data_1AXC
# 
_entry.id   1AXC 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1AXC         
WWPDB D_1000171370 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1AXC 
_pdbx_database_status.recvd_initial_deposition_date   1997-10-14 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    ? 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Gulbis, J.M.' 1 
'Kuriyan, J.'  2 
# 
_citation.id                        primary 
_citation.title                     'Structure of the C-terminal region of p21(WAF1/CIP1) complexed with human PCNA.' 
_citation.journal_abbrev            'Cell(Cambridge,Mass.)' 
_citation.journal_volume            87 
_citation.page_first                297 
_citation.page_last                 306 
_citation.year                      1996 
_citation.journal_id_ASTM           CELLB5 
_citation.country                   US 
_citation.journal_id_ISSN           0092-8674 
_citation.journal_id_CSD            0998 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   8861913 
_citation.pdbx_database_id_DOI      '10.1016/S0092-8674(00)81347-1' 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Gulbis, J.M.'  1 
primary 'Kelman, Z.'    2 
primary 'Hurwitz, J.'   3 
primary 
;O'Donnell, M.
;
4 
primary 'Kuriyan, J.'   5 
# 
_cell.entry_id           1AXC 
_cell.length_a           83.500 
_cell.length_b           83.500 
_cell.length_c           233.900 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              18 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1AXC 
_symmetry.space_group_name_H-M             'P 32 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                154 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer nat PCNA     28795.752 3   ? ? ?                                    ? 
2 polymer nat P21/WAF1 2779.233  3   ? ? '22 C TERMINAL RESIDUES (139 - 160)' ? 
3 water   nat water    18.015    295 ? ? ?                                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'PROLIFERATING CELL NUCLEAR ANTIGEN' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;MFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSMSKILK
CAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVI
SCAKDGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYK
IADMGHLKYYLAPKIEDEEGS
;
;MFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSMSKILK
CAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVI
SCAKDGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYK
IADMGHLKYYLAPKIEDEEGS
;
A,C,E ? 
2 'polypeptide(L)' no no GRKRRQTSMTDFYHSKRRLIFS GRKRRQTSMTDFYHSKRRLIFS B,D,F ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   PHE n 
1 3   GLU n 
1 4   ALA n 
1 5   ARG n 
1 6   LEU n 
1 7   VAL n 
1 8   GLN n 
1 9   GLY n 
1 10  SER n 
1 11  ILE n 
1 12  LEU n 
1 13  LYS n 
1 14  LYS n 
1 15  VAL n 
1 16  LEU n 
1 17  GLU n 
1 18  ALA n 
1 19  LEU n 
1 20  LYS n 
1 21  ASP n 
1 22  LEU n 
1 23  ILE n 
1 24  ASN n 
1 25  GLU n 
1 26  ALA n 
1 27  CYS n 
1 28  TRP n 
1 29  ASP n 
1 30  ILE n 
1 31  SER n 
1 32  SER n 
1 33  SER n 
1 34  GLY n 
1 35  VAL n 
1 36  ASN n 
1 37  LEU n 
1 38  GLN n 
1 39  SER n 
1 40  MET n 
1 41  ASP n 
1 42  SER n 
1 43  SER n 
1 44  HIS n 
1 45  VAL n 
1 46  SER n 
1 47  LEU n 
1 48  VAL n 
1 49  GLN n 
1 50  LEU n 
1 51  THR n 
1 52  LEU n 
1 53  ARG n 
1 54  SER n 
1 55  GLU n 
1 56  GLY n 
1 57  PHE n 
1 58  ASP n 
1 59  THR n 
1 60  TYR n 
1 61  ARG n 
1 62  CYS n 
1 63  ASP n 
1 64  ARG n 
1 65  ASN n 
1 66  LEU n 
1 67  ALA n 
1 68  MET n 
1 69  GLY n 
1 70  VAL n 
1 71  ASN n 
1 72  LEU n 
1 73  THR n 
1 74  SER n 
1 75  MET n 
1 76  SER n 
1 77  LYS n 
1 78  ILE n 
1 79  LEU n 
1 80  LYS n 
1 81  CYS n 
1 82  ALA n 
1 83  GLY n 
1 84  ASN n 
1 85  GLU n 
1 86  ASP n 
1 87  ILE n 
1 88  ILE n 
1 89  THR n 
1 90  LEU n 
1 91  ARG n 
1 92  ALA n 
1 93  GLU n 
1 94  ASP n 
1 95  ASN n 
1 96  ALA n 
1 97  ASP n 
1 98  THR n 
1 99  LEU n 
1 100 ALA n 
1 101 LEU n 
1 102 VAL n 
1 103 PHE n 
1 104 GLU n 
1 105 ALA n 
1 106 PRO n 
1 107 ASN n 
1 108 GLN n 
1 109 GLU n 
1 110 LYS n 
1 111 VAL n 
1 112 SER n 
1 113 ASP n 
1 114 TYR n 
1 115 GLU n 
1 116 MET n 
1 117 LYS n 
1 118 LEU n 
1 119 MET n 
1 120 ASP n 
1 121 LEU n 
1 122 ASP n 
1 123 VAL n 
1 124 GLU n 
1 125 GLN n 
1 126 LEU n 
1 127 GLY n 
1 128 ILE n 
1 129 PRO n 
1 130 GLU n 
1 131 GLN n 
1 132 GLU n 
1 133 TYR n 
1 134 SER n 
1 135 CYS n 
1 136 VAL n 
1 137 VAL n 
1 138 LYS n 
1 139 MET n 
1 140 PRO n 
1 141 SER n 
1 142 GLY n 
1 143 GLU n 
1 144 PHE n 
1 145 ALA n 
1 146 ARG n 
1 147 ILE n 
1 148 CYS n 
1 149 ARG n 
1 150 ASP n 
1 151 LEU n 
1 152 SER n 
1 153 HIS n 
1 154 ILE n 
1 155 GLY n 
1 156 ASP n 
1 157 ALA n 
1 158 VAL n 
1 159 VAL n 
1 160 ILE n 
1 161 SER n 
1 162 CYS n 
1 163 ALA n 
1 164 LYS n 
1 165 ASP n 
1 166 GLY n 
1 167 VAL n 
1 168 LYS n 
1 169 PHE n 
1 170 SER n 
1 171 ALA n 
1 172 SER n 
1 173 GLY n 
1 174 GLU n 
1 175 LEU n 
1 176 GLY n 
1 177 ASN n 
1 178 GLY n 
1 179 ASN n 
1 180 ILE n 
1 181 LYS n 
1 182 LEU n 
1 183 SER n 
1 184 GLN n 
1 185 THR n 
1 186 SER n 
1 187 ASN n 
1 188 VAL n 
1 189 ASP n 
1 190 LYS n 
1 191 GLU n 
1 192 GLU n 
1 193 GLU n 
1 194 ALA n 
1 195 VAL n 
1 196 THR n 
1 197 ILE n 
1 198 GLU n 
1 199 MET n 
1 200 ASN n 
1 201 GLU n 
1 202 PRO n 
1 203 VAL n 
1 204 GLN n 
1 205 LEU n 
1 206 THR n 
1 207 PHE n 
1 208 ALA n 
1 209 LEU n 
1 210 ARG n 
1 211 TYR n 
1 212 LEU n 
1 213 ASN n 
1 214 PHE n 
1 215 PHE n 
1 216 THR n 
1 217 LYS n 
1 218 ALA n 
1 219 THR n 
1 220 PRO n 
1 221 LEU n 
1 222 SER n 
1 223 SER n 
1 224 THR n 
1 225 VAL n 
1 226 THR n 
1 227 LEU n 
1 228 SER n 
1 229 MET n 
1 230 SER n 
1 231 ALA n 
1 232 ASP n 
1 233 VAL n 
1 234 PRO n 
1 235 LEU n 
1 236 VAL n 
1 237 VAL n 
1 238 GLU n 
1 239 TYR n 
1 240 LYS n 
1 241 ILE n 
1 242 ALA n 
1 243 ASP n 
1 244 MET n 
1 245 GLY n 
1 246 HIS n 
1 247 LEU n 
1 248 LYS n 
1 249 TYR n 
1 250 TYR n 
1 251 LEU n 
1 252 ALA n 
1 253 PRO n 
1 254 LYS n 
1 255 ILE n 
1 256 GLU n 
1 257 ASP n 
1 258 GLU n 
1 259 GLU n 
1 260 GLY n 
1 261 SER n 
2 1   GLY n 
2 2   ARG n 
2 3   LYS n 
2 4   ARG n 
2 5   ARG n 
2 6   GLN n 
2 7   THR n 
2 8   SER n 
2 9   MET n 
2 10  THR n 
2 11  ASP n 
2 12  PHE n 
2 13  TYR n 
2 14  HIS n 
2 15  SER n 
2 16  LYS n 
2 17  ARG n 
2 18  ARG n 
2 19  LEU n 
2 20  ILE n 
2 21  PHE n 
2 22  SER n 
# 
loop_
_entity_src_nat.entity_id 
_entity_src_nat.pdbx_src_id 
_entity_src_nat.pdbx_alt_source_flag 
_entity_src_nat.pdbx_beg_seq_num 
_entity_src_nat.pdbx_end_seq_num 
_entity_src_nat.common_name 
_entity_src_nat.pdbx_organism_scientific 
_entity_src_nat.pdbx_ncbi_taxonomy_id 
_entity_src_nat.genus 
_entity_src_nat.species 
_entity_src_nat.strain 
_entity_src_nat.tissue 
_entity_src_nat.tissue_fraction 
_entity_src_nat.pdbx_secretion 
_entity_src_nat.pdbx_fragment 
_entity_src_nat.pdbx_variant 
_entity_src_nat.pdbx_cell_line 
_entity_src_nat.pdbx_atcc 
_entity_src_nat.pdbx_cellular_location 
_entity_src_nat.pdbx_organ 
_entity_src_nat.pdbx_organelle 
_entity_src_nat.pdbx_cell 
_entity_src_nat.pdbx_plasmid_name 
_entity_src_nat.pdbx_plasmid_details 
_entity_src_nat.details 
1 1 sample ? ? human 'Homo sapiens' 9606 Homo ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample ? ? human 'Homo sapiens' 9606 Homo ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_db_isoform 
1 UNP PCNA_HUMAN  1 P12004 1 
;MFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSMSKILK
CAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVI
SCAKDGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYK
IADMGHLKYYLAPKIEDEEGS
;
? 
2 UNP CDN1A_HUMAN 2 P38936 1 
;MSEPAGDVRQNPCGSKACRRLFGPVDSEQLSRDCDALMAGCIQEARERWNFDFVTETPLEGDFAWERVRGLGLPKLYLPT
GPRRGRDELGGGRRPGTSPALLQGTAEEDHVDLSLSCTLVPRSGEQAEGSPGGPGDSQGRKRRQTSMTDFYHSKRRLIFS
KRKP
;
? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1AXC A 1 ? 261 ? P12004 1   ? 261 ? 1   261 
2 2 1AXC B 1 ? 22  ? P38936 139 ? 160 ? 139 160 
3 1 1AXC C 1 ? 261 ? P12004 1   ? 261 ? 1   261 
4 2 1AXC D 1 ? 22  ? P38936 139 ? 160 ? 139 160 
5 1 1AXC E 1 ? 261 ? P12004 1   ? 261 ? 1   261 
6 2 1AXC F 1 ? 22  ? P38936 139 ? 160 ? 139 160 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1AXC 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.48 
_exptl_crystal.density_percent_sol   50.49 
_exptl_crystal.description           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               ? 
_diffrn_detector.type                   ? 
_diffrn_detector.pdbx_collection_date   1996-10 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSLS BEAMLINE X25' 
_diffrn_source.pdbx_synchrotron_site       NSLS 
_diffrn_source.pdbx_synchrotron_beamline   X25 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1AXC 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             15.0 
_reflns.d_resolution_high            2.6 
_reflns.number_obs                   33552 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         96. 
_reflns.pdbx_Rmerge_I_obs            0.0730000 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              3.9 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_refine.entry_id                                 1AXC 
_refine.ls_number_reflns_obs                     22893 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          2.0 
_refine.pdbx_data_cutoff_high_absF               10000000.0 
_refine.pdbx_data_cutoff_low_absF                0.0 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             15.0 
_refine.ls_d_res_high                            2.6 
_refine.ls_percent_reflns_obs                    100. 
_refine.ls_R_factor_obs                          0.1920000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1920000 
_refine.ls_R_factor_R_free                       0.2890000 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 10. 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            9.95 
_refine.aniso_B[2][2]                            9.95 
_refine.aniso_B[3][3]                            -19.91 
_refine.aniso_B[1][2]                            0. 
_refine.aniso_B[1][3]                            0. 
_refine.aniso_B[2][3]                            0. 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'YEAST PCNA' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        7509 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             295 
_refine_hist.number_atoms_total               7804 
_refine_hist.d_res_high                       2.6 
_refine_hist.d_res_low                        15.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d                0.008 ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg             1.4   ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PARHCDX.PRO TOPHCSDX.PRO 'X-RAY DIFFRACTION' 
2 PARAM19.SOL TOPH19.SOL   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1AXC 
_struct.title                     'HUMAN PCNA' 
_struct.pdbx_descriptor           'PCNA, P21/WAF1' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1AXC 
_struct_keywords.pdbx_keywords   'COMPLEX (DNA-BINDING PROTEIN/DNA)' 
_struct_keywords.text            
'DNA, REPLICATION, PROCESSIVITY, ONCOGENE, WAF1, CIP1, COMPLEX (DNA-BINDING PROTEIN-DNA), COMPLEX (DNA-BINDING PROTEIN-DNA) complex' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 1 ? 
D N N 2 ? 
E N N 1 ? 
F N N 2 ? 
G N N 3 ? 
H N N 3 ? 
I N N 3 ? 
J N N 3 ? 
K N N 3 ? 
L N N 3 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLY A 9   ? LEU A 19  ? GLY A 9   LEU A 19  1 ? 11 
HELX_P HELX_P2  2  SER A 54  ? GLY A 56  ? SER A 54  GLY A 56  5 ? 3  
HELX_P HELX_P3  3  LEU A 72  ? CYS A 81  ? LEU A 72  CYS A 81  1 ? 10 
HELX_P HELX_P4  4  SER A 141 ? HIS A 153 ? SER A 141 HIS A 153 1 ? 13 
HELX_P HELX_P5  5  LEU A 209 ? LEU A 221 ? LEU A 209 LEU A 221 1 ? 13 
HELX_P HELX_P6  6  MET B 9   ? ASP B 11  ? MET B 147 ASP B 149 5 ? 3  
HELX_P HELX_P7  7  GLY C 9   ? ALA C 18  ? GLY C 9   ALA C 18  1 ? 10 
HELX_P HELX_P8  8  SER C 54  ? GLY C 56  ? SER C 54  GLY C 56  5 ? 3  
HELX_P HELX_P9  9  LEU C 72  ? CYS C 81  ? LEU C 72  CYS C 81  1 ? 10 
HELX_P HELX_P10 10 SER C 141 ? ILE C 154 ? SER C 141 ILE C 154 1 ? 14 
HELX_P HELX_P11 11 LEU C 209 ? LEU C 221 ? LEU C 209 LEU C 221 1 ? 13 
HELX_P HELX_P12 12 MET D 9   ? ASP D 11  ? MET D 147 ASP D 149 5 ? 3  
HELX_P HELX_P13 13 GLY E 9   ? GLU E 17  ? GLY E 9   GLU E 17  1 ? 9  
HELX_P HELX_P14 14 SER E 54  ? GLY E 56  ? SER E 54  GLY E 56  5 ? 3  
HELX_P HELX_P15 15 LEU E 72  ? CYS E 81  ? LEU E 72  CYS E 81  1 ? 10 
HELX_P HELX_P16 16 SER E 141 ? ILE E 154 ? SER E 141 ILE E 154 1 ? 14 
HELX_P HELX_P17 17 LEU E 209 ? LEU E 221 ? LEU E 209 LEU E 221 1 ? 13 
HELX_P HELX_P18 18 MET F 9   ? ASP F 11  ? MET F 147 ASP F 149 5 ? 3  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 8 ? 
C ? 2 ? 
D ? 2 ? 
E ? 5 ? 
F ? 9 ? 
G ? 4 ? 
H ? 5 ? 
I ? 2 ? 
J ? 7 ? 
K ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
B 5 6 ? anti-parallel 
B 6 7 ? anti-parallel 
B 7 8 ? anti-parallel 
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
E 4 5 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
F 3 4 ? anti-parallel 
F 4 5 ? anti-parallel 
F 5 6 ? anti-parallel 
F 6 7 ? anti-parallel 
F 7 8 ? anti-parallel 
F 8 9 ? anti-parallel 
G 1 2 ? anti-parallel 
G 2 3 ? anti-parallel 
G 3 4 ? anti-parallel 
H 1 2 ? anti-parallel 
H 2 3 ? anti-parallel 
H 3 4 ? anti-parallel 
H 4 5 ? anti-parallel 
I 1 2 ? anti-parallel 
J 1 2 ? anti-parallel 
J 2 3 ? anti-parallel 
J 3 4 ? anti-parallel 
J 4 5 ? anti-parallel 
J 5 6 ? anti-parallel 
J 6 7 ? anti-parallel 
K 1 2 ? anti-parallel 
K 2 3 ? anti-parallel 
K 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 THR A 59  ? CYS A 62  ? THR A 59  CYS A 62  
A 2 PHE A 2   ? LEU A 6   ? PHE A 2   LEU A 6   
A 3 ILE A 87  ? ALA A 92  ? ILE A 87  ALA A 92  
A 4 THR A 98  ? GLU A 104 ? THR A 98  GLU A 104 
A 5 VAL A 111 ? LYS A 117 ? VAL A 111 LYS A 117 
B 1 LEU A 66  ? ASN A 71  ? LEU A 66  ASN A 71  
B 2 GLU A 25  ? SER A 31  ? GLU A 25  SER A 31  
B 3 GLY A 34  ? MET A 40  ? GLY A 34  MET A 40  
B 4 SER A 46  ? ARG A 53  ? SER A 46  ARG A 53  
B 5 GLY A 245 ? LEU A 251 ? GLY A 245 LEU A 251 
B 6 LEU A 235 ? TYR A 239 ? LEU A 235 TYR A 239 
B 7 THR A 224 ? MET A 229 ? THR A 224 MET A 229 
B 8 CYS A 135 ? PRO A 140 ? CYS A 135 PRO A 140 
C 1 ALA A 157 ? CYS A 162 ? ALA A 157 CYS A 162 
C 2 VAL A 203 ? ALA A 208 ? VAL A 203 ALA A 208 
D 1 GLY A 166 ? GLY A 173 ? GLY A 166 GLY A 173 
D 2 GLY A 176 ? SER A 183 ? GLY A 176 SER A 183 
E 1 THR C 59  ? CYS C 62  ? THR C 59  CYS C 62  
E 2 PHE C 2   ? LEU C 6   ? PHE C 2   LEU C 6   
E 3 ILE C 87  ? ALA C 92  ? ILE C 87  ALA C 92  
E 4 THR C 98  ? GLU C 104 ? THR C 98  GLU C 104 
E 5 VAL C 111 ? LYS C 117 ? VAL C 111 LYS C 117 
F 1 LEU C 66  ? ASN C 71  ? LEU C 66  ASN C 71  
F 2 GLU C 25  ? SER C 31  ? GLU C 25  SER C 31  
F 3 GLY C 34  ? MET C 40  ? GLY C 34  MET C 40  
F 4 SER C 46  ? ARG C 53  ? SER C 46  ARG C 53  
F 5 GLY C 245 ? LEU C 251 ? GLY C 245 LEU C 251 
F 6 LEU C 235 ? TYR C 239 ? LEU C 235 TYR C 239 
F 7 THR C 224 ? MET C 229 ? THR C 224 MET C 229 
F 8 CYS C 135 ? PRO C 140 ? CYS C 135 PRO C 140 
F 9 THR C 196 ? MET C 199 ? THR C 196 MET C 199 
G 1 VAL C 203 ? ALA C 208 ? VAL C 203 ALA C 208 
G 2 ALA C 157 ? ALA C 163 ? ALA C 157 ALA C 163 
G 3 GLY C 166 ? GLY C 173 ? GLY C 166 GLY C 173 
G 4 GLY C 176 ? SER C 183 ? GLY C 176 SER C 183 
H 1 THR E 59  ? CYS E 62  ? THR E 59  CYS E 62  
H 2 PHE E 2   ? LEU E 6   ? PHE E 2   LEU E 6   
H 3 ILE E 87  ? ALA E 92  ? ILE E 87  ALA E 92  
H 4 THR E 98  ? GLU E 104 ? THR E 98  GLU E 104 
H 5 VAL E 111 ? LYS E 117 ? VAL E 111 LYS E 117 
I 1 GLU E 25  ? ILE E 30  ? GLU E 25  ILE E 30  
I 2 LEU E 66  ? ASN E 71  ? LEU E 66  ASN E 71  
J 1 GLY E 34  ? MET E 40  ? GLY E 34  MET E 40  
J 2 SER E 46  ? ARG E 53  ? SER E 46  ARG E 53  
J 3 GLY E 245 ? LEU E 251 ? GLY E 245 LEU E 251 
J 4 LEU E 235 ? TYR E 239 ? LEU E 235 TYR E 239 
J 5 THR E 224 ? MET E 229 ? THR E 224 MET E 229 
J 6 CYS E 135 ? PRO E 140 ? CYS E 135 PRO E 140 
J 7 THR E 196 ? MET E 199 ? THR E 196 MET E 199 
K 1 VAL E 203 ? ALA E 208 ? VAL E 203 ALA E 208 
K 2 ALA E 157 ? ALA E 163 ? ALA E 157 ALA E 163 
K 3 GLY E 166 ? SER E 172 ? GLY E 166 SER E 172 
K 4 ASN E 177 ? SER E 183 ? ASN E 177 SER E 183 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O THR A 59  ? O THR A 59  N ARG A 5   ? N ARG A 5   
A 2 3 O PHE A 2   ? O PHE A 2   N ALA A 92  ? N ALA A 92  
A 3 4 O ILE A 87  ? O ILE A 87  N GLU A 104 ? N GLU A 104 
A 4 5 O LEU A 99  ? O LEU A 99  N MET A 116 ? N MET A 116 
B 1 2 O LEU A 66  ? O LEU A 66  N ILE A 30  ? N ILE A 30  
B 2 3 O ASP A 29  ? O ASP A 29  N ASN A 36  ? N ASN A 36  
B 3 4 O VAL A 35  ? O VAL A 35  N LEU A 52  ? N LEU A 52  
B 4 5 O LEU A 47  ? O LEU A 47  N TYR A 250 ? N TYR A 250 
B 5 6 O LEU A 247 ? O LEU A 247 N TYR A 239 ? N TYR A 239 
B 6 7 O VAL A 236 ? O VAL A 236 N SER A 228 ? N SER A 228 
B 7 8 O VAL A 225 ? O VAL A 225 N MET A 139 ? N MET A 139 
C 1 2 O VAL A 158 ? O VAL A 158 N PHE A 207 ? N PHE A 207 
D 1 2 O VAL A 167 ? O VAL A 167 N LEU A 182 ? N LEU A 182 
E 1 2 O THR C 59  ? O THR C 59  N ARG C 5   ? N ARG C 5   
E 2 3 O PHE C 2   ? O PHE C 2   N ALA C 92  ? N ALA C 92  
E 3 4 O ILE C 87  ? O ILE C 87  N GLU C 104 ? N GLU C 104 
E 4 5 O LEU C 99  ? O LEU C 99  N MET C 116 ? N MET C 116 
F 1 2 O LEU C 66  ? O LEU C 66  N ILE C 30  ? N ILE C 30  
F 2 3 O ASP C 29  ? O ASP C 29  N ASN C 36  ? N ASN C 36  
F 3 4 O VAL C 35  ? O VAL C 35  N LEU C 52  ? N LEU C 52  
F 4 5 O LEU C 47  ? O LEU C 47  N TYR C 250 ? N TYR C 250 
F 5 6 O LEU C 247 ? O LEU C 247 N TYR C 239 ? N TYR C 239 
F 6 7 O VAL C 236 ? O VAL C 236 N SER C 228 ? N SER C 228 
F 7 8 O VAL C 225 ? O VAL C 225 N MET C 139 ? N MET C 139 
F 8 9 O VAL C 136 ? O VAL C 136 N GLU C 198 ? N GLU C 198 
G 1 2 O VAL C 203 ? O VAL C 203 N CYS C 162 ? N CYS C 162 
G 2 3 O VAL C 159 ? O VAL C 159 N SER C 170 ? N SER C 170 
G 3 4 O VAL C 167 ? O VAL C 167 N LEU C 182 ? N LEU C 182 
H 1 2 O THR E 59  ? O THR E 59  N ARG E 5   ? N ARG E 5   
H 2 3 O PHE E 2   ? O PHE E 2   N ALA E 92  ? N ALA E 92  
H 3 4 O ILE E 87  ? O ILE E 87  N GLU E 104 ? N GLU E 104 
H 4 5 O LEU E 99  ? O LEU E 99  N MET E 116 ? N MET E 116 
I 1 2 O ALA E 26  ? O ALA E 26  N VAL E 70  ? N VAL E 70  
J 1 2 O VAL E 35  ? O VAL E 35  N LEU E 52  ? N LEU E 52  
J 2 3 O LEU E 47  ? O LEU E 47  N TYR E 250 ? N TYR E 250 
J 3 4 O LEU E 247 ? O LEU E 247 N TYR E 239 ? N TYR E 239 
J 4 5 O VAL E 236 ? O VAL E 236 N SER E 228 ? N SER E 228 
J 5 6 O VAL E 225 ? O VAL E 225 N MET E 139 ? N MET E 139 
J 6 7 O VAL E 136 ? O VAL E 136 N GLU E 198 ? N GLU E 198 
K 1 2 O VAL E 203 ? O VAL E 203 N CYS E 162 ? N CYS E 162 
K 2 3 O VAL E 159 ? O VAL E 159 N SER E 170 ? N SER E 170 
K 3 4 O VAL E 167 ? O VAL E 167 N LEU E 182 ? N LEU E 182 
# 
_database_PDB_matrix.entry_id          1AXC 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1AXC 
_atom_sites.fract_transf_matrix[1][1]   0.011976 
_atom_sites.fract_transf_matrix[1][2]   0.006914 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.013829 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004275 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N    . MET A 1 1   ? 36.886  53.177  21.887 1.00 37.65 ? 1   MET A N    1 
ATOM   2    C CA   . MET A 1 1   ? 38.323  52.817  21.996 1.00 38.99 ? 1   MET A CA   1 
ATOM   3    C C    . MET A 1 1   ? 38.493  51.553  22.830 1.00 34.91 ? 1   MET A C    1 
ATOM   4    O O    . MET A 1 1   ? 37.730  51.314  23.770 1.00 33.59 ? 1   MET A O    1 
ATOM   5    C CB   . MET A 1 1   ? 39.113  53.971  22.610 1.00 41.12 ? 1   MET A CB   1 
ATOM   6    C CG   . MET A 1 1   ? 40.596  53.701  22.689 1.00 41.09 ? 1   MET A CG   1 
ATOM   7    S SD   . MET A 1 1   ? 41.129  53.384  24.355 1.00 37.34 ? 1   MET A SD   1 
ATOM   8    C CE   . MET A 1 1   ? 42.170  54.779  24.574 1.00 41.22 ? 1   MET A CE   1 
ATOM   9    H H1   . MET A 1 1   ? 36.549  53.278  22.856 1.00 0.00  ? 1   MET A H1   1 
ATOM   10   H H2   . MET A 1 1   ? 36.765  54.038  21.327 1.00 0.00  ? 1   MET A H2   1 
ATOM   11   H H3   . MET A 1 1   ? 36.399  52.359  21.472 1.00 0.00  ? 1   MET A H3   1 
ATOM   12   N N    . PHE A 1 2   ? 39.483  50.748  22.463 1.00 30.35 ? 2   PHE A N    1 
ATOM   13   C CA   . PHE A 1 2   ? 39.777  49.490  23.136 1.00 25.52 ? 2   PHE A CA   1 
ATOM   14   C C    . PHE A 1 2   ? 41.120  49.528  23.841 1.00 22.93 ? 2   PHE A C    1 
ATOM   15   O O    . PHE A 1 2   ? 42.131  49.938  23.265 1.00 25.16 ? 2   PHE A O    1 
ATOM   16   C CB   . PHE A 1 2   ? 39.760  48.343  22.109 1.00 25.93 ? 2   PHE A CB   1 
ATOM   17   C CG   . PHE A 1 2   ? 40.441  47.071  22.572 1.00 21.47 ? 2   PHE A CG   1 
ATOM   18   C CD1  . PHE A 1 2   ? 39.976  46.365  23.678 1.00 20.77 ? 2   PHE A CD1  1 
ATOM   19   C CD2  . PHE A 1 2   ? 41.541  46.573  21.880 1.00 24.33 ? 2   PHE A CD2  1 
ATOM   20   C CE1  . PHE A 1 2   ? 40.599  45.179  24.091 1.00 18.80 ? 2   PHE A CE1  1 
ATOM   21   C CE2  . PHE A 1 2   ? 42.168  45.393  22.282 1.00 23.83 ? 2   PHE A CE2  1 
ATOM   22   C CZ   . PHE A 1 2   ? 41.692  44.696  23.392 1.00 20.74 ? 2   PHE A CZ   1 
ATOM   23   H H    . PHE A 1 2   ? 40.081  50.985  21.727 1.00 0.00  ? 2   PHE A H    1 
ATOM   24   N N    . GLU A 1 3   ? 41.120  49.089  25.088 1.00 20.83 ? 3   GLU A N    1 
ATOM   25   C CA   . GLU A 1 3   ? 42.331  49.017  25.882 1.00 20.96 ? 3   GLU A CA   1 
ATOM   26   C C    . GLU A 1 3   ? 42.140  47.937  26.932 1.00 19.55 ? 3   GLU A C    1 
ATOM   27   O O    . GLU A 1 3   ? 41.260  48.046  27.794 1.00 21.64 ? 3   GLU A O    1 
ATOM   28   C CB   . GLU A 1 3   ? 42.651  50.354  26.558 1.00 21.55 ? 3   GLU A CB   1 
ATOM   29   C CG   . GLU A 1 3   ? 43.852  50.273  27.486 1.00 25.95 ? 3   GLU A CG   1 
ATOM   30   C CD   . GLU A 1 3   ? 44.355  51.630  27.932 1.00 33.12 ? 3   GLU A CD   1 
ATOM   31   O OE1  . GLU A 1 3   ? 45.073  52.289  27.148 1.00 35.10 ? 3   GLU A OE1  1 
ATOM   32   O OE2  . GLU A 1 3   ? 44.055  52.033  29.075 1.00 38.72 ? 3   GLU A OE2  1 
ATOM   33   H H    . GLU A 1 3   ? 40.278  48.803  25.502 1.00 0.00  ? 3   GLU A H    1 
ATOM   34   N N    . ALA A 1 4   ? 42.921  46.869  26.806 1.00 14.83 ? 4   ALA A N    1 
ATOM   35   C CA   . ALA A 1 4   ? 42.896  45.749  27.737 1.00 13.52 ? 4   ALA A CA   1 
ATOM   36   C C    . ALA A 1 4   ? 44.316  45.606  28.294 1.00 20.40 ? 4   ALA A C    1 
ATOM   37   O O    . ALA A 1 4   ? 45.292  45.875  27.594 1.00 30.24 ? 4   ALA A O    1 
ATOM   38   C CB   . ALA A 1 4   ? 42.478  44.495  27.020 1.00 8.09  ? 4   ALA A CB   1 
ATOM   39   H H    . ALA A 1 4   ? 43.567  46.851  26.070 1.00 0.00  ? 4   ALA A H    1 
ATOM   40   N N    . ARG A 1 5   ? 44.437  45.202  29.552 1.00 26.76 ? 5   ARG A N    1 
ATOM   41   C CA   . ARG A 1 5   ? 45.739  45.050  30.198 1.00 19.72 ? 5   ARG A CA   1 
ATOM   42   C C    . ARG A 1 5   ? 45.795  43.676  30.810 1.00 21.14 ? 5   ARG A C    1 
ATOM   43   O O    . ARG A 1 5   ? 44.867  43.267  31.524 1.00 21.99 ? 5   ARG A O    1 
ATOM   44   C CB   . ARG A 1 5   ? 45.909  46.102  31.294 1.00 19.96 ? 5   ARG A CB   1 
ATOM   45   C CG   . ARG A 1 5   ? 47.110  45.931  32.199 1.00 19.75 ? 5   ARG A CG   1 
ATOM   46   C CD   . ARG A 1 5   ? 47.036  46.949  33.331 1.00 27.54 ? 5   ARG A CD   1 
ATOM   47   N NE   . ARG A 1 5   ? 48.096  46.791  34.327 1.00 30.41 ? 5   ARG A NE   1 
ATOM   48   C CZ   . ARG A 1 5   ? 49.252  47.449  34.304 1.00 30.82 ? 5   ARG A CZ   1 
ATOM   49   N NH1  . ARG A 1 5   ? 49.513  48.315  33.329 1.00 29.42 ? 5   ARG A NH1  1 
ATOM   50   N NH2  . ARG A 1 5   ? 50.135  47.272  35.279 1.00 28.46 ? 5   ARG A NH2  1 
ATOM   51   H H    . ARG A 1 5   ? 43.665  44.935  30.061 1.00 0.00  ? 5   ARG A H    1 
ATOM   52   H HE   . ARG A 1 5   ? 47.946  46.168  35.071 1.00 0.00  ? 5   ARG A HE   1 
ATOM   53   H HH11 . ARG A 1 5   ? 48.838  48.479  32.610 1.00 0.00  ? 5   ARG A HH11 1 
ATOM   54   H HH12 . ARG A 1 5   ? 50.385  48.802  33.321 1.00 0.00  ? 5   ARG A HH12 1 
ATOM   55   H HH21 . ARG A 1 5   ? 49.933  46.646  36.032 1.00 0.00  ? 5   ARG A HH21 1 
ATOM   56   H HH22 . ARG A 1 5   ? 51.006  47.764  35.260 1.00 0.00  ? 5   ARG A HH22 1 
ATOM   57   N N    . LEU A 1 6   ? 46.881  42.967  30.515 1.00 21.89 ? 6   LEU A N    1 
ATOM   58   C CA   . LEU A 1 6   ? 47.108  41.617  31.015 1.00 16.67 ? 6   LEU A CA   1 
ATOM   59   C C    . LEU A 1 6   ? 48.438  41.563  31.774 1.00 20.06 ? 6   LEU A C    1 
ATOM   60   O O    . LEU A 1 6   ? 49.517  41.680  31.185 1.00 18.48 ? 6   LEU A O    1 
ATOM   61   C CB   . LEU A 1 6   ? 47.086  40.623  29.845 1.00 15.30 ? 6   LEU A CB   1 
ATOM   62   C CG   . LEU A 1 6   ? 47.154  39.106  30.068 1.00 12.36 ? 6   LEU A CG   1 
ATOM   63   C CD1  . LEU A 1 6   ? 46.246  38.662  31.211 1.00 10.22 ? 6   LEU A CD1  1 
ATOM   64   C CD2  . LEU A 1 6   ? 46.764  38.410  28.759 1.00 10.73 ? 6   LEU A CD2  1 
ATOM   65   H H    . LEU A 1 6   ? 47.556  43.372  29.941 1.00 0.00  ? 6   LEU A H    1 
ATOM   66   N N    . VAL A 1 7   ? 48.338  41.429  33.094 1.00 21.48 ? 7   VAL A N    1 
ATOM   67   C CA   . VAL A 1 7   ? 49.503  41.359  33.968 1.00 21.71 ? 7   VAL A CA   1 
ATOM   68   C C    . VAL A 1 7   ? 50.351  40.138  33.648 1.00 21.11 ? 7   VAL A C    1 
ATOM   69   O O    . VAL A 1 7   ? 51.563  40.169  33.815 1.00 30.31 ? 7   VAL A O    1 
ATOM   70   C CB   . VAL A 1 7   ? 49.086  41.343  35.455 1.00 21.02 ? 7   VAL A CB   1 
ATOM   71   C CG1  . VAL A 1 7   ? 50.290  41.116  36.344 1.00 22.72 ? 7   VAL A CG1  1 
ATOM   72   C CG2  . VAL A 1 7   ? 48.436  42.657  35.814 1.00 16.22 ? 7   VAL A CG2  1 
ATOM   73   H H    . VAL A 1 7   ? 47.445  41.381  33.487 1.00 0.00  ? 7   VAL A H    1 
ATOM   74   N N    . GLN A 1 8   ? 49.712  39.059  33.215 1.00 20.68 ? 8   GLN A N    1 
ATOM   75   C CA   . GLN A 1 8   ? 50.436  37.849  32.849 1.00 22.12 ? 8   GLN A CA   1 
ATOM   76   C C    . GLN A 1 8   ? 50.727  37.930  31.358 1.00 20.86 ? 8   GLN A C    1 
ATOM   77   O O    . GLN A 1 8   ? 49.896  37.524  30.552 1.00 20.05 ? 8   GLN A O    1 
ATOM   78   C CB   . GLN A 1 8   ? 49.587  36.605  33.120 1.00 28.70 ? 8   GLN A CB   1 
ATOM   79   C CG   . GLN A 1 8   ? 49.353  36.287  34.583 1.00 37.88 ? 8   GLN A CG   1 
ATOM   80   C CD   . GLN A 1 8   ? 50.100  35.043  35.047 1.00 41.45 ? 8   GLN A CD   1 
ATOM   81   O OE1  . GLN A 1 8   ? 50.833  34.416  34.278 1.00 44.98 ? 8   GLN A OE1  1 
ATOM   82   N NE2  . GLN A 1 8   ? 49.911  34.679  36.312 1.00 44.71 ? 8   GLN A NE2  1 
ATOM   83   H H    . GLN A 1 8   ? 48.743  39.076  33.121 1.00 0.00  ? 8   GLN A H    1 
ATOM   84   H HE21 . GLN A 1 8   ? 50.350  33.854  36.603 1.00 0.00  ? 8   GLN A HE21 1 
ATOM   85   H HE22 . GLN A 1 8   ? 49.337  35.222  36.888 1.00 0.00  ? 8   GLN A HE22 1 
ATOM   86   N N    . GLY A 1 9   ? 51.873  38.494  30.990 1.00 19.72 ? 9   GLY A N    1 
ATOM   87   C CA   . GLY A 1 9   ? 52.232  38.605  29.586 1.00 21.55 ? 9   GLY A CA   1 
ATOM   88   C C    . GLY A 1 9   ? 52.282  37.268  28.863 1.00 27.01 ? 9   GLY A C    1 
ATOM   89   O O    . GLY A 1 9   ? 51.789  37.136  27.736 1.00 31.24 ? 9   GLY A O    1 
ATOM   90   H H    . GLY A 1 9   ? 52.468  38.890  31.665 1.00 0.00  ? 9   GLY A H    1 
ATOM   91   N N    . SER A 1 10  ? 52.833  36.259  29.531 1.00 24.02 ? 10  SER A N    1 
ATOM   92   C CA   . SER A 1 10  ? 52.964  34.918  28.967 1.00 22.44 ? 10  SER A CA   1 
ATOM   93   C C    . SER A 1 10  ? 51.695  34.357  28.303 1.00 22.06 ? 10  SER A C    1 
ATOM   94   O O    . SER A 1 10  ? 51.753  33.815  27.201 1.00 21.92 ? 10  SER A O    1 
ATOM   95   C CB   . SER A 1 10  ? 53.438  33.951  30.048 1.00 17.85 ? 10  SER A CB   1 
ATOM   96   O OG   . SER A 1 10  ? 52.438  33.795  31.040 1.00 21.92 ? 10  SER A OG   1 
ATOM   97   H H    . SER A 1 10  ? 53.166  36.417  30.439 1.00 0.00  ? 10  SER A H    1 
ATOM   98   H HG   . SER A 1 10  ? 52.744  33.193  31.734 1.00 0.00  ? 10  SER A HG   1 
ATOM   99   N N    . ILE A 1 11  ? 50.554  34.484  28.972 1.00 23.11 ? 11  ILE A N    1 
ATOM   100  C CA   . ILE A 1 11  ? 49.301  33.963  28.437 1.00 16.66 ? 11  ILE A CA   1 
ATOM   101  C C    . ILE A 1 11  ? 49.091  34.313  26.980 1.00 14.31 ? 11  ILE A C    1 
ATOM   102  O O    . ILE A 1 11  ? 48.788  33.448  26.173 1.00 20.15 ? 11  ILE A O    1 
ATOM   103  C CB   . ILE A 1 11  ? 48.080  34.440  29.258 1.00 17.17 ? 11  ILE A CB   1 
ATOM   104  C CG1  . ILE A 1 11  ? 48.039  33.704  30.599 1.00 17.04 ? 11  ILE A CG1  1 
ATOM   105  C CG2  . ILE A 1 11  ? 46.773  34.220  28.476 1.00 10.36 ? 11  ILE A CG2  1 
ATOM   106  C CD1  . ILE A 1 11  ? 46.794  34.006  31.423 1.00 24.42 ? 11  ILE A CD1  1 
ATOM   107  H H    . ILE A 1 11  ? 50.568  34.936  29.842 1.00 0.00  ? 11  ILE A H    1 
ATOM   108  N N    . LEU A 1 12  ? 49.291  35.574  26.641 1.00 10.26 ? 12  LEU A N    1 
ATOM   109  C CA   . LEU A 1 12  ? 49.094  36.036  25.280 1.00 6.46  ? 12  LEU A CA   1 
ATOM   110  C C    . LEU A 1 12  ? 50.224  35.551  24.366 1.00 11.39 ? 12  LEU A C    1 
ATOM   111  O O    . LEU A 1 12  ? 50.021  35.337  23.164 1.00 11.56 ? 12  LEU A O    1 
ATOM   112  C CB   . LEU A 1 12  ? 49.009  37.556  25.293 1.00 13.42 ? 12  LEU A CB   1 
ATOM   113  C CG   . LEU A 1 12  ? 48.344  38.277  24.136 1.00 18.70 ? 12  LEU A CG   1 
ATOM   114  C CD1  . LEU A 1 12  ? 47.036  37.588  23.757 1.00 18.43 ? 12  LEU A CD1  1 
ATOM   115  C CD2  . LEU A 1 12  ? 48.108  39.720  24.572 1.00 20.80 ? 12  LEU A CD2  1 
ATOM   116  H H    . LEU A 1 12  ? 49.597  36.208  27.325 1.00 0.00  ? 12  LEU A H    1 
ATOM   117  N N    . LYS A 1 13  ? 51.416  35.392  24.933 1.00 7.56  ? 13  LYS A N    1 
ATOM   118  C CA   . LYS A 1 13  ? 52.559  34.900  24.173 1.00 5.39  ? 13  LYS A CA   1 
ATOM   119  C C    . LYS A 1 13  ? 52.262  33.464  23.736 1.00 13.49 ? 13  LYS A C    1 
ATOM   120  O O    . LYS A 1 13  ? 52.256  33.145  22.532 1.00 17.29 ? 13  LYS A O    1 
ATOM   121  C CB   . LYS A 1 13  ? 53.811  34.943  25.037 1.00 2.03  ? 13  LYS A CB   1 
ATOM   122  C CG   . LYS A 1 13  ? 54.275  36.356  25.375 1.00 3.84  ? 13  LYS A CG   1 
ATOM   123  C CD   . LYS A 1 13  ? 55.251  36.366  26.543 1.00 9.83  ? 13  LYS A CD   1 
ATOM   124  C CE   . LYS A 1 13  ? 56.487  35.540  26.250 1.00 16.90 ? 13  LYS A CE   1 
ATOM   125  N NZ   . LYS A 1 13  ? 57.135  35.957  24.971 1.00 18.54 ? 13  LYS A NZ   1 
ATOM   126  H H    . LYS A 1 13  ? 51.526  35.612  25.881 1.00 0.00  ? 13  LYS A H    1 
ATOM   127  H HZ1  . LYS A 1 13  ? 56.471  35.848  24.178 1.00 0.00  ? 13  LYS A HZ1  1 
ATOM   128  H HZ2  . LYS A 1 13  ? 57.417  36.954  25.046 1.00 0.00  ? 13  LYS A HZ2  1 
ATOM   129  H HZ3  . LYS A 1 13  ? 57.979  35.377  24.797 1.00 0.00  ? 13  LYS A HZ3  1 
ATOM   130  N N    . LYS A 1 14  ? 51.934  32.628  24.719 1.00 13.51 ? 14  LYS A N    1 
ATOM   131  C CA   . LYS A 1 14  ? 51.595  31.223  24.498 1.00 12.06 ? 14  LYS A CA   1 
ATOM   132  C C    . LYS A 1 14  ? 50.392  31.033  23.561 1.00 11.31 ? 14  LYS A C    1 
ATOM   133  O O    . LYS A 1 14  ? 50.363  30.100  22.757 1.00 22.21 ? 14  LYS A O    1 
ATOM   134  C CB   . LYS A 1 14  ? 51.281  30.556  25.829 1.00 11.75 ? 14  LYS A CB   1 
ATOM   135  C CG   . LYS A 1 14  ? 52.326  30.724  26.897 1.00 11.39 ? 14  LYS A CG   1 
ATOM   136  C CD   . LYS A 1 14  ? 51.817  30.078  28.162 1.00 19.70 ? 14  LYS A CD   1 
ATOM   137  C CE   . LYS A 1 14  ? 52.790  30.230  29.299 1.00 26.30 ? 14  LYS A CE   1 
ATOM   138  N NZ   . LYS A 1 14  ? 52.178  29.734  30.554 1.00 34.34 ? 14  LYS A NZ   1 
ATOM   139  H H    . LYS A 1 14  ? 51.909  32.976  25.623 1.00 0.00  ? 14  LYS A H    1 
ATOM   140  H HZ1  . LYS A 1 14  ? 51.928  28.730  30.451 1.00 0.00  ? 14  LYS A HZ1  1 
ATOM   141  H HZ2  . LYS A 1 14  ? 52.881  29.835  31.315 1.00 0.00  ? 14  LYS A HZ2  1 
ATOM   142  H HZ3  . LYS A 1 14  ? 51.331  30.292  30.787 1.00 0.00  ? 14  LYS A HZ3  1 
ATOM   143  N N    . VAL A 1 15  ? 49.383  31.887  23.695 1.00 7.11  ? 15  VAL A N    1 
ATOM   144  C CA   . VAL A 1 15  ? 48.194  31.810  22.857 1.00 2.24  ? 15  VAL A CA   1 
ATOM   145  C C    . VAL A 1 15  ? 48.605  31.999  21.409 1.00 10.47 ? 15  VAL A C    1 
ATOM   146  O O    . VAL A 1 15  ? 48.171  31.267  20.527 1.00 21.51 ? 15  VAL A O    1 
ATOM   147  C CB   . VAL A 1 15  ? 47.166  32.911  23.224 1.00 2.84  ? 15  VAL A CB   1 
ATOM   148  C CG1  . VAL A 1 15  ? 46.123  33.041  22.147 1.00 2.73  ? 15  VAL A CG1  1 
ATOM   149  C CG2  . VAL A 1 15  ? 46.492  32.594  24.531 1.00 3.59  ? 15  VAL A CG2  1 
ATOM   150  H H    . VAL A 1 15  ? 49.422  32.576  24.392 1.00 0.00  ? 15  VAL A H    1 
ATOM   151  N N    . LEU A 1 16  ? 49.493  32.951  21.169 1.00 19.32 ? 16  LEU A N    1 
ATOM   152  C CA   . LEU A 1 16  ? 49.919  33.230  19.811 1.00 24.79 ? 16  LEU A CA   1 
ATOM   153  C C    . LEU A 1 16  ? 50.844  32.177  19.207 1.00 19.34 ? 16  LEU A C    1 
ATOM   154  O O    . LEU A 1 16  ? 50.770  31.900  18.017 1.00 23.59 ? 16  LEU A O    1 
ATOM   155  C CB   . LEU A 1 16  ? 50.521  34.626  19.733 1.00 29.13 ? 16  LEU A CB   1 
ATOM   156  C CG   . LEU A 1 16  ? 50.455  35.280  18.357 1.00 28.70 ? 16  LEU A CG   1 
ATOM   157  C CD1  . LEU A 1 16  ? 49.186  34.922  17.623 1.00 30.25 ? 16  LEU A CD1  1 
ATOM   158  C CD2  . LEU A 1 16  ? 50.524  36.749  18.551 1.00 33.57 ? 16  LEU A CD2  1 
ATOM   159  H H    . LEU A 1 16  ? 49.863  33.478  21.914 1.00 0.00  ? 16  LEU A H    1 
ATOM   160  N N    . GLU A 1 17  ? 51.692  31.570  20.026 1.00 19.97 ? 17  GLU A N    1 
ATOM   161  C CA   . GLU A 1 17  ? 52.595  30.525  19.552 1.00 17.42 ? 17  GLU A CA   1 
ATOM   162  C C    . GLU A 1 17  ? 51.822  29.243  19.264 1.00 16.61 ? 17  GLU A C    1 
ATOM   163  O O    . GLU A 1 17  ? 52.275  28.392  18.498 1.00 25.83 ? 17  GLU A O    1 
ATOM   164  C CB   . GLU A 1 17  ? 53.676  30.246  20.588 1.00 23.04 ? 17  GLU A CB   1 
ATOM   165  C CG   . GLU A 1 17  ? 54.700  31.355  20.709 1.00 27.45 ? 17  GLU A CG   1 
ATOM   166  C CD   . GLU A 1 17  ? 55.517  31.527  19.449 1.00 29.98 ? 17  GLU A CD   1 
ATOM   167  O OE1  . GLU A 1 17  ? 56.196  30.561  19.042 1.00 34.11 ? 17  GLU A OE1  1 
ATOM   168  O OE2  . GLU A 1 17  ? 55.488  32.630  18.870 1.00 30.83 ? 17  GLU A OE2  1 
ATOM   169  H H    . GLU A 1 17  ? 51.685  31.827  20.974 1.00 0.00  ? 17  GLU A H    1 
ATOM   170  N N    . ALA A 1 18  ? 50.668  29.102  19.906 1.00 11.72 ? 18  ALA A N    1 
ATOM   171  C CA   . ALA A 1 18  ? 49.795  27.953  19.721 1.00 8.44  ? 18  ALA A CA   1 
ATOM   172  C C    . ALA A 1 18  ? 48.963  28.073  18.436 1.00 13.38 ? 18  ALA A C    1 
ATOM   173  O O    . ALA A 1 18  ? 48.487  27.069  17.909 1.00 25.45 ? 18  ALA A O    1 
ATOM   174  C CB   . ALA A 1 18  ? 48.873  27.818  20.919 1.00 4.91  ? 18  ALA A CB   1 
ATOM   175  H H    . ALA A 1 18  ? 50.382  29.782  20.552 1.00 0.00  ? 18  ALA A H    1 
ATOM   176  N N    . LEU A 1 19  ? 48.794  29.296  17.932 1.00 14.23 ? 19  LEU A N    1 
ATOM   177  C CA   . LEU A 1 19  ? 47.999  29.548  16.727 1.00 10.37 ? 19  LEU A CA   1 
ATOM   178  C C    . LEU A 1 19  ? 48.759  29.853  15.439 1.00 5.86  ? 19  LEU A C    1 
ATOM   179  O O    . LEU A 1 19  ? 48.431  29.315  14.392 1.00 11.08 ? 19  LEU A O    1 
ATOM   180  C CB   . LEU A 1 19  ? 47.021  30.705  16.974 1.00 11.62 ? 19  LEU A CB   1 
ATOM   181  C CG   . LEU A 1 19  ? 45.975  30.562  18.079 1.00 20.77 ? 19  LEU A CG   1 
ATOM   182  C CD1  . LEU A 1 19  ? 45.117  31.825  18.159 1.00 24.96 ? 19  LEU A CD1  1 
ATOM   183  C CD2  . LEU A 1 19  ? 45.112  29.356  17.809 1.00 18.87 ? 19  LEU A CD2  1 
ATOM   184  H H    . LEU A 1 19  ? 49.177  30.061  18.408 1.00 0.00  ? 19  LEU A H    1 
ATOM   185  N N    . LYS A 1 20  ? 49.724  30.763  15.525 1.00 8.92  ? 20  LYS A N    1 
ATOM   186  C CA   . LYS A 1 20  ? 50.532  31.237  14.392 1.00 16.65 ? 20  LYS A CA   1 
ATOM   187  C C    . LYS A 1 20  ? 50.914  30.239  13.307 1.00 15.90 ? 20  LYS A C    1 
ATOM   188  O O    . LYS A 1 20  ? 51.024  30.611  12.144 1.00 22.55 ? 20  LYS A O    1 
ATOM   189  C CB   . LYS A 1 20  ? 51.818  31.914  14.891 1.00 16.96 ? 20  LYS A CB   1 
ATOM   190  C CG   . LYS A 1 20  ? 52.828  30.914  15.424 1.00 23.67 ? 20  LYS A CG   1 
ATOM   191  C CD   . LYS A 1 20  ? 54.209  31.470  15.535 1.00 22.00 ? 20  LYS A CD   1 
ATOM   192  C CE   . LYS A 1 20  ? 55.147  30.374  15.984 1.00 30.09 ? 20  LYS A CE   1 
ATOM   193  N NZ   . LYS A 1 20  ? 56.494  30.896  16.341 1.00 39.37 ? 20  LYS A NZ   1 
ATOM   194  H H    . LYS A 1 20  ? 49.915  31.154  16.403 1.00 0.00  ? 20  LYS A H    1 
ATOM   195  H HZ1  . LYS A 1 20  ? 56.387  31.585  17.113 1.00 0.00  ? 20  LYS A HZ1  1 
ATOM   196  H HZ2  . LYS A 1 20  ? 57.090  30.112  16.675 1.00 0.00  ? 20  LYS A HZ2  1 
ATOM   197  H HZ3  . LYS A 1 20  ? 56.936  31.357  15.522 1.00 0.00  ? 20  LYS A HZ3  1 
ATOM   198  N N    . ASP A 1 21  ? 51.191  28.999  13.685 1.00 19.18 ? 21  ASP A N    1 
ATOM   199  C CA   . ASP A 1 21  ? 51.584  28.004  12.703 1.00 24.27 ? 21  ASP A CA   1 
ATOM   200  C C    . ASP A 1 21  ? 50.406  27.320  12.013 1.00 23.13 ? 21  ASP A C    1 
ATOM   201  O O    . ASP A 1 21  ? 50.539  26.870  10.876 1.00 32.92 ? 21  ASP A O    1 
ATOM   202  C CB   . ASP A 1 21  ? 52.556  26.979  13.316 1.00 29.97 ? 21  ASP A CB   1 
ATOM   203  C CG   . ASP A 1 21  ? 53.979  27.537  13.498 1.00 30.54 ? 21  ASP A CG   1 
ATOM   204  O OD1  . ASP A 1 21  ? 54.513  28.180  12.557 1.00 24.13 ? 21  ASP A OD1  1 
ATOM   205  O OD2  . ASP A 1 21  ? 54.568  27.312  14.580 1.00 32.44 ? 21  ASP A OD2  1 
ATOM   206  H H    . ASP A 1 21  ? 51.109  28.739  14.621 1.00 0.00  ? 21  ASP A H    1 
ATOM   207  N N    . LEU A 1 22  ? 49.264  27.230  12.693 1.00 17.51 ? 22  LEU A N    1 
ATOM   208  C CA   . LEU A 1 22  ? 48.074  26.612  12.099 1.00 20.50 ? 22  LEU A CA   1 
ATOM   209  C C    . LEU A 1 22  ? 47.274  27.643  11.279 1.00 18.91 ? 22  LEU A C    1 
ATOM   210  O O    . LEU A 1 22  ? 46.785  27.351  10.185 1.00 17.75 ? 22  LEU A O    1 
ATOM   211  C CB   . LEU A 1 22  ? 47.186  25.983  13.181 1.00 21.01 ? 22  LEU A CB   1 
ATOM   212  C CG   . LEU A 1 22  ? 45.979  25.151  12.726 1.00 15.17 ? 22  LEU A CG   1 
ATOM   213  C CD1  . LEU A 1 22  ? 46.463  23.979  11.913 1.00 12.71 ? 22  LEU A CD1  1 
ATOM   214  C CD2  . LEU A 1 22  ? 45.166  24.667  13.931 1.00 14.53 ? 22  LEU A CD2  1 
ATOM   215  H H    . LEU A 1 22  ? 49.227  27.618  13.590 1.00 0.00  ? 22  LEU A H    1 
ATOM   216  N N    . ILE A 1 23  ? 47.105  28.839  11.823 1.00 13.33 ? 23  ILE A N    1 
ATOM   217  C CA   . ILE A 1 23  ? 46.389  29.879  11.105 1.00 16.66 ? 23  ILE A CA   1 
ATOM   218  C C    . ILE A 1 23  ? 47.308  31.090  10.992 1.00 18.14 ? 23  ILE A C    1 
ATOM   219  O O    . ILE A 1 23  ? 47.941  31.489  11.969 1.00 16.75 ? 23  ILE A O    1 
ATOM   220  C CB   . ILE A 1 23  ? 45.053  30.238  11.785 1.00 18.76 ? 23  ILE A CB   1 
ATOM   221  C CG1  . ILE A 1 23  ? 45.270  30.516  13.271 1.00 19.87 ? 23  ILE A CG1  1 
ATOM   222  C CG2  . ILE A 1 23  ? 44.042  29.098  11.593 1.00 12.65 ? 23  ILE A CG2  1 
ATOM   223  C CD1  . ILE A 1 23  ? 43.992  30.839  14.018 1.00 26.07 ? 23  ILE A CD1  1 
ATOM   224  H H    . ILE A 1 23  ? 47.505  29.045  12.695 1.00 0.00  ? 23  ILE A H    1 
ATOM   225  N N    . ASN A 1 24  ? 47.432  31.613  9.773  1.00 21.48 ? 24  ASN A N    1 
ATOM   226  C CA   . ASN A 1 24  ? 48.294  32.759  9.494  1.00 22.79 ? 24  ASN A CA   1 
ATOM   227  C C    . ASN A 1 24  ? 47.566  34.088  9.653  1.00 22.15 ? 24  ASN A C    1 
ATOM   228  O O    . ASN A 1 24  ? 48.099  35.033  10.229 1.00 24.82 ? 24  ASN A O    1 
ATOM   229  C CB   . ASN A 1 24  ? 48.876  32.657  8.077  1.00 25.59 ? 24  ASN A CB   1 
ATOM   230  C CG   . ASN A 1 24  ? 49.658  31.360  7.843  1.00 29.41 ? 24  ASN A CG   1 
ATOM   231  O OD1  . ASN A 1 24  ? 50.308  30.832  8.741  1.00 26.65 ? 24  ASN A OD1  1 
ATOM   232  N ND2  . ASN A 1 24  ? 49.586  30.845  6.622  1.00 37.74 ? 24  ASN A ND2  1 
ATOM   233  H H    . ASN A 1 24  ? 46.925  31.194  9.054  1.00 0.00  ? 24  ASN A H    1 
ATOM   234  H HD21 . ASN A 1 24  ? 50.061  29.999  6.481  1.00 0.00  ? 24  ASN A HD21 1 
ATOM   235  H HD22 . ASN A 1 24  ? 49.071  31.296  5.923  1.00 0.00  ? 24  ASN A HD22 1 
ATOM   236  N N    . GLU A 1 25  ? 46.345  34.156  9.137  1.00 25.40 ? 25  GLU A N    1 
ATOM   237  C CA   . GLU A 1 25  ? 45.533  35.365  9.217  1.00 26.61 ? 25  GLU A CA   1 
ATOM   238  C C    . GLU A 1 25  ? 44.220  35.021  9.905  1.00 26.90 ? 25  GLU A C    1 
ATOM   239  O O    . GLU A 1 25  ? 43.679  33.938  9.683  1.00 22.40 ? 25  GLU A O    1 
ATOM   240  C CB   . GLU A 1 25  ? 45.230  35.862  7.821  1.00 32.29 ? 25  GLU A CB   1 
ATOM   241  C CG   . GLU A 1 25  ? 46.439  35.953  6.935  1.00 48.17 ? 25  GLU A CG   1 
ATOM   242  C CD   . GLU A 1 25  ? 46.064  36.132  5.483  1.00 58.37 ? 25  GLU A CD   1 
ATOM   243  O OE1  . GLU A 1 25  ? 44.911  35.796  5.119  1.00 61.68 ? 25  GLU A OE1  1 
ATOM   244  O OE2  . GLU A 1 25  ? 46.923  36.602  4.705  1.00 64.46 ? 25  GLU A OE2  1 
ATOM   245  H H    . GLU A 1 25  ? 45.929  33.378  8.718  1.00 0.00  ? 25  GLU A H    1 
ATOM   246  N N    . ALA A 1 26  ? 43.704  35.936  10.723 1.00 22.68 ? 26  ALA A N    1 
ATOM   247  C CA   . ALA A 1 26  ? 42.454  35.704  11.433 1.00 18.46 ? 26  ALA A CA   1 
ATOM   248  C C    . ALA A 1 26  ? 41.905  36.993  11.996 1.00 16.87 ? 26  ALA A C    1 
ATOM   249  O O    . ALA A 1 26  ? 42.652  37.906  12.321 1.00 17.05 ? 26  ALA A O    1 
ATOM   250  C CB   . ALA A 1 26  ? 42.664  34.700  12.553 1.00 20.92 ? 26  ALA A CB   1 
ATOM   251  H H    . ALA A 1 26  ? 44.154  36.797  10.866 1.00 0.00  ? 26  ALA A H    1 
ATOM   252  N N    . CYS A 1 27  ? 40.588  37.058  12.108 1.00 23.82 ? 27  CYS A N    1 
ATOM   253  C CA   . CYS A 1 27  ? 39.909  38.233  12.638 1.00 26.71 ? 27  CYS A CA   1 
ATOM   254  C C    . CYS A 1 27  ? 39.778  38.150  14.164 1.00 21.95 ? 27  CYS A C    1 
ATOM   255  O O    . CYS A 1 27  ? 39.395  37.107  14.711 1.00 19.93 ? 27  CYS A O    1 
ATOM   256  C CB   . CYS A 1 27  ? 38.523  38.362  11.983 1.00 29.75 ? 27  CYS A CB   1 
ATOM   257  S SG   . CYS A 1 27  ? 37.382  39.589  12.717 1.00 38.74 ? 27  CYS A SG   1 
ATOM   258  H H    . CYS A 1 27  ? 40.037  36.297  11.833 1.00 0.00  ? 27  CYS A H    1 
ATOM   259  N N    . TRP A 1 28  ? 40.151  39.232  14.842 1.00 14.65 ? 28  TRP A N    1 
ATOM   260  C CA   . TRP A 1 28  ? 40.048  39.320  16.295 1.00 8.04  ? 28  TRP A CA   1 
ATOM   261  C C    . TRP A 1 28  ? 38.878  40.228  16.597 1.00 5.93  ? 28  TRP A C    1 
ATOM   262  O O    . TRP A 1 28  ? 38.931  41.426  16.323 1.00 10.22 ? 28  TRP A O    1 
ATOM   263  C CB   . TRP A 1 28  ? 41.326  39.901  16.915 1.00 11.96 ? 28  TRP A CB   1 
ATOM   264  C CG   . TRP A 1 28  ? 42.525  38.984  16.820 1.00 17.66 ? 28  TRP A CG   1 
ATOM   265  C CD1  . TRP A 1 28  ? 43.129  38.541  15.681 1.00 20.32 ? 28  TRP A CD1  1 
ATOM   266  C CD2  . TRP A 1 28  ? 43.247  38.401  17.913 1.00 21.18 ? 28  TRP A CD2  1 
ATOM   267  N NE1  . TRP A 1 28  ? 44.182  37.718  15.992 1.00 20.56 ? 28  TRP A NE1  1 
ATOM   268  C CE2  . TRP A 1 28  ? 44.278  37.612  17.348 1.00 23.49 ? 28  TRP A CE2  1 
ATOM   269  C CE3  . TRP A 1 28  ? 43.127  38.464  19.303 1.00 25.85 ? 28  TRP A CE3  1 
ATOM   270  C CZ2  . TRP A 1 28  ? 45.183  36.887  18.141 1.00 26.95 ? 28  TRP A CZ2  1 
ATOM   271  C CZ3  . TRP A 1 28  ? 44.030  37.742  20.092 1.00 30.12 ? 28  TRP A CZ3  1 
ATOM   272  C CH2  . TRP A 1 28  ? 45.045  36.963  19.504 1.00 23.51 ? 28  TRP A CH2  1 
ATOM   273  H H    . TRP A 1 28  ? 40.513  40.000  14.356 1.00 0.00  ? 28  TRP A H    1 
ATOM   274  H HE1  . TRP A 1 28  ? 44.742  37.292  15.313 1.00 0.00  ? 28  TRP A HE1  1 
ATOM   275  N N    . ASP A 1 29  ? 37.784  39.634  17.056 1.00 11.76 ? 29  ASP A N    1 
ATOM   276  C CA   . ASP A 1 29  ? 36.581  40.379  17.397 1.00 10.36 ? 29  ASP A CA   1 
ATOM   277  C C    . ASP A 1 29  ? 36.683  40.788  18.849 1.00 20.35 ? 29  ASP A C    1 
ATOM   278  O O    . ASP A 1 29  ? 36.767  39.929  19.741 1.00 23.44 ? 29  ASP A O    1 
ATOM   279  C CB   . ASP A 1 29  ? 35.328  39.522  17.221 1.00 4.26  ? 29  ASP A CB   1 
ATOM   280  C CG   . ASP A 1 29  ? 35.077  39.143  15.794 1.00 5.52  ? 29  ASP A CG   1 
ATOM   281  O OD1  . ASP A 1 29  ? 34.702  40.031  15.006 1.00 6.84  ? 29  ASP A OD1  1 
ATOM   282  O OD2  . ASP A 1 29  ? 35.240  37.949  15.466 1.00 13.08 ? 29  ASP A OD2  1 
ATOM   283  H H    . ASP A 1 29  ? 37.775  38.662  17.171 1.00 0.00  ? 29  ASP A H    1 
ATOM   284  N N    . ILE A 1 30  ? 36.678  42.094  19.084 1.00 21.88 ? 30  ILE A N    1 
ATOM   285  C CA   . ILE A 1 30  ? 36.759  42.639  20.427 1.00 22.25 ? 30  ILE A CA   1 
ATOM   286  C C    . ILE A 1 30  ? 35.371  43.149  20.795 1.00 20.05 ? 30  ILE A C    1 
ATOM   287  O O    . ILE A 1 30  ? 34.716  43.828  20.001 1.00 22.22 ? 30  ILE A O    1 
ATOM   288  C CB   . ILE A 1 30  ? 37.773  43.800  20.499 1.00 22.66 ? 30  ILE A CB   1 
ATOM   289  C CG1  . ILE A 1 30  ? 39.031  43.458  19.699 1.00 21.75 ? 30  ILE A CG1  1 
ATOM   290  C CG2  . ILE A 1 30  ? 38.173  44.039  21.925 1.00 13.43 ? 30  ILE A CG2  1 
ATOM   291  C CD1  . ILE A 1 30  ? 39.783  42.259  20.228 1.00 29.01 ? 30  ILE A CD1  1 
ATOM   292  H H    . ILE A 1 30  ? 36.598  42.689  18.342 1.00 0.00  ? 30  ILE A H    1 
ATOM   293  N N    . SER A 1 31  ? 34.922  42.797  21.990 1.00 21.50 ? 31  SER A N    1 
ATOM   294  C CA   . SER A 1 31  ? 33.614  43.197  22.479 1.00 27.73 ? 31  SER A CA   1 
ATOM   295  C C    . SER A 1 31  ? 33.717  43.251  23.998 1.00 32.49 ? 31  SER A C    1 
ATOM   296  O O    . SER A 1 31  ? 34.640  42.680  24.573 1.00 36.13 ? 31  SER A O    1 
ATOM   297  C CB   . SER A 1 31  ? 32.575  42.154  22.071 1.00 33.90 ? 31  SER A CB   1 
ATOM   298  O OG   . SER A 1 31  ? 31.265  42.553  22.441 1.00 47.53 ? 31  SER A OG   1 
ATOM   299  H H    . SER A 1 31  ? 35.478  42.232  22.574 1.00 0.00  ? 31  SER A H    1 
ATOM   300  H HG   . SER A 1 31  ? 30.850  43.079  21.744 1.00 0.00  ? 31  SER A HG   1 
ATOM   301  N N    . SER A 1 32  ? 32.749  43.884  24.651 1.00 31.35 ? 32  SER A N    1 
ATOM   302  C CA   . SER A 1 32  ? 32.764  44.007  26.105 1.00 32.55 ? 32  SER A CA   1 
ATOM   303  C C    . SER A 1 32  ? 32.953  42.665  26.791 1.00 30.20 ? 32  SER A C    1 
ATOM   304  O O    . SER A 1 32  ? 33.509  42.586  27.883 1.00 25.18 ? 32  SER A O    1 
ATOM   305  C CB   . SER A 1 32  ? 31.474  44.657  26.592 1.00 39.09 ? 32  SER A CB   1 
ATOM   306  O OG   . SER A 1 32  ? 31.287  45.919  25.974 1.00 53.46 ? 32  SER A OG   1 
ATOM   307  H H    . SER A 1 32  ? 31.993  44.238  24.143 1.00 0.00  ? 32  SER A H    1 
ATOM   308  H HG   . SER A 1 32  ? 31.141  45.867  25.021 1.00 0.00  ? 32  SER A HG   1 
ATOM   309  N N    . SER A 1 33  ? 32.492  41.606  26.139 1.00 33.14 ? 33  SER A N    1 
ATOM   310  C CA   . SER A 1 33  ? 32.624  40.268  26.690 1.00 34.68 ? 33  SER A CA   1 
ATOM   311  C C    . SER A 1 33  ? 34.101  39.908  26.774 1.00 35.59 ? 33  SER A C    1 
ATOM   312  O O    . SER A 1 33  ? 34.548  39.308  27.754 1.00 41.99 ? 33  SER A O    1 
ATOM   313  C CB   . SER A 1 33  ? 31.878  39.267  25.813 1.00 34.27 ? 33  SER A CB   1 
ATOM   314  O OG   . SER A 1 33  ? 32.269  39.391  24.453 1.00 43.76 ? 33  SER A OG   1 
ATOM   315  H H    . SER A 1 33  ? 32.039  41.702  25.275 1.00 0.00  ? 33  SER A H    1 
ATOM   316  H HG   . SER A 1 33  ? 33.110  38.942  24.333 1.00 0.00  ? 33  SER A HG   1 
ATOM   317  N N    . GLY A 1 34  ? 34.856  40.311  25.756 1.00 33.65 ? 34  GLY A N    1 
ATOM   318  C CA   . GLY A 1 34  ? 36.278  40.025  25.715 1.00 27.36 ? 34  GLY A CA   1 
ATOM   319  C C    . GLY A 1 34  ? 36.725  39.804  24.289 1.00 19.03 ? 34  GLY A C    1 
ATOM   320  O O    . GLY A 1 34  ? 36.029  40.208  23.362 1.00 22.19 ? 34  GLY A O    1 
ATOM   321  H H    . GLY A 1 34  ? 34.479  40.814  25.007 1.00 0.00  ? 34  GLY A H    1 
ATOM   322  N N    . VAL A 1 35  ? 37.860  39.134  24.118 1.00 18.31 ? 35  VAL A N    1 
ATOM   323  C CA   . VAL A 1 35  ? 38.427  38.850  22.802 1.00 20.17 ? 35  VAL A CA   1 
ATOM   324  C C    . VAL A 1 35  ? 37.942  37.499  22.257 1.00 23.86 ? 35  VAL A C    1 
ATOM   325  O O    . VAL A 1 35  ? 37.977  36.490  22.965 1.00 26.96 ? 35  VAL A O    1 
ATOM   326  C CB   . VAL A 1 35  ? 39.978  38.883  22.868 1.00 20.04 ? 35  VAL A CB   1 
ATOM   327  C CG1  . VAL A 1 35  ? 40.586  38.521  21.520 1.00 19.72 ? 35  VAL A CG1  1 
ATOM   328  C CG2  . VAL A 1 35  ? 40.456  40.267  23.317 1.00 15.72 ? 35  VAL A CG2  1 
ATOM   329  H H    . VAL A 1 35  ? 38.323  38.804  24.914 1.00 0.00  ? 35  VAL A H    1 
ATOM   330  N N    . ASN A 1 36  ? 37.500  37.485  21.000 1.00 25.19 ? 36  ASN A N    1 
ATOM   331  C CA   . ASN A 1 36  ? 37.002  36.267  20.357 1.00 23.91 ? 36  ASN A CA   1 
ATOM   332  C C    . ASN A 1 36  ? 37.592  36.088  18.972 1.00 19.05 ? 36  ASN A C    1 
ATOM   333  O O    . ASN A 1 36  ? 37.714  37.042  18.216 1.00 25.76 ? 36  ASN A O    1 
ATOM   334  C CB   . ASN A 1 36  ? 35.483  36.305  20.235 1.00 29.53 ? 36  ASN A CB   1 
ATOM   335  C CG   . ASN A 1 36  ? 34.799  36.290  21.574 1.00 38.52 ? 36  ASN A CG   1 
ATOM   336  O OD1  . ASN A 1 36  ? 34.941  35.332  22.338 1.00 49.84 ? 36  ASN A OD1  1 
ATOM   337  N ND2  . ASN A 1 36  ? 34.056  37.350  21.880 1.00 40.15 ? 36  ASN A ND2  1 
ATOM   338  H H    . ASN A 1 36  ? 37.515  38.306  20.462 1.00 0.00  ? 36  ASN A H    1 
ATOM   339  H HD21 . ASN A 1 36  ? 33.609  37.335  22.746 1.00 0.00  ? 36  ASN A HD21 1 
ATOM   340  H HD22 . ASN A 1 36  ? 33.985  38.082  21.236 1.00 0.00  ? 36  ASN A HD22 1 
ATOM   341  N N    . LEU A 1 37  ? 37.927  34.854  18.630 1.00 16.55 ? 37  LEU A N    1 
ATOM   342  C CA   . LEU A 1 37  ? 38.514  34.548  17.338 1.00 13.07 ? 37  LEU A CA   1 
ATOM   343  C C    . LEU A 1 37  ? 38.113  33.148  16.878 1.00 15.09 ? 37  LEU A C    1 
ATOM   344  O O    . LEU A 1 37  ? 38.207  32.177  17.638 1.00 9.29  ? 37  LEU A O    1 
ATOM   345  C CB   . LEU A 1 37  ? 40.043  34.658  17.437 1.00 16.52 ? 37  LEU A CB   1 
ATOM   346  C CG   . LEU A 1 37  ? 41.011  34.269  16.309 1.00 18.44 ? 37  LEU A CG   1 
ATOM   347  C CD1  . LEU A 1 37  ? 42.362  34.890  16.608 1.00 20.03 ? 37  LEU A CD1  1 
ATOM   348  C CD2  . LEU A 1 37  ? 41.159  32.759  16.163 1.00 13.19 ? 37  LEU A CD2  1 
ATOM   349  H H    . LEU A 1 37  ? 37.798  34.126  19.280 1.00 0.00  ? 37  LEU A H    1 
ATOM   350  N N    . GLN A 1 38  ? 37.610  33.065  15.650 1.00 17.31 ? 38  GLN A N    1 
ATOM   351  C CA   . GLN A 1 38  ? 37.232  31.797  15.039 1.00 15.78 ? 38  GLN A CA   1 
ATOM   352  C C    . GLN A 1 38  ? 37.876  31.858  13.659 1.00 16.60 ? 38  GLN A C    1 
ATOM   353  O O    . GLN A 1 38  ? 37.791  32.884  12.969 1.00 12.11 ? 38  GLN A O    1 
ATOM   354  C CB   . GLN A 1 38  ? 35.716  31.639  14.907 1.00 14.18 ? 38  GLN A CB   1 
ATOM   355  C CG   . GLN A 1 38  ? 35.309  30.193  14.666 1.00 16.62 ? 38  GLN A CG   1 
ATOM   356  C CD   . GLN A 1 38  ? 34.006  30.060  13.916 1.00 19.10 ? 38  GLN A CD   1 
ATOM   357  O OE1  . GLN A 1 38  ? 33.927  30.380  12.732 1.00 21.93 ? 38  GLN A OE1  1 
ATOM   358  N NE2  . GLN A 1 38  ? 32.983  29.562  14.590 1.00 18.02 ? 38  GLN A NE2  1 
ATOM   359  H H    . GLN A 1 38  ? 37.535  33.861  15.082 1.00 0.00  ? 38  GLN A H    1 
ATOM   360  H HE21 . GLN A 1 38  ? 32.114  29.466  14.145 1.00 0.00  ? 38  GLN A HE21 1 
ATOM   361  H HE22 . GLN A 1 38  ? 33.167  29.307  15.507 1.00 0.00  ? 38  GLN A HE22 1 
ATOM   362  N N    . SER A 1 39  ? 38.551  30.781  13.277 1.00 13.27 ? 39  SER A N    1 
ATOM   363  C CA   . SER A 1 39  ? 39.242  30.742  12.005 1.00 14.13 ? 39  SER A CA   1 
ATOM   364  C C    . SER A 1 39  ? 39.544  29.308  11.605 1.00 15.89 ? 39  SER A C    1 
ATOM   365  O O    . SER A 1 39  ? 39.807  28.467  12.467 1.00 16.43 ? 39  SER A O    1 
ATOM   366  C CB   . SER A 1 39  ? 40.544  31.530  12.148 1.00 15.57 ? 39  SER A CB   1 
ATOM   367  O OG   . SER A 1 39  ? 41.379  31.401  11.016 1.00 21.58 ? 39  SER A OG   1 
ATOM   368  H H    . SER A 1 39  ? 38.606  29.992  13.858 1.00 0.00  ? 39  SER A H    1 
ATOM   369  H HG   . SER A 1 39  ? 41.090  31.987  10.306 1.00 0.00  ? 39  SER A HG   1 
ATOM   370  N N    . MET A 1 40  ? 39.456  29.031  10.303 1.00 15.06 ? 40  MET A N    1 
ATOM   371  C CA   . MET A 1 40  ? 39.750  27.711  9.739  1.00 12.38 ? 40  MET A CA   1 
ATOM   372  C C    . MET A 1 40  ? 41.152  27.762  9.149  1.00 18.12 ? 40  MET A C    1 
ATOM   373  O O    . MET A 1 40  ? 41.593  28.816  8.691  1.00 24.70 ? 40  MET A O    1 
ATOM   374  C CB   . MET A 1 40  ? 38.806  27.390  8.578  1.00 9.97  ? 40  MET A CB   1 
ATOM   375  C CG   . MET A 1 40  ? 37.428  26.902  8.928  1.00 11.51 ? 40  MET A CG   1 
ATOM   376  S SD   . MET A 1 40  ? 36.477  26.736  7.405  1.00 18.79 ? 40  MET A SD   1 
ATOM   377  C CE   . MET A 1 40  ? 36.270  25.060  7.325  1.00 16.34 ? 40  MET A CE   1 
ATOM   378  H H    . MET A 1 40  ? 39.217  29.751  9.691  1.00 0.00  ? 40  MET A H    1 
ATOM   379  N N    . ASP A 1 41  ? 41.842  26.628  9.108  1.00 20.82 ? 41  ASP A N    1 
ATOM   380  C CA   . ASP A 1 41  ? 43.168  26.614  8.502  1.00 19.68 ? 41  ASP A CA   1 
