1.00 18.68  ? 128 SER B OG    1 
ATOM   4712  N N     . ASN B 1 129 ? 9.692   60.745 100.630 1.00 16.52  ? 129 ASN B N     1 
ATOM   4713  C CA    . ASN B 1 129 ? 8.392   60.312 101.173 1.00 17.19  ? 129 ASN B CA    1 
ATOM   4714  C C     . ASN B 1 129 ? 8.273   58.838 100.848 1.00 20.21  ? 129 ASN B C     1 
ATOM   4715  O O     . ASN B 1 129 ? 7.981   57.985 101.701 1.00 20.89  ? 129 ASN B O     1 
ATOM   4716  C CB    . ASN B 1 129 ? 7.189   61.089 100.693 1.00 20.43  ? 129 ASN B CB    1 
ATOM   4717  C CG    . ASN B 1 129 ? 7.075   61.360 99.204  1.00 23.24  ? 129 ASN B CG    1 
ATOM   4718  O OD1   . ASN B 1 129 ? 8.021   61.267 98.436  1.00 16.06  ? 129 ASN B OD1   1 
ATOM   4719  N ND2   . ASN B 1 129 ? 5.881   61.715 98.748  1.00 13.71  ? 129 ASN B ND2   1 
ATOM   4720  N N     . PHE B 1 130 ? 8.580   58.491 99.581  1.00 17.86  ? 130 PHE B N     1 
ATOM   4721  C CA    . PHE B 1 130 ? 8.662   57.096 99.183  1.00 17.65  ? 130 PHE B CA    1 
ATOM   4722  C C     . PHE B 1 130 ? 9.334   56.953 97.801  1.00 24.00  ? 130 PHE B C     1 
ATOM   4723  O O     . PHE B 1 130 ? 8.841   57.468 96.812  1.00 19.64  ? 130 PHE B O     1 
ATOM   4724  C CB    . PHE B 1 130 ? 7.345   56.378 99.207  1.00 18.48  ? 130 PHE B CB    1 
ATOM   4725  C CG    . PHE B 1 130 ? 7.478   54.942 99.625  1.00 24.04  ? 130 PHE B CG    1 
ATOM   4726  C CD1   . PHE B 1 130 ? 8.258   54.047 98.940  1.00 23.20  ? 130 PHE B CD1   1 
ATOM   4727  C CD2   . PHE B 1 130 ? 6.782   54.486 100.747 1.00 30.94  ? 130 PHE B CD2   1 
ATOM   4728  C CE1   . PHE B 1 130 ? 8.360   52.721 99.317  1.00 28.33  ? 130 PHE B CE1   1 
ATOM   4729  C CE2   . PHE B 1 130 ? 6.887   53.153 101.132 1.00 32.79  ? 130 PHE B CE2   1 
ATOM   4730  C CZ    . PHE B 1 130 ? 7.666   52.267 100.418 1.00 34.25  ? 130 PHE B CZ    1 
ATOM   4731  N N     . HIS B 1 131 ? 10.496  56.304 97.795  1.00 23.13  ? 131 HIS B N     1 
ATOM   4732  C CA    . HIS B 1 131 ? 11.271  56.112 96.580  1.00 21.92  ? 131 HIS B CA    1 
ATOM   4733  C C     . HIS B 1 131 ? 10.551  55.144 95.633  1.00 22.38  ? 131 HIS B C     1 
ATOM   4734  O O     . HIS B 1 131 ? 10.267  54.005 96.023  1.00 17.68  ? 131 HIS B O     1 
ATOM   4735  C CB    . HIS B 1 131 ? 12.651  55.505 96.899  1.00 21.87  ? 131 HIS B CB    1 
ATOM   4736  C CG    . HIS B 1 131 ? 13.639  56.472 97.471  1.00 27.29  ? 131 HIS B CG    1 
ATOM   4737  N ND1   . HIS B 1 131 ? 13.840  56.590 98.836  1.00 24.52  ? 131 HIS B ND1   1 
ATOM   4738  C CD2   . HIS B 1 131 ? 14.486  57.370 96.888  1.00 25.63  ? 131 HIS B CD2   1 
ATOM   4739  C CE1   . HIS B 1 131 ? 14.763  57.513 99.063  1.00 21.90  ? 131 HIS B CE1   1 
ATOM   4740  N NE2   . HIS B 1 131 ? 15.170  58.014 97.904  1.00 27.99  ? 131 HIS B NE2   1 
ATOM   4741  N N     . PHE B 1 132 ? 10.327  55.573 94.386  1.00 19.98  ? 132 PHE B N     1 
ATOM   4742  C CA    . PHE B 1 132 ? 9.778   54.542 93.447  1.00 17.64  ? 132 PHE B CA    1 
ATOM   4743  C C     . PHE B 1 132 ? 10.848  53.490 93.246  1.00 14.93  ? 132 PHE B C     1 
ATOM   4744  O O     . PHE B 1 132 ? 12.040  53.710 93.579  1.00 16.52  ? 132 PHE B O     1 
ATOM   4745  C CB    . PHE B 1 132 ? 9.415   55.283 92.138  1.00 20.02  ? 132 PHE B CB    1 
ATOM   4746  C CG    . PHE B 1 132 ? 8.964   54.330 91.066  1.00 26.85  ? 132 PHE B CG    1 
ATOM   4747  C CD1   . PHE B 1 132 ? 7.786   53.626 91.242  1.00 27.35  ? 132 PHE B CD1   1 
ATOM   4748  C CD2   . PHE B 1 132 ? 9.709   54.110 89.934  1.00 21.73  ? 132 PHE B CD2   1 
ATOM   4749  C CE1   . PHE B 1 132 ? 7.341   52.736 90.278  1.00 29.78  ? 132 PHE B CE1   1 
ATOM   4750  C CE2   . PHE B 1 132 ? 9.275   53.233 88.965  1.00 27.02  ? 132 PHE B CE2   1 
ATOM   4751  C CZ    . PHE B 1 132 ? 8.093   52.547 89.133  1.00 32.71  ? 132 PHE B CZ    1 
ATOM   4752  N N     . ASP B 1 133 ? 10.549  52.325 92.721  1.00 13.64  ? 133 ASP B N     1 
ATOM   4753  C CA    . ASP B 1 133 ? 11.475  51.213 92.568  1.00 20.34  ? 133 ASP B CA    1 
ATOM   4754  C C     . ASP B 1 133 ? 12.736  51.527 91.779  1.00 23.85  ? 133 ASP B C     1 
ATOM   4755  O O     . ASP B 1 133 ? 13.857  51.171 92.192  1.00 19.74  ? 133 ASP B O     1 
ATOM   4756  C CB    . ASP B 1 133 ? 10.801  50.023 91.871  1.00 28.71  ? 133 ASP B CB    1 
ATOM   4757  C CG    . ASP B 1 133 ? 9.494   49.609 92.501  1.00 46.40  ? 133 ASP B CG    1 
ATOM   4758  O OD1   . ASP B 1 133 ? 9.030   50.294 93.434  1.00 51.53  ? 133 ASP B OD1   1 
ATOM   4759  O OD2   . ASP B 1 133 ? 8.935   48.585 92.050  1.00 59.56  ? 133 ASP B OD2   1 
ATOM   4760  N N     . THR B 1 134 ? 12.566  52.199 90.626  1.00 18.14  ? 134 THR B N     1 
ATOM   4761  C CA    . THR B 1 134 ? 13.813  52.456 89.853  1.00 18.13  ? 134 THR B CA    1 
ATOM   4762  C C     . THR B 1 134 ? 14.637  53.461 90.623  1.00 15.51  ? 134 THR B C     1 
ATOM   4763  O O     . THR B 1 134 ? 15.865  53.426 90.623  1.00 18.37  ? 134 THR B O     1 
ATOM   4764  C CB    . THR B 1 134 ? 13.504  52.946 88.431  1.00 16.67  ? 134 THR B CB    1 
ATOM   4765  O OG1   . THR B 1 134 ? 12.832  54.210 88.509  1.00 15.11  ? 134 THR B OG1   1 
ATOM   4766  C CG2   . THR B 1 134 ? 12.661  51.924 87.657  1.00 9.82   ? 134 THR B CG2   1 
ATOM   4767  N N     . THR B 1 135 ? 13.968  54.491 91.161  1.00 13.89  ? 135 THR B N     1 
ATOM   4768  C CA    . THR B 1 135 ? 14.653  55.537 91.940  1.00 18.77  ? 135 THR B CA    1 
ATOM   4769  C C     . THR B 1 135 ? 15.508  54.953 93.073  1.00 21.12  ? 135 THR B C     1 
ATOM   4770  O O     . THR B 1 135 ? 16.680  55.315 93.166  1.00 19.21  ? 135 THR B O     1 
ATOM   4771  C CB    . THR B 1 135 ? 13.592  56.455 92.539  1.00 19.02  ? 135 THR B CB    1 
ATOM   4772  O OG1   . THR B 1 135 ? 12.518  56.560 91.581  1.00 16.39  ? 135 THR B OG1   1 
ATOM   4773  C CG2   . THR B 1 135 ? 14.139  57.839 92.831  1.00 17.38  ? 135 THR B CG2   1 
ATOM   4774  N N     . ALA B 1 136 ? 14.939  54.033 93.850  1.00 20.26  ? 136 ALA B N     1 
ATOM   4775  C CA    . ALA B 1 136 ? 15.676  53.377 94.924  1.00 22.50  ? 136 ALA B CA    1 
ATOM   4776  C C     . ALA B 1 136 ? 16.804  52.541 94.317  1.00 22.41  ? 136 ALA B C     1 
ATOM   4777  O O     . ALA B 1 136 ? 17.891  52.476 94.902  1.00 20.47  ? 136 ALA B O     1 
ATOM   4778  C CB    . ALA B 1 136 ? 14.810  52.470 95.789  1.00 16.34  ? 136 ALA B CB    1 
ATOM   4779  N N     . ALA B 1 137 ? 16.527  51.880 93.172  1.00 19.44  ? 137 ALA B N     1 
ATOM   4780  C CA    . ALA B 1 137 ? 17.575  51.080 92.554  1.00 20.30  ? 137 ALA B CA    1 
ATOM   4781  C C     . ALA B 1 137 ? 18.787  51.945 92.202  1.00 21.79  ? 137 ALA B C     1 
ATOM   4782  O O     . ALA B 1 137 ? 19.897  51.489 92.485  1.00 18.72  ? 137 ALA B O     1 
ATOM   4783  C CB    . ALA B 1 137 ? 17.092  50.298 91.347  1.00 20.75  ? 137 ALA B CB    1 
ATOM   4784  N N     . HIS B 1 138 ? 18.608  53.137 91.651  1.00 19.28  ? 138 HIS B N     1 
ATOM   4785  C CA    . HIS B 1 138 ? 19.744  53.991 91.316  1.00 21.70  ? 138 HIS B CA    1 
ATOM   4786  C C     . HIS B 1 138 ? 20.457  54.507 92.572  1.00 24.86  ? 138 HIS B C     1 
ATOM   4787  O O     . HIS B 1 138 ? 21.655  54.767 92.543  1.00 21.08  ? 138 HIS B O     1 
ATOM   4788  C CB    . HIS B 1 138 ? 19.302  55.159 90.417  1.00 17.54  ? 138 HIS B CB    1 
ATOM   4789  C CG    . HIS B 1 138 ? 19.136  54.631 89.011  1.00 25.41  ? 138 HIS B CG    1 
ATOM   4790  N ND1   . HIS B 1 138 ? 20.218  54.328 88.215  1.00 19.96  ? 138 HIS B ND1   1 
ATOM   4791  C CD2   . HIS B 1 138 ? 18.036  54.313 88.277  1.00 21.85  ? 138 HIS B CD2   1 
ATOM   4792  C CE1   . HIS B 1 138 ? 19.796  53.840 87.061  1.00 28.86  ? 138 HIS B CE1   1 
ATOM   4793  N NE2   . HIS B 1 138 ? 18.462  53.820 87.071  1.00 25.03  ? 138 HIS B NE2   1 
ATOM   4794  N N     . VAL B 1 139 ? 19.706  54.734 93.657  1.00 22.36  ? 139 VAL B N     1 
ATOM   4795  C CA    . VAL B 1 139 ? 20.247  55.195 94.923  1.00 24.78  ? 139 VAL B CA    1 
ATOM   4796  C C     . VAL B 1 139 ? 21.202  54.111 95.439  1.00 22.30  ? 139 VAL B C     1 
ATOM   4797  O O     . VAL B 1 139 ? 22.373  54.372 95.681  1.00 22.98  ? 139 VAL B O     1 
ATOM   4798  C CB    . VAL B 1 139 ? 19.169  55.517 95.959  1.00 25.34  ? 139 VAL B CB    1 
ATOM   4799  C CG1   . VAL B 1 139 ? 19.718  55.558 97.383  1.00 26.89  ? 139 VAL B CG1   1 
ATOM   4800  C CG2   . VAL B 1 139 ? 18.491  56.861 95.667  1.00 22.20  ? 139 VAL B CG2   1 
ATOM   4801  N N     . GLU B 1 140 ? 20.753  52.872 95.444  1.00 21.29  ? 140 GLU B N     1 
ATOM   4802  C CA    . GLU B 1 140 ? 21.542  51.754 95.896  1.00 27.65  ? 140 GLU B CA    1 
ATOM   4803  C C     . GLU B 1 140 ? 22.708  51.387 94.996  1.00 32.64  ? 140 GLU B C     1 
ATOM   4804  O O     . GLU B 1 140 ? 23.797  51.053 95.496  1.00 30.91  ? 140 GLU B O     1 
ATOM   4805  C CB    . GLU B 1 140 ? 20.633  50.534 96.133  1.00 25.12  ? 140 GLU B CB    1 
ATOM   4806  C CG    . GLU B 1 140 ? 19.757  50.837 97.367  1.00 37.78  ? 140 GLU B CG    1 
ATOM   4807  C CD    . GLU B 1 140 ? 18.635  49.859 97.590  1.00 48.73  ? 140 GLU B CD    1 
ATOM   4808  O OE1   . GLU B 1 140 ? 18.642  48.776 96.966  1.00 52.01  ? 140 GLU B OE1   1 
ATOM   4809  O OE2   . GLU B 1 140 ? 17.719  50.136 98.399  1.00 51.04  ? 140 GLU B OE2   1 
ATOM   4810  N N     . LEU B 1 141 ? 22.564  51.513 93.686  1.00 28.08  ? 141 LEU B N     1 
ATOM   4811  C CA    . LEU B 1 141 ? 23.600  51.175 92.728  1.00 29.42  ? 141 LEU B CA    1 
ATOM   4812  C C     . LEU B 1 141 ? 24.759  52.158 92.885  1.00 27.53  ? 141 LEU B C     1 
ATOM   4813  O O     . LEU B 1 141 ? 25.884  51.814 92.576  1.00 25.02  ? 141 LEU B O     1 
ATOM   4814  C CB    . LEU B 1 141 ? 23.121  51.234 91.270  1.00 33.46  ? 141 LEU B CB    1 
ATOM   4815  C CG    . LEU B 1 141 ? 22.263  50.075 90.768  1.00 44.58  ? 141 LEU B CG    1 
ATOM   4816  C CD1   . LEU B 1 141 ? 21.631  50.427 89.425  1.00 42.76  ? 141 LEU B CD1   1 
ATOM   4817  C CD2   . LEU B 1 141 ? 23.067  48.785 90.670  1.00 45.45  ? 141 LEU B CD2   1 
ATOM   4818  N N     . ASN B 1 142 ? 24.449  53.369 93.337  1.00 23.09  ? 142 ASN B N     1 
ATOM   4819  C CA    . ASN B 1 142 ? 25.496  54.344 93.588  1.00 26.42  ? 142 ASN B CA    1 
ATOM   4820  C C     . ASN B 1 142 ? 26.007  54.270 95.029  1.00 25.25  ? 142 ASN B C     1 
ATOM   4821  O O     . ASN B 1 142 ? 26.544  55.255 95.533  1.00 27.39  ? 142 ASN B O     1 
ATOM   4822  C CB    . ASN B 1 142 ? 24.946  55.725 93.205  1.00 25.83  ? 142 ASN B CB    1 
ATOM   4823  C CG    . ASN B 1 142 ? 24.864  55.775 91.671  1.00 34.74  ? 142 ASN B CG    1 
ATOM   4824  O OD1   . ASN B 1 142 ? 25.911  56.051 91.089  1.00 34.17  ? 142 ASN B OD1   1 
ATOM   4825  N ND2   . ASN B 1 142 ? 23.733  55.482 91.051  1.00 22.39  ? 142 ASN B ND2   1 
ATOM   4826  N N     . GLY B 1 143 ? 25.841  53.145 95.697  1.00 26.98  ? 143 GLY B N     1 
ATOM   4827  C CA    . GLY B 1 143 ? 26.307  52.928 97.055  1.00 31.03  ? 143 GLY B CA    1 
ATOM   4828  C C     . GLY B 1 143 ? 25.654  53.785 98.120  1.00 32.50  ? 143 GLY B C     1 
ATOM   4829  O O     . GLY B 1 143 ? 26.304  54.105 99.129  1.00 32.53  ? 143 GLY B O     1 
ATOM   4830  N N     . CYS B 1 144 ? 24.399  54.218 97.916  1.00 28.41  ? 144 CYS B N     1 
ATOM   4831  C CA    . CYS B 1 144 ? 23.749  55.037 98.931  1.00 23.01  ? 144 CYS B CA    1 
ATOM   4832  C C     . CYS B 1 144 ? 22.579  54.280 99.549  1.00 25.82  ? 144 CYS B C     1 
ATOM   4833  O O     . CYS B 1 144 ? 22.124  53.246 99.071  1.00 26.25  ? 144 CYS B O     1 
ATOM   4834  C CB    . CYS B 1 144 ? 23.271  56.356 98.424  1.00 23.89  ? 144 CYS B CB    1 
ATOM   4835  S SG    . CYS B 1 144 ? 24.426  57.377 97.522  1.00 25.51  ? 144 CYS B SG    1 
ATOM   4836  N N     . LYS B 1 145 ? 22.073  54.870 100.635 1.00 26.24  ? 145 LYS B N     1 
ATOM   4837  C CA    . LYS B 1 145 ? 20.934  54.257 101.321 1.00 27.90  ? 145 LYS B CA    1 
ATOM   4838  C C     . LYS B 1 145 ? 19.683  55.049 100.932 1.00 21.89  ? 145 LYS B C     1 
ATOM   4839  O O     . LYS B 1 145 ? 19.737  56.261 100.808 1.00 23.68  ? 145 LYS B O     1 
ATOM   4840  C CB    . LYS B 1 145 ? 21.081  54.239 102.838 1.00 38.52  ? 145 LYS B CB    1 
ATOM   4841  C CG    . LYS B 1 145 ? 21.926  53.106 103.406 1.00 58.33  ? 145 LYS B CG    1 
ATOM   4842  C CD    . LYS B 1 145 ? 22.341  53.404 104.848 1.00 73.90  ? 145 LYS B CD    1 
ATOM   4843  C CE    . LYS B 1 145 ? 23.733  54.014 104.924 1.00 81.28  ? 145 LYS B CE    1 
ATOM   4844  N NZ    . LYS B 1 145 ? 23.997  54.779 106.176 1.00 80.45  ? 145 LYS B NZ    1 
ATOM   4845  N N     . ALA B 1 146 ? 18.625  54.308 100.651 1.00 22.89  ? 146 ALA B N     1 
ATOM   4846  C CA    . ALA B 1 146 ? 17.355  54.928 100.304 1.00 28.19  ? 146 ALA B CA    1 
ATOM   4847  C C     . ALA B 1 146 ? 16.433  54.905 101.528 1.00 26.30  ? 146 ALA B C     1 
ATOM   4848  O O     . ALA B 1 146 ? 16.014  53.834 101.949 1.00 29.31  ? 146 ALA B O     1 
ATOM   4849  C CB    . ALA B 1 146 ? 16.734  54.139 99.154  1.00 23.92  ? 146 ALA B CB    1 
ATOM   4850  N N     . ILE B 1 147 ? 16.096  56.048 102.090 1.00 26.17  ? 147 ILE B N     1 
ATOM   4851  C CA    . ILE B 1 147 ? 15.178  56.018 103.252 1.00 25.05  ? 147 ILE B CA    1 
ATOM   4852  C C     . ILE B 1 147 ? 13.817  56.583 102.885 1.00 24.39  ? 147 ILE B C     1 
ATOM   4853  O O     . ILE B 1 147 ? 13.720  57.695 102.360 1.00 22.20  ? 147 ILE B O     1 
ATOM   4854  C CB    . ILE B 1 147 ? 15.840  56.871 104.370 1.00 27.81  ? 147 ILE B CB    1 
ATOM   4855  C CG1   . ILE B 1 147 ? 17.123  56.160 104.844 1.00 30.94  ? 147 ILE B CG1   1 
ATOM   4856  C CG2   . ILE B 1 147 ? 14.876  57.081 105.532 1.00 26.61  ? 147 ILE B CG2   1 
ATOM   4857  C CD1   . ILE B 1 147 ? 18.098  57.053 105.573 1.00 32.76  ? 147 ILE B CD1   1 
ATOM   4858  N N     . ASN B 1 148 ? 12.740  55.890 103.213 1.00 20.47  ? 148 ASN B N     1 
ATOM   4859  C CA    . ASN B 1 148 ? 11.368  56.309 102.976 1.00 20.46  ? 148 ASN B CA    1 
ATOM   4860  C C     . ASN B 1 148 ? 10.646  56.719 104.258 1.00 21.95  ? 148 ASN B C     1 
ATOM   4861  O O     . ASN B 1 148 ? 10.544  55.886 105.157 1.00 22.34  ? 148 ASN B O     1 
ATOM   4862  C CB    . ASN B 1 148 ? 10.604  55.092 102.402 1.00 16.61  ? 148 ASN B CB    1 
ATOM   4863  C CG    . ASN B 1 148 ? 11.240  54.661 101.073 1.00 21.04  ? 148 ASN B CG    1 
ATOM   4864  O OD1   . ASN B 1 148 ? 11.628  55.509 100.274 1.00 18.60  ? 148 ASN B OD1   1 
ATOM   4865  N ND2   . ASN B 1 148 ? 11.377  53.381 100.883 1.00 17.33  ? 148 ASN B ND2   1 
ATOM   4866  N N     . ILE B 1 149 ? 10.087  57.912 104.351 1.00 19.62  ? 149 ILE B N     1 
ATOM   4867  C CA    . ILE B 1 149 ? 9.436   58.409 105.538 1.00 22.03  ? 149 ILE B CA    1 
ATOM   4868  C C     . ILE B 1 149 ? 8.040   58.972 105.285 1.00 21.66  ? 149 ILE B C     1 
ATOM   4869  O O     . ILE B 1 149 ? 7.678   60.065 105.742 1.00 23.89  ? 149 ILE B O     1 
ATOM   4870  C CB    . ILE B 1 149 ? 10.316  59.486 106.238 1.00 26.05  ? 149 ILE B CB    1 
ATOM   4871  C CG1   . ILE B 1 149 ? 10.765  60.532 105.243 1.00 18.68  ? 149 ILE B CG1   1 
ATOM   4872  C CG2   . ILE B 1 149 ? 11.536  58.837 106.910 1.00 25.11  ? 149 ILE B CG2   1 
ATOM   4873  C CD1   . ILE B 1 149 ? 11.145  61.886 105.793 1.00 20.58  ? 149 ILE B CD1   1 
ATOM   4874  N N     . VAL B 1 150 ? 7.223   58.208 104.557 1.00 22.24  ? 150 VAL B N     1 
ATOM   4875  C CA    . VAL B 1 150 ? 5.871   58.654 104.215 1.00 23.79  ? 150 VAL B CA    1 
ATOM   4876  C C     . VAL B 1 150 ? 5.040   58.669 105.503 1.00 22.79  ? 150 VAL B C     1 
ATOM   4877  O O     . VAL B 1 150 ? 5.257   57.813 106.350 1.00 20.33  ? 150 VAL B O     1 
ATOM   4878  C CB    . VAL B 1 150 ? 5.207   57.759 103.145 1.00 21.08  ? 150 VAL B CB    1 
ATOM   4879  C CG1   . VAL B 1 150 ? 4.973   56.349 103.663 1.00 25.70  ? 150 VAL B CG1   1 
ATOM   4880  C CG2   . VAL B 1 150 ? 3.884   58.333 102.670 1.00 21.41  ? 150 VAL B CG2   1 
ATOM   4881  N N     . THR B 1 151 ? 4.122   59.595 105.660 1.00 24.04  ? 151 THR B N     1 
ATOM   4882  C CA    . THR B 1 151 ? 3.222   59.617 106.810 1.00 25.92  ? 151 THR B CA    1 
ATOM   4883  C C     . THR B 1 151 ? 2.656   58.251 107.123 1.00 27.52  ? 151 THR B C     1 
ATOM   4884  O O     . THR B 1 151 ? 2.317   57.464 106.235 1.00 26.47  ? 151 THR B O     1 
ATOM   4885  C CB    . THR B 1 151 ? 2.050   60.587 106.596 1.00 34.77  ? 151 THR B CB    1 
ATOM   4886  O OG1   . THR B 1 151 ? 1.125   60.409 107.688 1.00 32.39  ? 151 THR B OG1   1 
ATOM   4887  C CG2   . THR B 1 151 ? 1.299   60.302 105.296 1.00 22.12  ? 151 THR B CG2   1 
ATOM   4888  N N     . GLU B 1 152 ? 2.386   57.952 108.396 1.00 27.98  ? 152 GLU B N     1 
ATOM   4889  C CA    . GLU B 1 152 ? 1.797   56.684 108.787 1.00 31.50  ? 152 GLU B CA    1 
ATOM   4890  C C     . GLU B 1 152 ? 0.309   56.601 108.422 1.00 23.75  ? 152 GLU B C     1 
ATOM   4891  O O     . GLU B 1 152 ? -0.192  55.494 108.287 1.00 25.23  ? 152 GLU B O     1 
ATOM   4892  C CB    . GLU B 1 152 ? 1.920   56.338 110.266 1.00 45.31  ? 152 GLU B CB    1 
ATOM   4893  C CG    . GLU B 1 152 ? 2.072   57.503 111.219 1.00 71.03  ? 152 GLU B CG    1 
ATOM   4894  C CD    . GLU B 1 152 ? 2.815   57.072 112.481 1.00 84.26  ? 152 GLU B CD    1 
ATOM   4895  O OE1   . GLU B 1 152 ? 3.880   56.424 112.361 1.00 89.31  ? 152 GLU B OE1   1 
ATOM   4896  O OE2   . GLU B 1 152 ? 2.307   57.386 113.577 1.00 88.88  ? 152 GLU B OE2   1 
ATOM   4897  N N     . LYS B 1 153 ? -0.313  57.710 108.092 1.00 26.53  ? 153 LYS B N     1 
ATOM   4898  C CA    . LYS B 1 153 ? -1.695  57.710 107.596 1.00 30.70  ? 153 LYS B CA    1 
ATOM   4899  C C     . LYS B 1 153 ? -1.822  56.867 106.332 1.00 31.87  ? 153 LYS B C     1 
ATOM   4900  O O     . LYS B 1 153 ? -2.847  56.187 106.174 1.00 32.07  ? 153 LYS B O     1 
ATOM   4901  C CB    . LYS B 1 153 ? -2.168  59.133 107.366 1.00 33.63  ? 153 LYS B CB    1 
ATOM   4902  C CG    . LYS B 1 153 ? -2.257  59.954 108.653 1.00 43.96  ? 153 LYS B CG    1 
ATOM   4903  C CD    . LYS B 1 153 ? -2.478  61.426 108.327 1.00 57.32  ? 153 LYS B CD    1 
ATOM   4904  C CE    . LYS B 1 153 ? -3.222  62.129 109.452 1.00 67.39  ? 153 LYS B CE    1 
ATOM   4905  N NZ    . LYS B 1 153 ? -3.356  63.598 109.212 1.00 72.88  ? 153 LYS B NZ    1 
ATOM   4906  N N     . ALA B 1 154 ? -0.772  56.778 105.522 1.00 28.73  ? 154 ALA B N     1 
ATOM   4907  C CA    . ALA B 1 154 ? -0.729  55.978 104.316 1.00 31.33  ? 154 ALA B CA    1 
ATOM   4908  C C     . ALA B 1 154 ? -0.936  54.507 104.568 1.00 33.40  ? 154 ALA B C     1 
ATOM   4909  O O     . ALA B 1 154 ? -1.490  53.818 103.711 1.00 36.79  ? 154 ALA B O     1 
ATOM   4910  C CB    . ALA B 1 154 ? 0.630   56.127 103.587 1.00 23.32  ? 154 ALA B CB    1 
ATOM   4911  N N     . PHE B 1 155 ? -0.556  53.983 105.718 1.00 38.05  ? 155 PHE B N     1 
ATOM   4912  C CA    . PHE B 1 155 ? -0.697  52.558 106.006 1.00 41.58  ? 155 PHE B CA    1 
ATOM   4913  C C     . PHE B 1 155 ? -2.052  52.179 106.581 1.00 41.02  ? 155 PHE B C     1 
ATOM   4914  O O     . PHE B 1 155 ? -2.359  51.012 106.799 1.00 41.60  ? 155 PHE B O     1 
ATOM   4915  C CB    . PHE B 1 155 ? 0.469   52.099 106.901 1.00 55.90  ? 155 PHE B CB    1 
ATOM   4916  C CG    . PHE B 1 155 ? 1.799   52.454 106.281 1.00 64.13  ? 155 PHE B CG    1 
ATOM   4917  C CD1   . PHE B 1 155 ? 2.156   51.938 105.047 1.00 68.75  ? 155 PHE B CD1   1 
ATOM   4918  C CD2   . PHE B 1 155 ? 2.668   53.323 106.915 1.00 67.31  ? 155 PHE B CD2   1 
ATOM   4919  C CE1   . PHE B 1 155 ? 3.369   52.271 104.466 1.00 72.36  ? 155 PHE B CE1   1 
ATOM   4920  C CE2   . PHE B 1 155 ? 3.877   53.655 106.342 1.00 68.95  ? 155 PHE B CE2   1 
ATOM   4921  C CZ    . PHE B 1 155 ? 4.230   53.131 105.117 1.00 69.38  ? 155 PHE B CZ    1 
ATOM   4922  N N     . ASP B 1 156 ? -2.889  53.173 106.824 1.00 38.99  ? 156 ASP B N     1 
ATOM   4923  C CA    . ASP B 1 156 ? -4.254  52.942 107.311 1.00 37.12  ? 156 ASP B CA    1 
ATOM   4924  C C     . ASP B 1 156 ? -5.191  52.986 106.096 1.00 33.35  ? 156 ASP B C     1 
ATOM   4925  O O     . ASP B 1 156 ? -5.753  54.020 105.789 1.00 30.21  ? 156 ASP B O     1 
ATOM   4926  C CB    . ASP B 1 156 ? -4.586  54.006 108.345 1.00 39.14  ? 156 ASP B CB    1 
ATOM   4927  C CG    . ASP B 1 156 ? -5.889  53.736 109.065 1.00 48.74  ? 156 ASP B CG    1 
ATOM   4928  O OD1   . ASP B 1 156 ? -6.549  52.713 108.786 1.00 47.61  ? 156 ASP B OD1   1 
ATOM   4929  O OD2   . ASP B 1 156 ? -6.232  54.588 109.906 1.00 56.05  ? 156 ASP B OD2   1 
ATOM   4930  N N     . SER B 1 157 ? -5.249  51.889 105.367 1.00 34.37  ? 157 SER B N     1 
ATOM   4931  C CA    . SER B 1 157 ? -5.949  51.742 104.117 1.00 38.92  ? 157 SER B CA    1 
ATOM   4932  C C     . SER B 1 157 ? -7.342  52.337 104.027 1.00 39.59  ? 157 SER B C     1 
ATOM   4933  O O     . SER B 1 157 ? -7.637  53.151 103.173 1.00 38.29  ? 157 SER B O     1 
ATOM   4934  C CB    . SER B 1 157 ? -6.140  50.249 103.733 1.00 42.78  ? 157 SER B CB    1 
ATOM   4935  O OG    . SER B 1 157 ? -4.981  49.790 103.066 1.00 55.33  ? 157 SER B OG    1 
ATOM   4936  N N     . GLU B 1 158 ? -8.208  51.871 104.922 1.00 41.85  ? 158 GLU B N     1 
ATOM   4937  C CA    . GLU B 1 158 ? -9.612  52.246 104.880 1.00 43.40  ? 158 GLU B CA    1 
ATOM   4938  C C     . GLU B 1 158 ? -9.925  53.596 105.477 1.00 40.43  ? 158 GLU B C     1 
ATOM   4939  O O     . GLU B 1 158 ? -11.013 54.097 105.184 1.00 39.90  ? 158 GLU B O     1 
ATOM   4940  C CB    . GLU B 1 158 ? -10.432 51.108 105.487 1.00 56.34  ? 158 GLU B CB    1 
ATOM   4941  C CG    . GLU B 1 158 ? -10.388 49.904 104.548 1.00 73.37  ? 158 GLU B CG    1 
ATOM   4942  C CD    . GLU B 1 158 ? -10.748 48.591 105.193 1.00 83.08  ? 158 GLU B CD    1 
ATOM   4943  O OE1   . GLU B 1 158 ? -10.771 48.505 106.440 1.00 91.90  ? 158 GLU B OE1   1 
ATOM   4944  O OE2   . GLU B 1 158 ? -11.011 47.627 104.446 1.00 88.70  ? 158 GLU B OE2   1 
ATOM   4945  N N     . THR B 1 159 ? -8.992  54.219 106.179 1.00 37.05  ? 159 THR B N     1 
ATOM   4946  C CA    . THR B 1 159 ? -9.278  55.509 106.781 1.00 36.74  ? 159 THR B CA    1 
ATOM   4947  C C     . THR B 1 159 ? -8.908  56.651 105.850 1.00 38.30  ? 159 THR B C     1 
ATOM   4948  O O     . THR B 1 159 ? -7.745  56.831 105.500 1.00 37.37  ? 159 THR B O     1 
ATOM   4949  C CB    . THR B 1 159 ? -8.531  55.693 108.122 1.00 39.11  ? 159 THR B CB    1 
ATOM   4950  O OG1   . THR B 1 159 ? -8.861  54.594 108.965 1.00 39.21  ? 159 THR B OG1   1 
ATOM   4951  C CG2   . THR B 1 159 ? -8.893  56.991 108.799 1.00 35.50  ? 159 THR B CG2   1 
ATOM   4952  N N     . TYR B 1 160 ? -9.905  57.455 105.527 1.00 35.94  ? 160 TYR B N     1 
ATOM   4953  C CA    . TYR B 1 160 ? -9.754  58.588 104.660 1.00 32.38  ? 160 TYR B CA    1 
ATOM   4954  C C     . TYR B 1 160 ? -8.781  59.591 105.256 1.00 34.02  ? 160 TYR B C     1 
ATOM   4955  O O     . TYR B 1 160 ? -8.867  59.968 106.407 1.00 33.79  ? 160 TYR B O     1 
ATOM   4956  C CB    . TYR B 1 160 ? -11.119 59.285 104.408 1.00 30.96  ? 160 TYR B CB    1 
ATOM   4957  C CG    . TYR B 1 160 ? -10.921 60.473 103.493 1.00 28.27  ? 160 TYR B CG    1 
ATOM   4958  C CD1   . TYR B 1 160 ? -10.553 61.704 103.997 1.00 24.00  ? 160 TYR B CD1   1 
ATOM   4959  C CD2   . TYR B 1 160 ? -11.061 60.319 102.100 1.00 29.33  ? 160 TYR B CD2   1 
ATOM   4960  C CE1   . TYR B 1 160 ? -10.334 62.772 103.153 1.00 28.81  ? 160 TYR B CE1   1 
ATOM   4961  C CE2   . TYR B 1 160 ? -10.846 61.394 101.262 1.00 29.09  ? 160 TYR B CE2   1 
ATOM   4962  C CZ    . TYR B 1 160 ? -10.470 62.604 101.776 1.00 29.94  ? 160 TYR B CZ    1 
ATOM   4963  O OH    . TYR B 1 160 ? -10.230 63.699 100.974 1.00 28.43  ? 160 TYR B OH    1 
ATOM   4964  N N     . ASP B 1 161 ? -7.922  60.135 104.398 1.00 30.44  ? 161 ASP B N     1 
ATOM   4965  C CA    . ASP B 1 161 ? -7.046  61.239 104.718 1.00 24.31  ? 161 ASP B CA    1 
ATOM   4966  C C     . ASP B 1 161 ? -6.820  62.002 103.411 1.00 21.99  ? 161 ASP B C     1 
ATOM   4967  O O     . ASP B 1 161 ? -6.792  61.375 102.337 1.00 23.15  ? 161 ASP B O     1 
ATOM   4968  C CB    . ASP B 1 161 ? -5.733  60.827 105.388 1.00 26.10  ? 161 ASP B CB    1 
ATOM   4969  C CG    . ASP B 1 161 ? -5.020  62.103 105.800 1.00 34.77  ? 161 ASP B CG    1 
ATOM   4970  O OD1   . ASP B 1 161 ? -5.406  62.662 106.838 1.00 40.03  ? 161 ASP B OD1   1 
ATOM   4971  O OD2   . ASP B 1 161 ? -4.132  62.604 105.089 1.00 37.75  ? 161 ASP B OD2   1 
ATOM   4972  N N     . ASP B 1 162 ? -6.750  63.302 103.435 1.00 17.21  ? 162 ASP B N     1 
ATOM   4973  C CA    . ASP B 1 162 ? -6.587  64.092 102.235 1.00 21.18  ? 162 ASP B CA    1 
ATOM   4974  C C     . ASP B 1 162 ? -5.184  63.962 101.627 1.00 24.96  ? 162 ASP B C     1 
ATOM   4975  O O     . ASP B 1 162 ? -5.012  64.379 100.470 1.00 22.03  ? 162 ASP B O     1 
ATOM   4976  C CB    . ASP B 1 162 ? -6.686  65.575 102.564 1.00 22.66  ? 162 ASP B CB    1 
ATOM   4977  C CG    . ASP B 1 162 ? -8.118  66.077 102.572 1.00 29.49  ? 162 ASP B CG    1 
ATOM   4978  O OD1   . ASP B 1 162 ? -9.012  65.445 101.973 1.00 31.68  ? 162 ASP B OD1   1 
ATOM   4979  O OD2   . ASP B 1 162 ? -8.262  67.157 103.192 1.00 29.26  ? 162 ASP B OD2   1 
ATOM   4980  N N     . TRP B 1 163 ? -4.181  63.708 102.474 1.00 19.84  ? 163 TRP B N     1 
ATOM   4981  C CA    . TRP B 1 163 ? -2.791  63.756 102.018 1.00 20.14  ? 163 TRP B CA    1 
ATOM   4982  C C     . TRP B 1 163 ? -1.975  62.577 102.444 1.00 18.62  ? 163 TRP B C     1 
ATOM   4983  O O     . TRP B 1 163 ? -0.973  62.757 103.141 1.00 20.00  ? 163 TRP B O     1 
ATOM   4984  C CB    . TRP B 1 163 ? -2.085  65.037 102.461 1.00 18.74  ? 163 TRP B CB    1 
ATOM   4985  C CG    . TRP B 1 163 ? -2.901  66.289 102.351 1.00 23.28  ? 163 TRP B CG    1 
ATOM   4986  C CD1   . TRP B 1 163 ? -3.513  66.987 103.364 1.00 23.01  ? 163 TRP B CD1   1 
ATOM   4987  C CD2   . TRP B 1 163 ? -3.247  66.973 101.133 1.00 23.40  ? 163 TRP B CD2   1 
ATOM   4988  N NE1   . TRP B 1 163 ? -4.174  68.069 102.834 1.00 22.18  ? 163 TRP B NE1   1 
ATOM   4989  C CE2   . TRP B 1 163 ? -4.038  68.078 101.474 1.00 22.49  ? 163 TRP B CE2   1 
ATOM   4990  C CE3   . TRP B 1 163 ? -2.929  66.753 99.780  1.00 22.34  ? 163 TRP B CE3   1 
ATOM   4991  C CZ2   . TRP B 1 163 ? -4.516  68.979 100.524 1.00 22.82  ? 163 TRP B CZ2   1 
ATOM   4992  C CZ3   . TRP B 1 163 ? -3.435  67.648 98.867  1.00 20.40  ? 163 TRP B CZ3   1 
ATOM   4993  C CH2   . TRP B 1 163 ? -4.211  68.735 99.222  1.00 21.31  ? 163 TRP B CH2   1 
ATOM   4994  N N     . LYS B 1 164 ? -2.304  61.364 102.010 1.00 17.30  ? 164 LYS B N     1 
ATOM   4995  C CA    . LYS B 1 164 ? -1.514  60.201 102.369 1.00 16.85  ? 164 LYS B CA    1 
ATOM   4996  C C     . LYS B 1 164 ? -0.148  60.072 101.701 1.00 18.31  ? 164 LYS B C     1 
ATOM   4997  O O     . LYS B 1 164 ? 0.509   59.048 101.937 1.00 19.36  ? 164 LYS B O     1 
ATOM   4998  C CB    . LYS B 1 164 ? -2.313  58.919 102.068 1.00 20.21  ? 164 LYS B CB    1 
ATOM   4999  C CG    . LYS B 1 164 ? -3.601  58.854 102.912 1.00 20.65  ? 164 LYS B CG    1 
ATOM   5000  C CD    . LYS B 1 164 ? -4.223  57.469 102.694 1.00 19.37  ? 164 LYS B CD    1 
ATOM   5001  C CE    . LYS B 1 164 ? -5.255  57.167 103.773 1.00 19.22  ? 164 LYS B CE    1 
ATOM   5002  N NZ    . LYS B 1 164 ? -5.754  55.763 103.670 1.00 20.47  ? 164 LYS B NZ    1 
ATOM   5003  N N     . GLY B 1 165 ? 0.287   61.023 100.873 1.00 17.58  ? 165 GLY B N     1 
ATOM   5004  C CA    . GLY B 1 165 ? 1.628   60.876 100.280 1.00 17.00  ? 165 GLY B CA    1 
ATOM   5005  C C     . GLY B 1 165 ? 2.621   61.789 101.006 1.00 17.92  ? 165 GLY B C     1 
ATOM   5006  O O     . GLY B 1 165 ? 3.805   61.790 100.720 1.00 15.50  ? 165 GLY B O     1 
ATOM   5007  N N     . ASP B 1 166 ? 2.153   62.558 101.985 1.00 14.92  ? 166 ASP B N     1 
ATOM   5008  C CA    . ASP B 1 166 ? 2.987   63.508 102.697 1.00 17.07  ? 166 ASP B CA    1 
ATOM   5009  C C     . ASP B 1 166 ? 4.227   62.877 103.337 1.00 14.82  ? 166 ASP B C     1 
ATOM   5010  O O     . ASP B 1 166 ? 4.217   61.726 103.769 1.00 13.58  ? 166 ASP B O     1 
ATOM   5011  C CB    . ASP B 1 166 ? 2.159   64.126 103.859 1.00 19.68  ? 166 ASP B CB    1 
ATOM   5012  C CG    . ASP B 1 166 ? 1.424   65.361 103.416 1.00 22.62  ? 166 ASP B CG    1 
ATOM   5013  O OD1   . ASP B 1 166 ? 1.449   65.671 102.198 1.00 23.81  ? 166 ASP B OD1   1 
ATOM   5014  O OD2   . ASP B 1 166 ? 0.804   66.032 104.271 1.00 24.00  ? 166 ASP B OD2   1 
ATOM   5015  N N     . PHE B 1 167 ? 5.239   63.716 103.484 1.00 16.76  ? 167 PHE B N     1 
ATOM   5016  C CA    . PHE B 1 167 ? 6.389   63.228 104.243 1.00 18.98  ? 167 PHE B CA    1 
ATOM   5017  C C     . PHE B 1 167 ? 6.040   63.300 105.762 1.00 20.74  ? 167 PHE B C     1 
ATOM   5018  O O     . PHE B 1 167 ? 5.428   64.252 106.209 1.00 17.77  ? 167 PHE B O     1 
ATOM   5019  C CB    . PHE B 1 167 ? 7.524   64.187 104.054 1.00 19.15  ? 167 PHE B CB    1 
ATOM   5020  C CG    . PHE B 1 167 ? 8.371   64.181 102.823 1.00 20.65  ? 167 PHE B CG    1 
ATOM   5021  C CD1   . PHE B 1 167 ? 7.881   64.764 101.647 1.00 21.17  ? 167 PHE B CD1   1 
ATOM   5022  C CD2   . PHE B 1 167 ? 9.668   63.682 102.864 1.00 19.69  ? 167 PHE B CD2   1 
ATOM   5023  C CE1   . PHE B 1 167 ? 8.672   64.824 100.533 1.00 19.96  ? 167 PHE B CE1   1 
ATOM   5024  C CE2   . PHE B 1 167 ? 10.453  63.738 101.726 1.00 24.71  ? 167 PHE B CE2   1 
ATOM   5025  C CZ    . PHE B 1 167 ? 9.947   64.302 100.562 1.00 19.60  ? 167 PHE B CZ    1 
ATOM   5026  N N     . ASP B 1 168 ? 6.528   62.349 106.543 1.00 20.38  ? 168 ASP B N     1 
ATOM   5027  C CA    . ASP B 1 168 ? 6.383   62.508 108.026 1.00 19.23  ? 168 ASP B CA    1 
ATOM   5028  C C     . ASP B 1 168 ? 7.461   63.498 108.443 1.00 17.99  ? 168 ASP B C     1 
ATOM   5029  O O     . ASP B 1 168 ? 8.624   63.068 108.406 1.00 19.03  ? 168 ASP B O     1 
ATOM   5030  C CB    . ASP B 1 168 ? 6.653   61.171 108.669 1.00 22.31  ? 168 ASP B CB    1 
ATOM   5031  C CG    . ASP B 1 168 ? 6.534   61.162 110.203 1.00 23.43  ? 168 ASP B CG    1 
ATOM   5032  O OD1   . ASP B 1 168 ? 6.881   62.147 110.875 1.00 24.15  ? 168 ASP B OD1   1 
ATOM   5033  O OD2   . ASP B 1 168 ? 6.115   60.106 110.681 1.00 26.28  ? 168 ASP B OD2   1 
ATOM   5034  N N     . ILE B 1 169 ? 7.157   64.737 108.764 1.00 17.50  ? 169 ILE B N     1 
ATOM   5035  C CA    . ILE B 1 169 ? 8.115   65.762 109.093 1.00 25.26  ? 169 ILE B CA    1 
ATOM   5036  C C     . ILE B 1 169 ? 8.966   65.456 110.330 1.00 31.35  ? 169 ILE B C     1 
ATOM   5037  O O     . ILE B 1 169 ? 10.137  65.859 110.414 1.00 29.60  ? 169 ILE B O     1 
ATOM   5038  C CB    . ILE B 1 169 ? 7.435   67.126 109.269 1.00 24.04  ? 169 ILE B CB    1 
ATOM   5039  C CG1   . ILE B 1 169 ? 6.725   67.556 107.977 1.00 33.69  ? 169 ILE B CG1   1 
ATOM   5040  C CG2   . ILE B 1 169 ? 8.448   68.188 109.694 1.00 26.43  ? 169 ILE B CG2   1 
ATOM   5041  C CD1   . ILE B 1 169 ? 7.657   67.853 106.817 1.00 25.98  ? 169 ILE B CD1   1 
ATOM   5042  N N     . LYS B 1 170 ? 8.417   64.721 111.282 1.00 30.26  ? 170 LYS B N     1 
ATOM   5043  C CA    . LYS B 1 170 ? 9.167   64.351 112.478 1.00 33.19  ? 170 LYS B CA    1 
ATOM   5044  C C     . LYS B 1 170 ? 10.268  63.369 112.084 1.00 31.45  ? 170 LYS B C     1 
ATOM   5045  O O     . LYS B 1 170 ? 11.419  63.523 112.498 1.00 28.17  ? 170 LYS B O     1 
ATOM   5046  C CB    . LYS B 1 170 ? 8.274   63.713 113.540 1.00 43.74  ? 170 LYS B CB    1 
ATOM   5047  C CG    . LYS B 1 170 ? 7.661   64.661 114.546 1.00 63.88  ? 170 LYS B CG    1 
ATOM   5048  C CD    . LYS B 1 170 ? 7.015   65.908 113.981 1.00 75.54  ? 170 LYS B CD    1 
ATOM   5049  C CE    . LYS B 1 170 ? 5.788   65.613 113.126 1.00 82.52  ? 170 LYS B CE    1 
ATOM   5050  N NZ    . LYS B 1 170 ? 5.367   66.805 112.330 1.00 84.49  ? 170 LYS B NZ    1 
ATOM   5051  N N     . LYS B 1 171 ? 9.907   62.361 111.276 1.00 25.59  ? 171 LYS B N     1 
ATOM   5052  C CA    . LYS B 1 171 ? 10.908  61.421 110.810 1.00 27.16  ? 171 LYS B CA    1 
ATOM   5053  C C     . LYS B 1 171 ? 11.969  62.111 109.941 1.00 27.08  ? 171 LYS B C     1 
ATOM   5054  O O     . LYS B 1 171 ? 13.140  61.696 109.992 1.00 29.86  ? 171 LYS B O     1 
ATOM   5055  C CB    . LYS B 1 171 ? 10.280  60.250 110.088 1.00 26.78  ? 171 LYS B CB    1 
ATOM   5056  C CG    . LYS B 1 171 ? 9.489   59.296 110.946 1.00 33.61  ? 171 LYS B CG    1 
ATOM   5057  C CD    . LYS B 1 171 ? 9.367   57.932 110.296 1.00 36.96  ? 171 LYS B CD    1 
ATOM   5058  C CE    . LYS B 1 171 ? 8.233   57.111 110.877 1.00 46.77  ? 171 LYS B CE    1 
ATOM   5059  N NZ    . LYS B 1 171 ? 6.947   57.380 110.168 1.00 65.80  ? 171 LYS B NZ    1 
ATOM   5060  N N     . LEU B 1 172 ? 11.630  63.168 109.226 1.00 25.40  ? 172 LEU B N     1 
ATOM   5061  C CA    . LEU B 1 172 ? 12.600  63.891 108.421 1.00 25.87  ? 172 LEU B CA    1 
ATOM   5062  C C     . LEU B 1 172 ? 13.667  64.515 109.339 1.00 28.20  ? 172 LEU B C     1 
ATOM   5063  O O     . LEU B 1 172 ? 14.876  64.355 109.151 1.00 24.57  ? 172 LEU B O     1 
ATOM   5064  C CB    . LEU B 1 172 ? 11.960  64.999 107.596 1.00 16.25  ? 172 LEU B CB    1 
ATOM   5065  C CG    . LEU B 1 172 ? 12.913  65.849 106.742 1.00 24.69  ? 172 LEU B CG    1 
ATOM   5066  C CD1   . LEU B 1 172 ? 13.756  65.001 105.798 1.00 21.25  ? 172 LEU B CD1   1 
ATOM   5067  C CD2   . LEU B 1 172 ? 12.114  66.883 105.975 1.00 18.98  ? 172 LEU B CD2   1 
ATOM   5068  N N     . LYS B 1 173 ? 13.183  65.262 110.338 1.00 27.37  ? 173 LYS B N     1 
ATOM   5069  C CA    . LYS B 1 173 ? 14.082  65.923 111.292 1.00 30.66  ? 173 LYS B CA    1 
ATOM   5070  C C     . LYS B 1 173 ? 14.930  64.921 112.067 1.00 30.62  ? 173 LYS B C     1 
ATOM   5071  O O     . LYS B 1 173 ? 16.150  65.070 112.251 1.00 31.09  ? 173 LYS B O     1 
ATOM   5072  C CB    . LYS B 1 173 ? 13.278  66.818 112.222 1.00 31.61  ? 173 LYS B CB    1 
ATOM   5073  C CG    . LYS B 1 173 ? 12.798  68.104 111.590 1.00 34.68  ? 173 LYS B CG    1 
ATOM   5074  C CD    . LYS B 1 173 ? 11.703  68.717 112.471 1.00 41.18  ? 173 LYS B CD    1 
ATOM   5075  C CE    . LYS B 1 173 ? 11.710  70.231 112.268 1.00 45.23  ? 173 LYS B CE    1 
ATOM   5076  N NZ    . LYS B 1 173 ? 10.401  70.834 112.652 1.00 59.54  ? 173 LYS B NZ    1 
ATOM   5077  N N     . GLU B 1 174 ? 14.351  63.799 112.460 1.00 27.45  ? 174 GLU B N     1 
ATOM   5078  C CA    . GLU B 1 174 ? 15.142  62.761 113.094 1.00 32.25  ? 174 GLU B CA    1 
ATOM   5079  C C     . GLU B 1 174 ? 16.225  62.218 112.168 1.00 36.52  ? 174 GLU B C     1 
ATOM   5080  O O     . GLU B 1 174 ? 17.353  61.963 112.614 1.00 33.96  ? 174 GLU B O     1 
ATOM   5081  C CB    . GLU B 1 174 ? 14.250  61.593 113.542 1.00 34.57  ? 174 GLU B CB    1 
ATOM   5082  C CG    . GLU B 1 174 ? 13.347  62.044 114.682 1.00 56.20  ? 174 GLU B CG    1 
ATOM   5083  C CD    . GLU B 1 174 ? 12.279  61.056 115.088 1.00 65.81  ? 174 GLU B CD    1 
ATOM   5084  O OE1   . GLU B 1 174 ? 12.131  60.000 114.435 1.00 71.66  ? 174 GLU B OE1   1 
ATOM   5085  O OE2   . GLU B 1 174 ? 11.574  61.347 116.089 1.00 70.96  ? 174 GLU B OE2   1 
ATOM   5086  N N     . ASN B 1 175 ? 15.878  61.985 110.876 1.00 31.98  ? 175 ASN B N     1 
ATOM   5087  C CA    . ASN B 1 175 ? 16.862  61.394 109.976 1.00 26.53  ? 175 ASN B CA    1 
ATOM   5088  C C     . ASN B 1 175 ? 17.994  62.371 109.714 1.00 23.39  ? 175 ASN B C     1 
ATOM   5089  O O     . ASN B 1 175 ? 19.142  61.935 109.575 1.00 27.61  ? 175 ASN B O     1 
ATOM   5090  C CB    . ASN B 1 175 ? 16.227  60.945 108.656 1.00 29.36  ? 175 ASN B CB    1 
ATOM   5091  C CG    . ASN B 1 175 ? 15.754  59.525 108.824 1.00 26.91  ? 175 ASN B CG    1 
ATOM   5092  O OD1   . ASN B 1 175 ? 16.531  58.592 108.609 1.00 32.25  ? 175 ASN B OD1   1 
ATOM   5093  N ND2   . ASN B 1 175 ? 14.485  59.400 109.224 1.00 28.24  ? 175 ASN B ND2   1 
ATOM   5094  N N     . ILE B 1 176 ? 17.688  63.648 109.633 1.00 22.68  ? 176 ILE B N     1 
ATOM   5095  C CA    . ILE B 1 176 ? 18.740  64.629 109.404 1.00 28.15  ? 176 ILE B CA    1 
ATOM   5096  C C     . ILE B 1 176 ? 19.719  64.626 110.583 1.00 34.54  ? 176 ILE B C     1 
ATOM   5097  O O     . ILE B 1 176 ? 20.945  64.658 110.421 1.00 33.92  ? 176 ILE B O     1 
ATOM   5098  C CB    . ILE B 1 176 ? 18.117  66.010 109.184 1.00 29.11  ? 176 ILE B CB    1 
ATOM   5099  C CG1   . ILE B 1 176 ? 17.305  65.976 107.874 1.00 30.96  ? 176 ILE B CG1   1 
ATOM   5100  C CG2   . ILE B 1 176 ? 19.192  67.083 109.153 1.00 28.24  ? 176 ILE B CG2   1 
ATOM   5101  C CD1   . ILE B 1 176 ? 16.705  67.313 107.485 1.00 25.26  ? 176 ILE B CD1   1 
ATOM   5102  N N     . ALA B 1 177 ? 19.174  64.589 111.801 1.00 33.75  ? 177 ALA B N     1 
ATOM   5103  C CA    . ALA B 1 177 ? 19.977  64.588 113.015 1.00 35.20  ? 177 ALA B CA    1 
ATOM   5104  C C     . ALA B 1 177 ? 20.786  63.303 113.118 1.00 32.75  ? 177 ALA B C     1 
ATOM   5105  O O     . ALA B 1 177 ? 21.968  63.357 113.417 1.00 36.14  ? 177 ALA B O     1 
ATOM   5106  C CB    . ALA B 1 177 ? 19.098  64.740 114.244 1.00 35.69  ? 177 ALA B CB    1 
ATOM   5107  N N     . GLN B 1 178 ? 20.198  62.157 112.855 1.00 29.81  ? 178 GLN B N     1 
ATOM   5108  C CA    . GLN B 1 178 ? 20.866  60.891 112.900 1.00 32.26  ? 178 GLN B CA    1 
ATOM   5109  C C     . GLN B 1 178 ? 21.956  60.705 111.835 1.00 38.14  ? 178 GLN B C     1 
ATOM   5110  O O     . GLN B 1 178 ? 23.037  60.183 112.175 1.00 37.50  ? 178 GLN B O     1 
ATOM   5111  C CB    . GLN B 1 178 ? 19.853  59.760 112.720 1.00 30.33  ? 178 GLN B CB    1 
ATOM   5112  C CG    . GLN B 1 178 ? 20.490  58.383 112.716 1.00 46.04  ? 178 GLN B CG    1 
ATOM   5113  C CD    . GLN B 1 178 ? 19.544  57.279 112.304 1.00 56.94  ? 178 GLN B CD    1 
ATOM   5114  O OE1   . GLN B 1 178 ? 18.326  57.404 112.386 1.00 65.50  ? 178 GLN B OE1   1 
ATOM   5115  N NE2   . GLN B 1 178 ? 20.063  56.149 111.836 1.00 61.18  ? 178 GLN B NE2   1 
ATOM   5116  N N     . HIS B 1 179 ? 21.674  61.074 110.576 1.00 34.55  ? 179 HIS B N     1 
ATOM   5117  C CA    . HIS B 1 179 ? 22.682  60.882 109.538 1.00 30.29  ? 179 HIS B CA    1 
ATOM   5118  C C     . HIS B 1 179 ? 23.584  62.083 109.389 1.00 27.99  ? 179 HIS B C     1 
ATOM   5119  O O     . HIS B 1 179 ? 24.734  61.892 108.993 1.00 30.02  ? 179 HIS B O     1 
ATOM   5120  C CB    . HIS B 1 179 ? 22.021  60.535 108.186 1.00 27.04  ? 179 HIS B CB    1 
ATOM   5121  C CG    . HIS B 1 179 ? 21.350  59.201 108.264 1.00 23.86  ? 179 HIS B CG    1 
ATOM   5122  N ND1   . HIS B 1 179 ? 21.985  57.999 108.106 1.00 25.76  ? 179 HIS B ND1   1 
ATOM   5123  C CD2   . HIS B 1 179 ? 20.040  58.909 108.501 1.00 23.52  ? 179 HIS B CD2   1 
ATOM   5124  C CE1   . HIS B 1 179 ? 21.095  57.015 108.266 1.00 23.90  ? 179 HIS B CE1   1 
ATOM   5125  N NE2   . HIS B 1 179 ? 19.897  57.551 108.503 1.00 22.58  ? 179 HIS B NE2   1 
ATOM   5126  N N     . GLY B 1 180 ? 23.105  63.280 109.697 1.00 26.92  ? 180 GLY B N     1 
ATOM   5127  C CA    . GLY B 1 180 ? 23.857  64.498 109.470 1.00 25.10  ? 180 GLY B CA    1 
ATOM   5128  C C     . GLY B 1 180 ? 23.503  65.018 108.069 1.00 28.05  ? 180 GLY B C     1 
ATOM   5129  O O     . GLY B 1 180 ? 23.451  64.230 107.130 1.00 29.79  ? 180 GLY B O     1 
ATOM   5130  N N     . ALA B 1 181 ? 23.310  66.326 107.917 1.00 27.77  ? 181 ALA B N     1 
ATOM   5131  C CA    . ALA B 1 181 ? 23.030  66.965 106.653 1.00 32.31  ? 181 ALA B CA    1 
ATOM   5132  C C     . ALA B 1 181 ? 24.127  66.686 105.627 1.00 35.80  ? 181 ALA B C     1 
ATOM   5133  O O     . ALA B 1 181 ? 23.836  66.566 104.437 1.00 34.33  ? 181 ALA B O     1 
ATOM   5134  C CB    . ALA B 1 181 ? 22.889  68.468 106.833 1.00 26.93  ? 181 ALA B CB    1 
ATOM   5135  N N     . ASP B 1 182 ? 25.384  66.549 106.073 1.00 33.12  ? 182 ASP B N     1 
ATOM   5136  C CA    . ASP B 1 182 ? 26.503  66.246 105.198 1.00 30.79  ? 182 ASP B CA    1 
ATOM   5137  C C     . ASP B 1 182 ? 26.330  64.892 104.532 1.00 26.29  ? 182 ASP B C     1 
ATOM   5138  O O     . ASP B 1 182 ? 26.894  64.698 103.455 1.00 29.36  ? 182 ASP B O     1 
ATOM   5139  C CB    . ASP B 1 182 ? 27.824  66.246 105.969 1.00 45.48  ? 182 ASP B CB    1 
ATOM   5140  C CG    . ASP B 1 182 ? 28.310  67.626 106.343 1.00 53.73  ? 182 ASP B CG    1 
ATOM   5141  O OD1   . ASP B 1 182 ? 27.694  68.639 105.954 1.00 63.62  ? 182 ASP B OD1   1 
ATOM   5142  O OD2   . ASP B 1 182 ? 29.342  67.706 107.047 1.00 70.35  ? 182 ASP B OD2   1 
ATOM   5143  N N     . ASN B 1 183 ? 25.592  63.957 105.095 1.00 19.47  ? 183 ASN B N     1 
ATOM   5144  C CA    . ASN B 1 183 ? 25.421  62.671 104.477 1.00 23.34  ? 183 ASN B CA    1 
ATOM   5145  C C     . ASN B 1 183 ? 24.132  62.561 103.635 1.00 20.42  ? 183 ASN B C     1 
ATOM   5146  O O     . ASN B 1 183 ? 23.924  61.489 103.073 1.00 22.56  ? 183 ASN B O     1 
ATOM   5147  C CB    . ASN B 1 183 ? 25.432  61.573 105.537 1.00 26.47  ? 183 ASN B CB    1 
ATOM   5148  C CG    . ASN B 1 183 ? 26.836  61.325 106.062 1.00 41.38  ? 183 ASN B CG    1 
ATOM   5149  O OD1   . ASN B 1 183 ? 27.765  61.126 105.279 1.00 30.37  ? 183 ASN B OD1   1 
ATOM   5150  N ND2   . ASN B 1 183 ? 26.943  61.347 107.389 1.00 33.46  ? 183 ASN B ND2   1 
ATOM   5151  N N     . ILE B 1 184 ? 23.311  63.604 103.625 1.00 20.19  ? 184 ILE B N     1 
ATOM   5152  C CA    . ILE B 1 184 ? 22.069  63.546 102.851 1.00 22.09  ? 184 ILE B CA    1 
ATOM   5153  C C     . ILE B 1 184 ? 22.354  64.093 101.443 1.00 16.14  ? 184 ILE B C     1 
ATOM   5154  O O     . ILE B 1 184 ? 22.485  65.319 101.292 1.00 18.34  ? 184 ILE B O     1 
ATOM   5155  C CB    . ILE B 1 184 ? 20.917  64.382 103.421 1.00 24.74  ? 184 ILE B CB    1 
ATOM   5156  C CG1   . ILE B 1 184 ? 20.731  64.230 104.939 1.00 27.53  ? 184 ILE B CG1   1 
ATOM   5157  C CG2   . ILE B 1 184 ? 19.591  64.019 102.708 1.00 24.04  ? 184 ILE B CG2   1 
ATOM   5158  C CD1   . ILE B 1 184 ? 20.556  62.807 105.389 1.00 28.29  ? 184 ILE B CD1   1 
ATOM   5159  N N     . VAL B 1 185 ? 22.430  63.160 100.501 1.00 18.66  ? 185 VAL B N     1 
ATOM   5160  C CA    . VAL B 1 185 ? 22.763  63.625 99.117  1.00 20.25  ? 185 VAL B CA    1 
ATOM   5161  C C     . VAL B 1 185 ? 21.677  64.524 98.572  1.00 17.41  ? 185 VAL B C     1 
ATOM   5162  O O     . VAL B 1 185 ? 21.922  65.615 98.043  1.00 17.02  ? 185 VAL B O     1 
ATOM   5163  C CB    . VAL B 1 185 ? 23.004  62.423 98.197  1.00 23.96  ? 185 VAL B CB    1 
ATOM   5164  C CG1   . VAL B 1 185 ? 23.340  62.912 96.798  1.00 22.07  ? 185 VAL B CG1   1 
ATOM   5165  C CG2   . VAL B 1 185 ? 24.125  61.559 98.769  1.00 22.75  ? 185 VAL B CG2   1 
ATOM   5166  N N     . ALA B 1 186 ? 20.441  64.089 98.792  1.00 19.92  ? 186 ALA B N     1 
ATOM   5167  C CA    . ALA B 1 186 ? 19.280  64.837 98.368  1.00 22.45  ? 186 ALA B CA    1 
ATOM   5168  C C     . ALA B 1 186 ? 18.006  64.313 99.021  1.00 17.07  ? 186 ALA B C     1 
ATOM   5169  O O     . ALA B 1 186 ? 17.934  63.180 99.444  1.00 18.39  ? 186 ALA B O     1 
ATOM   5170  C CB    . ALA B 1 186 ? 19.046  64.683 96.847  1.00 18.93  ? 186 ALA B CB    1 
ATOM   5171  N N     . ILE B 1 187 ? 16.996  65.154 98.989  1.00 16.88  ? 187 ILE B N     1 
ATOM   5172  C CA    . ILE B 1 187 ? 15.667  64.700 99.383  1.00 18.61  ? 187 ILE B CA    1 
ATOM   5173  C C     . ILE B 1 187 ? 14.892  64.532 98.052  1.00 18.90  ? 187 ILE B C     1 
ATOM   5174  O O     . ILE B 1 187 ? 14.986  65.423 97.234  1.00 15.90  ? 187 ILE B O     1 
ATOM   5175  C CB    . ILE B 1 187 ? 14.990  65.719 100.312 1.00 24.79  ? 187 ILE B CB    1 
ATOM   5176  C CG1   . ILE B 1 187 ? 15.623  65.584 101.742 1.00 21.53  ? 187 ILE B CG1   1 
ATOM   5177  C CG2   . ILE B 1 187 ? 13.484  65.501 100.368 1.00 21.24  ? 187 ILE B CG2   1 
ATOM   5178  C CD1   . ILE B 1 187 ? 15.415  66.874 102.511 1.00 23.25  ? 187 ILE B CD1   1 
ATOM   5179  N N     . VAL B 1 188 ? 14.207  63.422 97.894  1.00 17.60  ? 188 VAL B N     1 
ATOM   5180  C CA    . VAL B 1 188 ? 13.396  63.189 96.697  1.00 19.02  ? 188 VAL B CA    1 
ATOM   5181  C C     . VAL B 1 188 ? 11.900  63.271 97.028  1.00 17.73  ? 188 VAL B C     1 
ATOM   5182  O O     . VAL B 1 188 ? 11.393  62.373 97.706  1.00 17.12  ? 188 VAL B O     1 
ATOM   5183  C CB    . VAL B 1 188 ? 13.652  61.761 96.150  1.00 19.52  ? 188 VAL B CB    1 
ATOM   5184  C CG1   . VAL B 1 188 ? 12.817  61.522 94.890  1.00 16.89  ? 188 VAL B CG1   1 
ATOM   5185  C CG2   . VAL B 1 188 ? 15.137  61.549 95.856  1.00 18.04  ? 188 VAL B CG2   1 
ATOM   5186  N N     . SER B 1 189 ? 11.219  64.287 96.569  1.00 16.60  ? 189 SER B N     1 
ATOM   5187  C CA    . SER B 1 189 ? 9.785   64.439 96.788  1.00 16.67  ? 189 SER B CA    1 
ATOM   5188  C C     . SER B 1 189 ? 9.015   63.760 95.654  1.00 17.68  ? 189 SER B C     1 
ATOM   5189  O O     . SER B 1 189 ? 9.038   64.206 94.511  1.00 14.45  ? 189 SER B O     1 
ATOM   5190  C CB    . SER B 1 189 ? 9.386   65.900 96.835  1.00 15.56  ? 189 SER B CB    1 
ATOM   5191  O OG    . SER B 1 189 ? 9.951   66.649 97.895  1.00 22.31  ? 189 SER B OG    1 
ATOM   5192  N N     . THR B 1 190 ? 8.405   62.611 95.934  1.00 12.94  ? 190 THR B N     1 
ATOM   5193  C CA    . THR B 1 190 ? 7.670   61.918 94.902  1.00 15.61  ? 190 THR B CA    1 
ATOM   5194  C C     . THR B 1 190 ? 6.228   62.406 94.837  1.00 18.94  ? 190 THR B C     1 
ATOM   5195  O O     . THR B 1 190 ? 5.461   62.175 95.811  1.00 14.96  ? 190 THR B O     1 
ATOM   5196  C CB    . THR B 1 190 ? 7.707   60.424 95.186  1.00 15.19  ? 190 THR B CB    1 
ATOM   5197  O OG1   . THR B 1 190 ? 9.081   60.138 95.450  1.00 16.99  ? 190 THR B OG1   1 
ATOM   5198  C CG2   . THR B 1 190 ? 7.235   59.599 93.980  1.00 13.12  ? 190 THR B CG2   1 
ATOM   5199  N N     . VAL B 1 191 ? 5.851   63.024 93.710  1.00 14.22  ? 191 VAL B N     1 
ATOM   5200  C CA    . VAL B 1 191 ? 4.457   63.463 93.522  1.00 15.55  ? 191 VAL B CA    1 
ATOM   5201  C C     . VAL B 1 191 ? 3.828   62.847 92.293  1.00 20.03  ? 191 VAL B C     1 
ATOM   5202  O O     . VAL B 1 191 ? 4.365   63.003 91.150  1.00 14.05  ? 191 VAL B O     1 
ATOM   5203  C CB    . VAL B 1 191 ? 4.422   64.988 93.375  1.00 17.95  ? 191 VAL B CB    1 
ATOM   5204  C CG1   . VAL B 1 191 ? 4.809   65.712 94.697  1.00 15.04  ? 191 VAL B CG1   1 
ATOM   5205  C CG2   . VAL B 1 191 ? 5.330   65.602 92.298  1.00 9.73   ? 191 VAL B CG2   1 
ATOM   5206  N N     . THR B 1 192 ? 2.642   62.254 92.373  1.00 16.61  ? 192 THR B N     1 
ATOM   5207  C CA    . THR B 1 192 ? 1.998   61.900 93.597  1.00 15.18  ? 192 THR B CA    1 
ATOM   5208  C C     . THR B 1 192 ? 2.875   60.805 94.227  1.00 14.16  ? 192 THR B C     1 
ATOM   5209  O O     . THR B 1 192 ? 3.863   60.335 93.591  1.00 13.70  ? 192 THR B O     1 
ATOM   5210  C CB    . THR B 1 192 ? 0.629   61.222 93.352  1.00 11.94  ? 192 THR B CB    1 
ATOM   5211  O OG1   . THR B 1 192 ? 0.809   60.056 92.539  1.00 11.53  ? 192 THR B OG1   1 
ATOM   5212  C CG2   . THR B 1 192 ? -0.383  62.123 92.685  1.00 8.10   ? 192 THR B CG2   1 
ATOM   5213  N N     . CYS B 1 193 ? 2.598   60.432 95.469  1.00 16.76  ? 193 CYS B N     1 
ATOM   5214  C CA    . CYS B 1 193 ? 3.403   59.362 96.102  1.00 13.39  ? 193 CYS B CA    1 
ATOM   5215  C C     . CYS B 1 193 ? 2.929   58.021 95.627  1.00 17.47  ? 193 CYS B C     1 
ATOM   5216  O O     . CYS B 1 193 ? 1.991   57.327 96.049  1.00 17.26  ? 193 CYS B O     1 
ATOM   5217  C CB    . CYS B 1 193 ? 3.436   59.497 97.629  1.00 18.72  ? 193 CYS B CB    1 
ATOM   5218  S SG    . CYS B 1 193 ? 4.458   58.187 98.363  1.00 19.66  ? 193 CYS B SG    1 
ATOM   5219  N N     . ASN B 1 194 ? 3.673   57.509 94.647  1.00 20.07  ? 194 ASN B N     1 
ATOM   5220  C CA    . ASN B 1 194 ? 3.336   56.317 93.886  1.00 21.09  ? 194 ASN B CA    1 
ATOM   5221  C C     . ASN B 1 194 ? 3.166   55.077 94.736  1.00 24.58  ? 194 ASN B C     1 
ATOM   5222  O O     . ASN B 1 194 ? 2.140   54.376 94.715  1.00 20.58  ? 194 ASN B O     1 
ATOM   5223  C CB    . ASN B 1 194 ? 4.434   56.065 92.813  1.00 30.00  ? 194 ASN B CB    1 
ATOM   5224  C CG    . ASN B 1 194 ? 4.063   54.779 92.091  1.00 41.17  ? 194 ASN B CG    1 
ATOM   5225  O OD1   . ASN B 1 194 ? 2.955   54.619 91.583  1.00 47.20  ? 194 ASN B OD1   1 
ATOM   5226  N ND2   . ASN B 1 194 ? 4.941   53.786 92.118  1.00 57.52  ? 194 ASN B ND2   1 
ATOM   5227  N N     . SER B 1 195 ? 4.235   54.769 95.467  1.00 25.14  ? 195 SER B N     1 
ATOM   5228  C CA    . SER B 1 195 ? 4.280   53.584 96.309  1.00 29.50  ? 195 SER B CA    1 
ATOM   5229  C C     . SER B 1 195 ? 3.261   53.615 97.429  1.00 29.07  ? 195 SER B C     1 
ATOM   5230  O O     . SER B 1 195 ? 2.834   52.525 97.835  1.00 32.80  ? 195 SER B O     1 
ATOM   5231  C CB    . SER B 1 195 ? 5.696   53.356 96.841  1.00 32.15  ? 195 SER B CB    1 
ATOM   5232  O OG    . SER B 1 195 ? 6.621   53.369 95.759  1.00 33.17  ? 195 SER B OG    1 
ATOM   5233  N N     . ALA B 1 196 ? 2.755   54.774 97.826  1.00 27.66  ? 196 ALA B N     1 
ATOM   5234  C CA    . ALA B 1 196 ? 1.702   54.809 98.852  1.00 28.89  ? 196 ALA B CA    1 
ATOM   5235  C C     . ALA B 1 196 ? 0.319   54.648 98.222  1.00 28.70  ? 196 ALA B C     1 
ATOM   5236  O O     . ALA B 1 196 ? -0.666  54.753 98.955  1.00 31.51  ? 196 ALA B O     1 
ATOM   5237  C CB    . ALA B 1 196 ? 1.703   56.111 99.651  1.00 25.92  ? 196 ALA B CB    1 
ATOM   5238  N N     . GLY B 1 197 ? 0.210   54.409 96.926  1.00 24.19  ? 197 GLY B N     1 
ATOM   5239  C CA    . GLY B 1 197 ? -1.079  54.248 96.266  1.00 22.85  ? 197 GLY B CA    1 
ATOM   5240  C C     . GLY B 1 197 ? -1.442  55.426 95.379  1.00 23.53  ? 197 GLY B C     1 
ATOM   5241  O O     . GLY B 1 197 ? -2.601  55.684 95.105  1.00 27.73  ? 197 GLY B O     1 
ATOM   5242  N N     . GLY B 1 198 ? -0.460  56.184 94.891  1.00 20.35  ? 198 GLY B N     1 
ATOM   5243  C CA    . GLY B 1 198 ? -0.707  57.353 94.089  1.00 15.25  ? 198 GLY B CA    1 
ATOM   5244  C C     . GLY B 1 198 ? -1.342  58.469 94.892  1.00 18.77  ? 198 GLY B C     1 
ATOM   5245  O O     . GLY B 1 198 ? -2.164  59.213 94.334  1.00 12.88  ? 198 GLY B O     1 
ATOM   5246  N N     . GLN B 1 199 ? -0.960  58.597 96.167  1.00 15.80  ? 199 GLN B N     1 
ATOM   5247  C CA    . GLN B 1 199 ? -1.603  59.605 97.048  1.00 14.79  ? 199 GLN B CA    1 
ATOM   5248  C C     . GLN B 1 199 ? -0.903  60.924 96.971  1.00 13.11  ? 199 GLN B C     1 
ATOM   5249  O O     . GLN B 1 199 ? 0.330   60.959 96.940  1.00 15.60  ? 199 GLN B O     1 
ATOM   5250  C CB    . GLN B 1 199 ? -1.606  59.014 98.486  1.00 12.91  ? 199 GLN B CB    1 
ATOM   5251  C CG    . GLN B 1 199 ? -2.310  57.673 98.610  1.00 11.87  ? 199 GLN B CG    1 
ATOM   5252  C CD    . GLN B 1 199 ? -3.809  57.831 98.346  1.00 14.92  ? 199 GLN B CD    1 
ATOM   5253  O OE1   . GLN B 1 199 ? -4.372  58.868 98.750  1.00 16.10  ? 199 GLN B OE1   1 
ATOM   5254  N NE2   . GLN B 1 199 ? -4.435  56.865 97.709  1.00 17.19  ? 199 GLN B NE2   1 
ATOM   5255  N N     . PRO B 1 200 ? -1.623  62.045 96.994  1.00 12.55  ? 200 PRO B N     1 
ATOM   5256  C CA    . PRO B 1 200 ? -1.052  63.349 96.837  1.00 13.51  ? 200 PRO B CA    1 
ATOM   5257  C C     . PRO B 1 200 ? -0.220  63.774 98.056  1.00 20.10  ? 200 PRO B C     1 
ATOM   5258  O O     . PRO B 1 200 ? -0.440  63.311 99.159  1.00 17.51  ? 200 PRO B O     1 
ATOM   5259  C CB    . PRO B 1 200 ? -2.218  64.324 96.743  1.00 10.99  ? 200 PRO B CB    1 
ATOM   5260  C CG    . PRO B 1 200 ? -3.363  63.561 97.339  1.00 11.61  ? 200 PRO B CG    1 
ATOM   5261  C CD    . PRO B 1 200 ? -3.104  62.110 97.092  1.00 12.13  ? 200 PRO B CD    1 
ATOM   5262  N N     . VAL B 1 201 ? 0.672   64.702 97.765  1.00 15.21  ? 201 VAL B N     1 
ATOM   5263  C CA    . VAL B 1 201 ? 1.522   65.344 98.745  1.00 15.87  ? 201 VAL B CA    1 
ATOM   5264  C C     . VAL B 1 201 ? 0.958   66.767 98.765  1.00 17.99  ? 201 VAL B C     1 
ATOM   5265  O O     . VAL B 1 201 ? 0.856   67.365 97.692  1.00 15.33  ? 201 VAL B O     1 
ATOM   5266  C CB    . VAL B 1 201 ? 3.014   65.391 98.335  1.00 15.33  ? 201 VAL B CB    1 
ATOM   5267  C CG1   . VAL B 1 201 ? 3.859   66.047 99.447  1.00 13.61  ? 201 VAL B CG1   1 
ATOM   5268  C CG2   . VAL B 1 201 ? 3.490   63.964 98.069  1.00 7.91   ? 201 VAL B CG2   1 
ATOM   5269  N N     . SER B 1 202 ? 0.598   67.285 99.946  1.00 12.68  ? 202 SER B N     1 
ATOM   5270  C CA    . SER B 1 202 ? 0.080   68.641 99.970  1.00 14.16  ? 202 SER B CA    1 
ATOM   5271  C C     . SER B 1 202 ? 1.105   69.700 99.695  1.00 15.14  ? 202 SER B C     1 
ATOM   5272  O O     . SER B 1 202 ? 2.304   69.508 99.899  1.00 17.00  ? 202 SER B O     1 
ATOM   5273  C CB    . SER B 1 202 ? -0.570  68.886 101.367 1.00 21.59  ? 202 SER B CB    1 
ATOM   5274  O OG    . SER B 1 202 ? 0.455   69.139 102.290 1.00 20.83  ? 202 SER B OG    1 
ATOM   5275  N N     . MET B 1 203 ? 0.689   70.883 99.306  1.00 12.64  ? 203 MET B N     1 
ATOM   5276  C CA    . MET B 1 203 ? 1.559   72.003 99.041  1.00 16.27  ? 203 MET B CA    1 
ATOM   5277  C C     . MET B 1 203 ? 2.329   72.439 100.288 1.00 23.20  ? 203 MET B C     1 
ATOM   5278  O O     . MET B 1 203 ? 3.507   72.828 100.233 1.00 18.75  ? 203 MET B O     1 
ATOM   5279  C CB    . MET B 1 203 ? 0.743   73.198 98.524  1.00 12.44  ? 203 MET B CB    1 
ATOM   5280  C CG    . MET B 1 203 ? 1.635   74.338 98.028  1.00 20.48  ? 203 MET B CG    1 
ATOM   5281  S SD    . MET B 1 203 ? 2.499   73.820 96.508  1.00 21.23  ? 203 MET B SD    1 
ATOM   5282  C CE    . MET B 1 203 ? 1.205   74.185 95.298  1.00 20.33  ? 203 MET B CE    1 
ATOM   5283  N N     . SER B 1 204 ? 1.642   72.424 101.440 1.00 20.52  ? 204 SER B N     1 
ATOM   5284  C CA    . SER B 1 204 ? 2.267   72.861 102.686 1.00 22.68  ? 204 SER B CA    1 
ATOM   5285  C C     . SER B 1 204 ? 3.300   71.839 103.129 1.00 16.34  ? 204 SER B C     1 
ATOM   5286  O O     . SER B 1 204 ? 4.348   72.230 103.646 1.00 19.98  ? 204 SER B O     1 
ATOM   5287  C CB    . SER B 1 204 ? 1.187   73.120 103.758 1.00 22.66  ? 204 SER B CB    1 
ATOM   5288  O OG    . SER B 1 204 ? 0.632   71.844 104.088 1.00 34.26  ? 204 SER B OG    1 
ATOM   5289  N N     . ASN B 1 205 ? 3.117   70.559 102.862 1.00 15.78  ? 205 ASN B N     1 
ATOM   5290  C CA    . ASN B 1 205 ? 4.142   69.569 103.181 1.00 16.38  ? 205 ASN B CA    1 
ATOM   5291  C C     . ASN B 1 205 ? 5.338   69.754 102.248 1.00 24.98  ? 205 ASN B C     1 
ATOM   5292  O O     . ASN B 1 205 ? 6.488   69.785 102.701 1.00 20.47  ? 205 ASN B O     1 
ATOM   5293  C CB    . ASN B 1 205 ? 3.541   68.183 103.057 1.00 16.03  ? 205 ASN B CB    1 
ATOM   5294  C CG    . ASN B 1 205 ? 4.461   67.100 103.543 1.00 22.76  ? 205 ASN B CG    1 
ATOM   5295  O OD1   . ASN B 1 205 ? 5.031   66.314 102.771 1.00 22.02  ? 205 ASN B OD1   1 
ATOM   5296  N ND2   . ASN B 1 205 ? 4.619   66.971 104.870 1.00 22.42  ? 205 ASN B ND2   1 
ATOM   5297  N N     . LEU B 1 206 ? 5.115   69.911 100.926 1.00 21.88  ? 206 LEU B N     1 
ATOM   5298  C CA    . LEU B 1 206 ? 6.212   70.154 100.008 1.00 19.39  ? 206 LEU B CA    1 
ATOM   5299  C C     . LEU B 1 206 ? 7.001   71.359 100.496 1.00 18.10  ? 206 LEU B C     1 
ATOM   5300  O O     . LEU B 1 206 ? 8.230   71.342 100.491 1.00 17.23  ? 206 LEU B O     1 
ATOM   5301  C CB    . LEU B 1 206 ? 5.740   70.479 98.560  1.00 12.62  ? 206 LEU B CB    1 
ATOM   5302  C CG    . LEU B 1 206 ? 5.103   69.235 97.869  1.00 14.80  ? 206 LEU B CG    1 
ATOM   5303  C CD1   . LEU B 1 206 ? 4.374   69.651 96.607  1.00 17.25  ? 206 LEU B CD1   1 
ATOM   5304  C CD2   . LEU B 1 206 ? 6.151   68.172 97.594  1.00 15.31  ? 206 LEU B CD2   1 
ATOM   5305  N N     . LYS B 1 207 ? 6.323   72.431 100.846 1.00 18.88  ? 207 LYS B N     1 
ATOM   5306  C CA    . LYS B 1 207 ? 6.959   73.667 101.290 1.00 18.82  ? 207 LYS B CA    1 
ATOM   5307  C C     . LYS B 1 207 ? 7.765   73.462 102.579 1.00 24.06  ? 207 LYS B C     1 
ATOM   5308  O O     . LYS B 1 207 ? 8.922   73.867 102.709 1.00 22.65  ? 207 LYS B O     1 
ATOM   5309  C CB    . LYS B 1 207 ? 5.861   74.698 101.550 1.00 21.95  ? 207 LYS B CB    1 
ATOM   5310  C CG    . LYS B 1 207 ? 6.398   76.058 101.993 1.00 25.06  ? 207 LYS B CG    1 
ATOM   5311  C CD    . LYS B 1 207 ? 5.284   77.091 101.911 1.00 37.68  ? 207 LYS B CD    1 
ATOM   5312  C CE    . LYS B 1 207 ? 5.732   78.434 102.467 1.00 41.73  ? 207 LYS B CE    1 
ATOM   5313  N NZ    . LYS B 1 207 ? 5.652   78.443 103.957 1.00 51.49  ? 207 LYS B NZ    1 
ATOM   5314  N N     . GLU B 1 208 ? 7.157   72.774 103.549 1.00 20.44  ? 208 GLU B N     1 
ATOM   5315  C CA    . GLU B 1 208 ? 7.865   72.515 104.797 1.00 25.27  ? 208 GLU B CA    1 
ATOM   5316  C C     . GLU B 1 208 ? 9.117   71.683 104.570 1.00 24.93  ? 208 GLU B C     1 
ATOM   5317  O O     . GLU B 1 208 ? 10.194  72.028 105.083 1.00 22.18  ? 208 GLU B O     1 
ATOM   5318  C CB    . GLU B 1 208 ? 6.954   71.850 105.828 1.00 29.25  ? 208 GLU B CB    1 
ATOM   5319  C CG    . GLU B 1 208 ? 7.670   71.712 107.158 1.00 41.98  ? 208 GLU B CG    1 
ATOM   5320  C CD    . GLU B 1 208 ? 6.753   71.686 108.362 1.00 45.36  ? 208 GLU B CD    1 
ATOM   5321  O OE1   . GLU B 1 208 ? 5.600   71.224 108.278 1.00 45.53  ? 208 GLU B OE1   1 
ATOM   5322  O OE2   . GLU B 1 208 ? 7.245   72.122 109.417 1.00 51.67  ? 208 GLU B OE2   1 
ATOM   5323  N N     . VAL B 1 209 ? 9.028   70.592 103.831 1.00 23.34  ? 209 VAL B N     1 
ATOM   5324  C CA    . VAL B 1 209 ? 10.193  69.791 103.472 1.00 22.04  ? 209 VAL B CA    1 
ATOM   5325  C C     . VAL B 1 209 ? 11.263  70.629 102.797 1.00 23.70  ? 209 VAL B C     1 
ATOM   5326  O O     . VAL B 1 209 ? 12.441  70.498 103.149 1.00 23.46  ? 209 VAL B O     1 
ATOM   5327  C CB    . VAL B 1 209 ? 9.796   68.620 102.561 1.00 22.74  ? 209 VAL B CB    1 
ATOM   5328  C CG1   . VAL B 1 209 ? 11.009  67.908 101.965 1.00 21.02  ? 209 VAL B CG1   1 
ATOM   5329  C CG2   . VAL B 1 209 ? 8.962   67.641 103.374 1.00 19.61  ? 209 VAL B CG2   1 
ATOM   5330  N N     . TYR B 1 210 ? 10.904  71.500 101.840 1.00 22.58  ? 210 TYR B N     1 
ATOM   5331  C CA    . TYR B 1 210 ? 11.902  72.301 101.155 1.00 20.53  ? 210 TYR B CA    1 
ATOM   5332  C C     . TYR B 1 210 ? 12.576  73.287 102.120 1.00 24.49  ? 210 TYR B C     1 
ATOM   5333  O O     . TYR B 1 210 ? 13.779  73.520 102.000 1.00 23.67  ? 210 TYR B O     1 
ATOM   5334  C CB    . TYR B 1 210 ? 11.257  73.091 100.023 1.00 18.03  ? 210 TYR B CB    1 
ATOM   5335  C CG    . TYR B 1 210 ? 12.272  73.848 99.167  1.00 16.77  ? 210 TYR B CG    1 
ATOM   5336  C CD1   . TYR B 1 210 ? 13.138  73.102 98.351  1.00 20.23  ? 210 TYR B CD1   1 
ATOM   5337  C CD2   . TYR B 1 210 ? 12.367  75.202 99.141  1.00 15.89  ? 210 TYR B CD2   1 
ATOM   5338  C CE1   . TYR B 1 210 ? 14.025  73.743 97.526  1.00 18.72  ? 210 TYR B CE1   1 
ATOM   5339  C CE2   . TYR B 1 210 ? 13.311  75.866 98.366  1.00 19.64  ? 210 TYR B CE2   1 
ATOM   5340  C CZ    . TYR B 1 210 ? 14.130  75.111 97.559  1.00 20.51  ? 210 TYR B CZ    1 
ATOM   5341  O OH    . TYR B 1 210 ? 15.055  75.749 96.756  1.00 27.47  ? 210 TYR B OH    1 
ATOM   5342  N N     . GLU B 1 211 ? 11.821  74.000 102.950 1.00 22.09  ? 211 GLU B N     1 
ATOM   5343  C CA    . GLU B 1 211 ? 12.343  74.962 103.911 1.00 27.30  ? 211 GLU B CA    1 
ATOM   5344  C C     . GLU B 1 211 ? 13.365  74.327 104.869 1.00 25.38  ? 211 GLU B C     1 
ATOM   5345  O O     . GLU B 1 211 ? 14.432  74.834 105.139 1.00 24.77  ? 211 GLU B O     1 
ATOM   5346  C CB    . GLU B 1 211 ? 11.227  75.579 104.784 1.00 20.31  ? 211 GLU B CB    1 
ATOM   5347  C CG    . GLU B 1 211 ? 10.592  76.773 104.099 1.00 39.19  ? 211 GLU B CG    1 
ATOM   5348  C CD    . GLU B 1 211 ? 9.222   77.125 104.645 1.00 41.85  ? 211 GLU B CD    1 
ATOM   5349  O OE1   . GLU B 1 211 ? 8.703   76.415 105.532 1.00 47.65  ? 211 GLU B OE1   1 
ATOM   5350  O OE2   . GLU B 1 211 ? 8.657   78.124 104.154 1.00 49.18  ? 211 GLU B OE2   1 
ATOM   5351  N N     . ILE B 1 212 ? 13.030  73.139 105.364 1.00 23.21  ? 212 ILE B N     1 
ATOM   5352  C CA    . ILE B 1 212 ? 13.952  72.372 106.189 1.00 25.81  ? 212 ILE B CA    1 
ATOM   5353  C C     . ILE B 1 212 ? 15.189  72.020 105.371 1.00 28.71  ? 212 ILE B C     1 
ATOM   5354  O O     . ILE B 1 212 ? 16.325  72.207 105.850 1.00 27.17  ? 212 ILE B O     1 
ATOM   5355  C CB    . ILE B 1 212 ? 13.260  71.116 106.701 1.00 24.14  ? 212 ILE B CB    1 
ATOM   5356  C CG1   . ILE B 1 212 ? 12.215  71.527 107.760 1.00 25.37  ? 212 ILE B CG1   1 
ATOM   5357  C CG2   . ILE B 1 212 ? 14.240  70.104 107.270 1.00 25.58  ? 212 ILE B CG2   1 
ATOM   5358  C CD1   . ILE B 1 212 ? 11.333  70.357 108.168 1.00 23.35  ? 212 ILE B CD1   1 
ATOM   5359  N N     . ALA B 1 213 ? 15.009  71.482 104.152 1.00 25.75  ? 213 ALA B N     1 
ATOM   5360  C CA    . ALA B 1 213 ? 16.182  71.151 103.340 1.00 24.77  ? 213 ALA B CA    1 
ATOM   5361  C C     . ALA B 1 213 ? 17.080  72.366 103.137 1.00 22.87  ? 213 ALA B C     1 
ATOM   5362  O O     . ALA B 1 213 ? 18.293  72.198 103.209 1.00 22.63  ? 213 ALA B O     1 
ATOM   5363  C CB    . ALA B 1 213 ? 15.807  70.611 101.970 1.00 24.50  ? 213 ALA B CB    1 
ATOM   5364  N N     . LYS B 1 214 ? 16.543  73.557 102.898 1.00 21.97  ? 214 LYS B N     1 
ATOM   5365  C CA    . LYS B 1 214 ? 17.378  74.706 102.631 1.00 27.23  ? 214 LYS B CA    1 
ATOM   5366  C C     . LYS B 1 214 ? 18.039  75.212 103.916 1.00 30.50  ? 214 LYS B C     1 
ATOM   5367  O O     . LYS B 1 214 ? 19.002  75.979 103.809 1.00 31.42  ? 214 LYS B O     1 
ATOM   5368  C CB    . LYS B 1 214 ? 16.673  75.887 101.972 1.00 25.72  ? 214 LYS B CB    1 
ATOM   5369  C CG    . LYS B 1 214 ? 15.958  75.630 100.655 1.00 39.63  ? 214 LYS B CG    1 
ATOM   5370  C CD    . LYS B 1 214 ? 16.936  75.237 99.548  1.00 37.96  ? 214 LYS B CD    1 
ATOM   5371  C CE    . LYS B 1 214 ? 16.925  73.717 99.384  1.00 38.56  ? 214 LYS B CE    1 
ATOM   5372  N NZ    . LYS B 1 214 ? 17.909  73.252 98.369  1.00 25.32  ? 214 LYS B NZ    1 
ATOM   5373  N N     . GLN B 1 215 ? 17.532  74.845 105.082 1.00 29.61  ? 215 GLN B N     1 
ATOM   5374  C CA    . GLN B 1 215 ? 18.183  75.246 106.322 1.00 33.09  ? 215 GLN B CA    1 
ATOM   5375  C C     . GLN B 1 215 ? 19.471  74.440 106.463 1.00 30.32  ? 215 GLN B C     1 
ATOM   5376  O O     . GLN B 1 215 ? 20.453  74.971 106.937 1.00 30.94  ? 215 GLN B O     1 
ATOM   5377  C CB    . GLN B 1 215 ? 17.274  74.983 107.531 1.00 37.18  ? 215 GLN B CB    1 
ATOM   5378  C CG    . GLN B 1 215 ? 16.409  76.213 107.818 1.00 53.72  ? 215 GLN B CG    1 
ATOM   5379  C CD    . GLN B 1 215 ? 15.404  75.947 108.923 1.00 64.05  ? 215 GLN B CD    1 
ATOM   5380  O OE1   . GLN B 1 215 ? 15.348  74.842 109.476 1.00 68.34  ? 215 GLN B OE1   1 
ATOM   5381  N NE2   . GLN B 1 215 ? 14.624  76.975 109.235 1.00 70.06  ? 215 GLN B NE2   1 
ATOM   5382  N N     . HIS B 1 216 ? 19.451  73.167 106.093 1.00 27.03  ? 216 HIS B N     1 
ATOM   5383  C CA    . HIS B 1 216 ? 20.627  72.338 106.143 1.00 26.62  ? 216 HIS B CA    1 
ATOM   5384  C C     . HIS B 1 216 ? 21.357  72.294 104.802 1.00 28.02  ? 216 HIS B C     1 
ATOM   5385  O O     . HIS B 1 216 ? 22.167  71.375 104.650 1.00 27.22  ? 216 HIS B O     1 
ATOM   5386  C CB    . HIS B 1 216 ? 20.219  70.914 106.537 1.00 26.29  ? 216 HIS B CB    1 
ATOM   5387  C CG    . HIS B 1 216 ? 19.679  70.834 107.924 1.00 41.64  ? 216 HIS B CG    1 
ATOM   5388  N ND1   . HIS B 1 216 ? 18.374  71.185 108.236 1.00 42.84  ? 216 HIS B ND1   1 
ATOM   5389  C CD2   . HIS B 1 216 ? 20.287  70.479 109.082 1.00 37.40  ? 216 HIS B CD2   1 
ATOM   5390  C CE1   . HIS B 1 216 ? 18.193  71.020 109.536 1.00 46.13  ? 216 HIS B CE1   1 
ATOM   5391  N NE2   . HIS B 1 216 ? 19.326  70.601 110.068 1.00 42.28  ? 216 HIS B NE2   1 
ATOM   5392  N N     . GLY B 1 217 ? 21.038  73.104 103.792 1.00 27.96  ? 217 GLY B N     1 
ATOM   5393  C CA    . GLY B 1 217 ? 21.717  73.013 102.509 1.00 27.56  ? 217 GLY B CA    1 
ATOM   5394  C C     . GLY B 1 217 ? 21.502  71.711 101.758 1.00 27.04  ? 217 GLY B C     1 
ATOM   5395  O O     . GLY B 1 217 ? 22.380  71.306 100.988 1.00 28.32  ? 217 GLY B O     1 
ATOM   5396  N N     . ILE B 1 218 ? 20.394  71.016 101.916 1.00 22.83  ? 218 ILE B N     1 
ATOM   5397  C CA    . ILE B 1 218 ? 20.169  69.756 101.193 1.00 23.14  ? 218 ILE B CA    1 
ATOM   5398  C C     . ILE B 1 218 ? 19.449  70.043 99.866  1.00 23.67  ? 218 ILE B C     1 
ATOM   5399  O O     . ILE B 1 218 ? 18.611  70.961 99.781  1.00 21.65  ? 218 ILE B O     1 
ATOM   5400  C CB    . ILE B 1 218 ? 19.398  68.760 102.052 1.00 25.85  ? 218 ILE B CB    1 
ATOM   5401  C CG1   . ILE B 1 218 ? 20.231  68.445 103.307 1.00 29.37  ? 218 ILE B CG1   1 
ATOM   5402  C CG2   . ILE B 1 218 ? 19.077  67.471 101.316 1.00 20.10  ? 218 ILE B CG2   1 
ATOM   5403  C CD1   . ILE B 1 218 ? 19.449  67.789 104.425 1.00 20.52  ? 218 ILE B CD1   1 
ATOM   5404  N N     . PHE B 1 219 ? 19.865  69.321 98.836  1.00 23.32  ? 219 PHE B N     1 
ATOM   5405  C CA    . PHE B 1 219 ? 19.351  69.500 97.469  1.00 21.90  ? 219 PHE B CA    1 
ATOM   5406  C C     . PHE B 1 219 ? 18.009  68.791 97.377  1.00 18.51  ? 219 PHE B C     1 
ATOM   5407  O O     . PHE B 1 219 ? 17.879  67.676 97.890  1.00 19.76  ? 219 PHE B O     1 
ATOM   5408  C CB    . PHE B 1 219 ? 20.335  68.883 96.442  1.00 19.72  ? 219 PHE B CB    1 
ATOM   5409  C CG    . PHE B 1 219 ? 20.120  69.325 95.014  1.00 23.23  ? 219 PHE B CG    1 
ATOM   5410  C CD1   . PHE B 1 219 ? 20.626  70.512 94.541  1.00 19.54  ? 219 PHE B CD1   1 
ATOM   5411  C CD2   . PHE B 1 219 ? 19.340  68.549 94.163  1.00 20.99  ? 219 PHE B CD2   1 
ATOM   5412  C CE1   . PHE B 1 219 ? 20.409  70.928 93.233  1.00 22.43  ? 219 PHE B CE1   1 
ATOM   5413  C CE2   . PHE B 1 219 ? 19.120  68.931 92.840  1.00 19.28  ? 219 PHE B CE2   1 
ATOM   5414  C CZ    . PHE B 1 219 ? 19.662  70.128 92.395  1.00 17.16  ? 219 PHE B CZ    1 
ATOM   5415  N N     . VAL B 1 220 ? 16.995  69.426 96.791  1.00 18.09  ? 220 VAL B N     1 
ATOM   5416  C CA    . VAL B 1 220 ? 15.712  68.720 96.665  1.00 17.94  ? 220 VAL B CA    1 
ATOM   5417  C C     . VAL B 1 220 ? 15.369  68.390 95.209  1.00 15.56  ? 220 VAL B C     1 
ATOM   5418  O O     . VAL B 1 220 ? 15.357  69.267 94.350  1.00 16.09  ? 220 VAL B O     1 
ATOM   5419  C CB    . VAL B 1 220 ? 14.569  69.520 97.311  1.00 19.09  ? 220 VAL B CB    1 
ATOM   5420  C CG1   . VAL B 1 220 ? 13.263  68.756 97.154  1.00 15.65  ? 220 VAL B CG1   1 
ATOM   5421  C CG2   . VAL B 1 220 ? 14.871  69.679 98.829  1.00 16.22  ? 220 VAL B CG2   1 
ATOM   5422  N N     . VAL B 1 221 ? 15.040  67.129 94.980  1.00 16.40  ? 221 VAL B N     1 
ATOM   5423  C CA    . VAL B 1 221 ? 14.641  66.684 93.647  1.00 17.53  ? 221 VAL B CA    1 
ATOM   5424  C C     . VAL B 1 221 ? 13.151  66.347 93.694  1.00 17.45  ? 221 VAL B C     1 
ATOM   5425  O O     . VAL B 1 221 ? 12.771  65.551 94.560  1.00 15.88  ? 221 VAL B O     1 
ATOM   5426  C CB    . VAL B 1 221 ? 15.390  65.409 93.197  1.00 20.38  ? 221 VAL B CB    1 
ATOM   5427  C CG1   . VAL B 1 221 ? 14.918  64.956 91.825  1.00 20.06  ? 221 VAL B CG1   1 
ATOM   5428  C CG2   . VAL B 1 221 ? 16.890  65.693 93.139  1.00 21.06  ? 221 VAL B CG2   1 
ATOM   5429  N N     . MET B 1 222 ? 12.381  66.841 92.740  1.00 14.14  ? 222 MET B N     1 
ATOM   5430  C CA    . MET B 1 222 ? 10.960  66.435 92.658  1.00 11.88  ? 222 MET B CA    1 
ATOM   5431  C C     . MET B 1 222 ? 10.798  65.292 91.676  1.00 12.96  ? 222 MET B C     1 
ATOM   5432  O O     . MET B 1 222 ? 10.932  65.525 90.456  1.00 15.11  ? 222 MET B O     1 
ATOM   5433  C CB    . MET B 1 222 ? 10.145  67.654 92.177  1.00 7.96   ? 222 MET B CB    1 
ATOM   5434  C CG    . MET B 1 222 ? 8.631   67.455 92.248  1.00 19.60  ? 222 MET B CG    1 
ATOM   5435  S SD    . MET B 1 222 ? 7.966   67.962 93.869  1.00 23.93  ? 222 MET B SD    1 
ATOM   5436  C CE    . MET B 1 222 ? 7.921   69.730 93.619  1.00 15.20  ? 222 MET B CE    1 
ATOM   5437  N N     . ASP B 1 223 ? 10.532  64.074 92.076  1.00 9.23   ? 223 ASP B N     1 
ATOM   5438  C CA    . ASP B 1 223 ? 10.267  62.991 91.135  1.00 12.33  ? 223 ASP B CA    1 
ATOM   5439  C C     . ASP B 1 223 ? 8.850   63.299 90.614  1.00 17.23  ? 223 ASP B C     1 
ATOM   5440  O O     . ASP B 1 223 ? 7.883   63.338 91.388  1.00 14.32  ? 223 ASP B O     1 
ATOM   5441  C CB    . ASP B 1 223 ? 10.433  61.656 91.813  1.00 10.81  ? 223 ASP B CB    1 
ATOM   5442  C CG    . ASP B 1 223 ? 10.016  60.505 90.941  1.00 15.34  ? 223 ASP B CG    1 
ATOM   5443  O OD1   . ASP B 1 223 ? 9.118   60.697 90.090  1.00 16.26  ? 223 ASP B OD1   1 
ATOM   5444  O OD2   . ASP B 1 223 ? 10.482  59.374 91.122  1.00 13.57  ? 223 ASP B OD2   1 
ATOM   5445  N N     . SER B 1 224 ? 8.768   63.677 89.340  1.00 13.48  ? 224 SER B N     1 
ATOM   5446  C CA    . SER B 1 224 ? 7.545   64.219 88.785  1.00 14.30  ? 224 SER B CA    1 
ATOM   5447  C C     . SER B 1 224 ? 6.744   63.416 87.787  1.00 11.67  ? 224 SER B C     1 
ATOM   5448  O O     . SER B 1 224 ? 6.053   64.005 86.937  1.00 14.29  ? 224 SER B O     1 
ATOM   5449  C CB    . SER B 1 224 ? 8.007   65.510 88.060  1.00 13.45  ? 224 SER B CB    1 
ATOM   5450  O OG    . SER B 1 224 ? 8.682   66.355 88.974  1.00 11.41  ? 224 SER B OG    1 
ATOM   5451  N N     . ALA B 1 225 ? 6.794   62.088 87.819  1.00 11.09  ? 225 ALA B N     1 
ATOM   5452  C CA    . ALA B 1 225 ? 6.024   61.328 86.836  1.00 12.83  ? 225 ALA B CA    1 
ATOM   5453  C C     . ALA B 1 225 ? 4.561   61.737 86.906  1.00 16.50  ? 225 ALA B C     1 
ATOM   5454  O O     . ALA B 1 225 ? 3.877   61.778 85.888  1.00 14.09  ? 225 ALA B O     1 
ATOM   5455  C CB    . ALA B 1 225 ? 6.124   59.840 87.157  1.00 9.29   ? 225 ALA B CB    1 
ATOM   5456  N N     . ARG B 1 226 ? 4.007   61.924 88.135  1.00 13.93  ? 226 ARG B N     1 
ATOM   5457  C CA    . ARG B 1 226 ? 2.587   62.215 88.235  1.00 10.72  ? 226 ARG B CA    1 
ATOM   5458  C C     . ARG B 1 226 ? 2.318   63.545 88.852  1.00 9.74   ? 226 ARG B C     1 
ATOM   5459  O O     . ARG B 1 226 ? 1.370   63.719 89.617  1.00 11.50  ? 226 ARG B O     1 
ATOM   5460  C CB    . ARG B 1 226 ? 1.845   61.058 88.921  1.00 6.47   ? 226 ARG B CB    1 
ATOM   5461  C CG    . ARG B 1 226 ? 2.023   59.740 88.197  1.00 8.07   ? 226 ARG B CG    1 
ATOM   5462  C CD    . ARG B 1 226 ? 1.242   58.577 88.670  1.00 8.25   ? 226 ARG B CD    1 
ATOM   5463  N NE    . ARG B 1 226 ? 1.638   57.321 88.048  1.00 7.63   ? 226 ARG B NE    1 
ATOM   5464  C CZ    . ARG B 1 226 ? 2.754   56.691 88.392  1.00 15.81  ? 226 ARG B CZ    1 
ATOM   5465  N NH1   . ARG B 1 226 ? 3.603   57.216 89.257  1.00 12.67  ? 226 ARG B NH1   1 
ATOM   5466  N NH2   . ARG B 1 226 ? 3.044   55.526 87.798  1.00 8.17   ? 226 ARG B NH2   1 
ATOM   5467  N N     . PHE B 1 227 ? 3.037   64.555 88.364  1.00 8.89   ? 227 PHE B N     1 
ATOM   5468  C CA    . PHE B 1 227 ? 2.899   65.894 88.905  1.00 9.43   ? 227 PHE B CA    1 
ATOM   5469  C C     . PHE B 1 227 ? 1.560   66.526 88.643  1.00 12.96  ? 227 PHE B C     1 
ATOM   5470  O O     . PHE B 1 227 ? 1.146   67.468 89.388  1.00 10.52  ? 227 PHE B O     1 
ATOM   5471  C CB    . PHE B 1 227 ? 4.073   66.756 88.422  1.00 8.80   ? 227 PHE B CB    1 
ATOM   5472  C CG    . PHE B 1 227 ? 3.999   67.284 86.992  1.00 12.79  ? 227 PHE B CG    1 
ATOM   5473  C CD1   . PHE B 1 227 ? 4.147   66.409 85.920  1.00 13.97  ? 227 PHE B CD1   1 
ATOM   5474  C CD2   . PHE B 1 227 ? 3.779   68.602 86.715  1.00 11.72  ? 227 PHE B CD2   1 
ATOM   5475  C CE1   . PHE B 1 227 ? 4.109   66.870 84.631  1.00 12.68  ? 227 PHE B CE1   1 
ATOM   5476  C CE2   . PHE B 1 227 ? 3.708   69.107 85.412  1.00 13.27  ? 227 PHE B CE2   1 
ATOM   5477  C CZ    . PHE B 1 227 ? 3.875   68.208 84.361  1.00 10.32  ? 227 PHE B CZ    1 
ATOM   5478  N N     . CYS B 1 228 ? 0.920   66.197 87.509  1.00 11.95  ? 228 CYS B N     1 
ATOM   5479  C CA    . CYS B 1 228 ? -0.390  66.800 87.202  1.00 11.85  ? 228 CYS B CA    1 
ATOM   5480  C C     . CYS B 1 228 ? -1.455  66.158 88.072  1.00 8.88   ? 228 CYS B C     1 
ATOM   5481  O O     . CYS B 1 228 ? -2.404  66.820 88.532  1.00 10.37  ? 228 CYS B O     1 
ATOM   5482  C CB    . CYS B 1 228 ? -0.730  66.566 85.701  1.00 9.08   ? 228 CYS B CB    1 
ATOM   5483  S SG    . CYS B 1 228 ? 0.435   67.514 84.632  1.00 13.40  ? 228 CYS B SG    1 
ATOM   5484  N N     . GLU B 1 229 ? -1.439  64.860 88.285  1.00 8.00   ? 229 GLU B N     1 
ATOM   5485  C CA    . GLU B 1 229 ? -2.389  64.219 89.175  1.00 11.43  ? 229 GLU B CA    1 
ATOM   5486  C C     . GLU B 1 229 ? -2.228  64.849 90.562  1.00 14.31  ? 229 GLU B C     1 
ATOM   5487  O O     . GLU B 1 229 ? -3.239  65.183 91.160  1.00 15.70  ? 229 GLU B O     1 
ATOM   5488  C CB    . GLU B 1 229 ? -2.210  62.704 89.142  1.00 7.85   ? 229 GLU B CB    1 
ATOM   5489  C CG    . GLU B 1 229 ? -2.536  62.219 87.697  1.00 10.68  ? 229 GLU B CG    1 
ATOM   5490  C CD    . GLU B 1 229 ? -2.349  60.744 87.505  1.00 12.99  ? 229 GLU B CD    1 
ATOM   5491  O OE1   . GLU B 1 229 ? -1.866  60.040 88.457  1.00 16.59  ? 229 GLU B OE1   1 
ATOM   5492  O OE2   . GLU B 1 229 ? -2.657  60.224 86.409  1.00 19.01  ? 229 GLU B OE2   1 
ATOM   5493  N N     . ASN B 1 230 ? -1.004  65.090 91.046  1.00 14.11  ? 230 ASN B N     1 
ATOM   5494  C CA    . ASN B 1 230 ? -0.761  65.712 92.336  1.00 13.96  ? 230 ASN B CA    1 
ATOM   5495  C C     . ASN B 1 230 ? -1.369  67.115 92.359  1.00 15.44  ? 230 ASN B C     1 
ATOM   5496  O O     . ASN B 1 230 ? -2.161  67.423 93.263  1.00 14.70  ? 230 ASN B O     1 
ATOM   5497  C CB    . ASN B 1 230 ? 0.734   65.877 92.700  1.00 11.94  ? 230 ASN B CB    1 
ATOM   5498  C CG    . ASN B 1 230 ? 0.889   65.951 94.239  1.00 14.83  ? 230 ASN B CG    1 
ATOM   5499  O OD1   . ASN B 1 230 ? 0.951   64.939 94.919  1.00 11.39  ? 230 ASN B OD1   1 
ATOM   5500  N ND2   . ASN B 1 230 ? 0.973   67.110 94.821  1.00 10.42  ? 230 ASN B ND2   1 
ATOM   5501  N N     . ALA B 1 231 ? -1.071  67.937 91.363  1.00 12.15  ? 231 ALA B N     1 
ATOM   5502  C CA    . ALA B 1 231 ? -1.629  69.263 91.251  1.00 12.73  ? 231 ALA B CA    1 
ATOM   5503  C C     . ALA B 1 231 ? -3.172  69.246 91.240  1.00 13.92  ? 231 ALA B C     1 
ATOM   5504  O O     . ALA B 1 231 ? -3.796  70.094 91.902  1.00 12.72  ? 231 ALA B O     1 
ATOM   5505  C CB    . ALA B 1 231 ? -1.132  70.062 90.056  1.00 10.67  ? 231 ALA B CB    1 
ATOM   5506  N N     . TYR B 1 232 ? -3.813  68.257 90.612  1.00 13.20  ? 232 TYR B N     1 
ATOM   5507  C CA    . TYR B 1 232 ? -5.269  68.218 90.622  1.00 15.13  ? 232 TYR B CA    1 
ATOM   5508  C C     . TYR B 1 232 ? -5.758  68.061 92.084  1.00 16.58  ? 232 TYR B C     1 
ATOM   5509  O O     . TYR B 1 232 ? -6.695  68.702 92.524  1.00 14.93  ? 232 TYR B O     1 
ATOM   5510  C CB    . TYR B 1 232 ? -5.771  67.034 89.803  1.00 12.66  ? 232 TYR B CB    1 
ATOM   5511  C CG    . TYR B 1 232 ? -7.301  66.927 89.873  1.00 19.47  ? 232 TYR B CG    1 
ATOM   5512  C CD1   . TYR B 1 232 ? -8.124  67.667 89.058  1.00 19.51  ? 232 TYR B CD1   1 
ATOM   5513  C CD2   . TYR B 1 232 ? -7.874  66.079 90.808  1.00 21.26  ? 232 TYR B CD2   1 
ATOM   5514  C CE1   . TYR B 1 232 ? -9.497  67.531 89.126  1.00 21.18  ? 232 TYR B CE1   1 
ATOM   5515  C CE2   . TYR B 1 232 ? -9.242  65.960 90.916  1.00 21.89  ? 232 TYR B CE2   1 
ATOM   5516  C CZ    . TYR B 1 232 ? -10.051 66.689 90.062  1.00 24.42  ? 232 TYR B CZ    1 
ATOM   5517  O OH    . TYR B 1 232 ? -11.418 66.551 90.176  1.00 28.15  ? 232 TYR B OH    1 
ATOM   5518  N N     . PHE B 1 233 ? -5.164  67.111 92.797  1.00 12.73  ? 233 PHE B N     1 
ATOM   5519  C CA    . PHE B 1 233 ? -5.528  66.840 94.184  1.00 15.94  ? 233 PHE B CA    1 
ATOM   5520  C C     . PHE B 1 233 ? -5.317  68.038 95.093  1.00 18.65  ? 233 PHE B C     1 
ATOM   5521  O O     . PHE B 1 233 ? -6.159  68.352 95.946  1.00 18.93  ? 233 PHE B O     1 
ATOM   5522  C CB    . PHE B 1 233 ? -4.762  65.670 94.713  1.00 8.72   ? 233 PHE B CB    1 
ATOM   5523  C CG    . PHE B 1 233 ? -5.323  64.344 94.264  1.00 11.89  ? 233 PHE B CG    1 
ATOM   5524  C CD1   . PHE B 1 233 ? -6.658  64.050 94.470  1.00 14.95  ? 233 PHE B CD1   1 
ATOM   5525  C CD2   . PHE B 1 233 ? -4.480  63.432 93.622  1.00 12.24  ? 233 PHE B CD2   1 
ATOM   5526  C CE1   . PHE B 1 233 ? -7.170  62.826 94.053  1.00 18.13  ? 233 PHE B CE1   1 
ATOM   5527  C CE2   . PHE B 1 233 ? -5.001  62.202 93.233  1.00 12.86  ? 233 PHE B CE2   1 
ATOM   5528  C CZ    . PHE B 1 233 ? -6.335  61.911 93.437  1.00 16.75  ? 233 PHE B CZ    1 
ATOM   5529  N N     . ILE B 1 234 ? -4.292  68.827 94.853  1.00 15.74  ? 234 ILE B N     1 
ATOM   5530  C CA    . ILE B 1 234 ? -4.071  70.008 95.659  1.00 15.10  ? 234 ILE B CA    1 
ATOM   5531  C C     . ILE B 1 234 ? -5.222  70.968 95.396  1.00 21.06  ? 234 ILE B C     1 
ATOM   5532  O O     . ILE B 1 234 ? -5.766  71.570 96.323  1.00 17.56  ? 234 ILE B O     1 
ATOM   5533  C CB    . ILE B 1 234 ? -2.717  70.643 95.371  1.00 12.40  ? 234 ILE B CB    1 
ATOM   5534  C CG1   . ILE B 1 234 ? -1.586  69.793 95.962  1.00 17.99  ? 234 ILE B CG1   1 
ATOM   5535  C CG2   . ILE B 1 234 ? -2.616  72.087 95.827  1.00 12.55  ? 234 ILE B CG2   1 
ATOM   5536  C CD1   . ILE B 1 234 ? -0.206  70.364 95.630  1.00 16.43  ? 234 ILE B CD1   1 
ATOM   5537  N N     . LYS B 1 235 ? -5.551  71.204 94.128  1.00 20.30  ? 235 LYS B N     1 
ATOM   5538  C CA    . LYS B 1 235 ? -6.612  72.126 93.772  1.00 19.45  ? 235 LYS B CA    1 
ATOM   5539  C C     . LYS B 1 235 ? -7.935  71.630 94.367  1.00 20.94  ? 235 LYS B C     1 
ATOM   5540  O O     . LYS B 1 235 ? -8.702  72.476 94.786  1.00 20.10  ? 235 LYS B O     1 
ATOM   5541  C CB    . LYS B 1 235 ? -6.754  72.295 92.242  1.00 21.24  ? 235 LYS B CB    1 
ATOM   5542  C CG    . LYS B 1 235 ? -8.020  73.014 91.876  1.00 22.76  ? 235 LYS B CG    1 
ATOM   5543  C CD    . LYS B 1 235 ? -8.057  73.582 90.476  1.00 32.74  ? 235 LYS B CD    1 
ATOM   5544  C CE    . LYS B 1 235 ? -9.424  74.227 90.248  1.00 26.05  ? 235 LYS B CE    1 
ATOM   5545  N NZ    . LYS B 1 235 ? -9.280  75.438 89.402  1.00 28.95  ? 235 LYS B NZ    1 
ATOM   5546  N N     . ALA B 1 236 ? -8.198  70.350 94.351  1.00 18.24  ? 236 ALA B N     1 
ATOM   5547  C CA    . ALA B 1 236 ? -9.449  69.785 94.809  1.00 23.89  ? 236 ALA B CA    1 
ATOM   5548  C C     . ALA B 1 236 ? -9.561  69.799 96.344  1.00 28.41  ? 236 ALA B C     1 
ATOM   5549  O O     . ALA B 1 236 ? -10.671 69.935 96.858  1.00 27.77  ? 236 ALA B O     1 
ATOM   5550  C CB    . ALA B 1 236 ? -9.523  68.319 94.403  1.00 14.88  ? 236 ALA B CB    1 
ATOM   5551  N N     . ARG B 1 237 ? -8.451  69.589 97.054  1.00 25.54  ? 237 ARG B N     1 
ATOM   5552  C CA    . ARG B 1 237 ? -8.538  69.425 98.496  1.00 23.68  ? 237 ARG B CA    1 
ATOM   5553  C C     . ARG B 1 237 ? -7.952  70.562 99.303  1.00 27.16  ? 237 ARG B C     1 
ATOM   5554  O O     . ARG B 1 237 ? -8.183  70.565 100.509 1.00 30.39  ? 237 ARG B O     1 
ATOM   5555  C CB    . ARG B 1 237 ? -7.822  68.144 98.935  1.00 15.03  ? 237 ARG B CB    1 
ATOM   5556  C CG    . ARG B 1 237 ? -8.467  66.897 98.365  1.00 16.94  ? 237 ARG B CG    1 
ATOM   5557  C CD    . ARG B 1 237 ? -7.652  65.658 98.633  1.00 16.26  ? 237 ARG B CD    1 
ATOM   5558  N NE    . ARG B 1 237 ? -8.258  64.517 97.989  1.00 16.44  ? 237 ARG B NE    1 
ATOM   5559  C CZ    . ARG B 1 237 ? -7.759  63.309 97.892  1.00 22.00  ? 237 ARG B CZ    1 
ATOM   5560  N NH1   . ARG B 1 237 ? -6.579  63.022 98.429  1.00 18.75  ? 237 ARG B NH1   1 
ATOM   5561  N NH2   . ARG B 1 237 ? -8.442  62.374 97.260  1.00 16.38  ? 237 ARG B NH2   1 
ATOM   5562  N N     . ASP B 1 238 ? -7.179  71.446 98.699  1.00 24.84  ? 238 ASP B N     1 
ATOM   5563  C CA    . ASP B 1 238 ? -6.594  72.530 99.481  1.00 22.99  ? 238 ASP B CA    1 
ATOM   5564  C C     . ASP B 1 238 ? -7.368  73.798 99.215  1.00 26.66  ? 238 ASP B C     1 
ATOM   5565  O O     . ASP B 1 238 ? -7.247  74.411 98.160  1.00 25.31  ? 238 ASP B O     1 
ATOM   5566  C CB    . ASP B 1 238 ? -5.122  72.696 99.180  1.00 22.64  ? 238 ASP B CB    1 
ATOM   5567  C CG    . ASP B 1 238 ? -4.400  73.769 99.964  1.00 29.15  ? 238 ASP B CG    1 
ATOM   5568  O OD1   . ASP B 1 238 ? -5.040  74.714 100.483 1.00 27.50  ? 238 ASP B OD1   1 
ATOM   5569  O OD2   . ASP B 1 238 ? -3.149  73.721 100.043 1.00 25.05  ? 238 ASP B OD2   1 
ATOM   5570  N N     . PRO B 1 239 ? -8.059  74.316 100.235 1.00 28.78  ? 239 PRO B N     1 
ATOM   5571  C CA    . PRO B 1 239 ? -8.862  75.520 100.134 1.00 27.67  ? 239 PRO B CA    1 
ATOM   5572  C C     . PRO B 1 239 ? -8.122  76.698 99.547  1.00 27.43  ? 239 PRO B C     1 
ATOM   5573  O O     . PRO B 1 239 ? -8.707  77.519 98.834  1.00 26.52  ? 239 PRO B O     1 
ATOM   5574  C CB    . PRO B 1 239 ? -9.310  75.856 101.558 1.00 30.68  ? 239 PRO B CB    1 
ATOM   5575  C CG    . PRO B 1 239 ? -8.777  74.784 102.417 1.00 31.36  ? 239 PRO B CG    1 
ATOM   5576  C CD    . PRO B 1 239 ? -8.212  73.672 101.571 1.00 29.55  ? 239 PRO B CD    1 
ATOM   5577  N N     . LYS B 1 240 ? -6.823  76.793 99.825  1.00 25.98  ? 240 LYS B N     1 
ATOM   5578  C CA    . LYS B 1 240 ? -6.012  77.865 99.269  1.00 27.26  ? 240 LYS B CA    1 
ATOM   5579  C C     . LYS B 1 240 ? -5.927  77.828 97.749  1.00 26.90  ? 240 LYS B C     1 
ATOM   5580  O O     . LYS B 1 240 ? -5.786  78.904 97.137  1.00 26.66  ? 240 LYS B O     1 
ATOM   5581  C CB    . LYS B 1 240 ? -4.613  77.782 99.891  1.00 36.97  ? 240 LYS B CB    1 
ATOM   5582  C CG    . LYS B 1 240 ? -3.673  78.872 99.417  1.00 53.74  ? 240 LYS B CG    1 
ATOM   5583  C CD    . LYS B 1 240 ? -2.224  78.603 99.803  1.00 64.24  ? 240 LYS B CD    1 
ATOM   5584  C CE    . LYS B 1 240 ? -1.328  79.742 99.327  1.00 69.87  ? 240 LYS B CE    1 
ATOM   5585  N NZ    . LYS B 1 240 ? 0.004   79.242 98.889  1.00 77.96  ? 240 LYS B NZ    1 
ATOM   5586  N N     . TYR B 1 241 ? -6.080  76.676 97.097  1.00 24.66  ? 241 TYR B N     1 
ATOM   5587  C CA    . TYR B 1 241 ? -5.948  76.641 95.630  1.00 27.37  ? 241 TYR B CA    1 
ATOM   5588  C C     . TYR B 1 241 ? -7.260  76.384 94.928  1.00 29.33  ? 241 TYR B C     1 
ATOM   5589  O O     . TYR B 1 241 ? -7.306  76.107 93.732  1.00 27.33  ? 241 TYR B O     1 
ATOM   5590  C CB    . TYR B 1 241 ? -4.943  75.521 95.280  1.00 22.53  ? 241 TYR B CB    1 
ATOM   5591  C CG    . TYR B 1 241 ? -3.541  75.973 95.666  1.00 20.78  ? 241 TYR B CG    1 
ATOM   5592  C CD1   . TYR B 1 241 ? -2.854  76.803 94.794  1.00 21.74  ? 241 TYR B CD1   1 
ATOM   5593  C CD2   . TYR B 1 241 ? -2.955  75.622 96.864  1.00 20.99  ? 241 TYR B CD2   1 
ATOM   5594  C CE1   . TYR B 1 241 ? -1.599  77.279 95.088  1.00 22.84  ? 241 TYR B CE1   1 
ATOM   5595  C CE2   . TYR B 1 241 ? -1.670  76.090 97.174  1.00 23.49  ? 241 TYR B CE2   1 
ATOM   5596  C CZ    . TYR B 1 241 ? -1.013  76.909 96.294  1.00 25.63  ? 241 TYR B CZ    1 
ATOM   5597  O OH    . TYR B 1 241 ? 0.256   77.372 96.573  1.00 25.19  ? 241 TYR B OH    1 
ATOM   5598  N N     . LYS B 1 242 ? -8.366  76.522 95.643  1.00 30.06  ? 242 LYS B N     1 
ATOM   5599  C CA    . LYS B 1 242 ? -9.702  76.288 95.142  1.00 30.12  ? 242 LYS B CA    1 
ATOM   5600  C C     . LYS B 1 242 ? -9.977  76.962 93.817  1.00 25.61  ? 242 LYS B C     1 
ATOM   5601  O O     . LYS B 1 242 ? -10.615 76.330 92.982  1.00 27.29  ? 242 LYS B O     1 
ATOM   5602  C CB    . LYS B 1 242 ? -10.776 76.758 96.146  1.00 40.87  ? 242 LYS B CB    1 
ATOM   5603  C CG    . LYS B 1 242 ? -12.122 76.084 95.893  1.00 57.51  ? 242 LYS B CG    1 
ATOM   5604  C CD    . LYS B 1 242 ? -13.267 77.072 96.087  1.00 72.02  ? 242 LYS B CD    1 
ATOM   5605  C CE    . LYS B 1 242 ? -14.557 76.551 95.473  1.00 80.96  ? 242 LYS B CE    1 
ATOM   5606  N NZ    . LYS B 1 242 ? -15.173 77.555 94.553  1.00 85.34  ? 242 LYS B NZ    1 
ATOM   5607  N N     . ASN B 1 243 ? -9.586  78.210 93.676  1.00 24.44  ? 243 ASN B N     1 
ATOM   5608  C CA    . ASN B 1 243 ? -9.823  78.964 92.460  1.00 29.86  ? 243 ASN B CA    1 
ATOM   5609  C C     . ASN B 1 243 ? -8.584  79.104 91.587  1.00 30.17  ? 243 ASN B C     1 
ATOM   5610  O O     . ASN B 1 243 ? -8.514  79.980 90.729  1.00 33.14  ? 243 ASN B O     1 
ATOM   5611  C CB    . ASN B 1 243 ? -10.352 80.364 92.829  1.00 35.35  ? 243 ASN B CB    1 
ATOM   5612  C CG    . ASN B 1 243 ? -11.669 80.252 93.594  1.00 50.97  ? 243 ASN B CG    1 
ATOM   5613  O OD1   . ASN B 1 243 ? -12.549 79.442 93.284  1.00 48.16  ? 243 ASN B OD1   1 
ATOM   5614  N ND2   . ASN B 1 243 ? -11.771 81.066 94.640  1.00 57.96  ? 243 ASN B ND2   1 
ATOM   5615  N N     . ALA B 1 244 ? -7.564  78.289 91.836  1.00 27.92  ? 244 ALA B N     1 
ATOM   5616  C CA    . ALA B 1 244 ? -6.338  78.444 91.031  1.00 25.93  ? 244 ALA B CA    1 
ATOM   5617  C C     . ALA B 1 244 ? -6.442  77.572 89.787  1.00 21.09  ? 244 ALA B C     1 
ATOM   5618  O O     . ALA B 1 244 ? -7.154  76.571 89.853  1.00 20.96  ? 244 ALA B O     1 
ATOM   5619  C CB    . ALA B 1 244 ? -5.137  78.015 91.867  1.00 22.49  ? 244 ALA B CB    1 
ATOM   5620  N N     . THR B 1 245 ? -5.725  77.898 88.722  1.00 18.36  ? 245 THR B N     1 
ATOM   5621  C CA    . THR B 1 245 ? -5.699  76.963 87.581  1.00 17.97  ? 245 THR B CA    1 
ATOM   5622  C C     . THR B 1 245 ? -4.703  75.849 87.879  1.00 16.20  ? 245 THR B C     1 
ATOM   5623  O O     . THR B 1 245 ? -3.825  75.989 88.755  1.00 18.46  ? 245 THR B O     1 
ATOM   5624  C CB    . THR B 1 245 ? -5.235  77.664 86.298  1.00 22.23  ? 245 THR B CB    1 
ATOM   5625  O OG1   . THR B 1 245 ? -3.865  78.029 86.556  1.00 20.89  ? 245 THR B OG1   1 
ATOM   5626  C CG2   . THR B 1 245 ? -6.075  78.889 85.998  1.00 23.39  ? 245 THR B CG2   1 
ATOM   5627  N N     . ILE B 1 246 ? -4.754  74.734 87.190  1.00 15.02  ? 246 ILE B N     1 
ATOM   5628  C CA    . ILE B 1 246 ? -3.794  73.654 87.416  1.00 17.53  ? 246 ILE B CA    1 
ATOM   5629  C C     . ILE B 1 246 ? -2.363  74.148 87.203  1.00 18.09  ? 246 ILE B C     1 
ATOM   5630  O O     . ILE B 1 246 ? -1.470  73.733 87.954  1.00 15.02  ? 246 ILE B O     1 
ATOM   5631  C CB    . ILE B 1 246 ? -4.108  72.461 86.485  1.00 18.19  ? 246 ILE B CB    1 
ATOM   5632  C CG1   . ILE B 1 246 ? -5.480  71.883 86.816  1.00 15.97  ? 246 ILE B CG1   1 
ATOM   5633  C CG2   . ILE B 1 246 ? -3.015  71.409 86.562  1.00 16.27  ? 246 ILE B CG2   1 
ATOM   5634  C CD1   . ILE B 1 246 ? -5.617  71.171 88.145  1.00 21.22  ? 246 ILE B CD1   1 
ATOM   5635  N N     . LYS B 1 247 ? -2.114  75.001 86.210  1.00 15.60  ? 247 LYS B N     1 
ATOM   5636  C CA    . LYS B 1 247 ? -0.774  75.517 85.951  1.00 19.13  ? 247 LYS B CA    1 
ATOM   5637  C C     . LYS B 1 247 ? -0.273  76.380 87.098  1.00 19.06  ? 247 LYS B C     1 
ATOM   5638  O O     . LYS B 1 247 ? 0.932   76.358 87.368  1.00 17.54  ? 247 LYS B O     1 
ATOM   5639  C CB    . LYS B 1 247 ? -0.659  76.316 84.630  1.00 14.22  ? 247 LYS B CB    1 
ATOM   5640  C CG    . LYS B 1 247 ? -0.551  75.298 83.449  1.00 17.63  ? 247 LYS B CG    1 
ATOM   5641  C CD    . LYS B 1 247 ? -0.578  76.078 82.134  1.00 21.77  ? 247 LYS B CD    1 
ATOM   5642  C CE    . LYS B 1 247 ? -0.461  75.179 80.921  1.00 18.09  ? 247 LYS B CE    1 
ATOM   5643  N NZ    . LYS B 1 247 ? -0.249  76.060 79.700  1.00 25.14  ? 247 LYS B NZ    1 
ATOM   5644  N N     . GLU B 1 248 ? -1.175  77.134 87.744  1.00 17.45  ? 248 GLU B N     1 
ATOM   5645  C CA    . GLU B 1 248 ? -0.744  77.916 88.909  1.00 17.55  ? 248 GLU B CA    1 
ATOM   5646  C C     . GLU B 1 248 ? -0.311  77.002 90.033  1.00 16.42  ? 248 GLU B C     1 
ATOM   5647  O O     . GLU B 1 248 ? 0.681   77.261 90.698  1.00 19.25  ? 248 GLU B O     1 
ATOM   5648  C CB    . GLU B 1 248 ? -1.886  78.812 89.426  1.00 17.09  ? 248 GLU B CB    1 
ATOM   5649  C CG    . GLU B 1 248 ? -2.071  79.963 88.432  1.00 24.95  ? 248 GLU B CG    1 
ATOM   5650  C CD    . GLU B 1 248 ? -3.375  80.700 88.709  1.00 28.22  ? 248 GLU B CD    1 
ATOM   5651  O OE1   . GLU B 1 248 ? -4.403  80.141 89.122  1.00 33.94  ? 248 GLU B OE1   1 
ATOM   5652  O OE2   . GLU B 1 248 ? -3.327  81.914 88.546  1.00 40.30  ? 248 GLU B OE2   1 
ATOM   5653  N N     . VAL B 1 249 ? -1.063  75.926 90.253  1.00 14.88  ? 249 VAL B N     1 
ATOM   5654  C CA    . VAL B 1 249 ? -0.708  74.970 91.271  1.00 15.68  ? 249 VAL B CA    1 
ATOM   5655  C C     . VAL B 1 249 ? 0.667   74.380 90.954  1.00 19.00  ? 249 VAL B C     1 
ATOM   5656  O O     . VAL B 1 249 ? 1.512   74.274 91.849  1.00 16.51  ? 249 VAL B O     1 
ATOM   5657  C CB    . VAL B 1 249 ? -1.725  73.840 91.391  1.00 15.85  ? 249 VAL B CB    1 
ATOM   5658  C CG1   . VAL B 1 249 ? -1.176  72.759 92.314  1.00 13.21  ? 249 VAL B CG1   1 
ATOM   5659  C CG2   . VAL B 1 249 ? -3.083  74.334 91.942  1.00 17.64  ? 249 VAL B CG2   1 
ATOM   5660  N N     . ILE B 1 250 ? 0.865   73.953 89.703  1.00 16.54  ? 250 ILE B N     1 
ATOM   5661  C CA    . ILE B 1 250 ? 2.134   73.365 89.269  1.00 14.19  ? 250 ILE B CA    1 
ATOM   5662  C C     . ILE B 1 250 ? 3.237   74.380 89.490  1.00 13.56  ? 250 ILE B C     1 
ATOM   5663  O O     . ILE B 1 250 ? 4.275   74.031 90.038  1.00 15.83  ? 250 ILE B O     1 
ATOM   5664  C CB    . ILE B 1 250 ? 2.096   72.921 87.795  1.00 13.76  ? 250 ILE B CB    1 
ATOM   5665  C CG1   . ILE B 1 250 ? 1.227   71.676 87.626  1.00 11.31  ? 250 ILE B CG1   1 
ATOM   5666  C CG2   . ILE B 1 250 ? 3.496   72.544 87.243  1.00 10.94  ? 250 ILE B CG2   1 
ATOM   5667  C CD1   . ILE B 1 250 ? 0.768   71.482 86.181  1.00 14.73  ? 250 ILE B CD1   1 
ATOM   5668  N N     . PHE B 1 251 ? 3.019   75.634 89.102  1.00 13.73  ? 251 PHE B N     1 
ATOM   5669  C CA    . PHE B 1 251 ? 4.088   76.629 89.251  1.00 17.78  ? 251 PHE B CA    1 
ATOM   5670  C C     . PHE B 1 251 ? 4.523   76.771 90.712  1.00 22.35  ? 251 PHE B C     1 
ATOM   5671  O O     . PHE B 1 251 ? 5.728   76.898 90.987  1.00 19.00  ? 251 PHE B O     1 
ATOM   5672  C CB    . PHE B 1 251 ? 3.578   77.949 88.694  1.00 18.87  ? 251 PHE B CB    1 
ATOM   5673  C CG    . PHE B 1 251 ? 4.676   78.941 88.410  1.00 20.64  ? 251 PHE B CG    1 
ATOM   5674  C CD1   . PHE B 1 251 ? 5.366   78.920 87.217  1.00 25.97  ? 251 PHE B CD1   1 
ATOM   5675  C CD2   . PHE B 1 251 ? 4.996   79.900 89.358  1.00 23.42  ? 251 PHE B CD2   1 
ATOM   5676  C CE1   . PHE B 1 251 ? 6.363   79.832 86.945  1.00 34.79  ? 251 PHE B CE1   1 
ATOM   5677  C CE2   . PHE B 1 251 ? 5.991   80.833 89.084  1.00 26.67  ? 251 PHE B CE2   1 
ATOM   5678  C CZ    . PHE B 1 251 ? 6.683   80.790 87.899  1.00 29.50  ? 251 PHE B CZ    1 
ATOM   5679  N N     . ASP B 1 252 ? 3.593   76.725 91.681  1.00 17.92  ? 252 ASP B N     1 
ATOM   5680  C CA    . ASP B 1 252 ? 3.935   76.824 93.083  1.00 19.77  ? 252 ASP B CA    1 
ATOM   5681  C C     . ASP B 1 252 ? 4.620   75.571 93.583  1.00 15.97  ? 252 ASP B C     1 
ATOM   5682  O O     . ASP B 1 252 ? 5.553   75.660 94.386  1.00 17.31  ? 252 ASP B O     1 
ATOM   5683  C CB    . ASP B 1 252 ? 2.736   77.036 94.031  1.00 19.80  ? 252 ASP B CB    1 
ATOM   5684  C CG    . ASP B 1 252 ? 2.310   78.485 94.105  1.00 22.25  ? 252 ASP B CG    1 
ATOM   5685  O OD1   . ASP B 1 252 ? 2.911   79.353 93.450  1.00 20.77  ? 252 ASP B OD1   1 
ATOM   5686  O OD2   . ASP B 1 252 ? 1.330   78.745 94.849  1.00 27.51  ? 252 ASP B OD2   1 
ATOM   5687  N N     . MET B 1 253 ? 4.211   74.406 93.127  1.00 13.80  ? 253 MET B N     1 
ATOM   5688  C CA    . MET B 1 253 ? 4.860   73.194 93.622  1.00 14.35  ? 253 MET B CA    1 
ATOM   5689  C C     . MET B 1 253 ? 6.369   73.192 93.322  1.00 17.12  ? 253 MET B C     1 
ATOM   5690  O O     . MET B 1 253 ? 7.166   72.731 94.163  1.00 17.84  ? 253 MET B O     1 
ATOM   5691  C CB    . MET B 1 253 ? 4.283   71.945 92.957  1.00 16.16  ? 253 MET B CB    1 
ATOM   5692  C CG    . MET B 1 253 ? 2.907   71.491 93.319  1.00 19.55  ? 253 MET B CG    1 
ATOM   5693  S SD    . MET B 1 253 ? 2.244   70.201 92.251  1.00 20.02  ? 253 MET B SD    1 
ATOM   5694  C CE    . MET B 1 253 ? 3.422   68.887 92.324  1.00 16.97  ? 253 MET B CE    1 
ATOM   5695  N N     . TYR B 1 254 ? 6.765   73.675 92.141  1.00 14.85  ? 254 TYR B N     1 
ATOM   5696  C CA    . TYR B 1 254 ? 8.168   73.595 91.713  1.00 15.31  ? 254 TYR B CA    1 
ATOM   5697  C C     . TYR B 1 254 ? 9.040   74.692 92.280  1.00 15.61  ? 254 TYR B C     1 
ATOM   5698  O O     . TYR B 1 254 ? 10.266  74.790 92.134  1.00 16.70  ? 254 TYR B O     1 
ATOM   5699  C CB    . TYR B 1 254 ? 8.247   73.403 90.149  1.00 11.48  ? 254 TYR B CB    1 
ATOM   5700  C CG    . TYR B 1 254 ? 7.890   71.953 89.823  1.00 13.65  ? 254 TYR B CG    1 
ATOM   5701  C CD1   . TYR B 1 254 ? 6.549   71.589 89.638  1.00 10.54  ? 254 TYR B CD1   1 
ATOM   5702  C CD2   . TYR B 1 254 ? 8.862   70.968 89.770  1.00 10.88  ? 254 TYR B CD2   1 
ATOM   5703  C CE1   . TYR B 1 254 ? 6.221   70.258 89.395  1.00 11.11  ? 254 TYR B CE1   1 
ATOM   5704  C CE2   . TYR B 1 254 ? 8.507   69.648 89.550  1.00 11.73  ? 254 TYR B CE2   1 
ATOM   5705  C CZ    . TYR B 1 254 ? 7.182   69.301 89.344  1.00 12.17  ? 254 TYR B CZ    1 
ATOM   5706  O OH    . TYR B 1 254 ? 6.865   67.992 89.144  1.00 14.23  ? 254 TYR B OH    1 
ATOM   5707  N N     . LYS B 1 255 ? 8.417   75.581 93.075  1.00 14.92  ? 255 LYS B N     1 
ATOM   5708  C CA    . LYS B 1 255 ? 9.141   76.514 93.938  1.00 19.77  ? 255 LYS B CA    1 
ATOM   5709  C C     . LYS B 1 255 ? 9.819   75.722 95.060  1.00 18.11  ? 255 LYS B C     1 
ATOM   5710  O O     . LYS B 1 255 ? 10.796  76.167 95.647  1.00 19.44  ? 255 LYS B O     1 
ATOM   5711  C CB    . LYS B 1 255 ? 8.217   77.539 94.587  1.00 22.20  ? 255 LYS B CB    1 
ATOM   5712  C CG    . LYS B 1 255 ? 7.821   78.669 93.633  1.00 22.83  ? 255 LYS B CG    1 
ATOM   5713  C CD    . LYS B 1 255 ? 6.643   79.395 94.278  1.00 29.51  ? 255 LYS B CD    1 
ATOM   5714  C CE    . LYS B 1 255 ? 6.141   80.501 93.360  1.00 38.21  ? 255 LYS B CE    1 
ATOM   5715  N NZ    . LYS B 1 255 ? 5.003   81.250 93.972  1.00 43.33  ? 255 LYS B NZ    1 
ATOM   5716  N N     . TYR B 1 256 ? 9.373   74.504 95.383  1.00 15.38  ? 256 TYR B N     1 
ATOM   5717  C CA    . TYR B 1 256 ? 9.875   73.672 96.443  1.00 15.81  ? 256 TYR B CA    1 
ATOM   5718  C C     . TYR B 1 256 ? 10.723  72.488 96.037  1.00 17.17  ? 256 TYR B C     1 
ATOM   5719  O O     . TYR B 1 256 ? 10.694  71.441 96.702  1.00 17.96  ? 256 TYR B O     1 
ATOM   5720  C CB    . TYR B 1 256 ? 8.692   73.178 97.326  1.00 17.06  ? 256 TYR B CB    1 
ATOM   5721  C CG    . TYR B 1 256 ? 7.859   74.390 97.729  1.00 18.84  ? 256 TYR B CG    1 
ATOM   5722  C CD1   . TYR B 1 256 ? 8.459   75.472 98.358  1.00 21.41  ? 256 TYR B CD1   1 
ATOM   5723  C CD2   . TYR B 1 256 ? 6.500   74.448 97.410  1.00 20.35  ? 256 TYR B CD2   1 
ATOM   5724  C CE1   . TYR B 1 256 ? 7.716   76.598 98.698  1.00 24.85  ? 256 TYR B CE1   1 
ATOM   5725  C CE2   . TYR B 1 256 ? 5.762   75.565 97.730  1.00 22.96  ? 256 TYR B CE2   1 
ATOM   5726  C CZ    . TYR B 1 256 ? 6.376   76.622 98.396  1.00 24.54  ? 256 TYR B CZ    1 
ATOM   5727  O OH    . TYR B 1 256 ? 5.626   77.716 98.732  1.00 31.69  ? 256 TYR B OH    1 
ATOM   5728  N N     . ALA B 1 257 ? 11.529  72.715 94.972  1.00 14.92  ? 257 ALA B N     1 
ATOM   5729  C CA    . ALA B 1 257 ? 12.523  71.691 94.621  1.00 14.36  ? 257 ALA B CA    1 
ATOM   5730  C C     . ALA B 1 257 ? 13.645  72.438 93.913  1.00 13.94  ? 257 ALA B C     1 
ATOM   5731  O O     . ALA B 1 257 ? 13.392  73.572 93.539  1.00 14.01  ? 257 ALA B O     1 
ATOM   5732  C CB    . ALA B 1 257 ? 11.973  70.543 93.809  1.00 13.28  ? 257 ALA B CB    1 
ATOM   5733  N N     . ASP B 1 258 ? 14.807  71.806 93.779  1.00 15.58  ? 258 ASP B N     1 
ATOM   5734  C CA    . ASP B 1 258 ? 15.896  72.476 93.037  1.00 15.78  ? 258 ASP B CA    1 
ATOM   5735  C C     . ASP B 1 258 ? 16.037  71.882 91.614  1.00 17.52  ? 258 ASP B C     1 
ATOM   5736  O O     . ASP B 1 258 ? 16.813  72.375 90.798  1.00 14.70  ? 258 ASP B O     1 
ATOM   5737  C CB    . ASP B 1 258 ? 17.231  72.215 93.798  1.00 16.17  ? 258 ASP B CB    1 
ATOM   5738  C CG    . ASP B 1 258 ? 17.141  72.851 95.200  1.00 16.02  ? 258 ASP B CG    1 
ATOM   5739  O OD1   . ASP B 1 258 ? 16.983  74.085 95.234  1.00 20.33  ? 258 ASP B OD1   1 
ATOM   5740  O OD2   . ASP B 1 258 ? 17.138  72.105 96.196  1.00 17.25  ? 258 ASP B OD2   1 
ATOM   5741  N N     . ALA B 1 259 ? 15.382  70.738 91.398  1.00 14.80  ? 259 ALA B N     1 
ATOM   5742  C CA    . ALA B 1 259 ? 15.423  70.058 90.104  1.00 17.63  ? 259 ALA B CA    1 
ATOM   5743  C C     . ALA B 1 259 ? 14.284  69.044 90.038  1.00 17.02  ? 259 ALA B C     1 
ATOM   5744  O O     . ALA B 1 259 ? 13.645  68.771 91.068  1.00 16.70  ? 259 ALA B O     1 
ATOM   5745  C CB    . ALA B 1 259 ? 16.735  69.267 90.009  1.00 12.13  ? 259 ALA B CB    1 
ATOM   5746  N N     . LEU B 1 260 ? 14.091  68.447 88.840  1.00 13.05  ? 260 LEU B N     1 
ATOM   5747  C CA    . LEU B 1 260 ? 13.069  67.390 88.769  1.00 11.18  ? 260 LEU B CA    1 
ATOM   5748  C C     . LEU B 1 260 ? 13.633  66.263 87.936  1.00 10.23  ? 260 LEU B C     1 
ATOM   5749  O O     . LEU B 1 260 ? 14.467  66.431 87.050  1.00 13.12  ? 260 LEU B O     1 
ATOM   5750  C CB    . LEU B 1 260 ? 11.782  68.011 88.209  1.00 9.57   ? 260 LEU B CB    1 
ATOM   5751  C CG    . LEU B 1 260 ? 11.816  68.526 86.748  1.00 15.71  ? 260 LEU B CG    1 
ATOM   5752  C CD1   . LEU B 1 260 ? 11.680  67.360 85.782  1.00 9.75   ? 260 LEU B CD1   1 
ATOM   5753  C CD2   . LEU B 1 260 ? 10.748  69.576 86.524  1.00 14.00  ? 260 LEU B CD2   1 
ATOM   5754  N N     . THR B 1 261 ? 13.146  65.060 88.130  1.00 8.94   ? 261 THR B N     1 
ATOM   5755  C CA    . THR B 1 261 ? 13.384  63.920 87.290  1.00 9.20   ? 261 THR B CA    1 
ATOM   5756  C C     . THR B 1 261 ? 11.952  63.584 86.829  1.00 15.66  ? 261 THR B C     1 
ATOM   5757  O O     . THR B 1 261 ? 11.046  63.785 87.666  1.00 12.88  ? 261 THR B O     1 
ATOM   5758  C CB    . THR B 1 261 ? 13.987  62.711 88.012  1.00 16.10  ? 261 THR B CB    1 
ATOM   5759  O OG1   . THR B 1 261 ? 13.259  62.510 89.250  1.00 17.27  ? 261 THR B OG1   1 
ATOM   5760  C CG2   . THR B 1 261 ? 15.454  62.984 88.260  1.00 14.13  ? 261 THR B CG2   1 
ATOM   5761  N N     . MET B 1 262 ? 11.765  63.141 85.570  1.00 12.31  ? 262 MET B N     1 
ATOM   5762  C CA    . MET B 1 262 ? 10.373  62.889 85.149  1.00 11.33  ? 262 MET B CA    1 
ATOM   5763  C C     . MET B 1 262 ? 10.262  61.791 84.103  1.00 11.77  ? 262 MET B C     1 
ATOM   5764  O O     . MET B 1 262 ? 11.009  61.813 83.122  1.00 12.43  ? 262 MET B O     1 
ATOM   5765  C CB    . MET B 1 262 ? 9.759   64.148 84.554  1.00 8.36   ? 262 MET B CB    1 
ATOM   5766  C CG    . MET B 1 262 ? 8.303   64.002 84.093  1.00 17.96  ? 262 MET B CG    1 
ATOM   5767  S SD    . MET B 1 262 ? 7.794   65.323 82.964  1.00 19.48  ? 262 MET B SD    1 
ATOM   5768  C CE    . MET B 1 262 ? 7.699   66.764 83.992  1.00 16.48  ? 262 MET B CE    1 
ATOM   5769  N N     . SER B 1 263 ? 9.397   60.828 84.393  1.00 10.43  ? 263 SER B N     1 
ATOM   5770  C CA    . SER B 1 263 ? 9.010   59.832 83.423  1.00 10.53  ? 263 SER B CA    1 
ATOM   5771  C C     . SER B 1 263 ? 7.878   60.543 82.669  1.00 15.50  ? 263 SER B C     1 
ATOM   5772  O O     . SER B 1 263 ? 6.816   60.813 83.275  1.00 13.10  ? 263 SER B O     1 
ATOM   5773  C CB    . SER B 1 263 ? 8.456   58.569 84.045  1.00 7.83   ? 263 SER B CB    1 
ATOM   5774  O OG    . SER B 1 263 ? 8.046   57.647 83.005  1.00 11.22  ? 263 SER B OG    1 
ATOM   5775  N N     . ALA B 1 264 ? 8.101   60.812 81.376  1.00 12.73  ? 264 ALA B N     1 
ATOM   5776  C CA    . ALA B 1 264 ? 7.055   61.456 80.564  1.00 11.12  ? 264 ALA B CA    1 
ATOM   5777  C C     . ALA B 1 264 ? 6.079   60.419 80.040  1.00 8.28   ? 264 ALA B C     1 
ATOM   5778  O O     . ALA B 1 264 ? 5.065   60.735 79.384  1.00 11.08  ? 264 ALA B O     1 
ATOM   5779  C CB    . ALA B 1 264 ? 7.624   62.369 79.488  1.00 10.54  ? 264 ALA B CB    1 
ATOM   5780  N N     . LYS B 1 265 ? 6.293   59.156 80.381  1.00 5.35   ? 265 LYS B N     1 
ATOM   5781  C CA    . LYS B 1 265 ? 5.426   58.062 80.078  1.00 9.29   ? 265 LYS B CA    1 
ATOM   5782  C C     . LYS B 1 265 ? 4.195   58.037 81.005  1.00 9.61   ? 265 LYS B C     1 
ATOM   5783  O O     . LYS B 1 265 ? 3.355   57.189 80.819  1.00 11.67  ? 265 LYS B O     1 
ATOM   5784  C CB    . LYS B 1 265 ? 6.173   56.713 80.212  1.00 7.90   ? 265 LYS B CB    1 
ATOM   5785  C CG    . LYS B 1 265 ? 7.419   56.700 79.316  1.00 10.97  ? 265 LYS B CG    1 
ATOM   5786  C CD    . LYS B 1 265 ? 8.302   55.497 79.672  1.00 9.21   ? 265 LYS B CD    1 
ATOM   5787  C CE    . LYS B 1 265 ? 7.689   54.195 79.153  1.00 9.60   ? 265 LYS B CE    1 
ATOM   5788  N NZ    . LYS B 1 265 ? 8.571   53.003 79.372  1.00 12.25  ? 265 LYS B NZ    1 
HETATM 5789  N N1    . LLP B 1 266 ? 9.605   57.524 89.445  1.00 14.18  ? 266 LLP B N1    1 
HETATM 5790  C C2    . LLP B 1 266 ? 8.261   57.445 89.541  1.00 14.91  ? 266 LLP B C2    1 
HETATM 5791  C "C2'" . LLP B 1 266 ? 7.493   58.103 90.733  1.00 17.15  ? 266 LLP B "C2'" 1 
HETATM 5792  C C3    . LLP B 1 266 ? 7.584   56.779 88.515  1.00 19.65  ? 266 LLP B C3    1 
HETATM 5793  O O3    . LLP B 1 266 ? 6.306   56.670 88.564  1.00 15.90  ? 266 LLP B O3    1 
HETATM 5794  C C4    . LLP B 1 266 ? 8.286   56.177 87.435  1.00 15.97  ? 266 LLP B C4    1 
HETATM 5795  C "C4'" . LLP B 1 266 ? 7.574   55.467 86.345  1.00 21.94  ? 266 LLP B "C4'" 1 
HETATM 5796  C C5    . LLP B 1 266 ? 9.714   56.269 87.439  1.00 18.96  ? 266 LLP B C5    1 
HETATM 5797  C C6    . LLP B 1 266 ? 10.366  56.976 88.463  1.00 14.41  ? 266 LLP B C6    1 
HETATM 5798  C "C5'" . LLP B 1 266 ? 10.534  55.603 86.333  1.00 12.25  ? 266 LLP B "C5'" 1 
HETATM 5799  O OP4   . LLP B 1 266 ? 10.310  56.245 85.049  1.00 17.14  ? 266 LLP B OP4   1 
HETATM 5800  P P     . LLP B 1 266 ? 10.396  55.206 83.801  1.00 13.27  ? 266 LLP B P     1 
HETATM 5801  O OP1   . LLP B 1 266 ? 11.844  54.771 83.725  1.00 12.26  ? 266 LLP B OP1   1 
HETATM 5802  O OP2   . LLP B 1 266 ? 10.005  56.107 82.656  1.00 10.93  ? 266 LLP B OP2   1 
HETATM 5803  O OP3   . LLP B 1 266 ? 9.547   54.024 84.011  1.00 10.20  ? 266 LLP B OP3   1 
HETATM 5804  N N     . LLP B 1 266 ? 4.127   58.963 81.955  1.00 8.54   ? 266 LLP B N     1 
HETATM 5805  C CA    . LLP B 1 266 ? 2.998   59.009 82.892  1.00 12.21  ? 266 LLP B CA    1 
HETATM 5806  C CB    . LLP B 1 266 ? 3.429   58.990 84.351  1.00 10.35  ? 266 LLP B CB    1 
HETATM 5807  C CG    . LLP B 1 266 ? 3.780   57.617 84.913  1.00 8.60   ? 266 LLP B CG    1 
HETATM 5808  C CD    . LLP B 1 266 ? 5.036   57.029 84.275  1.00 7.43   ? 266 LLP B CD    1 
HETATM 5809  C CE    . LLP B 1 266 ? 5.463   55.736 84.968  1.00 12.04  ? 266 LLP B CE    1 
HETATM 5810  N NZ    . LLP B 1 266 ? 6.490   56.086 85.968  1.00 17.23  ? 266 LLP B NZ    1 
HETATM 5811  C C     . LLP B 1 266 ? 2.163   60.219 82.544  1.00 11.13  ? 266 LLP B C     1 
HETATM 5812  O O     . LLP B 1 266 ? 1.485   60.140 81.491  1.00 10.49  ? 266 LLP B O     1 
ATOM   5813  N N     . ASP B 1 267 ? 2.160   61.264 83.381  1.00 8.87   ? 267 ASP B N     1 
ATOM   5814  C CA    . ASP B 1 267 ? 1.297   62.393 83.170  1.00 6.85   ? 267 ASP B CA    1 
ATOM   5815  C C     . ASP B 1 267 ? 1.357   63.170 81.859  1.00 14.05  ? 267 ASP B C     1 
ATOM   5816  O O     . ASP B 1 267 ? 0.333   63.654 81.391  1.00 11.69  ? 267 ASP B O     1 
ATOM   5817  C CB    . ASP B 1 267 ? 1.387   63.366 84.343  1.00 4.88   ? 267 ASP B CB    1 
ATOM   5818  C CG    . ASP B 1 267 ? 0.511   62.904 85.536  1.00 8.88   ? 267 ASP B CG    1 
ATOM   5819  O OD1   . ASP B 1 267 ? 0.005   61.781 85.623  1.00 9.77   ? 267 ASP B OD1   1 
ATOM   5820  O OD2   . ASP B 1 267 ? 0.426   63.742 86.458  1.00 13.91  ? 267 ASP B OD2   1 
ATOM   5821  N N     . PRO B 1 268 ? 2.494   63.337 81.212  1.00 11.75  ? 268 PRO B N     1 
ATOM   5822  C CA    . PRO B 1 268 ? 2.622   63.962 79.897  1.00 10.68  ? 268 PRO B CA    1 
ATOM   5823  C C     . PRO B 1 268 ? 2.089   63.126 78.731  1.00 10.20  ? 268 PRO B C     1 
ATOM   5824  O O     . PRO B 1 268 ? 2.189   63.510 77.567  1.00 11.12  ? 268 PRO B O     1 
ATOM   5825  C CB    . PRO B 1 268 ? 4.126   64.251 79.768  1.00 10.44  ? 268 PRO B CB    1 
ATOM   5826  C CG    . PRO B 1 268 ? 4.618   64.227 81.197  1.00 9.98   ? 268 PRO B CG    1 
ATOM   5827  C CD    . PRO B 1 268 ? 3.836   63.017 81.747  1.00 8.93   ? 268 PRO B CD    1 
ATOM   5828  N N     . LEU B 1 269 ? 1.483   61.976 78.940  1.00 9.35   ? 269 LEU B N     1 
ATOM   5829  C CA    . LEU B 1 269 ? 0.670   61.224 77.997  1.00 12.52  ? 269 LEU B CA    1 
ATOM   5830  C C     . LEU B 1 269 ? 1.459   60.645 76.843  1.00 15.86  ? 269 LEU B C     1 
ATOM   5831  O O     . LEU B 1 269 ? 0.956   60.584 75.718  1.00 15.18  ? 269 LEU B O     1 
ATOM   5832  C CB    . LEU B 1 269 ? -0.445  62.162 77.400  1.00 12.78  ? 269 LEU B CB    1 
ATOM   5833  C CG    . LEU B 1 269 ? -1.461  62.570 78.507  1.00 16.39  ? 269 LEU B CG    1 
ATOM   5834  C CD1   . LEU B 1 269 ? -2.027  63.930 78.225  1.00 9.99   ? 269 LEU B CD1   1 
ATOM   5835  C CD2   . LEU B 1 269 ? -2.532  61.492 78.651  1.00 13.27  ? 269 LEU B CD2   1 
ATOM   5836  N N     . LEU B 1 270 ? 2.648   60.126 77.158  1.00 9.69   ? 270 LEU B N     1 
ATOM   5837  C CA    . LEU B 1 270 ? 3.460   59.586 76.077  1.00 10.36  ? 270 LEU B CA    1 
ATOM   5838  C C     . LEU B 1 270 ? 3.610   58.097 76.166  1.00 9.83   ? 270 LEU B C     1 
ATOM   5839  O O     . LEU B 1 270 ? 3.287   57.476 77.206  1.00 8.87   ? 270 LEU B O     1 
ATOM   5840  C CB    . LEU B 1 270 ? 4.864   60.223 76.159  1.00 6.26   ? 270 LEU B CB    1 
ATOM   5841  C CG    . LEU B 1 270 ? 4.862   61.733 76.129  1.00 8.52   ? 270 LEU B CG    1 
ATOM   5842  C CD1   . LEU B 1 270 ? 6.317   62.233 76.163  1.00 9.68   ? 270 LEU B CD1   1 
ATOM   5843  C CD2   . LEU B 1 270 ? 4.161   62.292 74.894  1.00 5.70   ? 270 LEU B CD2   1 
ATOM   5844  N N     . ASN B 1 271 ? 4.226   57.574 75.108  1.00 6.25   ? 271 ASN B N     1 
ATOM   5845  C CA    . ASN B 1 271 ? 4.557   56.155 75.111  1.00 4.94   ? 271 ASN B CA    1 
ATOM   5846  C C     . ASN B 1 271 ? 6.037   55.952 75.459  1.00 6.46   ? 271 ASN B C     1 
ATOM   5847  O O     . ASN B 1 271 ? 6.445   54.812 75.665  1.00 10.42  ? 271 ASN B O     1 
ATOM   5848  C CB    . ASN B 1 271 ? 4.246   55.547 73.746  1.00 5.23   ? 271 ASN B CB    1 
ATOM   5849  C CG    . ASN B 1 271 ? 2.777   55.756 73.393  1.00 16.20  ? 271 ASN B CG    1 
ATOM   5850  O OD1   . ASN B 1 271 ? 2.475   56.475 72.450  1.00 9.00   ? 271 ASN B OD1   1 
ATOM   5851  N ND2   . ASN B 1 271 ? 1.887   55.169 74.173  1.00 10.05  ? 271 ASN B ND2   1 
ATOM   5852  N N     . ILE B 1 272 ? 6.802   57.031 75.421  1.00 7.06   ? 272 ILE B N     1 
ATOM   5853  C CA    . ILE B 1 272 ? 8.223   56.901 75.706  1.00 9.21   ? 272 ILE B CA    1 
ATOM   5854  C C     . ILE B 1 272 ? 8.692   58.289 76.069  1.00 10.22  ? 272 ILE B C     1 
ATOM   5855  O O     . ILE B 1 272 ? 8.012   59.238 75.633  1.00 9.26   ? 272 ILE B O     1 
ATOM   5856  C CB    . ILE B 1 272 ? 9.048   56.306 74.544  1.00 13.86  ? 272 ILE B CB    1 
ATOM   5857  C CG1   . ILE B 1 272 ? 10.458  55.912 75.046  1.00 12.22  ? 272 ILE B CG1   1 
ATOM   5858  C CG2   . ILE B 1 272 ? 9.137   57.281 73.374  1.00 7.87   ? 272 ILE B CG2   1 
ATOM   5859  C CD1   . ILE B 1 272 ? 10.428  54.730 76.025  1.00 11.74  ? 272 ILE B CD1   1 
ATOM   5860  N N     . GLY B 1 273 ? 9.766   58.458 76.838  1.00 7.65   ? 273 GLY B N     1 
ATOM   5861  C CA    . GLY B 1 273 ? 10.183  59.851 77.059  1.00 5.40   ? 273 GLY B CA    1 
ATOM   5862  C C     . GLY B 1 273 ? 10.435  60.169 78.538  1.00 11.53  ? 273 GLY B C     1 
ATOM   5863  O O     . GLY B 1 273 ? 9.764   59.655 79.416  1.00 12.11  ? 273 GLY B O     1 
ATOM   5864  N N     . GLY B 1 274 ? 11.408  61.034 78.753  1.00 10.91  ? 274 GLY B N     1 
ATOM   5865  C CA    . GLY B 1 274 ? 11.821  61.386 80.116  1.00 10.36  ? 274 GLY B CA    1 
ATOM   5866  C C     . GLY B 1 274 ? 12.461  62.764 80.053  1.00 12.39  ? 274 GLY B C     1 
ATOM   5867  O O     . GLY B 1 274 ? 12.699  63.305 78.972  1.00 11.44  ? 274 GLY B O     1 
ATOM   5868  N N     . LEU B 1 275 ? 12.681  63.340 81.244  1.00 9.00   ? 275 LEU B N     1 
ATOM   5869  C CA    . LEU B 1 275 ? 13.217  64.681 81.332  1.00 8.68   ? 275 LEU B CA    1 
ATOM   5870  C C     . LEU B 1 275 ? 13.937  64.919 82.681  1.00 13.67  ? 275 LEU B C     1 
ATOM   5871  O O     . LEU B 1 275 ? 13.514  64.423 83.725  1.00 10.55  ? 275 LEU B O     1 
ATOM   5872  C CB    . LEU B 1 275 ? 12.087  65.703 81.256  1.00 7.51   ? 275 LEU B CB    1 
ATOM   5873  C CG    . LEU B 1 275 ? 12.491  67.172 81.156  1.00 13.17  ? 275 LEU B CG    1 
ATOM   5874  C CD1   . LEU B 1 275 ? 13.262  67.452 79.865  1.00 12.35  ? 275 LEU B CD1   1 
ATOM   5875  C CD2   . LEU B 1 275 ? 11.277  68.079 81.218  1.00 14.13  ? 275 LEU B CD2   1 
ATOM   5876  N N     . VAL B 1 276 ? 15.000  65.683 82.576  1.00 13.24  ? 276 VAL B N     1 
ATOM   5877  C CA    . VAL B 1 276 ? 15.727  66.219 83.714  1.00 10.00  ? 276 VAL B CA    1 
ATOM   5878  C C     . VAL B 1 276 ? 15.588  67.723 83.559  1.00 11.32  ? 276 VAL B C     1 
ATOM   5879  O O     . VAL B 1 276 ? 15.917  68.242 82.477  1.00 13.57  ? 276 VAL B O     1 
ATOM   5880  C CB    . VAL B 1 276 ? 17.215  65.881 83.830  1.00 17.61  ? 276 VAL B CB    1 
ATOM   5881  C CG1   . VAL B 1 276 ? 17.828  66.634 85.021  1.00 13.90  ? 276 VAL B CG1   1 
ATOM   5882  C CG2   . VAL B 1 276 ? 17.408  64.382 83.955  1.00 11.91  ? 276 VAL B CG2   1 
ATOM   5883  N N     . ALA B 1 277 ? 15.121  68.421 84.592  1.00 9.73   ? 277 ALA B N     1 
ATOM   5884  C CA    . ALA B 1 277 ? 15.095  69.873 84.518  1.00 12.78  ? 277 ALA B CA    1 
ATOM   5885  C C     . ALA B 1 277 ? 15.767  70.342 85.823  1.00 15.77  ? 277 ALA B C     1 
ATOM   5886  O O     . ALA B 1 277 ? 15.569  69.730 86.865  1.00 12.27  ? 277 ALA B O     1 
ATOM   5887  C CB    . ALA B 1 277 ? 13.710  70.463 84.395  1.00 10.03  ? 277 ALA B CB    1 
ATOM   5888  N N     . ILE B 1 278 ? 16.576  71.368 85.715  1.00 15.47  ? 278 ILE B N     1 
ATOM   5889  C CA    . ILE B 1 278 ? 17.335  71.884 86.852  1.00 16.82  ? 278 ILE B CA    1 
ATOM   5890  C C     . ILE B 1 278 ? 16.966  73.356 86.950  1.00 17.88  ? 278 ILE B C     1 
ATOM   5891  O O     . ILE B 1 278 ? 16.947  74.055 85.951  1.00 17.14  ? 278 ILE B O     1 
ATOM   5892  C CB    . ILE B 1 278 ? 18.837  71.680 86.682  1.00 19.45  ? 278 ILE B CB    1 
ATOM   5893  C CG1   . ILE B 1 278 ? 19.149  70.176 86.770  1.00 18.45  ? 278 ILE B CG1   1 
ATOM   5894  C CG2   . ILE B 1 278 ? 19.603  72.454 87.751  1.00 20.29  ? 278 ILE B CG2   1 
ATOM   5895  C CD1   . ILE B 1 278 ? 20.284  69.760 85.868  1.00 22.36  ? 278 ILE B CD1   1 
ATOM   5896  N N     . ARG B 1 279 ? 16.592  73.770 88.153  1.00 15.22  ? 279 ARG B N     1 
ATOM   5897  C CA    . ARG B 1 279 ? 16.111  75.138 88.347  1.00 15.65  ? 279 ARG B CA    1 
ATOM   5898  C C     . ARG B 1 279 ? 17.143  76.196 88.007  1.00 19.23  ? 279 ARG B C     1 
ATOM   5899  O O     . ARG B 1 279 ? 16.793  77.062 87.170  1.00 17.43  ? 279 ARG B O     1 
ATOM   5900  C CB    . ARG B 1 279 ? 15.642  75.267 89.799  1.00 18.28  ? 279 ARG B CB    1 
ATOM   5901  C CG    . ARG B 1 279 ? 14.991  76.624 90.146  1.00 22.89  ? 279 ARG B CG    1 
ATOM   5902  C CD    . ARG B 1 279 ? 14.518  76.448 91.599  1.00 31.21  ? 279 ARG B CD    1 
ATOM   5903  N NE    . ARG B 1 279 ? 13.792  77.557 92.156  1.00 35.35  ? 279 ARG B NE    1 
ATOM   5904  C CZ    . ARG B 1 279 ? 13.154  77.606 93.323  1.00 42.23  ? 279 ARG B CZ    1 
ATOM   5905  N NH1   . ARG B 1 279 ? 13.125  76.549 94.129  1.00 32.41  ? 279 ARG B NH1   1 
ATOM   5906  N NH2   . ARG B 1 279 ? 12.538  78.723 93.710  1.00 41.24  ? 279 ARG B NH2   1 
ATOM   5907  N N     . ASP B 1 280 ? 18.303  76.190 88.641  1.00 18.87  ? 280 ASP B N     1 
ATOM   5908  C CA    . ASP B 1 280 ? 19.275  77.245 88.386  1.00 22.07  ? 280 ASP B CA    1 
ATOM   5909  C C     . ASP B 1 280 ? 20.710  76.850 88.727  1.00 22.90  ? 280 ASP B C     1 
ATOM   5910  O O     . ASP B 1 280 ? 21.585  77.708 88.566  1.00 25.46  ? 280 ASP B O     1 
ATOM   5911  C CB    . ASP B 1 280 ? 18.987  78.528 89.163  1.00 28.72  ? 280 ASP B CB    1 
ATOM   5912  C CG    . ASP B 1 280 ? 18.858  78.310 90.652  1.00 31.91  ? 280 ASP B CG    1 
ATOM   5913  O OD1   . ASP B 1 280 ? 19.393  77.345 91.226  1.00 34.43  ? 280 ASP B OD1   1 
ATOM   5914  O OD2   . ASP B 1 280 ? 18.136  79.118 91.275  1.00 45.54  ? 280 ASP B OD2   1 
ATOM   5915  N N     . ASN B 1 281 ? 20.952  75.615 89.153  1.00 19.79  ? 281 ASN B N     1 
ATOM   5916  C CA    . ASN B 1 281 ? 22.349  75.264 89.427  1.00 21.86  ? 281 ASN B CA    1 
ATOM   5917  C C     . ASN B 1 281 ? 23.041  74.821 88.129  1.00 22.51  ? 281 ASN B C     1 
ATOM   5918  O O     . ASN B 1 281 ? 22.977  73.666 87.725  1.00 20.33  ? 281 ASN B O     1 
ATOM   5919  C CB    . ASN B 1 281 ? 22.387  74.192 90.496  1.00 23.81  ? 281 ASN B CB    1 
ATOM   5920  C CG    . ASN B 1 281 ? 23.792  73.984 91.053  1.00 29.01  ? 281 ASN B CG    1 
ATOM   5921  O OD1   . ASN B 1 281 ? 24.762  73.919 90.296  1.00 25.03  ? 281 ASN B OD1   1 
ATOM   5922  N ND2   . ASN B 1 281 ? 23.848  73.837 92.383  1.00 24.20  ? 281 ASN B ND2   1 
ATOM   5923  N N     . GLU B 1 282 ? 23.771  75.732 87.505  1.00 22.16  ? 282 GLU B N     1 
ATOM   5924  C CA    . GLU B 1 282 ? 24.501  75.466 86.280  1.00 25.05  ? 282 GLU B CA    1 
ATOM   5925  C C     . GLU B 1 282 ? 25.567  74.398 86.370  1.00 23.40  ? 282 GLU B C     1 
ATOM   5926  O O     . GLU B 1 282 ? 25.806  73.642 85.415  1.00 23.18  ? 282 GLU B O     1 
ATOM   5927  C CB    . GLU B 1 282 ? 25.171  76.760 85.772  1.00 32.38  ? 282 GLU B CB    1 
ATOM   5928  C CG    . GLU B 1 282 ? 25.687  76.597 84.344  1.00 48.95  ? 282 GLU B CG    1 
ATOM   5929  C CD    . GLU B 1 282 ? 26.131  77.930 83.771  1.00 58.01  ? 282 GLU B CD    1 
ATOM   5930  O OE1   . GLU B 1 282 ? 27.058  78.506 84.380  1.00 64.94  ? 282 GLU B OE1   1 
ATOM   5931  O OE2   . GLU B 1 282 ? 25.562  78.377 82.759  1.00 66.09  ? 282 GLU B OE2   1 
ATOM   5932  N N     . GLU B 1 283 ? 26.208  74.269 87.536  1.00 25.06  ? 283 GLU B N     1 
ATOM   5933  C CA    . GLU B 1 283 ? 27.245  73.273 87.717  1.00 22.90  ? 283 GLU B CA    1 
ATOM   5934  C C     . GLU B 1 283 ? 26.658  71.873 87.690  1.00 22.76  ? 283 GLU B C     1 
ATOM   5935  O O     . GLU B 1 283 ? 27.219  70.930 87.127  1.00 20.63  ? 283 GLU B O     1 
ATOM   5936  C CB    . GLU B 1 283 ? 27.987  73.580 89.024  1.00 31.09  ? 283 GLU B CB    1 
ATOM   5937  C CG    . GLU B 1 283 ? 29.116  72.618 89.354  1.00 43.76  ? 283 GLU B CG    1 
ATOM   5938  C CD    . GLU B 1 283 ? 29.926  73.018 90.578  1.00 54.01  ? 283 GLU B CD    1 
ATOM   5939  O OE1   . GLU B 1 283 ? 29.794  74.166 91.068  1.00 55.62  ? 283 GLU B OE1   1 
ATOM   5940  O OE2   . GLU B 1 283 ? 30.707  72.163 91.050  1.00 58.11  ? 283 GLU B OE2   1 
ATOM   5941  N N     . ILE B 1 284 ? 25.482  71.698 88.326  1.00 20.79  ? 284 ILE B N     1 
ATOM   5942  C CA    . ILE B 1 284 ? 24.866  70.377 88.339  1.00 18.25  ? 284 ILE B CA    1 
ATOM   5943  C C     . ILE B 1 284 ? 24.466  70.039 86.878  1.00 12.95  ? 284 ILE B C     1 
ATOM   5944  O O     . ILE B 1 284 ? 24.624  68.909 86.478  1.00 15.81  ? 284 ILE B O     1 
ATOM   5945  C CB    . ILE B 1 284 ? 23.621  70.370 89.232  1.00 21.16  ? 284 ILE B CB    1 
ATOM   5946  C CG1   . ILE B 1 284 ? 23.977  70.579 90.723  1.00 28.00  ? 284 ILE B CG1   1 
ATOM   5947  C CG2   . ILE B 1 284 ? 22.808  69.093 89.049  1.00 12.83  ? 284 ILE B CG2   1 
ATOM   5948  C CD1   . ILE B 1 284 ? 24.757  69.440 91.317  1.00 35.41  ? 284 ILE B CD1   1 
ATOM   5949  N N     . PHE B 1 285 ? 23.928  71.047 86.196  1.00 17.61  ? 285 PHE B N     1 
ATOM   5950  C CA    . PHE B 1 285 ? 23.535  70.908 84.803  1.00 19.98  ? 285 PHE B CA    1 
ATOM   5951  C C     . PHE B 1 285 ? 24.692  70.420 83.941  1.00 21.63  ? 285 PHE B C     1 
ATOM   5952  O O     . PHE B 1 285 ? 24.585  69.435 83.197  1.00 19.94  ? 285 PHE B O     1 
ATOM   5953  C CB    . PHE B 1 285 ? 23.078  72.266 84.293  1.00 18.59  ? 285 PHE B CB    1 
ATOM   5954  C CG    . PHE B 1 285 ? 22.744  72.330 82.822  1.00 19.92  ? 285 PHE B CG    1 
ATOM   5955  C CD1   . PHE B 1 285 ? 21.775  71.514 82.266  1.00 19.53  ? 285 PHE B CD1   1 
ATOM   5956  C CD2   . PHE B 1 285 ? 23.427  73.220 82.006  1.00 19.19  ? 285 PHE B CD2   1 
ATOM   5957  C CE1   . PHE B 1 285 ? 21.484  71.619 80.892  1.00 17.95  ? 285 PHE B CE1   1 
ATOM   5958  C CE2   . PHE B 1 285 ? 23.133  73.331 80.660  1.00 23.43  ? 285 PHE B CE2   1 
ATOM   5959  C CZ    . PHE B 1 285 ? 22.148  72.531 80.114  1.00 19.54  ? 285 PHE B CZ    1 
ATOM   5960  N N     . THR B 1 286 ? 25.823  71.120 84.091  1.00 20.24  ? 286 THR B N     1 
ATOM   5961  C CA    . THR B 1 286 ? 27.029  70.791 83.320  1.00 19.54  ? 286 THR B CA    1 
ATOM   5962  C C     . THR B 1 286 ? 27.527  69.407 83.609  1.00 18.15  ? 286 THR B C     1 
ATOM   5963  O O     . THR B 1 286 ? 27.785  68.599 82.679  1.00 20.74  ? 286 THR B O     1 
ATOM   5964  C CB    . THR B 1 286 ? 28.132  71.822 83.649  1.00 22.58  ? 286 THR B CB    1 
ATOM   5965  O OG1   . THR B 1 286 ? 27.672  73.086 83.147  1.00 25.81  ? 286 THR B OG1   1 
ATOM   5966  C CG2   . THR B 1 286 ? 29.439  71.425 83.000  1.00 28.18  ? 286 THR B CG2   1 
ATOM   5967  N N     . LEU B 1 287 ? 27.516  69.009 84.905  1.00 18.65  ? 287 LEU B N     1 
ATOM   5968  C CA    . LEU B 1 287 ? 27.933  67.625 85.187  1.00 15.78  ? 287 LEU B CA    1 
ATOM   5969  C C     . LEU B 1 287 ? 26.916  66.627 84.671  1.00 16.39  ? 287 LEU B C     1 
ATOM   5970  O O     . LEU B 1 287 ? 27.270  65.506 84.279  1.00 15.48  ? 287 LEU B O     1 
ATOM   5971  C CB    . LEU B 1 287 ? 28.123  67.418 86.694  1.00 21.42  ? 287 LEU B CB    1 
ATOM   5972  C CG    . LEU B 1 287 ? 29.290  68.236 87.295  1.00 32.23  ? 287 LEU B CG    1 
ATOM   5973  C CD1   . LEU B 1 287 ? 29.198  68.253 88.816  1.00 28.17  ? 287 LEU B CD1   1 
ATOM   5974  C CD2   . LEU B 1 287 ? 30.623  67.663 86.856  1.00 24.97  ? 287 LEU B CD2   1 
ATOM   5975  N N     . ALA B 1 288 ? 25.600  66.998 84.797  1.00 15.92  ? 288 ALA B N     1 
ATOM   5976  C CA    . ALA B 1 288 ? 24.595  66.034 84.331  1.00 17.65  ? 288 ALA B CA    1 
ATOM   5977  C C     . ALA B 1 288 ? 24.717  65.879 82.804  1.00 15.22  ? 288 ALA B C     1 
ATOM   5978  O O     . ALA B 1 288 ? 24.552  64.776 82.291  1.00 15.56  ? 288 ALA B O     1 
ATOM   5979  C CB    . ALA B 1 288 ? 23.208  66.473 84.781  1.00 11.29  ? 288 ALA B CB    1 
ATOM   5980  N N     . ARG B 1 289 ? 24.998  66.986 82.095  1.00 13.94  ? 289 ARG B N     1 
ATOM   5981  C CA    . ARG B 1 289 ? 25.215  66.889 80.646  1.00 17.34  ? 289 ARG B CA    1 
ATOM   5982  C C     . ARG B 1 289 ? 26.391  66.001 80.259  1.00 21.31  ? 289 ARG B C     1 
ATOM   5983  O O     . ARG B 1 289 ? 26.311  65.284 79.239  1.00 18.65  ? 289 ARG B O     1 
ATOM   5984  C CB    . ARG B 1 289 ? 25.459  68.278 80.067  1.00 16.76  ? 289 ARG B CB    1 
ATOM   5985  C CG    . ARG B 1 289 ? 24.185  68.915 79.543  1.00 17.33  ? 289 ARG B CG    1 
ATOM   5986  C CD    . ARG B 1 289 ? 24.511  70.236 78.870  1.00 21.35  ? 289 ARG B CD    1 
ATOM   5987  N NE    . ARG B 1 289 ? 23.408  70.645 77.998  1.00 21.92  ? 289 ARG B NE    1 
ATOM   5988  C CZ    . ARG B 1 289 ? 23.479  71.585 77.070  1.00 29.34  ? 289 ARG B CZ    1 
ATOM   5989  N NH1   . ARG B 1 289 ? 24.608  72.241 76.848  1.00 22.68  ? 289 ARG B NH1   1 
ATOM   5990  N NH2   . ARG B 1 289 ? 22.381  71.873 76.376  1.00 20.33  ? 289 ARG B NH2   1 
ATOM   5991  N N     . GLN B 1 290 ? 27.483  66.018 81.044  1.00 19.31  ? 290 GLN B N     1 
ATOM   5992  C CA    . GLN B 1 290 ? 28.617  65.139 80.763  1.00 18.85  ? 290 GLN B CA    1 
ATOM   5993  C C     . GLN B 1 290 ? 28.253  63.679 80.939  1.00 17.53  ? 290 GLN B C     1 
ATOM   5994  O O     . GLN B 1 290 ? 28.783  62.815 80.260  1.00 20.43  ? 290 GLN B O     1 
ATOM   5995  C CB    . GLN B 1 290 ? 29.802  65.413 81.709  1.00 18.36  ? 290 GLN B CB    1 
ATOM   5996  C CG    . GLN B 1 290 ? 30.268  66.856 81.500  1.00 34.66  ? 290 GLN B CG    1 
ATOM   5997  C CD    . GLN B 1 290 ? 31.368  67.254 82.469  1.00 43.75  ? 290 GLN B CD    1 
ATOM   5998  O OE1   . GLN B 1 290 ? 31.883  66.424 83.222  1.00 43.51  ? 290 GLN B OE1   1 
ATOM   5999  N NE2   . GLN B 1 290 ? 31.703  68.542 82.385  1.00 38.37  ? 290 GLN B NE2   1 
ATOM   6000  N N     . ARG B 1 291 ? 27.361  63.376 81.885  1.00 15.47  ? 291 ARG B N     1 
ATOM   6001  C CA    . ARG B 1 291 ? 26.980  61.979 82.038  1.00 16.40  ? 291 ARG B CA    1 
ATOM   6002  C C     . ARG B 1 291 ? 25.940  61.587 80.970  1.00 13.86  ? 291 ARG B C     1 
ATOM   6003  O O     . ARG B 1 291 ? 25.862  60.442 80.579  1.00 14.11  ? 291 ARG B O     1 
ATOM   6004  C CB    . ARG B 1 291 ? 26.389  61.753 83.448  1.00 17.30  ? 291 ARG B CB    1 
ATOM   6005  C CG    . ARG B 1 291 ? 26.205  60.271 83.696  1.00 21.16  ? 291 ARG B CG    1 
ATOM   6006  C CD    . ARG B 1 291 ? 26.031  59.991 85.193  1.00 18.64  ? 291 ARG B CD    1 
ATOM   6007  N NE    . ARG B 1 291 ? 25.569  58.614 85.343  1.00 16.21  ? 291 ARG B NE    1 
ATOM   6008  C CZ    . ARG B 1 291 ? 26.354  57.573 85.536  1.00 24.40  ? 291 ARG B CZ    1 
ATOM   6009  N NH1   . ARG B 1 291 ? 27.666  57.729 85.568  1.00 23.71  ? 291 ARG B NH1   1 
ATOM   6010  N NH2   . ARG B 1 291 ? 25.791  56.397 85.687  1.00 16.35  ? 291 ARG B NH2   1 
ATOM   6011  N N     . CYS B 1 292 ? 25.068  62.500 80.586  1.00 14.14  ? 292 CYS B N     1 
ATOM   6012  C CA    . CYS B 1 292 ? 24.060  62.253 79.559  1.00 16.43  ? 292 CYS B CA    1 
ATOM   6013  C C     . CYS B 1 292 ? 24.675  61.691 78.257  1.00 14.22  ? 292 CYS B C     1 
ATOM   6014  O O     . CYS B 1 292 ? 24.174  60.711 77.685  1.00 15.09  ? 292 CYS B O     1 
ATOM   6015  C CB    . CYS B 1 292 ? 23.349  63.580 79.209  1.00 14.41  ? 292 CYS B CB    1 
ATOM   6016  S SG    . CYS B 1 292 ? 22.052  63.331 77.935  1.00 17.46  ? 292 CYS B SG    1 
ATOM   6017  N N     . VAL B 1 293 ? 25.781  62.279 77.794  1.00 15.83  ? 293 VAL B N     1 
ATOM   6018  C CA    . VAL B 1 293 ? 26.427  61.856 76.557  1.00 13.60  ? 293 VAL B CA    1 
ATOM   6019  C C     . VAL B 1 293 ? 26.692  60.378 76.436  1.00 14.89  ? 293 VAL B C     1 
ATOM   6020  O O     . VAL B 1 293 ? 26.122  59.723 75.546  1.00 16.81  ? 293 VAL B O     1 
ATOM   6021  C CB    . VAL B 1 293 ? 27.652  62.716 76.222  1.00 22.15  ? 293 VAL B CB    1 
ATOM   6022  C CG1   . VAL B 1 293 ? 28.332  62.234 74.943  1.00 19.42  ? 293 VAL B CG1   1 
ATOM   6023  C CG2   . VAL B 1 293 ? 27.231  64.178 76.039  1.00 12.29  ? 293 VAL B CG2   1 
ATOM   6024  N N     . PRO B 1 294 ? 27.450  59.728 77.317  1.00 15.83  ? 294 PRO B N     1 
ATOM   6025  C CA    . PRO B 1 294 ? 27.708  58.310 77.210  1.00 15.54  ? 294 PRO B CA    1 
ATOM   6026  C C     . PRO B 1 294 ? 26.499  57.464 77.532  1.00 16.13  ? 294 PRO B C     1 
ATOM   6027  O O     . PRO B 1 294 ? 26.429  56.318 77.029  1.00 14.83  ? 294 PRO B O     1 
ATOM   6028  C CB    . PRO B 1 294 ? 28.823  58.017 78.226  1.00 18.88  ? 294 PRO B CB    1 
ATOM   6029  C CG    . PRO B 1 294 ? 28.791  59.191 79.154  1.00 17.69  ? 294 PRO B CG    1 
ATOM   6030  C CD    . PRO B 1 294 ? 28.250  60.379 78.395  1.00 16.43  ? 294 PRO B CD    1 
ATOM   6031  N N     . MET B 1 295 ? 25.629  57.909 78.436  1.00 16.80  ? 295 MET B N     1 
ATOM   6032  C CA    . MET B 1 295 ? 24.543  57.013 78.847  1.00 17.07  ? 295 MET B CA    1 
ATOM   6033  C C     . MET B 1 295 ? 23.262  57.076 77.997  1.00 14.86  ? 295 MET B C     1 
ATOM   6034  O O     . MET B 1 295 ? 22.630  56.041 77.823  1.00 16.70  ? 295 MET B O     1 
ATOM   6035  C CB    . MET B 1 295 ? 24.129  57.379 80.292  1.00 17.41  ? 295 MET B CB    1 
ATOM   6036  C CG    . MET B 1 295 ? 25.226  57.129 81.323  1.00 17.93  ? 295 MET B CG    1 
ATOM   6037  S SD    . MET B 1 295 ? 25.563  55.360 81.469  1.00 22.47  ? 295 MET B SD    1 
ATOM   6038  C CE    . MET B 1 295 ? 27.248  55.486 82.140  1.00 26.57  ? 295 MET B CE    1 
ATOM   6039  N N     . GLU B 1 296 ? 22.869  58.242 77.556  1.00 11.86  ? 296 GLU B N     1 
ATOM   6040  C CA    . GLU B 1 296 ? 21.615  58.493 76.877  1.00 16.31  ? 296 GLU B CA    1 
ATOM   6041  C C     . GLU B 1 296 ? 21.738  58.940 75.422  1.00 14.80  ? 296 GLU B C     1 
ATOM   6042  O O     . GLU B 1 296 ? 21.093  58.299 74.575  1.00 15.46  ? 296 GLU B O     1 
ATOM   6043  C CB    . GLU B 1 296 ? 20.865  59.603 77.666  1.00 15.05  ? 296 GLU B CB    1 
ATOM   6044  C CG    . GLU B 1 296 ? 20.403  59.086 79.041  1.00 20.78  ? 296 GLU B CG    1 
ATOM   6045  C CD    . GLU B 1 296 ? 19.375  57.978 78.981  1.00 24.62  ? 296 GLU B CD    1 
ATOM   6046  O OE1   . GLU B 1 296 ? 18.341  58.114 78.309  1.00 22.36  ? 296 GLU B OE1   1 
ATOM   6047  O OE2   . GLU B 1 296 ? 19.513  56.889 79.573  1.00 35.23  ? 296 GLU B OE2   1 
ATOM   6048  N N     . GLY B 1 297 ? 22.555  59.967 75.183  1.00 13.08  ? 297 GLY B N     1 
ATOM   6049  C CA    . GLY B 1 297 ? 22.750  60.474 73.828  1.00 14.48  ? 297 GLY B CA    1 
ATOM   6050  C C     . GLY B 1 297 ? 23.232  61.924 73.913  1.00 16.14  ? 297 GLY B C     1 
ATOM   6051  O O     . GLY B 1 297 ? 23.486  62.469 74.995  1.00 16.48  ? 297 GLY B O     1 
ATOM   6052  N N     . PHE B 1 298 ? 23.375  62.558 72.759  1.00 13.10  ? 298 PHE B N     1 
ATOM   6053  C CA    . PHE B 1 298 ? 23.823  63.943 72.722  1.00 12.77  ? 298 PHE B CA    1 
ATOM   6054  C C     . PHE B 1 298 ? 22.796  64.748 73.518  1.00 16.05  ? 298 PHE B C     1 
ATOM   6055  O O     . PHE B 1 298 ? 21.608  64.401 73.619  1.00 16.56  ? 298 PHE B O     1 
ATOM   6056  C CB    . PHE B 1 298 ? 24.041  64.419 71.291  1.00 15.68  ? 298 PHE B CB    1 
ATOM   6057  C CG    . PHE B 1 298 ? 24.536  65.837 71.295  1.00 15.99  ? 298 PHE B CG    1 
ATOM   6058  C CD1   . PHE B 1 298 ? 25.763  66.158 71.879  1.00 19.59  ? 298 PHE B CD1   1 
ATOM   6059  C CD2   . PHE B 1 298 ? 23.746  66.835 70.769  1.00 10.90  ? 298 PHE B CD2   1 
ATOM   6060  C CE1   . PHE B 1 298 ? 26.174  67.481 71.882  1.00 16.38  ? 298 PHE B CE1   1 
ATOM   6061  C CE2   . PHE B 1 298 ? 24.158  68.152 70.784  1.00 19.29  ? 298 PHE B CE2   1 
ATOM   6062  C CZ    . PHE B 1 298 ? 25.380  68.468 71.356  1.00 17.79  ? 298 PHE B CZ    1 
ATOM   6063  N N     . VAL B 1 299 ? 23.211  65.866 74.066  1.00 12.59  ? 299 VAL B N     1 
ATOM   6064  C CA    . VAL B 1 299 ? 22.388  66.598 75.027  1.00 15.43  ? 299 VAL B CA    1 
ATOM   6065  C C     . VAL B 1 299 ? 21.162  67.264 74.446  1.00 18.15  ? 299 VAL B C     1 
ATOM   6066  O O     . VAL B 1 299 ? 20.355  67.767 75.261  1.00 15.17  ? 299 VAL B O     1 
ATOM   6067  C CB    . VAL B 1 299 ? 23.283  67.611 75.800  1.00 13.41  ? 299 VAL B CB    1 
ATOM   6068  C CG1   . VAL B 1 299 ? 24.477  66.868 76.389  1.00 18.25  ? 299 VAL B CG1   1 
ATOM   6069  C CG2   . VAL B 1 299 ? 23.765  68.732 74.885  1.00 17.65  ? 299 VAL B CG2   1 
ATOM   6070  N N     . THR B 1 300 ? 21.009  67.369 73.119  1.00 15.42  ? 300 THR B N     1 
ATOM   6071  C CA    . THR B 1 300 ? 19.802  68.020 72.583  1.00 15.22  ? 300 THR B CA    1 
ATOM   6072  C C     . THR B 1 300 ? 18.803  66.966 72.106  1.00 14.12  ? 300 THR B C     1 
ATOM   6073  O O     . THR B 1 300 ? 17.789  67.343 71.506  1.00 15.50  ? 300 THR B O     1 
ATOM   6074  C CB    . THR B 1 300 ? 20.063  69.022 71.445  1.00 15.02  ? 300 THR B CB    1 
ATOM   6075  O OG1   . THR B 1 300 ? 20.803  68.318 70.412  1.00 13.64  ? 300 THR B OG1   1 
ATOM   6076  C CG2   . THR B 1 300 ? 20.959  70.172 71.905  1.00 16.28  ? 300 THR B CG2   1 
ATOM   6077  N N     . TYR B 1 301 ? 18.968  65.678 72.432  1.00 12.33  ? 301 TYR B N     1 
ATOM   6078  C CA    . TYR B 1 301 ? 17.919  64.720 72.157  1.00 13.67  ? 301 TYR B CA    1 
ATOM   6079  C C     . TYR B 1 301 ? 17.825  63.700 73.289  1.00 15.21  ? 301 TYR B C     1 
ATOM   6080  O O     . TYR B 1 301 ? 16.778  63.104 73.490  1.00 13.79  ? 301 TYR B O     1 
ATOM   6081  C CB    . TYR B 1 301 ? 17.946  64.010 70.808  1.00 11.20  ? 301 TYR B CB    1 
ATOM   6082  C CG    . TYR B 1 301 ? 19.149  63.114 70.635  1.00 13.42  ? 301 TYR B CG    1 
ATOM   6083  C CD1   . TYR B 1 301 ? 20.328  63.596 70.086  1.00 16.08  ? 301 TYR B CD1   1 
ATOM   6084  C CD2   . TYR B 1 301 ? 19.066  61.778 71.017  1.00 10.07  ? 301 TYR B CD2   1 
ATOM   6085  C CE1   . TYR B 1 301 ? 21.417  62.751 69.934  1.00 13.85  ? 301 TYR B CE1   1 
ATOM   6086  C CE2   . TYR B 1 301 ? 20.153  60.938 70.883  1.00 13.77  ? 301 TYR B CE2   1 
ATOM   6087  C CZ    . TYR B 1 301 ? 21.332  61.450 70.352  1.00 14.35  ? 301 TYR B CZ    1 
ATOM   6088  O OH    . TYR B 1 301 ? 22.416  60.604 70.207  1.00 15.60  ? 301 TYR B OH    1 
ATOM   6089  N N     . GLY B 1 302 ? 18.916  63.452 73.995  1.00 15.94  ? 302 GLY B N     1 
ATOM   6090  C CA    . GLY B 1 302 ? 18.907  62.598 75.162  1.00 15.51  ? 302 GLY B CA    1 
ATOM   6091  C C     . GLY B 1 302 ? 18.313  61.228 75.010  1.00 15.03  ? 302 GLY B C     1 
ATOM   6092  O O     . GLY B 1 302 ? 17.618  60.714 75.907  1.00 15.80  ? 302 GLY B O     1 
ATOM   6093  N N     . GLY B 1 303 ? 18.618  60.512 73.915  1.00 7.87   ? 303 GLY B N     1 
ATOM   6094  C CA    . GLY B 1 303 ? 18.092  59.167 73.763  1.00 6.05   ? 303 GLY B CA    1 
ATOM   6095  C C     . GLY B 1 303 ? 16.641  59.197 73.254  1.00 9.44   ? 303 GLY B C     1 
ATOM   6096  O O     . GLY B 1 303 ? 16.057  58.125 73.228  1.00 10.25  ? 303 GLY B O     1 
ATOM   6097  N N     . LEU B 1 304 ? 16.133  60.305 72.759  1.00 8.59   ? 304 LEU B N     1 
ATOM   6098  C CA    . LEU B 1 304 ? 14.791  60.351 72.159  1.00 9.16   ? 304 LEU B CA    1 
ATOM   6099  C C     . LEU B 1 304 ? 14.843  60.771 70.663  1.00 13.56  ? 304 LEU B C     1 
ATOM   6100  O O     . LEU B 1 304 ? 15.595  61.705 70.344  1.00 11.37  ? 304 LEU B O     1 
ATOM   6101  C CB    . LEU B 1 304 ? 14.034  61.533 72.796  1.00 9.20   ? 304 LEU B CB    1 
ATOM   6102  C CG    . LEU B 1 304 ? 13.479  61.194 74.217  1.00 9.52   ? 304 LEU B CG    1 
ATOM   6103  C CD1   . LEU B 1 304 ? 12.742  62.364 74.772  1.00 10.93  ? 304 LEU B CD1   1 
ATOM   6104  C CD2   . LEU B 1 304 ? 12.658  59.913 74.192  1.00 10.22  ? 304 LEU B CD2   1 
ATOM   6105  N N     . ALA B 1 305 ? 13.934  60.204 69.858  1.00 11.64  ? 305 ALA B N     1 
ATOM   6106  C CA    . ALA B 1 305 ? 13.763  60.708 68.488  1.00 10.75  ? 305 ALA B CA    1 
ATOM   6107  C C     . ALA B 1 305 ? 13.221  62.114 68.567  1.00 9.45   ? 305 ALA B C     1 
ATOM   6108  O O     . ALA B 1 305 ? 12.515  62.483 69.545  1.00 8.13   ? 305 ALA B O     1 
ATOM   6109  C CB    . ALA B 1 305 ? 12.784  59.827 67.713  1.00 8.11   ? 305 ALA B CB    1 
ATOM   6110  N N     . GLY B 1 306 ? 13.428  62.930 67.515  1.00 7.19   ? 306 GLY B N     1 
ATOM   6111  C CA    . GLY B 1 306 ? 12.910  64.295 67.569  1.00 5.91   ? 306 GLY B CA    1 
ATOM   6112  C C     . GLY B 1 306 ? 11.377  64.256 67.581  1.00 8.86   ? 306 GLY B C     1 
ATOM   6113  O O     . GLY B 1 306 ? 10.734  65.138 68.172  1.00 10.23  ? 306 GLY B O     1 
ATOM   6114  N N     . ARG B 1 307 ? 10.758  63.238 66.949  1.00 6.20   ? 307 ARG B N     1 
ATOM   6115  C CA    . ARG B 1 307 ? 9.300   63.170 67.033  1.00 10.49  ? 307 ARG B CA    1 
ATOM   6116  C C     . ARG B 1 307 ? 8.804   62.994 68.483  1.00 12.84  ? 307 ARG B C     1 
ATOM   6117  O O     . ARG B 1 307 ? 7.751   63.527 68.802  1.00 10.25  ? 307 ARG B O     1 
ATOM   6118  C CB    . ARG B 1 307 ? 8.780   62.058 66.166  1.00 4.75   ? 307 ARG B CB    1 
ATOM   6119  C CG    . ARG B 1 307 ? 9.323   60.661 66.491  1.00 4.87   ? 307 ARG B CG    1 
ATOM   6120  C CD    . ARG B 1 307 ? 8.684   59.606 65.606  1.00 10.21  ? 307 ARG B CD    1 
ATOM   6121  N NE    . ARG B 1 307 ? 9.342   58.305 65.811  1.00 8.42   ? 307 ARG B NE    1 
ATOM   6122  C CZ    . ARG B 1 307 ? 10.296  57.887 64.993  1.00 12.22  ? 307 ARG B CZ    1 
ATOM   6123  N NH1   . ARG B 1 307 ? 10.633  58.611 63.910  1.00 10.40  ? 307 ARG B NH1   1 
ATOM   6124  N NH2   . ARG B 1 307 ? 10.914  56.734 65.225  1.00 6.94   ? 307 ARG B NH2   1 
ATOM   6125  N N     . ASP B 1 308 ? 9.558   62.347 69.376  1.00 11.79  ? 308 ASP B N     1 
ATOM   6126  C CA    . ASP B 1 308 ? 9.141   62.126 70.750  1.00 9.31   ? 308 ASP B CA    1 
ATOM   6127  C C     . ASP B 1 308 ? 9.332   63.350 71.603  1.00 8.79   ? 308 ASP B C     1 
ATOM   6128  O O     . ASP B 1 308 ? 8.499   63.604 72.475  1.00 9.19   ? 308 ASP B O     1 
ATOM   6129  C CB    . ASP B 1 308 ? 9.818   60.878 71.327  1.00 5.54   ? 308 ASP B CB    1 
ATOM   6130  C CG    . ASP B 1 308 ? 9.291   59.669 70.651  1.00 8.43   ? 308 ASP B CG    1 
ATOM   6131  O OD1   . ASP B 1 308 ? 8.046   59.486 70.730  1.00 12.86  ? 308 ASP B OD1   1 
ATOM   6132  O OD2   . ASP B 1 308 ? 10.055  58.887 70.015  1.00 9.47   ? 308 ASP B OD2   1 
ATOM   6133  N N     . MET B 1 309 ? 10.292  64.229 71.301  1.00 8.61   ? 309 MET B N     1 
ATOM   6134  C CA    . MET B 1 309 ? 10.403  65.482 72.000  1.00 7.43   ? 309 MET B CA    1 
ATOM   6135  C C     . MET B 1 309 ? 9.218   66.358 71.583  1.00 10.58  ? 309 MET B C     1 
ATOM   6136  O O     . MET B 1 309 ? 8.689   67.168 72.381  1.00 8.23   ? 309 MET B O     1 
ATOM   6137  C CB    . MET B 1 309 ? 11.716  66.224 71.732  1.00 7.10   ? 309 MET B CB    1 
ATOM   6138  C CG    . MET B 1 309 ? 12.939  65.487 72.371  1.00 11.90  ? 309 MET B CG    1 
ATOM   6139  S SD    . MET B 1 309 ? 14.388  66.506 72.172  1.00 14.75  ? 309 MET B SD    1 
ATOM   6140  C CE    . MET B 1 309 ? 14.848  66.184 70.461  1.00 9.09   ? 309 MET B CE    1 
ATOM   6141  N N     . ALA B 1 310 ? 8.851   66.308 70.279  1.00 8.74   ? 310 ALA B N     1 
ATOM   6142  C CA    . ALA B 1 310 ? 7.726   67.109 69.808  1.00 11.02  ? 310 ALA B CA    1 
ATOM   6143  C C     . ALA B 1 310 ? 6.412   66.698 70.501  1.00 5.16   ? 310 ALA B C     1 
ATOM   6144  O O     . ALA B 1 310 ? 5.629   67.524 70.930  1.00 9.11   ? 310 ALA B O     1 
ATOM   6145  C CB    . ALA B 1 310 ? 7.561   66.918 68.282  1.00 4.91   ? 310 ALA B CB    1 
ATOM   6146  N N     . ALA B 1 311 ? 6.168   65.393 70.551  1.00 5.02   ? 311 ALA B N     1 
ATOM   6147  C CA    . ALA B 1 311 ? 4.984   64.870 71.256  1.00 11.68  ? 311 ALA B CA    1 
ATOM   6148  C C     . ALA B 1 311 ? 5.013   65.235 72.753  1.00 13.60  ? 311 ALA B C     1 
ATOM   6149  O O     . ALA B 1 311 ? 3.974   65.427 73.346  1.00 12.36  ? 311 ALA B O     1 
ATOM   6150  C CB    . ALA B 1 311 ? 4.968   63.360 71.139  1.00 5.09   ? 311 ALA B CB    1 
ATOM   6151  N N     . MET B 1 312 ? 6.184   65.272 73.391  1.00 10.45  ? 312 MET B N     1 
ATOM   6152  C CA    . MET B 1 312 ? 6.345   65.592 74.796  1.00 10.17  ? 312 MET B CA    1 
ATOM   6153  C C     . MET B 1 312 ? 5.948   67.026 75.061  1.00 8.58   ? 312 MET B C     1 
ATOM   6154  O O     . MET B 1 312 ? 5.316   67.370 76.036  1.00 11.02  ? 312 MET B O     1 
ATOM   6155  C CB    . MET B 1 312 ? 7.805   65.389 75.274  1.00 11.01  ? 312 MET B CB    1 
ATOM   6156  C CG    . MET B 1 312 ? 7.901   65.656 76.807  1.00 15.07  ? 312 MET B CG    1 
ATOM   6157  S SD    . MET B 1 312 ? 9.570   65.311 77.403  1.00 17.60  ? 312 MET B SD    1 
ATOM   6158  C CE    . MET B 1 312 ? 10.017  63.743 76.831  1.00 9.14   ? 312 MET B CE    1 
ATOM   6159  N N     . VAL B 1 313 ? 6.271   67.947 74.150  1.00 6.78   ? 313 VAL B N     1 
ATOM   6160  C CA    . VAL B 1 313 ? 5.908   69.345 74.313  1.00 7.92   ? 313 VAL B CA    1 
ATOM   6161  C C     . VAL B 1 313 ? 4.396   69.468 74.323  1.00 11.04  ? 313 VAL B C     1 
ATOM   6162  O O     . VAL B 1 313 ? 3.840   70.218 75.150  1.00 11.49  ? 313 VAL B O     1 
ATOM   6163  C CB    . VAL B 1 313 ? 6.480   70.196 73.157  1.00 14.41  ? 313 VAL B CB    1 
ATOM   6164  C CG1   . VAL B 1 313 ? 5.970   71.621 73.160  1.00 9.61   ? 313 VAL B CG1   1 
ATOM   6165  C CG2   . VAL B 1 313 ? 8.030   70.183 73.270  1.00 14.19  ? 313 VAL B CG2   1 
ATOM   6166  N N     . GLN B 1 314 ? 3.726   68.738 73.429  1.00 10.01  ? 314 GLN B N     1 
ATOM   6167  C CA    . GLN B 1 314 ? 2.268   68.820 73.346  1.00 13.21  ? 314 GLN B CA    1 
ATOM   6168  C C     . GLN B 1 314 ? 1.655   68.065 74.537  1.00 11.28  ? 314 GLN B C     1 
ATOM   6169  O O     . GLN B 1 314 ? 0.656   68.524 75.049  1.00 10.79  ? 314 GLN B O     1 
ATOM   6170  C CB    . GLN B 1 314 ? 1.809   68.201 72.011  1.00 9.28   ? 314 GLN B CB    1 
ATOM   6171  C CG    . GLN B 1 314 ? 0.299   68.134 71.773  1.00 12.31  ? 314 GLN B CG    1 
ATOM   6172  C CD    . GLN B 1 314 ? -0.372  69.482 71.798  1.00 16.56  ? 314 GLN B CD    1 
ATOM   6173  O OE1   . GLN B 1 314 ? 0.271   70.487 71.460  1.00 13.32  ? 314 GLN B OE1   1 
ATOM   6174  N NE2   . GLN B 1 314 ? -1.642  69.505 72.181  1.00 12.26  ? 314 GLN B NE2   1 
ATOM   6175  N N     . GLY B 1 315 ? 2.215   66.927 74.916  1.00 9.23   ? 315 GLY B N     1 
ATOM   6176  C CA    . GLY B 1 315 ? 1.737   66.119 76.019  1.00 12.72  ? 315 GLY B CA    1 
ATOM   6177  C C     . GLY B 1 315 ? 1.821   66.872 77.360  1.00 13.31  ? 315 GLY B C     1 
ATOM   6178  O O     . GLY B 1 315 ? 0.935   66.735 78.199  1.00 14.07  ? 315 GLY B O     1 
ATOM   6179  N N     . LEU B 1 316 ? 2.901   67.622 77.567  1.00 8.96   ? 316 LEU B N     1 
ATOM   6180  C CA    . LEU B 1 316 ? 3.096   68.411 78.761  1.00 13.94  ? 316 LEU B CA    1 
ATOM   6181  C C     . LEU B 1 316 ? 1.926   69.360 78.988  1.00 15.22  ? 316 LEU B C     1 
ATOM   6182  O O     . LEU B 1 316 ? 1.500   69.647 80.105  1.00 19.18  ? 316 LEU B O     1 
ATOM   6183  C CB    . LEU B 1 316 ? 4.413   69.243 78.685  1.00 9.58   ? 316 LEU B CB    1 
ATOM   6184  C CG    . LEU B 1 316 ? 5.625   68.348 79.095  1.00 15.60  ? 316 LEU B CG    1 
ATOM   6185  C CD1   . LEU B 1 316 ? 6.934   69.055 78.810  1.00 9.22   ? 316 LEU B CD1   1 
ATOM   6186  C CD2   . LEU B 1 316 ? 5.524   67.998 80.581  1.00 13.08  ? 316 LEU B CD2   1 
ATOM   6187  N N     . GLU B 1 317 ? 1.464   70.010 77.951  1.00 10.28  ? 317 GLU B N     1 
ATOM   6188  C CA    . GLU B 1 317 ? 0.346   70.910 77.916  1.00 10.98  ? 317 GLU B CA    1 
ATOM   6189  C C     . GLU B 1 317 ? -0.964  70.179 78.073  1.00 11.33  ? 317 GLU B C     1 
ATOM   6190  O O     . GLU B 1 317 ? -1.751  70.573 78.957  1.00 12.30  ? 317 GLU B O     1 
ATOM   6191  C CB    . GLU B 1 317 ? 0.322   71.714 76.592  1.00 16.91  ? 317 GLU B CB    1 
ATOM   6192  C CG    . GLU B 1 317 ? -0.975  72.513 76.453  1.00 15.54  ? 317 GLU B CG    1 
ATOM   6193  C CD    . GLU B 1 317 ? -0.906  73.691 77.417  1.00 18.46  ? 317 GLU B CD    1 
ATOM   6194  O OE1   . GLU B 1 317 ? 0.192   74.143 77.825  1.00 20.23  ? 317 GLU B OE1   1 
ATOM   6195  O OE2   . GLU B 1 317 ? -1.995  74.164 77.787  1.00 30.97  ? 317 GLU B OE2   1 