ATOM   381  C C    . ASP A 1 41  ? 42.943  26.616  6.986  1.00 22.16 ? 41  ASP A C    1 
ATOM   382  O O    . ASP A 1 41  ? 41.827  26.351  6.523  1.00 17.91 ? 41  ASP A O    1 
ATOM   383  C CB   . ASP A 1 41  ? 43.958  25.381  8.933  1.00 14.79 ? 41  ASP A CB   1 
ATOM   384  C CG   . ASP A 1 41  ? 43.572  24.140  8.172  1.00 13.79 ? 41  ASP A CG   1 
ATOM   385  O OD1  . ASP A 1 41  ? 42.422  23.683  8.288  1.00 16.11 ? 41  ASP A OD1  1 
ATOM   386  O OD2  . ASP A 1 41  ? 44.434  23.620  7.445  1.00 26.88 ? 41  ASP A OD2  1 
ATOM   387  H H    . ASP A 1 41  ? 41.468  25.817  9.503  1.00 0.00  ? 41  ASP A H    1 
ATOM   388  N N    . SER A 1 42  ? 44.011  26.850  6.229  1.00 24.08 ? 42  SER A N    1 
ATOM   389  C CA   . SER A 1 42  ? 43.971  26.907  4.764  1.00 23.07 ? 42  SER A CA   1 
ATOM   390  C C    . SER A 1 42  ? 43.138  25.821  4.072  1.00 22.77 ? 42  SER A C    1 
ATOM   391  O O    . SER A 1 42  ? 42.393  26.102  3.136  1.00 15.92 ? 42  SER A O    1 
ATOM   392  C CB   . SER A 1 42  ? 45.396  26.857  4.220  1.00 22.26 ? 42  SER A CB   1 
ATOM   393  O OG   . SER A 1 42  ? 46.189  27.876  4.800  1.00 35.18 ? 42  SER A OG   1 
ATOM   394  H H    . SER A 1 42  ? 44.875  26.965  6.666  1.00 0.00  ? 42  SER A H    1 
ATOM   395  H HG   . SER A 1 42  ? 46.097  27.933  5.757  1.00 0.00  ? 42  SER A HG   1 
ATOM   396  N N    . SER A 1 43  ? 43.291  24.581  4.520  1.00 22.59 ? 43  SER A N    1 
ATOM   397  C CA   . SER A 1 43  ? 42.576  23.460  3.927  1.00 24.38 ? 43  SER A CA   1 
ATOM   398  C C    . SER A 1 43  ? 41.173  23.272  4.470  1.00 21.69 ? 43  SER A C    1 
ATOM   399  O O    . SER A 1 43  ? 40.424  22.428  3.972  1.00 24.41 ? 43  SER A O    1 
ATOM   400  C CB   . SER A 1 43  ? 43.367  22.177  4.142  1.00 22.88 ? 43  SER A CB   1 
ATOM   401  O OG   . SER A 1 43  ? 43.652  22.030  5.520  1.00 30.94 ? 43  SER A OG   1 
ATOM   402  H H    . SER A 1 43  ? 43.903  24.385  5.257  1.00 0.00  ? 43  SER A H    1 
ATOM   403  H HG   . SER A 1 43  ? 44.180  21.224  5.625  1.00 0.00  ? 43  SER A HG   1 
ATOM   404  N N    . HIS A 1 44  ? 40.834  24.019  5.517  1.00 15.55 ? 44  HIS A N    1 
ATOM   405  C CA   . HIS A 1 44  ? 39.519  23.929  6.138  1.00 12.69 ? 44  HIS A CA   1 
ATOM   406  C C    . HIS A 1 44  ? 39.305  22.611  6.863  1.00 13.13 ? 44  HIS A C    1 
ATOM   407  O O    . HIS A 1 44  ? 38.173  22.270  7.212  1.00 18.18 ? 44  HIS A O    1 
ATOM   408  C CB   . HIS A 1 44  ? 38.413  24.116  5.095  1.00 12.42 ? 44  HIS A CB   1 
ATOM   409  C CG   . HIS A 1 44  ? 38.321  25.508  4.554  1.00 23.11 ? 44  HIS A CG   1 
ATOM   410  N ND1  . HIS A 1 44  ? 37.466  25.855  3.529  1.00 19.58 ? 44  HIS A ND1  1 
ATOM   411  C CD2  . HIS A 1 44  ? 38.973  26.646  4.899  1.00 23.93 ? 44  HIS A CD2  1 
ATOM   412  C CE1  . HIS A 1 44  ? 37.594  27.144  3.268  1.00 24.01 ? 44  HIS A CE1  1 
ATOM   413  N NE2  . HIS A 1 44  ? 38.501  27.646  4.087  1.00 27.11 ? 44  HIS A NE2  1 
ATOM   414  H H    . HIS A 1 44  ? 41.476  24.651  5.879  1.00 0.00  ? 44  HIS A H    1 
ATOM   415  H HD1  . HIS A 1 44  ? 36.869  25.243  3.055  1.00 0.00  ? 44  HIS A HD1  1 
ATOM   416  H HE2  . HIS A 1 44  ? 38.758  28.589  4.143  1.00 0.00  ? 44  HIS A HE2  1 
ATOM   417  N N    . VAL A 1 45  ? 40.384  21.874  7.108  1.00 13.45 ? 45  VAL A N    1 
ATOM   418  C CA   . VAL A 1 45  ? 40.279  20.579  7.782  1.00 13.99 ? 45  VAL A CA   1 
ATOM   419  C C    . VAL A 1 45  ? 40.159  20.724  9.292  1.00 18.40 ? 45  VAL A C    1 
ATOM   420  O O    . VAL A 1 45  ? 39.707  19.796  9.970  1.00 20.64 ? 45  VAL A O    1 
ATOM   421  C CB   . VAL A 1 45  ? 41.484  19.663  7.444  1.00 15.71 ? 45  VAL A CB   1 
ATOM   422  C CG1  . VAL A 1 45  ? 41.457  18.399  8.296  1.00 7.64  ? 45  VAL A CG1  1 
ATOM   423  C CG2  . VAL A 1 45  ? 41.470  19.300  5.957  1.00 11.35 ? 45  VAL A CG2  1 
ATOM   424  H H    . VAL A 1 45  ? 41.268  22.184  6.822  1.00 0.00  ? 45  VAL A H    1 
ATOM   425  N N    . SER A 1 46  ? 40.515  21.905  9.803  1.00 20.49 ? 46  SER A N    1 
ATOM   426  C CA   . SER A 1 46  ? 40.471  22.188  11.236 1.00 9.30  ? 46  SER A CA   1 
ATOM   427  C C    . SER A 1 46  ? 40.005  23.611  11.470 1.00 13.88 ? 46  SER A C    1 
ATOM   428  O O    . SER A 1 46  ? 40.165  24.476  10.602 1.00 9.67  ? 46  SER A O    1 
ATOM   429  C CB   . SER A 1 46  ? 41.856  22.031  11.844 1.00 6.92  ? 46  SER A CB   1 
ATOM   430  O OG   . SER A 1 46  ? 42.704  23.076  11.401 1.00 7.99  ? 46  SER A OG   1 
ATOM   431  H H    . SER A 1 46  ? 40.783  22.633  9.214  1.00 0.00  ? 46  SER A H    1 
ATOM   432  H HG   . SER A 1 46  ? 42.822  23.023  10.452 1.00 0.00  ? 46  SER A HG   1 
ATOM   433  N N    . LEU A 1 47  ? 39.483  23.856  12.668 1.00 16.12 ? 47  LEU A N    1 
ATOM   434  C CA   . LEU A 1 47  ? 38.984  25.169  13.054 1.00 14.07 ? 47  LEU A CA   1 
ATOM   435  C C    . LEU A 1 47  ? 39.491  25.507  14.454 1.00 17.69 ? 47  LEU A C    1 
ATOM   436  O O    . LEU A 1 47  ? 39.690  24.610  15.268 1.00 19.42 ? 47  LEU A O    1 
ATOM   437  C CB   . LEU A 1 47  ? 37.453  25.148  13.050 1.00 8.11  ? 47  LEU A CB   1 
ATOM   438  C CG   . LEU A 1 47  ? 36.724  26.440  13.413 1.00 4.25  ? 47  LEU A CG   1 
ATOM   439  C CD1  . LEU A 1 47  ? 35.544  26.592  12.505 1.00 3.20  ? 47  LEU A CD1  1 
ATOM   440  C CD2  . LEU A 1 47  ? 36.305  26.453  14.874 1.00 4.35  ? 47  LEU A CD2  1 
ATOM   441  H H    . LEU A 1 47  ? 39.462  23.141  13.337 1.00 0.00  ? 47  LEU A H    1 
ATOM   442  N N    . VAL A 1 48  ? 39.757  26.780  14.721 1.00 15.67 ? 48  VAL A N    1 
ATOM   443  C CA   . VAL A 1 48  ? 40.212  27.186  16.047 1.00 19.66 ? 48  VAL A CA   1 
ATOM   444  C C    . VAL A 1 48  ? 39.234  28.221  16.565 1.00 17.48 ? 48  VAL A C    1 
ATOM   445  O O    . VAL A 1 48  ? 38.638  28.955  15.782 1.00 26.65 ? 48  VAL A O    1 
ATOM   446  C CB   . VAL A 1 48  ? 41.622  27.798  16.031 1.00 15.98 ? 48  VAL A CB   1 
ATOM   447  C CG1  . VAL A 1 48  ? 42.024  28.189  17.432 1.00 19.06 ? 48  VAL A CG1  1 
ATOM   448  C CG2  . VAL A 1 48  ? 42.612  26.797  15.503 1.00 25.47 ? 48  VAL A CG2  1 
ATOM   449  H H    . VAL A 1 48  ? 39.657  27.468  14.036 1.00 0.00  ? 48  VAL A H    1 
ATOM   450  N N    . GLN A 1 49  ? 39.043  28.269  17.872 1.00 4.81  ? 49  GLN A N    1 
ATOM   451  C CA   . GLN A 1 49  ? 38.123  29.227  18.438 1.00 10.36 ? 49  GLN A CA   1 
ATOM   452  C C    . GLN A 1 49  ? 38.704  29.657  19.771 1.00 9.94  ? 49  GLN A C    1 
ATOM   453  O O    . GLN A 1 49  ? 38.856  28.835  20.670 1.00 11.08 ? 49  GLN A O    1 
ATOM   454  C CB   . GLN A 1 49  ? 36.748  28.569  18.597 1.00 19.32 ? 49  GLN A CB   1 
ATOM   455  C CG   . GLN A 1 49  ? 35.625  29.520  18.903 1.00 23.17 ? 49  GLN A CG   1 
ATOM   456  C CD   . GLN A 1 49  ? 35.742  30.096  20.283 1.00 30.94 ? 49  GLN A CD   1 
ATOM   457  O OE1  . GLN A 1 49  ? 35.593  29.378  21.276 1.00 28.87 ? 49  GLN A OE1  1 
ATOM   458  N NE2  . GLN A 1 49  ? 36.047  31.387  20.364 1.00 31.42 ? 49  GLN A NE2  1 
ATOM   459  H H    . GLN A 1 49  ? 39.505  27.640  18.468 1.00 0.00  ? 49  GLN A H    1 
ATOM   460  H HE21 . GLN A 1 49  ? 36.134  31.760  21.270 1.00 0.00  ? 49  GLN A HE21 1 
ATOM   461  H HE22 . GLN A 1 49  ? 36.176  31.910  19.550 1.00 0.00  ? 49  GLN A HE22 1 
ATOM   462  N N    . LEU A 1 50  ? 39.101  30.925  19.859 1.00 11.85 ? 50  LEU A N    1 
ATOM   463  C CA   . LEU A 1 50  ? 39.698  31.481  21.066 1.00 8.60  ? 50  LEU A CA   1 
ATOM   464  C C    . LEU A 1 50  ? 38.729  32.387  21.777 1.00 13.44 ? 50  LEU A C    1 
ATOM   465  O O    . LEU A 1 50  ? 37.978  33.126  21.143 1.00 17.18 ? 50  LEU A O    1 
ATOM   466  C CB   . LEU A 1 50  ? 40.956  32.286  20.731 1.00 2.26  ? 50  LEU A CB   1 
ATOM   467  C CG   . LEU A 1 50  ? 41.686  33.038  21.857 1.00 5.45  ? 50  LEU A CG   1 
ATOM   468  C CD1  . LEU A 1 50  ? 42.374  32.069  22.794 1.00 2.62  ? 50  LEU A CD1  1 
ATOM   469  C CD2  . LEU A 1 50  ? 42.735  33.975  21.274 1.00 5.46  ? 50  LEU A CD2  1 
ATOM   470  H H    . LEU A 1 50  ? 39.002  31.499  19.088 1.00 0.00  ? 50  LEU A H    1 
ATOM   471  N N    . THR A 1 51  ? 38.752  32.319  23.099 1.00 14.30 ? 51  THR A N    1 
ATOM   472  C CA   . THR A 1 51  ? 37.905  33.155  23.915 1.00 17.45 ? 51  THR A CA   1 
ATOM   473  C C    . THR A 1 51  ? 38.659  33.581  25.154 1.00 21.49 ? 51  THR A C    1 
ATOM   474  O O    . THR A 1 51  ? 39.048  32.747  25.976 1.00 20.37 ? 51  THR A O    1 
ATOM   475  C CB   . THR A 1 51  ? 36.617  32.455  24.318 1.00 14.98 ? 51  THR A CB   1 
ATOM   476  O OG1  . THR A 1 51  ? 35.828  32.213  23.148 1.00 24.02 ? 51  THR A OG1  1 
ATOM   477  C CG2  . THR A 1 51  ? 35.823  33.343  25.257 1.00 20.31 ? 51  THR A CG2  1 
ATOM   478  H H    . THR A 1 51  ? 39.357  31.684  23.542 1.00 0.00  ? 51  THR A H    1 
ATOM   479  H HG1  . THR A 1 51  ? 35.646  33.079  22.756 1.00 0.00  ? 51  THR A HG1  1 
ATOM   480  N N    . LEU A 1 52  ? 38.930  34.880  25.232 1.00 20.64 ? 52  LEU A N    1 
ATOM   481  C CA   . LEU A 1 52  ? 39.623  35.469  26.364 1.00 19.49 ? 52  LEU A CA   1 
ATOM   482  C C    . LEU A 1 52  ? 38.615  36.424  27.012 1.00 18.12 ? 52  LEU A C    1 
ATOM   483  O O    . LEU A 1 52  ? 38.322  37.490  26.480 1.00 20.30 ? 52  LEU A O    1 
ATOM   484  C CB   . LEU A 1 52  ? 40.876  36.226  25.897 1.00 14.57 ? 52  LEU A CB   1 
ATOM   485  C CG   . LEU A 1 52  ? 42.026  35.467  25.224 1.00 6.95  ? 52  LEU A CG   1 
ATOM   486  C CD1  . LEU A 1 52  ? 43.117  36.437  24.831 1.00 2.91  ? 52  LEU A CD1  1 
ATOM   487  C CD2  . LEU A 1 52  ? 42.581  34.409  26.145 1.00 9.30  ? 52  LEU A CD2  1 
ATOM   488  H H    . LEU A 1 52  ? 38.637  35.467  24.502 1.00 0.00  ? 52  LEU A H    1 
ATOM   489  N N    . ARG A 1 53  ? 38.018  35.989  28.114 1.00 21.95 ? 53  ARG A N    1 
ATOM   490  C CA   . ARG A 1 53  ? 37.027  36.783  28.826 1.00 23.56 ? 53  ARG A CA   1 
ATOM   491  C C    . ARG A 1 53  ? 37.606  38.069  29.386 1.00 26.15 ? 53  ARG A C    1 
ATOM   492  O O    . ARG A 1 53  ? 38.707  38.076  29.940 1.00 22.03 ? 53  ARG A O    1 
ATOM   493  C CB   . ARG A 1 53  ? 36.403  35.960  29.950 1.00 26.71 ? 53  ARG A CB   1 
ATOM   494  C CG   . ARG A 1 53  ? 35.556  34.800  29.445 1.00 34.38 ? 53  ARG A CG   1 
ATOM   495  C CD   . ARG A 1 53  ? 35.033  33.958  30.582 1.00 36.28 ? 53  ARG A CD   1 
ATOM   496  N NE   . ARG A 1 53  ? 35.554  32.594  30.549 1.00 44.09 ? 53  ARG A NE   1 
ATOM   497  C CZ   . ARG A 1 53  ? 36.245  32.030  31.537 1.00 47.58 ? 53  ARG A CZ   1 
ATOM   498  N NH1  . ARG A 1 53  ? 36.515  32.715  32.642 1.00 45.92 ? 53  ARG A NH1  1 
ATOM   499  N NH2  . ARG A 1 53  ? 36.617  30.758  31.447 1.00 48.47 ? 53  ARG A NH2  1 
ATOM   500  H H    . ARG A 1 53  ? 38.253  35.102  28.444 1.00 0.00  ? 53  ARG A H    1 
ATOM   501  H HE   . ARG A 1 53  ? 35.380  32.056  29.748 1.00 0.00  ? 53  ARG A HE   1 
ATOM   502  H HH11 . ARG A 1 53  ? 36.168  33.640  32.717 1.00 0.00  ? 53  ARG A HH11 1 
ATOM   503  H HH12 . ARG A 1 53  ? 37.012  32.286  33.399 1.00 0.00  ? 53  ARG A HH12 1 
ATOM   504  H HH21 . ARG A 1 53  ? 36.380  30.233  30.644 1.00 0.00  ? 53  ARG A HH21 1 
ATOM   505  H HH22 . ARG A 1 53  ? 37.120  30.331  32.198 1.00 0.00  ? 53  ARG A HH22 1 
ATOM   506  N N    . SER A 1 54  ? 36.850  39.154  29.256 1.00 20.87 ? 54  SER A N    1 
ATOM   507  C CA   . SER A 1 54  ? 37.295  40.447  29.748 1.00 24.71 ? 54  SER A CA   1 
ATOM   508  C C    . SER A 1 54  ? 37.666  40.366  31.229 1.00 24.68 ? 54  SER A C    1 
ATOM   509  O O    . SER A 1 54  ? 38.622  40.997  31.673 1.00 29.40 ? 54  SER A O    1 
ATOM   510  C CB   . SER A 1 54  ? 36.219  41.511  29.518 1.00 18.59 ? 54  SER A CB   1 
ATOM   511  O OG   . SER A 1 54  ? 35.035  41.221  30.235 1.00 31.90 ? 54  SER A OG   1 
ATOM   512  H H    . SER A 1 54  ? 35.993  39.071  28.806 1.00 0.00  ? 54  SER A H    1 
ATOM   513  H HG   . SER A 1 54  ? 34.624  40.429  29.882 1.00 0.00  ? 54  SER A HG   1 
ATOM   514  N N    . GLU A 1 55  ? 36.950  39.527  31.969 1.00 24.50 ? 55  GLU A N    1 
ATOM   515  C CA   . GLU A 1 55  ? 37.199  39.353  33.394 1.00 28.47 ? 55  GLU A CA   1 
ATOM   516  C C    . GLU A 1 55  ? 38.581  38.760  33.652 1.00 29.28 ? 55  GLU A C    1 
ATOM   517  O O    . GLU A 1 55  ? 39.080  38.794  34.776 1.00 34.24 ? 55  GLU A O    1 
ATOM   518  C CB   . GLU A 1 55  ? 36.124  38.465  34.027 1.00 27.34 ? 55  GLU A CB   1 
ATOM   519  C CG   . GLU A 1 55  ? 34.712  39.022  33.949 1.00 35.83 ? 55  GLU A CG   1 
ATOM   520  C CD   . GLU A 1 55  ? 34.124  38.967  32.545 1.00 41.25 ? 55  GLU A CD   1 
ATOM   521  O OE1  . GLU A 1 55  ? 34.352  37.966  31.836 1.00 39.00 ? 55  GLU A OE1  1 
ATOM   522  O OE2  . GLU A 1 55  ? 33.434  39.933  32.148 1.00 48.78 ? 55  GLU A OE2  1 
ATOM   523  H H    . GLU A 1 55  ? 36.250  39.027  31.516 1.00 0.00  ? 55  GLU A H    1 
ATOM   524  N N    . GLY A 1 56  ? 39.180  38.200  32.610 1.00 31.46 ? 56  GLY A N    1 
ATOM   525  C CA   . GLY A 1 56  ? 40.498  37.611  32.739 1.00 27.72 ? 56  GLY A CA   1 
ATOM   526  C C    . GLY A 1 56  ? 41.592  38.653  32.676 1.00 24.19 ? 56  GLY A C    1 
ATOM   527  O O    . GLY A 1 56  ? 42.742  38.354  32.980 1.00 27.14 ? 56  GLY A O    1 
ATOM   528  H H    . GLY A 1 56  ? 38.755  38.174  31.746 1.00 0.00  ? 56  GLY A H    1 
ATOM   529  N N    . PHE A 1 57  ? 41.239  39.876  32.292 1.00 22.50 ? 57  PHE A N    1 
ATOM   530  C CA   . PHE A 1 57  ? 42.211  40.960  32.191 1.00 27.69 ? 57  PHE A CA   1 
ATOM   531  C C    . PHE A 1 57  ? 42.128  41.888  33.389 1.00 26.66 ? 57  PHE A C    1 
ATOM   532  O O    . PHE A 1 57  ? 41.048  42.128  33.918 1.00 29.36 ? 57  PHE A O    1 
ATOM   533  C CB   . PHE A 1 57  ? 41.977  41.781  30.923 1.00 21.42 ? 57  PHE A CB   1 
ATOM   534  C CG   . PHE A 1 57  ? 42.063  40.984  29.659 1.00 13.95 ? 57  PHE A CG   1 
ATOM   535  C CD1  . PHE A 1 57  ? 40.991  40.210  29.238 1.00 16.06 ? 57  PHE A CD1  1 
ATOM   536  C CD2  . PHE A 1 57  ? 43.193  41.048  28.863 1.00 13.96 ? 57  PHE A CD2  1 
ATOM   537  C CE1  . PHE A 1 57  ? 41.043  39.514  28.037 1.00 14.94 ? 57  PHE A CE1  1 
ATOM   538  C CE2  . PHE A 1 57  ? 43.257  40.356  27.656 1.00 14.72 ? 57  PHE A CE2  1 
ATOM   539  C CZ   . PHE A 1 57  ? 42.181  39.590  27.244 1.00 14.76 ? 57  PHE A CZ   1 
ATOM   540  H H    . PHE A 1 57  ? 40.308  40.088  32.084 1.00 0.00  ? 57  PHE A H    1 
ATOM   541  N N    . ASP A 1 58  ? 43.270  42.429  33.798 1.00 30.47 ? 58  ASP A N    1 
ATOM   542  C CA   . ASP A 1 58  ? 43.300  43.346  34.926 1.00 31.10 ? 58  ASP A CA   1 
ATOM   543  C C    . ASP A 1 58  ? 42.512  44.581  34.551 1.00 28.27 ? 58  ASP A C    1 
ATOM   544  O O    . ASP A 1 58  ? 41.743  45.107  35.347 1.00 37.60 ? 58  ASP A O    1 
ATOM   545  C CB   . ASP A 1 58  ? 44.733  43.763  35.264 1.00 35.58 ? 58  ASP A CB   1 
ATOM   546  C CG   . ASP A 1 58  ? 44.782  44.978  36.193 1.00 42.85 ? 58  ASP A CG   1 
ATOM   547  O OD1  . ASP A 1 58  ? 44.372  44.852  37.370 1.00 46.37 ? 58  ASP A OD1  1 
ATOM   548  O OD2  . ASP A 1 58  ? 45.215  46.066  35.742 1.00 42.56 ? 58  ASP A OD2  1 
ATOM   549  H H    . ASP A 1 58  ? 44.085  42.218  33.305 1.00 0.00  ? 58  ASP A H    1 
ATOM   550  N N    . THR A 1 59  ? 42.738  45.056  33.338 1.00 27.16 ? 59  THR A N    1 
ATOM   551  C CA   . THR A 1 59  ? 42.065  46.240  32.839 1.00 24.44 ? 59  THR A CA   1 
ATOM   552  C C    . THR A 1 59  ? 41.444  45.865  31.502 1.00 23.53 ? 59  THR A C    1 
ATOM   553  O O    . THR A 1 59  ? 42.054  45.154  30.704 1.00 20.36 ? 59  THR A O    1 
ATOM   554  C CB   . THR A 1 59  ? 43.083  47.412  32.652 1.00 29.60 ? 59  THR A CB   1 
ATOM   555  O OG1  . THR A 1 59  ? 43.483  47.924  33.931 1.00 31.01 ? 59  THR A OG1  1 
ATOM   556  C CG2  . THR A 1 59  ? 42.497  48.543  31.805 1.00 35.86 ? 59  THR A CG2  1 
ATOM   557  H H    . THR A 1 59  ? 43.337  44.559  32.744 1.00 0.00  ? 59  THR A H    1 
ATOM   558  H HG1  . THR A 1 59  ? 43.840  47.200  34.457 1.00 0.00  ? 59  THR A HG1  1 
ATOM   559  N N    . TYR A 1 60  ? 40.206  46.281  31.285 1.00 24.31 ? 60  TYR A N    1 
ATOM   560  C CA   . TYR A 1 60  ? 39.546  45.993  30.030 1.00 22.82 ? 60  TYR A CA   1 
ATOM   561  C C    . TYR A 1 60  ? 38.514  47.048  29.714 1.00 22.41 ? 60  TYR A C    1 
ATOM   562  O O    . TYR A 1 60  ? 37.613  47.290  30.513 1.00 25.71 ? 60  TYR A O    1 
ATOM   563  C CB   . TYR A 1 60  ? 38.867  44.633  30.057 1.00 16.60 ? 60  TYR A CB   1 
ATOM   564  C CG   . TYR A 1 60  ? 38.403  44.222  28.687 1.00 18.86 ? 60  TYR A CG   1 
ATOM   565  C CD1  . TYR A 1 60  ? 39.285  43.639  27.777 1.00 15.68 ? 60  TYR A CD1  1 
ATOM   566  C CD2  . TYR A 1 60  ? 37.090  44.429  28.287 1.00 15.20 ? 60  TYR A CD2  1 
ATOM   567  C CE1  . TYR A 1 60  ? 38.865  43.273  26.509 1.00 14.80 ? 60  TYR A CE1  1 
ATOM   568  C CE2  . TYR A 1 60  ? 36.665  44.064  27.022 1.00 17.27 ? 60  TYR A CE2  1 
ATOM   569  C CZ   . TYR A 1 60  ? 37.555  43.490  26.144 1.00 11.90 ? 60  TYR A CZ   1 
ATOM   570  O OH   . TYR A 1 60  ? 37.120  43.129  24.902 1.00 15.20 ? 60  TYR A OH   1 
ATOM   571  H H    . TYR A 1 60  ? 39.705  46.771  31.971 1.00 0.00  ? 60  TYR A H    1 
ATOM   572  H HH   . TYR A 1 60  ? 36.216  43.411  24.795 1.00 0.00  ? 60  TYR A HH   1 
ATOM   573  N N    . ARG A 1 61  ? 38.632  47.635  28.527 1.00 19.48 ? 61  ARG A N    1 
ATOM   574  C CA   . ARG A 1 61  ? 37.717  48.664  28.072 1.00 18.17 ? 61  ARG A CA   1 
ATOM   575  C C    . ARG A 1 61  ? 37.460  48.495  26.590 1.00 21.31 ? 61  ARG A C    1 
ATOM   576  O O    . ARG A 1 61  ? 38.384  48.243  25.817 1.00 22.86 ? 61  ARG A O    1 
ATOM   577  C CB   . ARG A 1 61  ? 38.311  50.045  28.316 1.00 23.80 ? 61  ARG A CB   1 
ATOM   578  C CG   . ARG A 1 61  ? 37.605  51.157  27.568 1.00 27.45 ? 61  ARG A CG   1 
ATOM   579  C CD   . ARG A 1 61  ? 38.330  52.460  27.748 1.00 31.10 ? 61  ARG A CD   1 
ATOM   580  N NE   . ARG A 1 61  ? 37.875  53.450  26.784 1.00 36.86 ? 61  ARG A NE   1 
ATOM   581  C CZ   . ARG A 1 61  ? 38.018  54.760  26.939 1.00 39.09 ? 61  ARG A CZ   1 
ATOM   582  N NH1  . ARG A 1 61  ? 38.600  55.244  28.026 1.00 41.04 ? 61  ARG A NH1  1 
ATOM   583  N NH2  . ARG A 1 61  ? 37.624  55.584  25.980 1.00 40.42 ? 61  ARG A NH2  1 
ATOM   584  H H    . ARG A 1 61  ? 39.361  47.369  27.925 1.00 0.00  ? 61  ARG A H    1 
ATOM   585  H HE   . ARG A 1 61  ? 37.448  53.128  25.963 1.00 0.00  ? 61  ARG A HE   1 
ATOM   586  H HH11 . ARG A 1 61  ? 38.947  54.628  28.732 1.00 0.00  ? 61  ARG A HH11 1 
ATOM   587  H HH12 . ARG A 1 61  ? 38.709  56.233  28.127 1.00 0.00  ? 61  ARG A HH12 1 
ATOM   588  H HH21 . ARG A 1 61  ? 37.229  55.215  25.140 1.00 0.00  ? 61  ARG A HH21 1 
ATOM   589  H HH22 . ARG A 1 61  ? 37.732  56.572  26.087 1.00 0.00  ? 61  ARG A HH22 1 
ATOM   590  N N    . CYS A 1 62  ? 36.203  48.642  26.194 1.00 23.94 ? 62  CYS A N    1 
ATOM   591  C CA   . CYS A 1 62  ? 35.835  48.528  24.795 1.00 27.21 ? 62  CYS A CA   1 
ATOM   592  C C    . CYS A 1 62  ? 34.560  49.305  24.540 1.00 25.04 ? 62  CYS A C    1 
ATOM   593  O O    . CYS A 1 62  ? 33.465  48.799  24.778 1.00 31.24 ? 62  CYS A O    1 
ATOM   594  C CB   . CYS A 1 62  ? 35.636  47.071  24.390 1.00 24.99 ? 62  CYS A CB   1 
ATOM   595  S SG   . CYS A 1 62  ? 35.419  46.892  22.616 1.00 31.24 ? 62  CYS A SG   1 
ATOM   596  H H    . CYS A 1 62  ? 35.499  48.840  26.847 1.00 0.00  ? 62  CYS A H    1 
ATOM   597  N N    . ASP A 1 63  ? 34.712  50.535  24.064 1.00 23.86 ? 63  ASP A N    1 
ATOM   598  C CA   . ASP A 1 63  ? 33.578  51.407  23.772 1.00 26.77 ? 63  ASP A CA   1 
ATOM   599  C C    . ASP A 1 63  ? 32.737  50.834  22.649 1.00 28.86 ? 63  ASP A C    1 
ATOM   600  O O    . ASP A 1 63  ? 31.525  50.682  22.779 1.00 36.65 ? 63  ASP A O    1 
ATOM   601  C CB   . ASP A 1 63  ? 34.068  52.802  23.376 1.00 35.56 ? 63  ASP A CB   1 
ATOM   602  C CG   . ASP A 1 63  ? 34.913  53.463  24.461 1.00 44.43 ? 63  ASP A CG   1 
ATOM   603  O OD1  . ASP A 1 63  ? 34.754  53.126  25.660 1.00 45.00 ? 63  ASP A OD1  1 
ATOM   604  O OD2  . ASP A 1 63  ? 35.740  54.331  24.105 1.00 49.38 ? 63  ASP A OD2  1 
ATOM   605  H H    . ASP A 1 63  ? 35.630  50.844  23.928 1.00 0.00  ? 63  ASP A H    1 
ATOM   606  N N    . ARG A 1 64  ? 33.393  50.522  21.541 1.00 31.40 ? 64  ARG A N    1 
ATOM   607  C CA   . ARG A 1 64  ? 32.725  49.968  20.377 1.00 35.45 ? 64  ARG A CA   1 
ATOM   608  C C    . ARG A 1 64  ? 33.406  48.686  19.949 1.00 37.19 ? 64  ARG A C    1 
ATOM   609  O O    . ARG A 1 64  ? 34.632  48.573  20.031 1.00 43.97 ? 64  ARG A O    1 
ATOM   610  C CB   . ARG A 1 64  ? 32.741  50.983  19.235 1.00 40.95 ? 64  ARG A CB   1 
ATOM   611  C CG   . ARG A 1 64  ? 31.811  52.159  19.480 1.00 48.67 ? 64  ARG A CG   1 
ATOM   612  C CD   . ARG A 1 64  ? 32.336  53.455  18.884 1.00 54.92 ? 64  ARG A CD   1 
ATOM   613  N NE   . ARG A 1 64  ? 31.748  54.595  19.579 1.00 54.70 ? 64  ARG A NE   1 
ATOM   614  C CZ   . ARG A 1 64  ? 30.512  55.037  19.378 1.00 56.46 ? 64  ARG A CZ   1 
ATOM   615  N NH1  . ARG A 1 64  ? 29.722  54.457  18.482 1.00 54.06 ? 64  ARG A NH1  1 
ATOM   616  N NH2  . ARG A 1 64  ? 30.033  55.999  20.146 1.00 57.37 ? 64  ARG A NH2  1 
ATOM   617  H H    . ARG A 1 64  ? 34.342  50.677  21.532 1.00 0.00  ? 64  ARG A H    1 
ATOM   618  H HE   . ARG A 1 64  ? 32.295  55.068  20.239 1.00 0.00  ? 64  ARG A HE   1 
ATOM   619  H HH11 . ARG A 1 64  ? 30.049  53.685  17.939 1.00 0.00  ? 64  ARG A HH11 1 
ATOM   620  H HH12 . ARG A 1 64  ? 28.793  54.803  18.343 1.00 0.00  ? 64  ARG A HH12 1 
ATOM   621  H HH21 . ARG A 1 64  ? 30.601  56.384  20.872 1.00 0.00  ? 64  ARG A HH21 1 
ATOM   622  H HH22 . ARG A 1 64  ? 29.102  56.337  20.003 1.00 0.00  ? 64  ARG A HH22 1 
ATOM   623  N N    . ASN A 1 65  ? 32.601  47.715  19.528 1.00 34.02 ? 65  ASN A N    1 
ATOM   624  C CA   . ASN A 1 65  ? 33.099  46.420  19.079 1.00 29.29 ? 65  ASN A CA   1 
ATOM   625  C C    . ASN A 1 65  ? 34.001  46.589  17.871 1.00 31.73 ? 65  ASN A C    1 
ATOM   626  O O    . ASN A 1 65  ? 33.658  47.312  16.927 1.00 33.03 ? 65  ASN A O    1 
ATOM   627  C CB   . ASN A 1 65  ? 31.938  45.490  18.734 1.00 28.24 ? 65  ASN A CB   1 
ATOM   628  C CG   . ASN A 1 65  ? 31.121  45.091  19.950 1.00 30.68 ? 65  ASN A CG   1 
ATOM   629  O OD1  . ASN A 1 65  ? 30.376  44.118  19.909 1.00 34.26 ? 65  ASN A OD1  1 
ATOM   630  N ND2  . ASN A 1 65  ? 31.276  45.820  21.045 1.00 32.87 ? 65  ASN A ND2  1 
ATOM   631  H H    . ASN A 1 65  ? 31.639  47.899  19.513 1.00 0.00  ? 65  ASN A H    1 
ATOM   632  H HD21 . ASN A 1 65  ? 30.720  45.596  21.822 1.00 0.00  ? 65  ASN A HD21 1 
ATOM   633  H HD22 . ASN A 1 65  ? 31.911  46.555  21.106 1.00 0.00  ? 65  ASN A HD22 1 
ATOM   634  N N    . LEU A 1 66  ? 35.147  45.913  17.913 1.00 32.95 ? 66  LEU A N    1 
ATOM   635  C CA   . LEU A 1 66  ? 36.151  45.965  16.853 1.00 24.23 ? 66  LEU A CA   1 
ATOM   636  C C    . LEU A 1 66  ? 36.373  44.596  16.225 1.00 24.89 ? 66  LEU A C    1 
ATOM   637  O O    . LEU A 1 66  ? 36.315  43.575  16.902 1.00 28.27 ? 66  LEU A O    1 
ATOM   638  C CB   . LEU A 1 66  ? 37.486  46.446  17.429 1.00 21.88 ? 66  LEU A CB   1 
ATOM   639  C CG   . LEU A 1 66  ? 37.666  47.887  17.909 1.00 22.71 ? 66  LEU A CG   1 
ATOM   640  C CD1  . LEU A 1 66  ? 38.956  47.979  18.683 1.00 17.99 ? 66  LEU A CD1  1 
ATOM   641  C CD2  . LEU A 1 66  ? 37.688  48.852  16.717 1.00 26.00 ? 66  LEU A CD2  1 
ATOM   642  H H    . LEU A 1 66  ? 35.327  45.327  18.678 1.00 0.00  ? 66  LEU A H    1 
ATOM   643  N N    . ALA A 1 67  ? 36.639  44.585  14.927 1.00 22.72 ? 67  ALA A N    1 
ATOM   644  C CA   . ALA A 1 67  ? 36.916  43.357  14.200 1.00 18.64 ? 67  ALA A CA   1 
ATOM   645  C C    . ALA A 1 67  ? 38.210  43.672  13.470 1.00 21.03 ? 67  ALA A C    1 
ATOM   646  O O    . ALA A 1 67  ? 38.193  44.280  12.399 1.00 24.11 ? 67  ALA A O    1 
ATOM   647  C CB   . ALA A 1 67  ? 35.801  43.056  13.209 1.00 21.41 ? 67  ALA A CB   1 
ATOM   648  H H    . ALA A 1 67  ? 36.674  45.427  14.431 1.00 0.00  ? 67  ALA A H    1 
ATOM   649  N N    . MET A 1 68  ? 39.332  43.311  14.080 1.00 21.76 ? 68  MET A N    1 
ATOM   650  C CA   . MET A 1 68  ? 40.641  43.594  13.501 1.00 21.40 ? 68  MET A CA   1 
ATOM   651  C C    . MET A 1 68  ? 41.227  42.435  12.701 1.00 19.52 ? 68  MET A C    1 
ATOM   652  O O    . MET A 1 68  ? 41.435  41.351  13.239 1.00 22.69 ? 68  MET A O    1 
ATOM   653  C CB   . MET A 1 68  ? 41.620  43.994  14.608 1.00 20.29 ? 68  MET A CB   1 
ATOM   654  C CG   . MET A 1 68  ? 41.076  45.027  15.575 1.00 19.86 ? 68  MET A CG   1 
ATOM   655  S SD   . MET A 1 68  ? 42.213  45.367  16.922 1.00 29.57 ? 68  MET A SD   1 
ATOM   656  C CE   . MET A 1 68  ? 42.094  43.842  17.842 1.00 26.89 ? 68  MET A CE   1 
ATOM   657  H H    . MET A 1 68  ? 39.267  42.823  14.932 1.00 0.00  ? 68  MET A H    1 
ATOM   658  N N    . GLY A 1 69  ? 41.464  42.665  11.414 1.00 16.25 ? 69  GLY A N    1 
ATOM   659  C CA   . GLY A 1 69  ? 42.057  41.649  10.565 1.00 9.51  ? 69  GLY A CA   1 
ATOM   660  C C    . GLY A 1 69  ? 43.517  41.611  10.959 1.00 9.91  ? 69  GLY A C    1 
ATOM   661  O O    . GLY A 1 69  ? 44.241  42.580  10.728 1.00 15.68 ? 69  GLY A O    1 
ATOM   662  H H    . GLY A 1 69  ? 41.238  43.540  11.057 1.00 0.00  ? 69  GLY A H    1 
ATOM   663  N N    . VAL A 1 70  ? 43.945  40.511  11.569 1.00 11.62 ? 70  VAL A N    1 
ATOM   664  C CA   . VAL A 1 70  ? 45.314  40.358  12.052 1.00 17.17 ? 70  VAL A CA   1 
ATOM   665  C C    . VAL A 1 70  ? 46.097  39.229  11.390 1.00 18.30 ? 70  VAL A C    1 
ATOM   666  O O    . VAL A 1 70  ? 45.545  38.169  11.075 1.00 16.29 ? 70  VAL A O    1 
ATOM   667  C CB   . VAL A 1 70  ? 45.321  40.125  13.603 1.00 15.53 ? 70  VAL A CB   1 
ATOM   668  C CG1  . VAL A 1 70  ? 46.721  39.803  14.109 1.00 17.83 ? 70  VAL A CG1  1 
ATOM   669  C CG2  . VAL A 1 70  ? 44.784  41.349  14.322 1.00 11.97 ? 70  VAL A CG2  1 
ATOM   670  H H    . VAL A 1 70  ? 43.321  39.771  11.720 1.00 0.00  ? 70  VAL A H    1 
ATOM   671  N N    . ASN A 1 71  ? 47.389  39.470  11.184 1.00 15.67 ? 71  ASN A N    1 
ATOM   672  C CA   . ASN A 1 71  ? 48.275  38.471  10.610 1.00 19.66 ? 71  ASN A CA   1 
ATOM   673  C C    . ASN A 1 71  ? 48.993  37.833  11.788 1.00 17.24 ? 71  ASN A C    1 
ATOM   674  O O    . ASN A 1 71  ? 49.959  38.387  12.308 1.00 15.96 ? 71  ASN A O    1 
ATOM   675  C CB   . ASN A 1 71  ? 49.293  39.117  9.681  1.00 29.14 ? 71  ASN A CB   1 
ATOM   676  C CG   . ASN A 1 71  ? 50.294  38.117  9.129  1.00 33.35 ? 71  ASN A CG   1 
ATOM   677  O OD1  . ASN A 1 71  ? 50.774  37.237  9.851  1.00 34.20 ? 71  ASN A OD1  1 
ATOM   678  N ND2  . ASN A 1 71  ? 50.623  38.252  7.849  1.00 30.61 ? 71  ASN A ND2  1 
ATOM   679  H H    . ASN A 1 71  ? 47.750  40.345  11.429 1.00 0.00  ? 71  ASN A H    1 
ATOM   680  H HD21 . ASN A 1 71  ? 51.257  37.605  7.485  1.00 0.00  ? 71  ASN A HD21 1 
ATOM   681  H HD22 . ASN A 1 71  ? 50.219  38.984  7.341  1.00 0.00  ? 71  ASN A HD22 1 
ATOM   682  N N    . LEU A 1 72  ? 48.526  36.662  12.196 1.00 16.66 ? 72  LEU A N    1 
ATOM   683  C CA   . LEU A 1 72  ? 49.099  35.973  13.338 1.00 13.49 ? 72  LEU A CA   1 
ATOM   684  C C    . LEU A 1 72  ? 50.596  35.780  13.259 1.00 9.63  ? 72  LEU A C    1 
ATOM   685  O O    . LEU A 1 72  ? 51.264  35.755  14.287 1.00 13.44 ? 72  LEU A O    1 
ATOM   686  C CB   . LEU A 1 72  ? 48.364  34.659  13.600 1.00 11.37 ? 72  LEU A CB   1 
ATOM   687  C CG   . LEU A 1 72  ? 46.883  34.939  13.887 1.00 16.64 ? 72  LEU A CG   1 
ATOM   688  C CD1  . LEU A 1 72  ? 46.143  33.669  14.192 1.00 23.20 ? 72  LEU A CD1  1 
ATOM   689  C CD2  . LEU A 1 72  ? 46.749  35.898  15.055 1.00 16.34 ? 72  LEU A CD2  1 
ATOM   690  H H    . LEU A 1 72  ? 47.801  36.250  11.686 1.00 0.00  ? 72  LEU A H    1 
ATOM   691  N N    . THR A 1 73  ? 51.139  35.700  12.051 1.00 12.49 ? 73  THR A N    1 
ATOM   692  C CA   . THR A 1 73  ? 52.584  35.544  11.911 1.00 20.66 ? 73  THR A CA   1 
ATOM   693  C C    . THR A 1 73  ? 53.338  36.822  12.327 1.00 19.25 ? 73  THR A C    1 
ATOM   694  O O    . THR A 1 73  ? 54.393  36.737  12.959 1.00 23.45 ? 73  THR A O    1 
ATOM   695  C CB   . THR A 1 73  ? 52.988  35.113  10.489 1.00 23.58 ? 73  THR A CB   1 
ATOM   696  O OG1  . THR A 1 73  ? 52.409  33.831  10.197 1.00 24.61 ? 73  THR A OG1  1 
ATOM   697  C CG2  . THR A 1 73  ? 54.509  35.018  10.373 1.00 24.71 ? 73  THR A CG2  1 
ATOM   698  H H    . THR A 1 73  ? 50.590  35.729  11.238 1.00 0.00  ? 73  THR A H    1 
ATOM   699  H HG1  . THR A 1 73  ? 52.680  33.159  10.832 1.00 0.00  ? 73  THR A HG1  1 
ATOM   700  N N    . SER A 1 74  ? 52.777  37.990  12.013 1.00 14.72 ? 74  SER A N    1 
ATOM   701  C CA   . SER A 1 74  ? 53.381  39.275  12.377 1.00 12.18 ? 74  SER A CA   1 
ATOM   702  C C    . SER A 1 74  ? 53.213  39.543  13.874 1.00 7.79  ? 74  SER A C    1 
ATOM   703  O O    . SER A 1 74  ? 54.118  40.022  14.549 1.00 10.50 ? 74  SER A O    1 
ATOM   704  C CB   . SER A 1 74  ? 52.723  40.405  11.593 1.00 12.72 ? 74  SER A CB   1 
ATOM   705  O OG   . SER A 1 74  ? 52.913  40.225  10.206 1.00 26.03 ? 74  SER A OG   1 
ATOM   706  H H    . SER A 1 74  ? 51.943  37.993  11.493 1.00 0.00  ? 74  SER A H    1 
ATOM   707  H HG   . SER A 1 74  ? 52.455  40.945  9.755  1.00 0.00  ? 74  SER A HG   1 
ATOM   708  N N    . MET A 1 75  ? 52.037  39.241  14.390 1.00 6.77  ? 75  MET A N    1 
ATOM   709  C CA   . MET A 1 75  ? 51.759  39.446  15.799 1.00 13.37 ? 75  MET A CA   1 
ATOM   710  C C    . MET A 1 75  ? 52.623  38.500  16.618 1.00 13.98 ? 75  MET A C    1 
ATOM   711  O O    . MET A 1 75  ? 52.997  38.812  17.743 1.00 17.93 ? 75  MET A O    1 
ATOM   712  C CB   . MET A 1 75  ? 50.280  39.188  16.083 1.00 18.01 ? 75  MET A CB   1 
ATOM   713  C CG   . MET A 1 75  ? 49.776  39.737  17.393 1.00 15.75 ? 75  MET A CG   1 
ATOM   714  S SD   . MET A 1 75  ? 48.038  39.325  17.581 1.00 19.05 ? 75  MET A SD   1 
ATOM   715  C CE   . MET A 1 75  ? 47.690  40.148  19.153 1.00 5.70  ? 75  MET A CE   1 
ATOM   716  H H    . MET A 1 75  ? 51.336  38.886  13.798 1.00 0.00  ? 75  MET A H    1 
ATOM   717  N N    . SER A 1 76  ? 52.947  37.342  16.055 1.00 14.30 ? 76  SER A N    1 
ATOM   718  C CA   . SER A 1 76  ? 53.785  36.385  16.760 1.00 15.68 ? 76  SER A CA   1 
ATOM   719  C C    . SER A 1 76  ? 55.199  36.950  16.921 1.00 17.85 ? 76  SER A C    1 
ATOM   720  O O    . SER A 1 76  ? 55.808  36.833  17.993 1.00 19.71 ? 76  SER A O    1 
ATOM   721  C CB   . SER A 1 76  ? 53.821  35.053  16.024 1.00 15.95 ? 76  SER A CB   1 
ATOM   722  O OG   . SER A 1 76  ? 54.620  34.133  16.736 1.00 17.84 ? 76  SER A OG   1 
ATOM   723  H H    . SER A 1 76  ? 52.609  37.107  15.166 1.00 0.00  ? 76  SER A H    1 
ATOM   724  H HG   . SER A 1 76  ? 54.381  34.206  17.661 1.00 0.00  ? 76  SER A HG   1 
ATOM   725  N N    . LYS A 1 77  ? 55.709  37.581  15.866 1.00 11.72 ? 77  LYS A N    1 
ATOM   726  C CA   . LYS A 1 77  ? 57.039  38.186  15.914 1.00 11.33 ? 77  LYS A CA   1 
ATOM   727  C C    . LYS A 1 77  ? 57.064  39.281  16.968 1.00 10.06 ? 77  LYS A C    1 
ATOM   728  O O    . LYS A 1 77  ? 57.993  39.370  17.760 1.00 19.79 ? 77  LYS A O    1 
ATOM   729  C CB   . LYS A 1 77  ? 57.408  38.792  14.566 1.00 10.48 ? 77  LYS A CB   1 
ATOM   730  C CG   . LYS A 1 77  ? 57.736  37.789  13.497 1.00 9.16  ? 77  LYS A CG   1 
ATOM   731  C CD   . LYS A 1 77  ? 57.976  38.527  12.203 1.00 15.30 ? 77  LYS A CD   1 
ATOM   732  C CE   . LYS A 1 77  ? 58.372  37.590  11.096 1.00 16.27 ? 77  LYS A CE   1 
ATOM   733  N NZ   . LYS A 1 77  ? 58.567  38.383  9.855  1.00 30.76 ? 77  LYS A NZ   1 
ATOM   734  H H    . LYS A 1 77  ? 55.199  37.640  15.031 1.00 0.00  ? 77  LYS A H    1 
ATOM   735  H HZ1  . LYS A 1 77  ? 57.681  38.873  9.608  1.00 0.00  ? 77  LYS A HZ1  1 
ATOM   736  H HZ2  . LYS A 1 77  ? 59.317  39.092  9.994  1.00 0.00  ? 77  LYS A HZ2  1 
ATOM   737  H HZ3  . LYS A 1 77  ? 58.831  37.754  9.069  1.00 0.00  ? 77  LYS A HZ3  1 
ATOM   738  N N    . ILE A 1 78  ? 56.026  40.105  16.981 1.00 14.29 ? 78  ILE A N    1 
ATOM   739  C CA   . ILE A 1 78  ? 55.922  41.184  17.949 1.00 13.79 ? 78  ILE A CA   1 
ATOM   740  C C    . ILE A 1 78  ? 55.854  40.651  19.376 1.00 17.89 ? 78  ILE A C    1 
ATOM   741  O O    . ILE A 1 78  ? 56.558  41.142  20.258 1.00 24.04 ? 78  ILE A O    1 
ATOM   742  C CB   . ILE A 1 78  ? 54.698  42.068  17.660 1.00 11.80 ? 78  ILE A CB   1 
ATOM   743  C CG1  . ILE A 1 78  ? 54.983  42.956  16.441 1.00 11.84 ? 78  ILE A CG1  1 
ATOM   744  C CG2  . ILE A 1 78  ? 54.322  42.867  18.892 1.00 8.50  ? 78  ILE A CG2  1 
ATOM   745  C CD1  . ILE A 1 78  ? 53.973  44.072  16.218 1.00 9.49  ? 78  ILE A CD1  1 
ATOM   746  H H    . ILE A 1 78  ? 55.316  39.977  16.316 1.00 0.00  ? 78  ILE A H    1 
ATOM   747  N N    . LEU A 1 79  ? 55.015  39.647  19.614 1.00 19.84 ? 79  LEU A N    1 
ATOM   748  C CA   . LEU A 1 79  ? 54.913  39.099  20.960 1.00 15.59 ? 79  LEU A CA   1 
ATOM   749  C C    . LEU A 1 79  ? 56.174  38.362  21.377 1.00 16.14 ? 79  LEU A C    1 
ATOM   750  O O    . LEU A 1 79  ? 56.450  38.258  22.567 1.00 18.34 ? 79  LEU A O    1 
ATOM   751  C CB   . LEU A 1 79  ? 53.647  38.252  21.142 1.00 9.17  ? 79  LEU A CB   1 
ATOM   752  C CG   . LEU A 1 79  ? 52.389  39.102  21.407 1.00 5.45  ? 79  LEU A CG   1 
ATOM   753  C CD1  . LEU A 1 79  ? 51.163  38.280  21.280 1.00 9.69  ? 79  LEU A CD1  1 
ATOM   754  C CD2  . LEU A 1 79  ? 52.418  39.719  22.788 1.00 9.67  ? 79  LEU A CD2  1 
ATOM   755  H H    . LEU A 1 79  ? 54.464  39.272  18.898 1.00 0.00  ? 79  LEU A H    1 
ATOM   756  N N    . LYS A 1 80  ? 56.963  37.894  20.408 1.00 20.99 ? 80  LYS A N    1 
ATOM   757  C CA   . LYS A 1 80  ? 58.231  37.215  20.712 1.00 25.61 ? 80  LYS A CA   1 
ATOM   758  C C    . LYS A 1 80  ? 59.160  38.197  21.412 1.00 28.15 ? 80  LYS A C    1 
ATOM   759  O O    . LYS A 1 80  ? 60.103  37.794  22.092 1.00 33.89 ? 80  LYS A O    1 
ATOM   760  C CB   . LYS A 1 80  ? 58.936  36.746  19.440 1.00 33.34 ? 80  LYS A CB   1 
ATOM   761  C CG   . LYS A 1 80  ? 58.401  35.469  18.820 1.00 41.38 ? 80  LYS A CG   1 
ATOM   762  C CD   . LYS A 1 80  ? 58.747  34.242  19.644 1.00 46.09 ? 80  LYS A CD   1 
ATOM   763  C CE   . LYS A 1 80  ? 59.501  33.208  18.814 1.00 51.31 ? 80  LYS A CE   1 
ATOM   764  N NZ   . LYS A 1 80  ? 60.898  33.647  18.501 1.00 58.84 ? 80  LYS A NZ   1 
ATOM   765  H H    . LYS A 1 80  ? 56.688  37.993  19.472 1.00 0.00  ? 80  LYS A H    1 
ATOM   766  H HZ1  . LYS A 1 80  ? 60.923  34.564  18.008 1.00 0.00  ? 80  LYS A HZ1  1 
ATOM   767  H HZ2  . LYS A 1 80  ? 61.409  33.744  19.402 1.00 0.00  ? 80  LYS A HZ2  1 
ATOM   768  H HZ3  . LYS A 1 80  ? 61.386  32.928  17.927 1.00 0.00  ? 80  LYS A HZ3  1 
ATOM   769  N N    . CYS A 1 81  ? 58.913  39.487  21.188 1.00 31.74 ? 81  CYS A N    1 
ATOM   770  C CA   . CYS A 1 81  ? 59.701  40.565  21.777 1.00 28.01 ? 81  CYS A CA   1 
ATOM   771  C C    . CYS A 1 81  ? 59.334  40.856  23.232 1.00 26.86 ? 81  CYS A C    1 
ATOM   772  O O    . CYS A 1 81  ? 59.983  41.678  23.872 1.00 31.23 ? 81  CYS A O    1 
ATOM   773  C CB   . CYS A 1 81  ? 59.552  41.840  20.951 1.00 22.49 ? 81  CYS A CB   1 
ATOM   774  S SG   . CYS A 1 81  ? 59.869  41.615  19.191 1.00 27.06 ? 81  CYS A SG   1 
ATOM   775  H H    . CYS A 1 81  ? 58.175  39.753  20.600 1.00 0.00  ? 81  CYS A H    1 
ATOM   776  N N    . ALA A 1 82  ? 58.280  40.220  23.738 1.00 29.37 ? 82  ALA A N    1 
ATOM   777  C CA   . ALA A 1 82  ? 57.853  40.421  25.122 1.00 27.66 ? 82  ALA A CA   1 
ATOM   778  C C    . ALA A 1 82  ? 58.552  39.413  26.023 1.00 31.57 ? 82  ALA A C    1 
ATOM   779  O O    . ALA A 1 82  ? 59.002  38.360  25.567 1.00 36.61 ? 82  ALA A O    1 
ATOM   780  C CB   . ALA A 1 82  ? 56.338  40.270  25.253 1.00 14.28 ? 82  ALA A CB   1 
ATOM   781  H H    . ALA A 1 82  ? 57.795  39.556  23.207 1.00 0.00  ? 82  ALA A H    1 
ATOM   782  N N    . GLY A 1 83  ? 58.676  39.763  27.296 1.00 27.93 ? 83  GLY A N    1 
ATOM   783  C CA   . GLY A 1 83  ? 59.306  38.875  28.244 1.00 30.22 ? 83  GLY A CA   1 
ATOM   784  C C    . GLY A 1 83  ? 58.193  38.135  28.945 1.00 35.35 ? 83  GLY A C    1 
ATOM   785  O O    . GLY A 1 83  ? 57.086  38.660  29.058 1.00 41.00 ? 83  GLY A O    1 
ATOM   786  H H    . GLY A 1 83  ? 58.299  40.604  27.594 1.00 0.00  ? 83  GLY A H    1 
ATOM   787  N N    . ASN A 1 84  ? 58.479  36.942  29.452 1.00 37.93 ? 84  ASN A N    1 
ATOM   788  C CA   . ASN A 1 84  ? 57.465  36.148  30.131 1.00 39.46 ? 84  ASN A CA   1 
ATOM   789  C C    . ASN A 1 84  ? 56.907  36.757  31.398 1.00 40.96 ? 84  ASN A C    1 
ATOM   790  O O    . ASN A 1 84  ? 55.982  36.208  31.997 1.00 45.12 ? 84  ASN A O    1 
ATOM   791  C CB   . ASN A 1 84  ? 57.979  34.745  30.402 1.00 41.87 ? 84  ASN A CB   1 
ATOM   792  C CG   . ASN A 1 84  ? 57.962  33.898  29.168 1.00 47.21 ? 84  ASN A CG   1 
ATOM   793  O OD1  . ASN A 1 84  ? 56.995  33.182  28.908 1.00 53.58 ? 84  ASN A OD1  1 
ATOM   794  N ND2  . ASN A 1 84  ? 59.002  34.019  28.356 1.00 47.44 ? 84  ASN A ND2  1 
ATOM   795  H H    . ASN A 1 84  ? 59.389  36.587  29.363 1.00 0.00  ? 84  ASN A H    1 
ATOM   796  H HD21 . ASN A 1 84  ? 58.948  33.461  27.555 1.00 0.00  ? 84  ASN A HD21 1 
ATOM   797  H HD22 . ASN A 1 84  ? 59.742  34.625  28.561 1.00 0.00  ? 84  ASN A HD22 1 
ATOM   798  N N    . GLU A 1 85  ? 57.469  37.891  31.801 1.00 44.11 ? 85  GLU A N    1 
ATOM   799  C CA   . GLU A 1 85  ? 57.029  38.593  32.995 1.00 45.63 ? 85  GLU A CA   1 
ATOM   800  C C    . GLU A 1 85  ? 56.500  39.977  32.654 1.00 42.76 ? 85  GLU A C    1 
ATOM   801  O O    . GLU A 1 85  ? 56.173  40.758  33.549 1.00 50.41 ? 85  GLU A O    1 
ATOM   802  C CB   . GLU A 1 85  ? 58.184  38.734  33.984 1.00 51.25 ? 85  GLU A CB   1 
ATOM   803  C CG   . GLU A 1 85  ? 58.387  37.559  34.907 1.00 61.68 ? 85  GLU A CG   1 
ATOM   804  C CD   . GLU A 1 85  ? 58.615  38.008  36.341 1.00 70.57 ? 85  GLU A CD   1 
ATOM   805  O OE1  . GLU A 1 85  ? 59.518  38.845  36.574 1.00 70.98 ? 85  GLU A OE1  1 
ATOM   806  O OE2  . GLU A 1 85  ? 57.872  37.538  37.232 1.00 77.26 ? 85  GLU A OE2  1 
ATOM   807  H H    . GLU A 1 85  ? 58.218  38.287  31.311 1.00 0.00  ? 85  GLU A H    1 
ATOM   808  N N    . ASP A 1 86  ? 56.464  40.304  31.368 1.00 32.50 ? 86  ASP A N    1 
ATOM   809  C CA   . ASP A 1 86  ? 55.985  41.609  30.950 1.00 30.45 ? 86  ASP A CA   1 
ATOM   810  C C    . ASP A 1 86  ? 54.476  41.718  31.100 1.00 30.86 ? 86  ASP A C    1 
ATOM   811  O O    . ASP A 1 86  ? 53.762  40.713  31.029 1.00 30.00 ? 86  ASP A O    1 
ATOM   812  C CB   . ASP A 1 86  ? 56.381  41.896  29.496 1.00 30.36 ? 86  ASP A CB   1 
ATOM   813  C CG   . ASP A 1 86  ? 57.865  42.179  29.328 1.00 34.27 ? 86  ASP A CG   1 
ATOM   814  O OD1  . ASP A 1 86  ? 58.621  42.089  30.324 1.00 39.50 ? 86  ASP A OD1  1 
ATOM   815  O OD2  . ASP A 1 86  ? 58.279  42.501  28.191 1.00 27.37 ? 86  ASP A OD2  1 
ATOM   816  H H    . ASP A 1 86  ? 56.722  39.651  30.692 1.00 0.00  ? 86  ASP A H    1 
ATOM   817  N N    . ILE A 1 87  ? 54.017  42.936  31.379 1.00 28.79 ? 87  ILE A N    1 
ATOM   818  C CA   . ILE A 1 87  ? 52.596  43.249  31.506 1.00 26.20 ? 87  ILE A CA   1 
ATOM   819  C C    . ILE A 1 87  ? 52.239  43.729  30.112 1.00 28.85 ? 87  ILE A C    1 
ATOM   820  O O    . ILE A 1 87  ? 52.806  44.715  29.631 1.00 36.08 ? 87  ILE A O    1 
ATOM   821  C CB   . ILE A 1 87  ? 52.368  44.403  32.484 1.00 24.31 ? 87  ILE A CB   1 
ATOM   822  C CG1  . ILE A 1 87  ? 52.833  43.994  33.874 1.00 25.26 ? 87  ILE A CG1  1 
ATOM   823  C CG2  . ILE A 1 87  ? 50.907  44.808  32.499 1.00 18.80 ? 87  ILE A CG2  1 
ATOM   824  C CD1  . ILE A 1 87  ? 52.867  45.137  34.847 1.00 30.67 ? 87  ILE A CD1  1 
ATOM   825  H H    . ILE A 1 87  ? 54.674  43.651  31.515 1.00 0.00  ? 87  ILE A H    1 
ATOM   826  N N    . ILE A 1 88  ? 51.335  43.026  29.446 1.00 22.73 ? 88  ILE A N    1 
ATOM   827  C CA   . ILE A 1 88  ? 50.975  43.404  28.091 1.00 21.77 ? 88  ILE A CA   1 
ATOM   828  C C    . ILE A 1 88  ? 49.692  44.207  28.002 1.00 22.83 ? 88  ILE A C    1 
ATOM   829  O O    . ILE A 1 88  ? 48.674  43.845  28.591 1.00 28.15 ? 88  ILE A O    1 
ATOM   830  C CB   . ILE A 1 88  ? 50.924  42.165  27.163 1.00 20.64 ? 88  ILE A CB   1 
ATOM   831  C CG1  . ILE A 1 88  ? 52.323  41.536  27.090 1.00 20.54 ? 88  ILE A CG1  1 
ATOM   832  C CG2  . ILE A 1 88  ? 50.446  42.560  25.770 1.00 21.84 ? 88  ILE A CG2  1 
ATOM   833  C CD1  . ILE A 1 88  ? 52.436  40.300  26.248 1.00 18.52 ? 88  ILE A CD1  1 
ATOM   834  H H    . ILE A 1 88  ? 50.886  42.270  29.880 1.00 0.00  ? 88  ILE A H    1 
ATOM   835  N N    . THR A 1 89  ? 49.770  45.334  27.305 1.00 24.80 ? 89  THR A N    1 
ATOM   836  C CA   . THR A 1 89  ? 48.613  46.196  27.107 1.00 20.43 ? 89  THR A CA   1 
ATOM   837  C C    . THR A 1 89  ? 48.275  46.222  25.632 1.00 17.11 ? 89  THR A C    1 
ATOM   838  O O    . THR A 1 89  ? 49.169  46.316  24.787 1.00 12.38 ? 89  THR A O    1 
ATOM   839  C CB   . THR A 1 89  ? 48.888  47.639  27.545 1.00 18.85 ? 89  THR A CB   1 
ATOM   840  O OG1  . THR A 1 89  ? 49.304  47.655  28.916 1.00 27.28 ? 89  THR A OG1  1 
ATOM   841  C CG2  . THR A 1 89  ? 47.639  48.491  27.382 1.00 16.26 ? 89  THR A CG2  1 
ATOM   842  H H    . THR A 1 89  ? 50.629  45.606  26.921 1.00 0.00  ? 89  THR A H    1 
ATOM   843  H HG1  . THR A 1 89  ? 50.211  47.351  28.979 1.00 0.00  ? 89  THR A HG1  1 
ATOM   844  N N    . LEU A 1 90  ? 46.987  46.083  25.339 1.00 20.38 ? 90  LEU A N    1 
ATOM   845  C CA   . LEU A 1 90  ? 46.465  46.116  23.982 1.00 19.01 ? 90  LEU A CA   1 
ATOM   846  C C    . LEU A 1 90  ? 45.632  47.387  23.869 1.00 23.17 ? 90  LEU A C    1 
ATOM   847  O O    . LEU A 1 90  ? 44.817  47.674  24.749 1.00 25.79 ? 90  LEU A O    1 
ATOM   848  C CB   . LEU A 1 90  ? 45.581  44.893  23.720 1.00 11.96 ? 90  LEU A CB   1 
ATOM   849  C CG   . LEU A 1 90  ? 46.251  43.518  23.774 1.00 15.30 ? 90  LEU A CG   1 
ATOM   850  C CD1  . LEU A 1 90  ? 45.252  42.430  23.388 1.00 13.22 ? 90  LEU A CD1  1 
ATOM   851  C CD2  . LEU A 1 90  ? 47.450  43.486  22.834 1.00 11.51 ? 90  LEU A CD2  1 
ATOM   852  H H    . LEU A 1 90  ? 46.348  45.961  26.065 1.00 0.00  ? 90  LEU A H    1 
ATOM   853  N N    . ARG A 1 91  ? 45.851  48.163  22.814 1.00 26.27 ? 91  ARG A N    1 
ATOM   854  C CA   . ARG A 1 91  ? 45.099  49.402  22.618 1.00 27.79 ? 91  ARG A CA   1 
ATOM   855  C C    . ARG A 1 91  ? 44.800  49.667  21.143 1.00 30.20 ? 91  ARG A C    1 
ATOM   856  O O    . ARG A 1 91  ? 45.711  49.705  20.310 1.00 31.62 ? 91  ARG A O    1 
ATOM   857  C CB   . ARG A 1 91  ? 45.856  50.577  23.228 1.00 23.84 ? 91  ARG A CB   1 
ATOM   858  C CG   . ARG A 1 91  ? 45.112  51.894  23.154 1.00 24.45 ? 91  ARG A CG   1 
ATOM   859  C CD   . ARG A 1 91  ? 45.814  52.951  23.977 1.00 22.02 ? 91  ARG A CD   1 
ATOM   860  N NE   . ARG A 1 91  ? 47.202  53.105  23.567 1.00 23.65 ? 91  ARG A NE   1 
ATOM   861  C CZ   . ARG A 1 91  ? 48.251  52.855  24.345 1.00 25.16 ? 91  ARG A CZ   1 
ATOM   862  N NH1  . ARG A 1 91  ? 48.088  52.438  25.601 1.00 21.74 ? 91  ARG A NH1  1 
ATOM   863  N NH2  . ARG A 1 91  ? 49.469  53.008  23.853 1.00 25.07 ? 91  ARG A NH2  1 
ATOM   864  H H    . ARG A 1 91  ? 46.539  47.912  22.163 1.00 0.00  ? 91  ARG A H    1 
ATOM   865  H HE   . ARG A 1 91  ? 47.371  53.397  22.649 1.00 0.00  ? 91  ARG A HE   1 
ATOM   866  H HH11 . ARG A 1 91  ? 47.163  52.317  25.965 1.00 0.00  ? 91  ARG A HH11 1 
ATOM   867  H HH12 . ARG A 1 91  ? 48.877  52.257  26.190 1.00 0.00  ? 91  ARG A HH12 1 
ATOM   868  H HH21 . ARG A 1 91  ? 49.593  53.296  22.904 1.00 0.00  ? 91  ARG A HH21 1 
ATOM   869  H HH22 . ARG A 1 91  ? 50.259  52.818  24.435 1.00 0.00  ? 91  ARG A HH22 1 
ATOM   870  N N    . ALA A 1 92  ? 43.524  49.862  20.822 1.00 30.17 ? 92  ALA A N    1 
ATOM   871  C CA   . ALA A 1 92  ? 43.118  50.104  19.445 1.00 28.99 ? 92  ALA A CA   1 
ATOM   872  C C    . ALA A 1 92  ? 42.024  51.162  19.311 1.00 32.91 ? 92  ALA A C    1 
ATOM   873  O O    . ALA A 1 92  ? 41.128  51.267  20.154 1.00 32.86 ? 92  ALA A O    1 
ATOM   874  C CB   . ALA A 1 92  ? 42.671  48.803  18.805 1.00 27.21 ? 92  ALA A CB   1 
ATOM   875  H H    . ALA A 1 92  ? 42.843  49.857  21.525 1.00 0.00  ? 92  ALA A H    1 
ATOM   876  N N    . GLU A 1 93  ? 42.121  51.954  18.249 1.00 36.40 ? 93  GLU A N    1 
ATOM   877  C CA   . GLU A 1 93  ? 41.158  53.008  17.958 1.00 38.53 ? 93  GLU A CA   1 
ATOM   878  C C    . GLU A 1 93  ? 40.105  52.481  16.981 1.00 43.45 ? 93  GLU A C    1 
ATOM   879  O O    . GLU A 1 93  ? 40.408  51.673  16.099 1.00 46.67 ? 93  GLU A O    1 
ATOM   880  C CB   . GLU A 1 93  ? 41.873  54.214  17.348 1.00 37.48 ? 93  GLU A CB   1 
ATOM   881  C CG   . GLU A 1 93  ? 42.948  54.807  18.237 1.00 36.73 ? 93  GLU A CG   1 
ATOM   882  C CD   . GLU A 1 93  ? 42.378  55.488  19.457 1.00 39.33 ? 93  GLU A CD   1 
ATOM   883  O OE1  . GLU A 1 93  ? 41.511  56.363  19.274 1.00 39.39 ? 93  GLU A OE1  1 
ATOM   884  O OE2  . GLU A 1 93  ? 42.794  55.163  20.593 1.00 39.92 ? 93  GLU A OE2  1 
ATOM   885  H H    . GLU A 1 93  ? 42.849  51.774  17.615 1.00 0.00  ? 93  GLU A H    1 
ATOM   886  N N    . ASP A 1 94  ? 38.877  52.967  17.127 1.00 45.99 ? 94  ASP A N    1 
ATOM   887  C CA   . ASP A 1 94  ? 37.763  52.552  16.277 1.00 46.62 ? 94  ASP A CA   1 
ATOM   888  C C    . ASP A 1 94  ? 38.044  52.719  14.780 1.00 42.02 ? 94  ASP A C    1 
ATOM   889  O O    . ASP A 1 94  ? 37.773  51.824  13.984 1.00 37.76 ? 94  ASP A O    1 
ATOM   890  C CB   . ASP A 1 94  ? 36.505  53.335  16.662 1.00 54.26 ? 94  ASP A CB   1 
ATOM   891  C CG   . ASP A 1 94  ? 36.219  53.284  18.153 1.00 59.81 ? 94  ASP A CG   1 
ATOM   892  O OD1  . ASP A 1 94  ? 36.058  52.167  18.689 1.00 62.79 ? 94  ASP A OD1  1 
ATOM   893  O OD2  . ASP A 1 94  ? 36.166  54.360  18.789 1.00 63.30 ? 94  ASP A OD2  1 
ATOM   894  H H    . ASP A 1 94  ? 38.717  53.619  17.835 1.00 0.00  ? 94  ASP A H    1 
ATOM   895  N N    . ASN A 1 95  ? 38.584  53.872  14.403 1.00 41.08 ? 95  ASN A N    1 
ATOM   896  C CA   . ASN A 1 95  ? 38.893  54.150  13.000 1.00 47.00 ? 95  ASN A CA   1 
ATOM   897  C C    . ASN A 1 95  ? 40.331  53.811  12.612 1.00 46.22 ? 95  ASN A C    1 
ATOM   898  O O    . ASN A 1 95  ? 40.791  54.207  11.536 1.00 38.48 ? 95  ASN A O    1 
ATOM   899  C CB   . ASN A 1 95  ? 38.620  55.624  12.680 1.00 49.49 ? 95  ASN A CB   1 
ATOM   900  C CG   . ASN A 1 95  ? 37.152  55.909  12.444 1.00 55.51 ? 95  ASN A CG   1 
ATOM   901  O OD1  . ASN A 1 95  ? 36.552  55.379  11.510 1.00 57.04 ? 95  ASN A OD1  1 
ATOM   902  N ND2  . ASN A 1 95  ? 36.560  56.747  13.292 1.00 59.09 ? 95  ASN A ND2  1 
ATOM   903  H H    . ASN A 1 95  ? 38.757  54.531  15.101 1.00 0.00  ? 95  ASN A H    1 
ATOM   904  H HD21 . ASN A 1 95  ? 35.606  56.927  13.118 1.00 0.00  ? 95  ASN A HD21 1 
ATOM   905  H HD22 . ASN A 1 95  ? 37.041  57.157  14.035 1.00 0.00  ? 95  ASN A HD22 1 
ATOM   906  N N    . ALA A 1 96  ? 41.016  53.045  13.461 1.00 50.10 ? 96  ALA A N    1 
ATOM   907  C CA   . ALA A 1 96  ? 42.420  52.683  13.239 1.00 48.09 ? 96  ALA A CA   1 
ATOM   908  C C    . ALA A 1 96  ? 42.760  51.428  12.432 1.00 44.80 ? 96  ALA A C    1 
ATOM   909  O O    . ALA A 1 96  ? 42.143  50.368  12.562 1.00 36.62 ? 96  ALA A O    1 
ATOM   910  C CB   . ALA A 1 96  ? 43.170  52.665  14.560 1.00 52.47 ? 96  ALA A CB   1 
ATOM   911  H H    . ALA A 1 96  ? 40.569  52.648  14.238 1.00 0.00  ? 96  ALA A H    1 
ATOM   912  N N    . ASP A 1 97  ? 43.830  51.573  11.660 1.00 41.96 ? 97  ASP A N    1 
ATOM   913  C CA   . ASP A 1 97  ? 44.372  50.550  10.780 1.00 38.26 ? 97  ASP A CA   1 
ATOM   914  C C    . ASP A 1 97  ? 45.520  49.808  11.485 1.00 32.26 ? 97  ASP A C    1 
ATOM   915  O O    . ASP A 1 97  ? 46.152  48.927  10.900 1.00 30.84 ? 97  ASP A O    1 
ATOM   916  C CB   . ASP A 1 97  ? 44.876  51.271  9.514  1.00 47.53 ? 97  ASP A CB   1 
ATOM   917  C CG   . ASP A 1 97  ? 45.517  50.344  8.489  1.00 52.37 ? 97  ASP A CG   1 
ATOM   918  O OD1  . ASP A 1 97  ? 45.048  49.199  8.317  1.00 58.72 ? 97  ASP A OD1  1 
ATOM   919  O OD2  . ASP A 1 97  ? 46.483  50.790  7.828  1.00 53.97 ? 97  ASP A OD2  1 
ATOM   920  H H    . ASP A 1 97  ? 44.275  52.441  11.670 1.00 0.00  ? 97  ASP A H    1 
ATOM   921  N N    . THR A 1 98  ? 45.761  50.128  12.752 1.00 24.91 ? 98  THR A N    1 
ATOM   922  C CA   . THR A 1 98  ? 46.849  49.507  13.498 1.00 22.37 ? 98  THR A CA   1 
ATOM   923  C C    . THR A 1 98  ? 46.400  49.046  14.864 1.00 18.59 ? 98  THR A C    1 
ATOM   924  O O    . THR A 1 98  ? 45.357  49.478  15.348 1.00 19.86 ? 98  THR A O    1 
ATOM   925  C CB   . THR A 1 98  ? 48.018  50.499  13.742 1.00 26.37 ? 98  THR A CB   1 
ATOM   926  O OG1  . THR A 1 98  ? 47.534  51.641  14.465 1.00 30.88 ? 98  THR A OG1  1 
ATOM   927  C CG2  . THR A 1 98  ? 48.657  50.950  12.427 1.00 28.12 ? 98  THR A CG2  1 
ATOM   928  H H    . THR A 1 98  ? 45.187  50.751  13.240 1.00 0.00  ? 98  THR A H    1 
ATOM   929  H HG1  . THR A 1 98  ? 47.791  51.525  15.393 1.00 0.00  ? 98  THR A HG1  1 
ATOM   930  N N    . LEU A 1 99  ? 47.201  48.166  15.468 1.00 15.85 ? 99  LEU A N    1 
ATOM   931  C CA   . LEU A 1 99  ? 46.968  47.648  16.813 1.00 12.36 ? 99  LEU A CA   1 
ATOM   932  C C    . LEU A 1 99  ? 48.228  47.995  17.575 1.00 16.73 ? 99  LEU A C    1 
ATOM   933  O O    . LEU A 1 99  ? 49.340  47.858  17.045 1.00 13.23 ? 99  LEU A O    1 
ATOM   934  C CB   . LEU A 1 99  ? 46.758  46.132  16.829 1.00 6.96  ? 99  LEU A CB   1 
ATOM   935  C CG   . LEU A 1 99  ? 46.713  45.507  18.235 1.00 10.25 ? 99  LEU A CG   1 
ATOM   936  C CD1  . LEU A 1 99  ? 45.629  46.136  19.096 1.00 5.03  ? 99  LEU A CD1  1 
ATOM   937  C CD2  . LEU A 1 99  ? 46.478  44.011  18.123 1.00 11.39 ? 99  LEU A CD2  1 
ATOM   938  H H    . LEU A 1 99  ? 47.997  47.843  14.997 1.00 0.00  ? 99  LEU A H    1 
ATOM   939  N N    . ALA A 1 100 ? 48.049  48.467  18.804 1.00 19.21 ? 100 ALA A N    1 
ATOM   940  C CA   . ALA A 1 100 ? 49.168  48.877  19.639 1.00 17.59 ? 100 ALA A CA   1 
ATOM   941  C C    . ALA A 1 100 ? 49.362  47.992  20.856 1.00 18.72 ? 100 ALA A C    1 
ATOM   942  O O    . ALA A 1 100 ? 48.481  47.901  21.720 1.00 16.92 ? 100 ALA A O    1 
ATOM   943  C CB   . ALA A 1 100 ? 48.992  50.324  20.066 1.00 15.69 ? 100 ALA A CB   1 
ATOM   944  H H    . ALA A 1 100 ? 47.146  48.538  19.176 1.00 0.00  ? 100 ALA A H    1 
ATOM   945  N N    . LEU A 1 101 ? 50.529  47.355  20.913 1.00 20.81 ? 101 LEU A N    1 
ATOM   946  C CA   . LEU A 1 101 ? 50.908  46.478  22.016 1.00 18.65 ? 101 LEU A CA   1 
ATOM   947  C C    . LEU A 1 101 ? 52.016  47.179  22.814 1.00 17.11 ? 101 LEU A C    1 
ATOM   948  O O    . LEU A 1 101 ? 52.977  47.686  22.237 1.00 12.73 ? 101 LEU A O    1 
ATOM   949  C CB   . LEU A 1 101 ? 51.415  45.123  21.490 1.00 16.98 ? 101 LEU A CB   1 
ATOM   950  C CG   . LEU A 1 101 ? 50.603  44.379  20.423 1.00 12.70 ? 101 LEU A CG   1 
ATOM   951  C CD1  . LEU A 1 101 ? 50.886  44.991  19.064 1.00 11.53 ? 101 LEU A CD1  1 
ATOM   952  C CD2  . LEU A 1 101 ? 50.968  42.909  20.405 1.00 13.78 ? 101 LEU A CD2  1 
ATOM   953  H H    . LEU A 1 101 ? 51.178  47.520  20.200 1.00 0.00  ? 101 LEU A H    1 
ATOM   954  N N    . VAL A 1 102 ? 51.863  47.234  24.134 1.00 19.38 ? 102 VAL A N    1 
ATOM   955  C CA   . VAL A 1 102 ? 52.852  47.876  25.001 1.00 19.99 ? 102 VAL A CA   1 
ATOM   956  C C    . VAL A 1 102 ? 53.389  46.895  26.048 1.00 24.80 ? 102 VAL A C    1 
ATOM   957  O O    . VAL A 1 102 ? 52.631  46.370  26.873 1.00 28.84 ? 102 VAL A O    1 
ATOM   958  C CB   . VAL A 1 102 ? 52.244  49.108  25.708 1.00 17.10 ? 102 VAL A CB   1 
ATOM   959  C CG1  . VAL A 1 102 ? 53.247  49.725  26.664 1.00 15.28 ? 102 VAL A CG1  1 
ATOM   960  C CG2  . VAL A 1 102 ? 51.793  50.132  24.681 1.00 12.43 ? 102 VAL A CG2  1 
ATOM   961  H H    . VAL A 1 102 ? 51.058  46.841  24.529 1.00 0.00  ? 102 VAL A H    1 
ATOM   962  N N    . PHE A 1 103 ? 54.696  46.648  26.013 1.00 23.44 ? 103 PHE A N    1 
ATOM   963  C CA   . PHE A 1 103 ? 55.321  45.721  26.955 1.00 24.77 ? 103 PHE A CA   1 
ATOM   964  C C    . PHE A 1 103 ? 56.019  46.469  28.092 1.00 28.06 ? 103 PHE A C    1 
ATOM   965  O O    . PHE A 1 103 ? 56.902  47.300  27.849 1.00 31.46 ? 103 PHE A O    1 
ATOM   966  C CB   . PHE A 1 103 ? 56.337  44.832  26.236 1.00 14.44 ? 103 PHE A CB   1 
ATOM   967  C CG   . PHE A 1 103 ? 55.791  44.125  25.030 1.00 9.63  ? 103 PHE A CG   1 
ATOM   968  C CD1  . PHE A 1 103 ? 54.477  43.670  25.002 1.00 8.89  ? 103 PHE A CD1  1 
ATOM   969  C CD2  . PHE A 1 103 ? 56.609  43.884  23.925 1.00 8.38  ? 103 PHE A CD2  1 
ATOM   970  C CE1  . PHE A 1 103 ? 53.985  42.978  23.890 1.00 8.27  ? 103 PHE A CE1  1 
ATOM   971  C CE2  . PHE A 1 103 ? 56.130  43.194  22.808 1.00 3.60  ? 103 PHE A CE2  1 
ATOM   972  C CZ   . PHE A 1 103 ? 54.816  42.740  22.792 1.00 6.80  ? 103 PHE A CZ   1 
ATOM   973  H H    . PHE A 1 103 ? 55.243  47.118  25.355 1.00 0.00  ? 103 PHE A H    1 
ATOM   974  N N    . GLU A 1 104 ? 55.641  46.156  29.329 1.00 25.93 ? 104 GLU A N    1 
ATOM   975  C CA   . GLU A 1 104 ? 56.225  46.796  30.502 1.00 27.58 ? 104 GLU A CA   1 
ATOM   976  C C    . GLU A 1 104 ? 57.044  45.804  31.289 1.00 32.31 ? 104 GLU A C    1 
ATOM   977  O O    . GLU A 1 104 ? 56.487  44.863  31.863 1.00 33.95 ? 104 GLU A O    1 
ATOM   978  C CB   . GLU A 1 104 ? 55.135  47.357  31.408 1.00 31.12 ? 104 GLU A CB   1 
ATOM   979  C CG   . GLU A 1 104 ? 54.687  48.759  31.059 1.00 38.65 ? 104 GLU A CG   1 
ATOM   980  C CD   . GLU A 1 104 ? 53.393  49.144  31.751 1.00 46.02 ? 104 GLU A CD   1 
ATOM   981  O OE1  . GLU A 1 104 ? 53.274  48.934  32.984 1.00 47.75 ? 104 GLU A OE1  1 
ATOM   982  O OE2  . GLU A 1 104 ? 52.489  49.650  31.048 1.00 50.87 ? 104 GLU A OE2  1 
ATOM   983  H H    . GLU A 1 104 ? 54.946  45.472  29.457 1.00 0.00  ? 104 GLU A H    1 
ATOM   984  N N    . ALA A 1 105 ? 58.362  46.002  31.305 1.00 36.54 ? 105 ALA A N    1 
ATOM   985  C CA   . ALA A 1 105 ? 59.259  45.115  32.040 1.00 39.72 ? 105 ALA A CA   1 
ATOM   986  C C    . ALA A 1 105 ? 58.871  45.199  33.508 1.00 46.04 ? 105 ALA A C    1 
ATOM   987  O O    . ALA A 1 105 ? 58.695  46.293  34.048 1.00 45.99 ? 105 ALA A O    1 
ATOM   988  C CB   . ALA A 1 105 ? 60.700  45.531  31.848 1.00 35.09 ? 105 ALA A CB   1 
ATOM   989  H H    . ALA A 1 105 ? 58.723  46.792  30.851 1.00 0.00  ? 105 ALA A H    1 
ATOM   990  N N    . PRO A 1 106 ? 58.740  44.041  34.175 1.00 52.92 ? 106 PRO A N    1 
ATOM   991  C CA   . PRO A 1 106 ? 58.361  43.978  35.592 1.00 58.85 ? 106 PRO A CA   1 
ATOM   992  C C    . PRO A 1 106 ? 59.242  44.825  36.519 1.00 62.71 ? 106 PRO A C    1 
ATOM   993  O O    . PRO A 1 106 ? 60.473  44.805  36.434 1.00 64.13 ? 106 PRO A O    1 
ATOM   994  C CB   . PRO A 1 106 ? 58.452  42.479  35.902 1.00 55.91 ? 106 PRO A CB   1 
ATOM   995  C CG   . PRO A 1 106 ? 59.516  42.005  34.963 1.00 56.34 ? 106 PRO A CG   1 
ATOM   996  C CD   . PRO A 1 106 ? 59.149  42.713  33.684 1.00 54.22 ? 106 PRO A CD   1 
ATOM   997  N N    . GLU A 1 109 ? 62.660  49.551  34.190 1.00 46.79 ? 109 GLU A N    1 
ATOM   998  C CA   . GLU A 1 109 ? 62.465  50.792  33.444 1.00 43.03 ? 109 GLU A CA   1 
ATOM   999  C C    . GLU A 1 109 ? 62.678  50.578  31.943 1.00 39.72 ? 109 GLU A C    1 
ATOM   1000 O O    . GLU A 1 109 ? 63.379  51.339  31.273 1.00 38.72 ? 109 GLU A O    1 
ATOM   1001 C CB   . GLU A 1 109 ? 63.392  51.887  33.974 1.00 47.48 ? 109 GLU A CB   1 
ATOM   1002 H H    . GLU A 1 109 ? 63.444  48.988  34.012 1.00 0.00  ? 109 GLU A H    1 
ATOM   1003 N N    . LYS A 1 110 ? 62.084  49.506  31.436 1.00 34.24 ? 110 LYS A N    1 
ATOM   1004 C CA   . LYS A 1 110 ? 62.155  49.176  30.028 1.00 28.19 ? 110 LYS A CA   1 
ATOM   1005 C C    . LYS A 1 110 ? 60.713  49.016  29.600 1.00 28.88 ? 110 LYS A C    1 
ATOM   1006 O O    . LYS A 1 110 ? 59.971  48.202  30.152 1.00 32.30 ? 110 LYS A O    1 
ATOM   1007 C CB   . LYS A 1 110 ? 62.909  47.866  29.792 1.00 27.31 ? 110 LYS A CB   1 
ATOM   1008 C CG   . LYS A 1 110 ? 62.968  47.457  28.330 1.00 23.76 ? 110 LYS A CG   1 
ATOM   1009 C CD   . LYS A 1 110 ? 63.443  46.027  28.181 1.00 31.52 ? 110 LYS A CD   1 
ATOM   1010 C CE   . LYS A 1 110 ? 63.384  45.574  26.720 1.00 36.18 ? 110 LYS A CE   1 
ATOM   1011 N NZ   . LYS A 1 110 ? 63.993  44.230  26.492 1.00 34.34 ? 110 LYS A NZ   1 
ATOM   1012 H H    . LYS A 1 110 ? 61.524  48.947  32.015 1.00 0.00  ? 110 LYS A H    1 
ATOM   1013 H HZ1  . LYS A 1 110 ? 63.568  43.491  27.087 1.00 0.00  ? 110 LYS A HZ1  1 
ATOM   1014 H HZ2  . LYS A 1 110 ? 63.911  43.975  25.505 1.00 0.00  ? 110 LYS A HZ2  1 
ATOM   1015 H HZ3  . LYS A 1 110 ? 65.003  44.296  26.694 1.00 0.00  ? 110 LYS A HZ3  1 
ATOM   1016 N N    . VAL A 1 111 ? 60.289  49.857  28.676 1.00 30.85 ? 111 VAL A N    1 
ATOM   1017 C CA   . VAL A 1 111 ? 58.932  49.791  28.178 1.00 29.87 ? 111 VAL A CA   1 
ATOM   1018 C C    . VAL A 1 111 ? 59.014  49.771  26.666 1.00 30.54 ? 111 VAL A C    1 
ATOM   1019 O O    . VAL A 1 111 ? 59.592  50.680  26.056 1.00 31.92 ? 111 VAL A O    1 
ATOM   1020 C CB   . VAL A 1 111 ? 58.104  51.001  28.655 1.00 27.84 ? 111 VAL A CB   1 
ATOM   1021 C CG1  . VAL A 1 111 ? 56.735  51.017  27.989 1.00 19.25 ? 111 VAL A CG1  1 
ATOM   1022 C CG2  . VAL A 1 111 ? 57.947  50.948  30.155 1.00 30.45 ? 111 VAL A CG2  1 
ATOM   1023 H H    . VAL A 1 111 ? 60.908  50.529  28.317 1.00 0.00  ? 111 VAL A H    1 
ATOM   1024 N N    . SER A 1 112 ? 58.516  48.688  26.079 1.00 28.74 ? 112 SER A N    1 
ATOM   1025 C CA   . SER A 1 112 ? 58.499  48.528  24.633 1.00 24.13 ? 112 SER A CA   1 
ATOM   1026 C C    . SER A 1 112 ? 57.116  48.915  24.117 1.00 20.97 ? 112 SER A C    1 
ATOM   1027 O O    . SER A 1 112 ? 56.102  48.696  24.788 1.00 24.60 ? 112 SER A O    1 
ATOM   1028 C CB   . SER A 1 112 ? 58.815  47.082  24.267 1.00 22.94 ? 112 SER A CB   1 
ATOM   1029 O OG   . SER A 1 112 ? 59.967  46.644  24.958 1.00 22.13 ? 112 SER A OG   1 
ATOM   1030 H H    . SER A 1 112 ? 58.129  47.980  26.617 1.00 0.00  ? 112 SER A H    1 
ATOM   1031 H HG   . SER A 1 112 ? 60.217  45.777  24.651 1.00 0.00  ? 112 SER A HG   1 
ATOM   1032 N N    . ASP A 1 113 ? 57.079  49.498  22.931 1.00 19.71 ? 113 ASP A N    1 
ATOM   1033 C CA   . ASP A 1 113 ? 55.828  49.918  22.333 1.00 26.60 ? 113 ASP A CA   1 
ATOM   1034 C C    . ASP A 1 113 ? 55.863  49.612  20.842 1.00 23.83 ? 113 ASP A C    1 
ATOM   1035 O O    . ASP A 1 113 ? 56.686  50.149  20.093 1.00 21.18 ? 113 ASP A O    1 
ATOM   1036 C CB   . ASP A 1 113 ? 55.611  51.409  22.578 1.00 40.22 ? 113 ASP A CB   1 
ATOM   1037 C CG   . ASP A 1 113 ? 54.391  51.944  21.866 1.00 55.47 ? 113 ASP A CG   1 
ATOM   1038 O OD1  . ASP A 1 113 ? 53.282  51.857  22.440 1.00 60.82 ? 113 ASP A OD1  1 
ATOM   1039 O OD2  . ASP A 1 113 ? 54.544  52.449  20.728 1.00 63.96 ? 113 ASP A OD2  1 
ATOM   1040 H H    . ASP A 1 113 ? 57.902  49.675  22.442 1.00 0.00  ? 113 ASP A H    1 
ATOM   1041 N N    . TYR A 1 114 ? 54.992  48.699  20.437 1.00 20.23 ? 114 TYR A N    1 
ATOM   1042 C CA   . TYR A 1 114 ? 54.889  48.272  19.058 1.00 11.80 ? 114 TYR A CA   1 
ATOM   1043 C C    . TYR A 1 114 ? 53.573  48.754  18.478 1.00 17.80 ? 114 TYR A C    1 
ATOM   1044 O O    . TYR A 1 114 ? 52.622  49.059  19.207 1.00 24.50 ? 114 TYR A O    1 
ATOM   1045 C CB   . TYR A 1 114 ? 54.991  46.748  18.973 1.00 5.93  ? 114 TYR A CB   1 
ATOM   1046 C CG   . TYR A 1 114 ? 56.318  46.241  19.480 1.00 8.89  ? 114 TYR A CG   1 
ATOM   1047 C CD1  . TYR A 1 114 ? 57.422  46.159  18.634 1.00 7.20  ? 114 TYR A CD1  1 
ATOM   1048 C CD2  . TYR A 1 114 ? 56.502  45.951  20.830 1.00 9.51  ? 114 TYR A CD2  1 
ATOM   1049 C CE1  . TYR A 1 114 ? 58.681  45.822  19.123 1.00 9.40  ? 114 TYR A CE1  1 
ATOM   1050 C CE2  . TYR A 1 114 ? 57.759  45.611  21.331 1.00 10.59 ? 114 TYR A CE2  1 
ATOM   1051 C CZ   . TYR A 1 114 ? 58.842  45.553  20.476 1.00 15.26 ? 114 TYR A CZ   1 
ATOM   1052 O OH   . TYR A 1 114 ? 60.092  45.267  20.984 1.00 19.46 ? 114 TYR A OH   1 
ATOM   1053 H H    . TYR A 1 114 ? 54.364  48.332  21.087 1.00 0.00  ? 114 TYR A H    1 
ATOM   1054 H HH   . TYR A 1 114 ? 60.004  44.977  21.893 1.00 0.00  ? 114 TYR A HH   1 
ATOM   1055 N N    . GLU A 1 115 ? 53.543  48.876  17.161 1.00 15.38 ? 115 GLU A N    1 
ATOM   1056 C CA   . GLU A 1 115 ? 52.358  49.316  16.469 1.00 19.28 ? 115 GLU A CA   1 
ATOM   1057 C C    . GLU A 1 115 ? 52.227  48.422  15.252 1.00 21.46 ? 115 GLU A C    1 
ATOM   1058 O O    . GLU A 1 115 ? 52.826  48.675  14.207 1.00 32.40 ? 115 GLU A O    1 
ATOM   1059 C CB   . GLU A 1 115 ? 52.515  50.771  16.074 1.00 21.37 ? 115 GLU A CB   1 
ATOM   1060 C CG   . GLU A 1 115 ? 51.316  51.341  15.392 1.00 33.46 ? 115 GLU A CG   1 
ATOM   1061 C CD   . GLU A 1 115 ? 51.415  52.830  15.248 1.00 41.15 ? 115 GLU A CD   1 
ATOM   1062 O OE1  . GLU A 1 115 ? 52.040  53.288  14.260 1.00 41.74 ? 115 GLU A OE1  1 
ATOM   1063 O OE2  . GLU A 1 115 ? 50.879  53.534  16.136 1.00 44.15 ? 115 GLU A OE2  1 
ATOM   1064 H H    . GLU A 1 115 ? 54.364  48.696  16.654 1.00 0.00  ? 115 GLU A H    1 
ATOM   1065 N N    . MET A 1 116 ? 51.481  47.341  15.419 1.00 21.23 ? 116 MET A N    1 
ATOM   1066 C CA   . MET A 1 116 ? 51.281  46.366  14.362 1.00 23.18 ? 116 MET A CA   1 
ATOM   1067 C C    . MET A 1 116 ? 50.241  46.783  13.319 1.00 23.06 ? 116 MET A C    1 
ATOM   1068 O O    . MET A 1 116 ? 49.128  47.169  13.667 1.00 25.96 ? 116 MET A O    1 
ATOM   1069 C CB   . MET A 1 116 ? 50.888  45.025  14.991 1.00 20.07 ? 116 MET A CB   1 
ATOM   1070 C CG   . MET A 1 116 ? 50.528  43.948  13.990 1.00 20.35 ? 116 MET A CG   1 
ATOM   1071 S SD   . MET A 1 116 ? 50.093  42.425  14.803 1.00 21.99 ? 116 MET A SD   1 
ATOM   1072 C CE   . MET A 1 116 ? 48.583  42.850  15.526 1.00 22.39 ? 116 MET A CE   1 
ATOM   1073 H H    . MET A 1 116 ? 51.029  47.215  16.278 1.00 0.00  ? 116 MET A H    1 
ATOM   1074 N N    . LYS A 1 117 ? 50.607  46.711  12.045 1.00 21.68 ? 117 LYS A N    1 
ATOM   1075 C CA   . LYS A 1 117 ? 49.684  47.048  10.972 1.00 21.61 ? 117 LYS A CA   1 
ATOM   1076 C C    . LYS A 1 117 ? 48.674  45.923  10.845 1.00 20.30 ? 117 LYS A C    1 
ATOM   1077 O O    . LYS A 1 117 ? 49.053  44.749  10.856 1.00 19.82 ? 117 LYS A O    1 
ATOM   1078 C CB   . LYS A 1 117 ? 50.410  47.158  9.630  1.00 28.22 ? 117 LYS A CB   1 
ATOM   1079 C CG   . LYS A 1 117 ? 51.378  48.306  9.493  1.00 38.59 ? 117 LYS A CG   1 
ATOM   1080 C CD   . LYS A 1 117 ? 52.010  48.271  8.105  1.00 43.79 ? 117 LYS A CD   1 
ATOM   1081 C CE   . LYS A 1 117 ? 53.008  49.401  7.901  1.00 46.08 ? 117 LYS A CE   1 
ATOM   1082 N NZ   . LYS A 1 117 ? 53.646  49.327  6.554  1.00 47.31 ? 117 LYS A NZ   1 
ATOM   1083 H H    . LYS A 1 117 ? 51.511  46.432  11.817 1.00 0.00  ? 117 LYS A H    1 
ATOM   1084 H HZ1  . LYS A 1 117 ? 54.141  48.419  6.450  1.00 0.00  ? 117 LYS A HZ1  1 
ATOM   1085 H HZ2  . LYS A 1 117 ? 52.909  49.417  5.827  1.00 0.00  ? 117 LYS A HZ2  1 
ATOM   1086 H HZ3  . LYS A 1 117 ? 54.328  50.108  6.456  1.00 0.00  ? 117 LYS A HZ3  1 
ATOM   1087 N N    . LEU A 1 118 ? 47.398  46.279  10.723 1.00 23.17 ? 118 LEU A N    1 
ATOM   1088 C CA   . LEU A 1 118 ? 46.329  45.299  10.557 1.00 16.01 ? 118 LEU A CA   1 
ATOM   1089 C C    . LEU A 1 118 ? 46.196  45.014  9.062  1.00 16.74 ? 118 LEU A C    1 
ATOM   1090 O O    . LEU A 1 118 ? 47.111  45.311  8.293  1.00 14.01 ? 118 LEU A O    1 
ATOM   1091 C CB   . LEU A 1 118 ? 45.020  45.846  11.131 1.00 9.37  ? 118 LEU A CB   1 
ATOM   1092 C CG   . LEU A 1 118 ? 45.070  46.111  12.635 1.00 8.01  ? 118 LEU A CG   1 
ATOM   1093 C CD1  . LEU A 1 118 ? 43.805  46.792  13.085 1.00 9.60  ? 118 LEU A CD1  1 
ATOM   1094 C CD2  . LEU A 1 118 ? 45.277  44.811  13.382 1.00 5.12  ? 118 LEU A CD2  1 
ATOM   1095 H H    . LEU A 1 118 ? 47.157  47.231  10.729 1.00 0.00  ? 118 LEU A H    1 
ATOM   1096 N N    . MET A 1 119 ? 45.071  44.436  8.648  1.00 24.54 ? 119 MET A N    1 
ATOM   1097 C CA   . MET A 1 119 ? 44.840  44.114  7.238  1.00 20.92 ? 119 MET A CA   1 
ATOM   1098 C C    . MET A 1 119 ? 43.389  43.740  6.974  1.00 21.03 ? 119 MET A C    1 
ATOM   1099 O O    . MET A 1 119 ? 42.597  43.527  7.907  1.00 17.32 ? 119 MET A O    1 
ATOM   1100 C CB   . MET A 1 119 ? 45.735  42.947  6.799  1.00 25.45 ? 119 MET A CB   1 
ATOM   1101 C CG   . MET A 1 119 ? 45.517  41.669  7.601  1.00 25.73 ? 119 MET A CG   1 
ATOM   1102 S SD   . MET A 1 119 ? 46.395  40.240  6.976  1.00 29.31 ? 119 MET A SD   1 
ATOM   1103 C CE   . MET A 1 119 ? 48.023  40.794  7.203  1.00 38.65 ? 119 MET A CE   1 
ATOM   1104 H H    . MET A 1 119 ? 44.392  44.165  9.305  1.00 0.00  ? 119 MET A H    1 
ATOM   1105 N N    . ASP A 1 120 ? 43.044  43.678  5.694  1.00 15.37 ? 120 ASP A N    1 
ATOM   1106 C CA   . ASP A 1 120 ? 41.697  43.321  5.289  1.00 16.83 ? 120 ASP A CA   1 
ATOM   1107 C C    . ASP A 1 120 ? 41.693  41.815  5.161  1.00 16.56 ? 120 ASP A C    1 
ATOM   1108 O O    . ASP A 1 120 ? 42.661  41.238  4.663  1.00 16.94 ? 120 ASP A O    1 
ATOM   1109 C CB   . ASP A 1 120 ? 41.321  43.961  3.939  1.00 16.92 ? 120 ASP A CB   1 
ATOM   1110 C CG   . ASP A 1 120 ? 41.314  45.485  3.979  1.00 20.71 ? 120 ASP A CG   1 
ATOM   1111 O OD1  . ASP A 1 120 ? 41.046  46.072  5.050  1.00 23.85 ? 120 ASP A OD1  1 
ATOM   1112 O OD2  . ASP A 1 120 ? 41.580  46.098  2.920  1.00 27.03 ? 120 ASP A OD2  1 
ATOM   1113 H H    . ASP A 1 120 ? 43.711  43.850  5.000  1.00 0.00  ? 120 ASP A H    1 
ATOM   1114 N N    . LEU A 1 121 ? 40.593  41.189  5.576  1.00 21.82 ? 121 LEU A N    1 
ATOM   1115 C CA   . LEU A 1 121 ? 40.450  39.736  5.519  1.00 16.46 ? 121 LEU A CA   1 
ATOM   1116 C C    . LEU A 1 121 ? 39.072  39.275  5.071  1.00 21.90 ? 121 LEU A C    1 
ATOM   1117 O O    . LEU A 1 121 ? 38.062  39.623  5.684  1.00 24.59 ? 121 LEU A O    1 
ATOM   1118 C CB   . LEU A 1 121 ? 40.722  39.124  6.889  1.00 6.79  ? 121 LEU A CB   1 
ATOM   1119 C CG   . LEU A 1 121 ? 42.157  39.082  7.382  1.00 9.70  ? 121 LEU A CG   1 
ATOM   1120 C CD1  . LEU A 1 121 ? 42.139  38.616  8.812  1.00 16.53 ? 121 LEU A CD1  1 
ATOM   1121 C CD2  . LEU A 1 121 ? 42.987  38.150  6.525  1.00 11.20 ? 121 LEU A CD2  1 
ATOM   1122 H H    . LEU A 1 121 ? 39.839  41.719  5.904  1.00 0.00  ? 121 LEU A H    1 
ATOM   1123 N N    . ASP A 1 122 ? 39.037  38.475  4.011  1.00 24.10 ? 122 ASP A N    1 
ATOM   1124 C CA   . ASP A 1 122 ? 37.785  37.915  3.518  1.00 31.29 ? 122 ASP A CA   1 
ATOM   1125 C C    . ASP A 1 122 ? 37.620  36.593  4.286  1.00 31.84 ? 122 ASP A C    1 
ATOM   1126 O O    . ASP A 1 122 ? 37.972  35.510  3.800  1.00 26.94 ? 122 ASP A O    1 
ATOM   1127 C CB   . ASP A 1 122 ? 37.875  37.679  2.014  1.00 35.50 ? 122 ASP A CB   1 
ATOM   1128 C CG   . ASP A 1 122 ? 36.563  37.227  1.411  1.00 39.05 ? 122 ASP A CG   1 
ATOM   1129 O OD1  . ASP A 1 122 ? 35.499  37.415  2.047  1.00 36.45 ? 122 ASP A OD1  1 
ATOM   1130 O OD2  . ASP A 1 122 ? 36.608  36.686  0.287  1.00 42.22 ? 122 ASP A OD2  1 
ATOM   1131 H H    . ASP A 1 122 ? 39.857  38.223  3.550  1.00 0.00  ? 122 ASP A H    1 
ATOM   1132 N N    . VAL A 1 123 ? 37.154  36.730  5.525  1.00 31.17 ? 123 VAL A N    1 
ATOM   1133 C CA   . VAL A 1 123 ? 36.961  35.628  6.469  1.00 29.38 ? 123 VAL A CA   1 
ATOM   1134 C C    . VAL A 1 123 ? 35.719  34.791  6.202  1.00 25.60 ? 123 VAL A C    1 
ATOM   1135 O O    . VAL A 1 123 ? 34.779  35.238  5.559  1.00 31.69 ? 123 VAL A O    1 
ATOM   1136 C CB   . VAL A 1 123 ? 36.895  36.197  7.925  1.00 28.22 ? 123 VAL A CB   1 
ATOM   1137 C CG1  . VAL A 1 123 ? 36.675  35.109  8.948  1.00 26.79 ? 123 VAL A CG1  1 
ATOM   1138 C CG2  . VAL A 1 123 ? 38.170  36.954  8.244  1.00 29.38 ? 123 VAL A CG2  1 
ATOM   1139 H H    . VAL A 1 123 ? 36.889  37.633  5.799  1.00 0.00  ? 123 VAL A H    1 
ATOM   1140 N N    . GLU A 1 124 ? 35.738  33.563  6.700  1.00 27.67 ? 124 GLU A N    1 
ATOM   1141 C CA   . GLU A 1 124 ? 34.622  32.631  6.580  1.00 27.28 ? 124 GLU A CA   1 
ATOM   1142 C C    . GLU A 1 124 ? 34.508  31.956  7.950  1.00 23.70 ? 124 GLU A C    1 
ATOM   1143 O O    . GLU A 1 124 ? 35.435  31.260  8.373  1.00 25.42 ? 124 GLU A O    1 
ATOM   1144 C CB   . GLU A 1 124 ? 34.916  31.595  5.499  1.00 24.40 ? 124 GLU A CB   1 
ATOM   1145 C CG   . GLU A 1 124 ? 33.744  30.687  5.166  1.00 24.70 ? 124 GLU A CG   1 
ATOM   1146 C CD   . GLU A 1 124 ? 34.001  29.820  3.947  1.00 26.86 ? 124 GLU A CD   1 
ATOM   1147 O OE1  . GLU A 1 124 ? 35.144  29.785  3.435  1.00 27.70 ? 124 GLU A OE1  1 
ATOM   1148 O OE2  . GLU A 1 124 ? 33.044  29.174  3.491  1.00 32.24 ? 124 GLU A OE2  1 
ATOM   1149 H H    . GLU A 1 124 ? 36.521  33.234  7.181  1.00 0.00  ? 124 GLU A H    1 
ATOM   1150 N N    . GLN A 1 125 ? 33.421  32.234  8.671  1.00 23.66 ? 125 GLN A N    1 
ATOM   1151 C CA   . GLN A 1 125 ? 33.209  31.667  10.006 1.00 21.09 ? 125 GLN A CA   1 
ATOM   1152 C C    . GLN A 1 125 ? 32.043  30.696  9.986  1.00 17.85 ? 125 GLN A C    1 
ATOM   1153 O O    . GLN A 1 125 ? 31.130  30.834  9.167  1.00 17.82 ? 125 GLN A O    1 
ATOM   1154 C CB   . GLN A 1 125 ? 32.923  32.771  11.022 1.00 20.57 ? 125 GLN A CB   1 
ATOM   1155 C CG   . GLN A 1 125 ? 33.704  34.050  10.799 1.00 23.41 ? 125 GLN A CG   1 
ATOM   1156 C CD   . GLN A 1 125 ? 34.443  34.534  12.033 1.00 26.22 ? 125 GLN A CD   1 
ATOM   1157 O OE1  . GLN A 1 125 ? 35.522  35.111  11.930 1.00 26.78 ? 125 GLN A OE1  1 
ATOM   1158 N NE2  . GLN A 1 125 ? 33.860  34.312  13.209 1.00 28.55 ? 125 GLN A NE2  1 
ATOM   1159 H H    . GLN A 1 125 ? 32.714  32.816  8.314  1.00 0.00  ? 125 GLN A H    1 
ATOM   1160 H HE21 . GLN A 1 125 ? 34.357  34.635  13.987 1.00 0.00  ? 125 GLN A HE21 1 
ATOM   1161 H HE22 . GLN A 1 125 ? 33.001  33.850  13.237 1.00 0.00  ? 125 GLN A HE22 1 
ATOM   1162 N N    . LEU A 1 126 ? 32.070  29.716  10.882 1.00 12.88 ? 126 LEU A N    1 
ATOM   1163 C CA   . LEU A 1 126 ? 31.001  28.725  10.938 1.00 16.47 ? 126 LEU A CA   1 
ATOM   1164 C C    . LEU A 1 126 ? 30.082  28.817  12.166 1.00 17.81 ? 126 LEU A C    1 
ATOM   1165 O O    . LEU A 1 126 ? 30.485  29.276  13.239 1.00 21.71 ? 126 LEU A O    1 
ATOM   1166 C CB   . LEU A 1 126 ? 31.579  27.313  10.866 1.00 11.46 ? 126 LEU A CB   1 
ATOM   1167 C CG   . LEU A 1 126 ? 32.686  26.983  9.868  1.00 15.65 ? 126 LEU A CG   1 
ATOM   1168 C CD1  . LEU A 1 126 ? 33.022  25.516  10.043 1.00 16.10 ? 126 LEU A CD1  1 
ATOM   1169 C CD2  . LEU A 1 126 ? 32.289  27.285  8.426  1.00 4.09  ? 126 LEU A CD2  1 
ATOM   1170 H H    . LEU A 1 126 ? 32.820  29.641  11.497 1.00 0.00  ? 126 LEU A H    1 
ATOM   1171 N N    . GLY A 1 127 ? 28.850  28.353  11.995 1.00 14.78 ? 127 GLY A N    1 
ATOM   1172 C CA   . GLY A 1 127 ? 27.890  28.337  13.074 1.00 18.10 ? 127 GLY A CA   1 
ATOM   1173 C C    . GLY A 1 127 ? 27.976  26.977  13.749 1.00 18.42 ? 127 GLY A C    1 
ATOM   1174 O O    . GLY A 1 127 ? 27.561  25.955  13.177 1.00 16.79 ? 127 GLY A O    1 
ATOM   1175 H H    . GLY A 1 127 ? 28.592  27.982  11.149 1.00 0.00  ? 127 GLY A H    1 
ATOM   1176 N N    . ILE A 1 128 ? 28.560  26.968  14.946 1.00 18.75 ? 128 ILE A N    1 
ATOM   1177 C CA   . ILE A 1 128 ? 28.733  25.758  15.738 1.00 15.66 ? 128 ILE A CA   1 
ATOM   1178 C C    . ILE A 1 128 ? 27.848  25.838  16.980 1.00 22.32 ? 128 ILE A C    1 
ATOM   1179 O O    . ILE A 1 128 ? 28.151  26.566  17.927 1.00 21.88 ? 128 ILE A O    1 
ATOM   1180 C CB   . ILE A 1 128 ? 30.186  25.612  16.194 1.00 13.23 ? 128 ILE A CB   1 
ATOM   1181 C CG1  . ILE A 1 128 ? 31.137  25.826  15.018 1.00 8.13  ? 128 ILE A CG1  1 
ATOM   1182 C CG2  . ILE A 1 128 ? 30.402  24.243  16.800 1.00 18.69 ? 128 ILE A CG2  1 
ATOM   1183 C CD1  . ILE A 1 128 ? 32.579  25.840  15.419 1.00 4.39  ? 128 ILE A CD1  1 
ATOM   1184 H H    . ILE A 1 128 ? 28.891  27.817  15.306 1.00 0.00  ? 128 ILE A H    1 
ATOM   1185 N N    . PRO A 1 129 ? 26.719  25.110  16.978 1.00 29.74 ? 129 PRO A N    1 
ATOM   1186 C CA   . PRO A 1 129 ? 25.783  25.097  18.103 1.00 34.41 ? 129 PRO A CA   1 
ATOM   1187 C C    . PRO A 1 129 ? 26.292  24.236  19.259 1.00 31.85 ? 129 PRO A C    1 
ATOM   1188 O O    . PRO A 1 129 ? 27.072  23.307  19.048 1.00 34.94 ? 129 PRO A O    1 
ATOM   1189 C CB   . PRO A 1 129 ? 24.534  24.484  17.474 1.00 31.40 ? 129 PRO A CB   1 
ATOM   1190 C CG   . PRO A 1 129 ? 25.119  23.452  16.584 1.00 35.27 ? 129 PRO A CG   1 
ATOM   1191 C CD   . PRO A 1 129 ? 26.240  24.225  15.902 1.00 34.68 ? 129 PRO A CD   1 
ATOM   1192 N N    . GLU A 1 130 ? 25.853  24.555  20.474 1.00 31.80 ? 130 GLU A N    1 
ATOM   1193 C CA   . GLU A 1 130 ? 26.244  23.794  21.649 1.00 36.66 ? 130 GLU A CA   1 
ATOM   1194 C C    . GLU A 1 130 ? 25.863  22.336  21.447 1.00 41.13 ? 130 GLU A C    1 
ATOM   1195 O O    . GLU A 1 130 ? 24.768  22.036  20.967 1.00 50.54 ? 130 GLU A O    1 
ATOM   1196 C CB   . GLU A 1 130 ? 25.544  24.329  22.899 1.00 36.03 ? 130 GLU A CB   1 
ATOM   1197 C CG   . GLU A 1 130 ? 26.219  25.532  23.535 1.00 40.30 ? 130 GLU A CG   1 
ATOM   1198 C CD   . GLU A 1 130 ? 26.330  25.406  25.049 1.00 44.32 ? 130 GLU A CD   1 
ATOM   1199 O OE1  . GLU A 1 130 ? 26.498  24.270  25.550 1.00 43.15 ? 130 GLU A OE1  1 
ATOM   1200 O OE2  . GLU A 1 130 ? 26.254  26.444  25.745 1.00 49.65 ? 130 GLU A OE2  1 
ATOM   1201 H H    . GLU A 1 130 ? 25.247  25.306  20.589 1.00 0.00  ? 130 GLU A H    1 
ATOM   1202 N N    . GLN A 1 131 ? 26.781  21.433  21.766 1.00 40.95 ? 131 GLN A N    1 
ATOM   1203 C CA   . GLN A 1 131 ? 26.522  20.009  21.632 1.00 41.35 ? 131 GLN A CA   1 
ATOM   1204 C C    . GLN A 1 131 ? 26.944  19.330  22.908 1.00 41.81 ? 131 GLN A C    1 
ATOM   1205 O O    . GLN A 1 131 ? 27.640  19.915  23.733 1.00 45.30 ? 131 GLN A O    1 
ATOM   1206 C CB   . GLN A 1 131 ? 27.373  19.394  20.530 1.00 47.82 ? 131 GLN A CB   1 
ATOM   1207 C CG   . GLN A 1 131 ? 27.215  19.979  19.161 1.00 57.79 ? 131 GLN A CG   1 
ATOM   1208 C CD   . GLN A 1 131 ? 28.007  19.194  18.138 1.00 60.11 ? 131 GLN A CD   1 
ATOM   1209 O OE1  . GLN A 1 131 ? 28.196  17.984  18.283 1.00 58.74 ? 131 GLN A OE1  1 
ATOM   1210 N NE2  . GLN A 1 131 ? 28.479  19.874  17.104 1.00 61.41 ? 131 GLN A NE2  1 
ATOM   1211 H H    . GLN A 1 131 ? 27.659  21.725  22.103 1.00 0.00  ? 131 GLN A H    1 
ATOM   1212 H HE21 . GLN A 1 131 ? 28.995  19.381  16.432 1.00 0.00  ? 131 GLN A HE21 1 
ATOM   1213 H HE22 . GLN A 1 131 ? 28.312  20.833  17.053 1.00 0.00  ? 131 GLN A HE22 1 
ATOM   1214 N N    . GLU A 1 132 ? 26.512  18.087  23.060 1.00 42.61 ? 132 GLU A N    1 
ATOM   1215 C CA   . GLU A 1 132 ? 26.892  17.263  24.193 1.00 45.42 ? 132 GLU A CA   1 
ATOM   1216 C C    . GLU A 1 132 ? 27.421  16.045  23.455 1.00 40.08 ? 132 GLU A C    1 
ATOM   1217 O O    . GLU A 1 132 ? 26.719  15.454  22.637 1.00 41.72 ? 132 GLU A O    1 
ATOM   1218 C CB   . GLU A 1 132 ? 25.690  16.914  25.074 1.00 51.22 ? 132 GLU A CB   1 
ATOM   1219 C CG   . GLU A 1 132 ? 26.083  16.147  26.339 1.00 60.73 ? 132 GLU A CG   1 
ATOM   1220 C CD   . GLU A 1 132 ? 24.984  16.104  27.388 1.00 66.32 ? 132 GLU A CD   1 
ATOM   1221 O OE1  . GLU A 1 132 ? 23.809  15.868  27.026 1.00 73.23 ? 132 GLU A OE1  1 
ATOM   1222 O OE2  . GLU A 1 132 ? 25.303  16.303  28.581 1.00 66.00 ? 132 GLU A OE2  1 
ATOM   1223 H H    . GLU A 1 132 ? 25.933  17.683  22.379 1.00 0.00  ? 132 GLU A H    1 
ATOM   1224 N N    . TYR A 1 133 ? 28.685  15.722  23.677 1.00 34.97 ? 133 TYR A N    1 
ATOM   1225 C CA   . TYR A 1 133 ? 29.311  14.611  22.975 1.00 33.85 ? 133 TYR A CA   1 
ATOM   1226 C C    . TYR A 1 133 ? 29.156  13.216  23.580 1.00 32.75 ? 133 TYR A C    1 
ATOM   1227 O O    . TYR A 1 133 ? 28.956  13.056  24.789 1.00 30.27 ? 133 TYR A O    1 
ATOM   1228 C CB   . TYR A 1 133 ? 30.783  14.948  22.747 1.00 31.41 ? 133 TYR A CB   1 
ATOM   1229 C CG   . TYR A 1 133 ? 30.970  16.231  21.965 1.00 28.51 ? 133 TYR A CG   1 
ATOM   1230 C CD1  . TYR A 1 133 ? 30.750  17.470  22.555 1.00 28.35 ? 133 TYR A CD1  1 
ATOM   1231 C CD2  . TYR A 1 133 ? 31.362  16.201  20.632 1.00 30.33 ? 133 TYR A CD2  1 
ATOM   1232 C CE1  . TYR A 1 133 ? 30.921  18.651  21.833 1.00 30.25 ? 133 TYR A CE1  1 
ATOM   1233 C CE2  . TYR A 1 133 ? 31.534  17.372  19.904 1.00 32.66 ? 133 TYR A CE2  1 
ATOM   1234 C CZ   . TYR A 1 133 ? 31.315  18.593  20.509 1.00 31.68 ? 133 TYR A CZ   1 
ATOM   1235 O OH   . TYR A 1 133 ? 31.513  19.755  19.794 1.00 37.01 ? 133 TYR A OH   1 
ATOM   1236 H H    . TYR A 1 133 ? 29.205  16.249  24.318 1.00 0.00  ? 133 TYR A H    1 
ATOM   1237 H HH   . TYR A 1 133 ? 31.658  19.539  18.863 1.00 0.00  ? 133 TYR A HH   1 
ATOM   1238 N N    . SER A 1 134 ? 29.227  12.207  22.719 1.00 33.39 ? 134 SER A N    1 
ATOM   1239 C CA   . SER A 1 134 ? 29.119  10.817  23.150 1.00 37.21 ? 134 SER A CA   1 
ATOM   1240 C C    . SER A 1 134 ? 30.254  10.426  24.088 1.00 38.30 ? 134 SER A C    1 
ATOM   1241 O O    . SER A 1 134 ? 30.096  9.523   24.907 1.00 41.43 ? 134 SER A O    1 
ATOM   1242 C CB   . SER A 1 134 ? 29.115  9.872   21.945 1.00 37.76 ? 134 SER A CB   1 
ATOM   1243 O OG   . SER A 1 134 ? 27.879  9.904   21.252 1.00 40.41 ? 134 SER A OG   1 
ATOM   1244 H H    . SER A 1 134 ? 29.320  12.381  21.760 1.00 0.00  ? 134 SER A H    1 
ATOM   1245 H HG   . SER A 1 134 ? 28.027  9.314   20.514 1.00 0.00  ? 134 SER A HG   1 
ATOM   1246 N N    . CYS A 1 135 ? 31.405  11.072  23.941 1.00 36.60 ? 135 CYS A N    1 
ATOM   1247 C CA   . CYS A 1 135 ? 32.553  10.787  24.794 1.00 32.76 ? 135 CYS A CA   1 
ATOM   1248 C C    . CYS A 1 135 ? 33.352  12.045  25.039 1.00 28.23 ? 135 CYS A C    1 
ATOM   1249 O O    . CYS A 1 135 ? 33.581  12.824  24.115 1.00 25.83 ? 135 CYS A O    1 
ATOM   1250 C CB   . CYS A 1 135 ? 33.447  9.716   24.167 1.00 34.92 ? 135 CYS A CB   1 
ATOM   1251 S SG   . CYS A 1 135 ? 32.802  8.040   24.333 1.00 44.90 ? 135 CYS A SG   1 
ATOM   1252 H H    . CYS A 1 135 ? 31.510  11.737  23.232 1.00 0.00  ? 135 CYS A H    1 
ATOM   1253 N N    . VAL A 1 136 ? 33.749  12.246  26.292 1.00 21.56 ? 136 VAL A N    1 
ATOM   1254 C CA   . VAL A 1 136 ? 34.519  13.412  26.691 1.00 21.13 ? 136 VAL A CA   1 
ATOM   1255 C C    . VAL A 1 136 ? 35.666  12.969  27.591 1.00 23.94 ? 136 VAL A C    1 
ATOM   1256 O O    . VAL A 1 136 ? 35.459  12.643  28.768 1.00 27.06 ? 136 VAL A O    1 
ATOM   1257 C CB   . VAL A 1 136 ? 33.637  14.425  27.451 1.00 18.90 ? 136 VAL A CB   1 
ATOM   1258 C CG1  . VAL A 1 136 ? 34.479  15.544  28.020 1.00 25.18 ? 136 VAL A CG1  1 
ATOM   1259 C CG2  . VAL A 1 136 ? 32.578  14.993  26.531 1.00 22.19 ? 136 VAL A CG2  1 
ATOM   1260 H H    . VAL A 1 136 ? 33.508  11.592  26.975 1.00 0.00  ? 136 VAL A H    1 
ATOM   1261 N N    . VAL A 1 137 ? 36.875  12.961  27.037 1.00 21.57 ? 137 VAL A N    1 
ATOM   1262 C CA   . VAL A 1 137 ? 38.066  12.547  27.780 1.00 19.92 ? 137 VAL A CA   1 
ATOM   1263 C C    . VAL A 1 137 ? 38.834  13.737  28.312 1.00 20.12 ? 137 VAL A C    1 
ATOM   1264 O O    . VAL A 1 137 ? 39.087  14.691  27.579 1.00 24.20 ? 137 VAL A O    1 
ATOM   1265 C CB   . VAL A 1 137 ? 39.065  11.755  26.885 1.00 13.27 ? 137 VAL A CB   1 
ATOM   1266 C CG1  . VAL A 1 137 ? 40.203  11.204  27.721 1.00 3.02  ? 137 VAL A CG1  1 
ATOM   1267 C CG2  . VAL A 1 137 ? 38.357  10.642  26.144 1.00 14.83 ? 137 VAL A CG2  1 
ATOM   1268 H H    . VAL A 1 137 ? 36.972  13.265  26.109 1.00 0.00  ? 137 VAL A H    1 
ATOM   1269 N N    . LYS A 1 138 ? 39.172  13.703  29.592 1.00 18.84 ? 138 LYS A N    1 
ATOM   1270 C CA   . LYS A 1 138 ? 39.986  14.758  30.178 1.00 23.31 ? 138 LYS A CA   1 
ATOM   1271 C C    . LYS A 1 138 ? 41.296  14.049  30.527 1.00 23.68 ? 138 LYS A C    1 
ATOM   1272 O O    . LYS A 1 138 ? 41.285  13.022  31.203 1.00 24.69 ? 138 LYS A O    1 
ATOM   1273 C CB   . LYS A 1 138 ? 39.352  15.342  31.440 1.00 27.43 ? 138 LYS A CB   1 
ATOM   1274 C CG   . LYS A 1 138 ? 40.294  16.281  32.189 1.00 30.18 ? 138 LYS A CG   1 
ATOM   1275 C CD   . LYS A 1 138 ? 40.111  16.173  33.689 1.00 35.35 ? 138 LYS A CD   1 
ATOM   1276 C CE   . LYS A 1 138 ? 41.383  16.574  34.429 1.00 41.56 ? 138 LYS A CE   1 
ATOM   1277 N NZ   . LYS A 1 138 ? 41.188  16.614  35.910 1.00 46.85 ? 138 LYS A NZ   1 
ATOM   1278 H H    . LYS A 1 138 ? 38.897  12.947  30.150 1.00 0.00  ? 138 LYS A H    1 
ATOM   1279 H HZ1  . LYS A 1 138 ? 40.432  17.300  36.117 1.00 0.00  ? 138 LYS A HZ1  1 
ATOM   1280 H HZ2  . LYS A 1 138 ? 40.902  15.684  36.278 1.00 0.00  ? 138 LYS A HZ2  1 
ATOM   1281 H HZ3  . LYS A 1 138 ? 42.058  16.938  36.380 1.00 0.00  ? 138 LYS A HZ3  1 
ATOM   1282 N N    . MET A 1 139 ? 42.412  14.564  30.030 1.00 21.13 ? 139 MET A N    1 
ATOM   1283 C CA   . MET A 1 139 ? 43.704  13.949  30.297 1.00 18.85 ? 139 MET A CA   1 
ATOM   1284 C C    . MET A 1 139 ? 44.791  15.018  30.315 1.00 18.58 ? 139 MET A C    1 
ATOM   1285 O O    . MET A 1 139 ? 44.556  16.149  29.893 1.00 20.09 ? 139 MET A O    1 
ATOM   1286 C CB   . MET A 1 139 ? 44.010  12.888  29.227 1.00 15.73 ? 139 MET A CB   1 
ATOM   1287 C CG   . MET A 1 139 ? 44.210  13.436  27.813 1.00 19.66 ? 139 MET A CG   1 
ATOM   1288 S SD   . MET A 1 139 ? 44.961  12.238  26.681 1.00 12.02 ? 139 MET A SD   1 
ATOM   1289 C CE   . MET A 1 139 ? 43.560  11.359  26.245 1.00 23.37 ? 139 MET A CE   1 
ATOM   1290 H H    . MET A 1 139 ? 42.389  15.384  29.492 1.00 0.00  ? 139 MET A H    1 
ATOM   1291 N N    . PRO A 1 140 ? 45.979  14.693  30.848 1.00 20.45 ? 140 PRO A N    1 
ATOM   1292 C CA   . PRO A 1 140 ? 47.096  15.642  30.911 1.00 21.85 ? 140 PRO A CA   1 
ATOM   1293 C C    . PRO A 1 140 ? 47.554  16.041  29.509 1.00 21.49 ? 140 PRO A C    1 
ATOM   1294 O O    . PRO A 1 140 ? 47.855  15.183  28.677 1.00 18.18 ? 140 PRO A O    1 
ATOM   1295 C CB   . PRO A 1 140 ? 48.180  14.840  31.626 1.00 22.33 ? 140 PRO A CB   1 
ATOM   1296 C CG   . PRO A 1 140 ? 47.400  13.926  32.512 1.00 20.72 ? 140 PRO A CG   1 
ATOM   1297 C CD   . PRO A 1 140 ? 46.315  13.458  31.579 1.00 24.05 ? 140 PRO A CD   1 
ATOM   1298 N N    . SER A 1 141 ? 47.649  17.342  29.262 1.00 21.95 ? 141 SER A N    1 
ATOM   1299 C CA   . SER A 1 141 ? 48.055  17.842  27.957 1.00 22.18 ? 141 SER A CA   1 
ATOM   1300 C C    . SER A 1 141 ? 49.422  17.316  27.536 1.00 20.30 ? 141 SER A C    1 
ATOM   1301 O O    . SER A 1 141 ? 49.688  17.133  26.346 1.00 18.74 ? 141 SER A O    1 
ATOM   1302 C CB   . SER A 1 141 ? 48.021  19.366  27.936 1.00 22.55 ? 141 SER A CB   1 
ATOM   1303 O OG   . SER A 1 141 ? 48.766  19.907  29.007 1.00 25.64 ? 141 SER A OG   1 
ATOM   1304 H H    . SER A 1 141 ? 47.453  17.985  29.979 1.00 0.00  ? 141 SER A H    1 
ATOM   1305 H HG   . SER A 1 141 ? 48.950  20.822  28.766 1.00 0.00  ? 141 SER A HG   1 
ATOM   1306 N N    . GLY A 1 142 ? 50.282  17.052  28.510 1.00 17.52 ? 142 GLY A N    1 
ATOM   1307 C CA   . GLY A 1 142 ? 51.585  16.510  28.185 1.00 19.98 ? 142 GLY A CA   1 
ATOM   1308 C C    . GLY A 1 142 ? 51.420  15.103  27.622 1.00 20.59 ? 142 GLY A C    1 
ATOM   1309 O O    . GLY A 1 142 ? 52.056  14.730  26.635 1.00 23.35 ? 142 GLY A O    1 
ATOM   1310 H H    . GLY A 1 142 ? 50.026  17.245  29.437 1.00 0.00  ? 142 GLY A H    1 
ATOM   1311 N N    . GLU A 1 143 ? 50.517  14.339  28.227 1.00 17.83 ? 143 GLU A N    1 
ATOM   1312 C CA   . GLU A 1 143 ? 50.258  12.973  27.803 1.00 15.84 ? 143 GLU A CA   1 
ATOM   1313 C C    . GLU A 1 143 ? 49.714  12.978  26.393 1.00 16.10 ? 143 GLU A C    1 
ATOM   1314 O O    . GLU A 1 143 ? 50.142  12.191  25.552 1.00 22.30 ? 143 GLU A O    1 
ATOM   1315 C CB   . GLU A 1 143 ? 49.253  12.303  28.745 1.00 22.82 ? 143 GLU A CB   1 
ATOM   1316 C CG   . GLU A 1 143 ? 49.077  10.807  28.531 1.00 30.20 ? 143 GLU A CG   1 
ATOM   1317 C CD   . GLU A 1 143 ? 50.332  10.033  28.865 1.00 41.50 ? 143 GLU A CD   1 
ATOM   1318 O OE1  . GLU A 1 143 ? 50.497  9.678   30.055 1.00 49.07 ? 143 GLU A OE1  1 
ATOM   1319 O OE2  . GLU A 1 143 ? 51.158  9.797   27.948 1.00 40.92 ? 143 GLU A OE2  1 
ATOM   1320 H H    . GLU A 1 143 ? 49.993  14.700  28.969 1.00 0.00  ? 143 GLU A H    1 
ATOM   1321 N N    . PHE A 1 144 ? 48.792  13.896  26.127 1.00 16.72 ? 144 PHE A N    1 
ATOM   1322 C CA   . PHE A 1 144 ? 48.191  14.005  24.805 1.00 9.60  ? 144 PHE A CA   1 
ATOM   1323 C C    . PHE A 1 144 ? 49.261  14.310  23.747 1.00 7.97  ? 144 PHE A C    1 
ATOM   1324 O O    . PHE A 1 144 ? 49.340  13.621  22.732 1.00 11.34 ? 144 PHE A O    1 
ATOM   1325 C CB   . PHE A 1 144 ? 47.085  15.065  24.802 1.00 10.08 ? 144 PHE A CB   1 
ATOM   1326 C CG   . PHE A 1 144 ? 46.247  15.055  23.557 1.00 14.27 ? 144 PHE A CG   1 
ATOM   1327 C CD1  . PHE A 1 144 ? 45.608  13.887  23.145 1.00 12.52 ? 144 PHE A CD1  1 
ATOM   1328 C CD2  . PHE A 1 144 ? 46.135  16.195  22.767 1.00 17.66 ? 144 PHE A CD2  1 
ATOM   1329 C CE1  . PHE A 1 144 ? 44.874  13.851  21.966 1.00 9.82  ? 144 PHE A CE1  1 
ATOM   1330 C CE2  . PHE A 1 144 ? 45.402  16.173  21.580 1.00 19.26 ? 144 PHE A CE2  1 
ATOM   1331 C CZ   . PHE A 1 144 ? 44.770  14.996  21.178 1.00 15.71 ? 144 PHE A CZ   1 
ATOM   1332 H H    . PHE A 1 144 ? 48.503  14.496  26.847 1.00 0.00  ? 144 PHE A H    1 
ATOM   1333 N N    . ALA A 1 145 ? 50.113  15.300  24.013 1.00 8.13  ? 145 ALA A N    1 
ATOM   1334 C CA   . ALA A 1 145 ? 51.185  15.682  23.092 1.00 8.19  ? 145 ALA A CA   1 
ATOM   1335 C C    . ALA A 1 145 ? 52.201  14.569  22.824 1.00 16.56 ? 145 ALA A C    1 
ATOM   1336 O O    . ALA A 1 145 ? 52.739  14.461  21.720 1.00 19.87 ? 145 ALA A O    1 
ATOM   1337 C CB   . ALA A 1 145 ? 51.900  16.902  23.611 1.00 15.91 ? 145 ALA A CB   1 
ATOM   1338 H H    . ALA A 1 145 ? 50.011  15.795  24.853 1.00 0.00  ? 145 ALA A H    1 
ATOM   1339 N N    . ARG A 1 146 ? 52.533  13.799  23.854 1.00 18.43 ? 146 ARG A N    1 
ATOM   1340 C CA   . ARG A 1 146 ? 53.471  12.689  23.709 1.00 17.59 ? 146 ARG A CA   1 
ATOM   1341 C C    . ARG A 1 146 ? 52.849  11.625  22.807 1.00 16.98 ? 146 ARG A C    1 
ATOM   1342 O O    . ARG A 1 146 ? 53.475  11.164  21.854 1.00 21.45 ? 146 ARG A O    1 
ATOM   1343 C CB   . ARG A 1 146 ? 53.785  12.090  25.082 1.00 25.86 ? 146 ARG A CB   1 
ATOM   1344 C CG   . ARG A 1 146 ? 54.665  10.868  25.037 1.00 31.50 ? 146 ARG A CG   1 
ATOM   1345 C CD   . ARG A 1 146 ? 56.026  11.188  24.459 1.00 44.98 ? 146 ARG A CD   1 
ATOM   1346 N NE   . ARG A 1 146 ? 57.100  10.990  25.432 1.00 56.03 ? 146 ARG A NE   1 
ATOM   1347 C CZ   . ARG A 1 146 ? 58.108  10.136  25.274 1.00 59.98 ? 146 ARG A CZ   1 
ATOM   1348 N NH1  . ARG A 1 146 ? 58.190  9.385   24.180 1.00 60.61 ? 146 ARG A NH1  1 
ATOM   1349 N NH2  . ARG A 1 146 ? 59.049  10.047  26.205 1.00 62.80 ? 146 ARG A NH2  1 
ATOM   1350 H H    . ARG A 1 146 ? 52.127  13.969  24.732 1.00 0.00  ? 146 ARG A H    1 
ATOM   1351 H HE   . ARG A 1 146 ? 57.069  11.513  26.262 1.00 0.00  ? 146 ARG A HE   1 
ATOM   1352 H HH11 . ARG A 1 146 ? 57.496  9.471   23.465 1.00 0.00  ? 146 ARG A HH11 1 
ATOM   1353 H HH12 . ARG A 1 146 ? 58.953  8.752   24.060 1.00 0.00  ? 146 ARG A HH12 1 
ATOM   1354 H HH21 . ARG A 1 146 ? 58.993  10.616  27.026 1.00 0.00  ? 146 ARG A HH21 1 
ATOM   1355 H HH22 . ARG A 1 146 ? 59.806  9.404   26.088 1.00 0.00  ? 146 ARG A HH22 1 
ATOM   1356 N N    . ILE A 1 147 ? 51.611  11.244  23.106 1.00 12.45 ? 147 ILE A N    1 
ATOM   1357 C CA   . ILE A 1 147 ? 50.883  10.247  22.329 1.00 8.67  ? 147 ILE A CA   1 
ATOM   1358 C C    . ILE A 1 147 ? 50.849  10.592  20.835 1.00 17.37 ? 147 ILE A C    1 
ATOM   1359 O O    . ILE A 1 147 ? 51.304  9.805   20.006 1.00 24.05 ? 147 ILE A O    1 
ATOM   1360 C CB   . ILE A 1 147 ? 49.436  10.084  22.864 1.00 7.45  ? 147 ILE A CB   1 
ATOM   1361 C CG1  . ILE A 1 147 ? 49.468  9.430   24.248 1.00 5.11  ? 147 ILE A CG1  1 
ATOM   1362 C CG2  . ILE A 1 147 ? 48.577  9.296   21.877 1.00 3.89  ? 147 ILE A CG2  1 
ATOM   1363 C CD1  . ILE A 1 147 ? 48.118  9.075   24.813 1.00 3.31  ? 147 ILE A CD1  1 
ATOM   1364 H H    . ILE A 1 147 ? 51.167  11.629  23.893 1.00 0.00  ? 147 ILE A H    1 
ATOM   1365 N N    . CYS A 1 148 ? 50.303  11.764  20.507 1.00 17.35 ? 148 CYS A N    1 
ATOM   1366 C CA   . CYS A 1 148 ? 50.184  12.222  19.116 1.00 17.16 ? 148 CYS A CA   1 
ATOM   1367 C C    . CYS A 1 148 ? 51.506  12.199  18.368 1.00 16.10 ? 148 CYS A C    1 
ATOM   1368 O O    . CYS A 1 148 ? 51.574  11.761  17.224 1.00 28.09 ? 148 CYS A O    1 
ATOM   1369 C CB   . CYS A 1 148 ? 49.619  13.642  19.071 1.00 15.55 ? 148 CYS A CB   1 
ATOM   1370 S SG   . CYS A 1 148 ? 47.893  13.771  19.446 1.00 20.39 ? 148 CYS A SG   1 
ATOM   1371 H H    . CYS A 1 148 ? 49.939  12.340  21.203 1.00 0.00  ? 148 CYS A H    1 
ATOM   1372 N N    . ARG A 1 149 ? 52.556  12.655  19.026 1.00 17.79 ? 149 ARG A N    1 
ATOM   1373 C CA   . ARG A 1 149 ? 53.884  12.690  18.445 1.00 21.30 ? 149 ARG A CA   1 
ATOM   1374 C C    . ARG A 1 149 ? 54.438  11.285  18.191 1.00 19.40 ? 149 ARG A C    1 
ATOM   1375 O O    . ARG A 1 149 ? 54.969  10.998  17.117 1.00 21.96 ? 149 ARG A O    1 
ATOM   1376 C CB   . ARG A 1 149 ? 54.831  13.422  19.403 1.00 27.83 ? 149 ARG A CB   1 
ATOM   1377 C CG   . ARG A 1 149 ? 56.198  13.695  18.845 1.00 38.10 ? 149 ARG A CG   1 
ATOM   1378 C CD   . ARG A 1 149 ? 57.186  13.861  19.966 1.00 42.36 ? 149 ARG A CD   1 
ATOM   1379 N NE   . ARG A 1 149 ? 57.502  12.583  20.591 1.00 43.69 ? 149 ARG A NE   1 
ATOM   1380 C CZ   . ARG A 1 149 ? 58.090  12.465  21.773 1.00 45.08 ? 149 ARG A CZ   1 
ATOM   1381 N NH1  . ARG A 1 149 ? 58.420  13.549  22.462 1.00 50.98 ? 149 ARG A NH1  1 
ATOM   1382 N NH2  . ARG A 1 149 ? 58.369  11.265  22.252 1.00 46.98 ? 149 ARG A NH2  1 
ATOM   1383 H H    . ARG A 1 149 ? 52.418  13.064  19.892 1.00 0.00  ? 149 ARG A H    1 
ATOM   1384 H HE   . ARG A 1 149 ? 57.264  11.761  20.111 1.00 0.00  ? 149 ARG A HE   1 
ATOM   1385 H HH11 . ARG A 1 149 ? 58.219  14.464  22.098 1.00 0.00  ? 149 ARG A HH11 1 
ATOM   1386 H HH12 . ARG A 1 149 ? 58.846  13.453  23.357 1.00 0.00  ? 149 ARG A HH12 1 
ATOM   1387 H HH21 . ARG A 1 149 ? 58.133  10.450  21.726 1.00 0.00  ? 149 ARG A HH21 1 
ATOM   1388 H HH22 . ARG A 1 149 ? 58.797  11.180  23.148 1.00 0.00  ? 149 ARG A HH22 1 
ATOM   1389 N N    . ASP A 1 150 ? 54.221  10.390  19.147 1.00 18.36 ? 150 ASP A N    1 
ATOM   1390 C CA   . ASP A 1 150 ? 54.729  9.031   19.044 1.00 18.13 ? 150 ASP A CA   1 
ATOM   1391 C C    . ASP A 1 150 ? 54.062  8.255   17.924 1.00 16.48 ? 150 ASP A C    1 
ATOM   1392 O O    . ASP A 1 150 ? 54.727  7.687   17.059 1.00 18.28 ? 150 ASP A O    1 
ATOM   1393 C CB   . ASP A 1 150 ? 54.584  8.326   20.399 1.00 22.87 ? 150 ASP A CB   1 
ATOM   1394 C CG   . ASP A 1 150 ? 55.537  8.881   21.451 1.00 27.78 ? 150 ASP A CG   1 
ATOM   1395 O OD1  . ASP A 1 150 ? 56.279  9.843   21.164 1.00 30.40 ? 150 ASP A OD1  1 
ATOM   1396 O OD2  . ASP A 1 150 ? 55.575  8.316   22.571 1.00 31.15 ? 150 ASP A OD2  1 
ATOM   1397 H H    . ASP A 1 150 ? 53.651  10.620  19.904 1.00 0.00  ? 150 ASP A H    1 
ATOM   1398 N N    . LEU A 1 151 ? 52.742  8.300   17.884 1.00 17.25 ? 151 LEU A N    1 
ATOM   1399 C CA   . LEU A 1 151 ? 52.017  7.610   16.840 1.00 13.48 ? 151 LEU A CA   1 
ATOM   1400 C C    . LEU A 1 151 ? 52.342  8.167   15.454 1.00 11.81 ? 151 LEU A C    1 
ATOM   1401 O O    . LEU A 1 151 ? 52.199  7.478   14.452 1.00 25.95 ? 151 LEU A O    1 
ATOM   1402 C CB   . LEU A 1 151 ? 50.517  7.641   17.107 1.00 18.51 ? 151 LEU A CB   1 
ATOM   1403 C CG   . LEU A 1 151 ? 50.079  6.801   18.313 1.00 17.46 ? 151 LEU A CG   1 
ATOM   1404 C CD1  . LEU A 1 151 ? 48.614  6.988   18.556 1.00 19.90 ? 151 LEU A CD1  1 
ATOM   1405 C CD2  . LEU A 1 151 ? 50.406  5.339   18.120 1.00 17.98 ? 151 LEU A CD2  1 
ATOM   1406 H H    . LEU A 1 151 ? 52.273  8.823   18.558 1.00 0.00  ? 151 LEU A H    1 
ATOM   1407 N N    . SER A 1 152 ? 52.890  9.376   15.426 1.00 17.24 ? 152 SER A N    1 
ATOM   1408 C CA   . SER A 1 152 ? 53.283  10.014  14.169 1.00 20.97 ? 152 SER A CA   1 
ATOM   1409 C C    . SER A 1 152 ? 54.405  9.249   13.495 1.00 25.20 ? 152 SER A C    1 
ATOM   1410 O O    . SER A 1 152 ? 54.483  9.214   12.269 1.00 32.37 ? 152 SER A O    1 
ATOM   1411 C CB   . SER A 1 152 ? 53.741  11.435  14.424 1.00 19.47 ? 152 SER A CB   1 
ATOM   1412 O OG   . SER A 1 152 ? 52.644  12.272  14.703 1.00 30.91 ? 152 SER A OG   1 
ATOM   1413 H H    . SER A 1 152 ? 52.963  9.913   16.231 1.00 0.00  ? 152 SER A H    1 
ATOM   1414 H HG   . SER A 1 152 ? 52.184  12.444  13.873 1.00 0.00  ? 152 SER A HG   1 
ATOM   1415 N N    . HIS A 1 153 ? 55.276  8.629   14.287 1.00 22.78 ? 153 HIS A N    1 
ATOM   1416 C CA   . HIS A 1 153 ? 56.391  7.862   13.726 1.00 24.88 ? 153 HIS A CA   1 
ATOM   1417 C C    . HIS A 1 153 ? 55.916  6.504   13.209 1.00 18.27 ? 153 HIS A C    1 
ATOM   1418 O O    . HIS A 1 153 ? 56.701  5.724   12.675 1.00 9.05  ? 153 HIS A O    1 
ATOM   1419 C CB   . HIS A 1 153 ? 57.471  7.597   14.776 1.00 33.55 ? 153 HIS A CB   1 
ATOM   1420 C CG   . HIS A 1 153 ? 57.877  8.802   15.558 1.00 37.94 ? 153 HIS A CG   1 
ATOM   1421 N ND1  . HIS A 1 153 ? 57.778  10.084  15.061 1.00 41.06 ? 153 HIS A ND1  1 
ATOM   1422 C CD2  . HIS A 1 153 ? 58.373  8.921   16.812 1.00 37.99 ? 153 HIS A CD2  1 
ATOM   1423 C CE1  . HIS A 1 153 ? 58.192  10.942  15.977 1.00 42.95 ? 153 HIS A CE1  1 
ATOM   1424 N NE2  . HIS A 1 153 ? 58.557  10.260  17.048 1.00 42.09 ? 153 HIS A NE2  1 
ATOM   1425 H H    . HIS A 1 153 ? 55.168  8.666   15.263 1.00 0.00  ? 153 HIS A H    1 
ATOM   1426 H HD1  . HIS A 1 153 ? 57.471  10.332  14.163 1.00 0.00  ? 153 HIS A HD1  1 
ATOM   1427 H HE2  . HIS A 1 153 ? 58.875  10.647  17.882 1.00 0.00  ? 153 HIS A HE2  1 
ATOM   1428 N N    . ILE A 1 154 ? 54.642  6.206   13.431 1.00 16.69 ? 154 ILE A N    1 
ATOM   1429 C CA   . ILE A 1 154 ? 54.069  4.938   13.022 1.00 17.68 ? 154 ILE A CA   1 
ATOM   1430 C C    . ILE A 1 154 ? 53.092  5.095   11.875 1.00 18.20 ? 154 ILE A C    1 
ATOM   1431 O O    . ILE A 1 154 ? 53.079  4.262   10.965 1.00 18.32 ? 154 ILE A O    1 
ATOM   1432 C CB   . ILE A 1 154 ? 53.330  4.261   14.185 1.00 17.75 ? 154 ILE A CB   1 
ATOM   1433 C CG1  . ILE A 1 154 ? 54.188  4.306   15.455 1.00 20.93 ? 154 ILE A CG1  1 
ATOM   1434 C CG2  . ILE A 1 154 ? 52.981  2.825   13.821 1.00 24.89 ? 154 ILE A CG2  1 
ATOM   1435 C CD1  . ILE A 1 154 ? 55.460  3.520   15.378 1.00 20.54 ? 154 ILE A CD1  1 
ATOM   1436 H H    . ILE A 1 154 ? 54.062  6.852   13.876 1.00 0.00  ? 154 ILE A H    1 
ATOM   1437 N N    . GLY A 1 155 ? 52.274  6.147   11.919 1.00 19.24 ? 155 GLY A N    1 
ATOM   1438 C CA   . GLY A 1 155 ? 51.294  6.356   10.864 1.00 22.68 ? 155 GLY A CA   1 
ATOM   1439 C C    . GLY A 1 155 ? 50.852  7.782   10.639 1.00 18.18 ? 155 GLY A C    1 
ATOM   1440 O O    . GLY A 1 155 ? 51.383  8.705   11.249 1.00 23.56 ? 155 GLY A O    1 
ATOM   1441 H H    . GLY A 1 155 ? 52.291  6.789   12.654 1.00 0.00  ? 155 GLY A H    1 
ATOM   1442 N N    . ASP A 1 156 ? 49.890  7.955   9.734  1.00 21.90 ? 156 ASP A N    1 
ATOM   1443 C CA   . ASP A 1 156 ? 49.351  9.270   9.385  1.00 25.52 ? 156 ASP A CA   1 
ATOM   1444 C C    . ASP A 1 156 ? 48.066  9.625   10.115 1.00 20.96 ? 156 ASP A C    1 
ATOM   1445 O O    . ASP A 1 156 ? 47.842  10.789  10.431 1.00 28.09 ? 156 ASP A O    1 
ATOM   1446 C CB   . ASP A 1 156 ? 49.100  9.371   7.882  1.00 31.92 ? 156 ASP A CB   1 
ATOM   1447 C CG   . ASP A 1 156 ? 50.380  9.330   7.072  1.00 46.11 ? 156 ASP A CG   1 
ATOM   1448 O OD1  . ASP A 1 156 ? 51.413  9.823   7.574  1.00 52.70 ? 156 ASP A OD1  1 
ATOM   1449 O OD2  . ASP A 1 156 ? 50.354  8.809   5.930  1.00 50.34 ? 156 ASP A OD2  1 
ATOM   1450 H H    . ASP A 1 156 ? 49.544  7.155   9.287  1.00 0.00  ? 156 ASP A H    1 
ATOM   1451 N N    . ALA A 1 157 ? 47.205  8.634   10.325 1.00 15.98 ? 157 ALA A N    1 
ATOM   1452 C CA   . ALA A 1 157 ? 45.931  8.835   11.008 1.00 8.51  ? 157 ALA A CA   1 
ATOM   1453 C C    . ALA A 1 157 ? 45.924  8.102   12.323 1.00 11.29 ? 157 ALA A C    1 
ATOM   1454 O O    . ALA A 1 157 ? 46.659  7.135   12.504 1.00 21.07 ? 157 ALA A O    1 
ATOM   1455 C CB   . ALA A 1 157 ? 44.792  8.337   10.155 1.00 3.41  ? 157 ALA A CB   1 
ATOM   1456 H H    . ALA A 1 157 ? 47.432  7.730   10.031 1.00 0.00  ? 157 ALA A H    1 
ATOM   1457 N N    . VAL A 1 158 ? 45.055  8.531   13.226 1.00 15.81 ? 158 VAL A N    1 
ATOM   1458 C CA   . VAL A 1 158 ? 44.942  7.901   14.532 1.00 19.38 ? 158 VAL A CA   1 
ATOM   1459 C C    . VAL A 1 158 ? 43.486  7.506   14.755 1.00 22.26 ? 158 VAL A C    1 
ATOM   1460 O O    . VAL A 1 158 ? 42.573  8.299   14.501 1.00 29.27 ? 158 VAL A O    1 
ATOM   1461 C CB   . VAL A 1 158 ? 45.439  8.847   15.660 1.00 14.80 ? 158 VAL A CB   1 
ATOM   1462 C CG1  . VAL A 1 158 ? 44.674  10.151  15.635 1.00 15.15 ? 158 VAL A CG1  1 
ATOM   1463 C CG2  . VAL A 1 158 ? 45.323  8.180   17.012 1.00 14.23 ? 158 VAL A CG2  1 
ATOM   1464 H H    . VAL A 1 158 ? 44.466  9.280   13.026 1.00 0.00  ? 158 VAL A H    1 
ATOM   1465 N N    . VAL A 1 159 ? 43.276  6.252   15.143 1.00 20.13 ? 159 VAL A N    1 
ATOM   1466 C CA   . VAL A 1 159 ? 41.941  5.730   15.402 1.00 19.16 ? 159 VAL A CA   1 
ATOM   1467 C C    . VAL A 1 159 ? 41.660  5.780   16.892 1.00 22.39 ? 159 VAL A C    1 
ATOM   1468 O O    . VAL A 1 159 ? 42.052  4.885   17.639 1.00 28.42 ? 159 VAL A O    1 
ATOM   1469 C CB   . VAL A 1 159 ? 41.804  4.281   14.928 1.00 18.52 ? 159 VAL A CB   1 
ATOM   1470 C CG1  . VAL A 1 159 ? 40.397  3.783   15.194 1.00 24.50 ? 159 VAL A CG1  1 
ATOM   1471 C CG2  . VAL A 1 159 ? 42.141  4.175   13.461 1.00 11.16 ? 159 VAL A CG2  1 
ATOM   1472 H H    . VAL A 1 159 ? 44.043  5.657   15.253 1.00 0.00  ? 159 VAL A H    1 
ATOM   1473 N N    . ILE A 1 160 ? 40.985  6.837   17.318 1.00 22.53 ? 160 ILE A N    1 
ATOM   1474 C CA   . ILE A 1 160 ? 40.663  7.013   18.719 1.00 20.67 ? 160 ILE A CA   1 
ATOM   1475 C C    . ILE A 1 160 ? 39.381  6.259   19.057 1.00 28.18 ? 160 ILE A C    1 
ATOM   1476 O O    . ILE A 1 160 ? 38.330  6.492   18.447 1.00 26.51 ? 160 ILE A O    1 
ATOM   1477 C CB   . ILE A 1 160 ? 40.493  8.508   19.071 1.00 21.20 ? 160 ILE A CB   1 
ATOM   1478 C CG1  . ILE A 1 160 ? 41.685  9.320   18.553 1.00 18.55 ? 160 ILE A CG1  1 
ATOM   1479 C CG2  . ILE A 1 160 ? 40.383  8.673   20.580 1.00 19.59 ? 160 ILE A CG2  1 
ATOM   1480 C CD1  . ILE A 1 160 ? 41.498  10.823  18.658 1.00 21.43 ? 160 ILE A CD1  1 
ATOM   1481 H H    . ILE A 1 160 ? 40.668  7.489   16.660 1.00 0.00  ? 160 ILE A H    1 
ATOM   1482 N N    . SER A 1 161 ? 39.494  5.327   19.999 1.00 30.82 ? 161 SER A N    1 
ATOM   1483 C CA   . SER A 1 161 ? 38.370  4.521   20.464 1.00 26.34 ? 161 SER A CA   1 
ATOM   1484 C C    . SER A 1 161 ? 38.134  4.880   21.917 1.00 28.59 ? 161 SER A C    1 
ATOM   1485 O O    . SER A 1 161 ? 39.018  4.711   22.764 1.00 27.39 ? 161 SER A O    1 
ATOM   1486 C CB   . SER A 1 161 ? 38.685  3.028   20.353 1.00 24.64 ? 161 SER A CB   1 
ATOM   1487 O OG   . SER A 1 161 ? 38.965  2.659   19.011 1.00 35.49 ? 161 SER A OG   1 
ATOM   1488 H H    . SER A 1 161 ? 40.376  5.162   20.387 1.00 0.00  ? 161 SER A H    1 
ATOM   1489 H HG   . SER A 1 161 ? 39.190  1.726   18.947 1.00 0.00  ? 161 SER A HG   1 
ATOM   1490 N N    . CYS A 1 162 ? 36.942  5.384   22.205 1.00 34.78 ? 162 CYS A N    1 
ATOM   1491 C CA   . CYS A 1 162 ? 36.598  5.784   23.557 1.00 36.12 ? 162 CYS A CA   1 
ATOM   1492 C C    . CYS A 1 162 ? 35.448  4.945   24.087 1.00 38.68 ? 162 CYS A C    1 
ATOM   1493 O O    . CYS A 1 162 ? 34.434  4.768   23.409 1.00 46.87 ? 162 CYS A O    1 
ATOM   1494 C CB   . CYS A 1 162 ? 36.222  7.260   23.578 1.00 35.10 ? 162 CYS A CB   1 
ATOM   1495 S SG   . CYS A 1 162 ? 36.170  7.966   25.223 1.00 41.04 ? 162 CYS A SG   1 
ATOM   1496 H H    . CYS A 1 162 ? 36.266  5.451   21.502 1.00 0.00  ? 162 CYS A H    1 
ATOM   1497 N N    . ALA A 1 163 ? 35.647  4.380   25.272 1.00 38.61 ? 163 ALA A N    1 
ATOM   1498 C CA   . ALA A 1 163 ? 34.648  3.558   25.944 1.00 37.46 ? 163 ALA A CA   1 
ATOM   1499 C C    . ALA A 1 163 ? 34.679  3.986   27.405 1.00 40.44 ? 163 ALA A C    1 
ATOM   1500 O O    . ALA A 1 163 ? 35.462  4.858   27.783 1.00 44.49 ? 163 ALA A O    1 
ATOM   1501 C CB   . ALA A 1 163 ? 34.992  2.086   25.812 1.00 37.19 ? 163 ALA A CB   1 
ATOM   1502 H H    . ALA A 1 163 ? 36.497  4.533   25.743 1.00 0.00  ? 163 ALA A H    1 
ATOM   1503 N N    . LYS A 1 164 ? 33.867  3.361   28.243 1.00 39.09 ? 164 LYS A N    1 
ATOM   1504 C CA   . LYS A 1 164 ? 33.834  3.756   29.641 1.00 39.60 ? 164 LYS A CA   1 
ATOM   1505 C C    . LYS A 1 164 ? 35.066  3.402   30.464 1.00 37.88 ? 164 LYS A C    1 
ATOM   1506 O O    . LYS A 1 164 ? 35.427  4.141   31.374 1.00 41.65 ? 164 LYS A O    1 
ATOM   1507 C CB   . LYS A 1 164 ? 32.586  3.204   30.328 1.00 40.87 ? 164 LYS A CB   1 
ATOM   1508 C CG   . LYS A 1 164 ? 32.346  3.723   31.754 1.00 46.21 ? 164 LYS A CG   1 
ATOM   1509 C CD   . LYS A 1 164 ? 31.903  5.194   31.776 1.00 49.51 ? 164 LYS A CD   1 
ATOM   1510 C CE   . LYS A 1 164 ? 33.066  6.176   31.745 1.00 44.16 ? 164 LYS A CE   1 
ATOM   1511 N NZ   . LYS A 1 164 ? 33.749  6.278   33.061 1.00 40.28 ? 164 LYS A NZ   1 
ATOM   1512 H H    . LYS A 1 164 ? 33.295  2.638   27.917 1.00 0.00  ? 164 LYS A H    1 
ATOM   1513 H HZ1  . LYS A 1 164 ? 34.122  5.349   33.339 1.00 0.00  ? 164 LYS A HZ1  1 
ATOM   1514 H HZ2  . LYS A 1 164 ? 34.533  6.955   32.969 1.00 0.00  ? 164 LYS A HZ2  1 
ATOM   1515 H HZ3  . LYS A 1 164 ? 33.083  6.629   33.778 1.00 0.00  ? 164 LYS A HZ3  1 
ATOM   1516 N N    . ASP A 1 165 ? 35.733  2.305   30.139 1.00 38.89 ? 165 ASP A N    1 
ATOM   1517 C CA   . ASP A 1 165 ? 36.896  1.879   30.911 1.00 48.14 ? 165 ASP A CA   1 
ATOM   1518 C C    . ASP A 1 165 ? 38.171  2.703   30.722 1.00 44.71 ? 165 ASP A C    1 
ATOM   1519 O O    . ASP A 1 165 ? 38.925  2.921   31.670 1.00 42.75 ? 165 ASP A O    1 
ATOM   1520 C CB   . ASP A 1 165 ? 37.180  0.393   30.638 1.00 55.23 ? 165 ASP A CB   1 
ATOM   1521 C CG   . ASP A 1 165 ? 36.041  -0.525  31.087 1.00 64.92 ? 165 ASP A CG   1 
ATOM   1522 O OD1  . ASP A 1 165 ? 34.975  -0.009  31.522 1.00 68.84 ? 165 ASP A OD1  1 
ATOM   1523 O OD2  . ASP A 1 165 ? 36.223  -1.773  31.008 1.00 70.53 ? 165 ASP A OD2  1 
ATOM   1524 H H    . ASP A 1 165 ? 35.445  1.802   29.348 1.00 0.00  ? 165 ASP A H    1 
ATOM   1525 N N    . GLY A 1 166 ? 38.389  3.156   29.497 1.00 38.06 ? 166 GLY A N    1 
ATOM   1526 C CA   . GLY A 1 166 ? 39.563  3.938   29.183 1.00 30.26 ? 166 GLY A CA   1 
ATOM   1527 C C    . GLY A 1 166 ? 39.424  4.359   27.736 1.00 33.30 ? 166 GLY A C    1 
ATOM   1528 O O    . GLY A 1 166 ? 38.352  4.205   27.143 1.00 30.53 ? 166 GLY A O    1 
ATOM   1529 H H    . GLY A 1 166 ? 37.728  3.012   28.793 1.00 0.00  ? 166 GLY A H    1 
ATOM   1530 N N    . VAL A 1 167 ? 40.506  4.856   27.155 1.00 34.35 ? 167 VAL A N    1 
ATOM   1531 C CA   . VAL A 1 167 ? 40.502  5.292   25.764 1.00 32.29 ? 167 VAL A CA   1 
ATOM   1532 C C    . VAL A 1 167 ? 41.703  4.648   25.071 1.00 30.70 ? 167 VAL A C    1 
ATOM   1533 O O    . VAL A 1 167 ? 42.672  4.270   25.734 1.00 31.90 ? 167 VAL A O    1 
ATOM   1534 C CB   . VAL A 1 167 ? 40.580  6.828   25.689 1.00 29.60 ? 167 VAL A CB   1 
ATOM   1535 C CG1  . VAL A 1 167 ? 41.782  7.328   26.470 1.00 34.78 ? 167 VAL A CG1  1 
ATOM   1536 C CG2  . VAL A 1 167 ? 40.617  7.294   24.249 1.00 25.59 ? 167 VAL A CG2  1 
ATOM   1537 H H    . VAL A 1 167 ? 41.337  4.885   27.675 1.00 0.00  ? 167 VAL A H    1 
ATOM   1538 N N    . LYS A 1 168 ? 41.640  4.504   23.752 1.00 25.11 ? 168 LYS A N    1 
ATOM   1539 C CA   . LYS A 1 168 ? 42.740  3.888   23.016 1.00 27.29 ? 168 LYS A CA   1 
ATOM   1540 C C    . LYS A 1 168 ? 43.082  4.631   21.725 1.00 27.76 ? 168 LYS A C    1 
ATOM   1541 O O    . LYS A 1 168 ? 42.187  4.991   20.954 1.00 32.94 ? 168 LYS A O    1 
ATOM   1542 C CB   . LYS A 1 168 ? 42.403  2.427   22.711 1.00 25.61 ? 168 LYS A CB   1 
ATOM   1543 C CG   . LYS A 1 168 ? 43.498  1.662   21.990 1.00 21.90 ? 168 LYS A CG   1 
ATOM   1544 C CD   . LYS A 1 168 ? 43.250  0.167   22.070 1.00 27.53 ? 168 LYS A CD   1 
ATOM   1545 C CE   . LYS A 1 168 ? 42.090  -0.295  21.188 1.00 30.07 ? 168 LYS A CE   1 
ATOM   1546 N NZ   . LYS A 1 168 ? 42.485  -0.494  19.766 1.00 33.55 ? 168 LYS A NZ   1 
ATOM   1547 H H    . LYS A 1 168 ? 40.861  4.826   23.255 1.00 0.00  ? 168 LYS A H    1 
ATOM   1548 H HZ1  . LYS A 1 168 ? 42.856  0.396   19.374 1.00 0.00  ? 168 LYS A HZ1  1 
ATOM   1549 H HZ2  . LYS A 1 168 ? 43.217  -1.228  19.695 1.00 0.00  ? 168 LYS A HZ2  1 
ATOM   1550 H HZ3  . LYS A 1 168 ? 41.659  -0.781  19.199 1.00 0.00  ? 168 LYS A HZ3  1 
ATOM   1551 N N    . PHE A 1 169 ? 44.367  4.912   21.519 1.00 18.30 ? 169 PHE A N    1 
ATOM   1552 C CA   . PHE A 1 169 ? 44.813  5.598   20.308 1.00 14.31 ? 169 PHE A CA   1 
ATOM   1553 C C    . PHE A 1 169 ? 45.658  4.595   19.534 1.00 16.94 ? 169 PHE A C    1 
ATOM   1554 O O    . PHE A 1 169 ? 46.537  3.942   20.104 1.00 16.48 ? 169 PHE A O    1 
ATOM   1555 C CB   . PHE A 1 169 ? 45.658  6.823   20.647 1.00 13.76 ? 169 PHE A CB   1 
ATOM   1556 C CG   . PHE A 1 169 ? 45.013  7.769   21.638 1.00 19.39 ? 169 PHE A CG   1 
ATOM   1557 C CD1  . PHE A 1 169 ? 45.123  7.543   23.014 1.00 16.36 ? 169 PHE A CD1  1 
ATOM   1558 C CD2  . PHE A 1 169 ? 44.346  8.913   21.198 1.00 13.89 ? 169 PHE A CD2  1 
ATOM   1559 C CE1  . PHE A 1 169 ? 44.583  8.444   23.930 1.00 13.33 ? 169 PHE A CE1  1 
ATOM   1560 C CE2  . PHE A 1 169 ? 43.804  9.818   22.109 1.00 14.99 ? 169 PHE A CE2  1 
ATOM   1561 C CZ   . PHE A 1 169 ? 43.923  9.584   23.478 1.00 12.15 ? 169 PHE A CZ   1 
ATOM   1562 H H    . PHE A 1 169 ? 45.030  4.644   22.186 1.00 0.00  ? 169 PHE A H    1 
ATOM   1563 N N    . SER A 1 170 ? 45.410  4.479   18.236 1.00 19.63 ? 170 SER A N    1 
ATOM   1564 C CA   . SER A 1 170 ? 46.142  3.523   17.415 1.00 16.51 ? 170 SER A CA   1 
ATOM   1565 C C    . SER A 1 170 ? 46.514  4.096   16.046 1.00 17.46 ? 170 SER A C    1 
ATOM   1566 O O    . SER A 1 170 ? 45.812  4.947   15.499 1.00 17.61 ? 170 SER A O    1 
ATOM   1567 C CB   . SER A 1 170 ? 45.288  2.263   17.213 1.00 22.34 ? 170 SER A CB   1 
ATOM   1568 O OG   . SER A 1 170 ? 44.505  1.954   18.361 1.00 20.88 ? 170 SER A OG   1 