ATOM   6196  N N     . GLU B 1 318 ? -1.191  69.068 77.380  1.00 9.99   ? 318 GLU B N     1 
ATOM   6197  C CA    . GLU B 1 318 ? -2.445  68.349 77.519  1.00 10.90  ? 318 GLU B CA    1 
ATOM   6198  C C     . GLU B 1 318 ? -2.591  67.711 78.902  1.00 15.61  ? 318 GLU B C     1 
ATOM   6199  O O     . GLU B 1 318 ? -3.708  67.590 79.403  1.00 11.35  ? 318 GLU B O     1 
ATOM   6200  C CB    . GLU B 1 318 ? -2.559  67.218 76.461  1.00 12.00  ? 318 GLU B CB    1 
ATOM   6201  C CG    . GLU B 1 318 ? -2.792  67.786 75.061  1.00 12.56  ? 318 GLU B CG    1 
ATOM   6202  C CD    . GLU B 1 318 ? -2.971  66.714 74.010  1.00 9.46   ? 318 GLU B CD    1 
ATOM   6203  O OE1   . GLU B 1 318 ? -3.385  65.588 74.318  1.00 11.34  ? 318 GLU B OE1   1 
ATOM   6204  O OE2   . GLU B 1 318 ? -2.765  66.996 72.803  1.00 12.79  ? 318 GLU B OE2   1 
ATOM   6205  N N     . GLY B 1 319 ? -1.495  67.265 79.535  1.00 10.76  ? 319 GLY B N     1 
ATOM   6206  C CA    . GLY B 1 319 ? -1.543  66.601 80.820  1.00 11.84  ? 319 GLY B CA    1 
ATOM   6207  C C     . GLY B 1 319 ? -2.011  67.534 81.956  1.00 9.27   ? 319 GLY B C     1 
ATOM   6208  O O     . GLY B 1 319 ? -2.443  67.023 82.975  1.00 13.27  ? 319 GLY B O     1 
ATOM   6209  N N     . THR B 1 320 ? -1.935  68.836 81.781  1.00 8.56   ? 320 THR B N     1 
ATOM   6210  C CA    . THR B 1 320 ? -2.326  69.850 82.679  1.00 11.32  ? 320 THR B CA    1 
ATOM   6211  C C     . THR B 1 320 ? -3.791  70.273 82.516  1.00 16.23  ? 320 THR B C     1 
ATOM   6212  O O     . THR B 1 320 ? -4.234  71.047 83.363  1.00 13.58  ? 320 THR B O     1 
ATOM   6213  C CB    . THR B 1 320 ? -1.500  71.147 82.617  1.00 15.60  ? 320 THR B CB    1 
ATOM   6214  O OG1   . THR B 1 320 ? -1.903  71.876 81.454  1.00 14.18  ? 320 THR B OG1   1 
ATOM   6215  C CG2   . THR B 1 320 ? 0.009   70.959 82.627  1.00 10.38  ? 320 THR B CG2   1 
ATOM   6216  N N     . GLU B 1 321 ? -4.505  69.783 81.498  1.00 11.82  ? 321 GLU B N     1 
ATOM   6217  C CA    . GLU B 1 321 ? -5.888  70.272 81.345  1.00 16.90  ? 321 GLU B CA    1 
ATOM   6218  C C     . GLU B 1 321 ? -6.842  69.731 82.404  1.00 9.19   ? 321 GLU B C     1 
ATOM   6219  O O     . GLU B 1 321 ? -6.964  68.534 82.656  1.00 10.35  ? 321 GLU B O     1 
ATOM   6220  C CB    . GLU B 1 321 ? -6.388  69.958 79.925  1.00 14.66  ? 321 GLU B CB    1 
ATOM   6221  C CG    . GLU B 1 321 ? -5.617  70.840 78.919  1.00 25.80  ? 321 GLU B CG    1 
ATOM   6222  C CD    . GLU B 1 321 ? -5.963  70.471 77.482  1.00 32.06  ? 321 GLU B CD    1 
ATOM   6223  O OE1   . GLU B 1 321 ? -6.573  69.411 77.222  1.00 30.70  ? 321 GLU B OE1   1 
ATOM   6224  O OE2   . GLU B 1 321 ? -5.555  71.258 76.614  1.00 36.12  ? 321 GLU B OE2   1 
ATOM   6225  N N     . GLU B 1 322 ? -7.524  70.669 83.023  1.00 10.93  ? 322 GLU B N     1 
ATOM   6226  C CA    . GLU B 1 322 ? -8.361  70.305 84.205  1.00 13.12  ? 322 GLU B CA    1 
ATOM   6227  C C     . GLU B 1 322 ? -9.498  69.384 83.933  1.00 9.85   ? 322 GLU B C     1 
ATOM   6228  O O     . GLU B 1 322 ? -9.779  68.381 84.613  1.00 12.17  ? 322 GLU B O     1 
ATOM   6229  C CB    . GLU B 1 322 ? -8.882  71.607 84.863  1.00 18.28  ? 322 GLU B CB    1 
ATOM   6230  C CG    . GLU B 1 322 ? -9.519  71.233 86.205  1.00 28.54  ? 322 GLU B CG    1 
ATOM   6231  C CD    . GLU B 1 322 ? -9.842  72.423 87.092  1.00 29.31  ? 322 GLU B CD    1 
ATOM   6232  O OE1   . GLU B 1 322 ? -9.351  73.550 86.873  1.00 28.94  ? 322 GLU B OE1   1 
ATOM   6233  O OE2   . GLU B 1 322 ? -10.601 72.190 88.053  1.00 37.10  ? 322 GLU B OE2   1 
ATOM   6234  N N     . GLU B 1 323 ? -10.226 69.630 82.839  1.00 13.09  ? 323 GLU B N     1 
ATOM   6235  C CA    . GLU B 1 323 ? -11.341 68.772 82.425  1.00 12.77  ? 323 GLU B CA    1 
ATOM   6236  C C     . GLU B 1 323 ? -10.816 67.380 82.199  1.00 13.88  ? 323 GLU B C     1 
ATOM   6237  O O     . GLU B 1 323 ? -11.469 66.388 82.500  1.00 12.77  ? 323 GLU B O     1 
ATOM   6238  C CB    . GLU B 1 323 ? -12.020 69.342 81.189  1.00 17.42  ? 323 GLU B CB    1 
ATOM   6239  C CG    . GLU B 1 323 ? -11.982 70.854 81.023  1.00 47.10  ? 323 GLU B CG    1 
ATOM   6240  C CD    . GLU B 1 323 ? -10.629 71.354 80.517  1.00 58.65  ? 323 GLU B CD    1 
ATOM   6241  O OE1   . GLU B 1 323 ? -10.065 70.826 79.525  1.00 69.76  ? 323 GLU B OE1   1 
ATOM   6242  O OE2   . GLU B 1 323 ? -10.085 72.291 81.142  1.00 56.95  ? 323 GLU B OE2   1 
ATOM   6243  N N     . TYR B 1 324 ? -9.626  67.228 81.573  1.00 11.60  ? 324 TYR B N     1 
ATOM   6244  C CA    . TYR B 1 324 ? -9.081  65.879 81.373  1.00 9.15   ? 324 TYR B CA    1 
ATOM   6245  C C     . TYR B 1 324 ? -8.718  65.289 82.745  1.00 6.59   ? 324 TYR B C     1 
ATOM   6246  O O     . TYR B 1 324 ? -8.999  64.160 83.015  1.00 8.08   ? 324 TYR B O     1 
ATOM   6247  C CB    . TYR B 1 324 ? -7.857  65.939 80.398  1.00 9.67   ? 324 TYR B CB    1 
ATOM   6248  C CG    . TYR B 1 324 ? -6.911  64.800 80.735  1.00 8.73   ? 324 TYR B CG    1 
ATOM   6249  C CD1   . TYR B 1 324 ? -7.214  63.500 80.398  1.00 5.98   ? 324 TYR B CD1   1 
ATOM   6250  C CD2   . TYR B 1 324 ? -5.738  65.044 81.452  1.00 11.08  ? 324 TYR B CD2   1 
ATOM   6251  C CE1   . TYR B 1 324 ? -6.388  62.441 80.784  1.00 8.97   ? 324 TYR B CE1   1 
ATOM   6252  C CE2   . TYR B 1 324 ? -4.915  64.001 81.844  1.00 8.40   ? 324 TYR B CE2   1 
ATOM   6253  C CZ    . TYR B 1 324 ? -5.234  62.717 81.502  1.00 7.95   ? 324 TYR B CZ    1 
ATOM   6254  O OH    . TYR B 1 324 ? -4.436  61.655 81.844  1.00 9.99   ? 324 TYR B OH    1 
ATOM   6255  N N     . LEU B 1 325 ? -7.989  66.005 83.621  1.00 7.87   ? 325 LEU B N     1 
ATOM   6256  C CA    . LEU B 1 325 ? -7.605  65.391 84.917  1.00 13.15  ? 325 LEU B CA    1 
ATOM   6257  C C     . LEU B 1 325 ? -8.803  64.959 85.773  1.00 12.80  ? 325 LEU B C     1 
ATOM   6258  O O     . LEU B 1 325 ? -8.899  63.851 86.327  1.00 11.56  ? 325 LEU B O     1 
ATOM   6259  C CB    . LEU B 1 325 ? -6.773  66.424 85.738  1.00 11.50  ? 325 LEU B CB    1 
ATOM   6260  C CG    . LEU B 1 325 ? -5.360  66.652 85.197  1.00 13.52  ? 325 LEU B CG    1 
ATOM   6261  C CD1   . LEU B 1 325 ? -4.743  67.960 85.657  1.00 10.24  ? 325 LEU B CD1   1 
ATOM   6262  C CD2   . LEU B 1 325 ? -4.448  65.475 85.532  1.00 13.24  ? 325 LEU B CD2   1 
ATOM   6263  N N     . HIS B 1 326 ? -9.832  65.802 85.808  1.00 15.72  ? 326 HIS B N     1 
ATOM   6264  C CA    . HIS B 1 326 ? -11.088 65.490 86.517  1.00 14.09  ? 326 HIS B CA    1 
ATOM   6265  C C     . HIS B 1 326 ? -11.670 64.201 86.037  1.00 15.22  ? 326 HIS B C     1 
ATOM   6266  O O     . HIS B 1 326 ? -12.047 63.293 86.797  1.00 13.54  ? 326 HIS B O     1 
ATOM   6267  C CB    . HIS B 1 326 ? -12.079 66.655 86.264  1.00 14.49  ? 326 HIS B CB    1 
ATOM   6268  C CG    . HIS B 1 326 ? -13.368 66.474 87.010  1.00 28.09  ? 326 HIS B CG    1 
ATOM   6269  N ND1   . HIS B 1 326 ? -13.415 66.435 88.395  1.00 28.83  ? 326 HIS B ND1   1 
ATOM   6270  C CD2   . HIS B 1 326 ? -14.644 66.292 86.587  1.00 25.25  ? 326 HIS B CD2   1 
ATOM   6271  C CE1   . HIS B 1 326 ? -14.671 66.228 88.770  1.00 30.47  ? 326 HIS B CE1   1 
ATOM   6272  N NE2   . HIS B 1 326 ? -15.433 66.133 87.689  1.00 30.04  ? 326 HIS B NE2   1 
ATOM   6273  N N     . TYR B 1 327 ? -11.740 64.052 84.667  1.00 10.32  ? 327 TYR B N     1 
ATOM   6274  C CA    . TYR B 1 327 ? -12.269 62.811 84.103  1.00 9.50   ? 327 TYR B CA    1 
ATOM   6275  C C     . TYR B 1 327 ? -11.421 61.604 84.444  1.00 10.98  ? 327 TYR B C     1 
ATOM   6276  O O     . TYR B 1 327 ? -11.869 60.491 84.763  1.00 11.99  ? 327 TYR B O     1 
ATOM   6277  C CB    . TYR B 1 327 ? -12.320 62.936 82.529  1.00 9.71   ? 327 TYR B CB    1 
ATOM   6278  C CG    . TYR B 1 327 ? -12.294 61.602 81.833  1.00 11.61  ? 327 TYR B CG    1 
ATOM   6279  C CD1   . TYR B 1 327 ? -13.469 60.887 81.740  1.00 16.59  ? 327 TYR B CD1   1 
ATOM   6280  C CD2   . TYR B 1 327 ? -11.145 61.036 81.265  1.00 13.04  ? 327 TYR B CD2   1 
ATOM   6281  C CE1   . TYR B 1 327 ? -13.526 59.642 81.138  1.00 18.82  ? 327 TYR B CE1   1 
ATOM   6282  C CE2   . TYR B 1 327 ? -11.201 59.782 80.663  1.00 13.45  ? 327 TYR B CE2   1 
ATOM   6283  C CZ    . TYR B 1 327 ? -12.378 59.107 80.618  1.00 20.03  ? 327 TYR B CZ    1 
ATOM   6284  O OH    . TYR B 1 327 ? -12.522 57.874 79.987  1.00 25.25  ? 327 TYR B OH    1 
ATOM   6285  N N     . ARG B 1 328 ? -10.097 61.797 84.247  1.00 10.97  ? 328 ARG B N     1 
ATOM   6286  C CA    . ARG B 1 328 ? -9.153  60.712 84.426  1.00 9.43   ? 328 ARG B CA    1 
ATOM   6287  C C     . ARG B 1 328 ? -9.175  60.183 85.872  1.00 7.16   ? 328 ARG B C     1 
ATOM   6288  O O     . ARG B 1 328 ? -9.189  58.980 86.137  1.00 9.43   ? 328 ARG B O     1 
ATOM   6289  C CB    . ARG B 1 328 ? -7.775  61.304 84.063  1.00 9.02   ? 328 ARG B CB    1 
ATOM   6290  C CG    . ARG B 1 328 ? -6.640  60.291 84.007  1.00 10.34  ? 328 ARG B CG    1 
ATOM   6291  C CD    . ARG B 1 328 ? -6.177  59.794 85.370  1.00 10.32  ? 328 ARG B CD    1 
ATOM   6292  N NE    . ARG B 1 328 ? -4.883  59.145 85.372  1.00 6.99   ? 328 ARG B NE    1 
ATOM   6293  C CZ    . ARG B 1 328 ? -4.559  57.927 85.033  1.00 12.84  ? 328 ARG B CZ    1 
ATOM   6294  N NH1   . ARG B 1 328 ? -5.470  57.059 84.589  1.00 8.20   ? 328 ARG B NH1   1 
ATOM   6295  N NH2   . ARG B 1 328 ? -3.306  57.486 85.132  1.00 13.06  ? 328 ARG B NH2   1 
ATOM   6296  N N     . ILE B 1 329 ? -8.976  61.112 86.789  1.00 10.90  ? 329 ILE B N     1 
ATOM   6297  C CA    . ILE B 1 329 ? -8.959  60.756 88.231  1.00 12.99  ? 329 ILE B CA    1 
ATOM   6298  C C     . ILE B 1 329 ? -10.346 60.279 88.649  1.00 14.73  ? 329 ILE B C     1 
ATOM   6299  O O     . ILE B 1 329 ? -10.469 59.247 89.320  1.00 14.27  ? 329 ILE B O     1 
ATOM   6300  C CB    . ILE B 1 329 ? -8.414  61.970 88.993  1.00 19.90  ? 329 ILE B CB    1 
ATOM   6301  C CG1   . ILE B 1 329 ? -6.899  62.140 88.675  1.00 14.35  ? 329 ILE B CG1   1 
ATOM   6302  C CG2   . ILE B 1 329 ? -8.607  61.831 90.503  1.00 16.74  ? 329 ILE B CG2   1 
ATOM   6303  C CD1   . ILE B 1 329 ? -6.362  63.464 89.151  1.00 18.20  ? 329 ILE B CD1   1 
ATOM   6304  N N     . GLY B 1 330 ? -11.404 60.881 88.117  1.00 10.39  ? 330 GLY B N     1 
ATOM   6305  C CA    . GLY B 1 330 ? -12.776 60.393 88.371  1.00 11.64  ? 330 GLY B CA    1 
ATOM   6306  C C     . GLY B 1 330 ? -13.016 58.994 87.891  1.00 12.68  ? 330 GLY B C     1 
ATOM   6307  O O     . GLY B 1 330 ? -13.785 58.200 88.473  1.00 12.44  ? 330 GLY B O     1 
ATOM   6308  N N     . GLN B 1 331 ? -12.288 58.566 86.806  1.00 11.22  ? 331 GLN B N     1 
ATOM   6309  C CA    . GLN B 1 331 ? -12.472 57.193 86.327  1.00 7.69   ? 331 GLN B CA    1 
ATOM   6310  C C     . GLN B 1 331 ? -11.872 56.200 87.305  1.00 10.40  ? 331 GLN B C     1 
ATOM   6311  O O     . GLN B 1 331 ? -12.335 55.075 87.549  1.00 10.59  ? 331 GLN B O     1 
ATOM   6312  C CB    . GLN B 1 331 ? -11.785 57.052 84.933  1.00 9.73   ? 331 GLN B CB    1 
ATOM   6313  C CG    . GLN B 1 331 ? -11.649 55.572 84.575  1.00 5.38   ? 331 GLN B CG    1 
ATOM   6314  C CD    . GLN B 1 331 ? -11.223 55.407 83.109  1.00 22.07  ? 331 GLN B CD    1 
ATOM   6315  O OE1   . GLN B 1 331 ? -10.028 55.498 82.812  1.00 11.37  ? 331 GLN B OE1   1 
ATOM   6316  N NE2   . GLN B 1 331 ? -12.184 55.149 82.225  1.00 12.19  ? 331 GLN B NE2   1 
ATOM   6317  N N     . VAL B 1 332 ? -10.679 56.562 87.812  1.00 10.86  ? 332 VAL B N     1 
ATOM   6318  C CA    . VAL B 1 332 ? -10.018 55.705 88.798  1.00 9.84   ? 332 VAL B CA    1 
ATOM   6319  C C     . VAL B 1 332 ? -10.929 55.668 90.077  1.00 4.32   ? 332 VAL B C     1 
ATOM   6320  O O     . VAL B 1 332 ? -11.145 54.596 90.548  1.00 11.81  ? 332 VAL B O     1 
ATOM   6321  C CB    . VAL B 1 332 ? -8.637  56.281 89.143  1.00 17.67  ? 332 VAL B CB    1 
ATOM   6322  C CG1   . VAL B 1 332 ? -7.988  55.488 90.284  1.00 13.05  ? 332 VAL B CG1   1 
ATOM   6323  C CG2   . VAL B 1 332 ? -7.699  56.239 87.921  1.00 13.41  ? 332 VAL B CG2   1 
ATOM   6324  N N     . LYS B 1 333 ? -11.457 56.822 90.511  1.00 10.01  ? 333 LYS B N     1 
ATOM   6325  C CA    . LYS B 1 333 ? -12.356 56.788 91.709  1.00 14.45  ? 333 LYS B CA    1 
ATOM   6326  C C     . LYS B 1 333 ? -13.600 55.959 91.437  1.00 18.31  ? 333 LYS B C     1 
ATOM   6327  O O     . LYS B 1 333 ? -13.979 55.100 92.242  1.00 20.16  ? 333 LYS B O     1 
ATOM   6328  C CB    . LYS B 1 333 ? -12.638 58.230 92.104  1.00 12.16  ? 333 LYS B CB    1 
ATOM   6329  C CG    . LYS B 1 333 ? -13.712 58.392 93.202  1.00 19.75  ? 333 LYS B CG    1 
ATOM   6330  C CD    . LYS B 1 333 ? -13.852 59.854 93.555  1.00 20.15  ? 333 LYS B CD    1 
ATOM   6331  C CE    . LYS B 1 333 ? -14.742 60.173 94.738  1.00 35.51  ? 333 LYS B CE    1 
ATOM   6332  N NZ    . LYS B 1 333 ? -15.959 59.339 94.870  1.00 26.39  ? 333 LYS B NZ    1 
ATOM   6333  N N     . TYR B 1 334 ? -14.133 55.996 90.202  1.00 15.98  ? 334 TYR B N     1 
ATOM   6334  C CA    . TYR B 1 334 ? -15.291 55.180 89.838  1.00 12.65  ? 334 TYR B CA    1 
ATOM   6335  C C     . TYR B 1 334 ? -14.967 53.722 90.028  1.00 15.00  ? 334 TYR B C     1 
ATOM   6336  O O     . TYR B 1 334 ? -15.767 52.961 90.633  1.00 15.29  ? 334 TYR B O     1 
ATOM   6337  C CB    . TYR B 1 334 ? -15.806 55.505 88.422  1.00 13.03  ? 334 TYR B CB    1 
ATOM   6338  C CG    . TYR B 1 334 ? -16.924 54.577 87.964  1.00 13.80  ? 334 TYR B CG    1 
ATOM   6339  C CD1   . TYR B 1 334 ? -18.240 54.666 88.424  1.00 11.56  ? 334 TYR B CD1   1 
ATOM   6340  C CD2   . TYR B 1 334 ? -16.597 53.559 87.065  1.00 12.56  ? 334 TYR B CD2   1 
ATOM   6341  C CE1   . TYR B 1 334 ? -19.199 53.748 87.973  1.00 11.70  ? 334 TYR B CE1   1 
ATOM   6342  C CE2   . TYR B 1 334 ? -17.554 52.654 86.601  1.00 14.23  ? 334 TYR B CE2   1 
ATOM   6343  C CZ    . TYR B 1 334 ? -18.865 52.782 87.072  1.00 16.30  ? 334 TYR B CZ    1 
ATOM   6344  O OH    . TYR B 1 334 ? -19.758 51.842 86.603  1.00 13.74  ? 334 TYR B OH    1 
ATOM   6345  N N     . LEU B 1 335 ? -13.772 53.258 89.578  1.00 11.19  ? 335 LEU B N     1 
ATOM   6346  C CA    . LEU B 1 335 ? -13.511 51.843 89.774  1.00 10.47  ? 335 LEU B CA    1 
ATOM   6347  C C     . LEU B 1 335 ? -13.351 51.554 91.285  1.00 15.29  ? 335 LEU B C     1 
ATOM   6348  O O     . LEU B 1 335 ? -13.705 50.446 91.691  1.00 12.94  ? 335 LEU B O     1 
ATOM   6349  C CB    . LEU B 1 335 ? -12.166 51.528 89.096  1.00 13.22  ? 335 LEU B CB    1 
ATOM   6350  C CG    . LEU B 1 335 ? -11.582 50.145 89.308  1.00 14.57  ? 335 LEU B CG    1 
ATOM   6351  C CD1   . LEU B 1 335 ? -12.561 49.073 88.879  1.00 15.20  ? 335 LEU B CD1   1 
ATOM   6352  C CD2   . LEU B 1 335 ? -10.253 49.987 88.585  1.00 16.22  ? 335 LEU B CD2   1 
ATOM   6353  N N     . GLY B 1 336 ? -12.721 52.528 91.968  1.00 11.25  ? 336 GLY B N     1 
ATOM   6354  C CA    . GLY B 1 336 ? -12.465 52.262 93.403  1.00 18.10  ? 336 GLY B CA    1 
ATOM   6355  C C     . GLY B 1 336 ? -13.809 52.191 94.156  1.00 18.45  ? 336 GLY B C     1 
ATOM   6356  O O     . GLY B 1 336 ? -14.021 51.279 94.942  1.00 17.82  ? 336 GLY B O     1 
ATOM   6357  N N     . ASP B 1 337 ? -14.725 53.088 93.881  1.00 16.88  ? 337 ASP B N     1 
ATOM   6358  C CA    . ASP B 1 337 ? -16.031 53.148 94.500  1.00 18.74  ? 337 ASP B CA    1 
ATOM   6359  C C     . ASP B 1 337 ? -16.863 51.937 94.163  1.00 21.64  ? 337 ASP B C     1 
ATOM   6360  O O     . ASP B 1 337 ? -17.541 51.416 95.074  1.00 21.22  ? 337 ASP B O     1 
ATOM   6361  C CB    . ASP B 1 337 ? -16.812 54.396 94.148  1.00 12.29  ? 337 ASP B CB    1 
ATOM   6362  C CG    . ASP B 1 337 ? -16.284 55.608 94.834  1.00 12.42  ? 337 ASP B CG    1 
ATOM   6363  O OD1   . ASP B 1 337 ? -15.507 55.329 95.788  1.00 20.58  ? 337 ASP B OD1   1 
ATOM   6364  O OD2   . ASP B 1 337 ? -16.556 56.747 94.437  1.00 18.16  ? 337 ASP B OD2   1 
ATOM   6365  N N     . ARG B 1 338 ? -16.750 51.402 92.942  1.00 16.41  ? 338 ARG B N     1 
ATOM   6366  C CA    . ARG B 1 338 ? -17.478 50.187 92.652  1.00 19.09  ? 338 ARG B CA    1 
ATOM   6367  C C     . ARG B 1 338 ? -17.012 49.071 93.568  1.00 21.54  ? 338 ARG B C     1 
ATOM   6368  O O     . ARG B 1 338 ? -17.813 48.232 93.990  1.00 19.57  ? 338 ARG B O     1 
ATOM   6369  C CB    . ARG B 1 338 ? -17.363 49.737 91.173  1.00 18.29  ? 338 ARG B CB    1 
ATOM   6370  C CG    . ARG B 1 338 ? -18.139 50.744 90.317  1.00 23.44  ? 338 ARG B CG    1 
ATOM   6371  C CD    . ARG B 1 338 ? -19.269 50.099 89.551  1.00 24.54  ? 338 ARG B CD    1 
ATOM   6372  N NE    . ARG B 1 338 ? -19.664 48.783 89.990  1.00 20.66  ? 338 ARG B NE    1 
ATOM   6373  C CZ    . ARG B 1 338 ? -19.701 47.655 89.317  1.00 26.82  ? 338 ARG B CZ    1 
ATOM   6374  N NH1   . ARG B 1 338 ? -19.378 47.507 88.036  1.00 22.38  ? 338 ARG B NH1   1 
ATOM   6375  N NH2   . ARG B 1 338 ? -20.119 46.574 89.982  1.00 24.17  ? 338 ARG B NH2   1 
ATOM   6376  N N     . LEU B 1 339 ? -15.715 48.996 93.792  1.00 19.09  ? 339 LEU B N     1 
ATOM   6377  C CA    . LEU B 1 339 ? -15.173 47.919 94.608  1.00 20.41  ? 339 LEU B CA    1 
ATOM   6378  C C     . LEU B 1 339 ? -15.564 48.130 96.083  1.00 19.44  ? 339 LEU B C     1 
ATOM   6379  O O     . LEU B 1 339 ? -16.002 47.219 96.737  1.00 19.84  ? 339 LEU B O     1 
ATOM   6380  C CB    . LEU B 1 339 ? -13.654 47.866 94.409  1.00 18.86  ? 339 LEU B CB    1 
ATOM   6381  C CG    . LEU B 1 339 ? -13.164 47.541 92.997  1.00 21.68  ? 339 LEU B CG    1 
ATOM   6382  C CD1   . LEU B 1 339 ? -11.650 47.607 92.915  1.00 18.76  ? 339 LEU B CD1   1 
ATOM   6383  C CD2   . LEU B 1 339 ? -13.634 46.160 92.574  1.00 15.82  ? 339 LEU B CD2   1 
ATOM   6384  N N     . ARG B 1 340 ? -15.427 49.322 96.609  1.00 18.84  ? 340 ARG B N     1 
ATOM   6385  C CA    . ARG B 1 340 ? -15.657 49.677 97.993  1.00 24.16  ? 340 ARG B CA    1 
ATOM   6386  C C     . ARG B 1 340 ? -17.123 49.424 98.324  1.00 29.04  ? 340 ARG B C     1 
ATOM   6387  O O     . ARG B 1 340 ? -17.440 48.622 99.208  1.00 26.20  ? 340 ARG B O     1 
ATOM   6388  C CB    . ARG B 1 340 ? -15.309 51.121 98.211  1.00 18.86  ? 340 ARG B CB    1 
ATOM   6389  C CG    . ARG B 1 340 ? -14.521 51.426 99.469  1.00 30.09  ? 340 ARG B CG    1 
ATOM   6390  C CD    . ARG B 1 340 ? -14.417 52.952 99.590  1.00 33.38  ? 340 ARG B CD    1 
ATOM   6391  N NE    . ARG B 1 340 ? -14.512 53.345 100.987 1.00 35.81  ? 340 ARG B NE    1 
ATOM   6392  C CZ    . ARG B 1 340 ? -15.360 54.223 101.495 1.00 43.45  ? 340 ARG B CZ    1 
ATOM   6393  N NH1   . ARG B 1 340 ? -16.278 54.882 100.798 1.00 39.47  ? 340 ARG B NH1   1 
ATOM   6394  N NH2   . ARG B 1 340 ? -15.271 54.456 102.806 1.00 44.24  ? 340 ARG B NH2   1 
ATOM   6395  N N     . GLU B 1 341 ? -18.021 49.909 97.453  1.00 25.87  ? 341 GLU B N     1 
ATOM   6396  C CA    . GLU B 1 341 ? -19.430 49.604 97.607  1.00 23.65  ? 341 GLU B CA    1 
ATOM   6397  C C     . GLU B 1 341 ? -19.668 48.115 97.594  1.00 25.66  ? 341 GLU B C     1 
ATOM   6398  O O     . GLU B 1 341 ? -20.668 47.707 98.230  1.00 31.49  ? 341 GLU B O     1 
ATOM   6399  C CB    . GLU B 1 341 ? -20.299 50.329 96.583  1.00 19.76  ? 341 GLU B CB    1 
ATOM   6400  C CG    . GLU B 1 341 ? -20.216 51.843 96.686  1.00 24.84  ? 341 GLU B CG    1 
ATOM   6401  C CD    . GLU B 1 341 ? -20.708 52.581 95.449  1.00 29.34  ? 341 GLU B CD    1 
ATOM   6402  O OE1   . GLU B 1 341 ? -21.251 51.965 94.507  1.00 31.96  ? 341 GLU B OE1   1 
ATOM   6403  O OE2   . GLU B 1 341 ? -20.537 53.822 95.389  1.00 26.29  ? 341 GLU B OE2   1 
ATOM   6404  N N     . ALA B 1 342 ? -18.882 47.214 97.027  1.00 20.42  ? 342 ALA B N     1 
ATOM   6405  C CA    . ALA B 1 342 ? -19.181 45.798 97.138  1.00 21.47  ? 342 ALA B CA    1 
ATOM   6406  C C     . ALA B 1 342 ? -18.367 45.189 98.283  1.00 22.17  ? 342 ALA B C     1 
ATOM   6407  O O     . ALA B 1 342 ? -18.273 43.970 98.320  1.00 23.51  ? 342 ALA B O     1 
ATOM   6408  C CB    . ALA B 1 342 ? -18.952 45.029 95.858  1.00 27.35  ? 342 ALA B CB    1 
ATOM   6409  N N     . GLY B 1 343 ? -17.780 45.993 99.162  1.00 22.49  ? 343 GLY B N     1 
ATOM   6410  C CA    . GLY B 1 343 ? -17.017 45.451 100.270 1.00 29.54  ? 343 GLY B CA    1 
ATOM   6411  C C     . GLY B 1 343 ? -15.642 44.917 99.916  1.00 33.22  ? 343 GLY B C     1 
ATOM   6412  O O     . GLY B 1 343 ? -15.135 43.995 100.564 1.00 30.99  ? 343 GLY B O     1 
ATOM   6413  N N     . ILE B 1 344 ? -15.027 45.443 98.848  1.00 29.39  ? 344 ILE B N     1 
ATOM   6414  C CA    . ILE B 1 344 ? -13.686 45.028 98.466  1.00 25.32  ? 344 ILE B CA    1 
ATOM   6415  C C     . ILE B 1 344 ? -12.817 46.135 99.069  1.00 24.57  ? 344 ILE B C     1 
ATOM   6416  O O     . ILE B 1 344 ? -13.066 47.329 98.883  1.00 26.30  ? 344 ILE B O     1 
ATOM   6417  C CB    . ILE B 1 344 ? -13.400 44.887 96.975  1.00 31.97  ? 344 ILE B CB    1 
ATOM   6418  C CG1   . ILE B 1 344 ? -14.281 43.809 96.351  1.00 27.03  ? 344 ILE B CG1   1 
ATOM   6419  C CG2   . ILE B 1 344 ? -11.919 44.591 96.748  1.00 28.21  ? 344 ILE B CG2   1 
ATOM   6420  C CD1   . ILE B 1 344 ? -13.929 42.375 96.592  1.00 28.45  ? 344 ILE B CD1   1 
ATOM   6421  N N     . PRO B 1 345 ? -11.912 45.707 99.933  1.00 23.35  ? 345 PRO B N     1 
ATOM   6422  C CA    . PRO B 1 345 ? -11.137 46.681 100.680 1.00 22.87  ? 345 PRO B CA    1 
ATOM   6423  C C     . PRO B 1 345 ? -10.059 47.293 99.800  1.00 20.28  ? 345 PRO B C     1 
ATOM   6424  O O     . PRO B 1 345 ? -9.193  46.601 99.246  1.00 20.50  ? 345 PRO B O     1 
ATOM   6425  C CB    . PRO B 1 345 ? -10.475 45.874 101.792 1.00 22.30  ? 345 PRO B CB    1 
ATOM   6426  C CG    . PRO B 1 345 ? -10.420 44.490 101.266 1.00 25.28  ? 345 PRO B CG    1 
ATOM   6427  C CD    . PRO B 1 345 ? -11.572 44.324 100.296 1.00 24.70  ? 345 PRO B CD    1 
ATOM   6428  N N     . ILE B 1 346 ? -10.039 48.596 99.685  1.00 19.55  ? 346 ILE B N     1 
ATOM   6429  C CA    . ILE B 1 346 ? -9.052  49.259 98.857  1.00 23.10  ? 346 ILE B CA    1 
ATOM   6430  C C     . ILE B 1 346 ? -8.380  50.356 99.669  1.00 26.49  ? 346 ILE B C     1 
ATOM   6431  O O     . ILE B 1 346 ? -8.936  50.781 100.688 1.00 25.23  ? 346 ILE B O     1 
ATOM   6432  C CB    . ILE B 1 346 ? -9.625  49.966 97.605  1.00 18.78  ? 346 ILE B CB    1 
ATOM   6433  C CG1   . ILE B 1 346 ? -10.573 51.093 97.978  1.00 20.51  ? 346 ILE B CG1   1 
ATOM   6434  C CG2   . ILE B 1 346 ? -10.331 48.947 96.700  1.00 21.30  ? 346 ILE B CG2   1 
ATOM   6435  C CD1   . ILE B 1 346 ? -11.121 51.891 96.813  1.00 23.24  ? 346 ILE B CD1   1 
ATOM   6436  N N     . GLN B 1 347 ? -7.285  50.870 99.110  1.00 22.36  ? 347 GLN B N     1 
ATOM   6437  C CA    . GLN B 1 347 ? -6.656  52.038 99.726  1.00 22.97  ? 347 GLN B CA    1 
ATOM   6438  C C     . GLN B 1 347 ? -7.626  53.178 99.458  1.00 24.20  ? 347 GLN B C     1 
ATOM   6439  O O     . GLN B 1 347 ? -8.019  53.341 98.310  1.00 23.84  ? 347 GLN B O     1 
ATOM   6440  C CB    . GLN B 1 347 ? -5.267  52.359 99.180  1.00 21.59  ? 347 GLN B CB    1 
ATOM   6441  C CG    . GLN B 1 347 ? -4.679  53.723 99.419  1.00 28.57  ? 347 GLN B CG    1 
ATOM   6442  C CD    . GLN B 1 347 ? -4.111  53.960 100.808 1.00 47.58  ? 347 GLN B CD    1 
ATOM   6443  O OE1   . GLN B 1 347 ? -4.860  54.034 101.793 1.00 51.53  ? 347 GLN B OE1   1 
ATOM   6444  N NE2   . GLN B 1 347 ? -2.798  54.107 100.972 1.00 39.01  ? 347 GLN B NE2   1 
ATOM   6445  N N     . TYR B 1 348 ? -8.029  53.936 100.479 1.00 21.90  ? 348 TYR B N     1 
ATOM   6446  C CA    . TYR B 1 348 ? -9.042  54.970 100.331 1.00 20.10  ? 348 TYR B CA    1 
ATOM   6447  C C     . TYR B 1 348 ? -8.575  56.249 100.954 1.00 19.96  ? 348 TYR B C     1 
ATOM   6448  O O     . TYR B 1 348 ? -8.048  56.243 102.074 1.00 30.97  ? 348 TYR B O     1 
ATOM   6449  C CB    . TYR B 1 348 ? -10.320 54.452 101.051 1.00 21.58  ? 348 TYR B CB    1 
ATOM   6450  C CG    . TYR B 1 348 ? -11.498 55.360 100.824 1.00 25.43  ? 348 TYR B CG    1 
ATOM   6451  C CD1   . TYR B 1 348 ? -12.109 55.443 99.572  1.00 30.21  ? 348 TYR B CD1   1 
ATOM   6452  C CD2   . TYR B 1 348 ? -12.003 56.140 101.843 1.00 31.14  ? 348 TYR B CD2   1 
ATOM   6453  C CE1   . TYR B 1 348 ? -13.191 56.285 99.358  1.00 31.52  ? 348 TYR B CE1   1 
ATOM   6454  C CE2   . TYR B 1 348 ? -13.091 56.983 101.659 1.00 33.14  ? 348 TYR B CE2   1 
ATOM   6455  C CZ    . TYR B 1 348 ? -13.673 57.040 100.412 1.00 35.09  ? 348 TYR B CZ    1 
ATOM   6456  O OH    . TYR B 1 348 ? -14.744 57.875 100.225 1.00 39.99  ? 348 TYR B OH    1 
ATOM   6457  N N     . PRO B 1 349 ? -8.685  57.377 100.302 1.00 21.00  ? 349 PRO B N     1 
ATOM   6458  C CA    . PRO B 1 349 ? -9.293  57.492 98.977  1.00 20.94  ? 349 PRO B CA    1 
ATOM   6459  C C     . PRO B 1 349 ? -8.370  57.046 97.843  1.00 24.27  ? 349 PRO B C     1 
ATOM   6460  O O     . PRO B 1 349 ? -7.173  56.836 98.035  1.00 18.89  ? 349 PRO B O     1 
ATOM   6461  C CB    . PRO B 1 349 ? -9.499  58.990 98.790  1.00 18.20  ? 349 PRO B CB    1 
ATOM   6462  C CG    . PRO B 1 349 ? -8.405  59.630 99.592  1.00 20.92  ? 349 PRO B CG    1 
ATOM   6463  C CD    . PRO B 1 349 ? -8.196  58.696 100.762 1.00 18.68  ? 349 PRO B CD    1 
ATOM   6464  N N     . THR B 1 350 ? -8.953  56.907 96.648  1.00 19.62  ? 350 THR B N     1 
ATOM   6465  C CA    . THR B 1 350 ? -8.164  56.395 95.531  1.00 17.18  ? 350 THR B CA    1 
ATOM   6466  C C     . THR B 1 350 ? -7.175  57.458 95.082  1.00 12.54  ? 350 THR B C     1 
ATOM   6467  O O     . THR B 1 350 ? -7.464  58.650 95.144  1.00 12.80  ? 350 THR B O     1 
ATOM   6468  C CB    . THR B 1 350 ? -9.031  55.995 94.319  1.00 17.40  ? 350 THR B CB    1 
ATOM   6469  O OG1   . THR B 1 350 ? -9.960  57.054 94.076  1.00 19.03  ? 350 THR B OG1   1 
ATOM   6470  C CG2   . THR B 1 350 ? -9.756  54.697 94.545  1.00 17.06  ? 350 THR B CG2   1 
ATOM   6471  N N     . GLY B 1 351 ? -5.994  57.017 94.729  1.00 15.10  ? 351 GLY B N     1 
ATOM   6472  C CA    . GLY B 1 351 ? -4.966  57.918 94.203  1.00 18.42  ? 351 GLY B CA    1 
ATOM   6473  C C     . GLY B 1 351 ? -5.294  58.297 92.715  1.00 20.07  ? 351 GLY B C     1 
ATOM   6474  O O     . GLY B 1 351 ? -6.442  58.237 92.231  1.00 16.08  ? 351 GLY B O     1 
ATOM   6475  N N     . GLY B 1 352 ? -4.273  58.864 92.067  1.00 14.85  ? 352 GLY B N     1 
ATOM   6476  C CA    . GLY B 1 352 ? -4.497  59.456 90.754  1.00 13.21  ? 352 GLY B CA    1 
ATOM   6477  C C     . GLY B 1 352 ? -4.494  58.465 89.599  1.00 12.47  ? 352 GLY B C     1 
ATOM   6478  O O     . GLY B 1 352 ? -5.115  58.788 88.583  1.00 15.24  ? 352 GLY B O     1 
ATOM   6479  N N     . HIS B 1 353 ? -3.918  57.270 89.739  1.00 10.65  ? 353 HIS B N     1 
ATOM   6480  C CA    . HIS B 1 353 ? -3.735  56.484 88.514  1.00 14.85  ? 353 HIS B CA    1 
ATOM   6481  C C     . HIS B 1 353 ? -4.007  55.031 88.693  1.00 14.01  ? 353 HIS B C     1 
ATOM   6482  O O     . HIS B 1 353 ? -3.802  54.283 87.730  1.00 13.30  ? 353 HIS B O     1 
ATOM   6483  C CB    . HIS B 1 353 ? -2.222  56.650 88.132  1.00 13.83  ? 353 HIS B CB    1 
ATOM   6484  C CG    . HIS B 1 353 ? -1.309  55.973 89.122  1.00 13.07  ? 353 HIS B CG    1 
ATOM   6485  N ND1   . HIS B 1 353 ? -1.084  56.494 90.385  1.00 15.86  ? 353 HIS B ND1   1 
ATOM   6486  C CD2   . HIS B 1 353 ? -0.551  54.848 89.034  1.00 14.38  ? 353 HIS B CD2   1 
ATOM   6487  C CE1   . HIS B 1 353 ? -0.238  55.697 91.017  1.00 17.31  ? 353 HIS B CE1   1 
ATOM   6488  N NE2   . HIS B 1 353 ? 0.102   54.690 90.231  1.00 14.92  ? 353 HIS B NE2   1 
ATOM   6489  N N     . ALA B 1 354 ? -4.422  54.663 89.916  1.00 14.96  ? 354 ALA B N     1 
ATOM   6490  C CA    . ALA B 1 354 ? -4.623  53.231 90.135  1.00 13.63  ? 354 ALA B CA    1 
ATOM   6491  C C     . ALA B 1 354 ? -5.460  52.975 91.390  1.00 17.54  ? 354 ALA B C     1 
ATOM   6492  O O     . ALA B 1 354 ? -5.511  53.849 92.235  1.00 13.10  ? 354 ALA B O     1 
ATOM   6493  C CB    . ALA B 1 354 ? -3.244  52.673 90.389  1.00 9.46   ? 354 ALA B CB    1 
ATOM   6494  N N     . VAL B 1 355 ? -5.996  51.772 91.440  1.00 17.29  ? 355 VAL B N     1 
ATOM   6495  C CA    . VAL B 1 355 ? -6.764  51.366 92.621  1.00 19.31  ? 355 VAL B CA    1 
ATOM   6496  C C     . VAL B 1 355 ? -5.933  50.262 93.243  1.00 17.76  ? 355 VAL B C     1 
ATOM   6497  O O     . VAL B 1 355 ? -5.453  49.377 92.499  1.00 16.27  ? 355 VAL B O     1 
ATOM   6498  C CB    . VAL B 1 355 ? -8.151  50.847 92.256  1.00 21.78  ? 355 VAL B CB    1 
ATOM   6499  C CG1   . VAL B 1 355 ? -8.847  50.244 93.474  1.00 20.19  ? 355 VAL B CG1   1 
ATOM   6500  C CG2   . VAL B 1 355 ? -8.988  51.967 91.672  1.00 13.94  ? 355 VAL B CG2   1 
ATOM   6501  N N     . PHE B 1 356 ? -5.670  50.389 94.550  1.00 15.71  ? 356 PHE B N     1 
ATOM   6502  C CA    . PHE B 1 356 ? -4.910  49.352 95.238  1.00 17.16  ? 356 PHE B CA    1 
ATOM   6503  C C     . PHE B 1 356 ? -5.845  48.533 96.122  1.00 18.09  ? 356 PHE B C     1 
ATOM   6504  O O     . PHE B 1 356 ? -6.508  49.133 96.984  1.00 21.73  ? 356 PHE B O     1 
ATOM   6505  C CB    . PHE B 1 356 ? -3.828  50.015 96.106  1.00 23.46  ? 356 PHE B CB    1 
ATOM   6506  C CG    . PHE B 1 356 ? -2.666  50.619 95.380  1.00 24.07  ? 356 PHE B CG    1 
ATOM   6507  C CD1   . PHE B 1 356 ? -2.809  51.710 94.553  1.00 26.93  ? 356 PHE B CD1   1 
ATOM   6508  C CD2   . PHE B 1 356 ? -1.392  50.105 95.521  1.00 33.44  ? 356 PHE B CD2   1 
ATOM   6509  C CE1   . PHE B 1 356 ? -1.741  52.253 93.852  1.00 35.61  ? 356 PHE B CE1   1 
ATOM   6510  C CE2   . PHE B 1 356 ? -0.302  50.657 94.866  1.00 29.72  ? 356 PHE B CE2   1 
ATOM   6511  C CZ    . PHE B 1 356 ? -0.473  51.736 94.031  1.00 24.96  ? 356 PHE B CZ    1 
ATOM   6512  N N     . VAL B 1 357 ? -5.878  47.254 95.903  1.00 17.76  ? 357 VAL B N     1 
ATOM   6513  C CA    . VAL B 1 357 ? -6.755  46.364 96.622  1.00 23.77  ? 357 VAL B CA    1 
ATOM   6514  C C     . VAL B 1 357 ? -5.889  45.728 97.722  1.00 30.32  ? 357 VAL B C     1 
ATOM   6515  O O     . VAL B 1 357 ? -4.860  45.143 97.399  1.00 26.58  ? 357 VAL B O     1 
ATOM   6516  C CB    . VAL B 1 357 ? -7.323  45.306 95.690  1.00 24.40  ? 357 VAL B CB    1 
ATOM   6517  C CG1   . VAL B 1 357 ? -8.183  44.295 96.416  1.00 25.43  ? 357 VAL B CG1   1 
ATOM   6518  C CG2   . VAL B 1 357 ? -8.104  46.009 94.572  1.00 25.24  ? 357 VAL B CG2   1 
ATOM   6519  N N     . ASP B 1 358 ? -6.327  45.988 98.952  1.00 32.05  ? 358 ASP B N     1 
ATOM   6520  C CA    . ASP B 1 358 ? -5.599  45.472 100.124 1.00 32.53  ? 358 ASP B CA    1 
ATOM   6521  C C     . ASP B 1 358 ? -5.825  43.983 100.204 1.00 31.41  ? 358 ASP B C     1 
ATOM   6522  O O     . ASP B 1 358 ? -6.867  43.582 100.768 1.00 36.47  ? 358 ASP B O     1 
ATOM   6523  C CB    . ASP B 1 358 ? -6.140  46.205 101.350 1.00 39.86  ? 358 ASP B CB    1 
ATOM   6524  C CG    . ASP B 1 358 ? -5.418  45.844 102.641 1.00 51.46  ? 358 ASP B CG    1 
ATOM   6525  O OD1   . ASP B 1 358 ? -5.179  44.649 102.919 1.00 52.28  ? 358 ASP B OD1   1 
ATOM   6526  O OD2   . ASP B 1 358 ? -5.101  46.805 103.378 1.00 49.56  ? 358 ASP B OD2   1 
ATOM   6527  N N     . CYS B 1 359 ? -4.935  43.149 99.693  1.00 28.25  ? 359 CYS B N     1 
ATOM   6528  C CA    . CYS B 1 359 ? -5.168  41.722 99.662  1.00 34.35  ? 359 CYS B CA    1 
ATOM   6529  C C     . CYS B 1 359 ? -4.889  41.012 100.978 1.00 41.60  ? 359 CYS B C     1 
ATOM   6530  O O     . CYS B 1 359 ? -5.213  39.806 101.063 1.00 41.91  ? 359 CYS B O     1 
ATOM   6531  C CB    . CYS B 1 359 ? -4.380  41.048 98.536  1.00 40.66  ? 359 CYS B CB    1 
ATOM   6532  S SG    . CYS B 1 359 ? -4.775  41.696 96.877  1.00 39.24  ? 359 CYS B SG    1 
ATOM   6533  N N     . LYS B 1 360 ? -4.382  41.728 101.991 1.00 43.25  ? 360 LYS B N     1 
ATOM   6534  C CA    . LYS B 1 360 ? -4.187  40.965 103.244 1.00 51.94  ? 360 LYS B CA    1 
ATOM   6535  C C     . LYS B 1 360 ? -5.567  40.614 103.776 1.00 52.47  ? 360 LYS B C     1 
ATOM   6536  O O     . LYS B 1 360 ? -5.833  39.438 104.022 1.00 54.61  ? 360 LYS B O     1 
ATOM   6537  C CB    . LYS B 1 360 ? -3.226  41.654 104.196 1.00 56.60  ? 360 LYS B CB    1 
ATOM   6538  C CG    . LYS B 1 360 ? -2.224  40.613 104.702 1.00 66.38  ? 360 LYS B CG    1 
ATOM   6539  C CD    . LYS B 1 360 ? -0.839  41.185 104.912 1.00 71.79  ? 360 LYS B CD    1 
ATOM   6540  C CE    . LYS B 1 360 ? 0.183   40.089 105.163 1.00 75.11  ? 360 LYS B CE    1 
ATOM   6541  N NZ    . LYS B 1 360 ? 1.569   40.532 104.851 1.00 78.06  ? 360 LYS B NZ    1 
ATOM   6542  N N     . LYS B 1 361 ? -6.499  41.561 103.750 1.00 53.93  ? 361 LYS B N     1 
ATOM   6543  C CA    . LYS B 1 361 ? -7.888  41.349 104.136 1.00 51.96  ? 361 LYS B CA    1 
ATOM   6544  C C     . LYS B 1 361 ? -8.672  40.408 103.238 1.00 52.46  ? 361 LYS B C     1 
ATOM   6545  O O     . LYS B 1 361 ? -9.594  39.721 103.728 1.00 55.08  ? 361 LYS B O     1 
ATOM   6546  C CB    . LYS B 1 361 ? -8.617  42.693 104.205 1.00 46.63  ? 361 LYS B CB    1 
ATOM   6547  C CG    . LYS B 1 361 ? -7.724  43.845 104.666 1.00 53.42  ? 361 LYS B CG    1 
ATOM   6548  C CD    . LYS B 1 361 ? -8.431  44.665 105.736 1.00 58.00  ? 361 LYS B CD    1 
ATOM   6549  C CE    . LYS B 1 361 ? -7.833  46.053 105.878 1.00 65.93  ? 361 LYS B CE    1 
ATOM   6550  N NZ    . LYS B 1 361 ? -7.710  46.752 104.565 1.00 71.58  ? 361 LYS B NZ    1 
ATOM   6551  N N     . LEU B 1 362 ? -8.358  40.302 101.946 1.00 47.99  ? 362 LEU B N     1 
ATOM   6552  C CA    . LEU B 1 362 ? -9.142  39.397 101.108 1.00 46.68  ? 362 LEU B CA    1 
ATOM   6553  C C     . LEU B 1 362 ? -8.719  37.954 101.327 1.00 45.69  ? 362 LEU B C     1 
ATOM   6554  O O     . LEU B 1 362 ? -9.494  37.011 101.223 1.00 43.55  ? 362 LEU B O     1 
ATOM   6555  C CB    . LEU B 1 362 ? -8.984  39.724 99.617  1.00 45.78  ? 362 LEU B CB    1 
ATOM   6556  C CG    . LEU B 1 362 ? -9.682  40.940 99.030  1.00 44.52  ? 362 LEU B CG    1 
ATOM   6557  C CD1   . LEU B 1 362 ? -9.443  40.974 97.522  1.00 38.01  ? 362 LEU B CD1   1 
ATOM   6558  C CD2   . LEU B 1 362 ? -11.177 40.909 99.308  1.00 41.37  ? 362 LEU B CD2   1 
ATOM   6559  N N     . VAL B 1 363 ? -7.399  37.771 101.467 1.00 47.84  ? 363 VAL B N     1 
ATOM   6560  C CA    . VAL B 1 363 ? -6.853  36.423 101.608 1.00 50.28  ? 363 VAL B CA    1 
ATOM   6561  C C     . VAL B 1 363 ? -6.017  36.381 102.887 1.00 53.04  ? 363 VAL B C     1 
ATOM   6562  O O     . VAL B 1 363 ? -4.849  36.760 102.982 1.00 49.94  ? 363 VAL B O     1 
ATOM   6563  C CB    . VAL B 1 363 ? -6.101  35.932 100.361 1.00 50.65  ? 363 VAL B CB    1 
ATOM   6564  C CG1   . VAL B 1 363 ? -7.072  35.401 99.309  1.00 47.13  ? 363 VAL B CG1   1 
ATOM   6565  C CG2   . VAL B 1 363 ? -5.220  37.020 99.776  1.00 37.42  ? 363 VAL B CG2   1 
ATOM   6566  N N     . PRO B 1 364 ? -6.717  35.991 103.956 1.00 55.09  ? 364 PRO B N     1 
ATOM   6567  C CA    . PRO B 1 364 ? -6.122  35.899 105.293 1.00 55.11  ? 364 PRO B CA    1 
ATOM   6568  C C     . PRO B 1 364 ? -5.444  34.552 105.414 1.00 51.96  ? 364 PRO B C     1 
ATOM   6569  O O     . PRO B 1 364 ? -4.318  34.421 105.877 1.00 54.81  ? 364 PRO B O     1 
ATOM   6570  C CB    . PRO B 1 364 ? -7.333  36.119 106.186 1.00 55.65  ? 364 PRO B CB    1 
ATOM   6571  C CG    . PRO B 1 364 ? -8.485  35.530 105.446 1.00 55.72  ? 364 PRO B CG    1 
ATOM   6572  C CD    . PRO B 1 364 ? -8.136  35.550 103.986 1.00 55.10  ? 364 PRO B CD    1 
ATOM   6573  N N     . GLN B 1 365 ? -6.013  33.529 104.790 1.00 52.86  ? 365 GLN B N     1 
ATOM   6574  C CA    . GLN B 1 365 ? -5.493  32.179 104.718 1.00 54.65  ? 365 GLN B CA    1 
ATOM   6575  C C     . GLN B 1 365 ? -4.153  32.026 104.012 1.00 57.04  ? 365 GLN B C     1 
ATOM   6576  O O     . GLN B 1 365 ? -3.541  30.948 104.031 1.00 58.82  ? 365 GLN B O     1 
ATOM   6577  C CB    . GLN B 1 365 ? -6.566  31.312 104.018 1.00 56.37  ? 365 GLN B CB    1 
ATOM   6578  C CG    . GLN B 1 365 ? -7.781  31.179 104.914 1.00 61.74  ? 365 GLN B CG    1 
ATOM   6579  C CD    . GLN B 1 365 ? -8.897  30.240 104.561 1.00 59.95  ? 365 GLN B CD    1 
ATOM   6580  O OE1   . GLN B 1 365 ? -8.814  29.305 103.763 1.00 61.17  ? 365 GLN B OE1   1 
ATOM   6581  N NE2   . GLN B 1 365 ? -10.054 30.468 105.195 1.00 59.10  ? 365 GLN B NE2   1 
ATOM   6582  N N     . ILE B 1 366 ? -3.672  33.061 103.324 1.00 57.07  ? 366 ILE B N     1 
ATOM   6583  C CA    . ILE B 1 366 ? -2.396  33.089 102.650 1.00 53.05  ? 366 ILE B CA    1 
ATOM   6584  C C     . ILE B 1 366 ? -1.454  34.085 103.330 1.00 52.36  ? 366 ILE B C     1 
ATOM   6585  O O     . ILE B 1 366 ? -1.653  35.291 103.433 1.00 52.01  ? 366 ILE B O     1 
ATOM   6586  C CB    . ILE B 1 366 ? -2.448  33.359 101.143 1.00 50.41  ? 366 ILE B CB    1 
ATOM   6587  C CG1   . ILE B 1 366 ? -3.064  32.153 100.410 1.00 46.90  ? 366 ILE B CG1   1 
ATOM   6588  C CG2   . ILE B 1 366 ? -1.052  33.616 100.577 1.00 52.22  ? 366 ILE B CG2   1 
ATOM   6589  C CD1   . ILE B 1 366 ? -3.891  32.561 99.208  1.00 51.96  ? 366 ILE B CD1   1 
ATOM   6590  N N     . PRO B 1 367 ? -0.351  33.514 103.816 1.00 52.51  ? 367 PRO B N     1 
ATOM   6591  C CA    . PRO B 1 367 ? 0.698   34.276 104.462 1.00 52.80  ? 367 PRO B CA    1 
ATOM   6592  C C     . PRO B 1 367 ? 1.627   34.883 103.416 1.00 53.79  ? 367 PRO B C     1 
ATOM   6593  O O     . PRO B 1 367 ? 1.883   34.247 102.388 1.00 52.19  ? 367 PRO B O     1 
ATOM   6594  C CB    . PRO B 1 367 ? 1.438   33.232 105.275 1.00 53.60  ? 367 PRO B CB    1 
ATOM   6595  C CG    . PRO B 1 367 ? 1.119   31.907 104.693 1.00 52.36  ? 367 PRO B CG    1 
ATOM   6596  C CD    . PRO B 1 367 ? -0.036  32.064 103.761 1.00 52.49  ? 367 PRO B CD    1 
ATOM   6597  N N     . GLY B 1 368 ? 2.162   36.058 103.692 1.00 52.28  ? 368 GLY B N     1 
ATOM   6598  C CA    . GLY B 1 368 ? 3.100   36.729 102.827 1.00 55.46  ? 368 GLY B CA    1 
ATOM   6599  C C     . GLY B 1 368 ? 3.934   35.855 101.920 1.00 57.20  ? 368 GLY B C     1 
ATOM   6600  O O     . GLY B 1 368 ? 3.784   35.825 100.683 1.00 57.87  ? 368 GLY B O     1 
ATOM   6601  N N     . ASP B 1 369 ? 4.795   35.006 102.460 1.00 55.82  ? 369 ASP B N     1 
ATOM   6602  C CA    . ASP B 1 369 ? 5.698   34.148 101.710 1.00 55.73  ? 369 ASP B CA    1 
ATOM   6603  C C     . ASP B 1 369 ? 5.048   33.158 100.768 1.00 52.03  ? 369 ASP B C     1 
ATOM   6604  O O     . ASP B 1 369 ? 5.762   32.471 100.013 1.00 54.04  ? 369 ASP B O     1 
ATOM   6605  C CB    . ASP B 1 369 ? 6.696   33.489 102.678 1.00 62.33  ? 369 ASP B CB    1 
ATOM   6606  C CG    . ASP B 1 369 ? 6.048   32.487 103.605 1.00 63.59  ? 369 ASP B CG    1 
ATOM   6607  O OD1   . ASP B 1 369 ? 4.894   32.697 104.030 1.00 68.20  ? 369 ASP B OD1   1 
ATOM   6608  O OD2   . ASP B 1 369 ? 6.704   31.467 103.896 1.00 70.55  ? 369 ASP B OD2   1 
ATOM   6609  N N     . GLN B 1 370 ? 3.732   33.058 100.720 1.00 48.05  ? 370 GLN B N     1 
ATOM   6610  C CA    . GLN B 1 370 ? 3.018   32.287 99.720  1.00 45.22  ? 370 GLN B CA    1 
ATOM   6611  C C     . GLN B 1 370 ? 2.333   33.246 98.717  1.00 42.10  ? 370 GLN B C     1 
ATOM   6612  O O     . GLN B 1 370 ? 1.622   32.831 97.813  1.00 37.89  ? 370 GLN B O     1 
ATOM   6613  C CB    . GLN B 1 370 ? 2.049   31.304 100.334 1.00 54.70  ? 370 GLN B CB    1 
ATOM   6614  C CG    . GLN B 1 370 ? 2.660   29.991 100.814 1.00 62.92  ? 370 GLN B CG    1 
ATOM   6615  C CD    . GLN B 1 370 ? 1.585   29.079 101.382 1.00 68.95  ? 370 GLN B CD    1 
ATOM   6616  O OE1   . GLN B 1 370 ? 0.502   29.547 101.752 1.00 69.80  ? 370 GLN B OE1   1 
ATOM   6617  N NE2   . GLN B 1 370 ? 1.859   27.782 101.453 1.00 71.58  ? 370 GLN B NE2   1 
ATOM   6618  N N     . PHE B 1 371 ? 2.614   34.524 98.823  1.00 36.87  ? 371 PHE B N     1 
ATOM   6619  C CA    . PHE B 1 371 ? 2.236   35.650 98.015  1.00 44.65  ? 371 PHE B CA    1 
ATOM   6620  C C     . PHE B 1 371 ? 0.736   35.821 97.784  1.00 44.71  ? 371 PHE B C     1 
ATOM   6621  O O     . PHE B 1 371 ? 0.178   35.422 96.761  1.00 42.56  ? 371 PHE B O     1 
ATOM   6622  C CB    . PHE B 1 371 ? 2.993   35.655 96.666  1.00 43.24  ? 371 PHE B CB    1 
ATOM   6623  C CG    . PHE B 1 371 ? 4.470   35.406 96.841  1.00 44.94  ? 371 PHE B CG    1 
ATOM   6624  C CD1   . PHE B 1 371 ? 5.269   36.333 97.484  1.00 46.86  ? 371 PHE B CD1   1 
ATOM   6625  C CD2   . PHE B 1 371 ? 5.031   34.216 96.406  1.00 44.73  ? 371 PHE B CD2   1 
ATOM   6626  C CE1   . PHE B 1 371 ? 6.619   36.089 97.669  1.00 46.59  ? 371 PHE B CE1   1 
ATOM   6627  C CE2   . PHE B 1 371 ? 6.372   33.961 96.598  1.00 50.16  ? 371 PHE B CE2   1 
ATOM   6628  C CZ    . PHE B 1 371 ? 7.166   34.904 97.218  1.00 46.35  ? 371 PHE B CZ    1 
ATOM   6629  N N     . PRO B 1 372 ? 0.070   36.431 98.771  1.00 44.39  ? 372 PRO B N     1 
ATOM   6630  C CA    . PRO B 1 372 ? -1.372  36.605 98.788  1.00 40.40  ? 372 PRO B CA    1 
ATOM   6631  C C     . PRO B 1 372 ? -1.886  37.496 97.676  1.00 34.61  ? 372 PRO B C     1 
ATOM   6632  O O     . PRO B 1 372 ? -2.760  37.054 96.943  1.00 35.71  ? 372 PRO B O     1 
ATOM   6633  C CB    . PRO B 1 372 ? -1.674  37.161 100.178 1.00 40.06  ? 372 PRO B CB    1 
ATOM   6634  C CG    . PRO B 1 372 ? -0.411  37.863 100.566 1.00 39.66  ? 372 PRO B CG    1 
ATOM   6635  C CD    . PRO B 1 372 ? 0.666   36.931 100.043 1.00 42.31  ? 372 PRO B CD    1 
ATOM   6636  N N     . ALA B 1 373 ? -1.332  38.684 97.519  1.00 30.99  ? 373 ALA B N     1 
ATOM   6637  C CA    . ALA B 1 373 ? -1.697  39.591 96.443  1.00 32.35  ? 373 ALA B CA    1 
ATOM   6638  C C     . ALA B 1 373 ? -1.445  38.985 95.062  1.00 33.41  ? 373 ALA B C     1 
ATOM   6639  O O     . ALA B 1 373 ? -2.293  39.164 94.181  1.00 31.77  ? 373 ALA B O     1 
ATOM   6640  C CB    . ALA B 1 373 ? -1.008  40.925 96.535  1.00 21.77  ? 373 ALA B CB    1 
ATOM   6641  N N     . GLN B 1 374 ? -0.379  38.206 94.890  1.00 32.80  ? 374 GLN B N     1 
ATOM   6642  C CA    . GLN B 1 374 ? -0.083  37.542 93.633  1.00 32.96  ? 374 GLN B CA    1 
ATOM   6643  C C     . GLN B 1 374 ? -1.089  36.430 93.381  1.00 34.99  ? 374 GLN B C     1 
ATOM   6644  O O     . GLN B 1 374 ? -1.444  36.128 92.238  1.00 31.02  ? 374 GLN B O     1 
ATOM   6645  C CB    . GLN B 1 374 ? 1.352   36.997 93.521  1.00 32.22  ? 374 GLN B CB    1 
ATOM   6646  C CG    . GLN B 1 374 ? 1.773   36.619 92.102  1.00 33.16  ? 374 GLN B CG    1 
ATOM   6647  C CD    . GLN B 1 374 ? 1.716   37.793 91.138  1.00 31.74  ? 374 GLN B CD    1 
ATOM   6648  O OE1   . GLN B 1 374 ? 2.261   38.884 91.351  1.00 25.09  ? 374 GLN B OE1   1 
ATOM   6649  N NE2   . GLN B 1 374 ? 0.973   37.598 90.041  1.00 21.19  ? 374 GLN B NE2   1 
ATOM   6650  N N     . ALA B 1 375 ? -1.601  35.833 94.474  1.00 33.02  ? 375 ALA B N     1 
ATOM   6651  C CA    . ALA B 1 375 ? -2.611  34.794 94.292  1.00 31.50  ? 375 ALA B CA    1 
ATOM   6652  C C     . ALA B 1 375 ? -3.897  35.430 93.749  1.00 24.65  ? 375 ALA B C     1 
ATOM   6653  O O     . ALA B 1 375 ? -4.614  34.768 93.016  1.00 27.47  ? 375 ALA B O     1 
ATOM   6654  C CB    . ALA B 1 375 ? -2.919  34.084 95.604  1.00 35.44  ? 375 ALA B CB    1 
ATOM   6655  N N     . VAL B 1 376 ? -4.222  36.612 94.238  1.00 25.07  ? 376 VAL B N     1 
ATOM   6656  C CA    . VAL B 1 376 ? -5.430  37.302 93.753  1.00 30.71  ? 376 VAL B CA    1 
ATOM   6657  C C     . VAL B 1 376 ? -5.300  37.686 92.273  1.00 25.84  ? 376 VAL B C     1 
ATOM   6658  O O     . VAL B 1 376 ? -6.126  37.320 91.432  1.00 26.25  ? 376 VAL B O     1 
ATOM   6659  C CB    . VAL B 1 376 ? -5.715  38.513 94.654  1.00 31.66  ? 376 VAL B CB    1 
ATOM   6660  C CG1   . VAL B 1 376 ? -6.916  39.294 94.155  1.00 27.96  ? 376 VAL B CG1   1 
ATOM   6661  C CG2   . VAL B 1 376 ? -5.987  38.037 96.095  1.00 35.52  ? 376 VAL B CG2   1 
ATOM   6662  N N     . ILE B 1 377 ? -4.192  38.315 91.919  1.00 24.91  ? 377 ILE B N     1 
ATOM   6663  C CA    . ILE B 1 377 ? -3.887  38.680 90.535  1.00 22.49  ? 377 ILE B CA    1 
ATOM   6664  C C     . ILE B 1 377 ? -4.038  37.506 89.582  1.00 21.96  ? 377 ILE B C     1 
ATOM   6665  O O     . ILE B 1 377 ? -4.753  37.650 88.585  1.00 19.28  ? 377 ILE B O     1 
ATOM   6666  C CB    . ILE B 1 377 ? -2.476  39.284 90.448  1.00 25.71  ? 377 ILE B CB    1 
ATOM   6667  C CG1   . ILE B 1 377 ? -2.537  40.660 91.115  1.00 20.35  ? 377 ILE B CG1   1 
ATOM   6668  C CG2   . ILE B 1 377 ? -1.964  39.381 89.007  1.00 24.26  ? 377 ILE B CG2   1 
ATOM   6669  C CD1   . ILE B 1 377 ? -1.227  41.084 91.721  1.00 19.45  ? 377 ILE B CD1   1 
ATOM   6670  N N     . ASN B 1 378 ? -3.456  36.346 89.869  1.00 20.04  ? 378 ASN B N     1 
ATOM   6671  C CA    . ASN B 1 378 ? -3.557  35.209 88.976  1.00 21.80  ? 378 ASN B CA    1 
ATOM   6672  C C     . ASN B 1 378 ? -4.985  34.701 88.821  1.00 29.50  ? 378 ASN B C     1 
ATOM   6673  O O     . ASN B 1 378 ? -5.350  34.314 87.708  1.00 27.88  ? 378 ASN B O     1 
ATOM   6674  C CB    . ASN B 1 378 ? -2.651  34.050 89.381  1.00 27.85  ? 378 ASN B CB    1 
ATOM   6675  C CG    . ASN B 1 378 ? -1.183  34.366 89.178  1.00 31.63  ? 378 ASN B CG    1 
ATOM   6676  O OD1   . ASN B 1 378 ? -0.776  35.506 88.969  1.00 27.26  ? 378 ASN B OD1   1 
ATOM   6677  N ND2   . ASN B 1 378 ? -0.373  33.324 89.260  1.00 29.45  ? 378 ASN B ND2   1 
ATOM   6678  N N     . ALA B 1 379 ? -5.775  34.725 89.905  1.00 29.00  ? 379 ALA B N     1 
ATOM   6679  C CA    . ALA B 1 379 ? -7.159  34.252 89.790  1.00 28.70  ? 379 ALA B CA    1 
ATOM   6680  C C     . ALA B 1 379 ? -7.960  35.278 88.987  1.00 19.53  ? 379 ALA B C     1 
ATOM   6681  O O     . ALA B 1 379 ? -8.782  34.902 88.171  1.00 23.61  ? 379 ALA B O     1 
ATOM   6682  C CB    . ALA B 1 379 ? -7.821  34.065 91.155  1.00 28.67  ? 379 ALA B CB    1 
ATOM   6683  N N     . LEU B 1 380 ? -7.700  36.552 89.238  1.00 20.46  ? 380 LEU B N     1 
ATOM   6684  C CA    . LEU B 1 380 ? -8.359  37.592 88.457  1.00 20.29  ? 380 LEU B CA    1 
ATOM   6685  C C     . LEU B 1 380 ? -8.036  37.420 86.958  1.00 22.81  ? 380 LEU B C     1 
ATOM   6686  O O     . LEU B 1 380 ? -8.951  37.460 86.125  1.00 20.69  ? 380 LEU B O     1 
ATOM   6687  C CB    . LEU B 1 380 ? -7.941  38.967 88.963  1.00 21.19  ? 380 LEU B CB    1 
ATOM   6688  C CG    . LEU B 1 380 ? -8.390  40.133 88.049  1.00 21.71  ? 380 LEU B CG    1 
ATOM   6689  C CD1   . LEU B 1 380 ? -9.920  40.215 88.012  1.00 25.32  ? 380 LEU B CD1   1 
ATOM   6690  C CD2   . LEU B 1 380 ? -7.799  41.452 88.488  1.00 19.91  ? 380 LEU B CD2   1 
ATOM   6691  N N     . TYR B 1 381 ? -6.769  37.135 86.604  1.00 21.40  ? 381 TYR B N     1 
ATOM   6692  C CA    . TYR B 1 381 ? -6.375  36.936 85.220  1.00 22.11  ? 381 TYR B CA    1 
ATOM   6693  C C     . TYR B 1 381 ? -7.122  35.770 84.606  1.00 22.59  ? 381 TYR B C     1 
ATOM   6694  O O     . TYR B 1 381 ? -7.727  35.872 83.536  1.00 21.33  ? 381 TYR B O     1 
ATOM   6695  C CB    . TYR B 1 381 ? -4.842  36.736 85.020  1.00 24.76  ? 381 TYR B CB    1 
ATOM   6696  C CG    . TYR B 1 381 ? -4.579  36.305 83.564  1.00 24.36  ? 381 TYR B CG    1 
ATOM   6697  C CD1   . TYR B 1 381 ? -4.643  37.235 82.529  1.00 23.00  ? 381 TYR B CD1   1 
ATOM   6698  C CD2   . TYR B 1 381 ? -4.310  34.984 83.266  1.00 23.42  ? 381 TYR B CD2   1 
ATOM   6699  C CE1   . TYR B 1 381 ? -4.443  36.821 81.219  1.00 22.56  ? 381 TYR B CE1   1 
ATOM   6700  C CE2   . TYR B 1 381 ? -4.120  34.569 81.965  1.00 28.77  ? 381 TYR B CE2   1 
ATOM   6701  C CZ    . TYR B 1 381 ? -4.186  35.506 80.941  1.00 28.04  ? 381 TYR B CZ    1 
ATOM   6702  O OH    . TYR B 1 381 ? -4.009  35.075 79.644  1.00 28.50  ? 381 TYR B OH    1 
ATOM   6703  N N     . LEU B 1 382 ? -7.096  34.628 85.320  1.00 24.62  ? 382 LEU B N     1 
ATOM   6704  C CA    . LEU B 1 382 ? -7.780  33.435 84.840  1.00 24.35  ? 382 LEU B CA    1 
ATOM   6705  C C     . LEU B 1 382 ? -9.273  33.610 84.672  1.00 24.22  ? 382 LEU B C     1 
ATOM   6706  O O     . LEU B 1 382 ? -9.828  33.064 83.723  1.00 24.26  ? 382 LEU B O     1 
ATOM   6707  C CB    . LEU B 1 382 ? -7.490  32.227 85.741  1.00 36.49  ? 382 LEU B CB    1 
ATOM   6708  C CG    . LEU B 1 382 ? -6.100  31.608 85.562  1.00 37.57  ? 382 LEU B CG    1 
ATOM   6709  C CD1   . LEU B 1 382 ? -5.813  30.589 86.645  1.00 41.57  ? 382 LEU B CD1   1 
ATOM   6710  C CD2   . LEU B 1 382 ? -5.994  30.970 84.178  1.00 40.95  ? 382 LEU B CD2   1 
ATOM   6711  N N     . GLU B 1 383 ? -9.911  34.353 85.560  1.00 25.89  ? 383 GLU B N     1 
ATOM   6712  C CA    . GLU B 1 383 ? -11.344 34.566 85.486  1.00 31.52  ? 383 GLU B CA    1 
ATOM   6713  C C     . GLU B 1 383 ? -11.758 35.521 84.364  1.00 31.64  ? 383 GLU B C     1 
ATOM   6714  O O     . GLU B 1 383 ? -12.855 35.366 83.845  1.00 28.54  ? 383 GLU B O     1 
ATOM   6715  C CB    . GLU B 1 383 ? -11.878 35.221 86.780  1.00 34.56  ? 383 GLU B CB    1 
ATOM   6716  C CG    . GLU B 1 383 ? -11.954 34.259 87.946  1.00 46.78  ? 383 GLU B CG    1 
ATOM   6717  C CD    . GLU B 1 383 ? -12.836 33.057 87.668  1.00 48.56  ? 383 GLU B CD    1 
ATOM   6718  O OE1   . GLU B 1 383 ? -14.028 33.297 87.385  1.00 47.55  ? 383 GLU B OE1   1 
ATOM   6719  O OE2   . GLU B 1 383 ? -12.304 31.932 87.740  1.00 50.16  ? 383 GLU B OE2   1 
ATOM   6720  N N     . SER B 1 384 ? -10.937 36.531 84.106  1.00 27.99  ? 384 SER B N     1 
ATOM   6721  C CA    . SER B 1 384 ? -11.312 37.566 83.169  1.00 28.06  ? 384 SER B CA    1 
ATOM   6722  C C     . SER B 1 384 ? -10.374 37.976 82.047  1.00 24.92  ? 384 SER B C     1 
ATOM   6723  O O     . SER B 1 384 ? -10.790 38.862 81.294  1.00 17.71  ? 384 SER B O     1 
ATOM   6724  C CB    . SER B 1 384 ? -11.554 38.820 84.052  1.00 17.07  ? 384 SER B CB    1 
ATOM   6725  O OG    . SER B 1 384 ? -10.329 39.212 84.641  1.00 23.04  ? 384 SER B OG    1 
ATOM   6726  N N     . GLY B 1 385 ? -9.105  37.560 82.011  1.00 23.12  ? 385 GLY B N     1 
ATOM   6727  C CA    . GLY B 1 385 ? -8.191  38.074 81.008  1.00 22.73  ? 385 GLY B CA    1 
ATOM   6728  C C     . GLY B 1 385 ? -7.615  39.424 81.432  1.00 23.06  ? 385 GLY B C     1 
ATOM   6729  O O     . GLY B 1 385 ? -6.803  39.989 80.693  1.00 18.48  ? 385 GLY B O     1 
ATOM   6730  N N     . VAL B 1 386 ? -7.943  39.906 82.639  1.00 15.15  ? 386 VAL B N     1 
ATOM   6731  C CA    . VAL B 1 386 ? -7.401  41.206 83.039  1.00 16.27  ? 386 VAL B CA    1 
ATOM   6732  C C     . VAL B 1 386 ? -5.999  40.986 83.608  1.00 18.79  ? 386 VAL B C     1 
ATOM   6733  O O     . VAL B 1 386 ? -5.893  40.024 84.373  1.00 22.42  ? 386 VAL B O     1 
ATOM   6734  C CB    . VAL B 1 386 ? -8.312  41.866 84.085  1.00 20.44  ? 386 VAL B CB    1 
ATOM   6735  C CG1   . VAL B 1 386 ? -7.704  43.135 84.677  1.00 15.10  ? 386 VAL B CG1   1 
ATOM   6736  C CG2   . VAL B 1 386 ? -9.679  42.230 83.503  1.00 18.73  ? 386 VAL B CG2   1 
ATOM   6737  N N     . ARG B 1 387 ? -5.009  41.815 83.314  1.00 14.80  ? 387 ARG B N     1 
ATOM   6738  C CA    . ARG B 1 387 ? -3.691  41.593 83.933  1.00 18.68  ? 387 ARG B CA    1 
ATOM   6739  C C     . ARG B 1 387 ? -3.394  42.700 84.949  1.00 16.07  ? 387 ARG B C     1 
ATOM   6740  O O     . ARG B 1 387 ? -3.412  43.881 84.601  1.00 16.88  ? 387 ARG B O     1 
ATOM   6741  C CB    . ARG B 1 387 ? -2.548  41.537 82.931  1.00 14.47  ? 387 ARG B CB    1 
ATOM   6742  C CG    . ARG B 1 387 ? -1.144  41.741 83.469  1.00 16.54  ? 387 ARG B CG    1 
ATOM   6743  C CD    . ARG B 1 387 ? -0.123  41.177 82.455  1.00 19.41  ? 387 ARG B CD    1 
ATOM   6744  N NE    . ARG B 1 387 ? 0.142   42.083 81.353  1.00 13.84  ? 387 ARG B NE    1 
ATOM   6745  C CZ    . ARG B 1 387 ? 0.994   41.877 80.363  1.00 17.87  ? 387 ARG B CZ    1 
ATOM   6746  N NH1   . ARG B 1 387 ? 1.776   40.810 80.318  1.00 10.48  ? 387 ARG B NH1   1 
ATOM   6747  N NH2   . ARG B 1 387 ? 1.087   42.764 79.373  1.00 13.47  ? 387 ARG B NH2   1 
ATOM   6748  N N     . ALA B 1 388 ? -3.118  42.327 86.190  1.00 14.48  ? 388 ALA B N     1 
ATOM   6749  C CA    . ALA B 1 388 ? -2.758  43.408 87.140  1.00 15.07  ? 388 ALA B CA    1 
ATOM   6750  C C     . ALA B 1 388 ? -1.351  43.116 87.672  1.00 16.94  ? 388 ALA B C     1 
ATOM   6751  O O     . ALA B 1 388 ? -0.737  42.126 87.242  1.00 16.65  ? 388 ALA B O     1 
ATOM   6752  C CB    . ALA B 1 388 ? -3.801  43.499 88.249  1.00 15.59  ? 388 ALA B CB    1 
ATOM   6753  N N     . VAL B 1 389 ? -0.887  43.938 88.612  1.00 19.59  ? 389 VAL B N     1 
ATOM   6754  C CA    . VAL B 1 389 ? 0.457   43.743 89.166  1.00 24.34  ? 389 VAL B CA    1 
ATOM   6755  C C     . VAL B 1 389 ? 0.565   43.814 90.697  1.00 29.01  ? 389 VAL B C     1 
ATOM   6756  O O     . VAL B 1 389 ? -0.102  44.561 91.402  1.00 25.00  ? 389 VAL B O     1 
ATOM   6757  C CB    . VAL B 1 389 ? 1.417   44.770 88.540  1.00 14.81  ? 389 VAL B CB    1 
ATOM   6758  C CG1   . VAL B 1 389 ? 1.062   46.176 88.974  1.00 16.61  ? 389 VAL B CG1   1 
ATOM   6759  C CG2   . VAL B 1 389 ? 2.872   44.419 88.799  1.00 20.42  ? 389 VAL B CG2   1 
ATOM   6760  N N     . GLU B 1 390 ? 1.417   42.944 91.252  1.00 31.45  ? 390 GLU B N     1 
ATOM   6761  C CA    . GLU B 1 390 ? 1.591   42.805 92.691  1.00 31.74  ? 390 GLU B CA    1 
ATOM   6762  C C     . GLU B 1 390 ? 2.457   43.867 93.315  1.00 31.82  ? 390 GLU B C     1 
ATOM   6763  O O     . GLU B 1 390 ? 3.509   44.258 92.796  1.00 32.66  ? 390 GLU B O     1 
ATOM   6764  C CB    . GLU B 1 390 ? 2.133   41.405 93.007  1.00 33.30  ? 390 GLU B CB    1 
ATOM   6765  C CG    . GLU B 1 390 ? 1.924   41.046 94.473  1.00 43.40  ? 390 GLU B CG    1 
ATOM   6766  C CD    . GLU B 1 390 ? 3.200   40.953 95.298  1.00 40.72  ? 390 GLU B CD    1 
ATOM   6767  O OE1   . GLU B 1 390 ? 4.137   41.743 95.064  1.00 32.55  ? 390 GLU B OE1   1 
ATOM   6768  O OE2   . GLU B 1 390 ? 3.230   40.064 96.177  1.00 40.31  ? 390 GLU B OE2   1 
ATOM   6769  N N     . ILE B 1 391 ? 1.966   44.492 94.381  1.00 32.27  ? 391 ILE B N     1 
ATOM   6770  C CA    . ILE B 1 391 ? 2.747   45.507 95.098  1.00 34.91  ? 391 ILE B CA    1 
ATOM   6771  C C     . ILE B 1 391 ? 2.838   44.953 96.538  1.00 41.81  ? 391 ILE B C     1 
ATOM   6772  O O     . ILE B 1 391 ? 2.182   45.461 97.455  1.00 40.30  ? 391 ILE B O     1 
ATOM   6773  C CB    . ILE B 1 391 ? 2.206   46.917 95.076  1.00 29.95  ? 391 ILE B CB    1 
ATOM   6774  C CG1   . ILE B 1 391 ? 2.143   47.538 93.678  1.00 40.17  ? 391 ILE B CG1   1 
ATOM   6775  C CG2   . ILE B 1 391 ? 3.044   47.854 95.962  1.00 32.19  ? 391 ILE B CG2   1 
ATOM   6776  C CD1   . ILE B 1 391 ? 3.425   47.468 92.872  1.00 41.28  ? 391 ILE B CD1   1 
ATOM   6777  N N     . GLY B 1 392 ? 3.507   43.796 96.660  1.00 39.61  ? 392 GLY B N     1 
ATOM   6778  C CA    . GLY B 1 392 ? 3.552   43.154 97.961  1.00 45.31  ? 392 GLY B CA    1 
ATOM   6779  C C     . GLY B 1 392 ? 4.884   42.583 98.422  1.00 46.79  ? 392 GLY B C     1 
ATOM   6780  O O     . GLY B 1 392 ? 5.929   43.236 98.379  1.00 45.34  ? 392 GLY B O     1 
ATOM   6781  N N     . SER B 1 393 ? 4.811   41.334 98.893  1.00 45.31  ? 393 SER B N     1 
ATOM   6782  C CA    . SER B 1 393 ? 6.009   40.674 99.400  1.00 49.08  ? 393 SER B CA    1 
ATOM   6783  C C     . SER B 1 393 ? 6.726   39.941 98.273  1.00 48.76  ? 393 SER B C     1 
ATOM   6784  O O     . SER B 1 393 ? 7.948   39.748 98.321  1.00 44.55  ? 393 SER B O     1 
ATOM   6785  C CB    . SER B 1 393 ? 5.666   39.820 100.618 1.00 51.87  ? 393 SER B CB    1 
ATOM   6786  O OG    . SER B 1 393 ? 4.848   38.717 100.337 1.00 55.81  ? 393 SER B OG    1 
ATOM   6787  N N     . PHE B 1 394 ? 5.995   39.625 97.194  1.00 45.26  ? 394 PHE B N     1 
ATOM   6788  C CA    . PHE B 1 394 ? 6.615   39.009 96.030  1.00 43.51  ? 394 PHE B CA    1 
ATOM   6789  C C     . PHE B 1 394 ? 7.644   39.994 95.466  1.00 40.42  ? 394 PHE B C     1 
ATOM   6790  O O     . PHE B 1 394 ? 8.787   39.632 95.205  1.00 39.85  ? 394 PHE B O     1 
ATOM   6791  C CB    . PHE B 1 394 ? 5.649   38.621 94.925  1.00 47.32  ? 394 PHE B CB    1 
ATOM   6792  C CG    . PHE B 1 394 ? 6.208   37.918 93.730  1.00 50.43  ? 394 PHE B CG    1 
ATOM   6793  C CD1   . PHE B 1 394 ? 7.184   36.942 93.837  1.00 49.90  ? 394 PHE B CD1   1 
ATOM   6794  C CD2   . PHE B 1 394 ? 5.732   38.247 92.462  1.00 50.80  ? 394 PHE B CD2   1 
ATOM   6795  C CE1   . PHE B 1 394 ? 7.676   36.296 92.717  1.00 47.26  ? 394 PHE B CE1   1 
ATOM   6796  C CE2   . PHE B 1 394 ? 6.219   37.597 91.340  1.00 49.47  ? 394 PHE B CE2   1 
ATOM   6797  C CZ    . PHE B 1 394 ? 7.195   36.627 91.467  1.00 49.14  ? 394 PHE B CZ    1 
ATOM   6798  N N     . LEU B 1 395 ? 7.192   41.228 95.376  1.00 36.39  ? 395 LEU B N     1 
ATOM   6799  C CA    . LEU B 1 395 ? 7.999   42.332 94.897  1.00 38.63  ? 395 LEU B CA    1 
ATOM   6800  C C     . LEU B 1 395 ? 9.094   42.713 95.879  1.00 42.33  ? 395 LEU B C     1 
ATOM   6801  O O     . LEU B 1 395 ? 10.216  43.085 95.531  1.00 38.57  ? 395 LEU B O     1 
ATOM   6802  C CB    . LEU B 1 395 ? 7.051   43.518 94.694  1.00 32.40  ? 395 LEU B CB    1 
ATOM   6803  C CG    . LEU B 1 395 ? 7.676   44.887 94.502  1.00 32.60  ? 395 LEU B CG    1 
ATOM   6804  C CD1   . LEU B 1 395 ? 8.566   44.887 93.263  1.00 42.15  ? 395 LEU B CD1   1 
ATOM   6805  C CD2   . LEU B 1 395 ? 6.647   45.982 94.361  1.00 32.27  ? 395 LEU B CD2   1 
ATOM   6806  N N     . LEU B 1 396 ? 8.744   42.687 97.173  1.00 47.86  ? 396 LEU B N     1 
ATOM   6807  C CA    . LEU B 1 396 ? 9.655   43.067 98.250  1.00 48.59  ? 396 LEU B CA    1 
ATOM   6808  C C     . LEU B 1 396 ? 10.915  42.204 98.233  1.00 47.06  ? 396 LEU B C     1 
ATOM   6809  O O     . LEU B 1 396 ? 11.988  42.752 98.474  1.00 48.50  ? 396 LEU B O     1 
ATOM   6810  C CB    . LEU B 1 396 ? 8.957   43.013 99.604  1.00 56.50  ? 396 LEU B CB    1 
ATOM   6811  C CG    . LEU B 1 396 ? 9.263   44.142 100.589 1.00 63.22  ? 396 LEU B CG    1 
ATOM   6812  C CD1   . LEU B 1 396 ? 9.267   45.514 99.938  1.00 63.36  ? 396 LEU B CD1   1 
ATOM   6813  C CD2   . LEU B 1 396 ? 8.253   44.110 101.732 1.00 65.62  ? 396 LEU B CD2   1 
ATOM   6814  N N     . GLY B 1 397 ? 10.767  40.923 97.921  1.00 46.14  ? 397 GLY B N     1 
ATOM   6815  C CA    . GLY B 1 397 ? 11.876  40.018 97.784  1.00 52.49  ? 397 GLY B CA    1 
ATOM   6816  C C     . GLY B 1 397 ? 12.484  39.635 99.129  1.00 57.78  ? 397 GLY B C     1 
ATOM   6817  O O     . GLY B 1 397 ? 11.969  39.948 100.205 1.00 54.97  ? 397 GLY B O     1 
ATOM   6818  N N     . ARG B 1 398 ? 13.614  38.940 99.037  1.00 60.33  ? 398 ARG B N     1 
ATOM   6819  C CA    . ARG B 1 398 ? 14.306  38.442 100.207 1.00 62.75  ? 398 ARG B CA    1 
ATOM   6820  C C     . ARG B 1 398 ? 15.125  39.466 100.971 1.00 67.44  ? 398 ARG B C     1 
ATOM   6821  O O     . ARG B 1 398 ? 15.527  40.508 100.460 1.00 65.84  ? 398 ARG B O     1 
ATOM   6822  C CB    . ARG B 1 398 ? 15.195  37.264 99.770  1.00 51.11  ? 398 ARG B CB    1 
ATOM   6823  C CG    . ARG B 1 398 ? 14.337  36.009 99.685  1.00 47.68  ? 398 ARG B CG    1 
ATOM   6824  C CD    . ARG B 1 398 ? 15.067  34.850 99.084  1.00 53.91  ? 398 ARG B CD    1 
ATOM   6825  N NE    . ARG B 1 398 ? 14.314  33.651 98.883  1.00 55.95  ? 398 ARG B NE    1 
ATOM   6826  C CZ    . ARG B 1 398 ? 13.435  33.001 99.608  1.00 60.96  ? 398 ARG B CZ    1 
ATOM   6827  N NH1   . ARG B 1 398 ? 13.068  33.463 100.795 1.00 64.45  ? 398 ARG B NH1   1 
ATOM   6828  N NH2   . ARG B 1 398 ? 12.907  31.874 99.126  1.00 61.13  ? 398 ARG B NH2   1 
ATOM   6829  N N     . ASP B 1 399 ? 15.339  39.114 102.246 1.00 73.61  ? 399 ASP B N     1 
ATOM   6830  C CA    . ASP B 1 399 ? 16.194  39.917 103.124 1.00 78.83  ? 399 ASP B CA    1 
ATOM   6831  C C     . ASP B 1 399 ? 17.632  39.444 102.894 1.00 79.77  ? 399 ASP B C     1 
ATOM   6832  O O     . ASP B 1 399 ? 17.931  38.249 102.863 1.00 78.50  ? 399 ASP B O     1 
ATOM   6833  C CB    . ASP B 1 399 ? 15.776  39.817 104.583 1.00 85.52  ? 399 ASP B CB    1 
ATOM   6834  C CG    . ASP B 1 399 ? 16.771  40.414 105.562 1.00 89.99  ? 399 ASP B CG    1 
ATOM   6835  O OD1   . ASP B 1 399 ? 17.047  41.633 105.491 1.00 90.87  ? 399 ASP B OD1   1 
ATOM   6836  O OD2   . ASP B 1 399 ? 17.286  39.657 106.414 1.00 93.00  ? 399 ASP B OD2   1 
ATOM   6837  N N     . PRO B 1 400 ? 18.536  40.398 102.692 1.00 81.73  ? 400 PRO B N     1 
ATOM   6838  C CA    . PRO B 1 400 ? 19.935  40.128 102.417 1.00 83.89  ? 400 PRO B CA    1 
ATOM   6839  C C     . PRO B 1 400 ? 20.685  39.517 103.592 1.00 84.81  ? 400 PRO B C     1 
ATOM   6840  O O     . PRO B 1 400 ? 21.695  38.830 103.412 1.00 84.45  ? 400 PRO B O     1 
ATOM   6841  C CB    . PRO B 1 400 ? 20.522  41.469 102.005 1.00 83.86  ? 400 PRO B CB    1 
ATOM   6842  C CG    . PRO B 1 400 ? 19.587  42.504 102.512 1.00 84.02  ? 400 PRO B CG    1 
ATOM   6843  C CD    . PRO B 1 400 ? 18.245  41.854 102.686 1.00 82.99  ? 400 PRO B CD    1 
ATOM   6844  N N     . ALA B 1 401 ? 20.190  39.771 104.799 1.00 84.94  ? 401 ALA B N     1 
ATOM   6845  C CA    . ALA B 1 401 ? 20.740  39.211 106.015 1.00 85.51  ? 401 ALA B CA    1 
ATOM   6846  C C     . ALA B 1 401 ? 20.295  37.753 106.162 1.00 85.82  ? 401 ALA B C     1 
ATOM   6847  O O     . ALA B 1 401 ? 21.132  36.845 106.197 1.00 86.78  ? 401 ALA B O     1 
ATOM   6848  C CB    . ALA B 1 401 ? 20.293  40.023 107.224 1.00 84.36  ? 401 ALA B CB    1 
ATOM   6849  N N     . THR B 1 402 ? 18.987  37.533 106.236 1.00 84.31  ? 402 THR B N     1 
ATOM   6850  C CA    . THR B 1 402 ? 18.451  36.197 106.441 1.00 84.31  ? 402 THR B CA    1 
ATOM   6851  C C     . THR B 1 402 ? 18.462  35.307 105.207 1.00 83.70  ? 402 THR B C     1 
ATOM   6852  O O     . THR B 1 402 ? 18.736  34.107 105.270 1.00 82.37  ? 402 THR B O     1 
ATOM   6853  C CB    . THR B 1 402 ? 16.984  36.250 106.938 1.00 85.61  ? 402 THR B CB    1 
ATOM   6854  O OG1   . THR B 1 402 ? 16.211  37.111 106.090 1.00 86.05  ? 402 THR B OG1   1 
ATOM   6855  C CG2   . THR B 1 402 ? 16.911  36.742 108.372 1.00 85.23  ? 402 THR B CG2   1 
ATOM   6856  N N     . GLY B 1 403 ? 18.027  35.891 104.088 1.00 83.95  ? 403 GLY B N     1 
ATOM   6857  C CA    . GLY B 1 403 ? 17.882  35.154 102.836 1.00 82.27  ? 403 GLY B CA    1 
ATOM   6858  C C     . GLY B 1 403 ? 16.477  34.554 102.778 1.00 82.12  ? 403 GLY B C     1 
ATOM   6859  O O     . GLY B 1 403 ? 16.178  33.673 101.975 1.00 82.06  ? 403 GLY B O     1 
ATOM   6860  N N     . GLU B 1 404 ? 15.612  35.014 103.681 1.00 81.60  ? 404 GLU B N     1 
ATOM   6861  C CA    . GLU B 1 404 ? 14.242  34.529 103.747 1.00 81.18  ? 404 GLU B CA    1 
ATOM   6862  C C     . GLU B 1 404 ? 13.305  35.696 103.427 1.00 78.92  ? 404 GLU B C     1 
ATOM   6863  O O     . GLU B 1 404 ? 13.724  36.854 103.464 1.00 77.62  ? 404 GLU B O     1 
ATOM   6864  C CB    . GLU B 1 404 ? 13.865  33.912 105.085 1.00 86.12  ? 404 GLU B CB    1 
ATOM   6865  C CG    . GLU B 1 404 ? 14.975  33.495 106.022 1.00 93.57  ? 404 GLU B CG    1 
ATOM   6866  C CD    . GLU B 1 404 ? 15.454  32.068 105.846 1.00 97.83  ? 404 GLU B CD    1 
ATOM   6867  O OE1   . GLU B 1 404 ? 14.663  31.133 106.103 1.00 99.88  ? 404 GLU B OE1   1 
ATOM   6868  O OE2   . GLU B 1 404 ? 16.628  31.867 105.460 1.00 97.91  ? 404 GLU B OE2   1 
ATOM   6869  N N     . GLN B 1 405 ? 12.059  35.354 103.115 1.00 77.70  ? 405 GLN B N     1 
ATOM   6870  C CA    . GLN B 1 405 ? 11.068  36.362 102.801 1.00 75.70  ? 405 GLN B CA    1 
ATOM   6871  C C     . GLN B 1 405 ? 11.141  37.603 103.682 1.00 75.35  ? 405 GLN B C     1 
ATOM   6872  O O     . GLN B 1 405 ? 10.779  37.504 104.855 1.00 77.61  ? 405 GLN B O     1 
ATOM   6873  C CB    . GLN B 1 405 ? 9.629   35.816 102.921 1.00 71.59  ? 405 GLN B CB    1 
ATOM   6874  C CG    . GLN B 1 405 ? 8.566   36.848 102.503 1.00 65.96  ? 405 GLN B CG    1 
ATOM   6875  C CD    . GLN B 1 405 ? 8.965   37.494 101.175 1.00 55.30  ? 405 GLN B CD    1 
ATOM   6876  O OE1   . GLN B 1 405 ? 9.332   36.712 100.292 1.00 52.10  ? 405 GLN B OE1   1 
ATOM   6877  N NE2   . GLN B 1 405 ? 8.961   38.815 101.093 1.00 38.06  ? 405 GLN B NE2   1 
ATOM   6878  N N     . LYS B 1 406 ? 11.523  38.745 103.125 1.00 73.93  ? 406 LYS B N     1 
ATOM   6879  C CA    . LYS B 1 406 ? 11.512  39.973 103.929 1.00 74.52  ? 406 LYS B CA    1 
ATOM   6880  C C     . LYS B 1 406 ? 10.047  40.254 104.267 1.00 77.10  ? 406 LYS B C     1 
ATOM   6881  O O     . LYS B 1 406 ? 9.165   39.929 103.460 1.00 76.46  ? 406 LYS B O     1 
ATOM   6882  C CB    . LYS B 1 406 ? 12.188  41.112 103.199 1.00 69.82  ? 406 LYS B CB    1 
ATOM   6883  C CG    . LYS B 1 406 ? 11.639  42.494 103.457 1.00 72.05  ? 406 LYS B CG    1 
ATOM   6884  C CD    . LYS B 1 406 ? 12.720  43.555 103.508 1.00 72.94  ? 406 LYS B CD    1 
ATOM   6885  C CE    . LYS B 1 406 ? 13.238  43.895 102.123 1.00 74.16  ? 406 LYS B CE    1 
ATOM   6886  N NZ    . LYS B 1 406 ? 14.306  42.937 101.714 1.00 76.71  ? 406 LYS B NZ    1 
ATOM   6887  N N     . HIS B 1 407 ? 9.792   40.776 105.465 1.00 79.15  ? 407 HIS B N     1 
ATOM   6888  C CA    . HIS B 1 407 ? 8.416   41.014 105.890 1.00 80.52  ? 407 HIS B CA    1 
ATOM   6889  C C     . HIS B 1 407 ? 7.789   42.211 105.181 1.00 78.10  ? 407 HIS B C     1 
ATOM   6890  O O     . HIS B 1 407 ? 8.386   43.286 105.106 1.00 78.09  ? 407 HIS B O     1 
ATOM   6891  C CB    . HIS B 1 407 ? 8.309   41.182 107.411 1.00 89.29  ? 407 HIS B CB    1 
ATOM   6892  C CG    . HIS B 1 407 ? 6.904   41.085 107.930 1.00 94.82  ? 407 HIS B CG    1 
ATOM   6893  N ND1   . HIS B 1 407 ? 6.102   42.191 108.116 1.00 96.84  ? 407 HIS B ND1   1 
ATOM   6894  C CD2   . HIS B 1 407 ? 6.158   40.011 108.293 1.00 96.50  ? 407 HIS B CD2   1 
ATOM   6895  C CE1   . HIS B 1 407 ? 4.922   41.802 108.575 1.00 96.78  ? 407 HIS B CE1   1 
ATOM   6896  N NE2   . HIS B 1 407 ? 4.929   40.486 108.691 1.00 97.56  ? 407 HIS B NE2   1 
ATOM   6897  N N     . ALA B 1 408 ? 6.558   42.003 104.709 1.00 74.95  ? 408 ALA B N     1 
ATOM   6898  C CA    . ALA B 1 408 ? 5.855   43.066 103.999 1.00 72.94  ? 408 ALA B CA    1 
ATOM   6899  C C     . ALA B 1 408 ? 4.722   43.716 104.785 1.00 70.07  ? 408 ALA B C     1 
ATOM   6900  O O     . ALA B 1 408 ? 3.818   43.042 105.274 1.00 67.74  ? 408 ALA B O     1 
ATOM   6901  C CB    . ALA B 1 408 ? 5.277   42.525 102.686 1.00 68.73  ? 408 ALA B CB    1 
ATOM   6902  N N     . ASP B 1 409 ? 4.757   45.044 104.829 1.00 68.34  ? 409 ASP B N     1 
ATOM   6903  C CA    . ASP B 1 409 ? 3.693   45.816 105.450 1.00 69.24  ? 409 ASP B CA    1 
ATOM   6904  C C     . ASP B 1 409 ? 2.368   45.428 104.776 1.00 68.49  ? 409 ASP B C     1 
ATOM   6905  O O     . ASP B 1 409 ? 1.604   44.576 105.226 1.00 68.39  ? 409 ASP B O     1 
ATOM   6906  C CB    . ASP B 1 409 ? 3.927   47.315 105.257 1.00 79.09  ? 409 ASP B CB    1 
ATOM   6907  C CG    . ASP B 1 409 ? 4.986   47.949 106.129 1.00 87.12  ? 409 ASP B CG    1 
ATOM   6908  O OD1   . ASP B 1 409 ? 5.123   47.535 107.306 1.00 92.43  ? 409 ASP B OD1   1 
ATOM   6909  O OD2   . ASP B 1 409 ? 5.694   48.876 105.673 1.00 88.38  ? 409 ASP B OD2   1 
ATOM   6910  N N     . MET B 1 410 ? 2.153   46.043 103.610 1.00 65.91  ? 410 MET B N     1 
ATOM   6911  C CA    . MET B 1 410 ? 0.975   45.859 102.789 1.00 60.01  ? 410 MET B CA    1 
ATOM   6912  C C     . MET B 1 410 ? 1.108   44.847 101.662 1.00 53.45  ? 410 MET B C     1 
ATOM   6913  O O     . MET B 1 410 ? 2.132   44.783 100.978 1.00 54.58  ? 410 MET B O     1 
ATOM   6914  C CB    . MET B 1 410 ? 0.565   47.222 102.178 1.00 62.84  ? 410 MET B CB    1 
ATOM   6915  C CG    . MET B 1 410 ? 0.488   48.331 103.212 1.00 72.47  ? 410 MET B CG    1 
ATOM   6916  S SD    . MET B 1 410 ? -1.105  48.644 103.984 1.00 77.42  ? 410 MET B SD    1 
ATOM   6917  C CE    . MET B 1 410 ? -1.835  47.014 104.116 1.00 73.49  ? 410 MET B CE    1 
ATOM   6918  N N     . GLU B 1 411 ? 0.056   44.061 101.472 1.00 45.08  ? 411 GLU B N     1 
ATOM   6919  C CA    . GLU B 1 411 ? -0.038  43.119 100.374 1.00 43.94  ? 411 GLU B CA    1 
ATOM   6920  C C     . GLU B 1 411 ? -1.041  43.636 99.320  1.00 42.83  ? 411 GLU B C     1 
ATOM   6921  O O     . GLU B 1 411 ? -2.149  43.094 99.227  1.00 42.35  ? 411 GLU B O     1 
ATOM   6922  C CB    . GLU B 1 411 ? -0.459  41.727 100.817 1.00 37.62  ? 411 GLU B CB    1 
ATOM   6923  C CG    . GLU B 1 411 ? 0.511   40.949 101.667 1.00 49.86  ? 411 GLU B CG    1 
ATOM   6924  C CD    . GLU B 1 411 ? 1.920   40.892 101.103 1.00 53.22  ? 411 GLU B CD    1 
ATOM   6925  O OE1   . GLU B 1 411 ? 2.050   40.844 99.854  1.00 53.15  ? 411 GLU B OE1   1 
ATOM   6926  O OE2   . GLU B 1 411 ? 2.864   40.903 101.919 1.00 54.10  ? 411 GLU B OE2   1 
ATOM   6927  N N     . PHE B 1 412 ? -0.675  44.655 98.555  1.00 37.14  ? 412 PHE B N     1 
ATOM   6928  C CA    . PHE B 1 412 ? -1.564  45.207 97.537  1.00 38.20  ? 412 PHE B CA    1 
ATOM   6929  C C     . PHE B 1 412 ? -1.570  44.563 96.144  1.00 34.59  ? 412 PHE B C     1 
ATOM   6930  O O     . PHE B 1 412 ? -0.598  43.989 95.664  1.00 32.44  ? 412 PHE B O     1 
ATOM   6931  C CB    . PHE B 1 412 ? -1.202  46.673 97.278  1.00 27.60  ? 412 PHE B CB    1 
ATOM   6932  C CG    . PHE B 1 412 ? -1.558  47.667 98.332  1.00 39.82  ? 412 PHE B CG    1 
ATOM   6933  C CD1   . PHE B 1 412 ? -2.676  47.532 99.135  1.00 41.86  ? 412 PHE B CD1   1 
ATOM   6934  C CD2   . PHE B 1 412 ? -0.757  48.792 98.503  1.00 41.82  ? 412 PHE B CD2   1 
ATOM   6935  C CE1   . PHE B 1 412 ? -2.978  48.494 100.078 1.00 46.46  ? 412 PHE B CE1   1 
ATOM   6936  C CE2   . PHE B 1 412 ? -1.052  49.755 99.452  1.00 47.36  ? 412 PHE B CE2   1 
ATOM   6937  C CZ    . PHE B 1 412 ? -2.168  49.600 100.242 1.00 45.18  ? 412 PHE B CZ    1 
ATOM   6938  N N     . MET B 1 413 ? -2.694  44.740 95.458  1.00 31.59  ? 413 MET B N     1 