ATOM   1569 H H    . SER A 1 170 ? 44.707  5.013   17.819 1.00 0.00  ? 170 SER A H    1 
ATOM   1570 H HG   . SER A 1 170 ? 45.073  1.783   19.113 1.00 0.00  ? 170 SER A HG   1 
ATOM   1571 N N    . ALA A 1 171 ? 47.612  3.601   15.490 1.00 22.24 ? 171 ALA A N    1 
ATOM   1572 C CA   . ALA A 1 171 ? 48.094  4.027   14.178 1.00 21.35 ? 171 ALA A CA   1 
ATOM   1573 C C    . ALA A 1 171 ? 48.629  2.790   13.477 1.00 21.87 ? 171 ALA A C    1 
ATOM   1574 O O    . ALA A 1 171 ? 48.930  1.778   14.116 1.00 21.85 ? 171 ALA A O    1 
ATOM   1575 C CB   . ALA A 1 171 ? 49.201  5.057   14.320 1.00 20.80 ? 171 ALA A CB   1 
ATOM   1576 H H    . ALA A 1 171 ? 48.107  2.895   15.967 1.00 0.00  ? 171 ALA A H    1 
ATOM   1577 N N    . SER A 1 172 ? 48.741  2.868   12.163 1.00 23.17 ? 172 SER A N    1 
ATOM   1578 C CA   . SER A 1 172 ? 49.231  1.751   11.388 1.00 24.72 ? 172 SER A CA   1 
ATOM   1579 C C    . SER A 1 172 ? 50.059  2.302   10.255 1.00 29.07 ? 172 SER A C    1 
ATOM   1580 O O    . SER A 1 172 ? 49.747  3.362   9.708  1.00 31.74 ? 172 SER A O    1 
ATOM   1581 C CB   . SER A 1 172 ? 48.067  0.930   10.844 1.00 30.26 ? 172 SER A CB   1 
ATOM   1582 O OG   . SER A 1 172 ? 47.286  0.385   11.900 1.00 39.81 ? 172 SER A OG   1 
ATOM   1583 H H    . SER A 1 172 ? 48.484  3.688   11.688 1.00 0.00  ? 172 SER A H    1 
ATOM   1584 H HG   . SER A 1 172 ? 46.543  0.979   12.048 1.00 0.00  ? 172 SER A HG   1 
ATOM   1585 N N    . GLY A 1 173 ? 51.138  1.608   9.933  1.00 29.30 ? 173 GLY A N    1 
ATOM   1586 C CA   . GLY A 1 173 ? 52.002  2.062   8.869  1.00 31.53 ? 173 GLY A CA   1 
ATOM   1587 C C    . GLY A 1 173 ? 52.783  0.934   8.238  1.00 33.86 ? 173 GLY A C    1 
ATOM   1588 O O    . GLY A 1 173 ? 52.530  -0.244  8.498  1.00 36.94 ? 173 GLY A O    1 
ATOM   1589 H H    . GLY A 1 173 ? 51.343  0.782   10.408 1.00 0.00  ? 173 GLY A H    1 
ATOM   1590 N N    . GLU A 1 174 ? 53.764  1.305   7.426  1.00 32.97 ? 174 GLU A N    1 
ATOM   1591 C CA   . GLU A 1 174 ? 54.594  0.345   6.726  1.00 33.13 ? 174 GLU A CA   1 
ATOM   1592 C C    . GLU A 1 174 ? 55.726  -0.249  7.543  1.00 30.98 ? 174 GLU A C    1 
ATOM   1593 O O    . GLU A 1 174 ? 56.734  -0.683  6.991  1.00 38.08 ? 174 GLU A O    1 
ATOM   1594 C CB   . GLU A 1 174 ? 55.127  0.967   5.436  1.00 41.38 ? 174 GLU A CB   1 
ATOM   1595 C CG   . GLU A 1 174 ? 54.285  0.608   4.223  1.00 47.75 ? 174 GLU A CG   1 
ATOM   1596 C CD   . GLU A 1 174 ? 54.093  -0.892  4.104  1.00 48.09 ? 174 GLU A CD   1 
ATOM   1597 O OE1  . GLU A 1 174 ? 55.114  -1.614  4.024  1.00 50.61 ? 174 GLU A OE1  1 
ATOM   1598 O OE2  . GLU A 1 174 ? 52.928  -1.348  4.124  1.00 49.82 ? 174 GLU A OE2  1 
ATOM   1599 H H    . GLU A 1 174 ? 53.901  2.268   7.297  1.00 0.00  ? 174 GLU A H    1 
ATOM   1600 N N    . LEU A 1 175 ? 55.555  -0.275  8.857  1.00 25.05 ? 175 LEU A N    1 
ATOM   1601 C CA   . LEU A 1 175 ? 56.565  -0.830  9.753  1.00 23.63 ? 175 LEU A CA   1 
ATOM   1602 C C    . LEU A 1 175 ? 55.844  -1.636  10.810 1.00 18.93 ? 175 LEU A C    1 
ATOM   1603 O O    . LEU A 1 175 ? 56.450  -2.381  11.581 1.00 16.61 ? 175 LEU A O    1 
ATOM   1604 C CB   . LEU A 1 175 ? 57.428  0.280   10.394 1.00 26.18 ? 175 LEU A CB   1 
ATOM   1605 C CG   . LEU A 1 175 ? 56.970  1.285   11.461 1.00 25.27 ? 175 LEU A CG   1 
ATOM   1606 C CD1  . LEU A 1 175 ? 56.824  0.627   12.823 1.00 30.49 ? 175 LEU A CD1  1 
ATOM   1607 C CD2  . LEU A 1 175 ? 58.015  2.372   11.564 1.00 24.67 ? 175 LEU A CD2  1 
ATOM   1608 H H    . LEU A 1 175 ? 54.712  0.038   9.232  1.00 0.00  ? 175 LEU A H    1 
ATOM   1609 N N    . GLY A 1 176 ? 54.529  -1.506  10.800 1.00 19.51 ? 176 GLY A N    1 
ATOM   1610 C CA   . GLY A 1 176 ? 53.710  -2.201  11.758 1.00 19.57 ? 176 GLY A CA   1 
ATOM   1611 C C    . GLY A 1 176 ? 52.658  -1.234  12.240 1.00 21.63 ? 176 GLY A C    1 
ATOM   1612 O O    . GLY A 1 176 ? 52.344  -0.246  11.564 1.00 14.49 ? 176 GLY A O    1 
ATOM   1613 H H    . GLY A 1 176 ? 54.037  -0.949  10.162 1.00 0.00  ? 176 GLY A H    1 
ATOM   1614 N N    . ASN A 1 177 ? 52.151  -1.487  13.436 1.00 21.92 ? 177 ASN A N    1 
ATOM   1615 C CA   . ASN A 1 177 ? 51.115  -0.651  13.998 1.00 23.64 ? 177 ASN A CA   1 
ATOM   1616 C C    . ASN A 1 177 ? 51.407  -0.365  15.444 1.00 20.58 ? 177 ASN A C    1 
ATOM   1617 O O    . ASN A 1 177 ? 52.244  -1.028  16.054 1.00 19.11 ? 177 ASN A O    1 
ATOM   1618 C CB   . ASN A 1 177 ? 49.738  -1.315  13.842 1.00 31.09 ? 177 ASN A CB   1 
ATOM   1619 C CG   . ASN A 1 177 ? 49.713  -2.764  14.319 1.00 36.29 ? 177 ASN A CG   1 
ATOM   1620 O OD1  . ASN A 1 177 ? 49.377  -3.051  15.468 1.00 43.93 ? 177 ASN A OD1  1 
ATOM   1621 N ND2  . ASN A 1 177 ? 50.017  -3.688  13.417 1.00 39.93 ? 177 ASN A ND2  1 
ATOM   1622 H H    . ASN A 1 177 ? 52.514  -2.228  13.962 1.00 0.00  ? 177 ASN A H    1 
ATOM   1623 H HD21 . ASN A 1 177 ? 50.002  -4.614  13.736 1.00 0.00  ? 177 ASN A HD21 1 
ATOM   1624 H HD22 . ASN A 1 177 ? 50.226  -3.414  12.500 1.00 0.00  ? 177 ASN A HD22 1 
ATOM   1625 N N    . GLY A 1 178 ? 50.721  0.636   15.979 1.00 15.32 ? 178 GLY A N    1 
ATOM   1626 C CA   . GLY A 1 178 ? 50.907  1.015   17.365 1.00 21.50 ? 178 GLY A CA   1 
ATOM   1627 C C    . GLY A 1 178 ? 49.581  1.123   18.080 1.00 16.46 ? 178 GLY A C    1 
ATOM   1628 O O    . GLY A 1 178 ? 48.564  1.472   17.480 1.00 17.54 ? 178 GLY A O    1 
ATOM   1629 H H    . GLY A 1 178 ? 50.065  1.119   15.441 1.00 0.00  ? 178 GLY A H    1 
ATOM   1630 N N    . ASN A 1 179 ? 49.596  0.891   19.379 1.00 18.78 ? 179 ASN A N    1 
ATOM   1631 C CA   . ASN A 1 179 ? 48.364  0.934   20.135 1.00 28.54 ? 179 ASN A CA   1 
ATOM   1632 C C    . ASN A 1 179 ? 48.617  1.415   21.558 1.00 25.48 ? 179 ASN A C    1 
ATOM   1633 O O    . ASN A 1 179 ? 49.272  0.726   22.339 1.00 24.38 ? 179 ASN A O    1 
ATOM   1634 C CB   . ASN A 1 179 ? 47.774  -0.474  20.145 1.00 40.42 ? 179 ASN A CB   1 
ATOM   1635 C CG   . ASN A 1 179 ? 46.305  -0.487  20.440 1.00 50.17 ? 179 ASN A CG   1 
ATOM   1636 O OD1  . ASN A 1 179 ? 45.626  0.526   20.304 1.00 56.37 ? 179 ASN A OD1  1 
ATOM   1637 N ND2  . ASN A 1 179 ? 45.795  -1.644  20.837 1.00 56.08 ? 179 ASN A ND2  1 
ATOM   1638 H H    . ASN A 1 179 ? 50.436  0.658   19.827 1.00 0.00  ? 179 ASN A H    1 
ATOM   1639 H HD21 . ASN A 1 179 ? 44.835  -1.661  21.011 1.00 0.00  ? 179 ASN A HD21 1 
ATOM   1640 H HD22 . ASN A 1 179 ? 46.395  -2.411  20.922 1.00 0.00  ? 179 ASN A HD22 1 
ATOM   1641 N N    . ILE A 1 180 ? 48.122  2.604   21.883 1.00 25.30 ? 180 ILE A N    1 
ATOM   1642 C CA   . ILE A 1 180 ? 48.308  3.183   23.217 1.00 23.36 ? 180 ILE A CA   1 
ATOM   1643 C C    . ILE A 1 180 ? 46.987  3.219   23.980 1.00 21.24 ? 180 ILE A C    1 
ATOM   1644 O O    . ILE A 1 180 ? 46.062  3.962   23.627 1.00 20.01 ? 180 ILE A O    1 
ATOM   1645 C CB   . ILE A 1 180 ? 48.897  4.606   23.138 1.00 18.28 ? 180 ILE A CB   1 
ATOM   1646 C CG1  . ILE A 1 180 ? 50.175  4.596   22.301 1.00 17.65 ? 180 ILE A CG1  1 
ATOM   1647 C CG2  . ILE A 1 180 ? 49.210  5.119   24.526 1.00 17.28 ? 180 ILE A CG2  1 
ATOM   1648 C CD1  . ILE A 1 180 ? 50.696  5.966   21.988 1.00 18.34 ? 180 ILE A CD1  1 
ATOM   1649 H H    . ILE A 1 180 ? 47.613  3.099   21.228 1.00 0.00  ? 180 ILE A H    1 
ATOM   1650 N N    . LYS A 1 181 ? 46.922  2.431   25.045 1.00 21.76 ? 181 LYS A N    1 
ATOM   1651 C CA   . LYS A 1 181 ? 45.718  2.325   25.855 1.00 29.09 ? 181 LYS A CA   1 
ATOM   1652 C C    . LYS A 1 181 ? 45.797  3.028   27.215 1.00 27.86 ? 181 LYS A C    1 
ATOM   1653 O O    . LYS A 1 181 ? 46.578  2.642   28.088 1.00 33.83 ? 181 LYS A O    1 
ATOM   1654 C CB   . LYS A 1 181 ? 45.360  0.842   26.028 1.00 30.84 ? 181 LYS A CB   1 
ATOM   1655 C CG   . LYS A 1 181 ? 44.178  0.562   26.950 1.00 40.46 ? 181 LYS A CG   1 
ATOM   1656 C CD   . LYS A 1 181 ? 42.863  1.107   26.407 1.00 39.60 ? 181 LYS A CD   1 
ATOM   1657 C CE   . LYS A 1 181 ? 41.739  0.856   27.394 1.00 42.39 ? 181 LYS A CE   1 
ATOM   1658 N NZ   . LYS A 1 181 ? 40.430  1.337   26.891 1.00 43.02 ? 181 LYS A NZ   1 
ATOM   1659 H H    . LYS A 1 181 ? 47.715  1.916   25.293 1.00 0.00  ? 181 LYS A H    1 
ATOM   1660 H HZ1  . LYS A 1 181 ? 40.194  0.855   26.003 1.00 0.00  ? 181 LYS A HZ1  1 
ATOM   1661 H HZ2  . LYS A 1 181 ? 39.702  1.138   27.608 1.00 0.00  ? 181 LYS A HZ2  1 
ATOM   1662 H HZ3  . LYS A 1 181 ? 40.485  2.364   26.736 1.00 0.00  ? 181 LYS A HZ3  1 
ATOM   1663 N N    . LEU A 1 182 ? 44.983  4.065   27.382 1.00 21.86 ? 182 LEU A N    1 
ATOM   1664 C CA   . LEU A 1 182 ? 44.933  4.809   28.630 1.00 18.37 ? 182 LEU A CA   1 
ATOM   1665 C C    . LEU A 1 182 ? 43.744  4.324   29.454 1.00 22.40 ? 182 LEU A C    1 
ATOM   1666 O O    . LEU A 1 182 ? 42.673  4.062   28.911 1.00 29.86 ? 182 LEU A O    1 
ATOM   1667 C CB   . LEU A 1 182 ? 44.774  6.303   28.356 1.00 14.37 ? 182 LEU A CB   1 
ATOM   1668 C CG   . LEU A 1 182 ? 45.901  7.092   27.699 1.00 3.01  ? 182 LEU A CG   1 
ATOM   1669 C CD1  . LEU A 1 182 ? 45.499  8.545   27.631 1.00 6.08  ? 182 LEU A CD1  1 
ATOM   1670 C CD2  . LEU A 1 182 ? 47.170  6.961   28.499 1.00 14.16 ? 182 LEU A CD2  1 
ATOM   1671 H H    . LEU A 1 182 ? 44.371  4.312   26.660 1.00 0.00  ? 182 LEU A H    1 
ATOM   1672 N N    . SER A 1 183 ? 43.917  4.260   30.767 1.00 28.06 ? 183 SER A N    1 
ATOM   1673 C CA   . SER A 1 183 ? 42.864  3.813   31.676 1.00 28.58 ? 183 SER A CA   1 
ATOM   1674 C C    . SER A 1 183 ? 42.392  4.953   32.571 1.00 31.52 ? 183 SER A C    1 
ATOM   1675 O O    . SER A 1 183 ? 43.164  5.860   32.872 1.00 40.99 ? 183 SER A O    1 
ATOM   1676 C CB   . SER A 1 183 ? 43.398  2.687   32.568 1.00 23.79 ? 183 SER A CB   1 
ATOM   1677 O OG   . SER A 1 183 ? 43.808  1.570   31.800 1.00 34.36 ? 183 SER A OG   1 
ATOM   1678 H H    . SER A 1 183 ? 44.786  4.508   31.147 1.00 0.00  ? 183 SER A H    1 
ATOM   1679 H HG   . SER A 1 183 ? 44.178  0.898   32.380 1.00 0.00  ? 183 SER A HG   1 
ATOM   1680 N N    . GLN A 1 184 ? 41.125  4.930   32.977 1.00 34.04 ? 184 GLN A N    1 
ATOM   1681 C CA   . GLN A 1 184 ? 40.617  5.959   33.880 1.00 34.73 ? 184 GLN A CA   1 
ATOM   1682 C C    . GLN A 1 184 ? 41.473  5.839   35.138 1.00 41.03 ? 184 GLN A C    1 
ATOM   1683 O O    . GLN A 1 184 ? 41.760  4.725   35.580 1.00 46.64 ? 184 GLN A O    1 
ATOM   1684 C CB   . GLN A 1 184 ? 39.165  5.686   34.263 1.00 34.64 ? 184 GLN A CB   1 
ATOM   1685 C CG   . GLN A 1 184 ? 38.129  6.041   33.228 1.00 36.25 ? 184 GLN A CG   1 
ATOM   1686 C CD   . GLN A 1 184 ? 36.820  6.492   33.868 1.00 41.40 ? 184 GLN A CD   1 
ATOM   1687 O OE1  . GLN A 1 184 ? 36.458  7.666   33.794 1.00 41.37 ? 184 GLN A OE1  1 
ATOM   1688 N NE2  . GLN A 1 184 ? 36.128  5.571   34.533 1.00 39.48 ? 184 GLN A NE2  1 
ATOM   1689 H H    . GLN A 1 184 ? 40.535  4.214   32.661 1.00 0.00  ? 184 GLN A H    1 
ATOM   1690 H HE21 . GLN A 1 184 ? 35.287  5.878   34.930 1.00 0.00  ? 184 GLN A HE21 1 
ATOM   1691 H HE22 . GLN A 1 184 ? 36.479  4.663   34.587 1.00 0.00  ? 184 GLN A HE22 1 
ATOM   1692 N N    . THR A 1 185 ? 41.890  6.963   35.710 1.00 45.75 ? 185 THR A N    1 
ATOM   1693 C CA   . THR A 1 185 ? 42.722  6.930   36.915 1.00 51.81 ? 185 THR A CA   1 
ATOM   1694 C C    . THR A 1 185 ? 41.897  7.067   38.196 1.00 58.56 ? 185 THR A C    1 
ATOM   1695 O O    . THR A 1 185 ? 40.989  7.899   38.269 1.00 61.89 ? 185 THR A O    1 
ATOM   1696 C CB   . THR A 1 185 ? 43.772  8.047   36.899 1.00 50.37 ? 185 THR A CB   1 
ATOM   1697 O OG1  . THR A 1 185 ? 43.112  9.317   36.902 1.00 50.56 ? 185 THR A OG1  1 
ATOM   1698 C CG2  . THR A 1 185 ? 44.648  7.940   35.662 1.00 51.10 ? 185 THR A CG2  1 
ATOM   1699 H H    . THR A 1 185 ? 41.611  7.819   35.328 1.00 0.00  ? 185 THR A H    1 
ATOM   1700 H HG1  . THR A 1 185 ? 42.519  9.370   37.663 1.00 0.00  ? 185 THR A HG1  1 
ATOM   1701 N N    . SER A 1 186 ? 42.256  6.296   39.221 1.00 64.27 ? 186 SER A N    1 
ATOM   1702 C CA   . SER A 1 186 ? 41.550  6.326   40.501 1.00 64.42 ? 186 SER A CA   1 
ATOM   1703 C C    . SER A 1 186 ? 42.047  7.441   41.429 1.00 68.10 ? 186 SER A C    1 
ATOM   1704 O O    . SER A 1 186 ? 43.203  7.440   41.860 1.00 73.64 ? 186 SER A O    1 
ATOM   1705 C CB   . SER A 1 186 ? 41.666  4.965   41.189 1.00 61.17 ? 186 SER A CB   1 
ATOM   1706 O OG   . SER A 1 186 ? 43.008  4.510   41.185 1.00 61.13 ? 186 SER A OG   1 
ATOM   1707 H H    . SER A 1 186 ? 43.028  5.697   39.162 1.00 0.00  ? 186 SER A H    1 
ATOM   1708 H HG   . SER A 1 186 ? 43.542  5.105   41.734 1.00 0.00  ? 186 SER A HG   1 
ATOM   1709 N N    . GLU A 1 191 ? 45.482  15.589  40.425 1.00 66.86 ? 191 GLU A N    1 
ATOM   1710 C CA   . GLU A 1 191 ? 44.358  16.244  39.759 1.00 63.64 ? 191 GLU A CA   1 
ATOM   1711 C C    . GLU A 1 191 ? 44.691  16.494  38.294 1.00 63.81 ? 191 GLU A C    1 
ATOM   1712 O O    . GLU A 1 191 ? 43.861  16.290  37.409 1.00 63.64 ? 191 GLU A O    1 
ATOM   1713 C CB   . GLU A 1 191 ? 44.026  17.557  40.453 1.00 61.97 ? 191 GLU A CB   1 
ATOM   1714 H H    . GLU A 1 191 ? 46.253  16.088  40.766 1.00 0.00  ? 191 GLU A H    1 
ATOM   1715 N N    . GLU A 1 192 ? 45.929  16.899  38.045 1.00 61.65 ? 192 GLU A N    1 
ATOM   1716 C CA   . GLU A 1 192 ? 46.383  17.180  36.691 1.00 61.70 ? 192 GLU A CA   1 
ATOM   1717 C C    . GLU A 1 192 ? 47.025  15.946  36.064 1.00 59.71 ? 192 GLU A C    1 
ATOM   1718 O O    . GLU A 1 192 ? 47.456  15.979  34.910 1.00 57.34 ? 192 GLU A O    1 
ATOM   1719 C CB   . GLU A 1 192 ? 47.388  18.333  36.702 1.00 64.83 ? 192 GLU A CB   1 
ATOM   1720 C CG   . GLU A 1 192 ? 46.901  19.599  37.411 1.00 72.46 ? 192 GLU A CG   1 
ATOM   1721 C CD   . GLU A 1 192 ? 46.833  19.457  38.932 1.00 74.61 ? 192 GLU A CD   1 
ATOM   1722 O OE1  . GLU A 1 192 ? 47.733  18.811  39.516 1.00 76.03 ? 192 GLU A OE1  1 
ATOM   1723 O OE2  . GLU A 1 192 ? 45.882  19.995  39.541 1.00 73.85 ? 192 GLU A OE2  1 
ATOM   1724 H H    . GLU A 1 192 ? 46.552  17.006  38.791 1.00 0.00  ? 192 GLU A H    1 
ATOM   1725 N N    . GLU A 1 193 ? 47.089  14.863  36.833 1.00 55.62 ? 193 GLU A N    1 
ATOM   1726 C CA   . GLU A 1 193 ? 47.690  13.618  36.368 1.00 54.19 ? 193 GLU A CA   1 
ATOM   1727 C C    . GLU A 1 193 ? 46.629  12.533  36.195 1.00 49.13 ? 193 GLU A C    1 
ATOM   1728 O O    . GLU A 1 193 ? 46.943  11.344  36.147 1.00 48.26 ? 193 GLU A O    1 
ATOM   1729 C CB   . GLU A 1 193 ? 48.750  13.156  37.372 1.00 60.73 ? 193 GLU A CB   1 
ATOM   1730 C CG   . GLU A 1 193 ? 49.787  14.231  37.724 1.00 70.51 ? 193 GLU A CG   1 
ATOM   1731 C CD   . GLU A 1 193 ? 50.814  13.763  38.754 1.00 75.59 ? 193 GLU A CD   1 
ATOM   1732 O OE1  . GLU A 1 193 ? 50.411  13.203  39.800 1.00 77.49 ? 193 GLU A OE1  1 
ATOM   1733 O OE2  . GLU A 1 193 ? 52.027  13.966  38.518 1.00 77.65 ? 193 GLU A OE2  1 
ATOM   1734 H H    . GLU A 1 193 ? 46.714  14.883  37.735 1.00 0.00  ? 193 GLU A H    1 
ATOM   1735 N N    . ALA A 1 194 ? 45.377  12.956  36.063 1.00 43.43 ? 194 ALA A N    1 
ATOM   1736 C CA   . ALA A 1 194 ? 44.268  12.026  35.930 1.00 35.90 ? 194 ALA A CA   1 
ATOM   1737 C C    . ALA A 1 194 ? 43.672  11.943  34.537 1.00 31.29 ? 194 ALA A C    1 
ATOM   1738 O O    . ALA A 1 194 ? 43.773  12.881  33.746 1.00 35.97 ? 194 ALA A O    1 
ATOM   1739 C CB   . ALA A 1 194 ? 43.178  12.381  36.939 1.00 33.12 ? 194 ALA A CB   1 
ATOM   1740 H H    . ALA A 1 194 ? 45.168  13.911  36.040 1.00 0.00  ? 194 ALA A H    1 
ATOM   1741 N N    . VAL A 1 195 ? 43.053  10.800  34.256 1.00 25.50 ? 195 VAL A N    1 
ATOM   1742 C CA   . VAL A 1 195 ? 42.383  10.541  32.988 1.00 20.92 ? 195 VAL A CA   1 
ATOM   1743 C C    . VAL A 1 195 ? 40.959  10.117  33.350 1.00 20.36 ? 195 VAL A C    1 
ATOM   1744 O O    . VAL A 1 195 ? 40.750  9.071   33.964 1.00 16.32 ? 195 VAL A O    1 
ATOM   1745 C CB   . VAL A 1 195 ? 43.056  9.402   32.183 1.00 18.37 ? 195 VAL A CB   1 
ATOM   1746 C CG1  . VAL A 1 195 ? 42.268  9.132   30.912 1.00 18.88 ? 195 VAL A CG1  1 
ATOM   1747 C CG2  . VAL A 1 195 ? 44.484  9.762   31.836 1.00 11.45 ? 195 VAL A CG2  1 
ATOM   1748 H H    . VAL A 1 195 ? 43.037  10.096  34.940 1.00 0.00  ? 195 VAL A H    1 
ATOM   1749 N N    . THR A 1 196 ? 39.995  10.968  33.026 1.00 24.95 ? 196 THR A N    1 
ATOM   1750 C CA   . THR A 1 196 ? 38.599  10.699  33.324 1.00 30.96 ? 196 THR A CA   1 
ATOM   1751 C C    . THR A 1 196 ? 37.788  10.695  32.038 1.00 31.58 ? 196 THR A C    1 
ATOM   1752 O O    . THR A 1 196 ? 38.096  11.443  31.102 1.00 33.06 ? 196 THR A O    1 
ATOM   1753 C CB   . THR A 1 196 ? 38.034  11.715  34.357 1.00 31.41 ? 196 THR A CB   1 
ATOM   1754 O OG1  . THR A 1 196 ? 38.341  13.054  33.950 1.00 30.69 ? 196 THR A OG1  1 
ATOM   1755 C CG2  . THR A 1 196 ? 38.649  11.471  35.737 1.00 30.45 ? 196 THR A CG2  1 
ATOM   1756 H H    . THR A 1 196 ? 40.226  11.809  32.575 1.00 0.00  ? 196 THR A H    1 
ATOM   1757 H HG1  . THR A 1 196 ? 37.975  13.236  33.082 1.00 0.00  ? 196 THR A HG1  1 
ATOM   1758 N N    . ILE A 1 197 ? 36.752  9.859   32.002 1.00 33.00 ? 197 ILE A N    1 
ATOM   1759 C CA   . ILE A 1 197 ? 35.913  9.696   30.820 1.00 29.05 ? 197 ILE A CA   1 
ATOM   1760 C C    . ILE A 1 197 ? 34.412  9.826   31.057 1.00 33.16 ? 197 ILE A C    1 
ATOM   1761 O O    . ILE A 1 197 ? 33.809  8.999   31.728 1.00 38.26 ? 197 ILE A O    1 
ATOM   1762 C CB   . ILE A 1 197 ? 36.166  8.317   30.201 1.00 26.71 ? 197 ILE A CB   1 
ATOM   1763 C CG1  . ILE A 1 197 ? 37.659  8.159   29.913 1.00 28.50 ? 197 ILE A CG1  1 
ATOM   1764 C CG2  . ILE A 1 197 ? 35.326  8.124   28.950 1.00 27.97 ? 197 ILE A CG2  1 
ATOM   1765 C CD1  . ILE A 1 197 ? 38.042  6.824   29.379 1.00 31.30 ? 197 ILE A CD1  1 
ATOM   1766 H H    . ILE A 1 197 ? 36.510  9.315   32.789 1.00 0.00  ? 197 ILE A H    1 
ATOM   1767 N N    . GLU A 1 198 ? 33.804  10.858  30.487 1.00 38.88 ? 198 GLU A N    1 
ATOM   1768 C CA   . GLU A 1 198 ? 32.366  11.048  30.614 1.00 40.42 ? 198 GLU A CA   1 
ATOM   1769 C C    . GLU A 1 198 ? 31.767  10.536  29.311 1.00 44.92 ? 198 GLU A C    1 
ATOM   1770 O O    . GLU A 1 198 ? 31.431  11.307  28.404 1.00 43.71 ? 198 GLU A O    1 
ATOM   1771 C CB   . GLU A 1 198 ? 32.037  12.509  30.816 1.00 43.71 ? 198 GLU A CB   1 
ATOM   1772 H H    . GLU A 1 198 ? 34.329  11.504  29.966 1.00 0.00  ? 198 GLU A H    1 
ATOM   1773 N N    . MET A 1 199 ? 31.714  9.216   29.196 1.00 50.03 ? 199 MET A N    1 
ATOM   1774 C CA   . MET A 1 199 ? 31.191  8.574   28.001 1.00 53.46 ? 199 MET A CA   1 
ATOM   1775 C C    . MET A 1 199 ? 29.724  8.174   28.107 1.00 53.44 ? 199 MET A C    1 
ATOM   1776 O O    . MET A 1 199 ? 29.285  7.612   29.109 1.00 54.80 ? 199 MET A O    1 
ATOM   1777 C CB   . MET A 1 199 ? 32.074  7.371   27.639 1.00 57.88 ? 199 MET A CB   1 
ATOM   1778 C CG   . MET A 1 199 ? 31.484  6.389   26.637 1.00 61.40 ? 199 MET A CG   1 
ATOM   1779 S SD   . MET A 1 199 ? 30.765  5.029   27.536 1.00 68.72 ? 199 MET A SD   1 
ATOM   1780 C CE   . MET A 1 199 ? 30.184  4.019   26.293 1.00 61.25 ? 199 MET A CE   1 
ATOM   1781 H H    . MET A 1 199 ? 32.033  8.655   29.939 1.00 0.00  ? 199 MET A H    1 
ATOM   1782 N N    . ASN A 1 200 ? 28.967  8.548   27.086 1.00 54.37 ? 200 ASN A N    1 
ATOM   1783 C CA   . ASN A 1 200 ? 27.554  8.228   26.983 1.00 55.81 ? 200 ASN A CA   1 
ATOM   1784 C C    . ASN A 1 200 ? 27.462  7.026   26.063 1.00 56.65 ? 200 ASN A C    1 
ATOM   1785 O O    . ASN A 1 200 ? 26.815  6.036   26.385 1.00 64.38 ? 200 ASN A O    1 
ATOM   1786 C CB   . ASN A 1 200 ? 26.775  9.407   26.396 1.00 58.27 ? 200 ASN A CB   1 
ATOM   1787 C CG   . ASN A 1 200 ? 26.684  10.577  27.360 1.00 64.00 ? 200 ASN A CG   1 
ATOM   1788 O OD1  . ASN A 1 200 ? 26.398  10.395  28.547 1.00 66.71 ? 200 ASN A OD1  1 
ATOM   1789 N ND2  . ASN A 1 200 ? 26.949  11.780  26.865 1.00 64.79 ? 200 ASN A ND2  1 
ATOM   1790 H H    . ASN A 1 200 ? 29.392  9.076   26.411 1.00 0.00  ? 200 ASN A H    1 
ATOM   1791 H HD21 . ASN A 1 200 ? 26.913  12.508  27.524 1.00 0.00  ? 200 ASN A HD21 1 
ATOM   1792 H HD22 . ASN A 1 200 ? 27.179  11.902  25.922 1.00 0.00  ? 200 ASN A HD22 1 
ATOM   1793 N N    . GLU A 1 201 ? 28.106  7.120   24.908 1.00 54.15 ? 201 GLU A N    1 
ATOM   1794 C CA   . GLU A 1 201 ? 28.115  6.022   23.952 1.00 54.91 ? 201 GLU A CA   1 
ATOM   1795 C C    . GLU A 1 201 ? 29.543  5.859   23.462 1.00 49.44 ? 201 GLU A C    1 
ATOM   1796 O O    . GLU A 1 201 ? 30.293  6.835   23.422 1.00 49.37 ? 201 GLU A O    1 
ATOM   1797 C CB   . GLU A 1 201 ? 27.197  6.331   22.769 1.00 63.64 ? 201 GLU A CB   1 
ATOM   1798 C CG   . GLU A 1 201 ? 25.724  6.477   23.125 1.00 72.36 ? 201 GLU A CG   1 
ATOM   1799 C CD   . GLU A 1 201 ? 24.850  6.856   21.932 1.00 75.99 ? 201 GLU A CD   1 
ATOM   1800 O OE1  . GLU A 1 201 ? 25.347  6.868   20.780 1.00 74.85 ? 201 GLU A OE1  1 
ATOM   1801 O OE2  . GLU A 1 201 ? 23.655  7.145   22.158 1.00 80.56 ? 201 GLU A OE2  1 
ATOM   1802 H H    . GLU A 1 201 ? 28.598  7.935   24.671 1.00 0.00  ? 201 GLU A H    1 
ATOM   1803 N N    . PRO A 1 202 ? 29.963  4.618   23.152 1.00 44.75 ? 202 PRO A N    1 
ATOM   1804 C CA   . PRO A 1 202 ? 31.334  4.445   22.673 1.00 38.33 ? 202 PRO A CA   1 
ATOM   1805 C C    . PRO A 1 202 ? 31.452  5.112   21.316 1.00 35.76 ? 202 PRO A C    1 
ATOM   1806 O O    . PRO A 1 202 ? 30.468  5.215   20.577 1.00 33.39 ? 202 PRO A O    1 
ATOM   1807 C CB   . PRO A 1 202 ? 31.470  2.925   22.537 1.00 33.69 ? 202 PRO A CB   1 
ATOM   1808 C CG   . PRO A 1 202 ? 30.468  2.392   23.489 1.00 39.58 ? 202 PRO A CG   1 
ATOM   1809 C CD   . PRO A 1 202 ? 29.292  3.313   23.266 1.00 44.67 ? 202 PRO A CD   1 
ATOM   1810 N N    . VAL A 1 203 ? 32.643  5.606   21.010 1.00 36.54 ? 203 VAL A N    1 
ATOM   1811 C CA   . VAL A 1 203 ? 32.888  6.255   19.734 1.00 34.25 ? 203 VAL A CA   1 
ATOM   1812 C C    . VAL A 1 203 ? 34.258  5.790   19.274 1.00 33.03 ? 203 VAL A C    1 
ATOM   1813 O O    . VAL A 1 203 ? 35.104  5.435   20.092 1.00 31.48 ? 203 VAL A O    1 
ATOM   1814 C CB   . VAL A 1 203 ? 32.930  7.798   19.863 1.00 30.15 ? 203 VAL A CB   1 
ATOM   1815 C CG1  . VAL A 1 203 ? 32.773  8.432   18.506 1.00 33.89 ? 203 VAL A CG1  1 
ATOM   1816 C CG2  . VAL A 1 203 ? 31.859  8.301   20.797 1.00 33.18 ? 203 VAL A CG2  1 
ATOM   1817 H H    . VAL A 1 203 ? 33.374  5.526   21.661 1.00 0.00  ? 203 VAL A H    1 
ATOM   1818 N N    . GLN A 1 204 ? 34.447  5.732   17.964 1.00 33.67 ? 204 GLN A N    1 
ATOM   1819 C CA   . GLN A 1 204 ? 35.727  5.348   17.385 1.00 32.32 ? 204 GLN A CA   1 
ATOM   1820 C C    . GLN A 1 204 ? 35.847  6.212   16.150 1.00 31.65 ? 204 GLN A C    1 
ATOM   1821 O O    . GLN A 1 204 ? 35.053  6.081   15.219 1.00 37.76 ? 204 GLN A O    1 
ATOM   1822 C CB   . GLN A 1 204 ? 35.754  3.871   17.006 1.00 35.69 ? 204 GLN A CB   1 
ATOM   1823 C CG   . GLN A 1 204 ? 37.102  3.422   16.461 1.00 37.09 ? 204 GLN A CG   1 
ATOM   1824 C CD   . GLN A 1 204 ? 37.113  1.970   16.046 1.00 37.97 ? 204 GLN A CD   1 
ATOM   1825 O OE1  . GLN A 1 204 ? 37.134  1.072   16.889 1.00 43.39 ? 204 GLN A OE1  1 
ATOM   1826 N NE2  . GLN A 1 204 ? 37.101  1.726   14.741 1.00 36.67 ? 204 GLN A NE2  1 
ATOM   1827 H H    . GLN A 1 204 ? 33.714  5.956   17.353 1.00 0.00  ? 204 GLN A H    1 
ATOM   1828 H HE21 . GLN A 1 204 ? 37.108  0.786   14.475 1.00 0.00  ? 204 GLN A HE21 1 
ATOM   1829 H HE22 . GLN A 1 204 ? 37.097  2.466   14.101 1.00 0.00  ? 204 GLN A HE22 1 
ATOM   1830 N N    . LEU A 1 205 ? 36.810  7.123   16.161 1.00 31.71 ? 205 LEU A N    1 
ATOM   1831 C CA   . LEU A 1 205 ? 36.997  8.039   15.049 1.00 30.22 ? 205 LEU A CA   1 
ATOM   1832 C C    . LEU A 1 205 ? 38.417  8.025   14.508 1.00 31.84 ? 205 LEU A C    1 
ATOM   1833 O O    . LEU A 1 205 ? 39.359  7.682   15.229 1.00 30.68 ? 205 LEU A O    1 
ATOM   1834 C CB   . LEU A 1 205 ? 36.634  9.442   15.508 1.00 33.05 ? 205 LEU A CB   1 
ATOM   1835 C CG   . LEU A 1 205 ? 35.153  9.678   15.795 1.00 38.63 ? 205 LEU A CG   1 
ATOM   1836 C CD1  . LEU A 1 205 ? 34.982  10.630  16.964 1.00 40.08 ? 205 LEU A CD1  1 
ATOM   1837 C CD2  . LEU A 1 205 ? 34.482  10.223  14.542 1.00 42.95 ? 205 LEU A CD2  1 
ATOM   1838 H H    . LEU A 1 205 ? 37.442  7.164   16.908 1.00 0.00  ? 205 LEU A H    1 
ATOM   1839 N N    . THR A 1 206 ? 38.558  8.381   13.235 1.00 27.89 ? 206 THR A N    1 
ATOM   1840 C CA   . THR A 1 206 ? 39.861  8.439   12.581 1.00 27.06 ? 206 THR A CA   1 
ATOM   1841 C C    . THR A 1 206 ? 40.210  9.898   12.323 1.00 26.81 ? 206 THR A C    1 
ATOM   1842 O O    . THR A 1 206 ? 39.444  10.614  11.670 1.00 28.90 ? 206 THR A O    1 
ATOM   1843 C CB   . THR A 1 206 ? 39.849  7.715   11.222 1.00 28.26 ? 206 THR A CB   1 
ATOM   1844 O OG1  . THR A 1 206 ? 39.427  6.354   11.394 1.00 29.13 ? 206 THR A OG1  1 
ATOM   1845 C CG2  . THR A 1 206 ? 41.244  7.752   10.599 1.00 21.98 ? 206 THR A CG2  1 
ATOM   1846 H H    . THR A 1 206 ? 37.768  8.602   12.700 1.00 0.00  ? 206 THR A H    1 
ATOM   1847 H HG1  . THR A 1 206 ? 40.152  5.789   11.098 1.00 0.00  ? 206 THR A HG1  1 
ATOM   1848 N N    . PHE A 1 207 ? 41.372  10.331  12.803 1.00 26.60 ? 207 PHE A N    1 
ATOM   1849 C CA   . PHE A 1 207 ? 41.803  11.717  12.621 1.00 21.91 ? 207 PHE A CA   1 
ATOM   1850 C C    . PHE A 1 207 ? 43.238  11.811  12.107 1.00 21.33 ? 207 PHE A C    1 
ATOM   1851 O O    . PHE A 1 207 ? 44.061  10.934  12.374 1.00 29.13 ? 207 PHE A O    1 
ATOM   1852 C CB   . PHE A 1 207 ? 41.687  12.471  13.941 1.00 18.74 ? 207 PHE A CB   1 
ATOM   1853 C CG   . PHE A 1 207 ? 40.291  12.510  14.504 1.00 17.35 ? 207 PHE A CG   1 
ATOM   1854 C CD1  . PHE A 1 207 ? 39.260  13.132  13.809 1.00 17.90 ? 207 PHE A CD1  1 
ATOM   1855 C CD2  . PHE A 1 207 ? 40.014  11.947  15.738 1.00 14.93 ? 207 PHE A CD2  1 
ATOM   1856 C CE1  . PHE A 1 207 ? 37.981  13.191  14.339 1.00 19.10 ? 207 PHE A CE1  1 
ATOM   1857 C CE2  . PHE A 1 207 ? 38.736  12.001  16.273 1.00 13.56 ? 207 PHE A CE2  1 
ATOM   1858 C CZ   . PHE A 1 207 ? 37.722  12.623  15.575 1.00 13.24 ? 207 PHE A CZ   1 
ATOM   1859 H H    . PHE A 1 207 ? 41.961  9.713   13.287 1.00 0.00  ? 207 PHE A H    1 
ATOM   1860 N N    . ALA A 1 208 ? 43.532  12.873  11.367 1.00 16.34 ? 208 ALA A N    1 
ATOM   1861 C CA   . ALA A 1 208 ? 44.865  13.090  10.818 1.00 15.03 ? 208 ALA A CA   1 
ATOM   1862 C C    . ALA A 1 208 ? 45.810  13.600  11.902 1.00 11.19 ? 208 ALA A C    1 
ATOM   1863 O O    . ALA A 1 208 ? 45.589  14.670  12.475 1.00 13.73 ? 208 ALA A O    1 
ATOM   1864 C CB   . ALA A 1 208 ? 44.806  14.080  9.662  1.00 16.32 ? 208 ALA A CB   1 
ATOM   1865 H H    . ALA A 1 208 ? 42.838  13.535  11.181 1.00 0.00  ? 208 ALA A H    1 
ATOM   1866 N N    . LEU A 1 209 ? 46.884  12.855  12.148 1.00 7.38  ? 209 LEU A N    1 
ATOM   1867 C CA   . LEU A 1 209 ? 47.858  13.212  13.182 1.00 14.67 ? 209 LEU A CA   1 
ATOM   1868 C C    . LEU A 1 209 ? 48.570  14.538  12.918 1.00 14.57 ? 209 LEU A C    1 
ATOM   1869 O O    . LEU A 1 209 ? 48.923  15.256  13.853 1.00 17.16 ? 209 LEU A O    1 
ATOM   1870 C CB   . LEU A 1 209 ? 48.894  12.092  13.367 1.00 11.74 ? 209 LEU A CB   1 
ATOM   1871 C CG   . LEU A 1 209 ? 48.441  10.892  14.208 1.00 11.26 ? 209 LEU A CG   1 
ATOM   1872 C CD1  . LEU A 1 209 ? 49.079  9.605   13.725 1.00 16.53 ? 209 LEU A CD1  1 
ATOM   1873 C CD2  . LEU A 1 209 ? 48.778  11.122  15.656 1.00 3.30  ? 209 LEU A CD2  1 
ATOM   1874 H H    . LEU A 1 209 ? 47.038  12.049  11.622 1.00 0.00  ? 209 LEU A H    1 
ATOM   1875 N N    . ARG A 1 210 ? 48.721  14.891  11.648 1.00 20.18 ? 210 ARG A N    1 
ATOM   1876 C CA   . ARG A 1 210 ? 49.409  16.123  11.251 1.00 21.07 ? 210 ARG A CA   1 
ATOM   1877 C C    . ARG A 1 210 ? 48.784  17.350  11.910 1.00 20.34 ? 210 ARG A C    1 
ATOM   1878 O O    . ARG A 1 210 ? 49.475  18.258  12.404 1.00 23.06 ? 210 ARG A O    1 
ATOM   1879 C CB   . ARG A 1 210 ? 49.328  16.269  9.720  1.00 24.44 ? 210 ARG A CB   1 
ATOM   1880 C CG   . ARG A 1 210 ? 49.905  17.563  9.136  1.00 35.83 ? 210 ARG A CG   1 
ATOM   1881 C CD   . ARG A 1 210 ? 51.209  17.272  8.408  1.00 42.32 ? 210 ARG A CD   1 
ATOM   1882 N NE   . ARG A 1 210 ? 51.868  18.466  7.884  1.00 47.51 ? 210 ARG A NE   1 
ATOM   1883 C CZ   . ARG A 1 210 ? 52.521  19.352  8.632  1.00 48.95 ? 210 ARG A CZ   1 
ATOM   1884 N NH1  . ARG A 1 210 ? 52.606  19.193  9.951  1.00 46.75 ? 210 ARG A NH1  1 
ATOM   1885 N NH2  . ARG A 1 210 ? 53.110  20.392  8.052  1.00 51.68 ? 210 ARG A NH2  1 
ATOM   1886 H H    . ARG A 1 210 ? 48.328  14.277  10.957 1.00 0.00  ? 210 ARG A H    1 
ATOM   1887 H HE   . ARG A 1 210 ? 51.830  18.638  6.913  1.00 0.00  ? 210 ARG A HE   1 
ATOM   1888 H HH11 . ARG A 1 210 ? 52.175  18.409  10.390 1.00 0.00  ? 210 ARG A HH11 1 
ATOM   1889 H HH12 . ARG A 1 210 ? 53.078  19.882  10.493 1.00 0.00  ? 210 ARG A HH12 1 
ATOM   1890 H HH21 . ARG A 1 210 ? 53.056  20.512  7.060  1.00 0.00  ? 210 ARG A HH21 1 
ATOM   1891 H HH22 . ARG A 1 210 ? 53.585  21.084  8.610  1.00 0.00  ? 210 ARG A HH22 1 
ATOM   1892 N N    . TYR A 1 211 ? 47.458  17.369  11.921 1.00 19.62 ? 211 TYR A N    1 
ATOM   1893 C CA   . TYR A 1 211 ? 46.732  18.471  12.529 1.00 17.61 ? 211 TYR A CA   1 
ATOM   1894 C C    . TYR A 1 211 ? 46.750  18.422  14.073 1.00 21.70 ? 211 TYR A C    1 
ATOM   1895 O O    . TYR A 1 211 ? 46.948  19.452  14.743 1.00 26.18 ? 211 TYR A O    1 
ATOM   1896 C CB   . TYR A 1 211 ? 45.294  18.489  12.043 1.00 11.02 ? 211 TYR A CB   1 
ATOM   1897 C CG   . TYR A 1 211 ? 45.151  18.740  10.580 1.00 17.69 ? 211 TYR A CG   1 
ATOM   1898 C CD1  . TYR A 1 211 ? 45.077  20.022  10.144 1.00 16.88 ? 211 TYR A CD1  1 
ATOM   1899 C CD2  . TYR A 1 211 ? 45.083  17.700  9.661  1.00 17.13 ? 211 TYR A CD2  1 
ATOM   1900 C CE1  . TYR A 1 211 ? 44.935  20.331  8.817  1.00 17.11 ? 211 TYR A CE1  1 
ATOM   1901 C CE2  . TYR A 1 211 ? 44.938  17.984  8.297  1.00 16.03 ? 211 TYR A CE2  1 
ATOM   1902 C CZ   . TYR A 1 211 ? 44.860  19.312  7.880  1.00 18.85 ? 211 TYR A CZ   1 
ATOM   1903 O OH   . TYR A 1 211 ? 44.684  19.623  6.543  1.00 26.78 ? 211 TYR A OH   1 
ATOM   1904 H H    . TYR A 1 211 ? 46.957  16.691  11.439 1.00 0.00  ? 211 TYR A H    1 
ATOM   1905 H HH   . TYR A 1 211 ? 44.596  18.854  6.027  1.00 0.00  ? 211 TYR A HH   1 
ATOM   1906 N N    . LEU A 1 212 ? 46.660  17.217  14.632 1.00 17.36 ? 212 LEU A N    1 
ATOM   1907 C CA   . LEU A 1 212 ? 46.699  17.063  16.089 1.00 10.65 ? 212 LEU A CA   1 
ATOM   1908 C C    . LEU A 1 212 ? 48.011  17.560  16.681 1.00 10.25 ? 212 LEU A C    1 
ATOM   1909 O O    . LEU A 1 212 ? 48.035  18.120  17.775 1.00 9.61  ? 212 LEU A O    1 
ATOM   1910 C CB   . LEU A 1 212 ? 46.457  15.600  16.483 1.00 11.15 ? 212 LEU A CB   1 
ATOM   1911 C CG   . LEU A 1 212 ? 45.049  15.063  16.212 1.00 10.74 ? 212 LEU A CG   1 
ATOM   1912 C CD1  . LEU A 1 212 ? 44.943  13.567  16.527 1.00 7.67  ? 212 LEU A CD1  1 
ATOM   1913 C CD2  . LEU A 1 212 ? 44.038  15.860  17.027 1.00 2.00  ? 212 LEU A CD2  1 
ATOM   1914 H H    . LEU A 1 212 ? 46.541  16.447  14.036 1.00 0.00  ? 212 LEU A H    1 
ATOM   1915 N N    . ASN A 1 213 ? 49.110  17.392  15.953 1.00 8.57  ? 213 ASN A N    1 
ATOM   1916 C CA   . ASN A 1 213 ? 50.420  17.855  16.438 1.00 13.80 ? 213 ASN A CA   1 
ATOM   1917 C C    . ASN A 1 213 ? 50.551  19.359  16.399 1.00 13.61 ? 213 ASN A C    1 
ATOM   1918 O O    . ASN A 1 213 ? 51.546  19.903  16.861 1.00 20.45 ? 213 ASN A O    1 
ATOM   1919 C CB   . ASN A 1 213 ? 51.536  17.134  15.717 1.00 7.28  ? 213 ASN A CB   1 
ATOM   1920 C CG   . ASN A 1 213 ? 51.736  15.709  16.220 1.00 11.38 ? 213 ASN A CG   1 
ATOM   1921 O OD1  . ASN A 1 213 ? 51.882  15.476  17.428 1.00 16.74 ? 213 ASN A OD1  1 
ATOM   1922 N ND2  . ASN A 1 213 ? 51.691  14.755  15.317 1.00 10.58 ? 213 ASN A ND2  1 
ATOM   1923 H H    . ASN A 1 213 ? 49.041  16.948  15.093 1.00 0.00  ? 213 ASN A H    1 
ATOM   1924 H HD21 . ASN A 1 213 ? 51.780  13.838  15.662 1.00 0.00  ? 213 ASN A HD21 1 
ATOM   1925 H HD22 . ASN A 1 213 ? 51.573  14.996  14.380 1.00 0.00  ? 213 ASN A HD22 1 
ATOM   1926 N N    . PHE A 1 214 ? 49.595  20.026  15.758 1.00 14.11 ? 214 PHE A N    1 
ATOM   1927 C CA   . PHE A 1 214 ? 49.553  21.486  15.712 1.00 9.92  ? 214 PHE A CA   1 
ATOM   1928 C C    . PHE A 1 214 ? 48.770  21.924  16.953 1.00 12.76 ? 214 PHE A C    1 
ATOM   1929 O O    . PHE A 1 214 ? 49.140  22.877  17.648 1.00 22.03 ? 214 PHE A O    1 
ATOM   1930 C CB   . PHE A 1 214 ? 48.818  21.982  14.468 1.00 17.49 ? 214 PHE A CB   1 
ATOM   1931 C CG   . PHE A 1 214 ? 49.685  22.128  13.259 1.00 19.42 ? 214 PHE A CG   1 
ATOM   1932 C CD1  . PHE A 1 214 ? 50.772  22.985  13.286 1.00 20.53 ? 214 PHE A CD1  1 
ATOM   1933 C CD2  . PHE A 1 214 ? 49.395  21.450  12.079 1.00 20.05 ? 214 PHE A CD2  1 
ATOM   1934 C CE1  . PHE A 1 214 ? 51.544  23.189  12.152 1.00 18.72 ? 214 PHE A CE1  1 
ATOM   1935 C CE2  . PHE A 1 214 ? 50.169  21.653  10.941 1.00 18.93 ? 214 PHE A CE2  1 
ATOM   1936 C CZ   . PHE A 1 214 ? 51.244  22.514  10.983 1.00 15.34 ? 214 PHE A CZ   1 
ATOM   1937 H H    . PHE A 1 214 ? 48.975  19.525  15.178 1.00 0.00  ? 214 PHE A H    1 
ATOM   1938 N N    . PHE A 1 215 ? 47.676  21.219  17.217 1.00 8.81  ? 215 PHE A N    1 
ATOM   1939 C CA   . PHE A 1 215 ? 46.851  21.511  18.377 1.00 8.31  ? 215 PHE A CA   1 
ATOM   1940 C C    . PHE A 1 215 ? 47.696  21.433  19.654 1.00 4.69  ? 215 PHE A C    1 
ATOM   1941 O O    . PHE A 1 215 ? 47.606  22.300  20.504 1.00 6.50  ? 215 PHE A O    1 
ATOM   1942 C CB   . PHE A 1 215 ? 45.692  20.503  18.495 1.00 10.81 ? 215 PHE A CB   1 
ATOM   1943 C CG   . PHE A 1 215 ? 44.770  20.461  17.299 1.00 12.89 ? 215 PHE A CG   1 
ATOM   1944 C CD1  . PHE A 1 215 ? 44.941  21.301  16.174 1.00 12.18 ? 215 PHE A CD1  1 
ATOM   1945 C CD2  . PHE A 1 215 ? 43.743  19.539  17.285 1.00 10.00 ? 215 PHE A CD2  1 
ATOM   1946 C CE1  . PHE A 1 215 ? 44.070  21.185  15.065 1.00 11.33 ? 215 PHE A CE1  1 
ATOM   1947 C CE2  . PHE A 1 215 ? 42.877  19.408  16.203 1.00 5.48  ? 215 PHE A CE2  1 
ATOM   1948 C CZ   . PHE A 1 215 ? 43.040  20.227  15.082 1.00 10.63 ? 215 PHE A CZ   1 
ATOM   1949 H H    . PHE A 1 215 ? 47.453  20.457  16.652 1.00 0.00  ? 215 PHE A H    1 
ATOM   1950 N N    . THR A 1 216 ? 48.534  20.405  19.749 1.00 5.74  ? 216 THR A N    1 
ATOM   1951 C CA   . THR A 1 216 ? 49.372  20.180  20.922 1.00 2.97  ? 216 THR A CA   1 
ATOM   1952 C C    . THR A 1 216 ? 50.400  21.246  21.208 1.00 8.46  ? 216 THR A C    1 
ATOM   1953 O O    . THR A 1 216 ? 51.139  21.150  22.188 1.00 7.99  ? 216 THR A O    1 
ATOM   1954 C CB   . THR A 1 216 ? 50.048  18.816  20.850 1.00 6.33  ? 216 THR A CB   1 
ATOM   1955 O OG1  . THR A 1 216 ? 50.764  18.715  19.594 1.00 10.61 ? 216 THR A OG1  1 
ATOM   1956 C CG2  . THR A 1 216 ? 48.989  17.718  20.895 1.00 5.60  ? 216 THR A CG2  1 
ATOM   1957 H H    . THR A 1 216 ? 48.669  19.789  18.994 1.00 0.00  ? 216 THR A H    1 
ATOM   1958 H HG1  . THR A 1 216 ? 51.358  17.976  19.721 1.00 0.00  ? 216 THR A HG1  1 
ATOM   1959 N N    . LYS A 1 217 ? 50.459  22.261  20.355 1.00 14.89 ? 217 LYS A N    1 
ATOM   1960 C CA   . LYS A 1 217 ? 51.387  23.362  20.556 1.00 11.30 ? 217 LYS A CA   1 
ATOM   1961 C C    . LYS A 1 217 ? 50.768  24.284  21.602 1.00 14.61 ? 217 LYS A C    1 
ATOM   1962 O O    . LYS A 1 217 ? 51.406  25.225  22.077 1.00 19.18 ? 217 LYS A O    1 
ATOM   1963 C CB   . LYS A 1 217 ? 51.609  24.099  19.243 1.00 10.81 ? 217 LYS A CB   1 
ATOM   1964 C CG   . LYS A 1 217 ? 52.417  23.317  18.229 1.00 11.83 ? 217 LYS A CG   1 
ATOM   1965 C CD   . LYS A 1 217 ? 52.779  24.198  17.062 1.00 20.45 ? 217 LYS A CD   1 
ATOM   1966 C CE   . LYS A 1 217 ? 53.649  23.459  16.074 1.00 28.34 ? 217 LYS A CE   1 
ATOM   1967 N NZ   . LYS A 1 217 ? 53.634  24.127  14.744 1.00 34.81 ? 217 LYS A NZ   1 
ATOM   1968 H H    . LYS A 1 217 ? 49.896  22.259  19.548 1.00 0.00  ? 217 LYS A H    1 
ATOM   1969 H HZ1  . LYS A 1 217 ? 53.970  25.108  14.835 1.00 0.00  ? 217 LYS A HZ1  1 
ATOM   1970 H HZ2  . LYS A 1 217 ? 54.251  23.602  14.090 1.00 0.00  ? 217 LYS A HZ2  1 
ATOM   1971 H HZ3  . LYS A 1 217 ? 52.660  24.117  14.381 1.00 0.00  ? 217 LYS A HZ3  1 
ATOM   1972 N N    . ALA A 1 218 ? 49.517  23.995  21.955 1.00 11.01 ? 218 ALA A N    1 
ATOM   1973 C CA   . ALA A 1 218 ? 48.779  24.766  22.939 1.00 5.65  ? 218 ALA A CA   1 
ATOM   1974 C C    . ALA A 1 218 ? 48.944  24.152  24.326 1.00 10.59 ? 218 ALA A C    1 
ATOM   1975 O O    . ALA A 1 218 ? 48.301  24.579  25.290 1.00 15.72 ? 218 ALA A O    1 
ATOM   1976 C CB   . ALA A 1 218 ? 47.318  24.814  22.550 1.00 2.27  ? 218 ALA A CB   1 
ATOM   1977 H H    . ALA A 1 218 ? 49.040  23.257  21.525 1.00 0.00  ? 218 ALA A H    1 
ATOM   1978 N N    . THR A 1 219 ? 49.824  23.158  24.426 1.00 12.74 ? 219 THR A N    1 
ATOM   1979 C CA   . THR A 1 219 ? 50.086  22.471  25.688 1.00 10.42 ? 219 THR A CA   1 
ATOM   1980 C C    . THR A 1 219 ? 50.507  23.419  26.821 1.00 13.69 ? 219 THR A C    1 
ATOM   1981 O O    . THR A 1 219 ? 49.891  23.409  27.892 1.00 17.27 ? 219 THR A O    1 
ATOM   1982 C CB   . THR A 1 219 ? 51.110  21.318  25.489 1.00 3.31  ? 219 THR A CB   1 
ATOM   1983 O OG1  . THR A 1 219 ? 50.514  20.311  24.668 1.00 5.59  ? 219 THR A OG1  1 
ATOM   1984 C CG2  . THR A 1 219 ? 51.498  20.686  26.803 1.00 3.62  ? 219 THR A CG2  1 
ATOM   1985 H H    . THR A 1 219 ? 50.302  22.837  23.633 1.00 0.00  ? 219 THR A H    1 
ATOM   1986 H HG1  . THR A 1 219 ? 49.635  20.094  25.006 1.00 0.00  ? 219 THR A HG1  1 
ATOM   1987 N N    . PRO A 1 220 ? 51.502  24.294  26.584 1.00 15.19 ? 220 PRO A N    1 
ATOM   1988 C CA   . PRO A 1 220 ? 51.909  25.206  27.665 1.00 11.14 ? 220 PRO A CA   1 
ATOM   1989 C C    . PRO A 1 220 ? 50.773  26.050  28.267 1.00 14.48 ? 220 PRO A C    1 
ATOM   1990 O O    . PRO A 1 220 ? 50.909  26.602  29.360 1.00 20.91 ? 220 PRO A O    1 
ATOM   1991 C CB   . PRO A 1 220 ? 52.997  26.067  27.002 1.00 11.93 ? 220 PRO A CB   1 
ATOM   1992 C CG   . PRO A 1 220 ? 52.680  25.985  25.521 1.00 12.04 ? 220 PRO A CG   1 
ATOM   1993 C CD   . PRO A 1 220 ? 52.275  24.548  25.350 1.00 9.53  ? 220 PRO A CD   1 
ATOM   1994 N N    . LEU A 1 221 ? 49.649  26.131  27.569 1.00 18.24 ? 221 LEU A N    1 
ATOM   1995 C CA   . LEU A 1 221 ? 48.504  26.891  28.054 1.00 21.43 ? 221 LEU A CA   1 
ATOM   1996 C C    . LEU A 1 221 ? 47.744  26.216  29.188 1.00 21.65 ? 221 LEU A C    1 
ATOM   1997 O O    . LEU A 1 221 ? 47.065  26.886  29.960 1.00 30.34 ? 221 LEU A O    1 
ATOM   1998 C CB   . LEU A 1 221 ? 47.522  27.149  26.912 1.00 27.63 ? 221 LEU A CB   1 
ATOM   1999 C CG   . LEU A 1 221 ? 47.863  28.280  25.944 1.00 33.10 ? 221 LEU A CG   1 
ATOM   2000 C CD1  . LEU A 1 221 ? 46.836  28.309  24.829 1.00 35.18 ? 221 LEU A CD1  1 
ATOM   2001 C CD2  . LEU A 1 221 ? 47.876  29.612  26.696 1.00 31.45 ? 221 LEU A CD2  1 
ATOM   2002 H H    . LEU A 1 221 ? 49.563  25.687  26.702 1.00 0.00  ? 221 LEU A H    1 
ATOM   2003 N N    . SER A 1 222 ? 47.838  24.893  29.282 1.00 24.13 ? 222 SER A N    1 
ATOM   2004 C CA   . SER A 1 222 ? 47.107  24.153  30.302 1.00 14.33 ? 222 SER A CA   1 
ATOM   2005 C C    . SER A 1 222 ? 47.757  22.825  30.666 1.00 16.67 ? 222 SER A C    1 
ATOM   2006 O O    . SER A 1 222 ? 48.450  22.213  29.848 1.00 8.62  ? 222 SER A O    1 
ATOM   2007 C CB   . SER A 1 222 ? 45.683  23.892  29.804 1.00 17.45 ? 222 SER A CB   1 
ATOM   2008 O OG   . SER A 1 222 ? 45.004  22.989  30.652 1.00 32.27 ? 222 SER A OG   1 
ATOM   2009 H H    . SER A 1 222 ? 48.410  24.394  28.667 1.00 0.00  ? 222 SER A H    1 
ATOM   2010 H HG   . SER A 1 222 ? 44.348  22.536  30.109 1.00 0.00  ? 222 SER A HG   1 
ATOM   2011 N N    . SER A 1 223 ? 47.500  22.373  31.891 1.00 17.70 ? 223 SER A N    1 
ATOM   2012 C CA   . SER A 1 223 ? 48.036  21.115  32.390 1.00 20.96 ? 223 SER A CA   1 
ATOM   2013 C C    . SER A 1 223 ? 47.178  19.960  31.901 1.00 23.58 ? 223 SER A C    1 
ATOM   2014 O O    . SER A 1 223 ? 47.592  18.796  31.962 1.00 25.46 ? 223 SER A O    1 
ATOM   2015 C CB   . SER A 1 223 ? 48.027  21.112  33.913 1.00 24.34 ? 223 SER A CB   1 
ATOM   2016 O OG   . SER A 1 223 ? 48.492  22.350  34.410 1.00 40.59 ? 223 SER A OG   1 
ATOM   2017 H H    . SER A 1 223 ? 46.931  22.904  32.488 1.00 0.00  ? 223 SER A H    1 
ATOM   2018 H HG   . SER A 1 223 ? 49.405  22.468  34.131 1.00 0.00  ? 223 SER A HG   1 
ATOM   2019 N N    . THR A 1 224 ? 45.972  20.282  31.440 1.00 20.84 ? 224 THR A N    1 
ATOM   2020 C CA   . THR A 1 224 ? 45.044  19.271  30.959 1.00 19.03 ? 224 THR A CA   1 
ATOM   2021 C C    . THR A 1 224 ? 44.392  19.675  29.646 1.00 17.60 ? 224 THR A C    1 
ATOM   2022 O O    . THR A 1 224 ? 44.283  20.858  29.326 1.00 17.50 ? 224 THR A O    1 
ATOM   2023 C CB   . THR A 1 224 ? 43.914  19.004  31.988 1.00 20.06 ? 224 THR A CB   1 
ATOM   2024 O OG1  . THR A 1 224 ? 43.230  20.224  32.280 1.00 21.73 ? 224 THR A OG1  1 
ATOM   2025 C CG2  . THR A 1 224 ? 44.473  18.435  33.275 1.00 24.97 ? 224 THR A CG2  1 
ATOM   2026 H H    . THR A 1 224 ? 45.658  21.213  31.429 1.00 0.00  ? 224 THR A H    1 
ATOM   2027 H HG1  . THR A 1 224 ? 42.776  20.538  31.493 1.00 0.00  ? 224 THR A HG1  1 
ATOM   2028 N N    . VAL A 1 225 ? 43.911  18.675  28.926 1.00 15.17 ? 225 VAL A N    1 
ATOM   2029 C CA   . VAL A 1 225 ? 43.236  18.861  27.658 1.00 14.77 ? 225 VAL A CA   1 
ATOM   2030 C C    . VAL A 1 225 ? 42.004  17.970  27.742 1.00 19.96 ? 225 VAL A C    1 
ATOM   2031 O O    . VAL A 1 225 ? 42.000  17.000  28.511 1.00 18.53 ? 225 VAL A O    1 
ATOM   2032 C CB   . VAL A 1 225 ? 44.127  18.395  26.488 1.00 12.11 ? 225 VAL A CB   1 
ATOM   2033 C CG1  . VAL A 1 225 ? 44.514  16.954  26.671 1.00 11.49 ? 225 VAL A CG1  1 
ATOM   2034 C CG2  . VAL A 1 225 ? 43.410  18.572  25.173 1.00 14.31 ? 225 VAL A CG2  1 
ATOM   2035 H H    . VAL A 1 225 ? 43.974  17.758  29.253 1.00 0.00  ? 225 VAL A H    1 
ATOM   2036 N N    . THR A 1 226 ? 40.943  18.329  27.021 1.00 20.24 ? 226 THR A N    1 
ATOM   2037 C CA   . THR A 1 226 ? 39.730  17.522  27.015 1.00 20.13 ? 226 THR A CA   1 
ATOM   2038 C C    . THR A 1 226 ? 39.357  17.279  25.564 1.00 21.17 ? 226 THR A C    1 
ATOM   2039 O O    . THR A 1 226 ? 39.339  18.210  24.763 1.00 28.05 ? 226 THR A O    1 
ATOM   2040 C CB   . THR A 1 226 ? 38.557  18.214  27.772 1.00 23.49 ? 226 THR A CB   1 
ATOM   2041 O OG1  . THR A 1 226 ? 38.016  19.281  26.985 1.00 32.29 ? 226 THR A OG1  1 
ATOM   2042 C CG2  . THR A 1 226 ? 39.040  18.786  29.099 1.00 23.11 ? 226 THR A CG2  1 
ATOM   2043 H H    . THR A 1 226 ? 40.949  19.153  26.488 1.00 0.00  ? 226 THR A H    1 
ATOM   2044 H HG1  . THR A 1 226 ? 37.453  18.895  26.302 1.00 0.00  ? 226 THR A HG1  1 
ATOM   2045 N N    . LEU A 1 227 ? 39.084  16.029  25.217 1.00 19.73 ? 227 LEU A N    1 
ATOM   2046 C CA   . LEU A 1 227 ? 38.732  15.681  23.849 1.00 16.87 ? 227 LEU A CA   1 
ATOM   2047 C C    . LEU A 1 227 ? 37.260  15.307  23.793 1.00 19.83 ? 227 LEU A C    1 
ATOM   2048 O O    . LEU A 1 227 ? 36.829  14.401  24.498 1.00 26.46 ? 227 LEU A O    1 
ATOM   2049 C CB   . LEU A 1 227 ? 39.573  14.495  23.380 1.00 19.47 ? 227 LEU A CB   1 
ATOM   2050 C CG   . LEU A 1 227 ? 41.080  14.560  23.633 1.00 17.69 ? 227 LEU A CG   1 
ATOM   2051 C CD1  . LEU A 1 227 ? 41.677  13.180  23.440 1.00 16.44 ? 227 LEU A CD1  1 
ATOM   2052 C CD2  . LEU A 1 227 ? 41.726  15.581  22.717 1.00 15.01 ? 227 LEU A CD2  1 
ATOM   2053 H H    . LEU A 1 227 ? 39.088  15.319  25.882 1.00 0.00  ? 227 LEU A H    1 
ATOM   2054 N N    . SER A 1 228 ? 36.488  16.012  22.978 1.00 20.68 ? 228 SER A N    1 
ATOM   2055 C CA   . SER A 1 228 ? 35.072  15.724  22.859 1.00 15.19 ? 228 SER A CA   1 
ATOM   2056 C C    . SER A 1 228 ? 34.807  15.040  21.524 1.00 19.60 ? 228 SER A C    1 
ATOM   2057 O O    . SER A 1 228 ? 35.072  15.613  20.464 1.00 18.83 ? 228 SER A O    1 
ATOM   2058 C CB   . SER A 1 228 ? 34.256  17.007  22.965 1.00 11.98 ? 228 SER A CB   1 
ATOM   2059 O OG   . SER A 1 228 ? 34.344  17.551  24.267 1.00 10.49 ? 228 SER A OG   1 
ATOM   2060 H H    . SER A 1 228 ? 36.889  16.703  22.422 1.00 0.00  ? 228 SER A H    1 
ATOM   2061 H HG   . SER A 1 228 ? 34.800  18.395  24.240 1.00 0.00  ? 228 SER A HG   1 
ATOM   2062 N N    . MET A 1 229 ? 34.282  13.823  21.591 1.00 24.66 ? 229 MET A N    1 
ATOM   2063 C CA   . MET A 1 229 ? 34.001  13.035  20.417 1.00 22.17 ? 229 MET A CA   1 
ATOM   2064 C C    . MET A 1 229 ? 32.579  12.542  20.406 1.00 22.50 ? 229 MET A C    1 
ATOM   2065 O O    . MET A 1 229 ? 32.083  11.968  21.377 1.00 27.80 ? 229 MET A O    1 
ATOM   2066 C CB   . MET A 1 229 ? 34.899  11.787  20.361 1.00 20.83 ? 229 MET A CB   1 
ATOM   2067 C CG   . MET A 1 229 ? 36.387  12.061  20.310 1.00 23.10 ? 229 MET A CG   1 
ATOM   2068 S SD   . MET A 1 229 ? 37.299  10.588  20.707 1.00 29.62 ? 229 MET A SD   1 
ATOM   2069 C CE   . MET A 1 229 ? 37.361  10.661  22.541 1.00 9.55  ? 229 MET A CE   1 
ATOM   2070 H H    . MET A 1 229 ? 34.039  13.434  22.452 1.00 0.00  ? 229 MET A H    1 
ATOM   2071 N N    . SER A 1 230 ? 31.927  12.810  19.294 1.00 22.01 ? 230 SER A N    1 
ATOM   2072 C CA   . SER A 1 230 ? 30.583  12.362  19.044 1.00 19.72 ? 230 SER A CA   1 
ATOM   2073 C C    . SER A 1 230 ? 30.775  11.672  17.698 1.00 19.17 ? 230 SER A C    1 
ATOM   2074 O O    . SER A 1 230 ? 31.681  12.019  16.934 1.00 17.16 ? 230 SER A O    1 
ATOM   2075 C CB   . SER A 1 230 ? 29.633  13.533  18.911 1.00 30.56 ? 230 SER A CB   1 
ATOM   2076 O OG   . SER A 1 230 ? 28.311  13.100  18.682 1.00 41.84 ? 230 SER A OG   1 
ATOM   2077 H H    . SER A 1 230 ? 32.325  13.457  18.662 1.00 0.00  ? 230 SER A H    1 
ATOM   2078 H HG   . SER A 1 230 ? 27.781  13.921  18.607 1.00 0.00  ? 230 SER A HG   1 
ATOM   2079 N N    . ALA A 1 231 ? 29.981  10.653  17.423 1.00 22.27 ? 231 ALA A N    1 
ATOM   2080 C CA   . ALA A 1 231 ? 30.100  9.948   16.164 1.00 26.57 ? 231 ALA A CA   1 
ATOM   2081 C C    . ALA A 1 231 ? 29.805  10.849  14.965 1.00 29.30 ? 231 ALA A C    1 
ATOM   2082 O O    . ALA A 1 231 ? 28.902  11.678  15.015 1.00 33.74 ? 231 ALA A O    1 
ATOM   2083 C CB   . ALA A 1 231 ? 29.183  8.747   16.151 1.00 26.93 ? 231 ALA A CB   1 
ATOM   2084 H H    . ALA A 1 231 ? 29.333  10.407  18.119 1.00 0.00  ? 231 ALA A H    1 
ATOM   2085 N N    . ASP A 1 232 ? 30.612  10.711  13.913 1.00 29.60 ? 232 ASP A N    1 
ATOM   2086 C CA   . ASP A 1 232 ? 30.457  11.469  12.664 1.00 30.77 ? 232 ASP A CA   1 
ATOM   2087 C C    . ASP A 1 232 ? 30.563  12.983  12.759 1.00 31.29 ? 232 ASP A C    1 
ATOM   2088 O O    . ASP A 1 232 ? 30.033  13.700  11.914 1.00 37.19 ? 232 ASP A O    1 
ATOM   2089 C CB   . ASP A 1 232 ? 29.146  11.089  11.974 1.00 36.99 ? 232 ASP A CB   1 
ATOM   2090 H H    . ASP A 1 232 ? 31.367  10.101  14.021 1.00 0.00  ? 232 ASP A H    1 
ATOM   2091 N N    . VAL A 1 233 ? 31.216  13.486  13.789 1.00 32.06 ? 233 VAL A N    1 
ATOM   2092 C CA   . VAL A 1 233 ? 31.365  14.924  13.912 1.00 26.65 ? 233 VAL A CA   1 
ATOM   2093 C C    . VAL A 1 233 ? 32.841  15.251  14.128 1.00 27.99 ? 233 VAL A C    1 
ATOM   2094 O O    . VAL A 1 233 ? 33.667  14.363  14.345 1.00 27.76 ? 233 VAL A O    1 
ATOM   2095 C CB   . VAL A 1 233 ? 30.533  15.504  15.093 1.00 25.71 ? 233 VAL A CB   1 
ATOM   2096 C CG1  . VAL A 1 233 ? 29.099  15.029  15.018 1.00 27.67 ? 233 VAL A CG1  1 
ATOM   2097 C CG2  . VAL A 1 233 ? 31.135  15.123  16.435 1.00 23.09 ? 233 VAL A CG2  1 
ATOM   2098 H H    . VAL A 1 233 ? 31.647  12.889  14.439 1.00 0.00  ? 233 VAL A H    1 
ATOM   2099 N N    . PRO A 1 234 ? 33.219  16.520  13.937 1.00 24.19 ? 234 PRO A N    1 
ATOM   2100 C CA   . PRO A 1 234 ? 34.610  16.904  14.136 1.00 21.19 ? 234 PRO A CA   1 
ATOM   2101 C C    . PRO A 1 234 ? 34.980  16.802  15.630 1.00 23.06 ? 234 PRO A C    1 
ATOM   2102 O O    . PRO A 1 234 ? 34.129  16.974  16.513 1.00 20.10 ? 234 PRO A O    1 
ATOM   2103 C CB   . PRO A 1 234 ? 34.638  18.354  13.658 1.00 21.79 ? 234 PRO A CB   1 
ATOM   2104 C CG   . PRO A 1 234 ? 33.566  18.386  12.607 1.00 20.59 ? 234 PRO A CG   1 
ATOM   2105 C CD   . PRO A 1 234 ? 32.464  17.587  13.243 1.00 24.24 ? 234 PRO A CD   1 
ATOM   2106 N N    . LEU A 1 235 ? 36.239  16.489  15.894 1.00 26.25 ? 235 LEU A N    1 
ATOM   2107 C CA   . LEU A 1 235 ? 36.764  16.369  17.253 1.00 21.10 ? 235 LEU A CA   1 
ATOM   2108 C C    . LEU A 1 235 ? 37.012  17.767  17.822 1.00 20.89 ? 235 LEU A C    1 
ATOM   2109 O O    . LEU A 1 235 ? 37.287  18.712  17.078 1.00 19.75 ? 235 LEU A O    1 
ATOM   2110 C CB   . LEU A 1 235 ? 38.089  15.599  17.224 1.00 20.02 ? 235 LEU A CB   1 
ATOM   2111 C CG   . LEU A 1 235 ? 38.941  15.542  18.498 1.00 17.06 ? 235 LEU A CG   1 
ATOM   2112 C CD1  . LEU A 1 235 ? 38.183  14.793  19.579 1.00 16.69 ? 235 LEU A CD1  1 
ATOM   2113 C CD2  . LEU A 1 235 ? 40.278  14.868  18.223 1.00 14.98 ? 235 LEU A CD2  1 
ATOM   2114 H H    . LEU A 1 235 ? 36.850  16.334  15.147 1.00 0.00  ? 235 LEU A H    1 
ATOM   2115 N N    . VAL A 1 236 ? 36.898  17.897  19.136 1.00 16.02 ? 236 VAL A N    1 
ATOM   2116 C CA   . VAL A 1 236 ? 37.147  19.166  19.801 1.00 11.11 ? 236 VAL A CA   1 
ATOM   2117 C C    . VAL A 1 236 ? 38.206  18.932  20.886 1.00 16.54 ? 236 VAL A C    1 
ATOM   2118 O O    . VAL A 1 236 ? 37.994  18.159  21.828 1.00 16.79 ? 236 VAL A O    1 
ATOM   2119 C CB   . VAL A 1 236 ? 35.880  19.729  20.490 1.00 7.06  ? 236 VAL A CB   1 
ATOM   2120 C CG1  . VAL A 1 236 ? 36.079  21.187  20.831 1.00 2.00  ? 236 VAL A CG1  1 
ATOM   2121 C CG2  . VAL A 1 236 ? 34.663  19.543  19.618 1.00 5.30  ? 236 VAL A CG2  1 
ATOM   2122 H H    . VAL A 1 236 ? 36.622  17.118  19.667 1.00 0.00  ? 236 VAL A H    1 
ATOM   2123 N N    . VAL A 1 237 ? 39.361  19.558  20.716 1.00 17.91 ? 237 VAL A N    1 
ATOM   2124 C CA   . VAL A 1 237 ? 40.450  19.461  21.675 1.00 16.62 ? 237 VAL A CA   1 
ATOM   2125 C C    . VAL A 1 237 ? 40.482  20.834  22.338 1.00 11.78 ? 237 VAL A C    1 
ATOM   2126 O O    . VAL A 1 237 ? 40.768  21.826  21.682 1.00 24.93 ? 237 VAL A O    1 
ATOM   2127 C CB   . VAL A 1 237 ? 41.775  19.181  20.955 1.00 17.24 ? 237 VAL A CB   1 
ATOM   2128 C CG1  . VAL A 1 237 ? 42.879  18.950  21.957 1.00 20.71 ? 237 VAL A CG1  1 
ATOM   2129 C CG2  . VAL A 1 237 ? 41.626  17.975  20.057 1.00 14.62 ? 237 VAL A CG2  1 
ATOM   2130 H H    . VAL A 1 237 ? 39.481  20.114  19.917 1.00 0.00  ? 237 VAL A H    1 
ATOM   2131 N N    . GLU A 1 238 ? 40.107  20.903  23.608 1.00 13.12 ? 238 GLU A N    1 
ATOM   2132 C CA   . GLU A 1 238 ? 40.055  22.173  24.311 1.00 14.32 ? 238 GLU A CA   1 
ATOM   2133 C C    . GLU A 1 238 ? 41.103  22.389  25.386 1.00 20.37 ? 238 GLU A C    1 
ATOM   2134 O O    . GLU A 1 238 ? 41.347  21.521  26.224 1.00 24.73 ? 238 GLU A O    1 
ATOM   2135 C CB   . GLU A 1 238 ? 38.673  22.402  24.928 1.00 15.77 ? 238 GLU A CB   1 
ATOM   2136 C CG   . GLU A 1 238 ? 38.622  23.615  25.859 1.00 20.44 ? 238 GLU A CG   1 
ATOM   2137 C CD   . GLU A 1 238 ? 37.235  23.935  26.383 1.00 26.38 ? 238 GLU A CD   1 
ATOM   2138 O OE1  . GLU A 1 238 ? 36.385  23.019  26.452 1.00 31.27 ? 238 GLU A OE1  1 
ATOM   2139 O OE2  . GLU A 1 238 ? 36.995  25.113  26.732 1.00 22.86 ? 238 GLU A OE2  1 
ATOM   2140 H H    . GLU A 1 238 ? 39.887  20.080  24.095 1.00 0.00  ? 238 GLU A H    1 
ATOM   2141 N N    . TYR A 1 239 ? 41.681  23.586  25.368 1.00 16.93 ? 239 TYR A N    1 
ATOM   2142 C CA   . TYR A 1 239 ? 42.689  23.999  26.319 1.00 15.01 ? 239 TYR A CA   1 
ATOM   2143 C C    . TYR A 1 239 ? 42.115  25.167  27.062 1.00 18.65 ? 239 TYR A C    1 
ATOM   2144 O O    . TYR A 1 239 ? 41.793  26.209  26.471 1.00 17.32 ? 239 TYR A O    1 
ATOM   2145 C CB   . TYR A 1 239 ? 43.973  24.396  25.606 1.00 10.82 ? 239 TYR A CB   1 
ATOM   2146 C CG   . TYR A 1 239 ? 44.643  23.234  24.912 1.00 10.04 ? 239 TYR A CG   1 
ATOM   2147 C CD1  . TYR A 1 239 ? 44.205  22.789  23.659 1.00 6.32  ? 239 TYR A CD1  1 
ATOM   2148 C CD2  . TYR A 1 239 ? 45.694  22.556  25.525 1.00 2.00  ? 239 TYR A CD2  1 
ATOM   2149 C CE1  . TYR A 1 239 ? 44.803  21.685  23.042 1.00 6.34  ? 239 TYR A CE1  1 
ATOM   2150 C CE2  . TYR A 1 239 ? 46.288  21.462  24.924 1.00 3.85  ? 239 TYR A CE2  1 
ATOM   2151 C CZ   . TYR A 1 239 ? 45.841  21.031  23.690 1.00 3.02  ? 239 TYR A CZ   1 
ATOM   2152 O OH   . TYR A 1 239 ? 46.436  19.937  23.123 1.00 10.85 ? 239 TYR A OH   1 
ATOM   2153 H H    . TYR A 1 239 ? 41.413  24.224  24.675 1.00 0.00  ? 239 TYR A H    1 
ATOM   2154 H HH   . TYR A 1 239 ? 47.166  19.655  23.684 1.00 0.00  ? 239 TYR A HH   1 
ATOM   2155 N N    . LYS A 1 240 ? 41.877  24.972  28.349 1.00 25.13 ? 240 LYS A N    1 
ATOM   2156 C CA   . LYS A 1 240 ? 41.334  26.046  29.168 1.00 28.93 ? 240 LYS A CA   1 
ATOM   2157 C C    . LYS A 1 240 ? 42.453  26.951  29.611 1.00 31.76 ? 240 LYS A C    1 
ATOM   2158 O O    . LYS A 1 240 ? 43.397  26.522  30.282 1.00 37.84 ? 240 LYS A O    1 
ATOM   2159 C CB   . LYS A 1 240 ? 40.613  25.470  30.396 1.00 28.99 ? 240 LYS A CB   1 
ATOM   2160 C CG   . LYS A 1 240 ? 39.565  24.437  30.077 1.00 33.39 ? 240 LYS A CG   1 
ATOM   2161 C CD   . LYS A 1 240 ? 38.244  25.054  29.662 1.00 36.37 ? 240 LYS A CD   1 
ATOM   2162 C CE   . LYS A 1 240 ? 37.141  24.008  29.731 1.00 38.48 ? 240 LYS A CE   1 
ATOM   2163 N NZ   . LYS A 1 240 ? 35.802  24.624  29.551 1.00 42.61 ? 240 LYS A NZ   1 
ATOM   2164 H H    . LYS A 1 240 ? 42.061  24.115  28.754 1.00 0.00  ? 240 LYS A H    1 
ATOM   2165 H HZ1  . LYS A 1 240 ? 35.642  25.343  30.290 1.00 0.00  ? 240 LYS A HZ1  1 
ATOM   2166 H HZ2  . LYS A 1 240 ? 35.753  25.065  28.610 1.00 0.00  ? 240 LYS A HZ2  1 
ATOM   2167 H HZ3  . LYS A 1 240 ? 35.066  23.887  29.627 1.00 0.00  ? 240 LYS A HZ3  1 
ATOM   2168 N N    . ILE A 1 241 ? 42.413  28.195  29.167 1.00 31.75 ? 241 ILE A N    1 
ATOM   2169 C CA   . ILE A 1 241 ? 43.396  29.188  29.618 1.00 26.79 ? 241 ILE A CA   1 
ATOM   2170 C C    . ILE A 1 241 ? 42.848  29.614  30.985 1.00 24.14 ? 241 ILE A C    1 
ATOM   2171 O O    . ILE A 1 241 ? 41.766  30.202  31.101 1.00 21.52 ? 241 ILE A O    1 
ATOM   2172 C CB   . ILE A 1 241 ? 43.447  30.320  28.573 1.00 23.52 ? 241 ILE A CB   1 
ATOM   2173 C CG1  . ILE A 1 241 ? 43.785  29.766  27.193 1.00 14.52 ? 241 ILE A CG1  1 
ATOM   2174 C CG2  . ILE A 1 241 ? 44.467  31.370  28.957 1.00 26.67 ? 241 ILE A CG2  1 
ATOM   2175 C CD1  . ILE A 1 241 ? 43.739  30.747  26.079 1.00 15.15 ? 241 ILE A CD1  1 
ATOM   2176 H H    . ILE A 1 241 ? 41.690  28.444  28.520 1.00 0.00  ? 241 ILE A H    1 
ATOM   2177 N N    . ALA A 1 242 ? 43.628  29.337  32.021 1.00 30.95 ? 242 ALA A N    1 
ATOM   2178 C CA   . ALA A 1 242 ? 43.243  29.602  33.421 1.00 33.20 ? 242 ALA A CA   1 
ATOM   2179 C C    . ALA A 1 242 ? 42.650  30.960  33.688 1.00 39.03 ? 242 ALA A C    1 
ATOM   2180 O O    . ALA A 1 242 ? 43.351  31.959  33.586 1.00 47.18 ? 242 ALA A O    1 
ATOM   2181 C CB   . ALA A 1 242 ? 44.429  29.333  34.338 1.00 38.52 ? 242 ALA A CB   1 
ATOM   2182 H H    . ALA A 1 242 ? 44.545  29.139  31.826 1.00 0.00  ? 242 ALA A H    1 
ATOM   2183 N N    . ASP A 1 243 ? 41.371  30.963  34.069 1.00 41.54 ? 243 ASP A N    1 
ATOM   2184 C CA   . ASP A 1 243 ? 40.635  32.196  34.402 1.00 50.19 ? 243 ASP A CA   1 
ATOM   2185 C C    . ASP A 1 243 ? 40.737  33.295  33.348 1.00 47.02 ? 243 ASP A C    1 
ATOM   2186 O O    . ASP A 1 243 ? 40.808  34.487  33.644 1.00 52.79 ? 243 ASP A O    1 
ATOM   2187 C CB   . ASP A 1 243 ? 41.021  32.720  35.788 1.00 59.96 ? 243 ASP A CB   1 
ATOM   2188 C CG   . ASP A 1 243 ? 40.096  33.837  36.277 1.00 71.97 ? 243 ASP A CG   1 
ATOM   2189 O OD1  . ASP A 1 243 ? 39.122  34.217  35.557 1.00 73.58 ? 243 ASP A OD1  1 
ATOM   2190 O OD2  . ASP A 1 243 ? 40.346  34.333  37.405 1.00 78.11 ? 243 ASP A OD2  1 
ATOM   2191 H H    . ASP A 1 243 ? 40.915  30.127  34.073 1.00 0.00  ? 243 ASP A H    1 
ATOM   2192 N N    . MET A 1 244 ? 40.768  32.869  32.099 1.00 41.47 ? 244 MET A N    1 
ATOM   2193 C CA   . MET A 1 244 ? 40.829  33.800  30.994 1.00 31.58 ? 244 MET A CA   1 
ATOM   2194 C C    . MET A 1 244 ? 39.690  33.365  30.097 1.00 28.80 ? 244 MET A C    1 
ATOM   2195 O O    . MET A 1 244 ? 38.760  34.119  29.849 1.00 34.42 ? 244 MET A O    1 
ATOM   2196 C CB   . MET A 1 244 ? 42.163  33.708  30.274 1.00 33.05 ? 244 MET A CB   1 
ATOM   2197 C CG   . MET A 1 244 ? 43.050  34.841  30.623 1.00 34.05 ? 244 MET A CG   1 
ATOM   2198 S SD   . MET A 1 244 ? 42.145  36.319  30.289 1.00 44.38 ? 244 MET A SD   1 
ATOM   2199 C CE   . MET A 1 244 ? 42.880  36.803  28.764 1.00 47.55 ? 244 MET A CE   1 
ATOM   2200 H H    . MET A 1 244 ? 40.810  31.920  31.886 1.00 0.00  ? 244 MET A H    1 
ATOM   2201 N N    . GLY A 1 245 ? 39.767  32.118  29.655 1.00 21.28 ? 245 GLY A N    1 
ATOM   2202 C CA   . GLY A 1 245 ? 38.755  31.558  28.798 1.00 18.57 ? 245 GLY A CA   1 
ATOM   2203 C C    . GLY A 1 245 ? 39.226  30.196  28.341 1.00 23.17 ? 245 GLY A C    1 
ATOM   2204 O O    . GLY A 1 245 ? 39.442  29.295  29.153 1.00 27.38 ? 245 GLY A O    1 
ATOM   2205 H H    . GLY A 1 245 ? 40.519  31.558  29.956 1.00 0.00  ? 245 GLY A H    1 
ATOM   2206 N N    . HIS A 1 246 ? 39.450  30.055  27.045 1.00 19.65 ? 246 HIS A N    1 
ATOM   2207 C CA   . HIS A 1 246 ? 39.888  28.781  26.507 1.00 15.83 ? 246 HIS A CA   1 
ATOM   2208 C C    . HIS A 1 246 ? 40.324  28.966  25.068 1.00 16.56 ? 246 HIS A C    1 
ATOM   2209 O O    . HIS A 1 246 ? 40.203  30.055  24.514 1.00 21.21 ? 246 HIS A O    1 
ATOM   2210 C CB   . HIS A 1 246 ? 38.733  27.793  26.555 1.00 10.93 ? 246 HIS A CB   1 
ATOM   2211 C CG   . HIS A 1 246 ? 37.551  28.211  25.734 1.00 11.70 ? 246 HIS A CG   1 
ATOM   2212 N ND1  . HIS A 1 246 ? 36.376  28.639  26.290 1.00 16.23 ? 246 HIS A ND1  1 
ATOM   2213 C CD2  . HIS A 1 246 ? 37.396  28.294  24.389 1.00 13.93 ? 246 HIS A CD2  1 
ATOM   2214 C CE1  . HIS A 1 246 ? 35.531  28.978  25.327 1.00 15.79 ? 246 HIS A CE1  1 
ATOM   2215 N NE2  . HIS A 1 246 ? 36.125  28.777  24.169 1.00 17.73 ? 246 HIS A NE2  1 
ATOM   2216 H H    . HIS A 1 246 ? 39.317  30.812  26.446 1.00 0.00  ? 246 HIS A H    1 
ATOM   2217 H HD1  . HIS A 1 246 ? 36.182  28.698  27.248 1.00 0.00  ? 246 HIS A HD1  1 
ATOM   2218 H HE2  . HIS A 1 246 ? 35.718  28.941  23.294 1.00 0.00  ? 246 HIS A HE2  1 
ATOM   2219 N N    . LEU A 1 247 ? 40.811  27.885  24.476 1.00 16.30 ? 247 LEU A N    1 
ATOM   2220 C CA   . LEU A 1 247 ? 41.250  27.845  23.087 1.00 16.63 ? 247 LEU A CA   1 
ATOM   2221 C C    . LEU A 1 247 ? 40.829  26.448  22.650 1.00 22.11 ? 247 LEU A C    1 
ATOM   2222 O O    . LEU A 1 247 ? 41.129  25.460  23.331 1.00 27.42 ? 247 LEU A O    1 
ATOM   2223 C CB   . LEU A 1 247 ? 42.771  28.022  23.004 1.00 12.39 ? 247 LEU A CB   1 
ATOM   2224 C CG   . LEU A 1 247 ? 43.524  27.899  21.675 1.00 13.54 ? 247 LEU A CG   1 
ATOM   2225 C CD1  . LEU A 1 247 ? 42.937  28.790  20.619 1.00 14.88 ? 247 LEU A CD1  1 
ATOM   2226 C CD2  . LEU A 1 247 ? 44.975  28.249  21.900 1.00 15.91 ? 247 LEU A CD2  1 
ATOM   2227 H H    . LEU A 1 247 ? 40.893  27.052  24.985 1.00 0.00  ? 247 LEU A H    1 
ATOM   2228 N N    . LYS A 1 248 ? 40.032  26.373  21.594 1.00 17.34 ? 248 LYS A N    1 
ATOM   2229 C CA   . LYS A 1 248 ? 39.567  25.087  21.107 1.00 14.31 ? 248 LYS A CA   1 
ATOM   2230 C C    . LYS A 1 248 ? 40.013  24.850  19.679 1.00 14.31 ? 248 LYS A C    1 
ATOM   2231 O O    . LYS A 1 248 ? 40.103  25.785  18.886 1.00 24.50 ? 248 LYS A O    1 
ATOM   2232 C CB   . LYS A 1 248 ? 38.047  25.014  21.151 1.00 8.77  ? 248 LYS A CB   1 
ATOM   2233 C CG   . LYS A 1 248 ? 37.434  25.124  22.516 1.00 13.56 ? 248 LYS A CG   1 
ATOM   2234 C CD   . LYS A 1 248 ? 35.920  25.063  22.388 1.00 21.44 ? 248 LYS A CD   1 
ATOM   2235 C CE   . LYS A 1 248 ? 35.231  25.283  23.723 1.00 28.92 ? 248 LYS A CE   1 
ATOM   2236 N NZ   . LYS A 1 248 ? 33.747  25.206  23.611 1.00 30.21 ? 248 LYS A NZ   1 
ATOM   2237 H H    . LYS A 1 248 ? 39.756  27.186  21.123 1.00 0.00  ? 248 LYS A H    1 
ATOM   2238 H HZ1  . LYS A 1 248 ? 33.410  25.925  22.942 1.00 0.00  ? 248 LYS A HZ1  1 
ATOM   2239 H HZ2  . LYS A 1 248 ? 33.479  24.257  23.286 1.00 0.00  ? 248 LYS A HZ2  1 
ATOM   2240 H HZ3  . LYS A 1 248 ? 33.333  25.383  24.548 1.00 0.00  ? 248 LYS A HZ3  1 
ATOM   2241 N N    . TYR A 1 249 ? 40.291  23.593  19.365 1.00 11.85 ? 249 TYR A N    1 
ATOM   2242 C CA   . TYR A 1 249 ? 40.692  23.188  18.033 1.00 7.52  ? 249 TYR A CA   1 
ATOM   2243 C C    . TYR A 1 249 ? 39.717  22.103  17.583 1.00 10.43 ? 249 TYR A C    1 
ATOM   2244 O O    . TYR A 1 249 ? 39.510  21.127  18.304 1.00 14.79 ? 249 TYR A O    1 
ATOM   2245 C CB   . TYR A 1 249 ? 42.089  22.580  18.052 1.00 8.78  ? 249 TYR A CB   1 
ATOM   2246 C CG   . TYR A 1 249 ? 43.219  23.493  18.474 1.00 11.35 ? 249 TYR A CG   1 
ATOM   2247 C CD1  . TYR A 1 249 ? 43.904  24.271  17.538 1.00 5.56  ? 249 TYR A CD1  1 
ATOM   2248 C CD2  . TYR A 1 249 ? 43.653  23.523  19.796 1.00 7.91  ? 249 TYR A CD2  1 
ATOM   2249 C CE1  . TYR A 1 249 ? 44.992  25.048  17.913 1.00 6.23  ? 249 TYR A CE1  1 
ATOM   2250 C CE2  . TYR A 1 249 ? 44.745  24.298  20.179 1.00 5.60  ? 249 TYR A CE2  1 
ATOM   2251 C CZ   . TYR A 1 249 ? 45.408  25.057  19.238 1.00 8.36  ? 249 TYR A CZ   1 
ATOM   2252 O OH   . TYR A 1 249 ? 46.496  25.822  19.619 1.00 14.37 ? 249 TYR A OH   1 
ATOM   2253 H H    . TYR A 1 249 ? 40.228  22.892  20.046 1.00 0.00  ? 249 TYR A H    1 
ATOM   2254 H HH   . TYR A 1 249 ? 47.013  26.062  18.837 1.00 0.00  ? 249 TYR A HH   1 
ATOM   2255 N N    . TYR A 1 250 ? 39.080  22.298  16.433 1.00 8.05  ? 250 TYR A N    1 
ATOM   2256 C CA   . TYR A 1 250 ? 38.170  21.310  15.876 1.00 4.17  ? 250 TYR A CA   1 
ATOM   2257 C C    . TYR A 1 250 ? 38.913  20.640  14.739 1.00 8.67  ? 250 TYR A C    1 
ATOM   2258 O O    . TYR A 1 250 ? 39.657  21.305  14.008 1.00 8.75  ? 250 TYR A O    1 
ATOM   2259 C CB   . TYR A 1 250 ? 36.917  21.967  15.314 1.00 6.58  ? 250 TYR A CB   1 
ATOM   2260 C CG   . TYR A 1 250 ? 36.028  22.587  16.349 1.00 9.34  ? 250 TYR A CG   1 
ATOM   2261 C CD1  . TYR A 1 250 ? 36.379  23.782  16.960 1.00 9.36  ? 250 TYR A CD1  1 
ATOM   2262 C CD2  . TYR A 1 250 ? 34.832  21.981  16.718 1.00 9.49  ? 250 TYR A CD2  1 
ATOM   2263 C CE1  . TYR A 1 250 ? 35.569  24.363  17.915 1.00 13.48 ? 250 TYR A CE1  1 
ATOM   2264 C CE2  . TYR A 1 250 ? 34.013  22.555  17.676 1.00 17.94 ? 250 TYR A CE2  1 
ATOM   2265 C CZ   . TYR A 1 250 ? 34.394  23.748  18.269 1.00 15.09 ? 250 TYR A CZ   1 
ATOM   2266 O OH   . TYR A 1 250 ? 33.602  24.314  19.227 1.00 23.26 ? 250 TYR A OH   1 
ATOM   2267 H H    . TYR A 1 250 ? 39.235  23.093  15.929 1.00 0.00  ? 250 TYR A H    1 
ATOM   2268 H HH   . TYR A 1 250 ? 33.659  25.279  19.211 1.00 0.00  ? 250 TYR A HH   1 
ATOM   2269 N N    . LEU A 1 251 ? 38.701  19.336  14.581 1.00 10.94 ? 251 LEU A N    1 
ATOM   2270 C CA   . LEU A 1 251 ? 39.351  18.565  13.523 1.00 11.83 ? 251 LEU A CA   1 
ATOM   2271 C C    . LEU A 1 251 ? 38.323  17.701  12.812 1.00 16.79 ? 251 LEU A C    1 
ATOM   2272 O O    . LEU A 1 251 ? 37.667  16.872  13.446 1.00 20.08 ? 251 LEU A O    1 
ATOM   2273 C CB   . LEU A 1 251 ? 40.446  17.672  14.115 1.00 10.78 ? 251 LEU A CB   1 
ATOM   2274 C CG   . LEU A 1 251 ? 41.194  16.755  13.139 1.00 11.04 ? 251 LEU A CG   1 
ATOM   2275 C CD1  . LEU A 1 251 ? 41.795  17.571  12.000 1.00 10.81 ? 251 LEU A CD1  1 
ATOM   2276 C CD2  . LEU A 1 251 ? 42.271  15.983  13.872 1.00 2.19  ? 251 LEU A CD2  1 
ATOM   2277 H H    . LEU A 1 251 ? 38.088  18.880  15.194 1.00 0.00  ? 251 LEU A H    1 
ATOM   2278 N N    . ALA A 1 252 ? 38.179  17.912  11.503 1.00 22.81 ? 252 ALA A N    1 
ATOM   2279 C CA   . ALA A 1 252 ? 37.240  17.158  10.674 1.00 19.68 ? 252 ALA A CA   1 
ATOM   2280 C C    . ALA A 1 252 ? 37.688  15.705  10.642 1.00 22.57 ? 252 ALA A C    1 
ATOM   2281 O O    . ALA A 1 252 ? 38.863  15.418  10.382 1.00 23.14 ? 252 ALA A O    1 
ATOM   2282 C CB   . ALA A 1 252 ? 37.214  17.728  9.270  1.00 19.38 ? 252 ALA A CB   1 
ATOM   2283 H H    . ALA A 1 252 ? 38.738  18.588  11.064 1.00 0.00  ? 252 ALA A H    1 
ATOM   2284 N N    . PRO A 1 253 ? 36.769  14.759  10.895 1.00 25.83 ? 253 PRO A N    1 
ATOM   2285 C CA   . PRO A 1 253 ? 37.075  13.339  10.903 1.00 26.73 ? 253 PRO A CA   1 
ATOM   2286 C C    . PRO A 1 253 ? 37.265  12.788  9.487  1.00 28.80 ? 253 PRO A C    1 
ATOM   2287 O O    . PRO A 1 253 ? 36.826  13.398  8.512  1.00 23.58 ? 253 PRO A O    1 
ATOM   2288 C CB   . PRO A 1 253 ? 35.847  12.736  11.571 1.00 25.44 ? 253 PRO A CB   1 
ATOM   2289 C CG   . PRO A 1 253 ? 34.769  13.552  10.997 1.00 24.19 ? 253 PRO A CG   1 
ATOM   2290 C CD   . PRO A 1 253 ? 35.316  14.965  11.088 1.00 26.10 ? 253 PRO A CD   1 
ATOM   2291 N N    . LYS A 1 254 ? 37.909  11.641  9.371  1.00 27.68 ? 254 LYS A N    1 
ATOM   2292 C CA   . LYS A 1 254 ? 38.115  11.055  8.067  1.00 29.70 ? 254 LYS A CA   1 
ATOM   2293 C C    . LYS A 1 254 ? 37.027  10.053  7.680  1.00 37.41 ? 254 LYS A C    1 
ATOM   2294 O O    . LYS A 1 254 ? 36.577  9.238   8.502  1.00 35.99 ? 254 LYS A O    1 
ATOM   2295 C CB   . LYS A 1 254 ? 39.499  10.428  7.992  1.00 25.91 ? 254 LYS A CB   1 
ATOM   2296 C CG   . LYS A 1 254 ? 40.628  11.445  8.133  1.00 30.68 ? 254 LYS A CG   1 
ATOM   2297 C CD   . LYS A 1 254 ? 42.004  10.818  7.901  1.00 25.38 ? 254 LYS A CD   1 
ATOM   2298 C CE   . LYS A 1 254 ? 42.159  10.283  6.493  1.00 24.47 ? 254 LYS A CE   1 
ATOM   2299 N NZ   . LYS A 1 254 ? 43.127  11.061  5.673  1.00 31.06 ? 254 LYS A NZ   1 
ATOM   2300 H H    . LYS A 1 254 ? 38.237  11.163  10.175 1.00 0.00  ? 254 LYS A H    1 
ATOM   2301 H HZ1  . LYS A 1 254 ? 42.914  12.074  5.574  1.00 0.00  ? 254 LYS A HZ1  1 
ATOM   2302 H HZ2  . LYS A 1 254 ? 44.048  10.925  6.129  1.00 0.00  ? 254 LYS A HZ2  1 
ATOM   2303 H HZ3  . LYS A 1 254 ? 43.155  10.635  4.722  1.00 0.00  ? 254 LYS A HZ3  1 
ATOM   2304 N N    . ILE A 1 255 ? 36.581  10.192  6.431  1.00 44.98 ? 255 ILE A N    1 
ATOM   2305 C CA   . ILE A 1 255 ? 35.578  9.357   5.792  1.00 43.22 ? 255 ILE A CA   1 
ATOM   2306 C C    . ILE A 1 255 ? 34.166  9.747   6.163  1.00 45.31 ? 255 ILE A C    1 
ATOM   2307 O O    . ILE A 1 255 ? 33.298  9.772   5.303  1.00 52.76 ? 255 ILE A O    1 
ATOM   2308 C CB   . ILE A 1 255 ? 35.833  7.889   6.078  1.00 39.34 ? 255 ILE A CB   1 
ATOM   2309 H H    . ILE A 1 255 ? 36.855  10.981  5.978  1.00 0.00  ? 255 ILE A H    1 
ATOM   2310 N N    . ARG B 2 5   ? 38.496  9.200   3.724  1.00 45.06 ? 143 ARG B N    1 
ATOM   2311 C CA   . ARG B 2 5   ? 38.387  10.446  2.974  1.00 43.42 ? 143 ARG B CA   1 
ATOM   2312 C C    . ARG B 2 5   ? 38.316  11.634  3.921  1.00 38.75 ? 143 ARG B C    1 
ATOM   2313 O O    . ARG B 2 5   ? 37.317  11.832  4.602  1.00 34.10 ? 143 ARG B O    1 
ATOM   2314 C CB   . ARG B 2 5   ? 37.157  10.419  2.076  1.00 42.85 ? 143 ARG B CB   1 
ATOM   2315 H H    . ARG B 2 5   ? 37.696  8.650   3.867  1.00 0.00  ? 143 ARG B H    1 
ATOM   2316 N N    . GLN B 2 6   ? 39.371  12.436  3.943  1.00 36.04 ? 144 GLN B N    1 
ATOM   2317 C CA   . GLN B 2 6   ? 39.427  13.604  4.808  1.00 32.11 ? 144 GLN B CA   1 
ATOM   2318 C C    . GLN B 2 6   ? 38.277  14.549  4.522  1.00 34.25 ? 144 GLN B C    1 
ATOM   2319 O O    . GLN B 2 6   ? 38.139  15.051  3.405  1.00 43.21 ? 144 GLN B O    1 
ATOM   2320 C CB   . GLN B 2 6   ? 40.740  14.350  4.603  1.00 31.07 ? 144 GLN B CB   1 
ATOM   2321 C CG   . GLN B 2 6   ? 40.857  15.599  5.430  1.00 26.56 ? 144 GLN B CG   1 
ATOM   2322 C CD   . GLN B 2 6   ? 40.793  15.301  6.896  1.00 26.86 ? 144 GLN B CD   1 
ATOM   2323 O OE1  . GLN B 2 6   ? 41.787  14.914  7.501  1.00 32.13 ? 144 GLN B OE1  1 
ATOM   2324 N NE2  . GLN B 2 6   ? 39.623  15.475  7.484  1.00 31.24 ? 144 GLN B NE2  1 
ATOM   2325 H H    . GLN B 2 6   ? 40.115  12.254  3.338  1.00 0.00  ? 144 GLN B H    1 
ATOM   2326 H HE21 . GLN B 2 6   ? 39.567  15.277  8.443  1.00 0.00  ? 144 GLN B HE21 1 
ATOM   2327 H HE22 . GLN B 2 6   ? 38.865  15.807  6.964  1.00 0.00  ? 144 GLN B HE22 1 
ATOM   2328 N N    . THR B 2 7   ? 37.448  14.787  5.528  1.00 31.18 ? 145 THR B N    1 
ATOM   2329 C CA   . THR B 2 7   ? 36.317  15.690  5.368  1.00 25.75 ? 145 THR B CA   1 
ATOM   2330 C C    . THR B 2 7   ? 36.767  17.094  5.773  1.00 25.26 ? 145 THR B C    1 
ATOM   2331 O O    . THR B 2 7   ? 37.888  17.266  6.250  1.00 28.54 ? 145 THR B O    1 
ATOM   2332 C CB   . THR B 2 7   ? 35.172  15.262  6.268  1.00 23.06 ? 145 THR B CB   1 
ATOM   2333 O OG1  . THR B 2 7   ? 35.560  15.440  7.635  1.00 29.75 ? 145 THR B OG1  1 
ATOM   2334 C CG2  . THR B 2 7   ? 34.839  13.798  6.036  1.00 23.66 ? 145 THR B CG2  1 
ATOM   2335 H H    . THR B 2 7   ? 37.589  14.344  6.389  1.00 0.00  ? 145 THR B H    1 
ATOM   2336 H HG1  . THR B 2 7   ? 36.348  14.921  7.777  1.00 0.00  ? 145 THR B HG1  1 
ATOM   2337 N N    . SER B 2 8   ? 35.913  18.094  5.581  1.00 22.39 ? 146 SER B N    1 
ATOM   2338 C CA   . SER B 2 8   ? 36.270  19.450  5.972  1.00 18.84 ? 146 SER B CA   1 
ATOM   2339 C C    . SER B 2 8   ? 35.207  19.995  6.897  1.00 18.91 ? 146 SER B C    1 
ATOM   2340 O O    . SER B 2 8   ? 34.051  19.577  6.840  1.00 18.32 ? 146 SER B O    1 
ATOM   2341 C CB   . SER B 2 8   ? 36.433  20.369  4.761  1.00 19.65 ? 146 SER B CB   1 
ATOM   2342 O OG   . SER B 2 8   ? 35.203  20.596  4.109  1.00 25.12 ? 146 SER B OG   1 
ATOM   2343 H H    . SER B 2 8   ? 35.028  17.936  5.217  1.00 0.00  ? 146 SER B H    1 
ATOM   2344 H HG   . SER B 2 8   ? 35.039  19.829  3.559  1.00 0.00  ? 146 SER B HG   1 
ATOM   2345 N N    . MET B 2 9   ? 35.599  20.954  7.725  1.00 17.82 ? 147 MET B N    1 
ATOM   2346 C CA   . MET B 2 9   ? 34.699  21.564  8.685  1.00 13.11 ? 147 MET B CA   1 
ATOM   2347 C C    . MET B 2 9   ? 33.401  22.099  8.066  1.00 13.38 ? 147 MET B C    1 
ATOM   2348 O O    . MET B 2 9   ? 32.318  22.014  8.662  1.00 9.62  ? 147 MET B O    1 
ATOM   2349 C CB   . MET B 2 9   ? 35.432  22.673  9.435  1.00 12.71 ? 147 MET B CB   1 
ATOM   2350 C CG   . MET B 2 9   ? 36.563  22.188  10.309 1.00 6.64  ? 147 MET B CG   1 
ATOM   2351 S SD   . MET B 2 9   ? 35.973  21.020  11.518 1.00 14.91 ? 147 MET B SD   1 
ATOM   2352 C CE   . MET B 2 9   ? 34.773  22.050  12.418 1.00 6.83  ? 147 MET B CE   1 
ATOM   2353 H H    . MET B 2 9   ? 36.531  21.260  7.673  1.00 0.00  ? 147 MET B H    1 
ATOM   2354 N N    . THR B 2 10  ? 33.506  22.623  6.856  1.00 13.38 ? 148 THR B N    1 
ATOM   2355 C CA   . THR B 2 10  ? 32.348  23.161  6.166  1.00 18.84 ? 148 THR B CA   1 
ATOM   2356 C C    . THR B 2 10  ? 31.303  22.102  5.765  1.00 21.45 ? 148 THR B C    1 
ATOM   2357 O O    . THR B 2 10  ? 30.282  22.428  5.164  1.00 32.00 ? 148 THR B O    1 
ATOM   2358 C CB   . THR B 2 10  ? 32.786  23.966  4.935  1.00 16.47 ? 148 THR B CB   1 
ATOM   2359 O OG1  . THR B 2 10  ? 33.822  23.257  4.241  1.00 23.00 ? 148 THR B OG1  1 
ATOM   2360 C CG2  . THR B 2 10  ? 33.313  25.316  5.358  1.00 12.71 ? 148 THR B CG2  1 
ATOM   2361 H H    . THR B 2 10  ? 34.365  22.648  6.385  1.00 0.00  ? 148 THR B H    1 
ATOM   2362 H HG1  . THR B 2 10  ? 33.552  22.376  3.969  1.00 0.00  ? 148 THR B HG1  1 
ATOM   2363 N N    . ASP B 2 11  ? 31.568  20.839  6.073  1.00 22.84 ? 149 ASP B N    1 
ATOM   2364 C CA   . ASP B 2 11  ? 30.642  19.761  5.749  1.00 22.38 ? 149 ASP B CA   1 
ATOM   2365 C C    . ASP B 2 11  ? 29.707  19.498  6.910  1.00 25.27 ? 149 ASP B C    1 
ATOM   2366 O O    . ASP B 2 11  ? 28.683  18.831  6.762  1.00 31.06 ? 149 ASP B O    1 
ATOM   2367 C CB   . ASP B 2 11  ? 31.414  18.475  5.463  1.00 24.72 ? 149 ASP B CB   1 
ATOM   2368 C CG   . ASP B 2 11  ? 32.356  18.609  4.289  1.00 30.49 ? 149 ASP B CG   1 
ATOM   2369 O OD1  . ASP B 2 11  ? 32.233  19.611  3.542  1.00 33.21 ? 149 ASP B OD1  1 
ATOM   2370 O OD2  . ASP B 2 11  ? 33.214  17.709  4.110  1.00 30.73 ? 149 ASP B OD2  1 
ATOM   2371 H H    . ASP B 2 11  ? 32.411  20.598  6.511  1.00 0.00  ? 149 ASP B H    1 
ATOM   2372 N N    . PHE B 2 12  ? 30.066  20.025  8.070  1.00 25.16 ? 150 PHE B N    1 
ATOM   2373 C CA   . PHE B 2 12  ? 29.287  19.796  9.265  1.00 16.45 ? 150 PHE B CA   1 
ATOM   2374 C C    . PHE B 2 12  ? 28.615  21.024  9.813  1.00 19.83 ? 150 PHE B C    1 
ATOM   2375 O O    . PHE B 2 12  ? 27.583  20.900  10.470 1.00 16.84 ? 150 PHE B O    1 
ATOM   2376 C CB   . PHE B 2 12  ? 30.182  19.180  10.327 1.00 14.34 ? 150 PHE B CB   1 
ATOM   2377 C CG   . PHE B 2 12  ? 30.994  18.026  9.825  1.00 14.95 ? 150 PHE B CG   1 
ATOM   2378 C CD1  . PHE B 2 12  ? 32.145  18.244  9.084  1.00 16.51 ? 150 PHE B CD1  1 
ATOM   2379 C CD2  . PHE B 2 12  ? 30.612  16.720  10.097 1.00 16.71 ? 150 PHE B CD2  1 
ATOM   2380 C CE1  . PHE B 2 12  ? 32.905  17.186  8.624  1.00 16.08 ? 150 PHE B CE1  1 
ATOM   2381 C CE2  . PHE B 2 12  ? 31.371  15.650  9.639  1.00 17.00 ? 150 PHE B CE2  1 
ATOM   2382 C CZ   . PHE B 2 12  ? 32.518  15.886  8.902  1.00 16.58 ? 150 PHE B CZ   1 
ATOM   2383 H H    . PHE B 2 12  ? 30.877  20.567  8.112  1.00 0.00  ? 150 PHE B H    1 
ATOM   2384 N N    . TYR B 2 13  ? 29.197  22.200  9.566  1.00 21.83 ? 151 TYR B N    1 
ATOM   2385 C CA   . TYR B 2 13  ? 28.626  23.451  10.073 1.00 22.13 ? 151 TYR B CA   1 
ATOM   2386 C C    . TYR B 2 13  ? 28.365  24.524  9.025  1.00 24.18 ? 151 TYR B C    1 
ATOM   2387 O O    . TYR B 2 13  ? 29.122  24.689  8.071  1.00 30.09 ? 151 TYR B O    1 
ATOM   2388 C CB   . TYR B 2 13  ? 29.488  24.031  11.195 1.00 16.08 ? 151 TYR B CB   1 
ATOM   2389 C CG   . TYR B 2 13  ? 29.722  23.061  12.314 1.00 15.59 ? 151 TYR B CG   1 
ATOM   2390 C CD1  . TYR B 2 13  ? 28.659  22.523  13.024 1.00 15.18 ? 151 TYR B CD1  1 
ATOM   2391 C CD2  . TYR B 2 13  ? 31.010  22.663  12.652 1.00 18.19 ? 151 TYR B CD2  1 
ATOM   2392 C CE1  . TYR B 2 13  ? 28.867  21.610  14.045 1.00 17.57 ? 151 TYR B CE1  1 
ATOM   2393 C CE2  . TYR B 2 13  ? 31.235  21.751  13.673 1.00 19.35 ? 151 TYR B CE2  1 
ATOM   2394 C CZ   . TYR B 2 13  ? 30.161  21.228  14.367 1.00 21.55 ? 151 TYR B CZ   1 
ATOM   2395 O OH   . TYR B 2 13  ? 30.376  20.334  15.396 1.00 25.65 ? 151 TYR B OH   1 
ATOM   2396 H H    . TYR B 2 13  ? 30.019  22.251  9.028  1.00 0.00  ? 151 TYR B H    1 
ATOM   2397 H HH   . TYR B 2 13  ? 31.314  20.240  15.619 1.00 0.00  ? 151 TYR B HH   1 
ATOM   2398 N N    . HIS B 2 14  ? 27.291  25.270  9.255  1.00 26.85 ? 152 HIS B N    1 
ATOM   2399 C CA   . HIS B 2 14  ? 26.843  26.351  8.386  1.00 28.89 ? 152 HIS B CA   1 
ATOM   2400 C C    . HIS B 2 14  ? 27.860  27.492  8.389  1.00 31.13 ? 152 HIS B C    1 
ATOM   2401 O O    . HIS B 2 14  ? 28.240  27.976  9.447  1.00 32.21 ? 152 HIS B O    1 
ATOM   2402 C CB   . HIS B 2 14  ? 25.482  26.844  8.889  1.00 30.18 ? 152 HIS B CB   1 
ATOM   2403 C CG   . HIS B 2 14  ? 25.013  28.110  8.251  1.00 30.90 ? 152 HIS B CG   1 
ATOM   2404 N ND1  . HIS B 2 14  ? 24.364  28.136  7.036  1.00 29.74 ? 152 HIS B ND1  1 
ATOM   2405 C CD2  . HIS B 2 14  ? 25.067  29.399  8.675  1.00 29.52 ? 152 HIS B CD2  1 
ATOM   2406 C CE1  . HIS B 2 14  ? 24.036  29.380  6.738  1.00 31.07 ? 152 HIS B CE1  1 
ATOM   2407 N NE2  . HIS B 2 14  ? 24.452  30.164  7.717  1.00 30.12 ? 152 HIS B NE2  1 
ATOM   2408 H H    . HIS B 2 14  ? 26.789  25.095  10.075 1.00 0.00  ? 152 HIS B H    1 
ATOM   2409 H HD1  . HIS B 2 14  ? 24.191  27.355  6.470  1.00 0.00  ? 152 HIS B HD1  1 
ATOM   2410 H HE2  . HIS B 2 14  ? 24.331  31.136  7.719  1.00 0.00  ? 152 HIS B HE2  1 
ATOM   2411 N N    . SER B 2 15  ? 28.290  27.926  7.210  1.00 29.67 ? 153 SER B N    1 
ATOM   2412 C CA   . SER B 2 15  ? 29.255  29.004  7.111  1.00 33.58 ? 153 SER B CA   1 
ATOM   2413 C C    . SER B 2 15  ? 28.626  30.310  6.651  1.00 35.31 ? 153 SER B C    1 
ATOM   2414 O O    . SER B 2 15  ? 27.663  30.328  5.876  1.00 37.16 ? 153 SER B O    1 
ATOM   2415 C CB   . SER B 2 15  ? 30.376  28.619  6.141  1.00 37.94 ? 153 SER B CB   1 
ATOM   2416 O OG   . SER B 2 15  ? 29.841  28.268  4.879  1.00 49.94 ? 153 SER B OG   1 
ATOM   2417 H H    . SER B 2 15  ? 27.966  27.544  6.365  1.00 0.00  ? 153 SER B H    1 
ATOM   2418 H HG   . SER B 2 15  ? 30.507  28.375  4.195  1.00 0.00  ? 153 SER B HG   1 
ATOM   2419 N N    . LYS B 2 16  ? 29.194  31.404  7.133  1.00 35.76 ? 154 LYS B N    1 
ATOM   2420 C CA   . LYS B 2 16  ? 28.753  32.739  6.778  1.00 33.93 ? 154 LYS B CA   1 
ATOM   2421 C C    . LYS B 2 16  ? 30.065  33.490  6.552  1.00 33.59 ? 154 LYS B C    1 
ATOM   2422 O O    . LYS B 2 16  ? 30.962  33.466  7.408  1.00 36.94 ? 154 LYS B O    1 
ATOM   2423 C CB   . LYS B 2 16  ? 27.955  33.354  7.935  1.00 39.05 ? 154 LYS B CB   1 
ATOM   2424 C CG   . LYS B 2 16  ? 27.343  34.722  7.639  1.00 44.50 ? 154 LYS B CG   1 
ATOM   2425 C CD   . LYS B 2 16  ? 26.541  35.266  8.826  1.00 43.88 ? 154 LYS B CD   1 
ATOM   2426 C CE   . LYS B 2 16  ? 27.435  35.507  10.041 1.00 47.99 ? 154 LYS B CE   1 
ATOM   2427 N NZ   . LYS B 2 16  ? 26.706  36.098  11.200 1.00 42.32 ? 154 LYS B NZ   1 
ATOM   2428 H H    . LYS B 2 16  ? 29.926  31.339  7.781  1.00 0.00  ? 154 LYS B H    1 
ATOM   2429 H HZ1  . LYS B 2 16  ? 25.916  35.480  11.470 1.00 0.00  ? 154 LYS B HZ1  1 
ATOM   2430 H HZ2  . LYS B 2 16  ? 27.372  36.178  11.993 1.00 0.00  ? 154 LYS B HZ2  1 
ATOM   2431 H HZ3  . LYS B 2 16  ? 26.359  37.038  10.931 1.00 0.00  ? 154 LYS B HZ3  1 
ATOM   2432 N N    . ARG B 2 17  ? 30.224  34.055  5.360  1.00 25.55 ? 155 ARG B N    1 
ATOM   2433 C CA   . ARG B 2 17  ? 31.435  34.790  5.026  1.00 21.01 ? 155 ARG B CA   1 
ATOM   2434 C C    . ARG B 2 17  ? 31.381  36.223  5.555  1.00 24.51 ? 155 ARG B C    1 
ATOM   2435 O O    . ARG B 2 17  ? 30.307  36.820  5.628  1.00 21.38 ? 155 ARG B O    1 
ATOM   2436 C CB   . ARG B 2 17  ? 31.645  34.786  3.521  1.00 22.57 ? 155 ARG B CB   1 
ATOM   2437 C CG   . ARG B 2 17  ? 32.886  35.515  3.086  1.00 31.48 ? 155 ARG B CG   1 
ATOM   2438 C CD   . ARG B 2 17  ? 33.182  35.258  1.633  1.00 35.93 ? 155 ARG B CD   1 
ATOM   2439 N NE   . ARG B 2 17  ? 33.525  33.862  1.375  1.00 39.94 ? 155 ARG B NE   1 
ATOM   2440 C CZ   . ARG B 2 17  ? 34.658  33.279  1.760  1.00 43.11 ? 155 ARG B CZ   1 
ATOM   2441 N NH1  . ARG B 2 17  ? 35.576  33.965  2.427  1.00 44.97 ? 155 ARG B NH1  1 
ATOM   2442 N NH2  . ARG B 2 17  ? 34.873  32.002  1.473  1.00 45.80 ? 155 ARG B NH2  1 
ATOM   2443 H H    . ARG B 2 17  ? 29.505  33.994  4.701  1.00 0.00  ? 155 ARG B H    1 
ATOM   2444 H HE   . ARG B 2 17  ? 32.870  33.324  0.877  1.00 0.00  ? 155 ARG B HE   1 
ATOM   2445 H HH11 . ARG B 2 17  ? 35.418  34.927  2.651  1.00 0.00  ? 155 ARG B HH11 1 
ATOM   2446 H HH12 . ARG B 2 17  ? 36.417  33.514  2.719  1.00 0.00  ? 155 ARG B HH12 1 
ATOM   2447 H HH21 . ARG B 2 17  ? 34.174  31.493  0.968  1.00 0.00  ? 155 ARG B HH21 1 
ATOM   2448 H HH22 . ARG B 2 17  ? 35.716  31.552  1.761  1.00 0.00  ? 155 ARG B HH22 1 
ATOM   2449 N N    . ARG B 2 18  ? 32.541  36.766  5.922  1.00 31.64 ? 156 ARG B N    1 
ATOM   2450 C CA   . ARG B 2 18  ? 32.655  38.121  6.463  1.00 26.61 ? 156 ARG B CA   1 
ATOM   2451 C C    . ARG B 2 18  ? 33.835  38.861  5.841  1.00 24.19 ? 156 ARG B C    1 
ATOM   2452 O O    . ARG B 2 18  ? 34.923  38.291  5.686  1.00 25.19 ? 156 ARG B O    1 
ATOM   2453 C CB   . ARG B 2 18  ? 32.896  38.061  7.970  1.00 27.03 ? 156 ARG B CB   1 
ATOM   2454 C CG   . ARG B 2 18  ? 31.868  37.291  8.790  1.00 31.33 ? 156 ARG B CG   1 
ATOM   2455 C CD   . ARG B 2 18  ? 32.334  37.200  10.249 1.00 32.88 ? 156 ARG B CD   1 
ATOM   2456 N NE   . ARG B 2 18  ? 32.754  38.505  10.771 1.00 30.03 ? 156 ARG B NE   1 
ATOM   2457 C CZ   . ARG B 2 18  ? 33.456  38.687  11.887 1.00 31.17 ? 156 ARG B CZ   1 
ATOM   2458 N NH1  . ARG B 2 18  ? 33.837  37.653  12.624 1.00 28.18 ? 156 ARG B NH1  1 
ATOM   2459 N NH2  . ARG B 2 18  ? 33.755  39.917  12.284 1.00 35.73 ? 156 ARG B NH2  1 
ATOM   2460 H H    . ARG B 2 18  ? 33.363  36.261  5.818  1.00 0.00  ? 156 ARG B H    1 
ATOM   2461 H HE   . ARG B 2 18  ? 32.514  39.312  10.269 1.00 0.00  ? 156 ARG B HE   1 
ATOM   2462 H HH11 . ARG B 2 18  ? 33.591  36.724  12.354 1.00 0.00  ? 156 ARG B HH11 1 
ATOM   2463 H HH12 . ARG B 2 18  ? 34.351  37.814  13.464 1.00 0.00  ? 156 ARG B HH12 1 
ATOM   2464 H HH21 . ARG B 2 18  ? 33.445  40.706  11.753 1.00 0.00  ? 156 ARG B HH21 1 
ATOM   2465 H HH22 . ARG B 2 18  ? 34.274  40.063  13.125 1.00 0.00  ? 156 ARG B HH22 1 
ATOM   2466 N N    . LEU B 2 19  ? 33.630  40.130  5.497  1.00 20.44 ? 157 LEU B N    1 
ATOM   2467 C CA   . LEU B 2 19  ? 34.691  40.969  4.924  1.00 23.69 ? 157 LEU B CA   1 
ATOM   2468 C C    . LEU B 2 19  ? 35.231  41.886  6.019  1.00 29.93 ? 157 LEU B C    1 
ATOM   2469 O O    . LEU B 2 19  ? 34.493  42.720  6.557  1.00 33.52 ? 157 LEU B O    1 
ATOM   2470 C CB   . LEU B 2 19  ? 34.146  41.827  3.786  1.00 23.01 ? 157 LEU B CB   1 
ATOM   2471 C CG   . LEU B 2 19  ? 33.976  41.156  2.439  1.00 25.36 ? 157 LEU B CG   1 
ATOM   2472 C CD1  . LEU B 2 19  ? 33.401  42.152  1.438  1.00 25.67 ? 157 LEU B CD1  1 
ATOM   2473 C CD2  . LEU B 2 19  ? 35.331  40.657  1.975  1.00 30.96 ? 157 LEU B CD2  1 
ATOM   2474 H H    . LEU B 2 19  ? 32.752  40.527  5.646  1.00 0.00  ? 157 LEU B H    1 
ATOM   2475 N N    . ILE B 2 20  ? 36.513  41.732  6.347  1.00 26.77 ? 158 ILE B N    1 
ATOM   2476 C CA   . ILE B 2 20  ? 37.159  42.533  7.388  1.00 22.02 ? 158 ILE B CA   1 
ATOM   2477 C C    . ILE B 2 20  ? 37.952  43.689  6.808  1.00 23.77 ? 158 ILE B C    1 
ATOM   2478 O O    . ILE B 2 20  ? 38.896  43.477  6.060  1.00 19.53 ? 158 ILE B O    1 
ATOM   2479 C CB   . ILE B 2 20  ? 38.035  41.649  8.295  1.00 22.12 ? 158 ILE B CB   1 
ATOM   2480 C CG1  . ILE B 2 20  ? 37.214  40.466  8.793  1.00 22.78 ? 158 ILE B CG1  1 
ATOM   2481 C CG2  . ILE B 2 20  ? 38.574  42.447  9.474  1.00 16.23 ? 158 ILE B CG2  1 
ATOM   2482 C CD1  . ILE B 2 20  ? 35.928  40.812  9.489  1.00 21.67 ? 158 ILE B CD1  1 
ATOM   2483 H H    . ILE B 2 20  ? 37.036  41.080  5.865  1.00 0.00  ? 158 ILE B H    1 
ATOM   2484 N N    . PHE B 2 21  ? 37.540  44.912  7.126  1.00 26.24 ? 159 PHE B N    1 
ATOM   2485 C CA   . PHE B 2 21  ? 38.226  46.093  6.632  1.00 33.78 ? 159 PHE B CA   1 
ATOM   2486 C C    . PHE B 2 21  ? 39.041  46.726  7.742  1.00 39.86 ? 159 PHE B C    1 
ATOM   2487 O O    . PHE B 2 21  ? 38.501  47.365  8.651  1.00 40.11 ? 159 PHE B O    1 
ATOM   2488 C CB   . PHE B 2 21  ? 37.214  47.100  6.069  1.00 34.13 ? 159 PHE B CB   1 
ATOM   2489 C CG   . PHE B 2 21  ? 36.568  46.646  4.798  1.00 36.01 ? 159 PHE B CG   1 
ATOM   2490 C CD1  . PHE B 2 21  ? 37.315  46.560  3.621  1.00 32.12 ? 159 PHE B CD1  1 
ATOM   2491 C CD2  . PHE B 2 21  ? 35.213  46.320  4.768  1.00 33.08 ? 159 PHE B CD2  1 
ATOM   2492 C CE1  . PHE B 2 21  ? 36.718  46.159  2.430  1.00 34.83 ? 159 PHE B CE1  1 
ATOM   2493 C CE2  . PHE B 2 21  ? 34.599  45.917  3.582  1.00 34.88 ? 159 PHE B CE2  1 
ATOM   2494 C CZ   . PHE B 2 21  ? 35.353  45.837  2.406  1.00 36.60 ? 159 PHE B CZ   1 
ATOM   2495 H H    . PHE B 2 21  ? 36.782  45.027  7.725  1.00 0.00  ? 159 PHE B H    1 
ATOM   2496 N N    . SER B 2 22  ? 40.345  46.499  7.699  1.00 45.87 ? 160 SER B N    1 
ATOM   2497 C CA   . SER B 2 22  ? 41.244  47.069  8.701  1.00 48.80 ? 160 SER B CA   1 
ATOM   2498 C C    . SER B 2 22  ? 42.709  46.876  8.312  1.00 52.21 ? 160 SER B C    1 
ATOM   2499 O O    . SER B 2 22  ? 43.200  47.464  7.343  1.00 58.42 ? 160 SER B O    1 
ATOM   2500 C CB   . SER B 2 22  ? 40.977  46.443  10.072 1.00 43.66 ? 160 SER B CB   1 
ATOM   2501 O OG   . SER B 2 22  ? 41.201  45.047  10.032 1.00 40.22 ? 160 SER B OG   1 
ATOM   2502 H H    . SER B 2 22  ? 40.718  45.922  7.008  1.00 0.00  ? 160 SER B H    1 
ATOM   2503 H HG   . SER B 2 22  ? 40.615  44.675  9.365  1.00 0.00  ? 160 SER B HG   1 
ATOM   2504 N N    . MET C 1 1   ? 110.961 34.933  21.698 1.00 37.72 ? 1   MET C N    1 
ATOM   2505 C CA   . MET C 1 1   ? 109.945 33.917  21.927 1.00 33.34 ? 1   MET C CA   1 
ATOM   2506 C C    . MET C 1 1   ? 108.791 34.461  22.758 1.00 30.36 ? 1   MET C C    1 
ATOM   2507 O O    . MET C 1 1   ? 108.994 35.219  23.712 1.00 25.73 ? 1   MET C O    1 
ATOM   2508 C CB   . MET C 1 1   ? 110.554 32.696  22.618 1.00 37.24 ? 1   MET C CB   1 
ATOM   2509 C CG   . MET C 1 1   ? 109.614 31.496  22.665 1.00 41.20 ? 1   MET C CG   1 
ATOM   2510 S SD   . MET C 1 1   ? 109.012 31.064  24.308 1.00 47.28 ? 1   MET C SD   1 
ATOM   2511 C CE   . MET C 1 1   ? 109.808 29.487  24.513 1.00 41.40 ? 1   MET C CE   1 
ATOM   2512 H H    . MET C 1 1   ? 110.667 35.864  21.624 1.00 0.00  ? 1   MET C H    1 
ATOM   2513 N N    . PHE C 1 2   ? 107.583 34.062  22.380 1.00 25.54 ? 2   PHE C N    1 
ATOM   2514 C CA   . PHE C 1 2   ? 106.369 34.478  23.059 1.00 21.18 ? 2   PHE C CA   1 
ATOM   2515 C C    . PHE C 1 2   ? 105.735 33.300  23.772 1.00 22.67 ? 2   PHE C C    1 
ATOM   2516 O O    . PHE C 1 2   ? 105.533 32.239  23.173 1.00 20.73 ? 2   PHE C O    1 
ATOM   2517 C CB   . PHE C 1 2   ? 105.375 35.068  22.042 1.00 23.17 ? 2   PHE C CB   1 
ATOM   2518 C CG   . PHE C 1 2   ? 103.930 35.069  22.503 1.00 21.76 ? 2   PHE C CG   1 
ATOM   2519 C CD1  . PHE C 1 2   ? 103.536 35.778  23.631 1.00 21.70 ? 2   PHE C CD1  1 
ATOM   2520 C CD2  . PHE C 1 2   ? 102.968 34.350  21.804 1.00 22.76 ? 2   PHE C CD2  1 
ATOM   2521 C CE1  . PHE C 1 2   ? 102.207 35.772  24.058 1.00 22.35 ? 2   PHE C CE1  1 
ATOM   2522 C CE2  . PHE C 1 2   ? 101.640 34.337  22.221 1.00 23.34 ? 2   PHE C CE2  1 
ATOM   2523 C CZ   . PHE C 1 2   ? 101.261 35.051  23.353 1.00 23.67 ? 2   PHE C CZ   1 
ATOM   2524 H H    . PHE C 1 2   ? 107.501 33.452  21.621 1.00 0.00  ? 2   PHE C H    1 
ATOM   2525 N N    . GLU C 1 3   ? 105.441 33.489  25.054 1.00 19.07 ? 3   GLU C N    1 
ATOM   2526 C CA   . GLU C 1 3   ? 104.778 32.474  25.850 1.00 21.29 ? 3   GLU C CA   1 
ATOM   2527 C C    . GLU C 1 3   ? 103.933 33.192  26.885 1.00 19.72 ? 3   GLU C C    1 
ATOM   2528 O O    . GLU C 1 3   ? 104.444 33.962  27.703 1.00 25.82 ? 3   GLU C O    1 
ATOM   2529 C CB   . GLU C 1 3   ? 105.769 31.513  26.517 1.00 29.59 ? 3   GLU C CB   1 
ATOM   2530 C CG   . GLU C 1 3   ? 105.073 30.306  27.163 1.00 35.91 ? 3   GLU C CG   1 
ATOM   2531 C CD   . GLU C 1 3   ? 106.032 29.241  27.687 1.00 39.80 ? 3   GLU C CD   1 
ATOM   2532 O OE1  . GLU C 1 3   ? 106.456 29.330  28.862 1.00 44.60 ? 3   GLU C OE1  1 
ATOM   2533 O OE2  . GLU C 1 3   ? 106.335 28.292  26.932 1.00 40.47 ? 3   GLU C OE2  1 
ATOM   2534 H H    . GLU C 1 3   ? 105.670 34.341  25.479 1.00 0.00  ? 3   GLU C H    1 
ATOM   2535 N N    . ALA C 1 4   ? 102.626 32.987  26.788 1.00 15.98 ? 4   ALA C N    1 
ATOM   2536 C CA   . ALA C 1 4   ? 101.656 33.593  27.684 1.00 12.48 ? 4   ALA C CA   1 
ATOM   2537 C C    . ALA C 1 4   ? 100.801 32.474  28.272 1.00 15.73 ? 4   ALA C C    1 
ATOM   2538 O O    . ALA C 1 4   ? 100.257 31.639  27.543 1.00 18.05 ? 4   ALA C O    1 
ATOM   2539 C CB   . ALA C 1 4   ? 100.789 34.573  26.909 1.00 11.02 ? 4   ALA C CB   1 
ATOM   2540 H H    . ALA C 1 4   ? 102.296 32.379  26.094 1.00 0.00  ? 4   ALA C H    1 
ATOM   2541 N N    . ARG C 1 5   ? 100.714 32.433  29.592 1.00 18.50 ? 5   ARG C N    1 
ATOM   2542 C CA   . ARG C 1 5   ? 99.934  31.416  30.278 1.00 18.43 ? 5   ARG C CA   1 
ATOM   2543 C C    . ARG C 1 5   ? 98.700  32.073  30.874 1.00 21.49 ? 5   ARG C C    1 
ATOM   2544 O O    . ARG C 1 5   ? 98.800  33.113  31.538 1.00 23.85 ? 5   ARG C O    1 
ATOM   2545 C CB   . ARG C 1 5   ? 100.785 30.780  31.379 1.00 18.88 ? 5   ARG C CB   1 
ATOM   2546 C CG   . ARG C 1 5   ? 100.057 29.822  32.294 1.00 19.90 ? 5   ARG C CG   1 
ATOM   2547 C CD   . ARG C 1 5   ? 100.969 29.405  33.430 1.00 16.62 ? 5   ARG C CD   1 
ATOM   2548 N NE   . ARG C 1 5   ? 100.264 28.608  34.425 1.00 22.56 ? 5   ARG C NE   1 
ATOM   2549 C CZ   . ARG C 1 5   ? 100.116 27.286  34.363 1.00 26.97 ? 5   ARG C CZ   1 
ATOM   2550 N NH1  . ARG C 1 5   ? 100.627 26.601  33.346 1.00 27.07 ? 5   ARG C NH1  1 
ATOM   2551 N NH2  . ARG C 1 5   ? 99.462  26.647  35.328 1.00 25.13 ? 5   ARG C NH2  1 
ATOM   2552 H H    . ARG C 1 5   ? 101.165 33.092  30.125 1.00 0.00  ? 5   ARG C H    1 
ATOM   2553 H HE   . ARG C 1 5   ? 99.877  29.075  35.197 1.00 0.00  ? 5   ARG C HE   1 
ATOM   2554 H HH11 . ARG C 1 5   ? 101.137 27.068  32.624 1.00 0.00  ? 5   ARG C HH11 1 
ATOM   2555 H HH12 . ARG C 1 5   ? 100.524 25.606  33.318 1.00 0.00  ? 5   ARG C HH12 1 
ATOM   2556 H HH21 . ARG C 1 5   ? 99.094  27.161  36.102 1.00 0.00  ? 5   ARG C HH21 1 
ATOM   2557 H HH22 . ARG C 1 5   ? 99.362  25.654  35.293 1.00 0.00  ? 5   ARG C HH22 1 
ATOM   2558 N N    . LEU C 1 6   ? 97.539  31.479  30.612 1.00 22.75 ? 6   LEU C N    1 
ATOM   2559 C CA   . LEU C 1 6   ? 96.270  31.983  31.118 1.00 13.42 ? 6   LEU C CA   1 
ATOM   2560 C C    . LEU C 1 6   ? 95.545  30.857  31.843 1.00 16.22 ? 6   LEU C C    1 
ATOM   2561 O O    . LEU C 1 6   ? 95.306  29.785  31.287 1.00 20.64 ? 6   LEU C O    1 
ATOM   2562 C CB   . LEU C 1 6   ? 95.424  32.516  29.965 1.00 11.12 ? 6   LEU C CB   1 
ATOM   2563 C CG   . LEU C 1 6   ? 94.152  33.296  30.302 1.00 9.89  ? 6   LEU C CG   1 
ATOM   2564 C CD1  . LEU C 1 6   ? 94.424  34.327  31.388 1.00 11.09 ? 6   LEU C CD1  1 
ATOM   2565 C CD2  . LEU C 1 6   ? 93.659  33.986  29.042 1.00 11.86 ? 6   LEU C CD2  1 
ATOM   2566 H H    . LEU C 1 6   ? 97.530  30.675  30.053 1.00 0.00  ? 6   LEU C H    1 
ATOM   2567 N N    . VAL C 1 7   ? 95.245  31.080  33.112 1.00 14.57 ? 7   VAL C N    1 
ATOM   2568 C CA   . VAL C 1 7   ? 94.552  30.073  33.890 1.00 18.60 ? 7   VAL C CA   1 
ATOM   2569 C C    . VAL C 1 7   ? 93.112  30.019  33.398 1.00 23.04 ? 7   VAL C C    1 
ATOM   2570 O O    . VAL C 1 7   ? 92.577  28.948  33.139 1.00 27.79 ? 7   VAL C O    1 
ATOM   2571 C CB   . VAL C 1 7   ? 94.574  30.410  35.388 1.00 19.16 ? 7   VAL C CB   1 
ATOM   2572 C CG1  . VAL C 1 7   ? 94.134  29.207  36.196 1.00 17.71 ? 7   VAL C CG1  1 
ATOM   2573 C CG2  . VAL C 1 7   ? 95.956  30.865  35.806 1.00 16.31 ? 7   VAL C CG2  1 
ATOM   2574 H H    . VAL C 1 7   ? 95.509  31.933  33.509 1.00 0.00  ? 7   VAL C H    1 
ATOM   2575 N N    . GLN C 1 8   ? 92.499  31.190  33.257 1.00 26.83 ? 8   GLN C N    1 
ATOM   2576 C CA   . GLN C 1 8   ? 91.126  31.305  32.779 1.00 27.02 ? 8   GLN C CA   1 
ATOM   2577 C C    . GLN C 1 8   ? 91.100  31.118  31.260 1.00 27.06 ? 8   GLN C C    1 
ATOM   2578 O O    . GLN C 1 8   ? 90.968  32.088  30.518 1.00 27.68 ? 8   GLN C O    1 
ATOM   2579 C CB   . GLN C 1 8   ? 90.576  32.691  33.118 1.00 37.74 ? 8   GLN C CB   1 
ATOM   2580 C CG   . GLN C 1 8   ? 90.308  32.948  34.580 1.00 49.53 ? 8   GLN C CG   1 
ATOM   2581 C CD   . GLN C 1 8   ? 88.828  32.859  34.928 1.00 59.32 ? 8   GLN C CD   1 
ATOM   2582 O OE1  . GLN C 1 8   ? 87.978  32.644  34.059 1.00 61.64 ? 8   GLN C OE1  1 
ATOM   2583 N NE2  . GLN C 1 8   ? 88.513  33.021  36.208 1.00 63.86 ? 8   GLN C NE2  1 
ATOM   2584 H H    . GLN C 1 8   ? 92.998  32.011  33.438 1.00 0.00  ? 8   GLN C H    1 
ATOM   2585 H HE21 . GLN C 1 8   ? 87.563  32.993  36.433 1.00 0.00  ? 8   GLN C HE21 1 
ATOM   2586 H HE22 . GLN C 1 8   ? 89.229  33.170  36.861 1.00 0.00  ? 8   GLN C HE22 1 
ATOM   2587 N N    . GLY C 1 9   ? 91.243  29.885  30.792 1.00 28.44 ? 9   GLY C N    1 
ATOM   2588 C CA   . GLY C 1 9   ? 91.234  29.646  29.359 1.00 29.51 ? 9   GLY C CA   1 
ATOM   2589 C C    . GLY C 1 9   ? 89.917  30.019  28.695 1.00 33.89 ? 9   GLY C C    1 
ATOM   2590 O O    . GLY C 1 9   ? 89.881  30.367  27.502 1.00 31.85 ? 9   GLY C O    1 
ATOM   2591 H H    . GLY C 1 9   ? 91.362  29.124  31.409 1.00 0.00  ? 9   GLY C H    1 
ATOM   2592 N N    . SER C 1 10  ? 88.838  29.974  29.479 1.00 27.24 ? 10  SER C N    1 
ATOM   2593 C CA   . SER C 1 10  ? 87.499  30.293  29.002 1.00 19.07 ? 10  SER C CA   1 
ATOM   2594 C C    . SER C 1 10  ? 87.428  31.672  28.338 1.00 17.71 ? 10  SER C C    1 
ATOM   2595 O O    . SER C 1 10  ? 86.702  31.848  27.360 1.00 16.02 ? 10  SER C O    1 
ATOM   2596 C CB   . SER C 1 10  ? 86.499  30.198  30.152 1.00 15.04 ? 10  SER C CB   1 
ATOM   2597 O OG   . SER C 1 10  ? 86.819  31.138  31.158 1.00 19.32 ? 10  SER C OG   1 
ATOM   2598 H H    . SER C 1 10  ? 88.928  29.692  30.411 1.00 0.00  ? 10  SER C H    1 
ATOM   2599 H HG   . SER C 1 10  ? 86.199  31.109  31.896 1.00 0.00  ? 10  SER C HG   1 
ATOM   2600 N N    . ILE C 1 11  ? 88.201  32.632  28.848 1.00 17.44 ? 11  ILE C N    1 
ATOM   2601 C CA   . ILE C 1 11  ? 88.235  33.992  28.294 1.00 16.27 ? 11  ILE C CA   1 
ATOM   2602 C C    . ILE C 1 11  ? 88.647  33.988  26.834 1.00 16.27 ? 11  ILE C C    1 
ATOM   2603 O O    . ILE C 1 11  ? 88.070  34.702  26.009 1.00 16.48 ? 11  ILE C O    1 
ATOM   2604 C CB   . ILE C 1 11  ? 89.243  34.895  29.047 1.00 18.66 ? 11  ILE C CB   1 
ATOM   2605 C CG1  . ILE C 1 11  ? 88.718  35.225  30.443 1.00 19.61 ? 11  ILE C CG1  1 
ATOM   2606 C CG2  . ILE C 1 11  ? 89.525  36.169  28.247 1.00 14.53 ? 11  ILE C CG2  1 
ATOM   2607 C CD1  . ILE C 1 11  ? 89.667  36.080  31.260 1.00 20.80 ? 11  ILE C CD1  1 
ATOM   2608 H H    . ILE C 1 11  ? 88.737  32.415  29.641 1.00 0.00  ? 11  ILE C H    1 
ATOM   2609 N N    . LEU C 1 12  ? 89.663  33.189  26.531 1.00 17.01 ? 12  LEU C N    1 
ATOM   2610 C CA   . LEU C 1 12  ? 90.196  33.082  25.178 1.00 19.42 ? 12  LEU C CA   1 
ATOM   2611 C C    . LEU C 1 12  ? 89.222  32.343  24.261 1.00 21.13 ? 12  LEU C C    1 
ATOM   2612 O O    . LEU C 1 12  ? 89.175  32.601  23.047 1.00 20.78 ? 12  LEU C O    1 
ATOM   2613 C CB   . LEU C 1 12  ? 91.544  32.370  25.218 1.00 16.43 ? 12  LEU C CB   1 
ATOM   2614 C CG   . LEU C 1 12  ? 92.480  32.664  24.063 1.00 18.08 ? 12  LEU C CG   1 
ATOM   2615 C CD1  . LEU C 1 12  ? 92.651  34.164  23.929 1.00 19.71 ? 12  LEU C CD1  1 
ATOM   2616 C CD2  . LEU C 1 12  ? 93.812  31.993  24.341 1.00 23.34 ? 12  LEU C CD2  1 
ATOM   2617 H H    . LEU C 1 12  ? 90.060  32.638  27.241 1.00 0.00  ? 12  LEU C H    1 
ATOM   2618 N N    . LYS C 1 13  ? 88.472  31.409  24.849 1.00 18.71 ? 13  LYS C N    1 
ATOM   2619 C CA   . LYS C 1 13  ? 87.461  30.632  24.127 1.00 18.72 ? 13  LYS C CA   1 
ATOM   2620 C C    . LYS C 1 13  ? 86.347  31.597  23.738 1.00 16.67 ? 13  LYS C C    1 
ATOM   2621 O O    . LYS C 1 13  ? 85.896  31.631  22.590 1.00 15.40 ? 13  LYS C O    1 
ATOM   2622 C CB   . LYS C 1 13  ? 86.878  29.545  25.039 1.00 17.20 ? 13  LYS C CB   1 
ATOM   2623 C CG   . LYS C 1 13  ? 87.797  28.379  25.324 1.00 10.83 ? 13  LYS C CG   1 
ATOM   2624 C CD   . LYS C 1 13  ? 87.236  27.519  26.439 1.00 12.36 ? 13  LYS C CD   1 
ATOM   2625 C CE   . LYS C 1 13  ? 85.833  27.021  26.131 1.00 11.59 ? 13  LYS C CE   1 
ATOM   2626 N NZ   . LYS C 1 13  ? 85.786  26.186  24.904 1.00 9.36  ? 13  LYS C NZ   1 
ATOM   2627 H H    . LYS C 1 13  ? 88.604  31.228  25.805 1.00 0.00  ? 13  LYS C H    1 
ATOM   2628 H HZ1  . LYS C 1 13  ? 86.414  25.365  25.018 1.00 0.00  ? 13  LYS C HZ1  1 
ATOM   2629 H HZ2  . LYS C 1 13  ? 84.812  25.865  24.725 1.00 0.00  ? 13  LYS C HZ2  1 
ATOM   2630 H HZ3  . LYS C 1 13  ? 86.112  26.758  24.099 1.00 0.00  ? 13  LYS C HZ3  1 
ATOM   2631 N N    . LYS C 1 14  ? 85.934  32.395  24.719 1.00 17.14 ? 14  LYS C N    1 
ATOM   2632 C CA   . LYS C 1 14  ? 84.889  33.393  24.552 1.00 15.89 ? 14  LYS C CA   1 
ATOM   2633 C C    . LYS C 1 14  ? 85.264  34.448  23.519 1.00 12.87 ? 14  LYS C C    1 
ATOM   2634 O O    . LYS C 1 14  ? 84.450  34.788  22.659 1.00 15.80 ? 14  LYS C O    1 
ATOM   2635 C CB   . LYS C 1 14  ? 84.580  34.054  25.895 1.00 16.16 ? 14  LYS C CB   1 
ATOM   2636 C CG   . LYS C 1 14  ? 84.002  33.100  26.918 1.00 20.66 ? 14  LYS C CG   1 
ATOM   2637 C CD   . LYS C 1 14  ? 83.785  33.772  28.259 1.00 24.25 ? 14  LYS C CD   1 
ATOM   2638 C CE   . LYS C 1 14  ? 83.334  32.757  29.280 1.00 28.75 ? 14  LYS C CE   1 
ATOM   2639 N NZ   . LYS C 1 14  ? 83.390  33.297  30.662 1.00 34.79 ? 14  LYS C NZ   1 
ATOM   2640 H H    . LYS C 1 14  ? 86.352  32.304  25.595 1.00 0.00  ? 14  LYS C H    1 
ATOM   2641 H HZ1  . LYS C 1 14  ? 84.355  33.579  30.922 1.00 0.00  ? 14  LYS C HZ1  1 
ATOM   2642 H HZ2  . LYS C 1 14  ? 82.735  34.102  30.725 1.00 0.00  ? 14  LYS C HZ2  1 
ATOM   2643 H HZ3  . LYS C 1 14  ? 83.052  32.545  31.298 1.00 0.00  ? 14  LYS C HZ3  1 
ATOM   2644 N N    . VAL C 1 15  ? 86.487  34.967  23.598 1.00 7.92  ? 15  VAL C N    1 
ATOM   2645 C CA   . VAL C 1 15  ? 86.936  35.968  22.636 1.00 10.08 ? 15  VAL C CA   1 
ATOM   2646 C C    . VAL C 1 15  ? 86.743  35.459  21.203 1.00 10.43 ? 15  VAL C C    1 
ATOM   2647 O O    . VAL C 1 15  ? 86.052  36.090  20.409 1.00 15.75 ? 15  VAL C O    1 
ATOM   2648 C CB   . VAL C 1 15  ? 88.418  36.394  22.877 1.00 10.37 ? 15  VAL C CB   1 
ATOM   2649 C CG1  . VAL C 1 15  ? 88.930  37.230  21.703 1.00 10.03 ? 15  VAL C CG1  1 
ATOM   2650 C CG2  . VAL C 1 15  ? 88.534  37.211  24.173 1.00 3.78  ? 15  VAL C CG2  1 
ATOM   2651 H H    . VAL C 1 15  ? 87.086  34.686  24.320 1.00 0.00  ? 15  VAL C H    1 
ATOM   2652 N N    . LEU C 1 16  ? 87.278  34.287  20.883 1.00 17.25 ? 16  LEU C N    1 
ATOM   2653 C CA   . LEU C 1 16  ? 87.117  33.767  19.525 1.00 24.58 ? 16  LEU C CA   1 
ATOM   2654 C C    . LEU C 1 16  ? 85.676  33.518  19.097 1.00 25.52 ? 16  LEU C C    1 
ATOM   2655 O O    . LEU C 1 16  ? 85.328  33.752  17.943 1.00 28.71 ? 16  LEU C O    1 
ATOM   2656 C CB   . LEU C 1 16  ? 88.007  32.550  19.269 1.00 18.32 ? 16  LEU C CB   1 
ATOM   2657 C CG   . LEU C 1 16  ? 89.341  33.106  18.774 1.00 16.77 ? 16  LEU C CG   1 
ATOM   2658 C CD1  . LEU C 1 16  ? 90.436  32.819  19.757 1.00 15.05 ? 16  LEU C CD1  1 
ATOM   2659 C CD2  . LEU C 1 16  ? 89.664  32.572  17.406 1.00 15.71 ? 16  LEU C CD2  1 
ATOM   2660 H H    . LEU C 1 16  ? 87.786  33.776  21.552 1.00 0.00  ? 16  LEU C H    1 
ATOM   2661 N N    . GLU C 1 17  ? 84.833  33.071  20.022 1.00 30.46 ? 17  GLU C N    1 
ATOM   2662 C CA   . GLU C 1 17  ? 83.423  32.851  19.708 1.00 29.71 ? 17  GLU C CA   1 
ATOM   2663 C C    . GLU C 1 17  ? 82.785  34.203  19.402 1.00 26.47 ? 17  GLU C C    1 
ATOM   2664 O O    . GLU C 1 17  ? 81.807  34.289  18.659 1.00 28.81 ? 17  GLU C O    1 
ATOM   2665 C CB   . GLU C 1 17  ? 82.705  32.195  20.887 1.00 36.09 ? 17  GLU C CB   1 
ATOM   2666 C CG   . GLU C 1 17  ? 83.050  30.728  21.089 1.00 44.54 ? 17  GLU C CG   1 
ATOM   2667 C CD   . GLU C 1 17  ? 82.659  29.870  19.898 1.00 51.68 ? 17  GLU C CD   1 
ATOM   2668 O OE1  . GLU C 1 17  ? 81.469  29.505  19.776 1.00 51.53 ? 17  GLU C OE1  1 
ATOM   2669 O OE2  . GLU C 1 17  ? 83.547  29.563  19.076 1.00 58.60 ? 17  GLU C OE2  1 
ATOM   2670 H H    . GLU C 1 17  ? 85.164  32.871  20.925 1.00 0.00  ? 17  GLU C H    1 
ATOM   2671 N N    . ALA C 1 18  ? 83.380  35.255  19.955 1.00 18.88 ? 18  ALA C N    1 
ATOM   2672 C CA   . ALA C 1 18  ? 82.911  36.620  19.778 1.00 17.32 ? 18  ALA C CA   1 
ATOM   2673 C C    . ALA C 1 18  ? 83.473  37.307  18.529 1.00 19.10 ? 18  ALA C C    1 
ATOM   2674 O O    . ALA C 1 18  ? 83.080  38.433  18.212 1.00 23.92 ? 18  ALA C O    1 
ATOM   2675 C CB   . ALA C 1 18  ? 83.267  37.437  21.014 1.00 14.35 ? 18  ALA C CB   1 
ATOM   2676 H H    . ALA C 1 18  ? 84.170  35.121  20.519 1.00 0.00  ? 18  ALA C H    1 
ATOM   2677 N N    . LEU C 1 19  ? 84.382  36.640  17.820 1.00 15.48 ? 19  LEU C N    1 
ATOM   2678 C CA   . LEU C 1 19  ? 85.002  37.233  16.641 1.00 8.71  ? 19  LEU C CA   1 
ATOM   2679 C C    . LEU C 1 19  ? 84.933  36.454  15.339 1.00 5.02  ? 19  LEU C C    1 
ATOM   2680 O O    . LEU C 1 19  ? 84.704  37.047  14.298 1.00 9.25  ? 19  LEU C O    1 
ATOM   2681 C CB   . LEU C 1 19  ? 86.470  37.564  16.925 1.00 16.54 ? 19  LEU C CB   1 
ATOM   2682 C CG   . LEU C 1 19  ? 86.774  38.714  17.885 1.00 21.36 ? 19  LEU C CG   1 
ATOM   2683 C CD1  . LEU C 1 19  ? 88.276  38.951  17.956 1.00 20.75 ? 19  LEU C CD1  1 
ATOM   2684 C CD2  . LEU C 1 19  ? 86.057  39.964  17.412 1.00 18.21 ? 19  LEU C CD2  1 
ATOM   2685 H H    . LEU C 1 19  ? 84.653  35.748  18.113 1.00 0.00  ? 19  LEU C H    1 
ATOM   2686 N N    . LYS C 1 20  ? 85.189  35.150  15.393 1.00 11.80 ? 20  LYS C N    1 
ATOM   2687 C CA   . LYS C 1 20  ? 85.198  34.268  14.211 1.00 17.05 ? 20  LYS C CA   1 
ATOM   2688 C C    . LYS C 1 20  ? 84.103  34.528  13.185 1.00 17.16 ? 20  LYS C C    1 
ATOM   2689 O O    . LYS C 1 20  ? 84.343  34.413  11.986 1.00 21.66 ? 20  LYS C O    1 
ATOM   2690 C CB   . LYS C 1 20  ? 85.123  32.789  14.626 1.00 16.63 ? 20  LYS C CB   1 
ATOM   2691 C CG   . LYS C 1 20  ? 83.787  32.439  15.266 1.00 22.87 ? 20  LYS C CG   1 
ATOM   2692 C CD   . LYS C 1 20  ? 83.589  30.977  15.550 1.00 21.10 ? 20  LYS C CD   1 
ATOM   2693 C CE   . LYS C 1 20  ? 82.226  30.784  16.188 1.00 22.57 ? 20  LYS C CE   1 
ATOM   2694 N NZ   . LYS C 1 20  ? 81.913  29.362  16.464 1.00 30.94 ? 20  LYS C NZ   1 
ATOM   2695 H H    . LYS C 1 20  ? 85.392  34.758  16.263 1.00 0.00  ? 20  LYS C H    1 
ATOM   2696 H HZ1  . LYS C 1 20  ? 81.944  28.814  15.579 1.00 0.00  ? 20  LYS C HZ1  1 
ATOM   2697 H HZ2  . LYS C 1 20  ? 82.624  28.989  17.123 1.00 0.00  ? 20  LYS C HZ2  1 
ATOM   2698 H HZ3  . LYS C 1 20  ? 80.971  29.288  16.893 1.00 0.00  ? 20  LYS C HZ3  1 
ATOM   2699 N N    . ASP C 1 21  ? 82.897  34.845  13.652 1.00 20.84 ? 21  ASP C N    1 
ATOM   2700 C CA   . ASP C 1 21  ? 81.788  35.097  12.738 1.00 25.73 ? 21  ASP C CA   1 
ATOM   2701 C C    . ASP C 1 21  ? 81.839  36.460  12.072 1.00 25.18 ? 21  ASP C C    1 
ATOM   2702 O O    . ASP C 1 21  ? 81.384  36.621  10.941 1.00 35.66 ? 21  ASP C O    1 
ATOM   2703 C CB   . ASP C 1 21  ? 80.442  34.889  13.434 1.00 27.24 ? 21  ASP C CB   1 
ATOM   2704 C CG   . ASP C 1 21  ? 80.110  33.421  13.627 1.00 30.03 ? 21  ASP C CG   1 
ATOM   2705 O OD1  . ASP C 1 21  ? 80.394  32.609  12.714 1.00 31.28 ? 21  ASP C OD1  1 
ATOM   2706 O OD2  . ASP C 1 21  ? 79.560  33.076  14.693 1.00 36.82 ? 21  ASP C OD2  1 
ATOM   2707 H H    . ASP C 1 21  ? 82.747  34.945  14.616 1.00 0.00  ? 21  ASP C H    1 
ATOM   2708 N N    . LEU C 1 22  ? 82.372  37.449  12.775 1.00 22.45 ? 22  LEU C N    1 
ATOM   2709 C CA   . LEU C 1 22  ? 82.476  38.783  12.210 1.00 19.15 ? 22  LEU C CA   1 
ATOM   2710 C C    . LEU C 1 22  ? 83.714  38.890  11.313 1.00 19.54 ? 22  LEU C C    1 
ATOM   2711 O O    . LEU C 1 22  ? 83.632  39.388  10.187 1.00 26.48 ? 22  LEU C O    1 
ATOM   2712 C CB   . LEU C 1 22  ? 82.521  39.842  13.319 1.00 14.43 ? 22  LEU C CB   1 
ATOM   2713 C CG   . LEU C 1 22  ? 82.462  41.295  12.847 1.00 8.76  ? 22  LEU C CG   1 
ATOM   2714 C CD1  . LEU C 1 22  ? 81.176  41.520  12.059 1.00 3.26  ? 22  LEU C CD1  1 
ATOM   2715 C CD2  . LEU C 1 22  ? 82.550  42.231  14.029 1.00 10.21 ? 22  LEU C CD2  1 
ATOM   2716 H H    . LEU C 1 22  ? 82.713  37.257  13.671 1.00 0.00  ? 22  LEU C H    1 
ATOM   2717 N N    . ILE C 1 23  ? 84.851  38.407  11.803 1.00 8.74  ? 23  ILE C N    1 
ATOM   2718 C CA   . ILE C 1 23  ? 86.100  38.474  11.055 1.00 14.29 ? 23  ILE C CA   1 
ATOM   2719 C C    . ILE C 1 23  ? 86.761  37.099  10.948 1.00 17.27 ? 23  ILE C C    1 
ATOM   2720 O O    . ILE C 1 23  ? 87.077  36.455  11.941 1.00 16.06 ? 23  ILE C O    1 
ATOM   2721 C CB   . ILE C 1 23  ? 87.062  39.524  11.668 1.00 14.60 ? 23  ILE C CB   1 
ATOM   2722 C CG1  . ILE C 1 23  ? 87.187  39.309  13.178 1.00 14.48 ? 23  ILE C CG1  1 
ATOM   2723 C CG2  . ILE C 1 23  ? 86.527  40.925  11.408 1.00 10.54 ? 23  ILE C CG2  1 
ATOM   2724 C CD1  . ILE C 1 23  ? 87.877  40.431  13.903 1.00 21.04 ? 23  ILE C CD1  1 
ATOM   2725 H H    . ILE C 1 23  ? 84.852  37.962  12.673 1.00 0.00  ? 23  ILE C H    1 
ATOM   2726 N N    . ASN C 1 24  ? 86.993  36.685  9.714  1.00 24.60 ? 24  ASN C N    1 
ATOM   2727 C CA   . ASN C 1 24  ? 87.562  35.387  9.408  1.00 27.99 ? 24  ASN C CA   1 
ATOM   2728 C C    . ASN C 1 24  ? 89.080  35.301  9.491  1.00 27.84 ? 24  ASN C C    1 
ATOM   2729 O O    . ASN C 1 24  ? 89.621  34.261  9.847  1.00 35.34 ? 24  ASN C O    1 
ATOM   2730 C CB   . ASN C 1 24  ? 87.070  34.943  8.032  1.00 31.81 ? 24  ASN C CB   1 
ATOM   2731 C CG   . ASN C 1 24  ? 85.573  35.180  7.846  1.00 35.82 ? 24  ASN C CG   1 
ATOM   2732 O OD1  . ASN C 1 24  ? 84.761  34.879  8.726  1.00 36.41 ? 24  ASN C OD1  1 
ATOM   2733 N ND2  . ASN C 1 24  ? 85.206  35.752  6.703  1.00 42.69 ? 24  ASN C ND2  1 
ATOM   2734 H H    . ASN C 1 24  ? 86.773  37.317  8.998  1.00 0.00  ? 24  ASN C H    1 
ATOM   2735 H HD21 . ASN C 1 24  ? 84.247  35.926  6.599  1.00 0.00  ? 24  ASN C HD21 1 
ATOM   2736 H HD22 . ASN C 1 24  ? 85.874  35.980  6.028  1.00 0.00  ? 24  ASN C HD22 1 
ATOM   2737 N N    . GLU C 1 25  ? 89.770  36.381  9.152  1.00 29.62 ? 25  GLU C N    1 
ATOM   2738 C CA   . GLU C 1 25  ? 91.232  36.415  9.216  1.00 29.49 ? 25  GLU C CA   1 
ATOM   2739 C C    . GLU C 1 25  ? 91.622  37.680  9.970  1.00 26.95 ? 25  GLU C C    1 
ATOM   2740 O O    . GLU C 1 25  ? 90.923  38.690  9.875  1.00 33.55 ? 25  GLU C O    1 
ATOM   2741 C CB   . GLU C 1 25  ? 91.820  36.486  7.814  1.00 38.05 ? 25  GLU C CB   1 
ATOM   2742 C CG   . GLU C 1 25  ? 91.293  35.439  6.863  1.00 52.60 ? 25  GLU C CG   1 
ATOM   2743 C CD   . GLU C 1 25  ? 91.496  35.834  5.415  1.00 62.63 ? 25  GLU C CD   1 
ATOM   2744 O OE1  . GLU C 1 25  ? 91.009  36.923  5.024  1.00 66.85 ? 25  GLU C OE1  1 
ATOM   2745 O OE2  . GLU C 1 25  ? 92.138  35.058  4.671  1.00 67.23 ? 25  GLU C OE2  1 
ATOM   2746 H H    . GLU C 1 25  ? 89.317  37.211  8.893  1.00 0.00  ? 25  GLU C H    1 
ATOM   2747 N N    . ALA C 1 26  ? 92.719  37.639  10.718 1.00 22.23 ? 26  ALA C N    1 
ATOM   2748 C CA   . ALA C 1 26  ? 93.159  38.818  11.461 1.00 17.80 ? 26  ALA C CA   1 
ATOM   2749 C C    . ALA C 1 26  ? 94.586  38.701  11.950 1.00 16.49 ? 26  ALA C C    1 
ATOM   2750 O O    . ALA C 1 26  ? 95.096  37.608  12.190 1.00 17.95 ? 26  ALA C O    1 
ATOM   2751 C CB   . ALA C 1 26  ? 92.233  39.097  12.626 1.00 20.33 ? 26  ALA C CB   1 
ATOM   2752 H H    . ALA C 1 26  ? 93.258  36.820  10.778 1.00 0.00  ? 26  ALA C H    1 
ATOM   2753 N N    . CYS C 1 27  ? 95.226  39.847  12.093 1.00 17.87 ? 27  CYS C N    1 
ATOM   2754 C CA   . CYS C 1 27  ? 96.604  39.917  12.545 1.00 21.24 ? 27  CYS C CA   1 
ATOM   2755 C C    . CYS C 1 27  ? 96.659  40.097  14.062 1.00 16.47 ? 27  CYS C C    1 
ATOM   2756 O O    . CYS C 1 27  ? 95.985  40.975  14.616 1.00 15.74 ? 27  CYS C O    1 