ATOM   6939  C CA    . MET B 1 413 ? -2.885  44.361 94.057  1.00 25.00  ? 413 MET B CA    1 
ATOM   6940  C C     . MET B 1 413 ? -3.133  45.730 93.414  1.00 23.70  ? 413 MET B C     1 
ATOM   6941  O O     . MET B 1 413 ? -4.003  46.456 93.905  1.00 25.67  ? 413 MET B O     1 
ATOM   6942  C CB    . MET B 1 413 ? -3.997  43.412 93.693  1.00 24.14  ? 413 MET B CB    1 
ATOM   6943  C CG    . MET B 1 413 ? -4.495  43.553 92.227  1.00 13.37  ? 413 MET B CG    1 
ATOM   6944  S SD    . MET B 1 413 ? -5.661  42.230 91.804  1.00 24.24  ? 413 MET B SD    1 
ATOM   6945  C CE    . MET B 1 413 ? -7.105  43.008 92.577  1.00 26.32  ? 413 MET B CE    1 
ATOM   6946  N N     . ARG B 1 414 ? -2.290  46.104 92.468  1.00 21.35  ? 414 ARG B N     1 
ATOM   6947  C CA    . ARG B 1 414 ? -2.436  47.415 91.857  1.00 17.34  ? 414 ARG B CA    1 
ATOM   6948  C C     . ARG B 1 414 ? -3.195  47.279 90.519  1.00 17.80  ? 414 ARG B C     1 
ATOM   6949  O O     . ARG B 1 414 ? -2.819  46.454 89.688  1.00 14.75  ? 414 ARG B O     1 
ATOM   6950  C CB    . ARG B 1 414 ? -1.085  48.056 91.667  1.00 12.67  ? 414 ARG B CB    1 
ATOM   6951  C CG    . ARG B 1 414 ? -1.176  49.511 91.282  1.00 18.10  ? 414 ARG B CG    1 
ATOM   6952  C CD    . ARG B 1 414 ? 0.150   50.155 90.948  1.00 23.27  ? 414 ARG B CD    1 
ATOM   6953  N NE    . ARG B 1 414 ? 0.750   49.630 89.728  1.00 22.61  ? 414 ARG B NE    1 
ATOM   6954  C CZ    . ARG B 1 414 ? 2.057   49.634 89.465  1.00 27.75  ? 414 ARG B CZ    1 
ATOM   6955  N NH1   . ARG B 1 414 ? 2.920   50.111 90.366  1.00 21.56  ? 414 ARG B NH1   1 
ATOM   6956  N NH2   . ARG B 1 414 ? 2.518   49.126 88.320  1.00 21.18  ? 414 ARG B NH2   1 
ATOM   6957  N N     . LEU B 1 415 ? -4.251  48.051 90.400  1.00 14.66  ? 415 LEU B N     1 
ATOM   6958  C CA    . LEU B 1 415 ? -5.098  48.071 89.191  1.00 14.74  ? 415 LEU B CA    1 
ATOM   6959  C C     . LEU B 1 415 ? -4.712  49.395 88.529  1.00 15.46  ? 415 LEU B C     1 
ATOM   6960  O O     . LEU B 1 415 ? -5.250  50.410 88.972  1.00 16.60  ? 415 LEU B O     1 
ATOM   6961  C CB    . LEU B 1 415 ? -6.584  47.986 89.537  1.00 13.76  ? 415 LEU B CB    1 
ATOM   6962  C CG    . LEU B 1 415 ? -7.114  46.693 90.151  1.00 15.47  ? 415 LEU B CG    1 
ATOM   6963  C CD1   . LEU B 1 415 ? -8.642  46.787 90.415  1.00 18.03  ? 415 LEU B CD1   1 
ATOM   6964  C CD2   . LEU B 1 415 ? -6.828  45.436 89.382  1.00 16.35  ? 415 LEU B CD2   1 
ATOM   6965  N N     . THR B 1 416 ? -3.668  49.379 87.666  1.00 9.24   ? 416 THR B N     1 
ATOM   6966  C CA    . THR B 1 416 ? -3.101  50.618 87.134  1.00 12.01  ? 416 THR B CA    1 
ATOM   6967  C C     . THR B 1 416 ? -3.756  51.060 85.822  1.00 8.73   ? 416 THR B C     1 
ATOM   6968  O O     . THR B 1 416 ? -4.046  50.208 84.992  1.00 13.58  ? 416 THR B O     1 
ATOM   6969  C CB    . THR B 1 416 ? -1.579  50.454 86.922  1.00 12.01  ? 416 THR B CB    1 
ATOM   6970  O OG1   . THR B 1 416 ? -1.075  49.301 87.583  1.00 15.68  ? 416 THR B OG1   1 
ATOM   6971  C CG2   . THR B 1 416 ? -0.814  51.654 87.454  1.00 8.73   ? 416 THR B CG2   1 
ATOM   6972  N N     . ILE B 1 417 ? -4.193  52.290 85.698  1.00 10.85  ? 417 ILE B N     1 
ATOM   6973  C CA    . ILE B 1 417 ? -5.039  52.727 84.642  1.00 12.19  ? 417 ILE B CA    1 
ATOM   6974  C C     . ILE B 1 417 ? -4.284  53.675 83.682  1.00 11.54  ? 417 ILE B C     1 
ATOM   6975  O O     . ILE B 1 417 ? -3.949  54.773 84.064  1.00 14.66  ? 417 ILE B O     1 
ATOM   6976  C CB    . ILE B 1 417 ? -6.319  53.439 85.143  1.00 16.48  ? 417 ILE B CB    1 
ATOM   6977  C CG1   . ILE B 1 417 ? -7.071  52.714 86.284  1.00 12.37  ? 417 ILE B CG1   1 
ATOM   6978  C CG2   . ILE B 1 417 ? -7.259  53.677 83.944  1.00 11.47  ? 417 ILE B CG2   1 
ATOM   6979  C CD1   . ILE B 1 417 ? -7.368  51.254 86.092  1.00 14.25  ? 417 ILE B CD1   1 
ATOM   6980  N N     . ALA B 1 418 ? -4.100  53.179 82.456  1.00 10.96  ? 418 ALA B N     1 
ATOM   6981  C CA    . ALA B 1 418 ? -3.508  54.008 81.407  1.00 12.66  ? 418 ALA B CA    1 
ATOM   6982  C C     . ALA B 1 418 ? -4.408  55.191 81.094  1.00 10.22  ? 418 ALA B C     1 
ATOM   6983  O O     . ALA B 1 418 ? -5.592  55.120 81.385  1.00 13.98  ? 418 ALA B O     1 
ATOM   6984  C CB    . ALA B 1 418 ? -3.299  53.217 80.111  1.00 12.24  ? 418 ALA B CB    1 
ATOM   6985  N N     . ARG B 1 419 ? -3.854  56.306 80.661  1.00 9.71   ? 419 ARG B N     1 
ATOM   6986  C CA    . ARG B 1 419 ? -4.601  57.501 80.339  1.00 11.45  ? 419 ARG B CA    1 
ATOM   6987  C C     . ARG B 1 419 ? -5.235  57.489 78.951  1.00 13.89  ? 419 ARG B C     1 
ATOM   6988  O O     . ARG B 1 419 ? -4.599  57.328 77.887  1.00 12.03  ? 419 ARG B O     1 
ATOM   6989  C CB    . ARG B 1 419 ? -3.716  58.750 80.500  1.00 5.77   ? 419 ARG B CB    1 
ATOM   6990  C CG    . ARG B 1 419 ? -3.022  58.773 81.877  1.00 8.21   ? 419 ARG B CG    1 
ATOM   6991  C CD    . ARG B 1 419 ? -1.920  59.852 81.905  1.00 11.04  ? 419 ARG B CD    1 
ATOM   6992  N NE    . ARG B 1 419 ? -1.249  59.816 83.214  1.00 5.98   ? 419 ARG B NE    1 
ATOM   6993  C CZ    . ARG B 1 419 ? -0.589  58.767 83.677  1.00 7.87   ? 419 ARG B CZ    1 
ATOM   6994  N NH1   . ARG B 1 419 ? -0.363  57.648 82.999  1.00 6.01   ? 419 ARG B NH1   1 
ATOM   6995  N NH2   . ARG B 1 419 ? -0.052  58.879 84.916  1.00 14.25  ? 419 ARG B NH2   1 
ATOM   6996  N N     . ARG B 1 420 ? -6.543  57.768 78.981  1.00 10.38  ? 420 ARG B N     1 
ATOM   6997  C CA    . ARG B 1 420 ? -7.402  57.937 77.799  1.00 10.70  ? 420 ARG B CA    1 
ATOM   6998  C C     . ARG B 1 420 ? -7.568  56.706 76.948  1.00 10.17  ? 420 ARG B C     1 
ATOM   6999  O O     . ARG B 1 420 ? -7.778  56.790 75.718  1.00 13.36  ? 420 ARG B O     1 
ATOM   7000  C CB    . ARG B 1 420 ? -6.866  59.098 76.951  1.00 5.78   ? 420 ARG B CB    1 
ATOM   7001  C CG    . ARG B 1 420 ? -6.688  60.416 77.713  1.00 7.29   ? 420 ARG B CG    1 
ATOM   7002  C CD    . ARG B 1 420 ? -6.524  61.566 76.760  1.00 9.90   ? 420 ARG B CD    1 
ATOM   7003  N NE    . ARG B 1 420 ? -5.225  61.440 76.053  1.00 11.56  ? 420 ARG B NE    1 
ATOM   7004  C CZ    . ARG B 1 420 ? -4.604  62.522 75.610  1.00 9.51   ? 420 ARG B CZ    1 
ATOM   7005  N NH1   . ARG B 1 420 ? -5.177  63.698 75.717  1.00 4.60   ? 420 ARG B NH1   1 
ATOM   7006  N NH2   . ARG B 1 420 ? -3.409  62.429 75.012  1.00 11.63  ? 420 ARG B NH2   1 
ATOM   7007  N N     . VAL B 1 421 ? -7.440  55.518 77.548  1.00 5.90   ? 421 VAL B N     1 
ATOM   7008  C CA    . VAL B 1 421 ? -7.425  54.281 76.799  1.00 7.75   ? 421 VAL B CA    1 
ATOM   7009  C C     . VAL B 1 421 ? -8.688  53.460 76.946  1.00 14.58  ? 421 VAL B C     1 
ATOM   7010  O O     . VAL B 1 421 ? -9.211  52.876 75.979  1.00 11.45  ? 421 VAL B O     1 
ATOM   7011  C CB    . VAL B 1 421 ? -6.191  53.451 77.234  1.00 9.81   ? 421 VAL B CB    1 
ATOM   7012  C CG1   . VAL B 1 421 ? -6.133  52.027 76.643  1.00 6.87   ? 421 VAL B CG1   1 
ATOM   7013  C CG2   . VAL B 1 421 ? -4.939  54.270 76.872  1.00 13.64  ? 421 VAL B CG2   1 
ATOM   7014  N N     . TYR B 1 422 ? -9.179  53.352 78.172  1.00 10.19  ? 422 TYR B N     1 
ATOM   7015  C CA    . TYR B 1 422 ? -10.297 52.498 78.532  1.00 10.93  ? 422 TYR B CA    1 
ATOM   7016  C C     . TYR B 1 422 ? -11.510 53.306 78.970  1.00 8.18   ? 422 TYR B C     1 
ATOM   7017  O O     . TYR B 1 422 ? -11.308 54.359 79.517  1.00 10.07  ? 422 TYR B O     1 
ATOM   7018  C CB    . TYR B 1 422 ? -9.933  51.567 79.699  1.00 11.42  ? 422 TYR B CB    1 
ATOM   7019  C CG    . TYR B 1 422 ? -8.824  50.602 79.323  1.00 10.11  ? 422 TYR B CG    1 
ATOM   7020  C CD1   . TYR B 1 422 ? -9.071  49.536 78.484  1.00 7.56   ? 422 TYR B CD1   1 
ATOM   7021  C CD2   . TYR B 1 422 ? -7.537  50.795 79.832  1.00 9.60   ? 422 TYR B CD2   1 
ATOM   7022  C CE1   . TYR B 1 422 ? -8.032  48.681 78.133  1.00 9.07   ? 422 TYR B CE1   1 
ATOM   7023  C CE2   . TYR B 1 422 ? -6.509  49.938 79.511  1.00 9.94   ? 422 TYR B CE2   1 
ATOM   7024  C CZ    . TYR B 1 422 ? -6.768  48.904 78.659  1.00 9.25   ? 422 TYR B CZ    1 
ATOM   7025  O OH    . TYR B 1 422 ? -5.752  48.033 78.296  1.00 12.65  ? 422 TYR B OH    1 
ATOM   7026  N N     . THR B 1 423 ? -12.712 52.771 78.638  1.00 8.87   ? 423 THR B N     1 
ATOM   7027  C CA    . THR B 1 423 ? -13.918 53.497 79.025  1.00 11.97  ? 423 THR B CA    1 
ATOM   7028  C C     . THR B 1 423 ? -14.385 53.079 80.414  1.00 12.99  ? 423 THR B C     1 
ATOM   7029  O O     . THR B 1 423 ? -13.913 52.048 80.909  1.00 12.15  ? 423 THR B O     1 
ATOM   7030  C CB    . THR B 1 423 ? -15.083 53.137 78.044  1.00 10.02  ? 423 THR B CB    1 
ATOM   7031  O OG1   . THR B 1 423 ? -15.326 51.727 78.212  1.00 9.29   ? 423 THR B OG1   1 
ATOM   7032  C CG2   . THR B 1 423 ? -14.654 53.375 76.596  1.00 6.48   ? 423 THR B CG2   1 
ATOM   7033  N N     . ASN B 1 424 ? -15.429 53.735 80.938  1.00 12.87  ? 424 ASN B N     1 
ATOM   7034  C CA    . ASN B 1 424 ? -15.986 53.265 82.232  1.00 12.69  ? 424 ASN B CA    1 
ATOM   7035  C C     . ASN B 1 424 ? -16.641 51.914 82.044  1.00 14.93  ? 424 ASN B C     1 
ATOM   7036  O O     . ASN B 1 424 ? -16.736 51.135 83.007  1.00 15.64  ? 424 ASN B O     1 
ATOM   7037  C CB    . ASN B 1 424 ? -16.899 54.381 82.770  1.00 12.51  ? 424 ASN B CB    1 
ATOM   7038  C CG    . ASN B 1 424 ? -16.045 55.518 83.264  1.00 11.82  ? 424 ASN B CG    1 
ATOM   7039  O OD1   . ASN B 1 424 ? -14.925 55.303 83.746  1.00 15.96  ? 424 ASN B OD1   1 
ATOM   7040  N ND2   . ASN B 1 424 ? -16.484 56.740 83.165  1.00 14.50  ? 424 ASN B ND2   1 
ATOM   7041  N N     . ASP B 1 425 ? -17.048 51.482 80.828  1.00 8.55   ? 425 ASP B N     1 
ATOM   7042  C CA    . ASP B 1 425 ? -17.517 50.118 80.639  1.00 7.41   ? 425 ASP B CA    1 
ATOM   7043  C C     . ASP B 1 425 ? -16.402 49.111 80.803  1.00 11.49  ? 425 ASP B C     1 
ATOM   7044  O O     . ASP B 1 425 ? -16.653 47.952 81.247  1.00 12.64  ? 425 ASP B O     1 
ATOM   7045  C CB    . ASP B 1 425 ? -18.311 49.898 79.317  1.00 10.86  ? 425 ASP B CB    1 
ATOM   7046  C CG    . ASP B 1 425 ? -19.568 50.751 79.396  1.00 15.40  ? 425 ASP B CG    1 
ATOM   7047  O OD1   . ASP B 1 425 ? -20.293 50.695 80.411  1.00 19.78  ? 425 ASP B OD1   1 
ATOM   7048  O OD2   . ASP B 1 425 ? -19.829 51.542 78.485  1.00 22.20  ? 425 ASP B OD2   1 
ATOM   7049  N N     . HIS B 1 426 ? -15.160 49.490 80.434  1.00 12.35  ? 426 HIS B N     1 
ATOM   7050  C CA    . HIS B 1 426 ? -14.043 48.572 80.718  1.00 10.86  ? 426 HIS B CA    1 
ATOM   7051  C C     . HIS B 1 426 ? -13.856 48.534 82.260  1.00 6.43   ? 426 HIS B C     1 
ATOM   7052  O O     . HIS B 1 426 ? -13.587 47.473 82.759  1.00 10.72  ? 426 HIS B O     1 
ATOM   7053  C CB    . HIS B 1 426 ? -12.689 48.971 80.090  1.00 11.36  ? 426 HIS B CB    1 
ATOM   7054  C CG    . HIS B 1 426 ? -12.733 48.892 78.590  1.00 8.29   ? 426 HIS B CG    1 
ATOM   7055  N ND1   . HIS B 1 426 ? -12.681 49.990 77.768  1.00 11.10  ? 426 HIS B ND1   1 
ATOM   7056  C CD2   . HIS B 1 426 ? -12.917 47.792 77.806  1.00 7.59   ? 426 HIS B CD2   1 
ATOM   7057  C CE1   . HIS B 1 426 ? -12.752 49.541 76.534  1.00 8.18   ? 426 HIS B CE1   1 
ATOM   7058  N NE2   . HIS B 1 426 ? -12.899 48.208 76.518  1.00 9.89   ? 426 HIS B NE2   1 
ATOM   7059  N N     . MET B 1 427 ? -14.008 49.643 82.925  1.00 9.07   ? 427 MET B N     1 
ATOM   7060  C CA    . MET B 1 427 ? -13.911 49.653 84.410  1.00 13.91  ? 427 MET B CA    1 
ATOM   7061  C C     . MET B 1 427 ? -14.982 48.755 85.025  1.00 15.34  ? 427 MET B C     1 
ATOM   7062  O O     . MET B 1 427 ? -14.683 47.874 85.856  1.00 17.41  ? 427 MET B O     1 
ATOM   7063  C CB    . MET B 1 427 ? -14.066 51.057 84.934  1.00 7.87   ? 427 MET B CB    1 
ATOM   7064  C CG    . MET B 1 427 ? -12.985 52.084 84.626  1.00 13.17  ? 427 MET B CG    1 
ATOM   7065  S SD    . MET B 1 427 ? -11.277 51.566 84.919  1.00 15.62  ? 427 MET B SD    1 
ATOM   7066  C CE    . MET B 1 427 ? -10.701 51.192 83.246  1.00 14.97  ? 427 MET B CE    1 
ATOM   7067  N N     . ASP B 1 428 ? -16.210 48.775 84.463  1.00 14.52  ? 428 ASP B N     1 
ATOM   7068  C CA    . ASP B 1 428 ? -17.255 47.898 85.011  1.00 15.86  ? 428 ASP B CA    1 
ATOM   7069  C C     . ASP B 1 428 ? -16.871 46.457 84.878  1.00 13.80  ? 428 ASP B C     1 
ATOM   7070  O O     . ASP B 1 428 ? -17.069 45.550 85.709  1.00 14.83  ? 428 ASP B O     1 
ATOM   7071  C CB    . ASP B 1 428 ? -18.602 48.095 84.310  1.00 14.11  ? 428 ASP B CB    1 
ATOM   7072  C CG    . ASP B 1 428 ? -19.322 49.319 84.804  1.00 15.59  ? 428 ASP B CG    1 
ATOM   7073  O OD1   . ASP B 1 428 ? -19.030 49.761 85.940  1.00 16.71  ? 428 ASP B OD1   1 
ATOM   7074  O OD2   . ASP B 1 428 ? -20.125 49.841 83.999  1.00 21.12  ? 428 ASP B OD2   1 
ATOM   7075  N N     . TYR B 1 429 ? -16.207 46.193 83.722  1.00 11.04  ? 429 TYR B N     1 
ATOM   7076  C CA    . TYR B 1 429 ? -15.811 44.815 83.460  1.00 10.19  ? 429 TYR B CA    1 
ATOM   7077  C C     . TYR B 1 429 ? -14.845 44.354 84.556  1.00 13.60  ? 429 TYR B C     1 
ATOM   7078  O O     . TYR B 1 429 ? -14.873 43.202 84.986  1.00 14.24  ? 429 TYR B O     1 
ATOM   7079  C CB    . TYR B 1 429 ? -15.118 44.704 82.089  1.00 14.46  ? 429 TYR B CB    1 
ATOM   7080  C CG    . TYR B 1 429 ? -14.720 43.302 81.771  1.00 15.09  ? 429 TYR B CG    1 
ATOM   7081  C CD1   . TYR B 1 429 ? -15.587 42.378 81.200  1.00 18.55  ? 429 TYR B CD1   1 
ATOM   7082  C CD2   . TYR B 1 429 ? -13.406 42.913 82.066  1.00 16.29  ? 429 TYR B CD2   1 
ATOM   7083  C CE1   . TYR B 1 429 ? -15.176 41.087 80.907  1.00 17.53  ? 429 TYR B CE1   1 
ATOM   7084  C CE2   . TYR B 1 429 ? -13.006 41.621 81.815  1.00 16.78  ? 429 TYR B CE2   1 
ATOM   7085  C CZ    . TYR B 1 429 ? -13.874 40.729 81.219  1.00 22.98  ? 429 TYR B CZ    1 
ATOM   7086  O OH    . TYR B 1 429 ? -13.374 39.461 80.975  1.00 20.18  ? 429 TYR B OH    1 
ATOM   7087  N N     . ILE B 1 430 ? -13.864 45.212 84.843  1.00 14.12  ? 430 ILE B N     1 
ATOM   7088  C CA    . ILE B 1 430 ? -12.830 44.862 85.816  1.00 15.15  ? 430 ILE B CA    1 
ATOM   7089  C C     . ILE B 1 430 ? -13.460 44.659 87.226  1.00 14.07  ? 430 ILE B C     1 
ATOM   7090  O O     . ILE B 1 430 ? -13.193 43.666 87.909  1.00 14.95  ? 430 ILE B O     1 
ATOM   7091  C CB    . ILE B 1 430 ? -11.804 45.992 85.857  1.00 15.18  ? 430 ILE B CB    1 
ATOM   7092  C CG1   . ILE B 1 430 ? -10.908 46.047 84.593  1.00 15.51  ? 430 ILE B CG1   1 
ATOM   7093  C CG2   . ILE B 1 430 ? -10.941 45.908 87.128  1.00 15.22  ? 430 ILE B CG2   1 
ATOM   7094  C CD1   . ILE B 1 430 ? -10.503 47.499 84.333  1.00 9.64   ? 430 ILE B CD1   1 
ATOM   7095  N N     . ALA B 1 431 ? -14.260 45.631 87.629  1.00 15.00  ? 431 ALA B N     1 
ATOM   7096  C CA    . ALA B 1 431 ? -14.953 45.596 88.928  1.00 19.11  ? 431 ALA B CA    1 
ATOM   7097  C C     . ALA B 1 431 ? -15.836 44.366 89.040  1.00 20.49  ? 431 ALA B C     1 
ATOM   7098  O O     . ALA B 1 431 ? -15.706 43.575 89.994  1.00 21.44  ? 431 ALA B O     1 
ATOM   7099  C CB    . ALA B 1 431 ? -15.728 46.885 89.140  1.00 9.55   ? 431 ALA B CB    1 
ATOM   7100  N N     . ASP B 1 432 ? -16.666 44.099 88.030  1.00 17.33  ? 432 ASP B N     1 
ATOM   7101  C CA    . ASP B 1 432 ? -17.474 42.899 88.045  1.00 20.64  ? 432 ASP B CA    1 
ATOM   7102  C C     . ASP B 1 432 ? -16.645 41.640 88.123  1.00 22.89  ? 432 ASP B C     1 
ATOM   7103  O O     . ASP B 1 432 ? -17.035 40.746 88.902  1.00 24.63  ? 432 ASP B O     1 
ATOM   7104  C CB    . ASP B 1 432 ? -18.554 42.838 86.973  1.00 20.01  ? 432 ASP B CB    1 
ATOM   7105  C CG    . ASP B 1 432 ? -19.503 44.018 87.017  1.00 20.21  ? 432 ASP B CG    1 
ATOM   7106  O OD1   . ASP B 1 432 ? -19.621 44.820 87.970  1.00 29.32  ? 432 ASP B OD1   1 
ATOM   7107  O OD2   . ASP B 1 432 ? -20.166 44.226 85.975  1.00 29.90  ? 432 ASP B OD2   1 
ATOM   7108  N N     . ALA B 1 433 ? -15.528 41.502 87.394  1.00 22.05  ? 433 ALA B N     1 
ATOM   7109  C CA    . ALA B 1 433 ? -14.718 40.292 87.557  1.00 20.42  ? 433 ALA B CA    1 
ATOM   7110  C C     . ALA B 1 433 ? -14.188 40.147 89.007  1.00 20.57  ? 433 ALA B C     1 
ATOM   7111  O O     . ALA B 1 433 ? -14.160 39.019 89.542  1.00 19.90  ? 433 ALA B O     1 
ATOM   7112  C CB    . ALA B 1 433 ? -13.518 40.309 86.617  1.00 24.49  ? 433 ALA B CB    1 
ATOM   7113  N N     . LEU B 1 434 ? -13.713 41.229 89.598  1.00 15.29  ? 434 LEU B N     1 
ATOM   7114  C CA    . LEU B 1 434 ? -13.153 41.110 90.949  1.00 22.50  ? 434 LEU B CA    1 
ATOM   7115  C C     . LEU B 1 434 ? -14.243 40.774 91.982  1.00 26.70  ? 434 LEU B C     1 
ATOM   7116  O O     . LEU B 1 434 ? -14.146 39.798 92.725  1.00 22.41  ? 434 LEU B O     1 
ATOM   7117  C CB    . LEU B 1 434 ? -12.419 42.392 91.305  1.00 17.47  ? 434 LEU B CB    1 
ATOM   7118  C CG    . LEU B 1 434 ? -11.471 42.355 92.503  1.00 27.68  ? 434 LEU B CG    1 
ATOM   7119  C CD1   . LEU B 1 434 ? -10.441 41.252 92.363  1.00 27.09  ? 434 LEU B CD1   1 
ATOM   7120  C CD2   . LEU B 1 434 ? -10.825 43.727 92.691  1.00 33.63  ? 434 LEU B CD2   1 
ATOM   7121  N N     . ILE B 1 435 ? -15.357 41.485 91.940  1.00 25.53  ? 435 ILE B N     1 
ATOM   7122  C CA    . ILE B 1 435 ? -16.532 41.295 92.759  1.00 29.08  ? 435 ILE B CA    1 
ATOM   7123  C C     . ILE B 1 435 ? -17.020 39.859 92.635  1.00 32.08  ? 435 ILE B C     1 
ATOM   7124  O O     . ILE B 1 435 ? -17.232 39.204 93.654  1.00 32.16  ? 435 ILE B O     1 
ATOM   7125  C CB    . ILE B 1 435 ? -17.665 42.296 92.488  1.00 20.16  ? 435 ILE B CB    1 
ATOM   7126  C CG1   . ILE B 1 435 ? -17.223 43.687 92.932  1.00 19.55  ? 435 ILE B CG1   1 
ATOM   7127  C CG2   . ILE B 1 435 ? -18.959 41.885 93.176  1.00 31.18  ? 435 ILE B CG2   1 
ATOM   7128  C CD1   . ILE B 1 435 ? -17.999 44.822 92.304  1.00 21.25  ? 435 ILE B CD1   1 
ATOM   7129  N N     . GLY B 1 436 ? -17.035 39.295 91.442  1.00 32.88  ? 436 GLY B N     1 
ATOM   7130  C CA    . GLY B 1 436 ? -17.382 37.919 91.165  1.00 32.33  ? 436 GLY B CA    1 
ATOM   7131  C C     . GLY B 1 436 ? -16.420 36.891 91.723  1.00 33.50  ? 436 GLY B C     1 
ATOM   7132  O O     . GLY B 1 436 ? -16.748 35.702 91.737  1.00 32.93  ? 436 GLY B O     1 
ATOM   7133  N N     . LEU B 1 437 ? -15.273 37.294 92.256  1.00 33.49  ? 437 LEU B N     1 
ATOM   7134  C CA    . LEU B 1 437 ? -14.338 36.409 92.917  1.00 35.36  ? 437 LEU B CA    1 
ATOM   7135  C C     . LEU B 1 437 ? -14.528 36.390 94.441  1.00 36.85  ? 437 LEU B C     1 
ATOM   7136  O O     . LEU B 1 437 ? -13.767 35.717 95.133  1.00 33.73  ? 437 LEU B O     1 
ATOM   7137  C CB    . LEU B 1 437 ? -12.903 36.881 92.662  1.00 37.94  ? 437 LEU B CB    1 
ATOM   7138  C CG    . LEU B 1 437 ? -12.197 36.484 91.371  1.00 39.94  ? 437 LEU B CG    1 
ATOM   7139  C CD1   . LEU B 1 437 ? -10.784 37.066 91.344  1.00 38.54  ? 437 LEU B CD1   1 
ATOM   7140  C CD2   . LEU B 1 437 ? -12.212 34.979 91.209  1.00 38.90  ? 437 LEU B CD2   1 
ATOM   7141  N N     . LYS B 1 438 ? -15.418 37.189 94.996  1.00 38.59  ? 438 LYS B N     1 
ATOM   7142  C CA    . LYS B 1 438 ? -15.637 37.318 96.426  1.00 44.44  ? 438 LYS B CA    1 
ATOM   7143  C C     . LYS B 1 438 ? -15.668 36.017 97.211  1.00 47.85  ? 438 LYS B C     1 
ATOM   7144  O O     . LYS B 1 438 ? -14.939 35.887 98.194  1.00 48.64  ? 438 LYS B O     1 
ATOM   7145  C CB    . LYS B 1 438 ? -16.942 38.053 96.759  1.00 38.33  ? 438 LYS B CB    1 
ATOM   7146  C CG    . LYS B 1 438 ? -16.666 39.423 97.347  1.00 43.55  ? 438 LYS B CG    1 
ATOM   7147  C CD    . LYS B 1 438 ? -17.908 40.321 97.329  1.00 45.92  ? 438 LYS B CD    1 
ATOM   7148  C CE    . LYS B 1 438 ? -18.013 40.995 98.697  1.00 49.54  ? 438 LYS B CE    1 
ATOM   7149  N NZ    . LYS B 1 438 ? -19.265 41.786 98.818  1.00 55.33  ? 438 LYS B NZ    1 
ATOM   7150  N N     . GLU B 1 439 ? -16.473 35.062 96.784  1.00 51.09  ? 439 GLU B N     1 
ATOM   7151  C CA    . GLU B 1 439 ? -16.578 33.783 97.457  1.00 58.36  ? 439 GLU B CA    1 
ATOM   7152  C C     . GLU B 1 439 ? -15.318 32.944 97.294  1.00 58.39  ? 439 GLU B C     1 
ATOM   7153  O O     . GLU B 1 439 ? -15.043 32.129 98.176  1.00 58.25  ? 439 GLU B O     1 
ATOM   7154  C CB    . GLU B 1 439 ? -17.784 32.993 96.927  1.00 72.58  ? 439 GLU B CB    1 
ATOM   7155  C CG    . GLU B 1 439 ? -19.135 33.458 97.445  1.00 85.61  ? 439 GLU B CG    1 
ATOM   7156  C CD    . GLU B 1 439 ? -20.264 32.555 96.984  1.00 95.42  ? 439 GLU B CD    1 
ATOM   7157  O OE1   . GLU B 1 439 ? -20.286 31.367 97.375  1.00 100.48 ? 439 GLU B OE1   1 
ATOM   7158  O OE2   . GLU B 1 439 ? -21.143 33.015 96.227  1.00 99.54  ? 439 GLU B OE2   1 
ATOM   7159  N N     . LYS B 1 440 ? -14.584 33.096 96.193  1.00 55.79  ? 440 LYS B N     1 
ATOM   7160  C CA    . LYS B 1 440 ? -13.400 32.285 95.954  1.00 50.75  ? 440 LYS B CA    1 
ATOM   7161  C C     . LYS B 1 440 ? -12.193 32.689 96.770  1.00 46.98  ? 440 LYS B C     1 
ATOM   7162  O O     . LYS B 1 440 ? -11.314 31.855 97.003  1.00 46.69  ? 440 LYS B O     1 
ATOM   7163  C CB    . LYS B 1 440 ? -13.020 32.255 94.471  1.00 57.64  ? 440 LYS B CB    1 
ATOM   7164  C CG    . LYS B 1 440 ? -13.941 31.406 93.609  1.00 65.37  ? 440 LYS B CG    1 
ATOM   7165  C CD    . LYS B 1 440 ? -13.362 31.259 92.202  1.00 69.87  ? 440 LYS B CD    1 
ATOM   7166  C CE    . LYS B 1 440 ? -14.388 30.676 91.244  1.00 72.69  ? 440 LYS B CE    1 
ATOM   7167  N NZ    . LYS B 1 440 ? -15.249 31.730 90.644  1.00 72.39  ? 440 LYS B NZ    1 
ATOM   7168  N N     . PHE B 1 441 ? -12.121 33.905 97.275  1.00 46.71  ? 441 PHE B N     1 
ATOM   7169  C CA    . PHE B 1 441 ? -10.985 34.377 98.044  1.00 51.07  ? 441 PHE B CA    1 
ATOM   7170  C C     . PHE B 1 441 ? -10.538 33.469 99.182  1.00 56.71  ? 441 PHE B C     1 
ATOM   7171  O O     . PHE B 1 441 ? -9.324  33.257 99.356  1.00 54.22  ? 441 PHE B O     1 
ATOM   7172  C CB    . PHE B 1 441 ? -11.267 35.795 98.545  1.00 49.44  ? 441 PHE B CB    1 
ATOM   7173  C CG    . PHE B 1 441 ? -11.338 36.837 97.463  1.00 55.79  ? 441 PHE B CG    1 
ATOM   7174  C CD1   . PHE B 1 441 ? -10.582 36.752 96.305  1.00 54.92  ? 441 PHE B CD1   1 
ATOM   7175  C CD2   . PHE B 1 441 ? -12.172 37.937 97.622  1.00 55.89  ? 441 PHE B CD2   1 
ATOM   7176  C CE1   . PHE B 1 441 ? -10.660 37.730 95.336  1.00 55.89  ? 441 PHE B CE1   1 
ATOM   7177  C CE2   . PHE B 1 441 ? -12.253 38.922 96.656  1.00 53.87  ? 441 PHE B CE2   1 
ATOM   7178  C CZ    . PHE B 1 441 ? -11.496 38.815 95.511  1.00 53.55  ? 441 PHE B CZ    1 
ATOM   7179  N N     . ALA B 1 442 ? -11.473 32.935 99.966  1.00 60.18  ? 442 ALA B N     1 
ATOM   7180  C CA    . ALA B 1 442 ? -11.157 32.049 101.078 1.00 63.40  ? 442 ALA B CA    1 
ATOM   7181  C C     . ALA B 1 442 ? -10.390 30.815 100.632 1.00 64.92  ? 442 ALA B C     1 
ATOM   7182  O O     . ALA B 1 442 ? -9.271  30.629 101.132 1.00 68.42  ? 442 ALA B O     1 
ATOM   7183  C CB    . ALA B 1 442 ? -12.408 31.628 101.838 1.00 65.12  ? 442 ALA B CB    1 
ATOM   7184  N N     . THR B 1 443 ? -10.874 30.038 99.676  1.00 64.53  ? 443 THR B N     1 
ATOM   7185  C CA    . THR B 1 443 ? -10.147 28.874 99.206  1.00 66.24  ? 443 THR B CA    1 
ATOM   7186  C C     . THR B 1 443 ? -8.888  29.127 98.391  1.00 67.16  ? 443 THR B C     1 
ATOM   7187  O O     . THR B 1 443 ? -8.272  28.123 97.985  1.00 69.26  ? 443 THR B O     1 
ATOM   7188  C CB    . THR B 1 443 ? -11.039 27.955 98.331  1.00 71.20  ? 443 THR B CB    1 
ATOM   7189  O OG1   . THR B 1 443 ? -11.546 28.687 97.209  1.00 74.66  ? 443 THR B OG1   1 
ATOM   7190  C CG2   . THR B 1 443 ? -12.169 27.355 99.143  1.00 72.13  ? 443 THR B CG2   1 
ATOM   7191  N N     . LEU B 1 444 ? -8.464  30.342 98.079  1.00 66.52  ? 444 LEU B N     1 
ATOM   7192  C CA    . LEU B 1 444 ? -7.263  30.528 97.267  1.00 65.93  ? 444 LEU B CA    1 
ATOM   7193  C C     . LEU B 1 444 ? -6.057  29.834 97.904  1.00 65.80  ? 444 LEU B C     1 
ATOM   7194  O O     . LEU B 1 444 ? -5.665  30.146 99.026  1.00 62.41  ? 444 LEU B O     1 
ATOM   7195  C CB    . LEU B 1 444 ? -6.960  31.999 96.993  1.00 60.62  ? 444 LEU B CB    1 
ATOM   7196  C CG    . LEU B 1 444 ? -7.896  32.777 96.063  1.00 56.37  ? 444 LEU B CG    1 
ATOM   7197  C CD1   . LEU B 1 444 ? -7.341  34.177 95.821  1.00 56.16  ? 444 LEU B CD1   1 
ATOM   7198  C CD2   . LEU B 1 444 ? -8.138  32.042 94.758  1.00 47.91  ? 444 LEU B CD2   1 
ATOM   7199  N N     . LYS B 1 445 ? -5.430  28.937 97.141  1.00 66.52  ? 445 LYS B N     1 
ATOM   7200  C CA    . LYS B 1 445 ? -4.296  28.168 97.610  1.00 67.26  ? 445 LYS B CA    1 
ATOM   7201  C C     . LYS B 1 445 ? -3.049  28.934 97.999  1.00 65.69  ? 445 LYS B C     1 
ATOM   7202  O O     . LYS B 1 445 ? -2.654  28.755 99.165  1.00 70.79  ? 445 LYS B O     1 
ATOM   7203  C CB    . LYS B 1 445 ? -3.917  27.075 96.597  1.00 75.77  ? 445 LYS B CB    1 
ATOM   7204  C CG    . LYS B 1 445 ? -4.884  25.901 96.548  1.00 84.25  ? 445 LYS B CG    1 
ATOM   7205  C CD    . LYS B 1 445 ? -5.145  25.479 95.106  1.00 90.18  ? 445 LYS B CD    1 
ATOM   7206  C CE    . LYS B 1 445 ? -6.458  24.735 94.943  1.00 92.59  ? 445 LYS B CE    1 
ATOM   7207  N NZ    . LYS B 1 445 ? -6.399  23.355 95.502  1.00 93.34  ? 445 LYS B NZ    1 
ATOM   7208  N N     . GLY B 1 446 ? -2.365  29.660 97.130  1.00 60.66  ? 446 GLY B N     1 
ATOM   7209  C CA    . GLY B 1 446 ? -1.096  30.306 97.510  1.00 53.19  ? 446 GLY B CA    1 
ATOM   7210  C C     . GLY B 1 446 ? 0.024   29.922 96.532  1.00 47.53  ? 446 GLY B C     1 
ATOM   7211  O O     . GLY B 1 446 ? -0.156  28.995 95.732  1.00 44.72  ? 446 GLY B O     1 
ATOM   7212  N N     . LEU B 1 447 ? 1.169   30.609 96.559  1.00 44.01  ? 447 LEU B N     1 
ATOM   7213  C CA    . LEU B 1 447 ? 2.209   30.321 95.578  1.00 50.24  ? 447 LEU B CA    1 
ATOM   7214  C C     . LEU B 1 447 ? 3.603   29.921 96.050  1.00 50.30  ? 447 LEU B C     1 
ATOM   7215  O O     . LEU B 1 447 ? 4.151   30.515 96.962  1.00 50.12  ? 447 LEU B O     1 
ATOM   7216  C CB    . LEU B 1 447 ? 2.462   31.558 94.677  1.00 47.36  ? 447 LEU B CB    1 
ATOM   7217  C CG    . LEU B 1 447 ? 1.276   31.995 93.823  1.00 46.15  ? 447 LEU B CG    1 
ATOM   7218  C CD1   . LEU B 1 447 ? 1.448   33.457 93.456  1.00 46.22  ? 447 LEU B CD1   1 
ATOM   7219  C CD2   . LEU B 1 447 ? 1.178   31.087 92.612  1.00 45.21  ? 447 LEU B CD2   1 
ATOM   7220  N N     . GLU B 1 448 ? 4.202   28.997 95.316  1.00 53.46  ? 448 GLU B N     1 
ATOM   7221  C CA    . GLU B 1 448 ? 5.550   28.494 95.491  1.00 58.82  ? 448 GLU B CA    1 
ATOM   7222  C C     . GLU B 1 448 ? 6.414   28.886 94.275  1.00 60.29  ? 448 GLU B C     1 
ATOM   7223  O O     . GLU B 1 448 ? 5.865   29.115 93.194  1.00 58.92  ? 448 GLU B O     1 
ATOM   7224  C CB    . GLU B 1 448 ? 5.559   26.966 95.461  1.00 63.34  ? 448 GLU B CB    1 
ATOM   7225  C CG    . GLU B 1 448 ? 5.726   26.185 96.730  1.00 72.78  ? 448 GLU B CG    1 
ATOM   7226  C CD    . GLU B 1 448 ? 5.428   24.707 96.553  1.00 77.66  ? 448 GLU B CD    1 
ATOM   7227  O OE1   . GLU B 1 448 ? 4.998   24.278 95.460  1.00 78.13  ? 448 GLU B OE1   1 
ATOM   7228  O OE2   . GLU B 1 448 ? 5.624   23.956 97.537  1.00 83.62  ? 448 GLU B OE2   1 
ATOM   7229  N N     . PHE B 1 449 ? 7.735   28.837 94.425  1.00 60.03  ? 449 PHE B N     1 
ATOM   7230  C CA    . PHE B 1 449 ? 8.620   29.101 93.308  1.00 60.56  ? 449 PHE B CA    1 
ATOM   7231  C C     . PHE B 1 449 ? 8.917   27.837 92.498  1.00 62.78  ? 449 PHE B C     1 
ATOM   7232  O O     . PHE B 1 449 ? 9.099   26.760 93.048  1.00 62.39  ? 449 PHE B O     1 
ATOM   7233  C CB    . PHE B 1 449 ? 9.997   29.643 93.702  1.00 47.95  ? 449 PHE B CB    1 
ATOM   7234  C CG    . PHE B 1 449 ? 9.981   31.116 93.965  1.00 47.06  ? 449 PHE B CG    1 
ATOM   7235  C CD1   . PHE B 1 449 ? 10.080  32.024 92.933  1.00 50.14  ? 449 PHE B CD1   1 
ATOM   7236  C CD2   . PHE B 1 449 ? 9.844   31.592 95.251  1.00 44.96  ? 449 PHE B CD2   1 
ATOM   7237  C CE1   . PHE B 1 449 ? 10.064  33.384 93.184  1.00 52.19  ? 449 PHE B CE1   1 
ATOM   7238  C CE2   . PHE B 1 449 ? 9.833   32.940 95.519  1.00 46.94  ? 449 PHE B CE2   1 
ATOM   7239  C CZ    . PHE B 1 449 ? 9.933   33.832 94.473  1.00 51.70  ? 449 PHE B CZ    1 
ATOM   7240  N N     . GLU B 1 450 ? 8.999   28.019 91.187  1.00 65.01  ? 450 GLU B N     1 
ATOM   7241  C CA    . GLU B 1 450 ? 9.409   26.958 90.279  1.00 66.12  ? 450 GLU B CA    1 
ATOM   7242  C C     . GLU B 1 450 ? 10.853  27.325 89.906  1.00 65.29  ? 450 GLU B C     1 
ATOM   7243  O O     . GLU B 1 450 ? 11.709  26.474 89.719  1.00 66.27  ? 450 GLU B O     1 
ATOM   7244  C CB    . GLU B 1 450 ? 8.547   26.827 89.035  1.00 75.88  ? 450 GLU B CB    1 
ATOM   7245  C CG    . GLU B 1 450 ? 9.133   25.898 87.987  1.00 85.70  ? 450 GLU B CG    1 
ATOM   7246  C CD    . GLU B 1 450 ? 8.571   26.048 86.593  1.00 92.61  ? 450 GLU B CD    1 
ATOM   7247  O OE1   . GLU B 1 450 ? 7.420   26.510 86.435  1.00 96.29  ? 450 GLU B OE1   1 
ATOM   7248  O OE2   . GLU B 1 450 ? 9.290   25.688 85.631  1.00 96.08  ? 450 GLU B OE2   1 
ATOM   7249  N N     . TYR B 1 451 ? 11.090  28.629 89.850  1.00 64.05  ? 451 TYR B N     1 
ATOM   7250  C CA    . TYR B 1 451 ? 12.395  29.193 89.568  1.00 63.89  ? 451 TYR B CA    1 
ATOM   7251  C C     . TYR B 1 451 ? 12.486  30.563 90.238  1.00 62.37  ? 451 TYR B C     1 
ATOM   7252  O O     . TYR B 1 451 ? 11.660  31.418 89.933  1.00 62.01  ? 451 TYR B O     1 
ATOM   7253  C CB    . TYR B 1 451 ? 12.680  29.358 88.072  1.00 69.29  ? 451 TYR B CB    1 
ATOM   7254  C CG    . TYR B 1 451 ? 13.641  30.493 87.751  1.00 76.17  ? 451 TYR B CG    1 
ATOM   7255  C CD1   . TYR B 1 451 ? 14.996  30.383 88.029  1.00 79.15  ? 451 TYR B CD1   1 
ATOM   7256  C CD2   . TYR B 1 451 ? 13.188  31.686 87.206  1.00 78.99  ? 451 TYR B CD2   1 
ATOM   7257  C CE1   . TYR B 1 451 ? 15.872  31.415 87.763  1.00 80.97  ? 451 TYR B CE1   1 
ATOM   7258  C CE2   . TYR B 1 451 ? 14.052  32.728 86.931  1.00 82.19  ? 451 TYR B CE2   1 
ATOM   7259  C CZ    . TYR B 1 451 ? 15.395  32.588 87.216  1.00 83.90  ? 451 TYR B CZ    1 
ATOM   7260  O OH    . TYR B 1 451 ? 16.269  33.621 86.943  1.00 85.49  ? 451 TYR B OH    1 
ATOM   7261  N N     . GLU B 1 452 ? 13.497  30.786 91.062  1.00 60.98  ? 452 GLU B N     1 
ATOM   7262  C CA    . GLU B 1 452 ? 13.669  32.084 91.687  1.00 62.47  ? 452 GLU B CA    1 
ATOM   7263  C C     . GLU B 1 452 ? 15.035  32.705 91.377  1.00 64.82  ? 452 GLU B C     1 
ATOM   7264  O O     . GLU B 1 452 ? 16.087  32.296 91.871  1.00 65.29  ? 452 GLU B O     1 
ATOM   7265  C CB    . GLU B 1 452 ? 13.460  32.079 93.203  1.00 57.03  ? 452 GLU B CB    1 
ATOM   7266  C CG    . GLU B 1 452 ? 13.655  33.459 93.832  1.00 53.30  ? 452 GLU B CG    1 
ATOM   7267  C CD    . GLU B 1 452 ? 13.626  33.446 95.350  1.00 53.68  ? 452 GLU B CD    1 
ATOM   7268  O OE1   . GLU B 1 452 ? 13.459  32.339 95.907  1.00 51.01  ? 452 GLU B OE1   1 
ATOM   7269  O OE2   . GLU B 1 452 ? 13.780  34.523 95.975  1.00 48.24  ? 452 GLU B OE2   1 
ATOM   7270  N N     . PRO B 1 453 ? 14.974  33.778 90.594  1.00 65.83  ? 453 PRO B N     1 
ATOM   7271  C CA    . PRO B 1 453 ? 16.156  34.537 90.242  1.00 66.63  ? 453 PRO B CA    1 
ATOM   7272  C C     . PRO B 1 453 ? 16.674  35.283 91.464  1.00 65.36  ? 453 PRO B C     1 
ATOM   7273  O O     . PRO B 1 453 ? 15.889  35.818 92.229  1.00 63.65  ? 453 PRO B O     1 
ATOM   7274  C CB    . PRO B 1 453 ? 15.699  35.522 89.171  1.00 66.51  ? 453 PRO B CB    1 
ATOM   7275  C CG    . PRO B 1 453 ? 14.220  35.548 89.229  1.00 66.86  ? 453 PRO B CG    1 
ATOM   7276  C CD    . PRO B 1 453 ? 13.745  34.348 89.993  1.00 66.12  ? 453 PRO B CD    1 
ATOM   7277  N N     . PRO B 1 454 ? 17.989  35.398 91.583  1.00 67.21  ? 454 PRO B N     1 
ATOM   7278  C CA    . PRO B 1 454 ? 18.650  36.082 92.671  1.00 67.64  ? 454 PRO B CA    1 
ATOM   7279  C C     . PRO B 1 454 ? 18.284  37.535 92.912  1.00 67.24  ? 454 PRO B C     1 
ATOM   7280  O O     . PRO B 1 454 ? 18.309  38.031 94.049  1.00 66.15  ? 454 PRO B O     1 
ATOM   7281  C CB    . PRO B 1 454 ? 20.133  35.984 92.297  1.00 68.86  ? 454 PRO B CB    1 
ATOM   7282  C CG    . PRO B 1 454 ? 20.234  34.759 91.450  1.00 68.94  ? 454 PRO B CG    1 
ATOM   7283  C CD    . PRO B 1 454 ? 18.958  34.743 90.654  1.00 67.69  ? 454 PRO B CD    1 
ATOM   7284  N N     . VAL B 1 455 ? 18.017  38.292 91.857  1.00 66.20  ? 455 VAL B N     1 
ATOM   7285  C CA    . VAL B 1 455 ? 17.640  39.692 91.966  1.00 64.75  ? 455 VAL B CA    1 
ATOM   7286  C C     . VAL B 1 455 ? 16.480  39.965 91.004  1.00 62.76  ? 455 VAL B C     1 
ATOM   7287  O O     . VAL B 1 455 ? 16.301  39.241 90.020  1.00 61.70  ? 455 VAL B O     1 
ATOM   7288  C CB    . VAL B 1 455 ? 18.763  40.688 91.625  1.00 67.39  ? 455 VAL B CB    1 
ATOM   7289  C CG1   . VAL B 1 455 ? 19.705  40.940 92.790  1.00 68.48  ? 455 VAL B CG1   1 
ATOM   7290  C CG2   . VAL B 1 455 ? 19.528  40.206 90.399  1.00 67.40  ? 455 VAL B CG2   1 
ATOM   7291  N N     . LEU B 1 456 ? 15.704  41.002 91.301  1.00 61.31  ? 456 LEU B N     1 
ATOM   7292  C CA    . LEU B 1 456 ? 14.550  41.350 90.467  1.00 62.07  ? 456 LEU B CA    1 
ATOM   7293  C C     . LEU B 1 456 ? 13.734  40.128 90.082  1.00 59.52  ? 456 LEU B C     1 
ATOM   7294  O O     . LEU B 1 456 ? 13.484  39.861 88.902  1.00 62.05  ? 456 LEU B O     1 
ATOM   7295  C CB    . LEU B 1 456 ? 15.040  42.062 89.199  1.00 64.22  ? 456 LEU B CB    1 
ATOM   7296  C CG    . LEU B 1 456 ? 15.919  43.292 89.430  1.00 62.11  ? 456 LEU B CG    1 
ATOM   7297  C CD1   . LEU B 1 456 ? 16.526  43.720 88.102  1.00 64.47  ? 456 LEU B CD1   1 
ATOM   7298  C CD2   . LEU B 1 456 ? 15.114  44.401 90.088  1.00 61.60  ? 456 LEU B CD2   1 
ATOM   7299  N N     . ARG B 1 457 ? 13.291  39.351 91.076  1.00 54.50  ? 457 ARG B N     1 
ATOM   7300  C CA    . ARG B 1 457 ? 12.599  38.103 90.797  1.00 47.95  ? 457 ARG B CA    1 
ATOM   7301  C C     . ARG B 1 457 ? 11.132  38.351 90.438  1.00 40.55  ? 457 ARG B C     1 
ATOM   7302  O O     . ARG B 1 457 ? 10.510  37.424 89.923  1.00 36.35  ? 457 ARG B O     1 
ATOM   7303  C CB    . ARG B 1 457 ? 12.691  37.144 91.992  1.00 47.08  ? 457 ARG B CB    1 
ATOM   7304  C CG    . ARG B 1 457 ? 11.966  37.708 93.206  1.00 57.48  ? 457 ARG B CG    1 
ATOM   7305  C CD    . ARG B 1 457 ? 11.398  36.650 94.138  1.00 52.38  ? 457 ARG B CD    1 
ATOM   7306  N NE    . ARG B 1 457 ? 10.723  37.287 95.265  1.00 55.53  ? 457 ARG B NE    1 
ATOM   7307  C CZ    . ARG B 1 457 ? 10.403  36.754 96.431  1.00 59.49  ? 457 ARG B CZ    1 
ATOM   7308  N NH1   . ARG B 1 457 ? 10.707  35.489 96.684  1.00 54.39  ? 457 ARG B NH1   1 
ATOM   7309  N NH2   . ARG B 1 457 ? 9.782   37.498 97.348  1.00 54.10  ? 457 ARG B NH2   1 
ATOM   7310  N N     . HIS B 1 458 ? 10.673  39.558 90.745  1.00 36.26  ? 458 HIS B N     1 
ATOM   7311  C CA    . HIS B 1 458 ? 9.282   39.955 90.541  1.00 40.17  ? 458 HIS B CA    1 
ATOM   7312  C C     . HIS B 1 458 ? 8.987   40.012 89.050  1.00 41.28  ? 458 HIS B C     1 
ATOM   7313  O O     . HIS B 1 458 ? 7.942   39.582 88.560  1.00 38.52  ? 458 HIS B O     1 
ATOM   7314  C CB    . HIS B 1 458 ? 9.087   41.220 91.351  1.00 46.54  ? 458 HIS B CB    1 
ATOM   7315  C CG    . HIS B 1 458 ? 8.511   42.437 90.739  1.00 58.50  ? 458 HIS B CG    1 
ATOM   7316  N ND1   . HIS B 1 458 ? 9.296   43.494 90.305  1.00 64.76  ? 458 HIS B ND1   1 
ATOM   7317  C CD2   . HIS B 1 458 ? 7.222   42.778 90.493  1.00 62.08  ? 458 HIS B CD2   1 
ATOM   7318  C CE1   . HIS B 1 458 ? 8.502   44.428 89.801  1.00 69.82  ? 458 HIS B CE1   1 
ATOM   7319  N NE2   . HIS B 1 458 ? 7.242   44.022 89.901  1.00 67.90  ? 458 HIS B NE2   1 
ATOM   7320  N N     . PHE B 1 459 ? 9.997   40.372 88.254  1.00 40.22  ? 459 PHE B N     1 
ATOM   7321  C CA    . PHE B 1 459 ? 9.913   40.405 86.814  1.00 39.07  ? 459 PHE B CA    1 
ATOM   7322  C C     . PHE B 1 459 ? 10.076  39.058 86.148  1.00 40.74  ? 459 PHE B C     1 
ATOM   7323  O O     . PHE B 1 459 ? 9.440   38.926 85.090  1.00 45.38  ? 459 PHE B O     1 
ATOM   7324  C CB    . PHE B 1 459 ? 10.977  41.331 86.251  1.00 28.30  ? 459 PHE B CB    1 
ATOM   7325  C CG    . PHE B 1 459 ? 10.837  42.786 86.545  1.00 28.56  ? 459 PHE B CG    1 
ATOM   7326  C CD1   . PHE B 1 459 ? 9.662   43.459 86.307  1.00 34.92  ? 459 PHE B CD1   1 
ATOM   7327  C CD2   . PHE B 1 459 ? 11.894  43.504 87.068  1.00 35.43  ? 459 PHE B CD2   1 
ATOM   7328  C CE1   . PHE B 1 459 ? 9.536   44.806 86.566  1.00 30.08  ? 459 PHE B CE1   1 
ATOM   7329  C CE2   . PHE B 1 459 ? 11.772  44.855 87.352  1.00 34.92  ? 459 PHE B CE2   1 
ATOM   7330  C CZ    . PHE B 1 459 ? 10.593  45.510 87.095  1.00 31.93  ? 459 PHE B CZ    1 
ATOM   7331  N N     . THR B 1 460 ? 10.868  38.096 86.622  1.00 41.47  ? 460 THR B N     1 
ATOM   7332  C CA    . THR B 1 460 ? 11.041  36.873 85.836  1.00 38.63  ? 460 THR B CA    1 
ATOM   7333  C C     . THR B 1 460 ? 10.871  35.560 86.568  1.00 42.79  ? 460 THR B C     1 
ATOM   7334  O O     . THR B 1 460 ? 11.056  34.522 85.885  1.00 40.12  ? 460 THR B O     1 
ATOM   7335  C CB    . THR B 1 460 ? 12.447  36.795 85.179  1.00 44.15  ? 460 THR B CB    1 
ATOM   7336  O OG1   . THR B 1 460 ? 13.442  37.324 86.059  1.00 47.01  ? 460 THR B OG1   1 
ATOM   7337  C CG2   . THR B 1 460 ? 12.490  37.568 83.866  1.00 43.33  ? 460 THR B CG2   1 
ATOM   7338  N N     . ALA B 1 461 ? 10.565  35.568 87.880  1.00 39.32  ? 461 ALA B N     1 
ATOM   7339  C CA    . ALA B 1 461 ? 10.442  34.269 88.528  1.00 37.96  ? 461 ALA B CA    1 
ATOM   7340  C C     . ALA B 1 461 ? 9.370   33.395 87.908  1.00 39.87  ? 461 ALA B C     1 
ATOM   7341  O O     . ALA B 1 461 ? 8.320   33.901 87.495  1.00 41.86  ? 461 ALA B O     1 
ATOM   7342  C CB    . ALA B 1 461 ? 10.056  34.444 89.999  1.00 46.37  ? 461 ALA B CB    1 
ATOM   7343  N N     . ARG B 1 462 ? 9.612   32.097 87.894  1.00 38.10  ? 462 ARG B N     1 
ATOM   7344  C CA    . ARG B 1 462 ? 8.566   31.153 87.505  1.00 42.66  ? 462 ARG B CA    1 
ATOM   7345  C C     . ARG B 1 462 ? 7.999   30.593 88.819  1.00 45.98  ? 462 ARG B C     1 
ATOM   7346  O O     . ARG B 1 462 ? 8.750   30.203 89.721  1.00 44.16  ? 462 ARG B O     1 
ATOM   7347  C CB    . ARG B 1 462 ? 9.048   30.093 86.533  1.00 45.54  ? 462 ARG B CB    1 
ATOM   7348  C CG    . ARG B 1 462 ? 9.500   30.758 85.219  1.00 49.48  ? 462 ARG B CG    1 
ATOM   7349  C CD    . ARG B 1 462 ? 9.863   29.686 84.222  1.00 47.91  ? 462 ARG B CD    1 
ATOM   7350  N NE    . ARG B 1 462 ? 8.775   28.759 83.932  1.00 50.58  ? 462 ARG B NE    1 
ATOM   7351  C CZ    . ARG B 1 462 ? 7.853   28.985 82.999  1.00 52.52  ? 462 ARG B CZ    1 
ATOM   7352  N NH1   . ARG B 1 462 ? 7.873   30.103 82.290  1.00 46.73  ? 462 ARG B NH1   1 
ATOM   7353  N NH2   . ARG B 1 462 ? 6.915   28.068 82.799  1.00 50.47  ? 462 ARG B NH2   1 
ATOM   7354  N N     . LEU B 1 463 ? 6.687   30.687 88.986  1.00 43.14  ? 463 LEU B N     1 
ATOM   7355  C CA    . LEU B 1 463 ? 6.019   30.281 90.196  1.00 43.07  ? 463 LEU B CA    1 
ATOM   7356  C C     . LEU B 1 463 ? 5.081   29.117 89.892  1.00 46.75  ? 463 LEU B C     1 
ATOM   7357  O O     . LEU B 1 463 ? 4.792   28.793 88.740  1.00 47.55  ? 463 LEU B O     1 
ATOM   7358  C CB    . LEU B 1 463 ? 5.187   31.398 90.818  1.00 41.42  ? 463 LEU B CB    1 
ATOM   7359  C CG    . LEU B 1 463 ? 5.780   32.783 90.998  1.00 39.72  ? 463 LEU B CG    1 
ATOM   7360  C CD1   . LEU B 1 463 ? 4.687   33.820 91.191  1.00 43.73  ? 463 LEU B CD1   1 
ATOM   7361  C CD2   . LEU B 1 463 ? 6.731   32.849 92.179  1.00 47.82  ? 463 LEU B CD2   1 
ATOM   7362  N N     . LYS B 1 464 ? 4.625   28.505 90.985  1.00 49.00  ? 464 LYS B N     1 
ATOM   7363  C CA    . LYS B 1 464 ? 3.637   27.433 90.822  1.00 52.25  ? 464 LYS B CA    1 
ATOM   7364  C C     . LYS B 1 464 ? 2.627   27.515 91.967  1.00 50.51  ? 464 LYS B C     1 
ATOM   7365  O O     . LYS B 1 464 ? 2.927   27.920 93.086  1.00 48.04  ? 464 LYS B O     1 
ATOM   7366  C CB    . LYS B 1 464 ? 4.261   26.075 90.615  1.00 61.06  ? 464 LYS B CB    1 
ATOM   7367  C CG    . LYS B 1 464 ? 4.650   25.250 91.818  1.00 69.80  ? 464 LYS B CG    1 
ATOM   7368  C CD    . LYS B 1 464 ? 5.465   24.030 91.407  1.00 77.87  ? 464 LYS B CD    1 
ATOM   7369  C CE    . LYS B 1 464 ? 4.607   22.976 90.728  1.00 81.87  ? 464 LYS B CE    1 
ATOM   7370  N NZ    . LYS B 1 464 ? 5.197   21.612 90.839  1.00 85.22  ? 464 LYS B NZ    1 
ATOM   7371  N N     . PRO B 1 465 ? 1.390   27.195 91.615  1.00 52.27  ? 465 PRO B N     1 
ATOM   7372  C CA    . PRO B 1 465 ? 0.301   27.189 92.574  1.00 56.04  ? 465 PRO B CA    1 
ATOM   7373  C C     . PRO B 1 465 ? 0.525   26.081 93.599  1.00 58.57  ? 465 PRO B C     1 
ATOM   7374  O O     . PRO B 1 465 ? 0.921   24.961 93.256  1.00 56.40  ? 465 PRO B O     1 
ATOM   7375  C CB    . PRO B 1 465 ? -0.939  26.972 91.724  1.00 55.04  ? 465 PRO B CB    1 
ATOM   7376  C CG    . PRO B 1 465 ? -0.455  26.231 90.532  1.00 54.29  ? 465 PRO B CG    1 
ATOM   7377  C CD    . PRO B 1 465 ? 0.954   26.699 90.289  1.00 52.80  ? 465 PRO B CD    1 
ATOM   7378  N N     . ILE B 1 466 ? 0.302   26.438 94.862  1.00 61.24  ? 466 ILE B N     1 
ATOM   7379  C CA    . ILE B 1 466 ? 0.465   25.470 95.954  1.00 63.23  ? 466 ILE B CA    1 
ATOM   7380  C C     . ILE B 1 466 ? -0.673  24.458 95.959  1.00 65.03  ? 466 ILE B C     1 
ATOM   7381  O O     . ILE B 1 466 ? -0.429  23.263 95.657  1.00 66.45  ? 466 ILE B O     1 
ATOM   7382  C CB    . ILE B 1 466 ? 0.609   26.246 97.272  1.00 62.59  ? 466 ILE B CB    1 
ATOM   7383  C CG1   . ILE B 1 466 ? 2.099   26.320 97.645  1.00 59.95  ? 466 ILE B CG1   1 
ATOM   7384  C CG2   . ILE B 1 466 ? -0.199  25.670 98.418  1.00 68.96  ? 466 ILE B CG2   1 
ATOM   7385  C CD1   . ILE B 1 466 ? 2.436   27.540 98.468  1.00 56.40  ? 466 ILE B CD1   1 
ATOM   7386  N N     . ALA C 1 2   ? 22.289  71.019 29.555  1.00 25.75  ? 2   ALA C N     1 
ATOM   7387  C CA    . ALA C 1 2   ? 21.146  70.675 30.462  1.00 26.59  ? 2   ALA C CA    1 
ATOM   7388  C C     . ALA C 1 2   ? 21.598  70.950 31.897  1.00 25.73  ? 2   ALA C C     1 
ATOM   7389  O O     . ALA C 1 2   ? 22.725  70.617 32.242  1.00 28.90  ? 2   ALA C O     1 
ATOM   7390  C CB    . ALA C 1 2   ? 20.718  69.248 30.185  1.00 19.83  ? 2   ALA C CB    1 
ATOM   7391  N N     . LYS C 1 3   ? 20.857  71.693 32.674  1.00 23.29  ? 3   LYS C N     1 
ATOM   7392  C CA    . LYS C 1 3   ? 21.274  72.063 34.029  1.00 24.17  ? 3   LYS C CA    1 
ATOM   7393  C C     . LYS C 1 3   ? 20.374  71.439 35.089  1.00 24.66  ? 3   LYS C C     1 
ATOM   7394  O O     . LYS C 1 3   ? 19.146  71.609 35.071  1.00 20.53  ? 3   LYS C O     1 
ATOM   7395  C CB    . LYS C 1 3   ? 21.260  73.580 34.137  1.00 24.47  ? 3   LYS C CB    1 
ATOM   7396  C CG    . LYS C 1 3   ? 21.571  74.185 35.480  1.00 47.39  ? 3   LYS C CG    1 
ATOM   7397  C CD    . LYS C 1 3   ? 21.322  75.686 35.532  1.00 58.70  ? 3   LYS C CD    1 
ATOM   7398  C CE    . LYS C 1 3   ? 19.865  76.053 35.294  1.00 66.84  ? 3   LYS C CE    1 
ATOM   7399  N NZ    . LYS C 1 3   ? 19.443  77.299 35.998  1.00 75.39  ? 3   LYS C NZ    1 
ATOM   7400  N N     . ARG C 1 4   ? 20.981  70.726 36.014  1.00 21.06  ? 4   ARG C N     1 
ATOM   7401  C CA    . ARG C 1 4   ? 20.273  70.084 37.117  1.00 20.21  ? 4   ARG C CA    1 
ATOM   7402  C C     . ARG C 1 4   ? 20.054  71.066 38.243  1.00 20.55  ? 4   ARG C C     1 
ATOM   7403  O O     . ARG C 1 4   ? 20.944  71.864 38.564  1.00 18.11  ? 4   ARG C O     1 
ATOM   7404  C CB    . ARG C 1 4   ? 21.071  68.874 37.620  1.00 18.34  ? 4   ARG C CB    1 
ATOM   7405  C CG    . ARG C 1 4   ? 20.985  67.743 36.637  1.00 19.38  ? 4   ARG C CG    1 
ATOM   7406  C CD    . ARG C 1 4   ? 21.983  66.636 36.874  1.00 27.49  ? 4   ARG C CD    1 
ATOM   7407  N NE    . ARG C 1 4   ? 21.601  65.765 37.960  1.00 36.34  ? 4   ARG C NE    1 
ATOM   7408  C CZ    . ARG C 1 4   ? 21.323  64.471 37.974  1.00 38.60  ? 4   ARG C CZ    1 
ATOM   7409  N NH1   . ARG C 1 4   ? 21.336  63.748 36.880  1.00 25.33  ? 4   ARG C NH1   1 
ATOM   7410  N NH2   . ARG C 1 4   ? 21.021  63.863 39.122  1.00 40.09  ? 4   ARG C NH2   1 
ATOM   7411  N N     . ILE C 1 5   ? 18.819  71.140 38.745  1.00 15.04  ? 5   ILE C N     1 
ATOM   7412  C CA    . ILE C 1 5   ? 18.577  72.117 39.837  1.00 14.65  ? 5   ILE C CA    1 
ATOM   7413  C C     . ILE C 1 5   ? 18.328  71.288 41.107  1.00 18.52  ? 5   ILE C C     1 
ATOM   7414  O O     . ILE C 1 5   ? 17.589  70.297 41.038  1.00 18.57  ? 5   ILE C O     1 
ATOM   7415  C CB    . ILE C 1 5   ? 17.425  73.055 39.503  1.00 21.48  ? 5   ILE C CB    1 
ATOM   7416  C CG1   . ILE C 1 5   ? 17.865  73.972 38.337  1.00 27.29  ? 5   ILE C CG1   1 
ATOM   7417  C CG2   . ILE C 1 5   ? 17.047  73.927 40.702  1.00 11.99  ? 5   ILE C CG2   1 
ATOM   7418  C CD1   . ILE C 1 5   ? 16.739  74.828 37.816  1.00 34.17  ? 5   ILE C CD1   1 
ATOM   7419  N N     . VAL C 1 6   ? 18.993  71.624 42.205  1.00 15.88  ? 6   VAL C N     1 
ATOM   7420  C CA    . VAL C 1 6   ? 18.929  70.879 43.442  1.00 14.56  ? 6   VAL C CA    1 
ATOM   7421  C C     . VAL C 1 6   ? 17.598  71.075 44.188  1.00 10.88  ? 6   VAL C C     1 
ATOM   7422  O O     . VAL C 1 6   ? 16.996  72.165 44.242  1.00 9.56   ? 6   VAL C O     1 
ATOM   7423  C CB    . VAL C 1 6   ? 20.129  71.199 44.361  1.00 16.91  ? 6   VAL C CB    1 
ATOM   7424  C CG1   . VAL C 1 6   ? 20.065  72.638 44.850  1.00 18.04  ? 6   VAL C CG1   1 
ATOM   7425  C CG2   . VAL C 1 6   ? 20.156  70.278 45.585  1.00 15.67  ? 6   VAL C CG2   1 
ATOM   7426  N N     . GLU C 1 7   ? 17.126  70.013 44.813  1.00 12.41  ? 7   GLU C N     1 
ATOM   7427  C CA    . GLU C 1 7   ? 15.869  70.098 45.568  1.00 11.90  ? 7   GLU C CA    1 
ATOM   7428  C C     . GLU C 1 7   ? 16.003  71.096 46.708  1.00 11.39  ? 7   GLU C C     1 
ATOM   7429  O O     . GLU C 1 7   ? 16.891  70.983 47.566  1.00 11.46  ? 7   GLU C O     1 
ATOM   7430  C CB    . GLU C 1 7   ? 15.551  68.717 46.164  1.00 12.32  ? 7   GLU C CB    1 
ATOM   7431  C CG    . GLU C 1 7   ? 15.134  67.655 45.169  1.00 9.04   ? 7   GLU C CG    1 
ATOM   7432  C CD    . GLU C 1 7   ? 16.295  67.095 44.341  1.00 17.45  ? 7   GLU C CD    1 
ATOM   7433  O OE1   . GLU C 1 7   ? 17.494  67.320 44.624  1.00 13.38  ? 7   GLU C OE1   1 
ATOM   7434  O OE2   . GLU C 1 7   ? 15.957  66.340 43.412  1.00 12.35  ? 7   GLU C OE2   1 
ATOM   7435  N N     . PRO C 1 8   ? 15.025  71.965 46.875  1.00 13.03  ? 8   PRO C N     1 
ATOM   7436  C CA    . PRO C 1 8   ? 14.907  72.811 48.060  1.00 10.26  ? 8   PRO C CA    1 
ATOM   7437  C C     . PRO C 1 8   ? 14.193  72.061 49.189  1.00 11.04  ? 8   PRO C C     1 
ATOM   7438  O O     . PRO C 1 8   ? 13.394  72.647 49.918  1.00 8.83   ? 8   PRO C O     1 
ATOM   7439  C CB    . PRO C 1 8   ? 14.028  73.973 47.590  1.00 10.94  ? 8   PRO C CB    1 
ATOM   7440  C CG    . PRO C 1 8   ? 13.195  73.401 46.491  1.00 9.64   ? 8   PRO C CG    1 
ATOM   7441  C CD    . PRO C 1 8   ? 13.871  72.161 45.949  1.00 11.91  ? 8   PRO C CD    1 
ATOM   7442  N N     . PHE C 1 9   ? 14.325  70.752 49.312  1.00 8.83   ? 9   PHE C N     1 
ATOM   7443  C CA    . PHE C 1 9   ? 13.750  69.942 50.374  1.00 13.39  ? 9   PHE C CA    1 
ATOM   7444  C C     . PHE C 1 9   ? 14.628  68.712 50.547  1.00 13.04  ? 9   PHE C C     1 
ATOM   7445  O O     . PHE C 1 9   ? 15.483  68.457 49.692  1.00 13.39  ? 9   PHE C O     1 
ATOM   7446  C CB    . PHE C 1 9   ? 12.316  69.429 50.088  1.00 6.91   ? 9   PHE C CB    1 
ATOM   7447  C CG    . PHE C 1 9   ? 12.128  68.783 48.737  1.00 10.46  ? 9   PHE C CG    1 
ATOM   7448  C CD1   . PHE C 1 9   ? 12.408  67.462 48.491  1.00 9.14   ? 9   PHE C CD1   1 
ATOM   7449  C CD2   . PHE C 1 9   ? 11.673  69.559 47.661  1.00 11.92  ? 9   PHE C CD2   1 
ATOM   7450  C CE1   . PHE C 1 9   ? 12.239  66.889 47.244  1.00 14.12  ? 9   PHE C CE1   1 
ATOM   7451  C CE2   . PHE C 1 9   ? 11.511  68.983 46.394  1.00 11.84  ? 9   PHE C CE2   1 
ATOM   7452  C CZ    . PHE C 1 9   ? 11.773  67.653 46.184  1.00 9.91   ? 9   PHE C CZ    1 
ATOM   7453  N N     . ARG C 1 10  ? 14.351  67.883 51.552  1.00 9.46   ? 10  ARG C N     1 
ATOM   7454  C CA    . ARG C 1 10  ? 15.053  66.603 51.595  1.00 8.20   ? 10  ARG C CA    1 
ATOM   7455  C C     . ARG C 1 10  ? 13.999  65.535 51.762  1.00 8.79   ? 10  ARG C C     1 
ATOM   7456  O O     . ARG C 1 10  ? 12.828  65.833 51.993  1.00 9.91   ? 10  ARG C O     1 
ATOM   7457  C CB    . ARG C 1 10  ? 16.171  66.558 52.625  1.00 15.55  ? 10  ARG C CB    1 
ATOM   7458  C CG    . ARG C 1 10  ? 15.670  66.943 54.011  1.00 15.78  ? 10  ARG C CG    1 
ATOM   7459  C CD    . ARG C 1 10  ? 16.827  66.804 55.012  1.00 20.02  ? 10  ARG C CD    1 
ATOM   7460  N NE    . ARG C 1 10  ? 16.312  67.200 56.310  1.00 15.74  ? 10  ARG C NE    1 
ATOM   7461  C CZ    . ARG C 1 10  ? 16.870  68.015 57.188  1.00 24.68  ? 10  ARG C CZ    1 
ATOM   7462  N NH1   . ARG C 1 10  ? 18.036  68.600 57.014  1.00 24.77  ? 10  ARG C NH1   1 
ATOM   7463  N NH2   . ARG C 1 10  ? 16.200  68.216 58.328  1.00 21.60  ? 10  ARG C NH2   1 
ATOM   7464  N N     . ILE C 1 11  ? 14.359  64.298 51.583  1.00 7.53   ? 11  ILE C N     1 
ATOM   7465  C CA    . ILE C 1 11  ? 13.398  63.227 51.624  1.00 10.88  ? 11  ILE C CA    1 
ATOM   7466  C C     . ILE C 1 11  ? 13.110  62.828 53.081  1.00 15.16  ? 11  ILE C C     1 
ATOM   7467  O O     . ILE C 1 11  ? 14.036  62.694 53.886  1.00 10.95  ? 11  ILE C O     1 
ATOM   7468  C CB    . ILE C 1 11  ? 13.978  62.060 50.816  1.00 7.07   ? 11  ILE C CB    1 
ATOM   7469  C CG1   . ILE C 1 11  ? 14.376  62.590 49.418  1.00 12.20  ? 11  ILE C CG1   1 
ATOM   7470  C CG2   . ILE C 1 11  ? 13.012  60.894 50.830  1.00 6.54   ? 11  ILE C CG2   1 
ATOM   7471  C CD1   . ILE C 1 11  ? 15.028  61.480 48.602  1.00 10.34  ? 11  ILE C CD1   1 
ATOM   7472  N N     . LYS C 1 12  ? 11.841  62.622 53.340  1.00 10.59  ? 12  LYS C N     1 
ATOM   7473  C CA    . LYS C 1 12  ? 11.422  62.221 54.699  1.00 11.23  ? 12  LYS C CA    1 
ATOM   7474  C C     . LYS C 1 12  ? 10.781  60.850 54.688  1.00 10.44  ? 12  LYS C C     1 
ATOM   7475  O O     . LYS C 1 12  ? 10.859  60.090 55.683  1.00 12.97  ? 12  LYS C O     1 
ATOM   7476  C CB    . LYS C 1 12  ? 10.527  63.270 55.325  1.00 13.92  ? 12  LYS C CB    1 
ATOM   7477  C CG    . LYS C 1 12  ? 10.292  62.936 56.837  1.00 20.39  ? 12  LYS C CG    1 
ATOM   7478  C CD    . LYS C 1 12  ? 10.143  64.229 57.598  1.00 16.84  ? 12  LYS C CD    1 
ATOM   7479  C CE    . LYS C 1 12  ? 9.694   64.066 59.056  1.00 15.65  ? 12  LYS C CE    1 
ATOM   7480  N NZ    . LYS C 1 12  ? 9.623   65.448 59.638  1.00 15.28  ? 12  LYS C NZ    1 
ATOM   7481  N N     . MET C 1 13  ? 10.194  60.453 53.570  1.00 5.32   ? 13  MET C N     1 
ATOM   7482  C CA    . MET C 1 13  ? 9.616   59.131 53.462  1.00 8.13   ? 13  MET C CA    1 
ATOM   7483  C C     . MET C 1 13  ? 9.816   58.627 52.032  1.00 7.14   ? 13  MET C C     1 
ATOM   7484  O O     . MET C 1 13  ? 9.612   59.404 51.112  1.00 6.28   ? 13  MET C O     1 
ATOM   7485  C CB    . MET C 1 13  ? 8.127   59.122 53.833  1.00 7.36   ? 13  MET C CB    1 
ATOM   7486  C CG    . MET C 1 13  ? 7.574   57.696 54.007  1.00 10.75  ? 13  MET C CG    1 
ATOM   7487  S SD    . MET C 1 13  ? 5.730   57.742 54.271  1.00 19.41  ? 13  MET C SD    1 
ATOM   7488  C CE    . MET C 1 13  ? 5.602   58.528 55.826  1.00 18.28  ? 13  MET C CE    1 
ATOM   7489  N N     . VAL C 1 14  ? 10.118  57.352 51.890  1.00 8.89   ? 14  VAL C N     1 
ATOM   7490  C CA    . VAL C 1 14  ? 10.325  56.843 50.527  1.00 10.65  ? 14  VAL C CA    1 
ATOM   7491  C C     . VAL C 1 14  ? 9.273   55.780 50.293  1.00 11.72  ? 14  VAL C C     1 
ATOM   7492  O O     . VAL C 1 14  ? 8.758   55.231 51.264  1.00 10.18  ? 14  VAL C O     1 
ATOM   7493  C CB    . VAL C 1 14  ? 11.722  56.241 50.293  1.00 9.27   ? 14  VAL C CB    1 
ATOM   7494  C CG1   . VAL C 1 14  ? 12.791  57.286 50.599  1.00 10.38  ? 14  VAL C CG1   1 
ATOM   7495  C CG2   . VAL C 1 14  ? 11.982  54.982 51.105  1.00 9.63   ? 14  VAL C CG2   1 
ATOM   7496  N N     . GLU C 1 15  ? 9.117   55.455 49.030  1.00 6.28   ? 15  GLU C N     1 
ATOM   7497  C CA    . GLU C 1 15  ? 8.286   54.368 48.568  1.00 10.53  ? 15  GLU C CA    1 
ATOM   7498  C C     . GLU C 1 15  ? 9.140   53.556 47.604  1.00 9.07   ? 15  GLU C C     1 
ATOM   7499  O O     . GLU C 1 15  ? 9.643   54.139 46.633  1.00 12.41  ? 15  GLU C O     1 
ATOM   7500  C CB    . GLU C 1 15  ? 7.110   55.061 47.838  1.00 8.21   ? 15  GLU C CB    1 
ATOM   7501  C CG    . GLU C 1 15  ? 6.146   54.042 47.245  1.00 15.25  ? 15  GLU C CG    1 
ATOM   7502  C CD    . GLU C 1 15  ? 5.069   54.811 46.430  1.00 24.49  ? 15  GLU C CD    1 
ATOM   7503  O OE1   . GLU C 1 15  ? 5.176   56.016 46.128  1.00 22.47  ? 15  GLU C OE1   1 
ATOM   7504  O OE2   . GLU C 1 15  ? 4.111   54.106 46.091  1.00 28.02  ? 15  GLU C OE2   1 
ATOM   7505  N N     . LYS C 1 16  ? 9.313   52.285 47.792  1.00 13.24  ? 16  LYS C N     1 
ATOM   7506  C CA    . LYS C 1 16  ? 10.067  51.424 46.934  1.00 18.38  ? 16  LYS C CA    1 
ATOM   7507  C C     . LYS C 1 16  ? 9.487   51.329 45.515  1.00 22.48  ? 16  LYS C C     1 
ATOM   7508  O O     . LYS C 1 16  ? 8.292   51.278 45.307  1.00 17.84  ? 16  LYS C O     1 
ATOM   7509  C CB    . LYS C 1 16  ? 10.134  49.980 47.474  1.00 23.15  ? 16  LYS C CB    1 
ATOM   7510  C CG    . LYS C 1 16  ? 11.059  49.165 46.553  1.00 41.16  ? 16  LYS C CG    1 
ATOM   7511  C CD    . LYS C 1 16  ? 11.039  47.682 46.827  1.00 48.87  ? 16  LYS C CD    1 
ATOM   7512  C CE    . LYS C 1 16  ? 12.057  47.294 47.887  1.00 53.25  ? 16  LYS C CE    1 
ATOM   7513  N NZ    . LYS C 1 16  ? 12.048  45.811 48.088  1.00 57.77  ? 16  LYS C NZ    1 
ATOM   7514  N N     . ILE C 1 17  ? 10.354  51.278 44.511  1.00 18.01  ? 17  ILE C N     1 
ATOM   7515  C CA    . ILE C 1 17  ? 9.943   51.115 43.117  1.00 21.34  ? 17  ILE C CA    1 
ATOM   7516  C C     . ILE C 1 17  ? 10.909  50.061 42.569  1.00 23.89  ? 17  ILE C C     1 
ATOM   7517  O O     . ILE C 1 17  ? 12.018  49.928 43.072  1.00 22.67  ? 17  ILE C O     1 
ATOM   7518  C CB    . ILE C 1 17  ? 9.935   52.343 42.223  1.00 21.43  ? 17  ILE C CB    1 
ATOM   7519  C CG1   . ILE C 1 17  ? 11.286  53.077 42.232  1.00 27.73  ? 17  ILE C CG1   1 
ATOM   7520  C CG2   . ILE C 1 17  ? 8.810   53.292 42.605  1.00 27.91  ? 17  ILE C CG2   1 
ATOM   7521  C CD1   . ILE C 1 17  ? 11.329  54.327 41.372  1.00 34.04  ? 17  ILE C CD1   1 
ATOM   7522  N N     . ARG C 1 18  ? 10.457  49.361 41.559  1.00 24.90  ? 18  ARG C N     1 
ATOM   7523  C CA    . ARG C 1 18  ? 11.194  48.256 40.979  1.00 28.90  ? 18  ARG C CA    1 
ATOM   7524  C C     . ARG C 1 18  ? 11.162  48.296 39.453  1.00 29.80  ? 18  ARG C C     1 
ATOM   7525  O O     . ARG C 1 18  ? 10.159  48.731 38.869  1.00 24.26  ? 18  ARG C O     1 
ATOM   7526  C CB    . ARG C 1 18  ? 10.409  47.013 41.446  1.00 31.19  ? 18  ARG C CB    1 
ATOM   7527  C CG    . ARG C 1 18  ? 11.130  45.695 41.339  1.00 48.21  ? 18  ARG C CG    1 
ATOM   7528  C CD    . ARG C 1 18  ? 10.186  44.534 41.645  1.00 56.63  ? 18  ARG C CD    1 
ATOM   7529  N NE    . ARG C 1 18  ? 9.116   44.466 40.652  1.00 67.23  ? 18  ARG C NE    1 
ATOM   7530  C CZ    . ARG C 1 18  ? 9.027   43.577 39.668  1.00 66.55  ? 18  ARG C CZ    1 
ATOM   7531  N NH1   . ARG C 1 18  ? 9.954   42.638 39.507  1.00 67.03  ? 18  ARG C NH1   1 
ATOM   7532  N NH2   . ARG C 1 18  ? 7.993   43.640 38.843  1.00 68.44  ? 18  ARG C NH2   1 
ATOM   7533  N N     . VAL C 1 19  ? 12.203  47.778 38.831  1.00 27.42  ? 19  VAL C N     1 
ATOM   7534  C CA    . VAL C 1 19  ? 12.231  47.617 37.379  1.00 28.40  ? 19  VAL C CA    1 
ATOM   7535  C C     . VAL C 1 19  ? 11.862  46.172 37.100  1.00 27.03  ? 19  VAL C C     1 
ATOM   7536  O O     . VAL C 1 19  ? 12.600  45.277 37.481  1.00 30.25  ? 19  VAL C O     1 
ATOM   7537  C CB    . VAL C 1 19  ? 13.629  47.894 36.803  1.00 34.04  ? 19  VAL C CB    1 
ATOM   7538  C CG1   . VAL C 1 19  ? 13.621  47.791 35.287  1.00 34.87  ? 19  VAL C CG1   1 
ATOM   7539  C CG2   . VAL C 1 19  ? 14.096  49.283 37.224  1.00 32.23  ? 19  VAL C CG2   1 
ATOM   7540  N N     . PRO C 1 20  ? 10.712  45.922 36.517  1.00 26.85  ? 20  PRO C N     1 
ATOM   7541  C CA    . PRO C 1 20  ? 10.325  44.551 36.188  1.00 29.94  ? 20  PRO C CA    1 
ATOM   7542  C C     . PRO C 1 20  ? 11.293  44.087 35.106  1.00 34.20  ? 20  PRO C C     1 
ATOM   7543  O O     . PRO C 1 20  ? 11.840  44.914 34.374  1.00 32.76  ? 20  PRO C O     1 
ATOM   7544  C CB    . PRO C 1 20  ? 8.889   44.668 35.735  1.00 27.83  ? 20  PRO C CB    1 
ATOM   7545  C CG    . PRO C 1 20  ? 8.457   46.074 35.985  1.00 28.23  ? 20  PRO C CG    1 
ATOM   7546  C CD    . PRO C 1 20  ? 9.722   46.901 36.022  1.00 26.58  ? 20  PRO C CD    1 
ATOM   7547  N N     . SER C 1 21  ? 11.582  42.814 35.017  1.00 34.54  ? 21  SER C N     1 
ATOM   7548  C CA    . SER C 1 21  ? 12.468  42.242 34.007  1.00 36.02  ? 21  SER C CA    1 
ATOM   7549  C C     . SER C 1 21  ? 11.866  42.430 32.618  1.00 35.82  ? 21  SER C C     1 
ATOM   7550  O O     . SER C 1 21  ? 10.640  42.542 32.474  1.00 33.29  ? 21  SER C O     1 
ATOM   7551  C CB    . SER C 1 21  ? 12.649  40.736 34.262  1.00 29.49  ? 21  SER C CB    1 
ATOM   7552  O OG    . SER C 1 21  ? 11.471  40.054 33.841  1.00 38.26  ? 21  SER C OG    1 
ATOM   7553  N N     . ARG C 1 22  ? 12.698  42.336 31.579  1.00 37.64  ? 22  ARG C N     1 
ATOM   7554  C CA    . ARG C 1 22  ? 12.210  42.452 30.210  1.00 37.99  ? 22  ARG C CA    1 
ATOM   7555  C C     . ARG C 1 22  ? 11.082  41.455 29.951  1.00 35.24  ? 22  ARG C C     1 
ATOM   7556  O O     . ARG C 1 22  ? 10.065  41.810 29.373  1.00 31.72  ? 22  ARG C O     1 
ATOM   7557  C CB    . ARG C 1 22  ? 13.315  42.269 29.169  1.00 46.31  ? 22  ARG C CB    1 
ATOM   7558  C CG    . ARG C 1 22  ? 12.777  42.199 27.738  1.00 44.61  ? 22  ARG C CG    1 
ATOM   7559  C CD    . ARG C 1 22  ? 12.313  43.568 27.265  1.00 53.77  ? 22  ARG C CD    1 
ATOM   7560  N NE    . ARG C 1 22  ? 11.642  43.499 25.978  1.00 62.09  ? 22  ARG C NE    1 
ATOM   7561  C CZ    . ARG C 1 22  ? 11.954  44.184 24.883  1.00 62.33  ? 22  ARG C CZ    1 
ATOM   7562  N NH1   . ARG C 1 22  ? 12.959  45.045 24.875  1.00 63.37  ? 22  ARG C NH1   1 
ATOM   7563  N NH2   . ARG C 1 22  ? 11.222  43.982 23.796  1.00 65.73  ? 22  ARG C NH2   1 
ATOM   7564  N N     . GLU C 1 23  ? 11.244  40.223 30.404  1.00 35.80  ? 23  GLU C N     1 
ATOM   7565  C CA    . GLU C 1 23  ? 10.209  39.215 30.273  1.00 43.22  ? 23  GLU C CA    1 
ATOM   7566  C C     . GLU C 1 23  ? 8.899   39.625 30.939  1.00 42.69  ? 23  GLU C C     1 
ATOM   7567  O O     . GLU C 1 23  ? 7.823   39.449 30.359  1.00 41.48  ? 23  GLU C O     1 
ATOM   7568  C CB    . GLU C 1 23  ? 10.712  37.895 30.867  1.00 56.19  ? 23  GLU C CB    1 
ATOM   7569  C CG    . GLU C 1 23  ? 9.759   36.737 30.636  1.00 71.20  ? 23  GLU C CG    1 
ATOM   7570  C CD    . GLU C 1 23  ? 10.468  35.399 30.782  1.00 81.15  ? 23  GLU C CD    1 
ATOM   7571  O OE1   . GLU C 1 23  ? 11.000  35.152 31.892  1.00 85.59  ? 23  GLU C OE1   1 
ATOM   7572  O OE2   . GLU C 1 23  ? 10.482  34.638 29.791  1.00 85.50  ? 23  GLU C OE2   1 
ATOM   7573  N N     . GLU C 1 24  ? 8.978   40.164 32.160  1.00 40.90  ? 24  GLU C N     1 
ATOM   7574  C CA    . GLU C 1 24  ? 7.799   40.615 32.896  1.00 38.68  ? 24  GLU C CA    1 
ATOM   7575  C C     . GLU C 1 24  ? 7.119   41.758 32.147  1.00 33.57  ? 24  GLU C C     1 
ATOM   7576  O O     . GLU C 1 24  ? 5.901   41.723 31.979  1.00 33.15  ? 24  GLU C O     1 
ATOM   7577  C CB    . GLU C 1 24  ? 8.097   41.081 34.317  1.00 44.37  ? 24  GLU C CB    1 
ATOM   7578  C CG    . GLU C 1 24  ? 8.779   40.101 35.252  1.00 54.14  ? 24  GLU C CG    1 
ATOM   7579  C CD    . GLU C 1 24  ? 9.211   40.745 36.558  1.00 59.23  ? 24  GLU C CD    1 
ATOM   7580  O OE1   . GLU C 1 24  ? 8.306   41.011 37.382  1.00 67.58  ? 24  GLU C OE1   1 
ATOM   7581  O OE2   . GLU C 1 24  ? 10.415  40.998 36.781  1.00 56.18  ? 24  GLU C OE2   1 
ATOM   7582  N N     . ARG C 1 25  ? 7.886   42.721 31.651  1.00 31.33  ? 25  ARG C N     1 
ATOM   7583  C CA    . ARG C 1 25  ? 7.295   43.809 30.868  1.00 33.80  ? 25  ARG C CA    1 
ATOM   7584  C C     . ARG C 1 25  ? 6.591   43.341 29.598  1.00 35.87  ? 25  ARG C C     1 
ATOM   7585  O O     . ARG C 1 25  ? 5.494   43.803 29.274  1.00 32.38  ? 25  ARG C O     1 
ATOM   7586  C CB    . ARG C 1 25  ? 8.336   44.874 30.535  1.00 30.02  ? 25  ARG C CB    1 
ATOM   7587  C CG    . ARG C 1 25  ? 9.145   45.267 31.758  1.00 34.04  ? 25  ARG C CG    1 
ATOM   7588  C CD    . ARG C 1 25  ? 9.951   46.520 31.594  1.00 38.51  ? 25  ARG C CD    1 
ATOM   7589  N NE    . ARG C 1 25  ? 10.986  46.502 30.600  1.00 35.29  ? 25  ARG C NE    1 
ATOM   7590  C CZ    . ARG C 1 25  ? 12.265  46.213 30.770  1.00 43.23  ? 25  ARG C CZ    1 
ATOM   7591  N NH1   . ARG C 1 25  ? 12.735  45.857 31.953  1.00 38.12  ? 25  ARG C NH1   1 
ATOM   7592  N NH2   . ARG C 1 25  ? 13.080  46.276 29.735  1.00 40.87  ? 25  ARG C NH2   1 
ATOM   7593  N N     . GLU C 1 26  ? 7.190   42.365 28.903  1.00 35.92  ? 26  GLU C N     1 
ATOM   7594  C CA    . GLU C 1 26  ? 6.606   41.841 27.679  1.00 38.64  ? 26  GLU C CA    1 
ATOM   7595  C C     . GLU C 1 26  ? 5.277   41.178 27.973  1.00 35.46  ? 26  GLU C C     1 
ATOM   7596  O O     . GLU C 1 26  ? 4.259   41.467 27.348  1.00 33.56  ? 26  GLU C O     1 
ATOM   7597  C CB    . GLU C 1 26  ? 7.570   40.870 26.998  1.00 50.94  ? 26  GLU C CB    1 
ATOM   7598  C CG    . GLU C 1 26  ? 8.859   41.569 26.608  1.00 62.41  ? 26  GLU C CG    1 
ATOM   7599  C CD    . GLU C 1 26  ? 9.770   40.749 25.729  1.00 68.45  ? 26  GLU C CD    1 
ATOM   7600  O OE1   . GLU C 1 26  ? 9.679   39.503 25.769  1.00 72.49  ? 26  GLU C OE1   1 
ATOM   7601  O OE2   . GLU C 1 26  ? 10.574  41.374 25.004  1.00 71.89  ? 26  GLU C OE2   1 
ATOM   7602  N N     . ALA C 1 27  ? 5.305   40.325 28.994  1.00 32.17  ? 27  ALA C N     1 
ATOM   7603  C CA    . ALA C 1 27  ? 4.077   39.632 29.410  1.00 35.89  ? 27  ALA C CA    1 
ATOM   7604  C C     . ALA C 1 27  ? 3.010   40.629 29.812  1.00 37.03  ? 27  ALA C C     1 
ATOM   7605  O O     . ALA C 1 27  ? 1.888   40.556 29.312  1.00 38.01  ? 27  ALA C O     1 
ATOM   7606  C CB    . ALA C 1 27  ? 4.437   38.650 30.518  1.00 36.14  ? 27  ALA C CB    1 
ATOM   7607  N N     . ALA C 1 28  ? 3.361   41.607 30.650  1.00 36.38  ? 28  ALA C N     1 
ATOM   7608  C CA    . ALA C 1 28  ? 2.416   42.645 31.063  1.00 35.05  ? 28  ALA C CA    1 
ATOM   7609  C C     . ALA C 1 28  ? 1.842   43.446 29.910  1.00 32.33  ? 28  ALA C C     1 
ATOM   7610  O O     . ALA C 1 28  ? 0.629   43.695 29.848  1.00 28.80  ? 28  ALA C O     1 
ATOM   7611  C CB    . ALA C 1 28  ? 3.099   43.572 32.071  1.00 34.10  ? 28  ALA C CB    1 
ATOM   7612  N N     . LEU C 1 29  ? 2.640   43.929 28.967  1.00 33.21  ? 29  LEU C N     1 
ATOM   7613  C CA    . LEU C 1 29  ? 2.111   44.706 27.840  1.00 35.60  ? 29  LEU C CA    1 
ATOM   7614  C C     . LEU C 1 29  ? 1.099   43.920 27.004  1.00 36.22  ? 29  LEU C C     1 
ATOM   7615  O O     . LEU C 1 29  ? 0.060   44.433 26.596  1.00 31.65  ? 29  LEU C O     1 
ATOM   7616  C CB    . LEU C 1 29  ? 3.246   45.234 26.955  1.00 30.30  ? 29  LEU C CB    1 
ATOM   7617  C CG    . LEU C 1 29  ? 2.828   46.294 25.927  1.00 36.07  ? 29  LEU C CG    1 
ATOM   7618  C CD1   . LEU C 1 29  ? 2.018   47.416 26.543  1.00 29.53  ? 29  LEU C CD1   1 
ATOM   7619  C CD2   . LEU C 1 29  ? 4.073   46.851 25.239  1.00 39.24  ? 29  LEU C CD2   1 
ATOM   7620  N N     . LYS C 1 30  ? 1.426   42.653 26.763  1.00 38.75  ? 30  LYS C N     1 
ATOM   7621  C CA    . LYS C 1 30  ? 0.583   41.717 26.027  1.00 46.80  ? 30  LYS C CA    1 
ATOM   7622  C C     . LYS C 1 30  ? -0.758  41.546 26.727  1.00 46.42  ? 30  LYS C C     1 
ATOM   7623  O O     . LYS C 1 30  ? -1.834  41.792 26.188  1.00 45.90  ? 30  LYS C O     1 
ATOM   7624  C CB    . LYS C 1 30  ? 1.254   40.348 25.951  1.00 58.92  ? 30  LYS C CB    1 
ATOM   7625  C CG    . LYS C 1 30  ? 2.009   40.055 24.675  1.00 71.08  ? 30  LYS C CG    1 
ATOM   7626  C CD    . LYS C 1 30  ? 2.135   38.551 24.470  1.00 83.76  ? 30  LYS C CD    1 
ATOM   7627  C CE    . LYS C 1 30  ? 0.802   37.917 24.095  1.00 90.13  ? 30  LYS C CE    1 
ATOM   7628  N NZ    . LYS C 1 30  ? 0.990   36.548 23.538  1.00 94.41  ? 30  LYS C NZ    1 
ATOM   7629  N N     . GLU C 1 31  ? -0.661  41.223 28.017  1.00 44.66  ? 31  GLU C N     1 
ATOM   7630  C CA    . GLU C 1 31  ? -1.825  41.124 28.896  1.00 45.10  ? 31  GLU C CA    1 
ATOM   7631  C C     . GLU C 1 31  ? -2.669  42.392 28.875  1.00 40.23  ? 31  GLU C C     1 
ATOM   7632  O O     . GLU C 1 31  ? -3.905  42.346 28.903  1.00 37.18  ? 31  GLU C O     1 
ATOM   7633  C CB    . GLU C 1 31  ? -1.326  40.897 30.313  1.00 58.75  ? 31  GLU C CB    1 
ATOM   7634  C CG    . GLU C 1 31  ? -2.187  40.093 31.263  1.00 78.21  ? 31  GLU C CG    1 
ATOM   7635  C CD    . GLU C 1 31  ? -1.342  39.731 32.487  1.00 89.57  ? 31  GLU C CD    1 
ATOM   7636  O OE1   . GLU C 1 31  ? -0.162  39.351 32.281  1.00 95.08  ? 31  GLU C OE1   1 
ATOM   7637  O OE2   . GLU C 1 31  ? -1.852  39.847 33.620  1.00 94.65  ? 31  GLU C OE2   1 
ATOM   7638  N N     . ALA C 1 32  ? -2.041  43.564 28.816  1.00 35.55  ? 32  ALA C N     1 
ATOM   7639  C CA    . ALA C 1 32  ? -2.728  44.835 28.792  1.00 34.69  ? 32  ALA C CA    1 
ATOM   7640  C C     . ALA C 1 32  ? -3.172  45.253 27.400  1.00 37.42  ? 32  ALA C C     1 
ATOM   7641  O O     . ALA C 1 32  ? -3.609  46.396 27.202  1.00 35.66  ? 32  ALA C O     1 
ATOM   7642  C CB    . ALA C 1 32  ? -1.866  45.921 29.440  1.00 31.24  ? 32  ALA C CB    1 
ATOM   7643  N N     . GLY C 1 33  ? -3.065  44.334 26.429  1.00 38.93  ? 33  GLY C N     1 
ATOM   7644  C CA    . GLY C 1 33  ? -3.481  44.581 25.064  1.00 37.54  ? 33  GLY C CA    1 
ATOM   7645  C C     . GLY C 1 33  ? -2.713  45.709 24.400  1.00 37.88  ? 33  GLY C C     1 
ATOM   7646  O O     . GLY C 1 33  ? -3.292  46.599 23.762  1.00 36.30  ? 33  GLY C O     1 
ATOM   7647  N N     . TYR C 1 34  ? -1.415  45.794 24.669  1.00 38.16  ? 34  TYR C N     1 
ATOM   7648  C CA    . TYR C 1 34  ? -0.527  46.799 24.115  1.00 39.52  ? 34  TYR C CA    1 
ATOM   7649  C C     . TYR C 1 34  ? -0.970  48.218 24.395  1.00 39.37  ? 34  TYR C C     1 
ATOM   7650  O O     . TYR C 1 34  ? -0.705  49.141 23.627  1.00 37.61  ? 34  TYR C O     1 
ATOM   7651  C CB    . TYR C 1 34  ? -0.359  46.540 22.596  1.00 41.47  ? 34  TYR C CB    1 
ATOM   7652  C CG    . TYR C 1 34  ? 0.478   45.282 22.422  1.00 43.67  ? 34  TYR C CG    1 
ATOM   7653  C CD1   . TYR C 1 34  ? 1.859   45.354 22.427  1.00 46.20  ? 34  TYR C CD1   1 
ATOM   7654  C CD2   . TYR C 1 34  ? -0.120  44.039 22.307  1.00 45.19  ? 34  TYR C CD2   1 
ATOM   7655  C CE1   . TYR C 1 34  ? 2.628   44.214 22.293  1.00 49.42  ? 34  TYR C CE1   1 
ATOM   7656  C CE2   . TYR C 1 34  ? 0.637   42.894 22.180  1.00 48.87  ? 34  TYR C CE2   1 
ATOM   7657  C CZ    . TYR C 1 34  ? 2.010   42.989 22.171  1.00 52.68  ? 34  TYR C CZ    1 
ATOM   7658  O OH    . TYR C 1 34  ? 2.772   41.852 22.045  1.00 58.80  ? 34  TYR C OH    1 
ATOM   7659  N N     . ASN C 1 35  ? -1.633  48.408 25.535  1.00 36.42  ? 35  ASN C N     1 
ATOM   7660  C CA    . ASN C 1 35  ? -2.112  49.703 25.951  1.00 36.45  ? 35  ASN C CA    1 
ATOM   7661  C C     . ASN C 1 35  ? -1.712  49.923 27.412  1.00 38.72  ? 35  ASN C C     1 
ATOM   7662  O O     . ASN C 1 35  ? -2.411  49.480 28.314  1.00 37.50  ? 35  ASN C O     1 
ATOM   7663  C CB    . ASN C 1 35  ? -3.620  49.816 25.763  1.00 24.49  ? 35  ASN C CB    1 
ATOM   7664  C CG    . ASN C 1 35  ? -4.180  51.163 26.121  1.00 28.44  ? 35  ASN C CG    1 
ATOM   7665  O OD1   . ASN C 1 35  ? -3.455  52.116 26.418  1.00 33.61  ? 35  ASN C OD1   1 
ATOM   7666  N ND2   . ASN C 1 35  ? -5.512  51.287 26.098  1.00 30.30  ? 35  ASN C ND2   1 
ATOM   7667  N N     . PRO C 1 36  ? -0.655  50.706 27.619  1.00 39.48  ? 36  PRO C N     1 
ATOM   7668  C CA    . PRO C 1 36  ? -0.145  51.072 28.932  1.00 37.09  ? 36  PRO C CA    1 
ATOM   7669  C C     . PRO C 1 36  ? -1.183  51.554 29.921  1.00 33.05  ? 36  PRO C C     1 
ATOM   7670  O O     . PRO C 1 36  ? -1.049  51.207 31.090  1.00 27.67  ? 36  PRO C O     1 
ATOM   7671  C CB    . PRO C 1 36  ? 0.916   52.140 28.625  1.00 38.11  ? 36  PRO C CB    1 
ATOM   7672  C CG    . PRO C 1 36  ? 1.466   51.632 27.314  1.00 38.90  ? 36  PRO C CG    1 
ATOM   7673  C CD    . PRO C 1 36  ? 0.211   51.285 26.550  1.00 39.67  ? 36  PRO C CD    1 
ATOM   7674  N N     . PHE C 1 37  ? -2.275  52.198 29.535  1.00 29.71  ? 37  PHE C N     1 
ATOM   7675  C CA    . PHE C 1 37  ? -3.365  52.575 30.400  1.00 29.66  ? 37  PHE C CA    1 
ATOM   7676  C C     . PHE C 1 37  ? -3.985  51.394 31.158  1.00 26.87  ? 37  PHE C C     1 
ATOM   7677  O O     . PHE C 1 37  ? -4.500  51.624 32.229  1.00 27.19  ? 37  PHE C O     1 
ATOM   7678  C CB    . PHE C 1 37  ? -4.498  53.329 29.695  1.00 25.24  ? 37  PHE C CB    1 
ATOM   7679  C CG    . PHE C 1 37  ? -4.645  54.727 30.226  1.00 28.74  ? 37  PHE C CG    1 
ATOM   7680  C CD1   . PHE C 1 37  ? -5.161  54.953 31.491  1.00 27.27  ? 37  PHE C CD1   1 
ATOM   7681  C CD2   . PHE C 1 37  ? -4.249  55.812 29.453  1.00 28.47  ? 37  PHE C CD2   1 
ATOM   7682  C CE1   . PHE C 1 37  ? -5.286  56.240 31.965  1.00 25.83  ? 37  PHE C CE1   1 
ATOM   7683  C CE2   . PHE C 1 37  ? -4.378  57.098 29.939  1.00 31.26  ? 37  PHE C CE2   1 
ATOM   7684  C CZ    . PHE C 1 37  ? -4.896  57.316 31.195  1.00 30.71  ? 37  PHE C CZ    1 
ATOM   7685  N N     . LEU C 1 38  ? -3.904  50.179 30.668  1.00 25.99  ? 38  LEU C N     1 
ATOM   7686  C CA    . LEU C 1 38  ? -4.381  48.972 31.278  1.00 26.90  ? 38  LEU C CA    1 
ATOM   7687  C C     . LEU C 1 38  ? -3.337  48.231 32.106  1.00 24.52  ? 38  LEU C C     1 
ATOM   7688  O O     . LEU C 1 38  ? -3.615  47.147 32.619  1.00 26.70  ? 38  LEU C O     1 
ATOM   7689  C CB    . LEU C 1 38  ? -4.863  48.005 30.162  1.00 31.64  ? 38  LEU C CB    1 
ATOM   7690  C CG    . LEU C 1 38  ? -6.123  48.541 29.460  1.00 40.50  ? 38  LEU C CG    1 
ATOM   7691  C CD1   . LEU C 1 38  ? -6.507  47.650 28.288  1.00 44.72  ? 38  LEU C CD1   1 
ATOM   7692  C CD2   . LEU C 1 38  ? -7.266  48.698 30.451  1.00 40.61  ? 38  LEU C CD2   1 
ATOM   7693  N N     . LEU C 1 39  ? -2.099  48.721 32.121  1.00 20.11  ? 39  LEU C N     1 
ATOM   7694  C CA    . LEU C 1 39  ? -1.095  48.046 32.932  1.00 20.89  ? 39  LEU C CA    1 
ATOM   7695  C C     . LEU C 1 39  ? -1.403  48.281 34.420  1.00 18.72  ? 39  LEU C C     1 
ATOM   7696  O O     . LEU C 1 39  ? -1.774  49.384 34.799  1.00 17.55  ? 39  LEU C O     1 
ATOM   7697  C CB    . LEU C 1 39  ? 0.284   48.659 32.672  1.00 26.11  ? 39  LEU C CB    1 
ATOM   7698  C CG    . LEU C 1 39  ? 1.005   48.274 31.379  1.00 28.60  ? 39  LEU C CG    1 
ATOM   7699  C CD1   . LEU C 1 39  ? 2.165   49.210 31.128  1.00 26.03  ? 39  LEU C CD1   1 
ATOM   7700  C CD2   . LEU C 1 39  ? 1.447   46.822 31.406  1.00 20.69  ? 39  LEU C CD2   1 
ATOM   7701  N N     . PRO C 1 40  ? -1.180  47.288 35.238  1.00 20.14  ? 40  PRO C N     1 
ATOM   7702  C CA    . PRO C 1 40  ? -1.230  47.512 36.690  1.00 20.02  ? 40  PRO C CA    1 
ATOM   7703  C C     . PRO C 1 40  ? -0.013  48.347 37.068  1.00 22.77  ? 40  PRO C C     1 
ATOM   7704  O O     . PRO C 1 40  ? 1.061   48.196 36.426  1.00 19.13  ? 40  PRO C O     1 
ATOM   7705  C CB    . PRO C 1 40  ? -1.192  46.106 37.242  1.00 20.89  ? 40  PRO C CB    1 
ATOM   7706  C CG    . PRO C 1 40  ? -0.462  45.284 36.226  1.00 24.64  ? 40  PRO C CG    1 
ATOM   7707  C CD    . PRO C 1 40  ? -0.717  45.924 34.886  1.00 19.72  ? 40  PRO C CD    1 
ATOM   7708  N N     . SER C 1 41  ? -0.078  49.182 38.129  1.00 16.16  ? 41  SER C N     1 
ATOM   7709  C CA    . SER C 1 41  ? 1.065   49.984 38.557  1.00 14.20  ? 41  SER C CA    1 
ATOM   7710  C C     . SER C 1 41  ? 2.235   49.104 38.975  1.00 15.22  ? 41  SER C C     1 
ATOM   7711  O O     . SER C 1 41  ? 3.408   49.471 38.924  1.00 17.65  ? 41  SER C O     1 
ATOM   7712  C CB    . SER C 1 41  ? 0.731   50.870 39.780  1.00 15.78  ? 41  SER C CB    1 
ATOM   7713  O OG    . SER C 1 41  ? 0.527   50.014 40.894  1.00 17.35  ? 41  SER C OG    1 
ATOM   7714  N N     . SER C 1 42  ? 1.987   47.851 39.355  1.00 15.40  ? 42  SER C N     1 
ATOM   7715  C CA    . SER C 1 42  ? 3.033   46.929 39.735  1.00 18.40  ? 42  SER C CA    1 
ATOM   7716  C C     . SER C 1 42  ? 3.908   46.548 38.530  1.00 22.90  ? 42  SER C C     1 
ATOM   7717  O O     . SER C 1 42  ? 4.981   45.986 38.736  1.00 22.35  ? 42  SER C O     1 
ATOM   7718  C CB    . SER C 1 42  ? 2.433   45.654 40.313  1.00 18.58  ? 42  SER C CB    1 
ATOM   7719  O OG    . SER C 1 42  ? 1.896   44.923 39.215  1.00 24.71  ? 42  SER C OG    1 
ATOM   7720  N N     . ALA C 1 43  ? 3.507   46.802 37.299  1.00 20.05  ? 43  ALA C N     1 
ATOM   7721  C CA    . ALA C 1 43  ? 4.314   46.502 36.126  1.00 23.22  ? 43  ALA C CA    1 
ATOM   7722  C C     . ALA C 1 43  ? 5.059   47.753 35.652  1.00 24.20  ? 43  ALA C C     1 
ATOM   7723  O O     . ALA C 1 43  ? 5.660   47.729 34.587  1.00 24.63  ? 43  ALA C O     1 
ATOM   7724  C CB    . ALA C 1 43  ? 3.442   45.994 34.992  1.00 18.58  ? 43  ALA C CB    1 
ATOM   7725  N N     . VAL C 1 44  ? 5.062   48.840 36.417  1.00 19.34  ? 44  VAL C N     1 
ATOM   7726  C CA    . VAL C 1 44  ? 5.647   50.076 36.009  1.00 16.62  ? 44  VAL C CA    1 
ATOM   7727  C C     . VAL C 1 44  ? 6.772   50.442 36.961  1.00 21.68  ? 44  VAL C C     1 
ATOM   7728  O O     . VAL C 1 44  ? 6.623   50.232 38.159  1.00 17.88  ? 44  VAL C O     1 
ATOM   7729  C CB    . VAL C 1 44  ? 4.605   51.231 36.021  1.00 20.25  ? 44  VAL C CB    1 
ATOM   7730  C CG1   . VAL C 1 44  ? 5.189   52.599 35.731  1.00 12.51  ? 44  VAL C CG1   1 
ATOM   7731  C CG2   . VAL C 1 44  ? 3.481   50.884 35.076  1.00 17.01  ? 44  VAL C CG2   1 
ATOM   7732  N N     . TYR C 1 45  ? 7.829   50.985 36.373  1.00 19.77  ? 45  TYR C N     1 
ATOM   7733  C CA    . TYR C 1 45  ? 8.951   51.454 37.180  1.00 19.85  ? 45  TYR C CA    1 
ATOM   7734  C C     . TYR C 1 45  ? 8.768   52.942 37.441  1.00 19.92  ? 45  TYR C C     1 
ATOM   7735  O O     . TYR C 1 45  ? 8.544   53.365 38.576  1.00 24.88  ? 45  TYR C O     1 
ATOM   7736  C CB    . TYR C 1 45  ? 10.269  51.138 36.468  1.00 22.35  ? 45  TYR C CB    1 
ATOM   7737  C CG    . TYR C 1 45  ? 11.497  51.769 37.060  1.00 25.32  ? 45  TYR C CG    1 
ATOM   7738  C CD1   . TYR C 1 45  ? 11.724  51.724 38.429  1.00 25.00  ? 45  TYR C CD1   1 
ATOM   7739  C CD2   . TYR C 1 45  ? 12.455  52.398 36.262  1.00 28.50  ? 45  TYR C CD2   1 
ATOM   7740  C CE1   . TYR C 1 45  ? 12.846  52.278 38.990  1.00 29.70  ? 45  TYR C CE1   1 
ATOM   7741  C CE2   . TYR C 1 45  ? 13.586  52.961 36.833  1.00 27.32  ? 45  TYR C CE2   1 
ATOM   7742  C CZ    . TYR C 1 45  ? 13.784  52.901 38.183  1.00 32.32  ? 45  TYR C CZ    1 
ATOM   7743  O OH    . TYR C 1 45  ? 14.898  53.473 38.756  1.00 35.95  ? 45  TYR C OH    1 
ATOM   7744  N N     . ILE C 1 46  ? 8.905   53.805 36.441  1.00 17.49  ? 46  ILE C N     1 
ATOM   7745  C CA    . ILE C 1 46  ? 8.716   55.235 36.626  1.00 13.84  ? 46  ILE C CA    1 
ATOM   7746  C C     . ILE C 1 46  ? 7.391   55.526 35.914  1.00 17.79  ? 46  ILE C C     1 
ATOM   7747  O O     . ILE C 1 46  ? 7.221   55.058 34.761  1.00 13.74  ? 46  ILE C O     1 
ATOM   7748  C CB    . ILE C 1 46  ? 9.879   56.042 36.073  1.00 18.13  ? 46  ILE C CB    1 
ATOM   7749  C CG1   . ILE C 1 46  ? 11.115  55.845 36.972  1.00 16.18  ? 46  ILE C CG1   1 
ATOM   7750  C CG2   . ILE C 1 46  ? 9.541   57.507 35.922  1.00 10.79  ? 46  ILE C CG2   1 
ATOM   7751  C CD1   . ILE C 1 46  ? 12.423  56.268 36.300  1.00 16.88  ? 46  ILE C CD1   1 
ATOM   7752  N N     . ASP C 1 47  ? 6.460   56.171 36.607  1.00 13.06  ? 47  ASP C N     1 
ATOM   7753  C CA    . ASP C 1 47  ? 5.148   56.373 35.982  1.00 12.87  ? 47  ASP C CA    1 
ATOM   7754  C C     . ASP C 1 47  ? 5.018   57.818 35.535  1.00 10.80  ? 47  ASP C C     1 
ATOM   7755  O O     . ASP C 1 47  ? 5.128   58.696 36.362  1.00 12.99  ? 47  ASP C O     1 
ATOM   7756  C CB    . ASP C 1 47  ? 4.023   56.003 36.954  1.00 15.40  ? 47  ASP C CB    1 
ATOM   7757  C CG    . ASP C 1 47  ? 2.767   55.542 36.266  1.00 21.99  ? 47  ASP C CG    1 
ATOM   7758  O OD1   . ASP C 1 47  ? 2.590   55.661 35.031  1.00 17.83  ? 47  ASP C OD1   1 
ATOM   7759  O OD2   . ASP C 1 47  ? 1.891   55.016 36.955  1.00 14.53  ? 47  ASP C OD2   1 
ATOM   7760  N N     . LEU C 1 48  ? 4.878   58.013 34.219  1.00 10.40  ? 48  LEU C N     1 
ATOM   7761  C CA    . LEU C 1 48  ? 4.770   59.358 33.658  1.00 13.20  ? 48  LEU C CA    1 
ATOM   7762  C C     . LEU C 1 48  ? 3.431   59.548 32.939  1.00 12.54  ? 48  LEU C C     1 
ATOM   7763  O O     . LEU C 1 48  ? 3.272   60.442 32.125  1.00 14.62  ? 48  LEU C O     1 
ATOM   7764  C CB    . LEU C 1 48  ? 5.916   59.603 32.662  1.00 13.94  ? 48  LEU C CB    1 
ATOM   7765  C CG    . LEU C 1 48  ? 7.349   59.363 33.183  1.00 15.99  ? 48  LEU C CG    1 
ATOM   7766  C CD1   . LEU C 1 48  ? 8.345   59.665 32.078  1.00 17.04  ? 48  LEU C CD1   1 
ATOM   7767  C CD2   . LEU C 1 48  ? 7.681   60.204 34.419  1.00 10.80  ? 48  LEU C CD2   1 
ATOM   7768  N N     . LEU C 1 49  ? 2.461   58.734 33.311  1.00 11.94  ? 49  LEU C N     1 
ATOM   7769  C CA    . LEU C 1 49  ? 1.097   58.817 32.792  1.00 14.27  ? 49  LEU C CA    1 
ATOM   7770  C C     . LEU C 1 49  ? 0.474   60.174 33.026  1.00 14.73  ? 49  LEU C C     1 
ATOM   7771  O O     . LEU C 1 49  ? -0.167  60.763 32.130  1.00 12.99  ? 49  LEU C O     1 
ATOM   7772  C CB    . LEU C 1 49  ? 0.232   57.716 33.361  1.00 13.54  ? 49  LEU C CB    1 
ATOM   7773  C CG    . LEU C 1 49  ? -1.074  57.381 32.632  1.00 28.92  ? 49  LEU C CG    1 
ATOM   7774  C CD1   . LEU C 1 49  ? -0.759  56.703 31.290  1.00 25.40  ? 49  LEU C CD1   1 
ATOM   7775  C CD2   . LEU C 1 49  ? -1.945  56.462 33.483  1.00 28.80  ? 49  LEU C CD2   1 
ATOM   7776  N N     . THR C 1 50  ? 0.724   60.753 34.205  1.00 8.45   ? 50  THR C N     1 
ATOM   7777  C CA    . THR C 1 50  ? 0.107   62.043 34.477  1.00 7.17   ? 50  THR C CA    1 
ATOM   7778  C C     . THR C 1 50  ? 0.796   62.745 35.618  1.00 9.26   ? 50  THR C C     1 
ATOM   7779  O O     . THR C 1 50  ? 1.525   62.008 36.297  1.00 13.74  ? 50  THR C O     1 
ATOM   7780  C CB    . THR C 1 50  ? -1.397  61.798 34.898  1.00 17.29  ? 50  THR C CB    1 
ATOM   7781  O OG1   . THR C 1 50  ? -1.951  63.089 35.154  1.00 20.51  ? 50  THR C OG1   1 
ATOM   7782  C CG2   . THR C 1 50  ? -1.501  61.040 36.210  1.00 14.52  ? 50  THR C CG2   1 
ATOM   7783  N N     . ASP C 1 51  ? 0.521   64.018 35.822  1.00 9.34   ? 51  ASP C N     1 
ATOM   7784  C CA    . ASP C 1 51  ? 1.016   64.708 37.018  1.00 8.70   ? 51  ASP C CA    1 
ATOM   7785  C C     . ASP C 1 51  ? -0.185  64.950 37.962  1.00 7.86   ? 51  ASP C C     1 
ATOM   7786  O O     . ASP C 1 51  ? -0.202  65.849 38.772  1.00 12.00  ? 51  ASP C O     1 
ATOM   7787  C CB    . ASP C 1 51  ? 1.663   66.050 36.660  1.00 6.42   ? 51  ASP C CB    1 
ATOM   7788  C CG    . ASP C 1 51  ? 0.651   67.054 36.129  1.00 9.05   ? 51  ASP C CG    1 
ATOM   7789  O OD1   . ASP C 1 51  ? -0.253  66.557 35.419  1.00 9.80   ? 51  ASP C OD1   1 
ATOM   7790  O OD2   . ASP C 1 51  ? 0.720   68.272 36.394  1.00 11.39  ? 51  ASP C OD2   1 
ATOM   7791  N N     . SER C 1 52  ? -1.244  64.187 37.844  1.00 9.88   ? 52  SER C N     1 
ATOM   7792  C CA    . SER C 1 52  ? -2.445  64.348 38.610  1.00 10.62  ? 52  SER C CA    1 
ATOM   7793  C C     . SER C 1 52  ? -2.542  63.374 39.790  1.00 8.08   ? 52  SER C C     1 
ATOM   7794  O O     . SER C 1 52  ? -2.666  62.166 39.556  1.00 8.36   ? 52  SER C O     1 
ATOM   7795  C CB    . SER C 1 52  ? -3.656  64.048 37.703  1.00 11.90  ? 52  SER C CB    1 
ATOM   7796  O OG    . SER C 1 52  ? -4.831  64.471 38.432  1.00 16.54  ? 52  SER C OG    1 
ATOM   7797  N N     . GLY C 1 53  ? -2.552  63.948 41.011  1.00 9.63   ? 53  GLY C N     1 
ATOM   7798  C CA    . GLY C 1 53  ? -2.751  63.173 42.221  1.00 9.99   ? 53  GLY C CA    1 
ATOM   7799  C C     . GLY C 1 53  ? -1.655  62.210 42.631  1.00 13.49  ? 53  GLY C C     1 
ATOM   7800  O O     . GLY C 1 53  ? -1.850  61.410 43.553  1.00 7.03   ? 53  GLY C O     1 
ATOM   7801  N N     . THR C 1 54  ? -0.478  62.251 41.992  1.00 7.37   ? 54  THR C N     1 
ATOM   7802  C CA    . THR C 1 54  ? 0.592   61.320 42.303  1.00 8.92   ? 54  THR C CA    1 
ATOM   7803  C C     . THR C 1 54  ? 1.724   62.060 43.036  1.00 9.61   ? 54  THR C C     1 
ATOM   7804  O O     . THR C 1 54  ? 2.792   61.493 43.291  1.00 12.27  ? 54  THR C O     1 
ATOM   7805  C CB    . THR C 1 54  ? 1.162   60.693 41.008  1.00 12.34  ? 54  THR C CB    1 
ATOM   7806  O OG1   . THR C 1 54  ? 1.371   61.746 40.070  1.00 13.85  ? 54  THR C OG1   1 
ATOM   7807  C CG2   . THR C 1 54  ? 0.203   59.705 40.370  1.00 11.07  ? 54  THR C CG2   1 
ATOM   7808  N N     . ASN C 1 55  ? 1.510   63.334 43.304  1.00 5.14   ? 55  ASN C N     1 
ATOM   7809  C CA    . ASN C 1 55  ? 2.505   64.175 43.939  1.00 7.14   ? 55  ASN C CA    1 
ATOM   7810  C C     . ASN C 1 55  ? 2.911   63.664 45.342  1.00 12.00  ? 55  ASN C C     1 
ATOM   7811  O O     . ASN C 1 55  ? 2.102   63.074 46.032  1.00 8.26   ? 55  ASN C O     1 
ATOM   7812  C CB    . ASN C 1 55  ? 1.902   65.573 44.165  1.00 4.84   ? 55  ASN C CB    1 
ATOM   7813  C CG    . ASN C 1 55  ? 1.320   66.114 42.856  1.00 20.39  ? 55  ASN C CG    1 
ATOM   7814  O OD1   . ASN C 1 55  ? 2.038   66.314 41.862  1.00 10.64  ? 55  ASN C OD1   1 
ATOM   7815  N ND2   . ASN C 1 55  ? 0.014   66.320 42.770  1.00 8.55   ? 55  ASN C ND2   1 
ATOM   7816  N N     . ALA C 1 56  ? 4.076   64.140 45.802  1.00 7.88   ? 56  ALA C N     1 
ATOM   7817  C CA    . ALA C 1 56  ? 4.498   63.785 47.169  1.00 8.00   ? 56  ALA C CA    1 
ATOM   7818  C C     . ALA C 1 56  ? 4.142   64.992 48.042  1.00 7.93   ? 56  ALA C C     1 
ATOM   7819  O O     . ALA C 1 56  ? 4.459   66.156 47.773  1.00 9.93   ? 56  ALA C O     1 
ATOM   7820  C CB    . ALA C 1 56  ? 5.987   63.483 47.214  1.00 8.46   ? 56  ALA C CB    1 
ATOM   7821  N N     . MET C 1 57  ? 3.451   64.711 49.153  1.00 6.14   ? 57  MET C N     1 
ATOM   7822  C CA    . MET C 1 57  ? 3.092   65.777 50.107  1.00 8.39   ? 57  MET C CA    1 
ATOM   7823  C C     . MET C 1 57  ? 4.240   66.021 51.111  1.00 7.40   ? 57  MET C C     1 
ATOM   7824  O O     . MET C 1 57  ? 5.159   65.209 51.222  1.00 8.07   ? 57  MET C O     1 
ATOM   7825  C CB    . MET C 1 57  ? 1.856   65.295 50.883  1.00 6.43   ? 57  MET C CB    1 
ATOM   7826  C CG    . MET C 1 57  ? 0.610   65.288 49.994  1.00 8.47   ? 57  MET C CG    1 
ATOM   7827  S SD    . MET C 1 57  ? -0.925  65.414 50.966  1.00 10.95  ? 57  MET C SD    1 
ATOM   7828  C CE    . MET C 1 57  ? -0.980  63.785 51.676  1.00 8.78   ? 57  MET C CE    1 
ATOM   7829  N N     . SER C 1 58  ? 4.215   67.116 51.834  1.00 5.32   ? 58  SER C N     1 
ATOM   7830  C CA    . SER C 1 58  ? 5.217   67.353 52.860  1.00 8.97   ? 58  SER C CA    1 
ATOM   7831  C C     . SER C 1 58  ? 4.783   66.753 54.216  1.00 14.24  ? 58  SER C C     1 
ATOM   7832  O O     . SER C 1 58  ? 3.633   66.316 54.408  1.00 8.05   ? 58  SER C O     1 
ATOM   7833  C CB    . SER C 1 58  ? 5.368   68.862 53.072  1.00 7.19   ? 58  SER C CB    1 
ATOM   7834  O OG    . SER C 1 58  ? 4.146   69.438 53.480  1.00 10.64  ? 58  SER C OG    1 
ATOM   7835  N N     . ASP C 1 59  ? 5.679   66.917 55.194  1.00 9.96   ? 59  ASP C N     1 
ATOM   7836  C CA    . ASP C 1 59  ? 5.324   66.462 56.561  1.00 12.49  ? 59  ASP C CA    1 
ATOM   7837  C C     . ASP C 1 59  ? 4.266   67.395 57.137  1.00 7.40   ? 59  ASP C C     1 
ATOM   7838  O O     . ASP C 1 59  ? 3.318   66.951 57.774  1.00 8.59   ? 59  ASP C O     1 
ATOM   7839  C CB    . ASP C 1 59  ? 6.578   66.418 57.403  1.00 7.42   ? 59  ASP C CB    1 
ATOM   7840  C CG    . ASP C 1 59  ? 7.400   67.677 57.426  1.00 12.25  ? 59  ASP C CG    1 
ATOM   7841  O OD1   . ASP C 1 59  ? 7.167   68.702 56.732  1.00 11.76  ? 59  ASP C OD1   1 
ATOM   7842  O OD2   . ASP C 1 59  ? 8.364   67.642 58.199  1.00 16.31  ? 59  ASP C OD2   1 
ATOM   7843  N N     . HIS C 1 60  ? 4.256   68.687 56.816  1.00 5.50   ? 60  HIS C N     1 
ATOM   7844  C CA    . HIS C 1 60  ? 3.224   69.584 57.242  1.00 8.08   ? 60  HIS C CA    1 
ATOM   7845  C C     . HIS C 1 60  ? 1.864   69.247 56.629  1.00 10.08  ? 60  HIS C C     1 
ATOM   7846  O O     . HIS C 1 60  ? 0.855   69.389 57.346  1.00 9.67   ? 60  HIS C O     1 
ATOM   7847  C CB    . HIS C 1 60  ? 3.511   71.043 56.946  1.00 10.85  ? 60  HIS C CB    1 
ATOM   7848  C CG    . HIS C 1 60  ? 4.655   71.514 57.795  1.00 22.08  ? 60  HIS C CG    1 
ATOM   7849  N ND1   . HIS C 1 60  ? 4.473   72.182 58.979  1.00 26.89  ? 60  HIS C ND1   1 
ATOM   7850  C CD2   . HIS C 1 60  ? 5.999   71.390 57.658  1.00 28.91  ? 60  HIS C CD2   1 
ATOM   7851  C CE1   . HIS C 1 60  ? 5.630   72.476 59.525  1.00 26.25  ? 60  HIS C CE1   1 
ATOM   7852  N NE2   . HIS C 1 60  ? 6.573   72.014 58.735  1.00 25.86  ? 60  HIS C NE2   1 
ATOM   7853  N N     . GLN C 1 61  ? 1.821   68.712 55.396  1.00 8.85   ? 61  GLN C N     1 
ATOM   7854  C CA    . GLN C 1 61  ? 0.521   68.320 54.833  1.00 10.59  ? 61  GLN C CA    1 
ATOM   7855  C C     . GLN C 1 61  ? 0.008   67.064 55.545  1.00 10.98  ? 61  GLN C C     1 
ATOM   7856  O O     . GLN C 1 61  ? -1.189  66.968 55.857  1.00 8.53   ? 61  GLN C O     1 
ATOM   7857  C CB    . GLN C 1 61  ? 0.606   68.054 53.308  1.00 4.21   ? 61  GLN C CB    1 
ATOM   7858  C CG    . GLN C 1 61  ? 0.737   69.369 52.510  1.00 6.13   ? 61  GLN C CG    1 
ATOM   7859  C CD    . GLN C 1 61  ? 1.004   69.068 51.030  1.00 11.83  ? 61  GLN C CD    1 
ATOM   7860  O OE1   . GLN C 1 61  ? 2.105   68.622 50.667  1.00 10.31  ? 61  GLN C OE1   1 
ATOM   7861  N NE2   . GLN C 1 61  ? -0.001  69.259 50.194  1.00 7.82   ? 61  GLN C NE2   1 
ATOM   7862  N N     . TRP C 1 62  ? 0.879   66.109 55.843  1.00 6.39   ? 62  TRP C N     1 
ATOM   7863  C CA    . TRP C 1 62  ? 0.455   64.896 56.532  1.00 7.63   ? 62  TRP C CA    1 
ATOM   7864  C C     . TRP C 1 62  ? -0.010  65.223 57.955  1.00 10.89  ? 62  TRP C C     1 
ATOM   7865  O O     . TRP C 1 62  ? -0.991  64.687 58.431  1.00 11.44  ? 62  TRP C O     1 
ATOM   7866  C CB    . TRP C 1 62  ? 1.555   63.841 56.537  1.00 6.40   ? 62  TRP C CB    1 
ATOM   7867  C CG    . TRP C 1 62  ? 1.505   62.979 55.297  1.00 13.94  ? 62  TRP C CG    1 
ATOM   7868  C CD1   . TRP C 1 62  ? 2.195   63.250 54.131  1.00 10.19  ? 62  TRP C CD1   1 
ATOM   7869  C CD2   . TRP C 1 62  ? 0.771   61.793 55.074  1.00 17.73  ? 62  TRP C CD2   1 
ATOM   7870  N NE1   . TRP C 1 62  ? 1.939   62.244 53.221  1.00 15.55  ? 62  TRP C NE1   1 
ATOM   7871  C CE2   . TRP C 1 62  ? 1.058   61.356 53.757  1.00 16.78  ? 62  TRP C CE2   1 
ATOM   7872  C CE3   . TRP C 1 62  ? -0.118  61.036 55.854  1.00 21.12  ? 62  TRP C CE3   1 
ATOM   7873  C CZ2   . TRP C 1 62  ? 0.476   60.212 53.198  1.00 19.96  ? 62  TRP C CZ2   1 
ATOM   7874  C CZ3   . TRP C 1 62  ? -0.684  59.894 55.293  1.00 24.89  ? 62  TRP C CZ3   1 
ATOM   7875  C CH2   . TRP C 1 62  ? -0.387  59.501 53.984  1.00 23.81  ? 62  TRP C CH2   1 
ATOM   7876  N N     . ALA C 1 63  ? 0.660   66.186 58.596  1.00 10.49  ? 63  ALA C N     1 
ATOM   7877  C CA    . ALA C 1 63  ? 0.325   66.590 59.951  1.00 14.83  ? 63  ALA C CA    1 
ATOM   7878  C C     . ALA C 1 63  ? -1.084  67.231 59.930  1.00 15.66  ? 63  ALA C C     1 
ATOM   7879  O O     . ALA C 1 63  ? -1.925  66.950 60.783  1.00 10.76  ? 63  ALA C O     1 
ATOM   7880  C CB    . ALA C 1 63  ? 1.330   67.582 60.505  1.00 5.49   ? 63  ALA C CB    1 
ATOM   7881  N N     . ALA C 1 64  ? -1.328  68.095 58.952  1.00 10.33  ? 64  ALA C N     1 
ATOM   7882  C CA    . ALA C 1 64  ? -2.637  68.730 58.759  1.00 9.66   ? 64  ALA C CA    1 
ATOM   7883  C C     . ALA C 1 64  ? -3.731  67.698 58.516  1.00 9.49   ? 64  ALA C C     1 
ATOM   7884  O O     . ALA C 1 64  ? -4.863  67.830 59.049  1.00 9.14   ? 64  ALA C O     1 
ATOM   7885  C CB    . ALA C 1 64  ? -2.594  69.737 57.611  1.00 11.74  ? 64  ALA C CB    1 
ATOM   7886  N N     . MET C 1 65  ? -3.457  66.588 57.836  1.00 7.57   ? 65  MET C N     1 
ATOM   7887  C CA    . MET C 1 65  ? -4.448  65.536 57.678  1.00 11.49  ? 65  MET C CA    1 
ATOM   7888  C C     . MET C 1 65  ? -4.794  64.919 59.039  1.00 17.04  ? 65  MET C C     1 
ATOM   7889  O O     . MET C 1 65  ? -5.962  64.633 59.346  1.00 9.23   ? 65  MET C O     1 
ATOM   7890  C CB    . MET C 1 65  ? -3.913  64.428 56.740  1.00 5.94   ? 65  MET C CB    1 
ATOM   7891  C CG    . MET C 1 65  ? -3.761  64.915 55.263  1.00 12.31  ? 65  MET C CG    1 
ATOM   7892  S SD    . MET C 1 65  ? -4.138  63.592 54.111  1.00 17.99  ? 65  MET C SD    1 
ATOM   7893  C CE    . MET C 1 65  ? -2.944  62.329 54.474  1.00 18.00  ? 65  MET C CE    1 
ATOM   7894  N N     . ILE C 1 66  ? -3.783  64.644 59.870  1.00 10.41  ? 66  ILE C N     1 
ATOM   7895  C CA    . ILE C 1 66  ? -4.029  63.955 61.150  1.00 11.63  ? 66  ILE C CA    1 
ATOM   7896  C C     . ILE C 1 66  ? -5.000  64.752 62.007  1.00 6.13   ? 66  ILE C C     1 
ATOM   7897  O O     . ILE C 1 66  ? -5.803  64.188 62.765  1.00 11.09  ? 66  ILE C O     1 
ATOM   7898  C CB    . ILE C 1 66  ? -2.701  63.704 61.890  1.00 15.19  ? 66  ILE C CB    1 
ATOM   7899  C CG1   . ILE C 1 66  ? -1.787  62.776 61.049  1.00 19.77  ? 66  ILE C CG1   1 
ATOM   7900  C CG2   . ILE C 1 66  ? -2.890  63.081 63.276  1.00 14.95  ? 66  ILE C CG2   1 
ATOM   7901  C CD1   . ILE C 1 66  ? -2.355  61.382 60.897  1.00 38.10  ? 66  ILE C CD1   1 
ATOM   7902  N N     . THR C 1 67  ? -4.862  66.078 62.046  1.00 6.20   ? 67  THR C N     1 
ATOM   7903  C CA    . THR C 1 67  ? -5.741  66.878 62.879  1.00 10.05  ? 67  THR C CA    1 
ATOM   7904  C C     . THR C 1 67  ? -6.928  67.416 62.090  1.00 10.98  ? 67  THR C C     1 
ATOM   7905  O O     . THR C 1 67  ? -7.652  68.266 62.612  1.00 10.47  ? 67  THR C O     1 
ATOM   7906  C CB    . THR C 1 67  ? -4.995  68.037 63.546  1.00 13.49  ? 67  THR C CB    1 
ATOM   7907  O OG1   . THR C 1 67  ? -4.429  68.860 62.508  1.00 16.03  ? 67  THR C OG1   1 
ATOM   7908  C CG2   . THR C 1 67  ? -3.872  67.555 64.458  1.00 12.00  ? 67  THR C CG2   1 
ATOM   7909  N N     . GLY C 1 68  ? -7.188  66.912 60.874  1.00 14.01  ? 68  GLY C N     1 
ATOM   7910  C CA    . GLY C 1 68  ? -8.331  67.451 60.111  1.00 12.50  ? 68  GLY C CA    1 
ATOM   7911  C C     . GLY C 1 68  ? -9.653  67.116 60.824  1.00 13.71  ? 68  GLY C C     1 
ATOM   7912  O O     . GLY C 1 68  ? -9.865  66.072 61.450  1.00 11.45  ? 68  GLY C O     1 
ATOM   7913  N N     . ASP C 1 69  ? -10.604 68.029 60.653  1.00 11.94  ? 69  ASP C N     1 
ATOM   7914  C CA    . ASP C 1 69  ? -11.957 67.896 61.258  1.00 8.26   ? 69  ASP C CA    1 
ATOM   7915  C C     . ASP C 1 69  ? -12.880 67.181 60.295  1.00 10.52  ? 69  ASP C C     1 
ATOM   7916  O O     . ASP C 1 69  ? -13.238 67.708 59.222  1.00 10.70  ? 69  ASP C O     1 
ATOM   7917  C CB    . ASP C 1 69  ? -12.374 69.362 61.490  1.00 7.65   ? 69  ASP C CB    1 
ATOM   7918  C CG    . ASP C 1 69  ? -13.719 69.479 62.194  1.00 10.92  ? 69  ASP C CG    1 
ATOM   7919  O OD1   . ASP C 1 69  ? -14.332 68.451 62.472  1.00 8.99   ? 69  ASP C OD1   1 
ATOM   7920  O OD2   . ASP C 1 69  ? -14.198 70.587 62.489  1.00 9.39   ? 69  ASP C OD2   1 
ATOM   7921  N N     . GLU C 1 70  ? -13.360 65.991 60.605  1.00 5.19   ? 70  GLU C N     1 
ATOM   7922  C CA    . GLU C 1 70  ? -14.258 65.231 59.788  1.00 5.53   ? 70  GLU C CA    1 
ATOM   7923  C C     . GLU C 1 70  ? -15.734 65.603 59.961  1.00 8.74   ? 70  GLU C C     1 
ATOM   7924  O O     . GLU C 1 70  ? -16.600 64.913 59.424  1.00 11.19  ? 70  GLU C O     1 
ATOM   7925  C CB    . GLU C 1 70  ? -14.046 63.737 60.039  1.00 7.05   ? 70  GLU C CB    1 
ATOM   7926  C CG    . GLU C 1 70  ? -12.599 63.321 59.664  1.00 10.02  ? 70  GLU C CG    1 
ATOM   7927  C CD    . GLU C 1 70  ? -12.350 63.515 58.164  1.00 20.42  ? 70  GLU C CD    1 
ATOM   7928  O OE1   . GLU C 1 70  ? -13.287 63.597 57.324  1.00 9.40   ? 70  GLU C OE1   1 
ATOM   7929  O OE2   . GLU C 1 70  ? -11.183 63.623 57.775  1.00 10.38  ? 70  GLU C OE2   1 
ATOM   7930  N N     . ALA C 1 71  ? -16.040 66.723 60.590  1.00 9.16   ? 71  ALA C N     1 
ATOM   7931  C CA    . ALA C 1 71  ? -17.430 67.093 60.833  1.00 12.82  ? 71  ALA C CA    1 
ATOM   7932  C C     . ALA C 1 71  ? -18.178 67.210 59.519  1.00 15.48  ? 71  ALA C C     1 
ATOM   7933  O O     . ALA C 1 71  ? -17.740 67.787 58.529  1.00 14.01  ? 71  ALA C O     1 
ATOM   7934  C CB    . ALA C 1 71  ? -17.437 68.411 61.576  1.00 10.24  ? 71  ALA C CB    1 
ATOM   7935  N N     . TYR C 1 72  ? -19.407 66.704 59.542  1.00 15.10  ? 72  TYR C N     1 
ATOM   7936  C CA    . TYR C 1 72  ? -20.279 66.694 58.365  1.00 15.56  ? 72  TYR C CA    1 
ATOM   7937  C C     . TYR C 1 72  ? -20.600 68.092 57.898  1.00 14.43  ? 72  TYR C C     1 
ATOM   7938  O O     . TYR C 1 72  ? -20.587 68.386 56.696  1.00 17.27  ? 72  TYR C O     1 
ATOM   7939  C CB    . TYR C 1 72  ? -21.586 65.936 58.623  1.00 15.70  ? 72  TYR C CB    1 
ATOM   7940  C CG    . TYR C 1 72  ? -22.193 65.566 57.281  1.00 14.34  ? 72  TYR C CG    1 
ATOM   7941  C CD1   . TYR C 1 72  ? -21.706 64.427 56.667  1.00 16.23  ? 72  TYR C CD1   1 
ATOM   7942  C CD2   . TYR C 1 72  ? -23.155 66.333 56.652  1.00 14.14  ? 72  TYR C CD2   1 
ATOM   7943  C CE1   . TYR C 1 72  ? -22.183 64.033 55.422  1.00 19.10  ? 72  TYR C CE1   1 
ATOM   7944  C CE2   . TYR C 1 72  ? -23.671 65.944 55.411  1.00 17.39  ? 72  TYR C CE2   1 
ATOM   7945  C CZ    . TYR C 1 72  ? -23.145 64.804 54.809  1.00 20.37  ? 72  TYR C CZ    1 
ATOM   7946  O OH    . TYR C 1 72  ? -23.560 64.354 53.568  1.00 21.10  ? 72  TYR C OH    1 
ATOM   7947  N N     . ALA C 1 73  ? -20.829 68.982 58.842  1.00 14.13  ? 73  ALA C N     1 
ATOM   7948  C CA    . ALA C 1 73  ? -21.134 70.367 58.574  1.00 14.83  ? 73  ALA C CA    1 
ATOM   7949  C C     . ALA C 1 73  ? -20.297 71.290 59.423  1.00 13.57  ? 73  ALA C C     1 
ATOM   7950  O O     . ALA C 1 73  ? -20.156 71.101 60.651  1.00 15.61  ? 73  ALA C O     1 
ATOM   7951  C CB    . ALA C 1 73  ? -22.621 70.565 58.898  1.00 15.04  ? 73  ALA C CB    1 
ATOM   7952  N N     . GLY C 1 74  ? -19.718 72.328 58.818  1.00 13.20  ? 74  GLY C N     1 
ATOM   7953  C CA    . GLY C 1 74  ? -18.982 73.326 59.589  1.00 11.52  ? 74  GLY C CA    1 
ATOM   7954  C C     . GLY C 1 74  ? -17.571 72.877 59.979  1.00 10.88  ? 74  GLY C C     1 
ATOM   7955  O O     . GLY C 1 74  ? -17.037 73.377 60.982  1.00 10.66  ? 74  GLY C O     1 
ATOM   7956  N N     . SER C 1 75  ? -16.971 71.940 59.275  1.00 12.12  ? 75  SER C N     1 
ATOM   7957  C CA    . SER C 1 75  ? -15.574 71.563 59.536  1.00 11.29  ? 75  SER C CA    1 
ATOM   7958  C C     . SER C 1 75  ? -14.711 72.799 59.667  1.00 12.63  ? 75  SER C C     1 
ATOM   7959  O O     . SER C 1 75  ? -14.765 73.769 58.874  1.00 12.62  ? 75  SER C O     1 
ATOM   7960  C CB    . SER C 1 75  ? -15.027 70.748 58.370  1.00 12.39  ? 75  SER C CB    1 
ATOM   7961  O OG    . SER C 1 75  ? -13.619 70.517 58.445  1.00 15.85  ? 75  SER C OG    1 
ATOM   7962  N N     . ARG C 1 76  ? -13.796 72.812 60.625  1.00 13.76  ? 76  ARG C N     1 
ATOM   7963  C CA    . ARG C 1 76  ? -12.822 73.894 60.779  1.00 12.11  ? 76  ARG C CA    1 
ATOM   7964  C C     . ARG C 1 76  ? -12.052 74.107 59.450  1.00 8.50   ? 76  ARG C C     1 
ATOM   7965  O O     . ARG C 1 76  ? -11.667 75.226 59.180  1.00 10.79  ? 76  ARG C O     1 
ATOM   7966  C CB    . ARG C 1 76  ? -11.687 73.404 61.696  1.00 18.66  ? 76  ARG C CB    1 
ATOM   7967  C CG    . ARG C 1 76  ? -11.783 73.441 63.196  1.00 39.01  ? 76  ARG C CG    1 
ATOM   7968  C CD    . ARG C 1 76  ? -10.390 73.322 63.822  1.00 38.16  ? 76  ARG C CD    1 
ATOM   7969  N NE    . ARG C 1 76  ? -9.807  72.004 63.644  1.00 36.50  ? 76  ARG C NE    1 
ATOM   7970  C CZ    . ARG C 1 76  ? -10.271 70.872 64.143  1.00 37.19  ? 76  ARG C CZ    1 
ATOM   7971  N NH1   . ARG C 1 76  ? -11.377 70.834 64.884  1.00 37.14  ? 76  ARG C NH1   1 
ATOM   7972  N NH2   . ARG C 1 76  ? -9.640  69.718 63.913  1.00 35.90  ? 76  ARG C NH2   1 
ATOM   7973  N N     . ASN C 1 77  ? -11.668 72.996 58.799  1.00 6.19   ? 77  ASN C N     1 
ATOM   7974  C CA    . ASN C 1 77  ? -10.856 73.114 57.589  1.00 14.26  ? 77  ASN C CA    1 
ATOM   7975  C C     . ASN C 1 77  ? -11.581 73.758 56.420  1.00 15.33  ? 77  ASN C C     1 
ATOM   7976  O O     . ASN C 1 77  ? -10.905 74.310 55.531  1.00 14.19  ? 77  ASN C O     1 
ATOM   7977  C CB    . ASN C 1 77  ? -10.321 71.732 57.150  1.00 9.28   ? 77  ASN C CB    1 
ATOM   7978  C CG    . ASN C 1 77  ? -9.730  71.038 58.393  1.00 18.34  ? 77  ASN C CG    1 
ATOM   7979  O OD1   . ASN C 1 77  ? -10.251 70.067 58.910  1.00 15.31  ? 77  ASN C OD1   1 
ATOM   7980  N ND2   . ASN C 1 77  ? -8.607  71.567 58.844  1.00 9.73   ? 77  ASN C ND2   1 
ATOM   7981  N N     . TYR C 1 78  ? -12.905 73.716 56.390  1.00 11.51  ? 78  TYR C N     1 
ATOM   7982  C CA    . TYR C 1 78  ? -13.714 74.368 55.388  1.00 11.45  ? 78  TYR C CA    1 
ATOM   7983  C C     . TYR C 1 78  ? -13.512 75.878 55.572  1.00 13.74  ? 78  TYR C C     1 
ATOM   7984  O O     . TYR C 1 78  ? -13.213 76.584 54.585  1.00 12.84  ? 78  TYR C O     1 
ATOM   7985  C CB    . TYR C 1 78  ? -15.208 73.992 55.464  1.00 12.23  ? 78  TYR C CB    1 
ATOM   7986  C CG    . TYR C 1 78  ? -16.074 75.013 54.753  1.00 13.74  ? 78  TYR C CG    1 
ATOM   7987  C CD1   . TYR C 1 78  ? -16.235 74.928 53.357  1.00 15.82  ? 78  TYR C CD1   1 
ATOM   7988  C CD2   . TYR C 1 78  ? -16.681 76.033 55.435  1.00 13.25  ? 78  TYR C CD2   1 
ATOM   7989  C CE1   . TYR C 1 78  ? -17.010 75.887 52.712  1.00 16.19  ? 78  TYR C CE1   1 
ATOM   7990  C CE2   . TYR C 1 78  ? -17.462 76.997 54.799  1.00 18.44  ? 78  TYR C CE2   1 
ATOM   7991  C CZ    . TYR C 1 78  ? -17.622 76.893 53.424  1.00 17.18  ? 78  TYR C CZ    1 
ATOM   7992  O OH    . TYR C 1 78  ? -18.367 77.826 52.779  1.00 16.88  ? 78  TYR C OH    1 
ATOM   7993  N N     . TYR C 1 79  ? -13.585 76.352 56.838  1.00 11.10  ? 79  TYR C N     1 
ATOM   7994  C CA    . TYR C 1 79  ? -13.371 77.775 57.045  1.00 10.55  ? 79  TYR C CA    1 
ATOM   7995  C C     . TYR C 1 79  ? -11.939 78.193 56.705  1.00 13.52  ? 79  TYR C C     1 
ATOM   7996  O O     . TYR C 1 79  ? -11.719 79.305 56.207  1.00 12.74  ? 79  TYR C O     1 
ATOM   7997  C CB    . TYR C 1 79  ? -13.714 78.219 58.490  1.00 13.76  ? 79  TYR C CB    1 
ATOM   7998  C CG    . TYR C 1 79  ? -15.170 77.911 58.773  1.00 15.65  ? 79  TYR C CG    1 
ATOM   7999  C CD1   . TYR C 1 79  ? -16.179 78.764 58.309  1.00 18.21  ? 79  TYR C CD1   1 
ATOM   8000  C CD2   . TYR C 1 79  ? -15.508 76.782 59.471  1.00 16.39  ? 79  TYR C CD2   1 
ATOM   8001  C CE1   . TYR C 1 79  ? -17.510 78.484 58.526  1.00 19.08  ? 79  TYR C CE1   1 
ATOM   8002  C CE2   . TYR C 1 79  ? -16.848 76.486 59.715  1.00 21.56  ? 79  TYR C CE2   1 
ATOM   8003  C CZ    . TYR C 1 79  ? -17.829 77.336 59.228  1.00 24.33  ? 79  TYR C CZ    1 
ATOM   8004  O OH    . TYR C 1 79  ? -19.136 76.999 59.499  1.00 32.39  ? 79  TYR C OH    1 
ATOM   8005  N N     . ASP C 1 80  ? -10.941 77.365 57.080  1.00 11.68  ? 80  ASP C N     1 
ATOM   8006  C CA    . ASP C 1 80  ? -9.564  77.696 56.701  1.00 12.27  ? 80  ASP C CA    1 
ATOM   8007  C C     . ASP C 1 80  ? -9.404  77.771 55.161  1.00 10.55  ? 80  ASP C C     1 
ATOM   8008  O O     . ASP C 1 80  ? -8.649  78.597 54.675  1.00 10.55  ? 80  ASP C O     1 
ATOM   8009  C CB    . ASP C 1 80  ? -8.586  76.614 57.178  1.00 11.22  ? 80  ASP C CB    1 
ATOM   8010  C CG    . ASP C 1 80  ? -8.353  76.630 58.687  1.00 18.98  ? 80  ASP C CG    1 
ATOM   8011  O OD1   . ASP C 1 80  ? -8.695  77.611 59.399  1.00 14.98  ? 80  ASP C OD1   1 
ATOM   8012  O OD2   . ASP C 1 80  ? -7.836  75.612 59.154  1.00 17.37  ? 80  ASP C OD2   1 
ATOM   8013  N N     . LEU C 1 81  ? -10.023 76.833 54.440  1.00 7.30   ? 81  LEU C N     1 
ATOM   8014  C CA    . LEU C 1 81  ? -9.942  76.835 52.975  1.00 9.56   ? 81  LEU C CA    1 
ATOM   8015  C C     . LEU C 1 81  ? -10.587 78.087 52.394  1.00 13.72  ? 81  LEU C C     1 
ATOM   8016  O O     . LEU C 1 81  ? -10.069 78.781 51.510  1.00 12.86  ? 81  LEU C O     1 
ATOM   8017  C CB    . LEU C 1 81  ? -10.657 75.581 52.423  1.00 9.30   ? 81  LEU C CB    1 
ATOM   8018  C CG    . LEU C 1 81  ? -10.574 75.314 50.915  1.00 16.45  ? 81  LEU C CG    1 
ATOM   8019  C CD1   . LEU C 1 81  ? -9.118  75.218 50.443  1.00 12.41  ? 81  LEU C CD1   1 
ATOM   8020  C CD2   . LEU C 1 81  ? -11.303 73.995 50.633  1.00 13.52  ? 81  LEU C CD2   1 
ATOM   8021  N N     . LYS C 1 82  ? -11.740 78.467 52.953  1.00 12.98  ? 82  LYS C N     1 
ATOM   8022  C CA    . LYS C 1 82  ? -12.410 79.690 52.532  1.00 14.54  ? 82  LYS C CA    1 
ATOM   8023  C C     . LYS C 1 82  ? -11.491 80.879 52.732  1.00 14.38  ? 82  LYS C C     1 
ATOM   8024  O O     . LYS C 1 82  ? -11.309 81.691 51.798  1.00 14.70  ? 82  LYS C O     1 
ATOM   8025  C CB    . LYS C 1 82  ? -13.728 79.895 53.256  1.00 14.38  ? 82  LYS C CB    1 
ATOM   8026  C CG    . LYS C 1 82  ? -14.493 81.164 52.912  1.00 18.38  ? 82  LYS C CG    1 
ATOM   8027  C CD    . LYS C 1 82  ? -15.913 81.043 53.475  1.00 21.37  ? 82  LYS C CD    1 
ATOM   8028  C CE    . LYS C 1 82  ? -16.748 82.241 53.036  1.00 23.78  ? 82  LYS C CE    1 
ATOM   8029  N NZ    . LYS C 1 82  ? -16.192 83.535 53.514  1.00 25.27  ? 82  LYS C NZ    1 
ATOM   8030  N N     . ASP C 1 83  ? -10.851 80.980 53.904  1.00 13.42  ? 83  ASP C N     1 
ATOM   8031  C CA    . ASP C 1 83  ? -9.893  82.076 54.087  1.00 12.74  ? 83  ASP C CA    1 
ATOM   8032  C C     . ASP C 1 83  ? -8.697  81.956 53.152  1.00 11.24  ? 83  ASP C C     1 
ATOM   8033  O O     . ASP C 1 83  ? -8.191  82.986 52.737  1.00 13.42  ? 83  ASP C O     1 
ATOM   8034  C CB    . ASP C 1 83  ? -9.289  82.075 55.500  1.00 22.55  ? 83  ASP C CB    1 
ATOM   8035  C CG    . ASP C 1 83  ? -10.326 82.387 56.561  1.00 25.71  ? 83  ASP C CG    1 
ATOM   8036  O OD1   . ASP C 1 83  ? -11.338 83.037 56.246  1.00 22.64  ? 83  ASP C OD1   1 
ATOM   8037  O OD2   . ASP C 1 83  ? -10.141 81.970 57.717  1.00 24.13  ? 83  ASP C OD2   1 
ATOM   8038  N N     . LYS C 1 84  ? -8.235  80.740 52.830  1.00 10.82  ? 84  LYS C N     1 
ATOM   8039  C CA    . LYS C 1 84  ? -7.059  80.655 51.953  1.00 15.27  ? 84  LYS C CA    1 
ATOM   8040  C C     . LYS C 1 84  ? -7.412  81.182 50.558  1.00 16.83  ? 84  LYS C C     1 
ATOM   8041  O O     . LYS C 1 84  ? -6.655  81.885 49.893  1.00 16.77  ? 84  LYS C O     1 
ATOM   8042  C CB    . LYS C 1 84  ? -6.573  79.182 51.844  1.00 12.44  ? 84  LYS C CB    1 
ATOM   8043  C CG    . LYS C 1 84  ? -5.193  79.075 51.178  1.00 18.65  ? 84  LYS C CG    1 
ATOM   8044  C CD    . LYS C 1 84  ? -4.163  79.737 52.075  1.00 20.95  ? 84  LYS C CD    1 
ATOM   8045  C CE    . LYS C 1 84  ? -2.710  79.621 51.646  1.00 24.22  ? 84  LYS C CE    1 
ATOM   8046  N NZ    . LYS C 1 84  ? -1.875  80.318 52.712  1.00 21.77  ? 84  LYS C NZ    1 
ATOM   8047  N N     . ALA C 1 85  ? -8.597  80.810 50.053  1.00 15.26  ? 85  ALA C N     1 
ATOM   8048  C CA    . ALA C 1 85  ? -9.030  81.236 48.715  1.00 14.66  ? 85  ALA C CA    1 
ATOM   8049  C C     . ALA C 1 85  ? -9.192  82.743 48.650  1.00 15.12  ? 85  ALA C C     1 
ATOM   8050  O O     . ALA C 1 85  ? -8.903  83.408 47.661  1.00 16.48  ? 85  ALA C O     1 
ATOM   8051  C CB    . ALA C 1 85  ? -10.356 80.570 48.356  1.00 12.89  ? 85  ALA C CB    1 
ATOM   8052  N N     . LYS C 1 86  ? -9.646  83.351 49.737  1.00 15.71  ? 86  LYS C N     1 
ATOM   8053  C CA    . LYS C 1 86  ? -9.740  84.807 49.795  1.00 14.73  ? 86  LYS C CA    1 
ATOM   8054  C C     . LYS C 1 86  ? -8.343  85.412 49.768  1.00 17.94  ? 86  LYS C C     1 
ATOM   8055  O O     . LYS C 1 86  ? -8.097  86.458 49.168  1.00 16.10  ? 86  LYS C O     1 
ATOM   8056  C CB    . LYS C 1 86  ? -10.448 85.214 51.103  1.00 18.07  ? 86  LYS C CB    1 
ATOM   8057  C CG    . LYS C 1 86  ? -10.562 86.720 51.311  1.00 18.98  ? 86  LYS C CG    1 
ATOM   8058  C CD    . LYS C 1 86  ? -11.343 87.376 50.177  1.00 19.67  ? 86  LYS C CD    1 
ATOM   8059  C CE    . LYS C 1 86  ? -11.629 88.857 50.463  1.00 22.97  ? 86  LYS C CE    1 
ATOM   8060  N NZ    . LYS C 1 86  ? -12.315 89.487 49.275  1.00 22.91  ? 86  LYS C NZ    1 
ATOM   8061  N N     . GLU C 1 87  ? -7.396  84.838 50.534  1.00 16.00  ? 87  GLU C N     1 
ATOM   8062  C CA    . GLU C 1 87  ? -6.041  85.350 50.552  1.00 18.22  ? 87  GLU C CA    1 
ATOM   8063  C C     . GLU C 1 87  ? -5.332  85.254 49.199  1.00 15.65  ? 87  GLU C C     1 
ATOM   8064  O O     . GLU C 1 87  ? -4.674  86.185 48.722  1.00 14.96  ? 87  GLU C O     1 
ATOM   8065  C CB    . GLU C 1 87  ? -5.225  84.524 51.577  1.00 23.67  ? 87  GLU C CB    1 
ATOM   8066  C CG    . GLU C 1 87  ? -3.781  84.954 51.698  1.00 33.09  ? 87  GLU C CG    1 
ATOM   8067  C CD    . GLU C 1 87  ? -2.843  83.847 52.147  1.00 37.98  ? 87  GLU C CD    1 
ATOM   8068  O OE1   . GLU C 1 87  ? -3.211  83.055 53.035  1.00 37.80  ? 87  GLU C OE1   1 
ATOM   8069  O OE2   . GLU C 1 87  ? -1.708  83.743 51.624  1.00 42.12  ? 87  GLU C OE2   1 
ATOM   8070  N N     . LEU C 1 88  ? -5.442  84.092 48.551  1.00 13.43  ? 88  LEU C N     1 
ATOM   8071  C CA    . LEU C 1 88  ? -4.734  83.923 47.281  1.00 14.05  ? 88  LEU C CA    1 
ATOM   8072  C C     . LEU C 1 88  ? -5.374  84.618 46.080  1.00 17.05  ? 88  LEU C C     1 
ATOM   8073  O O     . LEU C 1 88  ? -4.667  85.198 45.274  1.00 16.05  ? 88  LEU C O     1 
ATOM   8074  C CB    . LEU C 1 88  ? -4.632  82.428 46.963  1.00 13.90  ? 88  LEU C CB    1 
ATOM   8075  C CG    . LEU C 1 88  ? -3.694  81.601 47.827  1.00 20.14  ? 88  LEU C CG    1 
ATOM   8076  C CD1   . LEU C 1 88  ? -3.770  80.117 47.517  1.00 15.64  ? 88  LEU C CD1   1 
ATOM   8077  C CD2   . LEU C 1 88  ? -2.277  82.114 47.613  1.00 20.70  ? 88  LEU C CD2   1 
ATOM   8078  N N     . PHE C 1 89  ? -6.678  84.467 45.902  1.00 15.61  ? 89  PHE C N     1 
ATOM   8079  C CA    . PHE C 1 89  ? -7.378  84.934 44.732  1.00 16.10  ? 89  PHE C CA    1 
ATOM   8080  C C     . PHE C 1 89  ? -8.252  86.146 44.944  1.00 17.09  ? 89  PHE C C     1 
ATOM   8081  O O     . PHE C 1 89  ? -8.722  86.745 43.980  1.00 18.01  ? 89  PHE C O     1 
ATOM   8082  C CB    . PHE C 1 89  ? -8.313  83.818 44.230  1.00 11.60  ? 89  PHE C CB    1 
ATOM   8083  C CG    . PHE C 1 89  ? -7.659  82.461 44.207  1.00 15.69  ? 89  PHE C CG    1 
ATOM   8084  C CD1   . PHE C 1 89  ? -6.570  82.231 43.366  1.00 16.56  ? 89  PHE C CD1   1 
ATOM   8085  C CD2   . PHE C 1 89  ? -8.113  81.452 45.029  1.00 15.63  ? 89  PHE C CD2   1 
ATOM   8086  C CE1   . PHE C 1 89  ? -5.967  80.976 43.371  1.00 19.82  ? 89  PHE C CE1   1 
ATOM   8087  C CE2   . PHE C 1 89  ? -7.521  80.221 45.009  1.00 14.37  ? 89  PHE C CE2   1 
ATOM   8088  C CZ    . PHE C 1 89  ? -6.433  79.963 44.191  1.00 15.76  ? 89  PHE C CZ    1 
ATOM   8089  N N     . ASN C 1 90  ? -8.558  86.438 46.213  1.00 16.50  ? 90  ASN C N     1 
ATOM   8090  C CA    . ASN C 1 90  ? -9.461  87.527 46.566  1.00 15.83  ? 90  ASN C CA    1 
ATOM   8091  C C     . ASN C 1 90  ? -10.902 87.171 46.208  1.00 18.18  ? 90  ASN C C     1 
ATOM   8092  O O     . ASN C 1 90  ? -11.708 88.060 45.963  1.00 18.78  ? 90  ASN C O     1 
ATOM   8093  C CB    . ASN C 1 90  ? -9.098  88.836 45.866  1.00 19.51  ? 90  ASN C CB    1 
ATOM   8094  C CG    . ASN C 1 90  ? -9.597  90.052 46.614  1.00 27.62  ? 90  ASN C CG    1 
ATOM   8095  O OD1   . ASN C 1 90  ? -9.953  89.966 47.795  1.00 24.01  ? 90  ASN C OD1   1 
ATOM   8096  N ND2   . ASN C 1 90  ? -9.641  91.172 45.908  1.00 27.56  ? 90  ASN C ND2   1 
ATOM   8097  N N     . TYR C 1 91  ? -11.245 85.899 46.147  1.00 15.63  ? 91  TYR C N     1 
ATOM   8098  C CA    . TYR C 1 91  ? -12.580 85.448 45.804  1.00 17.37  ? 91  TYR C CA    1 
ATOM   8099  C C     . TYR C 1 91  ? -13.318 85.171 47.129  1.00 20.59  ? 91  TYR C C     1 
ATOM   8100  O O     . TYR C 1 91  ? -12.738 84.621 48.063  1.00 16.74  ? 91  TYR C O     1 
ATOM   8101  C CB    . TYR C 1 91  ? -12.567 84.252 44.874  1.00 14.64  ? 91  TYR C CB    1 
ATOM   8102  C CG    . TYR C 1 91  ? -12.119 84.526 43.434  1.00 15.31  ? 91  TYR C CG    1 
ATOM   8103  C CD1   . TYR C 1 91  ? -11.586 85.734 43.031  1.00 13.76  ? 91  TYR C CD1   1 
ATOM   8104  C CD2   . TYR C 1 91  ? -12.232 83.523 42.486  1.00 11.14  ? 91  TYR C CD2   1 
ATOM   8105  C CE1   . TYR C 1 91  ? -11.192 85.961 41.700  1.00 15.65  ? 91  TYR C CE1   1 
ATOM   8106  C CE2   . TYR C 1 91  ? -11.850 83.727 41.161  1.00 13.81  ? 91  TYR C CE2   1 
ATOM   8107  C CZ    . TYR C 1 91  ? -11.326 84.953 40.783  1.00 15.32  ? 91  TYR C CZ    1 
ATOM   8108  O OH    . TYR C 1 91  ? -10.908 85.127 39.492  1.00 19.58  ? 91  TYR C OH    1 
ATOM   8109  N N     . ASP C 1 92  ? -14.602 85.517 47.164  1.00 16.96  ? 92  ASP C N     1 
ATOM   8110  C CA    . ASP C 1 92  ? -15.333 85.431 48.427  1.00 17.91  ? 92  ASP C CA    1 
ATOM   8111  C C     . ASP C 1 92  ? -16.115 84.165 48.679  1.00 14.36  ? 92  ASP C C     1 
ATOM   8112  O O     . ASP C 1 92  ? -16.659 84.017 49.765  1.00 15.92  ? 92  ASP C O     1 
ATOM   8113  C CB    . ASP C 1 92  ? -16.340 86.604 48.487  1.00 17.95  ? 92  ASP C CB    1 
ATOM   8114  C CG    . ASP C 1 92  ? -15.652 87.944 48.613  1.00 27.22  ? 92  ASP C CG    1 
ATOM   8115  O OD1   . ASP C 1 92  ? -14.584 88.056 49.260  1.00 27.05  ? 92  ASP C OD1   1 
ATOM   8116  O OD2   . ASP C 1 92  ? -16.216 88.916 48.053  1.00 31.81  ? 92  ASP C OD2   1 
ATOM   8117  N N     . TYR C 1 93  ? -16.327 83.320 47.673  1.00 14.16  ? 93  TYR C N     1 
ATOM   8118  C CA    . TYR C 1 93  ? -17.154 82.141 47.857  1.00 14.65  ? 93  TYR C CA    1 
ATOM   8119  C C     . TYR C 1 93  ? -16.418 80.889 47.439  1.00 17.94  ? 93  TYR C C     1 
ATOM   8120  O O     . TYR C 1 93  ? -15.748 80.934 46.382  1.00 14.78  ? 93  TYR C O     1 
ATOM   8121  C CB    . TYR C 1 93  ? -18.403 82.217 46.967  1.00 15.37  ? 93  TYR C CB    1 
ATOM   8122  C CG    . TYR C 1 93  ? -19.238 83.441 47.316  1.00 20.57  ? 93  TYR C CG    1 
ATOM   8123  C CD1   . TYR C 1 93  ? -19.980 83.494 48.487  1.00 22.97  ? 93  TYR C CD1   1 
ATOM   8124  C CD2   . TYR C 1 93  ? -19.224 84.536 46.473  1.00 22.81  ? 93  TYR C CD2   1 
ATOM   8125  C CE1   . TYR C 1 93  ? -20.720 84.627 48.799  1.00 26.19  ? 93  TYR C CE1   1 
ATOM   8126  C CE2   . TYR C 1 93  ? -19.953 85.669 46.797  1.00 24.97  ? 93  TYR C CE2   1 
ATOM   8127  C CZ    . TYR C 1 93  ? -20.711 85.706 47.944  1.00 26.29  ? 93  TYR C CZ    1 
ATOM   8128  O OH    . TYR C 1 93  ? -21.430 86.843 48.234  1.00 28.07  ? 93  TYR C OH    1 
ATOM   8129  N N     . ILE C 1 94  ? -16.578 79.809 48.184  1.00 11.55  ? 94  ILE C N     1 
ATOM   8130  C CA    . ILE C 1 94  ? -15.909 78.595 47.724  1.00 14.08  ? 94  ILE C CA    1 
ATOM   8131  C C     . ILE C 1 94  ? -16.882 77.454 47.875  1.00 12.66  ? 94  ILE C C     1 
ATOM   8132  O O     . ILE C 1 94  ? -17.740 77.455 48.761  1.00 14.66  ? 94  ILE C O     1 
ATOM   8133  C CB    . ILE C 1 94  ? -14.654 78.206 48.534  1.00 16.09  ? 94  ILE C CB    1 
ATOM   8134  C CG1   . ILE C 1 94  ? -15.009 78.012 50.038  1.00 16.41  ? 94  ILE C CG1   1 
ATOM   8135  C CG2   . ILE C 1 94  ? -13.558 79.253 48.452  1.00 9.52   ? 94  ILE C CG2   1 
ATOM   8136  C CD1   . ILE C 1 94  ? -14.031 76.989 50.625  1.00 17.30  ? 94  ILE C CD1   1 
ATOM   8137  N N     . ILE C 1 95  ? -16.711 76.442 47.069  1.00 10.64  ? 95  ILE C N     1 
ATOM   8138  C CA    . ILE C 1 95  ? -17.341 75.161 47.126  1.00 12.03  ? 95  ILE C CA    1 
ATOM   8139  C C     . ILE C 1 95  ? -16.241 74.107 46.872  1.00 15.84  ? 95  ILE C C     1 
ATOM   8140  O O     . ILE C 1 95  ? -15.698 73.990 45.779  1.00 13.64  ? 95  ILE C O     1 
ATOM   8141  C CB    . ILE C 1 95  ? -18.473 74.944 46.109  1.00 14.50  ? 95  ILE C CB    1 
ATOM   8142  C CG1   . ILE C 1 95  ? -19.472 76.117 46.120  1.00 15.73  ? 95  ILE C CG1   1 
ATOM   8143  C CG2   . ILE C 1 95  ? -19.164 73.617 46.386  1.00 12.69  ? 95  ILE C CG2   1 
ATOM   8144  C CD1   . ILE C 1 95  ? -20.430 76.142 44.956  1.00 25.21  ? 95  ILE C CD1   1 
ATOM   8145  N N     . PRO C 1 96  ? -15.913 73.317 47.886  1.00 17.08  ? 96  PRO C N     1 
ATOM   8146  C CA    . PRO C 1 96  ? -14.930 72.252 47.702  1.00 16.70  ? 96  PRO C CA    1 
ATOM   8147  C C     . PRO C 1 96  ? -15.541 71.248 46.742  1.00 13.97  ? 96  PRO C C     1 
ATOM   8148  O O     . PRO C 1 96  ? -16.746 71.103 46.643  1.00 14.80  ? 96  PRO C O     1 
ATOM   8149  C CB    . PRO C 1 96  ? -14.704 71.634 49.085  1.00 16.21  ? 96  PRO C CB    1 
ATOM   8150  C CG    . PRO C 1 96  ? -15.628 72.359 50.004  1.00 21.10  ? 96  PRO C CG    1 
ATOM   8151  C CD    . PRO C 1 96  ? -16.491 73.331 49.245  1.00 15.43  ? 96  PRO C CD    1 
ATOM   8152  N N     . ALA C 1 97  ? -14.704 70.484 46.046  1.00 12.11  ? 97  ALA C N     1 
ATOM   8153  C CA    . ALA C 1 97  ? -15.183 69.434 45.160  1.00 11.07  ? 97  ALA C CA    1 
ATOM   8154  C C     . ALA C 1 97  ? -14.225 68.269 45.289  1.00 11.96  ? 97  ALA C C     1 
ATOM   8155  O O     . ALA C 1 97  ? -13.069 68.516 45.706  1.00 11.99  ? 97  ALA C O     1 
ATOM   8156  C CB    . ALA C 1 97  ? -15.292 70.030 43.762  1.00 13.88  ? 97  ALA C CB    1 
ATOM   8157  N N     . HIS C 1 98  ? -14.659 67.053 44.949  1.00 8.97   ? 98  HIS C N     1 
ATOM   8158  C CA    . HIS C 1 98  ? -13.752 65.923 45.163  1.00 11.31  ? 98  HIS C CA    1 
ATOM   8159  C C     . HIS C 1 98  ? -12.576 65.997 44.214  1.00 15.04  ? 98  HIS C C     1 
ATOM   8160  O O     . HIS C 1 98  ? -11.523 65.508 44.634  1.00 10.61  ? 98  HIS C O     1 
ATOM   8161  C CB    . HIS C 1 98  ? -14.462 64.582 45.157  1.00 8.26   ? 98  HIS C CB    1 
ATOM   8162  C CG    . HIS C 1 98  ? -14.697 64.036 43.755  1.00 14.45  ? 98  HIS C CG    1 
ATOM   8163  N ND1   . HIS C 1 98  ? -15.744 64.455 42.974  1.00 11.67  ? 98  HIS C ND1   1 
ATOM   8164  C CD2   . HIS C 1 98  ? -14.044 63.119 43.021  1.00 12.58  ? 98  HIS C CD2   1 
ATOM   8165  C CE1   . HIS C 1 98  ? -15.752 63.797 41.808  1.00 12.67  ? 98  HIS C CE1   1 
ATOM   8166  N NE2   . HIS C 1 98  ? -14.705 62.969 41.816  1.00 16.62  ? 98  HIS C NE2   1 
ATOM   8167  N N     . GLN C 1 99  ? -12.664 66.551 43.020  1.00 12.09  ? 99  GLN C N     1 
ATOM   8168  C CA    . GLN C 1 99  ? -11.532 66.773 42.105  1.00 13.69  ? 99  GLN C CA    1 
ATOM   8169  C C     . GLN C 1 99  ? -11.942 67.760 41.009  1.00 15.54  ? 99  GLN C C     1 
ATOM   8170  O O     . GLN C 1 99  ? -13.062 68.311 41.116  1.00 11.46  ? 99  GLN C O     1 
ATOM   8171  C CB    . GLN C 1 99  ? -10.818 65.560 41.562  1.00 8.85   ? 99  GLN C CB    1 
ATOM   8172  C CG    . GLN C 1 99  ? -11.632 64.631 40.663  1.00 12.83  ? 99  GLN C CG    1 
ATOM   8173  C CD    . GLN C 1 99  ? -10.822 63.415 40.282  1.00 20.73  ? 99  GLN C CD    1 
ATOM   8174  O OE1   . GLN C 1 99  ? -10.336 62.668 41.157  1.00 13.37  ? 99  GLN C OE1   1 
ATOM   8175  N NE2   . GLN C 1 99  ? -10.617 63.152 38.986  1.00 12.30  ? 99  GLN C NE2   1 
ATOM   8176  N N     . GLY C 1 100 ? -11.082 68.039 40.027  1.00 10.14  ? 100 GLY C N     1 
ATOM   8177  C CA    . GLY C 1 100 ? -11.400 69.093 39.071  1.00 8.95   ? 100 GLY C CA    1 
ATOM   8178  C C     . GLY C 1 100 ? -12.673 68.906 38.240  1.00 9.88   ? 100 GLY C C     1 
ATOM   8179  O O     . GLY C 1 100 ? -13.438 69.841 38.026  1.00 11.38  ? 100 GLY C O     1 
ATOM   8180  N N     . ARG C 1 101 ? -12.895 67.695 37.774  1.00 9.86   ? 101 ARG C N     1 
ATOM   8181  C CA    . ARG C 1 101 ? -14.053 67.402 36.938  1.00 12.72  ? 101 ARG C CA    1 
ATOM   8182  C C     . ARG C 1 101 ? -15.313 67.424 37.810  1.00 17.08  ? 101 ARG C C     1 
ATOM   8183  O O     . ARG C 1 101 ? -16.358 67.712 37.252  1.00 15.06  ? 101 ARG C O     1 
ATOM   8184  C CB    . ARG C 1 101 ? -13.907 66.110 36.195  1.00 6.67   ? 101 ARG C CB    1 
ATOM   8185  C CG    . ARG C 1 101 ? -13.964 64.827 36.987  1.00 10.23  ? 101 ARG C CG    1 
ATOM   8186  C CD    . ARG C 1 101 ? -13.340 63.677 36.176  1.00 14.19  ? 101 ARG C CD    1 
ATOM   8187  N NE    . ARG C 1 101 ? -11.872 63.896 36.063  1.00 13.99  ? 101 ARG C NE    1 
ATOM   8188  C CZ    . ARG C 1 101 ? -11.064 63.023 35.459  1.00 16.32  ? 101 ARG C CZ    1 
ATOM   8189  N NH1   . ARG C 1 101 ? -11.563 61.920 34.900  1.00 9.44   ? 101 ARG C NH1   1 
ATOM   8190  N NH2   . ARG C 1 101 ? -9.755  63.265 35.452  1.00 13.10  ? 101 ARG C NH2   1 
ATOM   8191  N N     . GLY C 1 102 ? -15.202 67.263 39.139  1.00 13.75  ? 102 GLY C N     1 
ATOM   8192  C CA    . GLY C 1 102 ? -16.357 67.442 39.995  1.00 9.37   ? 102 GLY C CA    1 
ATOM   8193  C C     . GLY C 1 102 ? -16.676 68.933 40.052  1.00 13.06  ? 102 GLY C C     1 
ATOM   8194  O O     . GLY C 1 102 ? -17.829 69.357 40.048  1.00 13.40  ? 102 GLY C O     1 
ATOM   8195  N N     . ALA C 1 103 ? -15.640 69.761 40.149  1.00 7.23   ? 103 ALA C N     1 
ATOM   8196  C CA    . ALA C 1 103 ? -15.871 71.200 40.155  1.00 12.27  ? 103 ALA C CA    1 
ATOM   8197  C C     . ALA C 1 103 ? -16.504 71.636 38.805  1.00 14.91  ? 103 ALA C C     1 
ATOM   8198  O O     . ALA C 1 103 ? -17.362 72.526 38.803  1.00 12.64  ? 103 ALA C O     1 
ATOM   8199  C CB    . ALA C 1 103 ? -14.555 71.916 40.353  1.00 10.45  ? 103 ALA C CB    1 
ATOM   8200  N N     . GLU C 1 104 ? -16.110 71.031 37.685  1.00 12.08  ? 104 GLU C N     1 
ATOM   8201  C CA    . GLU C 1 104 ? -16.677 71.360 36.387  1.00 17.86  ? 104 GLU C CA    1 
ATOM   8202  C C     . GLU C 1 104 ? -18.165 70.997 36.387  1.00 18.29  ? 104 GLU C C     1 
ATOM   8203  O O     . GLU C 1 104 ? -19.049 71.767 35.994  1.00 17.65  ? 104 GLU C O     1 
ATOM   8204  C CB    . GLU C 1 104 ? -15.944 70.664 35.212  1.00 9.58   ? 104 GLU C CB    1 
ATOM   8205  C CG    . GLU C 1 104 ? -14.565 71.294 35.012  1.00 15.70  ? 104 GLU C CG    1 
ATOM   8206  C CD    . GLU C 1 104 ? -13.548 70.452 34.307  1.00 14.81  ? 104 GLU C CD    1 
ATOM   8207  O OE1   . GLU C 1 104 ? -13.768 69.286 33.931  1.00 13.15  ? 104 GLU C OE1   1 
ATOM   8208  O OE2   . GLU C 1 104 ? -12.445 71.014 34.063  1.00 16.44  ? 104 GLU C OE2   1 
ATOM   8209  N N     . ASN C 1 105 ? -18.445 69.795 36.844  1.00 14.68  ? 105 ASN C N     1 
ATOM   8210  C CA    . ASN C 1 105 ? -19.787 69.256 36.943  1.00 16.42  ? 105 ASN C CA    1 
ATOM   8211  C C     . ASN C 1 105 ? -20.684 70.159 37.771  1.00 16.58  ? 105 ASN C C     1 
ATOM   8212  O O     . ASN C 1 105 ? -21.862 70.247 37.449  1.00 19.30  ? 105 ASN C O     1 
ATOM   8213  C CB    . ASN C 1 105 ? -19.819 67.833 37.520  1.00 15.27  ? 105 ASN C CB    1 
ATOM   8214  C CG    . ASN C 1 105 ? -21.217 67.257 37.367  1.00 25.02  ? 105 ASN C CG    1 
ATOM   8215  O OD1   . ASN C 1 105 ? -21.934 67.580 36.397  1.00 20.16  ? 105 ASN C OD1   1 
ATOM   8216  N ND2   . ASN C 1 105 ? -21.597 66.435 38.327  1.00 14.59  ? 105 ASN C ND2   1 
ATOM   8217  N N     . ILE C 1 106 ? -20.191 70.799 38.817  1.00 15.59  ? 106 ILE C N     1 
ATOM   8218  C CA    . ILE C 1 106 ? -20.969 71.694 39.630  1.00 17.87  ? 106 ILE C CA    1 
ATOM   8219  C C     . ILE C 1 106 ? -21.218 73.024 38.933  1.00 21.05  ? 106 ILE C C     1 
ATOM   8220  O O     . ILE C 1 106 ? -22.322 73.579 39.036  1.00 20.51  ? 106 ILE C O     1 
ATOM   8221  C CB    . ILE C 1 106 ? -20.229 72.018 40.947  1.00 16.56  ? 106 ILE C CB    1 
ATOM   8222  C CG1   . ILE C 1 106 ? -20.318 70.829 41.920  1.00 23.25  ? 106 ILE C CG1   1 
ATOM   8223  C CG2   . ILE C 1 106 ? -20.751 73.289 41.645  1.00 16.86  ? 106 ILE C CG2   1 
ATOM   8224  C CD1   . ILE C 1 106 ? -19.277 71.035 43.023  1.00 20.15  ? 106 ILE C CD1   1 
ATOM   8225  N N     . LEU C 1 107 ? -20.151 73.629 38.413  1.00 15.50  ? 107 LEU C N     1 
ATOM   8226  C CA    . LEU C 1 107 ? -20.266 74.980 37.884  1.00 16.40  ? 107 LEU C CA    1 
ATOM   8227  C C     . LEU C 1 107 ? -20.804 75.101 36.460  1.00 18.03  ? 107 LEU C C     1 
ATOM   8228  O O     . LEU C 1 107 ? -21.562 76.038 36.251  1.00 16.08  ? 107 LEU C O     1 
ATOM   8229  C CB    . LEU C 1 107 ? -18.896 75.660 37.976  1.00 17.57  ? 107 LEU C CB    1 
ATOM   8230  C CG    . LEU C 1 107 ? -18.834 77.135 37.576  1.00 20.14  ? 107 LEU C CG    1 
ATOM   8231  C CD1   . LEU C 1 107 ? -19.702 77.980 38.505  1.00 19.19  ? 107 LEU C CD1   1 
ATOM   8232  C CD2   . LEU C 1 107 ? -17.394 77.641 37.545  1.00 17.95  ? 107 LEU C CD2   1 
ATOM   8233  N N     . PHE C 1 108 ? -20.396 74.274 35.510  1.00 15.99  ? 108 PHE C N     1 
ATOM   8234  C CA    . PHE C 1 108 ? -20.768 74.449 34.117  1.00 20.39  ? 108 PHE C CA    1 
ATOM   8235  C C     . PHE C 1 108 ? -22.256 74.384 33.844  1.00 21.89  ? 108 PHE C C     1 
ATOM   8236  O O     . PHE C 1 108 ? -22.778 75.353 33.297  1.00 22.80  ? 108 PHE C O     1 
ATOM   8237  C CB    . PHE C 1 108 ? -19.925 73.551 33.211  1.00 19.06  ? 108 PHE C CB    1 
ATOM   8238  C CG    . PHE C 1 108 ? -18.479 73.937 33.054  1.00 24.19  ? 108 PHE C CG    1 
ATOM   8239  C CD1   . PHE C 1 108 ? -17.873 74.902 33.837  1.00 23.11  ? 108 PHE C CD1   1 
ATOM   8240  C CD2   . PHE C 1 108 ? -17.684 73.316 32.101  1.00 27.10  ? 108 PHE C CD2   1 
ATOM   8241  C CE1   . PHE C 1 108 ? -16.557 75.281 33.680  1.00 26.43  ? 108 PHE C CE1   1 
ATOM   8242  C CE2   . PHE C 1 108 ? -16.353 73.674 31.946  1.00 30.63  ? 108 PHE C CE2   1 
ATOM   8243  C CZ    . PHE C 1 108 ? -15.783 74.649 32.732  1.00 21.24  ? 108 PHE C CZ    1 
ATOM   8244  N N     . PRO C 1 109 ? -22.993 73.412 34.332  1.00 21.77  ? 109 PRO C N     1 
ATOM   8245  C CA    . PRO C 1 109 ? -24.446 73.355 34.168  1.00 19.92  ? 109 PRO C CA    1 
ATOM   8246  C C     . PRO C 1 109 ? -25.109 74.588 34.734  1.00 21.66  ? 109 PRO C C     1 
ATOM   8247  O O     . PRO C 1 109 ? -26.064 75.138 34.199  1.00 21.77  ? 109 PRO C O     1 
ATOM   8248  C CB    . PRO C 1 109 ? -24.880 72.067 34.875  1.00 21.44  ? 109 PRO C CB    1 
ATOM   8249  C CG    . PRO C 1 109 ? -23.632 71.219 34.813  1.00 18.46  ? 109 PRO C CG    1 
ATOM   8250  C CD    . PRO C 1 109 ? -22.499 72.219 35.059  1.00 18.02  ? 109 PRO C CD    1 
ATOM   8251  N N     . VAL C 1 110 ? -24.569 75.123 35.835  1.00 19.25  ? 110 VAL C N     1 
ATOM   8252  C CA    . VAL C 1 110 ? -25.101 76.310 36.455  1.00 18.97  ? 110 VAL C CA    1 
ATOM   8253  C C     . VAL C 1 110 ? -24.877 77.525 35.568  1.00 23.96  ? 110 VAL C C     1 
ATOM   8254  O O     . VAL C 1 110 ? -25.758 78.395 35.504  1.00 23.61  ? 110 VAL C O     1 
ATOM   8255  C CB    . VAL C 1 110 ? -24.463 76.481 37.851  1.00 23.83  ? 110 VAL C CB    1 
ATOM   8256  C CG1   . VAL C 1 110 ? -24.603 77.902 38.320  1.00 19.22  ? 110 VAL C CG1   1 
ATOM   8257  C CG2   . VAL C 1 110 ? -25.101 75.479 38.806  1.00 22.76  ? 110 VAL C CG2   1 
ATOM   8258  N N     . LEU C 1 111 ? -23.701 77.641 34.937  1.00 19.71  ? 111 LEU C N     1 
ATOM   8259  C CA    . LEU C 1 111 ? -23.449 78.814 34.101  1.00 23.02  ? 111 LEU C CA    1 
ATOM   8260  C C     . LEU C 1 111 ? -24.386 78.778 32.873  1.00 19.35  ? 111 LEU C C     1 
ATOM   8261  O O     . LEU C 1 111 ? -24.854 79.848 32.489  1.00 21.35  ? 111 LEU C O     1 
ATOM   8262  C CB    . LEU C 1 111 ? -21.999 78.941 33.650  1.00 17.46  ? 111 LEU C CB    1 
ATOM   8263  C CG    . LEU C 1 111 ? -20.921 79.100 34.719  1.00 21.74  ? 111 LEU C CG    1 
ATOM   8264  C CD1   . LEU C 1 111 ? -19.525 78.960 34.144  1.00 16.15  ? 111 LEU C CD1   1 
ATOM   8265  C CD2   . LEU C 1 111 ? -21.067 80.452 35.422  1.00 19.74  ? 111 LEU C CD2   1 
ATOM   8266  N N     . LEU C 1 112 ? -24.627 77.611 32.315  1.00 16.83  ? 112 LEU C N     1 
ATOM   8267  C CA    . LEU C 1 112 ? -25.529 77.470 31.174  1.00 21.65  ? 112 LEU C CA    1 
ATOM   8268  C C     . LEU C 1 112 ? -26.939 77.912 31.601  1.00 28.22  ? 112 LEU C C     1 
ATOM   8269  O O     . LEU C 1 112 ? -27.500 78.884 31.105  1.00 24.00  ? 112 LEU C O     1 
ATOM   8270  C CB    . LEU C 1 112 ? -25.553 76.050 30.660  1.00 18.93  ? 112 LEU C CB    1 
ATOM   8271  C CG    . LEU C 1 112 ? -26.630 75.701 29.612  1.00 25.87  ? 112 LEU C CG    1 
ATOM   8272  C CD1   . LEU C 1 112 ? -26.413 76.485 28.314  1.00 21.47  ? 112 LEU C CD1   1 
ATOM   8273  C CD2   . LEU C 1 112 ? -26.671 74.206 29.333  1.00 18.63  ? 112 LEU C CD2   1 
ATOM   8274  N N     . LYS C 1 113 ? -27.463 77.300 32.670  1.00 28.54  ? 113 LYS C N     1 
ATOM   8275  C CA    . LYS C 1 113 ? -28.782 77.630 33.201  1.00 30.06  ? 113 LYS C CA    1 
ATOM   8276  C C     . LYS C 1 113 ? -28.940 79.102 33.496  1.00 29.98  ? 113 LYS C C     1 
ATOM   8277  O O     . LYS C 1 113 ? -29.952 79.714 33.164  1.00 30.50  ? 113 LYS C O     1 
ATOM   8278  C CB    . LYS C 1 113 ? -29.128 76.798 34.437  1.00 38.56  ? 113 LYS C CB    1 
ATOM   8279  C CG    . LYS C 1 113 ? -30.505 77.107 35.008  1.00 55.03  ? 113 LYS C CG    1 
ATOM   8280  C CD    . LYS C 1 113 ? -30.756 76.270 36.256  1.00 71.40  ? 113 LYS C CD    1 
ATOM   8281  C CE    . LYS C 1 113 ? -31.479 77.055 37.337  1.00 77.85  ? 113 LYS C CE    1 
ATOM   8282  N NZ    . LYS C 1 113 ? -31.881 76.190 38.480  1.00 82.45  ? 113 LYS C NZ    1 
ATOM   8283  N N     . TYR C 1 114 ? -27.931 79.740 34.023  1.00 27.01  ? 114 TYR C N     1 
ATOM   8284  C CA    . TYR C 1 114 ? -27.931 81.166 34.305  1.00 29.10  ? 114 TYR C CA    1 
ATOM   8285  C C     . TYR C 1 114 ? -28.009 82.016 33.045  1.00 33.51  ? 114 TYR C C     1 
ATOM   8286  O O     . TYR C 1 114 ? -28.637 83.073 33.074  1.00 34.30  ? 114 TYR C O     1 
ATOM   8287  C CB    . TYR C 1 114 ? -26.681 81.461 35.087  1.00 28.54  ? 114 TYR C CB    1 
ATOM   8288  C CG    . TYR C 1 114 ? -26.494 82.859 35.583  1.00 30.23  ? 114 TYR C CG    1 
ATOM   8289  C CD1   . TYR C 1 114 ? -27.140 83.311 36.726  1.00 30.57  ? 114 TYR C CD1   1 
ATOM   8290  C CD2   . TYR C 1 114 ? -25.663 83.736 34.898  1.00 31.87  ? 114 TYR C CD2   1 
ATOM   8291  C CE1   . TYR C 1 114 ? -26.935 84.602 37.178  1.00 30.01  ? 114 TYR C CE1   1 
ATOM   8292  C CE2   . TYR C 1 114 ? -25.469 85.030 35.337  1.00 33.65  ? 114 TYR C CE2   1 
ATOM   8293  C CZ    . TYR C 1 114 ? -26.106 85.452 36.483  1.00 35.11  ? 114 TYR C CZ    1 
ATOM   8294  O OH    . TYR C 1 114 ? -25.903 86.733 36.942  1.00 38.48  ? 114 TYR C OH    1 
ATOM   8295  N N     . LYS C 1 115 ? -27.347 81.605 31.967  1.00 33.89  ? 115 LYS C N     1 
ATOM   8296  C CA    . LYS C 1 115 ? -27.377 82.369 30.715  1.00 37.85  ? 115 LYS C CA    1 
ATOM   8297  C C     . LYS C 1 115 ? -28.728 82.153 30.041  1.00 40.26  ? 115 LYS C C     1 
ATOM   8298  O O     . LYS C 1 115 ? -29.300 83.088 29.502  1.00 40.39  ? 115 LYS C O     1 
ATOM   8299  C CB    . LYS C 1 115 ? -26.210 81.947 29.827  1.00 33.97  ? 115 LYS C CB    1 
ATOM   8300  C CG    . LYS C 1 115 ? -25.877 82.792 28.632  1.00 36.20  ? 115 LYS C CG    1 
ATOM   8301  C CD    . LYS C 1 115 ? -25.019 84.007 28.909  1.00 32.48  ? 115 LYS C CD    1 
ATOM   8302  C CE    . LYS C 1 115 ? -24.523 84.635 27.633  1.00 30.83  ? 115 LYS C CE    1 
ATOM   8303  N NZ    . LYS C 1 115 ? -23.282 85.427 27.760  1.00 27.28  ? 115 LYS C NZ    1 
ATOM   8304  N N     . GLN C 1 116 ? -29.276 80.950 30.085  1.00 39.23  ? 116 GLN C N     1 
ATOM   8305  C CA    . GLN C 1 116 ? -30.567 80.599 29.554  1.00 43.36  ? 116 GLN C CA    1 
ATOM   8306  C C     . GLN C 1 116 ? -31.734 81.271 30.281  1.00 50.08  ? 116 GLN C C     1 
ATOM   8307  O O     . GLN C 1 116 ? -32.715 81.703 29.670  1.00 48.38  ? 116 GLN C O     1 
ATOM   8308  C CB    . GLN C 1 116 ? -30.814 79.086 29.623  1.00 31.29  ? 116 GLN C CB    1 
ATOM   8309  C CG    . GLN C 1 116 ? -30.122 78.311 28.506  1.00 30.06  ? 116 GLN C CG    1 
ATOM   8310  C CD    . GLN C 1 116 ? -30.320 76.838 28.752  1.00 32.04  ? 116 GLN C CD    1 
ATOM   8311  O OE1   . GLN C 1 116 ? -30.673 76.452 29.876  1.00 39.20  ? 116 GLN C OE1   1 
ATOM   8312  N NE2   . GLN C 1 116 ? -30.089 76.007 27.743  1.00 38.67  ? 116 GLN C NE2   1 
ATOM   8313  N N     . LYS C 1 117 ? -31.630 81.434 31.601  1.00 56.07  ? 117 LYS C N     1 
ATOM   8314  C CA    . LYS C 1 117 ? -32.648 82.077 32.418  1.00 63.65  ? 117 LYS C CA    1 
ATOM   8315  C C     . LYS C 1 117 ? -33.033 83.422 31.808  1.00 68.32  ? 117 LYS C C     1 
ATOM   8316  O O     . LYS C 1 117 ? -34.222 83.737 31.693  1.00 69.57  ? 117 LYS C O     1 
ATOM   8317  C CB    . LYS C 1 117 ? -32.200 82.199 33.865  1.00 74.90  ? 117 LYS C CB    1 
ATOM   8318  C CG    . LYS C 1 117 ? -31.947 83.586 34.426  1.00 85.28  ? 117 LYS C CG    1 
ATOM   8319  C CD    . LYS C 1 117 ? -31.259 83.558 35.778  1.00 93.56  ? 117 LYS C CD    1 
ATOM   8320  C CE    . LYS C 1 117 ? -32.134 82.939 36.856  1.00 98.97  ? 117 LYS C CE    1 
ATOM   8321  N NZ    . LYS C 1 117 ? -31.428 81.879 37.636  1.00 101.58 ? 117 LYS C NZ    1 
ATOM   8322  N N     . GLU C 1 118 ? -32.042 84.177 31.346  1.00 69.50  ? 118 GLU C N     1 
ATOM   8323  C CA    . GLU C 1 118 ? -32.242 85.457 30.694  1.00 71.64  ? 118 GLU C CA    1 
ATOM   8324  C C     . GLU C 1 118 ? -32.870 85.378 29.312  1.00 69.33  ? 118 GLU C C     1 
ATOM   8325  O O     . GLU C 1 118 ? -33.241 86.418 28.754  1.00 71.32  ? 118 GLU C O     1 
ATOM   8326  C CB    . GLU C 1 118 ? -30.889 86.182 30.592  1.00 81.93  ? 118 GLU C CB    1 
ATOM   8327  C CG    . GLU C 1 118 ? -30.193 86.357 31.930  1.00 94.07  ? 118 GLU C CG    1 
ATOM   8328  C CD    . GLU C 1 118 ? -28.687 86.485 31.818  1.00 101.34 ? 118 GLU C CD    1 
ATOM   8329  O OE1   . GLU C 1 118 ? -28.146 86.237 30.717  1.00 106.44 ? 118 GLU C OE1   1 
ATOM   8330  O OE2   . GLU C 1 118 ? -28.028 86.838 32.823  1.00 103.99 ? 118 GLU C OE2   1 
ATOM   8331  N N     . GLY C 1 119 ? -32.983 84.203 28.711  1.00 67.37  ? 119 GLY C N     1 
ATOM   8332  C CA    . GLY C 1 119 ? -33.551 84.034 27.384  1.00 64.26  ? 119 GLY C CA    1 
ATOM   8333  C C     . GLY C 1 119 ? -32.463 83.879 26.324  1.00 62.21  ? 119 GLY C C     1 
ATOM   8334  O O     . GLY C 1 119 ? -32.733 83.714 25.130  1.00 62.24  ? 119 GLY C O     1 
ATOM   8335  N N     . LYS C 1 120 ? -31.205 83.931 26.762  1.00 56.51  ? 120 LYS C N     1 
ATOM   8336  C CA    . LYS C 1 120 ? -30.055 83.791 25.885  1.00 48.79  ? 120 LYS C CA    1 
ATOM   8337  C C     . LYS C 1 120 ? -29.610 82.343 25.782  1.00 44.68  ? 120 LYS C C     1 
ATOM   8338  O O     . LYS C 1 120 ? -30.323 81.408 26.131  1.00 40.62  ? 120 LYS C O     1 
ATOM   8339  C CB    . LYS C 1 120 ? -28.932 84.691 26.405  1.00 51.45  ? 120 LYS C CB    1 
ATOM   8340  C CG    . LYS C 1 120 ? -29.412 86.101 26.704  1.00 57.63  ? 120 LYS C CG    1 
ATOM   8341  C CD    . LYS C 1 120 ? -28.299 87.007 27.195  1.00 60.30  ? 120 LYS C CD    1 
ATOM   8342  C CE    . LYS C 1 120 ? -28.787 88.445 27.277  1.00 65.29  ? 120 LYS C CE    1 
ATOM   8343  N NZ    . LYS C 1 120 ? -28.120 89.202 28.370  1.00 75.22  ? 120 LYS C NZ    1 
ATOM   8344  N N     . ALA C 1 121 ? -28.411 82.118 25.257  1.00 41.79  ? 121 ALA C N     1 
ATOM   8345  C CA    . ALA C 1 121 ? -27.822 80.803 25.095  1.00 39.65  ? 121 ALA C CA    1 
ATOM   8346  C C     . ALA C 1 121 ? -28.672 79.818 24.313  1.00 37.84  ? 121 ALA C C     1 
ATOM   8347  O O     . ALA C 1 121 ? -28.746 78.636 24.663  1.00 35.67  ? 121 ALA C O     1 
ATOM   8348  C CB    . ALA C 1 121 ? -27.476 80.204 26.463  1.00 39.78  ? 121 ALA C CB    1 
ATOM   8349  N N     . LYS C 1 122 ? -29.195 80.247 23.161  1.00 37.08  ? 122 LYS C N     1 
ATOM   8350  C CA    . LYS C 1 122 ? -29.985 79.361 22.318  1.00 33.80  ? 122 LYS C CA    1 
ATOM   8351  C C     . LYS C 1 122 ? -29.099 78.370 21.616  1.00 31.70  ? 122 LYS C C     1 
ATOM   8352  O O     . LYS C 1 122 ? -29.518 77.223 21.447  1.00 32.15  ? 122 LYS C O     1 
ATOM   8353  C CB    . LYS C 1 122 ? -30.846 80.151 21.316  1.00 47.09  ? 122 LYS C CB    1 
ATOM   8354  C CG    . LYS C 1 122 ? -32.002 80.879 21.984  1.00 54.30  ? 122 LYS C CG    1 
ATOM   8355  C CD    . LYS C 1 122 ? -32.775 81.728 20.991  1.00 70.07  ? 122 LYS C CD    1 
ATOM   8356  C CE    . LYS C 1 122 ? -33.114 83.099 21.556  1.00 73.09  ? 122 LYS C CE    1 
ATOM   8357  N NZ    . LYS C 1 122 ? -33.332 84.096 20.465  1.00 79.17  ? 122 LYS C NZ    1 
ATOM   8358  N N     . ASN C 1 123 ? -27.909 78.771 21.172  1.00 29.02  ? 123 ASN C N     1 
ATOM   8359  C CA    . ASN C 1 123 ? -26.970 77.839 20.516  1.00 32.85  ? 123 ASN C CA    1 
ATOM   8360  C C     . ASN C 1 123 ? -25.661 78.057 21.311  1.00 31.43  ? 123 ASN C C     1 
ATOM   8361  O O     . ASN C 1 123 ? -24.802 78.870 20.936  1.00 25.97  ? 123 ASN C O     1 
ATOM   8362  C CB    . ASN C 1 123 ? -26.781 78.143 19.031  1.00 37.93  ? 123 ASN C CB    1 
ATOM   8363  C CG    . ASN C 1 123 ? -28.042 77.964 18.203  1.00 49.20  ? 123 ASN C CG    1 
ATOM   8364  O OD1   . ASN C 1 123 ? -28.802 78.924 18.052  1.00 44.79  ? 123 ASN C OD1   1 
ATOM   8365  N ND2   . ASN C 1 123 ? -28.290 76.770 17.692  1.00 45.87  ? 123 ASN C ND2   1 
ATOM   8366  N N     . PRO C 1 124 ? -25.656 77.510 22.524  1.00 27.83  ? 124 PRO C N     1 
ATOM   8367  C CA    . PRO C 1 124 ? -24.631 77.832 23.493  1.00 26.67  ? 124 PRO C CA    1 
ATOM   8368  C C     . PRO C 1 124 ? -23.265 77.273 23.188  1.00 21.03  ? 124 PRO C C     1 
ATOM   8369  O O     . PRO C 1 124 ? -23.067 76.142 22.760  1.00 19.07  ? 124 PRO C O     1 
ATOM   8370  C CB    . PRO C 1 124 ? -25.192 77.235 24.804  1.00 26.19  ? 124 PRO C CB    1 
ATOM   8371  C CG    . PRO C 1 124 ? -25.920 76.009 24.314  1.00 29.54  ? 124 PRO C CG    1 
ATOM   8372  C CD    . PRO C 1 124 ? -26.611 76.511 23.064  1.00 26.34  ? 124 PRO C CD    1 
ATOM   8373  N N     . VAL C 1 125 ? -22.274 78.129 23.409  1.00 21.62  ? 125 VAL C N     1 
ATOM   8374  C CA    . VAL C 1 125 ? -20.897 77.667 23.231  1.00 23.28  ? 125 VAL C CA    1 
ATOM   8375  C C     . VAL C 1 125 ? -20.043 78.077 24.438  1.00 21.32  ? 125 VAL C C     1 
ATOM   8376  O O     . VAL C 1 125 ? -20.306 79.061 25.114  1.00 17.43  ? 125 VAL C O     1 
ATOM   8377  C CB    . VAL C 1 125 ? -20.211 78.230 21.966  1.00 27.74  ? 125 VAL C CB    1 
ATOM   8378  C CG1   . VAL C 1 125 ? -21.037 78.087 20.690  1.00 31.78  ? 125 VAL C CG1   1 
ATOM   8379  C CG2   . VAL C 1 125 ? -19.831 79.694 22.159  1.00 24.03  ? 125 VAL C CG2   1 
ATOM   8380  N N     . PHE C 1 126 ? -18.926 77.342 24.542  1.00 19.82  ? 126 PHE C N     1 
ATOM   8381  C CA    . PHE C 1 126 ? -17.897 77.763 25.520  1.00 21.23  ? 126 PHE C CA    1 
ATOM   8382  C C     . PHE C 1 126 ? -16.634 78.016 24.675  1.00 16.49  ? 126 PHE C C     1 
ATOM   8383  O O     . PHE C 1 126 ? -16.356 77.209 23.776  1.00 17.45  ? 126 PHE C O     1 
ATOM   8384  C CB    . PHE C 1 126 ? -17.583 76.689 26.543  1.00 20.48  ? 126 PHE C CB    1 
ATOM   8385  C CG    . PHE C 1 126 ? -18.511 76.557 27.709  1.00 22.72  ? 126 PHE C CG    1 
ATOM   8386  C CD1   . PHE C 1 126 ? -19.780 76.020 27.557  1.00 23.63  ? 126 PHE C CD1   1 
ATOM   8387  C CD2   . PHE C 1 126 ? -18.092 76.950 28.975  1.00 25.24  ? 126 PHE C CD2   1 
ATOM   8388  C CE1   . PHE C 1 126 ? -20.613 75.873 28.661  1.00 23.04  ? 126 PHE C CE1   1 
ATOM   8389  C CE2   . PHE C 1 126 ? -18.927 76.812 30.074  1.00 23.71  ? 126 PHE C CE2   1 
ATOM   8390  C CZ    . PHE C 1 126 ? -20.192 76.275 29.917  1.00 23.77  ? 126 PHE C CZ    1 
ATOM   8391  N N     . ILE C 1 127 ? -15.914 79.054 25.008  1.00 18.17  ? 127 ILE C N     1 
ATOM   8392  C CA    . ILE C 1 127 ? -14.675 79.362 24.313  1.00 23.02  ? 127 ILE C CA    1 
ATOM   8393  C C     . ILE C 1 127 ? -13.493 79.271 25.269  1.00 21.45  ? 127 ILE C C     1 
ATOM   8394  O O     . ILE C 1 127 ? -13.546 79.838 26.378  1.00 21.81  ? 127 ILE C O     1 
ATOM   8395  C CB    . ILE C 1 127 ? -14.747 80.778 23.695  1.00 22.14  ? 127 ILE C CB    1 
ATOM   8396  C CG1   . ILE C 1 127 ? -15.806 80.785 22.562  1.00 28.24  ? 127 ILE C CG1   1 
ATOM   8397  C CG2   . ILE C 1 127 ? -13.367 81.138 23.132  1.00 16.73  ? 127 ILE C CG2   1 
ATOM   8398  C CD1   . ILE C 1 127 ? -16.118 82.189 22.123  1.00 24.96  ? 127 ILE C CD1   1 
ATOM   8399  N N     . SER C 1 128 ? -12.428 78.625 24.836  1.00 21.20  ? 128 SER C N     1 
ATOM   8400  C CA    . SER C 1 128 ? -11.219 78.530 25.656  1.00 20.39  ? 128 SER C CA    1 
ATOM   8401  C C     . SER C 1 128 ? -9.948  78.650 24.825  1.00 20.74  ? 128 SER C C     1 
ATOM   8402  O O     . SER C 1 128 ? -9.979  78.284 23.636  1.00 19.04  ? 128 SER C O     1 
ATOM   8403  C CB    . SER C 1 128 ? -11.161 77.135 26.343  1.00 22.26  ? 128 SER C CB    1 
ATOM   8404  O OG    . SER C 1 128 ? -10.134 77.148 27.354  1.00 18.92  ? 128 SER C OG    1 
ATOM   8405  N N     . ASN C 1 129 ? -8.824  79.014 25.450  1.00 16.23  ? 129 ASN C N     1 
ATOM   8406  C CA    . ASN C 1 129 ? -7.530  78.922 24.743  1.00 17.46  ? 129 ASN C CA    1 
ATOM   8407  C C     . ASN C 1 129 ? -7.413  77.464 24.329  1.00 20.09  ? 129 ASN C C     1 
ATOM   8408  O O     . ASN C 1 129 ? -7.124  77.096 23.186  1.00 21.33  ? 129 ASN C O     1 
ATOM   8409  C CB    . ASN C 1 129 ? -6.337  79.412 25.539  1.00 20.22  ? 129 ASN C CB    1 
ATOM   8410  C CG    . ASN C 1 129 ? -6.220  79.005 26.998  1.00 23.77  ? 129 ASN C CG    1 
ATOM   8411  O OD1   . ASN C 1 129 ? -7.185  78.624 27.684  1.00 15.91  ? 129 ASN C OD1   1 
ATOM   8412  N ND2   . ASN C 1 129 ? -4.985  79.138 27.500  1.00 14.06  ? 129 ASN C ND2   1 
ATOM   8413  N N     . PHE C 1 130 ? -7.710  76.550 25.253  1.00 17.92  ? 130 PHE C N     1 
ATOM   8414  C CA    . PHE C 1 130 ? -7.784  75.132 24.966  1.00 17.66  ? 130 PHE C CA    1 
ATOM   8415  C C     . PHE C 1 130 ? -8.430  74.364 26.117  1.00 23.86  ? 130 PHE C C     1 
ATOM   8416  O O     . PHE C 1 130 ? -7.926  74.336 27.229  1.00 19.56  ? 130 PHE C O     1 
ATOM   8417  C CB    . PHE C 1 130 ? -6.414  74.548 24.641  1.00 18.88  ? 130 PHE C CB    1 
ATOM   8418  C CG    . PHE C 1 130 ? -6.550  73.446 23.603  1.00 23.97  ? 130 PHE C CG    1 
ATOM   8419  C CD1   . PHE C 1 130 ? -7.307  72.328 23.824  1.00 23.34  ? 130 PHE C CD1   1 
ATOM   8420  C CD2   . PHE C 1 130 ? -5.907  73.588 22.375  1.00 30.77  ? 130 PHE C CD2   1 
ATOM   8421  C CE1   . PHE C 1 130 ? -7.417  71.317 22.877  1.00 28.48  ? 130 PHE C CE1   1 
ATOM   8422  C CE2   . PHE C 1 130 ? -6.028  72.618 21.404  1.00 32.56  ? 130 PHE C CE2   1 