ATOM   2757 C CB   . CYS C 1 27  ? 97.301  41.090  11.840 1.00 23.38 ? 27  CYS C CB   1 
ATOM   2758 S SG   . CYS C 1 27  ? 98.967  41.458  12.385 1.00 29.34 ? 27  CYS C SG   1 
ATOM   2759 H H    . CYS C 1 27  ? 94.762  40.690  11.895 1.00 0.00  ? 27  CYS C H    1 
ATOM   2760 N N    . TRP C 1 28  ? 97.405  39.230  14.738 1.00 8.00  ? 28  TRP C N    1 
ATOM   2761 C CA   . TRP C 1 28  ? 97.547  39.336  16.183 1.00 12.17 ? 28  TRP C CA   1 
ATOM   2762 C C    . TRP C 1 28  ? 98.907  39.967  16.494 1.00 12.09 ? 28  TRP C C    1 
ATOM   2763 O O    . TRP C 1 28  ? 99.956  39.436  16.114 1.00 14.01 ? 28  TRP C O    1 
ATOM   2764 C CB   . TRP C 1 28  ? 97.394  37.960  16.853 1.00 18.94 ? 28  TRP C CB   1 
ATOM   2765 C CG   . TRP C 1 28  ? 95.987  37.354  16.725 1.00 23.57 ? 28  TRP C CG   1 
ATOM   2766 C CD1  . TRP C 1 28  ? 95.315  37.075  15.570 1.00 25.05 ? 28  TRP C CD1  1 
ATOM   2767 C CD2  . TRP C 1 28  ? 95.111  36.954  17.802 1.00 25.14 ? 28  TRP C CD2  1 
ATOM   2768 N NE1  . TRP C 1 28  ? 94.083  36.527  15.856 1.00 25.89 ? 28  TRP C NE1  1 
ATOM   2769 C CE2  . TRP C 1 28  ? 93.936  36.442  17.207 1.00 23.63 ? 28  TRP C CE2  1 
ATOM   2770 C CE3  . TRP C 1 28  ? 95.211  36.982  19.195 1.00 26.17 ? 28  TRP C CE3  1 
ATOM   2771 C CZ2  . TRP C 1 28  ? 92.868  35.960  17.973 1.00 26.30 ? 28  TRP C CZ2  1 
ATOM   2772 C CZ3  . TRP C 1 28  ? 94.142  36.501  19.952 1.00 26.13 ? 28  TRP C CZ3  1 
ATOM   2773 C CH2  . TRP C 1 28  ? 92.990  35.998  19.337 1.00 23.71 ? 28  TRP C CH2  1 
ATOM   2774 H H    . TRP C 1 28  ? 97.863  38.500  14.270 1.00 0.00  ? 28  TRP C H    1 
ATOM   2775 H HE1  . TRP C 1 28  ? 93.445  36.239  15.176 1.00 0.00  ? 28  TRP C HE1  1 
ATOM   2776 N N    . ASP C 1 29  ? 98.873  41.157  17.081 1.00 11.72 ? 29  ASP C N    1 
ATOM   2777 C CA   . ASP C 1 29  ? 100.087 41.882  17.440 1.00 13.63 ? 29  ASP C CA   1 
ATOM   2778 C C    . ASP C 1 29  ? 100.440 41.576  18.879 1.00 18.28 ? 29  ASP C C    1 
ATOM   2779 O O    . ASP C 1 29  ? 99.724  42.006  19.797 1.00 18.92 ? 29  ASP C O    1 
ATOM   2780 C CB   . ASP C 1 29  ? 99.872  43.391  17.343 1.00 11.05 ? 29  ASP C CB   1 
ATOM   2781 C CG   . ASP C 1 29  ? 99.561  43.854  15.954 1.00 12.19 ? 29  ASP C CG   1 
ATOM   2782 O OD1  . ASP C 1 29  ? 100.323 43.519  15.018 1.00 10.09 ? 29  ASP C OD1  1 
ATOM   2783 O OD2  . ASP C 1 29  ? 98.557  44.583  15.812 1.00 18.43 ? 29  ASP C OD2  1 
ATOM   2784 H H    . ASP C 1 29  ? 98.006  41.555  17.291 1.00 0.00  ? 29  ASP C H    1 
ATOM   2785 N N    . ILE C 1 30  ? 101.535 40.856  19.092 1.00 19.00 ? 30  ILE C N    1 
ATOM   2786 C CA   . ILE C 1 30  ? 101.949 40.531  20.451 1.00 17.00 ? 30  ILE C CA   1 
ATOM   2787 C C    . ILE C 1 30  ? 103.106 41.434  20.856 1.00 18.74 ? 30  ILE C C    1 
ATOM   2788 O O    . ILE C 1 30  ? 104.094 41.577  20.132 1.00 22.51 ? 30  ILE C O    1 
ATOM   2789 C CB   . ILE C 1 30  ? 102.329 39.033  20.635 1.00 10.30 ? 30  ILE C CB   1 
ATOM   2790 C CG1  . ILE C 1 30  ? 101.170 38.130  20.233 1.00 7.75  ? 30  ILE C CG1  1 
ATOM   2791 C CG2  . ILE C 1 30  ? 102.578 38.734  22.089 1.00 6.15  ? 30  ILE C CG2  1 
ATOM   2792 C CD1  . ILE C 1 30  ? 100.941 38.062  18.771 1.00 17.08 ? 30  ILE C CD1  1 
ATOM   2793 H H    . ILE C 1 30  ? 102.072 40.579  18.321 1.00 0.00  ? 30  ILE C H    1 
ATOM   2794 N N    . SER C 1 31  ? 102.942 42.091  21.991 1.00 20.19 ? 31  SER C N    1 
ATOM   2795 C CA   . SER C 1 31  ? 103.943 42.992  22.517 1.00 25.67 ? 31  SER C CA   1 
ATOM   2796 C C    . SER C 1 31  ? 104.073 42.724  24.000 1.00 27.64 ? 31  SER C C    1 
ATOM   2797 O O    . SER C 1 31  ? 103.257 42.019  24.587 1.00 30.27 ? 31  SER C O    1 
ATOM   2798 C CB   . SER C 1 31  ? 103.503 44.443  22.314 1.00 33.58 ? 31  SER C CB   1 
ATOM   2799 O OG   . SER C 1 31  ? 104.262 45.318  23.139 1.00 43.45 ? 31  SER C OG   1 
ATOM   2800 H H    . SER C 1 31  ? 102.118 41.960  22.512 1.00 0.00  ? 31  SER C H    1 
ATOM   2801 H HG   . SER C 1 31  ? 105.033 45.635  22.651 1.00 0.00  ? 31  SER C HG   1 
ATOM   2802 N N    . SER C 1 32  ? 105.069 43.339  24.618 1.00 25.08 ? 32  SER C N    1 
ATOM   2803 C CA   . SER C 1 32  ? 105.288 43.171  26.039 1.00 26.09 ? 32  SER C CA   1 
ATOM   2804 C C    . SER C 1 32  ? 104.085 43.741  26.775 1.00 20.72 ? 32  SER C C    1 
ATOM   2805 O O    . SER C 1 32  ? 103.840 43.402  27.926 1.00 19.36 ? 32  SER C O    1 
ATOM   2806 C CB   . SER C 1 32  ? 106.564 43.892  26.449 1.00 31.11 ? 32  SER C CB   1 
ATOM   2807 O OG   . SER C 1 32  ? 107.634 43.502  25.604 1.00 41.26 ? 32  SER C OG   1 
ATOM   2808 H H    . SER C 1 32  ? 105.634 43.950  24.111 1.00 0.00  ? 32  SER C H    1 
ATOM   2809 H HG   . SER C 1 32  ? 107.418 43.474  24.665 1.00 0.00  ? 32  SER C HG   1 
ATOM   2810 N N    . SER C 1 33  ? 103.337 44.612  26.103 1.00 24.90 ? 33  SER C N    1 
ATOM   2811 C CA   . SER C 1 33  ? 102.141 45.198  26.700 1.00 28.20 ? 33  SER C CA   1 
ATOM   2812 C C    . SER C 1 33  ? 100.993 44.182  26.710 1.00 23.58 ? 33  SER C C    1 
ATOM   2813 O O    . SER C 1 33  ? 100.112 44.235  27.579 1.00 23.15 ? 33  SER C O    1 
ATOM   2814 C CB   . SER C 1 33  ? 101.728 46.474  25.955 1.00 31.76 ? 33  SER C CB   1 
ATOM   2815 O OG   . SER C 1 33  ? 101.425 46.221  24.590 1.00 41.02 ? 33  SER C OG   1 
ATOM   2816 H H    . SER C 1 33  ? 103.562 44.901  25.190 1.00 0.00  ? 33  SER C H    1 
ATOM   2817 H HG   . SER C 1 33  ? 100.562 45.815  24.482 1.00 0.00  ? 33  SER C HG   1 
ATOM   2818 N N    . GLY C 1 34  ? 101.017 43.254  25.755 1.00 13.32 ? 34  GLY C N    1 
ATOM   2819 C CA   . GLY C 1 34  ? 99.982  42.242  25.678 1.00 16.98 ? 34  GLY C CA   1 
ATOM   2820 C C    . GLY C 1 34  ? 99.597  41.887  24.260 1.00 15.20 ? 34  GLY C C    1 
ATOM   2821 O O    . GLY C 1 34  ? 100.350 42.143  23.323 1.00 20.04 ? 34  GLY C O    1 
ATOM   2822 H H    . GLY C 1 34  ? 101.733 43.212  25.089 1.00 0.00  ? 34  GLY C H    1 
ATOM   2823 N N    . VAL C 1 35  ? 98.424  41.286  24.107 1.00 18.13 ? 35  VAL C N    1 
ATOM   2824 C CA   . VAL C 1 35  ? 97.906  40.881  22.800 1.00 21.80 ? 35  VAL C CA   1 
ATOM   2825 C C    . VAL C 1 35  ? 96.937  41.937  22.271 1.00 25.99 ? 35  VAL C C    1 
ATOM   2826 O O    . VAL C 1 35  ? 95.963  42.291  22.945 1.00 27.20 ? 35  VAL C O    1 
ATOM   2827 C CB   . VAL C 1 35  ? 97.169  39.511  22.896 1.00 22.22 ? 35  VAL C CB   1 
ATOM   2828 C CG1  . VAL C 1 35  ? 96.503  39.159  21.583 1.00 19.57 ? 35  VAL C CG1  1 
ATOM   2829 C CG2  . VAL C 1 35  ? 98.147  38.414  23.301 1.00 24.10 ? 35  VAL C CG2  1 
ATOM   2830 H H    . VAL C 1 35  ? 97.887  41.100  24.904 1.00 0.00  ? 35  VAL C H    1 
ATOM   2831 N N    . ASN C 1 36  ? 97.214  42.445  21.075 1.00 23.89 ? 36  ASN C N    1 
ATOM   2832 C CA   . ASN C 1 36  ? 96.360  43.447  20.449 1.00 20.42 ? 36  ASN C CA   1 
ATOM   2833 C C    . ASN C 1 36  ? 95.912  42.978  19.079 1.00 14.80 ? 36  ASN C C    1 
ATOM   2834 O O    . ASN C 1 36  ? 96.690  42.388  18.331 1.00 13.98 ? 36  ASN C O    1 
ATOM   2835 C CB   . ASN C 1 36  ? 97.101  44.770  20.290 1.00 26.87 ? 36  ASN C CB   1 
ATOM   2836 C CG   . ASN C 1 36  ? 97.226  45.525  21.585 1.00 33.01 ? 36  ASN C CG   1 
ATOM   2837 O OD1  . ASN C 1 36  ? 96.245  46.058  22.100 1.00 41.26 ? 36  ASN C OD1  1 
ATOM   2838 N ND2  . ASN C 1 36  ? 98.438  45.595  22.114 1.00 40.06 ? 36  ASN C ND2  1 
ATOM   2839 H H    . ASN C 1 36  ? 97.992  42.123  20.580 1.00 0.00  ? 36  ASN C H    1 
ATOM   2840 H HD21 . ASN C 1 36  ? 98.522  46.090  22.951 1.00 0.00  ? 36  ASN C HD21 1 
ATOM   2841 H HD22 . ASN C 1 36  ? 99.189  45.169  21.659 1.00 0.00  ? 36  ASN C HD22 1 
ATOM   2842 N N    . LEU C 1 37  ? 94.664  43.259  18.742 1.00 9.76  ? 37  LEU C N    1 
ATOM   2843 C CA   . LEU C 1 37  ? 94.128  42.863  17.449 1.00 13.71 ? 37  LEU C CA   1 
ATOM   2844 C C    . LEU C 1 37  ? 93.137  43.899  16.947 1.00 10.03 ? 37  LEU C C    1 
ATOM   2845 O O    . LEU C 1 37  ? 92.227  44.284  17.668 1.00 18.92 ? 37  LEU C O    1 
ATOM   2846 C CB   . LEU C 1 37  ? 93.448  41.484  17.554 1.00 11.02 ? 37  LEU C CB   1 
ATOM   2847 C CG   . LEU C 1 37  ? 92.627  40.936  16.373 1.00 11.79 ? 37  LEU C CG   1 
ATOM   2848 C CD1  . LEU C 1 37  ? 92.538  39.438  16.495 1.00 10.89 ? 37  LEU C CD1  1 
ATOM   2849 C CD2  . LEU C 1 37  ? 91.221  41.540  16.306 1.00 4.46  ? 37  LEU C CD2  1 
ATOM   2850 H H    . LEU C 1 37  ? 94.079  43.738  19.370 1.00 0.00  ? 37  LEU C H    1 
ATOM   2851 N N    . GLN C 1 38  ? 93.348  44.397  15.738 1.00 8.46  ? 38  GLN C N    1 
ATOM   2852 C CA   . GLN C 1 38  ? 92.422  45.352  15.150 1.00 16.48 ? 38  GLN C CA   1 
ATOM   2853 C C    . GLN C 1 38  ? 92.136  44.834  13.752 1.00 21.11 ? 38  GLN C C    1 
ATOM   2854 O O    . GLN C 1 38  ? 93.062  44.514  12.998 1.00 26.22 ? 38  GLN C O    1 
ATOM   2855 C CB   . GLN C 1 38  ? 93.011  46.764  15.058 1.00 16.90 ? 38  GLN C CB   1 
ATOM   2856 C CG   . GLN C 1 38  ? 91.932  47.808  14.802 1.00 18.20 ? 38  GLN C CG   1 
ATOM   2857 C CD   . GLN C 1 38  ? 92.426  49.023  14.063 1.00 20.76 ? 38  GLN C CD   1 
ATOM   2858 O OE1  . GLN C 1 38  ? 92.643  48.974  12.854 1.00 35.02 ? 38  GLN C OE1  1 
ATOM   2859 N NE2  . GLN C 1 38  ? 92.581  50.132  14.770 1.00 19.34 ? 38  GLN C NE2  1 
ATOM   2860 H H    . GLN C 1 38  ? 94.143  44.134  15.220 1.00 0.00  ? 38  GLN C H    1 
ATOM   2861 H HE21 . GLN C 1 38  ? 92.873  50.942  14.308 1.00 0.00  ? 38  GLN C HE21 1 
ATOM   2862 H HE22 . GLN C 1 38  ? 92.386  50.118  15.740 1.00 0.00  ? 38  GLN C HE22 1 
ATOM   2863 N N    . SER C 1 39  ? 90.864  44.698  13.411 1.00 16.61 ? 39  SER C N    1 
ATOM   2864 C CA   . SER C 1 39  ? 90.527  44.205  12.093 1.00 15.33 ? 39  SER C CA   1 
ATOM   2865 C C    . SER C 1 39  ? 89.191  44.737  11.656 1.00 17.78 ? 39  SER C C    1 
ATOM   2866 O O    . SER C 1 39  ? 88.339  45.057  12.480 1.00 19.13 ? 39  SER C O    1 
ATOM   2867 C CB   . SER C 1 39  ? 90.515  42.682  12.067 1.00 17.44 ? 39  SER C CB   1 
ATOM   2868 O OG   . SER C 1 39  ? 90.243  42.224  10.757 1.00 15.83 ? 39  SER C OG   1 
ATOM   2869 H H    . SER C 1 39  ? 90.146  44.949  14.038 1.00 0.00  ? 39  SER C H    1 
ATOM   2870 H HG   . SER C 1 39  ? 90.940  42.468  10.143 1.00 0.00  ? 39  SER C HG   1 
ATOM   2871 N N    . MET C 1 40  ? 89.008  44.769  10.345 1.00 17.17 ? 40  MET C N    1 
ATOM   2872 C CA   . MET C 1 40  ? 87.812  45.281  9.710  1.00 17.67 ? 40  MET C CA   1 
ATOM   2873 C C    . MET C 1 40  ? 87.156  44.107  9.014  1.00 22.06 ? 40  MET C C    1 
ATOM   2874 O O    . MET C 1 40  ? 87.850  43.269  8.433  1.00 29.74 ? 40  MET C O    1 
ATOM   2875 C CB   . MET C 1 40  ? 88.252  46.320  8.680  1.00 18.57 ? 40  MET C CB   1 
ATOM   2876 C CG   . MET C 1 40  ? 87.226  47.357  8.313  1.00 20.63 ? 40  MET C CG   1 
ATOM   2877 S SD   . MET C 1 40  ? 88.021  48.936  8.000  1.00 17.82 ? 40  MET C SD   1 
ATOM   2878 C CE   . MET C 1 40  ? 88.814  48.659  6.457  1.00 17.21 ? 40  MET C CE   1 
ATOM   2879 H H    . MET C 1 40  ? 89.676  44.407  9.753  1.00 0.00  ? 40  MET C H    1 
ATOM   2880 N N    . ASP C 1 41  ? 85.837  43.997  9.114  1.00 21.94 ? 41  ASP C N    1 
ATOM   2881 C CA   . ASP C 1 41  ? 85.151  42.900  8.449  1.00 15.59 ? 41  ASP C CA   1 
ATOM   2882 C C    . ASP C 1 41  ? 85.177  43.175  6.947  1.00 19.54 ? 41  ASP C C    1 
ATOM   2883 O O    . ASP C 1 41  ? 85.362  44.325  6.516  1.00 12.35 ? 41  ASP C O    1 
ATOM   2884 C CB   . ASP C 1 41  ? 83.719  42.768  8.947  1.00 20.56 ? 41  ASP C CB   1 
ATOM   2885 C CG   . ASP C 1 41  ? 82.794  43.782  8.328  1.00 25.05 ? 41  ASP C CG   1 
ATOM   2886 O OD1  . ASP C 1 41  ? 82.811  44.952  8.752  1.00 30.13 ? 41  ASP C OD1  1 
ATOM   2887 O OD2  . ASP C 1 41  ? 82.054  43.401  7.406  1.00 29.83 ? 41  ASP C OD2  1 
ATOM   2888 H H    . ASP C 1 41  ? 85.331  44.659  9.625  1.00 0.00  ? 41  ASP C H    1 
ATOM   2889 N N    . SER C 1 42  ? 84.916  42.132  6.166  1.00 19.80 ? 42  SER C N    1 
ATOM   2890 C CA   . SER C 1 42  ? 84.938  42.188  4.703  1.00 21.57 ? 42  SER C CA   1 
ATOM   2891 C C    . SER C 1 42  ? 84.301  43.413  4.068  1.00 21.29 ? 42  SER C C    1 
ATOM   2892 O O    . SER C 1 42  ? 84.869  44.010  3.156  1.00 22.23 ? 42  SER C O    1 
ATOM   2893 C CB   . SER C 1 42  ? 84.291  40.932  4.137  1.00 21.18 ? 42  SER C CB   1 
ATOM   2894 O OG   . SER C 1 42  ? 84.900  39.780  4.688  1.00 35.12 ? 42  SER C OG   1 
ATOM   2895 H H    . SER C 1 42  ? 84.666  41.293  6.594  1.00 0.00  ? 42  SER C H    1 
ATOM   2896 H HG   . SER C 1 42  ? 84.866  39.834  5.656  1.00 0.00  ? 42  SER C HG   1 
ATOM   2897 N N    . SER C 1 43  ? 83.124  43.784  4.551  1.00 20.71 ? 43  SER C N    1 
ATOM   2898 C CA   . SER C 1 43  ? 82.413  44.928  4.016  1.00 23.04 ? 43  SER C CA   1 
ATOM   2899 C C    . SER C 1 43  ? 82.950  46.263  4.529  1.00 24.14 ? 43  SER C C    1 
ATOM   2900 O O    . SER C 1 43  ? 82.512  47.322  4.085  1.00 28.49 ? 43  SER C O    1 
ATOM   2901 C CB   . SER C 1 43  ? 80.928  44.804  4.343  1.00 22.57 ? 43  SER C CB   1 
ATOM   2902 O OG   . SER C 1 43  ? 80.743  44.743  5.744  1.00 29.75 ? 43  SER C OG   1 
ATOM   2903 H H    . SER C 1 43  ? 82.695  43.289  5.274  1.00 0.00  ? 43  SER C H    1 
ATOM   2904 H HG   . SER C 1 43  ? 79.792  44.655  5.893  1.00 0.00  ? 43  SER C HG   1 
ATOM   2905 N N    . HIS C 1 44  ? 83.864  46.216  5.489  1.00 20.60 ? 44  HIS C N    1 
ATOM   2906 C CA   . HIS C 1 44  ? 84.444  47.434  6.046  1.00 18.47 ? 44  HIS C CA   1 
ATOM   2907 C C    . HIS C 1 44  ? 83.395  48.344  6.704  1.00 18.29 ? 44  HIS C C    1 
ATOM   2908 O O    . HIS C 1 44  ? 83.576  49.564  6.787  1.00 18.13 ? 44  HIS C O    1 
ATOM   2909 C CB   . HIS C 1 44  ? 85.213  48.217  4.968  1.00 24.55 ? 44  HIS C CB   1 
ATOM   2910 C CG   . HIS C 1 44  ? 86.466  47.540  4.477  1.00 28.51 ? 44  HIS C CG   1 
ATOM   2911 N ND1  . HIS C 1 44  ? 87.318  48.128  3.564  1.00 24.03 ? 44  HIS C ND1  1 
ATOM   2912 C CD2  . HIS C 1 44  ? 87.008  46.331  4.765  1.00 26.76 ? 44  HIS C CD2  1 
ATOM   2913 C CE1  . HIS C 1 44  ? 88.324  47.312  3.308  1.00 17.94 ? 44  HIS C CE1  1 
ATOM   2914 N NE2  . HIS C 1 44  ? 88.162  46.214  4.025  1.00 17.52 ? 44  HIS C NE2  1 
ATOM   2915 H H    . HIS C 1 44  ? 84.132  45.348  5.798  1.00 0.00  ? 44  HIS C H    1 
ATOM   2916 H HD1  . HIS C 1 44  ? 87.193  49.012  3.161  1.00 0.00  ? 44  HIS C HD1  1 
ATOM   2917 H HE2  . HIS C 1 44  ? 88.755  45.437  4.020  1.00 0.00  ? 44  HIS C HE2  1 
ATOM   2918 N N    . VAL C 1 45  ? 82.296  47.755  7.162  1.00 14.65 ? 45  VAL C N    1 
ATOM   2919 C CA   . VAL C 1 45  ? 81.243  48.522  7.827  1.00 16.03 ? 45  VAL C CA   1 
ATOM   2920 C C    . VAL C 1 45  ? 81.499  48.564  9.329  1.00 19.20 ? 45  VAL C C    1 
ATOM   2921 O O    . VAL C 1 45  ? 81.115  49.523  10.004 1.00 26.11 ? 45  VAL C O    1 
ATOM   2922 C CB   . VAL C 1 45  ? 79.835  47.919  7.563  1.00 17.60 ? 45  VAL C CB   1 
ATOM   2923 C CG1  . VAL C 1 45  ? 78.804  48.498  8.525  1.00 6.81  ? 45  VAL C CG1  1 
ATOM   2924 C CG2  . VAL C 1 45  ? 79.421  48.183  6.130  1.00 15.02 ? 45  VAL C CG2  1 
ATOM   2925 H H    . VAL C 1 45  ? 82.179  46.794  7.031  1.00 0.00  ? 45  VAL C H    1 
ATOM   2926 N N    . SER C 1 46  ? 82.131  47.514  9.852  1.00 16.39 ? 46  SER C N    1 
ATOM   2927 C CA   . SER C 1 46  ? 82.441  47.437  11.269 1.00 11.67 ? 46  SER C CA   1 
ATOM   2928 C C    . SER C 1 46  ? 83.914  47.161  11.426 1.00 10.92 ? 46  SER C C    1 
ATOM   2929 O O    . SER C 1 46  ? 84.572  46.701  10.493 1.00 8.92  ? 46  SER C O    1 
ATOM   2930 C CB   . SER C 1 46  ? 81.650  46.333  11.965 1.00 7.76  ? 46  SER C CB   1 
ATOM   2931 O OG   . SER C 1 46  ? 82.241  45.066  11.738 1.00 17.41 ? 46  SER C OG   1 
ATOM   2932 H H    . SER C 1 46  ? 82.424  46.804  9.265  1.00 0.00  ? 46  SER C H    1 
ATOM   2933 H HG   . SER C 1 46  ? 82.198  44.831  10.810 1.00 0.00  ? 46  SER C HG   1 
ATOM   2934 N N    . LEU C 1 47  ? 84.393  47.348  12.647 1.00 16.42 ? 47  LEU C N    1 
ATOM   2935 C CA   . LEU C 1 47  ? 85.790  47.156  12.974 1.00 12.63 ? 47  LEU C CA   1 
ATOM   2936 C C    . LEU C 1 47  ? 85.873  46.617  14.404 1.00 15.73 ? 47  LEU C C    1 
ATOM   2937 O O    . LEU C 1 47  ? 85.036  46.945  15.245 1.00 13.61 ? 47  LEU C O    1 
ATOM   2938 C CB   . LEU C 1 47  ? 86.497  48.507  12.847 1.00 6.23  ? 47  LEU C CB   1 
ATOM   2939 C CG   . LEU C 1 47  ? 87.999  48.625  13.034 1.00 5.36  ? 47  LEU C CG   1 
ATOM   2940 C CD1  . LEU C 1 47  ? 88.613  49.364  11.842 1.00 2.46  ? 47  LEU C CD1  1 
ATOM   2941 C CD2  . LEU C 1 47  ? 88.257  49.357  14.328 1.00 2.00  ? 47  LEU C CD2  1 
ATOM   2942 H H    . LEU C 1 47  ? 83.788  47.607  13.370 1.00 0.00  ? 47  LEU C H    1 
ATOM   2943 N N    . VAL C 1 48  ? 86.850  45.752  14.653 1.00 17.07 ? 48  VAL C N    1 
ATOM   2944 C CA   . VAL C 1 48  ? 87.061  45.157  15.964 1.00 18.92 ? 48  VAL C CA   1 
ATOM   2945 C C    . VAL C 1 48  ? 88.421  45.577  16.499 1.00 16.30 ? 48  VAL C C    1 
ATOM   2946 O O    . VAL C 1 48  ? 89.379  45.728  15.743 1.00 20.31 ? 48  VAL C O    1 
ATOM   2947 C CB   . VAL C 1 48  ? 87.037  43.611  15.896 1.00 23.05 ? 48  VAL C CB   1 
ATOM   2948 C CG1  . VAL C 1 48  ? 87.410  43.017  17.243 1.00 28.67 ? 48  VAL C CG1  1 
ATOM   2949 C CG2  . VAL C 1 48  ? 85.667  43.124  15.489 1.00 28.34 ? 48  VAL C CG2  1 
ATOM   2950 H H    . VAL C 1 48  ? 87.463  45.496  13.952 1.00 0.00  ? 48  VAL C H    1 
ATOM   2951 N N    . GLN C 1 49  ? 88.498  45.743  17.810 1.00 17.34 ? 49  GLN C N    1 
ATOM   2952 C CA   . GLN C 1 49  ? 89.731  46.113  18.465 1.00 15.67 ? 49  GLN C CA   1 
ATOM   2953 C C    . GLN C 1 49  ? 89.719  45.346  19.786 1.00 19.30 ? 49  GLN C C    1 
ATOM   2954 O O    . GLN C 1 49  ? 88.854  45.562  20.629 1.00 13.37 ? 49  GLN C O    1 
ATOM   2955 C CB   . GLN C 1 49  ? 89.769  47.625  18.676 1.00 18.07 ? 49  GLN C CB   1 
ATOM   2956 C CG   . GLN C 1 49  ? 91.134  48.181  19.011 1.00 21.39 ? 49  GLN C CG   1 
ATOM   2957 C CD   . GLN C 1 49  ? 91.586  47.774  20.387 1.00 25.91 ? 49  GLN C CD   1 
ATOM   2958 O OE1  . GLN C 1 49  ? 90.977  48.164  21.384 1.00 26.83 ? 49  GLN C OE1  1 
ATOM   2959 N NE2  . GLN C 1 49  ? 92.636  46.959  20.456 1.00 24.57 ? 49  GLN C NE2  1 
ATOM   2960 H H    . GLN C 1 49  ? 87.696  45.623  18.364 1.00 0.00  ? 49  GLN C H    1 
ATOM   2961 H HE21 . GLN C 1 49  ? 92.907  46.709  21.365 1.00 0.00  ? 49  GLN C HE21 1 
ATOM   2962 H HE22 . GLN C 1 49  ? 93.096  46.646  19.651 1.00 0.00  ? 49  GLN C HE22 1 
ATOM   2963 N N    . LEU C 1 50  ? 90.626  44.375  19.892 1.00 23.60 ? 50  LEU C N    1 
ATOM   2964 C CA   . LEU C 1 50  ? 90.785  43.509  21.060 1.00 15.34 ? 50  LEU C CA   1 
ATOM   2965 C C    . LEU C 1 50  ? 92.091  43.823  21.776 1.00 16.86 ? 50  LEU C C    1 
ATOM   2966 O O    . LEU C 1 50  ? 93.141  43.993  21.140 1.00 16.72 ? 50  LEU C O    1 
ATOM   2967 C CB   . LEU C 1 50  ? 90.810  42.049  20.613 1.00 10.12 ? 50  LEU C CB   1 
ATOM   2968 C CG   . LEU C 1 50  ? 91.239  40.970  21.602 1.00 10.72 ? 50  LEU C CG   1 
ATOM   2969 C CD1  . LEU C 1 50  ? 90.082  40.619  22.500 1.00 13.39 ? 50  LEU C CD1  1 
ATOM   2970 C CD2  . LEU C 1 50  ? 91.674  39.729  20.844 1.00 15.00 ? 50  LEU C CD2  1 
ATOM   2971 H H    . LEU C 1 50  ? 91.234  44.228  19.154 1.00 0.00  ? 50  LEU C H    1 
ATOM   2972 N N    . THR C 1 51  ? 92.023  43.869  23.101 1.00 17.43 ? 51  THR C N    1 
ATOM   2973 C CA   . THR C 1 51  ? 93.183  44.142  23.927 1.00 11.51 ? 51  THR C CA   1 
ATOM   2974 C C    . THR C 1 51  ? 93.167  43.238  25.157 1.00 14.47 ? 51  THR C C    1 
ATOM   2975 O O    . THR C 1 51  ? 92.172  43.182  25.895 1.00 6.92  ? 51  THR C O    1 
ATOM   2976 C CB   . THR C 1 51  ? 93.248  45.632  24.350 1.00 12.04 ? 51  THR C CB   1 
ATOM   2977 O OG1  . THR C 1 51  ? 93.483  46.453  23.199 1.00 14.50 ? 51  THR C OG1  1 
ATOM   2978 C CG2  . THR C 1 51  ? 94.371  45.861  25.327 1.00 16.18 ? 51  THR C CG2  1 
ATOM   2979 H H    . THR C 1 51  ? 91.166  43.714  23.553 1.00 0.00  ? 51  THR C H    1 
ATOM   2980 H HG1  . THR C 1 51  ? 94.346  46.238  22.809 1.00 0.00  ? 51  THR C HG1  1 
ATOM   2981 N N    . LEU C 1 52  ? 94.239  42.460  25.298 1.00 12.67 ? 52  LEU C N    1 
ATOM   2982 C CA   . LEU C 1 52  ? 94.433  41.549  26.423 1.00 18.59 ? 52  LEU C CA   1 
ATOM   2983 C C    . LEU C 1 52  ? 95.767  41.968  27.038 1.00 22.36 ? 52  LEU C C    1 
ATOM   2984 O O    . LEU C 1 52  ? 96.829  41.638  26.506 1.00 25.96 ? 52  LEU C O    1 
ATOM   2985 C CB   . LEU C 1 52  ? 94.517  40.087  25.949 1.00 12.72 ? 52  LEU C CB   1 
ATOM   2986 C CG   . LEU C 1 52  ? 93.309  39.463  25.242 1.00 10.91 ? 52  LEU C CG   1 
ATOM   2987 C CD1  . LEU C 1 52  ? 93.636  38.069  24.778 1.00 2.00  ? 52  LEU C CD1  1 
ATOM   2988 C CD2  . LEU C 1 52  ? 92.105  39.452  26.157 1.00 10.94 ? 52  LEU C CD2  1 
ATOM   2989 H H    . LEU C 1 52  ? 94.941  42.503  24.614 1.00 0.00  ? 52  LEU C H    1 
ATOM   2990 N N    . ARG C 1 53  ? 95.707  42.749  28.115 1.00 22.46 ? 53  ARG C N    1 
ATOM   2991 C CA   . ARG C 1 53  ? 96.904  43.240  28.792 1.00 23.31 ? 53  ARG C CA   1 
ATOM   2992 C C    . ARG C 1 53  ? 97.768  42.117  29.354 1.00 24.50 ? 53  ARG C C    1 
ATOM   2993 O O    . ARG C 1 53  ? 97.260  41.164  29.956 1.00 21.53 ? 53  ARG C O    1 
ATOM   2994 C CB   . ARG C 1 53  ? 96.525  44.201  29.920 1.00 27.17 ? 53  ARG C CB   1 
ATOM   2995 C CG   . ARG C 1 53  ? 95.791  45.438  29.458 1.00 33.61 ? 53  ARG C CG   1 
ATOM   2996 C CD   . ARG C 1 53  ? 95.370  46.270  30.639 1.00 36.69 ? 53  ARG C CD   1 
ATOM   2997 N NE   . ARG C 1 53  ? 93.946  46.592  30.591 1.00 44.74 ? 53  ARG C NE   1 
ATOM   2998 C CZ   . ARG C 1 53  ? 93.108  46.417  31.611 1.00 53.15 ? 53  ARG C CZ   1 
ATOM   2999 N NH1  . ARG C 1 53  ? 93.548  45.917  32.760 1.00 55.62 ? 53  ARG C NH1  1 
ATOM   3000 N NH2  . ARG C 1 53  ? 91.833  46.769  31.495 1.00 57.25 ? 53  ARG C NH2  1 
ATOM   3001 H H    . ARG C 1 53  ? 94.836  42.996  28.465 1.00 0.00  ? 53  ARG C H    1 
ATOM   3002 H HE   . ARG C 1 53  ? 93.582  46.952  29.756 1.00 0.00  ? 53  ARG C HE   1 
ATOM   3003 H HH11 . ARG C 1 53  ? 94.512  45.672  32.858 1.00 0.00  ? 53  ARG C HH11 1 
ATOM   3004 H HH12 . ARG C 1 53  ? 92.919  45.785  33.524 1.00 0.00  ? 53  ARG C HH12 1 
ATOM   3005 H HH21 . ARG C 1 53  ? 91.496  47.161  30.640 1.00 0.00  ? 53  ARG C HH21 1 
ATOM   3006 H HH22 . ARG C 1 53  ? 91.211  46.632  32.265 1.00 0.00  ? 53  ARG C HH22 1 
ATOM   3007 N N    . SER C 1 54  ? 99.079  42.258  29.195 1.00 14.67 ? 54  SER C N    1 
ATOM   3008 C CA   . SER C 1 54  ? 100.016 41.263  29.681 1.00 19.50 ? 54  SER C CA   1 
ATOM   3009 C C    . SER C 1 54  ? 99.783  40.911  31.151 1.00 26.35 ? 54  SER C C    1 
ATOM   3010 O O    . SER C 1 54  ? 100.007 39.773  31.567 1.00 33.33 ? 54  SER C O    1 
ATOM   3011 C CB   . SER C 1 54  ? 101.450 41.744  29.465 1.00 14.84 ? 54  SER C CB   1 
ATOM   3012 O OG   . SER C 1 54  ? 101.648 43.019  30.041 1.00 14.83 ? 54  SER C OG   1 
ATOM   3013 H H    . SER C 1 54  ? 99.413  43.036  28.728 1.00 0.00  ? 54  SER C H    1 
ATOM   3014 H HG   . SER C 1 54  ? 101.133 43.691  29.593 1.00 0.00  ? 54  SER C HG   1 
ATOM   3015 N N    . GLU C 1 55  ? 99.273  41.874  31.916 1.00 28.70 ? 55  GLU C N    1 
ATOM   3016 C CA   . GLU C 1 55  ? 99.007  41.678  33.342 1.00 30.31 ? 55  GLU C CA   1 
ATOM   3017 C C    . GLU C 1 55  ? 97.828  40.749  33.610 1.00 28.56 ? 55  GLU C C    1 
ATOM   3018 O O    . GLU C 1 55  ? 97.629  40.296  34.737 1.00 32.43 ? 55  GLU C O    1 
ATOM   3019 C CB   . GLU C 1 55  ? 98.769  43.021  34.038 1.00 29.89 ? 55  GLU C CB   1 
ATOM   3020 C CG   . GLU C 1 55  ? 99.949  43.977  33.986 1.00 37.70 ? 55  GLU C CG   1 
ATOM   3021 C CD   . GLU C 1 55  ? 100.096 44.680  32.643 1.00 45.12 ? 55  GLU C CD   1 
ATOM   3022 O OE1  . GLU C 1 55  ? 99.063  44.998  32.016 1.00 50.96 ? 55  GLU C OE1  1 
ATOM   3023 O OE2  . GLU C 1 55  ? 101.248 44.928  32.219 1.00 46.80 ? 55  GLU C OE2  1 
ATOM   3024 H H    . GLU C 1 55  ? 99.083  42.735  31.507 1.00 0.00  ? 55  GLU C H    1 
ATOM   3025 N N    . GLY C 1 56  ? 97.029  40.495  32.584 1.00 25.05 ? 56  GLY C N    1 
ATOM   3026 C CA   . GLY C 1 56  ? 95.886  39.618  32.750 1.00 21.48 ? 56  GLY C CA   1 
ATOM   3027 C C    . GLY C 1 56  ? 96.274  38.159  32.701 1.00 18.83 ? 56  GLY C C    1 
ATOM   3028 O O    . GLY C 1 56  ? 95.482  37.293  33.064 1.00 20.85 ? 56  GLY C O    1 
ATOM   3029 H H    . GLY C 1 56  ? 97.195  40.906  31.729 1.00 0.00  ? 56  GLY C H    1 
ATOM   3030 N N    . PHE C 1 57  ? 97.486  37.891  32.229 1.00 19.78 ? 57  PHE C N    1 
ATOM   3031 C CA   . PHE C 1 57  ? 97.991  36.534  32.117 1.00 23.56 ? 57  PHE C CA   1 
ATOM   3032 C C    . PHE C 1 57  ? 98.762  36.139  33.364 1.00 25.45 ? 57  PHE C C    1 
ATOM   3033 O O    . PHE C 1 57  ? 99.359  36.989  34.007 1.00 32.78 ? 57  PHE C O    1 
ATOM   3034 C CB   . PHE C 1 57  ? 98.894  36.423  30.891 1.00 24.12 ? 57  PHE C CB   1 
ATOM   3035 C CG   . PHE C 1 57  ? 98.168  36.582  29.590 1.00 23.20 ? 57  PHE C CG   1 
ATOM   3036 C CD1  . PHE C 1 57  ? 97.994  37.837  29.024 1.00 24.62 ? 57  PHE C CD1  1 
ATOM   3037 C CD2  . PHE C 1 57  ? 97.654  35.473  28.932 1.00 25.07 ? 57  PHE C CD2  1 
ATOM   3038 C CE1  . PHE C 1 57  ? 97.316  37.984  27.819 1.00 26.83 ? 57  PHE C CE1  1 
ATOM   3039 C CE2  . PHE C 1 57  ? 96.971  35.609  27.720 1.00 26.64 ? 57  PHE C CE2  1 
ATOM   3040 C CZ   . PHE C 1 57  ? 96.801  36.864  27.164 1.00 21.66 ? 57  PHE C CZ   1 
ATOM   3041 H H    . PHE C 1 57  ? 98.083  38.616  31.952 1.00 0.00  ? 57  PHE C H    1 
ATOM   3042 N N    . ASP C 1 58  ? 98.738  34.854  33.712 1.00 29.13 ? 58  ASP C N    1 
ATOM   3043 C CA   . ASP C 1 58  ? 99.458  34.374  34.888 1.00 31.62 ? 58  ASP C CA   1 
ATOM   3044 C C    . ASP C 1 58  ? 100.931 34.442  34.585 1.00 27.88 ? 58  ASP C C    1 
ATOM   3045 O O    . ASP C 1 58  ? 101.756 34.616  35.472 1.00 28.72 ? 58  ASP C O    1 
ATOM   3046 C CB   . ASP C 1 58  ? 99.094  32.924  35.217 1.00 43.54 ? 58  ASP C CB   1 
ATOM   3047 C CG   . ASP C 1 58  ? 100.065 32.285  36.221 1.00 53.19 ? 58  ASP C CG   1 
ATOM   3048 O OD1  . ASP C 1 58  ? 100.057 32.678  37.409 1.00 56.39 ? 58  ASP C OD1  1 
ATOM   3049 O OD2  . ASP C 1 58  ? 100.846 31.394  35.819 1.00 57.01 ? 58  ASP C OD2  1 
ATOM   3050 H H    . ASP C 1 58  ? 98.243  34.229  33.150 1.00 0.00  ? 58  ASP C H    1 
ATOM   3051 N N    . THR C 1 59  ? 101.250 34.252  33.320 1.00 27.74 ? 59  THR C N    1 
ATOM   3052 C CA   . THR C 1 59  ? 102.622 34.279  32.863 1.00 28.37 ? 59  THR C CA   1 
ATOM   3053 C C    . THR C 1 59  ? 102.591 34.918  31.494 1.00 26.97 ? 59  THR C C    1 
ATOM   3054 O O    . THR C 1 59  ? 101.684 34.669  30.694 1.00 26.54 ? 59  THR C O    1 
ATOM   3055 C CB   . THR C 1 59  ? 103.205 32.845  32.778 1.00 34.06 ? 59  THR C CB   1 
ATOM   3056 O OG1  . THR C 1 59  ? 103.394 32.323  34.103 1.00 36.49 ? 59  THR C OG1  1 
ATOM   3057 C CG2  . THR C 1 59  ? 104.534 32.825  32.012 1.00 33.88 ? 59  THR C CG2  1 
ATOM   3058 H H    . THR C 1 59  ? 100.541 34.122  32.653 1.00 0.00  ? 59  THR C H    1 
ATOM   3059 H HG1  . THR C 1 59  ? 102.580 32.376  34.617 1.00 0.00  ? 59  THR C HG1  1 
ATOM   3060 N N    . TYR C 1 60  ? 103.553 35.783  31.238 1.00 18.81 ? 60  TYR C N    1 
ATOM   3061 C CA   . TYR C 1 60  ? 103.611 36.440  29.959 1.00 20.59 ? 60  TYR C CA   1 
ATOM   3062 C C    . TYR C 1 60  ? 105.061 36.696  29.642 1.00 17.95 ? 60  TYR C C    1 
ATOM   3063 O O    . TYR C 1 60  ? 105.823 37.106  30.508 1.00 25.16 ? 60  TYR C O    1 
ATOM   3064 C CB   . TYR C 1 60  ? 102.846 37.769  30.004 1.00 18.01 ? 60  TYR C CB   1 
ATOM   3065 C CG   . TYR C 1 60  ? 102.627 38.371  28.635 1.00 17.20 ? 60  TYR C CG   1 
ATOM   3066 C CD1  . TYR C 1 60  ? 101.566 37.950  27.843 1.00 21.78 ? 60  TYR C CD1  1 
ATOM   3067 C CD2  . TYR C 1 60  ? 103.510 39.309  28.104 1.00 13.32 ? 60  TYR C CD2  1 
ATOM   3068 C CE1  . TYR C 1 60  ? 101.392 38.435  26.559 1.00 25.23 ? 60  TYR C CE1  1 
ATOM   3069 C CE2  . TYR C 1 60  ? 103.344 39.801  26.815 1.00 16.18 ? 60  TYR C CE2  1 
ATOM   3070 C CZ   . TYR C 1 60  ? 102.283 39.354  26.049 1.00 19.92 ? 60  TYR C CZ   1 
ATOM   3071 O OH   . TYR C 1 60  ? 102.110 39.778  24.758 1.00 19.32 ? 60  TYR C OH   1 
ATOM   3072 H H    . TYR C 1 60  ? 104.245 36.004  31.898 1.00 0.00  ? 60  TYR C H    1 
ATOM   3073 H HH   . TYR C 1 60  ? 102.859 40.310  24.488 1.00 0.00  ? 60  TYR C HH   1 
ATOM   3074 N N    . ARG C 1 61  ? 105.450 36.416  28.412 1.00 18.52 ? 61  ARG C N    1 
ATOM   3075 C CA   . ARG C 1 61  ? 106.810 36.662  27.984 1.00 18.97 ? 61  ARG C CA   1 
ATOM   3076 C C    . ARG C 1 61  ? 106.814 36.915  26.500 1.00 21.68 ? 61  ARG C C    1 
ATOM   3077 O O    . ARG C 1 61  ? 106.243 36.141  25.733 1.00 20.06 ? 61  ARG C O    1 
ATOM   3078 C CB   . ARG C 1 61  ? 107.710 35.471  28.277 1.00 24.25 ? 61  ARG C CB   1 
ATOM   3079 C CG   . ARG C 1 61  ? 109.041 35.544  27.547 1.00 21.77 ? 61  ARG C CG   1 
ATOM   3080 C CD   . ARG C 1 61  ? 109.769 34.240  27.618 1.00 21.45 ? 61  ARG C CD   1 
ATOM   3081 N NE   . ARG C 1 61  ? 110.750 34.130  26.547 1.00 32.55 ? 61  ARG C NE   1 
ATOM   3082 C CZ   . ARG C 1 61  ? 111.747 33.253  26.545 1.00 37.58 ? 61  ARG C CZ   1 
ATOM   3083 N NH1  . ARG C 1 61  ? 111.901 32.414  27.563 1.00 41.08 ? 61  ARG C NH1  1 
ATOM   3084 N NH2  . ARG C 1 61  ? 112.569 33.189  25.508 1.00 42.68 ? 61  ARG C NH2  1 
ATOM   3085 H H    . ARG C 1 61  ? 104.828 35.999  27.778 1.00 0.00  ? 61  ARG C H    1 
ATOM   3086 H HE   . ARG C 1 61  ? 110.686 34.746  25.788 1.00 0.00  ? 61  ARG C HE   1 
ATOM   3087 H HH11 . ARG C 1 61  ? 111.266 32.443  28.337 1.00 0.00  ? 61  ARG C HH11 1 
ATOM   3088 H HH12 . ARG C 1 61  ? 112.648 31.747  27.567 1.00 0.00  ? 61  ARG C HH12 1 
ATOM   3089 H HH21 . ARG C 1 61  ? 112.450 33.793  24.725 1.00 0.00  ? 61  ARG C HH21 1 
ATOM   3090 H HH22 . ARG C 1 61  ? 113.312 32.519  25.524 1.00 0.00  ? 61  ARG C HH22 1 
ATOM   3091 N N    . CYS C 1 62  ? 107.445 38.015  26.110 1.00 27.70 ? 62  CYS C N    1 
ATOM   3092 C CA   . CYS C 1 62  ? 107.572 38.379  24.713 1.00 27.43 ? 62  CYS C CA   1 
ATOM   3093 C C    . CYS C 1 62  ? 108.888 39.117  24.525 1.00 28.90 ? 62  CYS C C    1 
ATOM   3094 O O    . CYS C 1 62  ? 108.990 40.297  24.848 1.00 35.02 ? 62  CYS C O    1 
ATOM   3095 C CB   . CYS C 1 62  ? 106.425 39.269  24.267 1.00 18.49 ? 62  CYS C CB   1 
ATOM   3096 S SG   . CYS C 1 62  ? 106.527 39.600  22.515 1.00 28.23 ? 62  CYS C SG   1 
ATOM   3097 H H    . CYS C 1 62  ? 107.859 38.603  26.775 1.00 0.00  ? 62  CYS C H    1 
ATOM   3098 N N    . ASP C 1 63  ? 109.905 38.409  24.042 1.00 29.38 ? 63  ASP C N    1 
ATOM   3099 C CA   . ASP C 1 63  ? 111.212 39.015  23.817 1.00 29.89 ? 63  ASP C CA   1 
ATOM   3100 C C    . ASP C 1 63  ? 111.082 40.020  22.679 1.00 33.24 ? 63  ASP C C    1 
ATOM   3101 O O    . ASP C 1 63  ? 111.327 41.214  22.848 1.00 39.64 ? 63  ASP C O    1 
ATOM   3102 C CB   . ASP C 1 63  ? 112.254 37.955  23.430 1.00 33.17 ? 63  ASP C CB   1 
ATOM   3103 C CG   . ASP C 1 63  ? 112.270 36.752  24.372 1.00 40.22 ? 63  ASP C CG   1 
ATOM   3104 O OD1  . ASP C 1 63  ? 112.105 36.919  25.598 1.00 43.54 ? 63  ASP C OD1  1 
ATOM   3105 O OD2  . ASP C 1 63  ? 112.465 35.622  23.875 1.00 49.97 ? 63  ASP C OD2  1 
ATOM   3106 H H    . ASP C 1 63  ? 109.753 37.459  23.834 1.00 0.00  ? 63  ASP C H    1 
ATOM   3107 N N    . ARG C 1 64  ? 110.613 39.525  21.539 1.00 34.90 ? 64  ARG C N    1 
ATOM   3108 C CA   . ARG C 1 64  ? 110.459 40.325  20.334 1.00 33.46 ? 64  ARG C CA   1 
ATOM   3109 C C    . ARG C 1 64  ? 109.005 40.383  19.861 1.00 33.82 ? 64  ARG C C    1 
ATOM   3110 O O    . ARG C 1 64  ? 108.309 39.364  19.848 1.00 40.16 ? 64  ARG C O    1 
ATOM   3111 C CB   . ARG C 1 64  ? 111.341 39.727  19.248 1.00 33.81 ? 64  ARG C CB   1 
ATOM   3112 C CG   . ARG C 1 64  ? 112.744 39.461  19.733 1.00 38.80 ? 64  ARG C CG   1 
ATOM   3113 C CD   . ARG C 1 64  ? 113.596 38.786  18.677 1.00 47.90 ? 64  ARG C CD   1 
ATOM   3114 N NE   . ARG C 1 64  ? 114.993 38.646  19.094 1.00 48.50 ? 64  ARG C NE   1 
ATOM   3115 C CZ   . ARG C 1 64  ? 115.777 39.664  19.439 1.00 47.23 ? 64  ARG C CZ   1 
ATOM   3116 N NH1  . ARG C 1 64  ? 115.311 40.907  19.426 1.00 46.30 ? 64  ARG C NH1  1 
ATOM   3117 N NH2  . ARG C 1 64  ? 117.037 39.443  19.778 1.00 47.80 ? 64  ARG C NH2  1 
ATOM   3118 H H    . ARG C 1 64  ? 110.347 38.581  21.541 1.00 0.00  ? 64  ARG C H    1 
ATOM   3119 H HE   . ARG C 1 64  ? 115.383 37.750  19.109 1.00 0.00  ? 64  ARG C HE   1 
ATOM   3120 H HH11 . ARG C 1 64  ? 114.368 41.101  19.147 1.00 0.00  ? 64  ARG C HH11 1 
ATOM   3121 H HH12 . ARG C 1 64  ? 115.901 41.676  19.678 1.00 0.00  ? 64  ARG C HH12 1 
ATOM   3122 H HH21 . ARG C 1 64  ? 117.412 38.519  19.761 1.00 0.00  ? 64  ARG C HH21 1 
ATOM   3123 H HH22 . ARG C 1 64  ? 117.617 40.222  20.020 1.00 0.00  ? 64  ARG C HH22 1 
ATOM   3124 N N    . ASN C 1 65  ? 108.566 41.566  19.438 1.00 27.58 ? 65  ASN C N    1 
ATOM   3125 C CA   . ASN C 1 65  ? 107.194 41.769  18.976 1.00 25.92 ? 65  ASN C CA   1 
ATOM   3126 C C    . ASN C 1 65  ? 106.850 40.905  17.782 1.00 28.78 ? 65  ASN C C    1 
ATOM   3127 O O    . ASN C 1 65  ? 107.618 40.821  16.821 1.00 34.43 ? 65  ASN C O    1 
ATOM   3128 C CB   . ASN C 1 65  ? 106.940 43.232  18.619 1.00 21.51 ? 65  ASN C CB   1 
ATOM   3129 C CG   . ASN C 1 65  ? 107.098 44.165  19.803 1.00 23.55 ? 65  ASN C CG   1 
ATOM   3130 O OD1  . ASN C 1 65  ? 107.014 45.377  19.647 1.00 30.55 ? 65  ASN C OD1  1 
ATOM   3131 N ND2  . ASN C 1 65  ? 107.310 43.611  20.992 1.00 26.10 ? 65  ASN C ND2  1 
ATOM   3132 H H    . ASN C 1 65  ? 109.198 42.313  19.406 1.00 0.00  ? 65  ASN C H    1 
ATOM   3133 H HD21 . ASN C 1 65  ? 107.491 44.214  21.744 1.00 0.00  ? 65  ASN C HD21 1 
ATOM   3134 H HD22 . ASN C 1 65  ? 107.329 42.645  21.142 1.00 0.00  ? 65  ASN C HD22 1 
ATOM   3135 N N    . LEU C 1 66  ? 105.667 40.307  17.835 1.00 31.15 ? 66  LEU C N    1 
ATOM   3136 C CA   . LEU C 1 66  ? 105.179 39.427  16.785 1.00 23.93 ? 66  LEU C CA   1 
ATOM   3137 C C    . LEU C 1 66  ? 103.907 39.948  16.128 1.00 24.99 ? 66  LEU C C    1 
ATOM   3138 O O    . LEU C 1 66  ? 103.120 40.668  16.742 1.00 27.18 ? 66  LEU C O    1 
ATOM   3139 C CB   . LEU C 1 66  ? 104.895 38.049  17.375 1.00 28.63 ? 66  LEU C CB   1 
ATOM   3140 C CG   . LEU C 1 66  ? 106.082 37.147  17.706 1.00 33.08 ? 66  LEU C CG   1 
ATOM   3141 C CD1  . LEU C 1 66  ? 105.747 36.283  18.891 1.00 30.69 ? 66  LEU C CD1  1 
ATOM   3142 C CD2  . LEU C 1 66  ? 106.430 36.296  16.489 1.00 38.70 ? 66  LEU C CD2  1 
ATOM   3143 H H    . LEU C 1 66  ? 105.086 40.467  18.608 1.00 0.00  ? 66  LEU C H    1 
ATOM   3144 N N    . ALA C 1 67  ? 103.717 39.559  14.875 1.00 25.33 ? 67  ALA C N    1 
ATOM   3145 C CA   . ALA C 1 67  ? 102.542 39.915  14.098 1.00 21.85 ? 67  ALA C CA   1 
ATOM   3146 C C    . ALA C 1 67  ? 102.187 38.598  13.432 1.00 20.08 ? 67  ALA C C    1 
ATOM   3147 O O    . ALA C 1 67  ? 102.813 38.211  12.445 1.00 23.43 ? 67  ALA C O    1 
ATOM   3148 C CB   . ALA C 1 67  ? 102.891 40.965  13.055 1.00 22.65 ? 67  ALA C CB   1 
ATOM   3149 H H    . ALA C 1 67  ? 104.390 39.005  14.426 1.00 0.00  ? 67  ALA C H    1 
ATOM   3150 N N    . MET C 1 68  ? 101.244 37.873  14.022 1.00 22.27 ? 68  MET C N    1 
ATOM   3151 C CA   . MET C 1 68  ? 100.835 36.568  13.498 1.00 17.72 ? 68  MET C CA   1 
ATOM   3152 C C    . MET C 1 68  ? 99.569  36.615  12.681 1.00 16.56 ? 68  MET C C    1 
ATOM   3153 O O    . MET C 1 68  ? 98.507  36.961  13.203 1.00 21.12 ? 68  MET C O    1 
ATOM   3154 C CB   . MET C 1 68  ? 100.625 35.581  14.651 1.00 18.70 ? 68  MET C CB   1 
ATOM   3155 C CG   . MET C 1 68  ? 101.794 35.490  15.612 1.00 21.50 ? 68  MET C CG   1 
ATOM   3156 S SD   . MET C 1 68  ? 101.557 34.184  16.789 1.00 20.98 ? 68  MET C SD   1 
ATOM   3157 C CE   . MET C 1 68  ? 100.347 34.941  17.818 1.00 29.96 ? 68  MET C CE   1 
ATOM   3158 H H    . MET C 1 68  ? 100.819 38.226  14.832 1.00 0.00  ? 68  MET C H    1 
ATOM   3159 N N    . GLY C 1 69  ? 99.678  36.267  11.404 1.00 17.56 ? 69  GLY C N    1 
ATOM   3160 C CA   . GLY C 1 69  ? 98.510  36.242  10.539 1.00 18.40 ? 69  GLY C CA   1 
ATOM   3161 C C    . GLY C 1 69  ? 97.723  34.986  10.861 1.00 17.18 ? 69  GLY C C    1 
ATOM   3162 O O    . GLY C 1 69  ? 98.144  33.886  10.505 1.00 20.78 ? 69  GLY C O    1 
ATOM   3163 H H    . GLY C 1 69  ? 100.552 36.022  11.044 1.00 0.00  ? 69  GLY C H    1 
ATOM   3164 N N    . VAL C 1 70  ? 96.577  35.152  11.512 1.00 10.96 ? 70  VAL C N    1 
ATOM   3165 C CA   . VAL C 1 70  ? 95.746  34.030  11.937 1.00 11.74 ? 70  VAL C CA   1 
ATOM   3166 C C    . VAL C 1 70  ? 94.398  33.899  11.223 1.00 14.90 ? 70  VAL C C    1 
ATOM   3167 O O    . VAL C 1 70  ? 93.767  34.888  10.843 1.00 15.74 ? 70  VAL C O    1 
ATOM   3168 C CB   . VAL C 1 70  ? 95.470  34.122  13.487 1.00 13.28 ? 70  VAL C CB   1 
ATOM   3169 C CG1  . VAL C 1 70  ? 94.547  33.024  13.956 1.00 13.73 ? 70  VAL C CG1  1 
ATOM   3170 C CG2  . VAL C 1 70  ? 96.771  34.060  14.270 1.00 15.39 ? 70  VAL C CG2  1 
ATOM   3171 H H    . VAL C 1 70  ? 96.262  36.058  11.712 1.00 0.00  ? 70  VAL C H    1 
ATOM   3172 N N    . ASN C 1 71  ? 93.978  32.658  11.020 1.00 12.72 ? 71  ASN C N    1 
ATOM   3173 C CA   . ASN C 1 71  ? 92.689  32.387  10.431 1.00 11.48 ? 71  ASN C CA   1 
ATOM   3174 C C    . ASN C 1 71  ? 91.841  32.150  11.670 1.00 15.65 ? 71  ASN C C    1 
ATOM   3175 O O    . ASN C 1 71  ? 91.963  31.106  12.313 1.00 17.71 ? 71  ASN C O    1 
ATOM   3176 C CB   . ASN C 1 71  ? 92.737  31.117  9.601  1.00 18.54 ? 71  ASN C CB   1 
ATOM   3177 C CG   . ASN C 1 71  ? 91.399  30.786  8.981  1.00 19.83 ? 71  ASN C CG   1 
ATOM   3178 O OD1  . ASN C 1 71  ? 90.360  30.892  9.630  1.00 25.19 ? 71  ASN C OD1  1 
ATOM   3179 N ND2  . ASN C 1 71  ? 91.411  30.394  7.719  1.00 22.60 ? 71  ASN C ND2  1 
ATOM   3180 H H    . ASN C 1 71  ? 94.553  31.905  11.282 1.00 0.00  ? 71  ASN C H    1 
ATOM   3181 H HD21 . ASN C 1 71  ? 90.552  30.164  7.312  1.00 0.00  ? 71  ASN C HD21 1 
ATOM   3182 H HD22 . ASN C 1 71  ? 92.272  30.334  7.260  1.00 0.00  ? 71  ASN C HD22 1 
ATOM   3183 N N    . LEU C 1 72  ? 91.005  33.123  12.021 1.00 18.83 ? 72  LEU C N    1 
ATOM   3184 C CA   . LEU C 1 72  ? 90.180  33.029  13.222 1.00 16.89 ? 72  LEU C CA   1 
ATOM   3185 C C    . LEU C 1 72  ? 89.247  31.835  13.238 1.00 16.68 ? 72  LEU C C    1 
ATOM   3186 O O    . LEU C 1 72  ? 88.955  31.287  14.301 1.00 20.21 ? 72  LEU C O    1 
ATOM   3187 C CB   . LEU C 1 72  ? 89.412  34.330  13.457 1.00 18.56 ? 72  LEU C CB   1 
ATOM   3188 C CG   . LEU C 1 72  ? 90.255  35.590  13.696 1.00 18.71 ? 72  LEU C CG   1 
ATOM   3189 C CD1  . LEU C 1 72  ? 89.334  36.766  13.904 1.00 21.27 ? 72  LEU C CD1  1 
ATOM   3190 C CD2  . LEU C 1 72  ? 91.165  35.434  14.902 1.00 15.01 ? 72  LEU C CD2  1 
ATOM   3191 H H    . LEU C 1 72  ? 90.908  33.902  11.431 1.00 0.00  ? 72  LEU C H    1 
ATOM   3192 N N    . THR C 1 73  ? 88.794  31.424  12.061 1.00 16.24 ? 73  THR C N    1 
ATOM   3193 C CA   . THR C 1 73  ? 87.921  30.261  11.932 1.00 17.30 ? 73  THR C CA   1 
ATOM   3194 C C    . THR C 1 73  ? 88.679  29.049  12.484 1.00 24.13 ? 73  THR C C    1 
ATOM   3195 O O    . THR C 1 73  ? 88.187  28.345  13.377 1.00 30.18 ? 73  THR C O    1 
ATOM   3196 C CB   . THR C 1 73  ? 87.574  30.001  10.455 1.00 13.67 ? 73  THR C CB   1 
ATOM   3197 O OG1  . THR C 1 73  ? 86.823  31.107  9.940  1.00 17.75 ? 73  THR C OG1  1 
ATOM   3198 C CG2  . THR C 1 73  ? 86.784  28.718  10.302 1.00 14.12 ? 73  THR C CG2  1 
ATOM   3199 H H    . THR C 1 73  ? 89.038  31.907  11.242 1.00 0.00  ? 73  THR C H    1 
ATOM   3200 H HG1  . THR C 1 73  ? 87.044  31.285  9.013  1.00 0.00  ? 73  THR C HG1  1 
ATOM   3201 N N    . SER C 1 74  ? 89.897  28.849  11.983 1.00 24.22 ? 74  SER C N    1 
ATOM   3202 C CA   . SER C 1 74  ? 90.756  27.747  12.404 1.00 19.87 ? 74  SER C CA   1 
ATOM   3203 C C    . SER C 1 74  ? 91.141  27.837  13.875 1.00 14.96 ? 74  SER C C    1 
ATOM   3204 O O    . SER C 1 74  ? 91.118  26.843  14.595 1.00 14.75 ? 74  SER C O    1 
ATOM   3205 C CB   . SER C 1 74  ? 92.013  27.708  11.543 1.00 19.96 ? 74  SER C CB   1 
ATOM   3206 O OG   . SER C 1 74  ? 91.654  27.507  10.191 1.00 34.93 ? 74  SER C OG   1 
ATOM   3207 H H    . SER C 1 74  ? 90.239  29.457  11.295 1.00 0.00  ? 74  SER C H    1 
ATOM   3208 H HG   . SER C 1 74  ? 92.451  27.518  9.646  1.00 0.00  ? 74  SER C HG   1 
ATOM   3209 N N    . MET C 1 75  ? 91.479  29.031  14.335 1.00 11.93 ? 75  MET C N    1 
ATOM   3210 C CA   . MET C 1 75  ? 91.843  29.184  15.728 1.00 14.82 ? 75  MET C CA   1 
ATOM   3211 C C    . MET C 1 75  ? 90.638  28.834  16.596 1.00 17.51 ? 75  MET C C    1 
ATOM   3212 O O    . MET C 1 75  ? 90.785  28.228  17.659 1.00 22.39 ? 75  MET C O    1 
ATOM   3213 C CB   . MET C 1 75  ? 92.334  30.601  16.013 1.00 16.42 ? 75  MET C CB   1 
ATOM   3214 C CG   . MET C 1 75  ? 92.761  30.804  17.444 1.00 16.31 ? 75  MET C CG   1 
ATOM   3215 S SD   . MET C 1 75  ? 93.669  32.303  17.670 1.00 27.27 ? 75  MET C SD   1 
ATOM   3216 C CE   . MET C 1 75  ? 94.308  32.049  19.316 1.00 10.82 ? 75  MET C CE   1 
ATOM   3217 H H    . MET C 1 75  ? 91.487  29.801  13.729 1.00 0.00  ? 75  MET C H    1 
ATOM   3218 N N    . SER C 1 76  ? 89.446  29.156  16.099 1.00 21.96 ? 76  SER C N    1 
ATOM   3219 C CA   . SER C 1 76  ? 88.199  28.873  16.806 1.00 17.55 ? 76  SER C CA   1 
ATOM   3220 C C    . SER C 1 76  ? 87.949  27.374  16.921 1.00 18.27 ? 76  SER C C    1 
ATOM   3221 O O    . SER C 1 76  ? 87.446  26.906  17.935 1.00 19.67 ? 76  SER C O    1 
ATOM   3222 C CB   . SER C 1 76  ? 87.023  29.517  16.084 1.00 19.48 ? 76  SER C CB   1 
ATOM   3223 O OG   . SER C 1 76  ? 85.809  29.106  16.674 1.00 23.92 ? 76  SER C OG   1 
ATOM   3224 H H    . SER C 1 76  ? 89.381  29.598  15.227 1.00 0.00  ? 76  SER C H    1 
ATOM   3225 H HG   . SER C 1 76  ? 85.821  29.396  17.591 1.00 0.00  ? 76  SER C HG   1 
ATOM   3226 N N    . LYS C 1 77  ? 88.259  26.628  15.864 1.00 18.11 ? 77  LYS C N    1 
ATOM   3227 C CA   . LYS C 1 77  ? 88.074  25.179  15.878 1.00 18.37 ? 77  LYS C CA   1 
ATOM   3228 C C    . LYS C 1 77  ? 89.017  24.539  16.882 1.00 17.54 ? 77  LYS C C    1 
ATOM   3229 O O    . LYS C 1 77  ? 88.724  23.477  17.426 1.00 24.68 ? 77  LYS C O    1 
ATOM   3230 C CB   . LYS C 1 77  ? 88.351  24.575  14.508 1.00 16.47 ? 77  LYS C CB   1 
ATOM   3231 C CG   . LYS C 1 77  ? 87.324  24.857  13.448 1.00 15.13 ? 77  LYS C CG   1 
ATOM   3232 C CD   . LYS C 1 77  ? 87.789  24.178  12.183 1.00 23.80 ? 77  LYS C CD   1 
ATOM   3233 C CE   . LYS C 1 77  ? 86.811  24.289  11.053 1.00 23.19 ? 77  LYS C CE   1 
ATOM   3234 N NZ   . LYS C 1 77  ? 87.468  23.760  9.824  1.00 39.19 ? 77  LYS C NZ   1 
ATOM   3235 H H    . LYS C 1 77  ? 88.595  27.064  15.053 1.00 0.00  ? 77  LYS C H    1 
ATOM   3236 H HZ1  . LYS C 1 77  ? 88.327  24.314  9.625  1.00 0.00  ? 77  LYS C HZ1  1 
ATOM   3237 H HZ2  . LYS C 1 77  ? 87.741  22.765  9.967  1.00 0.00  ? 77  LYS C HZ2  1 
ATOM   3238 H HZ3  . LYS C 1 77  ? 86.822  23.830  9.013  1.00 0.00  ? 77  LYS C HZ3  1 
ATOM   3239 N N    . ILE C 1 78  ? 90.180  25.160  17.058 1.00 15.87 ? 78  ILE C N    1 
ATOM   3240 C CA   . ILE C 1 78  ? 91.195  24.691  17.992 1.00 13.52 ? 78  ILE C CA   1 
ATOM   3241 C C    . ILE C 1 78  ? 90.802  24.988  19.442 1.00 16.57 ? 78  ILE C C    1 
ATOM   3242 O O    . ILE C 1 78  ? 90.977  24.148  20.329 1.00 17.21 ? 78  ILE C O    1 
ATOM   3243 C CB   . ILE C 1 78  ? 92.558  25.315  17.654 1.00 7.33  ? 78  ILE C CB   1 
ATOM   3244 C CG1  . ILE C 1 78  ? 93.163  24.584  16.463 1.00 10.26 ? 78  ILE C CG1  1 
ATOM   3245 C CG2  . ILE C 1 78  ? 93.506  25.247  18.830 1.00 11.69 ? 78  ILE C CG2  1 
ATOM   3246 C CD1  . ILE C 1 78  ? 94.449  25.186  16.008 1.00 14.40 ? 78  ILE C CD1  1 
ATOM   3247 H H    . ILE C 1 78  ? 90.378  25.945  16.505 1.00 0.00  ? 78  ILE C H    1 
ATOM   3248 N N    . LEU C 1 79  ? 90.261  26.175  19.687 1.00 12.14 ? 79  LEU C N    1 
ATOM   3249 C CA   . LEU C 1 79  ? 89.851  26.526  21.033 1.00 11.55 ? 79  LEU C CA   1 
ATOM   3250 C C    . LEU C 1 79  ? 88.654  25.728  21.521 1.00 11.78 ? 79  LEU C C    1 
ATOM   3251 O O    . LEU C 1 79  ? 88.500  25.537  22.718 1.00 18.51 ? 79  LEU C O    1 
ATOM   3252 C CB   . LEU C 1 79  ? 89.618  28.031  21.176 1.00 6.61  ? 79  LEU C CB   1 
ATOM   3253 C CG   . LEU C 1 79  ? 90.935  28.782  21.420 1.00 2.83  ? 79  LEU C CG   1 
ATOM   3254 C CD1  . LEU C 1 79  ? 90.677  30.237  21.489 1.00 7.54  ? 79  LEU C CD1  1 
ATOM   3255 C CD2  . LEU C 1 79  ? 91.582  28.345  22.714 1.00 2.24  ? 79  LEU C CD2  1 
ATOM   3256 H H    . LEU C 1 79  ? 90.162  26.817  18.950 1.00 0.00  ? 79  LEU C H    1 
ATOM   3257 N N    . LYS C 1 80  ? 87.839  25.212  20.605 1.00 17.36 ? 80  LYS C N    1 
ATOM   3258 C CA   . LYS C 1 80  ? 86.676  24.411  21.000 1.00 18.08 ? 80  LYS C CA   1 
ATOM   3259 C C    . LYS C 1 80  ? 87.121  23.081  21.573 1.00 14.88 ? 80  LYS C C    1 
ATOM   3260 O O    . LYS C 1 80  ? 86.304  22.299  22.039 1.00 21.75 ? 80  LYS C O    1 
ATOM   3261 C CB   . LYS C 1 80  ? 85.722  24.164  19.827 1.00 18.69 ? 80  LYS C CB   1 
ATOM   3262 C CG   . LYS C 1 80  ? 85.179  25.428  19.183 1.00 23.39 ? 80  LYS C CG   1 
ATOM   3263 C CD   . LYS C 1 80  ? 83.760  25.243  18.668 1.00 33.94 ? 80  LYS C CD   1 
ATOM   3264 C CE   . LYS C 1 80  ? 83.600  24.037  17.728 1.00 37.58 ? 80  LYS C CE   1 
ATOM   3265 N NZ   . LYS C 1 80  ? 84.269  24.186  16.405 1.00 27.94 ? 80  LYS C NZ   1 
ATOM   3266 H H    . LYS C 1 80  ? 87.997  25.382  19.653 1.00 0.00  ? 80  LYS C H    1 
ATOM   3267 H HZ1  . LYS C 1 80  ? 84.023  25.121  16.031 1.00 0.00  ? 80  LYS C HZ1  1 
ATOM   3268 H HZ2  . LYS C 1 80  ? 85.295  24.065  16.497 1.00 0.00  ? 80  LYS C HZ2  1 
ATOM   3269 H HZ3  . LYS C 1 80  ? 83.860  23.447  15.800 1.00 0.00  ? 80  LYS C HZ3  1 
ATOM   3270 N N    . CYS C 1 81  ? 88.416  22.806  21.482 1.00 21.68 ? 81  CYS C N    1 
ATOM   3271 C CA   . CYS C 1 81  ? 88.979  21.576  22.017 1.00 29.55 ? 81  CYS C CA   1 
ATOM   3272 C C    . CYS C 1 81  ? 89.394  21.768  23.469 1.00 31.98 ? 81  CYS C C    1 
ATOM   3273 O O    . CYS C 1 81  ? 89.778  20.815  24.147 1.00 39.69 ? 81  CYS C O    1 
ATOM   3274 C CB   . CYS C 1 81  ? 90.178  21.131  21.186 1.00 25.27 ? 81  CYS C CB   1 
ATOM   3275 S SG   . CYS C 1 81  ? 89.745  20.760  19.487 1.00 37.28 ? 81  CYS C SG   1 
ATOM   3276 H H    . CYS C 1 81  ? 89.025  23.415  21.020 1.00 0.00  ? 81  CYS C H    1 
ATOM   3277 N N    . ALA C 1 82  ? 89.360  23.011  23.929 1.00 32.94 ? 82  ALA C N    1 
ATOM   3278 C CA   . ALA C 1 82  ? 89.714  23.320  25.301 1.00 28.78 ? 82  ALA C CA   1 
ATOM   3279 C C    . ALA C 1 82  ? 88.432  23.295  26.112 1.00 28.89 ? 82  ALA C C    1 
ATOM   3280 O O    . ALA C 1 82  ? 87.357  23.620  25.606 1.00 32.77 ? 82  ALA C O    1 
ATOM   3281 C CB   . ALA C 1 82  ? 90.353  24.689  25.386 1.00 27.41 ? 82  ALA C CB   1 
ATOM   3282 H H    . ALA C 1 82  ? 89.027  23.742  23.370 1.00 0.00  ? 82  ALA C H    1 
ATOM   3283 N N    . GLY C 1 83  ? 88.539  22.823  27.342 1.00 24.08 ? 83  GLY C N    1 
ATOM   3284 C CA   . GLY C 1 83  ? 87.385  22.793  28.207 1.00 21.05 ? 83  GLY C CA   1 
ATOM   3285 C C    . GLY C 1 83  ? 87.341  24.169  28.823 1.00 27.24 ? 83  GLY C C    1 
ATOM   3286 O O    . GLY C 1 83  ? 88.278  24.951  28.655 1.00 27.44 ? 83  GLY C O    1 
ATOM   3287 H H    . GLY C 1 83  ? 89.407  22.524  27.648 1.00 0.00  ? 83  GLY C H    1 
ATOM   3288 N N    . ASN C 1 84  ? 86.283  24.474  29.558 1.00 35.47 ? 84  ASN C N    1 
ATOM   3289 C CA   . ASN C 1 84  ? 86.177  25.785  30.176 1.00 38.75 ? 84  ASN C CA   1 
ATOM   3290 C C    . ASN C 1 84  ? 87.054  25.971  31.404 1.00 41.98 ? 84  ASN C C    1 
ATOM   3291 O O    . ASN C 1 84  ? 87.234  27.092  31.882 1.00 48.25 ? 84  ASN C O    1 
ATOM   3292 C CB   . ASN C 1 84  ? 84.725  26.101  30.498 1.00 35.86 ? 84  ASN C CB   1 
ATOM   3293 C CG   . ASN C 1 84  ? 84.009  26.694  29.324 1.00 39.90 ? 84  ASN C CG   1 
ATOM   3294 O OD1  . ASN C 1 84  ? 83.745  27.893  29.290 1.00 43.36 ? 84  ASN C OD1  1 
ATOM   3295 N ND2  . ASN C 1 84  ? 83.729  25.869  28.322 1.00 41.31 ? 84  ASN C ND2  1 
ATOM   3296 H H    . ASN C 1 84  ? 85.575  23.807  29.661 1.00 0.00  ? 84  ASN C H    1 
ATOM   3297 H HD21 . ASN C 1 84  ? 83.263  26.269  27.557 1.00 0.00  ? 84  ASN C HD21 1 
ATOM   3298 H HD22 . ASN C 1 84  ? 83.986  24.922  28.365 1.00 0.00  ? 84  ASN C HD22 1 
ATOM   3299 N N    . GLU C 1 85  ? 87.614  24.873  31.899 1.00 43.12 ? 85  GLU C N    1 
ATOM   3300 C CA   . GLU C 1 85  ? 88.470  24.914  33.078 1.00 43.67 ? 85  GLU C CA   1 
ATOM   3301 C C    . GLU C 1 85  ? 89.958  24.751  32.773 1.00 38.47 ? 85  GLU C C    1 
ATOM   3302 O O    . GLU C 1 85  ? 90.793  24.815  33.675 1.00 39.48 ? 85  GLU C O    1 
ATOM   3303 C CB   . GLU C 1 85  ? 88.042  23.837  34.078 1.00 50.02 ? 85  GLU C CB   1 
ATOM   3304 C CG   . GLU C 1 85  ? 86.791  24.151  34.877 1.00 54.08 ? 85  GLU C CG   1 
ATOM   3305 C CD   . GLU C 1 85  ? 86.912  23.684  36.317 1.00 60.39 ? 85  GLU C CD   1 
ATOM   3306 O OE1  . GLU C 1 85  ? 87.021  22.457  36.546 1.00 57.65 ? 85  GLU C OE1  1 
ATOM   3307 O OE2  . GLU C 1 85  ? 86.924  24.552  37.219 1.00 66.16 ? 85  GLU C OE2  1 
ATOM   3308 H H    . GLU C 1 85  ? 87.433  24.015  31.468 1.00 0.00  ? 85  GLU C H    1 
ATOM   3309 N N    . ASP C 1 86  ? 90.285  24.511  31.511 1.00 32.86 ? 86  ASP C N    1 
ATOM   3310 C CA   . ASP C 1 86  ? 91.672  24.324  31.113 1.00 28.57 ? 86  ASP C CA   1 
ATOM   3311 C C    . ASP C 1 86  ? 92.519  25.578  31.233 1.00 29.47 ? 86  ASP C C    1 
ATOM   3312 O O    . ASP C 1 86  ? 92.016  26.697  31.119 1.00 28.05 ? 86  ASP C O    1 
ATOM   3313 C CB   . ASP C 1 86  ? 91.746  23.832  29.669 1.00 29.36 ? 86  ASP C CB   1 
ATOM   3314 C CG   . ASP C 1 86  ? 91.230  22.421  29.502 1.00 36.66 ? 86  ASP C CG   1 
ATOM   3315 O OD1  . ASP C 1 86  ? 90.833  21.790  30.509 1.00 38.75 ? 86  ASP C OD1  1 
ATOM   3316 O OD2  . ASP C 1 86  ? 91.234  21.937  28.350 1.00 37.93 ? 86  ASP C OD2  1 
ATOM   3317 H H    . ASP C 1 86  ? 89.574  24.511  30.844 1.00 0.00  ? 86  ASP C H    1 
ATOM   3318 N N    . ILE C 1 87  ? 93.810  25.370  31.469 1.00 31.05 ? 87  ILE C N    1 
ATOM   3319 C CA   . ILE C 1 87  ? 94.783  26.457  31.552 1.00 30.77 ? 87  ILE C CA   1 
ATOM   3320 C C    . ILE C 1 87  ? 95.360  26.518  30.140 1.00 30.54 ? 87  ILE C C    1 
ATOM   3321 O O    . ILE C 1 87  ? 95.942  25.535  29.663 1.00 36.38 ? 87  ILE C O    1 
ATOM   3322 C CB   . ILE C 1 87  ? 95.933  26.131  32.534 1.00 27.22 ? 87  ILE C CB   1 
ATOM   3323 C CG1  . ILE C 1 87  ? 95.373  25.851  33.924 1.00 19.52 ? 87  ILE C CG1  1 
ATOM   3324 C CG2  . ILE C 1 87  ? 96.937  27.278  32.578 1.00 26.88 ? 87  ILE C CG2  1 
ATOM   3325 C CD1  . ILE C 1 87  ? 96.435  25.540  34.942 1.00 26.15 ? 87  ILE C CD1  1 
ATOM   3326 H H    . ILE C 1 87  ? 94.115  24.450  31.606 1.00 0.00  ? 87  ILE C H    1 
ATOM   3327 N N    . ILE C 1 88  ? 95.165  27.644  29.460 1.00 24.99 ? 88  ILE C N    1 
ATOM   3328 C CA   . ILE C 1 88  ? 95.647  27.790  28.093 1.00 16.93 ? 88  ILE C CA   1 
ATOM   3329 C C    . ILE C 1 88  ? 96.962  28.552  27.994 1.00 17.68 ? 88  ILE C C    1 
ATOM   3330 O O    . ILE C 1 88  ? 97.107  29.647  28.536 1.00 25.52 ? 88  ILE C O    1 
ATOM   3331 C CB   . ILE C 1 88  ? 94.564  28.427  27.188 1.00 13.23 ? 88  ILE C CB   1 
ATOM   3332 C CG1  . ILE C 1 88  ? 93.298  27.557  27.220 1.00 14.30 ? 88  ILE C CG1  1 
ATOM   3333 C CG2  . ILE C 1 88  ? 95.065  28.557  25.759 1.00 12.10 ? 88  ILE C CG2  1 
ATOM   3334 C CD1  . ILE C 1 88  ? 92.150  28.086  26.415 1.00 9.33  ? 88  ILE C CD1  1 
ATOM   3335 H H    . ILE C 1 88  ? 94.704  28.387  29.900 1.00 0.00  ? 88  ILE C H    1 
ATOM   3336 N N    . THR C 1 89  ? 97.930  27.936  27.326 1.00 21.04 ? 89  THR C N    1 
ATOM   3337 C CA   . THR C 1 89  ? 99.245  28.525  27.128 1.00 17.08 ? 89  THR C CA   1 
ATOM   3338 C C    . THR C 1 89  ? 99.475  28.733  25.650 1.00 22.40 ? 89  THR C C    1 
ATOM   3339 O O    . THR C 1 89  ? 99.316  27.795  24.866 1.00 25.91 ? 89  THR C O    1 
ATOM   3340 C CB   . THR C 1 89  ? 100.350 27.589  27.598 1.00 14.06 ? 89  THR C CB   1 
ATOM   3341 O OG1  . THR C 1 89  ? 100.237 27.385  29.012 1.00 17.07 ? 89  THR C OG1  1 
ATOM   3342 C CG2  . THR C 1 89  ? 101.724 28.162  27.242 1.00 9.99  ? 89  THR C CG2  1 
ATOM   3343 H H    . THR C 1 89  ? 97.753  27.050  26.944 1.00 0.00  ? 89  THR C H    1 
ATOM   3344 H HG1  . THR C 1 89  ? 99.514  26.766  29.158 1.00 0.00  ? 89  THR C HG1  1 
ATOM   3345 N N    . LEU C 1 90  ? 99.831  29.954  25.269 1.00 22.91 ? 90  LEU C N    1 
ATOM   3346 C CA   . LEU C 1 90  ? 100.121 30.267  23.875 1.00 21.93 ? 90  LEU C CA   1 
ATOM   3347 C C    . LEU C 1 90  ? 101.640 30.400  23.788 1.00 19.77 ? 90  LEU C C    1 
ATOM   3348 O O    . LEU C 1 90  ? 102.266 30.963  24.690 1.00 23.55 ? 90  LEU C O    1 
ATOM   3349 C CB   . LEU C 1 90  ? 99.446  31.577  23.455 1.00 17.80 ? 90  LEU C CB   1 
ATOM   3350 C CG   . LEU C 1 90  ? 97.926  31.698  23.615 1.00 17.51 ? 90  LEU C CG   1 
ATOM   3351 C CD1  . LEU C 1 90  ? 97.467  33.100  23.207 1.00 16.85 ? 90  LEU C CD1  1 
ATOM   3352 C CD2  . LEU C 1 90  ? 97.217  30.644  22.786 1.00 13.22 ? 90  LEU C CD2  1 
ATOM   3353 H H    . LEU C 1 90  ? 99.934  30.657  25.943 1.00 0.00  ? 90  LEU C H    1 
ATOM   3354 N N    . ARG C 1 91  ? 102.242 29.824  22.757 1.00 16.44 ? 91  ARG C N    1 
ATOM   3355 C CA   . ARG C 1 91  ? 103.685 29.910  22.597 1.00 15.12 ? 91  ARG C CA   1 
ATOM   3356 C C    . ARG C 1 91  ? 104.050 29.977  21.129 1.00 21.10 ? 91  ARG C C    1 
ATOM   3357 O O    . ARG C 1 91  ? 103.610 29.135  20.342 1.00 23.50 ? 91  ARG C O    1 
ATOM   3358 C CB   . ARG C 1 91  ? 104.369 28.712  23.249 1.00 15.00 ? 91  ARG C CB   1 
ATOM   3359 C CG   . ARG C 1 91  ? 105.875 28.663  23.007 1.00 22.84 ? 91  ARG C CG   1 
ATOM   3360 C CD   . ARG C 1 91  ? 106.556 27.548  23.793 1.00 26.87 ? 91  ARG C CD   1 
ATOM   3361 N NE   . ARG C 1 91  ? 105.986 26.232  23.516 1.00 29.99 ? 91  ARG C NE   1 
ATOM   3362 C CZ   . ARG C 1 91  ? 105.341 25.488  24.412 1.00 27.71 ? 91  ARG C CZ   1 
ATOM   3363 N NH1  . ARG C 1 91  ? 105.173 25.917  25.661 1.00 24.37 ? 91  ARG C NH1  1 
ATOM   3364 N NH2  . ARG C 1 91  ? 104.863 24.309  24.052 1.00 27.66 ? 91  ARG C NH2  1 
ATOM   3365 H H    . ARG C 1 91  ? 101.705 29.318  22.112 1.00 0.00  ? 91  ARG C H    1 
ATOM   3366 H HE   . ARG C 1 91  ? 106.075 25.874  22.609 1.00 0.00  ? 91  ARG C HE   1 
ATOM   3367 H HH11 . ARG C 1 91  ? 105.525 26.806  25.947 1.00 0.00  ? 91  ARG C HH11 1 
ATOM   3368 H HH12 . ARG C 1 91  ? 104.688 25.341  26.319 1.00 0.00  ? 91  ARG C HH12 1 
ATOM   3369 H HH21 . ARG C 1 91  ? 104.991 23.986  23.114 1.00 0.00  ? 91  ARG C HH21 1 
ATOM   3370 H HH22 . ARG C 1 91  ? 104.381 23.740  24.717 1.00 0.00  ? 91  ARG C HH22 1 
ATOM   3371 N N    . ALA C 1 92  ? 104.856 30.973  20.765 1.00 24.26 ? 92  ALA C N    1 
ATOM   3372 C CA   . ALA C 1 92  ? 105.290 31.158  19.383 1.00 24.80 ? 92  ALA C CA   1 
ATOM   3373 C C    . ALA C 1 92  ? 106.757 31.543  19.312 1.00 28.92 ? 92  ALA C C    1 
ATOM   3374 O O    . ALA C 1 92  ? 107.303 32.139  20.243 1.00 26.91 ? 92  ALA C O    1 
ATOM   3375 C CB   . ALA C 1 92  ? 104.447 32.217  18.693 1.00 24.10 ? 92  ALA C CB   1 
ATOM   3376 H H    . ALA C 1 92  ? 105.184 31.596  21.446 1.00 0.00  ? 92  ALA C H    1 
ATOM   3377 N N    . GLU C 1 93  ? 107.389 31.174  18.204 1.00 33.48 ? 93  GLU C N    1 
ATOM   3378 C CA   . GLU C 1 93  ? 108.790 31.468  17.959 1.00 33.30 ? 93  GLU C CA   1 
ATOM   3379 C C    . GLU C 1 93  ? 108.846 32.604  16.941 1.00 39.87 ? 93  GLU C C    1 
ATOM   3380 O O    . GLU C 1 93  ? 107.935 32.766  16.126 1.00 40.51 ? 93  GLU C O    1 
ATOM   3381 C CB   . GLU C 1 93  ? 109.493 30.231  17.397 1.00 36.58 ? 93  GLU C CB   1 
ATOM   3382 C CG   . GLU C 1 93  ? 109.460 29.017  18.313 1.00 39.89 ? 93  GLU C CG   1 
ATOM   3383 C CD   . GLU C 1 93  ? 110.327 29.193  19.545 1.00 46.57 ? 93  GLU C CD   1 
ATOM   3384 O OE1  . GLU C 1 93  ? 111.311 29.960  19.470 1.00 53.41 ? 93  GLU C OE1  1 
ATOM   3385 O OE2  . GLU C 1 93  ? 110.036 28.564  20.588 1.00 46.83 ? 93  GLU C OE2  1 
ATOM   3386 H H    . GLU C 1 93  ? 106.864 30.734  17.498 1.00 0.00  ? 93  GLU C H    1 
ATOM   3387 N N    . ASP C 1 94  ? 109.932 33.367  16.972 1.00 45.36 ? 94  ASP C N    1 
ATOM   3388 C CA   . ASP C 1 94  ? 110.117 34.502  16.071 1.00 49.75 ? 94  ASP C CA   1 
ATOM   3389 C C    . ASP C 1 94  ? 110.133 34.157  14.576 1.00 50.08 ? 94  ASP C C    1 
ATOM   3390 O O    . ASP C 1 94  ? 109.458 34.813  13.785 1.00 47.65 ? 94  ASP C O    1 
ATOM   3391 C CB   . ASP C 1 94  ? 111.378 35.261  16.473 1.00 56.21 ? 94  ASP C CB   1 
ATOM   3392 C CG   . ASP C 1 94  ? 111.401 35.593  17.957 1.00 61.34 ? 94  ASP C CG   1 
ATOM   3393 O OD1  . ASP C 1 94  ? 110.445 36.246  18.437 1.00 64.83 ? 94  ASP C OD1  1 
ATOM   3394 O OD2  . ASP C 1 94  ? 112.358 35.180  18.647 1.00 61.19 ? 94  ASP C OD2  1 
ATOM   3395 H H    . ASP C 1 94  ? 110.620 33.188  17.641 1.00 0.00  ? 94  ASP C H    1 
ATOM   3396 N N    . ASN C 1 95  ? 110.908 33.146  14.189 1.00 49.80 ? 95  ASN C N    1 
ATOM   3397 C CA   . ASN C 1 95  ? 110.975 32.728  12.783 1.00 56.29 ? 95  ASN C CA   1 
ATOM   3398 C C    . ASN C 1 95  ? 109.940 31.637  12.484 1.00 53.08 ? 95  ASN C C    1 
ATOM   3399 O O    . ASN C 1 95  ? 110.075 30.889  11.509 1.00 45.68 ? 95  ASN C O    1 
ATOM   3400 C CB   . ASN C 1 95  ? 112.375 32.193  12.430 1.00 62.28 ? 95  ASN C CB   1 
ATOM   3401 C CG   . ASN C 1 95  ? 113.399 33.300  12.192 1.00 65.43 ? 95  ASN C CG   1 
ATOM   3402 O OD1  . ASN C 1 95  ? 113.458 33.898  11.115 1.00 64.13 ? 95  ASN C OD1  1 
ATOM   3403 N ND2  . ASN C 1 95  ? 114.252 33.534  13.184 1.00 67.35 ? 95  ASN C ND2  1 
ATOM   3404 H H    . ASN C 1 95  ? 111.442 32.685  14.861 1.00 0.00  ? 95  ASN C H    1 
ATOM   3405 H HD21 . ASN C 1 95  ? 114.870 34.277  13.045 1.00 0.00  ? 95  ASN C HD21 1 
ATOM   3406 H HD22 . ASN C 1 95  ? 114.208 32.975  13.984 1.00 0.00  ? 95  ASN C HD22 1 
ATOM   3407 N N    . ALA C 1 96  ? 108.911 31.553  13.326 1.00 55.63 ? 96  ALA C N    1 
ATOM   3408 C CA   . ALA C 1 96  ? 107.871 30.532  13.183 1.00 57.00 ? 96  ALA C CA   1 
ATOM   3409 C C    . ALA C 1 96  ? 106.643 30.879  12.334 1.00 53.64 ? 96  ALA C C    1 
ATOM   3410 O O    . ALA C 1 96  ? 106.108 31.992  12.378 1.00 49.66 ? 96  ALA C O    1 
ATOM   3411 C CB   . ALA C 1 96  ? 107.432 30.021  14.558 1.00 56.33 ? 96  ALA C CB   1 
ATOM   3412 H H    . ALA C 1 96  ? 108.790 32.216  14.033 1.00 0.00  ? 96  ALA C H    1 
ATOM   3413 N N    . ASP C 1 97  ? 106.188 29.865  11.608 1.00 46.39 ? 97  ASP C N    1 
ATOM   3414 C CA   . ASP C 1 97  ? 105.041 29.931  10.724 1.00 40.61 ? 97  ASP C CA   1 
ATOM   3415 C C    . ASP C 1 97  ? 103.861 29.319  11.482 1.00 32.28 ? 97  ASP C C    1 
ATOM   3416 O O    . ASP C 1 97  ? 102.773 29.158  10.934 1.00 30.59 ? 97  ASP C O    1 
ATOM   3417 C CB   . ASP C 1 97  ? 105.380 29.113  9.463  1.00 55.25 ? 97  ASP C CB   1 
ATOM   3418 C CG   . ASP C 1 97  ? 104.244 29.047  8.453  1.00 67.99 ? 97  ASP C CG   1 
ATOM   3419 O OD1  . ASP C 1 97  ? 103.826 30.100  7.926  1.00 71.85 ? 97  ASP C OD1  1 
ATOM   3420 O OD2  . ASP C 1 97  ? 103.796 27.914  8.160  1.00 75.99 ? 97  ASP C OD2  1 
ATOM   3421 H H    . ASP C 1 97  ? 106.665 29.017  11.644 1.00 0.00  ? 97  ASP C H    1 
ATOM   3422 N N    . THR C 1 98  ? 104.064 29.010  12.759 1.00 22.84 ? 98  THR C N    1 
ATOM   3423 C CA   . THR C 1 98  ? 103.012 28.399  13.562 1.00 24.58 ? 98  THR C CA   1 
ATOM   3424 C C    . THR C 1 98  ? 102.834 28.981  14.961 1.00 21.65 ? 98  THR C C    1 
ATOM   3425 O O    . THR C 1 98  ? 103.733 29.626  15.504 1.00 15.53 ? 98  THR C O    1 
ATOM   3426 C CB   . THR C 1 98  ? 103.248 26.874  13.757 1.00 30.83 ? 98  THR C CB   1 
ATOM   3427 O OG1  . THR C 1 98  ? 104.527 26.656  14.372 1.00 34.86 ? 98  THR C OG1  1 
ATOM   3428 C CG2  . THR C 1 98  ? 103.161 26.116  12.430 1.00 34.55 ? 98  THR C CG2  1 
ATOM   3429 H H    . THR C 1 98  ? 104.917 29.202  13.187 1.00 0.00  ? 98  THR C H    1 
ATOM   3430 H HG1  . THR C 1 98  ? 104.370 26.483  15.311 1.00 0.00  ? 98  THR C HG1  1 
ATOM   3431 N N    . LEU C 1 99  ? 101.658 28.710  15.529 1.00 18.26 ? 99  LEU C N    1 
ATOM   3432 C CA   . LEU C 1 99  ? 101.285 29.118  16.875 1.00 15.65 ? 99  LEU C CA   1 
ATOM   3433 C C    . LEU C 1 99  ? 100.982 27.826  17.611 1.00 17.63 ? 99  LEU C C    1 
ATOM   3434 O O    . LEU C 1 99  ? 100.319 26.937  17.072 1.00 20.54 ? 99  LEU C O    1 
ATOM   3435 C CB   . LEU C 1 99  ? 100.025 29.989  16.875 1.00 11.96 ? 99  LEU C CB   1 
ATOM   3436 C CG   . LEU C 1 99  ? 99.455  30.353  18.260 1.00 11.64 ? 99  LEU C CG   1 
ATOM   3437 C CD1  . LEU C 1 99  ? 100.446 31.210  19.057 1.00 8.15  ? 99  LEU C CD1  1 
ATOM   3438 C CD2  . LEU C 1 99  ? 98.128  31.082  18.093 1.00 12.71 ? 99  LEU C CD2  1 
ATOM   3439 H H    . LEU C 1 99  ? 101.000 28.201  15.014 1.00 0.00  ? 99  LEU C H    1 
ATOM   3440 N N    . ALA C 1 100 ? 101.461 27.726  18.841 1.00 22.18 ? 100 ALA C N    1 
ATOM   3441 C CA   . ALA C 1 100 ? 101.242 26.539  19.648 1.00 22.61 ? 100 ALA C CA   1 
ATOM   3442 C C    . ALA C 1 100 ? 100.331 26.846  20.828 1.00 20.58 ? 100 ALA C C    1 
ATOM   3443 O O    . ALA C 1 100 ? 100.592 27.778  21.593 1.00 18.17 ? 100 ALA C O    1 
ATOM   3444 C CB   . ALA C 1 100 ? 102.581 25.990  20.147 1.00 20.27 ? 100 ALA C CB   1 
ATOM   3445 H H    . ALA C 1 100 ? 101.959 28.475  19.228 1.00 0.00  ? 100 ALA C H    1 
ATOM   3446 N N    . LEU C 1 101 ? 99.251  26.076  20.945 1.00 17.83 ? 101 LEU C N    1 
ATOM   3447 C CA   . LEU C 1 101 ? 98.306  26.216  22.046 1.00 14.97 ? 101 LEU C CA   1 
ATOM   3448 C C    . LEU C 1 101 ? 98.335  24.915  22.862 1.00 13.94 ? 101 LEU C C    1 
ATOM   3449 O O    . LEU C 1 101 ? 98.159  23.830  22.310 1.00 16.47 ? 101 LEU C O    1 
ATOM   3450 C CB   . LEU C 1 101 ? 96.881  26.481  21.536 1.00 8.59  ? 101 LEU C CB   1 
ATOM   3451 C CG   . LEU C 1 101 ? 96.627  27.619  20.540 1.00 6.34  ? 101 LEU C CG   1 
ATOM   3452 C CD1  . LEU C 1 101 ? 96.976  27.144  19.144 1.00 7.84  ? 101 LEU C CD1  1 
ATOM   3453 C CD2  . LEU C 1 101 ? 95.162  28.036  20.571 1.00 2.47  ? 101 LEU C CD2  1 
ATOM   3454 H H    . LEU C 1 101 ? 99.100  25.369  20.286 1.00 0.00  ? 101 LEU C H    1 
ATOM   3455 N N    . VAL C 1 102 ? 98.593  25.027  24.161 1.00 13.99 ? 102 VAL C N    1 
ATOM   3456 C CA   . VAL C 1 102 ? 98.635  23.868  25.058 1.00 18.00 ? 102 VAL C CA   1 
ATOM   3457 C C    . VAL C 1 102 ? 97.526  23.954  26.125 1.00 21.25 ? 102 VAL C C    1 
ATOM   3458 O O    . VAL C 1 102 ? 97.495  24.902  26.918 1.00 24.69 ? 102 VAL C O    1 
ATOM   3459 C CB   . VAL C 1 102 ? 100.020 23.763  25.768 1.00 18.05 ? 102 VAL C CB   1 
ATOM   3460 C CG1  . VAL C 1 102 ? 100.007 22.637  26.786 1.00 15.96 ? 102 VAL C CG1  1 
ATOM   3461 C CG2  . VAL C 1 102 ? 101.132 23.534  24.749 1.00 10.65 ? 102 VAL C CG2  1 
ATOM   3462 H H    . VAL C 1 102 ? 98.769  25.919  24.526 1.00 0.00  ? 102 VAL C H    1 
ATOM   3463 N N    . PHE C 1 103 ? 96.616  22.979  26.141 1.00 19.50 ? 103 PHE C N    1 
ATOM   3464 C CA   . PHE C 1 103 ? 95.520  22.965  27.115 1.00 18.47 ? 103 PHE C CA   1 
ATOM   3465 C C    . PHE C 1 103 ? 95.802  21.958  28.219 1.00 21.14 ? 103 PHE C C    1 
ATOM   3466 O O    . PHE C 1 103 ? 96.096  20.794  27.946 1.00 26.89 ? 103 PHE C O    1 
ATOM   3467 C CB   . PHE C 1 103 ? 94.185  22.581  26.459 1.00 7.87  ? 103 PHE C CB   1 
ATOM   3468 C CG   . PHE C 1 103 ? 93.906  23.283  25.166 1.00 10.70 ? 103 PHE C CG   1 
ATOM   3469 C CD1  . PHE C 1 103 ? 94.315  24.599  24.959 1.00 10.17 ? 103 PHE C CD1  1 
ATOM   3470 C CD2  . PHE C 1 103 ? 93.226  22.620  24.142 1.00 11.64 ? 103 PHE C CD2  1 
ATOM   3471 C CE1  . PHE C 1 103 ? 94.050  25.244  23.757 1.00 7.41  ? 103 PHE C CE1  1 
ATOM   3472 C CE2  . PHE C 1 103 ? 92.958  23.258  22.935 1.00 8.19  ? 103 PHE C CE2  1 
ATOM   3473 C CZ   . PHE C 1 103 ? 93.372  24.573  22.745 1.00 10.43 ? 103 PHE C CZ   1 
ATOM   3474 H H    . PHE C 1 103 ? 96.682  22.262  25.491 1.00 0.00  ? 103 PHE C H    1 
ATOM   3475 N N    . GLU C 1 104 ? 95.668  22.389  29.464 1.00 26.00 ? 104 GLU C N    1 
ATOM   3476 C CA   . GLU C 1 104 ? 95.901  21.510  30.597 1.00 27.92 ? 104 GLU C CA   1 
ATOM   3477 C C    . GLU C 1 104 ? 94.625  21.361  31.393 1.00 31.92 ? 104 GLU C C    1 
ATOM   3478 O O    . GLU C 1 104 ? 94.118  22.331  31.965 1.00 30.63 ? 104 GLU C O    1 
ATOM   3479 C CB   . GLU C 1 104 ? 97.014  22.061  31.488 1.00 29.81 ? 104 GLU C CB   1 
ATOM   3480 C CG   . GLU C 1 104 ? 98.379  22.067  30.814 1.00 39.19 ? 104 GLU C CG   1 
ATOM   3481 C CD   . GLU C 1 104 ? 99.444  22.768  31.632 1.00 43.02 ? 104 GLU C CD   1 
ATOM   3482 O OE1  . GLU C 1 104 ? 99.399  22.678  32.881 1.00 44.73 ? 104 GLU C OE1  1 
ATOM   3483 O OE2  . GLU C 1 104 ? 100.330 23.405  31.020 1.00 42.89 ? 104 GLU C OE2  1 
ATOM   3484 H H    . GLU C 1 104 ? 95.419  23.325  29.624 1.00 0.00  ? 104 GLU C H    1 
ATOM   3485 N N    . ALA C 1 105 ? 94.064  20.158  31.365 1.00 39.69 ? 105 ALA C N    1 
ATOM   3486 C CA   . ALA C 1 105 ? 92.843  19.876  32.102 1.00 41.56 ? 105 ALA C CA   1 
ATOM   3487 C C    . ALA C 1 105 ? 93.152  20.056  33.586 1.00 45.76 ? 105 ALA C C    1 
ATOM   3488 O O    . ALA C 1 105 ? 94.186  19.590  34.073 1.00 46.58 ? 105 ALA C O    1 
ATOM   3489 C CB   . ALA C 1 105 ? 92.370  18.461  31.818 1.00 35.01 ? 105 ALA C CB   1 
ATOM   3490 H H    . ALA C 1 105 ? 94.498  19.440  30.855 1.00 0.00  ? 105 ALA C H    1 
ATOM   3491 N N    . PRO C 1 106 ? 92.281  20.766  34.314 1.00 49.70 ? 106 PRO C N    1 
ATOM   3492 C CA   . PRO C 1 106 ? 92.483  20.999  35.745 1.00 54.47 ? 106 PRO C CA   1 
ATOM   3493 C C    . PRO C 1 106 ? 92.360  19.694  36.541 1.00 57.26 ? 106 PRO C C    1 
ATOM   3494 O O    . PRO C 1 106 ? 92.963  19.535  37.604 1.00 58.13 ? 106 PRO C O    1 
ATOM   3495 C CB   . PRO C 1 106 ? 91.354  21.972  36.079 1.00 51.97 ? 106 PRO C CB   1 
ATOM   3496 C CG   . PRO C 1 106 ? 90.260  21.496  35.187 1.00 51.70 ? 106 PRO C CG   1 
ATOM   3497 C CD   . PRO C 1 106 ? 90.988  21.318  33.876 1.00 50.81 ? 106 PRO C CD   1 
ATOM   3498 N N    . GLU C 1 109 ? 94.963  14.966  34.143 1.00 42.03 ? 109 GLU C N    1 
ATOM   3499 C CA   . GLU C 1 109 ? 95.740  13.937  33.449 1.00 38.18 ? 109 GLU C CA   1 
ATOM   3500 C C    . GLU C 1 109 ? 95.585  14.075  31.937 1.00 32.18 ? 109 GLU C C    1 
ATOM   3501 O O    . GLU C 1 109 ? 96.019  13.216  31.162 1.00 30.82 ? 109 GLU C O    1 
ATOM   3502 C CB   . GLU C 1 109 ? 95.303  12.540  33.904 1.00 40.90 ? 109 GLU C CB   1 
ATOM   3503 H H    . GLU C 1 109 ? 93.998  14.826  34.247 1.00 0.00  ? 109 GLU C H    1 
ATOM   3504 N N    . LYS C 1 110 ? 94.968  15.171  31.521 1.00 26.99 ? 110 LYS C N    1 
ATOM   3505 C CA   . LYS C 1 110 ? 94.755  15.423  30.111 1.00 22.36 ? 110 LYS C CA   1 
ATOM   3506 C C    . LYS C 1 110 ? 95.516  16.671  29.739 1.00 17.95 ? 110 LYS C C    1 
ATOM   3507 O O    . LYS C 1 110 ? 95.349  17.721  30.353 1.00 26.51 ? 110 LYS C O    1 
ATOM   3508 C CB   . LYS C 1 110 ? 93.265  15.604  29.814 1.00 16.58 ? 110 LYS C CB   1 
ATOM   3509 C CG   . LYS C 1 110 ? 92.938  15.632  28.350 1.00 20.63 ? 110 LYS C CG   1 
ATOM   3510 C CD   . LYS C 1 110 ? 91.479  15.947  28.127 1.00 21.55 ? 110 LYS C CD   1 
ATOM   3511 C CE   . LYS C 1 110 ? 91.147  15.847  26.654 1.00 28.07 ? 110 LYS C CE   1 
ATOM   3512 N NZ   . LYS C 1 110 ? 89.731  16.183  26.359 1.00 31.94 ? 110 LYS C NZ   1 
ATOM   3513 H H    . LYS C 1 110 ? 94.669  15.835  32.176 1.00 0.00  ? 110 LYS C H    1 
ATOM   3514 H HZ1  . LYS C 1 110 ? 89.096  15.538  26.861 1.00 0.00  ? 110 LYS C HZ1  1 
ATOM   3515 H HZ2  . LYS C 1 110 ? 89.535  17.157  26.659 1.00 0.00  ? 110 LYS C HZ2  1 
ATOM   3516 H HZ3  . LYS C 1 110 ? 89.575  16.080  25.338 1.00 0.00  ? 110 LYS C HZ3  1 
ATOM   3517 N N    . VAL C 1 111 ? 96.420  16.524  28.789 1.00 19.06 ? 111 VAL C N    1 
ATOM   3518 C CA   . VAL C 1 111 ? 97.208  17.639  28.307 1.00 19.11 ? 111 VAL C CA   1 
ATOM   3519 C C    . VAL C 1 111 ? 97.054  17.589  26.800 1.00 16.80 ? 111 VAL C C    1 
ATOM   3520 O O    . VAL C 1 111 ? 97.296  16.543  26.191 1.00 15.67 ? 111 VAL C O    1 
ATOM   3521 C CB   . VAL C 1 111 ? 98.699  17.475  28.651 1.00 19.41 ? 111 VAL C CB   1 
ATOM   3522 C CG1  . VAL C 1 111 ? 99.482  18.699  28.181 1.00 17.50 ? 111 VAL C CG1  1 
ATOM   3523 C CG2  . VAL C 1 111 ? 98.875  17.253  30.139 1.00 15.44 ? 111 VAL C CG2  1 
ATOM   3524 H H    . VAL C 1 111 ? 96.558  15.642  28.379 1.00 0.00  ? 111 VAL C H    1 
ATOM   3525 N N    . SER C 1 112 ? 96.610  18.694  26.213 1.00 14.44 ? 112 SER C N    1 
ATOM   3526 C CA   . SER C 1 112 ? 96.431  18.768  24.775 1.00 19.67 ? 112 SER C CA   1 
ATOM   3527 C C    . SER C 1 112 ? 97.352  19.808  24.147 1.00 23.00 ? 112 SER C C    1 
ATOM   3528 O O    . SER C 1 112 ? 97.527  20.908  24.677 1.00 21.88 ? 112 SER C O    1 
ATOM   3529 C CB   . SER C 1 112 ? 94.977  19.074  24.445 1.00 23.96 ? 112 SER C CB   1 
ATOM   3530 O OG   . SER C 1 112 ? 94.134  18.063  24.954 1.00 29.38 ? 112 SER C OG   1 
ATOM   3531 H H    . SER C 1 112 ? 96.393  19.479  26.735 1.00 0.00  ? 112 SER C H    1 
ATOM   3532 H HG   . SER C 1 112 ? 93.226  18.275  24.720 1.00 0.00  ? 112 SER C HG   1 
ATOM   3533 N N    . ASP C 1 113 ? 97.972  19.433  23.034 1.00 31.40 ? 113 ASP C N    1 
ATOM   3534 C CA   . ASP C 1 113 ? 98.882  20.309  22.318 1.00 37.38 ? 113 ASP C CA   1 
ATOM   3535 C C    . ASP C 1 113 ? 98.443  20.427  20.870 1.00 35.75 ? 113 ASP C C    1 
ATOM   3536 O O    . ASP C 1 113 ? 98.299  19.424  20.160 1.00 30.96 ? 113 ASP C O    1 
ATOM   3537 C CB   . ASP C 1 113 ? 100.317 19.776  22.369 1.00 45.47 ? 113 ASP C CB   1 
ATOM   3538 C CG   . ASP C 1 113 ? 101.277 20.604  21.514 1.00 61.88 ? 113 ASP C CG   1 
ATOM   3539 O OD1  . ASP C 1 113 ? 101.383 20.331  20.292 1.00 64.84 ? 113 ASP C OD1  1 
ATOM   3540 O OD2  . ASP C 1 113 ? 101.915 21.537  22.062 1.00 66.05 ? 113 ASP C OD2  1 
ATOM   3541 H H    . ASP C 1 113 ? 97.807  18.541  22.669 1.00 0.00  ? 113 ASP C H    1 
ATOM   3542 N N    . TYR C 1 114 ? 98.222  21.662  20.444 1.00 33.27 ? 114 TYR C N    1 
ATOM   3543 C CA   . TYR C 1 114 ? 97.812  21.943  19.087 1.00 27.62 ? 114 TYR C CA   1 
ATOM   3544 C C    . TYR C 1 114 ? 98.854  22.861  18.480 1.00 28.55 ? 114 TYR C C    1 
ATOM   3545 O O    . TYR C 1 114 ? 99.516  23.627  19.190 1.00 30.52 ? 114 TYR C O    1 
ATOM   3546 C CB   . TYR C 1 114 ? 96.426  22.589  19.075 1.00 22.44 ? 114 TYR C CB   1 
ATOM   3547 C CG   . TYR C 1 114 ? 95.331  21.640  19.518 1.00 20.08 ? 114 TYR C CG   1 
ATOM   3548 C CD1  . TYR C 1 114 ? 95.092  21.403  20.868 1.00 16.57 ? 114 TYR C CD1  1 
ATOM   3549 C CD2  . TYR C 1 114 ? 94.565  20.943  18.583 1.00 20.02 ? 114 TYR C CD2  1 
ATOM   3550 C CE1  . TYR C 1 114 ? 94.126  20.492  21.277 1.00 16.59 ? 114 TYR C CE1  1 
ATOM   3551 C CE2  . TYR C 1 114 ? 93.600  20.030  18.985 1.00 16.46 ? 114 TYR C CE2  1 
ATOM   3552 C CZ   . TYR C 1 114 ? 93.384  19.808  20.333 1.00 17.92 ? 114 TYR C CZ   1 
ATOM   3553 O OH   . TYR C 1 114 ? 92.422  18.905  20.741 1.00 19.80 ? 114 TYR C OH   1 
ATOM   3554 H H    . TYR C 1 114 ? 98.364  22.414  21.052 1.00 0.00  ? 114 TYR C H    1 
ATOM   3555 H HH   . TYR C 1 114 ? 92.297  18.991  21.700 1.00 0.00  ? 114 TYR C HH   1 
ATOM   3556 N N    . GLU C 1 115 ? 99.039  22.739  17.175 1.00 28.76 ? 115 GLU C N    1 
ATOM   3557 C CA   . GLU C 1 115 ? 100.004 23.551  16.461 1.00 30.11 ? 115 GLU C CA   1 
ATOM   3558 C C    . GLU C 1 115 ? 99.285  24.128  15.252 1.00 28.95 ? 115 GLU C C    1 
ATOM   3559 O O    . GLU C 1 115 ? 99.123  23.461  14.229 1.00 28.54 ? 115 GLU C O    1 
ATOM   3560 C CB   . GLU C 1 115 ? 101.180 22.683  16.044 1.00 35.96 ? 115 GLU C CB   1 
ATOM   3561 C CG   . GLU C 1 115 ? 102.328 23.432  15.433 1.00 47.25 ? 115 GLU C CG   1 
ATOM   3562 C CD   . GLU C 1 115 ? 103.550 22.557  15.280 1.00 52.80 ? 115 GLU C CD   1 
ATOM   3563 O OE1  . GLU C 1 115 ? 104.204 22.278  16.311 1.00 55.90 ? 115 GLU C OE1  1 
ATOM   3564 O OE2  . GLU C 1 115 ? 103.847 22.145  14.135 1.00 55.71 ? 115 GLU C OE2  1 
ATOM   3565 H H    . GLU C 1 115 ? 98.516  22.070  16.685 1.00 0.00  ? 115 GLU C H    1 
ATOM   3566 N N    . MET C 1 116 ? 98.834  25.368  15.396 1.00 22.47 ? 116 MET C N    1 
ATOM   3567 C CA   . MET C 1 116 ? 98.090  26.060  14.357 1.00 19.82 ? 116 MET C CA   1 
ATOM   3568 C C    . MET C 1 116 ? 98.964  26.779  13.333 1.00 18.18 ? 116 MET C C    1 
ATOM   3569 O O    . MET C 1 116 ? 99.791  27.611  13.692 1.00 22.49 ? 116 MET C O    1 
ATOM   3570 C CB   . MET C 1 116 ? 97.137  27.061  15.017 1.00 18.73 ? 116 MET C CB   1 
ATOM   3571 C CG   . MET C 1 116 ? 96.219  27.794  14.062 1.00 21.56 ? 116 MET C CG   1 
ATOM   3572 S SD   . MET C 1 116 ? 95.296  29.095  14.887 1.00 19.81 ? 116 MET C SD   1 
ATOM   3573 C CE   . MET C 1 116 ? 96.555  30.363  15.017 1.00 25.95 ? 116 MET C CE   1 
ATOM   3574 H H    . MET C 1 116 ? 99.021  25.833  16.235 1.00 0.00  ? 116 MET C H    1 
ATOM   3575 N N    . LYS C 1 117 ? 98.770  26.467  12.055 1.00 18.80 ? 117 LYS C N    1 
ATOM   3576 C CA   . LYS C 1 117 ? 99.525  27.122  10.988 1.00 20.60 ? 117 LYS C CA   1 
ATOM   3577 C C    . LYS C 1 117 ? 99.024  28.550  10.866 1.00 16.91 ? 117 LYS C C    1 
ATOM   3578 O O    . LYS C 1 117 ? 97.818  28.803  10.987 1.00 15.11 ? 117 LYS C O    1 
ATOM   3579 C CB   . LYS C 1 117 ? 99.326  26.417  9.646  1.00 18.30 ? 117 LYS C CB   1 
ATOM   3580 C CG   . LYS C 1 117 ? 99.718  24.957  9.634  1.00 28.94 ? 117 LYS C CG   1 
ATOM   3581 C CD   . LYS C 1 117 ? 99.513  24.386  8.248  1.00 38.90 ? 117 LYS C CD   1 
ATOM   3582 C CE   . LYS C 1 117 ? 99.647  22.874  8.211  1.00 43.04 ? 117 LYS C CE   1 
ATOM   3583 N NZ   . LYS C 1 117 ? 99.378  22.388  6.824  1.00 53.53 ? 117 LYS C NZ   1 
ATOM   3584 H H    . LYS C 1 117 ? 98.116  25.779  11.828 1.00 0.00  ? 117 LYS C H    1 
ATOM   3585 H HZ1  . LYS C 1 117 ? 100.055 22.841  6.177  1.00 0.00  ? 117 LYS C HZ1  1 
ATOM   3586 H HZ2  . LYS C 1 117 ? 99.487  21.355  6.763  1.00 0.00  ? 117 LYS C HZ2  1 
ATOM   3587 H HZ3  . LYS C 1 117 ? 98.416  22.655  6.524  1.00 0.00  ? 117 LYS C HZ3  1 
ATOM   3588 N N    . LEU C 1 118 ? 99.953  29.476  10.651 1.00 15.06 ? 118 LEU C N    1 
ATOM   3589 C CA   . LEU C 1 118 ? 99.620  30.882  10.510 1.00 11.06 ? 118 LEU C CA   1 
ATOM   3590 C C    . LEU C 1 118 ? 99.516  31.186  9.035  1.00 10.30 ? 118 LEU C C    1 
ATOM   3591 O O    . LEU C 1 118 ? 99.580  30.271  8.215  1.00 15.28 ? 118 LEU C O    1 
ATOM   3592 C CB   . LEU C 1 118 ? 100.682 31.751  11.167 1.00 4.64  ? 118 LEU C CB   1 
ATOM   3593 C CG   . LEU C 1 118 ? 100.983 31.431  12.628 1.00 9.49  ? 118 LEU C CG   1 
ATOM   3594 C CD1  . LEU C 1 118 ? 101.882 32.510  13.194 1.00 12.67 ? 118 LEU C CD1  1 
ATOM   3595 C CD2  . LEU C 1 118 ? 99.700  31.331  13.433 1.00 5.91  ? 118 LEU C CD2  1 
ATOM   3596 H H    . LEU C 1 118 ? 100.892 29.218  10.534 1.00 0.00  ? 118 LEU C H    1 
ATOM   3597 N N    . MET C 1 119 ? 99.358  32.458  8.689  1.00 18.79 ? 119 MET C N    1 
ATOM   3598 C CA   . MET C 1 119 ? 99.235  32.852  7.289  1.00 23.48 ? 119 MET C CA   1 
ATOM   3599 C C    . MET C 1 119 ? 99.644  34.292  7.022  1.00 24.49 ? 119 MET C C    1 
ATOM   3600 O O    . MET C 1 119 ? 99.819  35.090  7.946  1.00 27.49 ? 119 MET C O    1 
ATOM   3601 C CB   . MET C 1 119 ? 97.799  32.652  6.802  1.00 29.19 ? 119 MET C CB   1 
ATOM   3602 C CG   . MET C 1 119 ? 96.773  33.511  7.515  1.00 33.64 ? 119 MET C CG   1 
ATOM   3603 S SD   . MET C 1 119 ? 95.161  33.385  6.755  1.00 38.37 ? 119 MET C SD   1 
ATOM   3604 C CE   . MET C 1 119 ? 94.785  31.711  7.104  1.00 41.45 ? 119 MET C CE   1 
ATOM   3605 H H    . MET C 1 119 ? 99.364  33.155  9.371  1.00 0.00  ? 119 MET C H    1 
ATOM   3606 N N    . ASP C 1 120 ? 99.836  34.592  5.743  1.00 23.83 ? 120 ASP C N    1 
ATOM   3607 C CA   . ASP C 1 120 ? 100.208 35.923  5.299  1.00 24.32 ? 120 ASP C CA   1 
ATOM   3608 C C    . ASP C 1 120 ? 98.922  36.711  5.174  1.00 27.08 ? 120 ASP C C    1 
ATOM   3609 O O    . ASP C 1 120 ? 97.932  36.189  4.652  1.00 31.52 ? 120 ASP C O    1 
ATOM   3610 C CB   . ASP C 1 120 ? 100.879 35.865  3.926  1.00 23.70 ? 120 ASP C CB   1 
ATOM   3611 C CG   . ASP C 1 120 ? 102.192 35.109  3.937  1.00 29.30 ? 120 ASP C CG   1 
ATOM   3612 O OD1  . ASP C 1 120 ? 102.816 34.981  5.016  1.00 31.02 ? 120 ASP C OD1  1 
ATOM   3613 O OD2  . ASP C 1 120 ? 102.606 34.649  2.850  1.00 30.77 ? 120 ASP C OD2  1 
ATOM   3614 H H    . ASP C 1 120 ? 99.695  33.904  5.067  1.00 0.00  ? 120 ASP C H    1 
ATOM   3615 N N    . LEU C 1 121 ? 98.941  37.965  5.619  1.00 25.12 ? 121 LEU C N    1 
ATOM   3616 C CA   . LEU C 1 121 ? 97.763  38.824  5.546  1.00 21.32 ? 121 LEU C CA   1 
ATOM   3617 C C    . LEU C 1 121 ? 98.101  40.243  5.109  1.00 21.28 ? 121 LEU C C    1 
ATOM   3618 O O    . LEU C 1 121 ? 99.018  40.849  5.641  1.00 22.86 ? 121 LEU C O    1 
ATOM   3619 C CB   . LEU C 1 121 ? 97.058  38.887  6.907  1.00 15.48 ? 121 LEU C CB   1 
ATOM   3620 C CG   . LEU C 1 121 ? 96.378  37.619  7.432  1.00 16.11 ? 121 LEU C CG   1 
ATOM   3621 C CD1  . LEU C 1 121 ? 95.938  37.828  8.861  1.00 15.59 ? 121 LEU C CD1  1 
ATOM   3622 C CD2  . LEU C 1 121 ? 95.203  37.238  6.552  1.00 14.52 ? 121 LEU C CD2  1 
ATOM   3623 H H    . LEU C 1 121 ? 99.774  38.325  5.982  1.00 0.00  ? 121 LEU C H    1 
ATOM   3624 N N    . ASP C 1 122 ? 97.369  40.763  4.131  1.00 24.40 ? 122 ASP C N    1 
ATOM   3625 C CA   . ASP C 1 122 ? 97.570  42.132  3.678  1.00 29.38 ? 122 ASP C CA   1 
ATOM   3626 C C    . ASP C 1 122 ? 96.500  42.960  4.388  1.00 31.89 ? 122 ASP C C    1 
ATOM   3627 O O    . ASP C 1 122 ? 95.505  43.373  3.788  1.00 42.97 ? 122 ASP C O    1 
ATOM   3628 C CB   . ASP C 1 122 ? 97.398  42.239  2.169  1.00 34.80 ? 122 ASP C CB   1 
ATOM   3629 C CG   . ASP C 1 122 ? 97.817  43.594  1.629  1.00 39.92 ? 122 ASP C CG   1 
ATOM   3630 O OD1  . ASP C 1 122 ? 98.287  44.448  2.420  1.00 33.72 ? 122 ASP C OD1  1 
ATOM   3631 O OD2  . ASP C 1 122 ? 97.688  43.787  0.399  1.00 44.64 ? 122 ASP C OD2  1 
ATOM   3632 H H    . ASP C 1 122 ? 96.659  40.239  3.712  1.00 0.00  ? 122 ASP C H    1 
ATOM   3633 N N    . VAL C 1 123 ? 96.697  43.144  5.685  1.00 29.36 ? 123 VAL C N    1 
ATOM   3634 C CA   . VAL C 1 123 ? 95.773  43.876  6.538  1.00 28.13 ? 123 VAL C CA   1 
ATOM   3635 C C    . VAL C 1 123 ? 95.764  45.358  6.174  1.00 27.71 ? 123 VAL C C    1 
ATOM   3636 O O    . VAL C 1 123 ? 96.591  45.810  5.390  1.00 37.28 ? 123 VAL C O    1 
ATOM   3637 C CB   . VAL C 1 123 ? 96.190  43.704  8.030  1.00 28.79 ? 123 VAL C CB   1 
ATOM   3638 C CG1  . VAL C 1 123 ? 95.183  44.325  8.960  1.00 30.72 ? 123 VAL C CG1  1 
ATOM   3639 C CG2  . VAL C 1 123 ? 96.347  42.232  8.371  1.00 34.75 ? 123 VAL C CG2  1 
ATOM   3640 H H    . VAL C 1 123 ? 97.547  42.810  6.036  1.00 0.00  ? 123 VAL C H    1 
ATOM   3641 N N    . GLU C 1 124 ? 94.769  46.078  6.679  1.00 26.94 ? 124 GLU C N    1 
ATOM   3642 C CA   . GLU C 1 124 ? 94.614  47.519  6.479  1.00 25.62 ? 124 GLU C CA   1 
ATOM   3643 C C    . GLU C 1 124 ? 94.172  47.996  7.854  1.00 23.84 ? 124 GLU C C    1 
ATOM   3644 O O    . GLU C 1 124 ? 93.125  47.576  8.337  1.00 29.94 ? 124 GLU C O    1 
ATOM   3645 C CB   . GLU C 1 124 ? 93.524  47.811  5.454  1.00 19.12 ? 124 GLU C CB   1 
ATOM   3646 C CG   . GLU C 1 124 ? 93.206  49.285  5.266  1.00 25.88 ? 124 GLU C CG   1 
ATOM   3647 C CD   . GLU C 1 124 ? 92.294  49.558  4.068  1.00 36.27 ? 124 GLU C CD   1 
ATOM   3648 O OE1  . GLU C 1 124 ? 91.686  48.601  3.527  1.00 40.26 ? 124 GLU C OE1  1 
ATOM   3649 O OE2  . GLU C 1 124 ? 92.191  50.736  3.649  1.00 40.15 ? 124 GLU C OE2  1 
ATOM   3650 H H    . GLU C 1 124 ? 94.076  45.652  7.222  1.00 0.00  ? 124 GLU C H    1 
ATOM   3651 N N    . GLN C 1 125 ? 94.964  48.834  8.507  1.00 20.27 ? 125 GLN C N    1 
ATOM   3652 C CA   . GLN C 1 125 ? 94.588  49.252  9.842  1.00 21.33 ? 125 GLN C CA   1 
ATOM   3653 C C    . GLN C 1 125 ? 94.247  50.718  9.979  1.00 21.96 ? 125 GLN C C    1 
ATOM   3654 O O    . GLN C 1 125 ? 94.864  51.564  9.325  1.00 28.28 ? 125 GLN C O    1 
ATOM   3655 C CB   . GLN C 1 125 ? 95.680  48.852  10.819 1.00 24.51 ? 125 GLN C CB   1 
ATOM   3656 C CG   . GLN C 1 125 ? 96.024  47.369  10.774 1.00 28.74 ? 125 GLN C CG   1 
ATOM   3657 C CD   . GLN C 1 125 ? 96.127  46.753  12.149 1.00 32.06 ? 125 GLN C CD   1 
ATOM   3658 O OE1  . GLN C 1 125 ? 96.105  47.454  13.160 1.00 41.66 ? 125 GLN C OE1  1 
ATOM   3659 N NE2  . GLN C 1 125 ? 96.265  45.439  12.199 1.00 30.48 ? 125 GLN C NE2  1 
ATOM   3660 H H    . GLN C 1 125 ? 95.778  49.194  8.091  1.00 0.00  ? 125 GLN C H    1 
ATOM   3661 H HE21 . GLN C 1 125 ? 96.212  45.095  13.121 1.00 0.00  ? 125 GLN C HE21 1 
ATOM   3662 H HE22 . GLN C 1 125 ? 96.379  44.886  11.409 1.00 0.00  ? 125 GLN C HE22 1 
ATOM   3663 N N    . LEU C 1 126 ? 93.273  51.023  10.835 1.00 17.89 ? 126 LEU C N    1 
ATOM   3664 C CA   . LEU C 1 126 ? 92.842  52.410  11.053 1.00 20.76 ? 126 LEU C CA   1 
ATOM   3665 C C    . LEU C 1 126 ? 93.397  53.133  12.276 1.00 21.95 ? 126 LEU C C    1 
ATOM   3666 O O    . LEU C 1 126 ? 93.599  52.537  13.338 1.00 26.16 ? 126 LEU C O    1 
ATOM   3667 C CB   . LEU C 1 126 ? 91.306  52.528  11.115 1.00 23.69 ? 126 LEU C CB   1 
ATOM   3668 C CG   . LEU C 1 126 ? 90.407  51.840  10.087 1.00 26.78 ? 126 LEU C CG   1 
ATOM   3669 C CD1  . LEU C 1 126 ? 88.965  52.331  10.265 1.00 18.64 ? 126 LEU C CD1  1 
ATOM   3670 C CD2  . LEU C 1 126 ? 90.879  52.140  8.670  1.00 25.77 ? 126 LEU C CD2  1 
ATOM   3671 H H    . LEU C 1 126 ? 92.862  50.272  11.298 1.00 0.00  ? 126 LEU C H    1 
ATOM   3672 N N    . GLY C 1 127 ? 93.632  54.435  12.122 1.00 19.18 ? 127 GLY C N    1 
ATOM   3673 C CA   . GLY C 1 127 ? 94.125  55.248  13.224 1.00 18.49 ? 127 GLY C CA   1 
ATOM   3674 C C    . GLY C 1 127 ? 92.919  55.853  13.924 1.00 20.71 ? 127 GLY C C    1 
ATOM   3675 O O    . GLY C 1 127 ? 92.304  56.801  13.409 1.00 20.75 ? 127 GLY C O    1 
ATOM   3676 H H    . GLY C 1 127 ? 93.465  54.866  11.263 1.00 0.00  ? 127 GLY C H    1 
ATOM   3677 N N    . ILE C 1 128 ? 92.531  55.263  15.054 1.00 19.77 ? 128 ILE C N    1 
ATOM   3678 C CA   . ILE C 1 128 ? 91.374  55.736  15.810 1.00 20.66 ? 128 ILE C CA   1 
ATOM   3679 C C    . ILE C 1 128 ? 91.808  56.468  17.084 1.00 21.53 ? 128 ILE C C    1 
ATOM   3680 O O    . ILE C 1 128 ? 92.164  55.845  18.083 1.00 25.32 ? 128 ILE C O    1 
ATOM   3681 C CB   . ILE C 1 128 ? 90.406  54.571  16.134 1.00 20.19 ? 128 ILE C CB   1 
ATOM   3682 C CG1  . ILE C 1 128 ? 90.060  53.811  14.843 1.00 20.07 ? 128 ILE C CG1  1 
ATOM   3683 C CG2  . ILE C 1 128 ? 89.131  55.111  16.760 1.00 17.89 ? 128 ILE C CG2  1 
ATOM   3684 C CD1  . ILE C 1 128 ? 89.105  52.666  15.032 1.00 18.35 ? 128 ILE C CD1  1 
ATOM   3685 H H    . ILE C 1 128 ? 93.048  54.497  15.391 1.00 0.00  ? 128 ILE C H    1 
ATOM   3686 N N    . PRO C 1 129 ? 91.756  57.809  17.062 1.00 22.46 ? 129 PRO C N    1 
ATOM   3687 C CA   . PRO C 1 129 ? 92.141  58.667  18.177 1.00 25.33 ? 129 PRO C CA   1 
ATOM   3688 C C    . PRO C 1 129 ? 91.166  58.617  19.340 1.00 28.26 ? 129 PRO C C    1 
ATOM   3689 O O    . PRO C 1 129 ? 89.987  58.319  19.154 1.00 33.82 ? 129 PRO C O    1 
ATOM   3690 C CB   . PRO C 1 129 ? 92.141  60.049  17.531 1.00 26.49 ? 129 PRO C CB   1 
ATOM   3691 C CG   . PRO C 1 129 ? 90.965  59.961  16.626 1.00 25.55 ? 129 PRO C CG   1 
ATOM   3692 C CD   . PRO C 1 129 ? 91.184  58.618  15.967 1.00 25.99 ? 129 PRO C CD   1 
ATOM   3693 N N    . GLU C 1 130 ? 91.664  58.917  20.537 1.00 33.97 ? 130 GLU C N    1 
ATOM   3694 C CA   . GLU C 1 130 ? 90.828  58.933  21.731 1.00 37.71 ? 130 GLU C CA   1 
ATOM   3695 C C    . GLU C 1 130 ? 89.824  60.054  21.601 1.00 37.36 ? 130 GLU C C    1 
ATOM   3696 O O    . GLU C 1 130 ? 90.194  61.195  21.329 1.00 44.30 ? 130 GLU C O    1 
ATOM   3697 C CB   . GLU C 1 130 ? 91.660  59.173  22.984 1.00 41.34 ? 130 GLU C CB   1 
ATOM   3698 C CG   . GLU C 1 130 ? 92.322  57.933  23.529 1.00 49.23 ? 130 GLU C CG   1 
ATOM   3699 C CD   . GLU C 1 130 ? 92.423  57.952  25.042 1.00 52.24 ? 130 GLU C CD   1 
ATOM   3700 O OE1  . GLU C 1 130 ? 91.672  58.717  25.693 1.00 51.05 ? 130 GLU C OE1  1 
ATOM   3701 O OE2  . GLU C 1 130 ? 93.246  57.190  25.584 1.00 56.71 ? 130 GLU C OE2  1 
ATOM   3702 H H    . GLU C 1 130 ? 92.616  59.140  20.608 1.00 0.00  ? 130 GLU C H    1 
ATOM   3703 N N    . GLN C 1 131 ? 88.557  59.732  21.804 1.00 37.15 ? 131 GLN C N    1 
ATOM   3704 C CA   . GLN C 1 131 ? 87.505  60.727  21.697 1.00 37.88 ? 131 GLN C CA   1 
ATOM   3705 C C    . GLN C 1 131 ? 86.716  60.783  22.981 1.00 40.99 ? 131 GLN C C    1 
ATOM   3706 O O    . GLN C 1 131 ? 86.794  59.877  23.811 1.00 45.81 ? 131 GLN C O    1 
ATOM   3707 C CB   . GLN C 1 131 ? 86.519  60.350  20.597 1.00 38.74 ? 131 GLN C CB   1 
ATOM   3708 C CG   . GLN C 1 131 ? 87.122  59.895  19.296 1.00 42.85 ? 131 GLN C CG   1 
ATOM   3709 C CD   . GLN C 1 131 ? 86.058  59.636  18.260 1.00 43.63 ? 131 GLN C CD   1 
ATOM   3710 O OE1  . GLN C 1 131 ? 84.933  60.126  18.381 1.00 44.11 ? 131 GLN C OE1  1 
ATOM   3711 N NE2  . GLN C 1 131 ? 86.401  58.872  17.233 1.00 45.12 ? 131 GLN C NE2  1 
ATOM   3712 H H    . GLN C 1 131 ? 88.331  58.805  22.031 1.00 0.00  ? 131 GLN C H    1 
ATOM   3713 H HE21 . GLN C 1 131 ? 85.721  58.650  16.561 1.00 0.00  ? 131 GLN C HE21 1 
ATOM   3714 H HE22 . GLN C 1 131 ? 87.316  58.537  17.184 1.00 0.00  ? 131 GLN C HE22 1 
ATOM   3715 N N    . GLU C 1 132 ? 85.954  61.860  23.127 1.00 43.50 ? 132 GLU C N    1 
ATOM   3716 C CA   . GLU C 1 132 ? 85.059  62.051  24.258 1.00 40.17 ? 132 GLU C CA   1 
ATOM   3717 C C    . GLU C 1 132 ? 83.737  62.125  23.505 1.00 37.41 ? 132 GLU C C    1 
ATOM   3718 O O    . GLU C 1 132 ? 83.493  63.078  22.767 1.00 44.04 ? 132 GLU C O    1 
ATOM   3719 C CB   . GLU C 1 132 ? 85.355  63.360  25.000 1.00 42.36 ? 132 GLU C CB   1 
ATOM   3720 C CG   . GLU C 1 132 ? 84.453  63.601  26.219 1.00 50.44 ? 132 GLU C CG   1 
ATOM   3721 C CD   . GLU C 1 132 ? 85.105  64.467  27.299 1.00 55.99 ? 132 GLU C CD   1 
ATOM   3722 O OE1  . GLU C 1 132 ? 85.594  65.573  26.979 1.00 57.56 ? 132 GLU C OE1  1 
ATOM   3723 O OE2  . GLU C 1 132 ? 85.127  64.043  28.477 1.00 55.71 ? 132 GLU C OE2  1 
ATOM   3724 H H    . GLU C 1 132 ? 85.983  62.563  22.447 1.00 0.00  ? 132 GLU C H    1 
ATOM   3725 N N    . TYR C 1 133 ? 82.954  61.058  23.586 1.00 32.94 ? 133 TYR C N    1 
ATOM   3726 C CA   . TYR C 1 133 ? 81.681  60.985  22.883 1.00 27.69 ? 133 TYR C CA   1 
ATOM   3727 C C    . TYR C 1 133 ? 80.546  61.764  23.537 1.00 27.93 ? 133 TYR C C    1 
ATOM   3728 O O    . TYR C 1 133 ? 80.525  61.959  24.755 1.00 30.99 ? 133 TYR C O    1 
ATOM   3729 C CB   . TYR C 1 133 ? 81.279  59.523  22.700 1.00 28.34 ? 133 TYR C CB   1 
ATOM   3730 C CG   . TYR C 1 133 ? 82.240  58.746  21.833 1.00 25.10 ? 133 TYR C CG   1 
ATOM   3731 C CD1  . TYR C 1 133 ? 83.403  58.206  22.364 1.00 25.88 ? 133 TYR C CD1  1 
ATOM   3732 C CD2  . TYR C 1 133 ? 81.985  58.559  20.483 1.00 24.63 ? 133 TYR C CD2  1 
ATOM   3733 C CE1  . TYR C 1 133 ? 84.287  57.498  21.569 1.00 34.74 ? 133 TYR C CE1  1 
ATOM   3734 C CE2  . TYR C 1 133 ? 82.857  57.857  19.678 1.00 30.80 ? 133 TYR C CE2  1 
ATOM   3735 C CZ   . TYR C 1 133 ? 84.011  57.324  20.220 1.00 37.39 ? 133 TYR C CZ   1 
ATOM   3736 O OH   . TYR C 1 133 ? 84.880  56.605  19.411 1.00 43.91 ? 133 TYR C OH   1 
ATOM   3737 H H    . TYR C 1 133 ? 83.228  60.299  24.139 1.00 0.00  ? 133 TYR C H    1 
ATOM   3738 H HH   . TYR C 1 133 ? 85.647  56.281  19.900 1.00 0.00  ? 133 TYR C HH   1 
ATOM   3739 N N    . SER C 1 134 ? 79.600  62.204  22.715 1.00 25.84 ? 134 SER C N    1 
ATOM   3740 C CA   . SER C 1 134 ? 78.444  62.955  23.184 1.00 23.91 ? 134 SER C CA   1 
ATOM   3741 C C    . SER C 1 134 ? 77.542  62.111  24.083 1.00 23.31 ? 134 SER C C    1 
ATOM   3742 O O    . SER C 1 134 ? 76.876  62.642  24.968 1.00 21.66 ? 134 SER C O    1 
ATOM   3743 C CB   . SER C 1 134 ? 77.639  63.477  21.997 1.00 25.21 ? 134 SER C CB   1 
ATOM   3744 O OG   . SER C 1 134 ? 78.467  64.202  21.106 1.00 34.36 ? 134 SER C OG   1 
ATOM   3745 H H    . SER C 1 134 ? 79.673  61.997  21.754 1.00 0.00  ? 134 SER C H    1 
ATOM   3746 H HG   . SER C 1 134 ? 79.260  64.504  21.560 1.00 0.00  ? 134 SER C HG   1 
ATOM   3747 N N    . CYS C 1 135 ? 77.509  60.805  23.851 1.00 25.29 ? 135 CYS C N    1 
ATOM   3748 C CA   . CYS C 1 135 ? 76.680  59.919  24.658 1.00 29.38 ? 135 CYS C CA   1 
ATOM   3749 C C    . CYS C 1 135 ? 77.361  58.597  24.936 1.00 22.76 ? 135 CYS C C    1 
ATOM   3750 O O    . CYS C 1 135 ? 77.904  57.976  24.032 1.00 20.28 ? 135 CYS C O    1 
ATOM   3751 C CB   . CYS C 1 135 ? 75.341  59.653  23.972 1.00 33.83 ? 135 CYS C CB   1 
ATOM   3752 S SG   . CYS C 1 135 ? 74.168  61.017  24.053 1.00 47.88 ? 135 CYS C SG   1 
ATOM   3753 H H    . CYS C 1 135 ? 78.045  60.413  23.132 1.00 0.00  ? 135 CYS C H    1 
ATOM   3754 N N    . VAL C 1 136 ? 77.352  58.194  26.199 1.00 19.59 ? 136 VAL C N    1 
ATOM   3755 C CA   . VAL C 1 136 ? 77.945  56.939  26.619 1.00 18.26 ? 136 VAL C CA   1 
ATOM   3756 C C    . VAL C 1 136 ? 76.930  56.274  27.534 1.00 21.03 ? 136 VAL C C    1 
ATOM   3757 O O    . VAL C 1 136 ? 76.605  56.795  28.608 1.00 21.18 ? 136 VAL C O    1 
ATOM   3758 C CB   . VAL C 1 136 ? 79.264  57.153  27.383 1.00 22.20 ? 136 VAL C CB   1 
ATOM   3759 C CG1  . VAL C 1 136 ? 79.826  55.815  27.850 1.00 21.95 ? 136 VAL C CG1  1 
ATOM   3760 C CG2  . VAL C 1 136 ? 80.273  57.871  26.499 1.00 23.33 ? 136 VAL C CG2  1 
ATOM   3761 H H    . VAL C 1 136 ? 76.945  58.762  26.885 1.00 0.00  ? 136 VAL C H    1 
ATOM   3762 N N    . VAL C 1 137 ? 76.400  55.148  27.073 1.00 22.21 ? 137 VAL C N    1 
ATOM   3763 C CA   . VAL C 1 137 ? 75.406  54.389  27.811 1.00 22.35 ? 137 VAL C CA   1 
ATOM   3764 C C    . VAL C 1 137 ? 76.007  53.115  28.374 1.00 26.18 ? 137 VAL C C    1 
ATOM   3765 O O    . VAL C 1 137 ? 76.648  52.348  27.655 1.00 28.59 ? 137 VAL C O    1 
ATOM   3766 C CB   . VAL C 1 137 ? 74.244  53.955  26.898 1.00 17.80 ? 137 VAL C CB   1 
ATOM   3767 C CG1  . VAL C 1 137 ? 73.120  53.348  27.725 1.00 16.75 ? 137 VAL C CG1  1 
ATOM   3768 C CG2  . VAL C 1 137 ? 73.751  55.119  26.088 1.00 23.91 ? 137 VAL C CG2  1 
ATOM   3769 H H    . VAL C 1 137 ? 76.695  54.818  26.203 1.00 0.00  ? 137 VAL C H    1 
ATOM   3770 N N    . LYS C 1 138 ? 75.839  52.911  29.669 1.00 22.53 ? 138 LYS C N    1 
ATOM   3771 C CA   . LYS C 1 138 ? 76.314  51.695  30.285 1.00 24.47 ? 138 LYS C CA   1 
ATOM   3772 C C    . LYS C 1 138 ? 75.027  50.934  30.585 1.00 25.04 ? 138 LYS C C    1 
ATOM   3773 O O    . LYS C 1 138 ? 74.064  51.510  31.104 1.00 25.24 ? 138 LYS C O    1 
ATOM   3774 C CB   . LYS C 1 138 ? 77.082  51.970  31.577 1.00 25.19 ? 138 LYS C CB   1 
ATOM   3775 C CG   . LYS C 1 138 ? 77.546  50.687  32.248 1.00 26.32 ? 138 LYS C CG   1 
ATOM   3776 C CD   . LYS C 1 138 ? 78.032  50.921  33.648 1.00 31.34 ? 138 LYS C CD   1 
ATOM   3777 C CE   . LYS C 1 138 ? 77.631  49.752  34.526 1.00 38.55 ? 138 LYS C CE   1 
ATOM   3778 N NZ   . LYS C 1 138 ? 76.148  49.687  34.660 1.00 35.73 ? 138 LYS C NZ   1 
ATOM   3779 H H    . LYS C 1 138 ? 75.371  53.568  30.215 1.00 0.00  ? 138 LYS C H    1 
ATOM   3780 H HZ1  . LYS C 1 138 ? 75.684  49.584  33.737 1.00 0.00  ? 138 LYS C HZ1  1 
ATOM   3781 H HZ2  . LYS C 1 138 ? 75.889  48.909  35.299 1.00 0.00  ? 138 LYS C HZ2  1 
ATOM   3782 H HZ3  . LYS C 1 138 ? 75.849  50.581  35.100 1.00 0.00  ? 138 LYS C HZ3  1 
ATOM   3783 N N    . MET C 1 139 ? 74.993  49.659  30.223 1.00 15.32 ? 139 MET C N    1 
ATOM   3784 C CA   . MET C 1 139 ? 73.812  48.865  30.456 1.00 12.36 ? 139 MET C CA   1 
ATOM   3785 C C    . MET C 1 139 ? 74.160  47.397  30.406 1.00 13.44 ? 139 MET C C    1 
ATOM   3786 O O    . MET C 1 139 ? 75.210  47.018  29.881 1.00 14.98 ? 139 MET C O    1 
ATOM   3787 C CB   . MET C 1 139 ? 72.766  49.167  29.382 1.00 16.65 ? 139 MET C CB   1 
ATOM   3788 C CG   . MET C 1 139 ? 73.137  48.682  27.982 1.00 17.85 ? 139 MET C CG   1 
ATOM   3789 S SD   . MET C 1 139 ? 71.680  48.495  26.929 1.00 24.05 ? 139 MET C SD   1 
ATOM   3790 C CE   . MET C 1 139 ? 71.555  50.127  26.276 1.00 24.24 ? 139 MET C CE   1 
ATOM   3791 H H    . MET C 1 139 ? 75.768  49.242  29.783 1.00 0.00  ? 139 MET C H    1 
ATOM   3792 N N    . PRO C 1 140 ? 73.294  46.548  30.978 1.00 9.86  ? 140 PRO C N    1 
ATOM   3793 C CA   . PRO C 1 140 ? 73.472  45.096  31.008 1.00 13.06 ? 140 PRO C CA   1 
ATOM   3794 C C    . PRO C 1 140 ? 73.610  44.540  29.588 1.00 15.05 ? 140 PRO C C    1 
ATOM   3795 O O    . PRO C 1 140 ? 72.773  44.804  28.727 1.00 23.59 ? 140 PRO C O    1 
ATOM   3796 C CB   . PRO C 1 140 ? 72.173  44.614  31.651 1.00 11.07 ? 140 PRO C CB   1 
ATOM   3797 C CG   . PRO C 1 140 ? 71.838  45.718  32.579 1.00 9.04  ? 140 PRO C CG   1 
ATOM   3798 C CD   . PRO C 1 140 ? 72.088  46.932  31.724 1.00 12.08 ? 140 PRO C CD   1 
ATOM   3799 N N    . SER C 1 141 ? 74.653  43.757  29.349 1.00 20.30 ? 141 SER C N    1 
ATOM   3800 C CA   . SER C 1 141 ? 74.895  43.174  28.036 1.00 16.76 ? 141 SER C CA   1 
ATOM   3801 C C    . SER C 1 141 ? 73.771  42.255  27.560 1.00 16.16 ? 141 SER C C    1 
ATOM   3802 O O    . SER C 1 141 ? 73.512  42.162  26.361 1.00 22.83 ? 141 SER C O    1 
ATOM   3803 C CB   . SER C 1 141 ? 76.215  42.418  28.053 1.00 15.19 ? 141 SER C CB   1 
ATOM   3804 O OG   . SER C 1 141 ? 76.236  41.519  29.142 1.00 19.18 ? 141 SER C OG   1 
ATOM   3805 H H    . SER C 1 141 ? 75.278  43.562  30.077 1.00 0.00  ? 141 SER C H    1 
ATOM   3806 H HG   . SER C 1 141 ? 76.977  40.895  29.058 1.00 0.00  ? 141 SER C HG   1 
ATOM   3807 N N    . GLY C 1 142 ? 73.115  41.567  28.486 1.00 15.83 ? 142 GLY C N    1 
ATOM   3808 C CA   . GLY C 1 142 ? 72.029  40.678  28.112 1.00 17.98 ? 142 GLY C CA   1 
ATOM   3809 C C    . GLY C 1 142 ? 70.860  41.498  27.602 1.00 23.53 ? 142 GLY C C    1 
ATOM   3810 O O    . GLY C 1 142 ? 70.193  41.125  26.632 1.00 23.32 ? 142 GLY C O    1 
ATOM   3811 H H    . GLY C 1 142 ? 73.353  41.668  29.408 1.00 0.00  ? 142 GLY C H    1 
ATOM   3812 N N    . GLU C 1 143 ? 70.644  42.643  28.244 1.00 28.95 ? 143 GLU C N    1 
ATOM   3813 C CA   . GLU C 1 143 ? 69.571  43.562  27.892 1.00 27.74 ? 143 GLU C CA   1 
ATOM   3814 C C    . GLU C 1 143 ? 69.820  44.100  26.497 1.00 23.58 ? 143 GLU C C    1 
ATOM   3815 O O    . GLU C 1 143 ? 68.924  44.110  25.659 1.00 30.29 ? 143 GLU C O    1 
ATOM   3816 C CB   . GLU C 1 143 ? 69.507  44.711  28.908 1.00 39.20 ? 143 GLU C CB   1 
ATOM   3817 C CG   . GLU C 1 143 ? 68.332  45.659  28.724 1.00 52.34 ? 143 GLU C CG   1 
ATOM   3818 C CD   . GLU C 1 143 ? 67.007  44.924  28.682 1.00 59.98 ? 143 GLU C CD   1 
ATOM   3819 O OE1  . GLU C 1 143 ? 66.422  44.686  29.763 1.00 67.98 ? 143 GLU C OE1  1 
ATOM   3820 O OE2  . GLU C 1 143 ? 66.560  44.576  27.567 1.00 59.96 ? 143 GLU C OE2  1 
ATOM   3821 H H    . GLU C 1 143 ? 71.232  42.891  28.987 1.00 0.00  ? 143 GLU C H    1 
ATOM   3822 N N    . PHE C 1 144 ? 71.055  44.513  26.239 1.00 23.68 ? 144 PHE C N    1 
ATOM   3823 C CA   . PHE C 1 144 ? 71.421  45.021  24.924 1.00 19.73 ? 144 PHE C CA   1 
ATOM   3824 C C    . PHE C 1 144 ? 71.190  43.914  23.894 1.00 17.94 ? 144 PHE C C    1 
ATOM   3825 O O    . PHE C 1 144 ? 70.563  44.141  22.860 1.00 29.23 ? 144 PHE C O    1 
ATOM   3826 C CB   . PHE C 1 144 ? 72.883  45.482  24.918 1.00 17.35 ? 144 PHE C CB   1 
ATOM   3827 C CG   . PHE C 1 144 ? 73.324  46.086  23.615 1.00 19.59 ? 144 PHE C CG   1 
ATOM   3828 C CD1  . PHE C 1 144 ? 72.668  47.187  23.084 1.00 15.00 ? 144 PHE C CD1  1 
ATOM   3829 C CD2  . PHE C 1 144 ? 74.392  45.537  22.902 1.00 20.59 ? 144 PHE C CD2  1 
ATOM   3830 C CE1  . PHE C 1 144 ? 73.069  47.734  21.859 1.00 11.96 ? 144 PHE C CE1  1 
ATOM   3831 C CE2  . PHE C 1 144 ? 74.796  46.079  21.679 1.00 9.49  ? 144 PHE C CE2  1 
ATOM   3832 C CZ   . PHE C 1 144 ? 74.131  47.180  21.162 1.00 6.96  ? 144 PHE C CZ   1 
ATOM   3833 H H    . PHE C 1 144 ? 71.719  44.483  26.960 1.00 0.00  ? 144 PHE C H    1 
ATOM   3834 N N    . ALA C 1 145 ? 71.634  42.700  24.205 1.00 14.78 ? 145 ALA C N    1 
ATOM   3835 C CA   . ALA C 1 145 ? 71.458  41.571  23.291 1.00 16.00 ? 145 ALA C CA   1 
ATOM   3836 C C    . ALA C 1 145 ? 69.988  41.320  22.933 1.00 20.53 ? 145 ALA C C    1 
ATOM   3837 O O    . ALA C 1 145 ? 69.655  41.079  21.767 1.00 20.87 ? 145 ALA C O    1 
ATOM   3838 C CB   . ALA C 1 145 ? 72.074  40.324  23.883 1.00 14.89 ? 145 ALA C CB   1 
ATOM   3839 H H    . ALA C 1 145 ? 72.075  42.555  25.063 1.00 0.00  ? 145 ALA C H    1 
ATOM   3840 N N    . ARG C 1 146 ? 69.111  41.375  23.936 1.00 22.58 ? 146 ARG C N    1 
ATOM   3841 C CA   . ARG C 1 146 ? 67.677  41.160  23.728 1.00 19.11 ? 146 ARG C CA   1 
ATOM   3842 C C    . ARG C 1 146 ? 67.159  42.171  22.723 1.00 17.77 ? 146 ARG C C    1 
ATOM   3843 O O    . ARG C 1 146 ? 66.578  41.808  21.702 1.00 21.91 ? 146 ARG C O    1 
ATOM   3844 C CB   . ARG C 1 146 ? 66.908  41.337  25.042 1.00 28.26 ? 146 ARG C CB   1 
ATOM   3845 C CG   . ARG C 1 146 ? 65.389  41.225  24.914 1.00 30.35 ? 146 ARG C CG   1 
ATOM   3846 C CD   . ARG C 1 146 ? 64.923  39.784  25.058 1.00 40.60 ? 146 ARG C CD   1 
ATOM   3847 N NE   . ARG C 1 146 ? 63.543  39.586  24.613 1.00 44.04 ? 146 ARG C NE   1 
ATOM   3848 C CZ   . ARG C 1 146 ? 62.697  38.703  25.136 1.00 48.01 ? 146 ARG C CZ   1 
ATOM   3849 N NH1  . ARG C 1 146 ? 63.070  37.922  26.148 1.00 52.63 ? 146 ARG C NH1  1 
ATOM   3850 N NH2  . ARG C 1 146 ? 61.495  38.556  24.601 1.00 45.50 ? 146 ARG C NH2  1 
ATOM   3851 H H    . ARG C 1 146 ? 69.442  41.558  24.838 1.00 0.00  ? 146 ARG C H    1 
ATOM   3852 H HE   . ARG C 1 146 ? 63.187  40.116  23.899 1.00 0.00  ? 146 ARG C HE   1 
ATOM   3853 H HH11 . ARG C 1 146 ? 63.994  37.995  26.531 1.00 0.00  ? 146 ARG C HH11 1 
ATOM   3854 H HH12 . ARG C 1 146 ? 62.435  37.253  26.544 1.00 0.00  ? 146 ARG C HH12 1 
ATOM   3855 H HH21 . ARG C 1 146 ? 61.232  39.079  23.797 1.00 0.00  ? 146 ARG C HH21 1 
ATOM   3856 H HH22 . ARG C 1 146 ? 60.879  37.872  24.990 1.00 0.00  ? 146 ARG C HH22 1 
ATOM   3857 N N    . ILE C 1 147 ? 67.416  43.441  23.005 1.00 13.00 ? 147 ILE C N    1 
ATOM   3858 C CA   . ILE C 1 147 ? 66.972  44.530  22.153 1.00 7.73  ? 147 ILE C CA   1 
ATOM   3859 C C    . ILE C 1 147 ? 67.341  44.335  20.684 1.00 15.58 ? 147 ILE C C    1 
ATOM   3860 O O    . ILE C 1 147 ? 66.492  44.478  19.793 1.00 15.59 ? 147 ILE C O    1 
ATOM   3861 C CB   . ILE C 1 147 ? 67.530  45.868  22.661 1.00 7.89  ? 147 ILE C CB   1 
ATOM   3862 C CG1  . ILE C 1 147 ? 66.955  46.167  24.048 1.00 11.57 ? 147 ILE C CG1  1 
ATOM   3863 C CG2  . ILE C 1 147 ? 67.232  46.981  21.667 1.00 6.61  ? 147 ILE C CG2  1 
ATOM   3864 C CD1  . ILE C 1 147 ? 67.250  47.544  24.561 1.00 9.35  ? 147 ILE C CD1  1 
ATOM   3865 H H    . ILE C 1 147 ? 67.930  43.654  23.815 1.00 0.00  ? 147 ILE C H    1 
ATOM   3866 N N    . CYS C 1 148 ? 68.599  43.998  20.425 1.00 16.93 ? 148 CYS C N    1 
ATOM   3867 C CA   . CYS C 1 148 ? 69.046  43.813  19.050 1.00 12.62 ? 148 CYS C CA   1 
ATOM   3868 C C    . CYS C 1 148 ? 68.343  42.645  18.385 1.00 10.40 ? 148 CYS C C    1 
ATOM   3869 O O    . CYS C 1 148 ? 67.814  42.770  17.288 1.00 13.20 ? 148 CYS C O    1 
ATOM   3870 C CB   . CYS C 1 148 ? 70.567  43.646  18.995 1.00 10.18 ? 148 CYS C CB   1 
ATOM   3871 S SG   . CYS C 1 148 ? 71.451  45.135  19.496 1.00 13.17 ? 148 CYS C SG   1 
ATOM   3872 H H    . CYS C 1 148 ? 69.239  43.890  21.162 1.00 0.00  ? 148 CYS C H    1 
ATOM   3873 N N    . ARG C 1 149 ? 68.282  41.521  19.077 1.00 17.05 ? 149 ARG C N    1 
ATOM   3874 C CA   . ARG C 1 149 ? 67.638  40.342  18.521 1.00 18.86 ? 149 ARG C CA   1 
ATOM   3875 C C    . ARG C 1 149 ? 66.186  40.651  18.144 1.00 18.96 ? 149 ARG C C    1 
ATOM   3876 O O    . ARG C 1 149 ? 65.742  40.348  17.035 1.00 21.02 ? 149 ARG C O    1 
ATOM   3877 C CB   . ARG C 1 149 ? 67.675  39.207  19.542 1.00 21.00 ? 149 ARG C CB   1 
ATOM   3878 C CG   . ARG C 1 149 ? 67.244  37.877  18.983 1.00 27.41 ? 149 ARG C CG   1 
ATOM   3879 C CD   . ARG C 1 149 ? 66.828  36.937  20.092 1.00 33.31 ? 149 ARG C CD   1 
ATOM   3880 N NE   . ARG C 1 149 ? 65.580  37.371  20.710 1.00 38.19 ? 149 ARG C NE   1 
ATOM   3881 C CZ   . ARG C 1 149 ? 65.197  37.027  21.933 1.00 43.02 ? 149 ARG C CZ   1 
ATOM   3882 N NH1  . ARG C 1 149 ? 65.966  36.240  22.669 1.00 47.84 ? 149 ARG C NH1  1 
ATOM   3883 N NH2  . ARG C 1 149 ? 64.055  37.489  22.427 1.00 44.36 ? 149 ARG C NH2  1 
ATOM   3884 H H    . ARG C 1 149 ? 68.679  41.500  19.973 1.00 0.00  ? 149 ARG C H    1 
ATOM   3885 H HE   . ARG C 1 149 ? 64.991  37.966  20.198 1.00 0.00  ? 149 ARG C HE   1 
ATOM   3886 H HH11 . ARG C 1 149 ? 66.836  35.919  22.297 1.00 0.00  ? 149 ARG C HH11 1 
ATOM   3887 H HH12 . ARG C 1 149 ? 65.691  35.985  23.594 1.00 0.00  ? 149 ARG C HH12 1 
ATOM   3888 H HH21 . ARG C 1 149 ? 63.480  38.102  21.884 1.00 0.00  ? 149 ARG C HH21 1 
ATOM   3889 H HH22 . ARG C 1 149 ? 63.773  37.233  23.352 1.00 0.00  ? 149 ARG C HH22 1 
ATOM   3890 N N    . ASP C 1 150 ? 65.475  41.299  19.061 1.00 13.53 ? 150 ASP C N    1 
ATOM   3891 C CA   . ASP C 1 150 ? 64.079  41.641  18.870 1.00 16.35 ? 150 ASP C CA   1 
ATOM   3892 C C    . ASP C 1 150 ? 63.779  42.656  17.776 1.00 16.70 ? 150 ASP C C    1 
ATOM   3893 O O    . ASP C 1 150 ? 63.057  42.338  16.827 1.00 19.72 ? 150 ASP C O    1 
ATOM   3894 C CB   . ASP C 1 150 ? 63.462  42.067  20.200 1.00 20.69 ? 150 ASP C CB   1 
ATOM   3895 C CG   . ASP C 1 150 ? 63.366  40.915  21.190 1.00 23.21 ? 150 ASP C CG   1 
ATOM   3896 O OD1  . ASP C 1 150 ? 63.463  39.737  20.781 1.00 28.42 ? 150 ASP C OD1  1 
ATOM   3897 O OD2  . ASP C 1 150 ? 63.179  41.189  22.385 1.00 26.19 ? 150 ASP C OD2  1 
ATOM   3898 H H    . ASP C 1 150 ? 65.916  41.571  19.894 1.00 0.00  ? 150 ASP C H    1 
ATOM   3899 N N    . LEU C 1 151 ? 64.340  43.857  17.875 1.00 8.45  ? 151 LEU C N    1 
ATOM   3900 C CA   . LEU C 1 151 ? 64.098  44.869  16.851 1.00 10.76 ? 151 LEU C CA   1 
ATOM   3901 C C    . LEU C 1 151 ? 64.405  44.321  15.454 1.00 16.63 ? 151 LEU C C    1 
ATOM   3902 O O    . LEU C 1 151 ? 63.895  44.840  14.454 1.00 20.91 ? 151 LEU C O    1 
ATOM   3903 C CB   . LEU C 1 151 ? 64.931  46.130  17.104 1.00 11.44 ? 151 LEU C CB   1 
ATOM   3904 C CG   . LEU C 1 151 ? 64.744  46.939  18.394 1.00 7.49  ? 151 LEU C CG   1 
ATOM   3905 C CD1  . LEU C 1 151 ? 65.543  48.206  18.284 1.00 6.50  ? 151 LEU C CD1  1 
ATOM   3906 C CD2  . LEU C 1 151 ? 63.296  47.289  18.631 1.00 10.02 ? 151 LEU C CD2  1 
ATOM   3907 H H    . LEU C 1 151 ? 64.929  44.043  18.637 1.00 0.00  ? 151 LEU C H    1 
ATOM   3908 N N    . SER C 1 152 ? 65.219  43.264  15.395 1.00 22.56 ? 152 SER C N    1 
ATOM   3909 C CA   . SER C 1 152 ? 65.594  42.608  14.134 1.00 25.65 ? 152 SER C CA   1 
ATOM   3910 C C    . SER C 1 152 ? 64.388  42.004  13.430 1.00 23.65 ? 152 SER C C    1 
ATOM   3911 O O    . SER C 1 152 ? 64.362  41.919  12.203 1.00 24.77 ? 152 SER C O    1 
ATOM   3912 C CB   . SER C 1 152 ? 66.613  41.489  14.377 1.00 23.17 ? 152 SER C CB   1 
ATOM   3913 O OG   . SER C 1 152 ? 67.865  41.999  14.778 1.00 28.76 ? 152 SER C OG   1 
ATOM   3914 H H    . SER C 1 152 ? 65.625  42.889  16.204 1.00 0.00  ? 152 SER C H    1 
ATOM   3915 H HG   . SER C 1 152 ? 68.402  41.210  14.885 1.00 0.00  ? 152 SER C HG   1 
ATOM   3916 N N    . HIS C 1 153 ? 63.425  41.522  14.210 1.00 24.01 ? 153 HIS C N    1 
ATOM   3917 C CA   . HIS C 1 153 ? 62.219  40.932  13.644 1.00 29.18 ? 153 HIS C CA   1 
ATOM   3918 C C    . HIS C 1 153 ? 61.321  42.026  13.089 1.00 25.71 ? 153 HIS C C    1 
ATOM   3919 O O    . HIS C 1 153 ? 60.463  41.767  12.247 1.00 25.34 ? 153 HIS C O    1 
ATOM   3920 C CB   . HIS C 1 153 ? 61.430  40.176  14.708 1.00 35.66 ? 153 HIS C CB   1 
ATOM   3921 C CG   . HIS C 1 153 ? 62.232  39.175  15.467 1.00 39.41 ? 153 HIS C CG   1 
ATOM   3922 N ND1  . HIS C 1 153 ? 61.842  38.705  16.703 1.00 42.44 ? 153 HIS C ND1  1 
ATOM   3923 C CD2  . HIS C 1 153 ? 63.397  38.554  15.175 1.00 42.81 ? 153 HIS C CD2  1 
ATOM   3924 C CE1  . HIS C 1 153 ? 62.734  37.838  17.140 1.00 47.74 ? 153 HIS C CE1  1 
ATOM   3925 N NE2  . HIS C 1 153 ? 63.691  37.726  16.233 1.00 47.57 ? 153 HIS C NE2  1 
ATOM   3926 H H    . HIS C 1 153 ? 63.527  41.567  15.181 1.00 0.00  ? 153 HIS C H    1 
ATOM   3927 H HD1  . HIS C 1 153 ? 61.040  38.995  17.184 1.00 0.00  ? 153 HIS C HD1  1 
ATOM   3928 H HE2  . HIS C 1 153 ? 64.478  37.155  16.317 1.00 0.00  ? 153 HIS C HE2  1 
ATOM   3929 N N    . ILE C 1 154 ? 61.499  43.240  13.601 1.00 23.20 ? 154 ILE C N    1 
ATOM   3930 C CA   . ILE C 1 154 ? 60.693  44.378  13.185 1.00 18.96 ? 154 ILE C CA   1 
ATOM   3931 C C    . ILE C 1 154 ? 61.249  45.060  11.950 1.00 23.23 ? 154 ILE C C    1 
ATOM   3932 O O    . ILE C 1 154 ? 60.480  45.514  11.097 1.00 27.95 ? 154 ILE C O    1 
ATOM   3933 C CB   . ILE C 1 154 ? 60.578  45.424  14.305 1.00 14.98 ? 154 ILE C CB   1 
ATOM   3934 C CG1  . ILE C 1 154 ? 60.298  44.751  15.652 1.00 16.76 ? 154 ILE C CG1  1 
ATOM   3935 C CG2  . ILE C 1 154 ? 59.468  46.400  13.989 1.00 18.76 ? 154 ILE C CG2  1 
ATOM   3936 C CD1  . ILE C 1 154 ? 58.986  44.000  15.733 1.00 14.56 ? 154 ILE C CD1  1 
ATOM   3937 H H    . ILE C 1 154 ? 62.196  43.372  14.272 1.00 0.00  ? 154 ILE C H    1 
ATOM   3938 N N    . GLY C 1 155 ? 62.576  45.136  11.850 1.00 23.88 ? 155 GLY C N    1 
ATOM   3939 C CA   . GLY C 1 155 ? 63.192  45.797  10.711 1.00 18.11 ? 155 GLY C CA   1 
ATOM   3940 C C    . GLY C 1 155 ? 64.694  45.635  10.642 1.00 17.38 ? 155 GLY C C    1 
ATOM   3941 O O    . GLY C 1 155 ? 65.292  45.004  11.506 1.00 17.78 ? 155 GLY C O    1 
ATOM   3942 H H    . GLY C 1 155 ? 63.168  44.738  12.528 1.00 0.00  ? 155 GLY C H    1 
ATOM   3943 N N    . ASP C 1 156 ? 65.303  46.229  9.619  1.00 20.87 ? 156 ASP C N    1 
ATOM   3944 C CA   . ASP C 1 156 ? 66.748  46.140  9.396  1.00 27.01 ? 156 ASP C CA   1 