ATOM   8423  C CZ    . PHE C 1 130 ? -6.766  71.478 21.657  1.00 34.46  ? 130 PHE C CZ    1 
ATOM   8424  N N     . HIS C 1 131 ? -9.596  73.791 25.865  1.00 22.97  ? 131 HIS C N     1 
ATOM   8425  C CA    . HIS C 1 131 ? -10.347 73.051 26.846  1.00 21.53  ? 131 HIS C CA    1 
ATOM   8426  C C     . HIS C 1 131 ? -9.634  71.739 27.187  1.00 22.76  ? 131 HIS C C     1 
ATOM   8427  O O     . HIS C 1 131 ? -9.438  70.917 26.284  1.00 17.82  ? 131 HIS C O     1 
ATOM   8428  C CB    . HIS C 1 131 ? -11.731 72.639 26.306  1.00 21.98  ? 131 HIS C CB    1 
ATOM   8429  C CG    . HIS C 1 131 ? -12.734 73.746 26.221  1.00 27.23  ? 131 HIS C CG    1 
ATOM   8430  N ND1   . HIS C 1 131 ? -12.894 74.515 25.083  1.00 24.72  ? 131 HIS C ND1   1 
ATOM   8431  C CD2   . HIS C 1 131 ? -13.631 74.213 27.126  1.00 25.65  ? 131 HIS C CD2   1 
ATOM   8432  C CE1   . HIS C 1 131 ? -13.851 75.413 25.275  1.00 21.91  ? 131 HIS C CE1   1 
ATOM   8433  N NE2   . HIS C 1 131 ? -14.307 75.254 26.514  1.00 28.58  ? 131 HIS C NE2   1 
ATOM   8434  N N     . PHE C 1 132 ? -9.419  71.496 28.487  1.00 20.29  ? 132 PHE C N     1 
ATOM   8435  C CA    . PHE C 1 132 ? -8.848  70.185 28.844  1.00 17.72  ? 132 PHE C CA    1 
ATOM   8436  C C     . PHE C 1 132 ? -9.881  69.148 28.526  1.00 15.39  ? 132 PHE C C     1 
ATOM   8437  O O     . PHE C 1 132 ? -11.089 69.461 28.378  1.00 17.00  ? 132 PHE C O     1 
ATOM   8438  C CB    . PHE C 1 132 ? -8.451  70.264 30.358  1.00 19.70  ? 132 PHE C CB    1 
ATOM   8439  C CG    . PHE C 1 132 ? -7.991  68.933 30.869  1.00 26.69  ? 132 PHE C CG    1 
ATOM   8440  C CD1   . PHE C 1 132 ? -6.808  68.398 30.405  1.00 27.21  ? 132 PHE C CD1   1 
ATOM   8441  C CD2   . PHE C 1 132 ? -8.731  68.201 31.782  1.00 22.18  ? 132 PHE C CD2   1 
ATOM   8442  C CE1   . PHE C 1 132 ? -6.364  67.161 30.840  1.00 29.68  ? 132 PHE C CE1   1 
ATOM   8443  C CE2   . PHE C 1 132 ? -8.303  66.968 32.238  1.00 27.03  ? 132 PHE C CE2   1 
ATOM   8444  C CZ    . PHE C 1 132 ? -7.108  66.456 31.766  1.00 32.81  ? 132 PHE C CZ    1 
ATOM   8445  N N     . ASP C 1 133 ? -9.577  67.863 28.446  1.00 13.64  ? 133 ASP C N     1 
ATOM   8446  C CA    . ASP C 1 133 ? -10.501 66.813 28.072  1.00 20.27  ? 133 ASP C CA    1 
ATOM   8447  C C     . ASP C 1 133 ? -11.764 66.706 28.938  1.00 24.03  ? 133 ASP C C     1 
ATOM   8448  O O     . ASP C 1 133 ? -12.872 66.524 28.407  1.00 19.39  ? 133 ASP C O     1 
ATOM   8449  C CB    . ASP C 1 133 ? -9.824  65.451 28.096  1.00 28.65  ? 133 ASP C CB    1 
ATOM   8450  C CG    . ASP C 1 133 ? -8.480  65.403 27.405  1.00 46.32  ? 133 ASP C CG    1 
ATOM   8451  O OD1   . ASP C 1 133 ? -7.962  66.434 26.945  1.00 51.39  ? 133 ASP C OD1   1 
ATOM   8452  O OD2   . ASP C 1 133 ? -7.919  64.289 27.327  1.00 59.34  ? 133 ASP C OD2   1 
ATOM   8453  N N     . THR C 1 134 ? -11.617 66.793 30.270  1.00 17.86  ? 134 THR C N     1 
ATOM   8454  C CA    . THR C 1 134 ? -12.840 66.668 31.086  1.00 18.57  ? 134 THR C CA    1 
ATOM   8455  C C     . THR C 1 134 ? -13.669 67.935 30.911  1.00 15.41  ? 134 THR C C     1 
ATOM   8456  O O     . THR C 1 134 ? -14.899 67.885 30.901  1.00 18.17  ? 134 THR C O     1 
ATOM   8457  C CB    . THR C 1 134 ? -12.533 66.483 32.595  1.00 16.34  ? 134 THR C CB    1 
ATOM   8458  O OG1   . THR C 1 134 ? -11.849 67.648 33.034  1.00 14.87  ? 134 THR C OG1   1 
ATOM   8459  C CG2   . THR C 1 134 ? -11.711 65.226 32.806  1.00 9.72   ? 134 THR C CG2   1 
ATOM   8460  N N     . THR C 1 135 ? -13.006 69.078 30.831  1.00 13.45  ? 135 THR C N     1 
ATOM   8461  C CA    . THR C 1 135 ? -13.697 70.355 30.691  1.00 18.72  ? 135 THR C CA    1 
ATOM   8462  C C     . THR C 1 135 ? -14.560 70.354 29.412  1.00 21.80  ? 135 THR C C     1 
ATOM   8463  O O     . THR C 1 135 ? -15.751 70.706 29.439  1.00 20.19  ? 135 THR C O     1 
ATOM   8464  C CB    . THR C 1 135 ? -12.635 71.454 30.620  1.00 19.24  ? 135 THR C CB    1 
ATOM   8465  O OG1   . THR C 1 135 ? -11.565 71.054 31.483  1.00 15.78  ? 135 THR C OG1   1 
ATOM   8466  C CG2   . THR C 1 135 ? -13.186 72.834 30.911  1.00 17.24  ? 135 THR C CG2   1 
ATOM   8467  N N     . ALA C 1 136 ? -13.970 69.913 28.303  1.00 20.63  ? 136 ALA C N     1 
ATOM   8468  C CA    . ALA C 1 136 ? -14.721 69.814 27.046  1.00 22.79  ? 136 ALA C CA    1 
ATOM   8469  C C     . ALA C 1 136 ? -15.836 68.792 27.212  1.00 22.20  ? 136 ALA C C     1 
ATOM   8470  O O     . ALA C 1 136 ? -16.918 68.989 26.642  1.00 20.67  ? 136 ALA C O     1 
ATOM   8471  C CB    . ALA C 1 136 ? -13.830 69.413 25.885  1.00 16.39  ? 136 ALA C CB    1 
ATOM   8472  N N     . ALA C 1 137 ? -15.557 67.684 27.892  1.00 19.21  ? 137 ALA C N     1 
ATOM   8473  C CA    . ALA C 1 137 ? -16.592 66.667 28.074  1.00 20.53  ? 137 ALA C CA    1 
ATOM   8474  C C     . ALA C 1 137 ? -17.828 67.228 28.789  1.00 22.23  ? 137 ALA C C     1 
ATOM   8475  O O     . ALA C 1 137 ? -18.964 66.903 28.395  1.00 19.08  ? 137 ALA C O     1 
ATOM   8476  C CB    . ALA C 1 137 ? -16.077 65.423 28.789  1.00 20.06  ? 137 ALA C CB    1 
ATOM   8477  N N     . HIS C 1 138 ? -17.656 68.065 29.797  1.00 19.57  ? 138 HIS C N     1 
ATOM   8478  C CA    . HIS C 1 138 ? -18.757 68.655 30.538  1.00 21.53  ? 138 HIS C CA    1 
ATOM   8479  C C     . HIS C 1 138 ? -19.458 69.674 29.643  1.00 24.59  ? 138 HIS C C     1 
ATOM   8480  O O     . HIS C 1 138 ? -20.682 69.798 29.652  1.00 21.06  ? 138 HIS C O     1 
ATOM   8481  C CB    . HIS C 1 138 ? -18.257 69.274 31.882  1.00 17.49  ? 138 HIS C CB    1 
ATOM   8482  C CG    . HIS C 1 138 ? -18.123 68.155 32.882  1.00 25.17  ? 138 HIS C CG    1 
ATOM   8483  N ND1   . HIS C 1 138 ? -19.202 67.504 33.432  1.00 19.64  ? 138 HIS C ND1   1 
ATOM   8484  C CD2   . HIS C 1 138 ? -17.012 67.518 33.341  1.00 21.36  ? 138 HIS C CD2   1 
ATOM   8485  C CE1   . HIS C 1 138 ? -18.773 66.532 34.216  1.00 28.82  ? 138 HIS C CE1   1 
ATOM   8486  N NE2   . HIS C 1 138 ? -17.434 66.523 34.186  1.00 25.10  ? 138 HIS C NE2   1 
ATOM   8487  N N     . VAL C 1 139 ? -18.680 70.412 28.841  1.00 22.19  ? 139 VAL C N     1 
ATOM   8488  C CA    . VAL C 1 139 ? -19.279 71.385 27.908  1.00 24.79  ? 139 VAL C CA    1 
ATOM   8489  C C     . VAL C 1 139 ? -20.238 70.665 26.950  1.00 22.68  ? 139 VAL C C     1 
ATOM   8490  O O     . VAL C 1 139 ? -21.403 71.028 26.834  1.00 23.58  ? 139 VAL C O     1 
ATOM   8491  C CB    . VAL C 1 139 ? -18.193 72.132 27.131  1.00 25.54  ? 139 VAL C CB    1 
ATOM   8492  C CG1   . VAL C 1 139 ? -18.744 72.825 25.878  1.00 26.91  ? 139 VAL C CG1   1 
ATOM   8493  C CG2   . VAL C 1 139 ? -17.507 73.136 28.055  1.00 22.09  ? 139 VAL C CG2   1 
ATOM   8494  N N     . GLU C 1 140 ? -19.822 69.561 26.370  1.00 21.49  ? 140 GLU C N     1 
ATOM   8495  C CA    . GLU C 1 140 ? -20.589 68.776 25.454  1.00 27.59  ? 140 GLU C CA    1 
ATOM   8496  C C     . GLU C 1 140 ? -21.731 68.009 26.076  1.00 32.58  ? 140 GLU C C     1 
ATOM   8497  O O     . GLU C 1 140 ? -22.850 67.952 25.493  1.00 31.13  ? 140 GLU C O     1 
ATOM   8498  C CB    . GLU C 1 140 ? -19.649 67.840 24.667  1.00 25.23  ? 140 GLU C CB    1 
ATOM   8499  C CG    . GLU C 1 140 ? -18.810 68.676 23.700  1.00 37.81  ? 140 GLU C CG    1 
ATOM   8500  C CD    . GLU C 1 140 ? -17.704 67.898 23.008  1.00 48.81  ? 140 GLU C CD    1 
ATOM   8501  O OE1   . GLU C 1 140 ? -17.708 66.649 23.048  1.00 51.97  ? 140 GLU C OE1   1 
ATOM   8502  O OE2   . GLU C 1 140 ? -16.807 68.527 22.410  1.00 50.99  ? 140 GLU C OE2   1 
ATOM   8503  N N     . LEU C 1 141 ? -21.545 67.478 27.280  1.00 28.14  ? 141 LEU C N     1 
ATOM   8504  C CA    . LEU C 1 141 ? -22.611 66.754 27.966  1.00 29.30  ? 141 LEU C CA    1 
ATOM   8505  C C     . LEU C 1 141 ? -23.777 67.695 28.274  1.00 27.59  ? 141 LEU C C     1 
ATOM   8506  O O     . LEU C 1 141 ? -24.904 67.242 28.446  1.00 25.35  ? 141 LEU C O     1 
ATOM   8507  C CB    . LEU C 1 141 ? -22.148 66.130 29.290  1.00 33.30  ? 141 LEU C CB    1 
ATOM   8508  C CG    . LEU C 1 141 ? -21.242 64.906 29.211  1.00 44.50  ? 141 LEU C CG    1 
ATOM   8509  C CD1   . LEU C 1 141 ? -20.582 64.636 30.552  1.00 42.62  ? 141 LEU C CD1   1 
ATOM   8510  C CD2   . LEU C 1 141 ? -22.037 63.700 28.729  1.00 45.47  ? 141 LEU C CD2   1 
ATOM   8511  N N     . ASN C 1 142 ? -23.503 68.991 28.442  1.00 23.25  ? 142 ASN C N     1 
ATOM   8512  C CA    . ASN C 1 142 ? -24.548 69.963 28.678  1.00 26.69  ? 142 ASN C CA    1 
ATOM   8513  C C     . ASN C 1 142 ? -25.058 70.578 27.367  1.00 25.25  ? 142 ASN C C     1 
ATOM   8514  O O     . ASN C 1 142 ? -25.602 71.684 27.369  1.00 26.99  ? 142 ASN C O     1 
ATOM   8515  C CB    . ASN C 1 142 ? -24.045 71.037 29.663  1.00 25.91  ? 142 ASN C CB    1 
ATOM   8516  C CG    . ASN C 1 142 ? -23.923 70.320 31.021  1.00 34.74  ? 142 ASN C CG    1 
ATOM   8517  O OD1   . ASN C 1 142 ? -24.923 70.094 31.694  1.00 33.76  ? 142 ASN C OD1   1 
ATOM   8518  N ND2   . ASN C 1 142 ? -22.713 69.893 31.358  1.00 22.93  ? 142 ASN C ND2   1 
ATOM   8519  N N     . GLY C 1 143 ? -24.847 69.894 26.257  1.00 27.19  ? 143 GLY C N     1 
ATOM   8520  C CA    . GLY C 1 143 ? -25.346 70.306 24.959  1.00 31.02  ? 143 GLY C CA    1 
ATOM   8521  C C     . GLY C 1 143 ? -24.654 71.529 24.385  1.00 32.40  ? 143 GLY C C     1 
ATOM   8522  O O     . GLY C 1 143 ? -25.290 72.243 23.608  1.00 32.71  ? 143 GLY C O     1 
ATOM   8523  N N     . CYS C 1 144 ? -23.412 71.840 24.802  1.00 28.13  ? 144 CYS C N     1 
ATOM   8524  C CA    . CYS C 1 144 ? -22.806 73.045 24.259  1.00 23.16  ? 144 CYS C CA    1 
ATOM   8525  C C     . CYS C 1 144 ? -21.643 72.653 23.345  1.00 25.95  ? 144 CYS C C     1 
ATOM   8526  O O     . CYS C 1 144 ? -21.257 71.492 23.291  1.00 26.34  ? 144 CYS C O     1 
ATOM   8527  C CB    . CYS C 1 144 ? -22.329 74.031 25.286  1.00 23.82  ? 144 CYS C CB    1 
ATOM   8528  S SG    . CYS C 1 144 ? -23.520 74.497 26.549  1.00 24.83  ? 144 CYS C SG    1 
ATOM   8529  N N     . LYS C 1 145 ? -21.136 73.667 22.656  1.00 25.99  ? 145 LYS C N     1 
ATOM   8530  C CA    . LYS C 1 145 ? -19.996 73.441 21.780  1.00 28.05  ? 145 LYS C CA    1 
ATOM   8531  C C     . LYS C 1 145 ? -18.757 74.000 22.491  1.00 21.78  ? 145 LYS C C     1 
ATOM   8532  O O     . LYS C 1 145 ? -18.804 75.098 23.035  1.00 24.04  ? 145 LYS C O     1 
ATOM   8533  C CB    . LYS C 1 145 ? -20.153 74.162 20.436  1.00 38.51  ? 145 LYS C CB    1 
ATOM   8534  C CG    . LYS C 1 145 ? -20.999 73.441 19.404  1.00 58.41  ? 145 LYS C CG    1 
ATOM   8535  C CD    . LYS C 1 145 ? -21.412 74.383 18.274  1.00 73.88  ? 145 LYS C CD    1 
ATOM   8536  C CE    . LYS C 1 145 ? -22.814 74.930 18.491  1.00 81.23  ? 145 LYS C CE    1 
ATOM   8537  N NZ    . LYS C 1 145 ? -23.093 76.204 17.777  1.00 80.45  ? 145 LYS C NZ    1 
ATOM   8538  N N     . ALA C 1 146 ? -17.673 73.277 22.393  1.00 22.99  ? 146 ALA C N     1 
ATOM   8539  C CA    . ALA C 1 146 ? -16.406 73.687 22.996  1.00 28.00  ? 146 ALA C CA    1 
ATOM   8540  C C     . ALA C 1 146 ? -15.491 74.217 21.903  1.00 26.42  ? 146 ALA C C     1 
ATOM   8541  O O     . ALA C 1 146 ? -15.110 73.455 21.027  1.00 29.44  ? 146 ALA C O     1 
ATOM   8542  C CB    . ALA C 1 146 ? -15.786 72.460 23.668  1.00 23.99  ? 146 ALA C CB    1 
ATOM   8543  N N     . ILE C 1 147 ? -15.182 75.501 21.894  1.00 26.05  ? 147 ILE C N     1 
ATOM   8544  C CA    . ILE C 1 147 ? -14.289 76.049 20.876  1.00 25.20  ? 147 ILE C CA    1 
ATOM   8545  C C     . ILE C 1 147 ? -12.917 76.385 21.458  1.00 24.77  ? 147 ILE C C     1 
ATOM   8546  O O     . ILE C 1 147 ? -12.809 77.075 22.497  1.00 22.41  ? 147 ILE C O     1 
ATOM   8547  C CB    . ILE C 1 147 ? -14.947 77.310 20.281  1.00 27.79  ? 147 ILE C CB    1 
ATOM   8548  C CG1   . ILE C 1 147 ? -16.213 76.899 19.506  1.00 31.31  ? 147 ILE C CG1   1 
ATOM   8549  C CG2   . ILE C 1 147 ? -13.976 78.050 19.376  1.00 26.87  ? 147 ILE C CG2   1 
ATOM   8550  C CD1   . ILE C 1 147 ? -17.213 78.012 19.289  1.00 32.70  ? 147 ILE C CD1   1 
ATOM   8551  N N     . ASN C 1 148 ? -11.862 75.927 20.803  1.00 19.97  ? 148 ASN C N     1 
ATOM   8552  C CA    . ASN C 1 148 ? -10.482 76.181 21.247  1.00 20.41  ? 148 ASN C CA    1 
ATOM   8553  C C     . ASN C 1 148 ? -9.747  77.155 20.363  1.00 21.88  ? 148 ASN C C     1 
ATOM   8554  O O     . ASN C 1 148 ? -9.666  76.864 19.157  1.00 22.83  ? 148 ASN C O     1 
ATOM   8555  C CB    . ASN C 1 148 ? -9.705  74.836 21.158  1.00 16.59  ? 148 ASN C CB    1 
ATOM   8556  C CG    . ASN C 1 148 ? -10.322 73.855 22.164  1.00 21.22  ? 148 ASN C CG    1 
ATOM   8557  O OD1   . ASN C 1 148 ? -10.669 74.267 23.279  1.00 18.29  ? 148 ASN C OD1   1 
ATOM   8558  N ND2   . ASN C 1 148 ? -10.467 72.621 21.725  1.00 17.63  ? 148 ASN C ND2   1 
ATOM   8559  N N     . ILE C 1 149 ? -9.266  78.278 20.827  1.00 19.42  ? 149 ILE C N     1 
ATOM   8560  C CA    . ILE C 1 149 ? -8.603  79.271 20.019  1.00 22.01  ? 149 ILE C CA    1 
ATOM   8561  C C     . ILE C 1 149 ? -7.213  79.668 20.521  1.00 21.75  ? 149 ILE C C     1 
ATOM   8562  O O     . ILE C 1 149 ? -6.840  80.841 20.644  1.00 23.78  ? 149 ILE C O     1 
ATOM   8563  C CB    . ILE C 1 149 ? -9.496  80.526 19.897  1.00 26.19  ? 149 ILE C CB    1 
ATOM   8564  C CG1   . ILE C 1 149 ? -9.885  81.008 21.285  1.00 18.97  ? 149 ILE C CG1   1 
ATOM   8565  C CG2   . ILE C 1 149 ? -10.744 80.227 19.051  1.00 24.98  ? 149 ILE C CG2   1 
ATOM   8566  C CD1   . ILE C 1 149 ? -10.298 82.454 21.404  1.00 20.29  ? 149 ILE C CD1   1 
ATOM   8567  N N     . VAL C 1 150 ? -6.393  78.648 20.808  1.00 22.33  ? 150 VAL C N     1 
ATOM   8568  C CA    . VAL C 1 150 ? -5.024  78.901 21.268  1.00 24.04  ? 150 VAL C CA    1 
ATOM   8569  C C     . VAL C 1 150 ? -4.213  79.530 20.112  1.00 22.89  ? 150 VAL C C     1 
ATOM   8570  O O     . VAL C 1 150 ? -4.438  79.142 18.976  1.00 19.86  ? 150 VAL C O     1 
ATOM   8571  C CB    . VAL C 1 150 ? -4.326  77.632 21.749  1.00 21.28  ? 150 VAL C CB    1 
ATOM   8572  C CG1   . VAL C 1 150 ? -4.117  76.608 20.649  1.00 25.62  ? 150 VAL C CG1   1 
ATOM   8573  C CG2   . VAL C 1 150 ? -2.978  77.980 22.398  1.00 21.54  ? 150 VAL C CG2   1 
ATOM   8574  N N     . THR C 1 151 ? -3.321  80.444 20.400  1.00 23.75  ? 151 THR C N     1 
ATOM   8575  C CA    . THR C 1 151 ? -2.430  80.998 19.389  1.00 26.00  ? 151 THR C CA    1 
ATOM   8576  C C     . THR C 1 151 ? -1.826  79.920 18.499  1.00 27.76  ? 151 THR C C     1 
ATOM   8577  O O     . THR C 1 151 ? -1.529  78.774 18.882  1.00 26.03  ? 151 THR C O     1 
ATOM   8578  C CB    . THR C 1 151 ? -1.279  81.772 20.054  1.00 34.77  ? 151 THR C CB    1 
ATOM   8579  O OG1   . THR C 1 151 ? -0.394  82.272 19.035  1.00 32.31  ? 151 THR C OG1   1 
ATOM   8580  C CG2   . THR C 1 151 ? -0.510  80.845 20.995  1.00 22.24  ? 151 THR C CG2   1 
ATOM   8581  N N     . GLU C 1 152 ? -1.550  80.296 17.232  1.00 28.28  ? 152 GLU C N     1 
ATOM   8582  C CA    . GLU C 1 152 ? -0.965  79.326 16.295  1.00 31.70  ? 152 GLU C CA    1 
ATOM   8583  C C     . GLU C 1 152 ? 0.514   79.087 16.588  1.00 23.69  ? 152 GLU C C     1 
ATOM   8584  O O     . GLU C 1 152 ? 1.011   78.005 16.294  1.00 25.72  ? 152 GLU C O     1 
ATOM   8585  C CB    . GLU C 1 152 ? -1.118  79.693 14.823  1.00 45.54  ? 152 GLU C CB    1 
ATOM   8586  C CG    . GLU C 1 152 ? -1.261  81.169 14.514  1.00 71.03  ? 152 GLU C CG    1 
ATOM   8587  C CD    . GLU C 1 152 ? -1.983  81.384 13.189  1.00 84.28  ? 152 GLU C CD    1 
ATOM   8588  O OE1   . GLU C 1 152 ? -3.047  80.751 12.978  1.00 89.36  ? 152 GLU C OE1   1 
ATOM   8589  O OE2   . GLU C 1 152 ? -1.458  82.184 12.383  1.00 88.90  ? 152 GLU C OE2   1 
ATOM   8590  N N     . LYS C 1 153 ? 1.154   79.955 17.341  1.00 26.89  ? 153 LYS C N     1 
ATOM   8591  C CA    . LYS C 1 153 ? 2.517   79.727 17.833  1.00 30.58  ? 153 LYS C CA    1 
ATOM   8592  C C     . LYS C 1 153 ? 2.618   78.416 18.596  1.00 31.86  ? 153 LYS C C     1 
ATOM   8593  O O     . LYS C 1 153 ? 3.646   77.732 18.522  1.00 32.89  ? 153 LYS C O     1 
ATOM   8594  C CB    . LYS C 1 153 ? 2.951   80.913 18.667  1.00 33.49  ? 153 LYS C CB    1 
ATOM   8595  C CG    . LYS C 1 153 ? 3.140   82.191 17.881  1.00 43.85  ? 153 LYS C CG    1 
ATOM   8596  C CD    . LYS C 1 153 ? 3.340   83.340 18.870  1.00 57.47  ? 153 LYS C CD    1 
ATOM   8597  C CE    . LYS C 1 153 ? 4.053   84.505 18.200  1.00 67.37  ? 153 LYS C CE    1 
ATOM   8598  N NZ    . LYS C 1 153 ? 4.139   85.685 19.105  1.00 72.88  ? 153 LYS C NZ    1 
ATOM   8599  N N     . ALA C 1 154 ? 1.574   77.947 19.262  1.00 28.65  ? 154 ALA C N     1 
ATOM   8600  C CA    . ALA C 1 154 ? 1.539   76.663 19.917  1.00 31.46  ? 154 ALA C CA    1 
ATOM   8601  C C     . ALA C 1 154 ? 1.807   75.475 19.009  1.00 33.75  ? 154 ALA C C     1 
ATOM   8602  O O     . ALA C 1 154 ? 2.422   74.480 19.429  1.00 36.90  ? 154 ALA C O     1 
ATOM   8603  C CB    . ALA C 1 154 ? 0.160   76.483 20.574  1.00 23.44  ? 154 ALA C CB    1 
ATOM   8604  N N     . PHE C 1 155 ? 1.391   75.512 17.746  1.00 38.37  ? 155 PHE C N     1 
ATOM   8605  C CA    . PHE C 1 155 ? 1.589   74.387 16.831  1.00 41.56  ? 155 PHE C CA    1 
ATOM   8606  C C     . PHE C 1 155 ? 2.941   74.335 16.137  1.00 41.27  ? 155 PHE C C     1 
ATOM   8607  O O     . PHE C 1 155 ? 3.256   73.429 15.360  1.00 41.76  ? 155 PHE C O     1 
ATOM   8608  C CB    . PHE C 1 155 ? 0.434   74.390 15.815  1.00 55.84  ? 155 PHE C CB    1 
ATOM   8609  C CG    . PHE C 1 155 ? -0.899  74.387 16.525  1.00 64.20  ? 155 PHE C CG    1 
ATOM   8610  C CD1   . PHE C 1 155 ? -1.249  73.337 17.359  1.00 68.69  ? 155 PHE C CD1   1 
ATOM   8611  C CD2   . PHE C 1 155 ? -1.781  75.444 16.371  1.00 67.32  ? 155 PHE C CD2   1 
ATOM   8612  C CE1   . PHE C 1 155 ? -2.463  73.337 18.022  1.00 72.32  ? 155 PHE C CE1   1 
ATOM   8613  C CE2   . PHE C 1 155 ? -2.995  75.443 17.032  1.00 69.03  ? 155 PHE C CE2   1 
ATOM   8614  C CZ    . PHE C 1 155 ? -3.340  74.392 17.861  1.00 69.38  ? 155 PHE C CZ    1 
ATOM   8615  N N     . ASP C 1 156 ? 3.800   75.305 16.413  1.00 39.06  ? 156 ASP C N     1 
ATOM   8616  C CA    . ASP C 1 156 ? 5.137   75.364 15.860  1.00 37.01  ? 156 ASP C CA    1 
ATOM   8617  C C     . ASP C 1 156 ? 6.056   74.851 16.963  1.00 33.44  ? 156 ASP C C     1 
ATOM   8618  O O     . ASP C 1 156 ? 6.640   75.643 17.687  1.00 30.84  ? 156 ASP C O     1 
ATOM   8619  C CB    . ASP C 1 156 ? 5.448   76.791 15.413  1.00 39.30  ? 156 ASP C CB    1 
ATOM   8620  C CG    . ASP C 1 156 ? 6.754   76.907 14.658  1.00 48.74  ? 156 ASP C CG    1 
ATOM   8621  O OD1   . ASP C 1 156 ? 7.433   75.879 14.461  1.00 47.71  ? 156 ASP C OD1   1 
ATOM   8622  O OD2   . ASP C 1 156 ? 7.101   78.045 14.296  1.00 56.12  ? 156 ASP C OD2   1 
ATOM   8623  N N     . SER C 1 157 ? 6.102   73.542 17.114  1.00 34.67  ? 157 SER C N     1 
ATOM   8624  C CA    . SER C 1 157 ? 6.824   72.843 18.155  1.00 38.86  ? 157 SER C CA    1 
ATOM   8625  C C     . SER C 1 157 ? 8.223   73.332 18.483  1.00 39.66  ? 157 SER C C     1 
ATOM   8626  O O     . SER C 1 157 ? 8.494   73.634 19.639  1.00 38.49  ? 157 SER C O     1 
ATOM   8627  C CB    . SER C 1 157 ? 7.016   71.362 17.763  1.00 42.92  ? 157 SER C CB    1 
ATOM   8628  O OG    . SER C 1 157 ? 5.890   70.605 18.127  1.00 55.34  ? 157 SER C OG    1 
ATOM   8629  N N     . GLU C 1 158 ? 9.095   73.353 17.479  1.00 41.84  ? 158 GLU C N     1 
ATOM   8630  C CA    . GLU C 1 158 ? 10.494  73.683 17.687  1.00 43.34  ? 158 GLU C CA    1 
ATOM   8631  C C     . GLU C 1 158 ? 10.800  75.154 17.795  1.00 40.35  ? 158 GLU C C     1 
ATOM   8632  O O     . GLU C 1 158 ? 11.855  75.496 18.337  1.00 39.90  ? 158 GLU C O     1 
ATOM   8633  C CB    . GLU C 1 158 ? 11.324  72.971 16.606  1.00 56.33  ? 158 GLU C CB    1 
ATOM   8634  C CG    . GLU C 1 158 ? 11.303  71.467 16.875  1.00 73.44  ? 158 GLU C CG    1 
ATOM   8635  C CD    . GLU C 1 158 ? 11.692  70.612 15.691  1.00 83.13  ? 158 GLU C CD    1 
ATOM   8636  O OE1   . GLU C 1 158 ? 11.694  71.103 14.541  1.00 91.91  ? 158 GLU C OE1   1 
ATOM   8637  O OE2   . GLU C 1 158 ? 11.998  69.421 15.918  1.00 88.75  ? 158 GLU C OE2   1 
ATOM   8638  N N     . THR C 1 159 ? 9.890   76.023 17.387  1.00 37.21  ? 159 THR C N     1 
ATOM   8639  C CA    . THR C 1 159 ? 10.162  77.451 17.496  1.00 36.88  ? 159 THR C CA    1 
ATOM   8640  C C     . THR C 1 159 ? 9.790   77.980 18.877  1.00 38.23  ? 159 THR C C     1 
ATOM   8641  O O     . THR C 1 159 ? 8.660   77.875 19.334  1.00 37.40  ? 159 THR C O     1 
ATOM   8642  C CB    . THR C 1 159 ? 9.393   78.224 16.402  1.00 39.37  ? 159 THR C CB    1 
ATOM   8643  O OG1   . THR C 1 159 ? 9.737   77.613 15.158  1.00 39.69  ? 159 THR C OG1   1 
ATOM   8644  C CG2   . THR C 1 159 ? 9.748   79.692 16.391  1.00 35.87  ? 159 THR C CG2   1 
ATOM   8645  N N     . TYR C 1 160 ? 10.767  78.559 19.545  1.00 36.06  ? 160 TYR C N     1 
ATOM   8646  C CA    . TYR C 1 160 ? 10.614  79.174 20.834  1.00 32.56  ? 160 TYR C CA    1 
ATOM   8647  C C     . TYR C 1 160 ? 9.636   80.342 20.775  1.00 34.03  ? 160 TYR C C     1 
ATOM   8648  O O     . TYR C 1 160 ? 9.761   81.253 19.979  1.00 34.22  ? 160 TYR C O     1 
ATOM   8649  C CB    . TYR C 1 160 ? 11.975  79.707 21.357  1.00 30.88  ? 160 TYR C CB    1 
ATOM   8650  C CG    . TYR C 1 160 ? 11.771  80.312 22.735  1.00 28.42  ? 160 TYR C CG    1 
ATOM   8651  C CD1   . TYR C 1 160 ? 11.360  81.638 22.873  1.00 24.66  ? 160 TYR C CD1   1 
ATOM   8652  C CD2   . TYR C 1 160 ? 11.954  79.541 23.879  1.00 29.35  ? 160 TYR C CD2   1 
ATOM   8653  C CE1   . TYR C 1 160 ? 11.128  82.179 24.118  1.00 28.89  ? 160 TYR C CE1   1 
ATOM   8654  C CE2   . TYR C 1 160 ? 11.728  80.096 25.127  1.00 29.58  ? 160 TYR C CE2   1 
ATOM   8655  C CZ    . TYR C 1 160 ? 11.309  81.397 25.241  1.00 30.10  ? 160 TYR C CZ    1 
ATOM   8656  O OH    . TYR C 1 160 ? 11.068  81.919 26.500  1.00 28.89  ? 160 TYR C OH    1 
ATOM   8657  N N     . ASP C 1 161 ? 8.745   80.426 21.742  1.00 30.59  ? 161 ASP C N     1 
ATOM   8658  C CA    . ASP C 1 161 ? 7.877   81.564 21.989  1.00 24.54  ? 161 ASP C CA    1 
ATOM   8659  C C     . ASP C 1 161 ? 7.642   81.618 23.507  1.00 22.01  ? 161 ASP C C     1 
ATOM   8660  O O     . ASP C 1 161 ? 7.578   80.554 24.156  1.00 23.01  ? 161 ASP C O     1 
ATOM   8661  C CB    . ASP C 1 161 ? 6.550   81.489 21.228  1.00 26.35  ? 161 ASP C CB    1 
ATOM   8662  C CG    . ASP C 1 161 ? 5.833   82.821 21.439  1.00 34.96  ? 161 ASP C CG    1 
ATOM   8663  O OD1   . ASP C 1 161 ? 6.237   83.777 20.769  1.00 40.25  ? 161 ASP C OD1   1 
ATOM   8664  O OD2   . ASP C 1 161 ? 4.932   82.935 22.298  1.00 38.09  ? 161 ASP C OD2   1 
ATOM   8665  N N     . ASP C 1 162 ? 7.567   82.801 24.079  1.00 17.15  ? 162 ASP C N     1 
ATOM   8666  C CA    . ASP C 1 162 ? 7.408   82.908 25.514  1.00 21.29  ? 162 ASP C CA    1 
ATOM   8667  C C     . ASP C 1 162 ? 6.045   82.436 26.016  1.00 25.06  ? 162 ASP C C     1 
ATOM   8668  O O     . ASP C 1 162 ? 5.914   82.277 27.232  1.00 22.23  ? 162 ASP C O     1 
ATOM   8669  C CB    . ASP C 1 162 ? 7.488   84.371 25.944  1.00 22.90  ? 162 ASP C CB    1 
ATOM   8670  C CG    . ASP C 1 162 ? 8.920   84.850 26.124  1.00 29.11  ? 162 ASP C CG    1 
ATOM   8671  O OD1   . ASP C 1 162 ? 9.817   84.054 26.414  1.00 31.60  ? 162 ASP C OD1   1 
ATOM   8672  O OD2   . ASP C 1 162 ? 9.082   86.063 25.975  1.00 28.94  ? 162 ASP C OD2   1 
ATOM   8673  N N     . TRP C 1 163 ? 5.013   82.591 25.182  1.00 20.51  ? 163 TRP C N     1 
ATOM   8674  C CA    . TRP C 1 163 ? 3.630   82.456 25.608  1.00 20.13  ? 163 TRP C CA    1 
ATOM   8675  C C     . TRP C 1 163 ? 2.822   81.627 24.638  1.00 19.03  ? 163 TRP C C     1 
ATOM   8676  O O     . TRP C 1 163 ? 1.838   82.098 24.067  1.00 20.18  ? 163 TRP C O     1 
ATOM   8677  C CB    . TRP C 1 163 ? 2.939   83.823 25.727  1.00 18.68  ? 163 TRP C CB    1 
ATOM   8678  C CG    . TRP C 1 163 ? 3.750   84.874 26.437  1.00 23.15  ? 163 TRP C CG    1 
ATOM   8679  C CD1   . TRP C 1 163 ? 4.332   85.974 25.895  1.00 23.02  ? 163 TRP C CD1   1 
ATOM   8680  C CD2   . TRP C 1 163 ? 4.101   84.885 27.836  1.00 22.93  ? 163 TRP C CD2   1 
ATOM   8681  N NE1   . TRP C 1 163 ? 4.995   86.694 26.867  1.00 22.24  ? 163 TRP C NE1   1 
ATOM   8682  C CE2   . TRP C 1 163 ? 4.867   86.040 28.064  1.00 22.50  ? 163 TRP C CE2   1 
ATOM   8683  C CE3   . TRP C 1 163 ? 3.812   84.040 28.908  1.00 21.97  ? 163 TRP C CE3   1 
ATOM   8684  C CZ2   . TRP C 1 163 ? 5.356   86.384 29.327  1.00 22.77  ? 163 TRP C CZ2   1 
ATOM   8685  C CZ3   . TRP C 1 163 ? 4.303   84.382 30.161  1.00 20.13  ? 163 TRP C CZ3   1 
ATOM   8686  C CH2   . TRP C 1 163 ? 5.079   85.527 30.361  1.00 21.42  ? 163 TRP C CH2   1 
ATOM   8687  N N     . LYS C 1 164 ? 3.154   80.347 24.505  1.00 17.34  ? 164 LYS C N     1 
ATOM   8688  C CA    . LYS C 1 164 ? 2.403   79.477 23.623  1.00 16.93  ? 164 LYS C CA    1 
ATOM   8689  C C     . LYS C 1 164 ? 1.053   79.070 24.188  1.00 18.25  ? 164 LYS C C     1 
ATOM   8690  O O     . LYS C 1 164 ? 0.444   78.225 23.525  1.00 19.38  ? 164 LYS C O     1 
ATOM   8691  C CB    . LYS C 1 164 ? 3.220   78.256 23.249  1.00 20.09  ? 164 LYS C CB    1 
ATOM   8692  C CG    . LYS C 1 164 ? 4.509   78.608 22.488  1.00 20.61  ? 164 LYS C CG    1 
ATOM   8693  C CD    . LYS C 1 164 ? 5.208   77.295 22.123  1.00 19.54  ? 164 LYS C CD    1 
ATOM   8694  C CE    . LYS C 1 164 ? 6.196   77.510 20.959  1.00 19.60  ? 164 LYS C CE    1 
ATOM   8695  N NZ    . LYS C 1 164 ? 6.621   76.166 20.442  1.00 20.47  ? 164 LYS C NZ    1 
ATOM   8696  N N     . GLY C 1 165 ? 0.611   79.590 25.341  1.00 17.49  ? 165 GLY C N     1 
ATOM   8697  C CA    . GLY C 1 165 ? -0.730  79.141 25.795  1.00 16.87  ? 165 GLY C CA    1 
ATOM   8698  C C     . GLY C 1 165 ? -1.744  80.248 25.590  1.00 17.75  ? 165 GLY C C     1 
ATOM   8699  O O     . GLY C 1 165 ? -2.933  80.105 25.888  1.00 15.99  ? 165 GLY C O     1 
ATOM   8700  N N     . ASP C 1 166 ? -1.311  81.371 25.042  1.00 14.73  ? 166 ASP C N     1 
ATOM   8701  C CA    . ASP C 1 166 ? -2.142  82.528 24.787  1.00 17.12  ? 166 ASP C CA    1 
ATOM   8702  C C     . ASP C 1 166 ? -3.344  82.252 23.879  1.00 15.40  ? 166 ASP C C     1 
ATOM   8703  O O     . ASP C 1 166 ? -3.341  81.358 23.012  1.00 14.01  ? 166 ASP C O     1 
ATOM   8704  C CB    . ASP C 1 166 ? -1.341  83.640 24.097  1.00 19.45  ? 166 ASP C CB    1 
ATOM   8705  C CG    . ASP C 1 166 ? -0.633  84.518 25.081  1.00 22.47  ? 166 ASP C CG    1 
ATOM   8706  O OD1   . ASP C 1 166 ? -0.663  84.174 26.289  1.00 23.48  ? 166 ASP C OD1   1 
ATOM   8707  O OD2   . ASP C 1 166 ? -0.072  85.531 24.635  1.00 23.84  ? 166 ASP C OD2   1 
ATOM   8708  N N     . PHE C 1 167 ? -4.408  82.979 24.185  1.00 16.85  ? 167 PHE C N     1 
ATOM   8709  C CA    . PHE C 1 167 ? -5.589  82.923 23.336  1.00 19.20  ? 167 PHE C CA    1 
ATOM   8710  C C     . PHE C 1 167 ? -5.221  83.704 22.031  1.00 20.89  ? 167 PHE C C     1 
ATOM   8711  O O     . PHE C 1 167 ? -4.604  84.761 22.146  1.00 18.70  ? 167 PHE C O     1 
ATOM   8712  C CB    . PHE C 1 167 ? -6.713  83.760 23.936  1.00 18.97  ? 167 PHE C CB    1 
ATOM   8713  C CG    . PHE C 1 167 ? -7.542  83.156 25.030  1.00 19.80  ? 167 PHE C CG    1 
ATOM   8714  C CD1   . PHE C 1 167 ? -7.055  83.120 26.332  1.00 21.44  ? 167 PHE C CD1   1 
ATOM   8715  C CD2   . PHE C 1 167 ? -8.805  82.673 24.769  1.00 20.09  ? 167 PHE C CD2   1 
ATOM   8716  C CE1   . PHE C 1 167 ? -7.838  82.606 27.365  1.00 20.28  ? 167 PHE C CE1   1 
ATOM   8717  C CE2   . PHE C 1 167 ? -9.567  82.143 25.799  1.00 24.77  ? 167 PHE C CE2   1 
ATOM   8718  C CZ    . PHE C 1 167 ? -9.083  82.110 27.081  1.00 19.02  ? 167 PHE C CZ    1 
ATOM   8719  N N     . ASP C 1 168 ? -5.664  83.238 20.902  1.00 19.75  ? 168 ASP C N     1 
ATOM   8720  C CA    . ASP C 1 168 ? -5.543  84.075 19.676  1.00 19.66  ? 168 ASP C CA    1 
ATOM   8721  C C     . ASP C 1 168 ? -6.628  85.161 19.758  1.00 17.75  ? 168 ASP C C     1 
ATOM   8722  O O     . ASP C 1 168 ? -7.804  84.828 19.613  1.00 18.91  ? 168 ASP C O     1 
ATOM   8723  C CB    . ASP C 1 168 ? -5.819  83.146 18.491  1.00 22.09  ? 168 ASP C CB    1 
ATOM   8724  C CG    . ASP C 1 168 ? -5.738  83.876 17.140  1.00 23.56  ? 168 ASP C CG    1 
ATOM   8725  O OD1   . ASP C 1 168 ? -6.078  85.073 17.081  1.00 24.58  ? 168 ASP C OD1   1 
ATOM   8726  O OD2   . ASP C 1 168 ? -5.335  83.220 16.175  1.00 26.33  ? 168 ASP C OD2   1 
ATOM   8727  N N     . ILE C 1 169 ? -6.326  86.409 20.044  1.00 17.69  ? 169 ILE C N     1 
ATOM   8728  C CA    . ILE C 1 169 ? -7.303  87.455 20.247  1.00 25.23  ? 169 ILE C CA    1 
ATOM   8729  C C     . ILE C 1 169 ? -8.174  87.736 19.023  1.00 31.59  ? 169 ILE C C     1 
ATOM   8730  O O     . ILE C 1 169 ? -9.375  88.072 19.150  1.00 29.72  ? 169 ILE C O     1 
ATOM   8731  C CB    . ILE C 1 169 ? -6.636  88.735 20.744  1.00 24.03  ? 169 ILE C CB    1 
ATOM   8732  C CG1   . ILE C 1 169 ? -5.954  88.463 22.093  1.00 33.78  ? 169 ILE C CG1   1 
ATOM   8733  C CG2   . ILE C 1 169 ? -7.620  89.881 20.883  1.00 26.56  ? 169 ILE C CG2   1 
ATOM   8734  C CD1   . ILE C 1 169 ? -6.909  88.139 23.239  1.00 26.07  ? 169 ILE C CD1   1 
ATOM   8735  N N     . LYS C 1 170 ? -7.589  87.513 17.842  1.00 30.31  ? 170 LYS C N     1 
ATOM   8736  C CA    . LYS C 1 170 ? -8.344  87.731 16.617  1.00 33.35  ? 170 LYS C CA    1 
ATOM   8737  C C     . LYS C 1 170 ? -9.446  86.685 16.556  1.00 31.48  ? 170 LYS C C     1 
ATOM   8738  O O     . LYS C 1 170 ? -10.607 87.050 16.323  1.00 28.44  ? 170 LYS C O     1 
ATOM   8739  C CB    . LYS C 1 170 ? -7.482  87.680 15.362  1.00 43.73  ? 170 LYS C CB    1 
ATOM   8740  C CG    . LYS C 1 170 ? -6.899  88.997 14.907  1.00 63.90  ? 170 LYS C CG    1 
ATOM   8741  C CD    . LYS C 1 170 ? -6.255  89.845 15.977  1.00 75.57  ? 170 LYS C CD    1 
ATOM   8742  C CE    . LYS C 1 170 ? -5.022  89.240 16.617  1.00 82.51  ? 170 LYS C CE    1 
ATOM   8743  N NZ    . LYS C 1 170 ? -4.651  89.971 17.869  1.00 84.49  ? 170 LYS C NZ    1 
ATOM   8744  N N     . LYS C 1 171 ? -9.067  85.421 16.756  1.00 25.56  ? 171 LYS C N     1 
ATOM   8745  C CA    . LYS C 1 171 ? -10.095 84.379 16.741  1.00 27.20  ? 171 LYS C CA    1 
ATOM   8746  C C     . LYS C 1 171 ? -11.156 84.586 17.824  1.00 27.21  ? 171 LYS C C     1 
ATOM   8747  O O     . LYS C 1 171 ? -12.308 84.194 17.624  1.00 30.15  ? 171 LYS C O     1 
ATOM   8748  C CB    . LYS C 1 171 ? -9.481  82.981 16.860  1.00 27.03  ? 171 LYS C CB    1 
ATOM   8749  C CG    . LYS C 1 171 ? -8.738  82.534 15.616  1.00 33.97  ? 171 LYS C CG    1 
ATOM   8750  C CD    . LYS C 1 171 ? -8.601  81.028 15.535  1.00 36.98  ? 171 LYS C CD    1 
ATOM   8751  C CE    . LYS C 1 171 ? -7.425  80.624 14.643  1.00 46.85  ? 171 LYS C CE    1 
ATOM   8752  N NZ    . LYS C 1 171 ? -6.136  80.535 15.413  1.00 65.87  ? 171 LYS C NZ    1 
ATOM   8753  N N     . LEU C 1 172 ? -10.791 85.152 18.989  1.00 25.54  ? 172 LEU C N     1 
ATOM   8754  C CA    . LEU C 1 172 ? -11.786 85.405 20.024  1.00 26.10  ? 172 LEU C CA    1 
ATOM   8755  C C     . LEU C 1 172 ? -12.849 86.400 19.519  1.00 28.03  ? 172 LEU C C     1 
ATOM   8756  O O     . LEU C 1 172 ? -14.048 86.176 19.650  1.00 24.82  ? 172 LEU C O     1 
ATOM   8757  C CB    . LEU C 1 172 ? -11.159 85.991 21.281  1.00 16.55  ? 172 LEU C CB    1 
ATOM   8758  C CG    . LEU C 1 172 ? -12.168 86.334 22.413  1.00 24.91  ? 172 LEU C CG    1 
ATOM   8759  C CD1   . LEU C 1 172 ? -12.943 85.092 22.812  1.00 21.08  ? 172 LEU C CD1   1 
ATOM   8760  C CD2   . LEU C 1 172 ? -11.414 86.939 23.578  1.00 18.37  ? 172 LEU C CD2   1 
ATOM   8761  N N     . LYS C 1 173 ? -12.412 87.547 19.016  1.00 27.72  ? 173 LYS C N     1 
ATOM   8762  C CA    . LYS C 1 173 ? -13.312 88.564 18.452  1.00 30.73  ? 173 LYS C CA    1 
ATOM   8763  C C     . LYS C 1 173 ? -14.159 88.009 17.306  1.00 30.80  ? 173 LYS C C     1 
ATOM   8764  O O     . LYS C 1 173 ? -15.385 88.206 17.291  1.00 31.09  ? 173 LYS C O     1 
ATOM   8765  C CB    . LYS C 1 173 ? -12.523 89.772 17.979  1.00 31.75  ? 173 LYS C CB    1 
ATOM   8766  C CG    . LYS C 1 173 ? -11.982 90.605 19.126  1.00 34.69  ? 173 LYS C CG    1 
ATOM   8767  C CD    . LYS C 1 173 ? -10.934 91.582 18.611  1.00 40.91  ? 173 LYS C CD    1 
ATOM   8768  C CE    . LYS C 1 173 ? -10.996 92.854 19.427  1.00 45.18  ? 173 LYS C CE    1 
ATOM   8769  N NZ    . LYS C 1 173 ? -9.701  93.584 19.430  1.00 59.66  ? 173 LYS C NZ    1 
ATOM   8770  N N     . GLU C 1 174 ? -13.580 87.191 16.436  1.00 27.75  ? 174 GLU C N     1 
ATOM   8771  C CA    . GLU C 1 174 ? -14.330 86.570 15.372  1.00 32.29  ? 174 GLU C CA    1 
ATOM   8772  C C     . GLU C 1 174 ? -15.392 85.628 15.920  1.00 36.38  ? 174 GLU C C     1 
ATOM   8773  O O     . GLU C 1 174 ? -16.532 85.605 15.410  1.00 34.77  ? 174 GLU C O     1 
ATOM   8774  C CB    . GLU C 1 174 ? -13.461 85.769 14.388  1.00 34.53  ? 174 GLU C CB    1 
ATOM   8775  C CG    . GLU C 1 174 ? -12.590 86.705 13.562  1.00 56.13  ? 174 GLU C CG    1 
ATOM   8776  C CD    . GLU C 1 174 ? -11.504 86.024 12.756  1.00 65.84  ? 174 GLU C CD    1 
ATOM   8777  O OE1   . GLU C 1 174 ? -11.370 84.779 12.821  1.00 71.70  ? 174 GLU C OE1   1 
ATOM   8778  O OE2   . GLU C 1 174 ? -10.774 86.761 12.049  1.00 70.93  ? 174 GLU C OE2   1 
ATOM   8779  N N     . ASN C 1 175 ? -15.035 84.819 16.927  1.00 31.74  ? 175 ASN C N     1 
ATOM   8780  C CA    . ASN C 1 175 ? -16.039 83.904 17.456  1.00 26.76  ? 175 ASN C CA    1 
ATOM   8781  C C     . ASN C 1 175 ? -17.172 84.652 18.127  1.00 23.26  ? 175 ASN C C     1 
ATOM   8782  O O     . ASN C 1 175 ? -18.320 84.237 18.079  1.00 27.44  ? 175 ASN C O     1 
ATOM   8783  C CB    . ASN C 1 175 ? -15.375 82.916 18.432  1.00 29.69  ? 175 ASN C CB    1 
ATOM   8784  C CG    . ASN C 1 175 ? -14.949 81.722 17.596  1.00 26.94  ? 175 ASN C CG    1 
ATOM   8785  O OD1   . ASN C 1 175 ? -15.743 80.806 17.446  1.00 32.23  ? 175 ASN C OD1   1 
ATOM   8786  N ND2   . ASN C 1 175 ? -13.734 81.841 17.074  1.00 28.38  ? 175 ASN C ND2   1 
ATOM   8787  N N     . ILE C 1 176 ? -16.871 85.749 18.797  1.00 22.94  ? 176 ILE C N     1 
ATOM   8788  C CA    . ILE C 1 176 ? -17.919 86.515 19.483  1.00 27.86  ? 176 ILE C CA    1 
ATOM   8789  C C     . ILE C 1 176 ? -18.903 87.074 18.463  1.00 34.37  ? 176 ILE C C     1 
ATOM   8790  O O     . ILE C 1 176 ? -20.112 87.048 18.701  1.00 33.82  ? 176 ILE C O     1 
ATOM   8791  C CB    . ILE C 1 176 ? -17.304 87.636 20.328  1.00 29.17  ? 176 ILE C CB    1 
ATOM   8792  C CG1   . ILE C 1 176 ? -16.506 87.008 21.478  1.00 30.86  ? 176 ILE C CG1   1 
ATOM   8793  C CG2   . ILE C 1 176 ? -18.379 88.569 20.896  1.00 28.14  ? 176 ILE C CG2   1 
ATOM   8794  C CD1   . ILE C 1 176 ? -15.890 88.029 22.421  1.00 25.27  ? 176 ILE C CD1   1 
ATOM   8795  N N     . ALA C 1 177 ? -18.372 87.584 17.335  1.00 33.64  ? 177 ALA C N     1 
ATOM   8796  C CA    . ALA C 1 177 ? -19.217 88.137 16.290  1.00 35.05  ? 177 ALA C CA    1 
ATOM   8797  C C     . ALA C 1 177 ? -19.997 87.023 15.622  1.00 32.83  ? 177 ALA C C     1 
ATOM   8798  O O     . ALA C 1 177 ? -21.199 87.207 15.443  1.00 36.26  ? 177 ALA C O     1 
ATOM   8799  C CB    . ALA C 1 177 ? -18.418 88.902 15.252  1.00 35.73  ? 177 ALA C CB    1 
ATOM   8800  N N     . GLN C 1 178 ? -19.368 85.892 15.338  1.00 30.21  ? 178 GLN C N     1 
ATOM   8801  C CA    . GLN C 1 178 ? -20.063 84.805 14.674  1.00 32.19  ? 178 GLN C CA    1 
ATOM   8802  C C     . GLN C 1 178 ? -21.143 84.140 15.507  1.00 37.99  ? 178 GLN C C     1 
ATOM   8803  O O     . GLN C 1 178 ? -22.184 83.757 14.959  1.00 37.88  ? 178 GLN C O     1 
ATOM   8804  C CB    . GLN C 1 178 ? -19.039 83.753 14.214  1.00 30.60  ? 178 GLN C CB    1 
ATOM   8805  C CG    . GLN C 1 178 ? -19.645 82.502 13.605  1.00 46.05  ? 178 GLN C CG    1 
ATOM   8806  C CD    . GLN C 1 178 ? -18.695 81.327 13.480  1.00 57.16  ? 178 GLN C CD    1 
ATOM   8807  O OE1   . GLN C 1 178 ? -17.468 81.474 13.438  1.00 65.48  ? 178 GLN C OE1   1 
ATOM   8808  N NE2   . GLN C 1 178 ? -19.235 80.106 13.418  1.00 61.23  ? 178 GLN C NE2   1 
ATOM   8809  N N     . HIS C 1 179 ? -20.895 83.869 16.797  1.00 34.58  ? 179 HIS C N     1 
ATOM   8810  C CA    . HIS C 1 179 ? -21.881 83.177 17.598  1.00 30.25  ? 179 HIS C CA    1 
ATOM   8811  C C     . HIS C 1 179 ? -22.771 84.164 18.344  1.00 28.04  ? 179 HIS C C     1 
ATOM   8812  O O     . HIS C 1 179 ? -23.904 83.799 18.645  1.00 30.47  ? 179 HIS C O     1 
ATOM   8813  C CB    . HIS C 1 179 ? -21.235 82.241 18.637  1.00 27.39  ? 179 HIS C CB    1 
ATOM   8814  C CG    . HIS C 1 179 ? -20.522 81.109 17.966  1.00 24.16  ? 179 HIS C CG    1 
ATOM   8815  N ND1   . HIS C 1 179 ? -21.153 79.929 17.616  1.00 26.07  ? 179 HIS C ND1   1 
ATOM   8816  C CD2   . HIS C 1 179 ? -19.213 81.005 17.596  1.00 23.88  ? 179 HIS C CD2   1 
ATOM   8817  C CE1   . HIS C 1 179 ? -20.263 79.123 17.033  1.00 24.08  ? 179 HIS C CE1   1 
ATOM   8818  N NE2   . HIS C 1 179 ? -19.087 79.763 17.022  1.00 23.36  ? 179 HIS C NE2   1 
ATOM   8819  N N     . GLY C 1 180 ? -22.263 85.353 18.619  1.00 26.88  ? 180 GLY C N     1 
ATOM   8820  C CA    . GLY C 1 180 ? -23.023 86.327 19.389  1.00 25.63  ? 180 GLY C CA    1 
ATOM   8821  C C     . GLY C 1 180 ? -22.657 86.144 20.865  1.00 27.76  ? 180 GLY C C     1 
ATOM   8822  O O     . GLY C 1 180 ? -22.665 85.018 21.351  1.00 29.88  ? 180 GLY C O     1 
ATOM   8823  N N     . ALA C 1 181 ? -22.443 87.216 21.604  1.00 27.63  ? 181 ALA C N     1 
ATOM   8824  C CA    . ALA C 1 181 ? -22.196 87.182 23.035  1.00 32.22  ? 181 ALA C CA    1 
ATOM   8825  C C     . ALA C 1 181 ? -23.315 86.496 23.805  1.00 35.51  ? 181 ALA C C     1 
ATOM   8826  O O     . ALA C 1 181 ? -23.036 85.828 24.806  1.00 34.23  ? 181 ALA C O     1 
ATOM   8827  C CB    . ALA C 1 181 ? -22.023 88.575 23.636  1.00 27.06  ? 181 ALA C CB    1 
ATOM   8828  N N     . ASP C 1 182 ? -24.565 86.580 23.368  1.00 32.87  ? 182 ASP C N     1 
ATOM   8829  C CA    . ASP C 1 182 ? -25.689 85.905 23.955  1.00 30.65  ? 182 ASP C CA    1 
ATOM   8830  C C     . ASP C 1 182 ? -25.498 84.397 23.937  1.00 26.19  ? 182 ASP C C     1 
ATOM   8831  O O     . ASP C 1 182 ? -26.050 83.733 24.811  1.00 28.92  ? 182 ASP C O     1 
ATOM   8832  C CB    . ASP C 1 182 ? -26.996 86.219 23.199  1.00 45.49  ? 182 ASP C CB    1 
ATOM   8833  C CG    . ASP C 1 182 ? -27.527 87.588 23.546  1.00 53.81  ? 182 ASP C CG    1 
ATOM   8834  O OD1   . ASP C 1 182 ? -26.930 88.289 24.397  1.00 63.69  ? 182 ASP C OD1   1 
ATOM   8835  O OD2   . ASP C 1 182 ? -28.559 87.974 22.949  1.00 70.44  ? 182 ASP C OD2   1 
ATOM   8836  N N     . ASN C 1 183 ? -24.771 83.849 22.975  1.00 19.70  ? 183 ASN C N     1 
ATOM   8837  C CA    . ASN C 1 183 ? -24.590 82.408 22.953  1.00 23.48  ? 183 ASN C CA    1 
ATOM   8838  C C     . ASN C 1 183 ? -23.309 81.939 23.665  1.00 19.92  ? 183 ASN C C     1 
ATOM   8839  O O     . ASN C 1 183 ? -23.053 80.731 23.708  1.00 22.77  ? 183 ASN C O     1 
ATOM   8840  C CB    . ASN C 1 183 ? -24.559 81.901 21.504  1.00 26.36  ? 183 ASN C CB    1 
ATOM   8841  C CG    . ASN C 1 183 ? -25.976 81.941 20.940  1.00 41.36  ? 183 ASN C CG    1 
ATOM   8842  O OD1   . ASN C 1 183 ? -26.879 81.390 21.564  1.00 30.32  ? 183 ASN C OD1   1 
ATOM   8843  N ND2   . ASN C 1 183 ? -26.076 82.591 19.790  1.00 33.49  ? 183 ASN C ND2   1 
ATOM   8844  N N     . ILE C 1 184 ? -22.485 82.855 24.118  1.00 19.94  ? 184 ILE C N     1 
ATOM   8845  C CA    . ILE C 1 184 ? -21.240 82.427 24.795  1.00 22.18  ? 184 ILE C CA    1 
ATOM   8846  C C     . ILE C 1 184 ? -21.520 82.275 26.298  1.00 16.09  ? 184 ILE C C     1 
ATOM   8847  O O     . ILE C 1 184 ? -21.659 83.262 26.987  1.00 17.95  ? 184 ILE C O     1 
ATOM   8848  C CB    . ILE C 1 184 ? -20.087 83.406 24.617  1.00 24.39  ? 184 ILE C CB    1 
ATOM   8849  C CG1   . ILE C 1 184 ? -19.913 83.972 23.199  1.00 27.70  ? 184 ILE C CG1   1 
ATOM   8850  C CG2   . ILE C 1 184 ? -18.760 82.778 25.045  1.00 23.94  ? 184 ILE C CG2   1 
ATOM   8851  C CD1   . ILE C 1 184 ? -19.675 82.994 22.100  1.00 28.06  ? 184 ILE C CD1   1 
ATOM   8852  N N     . VAL C 1 185 ? -21.636 81.038 26.744  1.00 18.93  ? 185 VAL C N     1 
ATOM   8853  C CA    . VAL C 1 185 ? -21.914 80.731 28.155  1.00 20.34  ? 185 VAL C CA    1 
ATOM   8854  C C     . VAL C 1 185 ? -20.806 81.232 29.070  1.00 17.93  ? 185 VAL C C     1 
ATOM   8855  O O     . VAL C 1 185 ? -20.966 81.976 30.025  1.00 16.51  ? 185 VAL C O     1 
ATOM   8856  C CB    . VAL C 1 185 ? -22.120 79.231 28.331  1.00 24.11  ? 185 VAL C CB    1 
ATOM   8857  C CG1   . VAL C 1 185 ? -22.477 78.895 29.783  1.00 22.25  ? 185 VAL C CG1   1 
ATOM   8858  C CG2   . VAL C 1 185 ? -23.254 78.801 27.411  1.00 22.70  ? 185 VAL C CG2   1 
ATOM   8859  N N     . ALA C 1 186 ? -19.571 80.965 28.609  1.00 20.52  ? 186 ALA C N     1 
ATOM   8860  C CA    . ALA C 1 186 ? -18.412 81.481 29.329  1.00 22.26  ? 186 ALA C CA    1 
ATOM   8861  C C     . ALA C 1 186 ? -17.148 81.339 28.478  1.00 17.73  ? 186 ALA C C     1 
ATOM   8862  O O     . ALA C 1 186 ? -17.053 80.541 27.543  1.00 18.28  ? 186 ALA C O     1 
ATOM   8863  C CB    . ALA C 1 186 ? -18.200 80.685 30.622  1.00 18.56  ? 186 ALA C CB    1 
ATOM   8864  N N     . ILE C 1 187 ? -16.167 82.122 28.911  1.00 17.23  ? 187 ILE C N     1 
ATOM   8865  C CA    . ILE C 1 187 ? -14.829 81.909 28.363  1.00 18.57  ? 187 ILE C CA    1 
ATOM   8866  C C     . ILE C 1 187 ? -14.064 81.155 29.465  1.00 19.02  ? 187 ILE C C     1 
ATOM   8867  O O     . ILE C 1 187 ? -14.109 81.539 30.626  1.00 16.64  ? 187 ILE C O     1 
ATOM   8868  C CB    . ILE C 1 187 ? -14.158 83.236 28.014  1.00 24.48  ? 187 ILE C CB    1 
ATOM   8869  C CG1   . ILE C 1 187 ? -14.757 83.798 26.701  1.00 21.43  ? 187 ILE C CG1   1 
ATOM   8870  C CG2   . ILE C 1 187 ? -12.646 83.065 27.887  1.00 21.25  ? 187 ILE C CG2   1 
ATOM   8871  C CD1   . ILE C 1 187 ? -14.498 85.276 26.560  1.00 23.31  ? 187 ILE C CD1   1 
ATOM   8872  N N     . VAL C 1 188 ? -13.363 80.098 29.119  1.00 18.35  ? 188 VAL C N     1 
ATOM   8873  C CA    . VAL C 1 188 ? -12.534 79.340 30.044  1.00 18.85  ? 188 VAL C CA    1 
ATOM   8874  C C     . VAL C 1 188 ? -11.046 79.588 29.776  1.00 17.83  ? 188 VAL C C     1 
ATOM   8875  O O     . VAL C 1 188 ? -10.550 79.130 28.739  1.00 16.87  ? 188 VAL C O     1 
ATOM   8876  C CB    . VAL C 1 188 ? -12.781 77.835 29.910  1.00 19.28  ? 188 VAL C CB    1 
ATOM   8877  C CG1   . VAL C 1 188 ? -11.896 77.065 30.881  1.00 16.39  ? 188 VAL C CG1   1 
ATOM   8878  C CG2   . VAL C 1 188 ? -14.247 77.506 30.124  1.00 18.22  ? 188 VAL C CG2   1 
ATOM   8879  N N     . SER C 1 189 ? -10.392 80.323 30.666  1.00 16.70  ? 189 SER C N     1 
ATOM   8880  C CA    . SER C 1 189 ? -8.951  80.556 30.525  1.00 16.83  ? 189 SER C CA    1 
ATOM   8881  C C     . SER C 1 189 ? -8.175  79.418 31.227  1.00 17.83  ? 189 SER C C     1 
ATOM   8882  O O     . SER C 1 189 ? -8.214  79.315 32.462  1.00 14.86  ? 189 SER C O     1 
ATOM   8883  C CB    . SER C 1 189 ? -8.526  81.846 31.191  1.00 15.41  ? 189 SER C CB    1 
ATOM   8884  O OG    . SER C 1 189 ? -9.179  82.996 30.698  1.00 22.61  ? 189 SER C OG    1 
ATOM   8885  N N     . THR C 1 190 ? -7.551  78.543 30.479  1.00 12.53  ? 190 THR C N     1 
ATOM   8886  C CA    . THR C 1 190 ? -6.772  77.456 31.032  1.00 15.92  ? 190 THR C CA    1 
ATOM   8887  C C     . THR C 1 190 ? -5.332  77.817 31.306  1.00 18.68  ? 190 THR C C     1 
ATOM   8888  O O     . THR C 1 190 ? -4.573  78.141 30.369  1.00 14.20  ? 190 THR C O     1 
ATOM   8889  C CB    . THR C 1 190 ? -6.879  76.262 30.088  1.00 14.88  ? 190 THR C CB    1 
ATOM   8890  O OG1   . THR C 1 190 ? -8.294  76.064 29.840  1.00 17.59  ? 190 THR C OG1   1 
ATOM   8891  C CG2   . THR C 1 190 ? -6.337  75.022 30.806  1.00 13.21  ? 190 THR C CG2   1 
ATOM   8892  N N     . VAL C 1 191 ? -4.968  77.875 32.602  1.00 14.15  ? 191 VAL C N     1 
ATOM   8893  C CA    . VAL C 1 191 ? -3.582  78.229 32.987  1.00 15.37  ? 191 VAL C CA    1 
ATOM   8894  C C     . VAL C 1 191 ? -2.912  77.123 33.782  1.00 19.44  ? 191 VAL C C     1 
ATOM   8895  O O     . VAL C 1 191 ? -3.462  76.561 34.727  1.00 13.31  ? 191 VAL C O     1 
ATOM   8896  C CB    . VAL C 1 191 ? -3.570  79.520 33.807  1.00 17.62  ? 191 VAL C CB    1 
ATOM   8897  C CG1   . VAL C 1 191 ? -3.996  80.692 32.920  1.00 14.85  ? 191 VAL C CG1   1 
ATOM   8898  C CG2   . VAL C 1 191 ? -4.477  79.449 35.053  1.00 8.97   ? 191 VAL C CG2   1 
ATOM   8899  N N     . THR C 1 192 ? -1.718  76.699 33.403  1.00 16.52  ? 192 THR C N     1 
ATOM   8900  C CA    . THR C 1 192 ? -1.051  76.909 32.160  1.00 15.04  ? 192 THR C CA    1 
ATOM   8901  C C     . THR C 1 192 ? -1.939  76.213 31.112  1.00 13.67  ? 192 THR C C     1 
ATOM   8902  O O     . THR C 1 192 ? -2.899  75.533 31.499  1.00 13.30  ? 192 THR C O     1 
ATOM   8903  C CB    . THR C 1 192 ? 0.298   76.136 32.071  1.00 11.84  ? 192 THR C CB    1 
ATOM   8904  O OG1   . THR C 1 192 ? 0.038   74.751 32.420  1.00 11.54  ? 192 THR C OG1   1 
ATOM   8905  C CG2   . THR C 1 192 ? 1.345   76.763 32.956  1.00 7.89   ? 192 THR C CG2   1 
ATOM   8906  N N     . CYS C 1 193 ? -1.678  76.404 29.827  1.00 17.09  ? 193 CYS C N     1 
ATOM   8907  C CA    . CYS C 1 193 ? -2.519  75.780 28.777  1.00 12.90  ? 193 CYS C CA    1 
ATOM   8908  C C     . CYS C 1 193 ? -2.043  74.378 28.544  1.00 17.71  ? 193 CYS C C     1 
ATOM   8909  O O     . CYS C 1 193 ? -1.047  74.019 27.893  1.00 16.38  ? 193 CYS C O     1 
ATOM   8910  C CB    . CYS C 1 193 ? -2.514  76.609 27.491  1.00 18.82  ? 193 CYS C CB    1 
ATOM   8911  S SG    . CYS C 1 193 ? -3.575  75.839 26.232  1.00 20.19  ? 193 CYS C SG    1 
ATOM   8912  N N     . ASN C 1 194 ? -2.771  73.488 29.229  1.00 19.74  ? 194 ASN C N     1 
ATOM   8913  C CA    . ASN C 1 194 ? -2.417  72.091 29.329  1.00 21.30  ? 194 ASN C CA    1 
ATOM   8914  C C     . ASN C 1 194 ? -2.256  71.402 27.982  1.00 24.74  ? 194 ASN C C     1 
ATOM   8915  O O     . ASN C 1 194 ? -1.257  70.726 27.723  1.00 20.95  ? 194 ASN C O     1 
ATOM   8916  C CB    . ASN C 1 194 ? -3.531  71.346 30.124  1.00 30.03  ? 194 ASN C CB    1 
ATOM   8917  C CG    . ASN C 1 194 ? -3.176  69.869 30.173  1.00 41.15  ? 194 ASN C CG    1 
ATOM   8918  O OD1   . ASN C 1 194 ? -2.117  69.459 30.642  1.00 47.36  ? 194 ASN C OD1   1 
ATOM   8919  N ND2   . ASN C 1 194 ? -4.015  69.033 29.603  1.00 57.33  ? 194 ASN C ND2   1 
ATOM   8920  N N     . SER C 1 195 ? -3.327  71.476 27.176  1.00 25.43  ? 195 SER C N     1 
ATOM   8921  C CA    . SER C 1 195 ? -3.351  70.783 25.885  1.00 29.62  ? 195 SER C CA    1 
ATOM   8922  C C     . SER C 1 195 ? -2.362  71.339 24.878  1.00 28.95  ? 195 SER C C     1 
ATOM   8923  O O     . SER C 1 195 ? -1.979  70.553 24.016  1.00 33.04  ? 195 SER C O     1 
ATOM   8924  C CB    . SER C 1 195 ? -4.758  70.725 25.297  1.00 32.17  ? 195 SER C CB    1 
ATOM   8925  O OG    . SER C 1 195 ? -5.637  70.232 26.294  1.00 32.95  ? 195 SER C OG    1 
ATOM   8926  N N     . ALA C 1 196 ? -1.862  72.546 25.018  1.00 27.56  ? 196 ALA C N     1 
ATOM   8927  C CA    . ALA C 1 196 ? -0.797  73.053 24.170  1.00 28.64  ? 196 ALA C CA    1 
ATOM   8928  C C     . ALA C 1 196 ? 0.588   72.676 24.731  1.00 28.45  ? 196 ALA C C     1 
ATOM   8929  O O     . ALA C 1 196 ? 1.585   73.209 24.261  1.00 31.28  ? 196 ALA C O     1 
ATOM   8930  C CB    . ALA C 1 196 ? -0.871  74.555 24.016  1.00 25.86  ? 196 ALA C CB    1 
ATOM   8931  N N     . GLY C 1 197 ? 0.683   71.768 25.693  1.00 24.07  ? 197 GLY C N     1 
ATOM   8932  C CA    . GLY C 1 197 ? 1.933   71.312 26.250  1.00 22.88  ? 197 GLY C CA    1 
ATOM   8933  C C     . GLY C 1 197 ? 2.298   71.990 27.555  1.00 23.63  ? 197 GLY C C     1 
ATOM   8934  O O     . GLY C 1 197 ? 3.486   72.074 27.854  1.00 27.97  ? 197 GLY C O     1 
ATOM   8935  N N     . GLY C 1 198 ? 1.337   72.481 28.323  1.00 20.07  ? 198 GLY C N     1 
ATOM   8936  C CA    . GLY C 1 198 ? 1.635   73.138 29.592  1.00 15.01  ? 198 GLY C CA    1 
ATOM   8937  C C     . GLY C 1 198 ? 2.282   74.486 29.386  1.00 18.66  ? 198 GLY C C     1 
ATOM   8938  O O     . GLY C 1 198 ? 3.099   74.913 30.214  1.00 12.62  ? 198 GLY C O     1 
ATOM   8939  N N     . GLN C 1 199 ? 1.921   75.162 28.290  1.00 15.69  ? 199 GLN C N     1 
ATOM   8940  C CA    . GLN C 1 199 ? 2.502   76.482 27.985  1.00 14.76  ? 199 GLN C CA    1 
ATOM   8941  C C     . GLN C 1 199 ? 1.759   77.592 28.694  1.00 12.91  ? 199 GLN C C     1 
ATOM   8942  O O     . GLN C 1 199 ? 0.543   77.556 28.780  1.00 15.24  ? 199 GLN C O     1 
ATOM   8943  C CB    . GLN C 1 199 ? 2.524   76.637 26.476  1.00 13.14  ? 199 GLN C CB    1 
ATOM   8944  C CG    . GLN C 1 199 ? 3.189   75.460 25.726  1.00 12.12  ? 199 GLN C CG    1 
ATOM   8945  C CD    . GLN C 1 199 ? 4.716   75.539 25.964  1.00 14.61  ? 199 GLN C CD    1 
ATOM   8946  O OE1   . GLN C 1 199 ? 5.250   76.622 26.110  1.00 15.58  ? 199 GLN C OE1   1 
ATOM   8947  N NE2   . GLN C 1 199 ? 5.379   74.400 26.061  1.00 17.24  ? 199 GLN C NE2   1 
ATOM   8948  N N     . PRO C 1 200 ? 2.463   78.605 29.187  1.00 12.60  ? 200 PRO C N     1 
ATOM   8949  C CA    . PRO C 1 200 ? 1.902   79.678 29.938  1.00 13.31  ? 200 PRO C CA    1 
ATOM   8950  C C     . PRO C 1 200 ? 1.070   80.640 29.093  1.00 20.25  ? 200 PRO C C     1 
ATOM   8951  O O     . PRO C 1 200 ? 1.319   80.837 27.898  1.00 17.68  ? 200 PRO C O     1 
ATOM   8952  C CB    . PRO C 1 200 ? 3.087   80.466 30.491  1.00 10.74  ? 200 PRO C CB    1 
ATOM   8953  C CG    . PRO C 1 200 ? 4.234   80.055 29.640  1.00 11.22  ? 200 PRO C CG    1 
ATOM   8954  C CD    . PRO C 1 200 ? 3.957   78.715 29.089  1.00 11.85  ? 200 PRO C CD    1 
ATOM   8955  N N     . VAL C 1 201 ? 0.124   81.274 29.795  1.00 15.10  ? 201 VAL C N     1 
ATOM   8956  C CA    . VAL C 1 201 ? -0.682  82.321 29.203  1.00 15.77  ? 201 VAL C CA    1 
ATOM   8957  C C     . VAL C 1 201 ? -0.122  83.584 29.847  1.00 17.57  ? 201 VAL C C     1 
ATOM   8958  O O     . VAL C 1 201 ? 0.059   83.610 31.064  1.00 15.66  ? 201 VAL C O     1 
ATOM   8959  C CB    . VAL C 1 201 ? -2.180  82.153 29.514  1.00 15.04  ? 201 VAL C CB    1 
ATOM   8960  C CG1   . VAL C 1 201 ? -3.005  83.230 28.843  1.00 13.86  ? 201 VAL C CG1   1 
ATOM   8961  C CG2   . VAL C 1 201 ? -2.657  80.767 29.113  1.00 8.46   ? 201 VAL C CG2   1 
ATOM   8962  N N     . SER C 1 202 ? 0.202   84.606 29.066  1.00 13.20  ? 202 SER C N     1 
ATOM   8963  C CA    . SER C 1 202 ? 0.752   85.820 29.661  1.00 14.34  ? 202 SER C CA    1 
ATOM   8964  C C     . SER C 1 202 ? -0.297  86.615 30.417  1.00 15.56  ? 202 SER C C     1 
ATOM   8965  O O     . SER C 1 202 ? -1.497  86.529 30.117  1.00 17.09  ? 202 SER C O     1 
ATOM   8966  C CB    . SER C 1 202 ? 1.361   86.720 28.565  1.00 21.51  ? 202 SER C CB    1 
ATOM   8967  O OG    . SER C 1 202 ? 0.310   87.262 27.815  1.00 20.86  ? 202 SER C OG    1 
ATOM   8968  N N     . MET C 1 203 ? 0.153   87.495 31.306  1.00 12.32  ? 203 MET C N     1 
ATOM   8969  C CA    . MET C 1 203 ? -0.747  88.344 32.035  1.00 15.92  ? 203 MET C CA    1 
ATOM   8970  C C     . MET C 1 203 ? -1.540  89.258 31.098  1.00 22.98  ? 203 MET C C     1 
ATOM   8971  O O     . MET C 1 203 ? -2.700  89.605 31.370  1.00 18.44  ? 203 MET C O     1 
ATOM   8972  C CB    . MET C 1 203 ? 0.001   89.224 33.022  1.00 12.12  ? 203 MET C CB    1 
ATOM   8973  C CG    . MET C 1 203 ? -0.914  89.969 33.999  1.00 20.03  ? 203 MET C CG    1 
ATOM   8974  S SD    . MET C 1 203 ? -1.698  88.789 35.163  1.00 20.72  ? 203 MET C SD    1 
ATOM   8975  C CE    . MET C 1 203 ? -0.386  88.612 36.370  1.00 19.93  ? 203 MET C CE    1 
ATOM   8976  N N     . SER C 1 204 ? -0.861  89.783 30.065  1.00 20.70  ? 204 SER C N     1 
ATOM   8977  C CA    . SER C 1 204 ? -1.523  90.784 29.208  1.00 22.51  ? 204 SER C CA    1 
ATOM   8978  C C     . SER C 1 204 ? -2.568  90.091 28.376  1.00 16.24  ? 204 SER C C     1 
ATOM   8979  O O     . SER C 1 204 ? -3.627  90.655 28.130  1.00 19.39  ? 204 SER C O     1 
ATOM   8980  C CB    . SER C 1 204 ? -0.468  91.543 28.379  1.00 22.76  ? 204 SER C CB    1 
ATOM   8981  O OG    . SER C 1 204 ? 0.078   90.626 27.434  1.00 34.41  ? 204 SER C OG    1 
ATOM   8982  N N     . ASN C 1 205 ? -2.328  88.855 27.969  1.00 15.98  ? 205 ASN C N     1 
ATOM   8983  C CA    . ASN C 1 205 ? -3.346  88.089 27.254  1.00 16.30  ? 205 ASN C CA    1 
ATOM   8984  C C     . ASN C 1 205 ? -4.531  87.795 28.181  1.00 24.98  ? 205 ASN C C     1 
ATOM   8985  O O     . ASN C 1 205 ? -5.704  88.011 27.830  1.00 20.46  ? 205 ASN C O     1 
ATOM   8986  C CB    . ASN C 1 205 ? -2.737  86.794 26.747  1.00 15.87  ? 205 ASN C CB    1 
ATOM   8987  C CG    . ASN C 1 205 ? -3.627  86.044 25.812  1.00 22.22  ? 205 ASN C CG    1 
ATOM   8988  O OD1   . ASN C 1 205 ? -4.124  84.970 26.115  1.00 21.34  ? 205 ASN C OD1   1 
ATOM   8989  N ND2   . ASN C 1 205 ? -3.800  86.603 24.605  1.00 22.57  ? 205 ASN C ND2   1 
ATOM   8990  N N     . LEU C 1 206 ? -4.270  87.349 29.430  1.00 21.59  ? 206 LEU C N     1 
ATOM   8991  C CA    . LEU C 1 206 ? -5.382  87.145 30.358  1.00 19.55  ? 206 LEU C CA    1 
ATOM   8992  C C     . LEU C 1 206 ? -6.199  88.431 30.503  1.00 18.20  ? 206 LEU C C     1 
ATOM   8993  O O     . LEU C 1 206 ? -7.413  88.373 30.517  1.00 16.70  ? 206 LEU C O     1 
ATOM   8994  C CB    . LEU C 1 206 ? -4.940  86.748 31.783  1.00 12.48  ? 206 LEU C CB    1 
ATOM   8995  C CG    . LEU C 1 206 ? -4.302  85.346 31.842  1.00 14.81  ? 206 LEU C CG    1 
ATOM   8996  C CD1   . LEU C 1 206 ? -3.595  85.120 33.168  1.00 16.76  ? 206 LEU C CD1   1 
ATOM   8997  C CD2   . LEU C 1 206 ? -5.348  84.276 31.566  1.00 15.69  ? 206 LEU C CD2   1 
ATOM   8998  N N     . LYS C 1 207 ? -5.519  89.558 30.680  1.00 18.49  ? 207 LYS C N     1 
ATOM   8999  C CA    . LYS C 1 207 ? -6.173  90.826 30.858  1.00 18.69  ? 207 LYS C CA    1 
ATOM   9000  C C     . LYS C 1 207 ? -6.996  91.255 29.632  1.00 24.09  ? 207 LYS C C     1 
ATOM   9001  O O     . LYS C 1 207 ? -8.164  91.661 29.782  1.00 22.63  ? 207 LYS C O     1 
ATOM   9002  C CB    . LYS C 1 207 ? -5.105  91.878 31.130  1.00 22.03  ? 207 LYS C CB    1 
ATOM   9003  C CG    . LYS C 1 207 ? -5.654  93.288 31.348  1.00 24.99  ? 207 LYS C CG    1 
ATOM   9004  C CD    . LYS C 1 207 ? -4.540  94.167 31.878  1.00 37.67  ? 207 LYS C CD    1 
ATOM   9005  C CE    . LYS C 1 207 ? -4.967  95.625 31.980  1.00 41.88  ? 207 LYS C CE    1 
ATOM   9006  N NZ    . LYS C 1 207 ? -4.955  96.278 30.641  1.00 51.56  ? 207 LYS C NZ    1 
ATOM   9007  N N     . GLU C 1 208 ? -6.445  91.104 28.437  1.00 20.04  ? 208 GLU C N     1 
ATOM   9008  C CA    . GLU C 1 208 ? -7.158  91.469 27.221  1.00 25.22  ? 208 GLU C CA    1 
ATOM   9009  C C     . GLU C 1 208 ? -8.380  90.615 26.971  1.00 24.83  ? 208 GLU C C     1 
ATOM   9010  O O     . GLU C 1 208 ? -9.458  91.102 26.629  1.00 21.69  ? 208 GLU C O     1 
ATOM   9011  C CB    . GLU C 1 208 ? -6.224  91.369 25.999  1.00 29.45  ? 208 GLU C CB    1 
ATOM   9012  C CG    . GLU C 1 208 ? -6.933  91.782 24.725  1.00 41.92  ? 208 GLU C CG    1 
ATOM   9013  C CD    . GLU C 1 208 ? -6.014  92.368 23.675  1.00 45.36  ? 208 GLU C CD    1 
ATOM   9014  O OE1   . GLU C 1 208 ? -4.849  91.944 23.541  1.00 45.57  ? 208 GLU C OE1   1 
ATOM   9015  O OE2   . GLU C 1 208 ? -6.524  93.272 22.979  1.00 51.93  ? 208 GLU C OE2   1 
ATOM   9016  N N     . VAL C 1 209 ? -8.256  89.302 27.192  1.00 23.72  ? 209 VAL C N     1 
ATOM   9017  C CA    . VAL C 1 209 ? -9.385  88.398 27.099  1.00 22.30  ? 209 VAL C CA    1 
ATOM   9018  C C     . VAL C 1 209 ? -10.477 88.830 28.090  1.00 23.75  ? 209 VAL C C     1 
ATOM   9019  O O     . VAL C 1 209 ? -11.656 88.781 27.738  1.00 23.60  ? 209 VAL C O     1 
ATOM   9020  C CB    . VAL C 1 209 ? -8.967  86.947 27.383  1.00 23.06  ? 209 VAL C CB    1 
ATOM   9021  C CG1   . VAL C 1 209 ? -10.145 86.017 27.630  1.00 20.82  ? 209 VAL C CG1   1 
ATOM   9022  C CG2   . VAL C 1 209 ? -8.121  86.465 26.224  1.00 19.75  ? 209 VAL C CG2   1 
ATOM   9023  N N     . TYR C 1 210 ? -10.123 89.150 29.326  1.00 22.97  ? 210 TYR C N     1 
ATOM   9024  C CA    . TYR C 1 210 ? -11.114 89.516 30.346  1.00 20.80  ? 210 TYR C CA    1 
ATOM   9025  C C     . TYR C 1 210 ? -11.813 90.845 29.994  1.00 24.52  ? 210 TYR C C     1 
ATOM   9026  O O     . TYR C 1 210 ? -12.998 91.019 30.238  1.00 23.19  ? 210 TYR C O     1 
ATOM   9027  C CB    . TYR C 1 210 ? -10.463 89.729 31.715  1.00 17.79  ? 210 TYR C CB    1 
ATOM   9028  C CG    . TYR C 1 210 ? -11.479 89.945 32.822  1.00 16.79  ? 210 TYR C CG    1 
ATOM   9029  C CD1   . TYR C 1 210 ? -12.315 88.891 33.194  1.00 20.07  ? 210 TYR C CD1   1 
ATOM   9030  C CD2   . TYR C 1 210 ? -11.601 91.160 33.480  1.00 15.76  ? 210 TYR C CD2   1 
ATOM   9031  C CE1   . TYR C 1 210 ? -13.248 89.004 34.206  1.00 18.38  ? 210 TYR C CE1   1 
ATOM   9032  C CE2   . TYR C 1 210 ? -12.543 91.311 34.490  1.00 19.76  ? 210 TYR C CE2   1 
ATOM   9033  C CZ    . TYR C 1 210 ? -13.347 90.236 34.830  1.00 20.45  ? 210 TYR C CZ    1 
ATOM   9034  O OH    . TYR C 1 210 ? -14.259 90.352 35.850  1.00 27.91  ? 210 TYR C OH    1 
ATOM   9035  N N     . GLU C 1 211 ? -11.043 91.833 29.550  1.00 22.42  ? 211 GLU C N     1 
ATOM   9036  C CA    . GLU C 1 211 ? -11.571 93.134 29.132  1.00 27.27  ? 211 GLU C CA    1 
ATOM   9037  C C     . GLU C 1 211 ? -12.579 93.006 27.994  1.00 25.42  ? 211 GLU C C     1 
ATOM   9038  O O     . GLU C 1 211 ? -13.655 93.599 28.058  1.00 24.83  ? 211 GLU C O     1 
ATOM   9039  C CB    . GLU C 1 211 ? -10.427 94.037 28.633  1.00 20.17  ? 211 GLU C CB    1 
ATOM   9040  C CG    . GLU C 1 211 ? -9.815  94.783 29.803  1.00 39.32  ? 211 GLU C CG    1 
ATOM   9041  C CD    . GLU C 1 211 ? -8.458  95.375 29.485  1.00 41.91  ? 211 GLU C CD    1 
ATOM   9042  O OE1   . GLU C 1 211 ? -7.969  95.170 28.351  1.00 47.80  ? 211 GLU C OE1   1 
ATOM   9043  O OE2   . GLU C 1 211 ? -7.896  96.040 30.381  1.00 49.18  ? 211 GLU C OE2   1 
ATOM   9044  N N     . ILE C 1 212 ? -12.229 92.191 26.991  1.00 23.22  ? 212 ILE C N     1 
ATOM   9045  C CA    . ILE C 1 212 ? -13.172 91.899 25.911  1.00 25.39  ? 212 ILE C CA    1 
ATOM   9046  C C     . ILE C 1 212 ? -14.415 91.216 26.453  1.00 28.56  ? 212 ILE C C     1 
ATOM   9047  O O     . ILE C 1 212 ? -15.543 91.584 26.111  1.00 26.71  ? 212 ILE C O     1 
ATOM   9048  C CB    . ILE C 1 212 ? -12.481 91.026 24.864  1.00 23.89  ? 212 ILE C CB    1 
ATOM   9049  C CG1   . ILE C 1 212 ? -11.447 91.913 24.126  1.00 25.42  ? 212 ILE C CG1   1 
ATOM   9050  C CG2   . ILE C 1 212 ? -13.421 90.351 23.893  1.00 25.25  ? 212 ILE C CG2   1 
ATOM   9051  C CD1   . ILE C 1 212 ? -10.522 91.091 23.243  1.00 23.69  ? 212 ILE C CD1   1 
ATOM   9052  N N     . ALA C 1 213 ? -14.233 90.184 27.290  1.00 25.71  ? 213 ALA C N     1 
ATOM   9053  C CA    . ALA C 1 213 ? -15.381 89.493 27.878  1.00 24.91  ? 213 ALA C CA    1 
ATOM   9054  C C     . ALA C 1 213 ? -16.279 90.460 28.643  1.00 22.67  ? 213 ALA C C     1 
ATOM   9055  O O     . ALA C 1 213 ? -17.490 90.353 28.505  1.00 22.80  ? 213 ALA C O     1 
ATOM   9056  C CB    . ALA C 1 213 ? -14.926 88.369 28.799  1.00 24.15  ? 213 ALA C CB    1 
ATOM   9057  N N     . LYS C 1 214 ? -15.720 91.387 29.416  1.00 21.83  ? 214 LYS C N     1 
ATOM   9058  C CA    . LYS C 1 214 ? -16.497 92.336 30.182  1.00 27.37  ? 214 LYS C CA    1 
ATOM   9059  C C     . LYS C 1 214 ? -17.195 93.380 29.302  1.00 30.32  ? 214 LYS C C     1 
ATOM   9060  O O     . LYS C 1 214 ? -18.257 93.871 29.671  1.00 30.73  ? 214 LYS C O     1 
ATOM   9061  C CB    . LYS C 1 214 ? -15.695 93.043 31.274  1.00 25.54  ? 214 LYS C CB    1 
ATOM   9062  C CG    . LYS C 1 214 ? -15.173 92.122 32.377  1.00 39.51  ? 214 LYS C CG    1 
ATOM   9063  C CD    . LYS C 1 214 ? -16.264 91.285 33.028  1.00 37.78  ? 214 LYS C CD    1 
ATOM   9064  C CE    . LYS C 1 214 ? -16.275 89.887 32.442  1.00 38.52  ? 214 LYS C CE    1 
ATOM   9065  N NZ    . LYS C 1 214 ? -17.213 88.968 33.144  1.00 25.63  ? 214 LYS C NZ    1 
ATOM   9066  N N     . GLN C 1 215 ? -16.630 93.680 28.128  1.00 29.42  ? 215 GLN C N     1 
ATOM   9067  C CA    . GLN C 1 215 ? -17.291 94.581 27.191  1.00 33.08  ? 215 GLN C CA    1 
ATOM   9068  C C     . GLN C 1 215 ? -18.545 93.944 26.604  1.00 30.19  ? 215 GLN C C     1 
ATOM   9069  O O     . GLN C 1 215 ? -19.443 94.643 26.171  1.00 30.19  ? 215 GLN C O     1 
ATOM   9070  C CB    . GLN C 1 215 ? -16.360 95.004 26.064  1.00 36.92  ? 215 GLN C CB    1 
ATOM   9071  C CG    . GLN C 1 215 ? -15.446 96.125 26.557  1.00 53.55  ? 215 GLN C CG    1 
ATOM   9072  C CD    . GLN C 1 215 ? -14.967 96.930 25.365  1.00 64.06  ? 215 GLN C CD    1 
ATOM   9073  O OE1   . GLN C 1 215 ? -14.539 96.303 24.393  1.00 68.25  ? 215 GLN C OE1   1 
ATOM   9074  N NE2   . GLN C 1 215 ? -15.084 98.246 25.496  1.00 70.07  ? 215 GLN C NE2   1 
ATOM   9075  N N     . HIS C 1 216 ? -18.597 92.621 26.601  1.00 26.78  ? 216 HIS C N     1 
ATOM   9076  C CA    . HIS C 1 216 ? -19.744 91.896 26.083  1.00 26.80  ? 216 HIS C CA    1 
ATOM   9077  C C     . HIS C 1 216 ? -20.571 91.172 27.151  1.00 27.73  ? 216 HIS C C     1 
ATOM   9078  O O     . HIS C 1 216 ? -21.375 90.318 26.822  1.00 26.23  ? 216 HIS C O     1 
ATOM   9079  C CB    . HIS C 1 216 ? -19.222 90.875 25.047  1.00 25.80  ? 216 HIS C CB    1 
ATOM   9080  C CG    . HIS C 1 216 ? -18.684 91.643 23.867  1.00 41.67  ? 216 HIS C CG    1 
ATOM   9081  N ND1   . HIS C 1 216 ? -17.359 92.013 23.761  1.00 42.50  ? 216 HIS C ND1   1 
ATOM   9082  C CD2   . HIS C 1 216 ? -19.318 92.154 22.778  1.00 37.31  ? 216 HIS C CD2   1 
ATOM   9083  C CE1   . HIS C 1 216 ? -17.191 92.692 22.647  1.00 46.03  ? 216 HIS C CE1   1 
ATOM   9084  N NE2   . HIS C 1 216 ? -18.355 92.777 22.037  1.00 41.98  ? 216 HIS C NE2   1 
ATOM   9085  N N     . GLY C 1 217 ? -20.256 91.375 28.428  1.00 27.94  ? 217 GLY C N     1 
ATOM   9086  C CA    . GLY C 1 217 ? -20.943 90.675 29.518  1.00 27.55  ? 217 GLY C CA    1 
ATOM   9087  C C     . GLY C 1 217 ? -20.701 89.179 29.569  1.00 26.83  ? 217 GLY C C     1 
ATOM   9088  O O     . GLY C 1 217 ? -21.577 88.446 30.028  1.00 27.81  ? 217 GLY C O     1 
ATOM   9089  N N     . ILE C 1 218 ? -19.568 88.668 29.061  1.00 22.95  ? 218 ILE C N     1 
ATOM   9090  C CA    . ILE C 1 218 ? -19.345 87.213 29.114  1.00 23.16  ? 218 ILE C CA    1 
ATOM   9091  C C     . ILE C 1 218 ? -18.641 86.852 30.432  1.00 23.30  ? 218 ILE C C     1 
ATOM   9092  O O     . ILE C 1 218 ? -17.818 87.586 30.961  1.00 21.07  ? 218 ILE C O     1 
ATOM   9093  C CB    . ILE C 1 218 ? -18.552 86.752 27.893  1.00 26.20  ? 218 ILE C CB    1 
ATOM   9094  C CG1   . ILE C 1 218 ? -19.406 87.049 26.631  1.00 29.64  ? 218 ILE C CG1   1 
ATOM   9095  C CG2   . ILE C 1 218 ? -18.197 85.273 27.969  1.00 20.12  ? 218 ILE C CG2   1 
ATOM   9096  C CD1   . ILE C 1 218 ? -18.598 87.057 25.345  1.00 20.45  ? 218 ILE C CD1   1 
ATOM   9097  N N     . PHE C 1 219 ? -19.050 85.749 31.033  1.00 23.03  ? 219 PHE C N     1 
ATOM   9098  C CA    . PHE C 1 219 ? -18.544 85.267 32.295  1.00 21.89  ? 219 PHE C CA    1 
ATOM   9099  C C     . PHE C 1 219 ? -17.193 84.597 32.033  1.00 18.72  ? 219 PHE C C     1 
ATOM   9100  O O     . PHE C 1 219 ? -17.066 83.810 31.099  1.00 19.59  ? 219 PHE C O     1 
ATOM   9101  C CB    . PHE C 1 219 ? -19.539 84.241 32.896  1.00 19.74  ? 219 PHE C CB    1 
ATOM   9102  C CG    . PHE C 1 219 ? -19.292 83.965 34.358  1.00 23.29  ? 219 PHE C CG    1 
ATOM   9103  C CD1   . PHE C 1 219 ? -19.817 84.793 35.342  1.00 19.78  ? 219 PHE C CD1   1 
ATOM   9104  C CD2   . PHE C 1 219 ? -18.531 82.864 34.745  1.00 20.83  ? 219 PHE C CD2   1 
ATOM   9105  C CE1   . PHE C 1 219 ? -19.554 84.560 36.681  1.00 22.74  ? 219 PHE C CE1   1 
ATOM   9106  C CE2   . PHE C 1 219 ? -18.302 82.609 36.083  1.00 19.48  ? 219 PHE C CE2   1 
ATOM   9107  C CZ    . PHE C 1 219 ? -18.808 83.459 37.067  1.00 17.11  ? 219 PHE C CZ    1 
ATOM   9108  N N     . VAL C 1 220 ? -16.181 84.898 32.858  1.00 18.24  ? 220 VAL C N     1 
ATOM   9109  C CA    . VAL C 1 220 ? -14.894 84.211 32.610  1.00 18.17  ? 220 VAL C CA    1 
ATOM   9110  C C     . VAL C 1 220 ? -14.561 83.243 33.750  1.00 15.79  ? 220 VAL C C     1 
ATOM   9111  O O     . VAL C 1 220 ? -14.574 83.662 34.919  1.00 16.42  ? 220 VAL C O     1 
ATOM   9112  C CB    . VAL C 1 220 ? -13.761 85.219 32.407  1.00 18.86  ? 220 VAL C CB    1 
ATOM   9113  C CG1   . VAL C 1 220 ? -12.427 84.493 32.219  1.00 15.84  ? 220 VAL C CG1   1 
ATOM   9114  C CG2   . VAL C 1 220 ? -14.063 86.119 31.202  1.00 16.31  ? 220 VAL C CG2   1 
ATOM   9115  N N     . VAL C 1 221 ? -14.241 82.016 33.435  1.00 16.11  ? 221 VAL C N     1 
ATOM   9116  C CA    . VAL C 1 221 ? -13.797 81.017 34.370  1.00 16.97  ? 221 VAL C CA    1 
ATOM   9117  C C     . VAL C 1 221 ? -12.304 80.716 34.143  1.00 18.01  ? 221 VAL C C     1 
ATOM   9118  O O     . VAL C 1 221 ? -11.905 80.404 33.010  1.00 15.84  ? 221 VAL C O     1 
ATOM   9119  C CB    . VAL C 1 221 ? -14.535 79.676 34.209  1.00 20.82  ? 221 VAL C CB    1 
ATOM   9120  C CG1   . VAL C 1 221 ? -14.055 78.646 35.250  1.00 19.50  ? 221 VAL C CG1   1 
ATOM   9121  C CG2   . VAL C 1 221 ? -16.039 79.849 34.359  1.00 21.16  ? 221 VAL C CG2   1 
ATOM   9122  N N     . MET C 1 222 ? -11.506 80.743 35.219  1.00 14.62  ? 222 MET C N     1 
ATOM   9123  C CA    . MET C 1 222 ? -10.093 80.376 35.116  1.00 12.06  ? 222 MET C CA    1 
ATOM   9124  C C     . MET C 1 222 ? -9.888  78.922 35.490  1.00 13.38  ? 222 MET C C     1 
ATOM   9125  O O     . MET C 1 222 ? -10.076 78.574 36.688  1.00 14.73  ? 222 MET C O     1 
ATOM   9126  C CB    . MET C 1 222 ? -9.304  81.273 36.078  1.00 8.38   ? 222 MET C CB    1 
ATOM   9127  C CG    . MET C 1 222 ? -7.790  81.058 35.901  1.00 19.42  ? 222 MET C CG    1 
ATOM   9128  S SD    . MET C 1 222 ? -7.108  82.337 34.834  1.00 23.59  ? 222 MET C SD    1 
ATOM   9129  C CE    . MET C 1 222 ? -7.124  83.803 35.781  1.00 15.13  ? 222 MET C CE    1 
ATOM   9130  N N     . ASP C 1 223 ? -9.635  78.031 34.515  1.00 9.02   ? 223 ASP C N     1 
ATOM   9131  C CA    . ASP C 1 223 ? -9.379  76.633 34.837  1.00 11.79  ? 223 ASP C CA    1 
ATOM   9132  C C     . ASP C 1 223 ? -7.966  76.652 35.451  1.00 17.24  ? 223 ASP C C     1 
ATOM   9133  O O     . ASP C 1 223 ? -7.006  77.024 34.790  1.00 14.44  ? 223 ASP C O     1 
ATOM   9134  C CB    . ASP C 1 223 ? -9.520  75.740 33.622  1.00 11.08  ? 223 ASP C CB    1 
ATOM   9135  C CG    . ASP C 1 223 ? -9.055  74.329 33.851  1.00 15.53  ? 223 ASP C CG    1 
ATOM   9136  O OD1   . ASP C 1 223 ? -8.147  74.069 34.686  1.00 15.53  ? 223 ASP C OD1   1 
ATOM   9137  O OD2   . ASP C 1 223 ? -9.546  73.404 33.175  1.00 13.65  ? 223 ASP C OD2   1 
ATOM   9138  N N     . SER C 1 224 ? -7.869  76.382 36.766  1.00 13.49  ? 224 SER C N     1 
ATOM   9139  C CA    . SER C 1 224 ? -6.647  76.626 37.493  1.00 14.68  ? 224 SER C CA    1 
ATOM   9140  C C     . SER C 1 224 ? -5.855  75.442 37.992  1.00 11.37  ? 224 SER C C     1 
ATOM   9141  O O     . SER C 1 224 ? -5.091  75.607 38.944  1.00 14.44  ? 224 SER C O     1 
ATOM   9142  C CB    . SER C 1 224 ? -7.060  77.470 38.723  1.00 13.24  ? 224 SER C CB    1 
ATOM   9143  O OG    . SER C 1 224 ? -7.748  78.620 38.304  1.00 11.12  ? 224 SER C OG    1 
ATOM   9144  N N     . ALA C 1 225 ? -5.915  74.306 37.352  1.00 10.66  ? 225 ALA C N     1 
ATOM   9145  C CA    . ALA C 1 225 ? -5.114  73.166 37.825  1.00 13.21  ? 225 ALA C CA    1 
ATOM   9146  C C     . ALA C 1 225 ? -3.646  73.559 37.985  1.00 16.04  ? 225 ALA C C     1 
ATOM   9147  O O     . ALA C 1 225 ? -3.015  73.088 38.935  1.00 14.01  ? 225 ALA C O     1 
ATOM   9148  C CB    . ALA C 1 225 ? -5.228  72.036 36.836  1.00 8.97   ? 225 ALA C CB    1 
ATOM   9149  N N     . ARG C 1 226 ? -3.098  74.313 37.027  1.00 13.23  ? 226 ARG C N     1 
ATOM   9150  C CA    . ARG C 1 226 ? -1.666  74.628 37.091  1.00 10.89  ? 226 ARG C CA    1 
ATOM   9151  C C     . ARG C 1 226 ? -1.431  76.100 37.157  1.00 9.64   ? 226 ARG C C     1 
ATOM   9152  O O     . ARG C 1 226 ? -0.555  76.635 36.474  1.00 11.51  ? 226 ARG C O     1 
ATOM   9153  C CB    . ARG C 1 226 ? -0.929  73.970 35.916  1.00 5.82   ? 226 ARG C CB    1 
ATOM   9154  C CG    . ARG C 1 226 ? -1.013  72.455 35.998  1.00 7.75   ? 226 ARG C CG    1 
ATOM   9155  C CD    . ARG C 1 226 ? -0.334  71.685 34.919  1.00 7.82   ? 226 ARG C CD    1 
ATOM   9156  N NE    . ARG C 1 226 ? -0.685  70.250 34.895  1.00 8.02   ? 226 ARG C NE    1 
ATOM   9157  C CZ    . ARG C 1 226 ? -1.811  69.836 34.296  1.00 15.45  ? 226 ARG C CZ    1 
ATOM   9158  N NH1   . ARG C 1 226 ? -2.659  70.722 33.805  1.00 12.38  ? 226 ARG C NH1   1 
ATOM   9159  N NH2   . ARG C 1 226 ? -2.125  68.560 34.238  1.00 7.37   ? 226 ARG C NH2   1 
ATOM   9160  N N     . PHE C 1 227 ? -2.189  76.757 38.034  1.00 8.58   ? 227 PHE C N     1 
ATOM   9161  C CA    . PHE C 1 227 ? -2.045  78.201 38.143  1.00 9.30   ? 227 PHE C CA    1 
ATOM   9162  C C     . PHE C 1 227 ? -0.704  78.644 38.695  1.00 12.30  ? 227 PHE C C     1 
ATOM   9163  O O     . PHE C 1 227 ? -0.299  79.775 38.390  1.00 10.15  ? 227 PHE C O     1 
ATOM   9164  C CB    . PHE C 1 227 ? -3.177  78.753 39.018  1.00 8.70   ? 227 PHE C CB    1 
ATOM   9165  C CG    . PHE C 1 227 ? -3.093  78.545 40.506  1.00 12.11  ? 227 PHE C CG    1 
ATOM   9166  C CD1   . PHE C 1 227 ? -3.255  77.281 41.064  1.00 13.69  ? 227 PHE C CD1   1 
ATOM   9167  C CD2   . PHE C 1 227 ? -2.829  79.613 41.349  1.00 11.77  ? 227 PHE C CD2   1 
ATOM   9168  C CE1   . PHE C 1 227 ? -3.197  77.095 42.430  1.00 12.44  ? 227 PHE C CE1   1 
ATOM   9169  C CE2   . PHE C 1 227 ? -2.764  79.431 42.729  1.00 13.31  ? 227 PHE C CE2   1 
ATOM   9170  C CZ    . PHE C 1 227 ? -2.964  78.166 43.282  1.00 9.75   ? 227 PHE C CZ    1 
ATOM   9171  N N     . CYS C 1 228 ? -0.044  77.829 39.512  1.00 11.07  ? 228 CYS C N     1 
ATOM   9172  C CA    . CYS C 1 228 ? 1.262   78.243 40.058  1.00 11.95  ? 228 CYS C CA    1 
ATOM   9173  C C     . CYS C 1 228 ? 2.374   78.134 39.008  1.00 8.99   ? 228 CYS C C     1 
ATOM   9174  O O     . CYS C 1 228 ? 3.311   78.915 38.948  1.00 9.56   ? 228 CYS C O     1 
ATOM   9175  C CB    . CYS C 1 228 ? 1.574   77.321 41.252  1.00 8.46   ? 228 CYS C CB    1 
ATOM   9176  S SG    . CYS C 1 228 ? 0.457   77.716 42.693  1.00 12.93  ? 228 CYS C SG    1 
ATOM   9177  N N     . GLU C 1 229 ? 2.328   77.063 38.216  1.00 7.34   ? 229 GLU C N     1 
ATOM   9178  C CA    . GLU C 1 229 ? 3.312   76.938 37.137  1.00 11.38  ? 229 GLU C CA    1 
ATOM   9179  C C     . GLU C 1 229 ? 3.130   78.133 36.192  1.00 13.73  ? 229 GLU C C     1 
ATOM   9180  O O     . GLU C 1 229 ? 4.118   78.761 35.821  1.00 14.54  ? 229 GLU C O     1 
ATOM   9181  C CB    . GLU C 1 229 ? 3.126   75.570 36.496  1.00 7.49   ? 229 GLU C CB    1 
ATOM   9182  C CG    . GLU C 1 229 ? 3.549   74.474 37.468  1.00 10.29  ? 229 GLU C CG    1 
ATOM   9183  C CD    . GLU C 1 229 ? 3.320   73.074 36.985  1.00 12.91  ? 229 GLU C CD    1 
ATOM   9184  O OE1   . GLU C 1 229 ? 2.833   72.876 35.838  1.00 16.00  ? 229 GLU C OE1   1 
ATOM   9185  O OE2   . GLU C 1 229 ? 3.647   72.160 37.763  1.00 18.98  ? 229 GLU C OE2   1 
ATOM   9186  N N     . ASN C 1 230 ? 1.886   78.545 35.928  1.00 13.56  ? 230 ASN C N     1 
ATOM   9187  C CA    . ASN C 1 230 ? 1.609   79.706 35.096  1.00 13.61  ? 230 ASN C CA    1 
ATOM   9188  C C     . ASN C 1 230 ? 2.195   80.947 35.699  1.00 14.94  ? 230 ASN C C     1 
ATOM   9189  O O     . ASN C 1 230 ? 2.882   81.701 35.027  1.00 14.68  ? 230 ASN C O     1 
ATOM   9190  C CB    . ASN C 1 230 ? 0.084   79.958 34.850  1.00 12.10  ? 230 ASN C CB    1 
ATOM   9191  C CG    . ASN C 1 230 ? -0.054  80.712 33.504  1.00 15.09  ? 230 ASN C CG    1 
ATOM   9192  O OD1   . ASN C 1 230 ? -0.089  80.075 32.463  1.00 11.27  ? 230 ASN C OD1   1 
ATOM   9193  N ND2   . ASN C 1 230 ? -0.089  82.021 33.537  1.00 11.19  ? 230 ASN C ND2   1 
ATOM   9194  N N     . ALA C 1 231 ? 1.996   81.167 37.016  1.00 12.49  ? 231 ALA C N     1 
ATOM   9195  C CA    . ALA C 1 231 ? 2.534   82.351 37.661  1.00 12.61  ? 231 ALA C CA    1 
ATOM   9196  C C     . ALA C 1 231 ? 4.063   82.345 37.689  1.00 13.46  ? 231 ALA C C     1 
ATOM   9197  O O     . ALA C 1 231 ? 4.666   83.417 37.604  1.00 12.29  ? 231 ALA C O     1 
ATOM   9198  C CB    . ALA C 1 231 ? 1.992   82.520 39.066  1.00 11.07  ? 231 ALA C CB    1 
ATOM   9199  N N     . TYR C 1 232 ? 4.688   81.156 37.775  1.00 12.72  ? 232 TYR C N     1 
ATOM   9200  C CA    . TYR C 1 232 ? 6.144   81.129 37.756  1.00 15.15  ? 232 TYR C CA    1 
ATOM   9201  C C     . TYR C 1 232 ? 6.651   81.662 36.392  1.00 16.29  ? 232 TYR C C     1 
ATOM   9202  O O     . TYR C 1 232 ? 7.566   82.469 36.323  1.00 14.20  ? 232 TYR C O     1 
ATOM   9203  C CB    . TYR C 1 232 ? 6.658   79.702 37.964  1.00 12.68  ? 232 TYR C CB    1 
ATOM   9204  C CG    . TYR C 1 232 ? 8.172   79.650 37.805  1.00 19.28  ? 232 TYR C CG    1 
ATOM   9205  C CD1   . TYR C 1 232 ? 9.011   79.970 38.869  1.00 19.73  ? 232 TYR C CD1   1 
ATOM   9206  C CD2   . TYR C 1 232 ? 8.745   79.318 36.594  1.00 21.14  ? 232 TYR C CD2   1 
ATOM   9207  C CE1   . TYR C 1 232 ? 10.401  79.923 38.732  1.00 21.13  ? 232 TYR C CE1   1 
ATOM   9208  C CE2   . TYR C 1 232 ? 10.113  79.283 36.433  1.00 21.66  ? 232 TYR C CE2   1 
ATOM   9209  C CZ    . TYR C 1 232 ? 10.927  79.591 37.508  1.00 24.21  ? 232 TYR C CZ    1 
ATOM   9210  O OH    . TYR C 1 232 ? 12.286  79.514 37.315  1.00 28.32  ? 232 TYR C OH    1 
ATOM   9211  N N     . PHE C 1 233 ? 6.052   81.129 35.318  1.00 12.26  ? 233 PHE C N     1 
ATOM   9212  C CA    . PHE C 1 233 ? 6.443   81.582 33.976  1.00 16.07  ? 233 PHE C CA    1 
ATOM   9213  C C     . PHE C 1 233 ? 6.190   83.062 33.748  1.00 18.40  ? 233 PHE C C     1 
ATOM   9214  O O     . PHE C 1 233 ? 7.051   83.733 33.152  1.00 18.51  ? 233 PHE C O     1 
ATOM   9215  C CB    . PHE C 1 233 ? 5.695   80.782 32.921  1.00 8.53   ? 233 PHE C CB    1 
ATOM   9216  C CG    . PHE C 1 233 ? 6.215   79.416 32.704  1.00 11.57  ? 233 PHE C CG    1 
ATOM   9217  C CD1   . PHE C 1 233 ? 7.553   79.225 32.385  1.00 15.29  ? 233 PHE C CD1   1 
ATOM   9218  C CD2   . PHE C 1 233 ? 5.381   78.320 32.809  1.00 12.45  ? 233 PHE C CD2   1 
ATOM   9219  C CE1   . PHE C 1 233 ? 8.057   77.958 32.111  1.00 17.75  ? 233 PHE C CE1   1 
ATOM   9220  C CE2   . PHE C 1 233 ? 5.884   77.048 32.554  1.00 12.69  ? 233 PHE C CE2   1 
ATOM   9221  C CZ    . PHE C 1 233 ? 7.211   76.879 32.211  1.00 16.47  ? 233 PHE C CZ    1 
ATOM   9222  N N     . ILE C 1 234 ? 5.092   83.600 34.300  1.00 15.40  ? 234 ILE C N     1 
ATOM   9223  C CA    . ILE C 1 234 ? 4.880   85.040 34.159  1.00 14.99  ? 234 ILE C CA    1 
ATOM   9224  C C     . ILE C 1 234 ? 6.032   85.777 34.809  1.00 20.47  ? 234 ILE C C     1 
ATOM   9225  O O     . ILE C 1 234 ? 6.567   86.744 34.286  1.00 17.63  ? 234 ILE C O     1 
ATOM   9226  C CB    . ILE C 1 234 ? 3.514   85.492 34.726  1.00 12.51  ? 234 ILE C CB    1 
ATOM   9227  C CG1   . ILE C 1 234 ? 2.406   85.010 33.778  1.00 17.95  ? 234 ILE C CG1   1 
ATOM   9228  C CG2   . ILE C 1 234 ? 3.460   86.996 34.868  1.00 12.05  ? 234 ILE C CG2   1 
ATOM   9229  C CD1   . ILE C 1 234 ? 0.996   85.207 34.311  1.00 16.87  ? 234 ILE C CD1   1 
ATOM   9230  N N     . LYS C 1 235 ? 6.437   85.361 36.010  1.00 19.99  ? 235 LYS C N     1 
ATOM   9231  C CA    . LYS C 1 235 ? 7.477   86.011 36.757  1.00 19.19  ? 235 LYS C CA    1 
ATOM   9232  C C     . LYS C 1 235 ? 8.826   85.865 36.033  1.00 21.07  ? 235 LYS C C     1 
ATOM   9233  O O     . LYS C 1 235 ? 9.645   86.774 36.051  1.00 20.19  ? 235 LYS C O     1 
ATOM   9234  C CB    . LYS C 1 235 ? 7.591   85.487 38.200  1.00 21.38  ? 235 LYS C CB    1 
ATOM   9235  C CG    . LYS C 1 235 ? 8.854   85.993 38.866  1.00 22.51  ? 235 LYS C CG    1 
ATOM   9236  C CD    . LYS C 1 235 ? 8.858   85.905 40.363  1.00 32.61  ? 235 LYS C CD    1 
ATOM   9237  C CE    . LYS C 1 235 ? 10.266  86.231 40.896  1.00 25.89  ? 235 LYS C CE    1 
ATOM   9238  N NZ    . LYS C 1 235 ? 10.115  86.944 42.183  1.00 28.71  ? 235 LYS C NZ    1 
ATOM   9239  N N     . ALA C 1 236 ? 9.075   84.707 35.453  1.00 18.41  ? 236 ALA C N     1 
ATOM   9240  C CA    . ALA C 1 236 ? 10.315  84.470 34.749  1.00 23.90  ? 236 ALA C CA    1 
ATOM   9241  C C     . ALA C 1 236 ? 10.410  85.228 33.424  1.00 28.27  ? 236 ALA C C     1 
ATOM   9242  O O     . ALA C 1 236 ? 11.538  85.574 33.054  1.00 27.65  ? 236 ALA C O     1 
ATOM   9243  C CB    . ALA C 1 236 ? 10.409  82.980 34.432  1.00 14.96  ? 236 ALA C CB    1 
ATOM   9244  N N     . ARG C 1 237 ? 9.311   85.387 32.680  1.00 25.81  ? 237 ARG C N     1 
ATOM   9245  C CA    . ARG C 1 237 ? 9.408   85.928 31.336  1.00 23.55  ? 237 ARG C CA    1 
ATOM   9246  C C     . ARG C 1 237 ? 8.786   87.283 31.096  1.00 27.27  ? 237 ARG C C     1 
ATOM   9247  O O     . ARG C 1 237 ? 9.000   87.816 30.003  1.00 30.46  ? 237 ARG C O     1 
ATOM   9248  C CB    . ARG C 1 237 ? 8.747   84.978 30.347  1.00 15.46  ? 237 ARG C CB    1 
ATOM   9249  C CG    . ARG C 1 237 ? 9.370   83.602 30.265  1.00 17.23  ? 237 ARG C CG    1 
ATOM   9250  C CD    . ARG C 1 237 ? 8.519   82.657 29.442  1.00 16.24  ? 237 ARG C CD    1 
ATOM   9251  N NE    . ARG C 1 237 ? 9.116   81.336 29.474  1.00 16.58  ? 237 ARG C NE    1 
ATOM   9252  C CZ    . ARG C 1 237 ? 8.620   80.218 28.983  1.00 22.07  ? 237 ARG C CZ    1 
ATOM   9253  N NH1   . ARG C 1 237 ? 7.439   80.203 28.383  1.00 18.36  ? 237 ARG C NH1   1 
ATOM   9254  N NH2   . ARG C 1 237 ? 9.325   79.093 29.137  1.00 16.57  ? 237 ARG C NH2   1 
ATOM   9255  N N     . ASP C 1 238 ? 8.003   87.795 32.025  1.00 25.17  ? 238 ASP C N     1 
ATOM   9256  C CA    . ASP C 1 238 ? 7.398   89.107 31.861  1.00 22.73  ? 238 ASP C CA    1 
ATOM   9257  C C     . ASP C 1 238 ? 8.180   90.091 32.698  1.00 26.55  ? 238 ASP C C     1 
ATOM   9258  O O     . ASP C 1 238 ? 8.110   90.104 33.932  1.00 25.48  ? 238 ASP C O     1 
ATOM   9259  C CB    . ASP C 1 238 ? 5.944   89.075 32.314  1.00 22.88  ? 238 ASP C CB    1 
ATOM   9260  C CG    . ASP C 1 238 ? 5.194   90.369 32.049  1.00 29.04  ? 238 ASP C CG    1 
ATOM   9261  O OD1   . ASP C 1 238 ? 5.836   91.429 31.961  1.00 27.15  ? 238 ASP C OD1   1 
ATOM   9262  O OD2   . ASP C 1 238 ? 3.957   90.234 31.944  1.00 24.98  ? 238 ASP C OD2   1 
ATOM   9263  N N     . PRO C 1 239 ? 8.863   91.042 32.055  1.00 28.84  ? 239 PRO C N     1 
ATOM   9264  C CA    . PRO C 1 239 ? 9.640   92.062 32.714  1.00 27.32  ? 239 PRO C CA    1 
ATOM   9265  C C     . PRO C 1 239 ? 8.865   92.796 33.799  1.00 27.42  ? 239 PRO C C     1 
ATOM   9266  O O     . PRO C 1 239 ? 9.398   93.169 34.842  1.00 26.39  ? 239 PRO C O     1 
ATOM   9267  C CB    . PRO C 1 239 ? 9.998   93.052 31.595  1.00 30.66  ? 239 PRO C CB    1 
ATOM   9268  C CG    . PRO C 1 239 ? 9.536   92.473 30.326  1.00 31.16  ? 239 PRO C CG    1 
ATOM   9269  C CD    . PRO C 1 239 ? 8.962   91.120 30.565  1.00 29.27  ? 239 PRO C CD    1 
ATOM   9270  N N     . LYS C 1 240 ? 7.575   93.014 33.569  1.00 25.70  ? 240 LYS C N     1 
ATOM   9271  C CA    . LYS C 1 240 ? 6.740   93.711 34.536  1.00 27.54  ? 240 LYS C CA    1 
ATOM   9272  C C     . LYS C 1 240 ? 6.655   92.956 35.854  1.00 26.78  ? 240 LYS C C     1 
ATOM   9273  O O     . LYS C 1 240 ? 6.517   93.595 36.872  1.00 26.51  ? 240 LYS C O     1 
ATOM   9274  C CB    . LYS C 1 240 ? 5.353   93.948 33.932  1.00 36.94  ? 240 LYS C CB    1 
ATOM   9275  C CG    . LYS C 1 240 ? 4.399   94.666 34.872  1.00 53.70  ? 240 LYS C CG    1 
ATOM   9276  C CD    . LYS C 1 240 ? 2.946   94.546 34.433  1.00 64.23  ? 240 LYS C CD    1 
ATOM   9277  C CE    . LYS C 1 240 ? 2.032   95.329 35.364  1.00 69.90  ? 240 LYS C CE    1 
ATOM   9278  N NZ    . LYS C 1 240 ? 0.692   94.690 35.482  1.00 77.92  ? 240 LYS C NZ    1 
ATOM   9279  N N     . TYR C 1 241 ? 6.814   91.634 35.879  1.00 24.66  ? 241 TYR C N     1 
ATOM   9280  C CA    . TYR C 1 241 ? 6.723   90.905 37.140  1.00 27.70  ? 241 TYR C CA    1 
ATOM   9281  C C     . TYR C 1 241 ? 8.038   90.354 37.660  1.00 29.41  ? 241 TYR C C     1 
ATOM   9282  O O     . TYR C 1 241 ? 8.065   89.563 38.616  1.00 27.21  ? 241 TYR C O     1 
ATOM   9283  C CB    . TYR C 1 241 ? 5.716   89.758 36.906  1.00 22.25  ? 241 TYR C CB    1 
ATOM   9284  C CG    . TYR C 1 241 ? 4.314   90.327 36.857  1.00 20.72  ? 241 TYR C CG    1 
ATOM   9285  C CD1   . TYR C 1 241 ? 3.649   90.674 38.029  1.00 21.60  ? 241 TYR C CD1   1 
ATOM   9286  C CD2   . TYR C 1 241 ? 3.678   90.540 35.643  1.00 21.00  ? 241 TYR C CD2   1 
ATOM   9287  C CE1   . TYR C 1 241 ? 2.377   91.208 37.992  1.00 22.70  ? 241 TYR C CE1   1 
ATOM   9288  C CE2   . TYR C 1 241 ? 2.398   91.099 35.589  1.00 23.32  ? 241 TYR C CE2   1 
ATOM   9289  C CZ    . TYR C 1 241 ? 1.752   91.424 36.768  1.00 25.54  ? 241 TYR C CZ    1 
ATOM   9290  O OH    . TYR C 1 241 ? 0.477   91.947 36.748  1.00 24.30  ? 241 TYR C OH    1 
ATOM   9291  N N     . LYS C 1 242 ? 9.148   90.839 37.113  1.00 29.95  ? 242 LYS C N     1 
ATOM   9292  C CA    . LYS C 1 242 ? 10.476  90.393 37.450  1.00 29.82  ? 242 LYS C CA    1 
ATOM   9293  C C     . LYS C 1 242 ? 10.744  90.406 38.946  1.00 25.67  ? 242 LYS C C     1 
ATOM   9294  O O     . LYS C 1 242 ? 11.363  89.448 39.398  1.00 26.79  ? 242 LYS C O     1 
ATOM   9295  C CB    . LYS C 1 242 ? 11.536  91.264 36.756  1.00 40.92  ? 242 LYS C CB    1 
ATOM   9296  C CG    . LYS C 1 242 ? 12.905  90.604 36.715  1.00 57.46  ? 242 LYS C CG    1 
ATOM   9297  C CD    . LYS C 1 242 ? 14.008  91.605 37.021  1.00 72.01  ? 242 LYS C CD    1 
ATOM   9298  C CE    . LYS C 1 242 ? 15.321  90.893 37.310  1.00 81.02  ? 242 LYS C CE    1 
ATOM   9299  N NZ    . LYS C 1 242 ? 15.963  91.402 38.560  1.00 85.35  ? 242 LYS C NZ    1 
ATOM   9300  N N     . ASN C 1 243 ? 10.326  91.438 39.652  1.00 24.40  ? 243 ASN C N     1 
ATOM   9301  C CA    . ASN C 1 243 ? 10.579  91.571 41.081  1.00 29.84  ? 243 ASN C CA    1 
ATOM   9302  C C     . ASN C 1 243 ? 9.358   91.282 41.933  1.00 30.09  ? 243 ASN C C     1 
ATOM   9303  O O     . ASN C 1 243 ? 9.329   91.629 43.114  1.00 33.76  ? 243 ASN C O     1 
ATOM   9304  C CB    . ASN C 1 243 ? 11.097  92.986 41.394  1.00 35.20  ? 243 ASN C CB    1 
ATOM   9305  C CG    . ASN C 1 243 ? 12.412  93.268 40.673  1.00 50.92  ? 243 ASN C CG    1 
ATOM   9306  O OD1   . ASN C 1 243 ? 13.312  92.428 40.608  1.00 48.18  ? 243 ASN C OD1   1 
ATOM   9307  N ND2   . ASN C 1 243 ? 12.516  94.464 40.103  1.00 57.94  ? 243 ASN C ND2   1 
ATOM   9308  N N     . ALA C 1 244 ? 8.315   90.679 41.392  1.00 27.81  ? 244 ALA C N     1 
ATOM   9309  C CA    . ALA C 1 244 ? 7.089   90.425 42.140  1.00 25.65  ? 244 ALA C CA    1 
ATOM   9310  C C     . ALA C 1 244 ? 7.174   89.049 42.811  1.00 21.42  ? 244 ALA C C     1 
ATOM   9311  O O     . ALA C 1 244 ? 7.926   88.212 42.315  1.00 21.23  ? 244 ALA C O     1 
ATOM   9312  C CB    . ALA C 1 244 ? 5.886   90.428 41.194  1.00 22.12  ? 244 ALA C CB    1 
ATOM   9313  N N     . THR C 1 245 ? 6.457   88.817 43.899  1.00 18.22  ? 245 THR C N     1 
ATOM   9314  C CA    . THR C 1 245 ? 6.461   87.480 44.506  1.00 17.57  ? 245 THR C CA    1 
ATOM   9315  C C     . THR C 1 245 ? 5.497   86.613 43.720  1.00 16.05  ? 245 THR C C     1 
ATOM   9316  O O     . THR C 1 245 ? 4.663   87.162 43.005  1.00 17.48  ? 245 THR C O     1 
ATOM   9317  C CB    . THR C 1 245 ? 5.994   87.505 45.962  1.00 21.77  ? 245 THR C CB    1 
ATOM   9318  O OG1   . THR C 1 245 ? 4.623   87.943 46.060  1.00 20.08  ? 245 THR C OG1   1 
ATOM   9319  C CG2   . THR C 1 245 ? 6.824   88.501 46.779  1.00 23.67  ? 245 THR C CG2   1 
ATOM   9320  N N     . ILE C 1 246 ? 5.552   85.290 43.852  1.00 14.70  ? 246 ILE C N     1 
ATOM   9321  C CA    . ILE C 1 246 ? 4.614   84.433 43.123  1.00 17.34  ? 246 ILE C CA    1 
ATOM   9322  C C     . ILE C 1 246 ? 3.181   84.757 43.551  1.00 18.01  ? 246 ILE C C     1 
ATOM   9323  O O     . ILE C 1 246 ? 2.278   84.740 42.711  1.00 15.16  ? 246 ILE C O     1 
ATOM   9324  C CB    . ILE C 1 246 ? 4.915   82.948 43.368  1.00 18.16  ? 246 ILE C CB    1 
ATOM   9325  C CG1   . ILE C 1 246 ? 6.310   82.591 42.831  1.00 16.12  ? 246 ILE C CG1   1 
ATOM   9326  C CG2   . ILE C 1 246 ? 3.850   82.019 42.786  1.00 15.39  ? 246 ILE C CG2   1 
ATOM   9327  C CD1   . ILE C 1 246 ? 6.432   82.678 41.326  1.00 21.31  ? 246 ILE C CD1   1 
ATOM   9328  N N     . LYS C 1 247 ? 2.939   85.033 44.840  1.00 15.70  ? 247 LYS C N     1 
ATOM   9329  C CA    . LYS C 1 247 ? 1.578   85.391 45.263  1.00 19.29  ? 247 LYS C CA    1 
ATOM   9330  C C     . LYS C 1 247 ? 1.072   86.704 44.665  1.00 18.66  ? 247 LYS C C     1 
ATOM   9331  O O     . LYS C 1 247 ? -0.141  86.815 44.437  1.00 17.32  ? 247 LYS C O     1 
ATOM   9332  C CB    . LYS C 1 247 ? 1.472   85.471 46.788  1.00 14.24  ? 247 LYS C CB    1 
ATOM   9333  C CG    . LYS C 1 247 ? 1.451   84.046 47.383  1.00 17.23  ? 247 LYS C CG    1 
ATOM   9334  C CD    . LYS C 1 247 ? 1.513   84.167 48.900  1.00 21.97  ? 247 LYS C CD    1 
ATOM   9335  C CE    . LYS C 1 247 ? 1.365   82.785 49.564  1.00 18.13  ? 247 LYS C CE    1 
ATOM   9336  N NZ    . LYS C 1 247 ? 1.108   83.030 51.017  1.00 25.18  ? 247 LYS C NZ    1 
ATOM   9337  N N     . GLU C 1 248 ? 1.912   87.693 44.456  1.00 16.36  ? 248 GLU C N     1 
ATOM   9338  C CA    . GLU C 1 248 ? 1.522   88.918 43.782  1.00 17.35  ? 248 GLU C CA    1 
ATOM   9339  C C     . GLU C 1 248 ? 1.072   88.615 42.363  1.00 16.36  ? 248 GLU C C     1 
ATOM   9340  O O     . GLU C 1 248 ? 0.041   89.108 41.926  1.00 18.87  ? 248 GLU C O     1 
ATOM   9341  C CB    . GLU C 1 248 ? 2.689   89.929 43.703  1.00 16.35  ? 248 GLU C CB    1 
ATOM   9342  C CG    . GLU C 1 248 ? 2.857   90.557 45.076  1.00 25.06  ? 248 GLU C CG    1 
ATOM   9343  C CD    . GLU C 1 248 ? 4.173   91.290 45.242  1.00 28.17  ? 248 GLU C CD    1 
ATOM   9344  O OE1   . GLU C 1 248 ? 5.229   90.997 44.660  1.00 33.46  ? 248 GLU C OE1   1 
ATOM   9345  O OE2   . GLU C 1 248 ? 4.073   92.243 46.025  1.00 40.25  ? 248 GLU C OE2   1 
ATOM   9346  N N     . VAL C 1 249 ? 1.838   87.767 41.672  1.00 14.52  ? 249 VAL C N     1 
ATOM   9347  C CA    . VAL C 1 249 ? 1.495   87.408 40.296  1.00 15.93  ? 249 VAL C CA    1 
ATOM   9348  C C     . VAL C 1 249 ? 0.137   86.720 40.330  1.00 18.43  ? 249 VAL C C     1 
ATOM   9349  O O     . VAL C 1 249 ? -0.733  87.018 39.511  1.00 16.60  ? 249 VAL C O     1 
ATOM   9350  C CB    . VAL C 1 249 ? 2.544   86.466 39.670  1.00 15.55  ? 249 VAL C CB    1 
ATOM   9351  C CG1   . VAL C 1 249 ? 2.048   85.904 38.336  1.00 13.35  ? 249 VAL C CG1   1 
ATOM   9352  C CG2   . VAL C 1 249 ? 3.888   87.165 39.458  1.00 17.42  ? 249 VAL C CG2   1 
ATOM   9353  N N     . ILE C 1 250 ? -0.046  85.759 41.227  1.00 15.92  ? 250 ILE C N     1 
ATOM   9354  C CA    . ILE C 1 250 ? -1.307  85.013 41.304  1.00 14.23  ? 250 ILE C CA    1 
ATOM   9355  C C     . ILE C 1 250 ? -2.430  85.998 41.570  1.00 13.47  ? 250 ILE C C     1 
ATOM   9356  O O     . ILE C 1 250 ? -3.472  85.925 40.943  1.00 15.75  ? 250 ILE C O     1 
ATOM   9357  C CB    . ILE C 1 250 ? -1.281  83.925 42.418  1.00 14.02  ? 250 ILE C CB    1 
ATOM   9358  C CG1   . ILE C 1 250 ? -0.364  82.767 41.974  1.00 11.54  ? 250 ILE C CG1   1 
ATOM   9359  C CG2   . ILE C 1 250 ? -2.673  83.372 42.724  1.00 10.30  ? 250 ILE C CG2   1 
ATOM   9360  C CD1   . ILE C 1 250 ? 0.061   81.893 43.148  1.00 14.43  ? 250 ILE C CD1   1 
ATOM   9361  N N     . PHE C 1 251 ? -2.228  86.900 42.528  1.00 13.82  ? 251 PHE C N     1 
ATOM   9362  C CA    . PHE C 1 251 ? -3.267  87.866 42.856  1.00 18.13  ? 251 PHE C CA    1 
ATOM   9363  C C     . PHE C 1 251 ? -3.695  88.664 41.631  1.00 22.10  ? 251 PHE C C     1 
ATOM   9364  O O     . PHE C 1 251 ? -4.903  88.880 41.465  1.00 18.44  ? 251 PHE C O     1 
ATOM   9365  C CB    . PHE C 1 251 ? -2.757  88.790 43.980  1.00 18.69  ? 251 PHE C CB    1 
ATOM   9366  C CG    . PHE C 1 251 ? -3.859  89.566 44.660  1.00 20.68  ? 251 PHE C CG    1 
ATOM   9367  C CD1   . PHE C 1 251 ? -4.567  88.973 45.690  1.00 26.16  ? 251 PHE C CD1   1 
ATOM   9368  C CD2   . PHE C 1 251 ? -4.182  90.854 44.277  1.00 23.22  ? 251 PHE C CD2   1 
ATOM   9369  C CE1   . PHE C 1 251 ? -5.579  89.663 46.351  1.00 34.86  ? 251 PHE C CE1   1 
ATOM   9370  C CE2   . PHE C 1 251 ? -5.197  91.547 44.926  1.00 26.64  ? 251 PHE C CE2   1 
ATOM   9371  C CZ    . PHE C 1 251 ? -5.898  90.951 45.962  1.00 29.56  ? 251 PHE C CZ    1 
ATOM   9372  N N     . ASP C 1 252 ? -2.763  89.103 40.773  1.00 17.66  ? 252 ASP C N     1 
ATOM   9373  C CA    . ASP C 1 252 ? -3.147  89.842 39.583  1.00 19.29  ? 252 ASP C CA    1 
ATOM   9374  C C     . ASP C 1 252 ? -3.863  88.981 38.556  1.00 16.04  ? 252 ASP C C     1 
ATOM   9375  O O     . ASP C 1 252 ? -4.806  89.422 37.885  1.00 16.31  ? 252 ASP C O     1 
ATOM   9376  C CB    . ASP C 1 252 ? -1.918  90.426 38.858  1.00 19.76  ? 252 ASP C CB    1 
ATOM   9377  C CG    . ASP C 1 252 ? -1.535  91.769 39.431  1.00 22.17  ? 252 ASP C CG    1 
ATOM   9378  O OD1   . ASP C 1 252 ? -2.192  92.192 40.400  1.00 21.13  ? 252 ASP C OD1   1 
ATOM   9379  O OD2   . ASP C 1 252 ? -0.554  92.352 38.948  1.00 27.19  ? 252 ASP C OD2   1 
ATOM   9380  N N     . MET C 1 253 ? -3.379  87.742 38.387  1.00 14.40  ? 253 MET C N     1 
ATOM   9381  C CA    . MET C 1 253 ? -4.005  86.851 37.416  1.00 13.90  ? 253 MET C CA    1 
ATOM   9382  C C     . MET C 1 253 ? -5.509  86.734 37.653  1.00 17.10  ? 253 MET C C     1 
ATOM   9383  O O     . MET C 1 253 ? -6.323  86.638 36.701  1.00 17.75  ? 253 MET C O     1 
ATOM   9384  C CB    . MET C 1 253 ? -3.424  85.435 37.569  1.00 16.03  ? 253 MET C CB    1 
ATOM   9385  C CG    . MET C 1 253 ? -2.126  85.159 36.809  1.00 19.36  ? 253 MET C CG    1 
ATOM   9386  S SD    . MET C 1 253 ? -1.441  83.547 37.253  1.00 18.90  ? 253 MET C SD    1 
ATOM   9387  C CE    . MET C 1 253 ? -2.567  82.387 36.539  1.00 16.76  ? 253 MET C CE    1 
ATOM   9388  N N     . TYR C 1 254 ? -5.894  86.611 38.930  1.00 14.53  ? 254 TYR C N     1 
ATOM   9389  C CA    . TYR C 1 254 ? -7.289  86.347 39.298  1.00 15.09  ? 254 TYR C CA    1 
ATOM   9390  C C     . TYR C 1 254 ? -8.144  87.588 39.266  1.00 15.54  ? 254 TYR C C     1 
ATOM   9391  O O     . TYR C 1 254 ? -9.374  87.538 39.288  1.00 16.91  ? 254 TYR C O     1 
ATOM   9392  C CB    . TYR C 1 254 ? -7.325  85.541 40.631  1.00 11.52  ? 254 TYR C CB    1 
ATOM   9393  C CG    . TYR C 1 254 ? -6.949  84.117 40.223  1.00 13.44  ? 254 TYR C CG    1 
ATOM   9394  C CD1   . TYR C 1 254 ? -7.898  83.236 39.782  1.00 10.59  ? 254 TYR C CD1   1 
ATOM   9395  C CD2   . TYR C 1 254 ? -5.614  83.735 40.218  1.00 11.09  ? 254 TYR C CD2   1 
ATOM   9396  C CE1   . TYR C 1 254 ? -7.566  81.960 39.353  1.00 11.35  ? 254 TYR C CE1   1 
ATOM   9397  C CE2   . TYR C 1 254 ? -5.287  82.461 39.791  1.00 11.67  ? 254 TYR C CE2   1 
ATOM   9398  C CZ    . TYR C 1 254 ? -6.230  81.587 39.390  1.00 12.34  ? 254 TYR C CZ    1 
ATOM   9399  O OH    . TYR C 1 254 ? -5.886  80.323 38.972  1.00 14.13  ? 254 TYR C OH    1 
ATOM   9400  N N     . LYS C 1 255 ? -7.515  88.741 39.015  1.00 14.37  ? 255 LYS C N     1 
ATOM   9401  C CA    . LYS C 1 255 ? -8.288  89.956 38.698  1.00 20.09  ? 255 LYS C CA    1 
ATOM   9402  C C     . LYS C 1 255 ? -8.979  89.754 37.341  1.00 17.90  ? 255 LYS C C     1 
ATOM   9403  O O     . LYS C 1 255 ? -9.881  90.483 36.992  1.00 19.32  ? 255 LYS C O     1 
ATOM   9404  C CB    . LYS C 1 255 ? -7.368  91.166 38.563  1.00 21.87  ? 255 LYS C CB    1 
ATOM   9405  C CG    . LYS C 1 255 ? -7.035  91.772 39.914  1.00 22.88  ? 255 LYS C CG    1 
ATOM   9406  C CD    . LYS C 1 255 ? -5.988  92.860 39.848  1.00 29.18  ? 255 LYS C CD    1 
ATOM   9407  C CE    . LYS C 1 255 ? -5.682  93.354 41.265  1.00 38.06  ? 255 LYS C CE    1 
ATOM   9408  N NZ    . LYS C 1 255 ? -4.302  93.895 41.347  1.00 43.33  ? 255 LYS C NZ    1 
ATOM   9409  N N     . TYR C 1 256 ? -8.551  88.810 36.498  1.00 15.66  ? 256 TYR C N     1 
ATOM   9410  C CA    . TYR C 1 256 ? -9.050  88.576 35.168  1.00 15.67  ? 256 TYR C CA    1 
ATOM   9411  C C     . TYR C 1 256 ? -9.857  87.327 35.018  1.00 16.97  ? 256 TYR C C     1 
ATOM   9412  O O     . TYR C 1 256 ? -9.841  86.690 33.964  1.00 18.16  ? 256 TYR C O     1 
ATOM   9413  C CB    . TYR C 1 256 ? -7.867  88.567 34.123  1.00 17.13  ? 256 TYR C CB    1 
ATOM   9414  C CG    . TYR C 1 256 ? -7.048  89.826 34.379  1.00 18.61  ? 256 TYR C CG    1 
ATOM   9415  C CD1   . TYR C 1 256 ? -7.638  91.075 34.340  1.00 20.13  ? 256 TYR C CD1   1 
ATOM   9416  C CD2   . TYR C 1 256 ? -5.704  89.745 34.710  1.00 21.48  ? 256 TYR C CD2   1 
ATOM   9417  C CE1   . TYR C 1 256 ? -6.914  92.229 34.599  1.00 22.55  ? 256 TYR C CE1   1 
ATOM   9418  C CE2   . TYR C 1 256 ? -4.965  90.884 34.973  1.00 24.52  ? 256 TYR C CE2   1 
ATOM   9419  C CZ    . TYR C 1 256 ? -5.576  92.112 34.901  1.00 24.41  ? 256 TYR C CZ    1 
ATOM   9420  O OH    . TYR C 1 256 ? -4.833  93.232 35.184  1.00 31.57  ? 256 TYR C OH    1 
ATOM   9421  N N     . ALA C 1 257 ? -10.694 87.025 36.017  1.00 14.81  ? 257 ALA C N     1 
ATOM   9422  C CA    . ALA C 1 257 ? -11.668 85.960 35.878  1.00 14.42  ? 257 ALA C CA    1 
ATOM   9423  C C     . ALA C 1 257 ? -12.814 86.264 36.860  1.00 14.58  ? 257 ALA C C     1 
ATOM   9424  O O     . ALA C 1 257 ? -12.602 87.116 37.734  1.00 14.45  ? 257 ALA C O     1 
ATOM   9425  C CB    . ALA C 1 257 ? -11.097 84.571 36.063  1.00 13.33  ? 257 ALA C CB    1 
ATOM   9426  N N     . ASP C 1 258 ? -13.935 85.609 36.690  1.00 15.78  ? 258 ASP C N     1 
ATOM   9427  C CA    . ASP C 1 258 ? -15.062 85.834 37.621  1.00 16.12  ? 258 ASP C CA    1 
ATOM   9428  C C     . ASP C 1 258 ? -15.202 84.654 38.590  1.00 17.36  ? 258 ASP C C     1 
ATOM   9429  O O     . ASP C 1 258 ? -15.988 84.668 39.531  1.00 14.71  ? 258 ASP C O     1 
ATOM   9430  C CB    . ASP C 1 258 ? -16.378 85.925 36.806  1.00 16.57  ? 258 ASP C CB    1 
ATOM   9431  C CG    . ASP C 1 258 ? -16.284 87.153 35.872  1.00 15.92  ? 258 ASP C CG    1 
ATOM   9432  O OD1   . ASP C 1 258 ? -16.080 88.260 36.395  1.00 20.29  ? 258 ASP C OD1   1 
ATOM   9433  O OD2   . ASP C 1 258 ? -16.325 86.914 34.663  1.00 17.29  ? 258 ASP C OD2   1 
ATOM   9434  N N     . ALA C 1 259 ? -14.575 83.539 38.247  1.00 14.47  ? 259 ALA C N     1 
ATOM   9435  C CA    . ALA C 1 259 ? -14.622 82.306 38.991  1.00 17.18  ? 259 ALA C CA    1 
ATOM   9436  C C     . ALA C 1 259 ? -13.416 81.440 38.629  1.00 16.50  ? 259 ALA C C     1 
ATOM   9437  O O     . ALA C 1 259 ? -12.743 81.671 37.631  1.00 16.69  ? 259 ALA C O     1 
ATOM   9438  C CB    . ALA C 1 259 ? -15.869 81.478 38.639  1.00 11.81  ? 259 ALA C CB    1 
ATOM   9439  N N     . LEU C 1 260 ? -13.233 80.365 39.385  1.00 13.13  ? 260 LEU C N     1 
ATOM   9440  C CA    . LEU C 1 260 ? -12.199 79.406 39.029  1.00 11.38  ? 260 LEU C CA    1 
ATOM   9441  C C     . LEU C 1 260 ? -12.739 78.021 39.273  1.00 10.60  ? 260 LEU C C     1 
ATOM   9442  O O     . LEU C 1 260 ? -13.583 77.795 40.163  1.00 13.02  ? 260 LEU C O     1 
ATOM   9443  C CB    . LEU C 1 260 ? -10.907 79.707 39.779  1.00 9.65   ? 260 LEU C CB    1 
ATOM   9444  C CG    . LEU C 1 260 ? -10.912 79.473 41.292  1.00 15.53  ? 260 LEU C CG    1 
ATOM   9445  C CD1   . LEU C 1 260 ? -10.722 78.002 41.633  1.00 9.67   ? 260 LEU C CD1   1 
ATOM   9446  C CD2   . LEU C 1 260 ? -9.845  80.325 41.944  1.00 13.73  ? 260 LEU C CD2   1 
ATOM   9447  N N     . THR C 1 261 ? -12.192 77.088 38.507  1.00 8.76   ? 261 THR C N     1 
ATOM   9448  C CA    . THR C 1 261 ? -12.446 75.669 38.723  1.00 9.71   ? 261 THR C CA    1 
ATOM   9449  C C     . THR C 1 261 ? -11.023 75.138 38.961  1.00 15.49  ? 261 THR C C     1 
ATOM   9450  O O     . THR C 1 261 ? -10.106 75.641 38.308  1.00 12.95  ? 261 THR C O     1 
ATOM   9451  C CB    . THR C 1 261 ? -13.072 74.892 37.567  1.00 15.63  ? 261 THR C CB    1 
ATOM   9452  O OG1   . THR C 1 261 ? -12.353 75.266 36.373  1.00 16.81  ? 261 THR C OG1   1 
ATOM   9453  C CG2   . THR C 1 261 ? -14.543 75.250 37.409  1.00 14.25  ? 261 THR C CG2   1 
ATOM   9454  N N     . MET C 1 262 ? -10.843 74.161 39.845  1.00 12.22  ? 262 MET C N     1 
ATOM   9455  C CA    . MET C 1 262 ? -9.453  73.769 40.067  1.00 10.70  ? 262 MET C CA    1 
ATOM   9456  C C     . MET C 1 262 ? -9.342  72.318 40.466  1.00 11.88  ? 262 MET C C     1 
ATOM   9457  O O     . MET C 1 262 ? -10.096 71.863 41.332  1.00 12.58  ? 262 MET C O     1 
ATOM   9458  C CB    . MET C 1 262 ? -8.915  74.651 41.227  1.00 8.51   ? 262 MET C CB    1 
ATOM   9459  C CG    . MET C 1 262 ? -7.469  74.251 41.568  1.00 17.82  ? 262 MET C CG    1 
ATOM   9460  S SD    . MET C 1 262 ? -6.885  74.886 43.110  1.00 19.07  ? 262 MET C SD    1 
ATOM   9461  C CE    . MET C 1 262 ? -6.671  76.620 42.883  1.00 16.11  ? 262 MET C CE    1 
ATOM   9462  N N     . SER C 1 263 ? -8.434  71.617 39.794  1.00 10.29  ? 263 SER C N     1 
ATOM   9463  C CA    . SER C 1 263 ? -8.039  70.300 40.188  1.00 10.98  ? 263 SER C CA    1 
ATOM   9464  C C     . SER C 1 263 ? -6.898  70.554 41.194  1.00 15.35  ? 263 SER C C     1 
ATOM   9465  O O     . SER C 1 263 ? -5.821  71.022 40.777  1.00 13.06  ? 263 SER C O     1 
ATOM   9466  C CB    . SER C 1 263 ? -7.457  69.478 39.042  1.00 7.69   ? 263 SER C CB    1 
ATOM   9467  O OG    . SER C 1 263 ? -7.025  68.202 39.522  1.00 11.07  ? 263 SER C OG    1 
ATOM   9468  N N     . ALA C 1 264 ? -7.102  70.237 42.453  1.00 12.27  ? 264 ALA C N     1 
ATOM   9469  C CA    . ALA C 1 264 ? -6.062  70.441 43.464  1.00 11.11  ? 264 ALA C CA    1 
ATOM   9470  C C     . ALA C 1 264 ? -5.078  69.302 43.454  1.00 7.72   ? 264 ALA C C     1 
ATOM   9471  O O     . ALA C 1 264 ? -4.063  69.264 44.165  1.00 10.87  ? 264 ALA C O     1 
ATOM   9472  C CB    . ALA C 1 264 ? -6.659  70.658 44.864  1.00 11.06  ? 264 ALA C CB    1 
ATOM   9473  N N     . LYS C 1 265 ? -5.300  68.317 42.585  1.00 5.85   ? 265 LYS C N     1 
ATOM   9474  C CA    . LYS C 1 265 ? -4.442  67.200 42.323  1.00 9.67   ? 265 LYS C CA    1 
ATOM   9475  C C     . LYS C 1 265 ? -3.209  67.615 41.511  1.00 8.83   ? 265 LYS C C     1 
ATOM   9476  O O     . LYS C 1 265 ? -2.405  66.761 41.245  1.00 11.26  ? 265 LYS C O     1 
ATOM   9477  C CB    . LYS C 1 265 ? -5.178  66.067 41.579  1.00 7.98   ? 265 LYS C CB    1 
ATOM   9478  C CG    . LYS C 1 265 ? -6.408  65.590 42.399  1.00 10.32  ? 265 LYS C CG    1 
ATOM   9479  C CD    . LYS C 1 265 ? -7.235  64.694 41.484  1.00 9.38   ? 265 LYS C CD    1 
ATOM   9480  C CE    . LYS C 1 265 ? -6.656  63.326 41.318  1.00 8.81   ? 265 LYS C CE    1 
ATOM   9481  N NZ    . LYS C 1 265 ? -7.496  62.413 40.495  1.00 12.67  ? 265 LYS C NZ    1 
HETATM 9482  N N1    . LLP C 1 266 ? -8.701  71.050 33.755  1.00 13.84  ? 266 LLP C N1    1 
HETATM 9483  C C2    . LLP C 1 266 ? -7.319  71.022 33.675  1.00 15.06  ? 266 LLP C C2    1 
HETATM 9484  C "C2'" . LLP C 1 266 ? -6.539  72.141 32.956  1.00 16.79  ? 266 LLP C "C2'" 1 
HETATM 9485  C C3    . LLP C 1 266 ? -6.658  69.956 34.291  1.00 19.51  ? 266 LLP C C3    1 
HETATM 9486  O O3    . LLP C 1 266 ? -5.391  69.903 34.224  1.00 15.61  ? 266 LLP C O3    1 
HETATM 9487  C C4    . LLP C 1 266 ? -7.322  68.903 35.003  1.00 15.75  ? 266 LLP C C4    1 
HETATM 9488  C "C4'" . LLP C 1 266 ? -6.612  67.784 35.646  1.00 21.79  ? 266 LLP C "C4'" 1 
HETATM 9489  C C5    . LLP C 1 266 ? -8.743  68.998 34.991  1.00 18.80  ? 266 LLP C C5    1 
HETATM 9490  C C6    . LLP C 1 266 ? -9.374  70.081 34.382  1.00 13.89  ? 266 LLP C C6    1 
HETATM 9491  C "C5'" . LLP C 1 266 ? -9.596  67.914 35.644  1.00 12.77  ? 266 LLP C "C5'" 1 
HETATM 9492  O OP4   . LLP C 1 266 ? -9.304  67.818 37.056  1.00 16.37  ? 266 LLP C OP4   1 
HETATM 9493  P P     . LLP C 1 266 ? -9.352  66.350 37.661  1.00 13.16  ? 266 LLP C P     1 
HETATM 9494  O OP1   . LLP C 1 266 ? -10.784 65.829 37.579  1.00 12.62  ? 266 LLP C OP1   1 
HETATM 9495  O OP2   . LLP C 1 266 ? -8.961  66.509 39.119  1.00 10.75  ? 266 LLP C OP2   1 
HETATM 9496  O OP3   . LLP C 1 266 ? -8.531  65.355 36.945  1.00 9.87   ? 266 LLP C OP3   1 
HETATM 9497  N N     . LLP C 1 266 ? -3.119  68.869 41.113  1.00 8.34   ? 266 LLP C N     1 
HETATM 9498  C CA    . LLP C 1 266 ? -1.992  69.345 40.288  1.00 11.58  ? 266 LLP C CA    1 
HETATM 9499  C CB    . LLP C 1 266 ? -2.489  70.028 39.021  1.00 10.20  ? 266 LLP C CB    1 
HETATM 9500  C CG    . LLP C 1 266 ? -2.856  69.052 37.900  1.00 8.61   ? 266 LLP C CG    1 
HETATM 9501  C CD    . LLP C 1 266 ? -4.005  68.129 38.188  1.00 7.46   ? 266 LLP C CD    1 
HETATM 9502  C CE    . LLP C 1 266 ? -4.440  67.311 36.942  1.00 11.94  ? 266 LLP C CE    1 
HETATM 9503  N NZ    . LLP C 1 266 ? -5.442  68.082 36.153  1.00 17.12  ? 266 LLP C NZ    1 
HETATM 9504  C C     . LLP C 1 266 ? -1.151  70.260 41.155  1.00 10.66  ? 266 LLP C C     1 
HETATM 9505  O O     . LLP C 1 266 ? -0.420  69.707 41.992  1.00 10.67  ? 266 LLP C O     1 
ATOM   9506  N N     . ASP C 1 267 ? -1.130  71.570 40.975  1.00 8.50   ? 267 ASP C N     1 
ATOM   9507  C CA    . ASP C 1 267 ? -0.326  72.529 41.625  1.00 6.50   ? 267 ASP C CA    1 
ATOM   9508  C C     . ASP C 1 267 ? -0.419  72.552 43.135  1.00 13.76  ? 267 ASP C C     1 
ATOM   9509  O O     . ASP C 1 267 ? 0.640   72.708 43.752  1.00 11.87  ? 267 ASP C O     1 
ATOM   9510  C CB    . ASP C 1 267 ? -0.438  73.936 41.037  1.00 4.96   ? 267 ASP C CB    1 
ATOM   9511  C CG    . ASP C 1 267 ? 0.402   74.081 39.720  1.00 8.49   ? 267 ASP C CG    1 
ATOM   9512  O OD1   . ASP C 1 267 ? 0.901   73.087 39.167  1.00 9.09   ? 267 ASP C OD1   1 
ATOM   9513  O OD2   . ASP C 1 267 ? 0.573   75.216 39.309  1.00 13.05  ? 267 ASP C OD2   1 
ATOM   9514  N N     . PRO C 1 268 ? -1.557  72.361 43.755  1.00 11.85  ? 268 PRO C N     1 
ATOM   9515  C CA    . PRO C 1 268 ? -1.698  72.325 45.238  1.00 10.61  ? 268 PRO C CA    1 
ATOM   9516  C C     . PRO C 1 268 ? -1.147  71.068 45.880  1.00 10.29  ? 268 PRO C C     1 
ATOM   9517  O O     . PRO C 1 268 ? -1.254  70.815 47.093  1.00 10.98  ? 268 PRO C O     1 
ATOM   9518  C CB    . PRO C 1 268 ? -3.177  72.580 45.500  1.00 10.47  ? 268 PRO C CB    1 
ATOM   9519  C CG    . PRO C 1 268 ? -3.664  73.193 44.188  1.00 10.42  ? 268 PRO C CG    1 
ATOM   9520  C CD    . PRO C 1 268 ? -2.902  72.382 43.106  1.00 8.81   ? 268 PRO C CD    1 
ATOM   9521  N N     . LEU C 1 269 ? -0.465  70.169 45.163  1.00 8.90   ? 269 LEU C N     1 
ATOM   9522  C CA    . LEU C 1 269 ? 0.335   69.083 45.616  1.00 11.86  ? 269 LEU C CA    1 
ATOM   9523  C C     . LEU C 1 269 ? -0.436  68.015 46.369  1.00 15.63  ? 269 LEU C C     1 
ATOM   9524  O O     . LEU C 1 269 ? 0.082   67.445 47.335  1.00 14.61  ? 269 LEU C O     1 
ATOM   9525  C CB    . LEU C 1 269 ? 1.458   69.671 46.556  1.00 12.21  ? 269 LEU C CB    1 
ATOM   9526  C CG    . LEU C 1 269 ? 2.448   70.575 45.764  1.00 16.21  ? 269 LEU C CG    1 
ATOM   9527  C CD1   . LEU C 1 269 ? 3.090   71.650 46.629  1.00 10.24  ? 269 LEU C CD1   1 
ATOM   9528  C CD2   . LEU C 1 269 ? 3.563   69.743 45.144  1.00 13.55  ? 269 LEU C CD2   1 
ATOM   9529  N N     . LEU C 1 270 ? -1.651  67.723 45.914  1.00 9.32   ? 270 LEU C N     1 
ATOM   9530  C CA    . LEU C 1 270 ? -2.467  66.718 46.581  1.00 9.91   ? 270 LEU C CA    1 
ATOM   9531  C C     . LEU C 1 270 ? -2.604  65.447 45.804  1.00 9.20   ? 270 LEU C C     1 
ATOM   9532  O O     . LEU C 1 270 ? -2.264  65.397 44.596  1.00 7.87   ? 270 LEU C O     1 
ATOM   9533  C CB    . LEU C 1 270 ? -3.886  67.280 46.831  1.00 5.99   ? 270 LEU C CB    1 
ATOM   9534  C CG    . LEU C 1 270 ? -3.908  68.628 47.542  1.00 8.72   ? 270 LEU C CG    1 
ATOM   9535  C CD1   . LEU C 1 270 ? -5.355  69.088 47.756  1.00 9.74   ? 270 LEU C CD1   1 
ATOM   9536  C CD2   . LEU C 1 270 ? -3.159  68.512 48.879  1.00 5.56   ? 270 LEU C CD2   1 
ATOM   9537  N N     . ASN C 1 271 ? -3.185  64.472 46.477  1.00 4.91   ? 271 ASN C N     1 
ATOM   9538  C CA    . ASN C 1 271 ? -3.509  63.207 45.868  1.00 4.86   ? 271 ASN C CA    1 
ATOM   9539  C C     . ASN C 1 271 ? -4.991  63.153 45.437  1.00 6.51   ? 271 ASN C C     1 
ATOM   9540  O O     . ASN C 1 271 ? -5.331  62.260 44.678  1.00 9.89   ? 271 ASN C O     1 
ATOM   9541  C CB    . ASN C 1 271 ? -3.176  61.984 46.744  1.00 5.16   ? 271 ASN C CB    1 
ATOM   9542  C CG    . ASN C 1 271 ? -1.712  62.064 47.162  1.00 16.27  ? 271 ASN C CG    1 
ATOM   9543  O OD1   . ASN C 1 271 ? -1.465  62.215 48.355  1.00 8.32   ? 271 ASN C OD1   1 
ATOM   9544  N ND2   . ASN C 1 271 ? -0.792  62.078 46.202  1.00 9.99   ? 271 ASN C ND2   1 
ATOM   9545  N N     . ILE C 1 272 ? -5.794  64.101 45.906  1.00 7.48   ? 272 ILE C N     1 
ATOM   9546  C CA    . ILE C 1 272 ? -7.212  64.121 45.645  1.00 8.85   ? 272 ILE C CA    1 
ATOM   9547  C C     . ILE C 1 272 ? -7.683  65.524 45.984  1.00 10.17  ? 272 ILE C C     1 
ATOM   9548  O O     . ILE C 1 272 ? -6.968  66.203 46.727  1.00 8.77   ? 272 ILE C O     1 
ATOM   9549  C CB    . ILE C 1 272 ? -8.001  63.047 46.415  1.00 13.63  ? 272 ILE C CB    1 
ATOM   9550  C CG1   . ILE C 1 272 ? -9.418  62.850 45.849  1.00 12.27  ? 272 ILE C CG1   1 
ATOM   9551  C CG2   . ILE C 1 272 ? -8.070  63.336 47.913  1.00 8.49   ? 272 ILE C CG2   1 
ATOM   9552  C CD1   . ILE C 1 272 ? -9.403  62.296 44.415  1.00 11.66  ? 272 ILE C CD1   1 
ATOM   9553  N N     . GLY C 1 273 ? -8.759  66.025 45.365  1.00 6.79   ? 273 GLY C N     1 
ATOM   9554  C CA    . GLY C 1 273 ? -9.180  67.355 45.804  1.00 4.90   ? 273 GLY C CA    1 
ATOM   9555  C C     . GLY C 1 273 ? -9.423  68.294 44.633  1.00 11.92  ? 273 GLY C C     1 
ATOM   9556  O O     . GLY C 1 273 ? -8.722  68.310 43.597  1.00 11.97  ? 273 GLY C O     1 
ATOM   9557  N N     . GLY C 1 274 ? -10.411 69.127 44.840  1.00 10.98  ? 274 GLY C N     1 
ATOM   9558  C CA    . GLY C 1 274 ? -10.802 70.143 43.877  1.00 10.18  ? 274 GLY C CA    1 
ATOM   9559  C C     . GLY C 1 274 ? -11.463 71.309 44.591  1.00 12.73  ? 274 GLY C C     1 
ATOM   9560  O O     . GLY C 1 274 ? -11.799 71.226 45.804  1.00 12.05  ? 274 GLY C O     1 
ATOM   9561  N N     . LEU C 1 275 ? -11.742 72.319 43.785  1.00 8.46   ? 275 LEU C N     1 
ATOM   9562  C CA    . LEU C 1 275 ? -12.338 73.523 44.298  1.00 9.30   ? 275 LEU C CA    1 
ATOM   9563  C C     . LEU C 1 275 ? -13.025 74.356 43.208  1.00 14.13  ? 275 LEU C C     1 
ATOM   9564  O O     . LEU C 1 275 ? -12.524 74.435 42.071  1.00 11.02  ? 275 LEU C O     1 
ATOM   9565  C CB    . LEU C 1 275 ? -11.218 74.413 44.842  1.00 8.01   ? 275 LEU C CB    1 
ATOM   9566  C CG    . LEU C 1 275 ? -11.605 75.652 45.623  1.00 13.64  ? 275 LEU C CG    1 
ATOM   9567  C CD1   . LEU C 1 275 ? -12.334 75.292 46.916  1.00 11.95  ? 275 LEU C CD1   1 
ATOM   9568  C CD2   . LEU C 1 275 ? -10.351 76.473 45.939  1.00 14.07  ? 275 LEU C CD2   1 
ATOM   9569  N N     . VAL C 1 276 ? -14.112 74.967 43.651  1.00 12.83  ? 276 VAL C N     1 
ATOM   9570  C CA    . VAL C 1 276 ? -14.811 75.987 42.882  1.00 9.56   ? 276 VAL C CA    1 
ATOM   9571  C C     . VAL C 1 276 ? -14.678 77.254 43.722  1.00 11.28  ? 276 VAL C C     1 
ATOM   9572  O O     . VAL C 1 276 ? -15.018 77.221 44.931  1.00 13.05  ? 276 VAL C O     1 
ATOM   9573  C CB    . VAL C 1 276 ? -16.306 75.716 42.670  1.00 17.40  ? 276 VAL C CB    1 
ATOM   9574  C CG1   . VAL C 1 276 ? -16.986 76.921 41.976  1.00 13.97  ? 276 VAL C CG1   1 
ATOM   9575  C CG2   . VAL C 1 276 ? -16.532 74.472 41.845  1.00 11.31  ? 276 VAL C CG2   1 
ATOM   9576  N N     . ALA C 1 277 ? -14.222 78.351 43.148  1.00 9.42   ? 277 ALA C N     1 
ATOM   9577  C CA    . ALA C 1 277 ? -14.200 79.603 43.893  1.00 12.79  ? 277 ALA C CA    1 
ATOM   9578  C C     . ALA C 1 277 ? -14.842 80.652 42.967  1.00 16.24  ? 277 ALA C C     1 
ATOM   9579  O O     . ALA C 1 277 ? -14.646 80.653 41.750  1.00 12.14  ? 277 ALA C O     1 
ATOM   9580  C CB    . ALA C 1 277 ? -12.849 80.087 44.371  1.00 10.63  ? 277 ALA C CB    1 
ATOM   9581  N N     . ILE C 1 278 ? -15.735 81.437 43.543  1.00 15.27  ? 278 ILE C N     1 
ATOM   9582  C CA    . ILE C 1 278 ? -16.472 82.435 42.789  1.00 16.54  ? 278 ILE C CA    1 
ATOM   9583  C C     . ILE C 1 278 ? -16.087 83.780 43.378  1.00 17.65  ? 278 ILE C C     1 
ATOM   9584  O O     . ILE C 1 278 ? -16.105 83.959 44.591  1.00 16.77  ? 278 ILE C O     1 
ATOM   9585  C CB    . ILE C 1 278 ? -17.972 82.147 42.872  1.00 19.26  ? 278 ILE C CB    1 
ATOM   9586  C CG1   . ILE C 1 278 ? -18.278 80.877 42.088  1.00 17.87  ? 278 ILE C CG1   1 
ATOM   9587  C CG2   . ILE C 1 278 ? -18.790 83.353 42.383  1.00 20.52  ? 278 ILE C CG2   1 
ATOM   9588  C CD1   . ILE C 1 278 ? -19.388 80.039 42.666  1.00 22.59  ? 278 ILE C CD1   1 
ATOM   9589  N N     . ARG C 1 279 ? -15.705 84.700 42.517  1.00 15.00  ? 279 ARG C N     1 
ATOM   9590  C CA    . ARG C 1 279 ? -15.271 86.008 42.979  1.00 15.75  ? 279 ARG C CA    1 
ATOM   9591  C C     . ARG C 1 279 ? -16.354 86.752 43.745  1.00 19.07  ? 279 ARG C C     1 
ATOM   9592  O O     . ARG C 1 279 ? -16.032 87.189 44.862  1.00 17.14  ? 279 ARG C O     1 
ATOM   9593  C CB    . ARG C 1 279 ? -14.869 86.843 41.756  1.00 18.25  ? 279 ARG C CB    1 
ATOM   9594  C CG    . ARG C 1 279 ? -14.219 88.196 42.018  1.00 23.18  ? 279 ARG C CG    1 
ATOM   9595  C CD    . ARG C 1 279 ? -13.636 88.663 40.674  1.00 31.10  ? 279 ARG C CD    1 
ATOM   9596  N NE    . ARG C 1 279 ? -12.959 89.944 40.753  1.00 35.28  ? 279 ARG C NE    1 
ATOM   9597  C CZ    . ARG C 1 279 ? -12.330 90.550 39.747  1.00 42.21  ? 279 ARG C CZ    1 
ATOM   9598  N NH1   . ARG C 1 279 ? -12.261 90.006 38.538  1.00 31.97  ? 279 ARG C NH1   1 
ATOM   9599  N NH2   . ARG C 1 279 ? -11.746 91.737 39.958  1.00 41.33  ? 279 ARG C NH2   1 
ATOM   9600  N N     . ASP C 1 280 ? -17.509 87.044 43.147  1.00 18.98  ? 280 ASP C N     1 
ATOM   9601  C CA    . ASP C 1 280 ? -18.467 87.862 43.913  1.00 22.13  ? 280 ASP C CA    1 
ATOM   9602  C C     . ASP C 1 280 ? -19.911 87.656 43.478  1.00 22.72  ? 280 ASP C C     1 
ATOM   9603  O O     . ASP C 1 280 ? -20.779 88.297 44.054  1.00 25.59  ? 280 ASP C O     1 
ATOM   9604  C CB    . ASP C 1 280 ? -18.146 89.358 43.858  1.00 28.40  ? 280 ASP C CB    1 
ATOM   9605  C CG    . ASP C 1 280 ? -18.066 89.887 42.434  1.00 31.93  ? 280 ASP C CG    1 
ATOM   9606  O OD1   . ASP C 1 280 ? -18.680 89.319 41.506  1.00 34.23  ? 280 ASP C OD1   1 
ATOM   9607  O OD2   . ASP C 1 280 ? -17.320 90.868 42.229  1.00 45.43  ? 280 ASP C OD2   1 
ATOM   9608  N N     . ASN C 1 281 ? -20.208 86.782 42.561  1.00 19.72  ? 281 ASN C N     1 
ATOM   9609  C CA    . ASN C 1 281 ? -21.562 86.547 42.104  1.00 21.66  ? 281 ASN C CA    1 
ATOM   9610  C C     . ASN C 1 281 ? -22.251 85.549 43.027  1.00 22.49  ? 281 ASN C C     1 
ATOM   9611  O O     . ASN C 1 281 ? -22.144 84.320 42.949  1.00 20.52  ? 281 ASN C O     1 
ATOM   9612  C CB    . ASN C 1 281 ? -21.575 86.093 40.651  1.00 23.83  ? 281 ASN C CB    1 
ATOM   9613  C CG    . ASN C 1 281 ? -22.965 86.172 40.035  1.00 28.64  ? 281 ASN C CG    1 
ATOM   9614  O OD1   . ASN C 1 281 ? -23.955 85.721 40.609  1.00 25.12  ? 281 ASN C OD1   1 
ATOM   9615  N ND2   . ASN C 1 281 ? -23.030 86.732 38.832  1.00 24.38  ? 281 ASN C ND2   1 
ATOM   9616  N N     . GLU C 1 282 ? -23.016 86.090 43.964  1.00 22.17  ? 282 GLU C N     1 
ATOM   9617  C CA    . GLU C 1 282 ? -23.704 85.289 44.966  1.00 25.24  ? 282 GLU C CA    1 
ATOM   9618  C C     . GLU C 1 282 ? -24.759 84.370 44.410  1.00 23.19  ? 282 GLU C C     1 
ATOM   9619  O O     . GLU C 1 282 ? -24.986 83.244 44.886  1.00 23.33  ? 282 GLU C O     1 
ATOM   9620  C CB    . GLU C 1 282 ? -24.272 86.204 46.062  1.00 32.30  ? 282 GLU C CB    1 
ATOM   9621  C CG    . GLU C 1 282 ? -24.811 85.384 47.223  1.00 48.84  ? 282 GLU C CG    1 
ATOM   9622  C CD    . GLU C 1 282 ? -25.316 86.293 48.331  1.00 58.00  ? 282 GLU C CD    1 
ATOM   9623  O OE1   . GLU C 1 282 ? -26.268 87.051 48.056  1.00 64.74  ? 282 GLU C OE1   1 
ATOM   9624  O OE2   . GLU C 1 282 ? -24.740 86.225 49.436  1.00 66.05  ? 282 GLU C OE2   1 
ATOM   9625  N N     . GLU C 1 283 ? -25.422 84.818 43.349  1.00 25.33  ? 283 GLU C N     1 
ATOM   9626  C CA    . GLU C 1 283 ? -26.439 84.007 42.687  1.00 23.18  ? 283 GLU C CA    1 
ATOM   9627  C C     . GLU C 1 283 ? -25.807 82.759 42.066  1.00 22.37  ? 283 GLU C C     1 
ATOM   9628  O O     . GLU C 1 283 ? -26.372 81.669 42.148  1.00 20.43  ? 283 GLU C O     1 
ATOM   9629  C CB    . GLU C 1 283 ? -27.142 84.866 41.630  1.00 30.69  ? 283 GLU C CB    1 
ATOM   9630  C CG    . GLU C 1 283 ? -28.280 84.148 40.925  1.00 43.84  ? 283 GLU C CG    1 
ATOM   9631  C CD    . GLU C 1 283 ? -29.115 85.067 40.044  1.00 53.98  ? 283 GLU C CD    1 
ATOM   9632  O OE1   . GLU C 1 283 ? -28.979 86.308 40.130  1.00 55.55  ? 283 GLU C OE1   1 
ATOM   9633  O OE2   . GLU C 1 283 ? -29.918 84.519 39.255  1.00 58.29  ? 283 GLU C OE2   1 
ATOM   9634  N N     . ILE C 1 284 ? -24.660 82.911 41.403  1.00 20.34  ? 284 ILE C N     1 
ATOM   9635  C CA    . ILE C 1 284 ? -24.003 81.733 40.806  1.00 18.73  ? 284 ILE C CA    1 
ATOM   9636  C C     . ILE C 1 284 ? -23.580 80.774 41.932  1.00 12.69  ? 284 ILE C C     1 
ATOM   9637  O O     . ILE C 1 284 ? -23.787 79.564 41.889  1.00 16.02  ? 284 ILE C O     1 
ATOM   9638  C CB    . ILE C 1 284 ? -22.759 82.165 39.986  1.00 21.11  ? 284 ILE C CB    1 
ATOM   9639  C CG1   . ILE C 1 284 ? -23.192 83.019 38.789  1.00 27.90  ? 284 ILE C CG1   1 
ATOM   9640  C CG2   . ILE C 1 284 ? -21.920 80.970 39.539  1.00 12.54  ? 284 ILE C CG2   1 
ATOM   9641  C CD1   . ILE C 1 284 ? -23.987 82.298 37.738  1.00 35.35  ? 284 ILE C CD1   1 
ATOM   9642  N N     . PHE C 1 285 ? -23.053 81.353 43.004  1.00 17.74  ? 285 PHE C N     1 
ATOM   9643  C CA    . PHE C 1 285 ? -22.641 80.554 44.175  1.00 19.64  ? 285 PHE C CA    1 
ATOM   9644  C C     . PHE C 1 285 ? -23.788 79.736 44.739  1.00 21.43  ? 285 PHE C C     1 
ATOM   9645  O O     . PHE C 1 285 ? -23.741 78.500 44.905  1.00 19.72  ? 285 PHE C O     1 
ATOM   9646  C CB    . PHE C 1 285 ? -22.130 81.529 45.227  1.00 18.45  ? 285 PHE C CB    1 
ATOM   9647  C CG    . PHE C 1 285 ? -21.840 80.912 46.571  1.00 19.79  ? 285 PHE C CG    1 
ATOM   9648  C CD1   . PHE C 1 285 ? -20.876 79.938 46.700  1.00 18.88  ? 285 PHE C CD1   1 
ATOM   9649  C CD2   . PHE C 1 285 ? -22.555 81.324 47.690  1.00 19.05  ? 285 PHE C CD2   1 
ATOM   9650  C CE1   . PHE C 1 285 ? -20.595 79.368 47.945  1.00 17.51  ? 285 PHE C CE1   1 
ATOM   9651  C CE2   . PHE C 1 285 ? -22.281 80.776 48.939  1.00 23.35  ? 285 PHE C CE2   1 
ATOM   9652  C CZ    . PHE C 1 285 ? -21.292 79.813 49.053  1.00 19.65  ? 285 PHE C CZ    1 
ATOM   9653  N N     . THR C 1 286 ? -24.922 80.430 44.928  1.00 20.09  ? 286 THR C N     1 
ATOM   9654  C CA    . THR C 1 286 ? -26.126 79.762 45.434  1.00 19.54  ? 286 THR C CA    1 
ATOM   9655  C C     . THR C 1 286 ? -26.593 78.639 44.557  1.00 17.59  ? 286 THR C C     1 
ATOM   9656  O O     . THR C 1 286 ? -26.847 77.531 45.042  1.00 20.55  ? 286 THR C O     1 
ATOM   9657  C CB    . THR C 1 286 ? -27.281 80.791 45.587  1.00 22.48  ? 286 THR C CB    1 
ATOM   9658  O OG1   . THR C 1 286 ? -26.787 81.749 46.521  1.00 26.43  ? 286 THR C OG1   1 
ATOM   9659  C CG2   . THR C 1 286 ? -28.526 80.101 46.097  1.00 27.96  ? 286 THR C CG2   1 
ATOM   9660  N N     . LEU C 1 287 ? -26.618 78.867 43.241  1.00 18.47  ? 287 LEU C N     1 
ATOM   9661  C CA    . LEU C 1 287 ? -27.046 77.801 42.337  1.00 15.86  ? 287 LEU C CA    1 
ATOM   9662  C C     . LEU C 1 287 ? -26.017 76.682 42.319  1.00 16.00  ? 287 LEU C C     1 
ATOM   9663  O O     . LEU C 1 287 ? -26.382 75.508 42.094  1.00 15.38  ? 287 LEU C O     1 
ATOM   9664  C CB    . LEU C 1 287 ? -27.235 78.370 40.918  1.00 21.26  ? 287 LEU C CB    1 
ATOM   9665  C CG    . LEU C 1 287 ? -28.433 79.334 40.755  1.00 32.29  ? 287 LEU C CG    1 
ATOM   9666  C CD1   . LEU C 1 287 ? -28.402 80.089 39.428  1.00 27.95  ? 287 LEU C CD1   1 
ATOM   9667  C CD2   . LEU C 1 287 ? -29.733 78.561 40.895  1.00 24.92  ? 287 LEU C CD2   1 
ATOM   9668  N N     . ALA C 1 288 ? -24.728 77.047 42.406  1.00 15.70  ? 288 ALA C N     1 
ATOM   9669  C CA    . ALA C 1 288 ? -23.694 75.979 42.332  1.00 17.74  ? 288 ALA C CA    1 
ATOM   9670  C C     . ALA C 1 288 ? -23.777 75.120 43.608  1.00 15.30  ? 288 ALA C C     1 
ATOM   9671  O O     . ALA C 1 288 ? -23.662 73.893 43.567  1.00 15.21  ? 288 ALA C O     1 
ATOM   9672  C CB    . ALA C 1 288 ? -22.321 76.611 42.149  1.00 11.37  ? 288 ALA C CB    1 
ATOM   9673  N N     . ARG C 1 289 ? -24.069 75.761 44.753  1.00 13.87  ? 289 ARG C N     1 
ATOM   9674  C CA    . ARG C 1 289 ? -24.294 75.004 45.988  1.00 17.01  ? 289 ARG C CA    1 
ATOM   9675  C C     . ARG C 1 289 ? -25.449 74.041 45.879  1.00 21.04  ? 289 ARG C C     1 
ATOM   9676  O O     . ARG C 1 289 ? -25.367 72.883 46.323  1.00 18.29  ? 289 ARG C O     1 
ATOM   9677  C CB    . ARG C 1 289 ? -24.566 75.972 47.154  1.00 17.37  ? 289 ARG C CB    1 
ATOM   9678  C CG    . ARG C 1 289 ? -23.283 76.401 47.862  1.00 17.25  ? 289 ARG C CG    1 
ATOM   9679  C CD    . ARG C 1 289 ? -23.662 77.137 49.145  1.00 21.51  ? 289 ARG C CD    1 
ATOM   9680  N NE    . ARG C 1 289 ? -22.555 77.110 50.086  1.00 21.84  ? 289 ARG C NE    1 
ATOM   9681  C CZ    . ARG C 1 289 ? -22.575 77.562 51.332  1.00 29.46  ? 289 ARG C CZ    1 
ATOM   9682  N NH1   . ARG C 1 289 ? -23.687 78.126 51.823  1.00 23.20  ? 289 ARG C NH1   1 
ATOM   9683  N NH2   . ARG C 1 289 ? -21.488 77.459 52.065  1.00 19.89  ? 289 ARG C NH2   1 
ATOM   9684  N N     . GLN C 1 290 ? -26.557 74.437 45.204  1.00 19.87  ? 290 GLN C N     1 
ATOM   9685  C CA    . GLN C 1 290 ? -27.688 73.518 45.066  1.00 18.66  ? 290 GLN C CA    1 
ATOM   9686  C C     . GLN C 1 290 ? -27.291 72.289 44.259  1.00 17.67  ? 290 GLN C C     1 
ATOM   9687  O O     . GLN C 1 290 ? -27.705 71.152 44.533  1.00 20.14  ? 290 GLN C O     1 
ATOM   9688  C CB    . GLN C 1 290 ? -28.848 74.218 44.329  1.00 18.36  ? 290 GLN C CB    1 
ATOM   9689  C CG    . GLN C 1 290 ? -29.320 75.401 45.177  1.00 35.09  ? 290 GLN C CG    1 
ATOM   9690  C CD    . GLN C 1 290 ? -30.459 76.176 44.526  1.00 43.74  ? 290 GLN C CD    1 
ATOM   9691  O OE1   . GLN C 1 290 ? -30.989 75.764 43.489  1.00 43.39  ? 290 GLN C OE1   1 
ATOM   9692  N NE2   . GLN C 1 290 ? -30.804 77.281 45.178  1.00 38.16  ? 290 GLN C NE2   1 
ATOM   9693  N N     . ARG C 1 291 ? -26.473 72.500 43.216  1.00 15.44  ? 291 ARG C N     1 
ATOM   9694  C CA    . ARG C 1 291 ? -26.026 71.333 42.453  1.00 16.11  ? 291 ARG C CA    1 
ATOM   9695  C C     . ARG C 1 291 ? -24.948 70.538 43.230  1.00 13.54  ? 291 ARG C C     1 
ATOM   9696  O O     . ARG C 1 291 ? -24.844 69.322 43.054  1.00 13.84  ? 291 ARG C O     1 
ATOM   9697  C CB    . ARG C 1 291 ? -25.424 71.805 41.113  1.00 17.17  ? 291 ARG C CB    1 
ATOM   9698  C CG    . ARG C 1 291 ? -25.227 70.598 40.186  1.00 21.19  ? 291 ARG C CG    1 
ATOM   9699  C CD    . ARG C 1 291 ? -25.059 71.084 38.737  1.00 18.44  ? 291 ARG C CD    1 
ATOM   9700  N NE    . ARG C 1 291 ? -24.574 69.943 37.958  1.00 16.12  ? 291 ARG C NE    1 
ATOM   9701  C CZ    . ARG C 1 291 ? -25.361 69.066 37.371  1.00 24.49  ? 291 ARG C CZ    1 
ATOM   9702  N NH1   . ARG C 1 291 ? -26.685 69.196 37.456  1.00 23.50  ? 291 ARG C NH1   1 
ATOM   9703  N NH2   . ARG C 1 291 ? -24.786 68.082 36.697  1.00 15.83  ? 291 ARG C NH2   1 
ATOM   9704  N N     . CYS C 1 292 ? -24.140 71.208 44.045  1.00 13.82  ? 292 CYS C N     1 
ATOM   9705  C CA    . CYS C 1 292 ? -23.098 70.495 44.806  1.00 15.81  ? 292 CYS C CA    1 
ATOM   9706  C C     . CYS C 1 292 ? -23.705 69.373 45.640  1.00 14.08  ? 292 CYS C C     1 
ATOM   9707  O O     . CYS C 1 292 ? -23.239 68.227 45.670  1.00 15.77  ? 292 CYS C O     1 
ATOM   9708  C CB    . CYS C 1 292 ? -22.419 71.495 45.774  1.00 14.36  ? 292 CYS C CB    1 
ATOM   9709  S SG    . CYS C 1 292 ? -21.092 70.616 46.749  1.00 18.09  ? 292 CYS C SG    1 
ATOM   9710  N N     . VAL C 1 293 ? -24.818 69.659 46.339  1.00 15.88  ? 293 VAL C N     1 
ATOM   9711  C CA    . VAL C 1 293 ? -25.440 68.703 47.253  1.00 13.86  ? 293 VAL C CA    1 
ATOM   9712  C C     . VAL C 1 293 ? -25.692 67.341 46.692  1.00 15.20  ? 293 VAL C C     1 
ATOM   9713  O O     . VAL C 1 293 ? -25.190 66.350 47.254  1.00 16.80  ? 293 VAL C O     1 
ATOM   9714  C CB    . VAL C 1 293 ? -26.680 69.295 47.954  1.00 22.02  ? 293 VAL C CB    1 
ATOM   9715  C CG1   . VAL C 1 293 ? -27.366 68.251 48.834  1.00 19.44  ? 293 VAL C CG1   1 
ATOM   9716  C CG2   . VAL C 1 293 ? -26.264 70.492 48.810  1.00 12.23  ? 293 VAL C CG2   1 
ATOM   9717  N N     . PRO C 1 294 ? -26.444 67.184 45.596  1.00 15.83  ? 294 PRO C N     1 
ATOM   9718  C CA    . PRO C 1 294 ? -26.676 65.867 45.050  1.00 15.27  ? 294 PRO C CA    1 
ATOM   9719  C C     . PRO C 1 294 ? -25.477 65.251 44.359  1.00 15.70  ? 294 PRO C C     1 
ATOM   9720  O O     . PRO C 1 294 ? -25.437 64.016 44.269  1.00 13.98  ? 294 PRO C O     1 
ATOM   9721  C CB    . PRO C 1 294 ? -27.799 66.091 44.038  1.00 19.21  ? 294 PRO C CB    1 
ATOM   9722  C CG    . PRO C 1 294 ? -27.811 67.542 43.751  1.00 17.59  ? 294 PRO C CG    1 
ATOM   9723  C CD    . PRO C 1 294 ? -27.212 68.253 44.930  1.00 16.38  ? 294 PRO C CD    1 
ATOM   9724  N N     . MET C 1 295 ? -24.608 66.043 43.725  1.00 17.05  ? 295 MET C N     1 
ATOM   9725  C CA    . MET C 1 295 ? -23.515 65.470 42.933  1.00 16.91  ? 295 MET C CA    1 
ATOM   9726  C C     . MET C 1 295 ? -22.232 65.155 43.733  1.00 14.84  ? 295 MET C C     1 
ATOM   9727  O O     . MET C 1 295 ? -21.578 64.155 43.469  1.00 16.53  ? 295 MET C O     1 
ATOM   9728  C CB    . MET C 1 295 ? -23.105 66.466 41.841  1.00 17.58  ? 295 MET C CB    1 
ATOM   9729  C CG    . MET C 1 295 ? -24.222 66.713 40.799  1.00 18.12  ? 295 MET C CG    1 
ATOM   9730  S SD    . MET C 1 295 ? -24.603 65.168 39.923  1.00 22.36  ? 295 MET C SD    1 
ATOM   9731  C CE    . MET C 1 295 ? -26.263 65.608 39.374  1.00 26.45  ? 295 MET C CE    1 
ATOM   9732  N N     . GLU C 1 296 ? -21.833 66.035 44.626  1.00 12.75  ? 296 GLU C N     1 
ATOM   9733  C CA    . GLU C 1 296 ? -20.575 65.921 45.373  1.00 16.66  ? 296 GLU C CA    1 
ATOM   9734  C C     . GLU C 1 296 ? -20.711 65.650 46.873  1.00 14.70  ? 296 GLU C C     1 
ATOM   9735  O O     . GLU C 1 296 ? -20.111 64.701 47.383  1.00 15.40  ? 296 GLU C O     1 
ATOM   9736  C CB    . GLU C 1 296 ? -19.878 67.269 45.157  1.00 15.49  ? 296 GLU C CB    1 
ATOM   9737  C CG    . GLU C 1 296 ? -19.437 67.442 43.686  1.00 20.83  ? 296 GLU C CG    1 
ATOM   9738  C CD    . GLU C 1 296 ? -18.348 66.471 43.269  1.00 24.51  ? 296 GLU C CD    1 
ATOM   9739  O OE1   . GLU C 1 296 ? -17.361 66.293 43.968  1.00 22.05  ? 296 GLU C OE1   1 
ATOM   9740  O OE2   . GLU C 1 296 ? -18.375 65.759 42.247  1.00 35.02  ? 296 GLU C OE2   1 
ATOM   9741  N N     . GLY C 1 297 ? -21.519 66.430 47.571  1.00 13.72  ? 297 GLY C N     1 
ATOM   9742  C CA    . GLY C 1 297 ? -21.740 66.248 49.016  1.00 14.29  ? 297 GLY C CA    1 
ATOM   9743  C C     . GLY C 1 297 ? -22.264 67.562 49.596  1.00 16.06  ? 297 GLY C C     1 
ATOM   9744  O O     . GLY C 1 297 ? -22.480 68.554 48.879  1.00 15.80  ? 297 GLY C O     1 
ATOM   9745  N N     . PHE C 1 298 ? -22.371 67.593 50.940  1.00 13.61  ? 298 PHE C N     1 
ATOM   9746  C CA    . PHE C 1 298 ? -22.844 68.802 51.596  1.00 12.03  ? 298 PHE C CA    1 
ATOM   9747  C C     . PHE C 1 298 ? -21.848 69.900 51.282  1.00 16.21  ? 298 PHE C C     1 
ATOM   9748  O O     . PHE C 1 298 ? -20.647 69.649 51.007  1.00 16.75  ? 298 PHE C O     1 
ATOM   9749  C CB    . PHE C 1 298 ? -23.071 68.533 53.095  1.00 16.22  ? 298 PHE C CB    1 
ATOM   9750  C CG    . PHE C 1 298 ? -23.567 69.813 53.759  1.00 16.16  ? 298 PHE C CG    1 
ATOM   9751  C CD1   . PHE C 1 298 ? -24.805 70.330 53.438  1.00 19.20  ? 298 PHE C CD1   1 
ATOM   9752  C CD2   . PHE C 1 298 ? -22.739 70.454 54.648  1.00 11.16  ? 298 PHE C CD2   1 
ATOM   9753  C CE1   . PHE C 1 298 ? -25.228 71.493 54.041  1.00 16.27  ? 298 PHE C CE1   1 
ATOM   9754  C CE2   . PHE C 1 298 ? -23.154 71.641 55.252  1.00 19.58  ? 298 PHE C CE2   1 
ATOM   9755  C CZ    . PHE C 1 298 ? -24.400 72.156 54.939  1.00 18.03  ? 298 PHE C CZ    1 
ATOM   9756  N N     . VAL C 1 299 ? -22.280 71.151 51.323  1.00 12.48  ? 299 VAL C N     1 
ATOM   9757  C CA    . VAL C 1 299 ? -21.444 72.254 50.834  1.00 15.54  ? 299 VAL C CA    1 
ATOM   9758  C C     . VAL C 1 299 ? -20.220 72.598 51.641  1.00 18.12  ? 299 VAL C C     1 
ATOM   9759  O O     . VAL C 1 299 ? -19.415 73.453 51.206  1.00 15.53  ? 299 VAL C O     1 
ATOM   9760  C CB    . VAL C 1 299 ? -22.360 73.505 50.611  1.00 13.22  ? 299 VAL C CB    1 
ATOM   9761  C CG1   . VAL C 1 299 ? -23.457 73.117 49.635  1.00 18.02  ? 299 VAL C CG1   1 
ATOM   9762  C CG2   . VAL C 1 299 ? -22.885 73.941 51.966  1.00 17.32  ? 299 VAL C CG2   1 
ATOM   9763  N N     . THR C 1 300 ? -20.050 72.035 52.857  1.00 15.56  ? 300 THR C N     1 
ATOM   9764  C CA    . THR C 1 300 ? -18.838 72.394 53.610  1.00 15.60  ? 300 THR C CA    1 
ATOM   9765  C C     . THR C 1 300 ? -17.792 71.294 53.528  1.00 13.68  ? 300 THR C C     1 
ATOM   9766  O O     . THR C 1 300 ? -16.815 71.306 54.297  1.00 15.19  ? 300 THR C O     1 
ATOM   9767  C CB    . THR C 1 300 ? -19.119 72.758 55.083  1.00 14.75  ? 300 THR C CB    1 
ATOM   9768  O OG1   . THR C 1 300 ? -19.832 71.646 55.651  1.00 13.66  ? 300 THR C OG1   1 
ATOM   9769  C CG2   . THR C 1 300 ? -19.970 74.006 55.155  1.00 16.34  ? 300 THR C CG2   1 
ATOM   9770  N N     . TYR C 1 301 ? -17.970 70.308 52.654  1.00 12.92  ? 301 TYR C N     1 
ATOM   9771  C CA    . TYR C 1 301 ? -16.919 69.294 52.451  1.00 13.60  ? 301 TYR C CA    1 
ATOM   9772  C C     . TYR C 1 301 ? -16.830 68.916 50.959  1.00 15.54  ? 301 TYR C C     1 
ATOM   9773  O O     . TYR C 1 301 ? -15.822 68.398 50.473  1.00 14.11  ? 301 TYR C O     1 
ATOM   9774  C CB    . TYR C 1 301 ? -17.007 68.070 53.311  1.00 10.35  ? 301 TYR C CB    1 
ATOM   9775  C CG    . TYR C 1 301 ? -18.161 67.165 53.053  1.00 13.84  ? 301 TYR C CG    1 
ATOM   9776  C CD1   . TYR C 1 301 ? -18.062 66.176 52.070  1.00 10.00  ? 301 TYR C CD1   1 
ATOM   9777  C CD2   . TYR C 1 301 ? -19.350 67.298 53.784  1.00 16.29  ? 301 TYR C CD2   1 
ATOM   9778  C CE1   . TYR C 1 301 ? -19.124 65.334 51.837  1.00 14.05  ? 301 TYR C CE1   1 
ATOM   9779  C CE2   . TYR C 1 301 ? -20.426 66.460 53.546  1.00 13.76  ? 301 TYR C CE2   1 
ATOM   9780  C CZ    . TYR C 1 301 ? -20.311 65.506 52.551  1.00 15.11  ? 301 TYR C CZ    1 
ATOM   9781  O OH    . TYR C 1 301 ? -21.343 64.646 52.240  1.00 15.89  ? 301 TYR C OH    1 
ATOM   9782  N N     . GLY C 1 302 ? -17.922 69.060 50.209  1.00 15.83  ? 302 GLY C N     1 
ATOM   9783  C CA    . GLY C 1 302 ? -17.941 68.807 48.779  1.00 15.16  ? 302 GLY C CA    1 
ATOM   9784  C C     . GLY C 1 302 ? -17.336 67.522 48.289  1.00 15.18  ? 302 GLY C C     1 
ATOM   9785  O O     . GLY C 1 302 ? -16.619 67.460 47.274  1.00 16.05  ? 302 GLY C O     1 
ATOM   9786  N N     . GLY C 1 303 ? -17.612 66.362 48.895  1.00 8.45   ? 303 GLY C N     1 
ATOM   9787  C CA    . GLY C 1 303 ? -17.065 65.106 48.467  1.00 6.20   ? 303 GLY C CA    1 
ATOM   9788  C C     . GLY C 1 303 ? -15.625 64.889 48.921  1.00 9.79   ? 303 GLY C C     1 
ATOM   9789  O O     . GLY C 1 303 ? -15.065 63.853 48.510  1.00 10.45  ? 303 GLY C O     1 
ATOM   9790  N N     . LEU C 1 304 ? -15.120 65.690 49.853  1.00 8.76   ? 304 LEU C N     1 
ATOM   9791  C CA    . LEU C 1 304 ? -13.785 65.431 50.412  1.00 9.07   ? 304 LEU C CA    1 
ATOM   9792  C C     . LEU C 1 304 ? -13.854 65.113 51.925  1.00 13.44  ? 304 LEU C C     1 
ATOM   9793  O O     . LEU C 1 304 ? -14.629 65.757 52.642  1.00 11.68  ? 304 LEU C O     1 
ATOM   9794  C CB    . LEU C 1 304 ? -12.972 66.750 50.365  1.00 9.70   ? 304 LEU C CB    1 
ATOM   9795  C CG    . LEU C 1 304 ? -12.486 67.166 48.951  1.00 9.58   ? 304 LEU C CG    1 
ATOM   9796  C CD1   . LEU C 1 304 ? -11.748 68.469 48.971  1.00 10.72  ? 304 LEU C CD1   1 
ATOM   9797  C CD2   . LEU C 1 304 ? -11.647 66.044 48.327  1.00 9.93   ? 304 LEU C CD2   1 
ATOM   9798  N N     . ALA C 1 305 ? -12.929 64.300 52.409  1.00 11.57  ? 305 ALA C N     1 
ATOM   9799  C CA    . ALA C 1 305 ? -12.699 64.084 53.817  1.00 10.55  ? 305 ALA C CA    1 
ATOM   9800  C C     . ALA C 1 305 ? -12.190 65.379 54.409  1.00 8.55   ? 305 ALA C C     1 
ATOM   9801  O O     . ALA C 1 305 ? -11.554 66.186 53.719  1.00 7.80   ? 305 ALA C O     1 
ATOM   9802  C CB    . ALA C 1 305 ? -11.691 62.960 53.954  1.00 8.21   ? 305 ALA C CB    1 
ATOM   9803  N N     . GLY C 1 306 ? -12.414 65.664 55.681  1.00 7.05   ? 306 GLY C N     1 
ATOM   9804  C CA    . GLY C 1 306 ? -11.909 66.916 56.288  1.00 6.09   ? 306 GLY C CA    1 
ATOM   9805  C C     . GLY C 1 306 ? -10.361 66.871 56.223  1.00 8.55   ? 306 GLY C C     1 
ATOM   9806  O O     . GLY C 1 306 ? -9.731  67.912 56.042  1.00 9.95   ? 306 GLY C O     1 
ATOM   9807  N N     . ARG C 1 307 ? -9.728  65.697 56.342  1.00 6.23   ? 307 ARG C N     1 
ATOM   9808  C CA    . ARG C 1 307 ? -8.250  65.675 56.250  1.00 10.51  ? 307 ARG C CA    1 
ATOM   9809  C C     . ARG C 1 307 ? -7.785  66.171 54.867  1.00 13.18  ? 307 ARG C C     1 
ATOM   9810  O O     . ARG C 1 307 ? -6.719  66.808 54.764  1.00 11.09  ? 307 ARG C O     1 
ATOM   9811  C CB    . ARG C 1 307 ? -7.735  64.289 56.520  1.00 4.57   ? 307 ARG C CB    1 
ATOM   9812  C CG    . ARG C 1 307 ? -8.343  63.201 55.602  1.00 4.62   ? 307 ARG C CG    1 
ATOM   9813  C CD    . ARG C 1 307 ? -7.496  61.902 55.790  1.00 9.40   ? 307 ARG C CD    1 
ATOM   9814  N NE    . ARG C 1 307 ? -8.204  60.839 55.090  1.00 8.65   ? 307 ARG C NE    1 
ATOM   9815  C CZ    . ARG C 1 307 ? -9.185  60.068 55.574  1.00 11.92  ? 307 ARG C CZ    1 
ATOM   9816  N NH1   . ARG C 1 307 ? -9.557  60.126 56.848  1.00 10.98  ? 307 ARG C NH1   1 
ATOM   9817  N NH2   . ARG C 1 307 ? -9.758  59.187 54.789  1.00 6.87   ? 307 ARG C NH2   1 
ATOM   9818  N N     . ASP C 1 308 ? -8.539  65.941 53.782  1.00 11.34  ? 308 ASP C N     1 
ATOM   9819  C CA    . ASP C 1 308 ? -8.093  66.438 52.466  1.00 9.53   ? 308 ASP C CA    1 
ATOM   9820  C C     . ASP C 1 308 ? -8.300  67.919 52.313  1.00 8.85   ? 308 ASP C C     1 
ATOM   9821  O O     . ASP C 1 308 ? -7.502  68.619 51.678  1.00 10.11  ? 308 ASP C O     1 
ATOM   9822  C CB    . ASP C 1 308 ? -8.780  65.647 51.325  1.00 5.68   ? 308 ASP C CB    1 
ATOM   9823  C CG    . ASP C 1 308 ? -8.271  64.237 51.418  1.00 8.02   ? 308 ASP C CG    1 
ATOM   9824  O OD1   . ASP C 1 308 ? -7.025  64.162 51.281  1.00 12.81  ? 308 ASP C OD1   1 
ATOM   9825  O OD2   . ASP C 1 308 ? -9.037  63.262 51.586  1.00 8.99   ? 308 ASP C OD2   1 
ATOM   9826  N N     . MET C 1 309 ? -9.304  68.520 52.946  1.00 8.65   ? 309 MET C N     1 
ATOM   9827  C CA    . MET C 1 309 ? -9.418  69.974 52.931  1.00 8.33   ? 309 MET C CA    1 
ATOM   9828  C C     . MET C 1 309 ? -8.242  70.555 53.701  1.00 9.80   ? 309 MET C C     1 
ATOM   9829  O O     . MET C 1 309 ? -7.741  71.611 53.327  1.00 7.76   ? 309 MET C O     1 
ATOM   9830  C CB    . MET C 1 309 ? -10.744 70.479 53.538  1.00 6.51   ? 309 MET C CB    1 
ATOM   9831  C CG    . MET C 1 309 ? -11.950 70.173 52.656  1.00 11.77  ? 309 MET C CG    1 
ATOM   9832  S SD    . MET C 1 309 ? -13.465 70.980 53.223  1.00 14.74  ? 309 MET C SD    1 
ATOM   9833  C CE    . MET C 1 309 ? -13.867 69.852 54.575  1.00 8.78   ? 309 MET C CE    1 
ATOM   9834  N N     . ALA C 1 310 ? -7.829  69.896 54.785  1.00 8.97   ? 310 ALA C N     1 
ATOM   9835  C CA    . ALA C 1 310 ? -6.706  70.439 55.594  1.00 10.84  ? 310 ALA C CA    1 
ATOM   9836  C C     . ALA C 1 310 ? -5.420  70.404 54.786  1.00 4.82   ? 310 ALA C C     1 
ATOM   9837  O O     . ALA C 1 310 ? -4.662  71.345 54.762  1.00 8.38   ? 310 ALA C O     1 
ATOM   9838  C CB    . ALA C 1 310 ? -6.539  69.569 56.878  1.00 4.77   ? 310 ALA C CB    1 
ATOM   9839  N N     . ALA C 1 311 ? -5.179  69.277 54.102  1.00 5.14   ? 311 ALA C N     1 
ATOM   9840  C CA    . ALA C 1 311 ? -3.990  69.134 53.258  1.00 11.51  ? 311 ALA C CA    1 
ATOM   9841  C C     . ALA C 1 311 ? -4.041  70.144 52.120  1.00 13.67  ? 311 ALA C C     1 
ATOM   9842  O O     . ALA C 1 311 ? -3.022  70.722 51.713  1.00 12.24  ? 311 ALA C O     1 
ATOM   9843  C CB    . ALA C 1 311 ? -3.941  67.694 52.682  1.00 5.52   ? 311 ALA C CB    1 
ATOM   9844  N N     . MET C 1 312 ? -5.268  70.468 51.674  1.00 10.03  ? 312 MET C N     1 
ATOM   9845  C CA    . MET C 1 312 ? -5.425  71.387 50.551  1.00 10.35  ? 312 MET C CA    1 
ATOM   9846  C C     . MET C 1 312 ? -5.004  72.773 50.940  1.00 8.40   ? 312 MET C C     1 
ATOM   9847  O O     . MET C 1 312 ? -4.346  73.535 50.226  1.00 10.47  ? 312 MET C O     1 
ATOM   9848  C CB    . MET C 1 312 ? -6.862  71.408 49.980  1.00 10.61  ? 312 MET C CB    1 
ATOM   9849  C CG    . MET C 1 312 ? -6.940  72.369 48.758  1.00 14.89  ? 312 MET C CG    1 
ATOM   9850  S SD    . MET C 1 312 ? -8.609  72.395 48.049  1.00 17.33  ? 312 MET C SD    1 
ATOM   9851  C CE    . MET C 1 312 ? -9.004  70.694 47.905  1.00 9.51   ? 312 MET C CE    1 
ATOM   9852  N N     . VAL C 1 313 ? -5.367  73.160 52.175  1.00 6.94   ? 313 VAL C N     1 
ATOM   9853  C CA    . VAL C 1 313 ? -5.008  74.485 52.664  1.00 8.07   ? 313 VAL C CA    1 
ATOM   9854  C C     . VAL C 1 313 ? -3.483  74.633 52.723  1.00 10.42  ? 313 VAL C C     1 
ATOM   9855  O O     . VAL C 1 313 ? -2.976  75.700 52.398  1.00 10.47  ? 313 VAL C O     1 
ATOM   9856  C CB    . VAL C 1 313 ? -5.575  74.757 54.065  1.00 14.55  ? 313 VAL C CB    1 
ATOM   9857  C CG1   . VAL C 1 313 ? -5.000  76.050 54.655  1.00 9.58   ? 313 VAL C CG1   1 
ATOM   9858  C CG2   . VAL C 1 313 ? -7.101  74.866 53.964  1.00 13.82  ? 313 VAL C CG2   1 
ATOM   9859  N N     . GLN C 1 314 ? -2.795  73.616 53.217  1.00 10.06  ? 314 GLN C N     1 
ATOM   9860  C CA    . GLN C 1 314 ? -1.338  73.675 53.320  1.00 13.25  ? 314 GLN C CA    1 
ATOM   9861  C C     . GLN C 1 314 ? -0.731  73.522 51.902  1.00 11.06  ? 314 GLN C C     1 
ATOM   9862  O O     . GLN C 1 314 ? 0.249   74.183 51.626  1.00 10.11  ? 314 GLN C O     1 
ATOM   9863  C CB    . GLN C 1 314 ? -0.849  72.559 54.241  1.00 9.11   ? 314 GLN C CB    1 
ATOM   9864  C CG    . GLN C 1 314 ? 0.676   72.385 54.244  1.00 12.25  ? 314 GLN C CG    1 
ATOM   9865  C CD    . GLN C 1 314 ? 1.329   73.584 54.899  1.00 16.89  ? 314 GLN C CD    1 
ATOM   9866  O OE1   . GLN C 1 314 ? 0.658   74.219 55.713  1.00 13.37  ? 314 GLN C OE1   1 
ATOM   9867  N NE2   . GLN C 1 314 ? 2.582   73.853 54.542  1.00 12.47  ? 314 GLN C NE2   1 
ATOM   9868  N N     . GLY C 1 315 ? -1.308  72.684 51.055  1.00 9.48   ? 315 GLY C N     1 
ATOM   9869  C CA    . GLY C 1 315 ? -0.771  72.473 49.683  1.00 12.58  ? 315 GLY C CA    1 
ATOM   9870  C C     . GLY C 1 315 ? -0.857  73.737 48.836  1.00 13.35  ? 315 GLY C C     1 
ATOM   9871  O O     . GLY C 1 315 ? -0.002  74.098 48.001  1.00 14.21  ? 315 GLY C O     1 
ATOM   9872  N N     . LEU C 1 316 ? -1.910  74.521 48.999  1.00 8.80   ? 316 LEU C N     1 
ATOM   9873  C CA    . LEU C 1 316 ? -2.125  75.777 48.310  1.00 13.50  ? 316 LEU C CA    1 
ATOM   9874  C C     . LEU C 1 316 ? -0.998  76.716 48.689  1.00 14.84  ? 316 LEU C C     1 
ATOM   9875  O O     . LEU C 1 316 ? -0.444  77.357 47.808  1.00 18.80  ? 316 LEU C O     1 
ATOM   9876  C CB    . LEU C 1 316 ? -3.490  76.402 48.593  1.00 10.02  ? 316 LEU C CB    1 
ATOM   9877  C CG    . LEU C 1 316 ? -4.679  75.785 47.810  1.00 15.61  ? 316 LEU C CG    1 
ATOM   9878  C CD1   . LEU C 1 316 ? -6.027  76.305 48.336  1.00 8.94   ? 316 LEU C CD1   1 
ATOM   9879  C CD2   . LEU C 1 316 ? -4.538  76.156 46.326  1.00 13.05  ? 316 LEU C CD2   1 
ATOM   9880  N N     . GLU C 1 317 ? -0.561  76.730 49.955  1.00 11.16  ? 317 GLU C N     1 
ATOM   9881  C CA    . GLU C 1 317 ? 0.578   77.596 50.308  1.00 10.65  ? 317 GLU C CA    1 
ATOM   9882  C C     . GLU C 1 317 ? 1.854   77.021 49.695  1.00 11.32  ? 317 GLU C C     1 
ATOM   9883  O O     . GLU C 1 317 ? 2.601   77.788 49.076  1.00 12.14  ? 317 GLU C O     1 
ATOM   9884  C CB    . GLU C 1 317 ? 0.721   77.674 51.831  1.00 17.24  ? 317 GLU C CB    1 
ATOM   9885  C CG    . GLU C 1 317 ? 1.815   78.510 52.448  1.00 15.56  ? 317 GLU C CG    1 
ATOM   9886  C CD    . GLU C 1 317 ? 1.692   79.977 52.083  1.00 18.00  ? 317 GLU C CD    1 
ATOM   9887  O OE1   . GLU C 1 317 ? 0.616   80.490 51.720  1.00 19.70  ? 317 GLU C OE1   1 
ATOM   9888  O OE2   . GLU C 1 317 ? 2.723   80.651 52.121  1.00 30.71  ? 317 GLU C OE2   1 
ATOM   9889  N N     . GLU C 1 318 ? 2.150   75.734 49.823  1.00 9.36   ? 318 GLU C N     1 
ATOM   9890  C CA    . GLU C 1 318 ? 3.423   75.186 49.366  1.00 10.86  ? 318 GLU C CA    1 
ATOM   9891  C C     . GLU C 1 318 ? 3.584   75.263 47.849  1.00 15.70  ? 318 GLU C C     1 
ATOM   9892  O O     . GLU C 1 318 ? 4.689   75.482 47.356  1.00 11.09  ? 318 GLU C O     1 
ATOM   9893  C CB    . GLU C 1 318 ? 3.555   73.701 49.786  1.00 11.80  ? 318 GLU C CB    1 
ATOM   9894  C CG    . GLU C 1 318 ? 3.606   73.553 51.323  1.00 12.25  ? 318 GLU C CG    1 
ATOM   9895  C CD    . GLU C 1 318 ? 3.915   72.132 51.739  1.00 10.14  ? 318 GLU C CD    1 
ATOM   9896  O OE1   . GLU C 1 318 ? 4.347   71.301 50.881  1.00 11.64  ? 318 GLU C OE1   1 
ATOM   9897  O OE2   . GLU C 1 318 ? 3.727   71.764 52.956  1.00 13.12  ? 318 GLU C OE2   1 
ATOM   9898  N N     . GLY C 1 319 ? 2.470   75.167 47.099  1.00 10.47  ? 319 GLY C N     1 
ATOM   9899  C CA    . GLY C 1 319 ? 2.522   75.186 45.654  1.00 11.92  ? 319 GLY C CA    1 
ATOM   9900  C C     . GLY C 1 319 ? 2.946   76.524 45.079  1.00 9.37   ? 319 GLY C C     1 
ATOM   9901  O O     . GLY C 1 319 ? 3.374   76.567 43.924  1.00 12.96  ? 319 GLY C O     1 
ATOM   9902  N N     . THR C 1 320 ? 2.812   77.592 45.871  1.00 8.83   ? 320 THR C N     1 
ATOM   9903  C CA    . THR C 1 320 ? 3.187   78.916 45.466  1.00 10.92  ? 320 THR C CA    1 
ATOM   9904  C C     . THR C 1 320 ? 4.653   79.209 45.765  1.00 15.84  ? 320 THR C C     1 
ATOM   9905  O O     . THR C 1 320 ? 5.064   80.320 45.397  1.00 13.67  ? 320 THR C O     1 
ATOM   9906  C CB    . THR C 1 320 ? 2.361   80.003 46.176  1.00 15.60  ? 320 THR C CB    1 
ATOM   9907  O OG1   . THR C 1 320 ? 2.717   80.076 47.577  1.00 13.98  ? 320 THR C OG1   1 
ATOM   9908  C CG2   . THR C 1 320 ? 0.867   79.665 46.148  1.00 11.18  ? 320 THR C CG2   1 
ATOM   9909  N N     . GLU C 1 321 ? 5.413   78.346 46.412  1.00 10.98  ? 321 GLU C N     1 
ATOM   9910  C CA    . GLU C 1 321 ? 6.750   78.806 46.844  1.00 16.91  ? 321 GLU C CA    1 
ATOM   9911  C C     . GLU C 1 321 ? 7.707   78.802 45.646  1.00 9.68   ? 321 GLU C C     1 
ATOM   9912  O O     . GLU C 1 321 ? 7.800   77.766 45.015  1.00 10.24  ? 321 GLU C O     1 
ATOM   9913  C CB    . GLU C 1 321 ? 7.373   77.961 47.971  1.00 14.58  ? 321 GLU C CB    1 
ATOM   9914  C CG    . GLU C 1 321 ? 6.613   78.146 49.287  1.00 25.88  ? 321 GLU C CG    1 
ATOM   9915  C CD    . GLU C 1 321 ? 6.855   77.086 50.342  1.00 32.10  ? 321 GLU C CD    1 
ATOM   9916  O OE1   . GLU C 1 321 ? 7.513   76.055 50.090  1.00 31.13  ? 321 GLU C OE1   1 
ATOM   9917  O OE2   . GLU C 1 321 ? 6.330   77.216 51.471  1.00 35.98  ? 321 GLU C OE2   1 
ATOM   9918  N N     . GLU C 1 322 ? 8.395   79.894 45.431  1.00 10.50  ? 322 GLU C N     1 
ATOM   9919  C CA    . GLU C 1 322 ? 9.234   80.051 44.271  1.00 12.93  ? 322 GLU C CA    1 
ATOM   9920  C C     . GLU C 1 322 ? 10.400  79.108 44.128  1.00 10.70  ? 322 GLU C C     1 
ATOM   9921  O O     . GLU C 1 322 ? 10.742  78.589 43.042  1.00 12.09  ? 322 GLU C O     1 
ATOM   9922  C CB    . GLU C 1 322 ? 9.780   81.506 44.307  1.00 18.38  ? 322 GLU C CB    1 
ATOM   9923  C CG    . GLU C 1 322 ? 10.464  81.753 42.955  1.00 28.38  ? 322 GLU C CG    1 
ATOM   9924  C CD    . GLU C 1 322 ? 10.845  83.214 42.811  1.00 29.26  ? 322 GLU C CD    1 
ATOM   9925  O OE1   . GLU C 1 322 ? 10.276  84.006 43.592  1.00 28.96  ? 322 GLU C OE1   1 
ATOM   9926  O OE2   . GLU C 1 322 ? 11.668  83.498 41.923  1.00 37.05  ? 322 GLU C OE2   1 
ATOM   9927  N N     . GLU C 1 323 ? 11.061  78.810 45.258  1.00 12.67  ? 323 GLU C N     1 
ATOM   9928  C CA    . GLU C 1 323 ? 12.205  77.886 45.269  1.00 13.21  ? 323 GLU C CA    1 
ATOM   9929  C C     . GLU C 1 323 ? 11.705  76.527 44.788  1.00 13.80  ? 323 GLU C C     1 
ATOM   9930  O O     . GLU C 1 323 ? 12.394  75.846 44.028  1.00 11.04  ? 323 GLU C O     1 
ATOM   9931  C CB    . GLU C 1 323 ? 12.911  77.783 46.624  1.00 17.23  ? 323 GLU C CB    1 
ATOM   9932  C CG    . GLU C 1 323 ? 12.807  79.046 47.476  1.00 47.08  ? 323 GLU C CG    1 
ATOM   9933  C CD    . GLU C 1 323 ? 11.442  79.147 48.169  1.00 58.61  ? 323 GLU C CD    1 
ATOM   9934  O OE1   . GLU C 1 323 ? 10.966  78.173 48.810  1.00 69.73  ? 323 GLU C OE1   1 
ATOM   9935  O OE2   . GLU C 1 323 ? 10.792  80.209 48.068  1.00 56.79  ? 323 GLU C OE2   1 
ATOM   9936  N N     . TYR C 1 324 ? 10.517  76.144 45.282  1.00 11.00  ? 324 TYR C N     1 
ATOM   9937  C CA    . TYR C 1 324 ? 9.978   74.855 44.819  1.00 8.92   ? 324 TYR C CA    1 
ATOM   9938  C C     . TYR C 1 324 ? 9.639   74.920 43.319  1.00 6.81   ? 324 TYR C C     1 
ATOM   9939  O O     . TYR C 1 324 ? 9.947   74.025 42.521  1.00 8.33   ? 324 TYR C O     1 
ATOM   9940  C CB    . TYR C 1 324 ? 8.750   74.450 45.693  1.00 10.17  ? 324 TYR C CB    1 
ATOM   9941  C CG    . TYR C 1 324 ? 7.793   73.617 44.855  1.00 8.21   ? 324 TYR C CG    1 
ATOM   9942  C CD1   . TYR C 1 324 ? 8.083   72.310 44.562  1.00 5.72   ? 324 TYR C CD1   1 
ATOM   9943  C CD2   . TYR C 1 324 ? 6.642   74.174 44.318  1.00 11.42  ? 324 TYR C CD2   1 
ATOM   9944  C CE1   . TYR C 1 324 ? 7.256   71.535 43.747  1.00 8.84   ? 324 TYR C CE1   1 
ATOM   9945  C CE2   . TYR C 1 324 ? 5.801   73.426 43.499  1.00 8.67   ? 324 TYR C CE2   1 
ATOM   9946  C CZ    . TYR C 1 324 ? 6.125   72.123 43.213  1.00 7.81   ? 324 TYR C CZ    1 
ATOM   9947  O OH    . TYR C 1 324 ? 5.313   71.383 42.361  1.00 9.92   ? 324 TYR C OH    1 
ATOM   9948  N N     . LEU C 1 325 ? 8.920   75.953 42.879  1.00 7.87   ? 325 LEU C N     1 
ATOM   9949  C CA    . LEU C 1 325 ? 8.532   76.067 41.467  1.00 13.42  ? 325 LEU C CA    1 
ATOM   9950  C C     . LEU C 1 325 ? 9.758   76.134 40.525  1.00 13.19  ? 325 LEU C C     1 
ATOM   9951  O O     . LEU C 1 325 ? 9.817   75.454 39.481  1.00 10.81  ? 325 LEU C O     1 
ATOM   9952  C CB    . LEU C 1 325 ? 7.637   77.317 41.284  1.00 11.43  ? 325 LEU C CB    1 
ATOM   9953  C CG    . LEU C 1 325 ? 6.196   77.130 41.795  1.00 13.82  ? 325 LEU C CG    1 
ATOM   9954  C CD1   . LEU C 1 325 ? 5.537   78.479 42.059  1.00 10.27  ? 325 LEU C CD1   1 
ATOM   9955  C CD2   . LEU C 1 325 ? 5.344   76.318 40.816  1.00 12.89  ? 325 LEU C CD2   1 
ATOM   9956  N N     . HIS C 1 326 ? 10.784  76.853 40.959  1.00 14.85  ? 326 HIS C N     1 
ATOM   9957  C CA    . HIS C 1 326 ? 12.017  76.950 40.157  1.00 14.50  ? 326 HIS C CA    1 
ATOM   9958  C C     . HIS C 1 326 ? 12.596  75.559 39.955  1.00 15.92  ? 326 HIS C C     1 
ATOM   9959  O O     . HIS C 1 326 ? 12.883  75.125 38.817  1.00 13.15  ? 326 HIS C O     1 
ATOM   9960  C CB    . HIS C 1 326 ? 13.017  77.866 40.858  1.00 14.46  ? 326 HIS C CB    1 
ATOM   9961  C CG    . HIS C 1 326 ? 14.304  78.021 40.139  1.00 28.15  ? 326 HIS C CG    1 
ATOM   9962  N ND1   . HIS C 1 326 ? 14.379  78.673 38.914  1.00 28.78  ? 326 HIS C ND1   1 
ATOM   9963  C CD2   . HIS C 1 326 ? 15.555  77.608 40.454  1.00 25.15  ? 326 HIS C CD2   1 
ATOM   9964  C CE1   . HIS C 1 326 ? 15.635  78.647 38.509  1.00 30.31  ? 326 HIS C CE1   1 
ATOM   9965  N NE2   . HIS C 1 326 ? 16.357  78.013 39.413  1.00 30.12  ? 326 HIS C NE2   1 
ATOM   9966  N N     . TYR C 1 327 ? 12.641  74.786 41.070  1.00 10.00  ? 327 TYR C N     1 
ATOM   9967  C CA    . TYR C 1 327 ? 13.170  73.433 40.947  1.00 9.49   ? 327 TYR C CA    1 
ATOM   9968  C C     . TYR C 1 327 ? 12.290  72.534 40.093  1.00 10.96  ? 327 TYR C C     1 
ATOM   9969  O O     . TYR C 1 327 ? 12.717  71.679 39.288  1.00 11.60  ? 327 TYR C O     1 
ATOM   9970  C CB    . TYR C 1 327 ? 13.189  72.875 42.405  1.00 9.64   ? 327 TYR C CB    1 
ATOM   9971  C CG    . TYR C 1 327 ? 13.236  71.360 42.430  1.00 11.49  ? 327 TYR C CG    1 
ATOM   9972  C CD1   . TYR C 1 327 ? 14.458  70.798 42.140  1.00 15.80  ? 327 TYR C CD1   1 
ATOM   9973  C CD2   . TYR C 1 327 ? 12.139  70.544 42.673  1.00 12.60  ? 327 TYR C CD2   1 
ATOM   9974  C CE1   . TYR C 1 327 ? 14.594  69.427 42.098  1.00 19.04  ? 327 TYR C CE1   1 
ATOM   9975  C CE2   . TYR C 1 327 ? 12.284  69.146 42.626  1.00 12.93  ? 327 TYR C CE2   1 
ATOM   9976  C CZ    . TYR C 1 327 ? 13.512  68.616 42.350  1.00 19.74  ? 327 TYR C CZ    1 
ATOM   9977  O OH    . TYR C 1 327 ? 13.777  67.257 42.291  1.00 24.43  ? 327 TYR C OH    1 
ATOM   9978  N N     . ARG C 1 328 ? 10.970  72.643 40.342  1.00 10.23  ? 328 ARG C N     1 
ATOM   9979  C CA    . ARG C 1 328 ? 10.033  71.725 39.689  1.00 9.78   ? 328 ARG C CA    1 
ATOM   9980  C C     . ARG C 1 328 ? 10.078  71.901 38.150  1.00 7.06   ? 328 ARG C C     1 
ATOM   9981  O O     . ARG C 1 328 ? 10.127  70.925 37.400  1.00 9.82   ? 328 ARG C O     1 
ATOM   9982  C CB    . ARG C 1 328 ? 8.644   71.967 40.254  1.00 8.93   ? 328 ARG C CB    1 
ATOM   9983  C CG    . ARG C 1 328 ? 7.565   71.008 39.817  1.00 10.39  ? 328 ARG C CG    1 
ATOM   9984  C CD    . ARG C 1 328 ? 7.133   71.303 38.350  1.00 10.04  ? 328 ARG C CD    1 
ATOM   9985  N NE    . ARG C 1 328 ? 5.858   70.669 38.042  1.00 6.86   ? 328 ARG C NE    1 
ATOM   9986  C CZ    . ARG C 1 328 ? 5.555   69.430 37.786  1.00 12.78  ? 328 ARG C CZ    1 
ATOM   9987  N NH1   . ARG C 1 328 ? 6.441   68.437 37.791  1.00 7.54   ? 328 ARG C NH1   1 
ATOM   9988  N NH2   . ARG C 1 328 ? 4.283   69.120 37.529  1.00 12.80  ? 328 ARG C NH2   1 
ATOM   9989  N N     . ILE C 1 329 ? 9.929   73.139 37.738  1.00 10.40  ? 329 ILE C N     1 
ATOM   9990  C CA    . ILE C 1 329 ? 9.915   73.453 36.307  1.00 12.99  ? 329 ILE C CA    1 
ATOM   9991  C C     . ILE C 1 329 ? 11.307  73.294 35.713  1.00 14.91  ? 329 ILE C C     1 
ATOM   9992  O O     . ILE C 1 329 ? 11.453  72.826 34.577  1.00 13.52  ? 329 ILE C O     1 
ATOM   9993  C CB    . ILE C 1 329 ? 9.415   74.920 36.260  1.00 19.93  ? 329 ILE C CB    1 
ATOM   9994  C CG1   . ILE C 1 329 ? 7.917   74.916 36.585  1.00 14.22  ? 329 ILE C CG1   1 
ATOM   9995  C CG2   . ILE C 1 329 ? 9.688   75.552 34.903  1.00 16.57  ? 329 ILE C CG2   1 
ATOM   9996  C CD1   . ILE C 1 329 ? 7.353   76.295 36.778  1.00 17.97  ? 329 ILE C CD1   1 
ATOM   9997  N N     . GLY C 1 330 ? 12.358  73.640 36.517  1.00 10.70  ? 330 GLY C N     1 
ATOM   9998  C CA    . GLY C 1 330 ? 13.719  73.388 35.949  1.00 11.78  ? 330 GLY C CA    1 
ATOM   9999  C C     . GLY C 1 330 ? 13.969  71.914 35.775  1.00 12.63  ? 330 GLY C C     1 
ATOM   10000 O O     . GLY C 1 330 ? 14.705  71.446 34.902  1.00 13.20  ? 330 GLY C O     1 
ATOM   10001 N N     . GLN C 1 331 ? 13.324  71.023 36.554  1.00 10.88  ? 331 GLN C N     1 
ATOM   10002 C CA    . GLN C 1 331 ? 13.492  69.599 36.362  1.00 8.71   ? 331 GLN C CA    1 
ATOM   10003 C C     . GLN C 1 331 ? 12.887  69.129 35.028  1.00 10.60  ? 331 GLN C C     1 
ATOM   10004 O O     . GLN C 1 331 ? 13.395  68.222 34.346  1.00 11.51  ? 331 GLN C O     1 
ATOM   10005 C CB    . GLN C 1 331 ? 12.819  68.825 37.527  1.00 9.52   ? 331 GLN C CB    1 
ATOM   10006 C CG    . GLN C 1 331 ? 12.808  67.352 37.265  1.00 5.89   ? 331 GLN C CG    1 
ATOM   10007 C CD    . GLN C 1 331 ? 12.332  66.465 38.415  1.00 21.87  ? 331 GLN C CD    1 
ATOM   10008 O OE1   . GLN C 1 331 ? 11.158  66.404 38.748  1.00 11.49  ? 331 GLN C OE1   1 
ATOM   10009 N NE2   . GLN C 1 331 ? 13.222  65.703 39.017  1.00 11.74  ? 331 GLN C NE2   1 
ATOM   10010 N N     . VAL C 1 332 ? 11.677  69.545 34.730  1.00 11.08  ? 332 VAL C N     1 
ATOM   10011 C CA    . VAL C 1 332 ? 11.001  69.257 33.455  1.00 10.15  ? 332 VAL C CA    1 
ATOM   10012 C C     . VAL C 1 332 ? 11.886  69.806 32.280  1.00 4.57   ? 332 VAL C C     1 
ATOM   10013 O O     . VAL C 1 332 ? 12.119  69.097 31.320  1.00 11.79  ? 332 VAL C O     1 
ATOM   10014 C CB    . VAL C 1 332 ? 9.624   69.923 33.377  1.00 17.57  ? 332 VAL C CB    1 
ATOM   10015 C CG1   . VAL C 1 332 ? 9.002   69.751 31.970  1.00 13.19  ? 332 VAL C CG1   1 
ATOM   10016 C CG2   . VAL C 1 332 ? 8.667   69.344 34.415  1.00 13.03  ? 332 VAL C CG2   1 
ATOM   10017 N N     . LYS C 1 333 ? 12.399  71.004 32.401  1.00 9.52   ? 333 LYS C N     1 
ATOM   10018 C CA    . LYS C 1 333 ? 13.321  71.568 31.419  1.00 14.47  ? 333 LYS C CA    1 
ATOM   10019 C C     . LYS C 1 333 ? 14.576  70.726 31.267  1.00 18.09  ? 333 LYS C C     1 
ATOM   10020 O O     . LYS C 1 333 ? 15.004  70.465 30.124  1.00 19.56  ? 333 LYS C O     1 
ATOM   10021 C CB    . LYS C 1 333 ? 13.689  72.982 31.799  1.00 12.37  ? 333 LYS C CB    1 
ATOM   10022 C CG    . LYS C 1 333 ? 14.667  73.669 30.822  1.00 19.44  ? 333 LYS C CG    1 
ATOM   10023 C CD    . LYS C 1 333 ? 14.549  75.165 31.099  1.00 20.08  ? 333 LYS C CD    1 
ATOM   10024 C CE    . LYS C 1 333 ? 15.461  76.042 30.268  1.00 35.54  ? 333 LYS C CE    1 
ATOM   10025 N NZ    . LYS C 1 333 ? 16.547  75.331 29.564  1.00 26.22  ? 333 LYS C NZ    1 
ATOM   10026 N N     . TYR C 1 334 ? 15.097  70.226 32.394  1.00 15.91  ? 334 TYR C N     1 
ATOM   10027 C CA    . TYR C 1 334 ? 16.285  69.368 32.322  1.00 12.80  ? 334 TYR C CA    1 
ATOM   10028 C C     . TYR C 1 334 ? 16.014  68.163 31.458  1.00 14.29  ? 334 TYR C C     1 
ATOM   10029 O O     . TYR C 1 334 ? 16.846  67.773 30.650  1.00 14.55  ? 334 TYR C O     1 
ATOM   10030 C CB    . TYR C 1 334 ? 16.813  68.984 33.722  1.00 12.87  ? 334 TYR C CB    1 
ATOM   10031 C CG    . TYR C 1 334 ? 17.930  67.967 33.715  1.00 13.23  ? 334 TYR C CG    1 
ATOM   10032 C CD1   . TYR C 1 334 ? 19.229  68.311 33.374  1.00 10.82  ? 334 TYR C CD1   1 
ATOM   10033 C CD2   . TYR C 1 334 ? 17.651  66.663 34.053  1.00 12.12  ? 334 TYR C CD2   1 
ATOM   10034 C CE1   . TYR C 1 334 ? 20.220  67.347 33.363  1.00 11.69  ? 334 TYR C CE1   1 
ATOM   10035 C CE2   . TYR C 1 334 ? 18.631  65.686 34.068  1.00 13.97  ? 334 TYR C CE2   1 
ATOM   10036 C CZ    . TYR C 1 334 ? 19.940  66.070 33.714  1.00 16.41  ? 334 TYR C CZ    1 
ATOM   10037 O OH    . TYR C 1 334 ? 20.897  65.093 33.746  1.00 13.70  ? 334 TYR C OH    1 
ATOM   10038 N N     . LEU C 1 335 ? 14.888  67.491 31.640  1.00 10.88  ? 335 LEU C N     1 
ATOM   10039 C CA    . LEU C 1 335 ? 14.537  66.321 30.875  1.00 10.57  ? 335 LEU C CA    1 
ATOM   10040 C C     . LEU C 1 335 ? 14.425  66.689 29.361  1.00 15.32  ? 335 LEU C C     1 
ATOM   10041 O O     . LEU C 1 335 ? 14.901  65.968 28.487  1.00 12.60  ? 335 LEU C O     1 
ATOM   10042 C CB    . LEU C 1 335 ? 13.254  65.690 31.366  1.00 12.55  ? 335 LEU C CB    1 
ATOM   10043 C CG    . LEU C 1 335 ? 12.614  64.605 30.524  1.00 14.76  ? 335 LEU C CG    1 
ATOM   10044 C CD1   . LEU C 1 335 ? 13.518  63.390 30.338  1.00 15.07  ? 335 LEU C CD1   1 
ATOM   10045 C CD2   . LEU C 1 335 ? 11.296  64.082 31.128  1.00 16.21  ? 335 LEU C CD2   1 
ATOM   10046 N N     . GLY C 1 336 ? 13.747  67.781 29.105  1.00 10.90  ? 336 GLY C N     1 
ATOM   10047 C CA    . GLY C 1 336 ? 13.526  68.340 27.787  1.00 17.72  ? 336 GLY C CA    1 
ATOM   10048 C C     . GLY C 1 336 ? 14.894  68.613 27.111  1.00 18.93  ? 336 GLY C C     1 
ATOM   10049 O O     . GLY C 1 336 ? 15.089  68.133 25.998  1.00 17.38  ? 336 GLY C O     1 
ATOM   10050 N N     . ASP C 1 337 ? 15.791  69.286 27.792  1.00 16.24  ? 337 ASP C N     1 
ATOM   10051 C CA    . ASP C 1 337 ? 17.110  69.602 27.303  1.00 19.00  ? 337 ASP C CA    1 
ATOM   10052 C C     . ASP C 1 337 ? 17.975  68.376 27.030  1.00 21.81  ? 337 ASP C C     1 
ATOM   10053 O O     . ASP C 1 337 ? 18.598  68.254 25.964  1.00 20.44  ? 337 ASP C O     1 
ATOM   10054 C CB    . ASP C 1 337 ? 17.821  70.570 28.258  1.00 12.08  ? 337 ASP C CB    1 
ATOM   10055 C CG    . ASP C 1 337 ? 17.293  71.946 28.187  1.00 11.88  ? 337 ASP C CG    1 
ATOM   10056 O OD1   . ASP C 1 337 ? 16.478  72.268 27.333  1.00 19.73  ? 337 ASP C OD1   1 
ATOM   10057 O OD2   . ASP C 1 337 ? 17.647  72.817 28.992  1.00 18.50  ? 337 ASP C OD2   1 
ATOM   10058 N N     . ARG C 1 338 ? 17.934  67.368 27.896  1.00 16.25  ? 338 ARG C N     1 
ATOM   10059 C CA    . ARG C 1 338 ? 18.655  66.129 27.620  1.00 18.94  ? 338 ARG C CA    1 
ATOM   10060 C C     . ARG C 1 338 ? 18.164  65.519 26.307  1.00 21.71  ? 338 ARG C C     1 
ATOM   10061 O O     . ARG C 1 338 ? 18.910  64.875 25.587  1.00 19.26  ? 338 ARG C O     1 
ATOM   10062 C CB    . ARG C 1 338 ? 18.474  65.068 28.731  1.00 17.93  ? 338 ARG C CB    1 
ATOM   10063 C CG    . ARG C 1 338 ? 19.191  65.470 30.017  1.00 23.39  ? 338 ARG C CG    1 
ATOM   10064 C CD    . ARG C 1 338 ? 20.462  64.715 30.288  1.00 24.37  ? 338 ARG C CD    1 
ATOM   10065 N NE    . ARG C 1 338 ? 20.873  63.767 29.285  1.00 20.49  ? 338 ARG C NE    1 
ATOM   10066 C CZ    . ARG C 1 338 ? 20.920  62.460 29.356  1.00 26.66  ? 338 ARG C CZ    1 
ATOM   10067 N NH1   . ARG C 1 338 ? 20.570  61.831 30.472  1.00 22.13  ? 338 ARG C NH1   1 
ATOM   10068 N NH2   . ARG C 1 338 ? 21.331  61.760 28.303  1.00 23.96  ? 338 ARG C NH2   1 
ATOM   10069 N N     . LEU C 1 339 ? 16.859  65.590 26.051  1.00 19.22  ? 339 LEU C N     1 
ATOM   10070 C CA    . LEU C 1 339 ? 16.264  65.021 24.855  1.00 20.45  ? 339 LEU C CA    1 
ATOM   10071 C C     . LEU C 1 339 ? 16.622  65.872 23.624  1.00 19.73  ? 339 LEU C C     1 
ATOM   10072 O O     . LEU C 1 339 ? 17.139  65.384 22.625  1.00 19.79  ? 339 LEU C O     1 
ATOM   10073 C CB    . LEU C 1 339 ? 14.746  64.929 25.041  1.00 18.92  ? 339 LEU C CB    1 
ATOM   10074 C CG    . LEU C 1 339 ? 14.317  63.825 26.020  1.00 21.51  ? 339 LEU C CG    1 
ATOM   10075 C CD1   . LEU C 1 339 ? 12.796  63.757 26.084  1.00 19.05  ? 339 LEU C CD1   1 
ATOM   10076 C CD2   . LEU C 1 339 ? 14.924  62.494 25.600  1.00 15.26  ? 339 LEU C CD2   1 
ATOM   10077 N N     . ARG C 1 340 ? 16.509  67.167 23.772  1.00 18.30  ? 340 ARG C N     1 
ATOM   10078 C CA    . ARG C 1 340 ? 16.805  68.090 22.688  1.00 24.40  ? 340 ARG C CA    1 
ATOM   10079 C C     . ARG C 1 340 ? 18.268  68.008 22.260  1.00 28.95  ? 340 ARG C C     1 
ATOM   10080 O O     . ARG C 1 340 ? 18.608  67.786 21.100  1.00 25.55  ? 340 ARG C O     1 
ATOM   10081 C CB    . ARG C 1 340 ? 16.418  69.494 23.100  1.00 18.89  ? 340 ARG C CB    1 
ATOM   10082 C CG    . ARG C 1 340 ? 16.325  70.466 21.924  1.00 30.10  ? 340 ARG C CG    1 
ATOM   10083 C CD    . ARG C 1 340 ? 15.588  71.709 22.406  1.00 33.52  ? 340 ARG C CD    1 
ATOM   10084 N NE    . ARG C 1 340 ? 15.342  72.606 21.256  1.00 35.88  ? 340 ARG C NE    1 
ATOM   10085 C CZ    . ARG C 1 340 ? 16.030  73.741 21.165  1.00 43.48  ? 340 ARG C CZ    1 
ATOM   10086 N NH1   . ARG C 1 340 ? 16.929  74.016 22.109  1.00 39.60  ? 340 ARG C NH1   1 
ATOM   10087 N NH2   . ARG C 1 340 ? 15.820  74.565 20.149  1.00 44.03  ? 340 ARG C NH2   1 
ATOM   10088 N N     . GLU C 1 341 ? 19.182  67.993 23.221  1.00 25.90  ? 341 GLU C N     1 
ATOM   10089 C CA    . GLU C 1 341 ? 20.609  67.924 23.009  1.00 23.99  ? 341 GLU C CA    1 
ATOM   10090 C C     . GLU C 1 341 ? 21.009  66.645 22.307  1.00 25.64  ? 341 GLU C C     1 
ATOM   10091 O O     . GLU C 1 341 ? 22.060  66.591 21.671  1.00 31.05  ? 341 GLU C O     1 
ATOM   10092 C CB    . GLU C 1 341 ? 21.384  68.107 24.320  1.00 19.74  ? 341 GLU C CB    1 
ATOM   10093 C CG    . GLU C 1 341 ? 21.322  69.526 24.845  1.00 24.93  ? 341 GLU C CG    1 
ATOM   10094 C CD    . GLU C 1 341 ? 21.809  69.658 26.293  1.00 29.34  ? 341 GLU C CD    1 
ATOM   10095 O OE1   . GLU C 1 341 ? 22.493  68.746 26.809  1.00 31.74  ? 341 GLU C OE1   1 
ATOM   10096 O OE2   . GLU C 1 341 ? 21.505  70.712 26.895  1.00 25.97  ? 341 GLU C OE2   1 
ATOM   10097 N N     . ALA C 1 342 ? 20.167  65.620 22.351  1.00 20.80  ? 342 ALA C N     1 
ATOM   10098 C CA    . ALA C 1 342 ? 20.430  64.367 21.677  1.00 22.00  ? 342 ALA C CA    1 
ATOM   10099 C C     . ALA C 1 342 ? 19.682  64.290 20.361  1.00 22.05  ? 342 ALA C C     1 
ATOM   10100 O O     . ALA C 1 342 ? 19.614  63.231 19.763  1.00 24.04  ? 342 ALA C O     1 
ATOM   10101 C CB    . ALA C 1 342 ? 20.094  63.195 22.592  1.00 27.24  ? 342 ALA C CB    1 
ATOM   10102 N N     . GLY C 1 343 ? 19.086  65.355 19.862  1.00 22.61  ? 343 GLY C N     1 
ATOM   10103 C CA    . GLY C 1 343 ? 18.359  65.270 18.608  1.00 29.53  ? 343 GLY C CA    1 
ATOM   10104 C C     . GLY C 1 343 ? 16.942  64.730 18.725  1.00 33.31  ? 343 GLY C C     1 
ATOM   10105 O O     . GLY C 1 343 ? 16.397  64.418 17.674  1.00 30.78  ? 343 GLY C O     1 
ATOM   10106 N N     . ILE C 1 344 ? 16.340  64.614 19.913  1.00 29.48  ? 344 ILE C N     1 
ATOM   10107 C CA    . ILE C 1 344 ? 14.933  64.150 19.970  1.00 25.35  ? 344 ILE C CA    1 
ATOM   10108 C C     . ILE C 1 344 ? 14.085  65.400 19.916  1.00 24.15  ? 344 ILE C C     1 
ATOM   10109 O O     . ILE C 1 344 ? 14.311  66.330 20.687  1.00 26.10  ? 344 ILE C O     1 
ATOM   10110 C CB    . ILE C 1 344 ? 14.693  63.374 21.269  1.00 32.06  ? 344 ILE C CB    1 
ATOM   10111 C CG1   . ILE C 1 344 ? 15.603  62.140 21.321  1.00 26.84  ? 344 ILE C CG1   1 
ATOM   10112 C CG2   . ILE C 1 344 ? 13.219  63.063 21.535  1.00 28.10  ? 344 ILE C CG2   1 
ATOM   10113 C CD1   . ILE C 1 344 ? 15.209  61.021 20.399  1.00 28.36  ? 344 ILE C CD1   1 
ATOM   10114 N N     . PRO C 1 345 ? 13.158  65.508 18.974  1.00 23.40  ? 345 PRO C N     1 
ATOM   10115 C CA    . PRO C 1 345 ? 12.307  66.680 18.837  1.00 23.00  ? 345 PRO C CA    1 
ATOM   10116 C C     . PRO C 1 345 ? 11.215  66.794 19.900  1.00 20.03  ? 345 PRO C C     1 
ATOM   10117 O O     . PRO C 1 345 ? 10.395  65.887 20.050  1.00 19.97  ? 345 PRO C O     1 
ATOM   10118 C CB    . PRO C 1 345 ? 11.671  66.444 17.457  1.00 21.18  ? 345 PRO C CB    1 
ATOM   10119 C CG    . PRO C 1 345 ? 11.566  64.956 17.381  1.00 23.98  ? 345 PRO C CG    1 
ATOM   10120 C CD    . PRO C 1 345 ? 12.837  64.418 18.012  1.00 22.61  ? 345 PRO C CD    1 
ATOM   10121 N N     . ILE C 1 346 ? 11.122  67.931 20.566  1.00 19.50  ? 346 ILE C N     1 
ATOM   10122 C CA    . ILE C 1 346 ? 10.128  68.176 21.578  1.00 22.92  ? 346 ILE C CA    1 
ATOM   10123 C C     . ILE C 1 346 ? 9.445   69.520 21.370  1.00 26.24  ? 346 ILE C C     1 
ATOM   10124 O O     . ILE C 1 346 ? 9.972   70.366 20.644  1.00 24.99  ? 346 ILE C O     1 
ATOM   10125 C CB    . ILE C 1 346 ? 10.775  68.199 22.994  1.00 18.36  ? 346 ILE C CB    1 
ATOM   10126 C CG1   . ILE C 1 346 ? 11.782  69.338 23.117  1.00 20.70  ? 346 ILE C CG1   1 
ATOM   10127 C CG2   . ILE C 1 346 ? 11.409  66.865 23.323  1.00 19.11  ? 346 ILE C CG2   1 
ATOM   10128 C CD1   . ILE C 1 346 ? 12.255  69.610 24.541  1.00 21.01  ? 346 ILE C CD1   1 
ATOM   10129 N N     . GLN C 1 347 ? 8.325   69.676 22.082  1.00 22.71  ? 347 GLN C N     1 
ATOM   10130 C CA    . GLN C 1 347 ? 7.681   70.994 22.062  1.00 22.91  ? 347 GLN C CA    1 
ATOM   10131 C C     . GLN C 1 347 ? 8.660   71.855 22.838  1.00 24.05  ? 347 GLN C C     1 
ATOM   10132 O O     . GLN C 1 347 ? 9.133   71.441 23.908  1.00 23.79  ? 347 GLN C O     1 
ATOM   10133 C CB    . GLN C 1 347 ? 6.262   70.873 22.580  1.00 23.14  ? 347 GLN C CB    1 
ATOM   10134 C CG    . GLN C 1 347 ? 5.646   72.123 23.166  1.00 34.20  ? 347 GLN C CG    1 
ATOM   10135 C CD    . GLN C 1 347 ? 4.966   73.045 22.180  1.00 48.87  ? 347 GLN C CD    1 
ATOM   10136 O OE1   . GLN C 1 347 ? 5.614   73.550 21.247  1.00 52.72  ? 347 GLN C OE1   1 
ATOM   10137 N NE2   . GLN C 1 347 ? 3.663   73.294 22.379  1.00 41.58  ? 347 GLN C NE2   1 
ATOM   10138 N N     . TYR C 1 348 ? 9.031   73.014 22.289  1.00 21.98  ? 348 TYR C N     1 
ATOM   10139 C CA    . TYR C 1 348 ? 10.029  73.857 22.959  1.00 20.13  ? 348 TYR C CA    1 
ATOM   10140 C C     . TYR C 1 348 ? 9.529   75.267 22.959  1.00 20.12  ? 348 TYR C C     1 
ATOM   10141 O O     . TYR C 1 348 ? 8.934   75.734 21.977  1.00 30.86  ? 348 TYR C O     1 
ATOM   10142 C CB    . TYR C 1 348 ? 11.344  73.523 22.199  1.00 21.53  ? 348 TYR C CB    1 
ATOM   10143 C CG    . TYR C 1 348 ? 12.496  74.301 22.809  1.00 28.33  ? 348 TYR C CG    1 
ATOM   10144 C CD1   . TYR C 1 348 ? 13.142  73.834 23.956  1.00 28.07  ? 348 TYR C CD1   1 
ATOM   10145 C CD2   . TYR C 1 348 ? 12.874  75.511 22.246  1.00 31.80  ? 348 TYR C CD2   1 
ATOM   10146 C CE1   . TYR C 1 348 ? 14.166  74.568 24.521  1.00 29.33  ? 348 TYR C CE1   1 
ATOM   10147 C CE2   . TYR C 1 348 ? 13.909  76.233 22.811  1.00 32.94  ? 348 TYR C CE2   1 
ATOM   10148 C CZ    . TYR C 1 348 ? 14.538  75.756 23.940  1.00 31.23  ? 348 TYR C CZ    1 
ATOM   10149 O OH    . TYR C 1 348 ? 15.559  76.508 24.465  1.00 38.10  ? 348 TYR C OH    1 
ATOM   10150 N N     . PRO C 1 349 ? 9.687   75.997 24.057  1.00 21.31  ? 349 PRO C N     1 
ATOM   10151 C CA    . PRO C 1 349 ? 10.278  75.510 25.285  1.00 20.55  ? 349 PRO C CA    1 
ATOM   10152 C C     . PRO C 1 349 ? 9.334   74.579 26.046  1.00 24.24  ? 349 PRO C C     1 
ATOM   10153 O O     . PRO C 1 349 ? 8.131   74.439 25.704  1.00 18.36  ? 349 PRO C O     1 
ATOM   10154 C CB    . PRO C 1 349 ? 10.459  76.805 26.091  1.00 20.61  ? 349 PRO C CB    1 
ATOM   10155 C CG    . PRO C 1 349 ? 9.249   77.630 25.703  1.00 21.93  ? 349 PRO C CG    1 
ATOM   10156 C CD    . PRO C 1 349 ? 9.125   77.376 24.221  1.00 19.71  ? 349 PRO C CD    1 
ATOM   10157 N N     . THR C 1 350 ? 9.881   73.877 27.051  1.00 19.17  ? 350 THR C N     1 
ATOM   10158 C CA    . THR C 1 350 ? 9.078   72.928 27.812  1.00 16.48  ? 350 THR C CA    1 
ATOM   10159 C C     . THR C 1 350 ? 8.079   73.671 28.712  1.00 12.01  ? 350 THR C C     1 
ATOM   10160 O O     . THR C 1 350 ? 8.324   74.775 29.162  1.00 12.14  ? 350 THR C O     1 
ATOM   10161 C CB    . THR C 1 350 ? 9.935   72.012 28.703  1.00 18.44  ? 350 THR C CB    1 
ATOM   10162 O OG1   . THR C 1 350 ? 10.915  72.788 29.396  1.00 15.71  ? 350 THR C OG1   1 
ATOM   10163 C CG2   . THR C 1 350 ? 10.677  70.981 27.846  1.00 18.21  ? 350 THR C CG2   1 
ATOM   10164 N N     . GLY C 1 351 ? 6.912   73.109 28.873  1.00 14.69  ? 351 GLY C N     1 
ATOM   10165 C CA    . GLY C 1 351 ? 5.888   73.688 29.753  1.00 18.24  ? 351 GLY C CA    1 
ATOM   10166 C C     . GLY C 1 351 ? 6.196   73.344 31.222  1.00 19.70  ? 351 GLY C C     1 
ATOM   10167 O O     . GLY C 1 351 ? 7.313   72.951 31.596  1.00 15.73  ? 351 GLY C O     1 
ATOM   10168 N N     . GLY C 1 352 ? 5.184   73.543 32.068  1.00 15.25  ? 352 GLY C N     1 
ATOM   10169 C CA    . GLY C 1 352 ? 5.401   73.434 33.503  1.00 12.42  ? 352 GLY C CA    1 
ATOM   10170 C C     . GLY C 1 352 ? 5.510   72.016 34.027  1.00 12.31  ? 352 GLY C C     1 
ATOM   10171 O O     . GLY C 1 352 ? 6.153   71.803 35.072  1.00 14.26  ? 352 GLY C O     1 
ATOM   10172 N N     . HIS C 1 353 ? 4.826   71.057 33.409  1.00 10.12  ? 353 HIS C N     1 
ATOM   10173 C CA    . HIS C 1 353 ? 4.679   69.759 34.058  1.00 14.30  ? 353 HIS C CA    1 
ATOM   10174 C C     . HIS C 1 353 ? 4.955   68.536 33.223  1.00 13.60  ? 353 HIS C C     1 
ATOM   10175 O O     . HIS C 1 353 ? 4.775   67.423 33.696  1.00 12.48  ? 353 HIS C O     1 
ATOM   10176 C CB    . HIS C 1 353 ? 3.197   69.705 34.492  1.00 13.62  ? 353 HIS C CB    1 
ATOM   10177 C CG    . HIS C 1 353 ? 2.283   69.613 33.283  1.00 10.07  ? 353 HIS C CG    1 
ATOM   10178 N ND1   . HIS C 1 353 ? 2.075   70.706 32.440  1.00 14.71  ? 353 HIS C ND1   1 
ATOM   10179 C CD2   . HIS C 1 353 ? 1.514   68.599 32.840  1.00 11.63  ? 353 HIS C CD2   1 
ATOM   10180 C CE1   . HIS C 1 353 ? 1.198   70.316 31.508  1.00 13.54  ? 353 HIS C CE1   1 
ATOM   10181 N NE2   . HIS C 1 353 ? 0.855   69.056 31.716  1.00 11.60  ? 353 HIS C NE2   1 
ATOM   10182 N N     . ALA C 1 354 ? 5.374   68.759 31.967  1.00 14.76  ? 354 ALA C N     1 
ATOM   10183 C CA    . ALA C 1 354 ? 5.543   67.644 31.063  1.00 13.43  ? 354 ALA C CA    1 
ATOM   10184 C C     . ALA C 1 354 ? 6.419   68.011 29.871  1.00 17.28  ? 354 ALA C C     1 
ATOM   10185 O O     . ALA C 1 354 ? 6.543   69.164 29.507  1.00 13.12  ? 354 ALA C O     1 
ATOM   10186 C CB    . ALA C 1 354 ? 4.162   67.309 30.467  1.00 8.24   ? 354 ALA C CB    1 
ATOM   10187 N N     . VAL C 1 355 ? 6.974   66.995 29.261  1.00 16.47  ? 355 VAL C N     1 
ATOM   10188 C CA    . VAL C 1 355 ? 7.766   67.146 28.055  1.00 19.05  ? 355 VAL C CA    1 
ATOM   10189 C C     . VAL C 1 355 ? 6.964   66.387 26.987  1.00 17.17  ? 355 VAL C C     1 
ATOM   10190 O O     . VAL C 1 355 ? 6.507   65.267 27.201  1.00 15.30  ? 355 VAL C O     1 
ATOM   10191 C CB    . VAL C 1 355 ? 9.180   66.553 28.205  1.00 22.89  ? 355 VAL C CB    1 
ATOM   10192 C CG1   . VAL C 1 355 ? 9.905   66.370 26.870  1.00 16.18  ? 355 VAL C CG1   1 
ATOM   10193 C CG2   . VAL C 1 355 ? 9.982   67.447 29.144  1.00 12.93  ? 355 VAL C CG2   1 
ATOM   10194 N N     . PHE C 1 356 ? 6.761   67.062 25.860  1.00 15.85  ? 356 PHE C N     1 
ATOM   10195 C CA    . PHE C 1 356 ? 6.013   66.444 24.738  1.00 17.22  ? 356 PHE C CA    1 
ATOM   10196 C C     . PHE C 1 356 ? 6.988   66.135 23.607  1.00 17.95  ? 356 PHE C C     1 
ATOM   10197 O O     . PHE C 1 356 ? 7.664   67.057 23.127  1.00 21.34  ? 356 PHE C O     1 
ATOM   10198 C CB    . PHE C 1 356 ? 4.956   67.422 24.203  1.00 20.18  ? 356 PHE C CB    1 
ATOM   10199 C CG    . PHE C 1 356 ? 3.791   67.602 25.136  1.00 21.57  ? 356 PHE C CG    1 
ATOM   10200 C CD1   . PHE C 1 356 ? 3.942   68.236 26.358  1.00 25.38  ? 356 PHE C CD1   1 
ATOM   10201 C CD2   . PHE C 1 356 ? 2.551   67.094 24.811  1.00 31.47  ? 356 PHE C CD2   1 
ATOM   10202 C CE1   . PHE C 1 356 ? 2.874   68.372 27.226  1.00 33.56  ? 356 PHE C CE1   1 
ATOM   10203 C CE2   . PHE C 1 356 ? 1.466   67.242 25.662  1.00 27.47  ? 356 PHE C CE2   1 
ATOM   10204 C CZ    . PHE C 1 356 ? 1.639   67.887 26.858  1.00 26.64  ? 356 PHE C CZ    1 
ATOM   10205 N N     . VAL C 1 357 ? 7.104   64.903 23.179  1.00 13.85  ? 357 VAL C N     1 
ATOM   10206 C CA    . VAL C 1 357 ? 7.999   64.407 22.167  1.00 23.62  ? 357 VAL C CA    1 
ATOM   10207 C C     . VAL C 1 357 ? 7.223   64.124 20.865  1.00 27.08  ? 357 VAL C C     1 
ATOM   10208 O O     . VAL C 1 357 ? 6.237   63.406 20.861  1.00 24.31  ? 357 VAL C O     1 
ATOM   10209 C CB    . VAL C 1 357 ? 8.675   63.106 22.616  1.00 25.67  ? 357 VAL C CB    1 
ATOM   10210 C CG1   . VAL C 1 357 ? 9.577   62.510 21.562  1.00 24.69  ? 357 VAL C CG1   1 
ATOM   10211 C CG2   . VAL C 1 357 ? 9.458   63.349 23.925  1.00 23.94  ? 357 VAL C CG2   1 
ATOM   10212 N N     . ASP C 1 358 ? 7.646   64.776 19.800  1.00 28.14  ? 358 ASP C N     1 
ATOM   10213 C CA    . ASP C 1 358 ? 7.019   64.647 18.472  1.00 29.42  ? 358 ASP C CA    1 
ATOM   10214 C C     . ASP C 1 358 ? 7.413   63.329 17.848  1.00 27.37  ? 358 ASP C C     1 
ATOM   10215 O O     . ASP C 1 358 ? 8.526   63.210 17.335  1.00 30.36  ? 358 ASP C O     1 
ATOM   10216 C CB    . ASP C 1 358 ? 7.513   65.826 17.635  1.00 42.29  ? 358 ASP C CB    1 
ATOM   10217 C CG    . ASP C 1 358 ? 6.933   65.934 16.230  1.00 52.99  ? 358 ASP C CG    1 
ATOM   10218 O OD1   . ASP C 1 358 ? 6.746   64.908 15.541  1.00 51.78  ? 358 ASP C OD1   1 
ATOM   10219 O OD2   . ASP C 1 358 ? 6.668   67.100 15.840  1.00 50.20  ? 358 ASP C OD2   1 
ATOM   10220 N N     . CYS C 1 359 ? 6.579   62.312 17.895  1.00 26.78  ? 359 CYS C N     1 
ATOM   10221 C CA    . CYS C 1 359 ? 6.862   60.990 17.379  1.00 33.55  ? 359 CYS C CA    1 
ATOM   10222 C C     . CYS C 1 359 ? 6.781   60.839 15.859  1.00 39.54  ? 359 CYS C C     1 
ATOM   10223 O O     . CYS C 1 359 ? 7.245   59.828 15.306  1.00 36.89  ? 359 CYS C O     1 
ATOM   10224 C CB    . CYS C 1 359 ? 5.923   59.968 18.057  1.00 37.19  ? 359 CYS C CB    1 
ATOM   10225 S SG    . CYS C 1 359 ? 6.327   59.776 19.827  1.00 37.33  ? 359 CYS C SG    1 
ATOM   10226 N N     . LYS C 1 360 ? 6.196   61.819 15.188  1.00 40.28  ? 360 LYS C N     1 
ATOM   10227 C CA    . LYS C 1 360 ? 6.112   61.819 13.729  1.00 50.99  ? 360 LYS C CA    1 
ATOM   10228 C C     . LYS C 1 360 ? 7.516   61.762 13.119  1.00 51.96  ? 360 LYS C C     1 
ATOM   10229 O O     . LYS C 1 360 ? 7.844   60.881 12.324  1.00 52.28  ? 360 LYS C O     1 
ATOM   10230 C CB    . LYS C 1 360 ? 5.404   63.067 13.207  1.00 55.06  ? 360 LYS C CB    1 
ATOM   10231 C CG    . LYS C 1 360 ? 4.212   62.781 12.311  1.00 65.83  ? 360 LYS C CG    1 
ATOM   10232 C CD    . LYS C 1 360 ? 3.499   64.083 11.961  1.00 72.15  ? 360 LYS C CD    1 
ATOM   10233 C CE    . LYS C 1 360 ? 2.351   63.844 10.993  1.00 76.46  ? 360 LYS C CE    1 
ATOM   10234 N NZ    . LYS C 1 360 ? 1.099   64.523 11.439  1.00 78.44  ? 360 LYS C NZ    1 
ATOM   10235 N N     . LYS C 1 361 ? 8.382   62.655 13.612  1.00 51.45  ? 361 LYS C N     1 
ATOM   10236 C CA    . LYS C 1 361 ? 9.755   62.738 13.164  1.00 49.10  ? 361 LYS C CA    1 
ATOM   10237 C C     . LYS C 1 361 ? 10.590  61.551 13.597  1.00 49.81  ? 361 LYS C C     1 
ATOM   10238 O O     . LYS C 1 361 ? 11.651  61.322 13.012  1.00 53.40  ? 361 LYS C O     1 
ATOM   10239 C CB    . LYS C 1 361 ? 10.409  64.026 13.645  1.00 46.34  ? 361 LYS C CB    1 
ATOM   10240 C CG    . LYS C 1 361 ? 9.548   65.274 13.591  1.00 52.18  ? 361 LYS C CG    1 
ATOM   10241 C CD    . LYS C 1 361 ? 10.407  66.508 13.339  1.00 59.44  ? 361 LYS C CD    1 
ATOM   10242 C CE    . LYS C 1 361 ? 9.572   67.772 13.266  1.00 65.88  ? 361 LYS C CE    1 
ATOM   10243 N NZ    . LYS C 1 361 ? 9.588   68.560 14.532  1.00 71.81  ? 361 LYS C NZ    1 
ATOM   10244 N N     . LEU C 1 362 ? 10.171  60.786 14.595  1.00 48.39  ? 362 LEU C N     1 
ATOM   10245 C CA    . LEU C 1 362 ? 10.956  59.645 15.049  1.00 47.13  ? 362 LEU C CA    1 
ATOM   10246 C C     . LEU C 1 362 ? 10.602  58.394 14.265  1.00 45.16  ? 362 LEU C C     1 
ATOM   10247 O O     . LEU C 1 362 ? 11.437  57.504 14.103  1.00 42.72  ? 362 LEU C O     1 
ATOM   10248 C CB    . LEU C 1 362 ? 10.749  59.383 16.542  1.00 43.33  ? 362 LEU C CB    1 
ATOM   10249 C CG    . LEU C 1 362 ? 11.193  60.451 17.531  1.00 43.00  ? 362 LEU C CG    1 
ATOM   10250 C CD1   . LEU C 1 362 ? 11.052  59.920 18.957  1.00 39.78  ? 362 LEU C CD1   1 
ATOM   10251 C CD2   . LEU C 1 362 ? 12.631  60.878 17.263  1.00 42.68  ? 362 LEU C CD2   1 
ATOM   10252 N N     . VAL C 1 363 ? 9.340   58.270 13.852  1.00 44.86  ? 363 VAL C N     1 
ATOM   10253 C CA    . VAL C 1 363 ? 8.922   57.069 13.130  1.00 48.60  ? 363 VAL C CA    1 
ATOM   10254 C C     . VAL C 1 363 ? 8.112   57.453 11.898  1.00 51.56  ? 363 VAL C C     1 
ATOM   10255 O O     . VAL C 1 363 ? 6.898   57.330 11.809  1.00 49.61  ? 363 VAL C O     1 
ATOM   10256 C CB    . VAL C 1 363 ? 8.112   56.091 13.998  1.00 48.50  ? 363 VAL C CB    1 
ATOM   10257 C CG1   . VAL C 1 363 ? 9.020   55.252 14.882  1.00 46.47  ? 363 VAL C CG1   1 
ATOM   10258 C CG2   . VAL C 1 363 ? 7.062   56.824 14.821  1.00 35.58  ? 363 VAL C CG2   1 
ATOM   10259 N N     . PRO C 1 364 ? 8.813   57.914 10.865  1.00 54.24  ? 364 PRO C N     1 
ATOM   10260 C CA    . PRO C 1 364 ? 8.177   58.372 9.630   1.00 54.26  ? 364 PRO C CA    1 
ATOM   10261 C C     . PRO C 1 364 ? 7.478   57.256 8.887   1.00 51.86  ? 364 PRO C C     1 
ATOM   10262 O O     . PRO C 1 364 ? 6.404   57.463 8.317   1.00 52.90  ? 364 PRO C O     1 
ATOM   10263 C CB    . PRO C 1 364 ? 9.293   59.054 8.862   1.00 55.30  ? 364 PRO C CB    1 
ATOM   10264 C CG    . PRO C 1 364 ? 10.360  59.324 9.875   1.00 56.47  ? 364 PRO C CG    1 
ATOM   10265 C CD    . PRO C 1 364 ? 10.280  58.139 10.815  1.00 53.47  ? 364 PRO C CD    1 
ATOM   10266 N N     . GLN C 1 365 ? 7.965   56.030 9.002   1.00 52.50  ? 365 GLN C N     1 
ATOM   10267 C CA    . GLN C 1 365 ? 7.372   54.862 8.385   1.00 54.06  ? 365 GLN C CA    1 
ATOM   10268 C C     . GLN C 1 365 ? 6.005   54.487 8.931   1.00 55.97  ? 365 GLN C C     1 
ATOM   10269 O O     . GLN C 1 365 ? 5.337   53.656 8.305   1.00 57.90  ? 365 GLN C O     1 
ATOM   10270 C CB    . GLN C 1 365 ? 8.309   53.652 8.521   1.00 55.89  ? 365 GLN C CB    1 
ATOM   10271 C CG    . GLN C 1 365 ? 8.292   52.969 9.874   1.00 59.42  ? 365 GLN C CG    1 
ATOM   10272 C CD    . GLN C 1 365 ? 9.236   53.586 10.891  1.00 58.58  ? 365 GLN C CD    1 
ATOM   10273 O OE1   . GLN C 1 365 ? 9.699   54.721 10.758  1.00 56.94  ? 365 GLN C OE1   1 
ATOM   10274 N NE2   . GLN C 1 365 ? 9.537   52.827 11.942  1.00 56.00  ? 365 GLN C NE2   1 
ATOM   10275 N N     . ILE C 1 366 ? 5.604   54.983 10.100  1.00 55.06  ? 366 ILE C N     1 
ATOM   10276 C CA    . ILE C 1 366 ? 4.316   54.630 10.665  1.00 51.53  ? 366 ILE C CA    1 
ATOM   10277 C C     . ILE C 1 366 ? 3.301   55.739 10.405  1.00 51.40  ? 366 ILE C C     1 
ATOM   10278 O O     . ILE C 1 366 ? 3.402   56.857 10.885  1.00 49.87  ? 366 ILE C O     1 
ATOM   10279 C CB    . ILE C 1 366 ? 4.366   54.301 12.166  1.00 50.03  ? 366 ILE C CB    1 
ATOM   10280 C CG1   . ILE C 1 366 ? 5.513   53.347 12.481  1.00 47.08  ? 366 ILE C CG1   1 
ATOM   10281 C CG2   . ILE C 1 366 ? 3.039   53.700 12.622  1.00 51.55  ? 366 ILE C CG2   1 
ATOM   10282 C CD1   . ILE C 1 366 ? 5.882   53.190 13.934  1.00 49.99  ? 366 ILE C CD1   1 
ATOM   10283 N N     . PRO C 1 367 ? 2.281   55.393 9.621   1.00 52.82  ? 367 PRO C N     1 
ATOM   10284 C CA    . PRO C 1 367 ? 1.196   56.298 9.307   1.00 52.98  ? 367 PRO C CA    1 
ATOM   10285 C C     . PRO C 1 367 ? 0.321   56.582 10.521  1.00 52.90  ? 367 PRO C C     1 
ATOM   10286 O O     . PRO C 1 367 ? 0.080   55.711 11.359  1.00 51.00  ? 367 PRO C O     1 
ATOM   10287 C CB    . PRO C 1 367 ? 0.426   55.553 8.222   1.00 52.64  ? 367 PRO C CB    1 
ATOM   10288 C CG    . PRO C 1 367 ? 0.675   54.115 8.497   1.00 52.41  ? 367 PRO C CG    1 
ATOM   10289 C CD    . PRO C 1 367 ? 2.077   54.037 9.032   1.00 51.95  ? 367 PRO C CD    1 
ATOM   10290 N N     . GLY C 1 368 ? -0.206  57.790 10.605  1.00 51.22  ? 368 GLY C N     1 
ATOM   10291 C CA    . GLY C 1 368 ? -1.054  58.257 11.671  1.00 53.43  ? 368 GLY C CA    1 
ATOM   10292 C C     . GLY C 1 368 ? -1.994  57.220 12.241  1.00 56.27  ? 368 GLY C C     1 
ATOM   10293 O O     . GLY C 1 368 ? -1.992  56.890 13.439  1.00 56.20  ? 368 GLY C O     1 
ATOM   10294 N N     . ASP C 1 369 ? -2.810  56.603 11.399  1.00 54.92  ? 369 ASP C N     1 
ATOM   10295 C CA    . ASP C 1 369 ? -3.803  55.597 11.723  1.00 53.59  ? 369 ASP C CA    1 
ATOM   10296 C C     . ASP C 1 369 ? -3.270  54.287 12.273  1.00 49.31  ? 369 ASP C C     1 
ATOM   10297 O O     . ASP C 1 369 ? -4.028  53.382 12.653  1.00 50.52  ? 369 ASP C O     1 
ATOM   10298 C CB    . ASP C 1 369 ? -4.654  55.368 10.452  1.00 62.72  ? 369 ASP C CB    1 
ATOM   10299 C CG    . ASP C 1 369 ? -3.900  54.604 9.377   1.00 63.01  ? 369 ASP C CG    1 
ATOM   10300 O OD1   . ASP C 1 369 ? -2.712  54.892 9.128   1.00 67.60  ? 369 ASP C OD1   1 
ATOM   10301 O OD2   . ASP C 1 369 ? -4.480  53.683 8.771   1.00 69.88  ? 369 ASP C OD2   1 
ATOM   10302 N N     . GLN C 1 370 ? -1.961  54.136 12.340  1.00 44.27  ? 370 GLN C N     1 
ATOM   10303 C CA    . GLN C 1 370 ? -1.267  53.004 12.908  1.00 44.37  ? 370 GLN C CA    1 
ATOM   10304 C C     . GLN C 1 370 ? -0.614  53.388 14.242  1.00 40.34  ? 370 GLN C C     1 
ATOM   10305 O O     . GLN C 1 370 ? 0.131   52.658 14.866  1.00 36.99  ? 370 GLN C O     1 
ATOM   10306 C CB    . GLN C 1 370 ? -0.235  52.454 11.929  1.00 52.92  ? 370 GLN C CB    1 
ATOM   10307 C CG    . GLN C 1 370 ? -0.861  51.700 10.772  1.00 61.46  ? 370 GLN C CG    1 
ATOM   10308 C CD    . GLN C 1 370 ? 0.163   51.067 9.857   1.00 68.03  ? 370 GLN C CD    1 
ATOM   10309 O OE1   . GLN C 1 370 ? 1.373   51.134 10.076  1.00 68.94  ? 370 GLN C OE1   1 
ATOM   10310 N NE2   . GLN C 1 370 ? -0.333  50.436 8.797   1.00 71.84  ? 370 GLN C NE2   1 
ATOM   10311 N N     . PHE C 1 371 ? -0.937  54.582 14.703  1.00 37.80  ? 371 PHE C N     1 
ATOM   10312 C CA    . PHE C 1 371 ? -0.587  55.183 15.973  1.00 42.91  ? 371 PHE C CA    1 
ATOM   10313 C C     . PHE C 1 371 ? 0.898   55.184 16.285  1.00 41.13  ? 371 PHE C C     1 
ATOM   10314 O O     . PHE C 1 371 ? 1.397   54.423 17.098  1.00 37.65  ? 371 PHE C O     1 
ATOM   10315 C CB    . PHE C 1 371 ? -1.409  54.482 17.064  1.00 40.25  ? 371 PHE C CB    1 
ATOM   10316 C CG    . PHE C 1 371 ? -2.861  54.296 16.698  1.00 43.39  ? 371 PHE C CG    1 
ATOM   10317 C CD1   . PHE C 1 371 ? -3.677  55.375 16.440  1.00 45.05  ? 371 PHE C CD1   1 
ATOM   10318 C CD2   . PHE C 1 371 ? -3.393  53.028 16.566  1.00 44.37  ? 371 PHE C CD2   1 
ATOM   10319 C CE1   . PHE C 1 371 ? -5.006  55.215 16.114  1.00 44.18  ? 371 PHE C CE1   1 
ATOM   10320 C CE2   . PHE C 1 371 ? -4.717  52.849 16.228  1.00 50.53  ? 371 PHE C CE2   1 
ATOM   10321 C CZ    . PHE C 1 371 ? -5.530  53.948 16.005  1.00 46.33  ? 371 PHE C CZ    1 
ATOM   10322 N N     . PRO C 1 372 ? 1.647   56.051 15.600  1.00 40.08  ? 372 PRO C N     1 
ATOM   10323 C CA    . PRO C 1 372 ? 3.087   56.149 15.736  1.00 37.02  ? 372 PRO C CA    1 
ATOM   10324 C C     . PRO C 1 372 ? 3.548   56.547 17.138  1.00 33.94  ? 372 PRO C C     1 
ATOM   10325 O O     . PRO C 1 372 ? 4.583   56.064 17.601  1.00 32.84  ? 372 PRO C O     1 
ATOM   10326 C CB    . PRO C 1 372 ? 3.490   57.222 14.719  1.00 38.14  ? 372 PRO C CB    1 
ATOM   10327 C CG    . PRO C 1 372 ? 2.248   58.010 14.476  1.00 36.62  ? 372 PRO C CG    1 
ATOM   10328 C CD    . PRO C 1 372 ? 1.125   57.014 14.594  1.00 37.67  ? 372 PRO C CD    1 
ATOM   10329 N N     . ALA C 1 373 ? 2.849   57.483 17.770  1.00 26.87  ? 373 ALA C N     1 
ATOM   10330 C CA    . ALA C 1 373 ? 3.212   57.885 19.131  1.00 32.89  ? 373 ALA C CA    1 
ATOM   10331 C C     . ALA C 1 373 ? 3.023   56.706 20.085  1.00 30.70  ? 373 ALA C C     1 
ATOM   10332 O O     . ALA C 1 373 ? 3.899   56.427 20.913  1.00 31.44  ? 373 ALA C O     1 
ATOM   10333 C CB    . ALA C 1 373 ? 2.480   59.147 19.563  1.00 19.84  ? 373 ALA C CB    1 
ATOM   10334 N N     . GLN C 1 374 ? 1.981   55.898 19.948  1.00 30.86  ? 374 GLN C N     1 
ATOM   10335 C CA    . GLN C 1 374 ? 1.735   54.730 20.775  1.00 28.33  ? 374 GLN C CA    1 
ATOM   10336 C C     . GLN C 1 374 ? 2.783   53.648 20.549  1.00 34.17  ? 374 GLN C C     1 
ATOM   10337 O O     . GLN C 1 374 ? 3.090   52.914 21.500  1.00 29.93  ? 374 GLN C O     1 
ATOM   10338 C CB    . GLN C 1 374 ? 0.358   54.115 20.594  1.00 29.75  ? 374 GLN C CB    1 
ATOM   10339 C CG    . GLN C 1 374 ? -0.096  53.161 21.696  1.00 31.09  ? 374 GLN C CG    1 
ATOM   10340 C CD    . GLN C 1 374 ? -0.035  53.814 23.070  1.00 29.17  ? 374 GLN C CD    1 
ATOM   10341 O OE1   . GLN C 1 374 ? -0.637  54.857 23.299  1.00 21.88  ? 374 GLN C OE1   1 
ATOM   10342 N NE2   . GLN C 1 374 ? 0.740   53.240 23.982  1.00 21.65  ? 374 GLN C NE2   1 
ATOM   10343 N N     . ALA C 1 375 ? 3.315   53.556 19.319  1.00 29.79  ? 375 ALA C N     1 
ATOM   10344 C CA    . ALA C 1 375 ? 4.355   52.564 19.051  1.00 28.95  ? 375 ALA C CA    1 
ATOM   10345 C C     . ALA C 1 375 ? 5.640   52.994 19.747  1.00 22.31  ? 375 ALA C C     1 
ATOM   10346 O O     . ALA C 1 375 ? 6.370   52.161 20.270  1.00 24.05  ? 375 ALA C O     1 
ATOM   10347 C CB    . ALA C 1 375 ? 4.614   52.346 17.561  1.00 33.63  ? 375 ALA C CB    1 
ATOM   10348 N N     . VAL C 1 376 ? 5.930   54.293 19.752  1.00 21.49  ? 376 VAL C N     1 
ATOM   10349 C CA    . VAL C 1 376 ? 7.113   54.751 20.487  1.00 27.19  ? 376 VAL C CA    1 
ATOM   10350 C C     . VAL C 1 376 ? 6.938   54.466 21.990  1.00 23.93  ? 376 VAL C C     1 
ATOM   10351 O O     . VAL C 1 376 ? 7.796   53.926 22.683  1.00 24.25  ? 376 VAL C O     1 
ATOM   10352 C CB    . VAL C 1 376 ? 7.347   56.246 20.219  1.00 31.03  ? 376 VAL C CB    1 
ATOM   10353 C CG1   . VAL C 1 376 ? 8.474   56.787 21.106  1.00 24.07  ? 376 VAL C CG1   1 
ATOM   10354 C CG2   . VAL C 1 376 ? 7.696   56.484 18.746  1.00 33.76  ? 376 VAL C CG2   1 
ATOM   10355 N N     . ILE C 1 377 ? 5.768   54.800 22.530  1.00 25.09  ? 377 ILE C N     1 
ATOM   10356 C CA    . ILE C 1 377 ? 5.458   54.602 23.968  1.00 21.67  ? 377 ILE C CA    1 
ATOM   10357 C C     . ILE C 1 377 ? 5.606   53.169 24.407  1.00 22.08  ? 377 ILE C C     1 
ATOM   10358 O O     . ILE C 1 377 ? 6.308   52.869 25.390  1.00 19.52  ? 377 ILE C O     1 
ATOM   10359 C CB    . ILE C 1 377 ? 4.042   55.135 24.213  1.00 23.18  ? 377 ILE C CB    1 
ATOM   10360 C CG1   . ILE C 1 377 ? 4.158   56.657 24.139  1.00 16.82  ? 377 ILE C CG1   1 
ATOM   10361 C CG2   . ILE C 1 377 ? 3.428   54.630 25.514  1.00 27.36  ? 377 ILE C CG2   1 
ATOM   10362 C CD1   . ILE C 1 377 ? 2.800   57.358 24.113  1.00 18.31  ? 377 ILE C CD1   1 
ATOM   10363 N N     . ASN C 1 378 ? 5.060   52.247 23.619  1.00 20.55  ? 378 ASN C N     1 
ATOM   10364 C CA    . ASN C 1 378 ? 5.139   50.823 23.871  1.00 20.19  ? 378 ASN C CA    1 
ATOM   10365 C C     . ASN C 1 378 ? 6.560   50.310 23.826  1.00 26.54  ? 378 ASN C C     1 
ATOM   10366 O O     . ASN C 1 378 ? 6.938   49.483 24.666  1.00 26.60  ? 378 ASN C O     1 
ATOM   10367 C CB    . ASN C 1 378 ? 4.261   50.061 22.864  1.00 28.42  ? 378 ASN C CB    1 
ATOM   10368 C CG    . ASN C 1 378 ? 2.794   50.165 23.221  1.00 30.51  ? 378 ASN C CG    1 
ATOM   10369 O OD1   . ASN C 1 378 ? 2.416   51.022 24.030  1.00 27.61  ? 378 ASN C OD1   1 
ATOM   10370 N ND2   . ASN C 1 378 ? 1.943   49.316 22.644  1.00 31.34  ? 378 ASN C ND2   1 
ATOM   10371 N N     . ALA C 1 379 ? 7.370   50.863 22.914  1.00 26.98  ? 379 ALA C N     1 
ATOM   10372 C CA    . ALA C 1 379 ? 8.785   50.473 22.851  1.00 25.71  ? 379 ALA C CA    1 
ATOM   10373 C C     . ALA C 1 379 ? 9.505   51.011 24.094  1.00 19.58  ? 379 ALA C C     1 
ATOM   10374 O O     . ALA C 1 379 ? 10.262  50.282 24.720  1.00 20.96  ? 379 ALA C O     1 
ATOM   10375 C CB    . ALA C 1 379 ? 9.424   51.004 21.575  1.00 25.18  ? 379 ALA C CB    1 
ATOM   10376 N N     . LEU C 1 380 ? 9.276   52.279 24.429  1.00 19.65  ? 380 LEU C N     1 
ATOM   10377 C CA    . LEU C 1 380 ? 9.870   52.844 25.648  1.00 23.51  ? 380 LEU C CA    1 
ATOM   10378 C C     . LEU C 1 380 ? 9.587   51.978 26.890  1.00 18.65  ? 380 LEU C C     1 
ATOM   10379 O O     . LEU C 1 380 ? 10.457  51.579 27.676  1.00 18.67  ? 380 LEU C O     1 
ATOM   10380 C CB    . LEU C 1 380 ? 9.344   54.255 25.885  1.00 18.22  ? 380 LEU C CB    1 
ATOM   10381 C CG    . LEU C 1 380 ? 9.870   54.961 27.131  1.00 19.29  ? 380 LEU C CG    1 
ATOM   10382 C CD1   . LEU C 1 380 ? 11.392  55.038 27.147  1.00 24.56  ? 380 LEU C CD1   1 
ATOM   10383 C CD2   . LEU C 1 380 ? 9.278   56.363 27.265  1.00 18.53  ? 380 LEU C CD2   1 
ATOM   10384 N N     . TYR C 1 381 ? 8.324   51.604 27.035  1.00 21.35  ? 381 TYR C N     1 
ATOM   10385 C CA    . TYR C 1 381 ? 7.889   50.727 28.110  1.00 20.83  ? 381 TYR C CA    1 
ATOM   10386 C C     . TYR C 1 381 ? 8.660   49.404 28.072  1.00 22.06  ? 381 TYR C C     1 
ATOM   10387 O O     . TYR C 1 381 ? 9.201   48.949 29.082  1.00 22.01  ? 381 TYR C O     1 
ATOM   10388 C CB    . TYR C 1 381 ? 6.366   50.474 28.111  1.00 21.79  ? 381 TYR C CB    1 
ATOM   10389 C CG    . TYR C 1 381 ? 6.082   49.465 29.225  1.00 25.00  ? 381 TYR C CG    1 
ATOM   10390 C CD1   . TYR C 1 381 ? 6.167   49.865 30.562  1.00 23.67  ? 381 TYR C CD1   1 
ATOM   10391 C CD2   . TYR C 1 381 ? 5.793   48.148 28.934  1.00 23.23  ? 381 TYR C CD2   1 
ATOM   10392 C CE1   . TYR C 1 381 ? 5.961   48.930 31.564  1.00 23.58  ? 381 TYR C CE1   1 
ATOM   10393 C CE2   . TYR C 1 381 ? 5.577   47.217 29.937  1.00 28.01  ? 381 TYR C CE2   1 
ATOM   10394 C CZ    . TYR C 1 381 ? 5.675   47.627 31.259  1.00 28.82  ? 381 TYR C CZ    1 
ATOM   10395 O OH    . TYR C 1 381 ? 5.465   46.717 32.271  1.00 30.13  ? 381 TYR C OH    1 
ATOM   10396 N N     . LEU C 1 382 ? 8.657   48.717 26.934  1.00 21.95  ? 382 LEU C N     1 
ATOM   10397 C CA    . LEU C 1 382 ? 9.327   47.426 26.828  1.00 26.51  ? 382 LEU C CA    1 
ATOM   10398 C C     . LEU C 1 382 ? 10.825  47.503 27.069  1.00 25.18  ? 382 LEU C C     1 
ATOM   10399 O O     . LEU C 1 382 ? 11.422  46.564 27.575  1.00 28.48  ? 382 LEU C O     1 
ATOM   10400 C CB    . LEU C 1 382 ? 9.048   46.790 25.458  1.00 36.30  ? 382 LEU C CB    1 
ATOM   10401 C CG    . LEU C 1 382 ? 7.662   46.172 25.309  1.00 39.75  ? 382 LEU C CG    1 
ATOM   10402 C CD1   . LEU C 1 382 ? 7.478   45.650 23.891  1.00 45.45  ? 382 LEU C CD1   1 
ATOM   10403 C CD2   . LEU C 1 382 ? 7.449   45.078 26.339  1.00 41.73  ? 382 LEU C CD2   1 
ATOM   10404 N N     . GLU C 1 383 ? 11.446  48.623 26.785  1.00 25.26  ? 383 GLU C N     1 
ATOM   10405 C CA    . GLU C 1 383 ? 12.838  48.873 26.961  1.00 29.10  ? 383 GLU C CA    1 
ATOM   10406 C C     . GLU C 1 383 ? 13.270  49.342 28.340  1.00 32.87  ? 383 GLU C C     1 
ATOM   10407 O O     . GLU C 1 383 ? 14.444  49.168 28.677  1.00 28.04  ? 383 GLU C O     1 
ATOM   10408 C CB    . GLU C 1 383 ? 13.164  50.025 25.970  1.00 38.49  ? 383 GLU C CB    1 
ATOM   10409 C CG    . GLU C 1 383 ? 14.487  49.907 25.252  1.00 48.13  ? 383 GLU C CG    1 
ATOM   10410 C CD    . GLU C 1 383 ? 14.852  48.520 24.762  1.00 49.29  ? 383 GLU C CD    1 
ATOM   10411 O OE1   . GLU C 1 383 ? 14.006  47.829 24.156  1.00 49.53  ? 383 GLU C OE1   1 
ATOM   10412 O OE2   . GLU C 1 383 ? 16.020  48.153 25.014  1.00 53.24  ? 383 GLU C OE2   1 
ATOM   10413 N N     . SER C 1 384 ? 12.378  49.998 29.094  1.00 27.57  ? 384 SER C N     1 
ATOM   10414 C CA    . SER C 1 384 ? 12.797  50.579 30.359  1.00 26.37  ? 384 SER C CA    1 
ATOM   10415 C C     . SER C 1 384 ? 11.822  50.488 31.532  1.00 24.54  ? 384 SER C C     1 
ATOM   10416 O O     . SER C 1 384 ? 12.163  50.890 32.638  1.00 16.98  ? 384 SER C O     1 
ATOM   10417 C CB    . SER C 1 384 ? 13.012  52.076 30.029  1.00 19.11  ? 384 SER C CB    1 
ATOM   10418 O OG    . SER C 1 384 ? 11.739  52.614 29.684  1.00 21.34  ? 384 SER C OG    1 
ATOM   10419 N N     . GLY C 1 385 ? 10.591  50.028 31.320  1.00 22.67  ? 385 GLY C N     1 
ATOM   10420 C CA    . GLY C 1 385 ? 9.597   49.991 32.383  1.00 23.42  ? 385 GLY C CA    1 
ATOM   10421 C C     . GLY C 1 385 ? 8.999   51.370 32.676  1.00 22.44  ? 385 GLY C C     1 
ATOM   10422 O O     . GLY C 1 385 ? 8.292   51.528 33.665  1.00 23.29  ? 385 GLY C O     1 
ATOM   10423 N N     . VAL C 1 386 ? 9.245   52.380 31.864  1.00 16.83  ? 386 VAL C N     1 
ATOM   10424 C CA    . VAL C 1 386 ? 8.697   53.704 31.968  1.00 15.91  ? 386 VAL C CA    1 
ATOM   10425 C C     . VAL C 1 386 ? 7.357   53.749 31.219  1.00 20.56  ? 386 VAL C C     1 
ATOM   10426 O O     . VAL C 1 386 ? 7.275   53.230 30.093  1.00 23.62  ? 386 VAL C O     1 
ATOM   10427 C CB    . VAL C 1 386 ? 9.659   54.776 31.423  1.00 17.79  ? 386 VAL C CB    1 
ATOM   10428 C CG1   . VAL C 1 386 ? 9.024   56.155 31.449  1.00 10.70  ? 386 VAL C CG1   1 
ATOM   10429 C CG2   . VAL C 1 386 ? 10.959  54.807 32.248  1.00 13.74  ? 386 VAL C CG2   1 
ATOM   10430 N N     . ARG C 1 387 ? 6.332   54.365 31.805  1.00 16.68  ? 387 ARG C N     1 
ATOM   10431 C CA    . ARG C 1 387 ? 5.007   54.431 31.236  1.00 15.77  ? 387 ARG C CA    1 
ATOM   10432 C C     . ARG C 1 387 ? 4.684   55.866 30.859  1.00 16.26  ? 387 ARG C C     1 
ATOM   10433 O O     . ARG C 1 387 ? 4.635   56.715 31.719  1.00 15.70  ? 387 ARG C O     1 
ATOM   10434 C CB    . ARG C 1 387 ? 3.888   53.923 32.150  1.00 14.50  ? 387 ARG C CB    1 
ATOM   10435 C CG    . ARG C 1 387 ? 2.468   54.250 31.688  1.00 14.39  ? 387 ARG C CG    1 
ATOM   10436 C CD    . ARG C 1 387 ? 1.410   53.310 32.299  1.00 19.89  ? 387 ARG C CD    1 
ATOM   10437 N NE    . ARG C 1 387 ? 1.144   53.614 33.714  1.00 13.22  ? 387 ARG C NE    1 
ATOM   10438 C CZ    . ARG C 1 387 ? 0.300   52.970 34.501  1.00 18.69  ? 387 ARG C CZ    1 
ATOM   10439 N NH1   . ARG C 1 387 ? -0.445  51.975 34.014  1.00 12.84  ? 387 ARG C NH1   1 
ATOM   10440 N NH2   . ARG C 1 387 ? 0.134   53.286 35.805  1.00 12.70  ? 387 ARG C NH2   1 
ATOM   10441 N N     . ALA C 1 388 ? 4.483   56.076 29.539  1.00 13.97  ? 388 ALA C N     1 
ATOM   10442 C CA    . ALA C 1 388 ? 4.170   57.440 29.102  1.00 13.26  ? 388 ALA C CA    1 
ATOM   10443 C C     . ALA C 1 388 ? 2.769   57.367 28.500  1.00 16.42  ? 388 ALA C C     1 
ATOM   10444 O O     . ALA C 1 388 ? 2.135   56.297 28.593  1.00 16.25  ? 388 ALA C O     1 
ATOM   10445 C CB    . ALA C 1 388 ? 5.281   57.957 28.203  1.00 15.24  ? 388 ALA C CB    1 
ATOM   10446 N N     . VAL C 1 389 ? 2.257   58.493 28.010  1.00 18.16  ? 389 VAL C N     1 
ATOM   10447 C CA    . VAL C 1 389 ? 0.886   58.489 27.496  1.00 20.46  ? 389 VAL C CA    1 
ATOM   10448 C C     . VAL C 1 389 ? 0.806   59.227 26.163  1.00 26.81  ? 389 VAL C C     1 
ATOM   10449 O O     . VAL C 1 389 ? 1.587   60.154 25.905  1.00 23.88  ? 389 VAL C O     1 
ATOM   10450 C CB    . VAL C 1 389 ? -0.094  59.131 28.485  1.00 18.04  ? 389 VAL C CB    1 
ATOM   10451 C CG1   . VAL C 1 389 ? 0.227   60.605 28.627  1.00 14.05  ? 389 VAL C CG1   1 
ATOM   10452 C CG2   . VAL C 1 389 ? -1.552  58.886 28.081  1.00 20.78  ? 389 VAL C CG2   1 
ATOM   10453 N N     . GLU C 1 390 ? -0.079  58.730 25.300  1.00 28.08  ? 390 GLU C N     1 
ATOM   10454 C CA    . GLU C 1 390 ? -0.223  59.236 23.941  1.00 29.41  ? 390 GLU C CA    1 
ATOM   10455 C C     . GLU C 1 390 ? -1.116  60.445 23.832  1.00 27.61  ? 390 GLU C C     1 
ATOM   10456 O O     . GLU C 1 390 ? -2.188  60.488 24.416  1.00 24.61  ? 390 GLU C O     1 
ATOM   10457 C CB    . GLU C 1 390 ? -0.786  58.125 23.032  1.00 33.57  ? 390 GLU C CB    1 
ATOM   10458 C CG    . GLU C 1 390 ? -0.626  58.313 21.548  1.00 39.80  ? 390 GLU C CG    1 
ATOM   10459 C CD    . GLU C 1 390 ? -1.823  58.772 20.740  1.00 38.74  ? 390 GLU C CD    1 
ATOM   10460 O OE1   . GLU C 1 390 ? -2.791  59.381 21.220  1.00 28.27  ? 390 GLU C OE1   1 
ATOM   10461 O OE2   . GLU C 1 390 ? -1.800  58.557 19.502  1.00 35.51  ? 390 GLU C OE2   1 
ATOM   10462 N N     . ILE C 1 391 ? -0.675  61.449 23.097  1.00 25.30  ? 391 ILE C N     1 
ATOM   10463 C CA    . ILE C 1 391 ? -1.465  62.634 22.781  1.00 31.87  ? 391 ILE C CA    1 
ATOM   10464 C C     . ILE C 1 391 ? -1.387  62.779 21.233  1.00 37.17  ? 391 ILE C C     1 
ATOM   10465 O O     . ILE C 1 391 ? -0.680  63.635 20.701  1.00 31.14  ? 391 ILE C O     1 
ATOM   10466 C CB    . ILE C 1 391 ? -0.999  63.944 23.413  1.00 29.72  ? 391 ILE C CB    1 
ATOM   10467 C CG1   . ILE C 1 391 ? -0.599  63.816 24.871  1.00 36.94  ? 391 ILE C CG1   1 
ATOM   10468 C CG2   . ILE C 1 391 ? -2.077  65.014 23.231  1.00 29.75  ? 391 ILE C CG2   1 
ATOM   10469 C CD1   . ILE C 1 391 ? -1.692  63.870 25.903  1.00 39.42  ? 391 ILE C CD1   1 
ATOM   10470 N N     . GLY C 1 392 ? -2.032  61.843 20.542  1.00 36.73  ? 392 GLY C N     1 
ATOM   10471 C CA    . GLY C 1 392 ? -1.992  61.793 19.089  1.00 41.98  ? 392 GLY C CA    1 
ATOM   10472 C C     . GLY C 1 392 ? -3.283  61.306 18.434  1.00 42.68  ? 392 GLY C C     1 
ATOM   10473 O O     . GLY C 1 392 ? -4.398  61.530 18.894  1.00 40.30  ? 392 GLY C O     1 
ATOM   10474 N N     . SER C 1 393 ? -3.139  60.535 17.367  1.00 41.30  ? 393 SER C N     1 
ATOM   10475 C CA    . SER C 1 393 ? -4.281  60.056 16.591  1.00 47.46  ? 393 SER C CA    1 
ATOM   10476 C C     . SER C 1 393 ? -5.000  58.889 17.251  1.00 46.85  ? 393 SER C C     1 
ATOM   10477 O O     . SER C 1 393 ? -6.195  58.681 16.989  1.00 42.39  ? 393 SER C O     1 
ATOM   10478 C CB    . SER C 1 393 ? -3.850  59.788 15.150  1.00 49.66  ? 393 SER C CB    1 
ATOM   10479 O OG    . SER C 1 393 ? -3.313  58.497 15.015  1.00 55.90  ? 393 SER C OG    1 
ATOM   10480 N N     . PHE C 1 394 ? -4.345  58.209 18.203  1.00 41.81  ? 394 PHE C N     1 
ATOM   10481 C CA    . PHE C 1 394 ? -5.015  57.163 18.964  1.00 40.04  ? 394 PHE C CA    1 
ATOM   10482 C C     . PHE C 1 394 ? -6.046  57.833 19.869  1.00 37.44  ? 394 PHE C C     1 
ATOM   10483 O O     . PHE C 1 394 ? -7.194  57.438 19.976  1.00 36.38  ? 394 PHE C O     1 
ATOM   10484 C CB    . PHE C 1 394 ? -4.052  56.289 19.736  1.00 44.96  ? 394 PHE C CB    1 
ATOM   10485 C CG    . PHE C 1 394 ? -4.591  55.310 20.731  1.00 49.77  ? 394 PHE C CG    1 
ATOM   10486 C CD1   . PHE C 1 394 ? -5.801  54.657 20.546  1.00 49.83  ? 394 PHE C CD1   1 
ATOM   10487 C CD2   . PHE C 1 394 ? -3.856  55.012 21.873  1.00 47.85  ? 394 PHE C CD2   1 
ATOM   10488 C CE1   . PHE C 1 394 ? -6.267  53.748 21.473  1.00 46.95  ? 394 PHE C CE1   1 
ATOM   10489 C CE2   . PHE C 1 394 ? -4.317  54.097 22.798  1.00 46.42  ? 394 PHE C CE2   1 
ATOM   10490 C CZ    . PHE C 1 394 ? -5.522  53.473 22.598  1.00 48.08  ? 394 PHE C CZ    1 
ATOM   10491 N N     . LEU C 1 395 ? -5.640  58.906 20.515  1.00 36.42  ? 395 LEU C N     1 
ATOM   10492 C CA    . LEU C 1 395 ? -6.462  59.686 21.401  1.00 35.59  ? 395 LEU C CA    1 
ATOM   10493 C C     . LEU C 1 395 ? -7.530  60.436 20.607  1.00 40.32  ? 395 LEU C C     1 
ATOM   10494 O O     . LEU C 1 395 ? -8.697  60.457 21.002  1.00 34.98  ? 395 LEU C O     1 
ATOM   10495 C CB    . LEU C 1 395 ? -5.624  60.697 22.197  1.00 30.36  ? 395 LEU C CB    1 
ATOM   10496 C CG    . LEU C 1 395 ? -6.456  61.704 22.995  1.00 30.16  ? 395 LEU C CG    1 
ATOM   10497 C CD1   . LEU C 1 395 ? -7.158  61.012 24.141  1.00 37.11  ? 395 LEU C CD1   1 
ATOM   10498 C CD2   . LEU C 1 395 ? -5.614  62.860 23.501  1.00 31.18  ? 395 LEU C CD2   1 
ATOM   10499 N N     . LEU C 1 396 ? -7.109  61.056 19.498  1.00 43.68  ? 396 LEU C N     1 
ATOM   10500 C CA    . LEU C 1 396 ? -8.006  61.860 18.684  1.00 45.74  ? 396 LEU C CA    1 
ATOM   10501 C C     . LEU C 1 396 ? -9.262  61.097 18.273  1.00 45.20  ? 396 LEU C C     1 
ATOM   10502 O O     . LEU C 1 396 ? -10.343 61.657 18.445  1.00 44.38  ? 396 LEU C O     1 
ATOM   10503 C CB    . LEU C 1 396 ? -7.302  62.436 17.459  1.00 56.16  ? 396 LEU C CB    1 
ATOM   10504 C CG    . LEU C 1 396 ? -7.954  63.669 16.826  1.00 63.39  ? 396 LEU C CG    1 
ATOM   10505 C CD1   . LEU C 1 396 ? -8.315  64.715 17.869  1.00 62.54  ? 396 LEU C CD1   1 
ATOM   10506 C CD2   . LEU C 1 396 ? -7.022  64.267 15.781  1.00 64.76  ? 396 LEU C CD2   1 
ATOM   10507 N N     . GLY C 1 397 ? -9.118  59.857 17.832  1.00 45.93  ? 397 GLY C N     1 
ATOM   10508 C CA    . GLY C 1 397 ? -10.273 59.030 17.524  1.00 53.16  ? 397 GLY C CA    1 
ATOM   10509 C C     . GLY C 1 397 ? -10.769 59.191 16.092  1.00 56.06  ? 397 GLY C C     1 
ATOM   10510 O O     . GLY C 1 397 ? -10.071 59.739 15.240  1.00 53.52  ? 397 GLY C O     1 
ATOM   10511 N N     . ARG C 1 398 ? -11.977 58.692 15.835  1.00 60.27  ? 398 ARG C N     1 
ATOM   10512 C CA    . ARG C 1 398 ? -12.543 58.736 14.494  1.00 62.65  ? 398 ARG C CA    1 
ATOM   10513 C C     . ARG C 1 398 ? -13.522 59.872 14.239  1.00 65.98  ? 398 ARG C C     1 
ATOM   10514 O O     . ARG C 1 398 ? -14.166 60.412 15.123  1.00 65.36  ? 398 ARG C O     1 
ATOM   10515 C CB    . ARG C 1 398 ? -13.258 57.428 14.151  1.00 51.12  ? 398 ARG C CB    1 
ATOM   10516 C CG    . ARG C 1 398 ? -12.354 56.213 14.095  1.00 46.66  ? 398 ARG C CG    1 
ATOM   10517 C CD    . ARG C 1 398 ? -13.129 54.977 14.503  1.00 51.12  ? 398 ARG C CD    1 
ATOM   10518 N NE    . ARG C 1 398 ? -12.512 53.711 14.208  1.00 55.00  ? 398 ARG C NE    1 
ATOM   10519 C CZ    . ARG C 1 398 ? -11.833 53.230 13.190  1.00 59.45  ? 398 ARG C CZ    1 
ATOM   10520 N NH1   . ARG C 1 398 ? -11.566 53.957 12.113  1.00 60.69  ? 398 ARG C NH1   1 
ATOM   10521 N NH2   . ARG C 1 398 ? -11.395 51.974 13.234  1.00 59.86  ? 398 ARG C NH2   1 
ATOM   10522 N N     . ASP C 1 399 ? -13.598 60.222 12.959  1.00 72.29  ? 399 ASP C N     1 
ATOM   10523 C CA    . ASP C 1 399 ? -14.561 61.221 12.489  1.00 77.39  ? 399 ASP C CA    1 
ATOM   10524 C C     . ASP C 1 399 ? -15.911 60.504 12.534  1.00 78.50  ? 399 ASP C C     1 
ATOM   10525 O O     . ASP C 1 399 ? -16.030 59.388 12.035  1.00 76.75  ? 399 ASP C O     1 
ATOM   10526 C CB    . ASP C 1 399 ? -14.205 61.649 11.077  1.00 85.00  ? 399 ASP C CB    1 
ATOM   10527 C CG    . ASP C 1 399 ? -14.943 62.844 10.525  1.00 89.18  ? 399 ASP C CG    1 
ATOM   10528 O OD1   . ASP C 1 399 ? -16.114 63.086 10.874  1.00 90.17  ? 399 ASP C OD1   1 
ATOM   10529 O OD2   . ASP C 1 399 ? -14.336 63.574 9.712   1.00 93.17  ? 399 ASP C OD2   1 
ATOM   10530 N N     . PRO C 1 400 ? -16.893 61.105 13.185  1.00 80.86  ? 400 PRO C N     1 
ATOM   10531 C CA    . PRO C 1 400 ? -18.214 60.507 13.311  1.00 82.77  ? 400 PRO C CA    1 
ATOM   10532 C C     . PRO C 1 400 ? -18.940 60.448 11.977  1.00 83.20  ? 400 PRO C C     1 
ATOM   10533 O O     . PRO C 1 400 ? -19.610 59.473 11.644  1.00 82.70  ? 400 PRO C O     1 
ATOM   10534 C CB    . PRO C 1 400 ? -18.899 61.376 14.349  1.00 83.17  ? 400 PRO C CB    1 
ATOM   10535 C CG    . PRO C 1 400 ? -18.216 62.697 14.285  1.00 82.81  ? 400 PRO C CG    1 
ATOM   10536 C CD    . PRO C 1 400 ? -16.813 62.440 13.821  1.00 81.59  ? 400 PRO C CD    1 
ATOM   10537 N N     . ALA C 1 401 ? -18.766 61.467 11.147  1.00 83.60  ? 401 ALA C N     1 
ATOM   10538 C CA    . ALA C 1 401 ? -19.352 61.543 9.824   1.00 84.84  ? 401 ALA C CA    1 
ATOM   10539 C C     . ALA C 1 401 ? -18.839 60.471 8.871   1.00 84.01  ? 401 ALA C C     1 
ATOM   10540 O O     . ALA C 1 401 ? -19.638 59.877 8.143   1.00 84.51  ? 401 ALA C O     1 
ATOM   10541 C CB    . ALA C 1 401 ? -19.116 62.935 9.246   1.00 84.19  ? 401 ALA C CB    1 
ATOM   10542 N N     . THR C 1 402 ? -17.542 60.201 8.840   1.00 83.14  ? 402 THR C N     1 
ATOM   10543 C CA    . THR C 1 402 ? -17.002 59.205 7.929   1.00 83.24  ? 402 THR C CA    1 
ATOM   10544 C C     . THR C 1 402 ? -16.672 57.878 8.595   1.00 82.21  ? 402 THR C C     1 
ATOM   10545 O O     . THR C 1 402 ? -16.684 56.843 7.926   1.00 80.48  ? 402 THR C O     1 
ATOM   10546 C CB    . THR C 1 402 ? -15.742 59.700 7.184   1.00 84.35  ? 402 THR C CB    1 
ATOM   10547 O OG1   . THR C 1 402 ? -14.654 59.837 8.105   1.00 84.56  ? 402 THR C OG1   1 
ATOM   10548 C CG2   . THR C 1 402 ? -16.008 61.025 6.495   1.00 83.71  ? 402 THR C CG2   1 
ATOM   10549 N N     . GLY C 1 403 ? -16.287 57.915 9.867   1.00 82.08  ? 403 GLY C N     1 
ATOM   10550 C CA    . GLY C 1 403 ? -15.905 56.715 10.603  1.00 81.01  ? 403 GLY C CA    1 
ATOM   10551 C C     . GLY C 1 403 ? -14.434 56.381 10.379  1.00 80.53  ? 403 GLY C C     1 
ATOM   10552 O O     . GLY C 1 403 ? -13.946 55.302 10.689  1.00 79.71  ? 403 GLY C O     1 
ATOM   10553 N N     . GLU C 1 404 ? -13.716 57.333 9.805   1.00 80.08  ? 404 GLU C N     1 
ATOM   10554 C CA    . GLU C 1 404 ? -12.312 57.207 9.480   1.00 79.98  ? 404 GLU C CA    1 
ATOM   10555 C C     . GLU C 1 404 ? -11.456 57.892 10.538  1.00 77.73  ? 404 GLU C C     1 
ATOM   10556 O O     . GLU C 1 404 ? -11.917 58.836 11.184  1.00 76.01  ? 404 GLU C O     1 
ATOM   10557 C CB    . GLU C 1 404 ? -12.034 57.858 8.121   1.00 85.47  ? 404 GLU C CB    1 
ATOM   10558 C CG    . GLU C 1 404 ? -12.862 57.302 6.976   1.00 92.98  ? 404 GLU C CG    1 
ATOM   10559 C CD    . GLU C 1 404 ? -12.433 55.900 6.584   1.00 97.61  ? 404 GLU C CD    1 
ATOM   10560 O OE1   . GLU C 1 404 ? -11.202 55.679 6.521   1.00 99.77  ? 404 GLU C OE1   1 
ATOM   10561 O OE2   . GLU C 1 404 ? -13.310 55.039 6.350   1.00 98.19  ? 404 GLU C OE2   1 
ATOM   10562 N N     . GLN C 1 405 ? -10.221 57.423 10.683  1.00 76.92  ? 405 GLN C N     1 
ATOM   10563 C CA    . GLN C 1 405 ? -9.322  58.026 11.657  1.00 74.94  ? 405 GLN C CA    1 
ATOM   10564 C C     . GLN C 1 405 ? -9.277  59.540 11.469  1.00 75.29  ? 405 GLN C C     1 
ATOM   10565 O O     . GLN C 1 405 ? -8.852  59.984 10.402  1.00 76.97  ? 405 GLN C O     1 
ATOM   10566 C CB    . GLN C 1 405 ? -7.899  57.478 11.542  1.00 69.84  ? 405 GLN C CB    1 
ATOM   10567 C CG    . GLN C 1 405 ? -6.876  58.253 12.376  1.00 66.18  ? 405 GLN C CG    1 
ATOM   10568 C CD    . GLN C 1 405 ? -7.212  58.250 13.862  1.00 53.97  ? 405 GLN C CD    1 
ATOM   10569 O OE1   . GLN C 1 405 ? -7.380  57.169 14.415  1.00 48.33  ? 405 GLN C OE1   1 
ATOM   10570 N NE2   . GLN C 1 405 ? -7.337  59.426 14.460  1.00 39.35  ? 405 GLN C NE2   1 
ATOM   10571 N N     . LYS C 1 406 ? -9.671  60.300 12.477  1.00 73.86  ? 406 LYS C N     1 
ATOM   10572 C CA    . LYS C 1 406 ? -9.594  61.760 12.398  1.00 73.88  ? 406 LYS C CA    1 
ATOM   10573 C C     . LYS C 1 406 ? -8.137  62.138 12.151  1.00 76.04  ? 406 LYS C C     1 
ATOM   10574 O O     . LYS C 1 406 ? -7.237  61.428 12.605  1.00 75.73  ? 406 LYS C O     1 
ATOM   10575 C CB    . LYS C 1 406 ? -10.144 62.367 13.671  1.00 69.58  ? 406 LYS C CB    1 
ATOM   10576 C CG    . LYS C 1 406 ? -10.209 63.870 13.741  1.00 71.99  ? 406 LYS C CG    1 
ATOM   10577 C CD    . LYS C 1 406 ? -11.574 64.333 14.223  1.00 72.60  ? 406 LYS C CD    1 
ATOM   10578 C CE    . LYS C 1 406 ? -11.626 64.524 15.724  1.00 74.31  ? 406 LYS C CE    1 
ATOM   10579 N NZ    . LYS C 1 406 ? -12.828 63.867 16.322  1.00 76.33  ? 406 LYS C NZ    1 
ATOM   10580 N N     . HIS C 1 407 ? -7.891  63.187 11.378  1.00 78.42  ? 407 HIS C N     1 
ATOM   10581 C CA    . HIS C 1 407 ? -6.528  63.585 11.046  1.00 80.03  ? 407 HIS C CA    1 
ATOM   10582 C C     . HIS C 1 407 ? -5.825  64.199 12.254  1.00 78.04  ? 407 HIS C C     1 
ATOM   10583 O O     . HIS C 1 407 ? -6.371  65.129 12.854  1.00 78.01  ? 407 HIS C O     1 
ATOM   10584 C CB    . HIS C 1 407 ? -6.481  64.557 9.863   1.00 88.31  ? 407 HIS C CB    1 
ATOM   10585 C CG    . HIS C 1 407 ? -5.094  65.026 9.539   1.00 94.01  ? 407 HIS C CG    1 
ATOM   10586 N ND1   . HIS C 1 407 ? -4.636  66.281 9.867   1.00 95.75  ? 407 HIS C ND1   1 
ATOM   10587 C CD2   . HIS C 1 407 ? -4.061  64.400 8.925   1.00 96.04  ? 407 HIS C CD2   1 
ATOM   10588 C CE1   . HIS C 1 407 ? -3.385  66.416 9.471   1.00 96.18  ? 407 HIS C CE1   1 
ATOM   10589 N NE2   . HIS C 1 407 ? -3.011  65.286 8.896   1.00 97.26  ? 407 HIS C NE2   1 
ATOM   10590 N N     . ALA C 1 408 ? -4.645  63.670 12.583  1.00 75.06  ? 408 ALA C N     1 
ATOM   10591 C CA    . ALA C 1 408 ? -3.905  64.199 13.727  1.00 72.46  ? 408 ALA C CA    1 
ATOM   10592 C C     . ALA C 1 408 ? -2.713  65.020 13.239  1.00 69.86  ? 408 ALA C C     1 
ATOM   10593 O O     . ALA C 1 408 ? -1.807  64.484 12.604  1.00 67.32  ? 408 ALA C O     1 
ATOM   10594 C CB    . ALA C 1 408 ? -3.418  63.127 14.685  1.00 66.99  ? 408 ALA C CB    1 
ATOM   10595 N N     . ASP C 1 409 ? -2.747  66.305 13.576  1.00 68.19  ? 409 ASP C N     1 
ATOM   10596 C CA    . ASP C 1 409 ? -1.639  67.183 13.189  1.00 68.99  ? 409 ASP C CA    1 
ATOM   10597 C C     . ASP C 1 409 ? -0.336  66.727 13.827  1.00 66.94  ? 409 ASP C C     1 
ATOM   10598 O O     . ASP C 1 409 ? 0.684   66.565 13.164  1.00 66.75  ? 409 ASP C O     1 
ATOM   10599 C CB    . ASP C 1 409 ? -2.002  68.628 13.544  1.00 78.93  ? 409 ASP C CB    1 
ATOM   10600 C CG    . ASP C 1 409 ? -2.940  69.247 12.516  1.00 86.40  ? 409 ASP C CG    1 
ATOM   10601 O OD1   . ASP C 1 409 ? -2.596  69.209 11.313  1.00 90.94  ? 409 ASP C OD1   1 
ATOM   10602 O OD2   . ASP C 1 409 ? -4.018  69.769 12.874  1.00 88.01  ? 409 ASP C OD2   1 
ATOM   10603 N N     . MET C 1 410 ? -0.332  66.500 15.140  1.00 64.07  ? 410 MET C N     1 
ATOM   10604 C CA    . MET C 1 410 ? 0.848   66.060 15.866  1.00 58.17  ? 410 MET C CA    1 
ATOM   10605 C C     . MET C 1 410 ? 0.640   64.726 16.572  1.00 50.57  ? 410 MET C C     1 
ATOM   10606 O O     . MET C 1 410 ? -0.401  64.404 17.110  1.00 51.74  ? 410 MET C O     1 
ATOM   10607 C CB    . MET C 1 410 ? 1.325   67.108 16.873  1.00 62.92  ? 410 MET C CB    1 
ATOM   10608 C CG    . MET C 1 410 ? 1.490   68.516 16.324  1.00 71.53  ? 410 MET C CG    1 
ATOM   10609 S SD    . MET C 1 410 ? 3.073   68.877 15.572  1.00 76.42  ? 410 MET C SD    1 
ATOM   10610 C CE    . MET C 1 410 ? 3.288   67.609 14.346  1.00 73.85  ? 410 MET C CE    1 
ATOM   10611 N N     . GLU C 1 411 ? 1.683   63.927 16.562  1.00 42.20  ? 411 GLU C N     1 
ATOM   10612 C CA    . GLU C 1 411 ? 1.764   62.616 17.169  1.00 42.13  ? 411 GLU C CA    1 
ATOM   10613 C C     . GLU C 1 411 ? 2.697   62.689 18.389  1.00 39.66  ? 411 GLU C C     1 
ATOM   10614 O O     . GLU C 1 411 ? 3.864   62.349 18.346  1.00 37.20  ? 411 GLU C O     1 
ATOM   10615 C CB    . GLU C 1 411 ? 2.247   61.598 16.130  1.00 38.32  ? 411 GLU C CB    1 
ATOM   10616 C CG    . GLU C 1 411 ? 1.306   61.328 14.975  1.00 46.78  ? 411 GLU C CG    1 
ATOM   10617 C CD    . GLU C 1 411 ? -0.075  60.848 15.375  1.00 50.51  ? 411 GLU C CD    1 
ATOM   10618 O OE1   . GLU C 1 411 ? -0.318  60.379 16.506  1.00 47.81  ? 411 GLU C OE1   1 
ATOM   10619 O OE2   . GLU C 1 411 ? -0.979  60.955 14.524  1.00 53.72  ? 411 GLU C OE2   1 
ATOM   10620 N N     . PHE C 1 412 ? 2.193   63.194 19.496  1.00 34.19  ? 412 PHE C N     1 
ATOM   10621 C CA    . PHE C 1 412 ? 2.942   63.397 20.710  1.00 33.93  ? 412 PHE C CA    1 
ATOM   10622 C C     . PHE C 1 412 ? 2.930   62.256 21.723  1.00 32.55  ? 412 PHE C C     1 
ATOM   10623 O O     . PHE C 1 412 ? 1.958   61.544 21.991  1.00 32.46  ? 412 PHE C O     1 
ATOM   10624 C CB    . PHE C 1 412 ? 2.391   64.632 21.430  1.00 27.37  ? 412 PHE C CB    1 
ATOM   10625 C CG    . PHE C 1 412 ? 2.802   65.962 20.893  1.00 37.27  ? 412 PHE C CG    1 
ATOM   10626 C CD1   . PHE C 1 412 ? 4.098   66.221 20.483  1.00 40.23  ? 412 PHE C CD1   1 
ATOM   10627 C CD2   . PHE C 1 412 ? 1.870   66.991 20.827  1.00 39.83  ? 412 PHE C CD2   1 
ATOM   10628 C CE1   . PHE C 1 412 ? 4.460   67.467 19.999  1.00 45.57  ? 412 PHE C CE1   1 
ATOM   10629 C CE2   . PHE C 1 412 ? 2.213   68.245 20.350  1.00 44.31  ? 412 PHE C CE2   1 
ATOM   10630 C CZ    . PHE C 1 412 ? 3.511   68.476 19.941  1.00 45.73  ? 412 PHE C CZ    1 
ATOM   10631 N N     . MET C 1 413 ? 4.079   62.116 22.373  1.00 27.01  ? 413 MET C N     1 
ATOM   10632 C CA    . MET C 1 413 ? 4.224   61.244 23.535  1.00 20.76  ? 413 MET C CA    1 
ATOM   10633 C C     . MET C 1 413 ? 4.410   62.236 24.705  1.00 22.29  ? 413 MET C C     1 
ATOM   10634 O O     . MET C 1 413 ? 5.236   63.152 24.634  1.00 19.27  ? 413 MET C O     1 
ATOM   10635 C CB    . MET C 1 413 ? 5.301   60.208 23.474  1.00 25.47  ? 413 MET C CB    1 
ATOM   10636 C CG    . MET C 1 413 ? 5.879   59.730 24.797  1.00 11.61  ? 413 MET C CG    1 
ATOM   10637 S SD    . MET C 1 413 ? 7.106   58.445 24.622  1.00 21.90  ? 413 MET C SD    1 
ATOM   10638 C CE    . MET C 1 413 ? 8.560   59.357 24.086  1.00 19.03  ? 413 MET C CE    1 
ATOM   10639 N N     . ARG C 1 414 ? 3.545   62.114 25.710  1.00 17.32  ? 414 ARG C N     1 
ATOM   10640 C CA    . ARG C 1 414 ? 3.652   63.009 26.848  1.00 16.72  ? 414 ARG C CA    1 
ATOM   10641 C C     . ARG C 1 414 ? 4.435   62.314 27.982  1.00 15.86  ? 414 ARG C C     1 
ATOM   10642 O O     . ARG C 1 414 ? 4.020   61.243 28.429  1.00 14.73  ? 414 ARG C O     1 
ATOM   10643 C CB    . ARG C 1 414 ? 2.281   63.465 27.380  1.00 12.84  ? 414 ARG C CB    1 
ATOM   10644 C CG    . ARG C 1 414 ? 2.415   64.642 28.338  1.00 15.93  ? 414 ARG C CG    1 
ATOM   10645 C CD    . ARG C 1 414 ? 1.083   65.125 28.920  1.00 18.84  ? 414 ARG C CD    1 
ATOM   10646 N NE    . ARG C 1 414 ? 0.424   64.076 29.695  1.00 21.21  ? 414 ARG C NE    1 
ATOM   10647 C CZ    . ARG C 1 414 ? -0.876  64.058 29.962  1.00 21.83  ? 414 ARG C CZ    1 
ATOM   10648 N NH1   . ARG C 1 414 ? -1.671  65.017 29.496  1.00 19.58  ? 414 ARG C NH1   1 
ATOM   10649 N NH2   . ARG C 1 414 ? -1.403  63.096 30.676  1.00 17.07  ? 414 ARG C NH2   1 
ATOM   10650 N N     .