ATOM   3945 C C    . ASP C 1 156 ? 67.600  47.071  10.241 1.00 24.18 ? 156 ASP C C    1 
ATOM   3946 O O    . ASP C 1 156 ? 68.653  46.669  10.724 1.00 27.27 ? 156 ASP C O    1 
ATOM   3947 C CB   . ASP C 1 156 ? 67.097  46.413  7.927  1.00 30.66 ? 156 ASP C CB   1 
ATOM   3948 C CG   . ASP C 1 156 ? 66.512  45.394  6.980  1.00 43.52 ? 156 ASP C CG   1 
ATOM   3949 O OD1  . ASP C 1 156 ? 66.905  44.209  7.057  1.00 48.85 ? 156 ASP C OD1  1 
ATOM   3950 O OD2  . ASP C 1 156 ? 65.674  45.785  6.137  1.00 52.20 ? 156 ASP C OD2  1 
ATOM   3951 H H    . ASP C 1 156 ? 64.741  46.753  9.014  1.00 0.00  ? 156 ASP C H    1 
ATOM   3952 N N    . ALA C 1 157 ? 67.193  48.335  10.324 1.00 21.80 ? 157 ALA C N    1 
ATOM   3953 C CA   . ALA C 1 157 ? 67.941  49.344  11.065 1.00 17.48 ? 157 ALA C CA   1 
ATOM   3954 C C    . ALA C 1 157 ? 67.330  49.723  12.400 1.00 16.32 ? 157 ALA C C    1 
ATOM   3955 O O    . ALA C 1 157 ? 66.118  49.627  12.610 1.00 15.64 ? 157 ALA C O    1 
ATOM   3956 C CB   . ALA C 1 157 ? 68.138  50.586  10.217 1.00 13.09 ? 157 ALA C CB   1 
ATOM   3957 H H    . ALA C 1 157 ? 66.350  48.593  9.905  1.00 0.00  ? 157 ALA C H    1 
ATOM   3958 N N    . VAL C 1 158 ? 68.183  50.219  13.280 1.00 9.65  ? 158 VAL C N    1 
ATOM   3959 C CA   . VAL C 1 158 ? 67.769  50.618  14.603 1.00 11.11 ? 158 VAL C CA   1 
ATOM   3960 C C    . VAL C 1 158 ? 68.177  52.068  14.784 1.00 16.82 ? 158 VAL C C    1 
ATOM   3961 O O    . VAL C 1 158 ? 69.244  52.485  14.327 1.00 19.68 ? 158 VAL C O    1 
ATOM   3962 C CB   . VAL C 1 158 ? 68.424  49.707  15.686 1.00 4.12  ? 158 VAL C CB   1 
ATOM   3963 C CG1  . VAL C 1 158 ? 69.933  49.715  15.553 1.00 6.03  ? 158 VAL C CG1  1 
ATOM   3964 C CG2  . VAL C 1 158 ? 68.008  50.128  17.076 1.00 9.39  ? 158 VAL C CG2  1 
ATOM   3965 H H    . VAL C 1 158 ? 69.115  50.347  13.038 1.00 0.00  ? 158 VAL C H    1 
ATOM   3966 N N    . VAL C 1 159 ? 67.277  52.856  15.350 1.00 15.37 ? 159 VAL C N    1 
ATOM   3967 C CA   . VAL C 1 159 ? 67.563  54.249  15.607 1.00 17.03 ? 159 VAL C CA   1 
ATOM   3968 C C    . VAL C 1 159 ? 67.768  54.393  17.094 1.00 19.50 ? 159 VAL C C    1 
ATOM   3969 O O    . VAL C 1 159 ? 66.844  54.190  17.874 1.00 27.56 ? 159 VAL C O    1 
ATOM   3970 C CB   . VAL C 1 159 ? 66.421  55.146  15.159 1.00 16.76 ? 159 VAL C CB   1 
ATOM   3971 C CG1  . VAL C 1 159 ? 66.656  56.565  15.647 1.00 8.24  ? 159 VAL C CG1  1 
ATOM   3972 C CG2  . VAL C 1 159 ? 66.313  55.097  13.640 1.00 13.93 ? 159 VAL C CG2  1 
ATOM   3973 H H    . VAL C 1 159 ? 66.405  52.486  15.582 1.00 0.00  ? 159 VAL C H    1 
ATOM   3974 N N    . ILE C 1 160 ? 69.006  54.648  17.488 1.00 22.28 ? 160 ILE C N    1 
ATOM   3975 C CA   . ILE C 1 160 ? 69.326  54.806  18.895 1.00 21.07 ? 160 ILE C CA   1 
ATOM   3976 C C    . ILE C 1 160 ? 69.312  56.291  19.215 1.00 27.95 ? 160 ILE C C    1 
ATOM   3977 O O    . ILE C 1 160 ? 70.032  57.079  18.586 1.00 24.29 ? 160 ILE C O    1 
ATOM   3978 C CB   . ILE C 1 160 ? 70.721  54.243  19.239 1.00 19.29 ? 160 ILE C CB   1 
ATOM   3979 C CG1  . ILE C 1 160 ? 70.960  52.900  18.539 1.00 14.17 ? 160 ILE C CG1  1 
ATOM   3980 C CG2  . ILE C 1 160 ? 70.839  54.078  20.740 1.00 21.16 ? 160 ILE C CG2  1 
ATOM   3981 C CD1  . ILE C 1 160 ? 72.302  52.269  18.845 1.00 11.36 ? 160 ILE C CD1  1 
ATOM   3982 H H    . ILE C 1 160 ? 69.708  54.741  16.816 1.00 0.00  ? 160 ILE C H    1 
ATOM   3983 N N    . SER C 1 161 ? 68.449  56.674  20.149 1.00 31.92 ? 161 SER C N    1 
ATOM   3984 C CA   . SER C 1 161 ? 68.336  58.062  20.579 1.00 30.13 ? 161 SER C CA   1 
ATOM   3985 C C    . SER C 1 161 ? 68.833  58.082  22.008 1.00 32.29 ? 161 SER C C    1 
ATOM   3986 O O    . SER C 1 161 ? 68.371  57.292  22.831 1.00 29.51 ? 161 SER C O    1 
ATOM   3987 C CB   . SER C 1 161 ? 66.880  58.528  20.560 1.00 25.87 ? 161 SER C CB   1 
ATOM   3988 O OG   . SER C 1 161 ? 66.276  58.278  19.306 1.00 33.96 ? 161 SER C OG   1 
ATOM   3989 H H    . SER C 1 161 ? 67.887  56.004  20.566 1.00 0.00  ? 161 SER C H    1 
ATOM   3990 H HG   . SER C 1 161 ? 65.842  57.420  19.427 1.00 0.00  ? 161 SER C HG   1 
ATOM   3991 N N    . CYS C 1 162 ? 69.807  58.935  22.293 1.00 34.05 ? 162 CYS C N    1 
ATOM   3992 C CA   . CYS C 1 162 ? 70.334  59.026  23.640 1.00 33.60 ? 162 CYS C CA   1 
ATOM   3993 C C    . CYS C 1 162 ? 70.093  60.404  24.223 1.00 34.51 ? 162 CYS C C    1 
ATOM   3994 O O    . CYS C 1 162 ? 70.422  61.417  23.609 1.00 39.21 ? 162 CYS C O    1 
ATOM   3995 C CB   . CYS C 1 162 ? 71.821  58.704  23.670 1.00 31.57 ? 162 CYS C CB   1 
ATOM   3996 S SG   . CYS C 1 162 ? 72.488  58.637  25.346 1.00 40.22 ? 162 CYS C SG   1 
ATOM   3997 H H    . CYS C 1 162 ? 70.176  59.503  21.595 1.00 0.00  ? 162 CYS C H    1 
ATOM   3998 N N    . ALA C 1 163 ? 69.472  60.424  25.392 1.00 37.21 ? 163 ALA C N    1 
ATOM   3999 C CA   . ALA C 1 163 ? 69.177  61.652  26.103 1.00 41.05 ? 163 ALA C CA   1 
ATOM   4000 C C    . ALA C 1 163 ? 69.594  61.389  27.556 1.00 47.47 ? 163 ALA C C    1 
ATOM   4001 O O    . ALA C 1 163 ? 69.866  60.244  27.928 1.00 50.95 ? 163 ALA C O    1 
ATOM   4002 C CB   . ALA C 1 163 ? 67.703  61.976  26.006 1.00 41.54 ? 163 ALA C CB   1 
ATOM   4003 H H    . ALA C 1 163 ? 69.238  59.579  25.841 1.00 0.00  ? 163 ALA C H    1 
ATOM   4004 N N    . LYS C 1 164 ? 69.611  62.434  28.379 1.00 48.49 ? 164 LYS C N    1 
ATOM   4005 C CA   . LYS C 1 164 ? 70.052  62.319  29.767 1.00 47.56 ? 164 LYS C CA   1 
ATOM   4006 C C    . LYS C 1 164 ? 69.370  61.274  30.639 1.00 47.03 ? 164 LYS C C    1 
ATOM   4007 O O    . LYS C 1 164 ? 70.016  60.475  31.307 1.00 52.31 ? 164 LYS C O    1 
ATOM   4008 C CB   . LYS C 1 164 ? 69.956  63.675  30.469 1.00 46.69 ? 164 LYS C CB   1 
ATOM   4009 C CG   . LYS C 1 164 ? 70.619  63.721  31.846 1.00 51.44 ? 164 LYS C CG   1 
ATOM   4010 C CD   . LYS C 1 164 ? 72.150  63.555  31.775 1.00 55.72 ? 164 LYS C CD   1 
ATOM   4011 C CE   . LYS C 1 164 ? 72.607  62.096  31.642 1.00 51.97 ? 164 LYS C CE   1 
ATOM   4012 N NZ   . LYS C 1 164 ? 72.339  61.276  32.857 1.00 48.30 ? 164 LYS C NZ   1 
ATOM   4013 H H    . LYS C 1 164 ? 69.266  63.281  28.045 1.00 0.00  ? 164 LYS C H    1 
ATOM   4014 H HZ1  . LYS C 1 164 ? 71.324  61.302  33.084 1.00 0.00  ? 164 LYS C HZ1  1 
ATOM   4015 H HZ2  . LYS C 1 164 ? 72.631  60.287  32.726 1.00 0.00  ? 164 LYS C HZ2  1 
ATOM   4016 H HZ3  . LYS C 1 164 ? 72.869  61.694  33.648 1.00 0.00  ? 164 LYS C HZ3  1 
ATOM   4017 N N    . ASP C 1 165 ? 68.052  61.286  30.610 1.00 47.77 ? 165 ASP C N    1 
ATOM   4018 C CA   . ASP C 1 165 ? 67.240  60.396  31.428 1.00 51.20 ? 165 ASP C CA   1 
ATOM   4019 C C    . ASP C 1 165 ? 66.789  59.094  30.760 1.00 49.82 ? 165 ASP C C    1 
ATOM   4020 O O    . ASP C 1 165 ? 65.774  58.506  31.162 1.00 51.40 ? 165 ASP C O    1 
ATOM   4021 C CB   . ASP C 1 165 ? 66.025  61.189  31.897 1.00 56.39 ? 165 ASP C CB   1 
ATOM   4022 C CG   . ASP C 1 165 ? 65.411  62.036  30.775 1.00 59.73 ? 165 ASP C CG   1 
ATOM   4023 O OD1  . ASP C 1 165 ? 65.697  61.750  29.576 1.00 57.42 ? 165 ASP C OD1  1 
ATOM   4024 O OD2  . ASP C 1 165 ? 64.665  62.997  31.091 1.00 67.07 ? 165 ASP C OD2  1 
ATOM   4025 H H    . ASP C 1 165 ? 67.665  61.907  29.962 1.00 0.00  ? 165 ASP C H    1 
ATOM   4026 N N    . GLY C 1 166 ? 67.534  58.640  29.759 1.00 44.98 ? 166 GLY C N    1 
ATOM   4027 C CA   . GLY C 1 166 ? 67.179  57.410  29.088 1.00 35.08 ? 166 GLY C CA   1 
ATOM   4028 C C    . GLY C 1 166 ? 67.577  57.358  27.631 1.00 32.48 ? 166 GLY C C    1 
ATOM   4029 O O    . GLY C 1 166 ? 67.812  58.392  27.003 1.00 32.89 ? 166 GLY C O    1 
ATOM   4030 H H    . GLY C 1 166 ? 68.328  59.124  29.460 1.00 0.00  ? 166 GLY C H    1 
ATOM   4031 N N    . VAL C 1 167 ? 67.649  56.141  27.100 1.00 25.56 ? 167 VAL C N    1 
ATOM   4032 C CA   . VAL C 1 167 ? 68.011  55.904  25.712 1.00 20.44 ? 167 VAL C CA   1 
ATOM   4033 C C    . VAL C 1 167 ? 66.865  55.135  25.048 1.00 20.18 ? 167 VAL C C    1 
ATOM   4034 O O    . VAL C 1 167 ? 66.174  54.364  25.705 1.00 24.54 ? 167 VAL C O    1 
ATOM   4035 C CB   . VAL C 1 167 ? 69.330  55.126  25.621 1.00 11.44 ? 167 VAL C CB   1 
ATOM   4036 C CG1  . VAL C 1 167 ? 69.243  53.845  26.428 1.00 18.84 ? 167 VAL C CG1  1 
ATOM   4037 C CG2  . VAL C 1 167 ? 69.670  54.839  24.188 1.00 8.36  ? 167 VAL C CG2  1 
ATOM   4038 H H    . VAL C 1 167 ? 67.388  55.381  27.661 1.00 0.00  ? 167 VAL C H    1 
ATOM   4039 N N    . LYS C 1 168 ? 66.644  55.373  23.758 1.00 25.17 ? 168 LYS C N    1 
ATOM   4040 C CA   . LYS C 1 168 ? 65.558  54.728  23.026 1.00 21.13 ? 168 LYS C CA   1 
ATOM   4041 C C    . LYS C 1 168 ? 66.038  54.063  21.744 1.00 23.01 ? 168 LYS C C    1 
ATOM   4042 O O    . LYS C 1 168 ? 66.831  54.639  20.994 1.00 24.61 ? 168 LYS C O    1 
ATOM   4043 C CB   . LYS C 1 168 ? 64.479  55.758  22.698 1.00 17.16 ? 168 LYS C CB   1 
ATOM   4044 C CG   . LYS C 1 168 ? 63.223  55.175  22.127 1.00 22.02 ? 168 LYS C CG   1 
ATOM   4045 C CD   . LYS C 1 168 ? 62.084  56.174  22.164 1.00 30.51 ? 168 LYS C CD   1 
ATOM   4046 C CE   . LYS C 1 168 ? 62.245  57.308  21.160 1.00 38.93 ? 168 LYS C CE   1 
ATOM   4047 N NZ   . LYS C 1 168 ? 61.855  56.924  19.772 1.00 44.50 ? 168 LYS C NZ   1 
ATOM   4048 H H    . LYS C 1 168 ? 67.202  55.994  23.267 1.00 0.00  ? 168 LYS C H    1 
ATOM   4049 H HZ1  . LYS C 1 168 ? 62.445  56.135  19.437 1.00 0.00  ? 168 LYS C HZ1  1 
ATOM   4050 H HZ2  . LYS C 1 168 ? 60.854  56.649  19.748 1.00 0.00  ? 168 LYS C HZ2  1 
ATOM   4051 H HZ3  . LYS C 1 168 ? 61.999  57.739  19.143 1.00 0.00  ? 168 LYS C HZ3  1 
ATOM   4052 N N    . PHE C 1 169 ? 65.585  52.832  21.525 1.00 23.72 ? 169 PHE C N    1 
ATOM   4053 C CA   . PHE C 1 169 ? 65.934  52.054  20.343 1.00 17.86 ? 169 PHE C CA   1 
ATOM   4054 C C    . PHE C 1 169 ? 64.646  51.862  19.557 1.00 20.33 ? 169 PHE C C    1 
ATOM   4055 O O    . PHE C 1 169 ? 63.626  51.444  20.110 1.00 21.33 ? 169 PHE C O    1 
ATOM   4056 C CB   . PHE C 1 169 ? 66.493  50.689  20.748 1.00 20.39 ? 169 PHE C CB   1 
ATOM   4057 C CG   . PHE C 1 169 ? 67.665  50.758  21.705 1.00 22.71 ? 169 PHE C CG   1 
ATOM   4058 C CD1  . PHE C 1 169 ? 67.454  50.915  23.081 1.00 14.46 ? 169 PHE C CD1  1 
ATOM   4059 C CD2  . PHE C 1 169 ? 68.979  50.630  21.234 1.00 17.48 ? 169 PHE C CD2  1 
ATOM   4060 C CE1  . PHE C 1 169 ? 68.532  50.939  23.968 1.00 16.67 ? 169 PHE C CE1  1 
ATOM   4061 C CE2  . PHE C 1 169 ? 70.060  50.654  22.114 1.00 20.50 ? 169 PHE C CE2  1 
ATOM   4062 C CZ   . PHE C 1 169 ? 69.836  50.809  23.486 1.00 19.76 ? 169 PHE C CZ   1 
ATOM   4063 H H    . PHE C 1 169 ? 64.972  52.432  22.178 1.00 0.00  ? 169 PHE C H    1 
ATOM   4064 N N    . SER C 1 170 ? 64.698  52.137  18.264 1.00 21.75 ? 170 SER C N    1 
ATOM   4065 C CA   . SER C 1 170 ? 63.517  52.014  17.423 1.00 20.12 ? 170 SER C CA   1 
ATOM   4066 C C    . SER C 1 170 ? 63.815  51.267  16.124 1.00 21.03 ? 170 SER C C    1 
ATOM   4067 O O    . SER C 1 170 ? 64.951  51.255  15.651 1.00 27.01 ? 170 SER C O    1 
ATOM   4068 C CB   . SER C 1 170 ? 62.981  53.412  17.106 1.00 23.27 ? 170 SER C CB   1 
ATOM   4069 O OG   . SER C 1 170 ? 62.868  54.202  18.282 1.00 21.50 ? 170 SER C OG   1 
ATOM   4070 H H    . SER C 1 170 ? 65.540  52.430  17.865 1.00 0.00  ? 170 SER C H    1 
ATOM   4071 H HG   . SER C 1 170 ? 63.562  54.870  18.317 1.00 0.00  ? 170 SER C HG   1 
ATOM   4072 N N    . ALA C 1 171 ? 62.792  50.630  15.565 1.00 24.38 ? 171 ALA C N    1 
ATOM   4073 C CA   . ALA C 1 171 ? 62.911  49.887  14.313 1.00 24.95 ? 171 ALA C CA   1 
ATOM   4074 C C    . ALA C 1 171 ? 61.589  49.980  13.537 1.00 25.82 ? 171 ALA C C    1 
ATOM   4075 O O    . ALA C 1 171 ? 60.531  50.271  14.108 1.00 22.86 ? 171 ALA C O    1 
ATOM   4076 C CB   . ALA C 1 171 ? 63.265  48.435  14.596 1.00 25.60 ? 171 ALA C CB   1 
ATOM   4077 H H    . ALA C 1 171 ? 61.918  50.632  16.008 1.00 0.00  ? 171 ALA C H    1 
ATOM   4078 N N    . SER C 1 172 ? 61.646  49.744  12.236 1.00 26.51 ? 172 SER C N    1 
ATOM   4079 C CA   . SER C 1 172 ? 60.448  49.819  11.418 1.00 31.45 ? 172 SER C CA   1 
ATOM   4080 C C    . SER C 1 172 ? 60.496  48.817  10.275 1.00 30.26 ? 172 SER C C    1 
ATOM   4081 O O    . SER C 1 172 ? 61.560  48.545  9.718  1.00 35.42 ? 172 SER C O    1 
ATOM   4082 C CB   . SER C 1 172 ? 60.275  51.239  10.872 1.00 36.00 ? 172 SER C CB   1 
ATOM   4083 O OG   . SER C 1 172 ? 60.246  52.196  11.923 1.00 46.86 ? 172 SER C OG   1 
ATOM   4084 H H    . SER C 1 172 ? 62.493  49.506  11.812 1.00 0.00  ? 172 SER C H    1 
ATOM   4085 H HG   . SER C 1 172 ? 59.542  51.983  12.539 1.00 0.00  ? 172 SER C HG   1 
ATOM   4086 N N    . GLY C 1 173 ? 59.339  48.256  9.949  1.00 28.08 ? 173 GLY C N    1 
ATOM   4087 C CA   . GLY C 1 173 ? 59.249  47.292  8.873  1.00 28.17 ? 173 GLY C CA   1 
ATOM   4088 C C    . GLY C 1 173 ? 57.837  47.229  8.327  1.00 23.28 ? 173 GLY C C    1 
ATOM   4089 O O    . GLY C 1 173 ? 56.968  48.000  8.733  1.00 25.91 ? 173 GLY C O    1 
ATOM   4090 H H    . GLY C 1 173 ? 58.526  48.483  10.435 1.00 0.00  ? 173 GLY C H    1 
ATOM   4091 N N    . GLU C 1 174 ? 57.596  46.281  7.432  1.00 24.09 ? 174 GLU C N    1 
ATOM   4092 C CA   . GLU C 1 174 ? 56.283  46.121  6.828  1.00 29.17 ? 174 GLU C CA   1 
ATOM   4093 C C    . GLU C 1 174 ? 55.193  45.719  7.811  1.00 25.94 ? 174 GLU C C    1 
ATOM   4094 O O    . GLU C 1 174 ? 54.011  45.922  7.548  1.00 32.02 ? 174 GLU C O    1 
ATOM   4095 C CB   . GLU C 1 174 ? 56.354  45.131  5.675  1.00 37.27 ? 174 GLU C CB   1 
ATOM   4096 C CG   . GLU C 1 174 ? 57.099  43.855  6.010  1.00 52.96 ? 174 GLU C CG   1 
ATOM   4097 C CD   . GLU C 1 174 ? 57.451  43.035  4.778  1.00 61.29 ? 174 GLU C CD   1 
ATOM   4098 O OE1  . GLU C 1 174 ? 57.323  43.556  3.644  1.00 65.02 ? 174 GLU C OE1  1 
ATOM   4099 O OE2  . GLU C 1 174 ? 57.865  41.866  4.949  1.00 67.83 ? 174 GLU C OE2  1 
ATOM   4100 H H    . GLU C 1 174 ? 58.342  45.699  7.190  1.00 0.00  ? 174 GLU C H    1 
ATOM   4101 N N    . LEU C 1 175 ? 55.582  45.159  8.948  1.00 19.79 ? 175 LEU C N    1 
ATOM   4102 C CA   . LEU C 1 175 ? 54.598  44.754  9.947  1.00 18.76 ? 175 LEU C CA   1 
ATOM   4103 C C    . LEU C 1 175 ? 54.225  45.891  10.889 1.00 17.10 ? 175 LEU C C    1 
ATOM   4104 O O    . LEU C 1 175 ? 53.242  45.797  11.620 1.00 22.77 ? 175 LEU C O    1 
ATOM   4105 C CB   . LEU C 1 175 ? 55.083  43.529  10.746 1.00 17.13 ? 175 LEU C CB   1 
ATOM   4106 C CG   . LEU C 1 175 ? 56.271  43.566  11.716 1.00 11.70 ? 175 LEU C CG   1 
ATOM   4107 C CD1  . LEU C 1 175 ? 55.884  44.238  13.030 1.00 6.40  ? 175 LEU C CD1  1 
ATOM   4108 C CD2  . LEU C 1 175 ? 56.714  42.140  11.973 1.00 10.11 ? 175 LEU C CD2  1 
ATOM   4109 H H    . LEU C 1 175 ? 56.533  45.031  9.129  1.00 0.00  ? 175 LEU C H    1 
ATOM   4110 N N    . GLY C 1 176 ? 54.995  46.968  10.852 1.00 14.87 ? 176 GLY C N    1 
ATOM   4111 C CA   . GLY C 1 176 ? 54.735  48.092  11.725 1.00 11.45 ? 176 GLY C CA   1 
ATOM   4112 C C    . GLY C 1 176 ? 56.072  48.564  12.250 1.00 18.16 ? 176 GLY C C    1 
ATOM   4113 O O    . GLY C 1 176 ? 57.102  48.395  11.590 1.00 15.53 ? 176 GLY C O    1 
ATOM   4114 H H    . GLY C 1 176 ? 55.760  47.045  10.243 1.00 0.00  ? 176 GLY C H    1 
ATOM   4115 N N    . ASN C 1 177 ? 56.083  49.138  13.441 1.00 20.04 ? 177 ASN C N    1 
ATOM   4116 C CA   . ASN C 1 177 ? 57.333  49.614  14.012 1.00 23.30 ? 177 ASN C CA   1 
ATOM   4117 C C    . ASN C 1 177 ? 57.481  49.222  15.467 1.00 22.11 ? 177 ASN C C    1 
ATOM   4118 O O    . ASN C 1 177 ? 56.500  48.910  16.140 1.00 26.12 ? 177 ASN C O    1 
ATOM   4119 C CB   . ASN C 1 177 ? 57.466  51.135  13.834 1.00 34.21 ? 177 ASN C CB   1 
ATOM   4120 C CG   . ASN C 1 177 ? 56.284  51.914  14.403 1.00 39.39 ? 177 ASN C CG   1 
ATOM   4121 O OD1  . ASN C 1 177 ? 56.307  52.356  15.557 1.00 43.38 ? 177 ASN C OD1  1 
ATOM   4122 N ND2  . ASN C 1 177 ? 55.265  52.130  13.574 1.00 44.18 ? 177 ASN C ND2  1 
ATOM   4123 H H    . ASN C 1 177 ? 55.245  49.226  13.941 1.00 0.00  ? 177 ASN C H    1 
ATOM   4124 H HD21 . ASN C 1 177 ? 54.514  52.639  13.950 1.00 0.00  ? 177 ASN C HD21 1 
ATOM   4125 H HD22 . ASN C 1 177 ? 55.300  51.796  12.654 1.00 0.00  ? 177 ASN C HD22 1 
ATOM   4126 N N    . GLY C 1 178 ? 58.715  49.205  15.945 1.00 21.55 ? 178 GLY C N    1 
ATOM   4127 C CA   . GLY C 1 178 ? 58.957  48.838  17.326 1.00 27.73 ? 178 GLY C CA   1 
ATOM   4128 C C    . GLY C 1 178 ? 59.772  49.899  18.014 1.00 23.46 ? 178 GLY C C    1 
ATOM   4129 O O    . GLY C 1 178 ? 60.607  50.534  17.372 1.00 26.92 ? 178 GLY C O    1 
ATOM   4130 H H    . GLY C 1 178 ? 59.468  49.476  15.391 1.00 0.00  ? 178 GLY C H    1 
ATOM   4131 N N    . ASN C 1 179 ? 59.558  50.078  19.311 1.00 23.76 ? 179 ASN C N    1 
ATOM   4132 C CA   . ASN C 1 179 ? 60.277  51.098  20.067 1.00 28.37 ? 179 ASN C CA   1 
ATOM   4133 C C    . ASN C 1 179 ? 60.504  50.685  21.516 1.00 19.70 ? 179 ASN C C    1 
ATOM   4134 O O    . ASN C 1 179 ? 59.553  50.451  22.250 1.00 19.35 ? 179 ASN C O    1 
ATOM   4135 C CB   . ASN C 1 179 ? 59.484  52.408  20.028 1.00 40.38 ? 179 ASN C CB   1 
ATOM   4136 C CG   . ASN C 1 179 ? 60.149  53.509  20.808 1.00 47.86 ? 179 ASN C CG   1 
ATOM   4137 O OD1  . ASN C 1 179 ? 61.298  53.378  21.222 1.00 53.81 ? 179 ASN C OD1  1 
ATOM   4138 N ND2  . ASN C 1 179 ? 59.429  54.599  21.026 1.00 53.23 ? 179 ASN C ND2  1 
ATOM   4139 H H    . ASN C 1 179 ? 58.895  49.536  19.785 1.00 0.00  ? 179 ASN C H    1 
ATOM   4140 H HD21 . ASN C 1 179 ? 59.863  55.333  21.493 1.00 0.00  ? 179 ASN C HD21 1 
ATOM   4141 H HD22 . ASN C 1 179 ? 58.511  54.628  20.694 1.00 0.00  ? 179 ASN C HD22 1 
ATOM   4142 N N    . ILE C 1 180 ? 61.760  50.625  21.933 1.00 13.58 ? 180 ILE C N    1 
ATOM   4143 C CA   . ILE C 1 180 ? 62.081  50.226  23.297 1.00 20.55 ? 180 ILE C CA   1 
ATOM   4144 C C    . ILE C 1 180 ? 62.740  51.373  24.067 1.00 22.85 ? 180 ILE C C    1 
ATOM   4145 O O    . ILE C 1 180 ? 63.752  51.928  23.635 1.00 22.82 ? 180 ILE C O    1 
ATOM   4146 C CB   . ILE C 1 180 ? 62.994  48.976  23.317 1.00 17.83 ? 180 ILE C CB   1 
ATOM   4147 C CG1  . ILE C 1 180 ? 62.426  47.898  22.392 1.00 15.49 ? 180 ILE C CG1  1 
ATOM   4148 C CG2  . ILE C 1 180 ? 63.090  48.417  24.724 1.00 9.11  ? 180 ILE C CG2  1 
ATOM   4149 C CD1  . ILE C 1 180 ? 63.355  46.728  22.159 1.00 19.37 ? 180 ILE C CD1  1 
ATOM   4150 H H    . ILE C 1 180 ? 62.475  50.887  21.337 1.00 0.00  ? 180 ILE C H    1 
ATOM   4151 N N    . LYS C 1 181 ? 62.161  51.713  25.214 1.00 23.68 ? 181 LYS C N    1 
ATOM   4152 C CA   . LYS C 1 181 ? 62.669  52.794  26.040 1.00 21.19 ? 181 LYS C CA   1 
ATOM   4153 C C    . LYS C 1 181 ? 63.284  52.313  27.352 1.00 21.15 ? 181 LYS C C    1 
ATOM   4154 O O    . LYS C 1 181 ? 62.631  51.648  28.162 1.00 22.49 ? 181 LYS C O    1 
ATOM   4155 C CB   . LYS C 1 181 ? 61.557  53.804  26.318 1.00 23.78 ? 181 LYS C CB   1 
ATOM   4156 C CG   . LYS C 1 181 ? 61.119  54.622  25.108 1.00 31.73 ? 181 LYS C CG   1 
ATOM   4157 C CD   . LYS C 1 181 ? 59.911  55.510  25.456 1.00 41.66 ? 181 LYS C CD   1 
ATOM   4158 C CE   . LYS C 1 181 ? 59.649  56.599  24.411 1.00 45.94 ? 181 LYS C CE   1 
ATOM   4159 N NZ   . LYS C 1 181 ? 58.616  57.605  24.826 1.00 45.72 ? 181 LYS C NZ   1 
ATOM   4160 H H    . LYS C 1 181 ? 61.370  51.216  25.510 1.00 0.00  ? 181 LYS C H    1 
ATOM   4161 H HZ1  . LYS C 1 181 ? 58.894  58.042  25.729 1.00 0.00  ? 181 LYS C HZ1  1 
ATOM   4162 H HZ2  . LYS C 1 181 ? 58.572  58.343  24.097 1.00 0.00  ? 181 LYS C HZ2  1 
ATOM   4163 H HZ3  . LYS C 1 181 ? 57.695  57.139  24.922 1.00 0.00  ? 181 LYS C HZ3  1 
ATOM   4164 N N    . LEU C 1 182 ? 64.555  52.646  27.540 1.00 20.22 ? 182 LEU C N    1 
ATOM   4165 C CA   . LEU C 1 182 ? 65.297  52.284  28.735 1.00 16.95 ? 182 LEU C CA   1 
ATOM   4166 C C    . LEU C 1 182 ? 65.572  53.546  29.531 1.00 17.31 ? 182 LEU C C    1 
ATOM   4167 O O    . LEU C 1 182 ? 66.185  54.485  29.030 1.00 16.16 ? 182 LEU C O    1 
ATOM   4168 C CB   . LEU C 1 182 ? 66.631  51.629  28.359 1.00 18.90 ? 182 LEU C CB   1 
ATOM   4169 C CG   . LEU C 1 182 ? 66.672  50.219  27.768 1.00 16.27 ? 182 LEU C CG   1 
ATOM   4170 C CD1  . LEU C 1 182 ? 68.098  49.887  27.405 1.00 16.47 ? 182 LEU C CD1  1 
ATOM   4171 C CD2  . LEU C 1 182 ? 66.146  49.205  28.768 1.00 19.11 ? 182 LEU C CD2  1 
ATOM   4172 H H    . LEU C 1 182 ? 65.019  53.161  26.846 1.00 0.00  ? 182 LEU C H    1 
ATOM   4173 N N    . SER C 1 183 ? 65.117  53.569  30.773 1.00 24.39 ? 183 SER C N    1 
ATOM   4174 C CA   . SER C 1 183 ? 65.330  54.716  31.644 1.00 22.66 ? 183 SER C CA   1 
ATOM   4175 C C    . SER C 1 183 ? 66.548  54.498  32.534 1.00 24.23 ? 183 SER C C    1 
ATOM   4176 O O    . SER C 1 183 ? 66.841  53.367  32.933 1.00 30.32 ? 183 SER C O    1 
ATOM   4177 C CB   . SER C 1 183 ? 64.092  54.943  32.503 1.00 20.69 ? 183 SER C CB   1 
ATOM   4178 O OG   . SER C 1 183 ? 62.953  55.138  31.684 1.00 31.24 ? 183 SER C OG   1 
ATOM   4179 H H    . SER C 1 183 ? 64.627  52.794  31.120 1.00 0.00  ? 183 SER C H    1 
ATOM   4180 H HG   . SER C 1 183 ? 63.090  55.911  31.129 1.00 0.00  ? 183 SER C HG   1 
ATOM   4181 N N    . GLN C 1 184 ? 67.271  55.576  32.821 1.00 27.33 ? 184 GLN C N    1 
ATOM   4182 C CA   . GLN C 1 184 ? 68.448  55.492  33.676 1.00 35.57 ? 184 GLN C CA   1 
ATOM   4183 C C    . GLN C 1 184 ? 67.968  55.024  35.042 1.00 42.58 ? 184 GLN C C    1 
ATOM   4184 O O    . GLN C 1 184 ? 67.138  55.683  35.672 1.00 47.85 ? 184 GLN C O    1 
ATOM   4185 C CB   . GLN C 1 184 ? 69.125  56.859  33.791 1.00 34.48 ? 184 GLN C CB   1 
ATOM   4186 C CG   . GLN C 1 184 ? 70.447  56.826  34.560 1.00 36.09 ? 184 GLN C CG   1 
ATOM   4187 C CD   . GLN C 1 184 ? 71.177  58.151  34.529 1.00 34.17 ? 184 GLN C CD   1 
ATOM   4188 O OE1  . GLN C 1 184 ? 70.817  59.050  33.777 1.00 34.47 ? 184 GLN C OE1  1 
ATOM   4189 N NE2  . GLN C 1 184 ? 72.212  58.277  35.349 1.00 35.03 ? 184 GLN C NE2  1 
ATOM   4190 H H    . GLN C 1 184 ? 66.996  56.447  32.467 1.00 0.00  ? 184 GLN C H    1 
ATOM   4191 H HE21 . GLN C 1 184 ? 72.641  59.160  35.303 1.00 0.00  ? 184 GLN C HE21 1 
ATOM   4192 H HE22 . GLN C 1 184 ? 72.471  57.543  35.933 1.00 0.00  ? 184 GLN C HE22 1 
ATOM   4193 N N    . THR C 1 185 ? 68.455  53.870  35.483 1.00 47.90 ? 185 THR C N    1 
ATOM   4194 C CA   . THR C 1 185 ? 68.041  53.318  36.767 1.00 51.16 ? 185 THR C CA   1 
ATOM   4195 C C    . THR C 1 185 ? 68.394  54.233  37.941 1.00 53.05 ? 185 THR C C    1 
ATOM   4196 O O    . THR C 1 185 ? 69.540  54.267  38.398 1.00 56.56 ? 185 THR C O    1 
ATOM   4197 C CB   . THR C 1 185 ? 68.648  51.920  36.986 1.00 50.67 ? 185 THR C CB   1 
ATOM   4198 O OG1  . THR C 1 185 ? 70.069  51.987  36.823 1.00 53.56 ? 185 THR C OG1  1 
ATOM   4199 C CG2  . THR C 1 185 ? 68.075  50.930  35.982 1.00 50.00 ? 185 THR C CG2  1 
ATOM   4200 H H    . THR C 1 185 ? 69.125  53.388  34.957 1.00 0.00  ? 185 THR C H    1 
ATOM   4201 H HG1  . THR C 1 185 ? 70.402  52.620  37.475 1.00 0.00  ? 185 THR C HG1  1 
ATOM   4202 N N    . GLU C 1 191 ? 73.884  46.635  40.358 1.00 40.71 ? 191 GLU C N    1 
ATOM   4203 C CA   . GLU C 1 191 ? 75.204  47.027  39.878 1.00 44.49 ? 191 GLU C CA   1 
ATOM   4204 C C    . GLU C 1 191 ? 75.342  46.647  38.412 1.00 49.83 ? 191 GLU C C    1 
ATOM   4205 O O    . GLU C 1 191 ? 75.533  47.501  37.552 1.00 56.96 ? 191 GLU C O    1 
ATOM   4206 C CB   . GLU C 1 191 ? 76.283  46.348  40.698 1.00 40.18 ? 191 GLU C CB   1 
ATOM   4207 H H    . GLU C 1 191 ? 73.698  45.726  40.654 1.00 0.00  ? 191 GLU C H    1 
ATOM   4208 N N    . GLU C 1 192 ? 75.216  45.357  38.134 1.00 50.66 ? 192 GLU C N    1 
ATOM   4209 C CA   . GLU C 1 192 ? 75.313  44.857  36.771 1.00 50.30 ? 192 GLU C CA   1 
ATOM   4210 C C    . GLU C 1 192 ? 73.921  44.929  36.148 1.00 50.90 ? 192 GLU C C    1 
ATOM   4211 O O    . GLU C 1 192 ? 73.713  44.506  35.009 1.00 50.39 ? 192 GLU C O    1 
ATOM   4212 C CB   . GLU C 1 192 ? 75.777  43.392  36.776 1.00 55.31 ? 192 GLU C CB   1 
ATOM   4213 C CG   . GLU C 1 192 ? 76.981  43.073  37.671 1.00 59.85 ? 192 GLU C CG   1 
ATOM   4214 C CD   . GLU C 1 192 ? 76.612  42.792  39.127 1.00 60.80 ? 192 GLU C CD   1 
ATOM   4215 O OE1  . GLU C 1 192 ? 75.436  42.478  39.417 1.00 62.46 ? 192 GLU C OE1  1 
ATOM   4216 O OE2  . GLU C 1 192 ? 77.515  42.871  39.985 1.00 64.66 ? 192 GLU C OE2  1 
ATOM   4217 H H    . GLU C 1 192 ? 75.027  44.740  38.865 1.00 0.00  ? 192 GLU C H    1 
ATOM   4218 N N    . GLU C 1 193 ? 72.972  45.458  36.917 1.00 49.00 ? 193 GLU C N    1 
ATOM   4219 C CA   . GLU C 1 193 ? 71.581  45.552  36.497 1.00 48.05 ? 193 GLU C CA   1 
ATOM   4220 C C    . GLU C 1 193 ? 71.097  46.982  36.282 1.00 44.11 ? 193 GLU C C    1 
ATOM   4221 O O    . GLU C 1 193 ? 69.924  47.210  35.980 1.00 48.10 ? 193 GLU C O    1 
ATOM   4222 C CB   . GLU C 1 193 ? 70.715  44.854  37.546 1.00 54.81 ? 193 GLU C CB   1 
ATOM   4223 C CG   . GLU C 1 193 ? 71.093  43.383  37.742 1.00 65.46 ? 193 GLU C CG   1 
ATOM   4224 C CD   . GLU C 1 193 ? 70.909  42.893  39.172 1.00 68.39 ? 193 GLU C CD   1 
ATOM   4225 O OE1  . GLU C 1 193 ? 71.877  43.002  39.963 1.00 67.26 ? 193 GLU C OE1  1 
ATOM   4226 O OE2  . GLU C 1 193 ? 69.810  42.383  39.496 1.00 68.76 ? 193 GLU C OE2  1 
ATOM   4227 H H    . GLU C 1 193 ? 73.190  45.821  37.791 1.00 0.00  ? 193 GLU C H    1 
ATOM   4228 N N    . ALA C 1 194 ? 72.008  47.939  36.410 1.00 36.30 ? 194 ALA C N    1 
ATOM   4229 C CA   . ALA C 1 194 ? 71.665  49.343  36.256 1.00 30.08 ? 194 ALA C CA   1 
ATOM   4230 C C    . ALA C 1 194 ? 71.891  49.839  34.842 1.00 29.31 ? 194 ALA C C    1 
ATOM   4231 O O    . ALA C 1 194 ? 72.478  49.148  34.017 1.00 35.36 ? 194 ALA C O    1 
ATOM   4232 C CB   . ALA C 1 194 ? 72.482  50.181  37.239 1.00 27.17 ? 194 ALA C CB   1 
ATOM   4233 H H    . ALA C 1 194 ? 72.943  47.702  36.567 1.00 0.00  ? 194 ALA C H    1 
ATOM   4234 N N    . VAL C 1 195 ? 71.405  51.042  34.568 1.00 23.49 ? 195 VAL C N    1 
ATOM   4235 C CA   . VAL C 1 195 ? 71.569  51.691  33.275 1.00 19.77 ? 195 VAL C CA   1 
ATOM   4236 C C    . VAL C 1 195 ? 71.961  53.123  33.623 1.00 25.10 ? 195 VAL C C    1 
ATOM   4237 O O    . VAL C 1 195 ? 71.259  53.801  34.386 1.00 26.44 ? 195 VAL C O    1 
ATOM   4238 C CB   . VAL C 1 195 ? 70.242  51.714  32.454 1.00 20.56 ? 195 VAL C CB   1 
ATOM   4239 C CG1  . VAL C 1 195 ? 70.397  52.578  31.206 1.00 10.91 ? 195 VAL C CG1  1 
ATOM   4240 C CG2  . VAL C 1 195 ? 69.828  50.304  32.066 1.00 16.92 ? 195 VAL C CG2  1 
ATOM   4241 H H    . VAL C 1 195 ? 70.910  51.526  35.257 1.00 0.00  ? 195 VAL C H    1 
ATOM   4242 N N    . THR C 1 196 ? 73.099  53.569  33.109 1.00 26.96 ? 196 THR C N    1 
ATOM   4243 C CA   . THR C 1 196 ? 73.566  54.920  33.374 1.00 31.02 ? 196 THR C CA   1 
ATOM   4244 C C    . THR C 1 196 ? 73.991  55.579  32.074 1.00 27.57 ? 196 THR C C    1 
ATOM   4245 O O    . THR C 1 196 ? 74.529  54.913  31.191 1.00 32.77 ? 196 THR C O    1 
ATOM   4246 C CB   . THR C 1 196 ? 74.730  54.921  34.372 1.00 33.01 ? 196 THR C CB   1 
ATOM   4247 O OG1  . THR C 1 196 ? 75.839  54.202  33.817 1.00 43.33 ? 196 THR C OG1  1 
ATOM   4248 C CG2  . THR C 1 196 ? 74.304  54.254  35.676 1.00 33.98 ? 196 THR C CG2  1 
ATOM   4249 H H    . THR C 1 196 ? 73.640  52.987  32.529 1.00 0.00  ? 196 THR C H    1 
ATOM   4250 H HG1  . THR C 1 196 ? 76.120  54.573  32.976 1.00 0.00  ? 196 THR C HG1  1 
ATOM   4251 N N    . ILE C 1 197 ? 73.758  56.884  31.967 1.00 29.05 ? 197 ILE C N    1 
ATOM   4252 C CA   . ILE C 1 197 ? 74.084  57.637  30.760 1.00 30.84 ? 197 ILE C CA   1 
ATOM   4253 C C    . ILE C 1 197 ? 74.942  58.867  31.043 1.00 33.11 ? 197 ILE C C    1 
ATOM   4254 O O    . ILE C 1 197 ? 74.657  59.626  31.973 1.00 34.73 ? 197 ILE C O    1 
ATOM   4255 C CB   . ILE C 1 197 ? 72.796  58.137  30.071 1.00 26.83 ? 197 ILE C CB   1 
ATOM   4256 C CG1  . ILE C 1 197 ? 71.828  56.973  29.854 1.00 25.59 ? 197 ILE C CG1  1 
ATOM   4257 C CG2  . ILE C 1 197 ? 73.127  58.833  28.764 1.00 25.36 ? 197 ILE C CG2  1 
ATOM   4258 C CD1  . ILE C 1 197 ? 70.462  57.393  29.402 1.00 27.79 ? 197 ILE C CD1  1 
ATOM   4259 H H    . ILE C 1 197 ? 73.366  57.401  32.702 1.00 0.00  ? 197 ILE C H    1 
ATOM   4260 N N    . GLU C 1 198 ? 76.008  59.028  30.260 1.00 33.38 ? 198 GLU C N    1 
ATOM   4261 C CA   . GLU C 1 198 ? 76.903  60.184  30.352 1.00 32.63 ? 198 GLU C CA   1 
ATOM   4262 C C    . GLU C 1 198 ? 76.671  60.892  29.022 1.00 34.19 ? 198 GLU C C    1 
ATOM   4263 O O    . GLU C 1 198 ? 77.262  60.545  27.998 1.00 35.51 ? 198 GLU C O    1 
ATOM   4264 C CB   . GLU C 1 198 ? 78.345  59.741  30.481 1.00 30.21 ? 198 GLU C CB   1 
ATOM   4265 H H    . GLU C 1 198 ? 76.217  58.332  29.603 1.00 0.00  ? 198 GLU C H    1 
ATOM   4266 N N    . MET C 1 199 ? 75.764  61.857  29.039 1.00 41.57 ? 199 MET C N    1 
ATOM   4267 C CA   . MET C 1 199 ? 75.372  62.577  27.835 1.00 42.93 ? 199 MET C CA   1 
ATOM   4268 C C    . MET C 1 199 ? 75.764  64.061  27.839 1.00 39.98 ? 199 MET C C    1 
ATOM   4269 O O    . MET C 1 199 ? 75.281  64.834  28.662 1.00 42.17 ? 199 MET C O    1 
ATOM   4270 C CB   . MET C 1 199 ? 73.853  62.395  27.662 1.00 42.78 ? 199 MET C CB   1 
ATOM   4271 C CG   . MET C 1 199 ? 73.260  62.862  26.363 1.00 46.58 ? 199 MET C CG   1 
ATOM   4272 S SD   . MET C 1 199 ? 72.939  64.608  26.385 1.00 56.46 ? 199 MET C SD   1 
ATOM   4273 C CE   . MET C 1 199 ? 71.611  64.669  27.539 1.00 49.08 ? 199 MET C CE   1 
ATOM   4274 H H    . MET C 1 199 ? 75.361  62.110  29.895 1.00 0.00  ? 199 MET C H    1 
ATOM   4275 N N    . ASN C 1 200 ? 76.688  64.425  26.952 1.00 35.59 ? 200 ASN C N    1 
ATOM   4276 C CA   . ASN C 1 200 ? 77.154  65.804  26.802 1.00 29.27 ? 200 ASN C CA   1 
ATOM   4277 C C    . ASN C 1 200 ? 76.179  66.523  25.886 1.00 30.62 ? 200 ASN C C    1 
ATOM   4278 O O    . ASN C 1 200 ? 75.909  67.714  26.040 1.00 29.59 ? 200 ASN C O    1 
ATOM   4279 C CB   . ASN C 1 200 ? 78.539  65.857  26.146 1.00 25.89 ? 200 ASN C CB   1 
ATOM   4280 C CG   . ASN C 1 200 ? 79.621  65.223  26.994 1.00 27.74 ? 200 ASN C CG   1 
ATOM   4281 O OD1  . ASN C 1 200 ? 79.433  64.973  28.182 1.00 33.13 ? 200 ASN C OD1  1 
ATOM   4282 N ND2  . ASN C 1 200 ? 80.767  64.963  26.384 1.00 24.93 ? 200 ASN C ND2  1 
ATOM   4283 H H    . ASN C 1 200 ? 77.085  63.720  26.413 1.00 0.00  ? 200 ASN C H    1 
ATOM   4284 H HD21 . ASN C 1 200 ? 81.455  64.544  26.940 1.00 0.00  ? 200 ASN C HD21 1 
ATOM   4285 H HD22 . ASN C 1 200 ? 80.875  65.188  25.442 1.00 0.00  ? 200 ASN C HD22 1 
ATOM   4286 N N    . GLU C 1 201 ? 75.704  65.799  24.882 1.00 35.83 ? 201 GLU C N    1 
ATOM   4287 C CA   . GLU C 1 201 ? 74.766  66.340  23.911 1.00 39.85 ? 201 GLU C CA   1 
ATOM   4288 C C    . GLU C 1 201 ? 73.897  65.187  23.475 1.00 36.58 ? 201 GLU C C    1 
ATOM   4289 O O    . GLU C 1 201 ? 74.348  64.044  23.461 1.00 36.12 ? 201 GLU C O    1 
ATOM   4290 C CB   . GLU C 1 201 ? 75.491  66.853  22.658 1.00 44.74 ? 201 GLU C CB   1 
ATOM   4291 C CG   . GLU C 1 201 ? 76.563  67.911  22.872 1.00 52.91 ? 201 GLU C CG   1 
ATOM   4292 C CD   . GLU C 1 201 ? 77.095  68.484  21.562 1.00 56.77 ? 201 GLU C CD   1 
ATOM   4293 O OE1  . GLU C 1 201 ? 76.624  68.067  20.477 1.00 61.26 ? 201 GLU C OE1  1 
ATOM   4294 O OE2  . GLU C 1 201 ? 77.981  69.364  21.619 1.00 59.18 ? 201 GLU C OE2  1 
ATOM   4295 H H    . GLU C 1 201 ? 75.962  64.857  24.779 1.00 0.00  ? 201 GLU C H    1 
ATOM   4296 N N    . PRO C 1 202 ? 72.619  65.459  23.178 1.00 38.22 ? 202 PRO C N    1 
ATOM   4297 C CA   . PRO C 1 202 ? 71.735  64.379  22.735 1.00 35.32 ? 202 PRO C CA   1 
ATOM   4298 C C    . PRO C 1 202 ? 72.250  63.871  21.384 1.00 32.94 ? 202 PRO C C    1 
ATOM   4299 O O    . PRO C 1 202 ? 72.887  64.620  20.639 1.00 30.39 ? 202 PRO C O    1 
ATOM   4300 C CB   . PRO C 1 202 ? 70.390  65.087  22.582 1.00 30.71 ? 202 PRO C CB   1 
ATOM   4301 C CG   . PRO C 1 202 ? 70.460  66.165  23.619 1.00 37.22 ? 202 PRO C CG   1 
ATOM   4302 C CD   . PRO C 1 202 ? 71.857  66.696  23.424 1.00 38.16 ? 202 PRO C CD   1 
ATOM   4303 N N    . VAL C 1 203 ? 72.021  62.596  21.090 1.00 30.83 ? 203 VAL C N    1 
ATOM   4304 C CA   . VAL C 1 203 ? 72.455  62.021  19.822 1.00 29.10 ? 203 VAL C CA   1 
ATOM   4305 C C    . VAL C 1 203 ? 71.382  61.057  19.338 1.00 28.02 ? 203 VAL C C    1 
ATOM   4306 O O    . VAL C 1 203 ? 70.697  60.434  20.143 1.00 31.80 ? 203 VAL C O    1 
ATOM   4307 C CB   . VAL C 1 203 ? 73.764  61.213  19.961 1.00 27.97 ? 203 VAL C CB   1 
ATOM   4308 C CG1  . VAL C 1 203 ? 74.412  61.045  18.601 1.00 31.26 ? 203 VAL C CG1  1 
ATOM   4309 C CG2  . VAL C 1 203 ? 74.719  61.876  20.931 1.00 33.64 ? 203 VAL C CG2  1 
ATOM   4310 H H    . VAL C 1 203 ? 71.541  62.032  21.736 1.00 0.00  ? 203 VAL C H    1 
ATOM   4311 N N    . GLN C 1 204 ? 71.225  60.950  18.027 1.00 26.17 ? 204 GLN C N    1 
ATOM   4312 C CA   . GLN C 1 204 ? 70.253  60.035  17.447 1.00 30.75 ? 204 GLN C CA   1 
ATOM   4313 C C    . GLN C 1 204 ? 70.912  59.454  16.209 1.00 31.22 ? 204 GLN C C    1 
ATOM   4314 O O    . GLN C 1 204 ? 71.205  60.190  15.271 1.00 41.50 ? 204 GLN C O    1 
ATOM   4315 C CB   . GLN C 1 204 ? 68.971  60.775  17.068 1.00 33.03 ? 204 GLN C CB   1 
ATOM   4316 C CG   . GLN C 1 204 ? 67.870  59.864  16.554 1.00 38.51 ? 204 GLN C CG   1 
ATOM   4317 C CD   . GLN C 1 204 ? 66.640  60.625  16.104 1.00 43.92 ? 204 GLN C CD   1 
ATOM   4318 O OE1  . GLN C 1 204 ? 65.926  61.209  16.915 1.00 48.96 ? 204 GLN C OE1  1 
ATOM   4319 N NE2  . GLN C 1 204 ? 66.384  60.620  14.805 1.00 46.63 ? 204 GLN C NE2  1 
ATOM   4320 H H    . GLN C 1 204 ? 71.776  61.480  17.414 1.00 0.00  ? 204 GLN C H    1 
ATOM   4321 H HE21 . GLN C 1 204 ? 65.599  61.119  14.513 1.00 0.00  ? 204 GLN C HE21 1 
ATOM   4322 H HE22 . GLN C 1 204 ? 66.964  60.132  14.182 1.00 0.00  ? 204 GLN C HE22 1 
ATOM   4323 N N    . LEU C 1 205 ? 71.191  58.152  16.221 1.00 33.76 ? 205 LEU C N    1 
ATOM   4324 C CA   . LEU C 1 205 ? 71.848  57.498  15.090 1.00 26.98 ? 205 LEU C CA   1 
ATOM   4325 C C    . LEU C 1 205 ? 71.098  56.288  14.556 1.00 23.81 ? 205 LEU C C    1 
ATOM   4326 O O    . LEU C 1 205 ? 70.312  55.670  15.271 1.00 21.94 ? 205 LEU C O    1 
ATOM   4327 C CB   . LEU C 1 205 ? 73.263  57.090  15.479 1.00 28.79 ? 205 LEU C CB   1 
ATOM   4328 C CG   . LEU C 1 205 ? 74.287  58.222  15.584 1.00 35.75 ? 205 LEU C CG   1 
ATOM   4329 C CD1  . LEU C 1 205 ? 75.307  57.904  16.667 1.00 38.89 ? 205 LEU C CD1  1 
ATOM   4330 C CD2  . LEU C 1 205 ? 74.968  58.447  14.234 1.00 33.56 ? 205 LEU C CD2  1 
ATOM   4331 H H    . LEU C 1 205 ? 70.937  57.603  16.992 1.00 0.00  ? 205 LEU C H    1 
ATOM   4332 N N    . THR C 1 206 ? 71.357  55.959  13.294 1.00 24.27 ? 206 THR C N    1 
ATOM   4333 C CA   . THR C 1 206 ? 70.730  54.823  12.620 1.00 21.34 ? 206 THR C CA   1 
ATOM   4334 C C    . THR C 1 206 ? 71.784  53.746  12.320 1.00 21.50 ? 206 THR C C    1 
ATOM   4335 O O    . THR C 1 206 ? 72.774  54.006  11.627 1.00 26.23 ? 206 THR C O    1 
ATOM   4336 C CB   . THR C 1 206 ? 70.076  55.271  11.293 1.00 19.54 ? 206 THR C CB   1 
ATOM   4337 O OG1  . THR C 1 206 ? 69.351  56.496  11.493 1.00 22.13 ? 206 THR C OG1  1 
ATOM   4338 C CG2  . THR C 1 206 ? 69.126  54.201  10.791 1.00 21.50 ? 206 THR C CG2  1 
ATOM   4339 H H    . THR C 1 206 ? 71.994  56.492  12.769 1.00 0.00  ? 206 THR C H    1 
ATOM   4340 H HG1  . THR C 1 206 ? 69.984  57.218  11.512 1.00 0.00  ? 206 THR C HG1  1 
ATOM   4341 N N    . PHE C 1 207 ? 71.576  52.540  12.833 1.00 19.40 ? 207 PHE C N    1 
ATOM   4342 C CA   . PHE C 1 207 ? 72.533  51.462  12.621 1.00 22.40 ? 207 PHE C CA   1 
ATOM   4343 C C    . PHE C 1 207 ? 71.894  50.163  12.128 1.00 25.85 ? 207 PHE C C    1 
ATOM   4344 O O    . PHE C 1 207 ? 70.743  49.868  12.445 1.00 30.43 ? 207 PHE C O    1 
ATOM   4345 C CB   . PHE C 1 207 ? 73.308  51.192  13.911 1.00 16.87 ? 207 PHE C CB   1 
ATOM   4346 C CG   . PHE C 1 207 ? 74.058  52.378  14.433 1.00 16.63 ? 207 PHE C CG   1 
ATOM   4347 C CD1  . PHE C 1 207 ? 75.027  53.003  13.661 1.00 20.36 ? 207 PHE C CD1  1 
ATOM   4348 C CD2  . PHE C 1 207 ? 73.820  52.854  15.718 1.00 23.98 ? 207 PHE C CD2  1 
ATOM   4349 C CE1  . PHE C 1 207 ? 75.756  54.081  14.161 1.00 20.48 ? 207 PHE C CE1  1 
ATOM   4350 C CE2  . PHE C 1 207 ? 74.545  53.937  16.230 1.00 23.99 ? 207 PHE C CE2  1 
ATOM   4351 C CZ   . PHE C 1 207 ? 75.513  54.548  15.449 1.00 19.80 ? 207 PHE C CZ   1 
ATOM   4352 H H    . PHE C 1 207 ? 70.777  52.364  13.359 1.00 0.00  ? 207 PHE C H    1 
ATOM   4353 N N    . ALA C 1 208 ? 72.655  49.392  11.353 1.00 24.14 ? 208 ALA C N    1 
ATOM   4354 C CA   . ALA C 1 208 ? 72.203  48.114  10.809 1.00 15.22 ? 208 ALA C CA   1 
ATOM   4355 C C    . ALA C 1 208 ? 72.206  47.032  11.884 1.00 10.55 ? 208 ALA C C    1 
ATOM   4356 O O    . ALA C 1 208 ? 73.261  46.640  12.390 1.00 16.96 ? 208 ALA C O    1 
ATOM   4357 C CB   . ALA C 1 208 ? 73.098  47.702  9.658  1.00 10.96 ? 208 ALA C CB   1 
ATOM   4358 H H    . ALA C 1 208 ? 73.566  49.705  11.141 1.00 0.00  ? 208 ALA C H    1 
ATOM   4359 N N    . LEU C 1 209 ? 71.028  46.512  12.198 1.00 9.31  ? 209 LEU C N    1 
ATOM   4360 C CA   . LEU C 1 209 ? 70.887  45.483  13.222 1.00 10.62 ? 209 LEU C CA   1 
ATOM   4361 C C    . LEU C 1 209 ? 71.666  44.204  12.953 1.00 11.01 ? 209 LEU C C    1 
ATOM   4362 O O    . LEU C 1 209 ? 72.003  43.477  13.878 1.00 17.17 ? 209 LEU C O    1 
ATOM   4363 C CB   . LEU C 1 209 ? 69.411  45.163  13.438 1.00 9.78  ? 209 LEU C CB   1 
ATOM   4364 C CG   . LEU C 1 209 ? 68.654  46.224  14.238 1.00 14.30 ? 209 LEU C CG   1 
ATOM   4365 C CD1  . LEU C 1 209 ? 67.172  46.231  13.872 1.00 15.60 ? 209 LEU C CD1  1 
ATOM   4366 C CD2  . LEU C 1 209 ? 68.864  45.977  15.728 1.00 6.80  ? 209 LEU C CD2  1 
ATOM   4367 H H    . LEU C 1 209 ? 70.229  46.823  11.725 1.00 0.00  ? 209 LEU C H    1 
ATOM   4368 N N    . ARG C 1 210 ? 71.970  43.944  11.689 1.00 16.99 ? 210 ARG C N    1 
ATOM   4369 C CA   . ARG C 1 210 ? 72.706  42.749  11.299 1.00 16.02 ? 210 ARG C CA   1 
ATOM   4370 C C    . ARG C 1 210 ? 74.067  42.709  11.957 1.00 14.19 ? 210 ARG C C    1 
ATOM   4371 O O    . ARG C 1 210 ? 74.461  41.691  12.512 1.00 16.78 ? 210 ARG C O    1 
ATOM   4372 C CB   . ARG C 1 210 ? 72.875  42.696  9.778  1.00 21.35 ? 210 ARG C CB   1 
ATOM   4373 H H    . ARG C 1 210 ? 71.663  44.567  10.993 1.00 0.00  ? 210 ARG C H    1 
ATOM   4374 H HG2  . ARG C 1 210 ? 73.290  41.324  8.422  1.00 0.00  ? 210 ARG C HG2  1 
ATOM   4375 N N    . TYR C 1 211 ? 74.773  43.831  11.920 1.00 16.20 ? 211 TYR C N    1 
ATOM   4376 C CA   . TYR C 1 211 ? 76.098  43.904  12.510 1.00 15.15 ? 211 TYR C CA   1 
ATOM   4377 C C    . TYR C 1 211 ? 76.033  43.863  14.029 1.00 20.59 ? 211 TYR C C    1 
ATOM   4378 O O    . TYR C 1 211 ? 76.831  43.173  14.665 1.00 29.03 ? 211 TYR C O    1 
ATOM   4379 C CB   . TYR C 1 211 ? 76.812  45.161  12.041 1.00 15.91 ? 211 TYR C CB   1 
ATOM   4380 C CG   . TYR C 1 211 ? 77.161  45.140  10.569 1.00 17.69 ? 211 TYR C CG   1 
ATOM   4381 C CD1  . TYR C 1 211 ? 76.196  45.399  9.595  1.00 15.29 ? 211 TYR C CD1  1 
ATOM   4382 C CD2  . TYR C 1 211 ? 78.456  44.864  10.151 1.00 15.57 ? 211 TYR C CD2  1 
ATOM   4383 C CE1  . TYR C 1 211 ? 76.512  45.385  8.255  1.00 13.67 ? 211 TYR C CE1  1 
ATOM   4384 C CE2  . TYR C 1 211 ? 78.783  44.847  8.809  1.00 17.67 ? 211 TYR C CE2  1 
ATOM   4385 C CZ   . TYR C 1 211 ? 77.809  45.107  7.871  1.00 19.79 ? 211 TYR C CZ   1 
ATOM   4386 O OH   . TYR C 1 211 ? 78.147  45.075  6.544  1.00 30.78 ? 211 TYR C OH   1 
ATOM   4387 H H    . TYR C 1 211 ? 74.380  44.625  11.500 1.00 0.00  ? 211 TYR C H    1 
ATOM   4388 H HH   . TYR C 1 211 ? 77.390  45.251  5.969  1.00 0.00  ? 211 TYR C HH   1 
ATOM   4389 N N    . LEU C 1 212 ? 75.070  44.574  14.613 1.00 16.19 ? 212 LEU C N    1 
ATOM   4390 C CA   . LEU C 1 212 ? 74.919  44.596  16.068 1.00 8.18  ? 212 LEU C CA   1 
ATOM   4391 C C    . LEU C 1 212 ? 74.707  43.187  16.638 1.00 10.29 ? 212 LEU C C    1 
ATOM   4392 O O    . LEU C 1 212 ? 75.308  42.832  17.653 1.00 12.08 ? 212 LEU C O    1 
ATOM   4393 C CB   . LEU C 1 212 ? 73.788  45.551  16.480 1.00 7.29  ? 212 LEU C CB   1 
ATOM   4394 C CG   . LEU C 1 212 ? 74.115  47.051  16.394 1.00 3.14  ? 212 LEU C CG   1 
ATOM   4395 C CD1  . LEU C 1 212 ? 72.873  47.899  16.583 1.00 10.55 ? 212 LEU C CD1  1 
ATOM   4396 C CD2  . LEU C 1 212 ? 75.125  47.422  17.438 1.00 2.22  ? 212 LEU C CD2  1 
ATOM   4397 H H    . LEU C 1 212 ? 74.468  45.102  14.051 1.00 0.00  ? 212 LEU C H    1 
ATOM   4398 N N    . ASN C 1 213 ? 73.910  42.365  15.954 1.00 9.21  ? 213 ASN C N    1 
ATOM   4399 C CA   . ASN C 1 213 ? 73.660  40.986  16.393 1.00 6.97  ? 213 ASN C CA   1 
ATOM   4400 C C    . ASN C 1 213 ? 74.902  40.096  16.269 1.00 9.67  ? 213 ASN C C    1 
ATOM   4401 O O    . ASN C 1 213 ? 74.838  38.894  16.514 1.00 9.91  ? 213 ASN C O    1 
ATOM   4402 C CB   . ASN C 1 213 ? 72.494  40.358  15.624 1.00 9.78  ? 213 ASN C CB   1 
ATOM   4403 C CG   . ASN C 1 213 ? 71.157  40.971  15.985 1.00 8.79  ? 213 ASN C CG   1 
ATOM   4404 O OD1  . ASN C 1 213 ? 70.725  40.905  17.125 1.00 17.36 ? 213 ASN C OD1  1 
ATOM   4405 N ND2  . ASN C 1 213 ? 70.491  41.557  15.008 1.00 13.50 ? 213 ASN C ND2  1 
ATOM   4406 H H    . ASN C 1 213 ? 73.482  42.699  15.136 1.00 0.00  ? 213 ASN C H    1 
ATOM   4407 H HD21 . ASN C 1 213 ? 69.666  42.018  15.267 1.00 0.00  ? 213 ASN C HD21 1 
ATOM   4408 H HD22 . ASN C 1 213 ? 70.848  41.553  14.095 1.00 0.00  ? 213 ASN C HD22 1 
ATOM   4409 N N    . PHE C 1 214 ? 76.001  40.674  15.790 1.00 12.45 ? 214 PHE C N    1 
ATOM   4410 C CA   . PHE C 1 214 ? 77.277  39.971  15.686 1.00 11.05 ? 214 PHE C CA   1 
ATOM   4411 C C    . PHE C 1 214 ? 78.072  40.372  16.920 1.00 11.90 ? 214 PHE C C    1 
ATOM   4412 O O    . PHE C 1 214 ? 78.687  39.535  17.580 1.00 13.73 ? 214 PHE C O    1 
ATOM   4413 C CB   . PHE C 1 214 ? 78.042  40.394  14.438 1.00 13.93 ? 214 PHE C CB   1 
ATOM   4414 C CG   . PHE C 1 214 ? 77.779  39.529  13.262 1.00 17.06 ? 214 PHE C CG   1 
ATOM   4415 C CD1  . PHE C 1 214 ? 77.793  38.145  13.391 1.00 19.72 ? 214 PHE C CD1  1 
ATOM   4416 C CD2  . PHE C 1 214 ? 77.510  40.088  12.025 1.00 21.19 ? 214 PHE C CD2  1 
ATOM   4417 C CE1  . PHE C 1 214 ? 77.539  37.326  12.304 1.00 20.83 ? 214 PHE C CE1  1 
ATOM   4418 C CE2  . PHE C 1 214 ? 77.255  39.279  10.928 1.00 19.47 ? 214 PHE C CE2  1 
ATOM   4419 C CZ   . PHE C 1 214 ? 77.269  37.893  11.070 1.00 21.76 ? 214 PHE C CZ   1 
ATOM   4420 H H    . PHE C 1 214 ? 75.964  41.592  15.472 1.00 0.00  ? 214 PHE C H    1 
ATOM   4421 N N    . PHE C 1 215 ? 78.024  41.665  17.235 1.00 10.58 ? 215 PHE C N    1 
ATOM   4422 C CA   . PHE C 1 215 ? 78.705  42.215  18.402 1.00 4.42  ? 215 PHE C CA   1 
ATOM   4423 C C    . PHE C 1 215 ? 78.206  41.467  19.634 1.00 3.82  ? 215 PHE C C    1 
ATOM   4424 O O    . PHE C 1 215 ? 78.986  40.931  20.406 1.00 2.53  ? 215 PHE C O    1 
ATOM   4425 C CB   . PHE C 1 215 ? 78.377  43.704  18.548 1.00 6.44  ? 215 PHE C CB   1 
ATOM   4426 C CG   . PHE C 1 215 ? 78.830  44.565  17.382 1.00 6.15  ? 215 PHE C CG   1 
ATOM   4427 C CD1  . PHE C 1 215 ? 79.526  44.017  16.297 1.00 12.12 ? 215 PHE C CD1  1 
ATOM   4428 C CD2  . PHE C 1 215 ? 78.560  45.934  17.378 1.00 2.90  ? 215 PHE C CD2  1 
ATOM   4429 C CE1  . PHE C 1 215 ? 79.946  44.821  15.228 1.00 10.00 ? 215 PHE C CE1  1 
ATOM   4430 C CE2  . PHE C 1 215 ? 78.975  46.743  16.318 1.00 4.03  ? 215 PHE C CE2  1 
ATOM   4431 C CZ   . PHE C 1 215 ? 79.669  46.184  15.244 1.00 3.88  ? 215 PHE C CZ   1 
ATOM   4432 H H    . PHE C 1 215 ? 77.501  42.262  16.654 1.00 0.00  ? 215 PHE C H    1 
ATOM   4433 N N    . THR C 1 216 ? 76.889  41.377  19.760 1.00 11.96 ? 216 THR C N    1 
ATOM   4434 C CA   . THR C 1 216 ? 76.244  40.699  20.877 1.00 14.21 ? 216 THR C CA   1 
ATOM   4435 C C    . THR C 1 216 ? 76.777  39.289  21.159 1.00 14.18 ? 216 THR C C    1 
ATOM   4436 O O    . THR C 1 216 ? 76.601  38.753  22.256 1.00 10.59 ? 216 THR C O    1 
ATOM   4437 C CB   . THR C 1 216 ? 74.726  40.660  20.675 1.00 15.30 ? 216 THR C CB   1 
ATOM   4438 O OG1  . THR C 1 216 ? 74.418  39.988  19.447 1.00 23.76 ? 216 THR C OG1  1 
ATOM   4439 C CG2  . THR C 1 216 ? 74.178  42.072  20.615 1.00 14.83 ? 216 THR C CG2  1 
ATOM   4440 H H    . THR C 1 216 ? 76.305  41.780  19.086 1.00 0.00  ? 216 THR C H    1 
ATOM   4441 H HG1  . THR C 1 216 ? 73.480  39.768  19.546 1.00 0.00  ? 216 THR C HG1  1 
ATOM   4442 N N    . LYS C 1 217 ? 77.470  38.697  20.198 1.00 14.47 ? 217 LYS C N    1 
ATOM   4443 C CA   . LYS C 1 217 ? 78.042  37.377  20.421 1.00 15.22 ? 217 LYS C CA   1 
ATOM   4444 C C    . LYS C 1 217 ? 79.172  37.442  21.461 1.00 17.36 ? 217 LYS C C    1 
ATOM   4445 O O    . LYS C 1 217 ? 79.817  36.431  21.747 1.00 25.09 ? 217 LYS C O    1 
ATOM   4446 C CB   . LYS C 1 217 ? 78.564  36.792  19.114 1.00 11.60 ? 217 LYS C CB   1 
ATOM   4447 C CG   . LYS C 1 217 ? 77.473  36.283  18.201 1.00 14.92 ? 217 LYS C CG   1 
ATOM   4448 C CD   . LYS C 1 217 ? 78.038  35.792  16.880 1.00 22.13 ? 217 LYS C CD   1 
ATOM   4449 C CE   . LYS C 1 217 ? 76.906  35.391  15.940 1.00 27.66 ? 217 LYS C CE   1 
ATOM   4450 N NZ   . LYS C 1 217 ? 77.363  35.171  14.539 1.00 28.68 ? 217 LYS C NZ   1 
ATOM   4451 H H    . LYS C 1 217 ? 77.623  39.144  19.340 1.00 0.00  ? 217 LYS C H    1 
ATOM   4452 H HZ1  . LYS C 1 217 ? 78.076  34.419  14.533 1.00 0.00  ? 217 LYS C HZ1  1 
ATOM   4453 H HZ2  . LYS C 1 217 ? 76.549  34.884  13.960 1.00 0.00  ? 217 LYS C HZ2  1 
ATOM   4454 H HZ3  . LYS C 1 217 ? 77.774  36.054  14.189 1.00 0.00  ? 217 LYS C HZ3  1 
ATOM   4455 N N    . ALA C 1 218 ? 79.409  38.630  22.018 1.00 15.66 ? 218 ALA C N    1 
ATOM   4456 C CA   . ALA C 1 218 ? 80.443  38.840  23.027 1.00 7.00  ? 218 ALA C CA   1 
ATOM   4457 C C    . ALA C 1 218 ? 79.845  38.982  24.410 1.00 10.38 ? 218 ALA C C    1 
ATOM   4458 O O    . ALA C 1 218 ? 80.576  39.141  25.378 1.00 14.77 ? 218 ALA C O    1 
ATOM   4459 C CB   . ALA C 1 218 ? 81.258  40.081  22.697 1.00 4.91  ? 218 ALA C CB   1 
ATOM   4460 H H    . ALA C 1 218 ? 78.938  39.431  21.719 1.00 0.00  ? 218 ALA C H    1 
ATOM   4461 N N    . THR C 1 219 ? 78.523  38.896  24.511 1.00 16.22 ? 219 THR C N    1 
ATOM   4462 C CA   . THR C 1 219 ? 77.839  39.031  25.801 1.00 15.83 ? 219 THR C CA   1 
ATOM   4463 C C    . THR C 1 219 ? 78.495  38.261  26.960 1.00 15.05 ? 219 THR C C    1 
ATOM   4464 O O    . THR C 1 219 ? 78.699  38.838  28.028 1.00 17.27 ? 219 THR C O    1 
ATOM   4465 C CB   . THR C 1 219 ? 76.337  38.641  25.701 1.00 15.81 ? 219 THR C CB   1 
ATOM   4466 O OG1  . THR C 1 219 ? 75.731  39.304  24.582 1.00 9.99  ? 219 THR C OG1  1 
ATOM   4467 C CG2  . THR C 1 219 ? 75.596  39.053  26.963 1.00 14.08 ? 219 THR C CG2  1 
ATOM   4468 H H    . THR C 1 219 ? 77.976  38.733  23.707 1.00 0.00  ? 219 THR C H    1 
ATOM   4469 H HG1  . THR C 1 219 ? 75.848  40.260  24.671 1.00 0.00  ? 219 THR C HG1  1 
ATOM   4470 N N    . PRO C 1 220 ? 78.891  36.981  26.748 1.00 12.98 ? 220 PRO C N    1 
ATOM   4471 C CA   . PRO C 1 220 ? 79.526  36.191  27.814 1.00 9.49  ? 220 PRO C CA   1 
ATOM   4472 C C    . PRO C 1 220 ? 80.845  36.738  28.372 1.00 12.69 ? 220 PRO C C    1 
ATOM   4473 O O    . PRO C 1 220 ? 81.400  36.179  29.313 1.00 20.15 ? 220 PRO C O    1 
ATOM   4474 C CB   . PRO C 1 220 ? 79.724  34.824  27.153 1.00 11.43 ? 220 PRO C CB   1 
ATOM   4475 C CG   . PRO C 1 220 ? 79.876  35.149  25.723 1.00 12.07 ? 220 PRO C CG   1 
ATOM   4476 C CD   . PRO C 1 220 ? 78.783  36.167  25.523 1.00 12.43 ? 220 PRO C CD   1 
ATOM   4477 N N    . LEU C 1 221 ? 81.355  37.815  27.791 1.00 16.49 ? 221 LEU C N    1 
ATOM   4478 C CA   . LEU C 1 221 ? 82.596  38.413  28.266 1.00 13.54 ? 221 LEU C CA   1 
ATOM   4479 C C    . LEU C 1 221 ? 82.358  39.420  29.377 1.00 13.06 ? 221 LEU C C    1 
ATOM   4480 O O    . LEU C 1 221 ? 83.281  39.744  30.129 1.00 19.03 ? 221 LEU C O    1 
ATOM   4481 C CB   . LEU C 1 221 ? 83.331  39.112  27.120 1.00 13.66 ? 221 LEU C CB   1 
ATOM   4482 C CG   . LEU C 1 221 ? 83.975  38.226  26.062 1.00 11.20 ? 221 LEU C CG   1 
ATOM   4483 C CD1  . LEU C 1 221 ? 84.568  39.105  24.996 1.00 11.70 ? 221 LEU C CD1  1 
ATOM   4484 C CD2  . LEU C 1 221 ? 85.056  37.354  26.700 1.00 11.27 ? 221 LEU C CD2  1 
ATOM   4485 H H    . LEU C 1 221 ? 80.911  38.214  27.020 1.00 0.00  ? 221 LEU C H    1 
ATOM   4486 N N    . SER C 1 222 ? 81.126  39.907  29.489 1.00 18.69 ? 222 SER C N    1 
ATOM   4487 C CA   . SER C 1 222 ? 80.797  40.912  30.498 1.00 19.88 ? 222 SER C CA   1 
ATOM   4488 C C    . SER C 1 222 ? 79.310  40.938  30.863 1.00 20.69 ? 222 SER C C    1 
ATOM   4489 O O    . SER C 1 222 ? 78.461  40.486  30.094 1.00 14.59 ? 222 SER C O    1 
ATOM   4490 C CB   . SER C 1 222 ? 81.219  42.294  29.983 1.00 20.10 ? 222 SER C CB   1 
ATOM   4491 O OG   . SER C 1 222 ? 80.969  43.312  30.935 1.00 27.20 ? 222 SER C OG   1 
ATOM   4492 H H    . SER C 1 222 ? 80.398  39.593  28.911 1.00 0.00  ? 222 SER C H    1 
ATOM   4493 H HG   . SER C 1 222 ? 81.590  43.147  31.651 1.00 0.00  ? 222 SER C HG   1 
ATOM   4494 N N    . SER C 1 223 ? 79.019  41.447  32.060 1.00 23.23 ? 223 SER C N    1 
ATOM   4495 C CA   . SER C 1 223 ? 77.650  41.573  32.552 1.00 26.72 ? 223 SER C CA   1 
ATOM   4496 C C    . SER C 1 223 ? 77.099  42.888  32.050 1.00 29.53 ? 223 SER C C    1 
ATOM   4497 O O    . SER C 1 223 ? 75.901  43.161  32.165 1.00 26.86 ? 223 SER C O    1 
ATOM   4498 C CB   . SER C 1 223 ? 77.613  41.607  34.079 1.00 28.34 ? 223 SER C CB   1 
ATOM   4499 O OG   . SER C 1 223 ? 77.960  40.356  34.640 1.00 40.46 ? 223 SER C OG   1 
ATOM   4500 H H    . SER C 1 223 ? 79.755  41.766  32.623 1.00 0.00  ? 223 SER C H    1 
ATOM   4501 H HG   . SER C 1 223 ? 78.906  40.208  34.563 1.00 0.00  ? 223 SER C HG   1 
ATOM   4502 N N    . THR C 1 224 ? 77.986  43.712  31.509 1.00 29.01 ? 224 THR C N    1 
ATOM   4503 C CA   . THR C 1 224 ? 77.599  45.013  31.016 1.00 27.99 ? 224 THR C CA   1 
ATOM   4504 C C    . THR C 1 224 ? 78.362  45.351  29.742 1.00 28.69 ? 224 THR C C    1 
ATOM   4505 O O    . THR C 1 224 ? 79.378  44.730  29.418 1.00 30.14 ? 224 THR C O    1 
ATOM   4506 C CB   . THR C 1 224 ? 77.868  46.096  32.082 1.00 31.52 ? 224 THR C CB   1 
ATOM   4507 O OG1  . THR C 1 224 ? 79.279  46.208  32.307 1.00 37.20 ? 224 THR C OG1  1 
ATOM   4508 C CG2  . THR C 1 224 ? 77.186  45.741  33.400 1.00 24.10 ? 224 THR C CG2  1 
ATOM   4509 H H    . THR C 1 224 ? 78.934  43.474  31.390 1.00 0.00  ? 224 THR C H    1 
ATOM   4510 H HG1  . THR C 1 224 ? 79.622  45.365  32.605 1.00 0.00  ? 224 THR C HG1  1 
ATOM   4511 N N    . VAL C 1 225 ? 77.853  46.343  29.027 1.00 24.86 ? 225 VAL C N    1 
ATOM   4512 C CA   . VAL C 1 225 ? 78.438  46.804  27.781 1.00 21.35 ? 225 VAL C CA   1 
ATOM   4513 C C    . VAL C 1 225 ? 78.234  48.319  27.766 1.00 24.38 ? 225 VAL C C    1 
ATOM   4514 O O    . VAL C 1 225 ? 77.335  48.821  28.448 1.00 31.11 ? 225 VAL C O    1 
ATOM   4515 C CB   . VAL C 1 225 ? 77.696  46.155  26.573 1.00 15.28 ? 225 VAL C CB   1 
ATOM   4516 C CG1  . VAL C 1 225 ? 76.213  46.479  26.622 1.00 15.91 ? 225 VAL C CG1  1 
ATOM   4517 C CG2  . VAL C 1 225 ? 78.275  46.629  25.270 1.00 17.03 ? 225 VAL C CG2  1 
ATOM   4518 H H    . VAL C 1 225 ? 77.055  46.817  29.337 1.00 0.00  ? 225 VAL C H    1 
ATOM   4519 N N    . THR C 1 226 ? 79.101  49.053  27.076 1.00 21.11 ? 226 THR C N    1 
ATOM   4520 C CA   . THR C 1 226 ? 78.933  50.498  26.981 1.00 25.99 ? 226 THR C CA   1 
ATOM   4521 C C    . THR C 1 226 ? 78.772  50.896  25.520 1.00 31.63 ? 226 THR C C    1 
ATOM   4522 O O    . THR C 1 226 ? 79.401  50.303  24.641 1.00 39.60 ? 226 THR C O    1 
ATOM   4523 C CB   . THR C 1 226 ? 80.123  51.276  27.584 1.00 26.11 ? 226 THR C CB   1 
ATOM   4524 O OG1  . THR C 1 226 ? 81.318  50.990  26.851 1.00 28.72 ? 226 THR C OG1  1 
ATOM   4525 C CG2  . THR C 1 226 ? 80.322  50.908  29.046 1.00 31.39 ? 226 THR C CG2  1 
ATOM   4526 H H    . THR C 1 226 ? 79.865  48.634  26.628 1.00 0.00  ? 226 THR C H    1 
ATOM   4527 H HG1  . THR C 1 226 ? 81.256  51.412  25.982 1.00 0.00  ? 226 THR C HG1  1 
ATOM   4528 N N    . LEU C 1 227 ? 77.893  51.858  25.256 1.00 28.63 ? 227 LEU C N    1 
ATOM   4529 C CA   . LEU C 1 227 ? 77.674  52.337  23.895 1.00 26.08 ? 227 LEU C CA   1 
ATOM   4530 C C    . LEU C 1 227 ? 78.107  53.800  23.829 1.00 25.14 ? 227 LEU C C    1 
ATOM   4531 O O    . LEU C 1 227 ? 77.590  54.635  24.567 1.00 24.37 ? 227 LEU C O    1 
ATOM   4532 C CB   . LEU C 1 227 ? 76.194  52.242  23.516 1.00 29.26 ? 227 LEU C CB   1 
ATOM   4533 C CG   . LEU C 1 227 ? 75.411  50.945  23.727 1.00 25.00 ? 227 LEU C CG   1 
ATOM   4534 C CD1  . LEU C 1 227 ? 73.979  51.165  23.269 1.00 24.07 ? 227 LEU C CD1  1 
ATOM   4535 C CD2  . LEU C 1 227 ? 76.040  49.816  22.951 1.00 28.68 ? 227 LEU C CD2  1 
ATOM   4536 H H    . LEU C 1 227 ? 77.387  52.262  25.981 1.00 0.00  ? 227 LEU C H    1 
ATOM   4537 N N    . SER C 1 228 ? 79.077  54.107  22.980 1.00 21.64 ? 228 SER C N    1 
ATOM   4538 C CA   . SER C 1 228 ? 79.536  55.480  22.840 1.00 17.39 ? 228 SER C CA   1 
ATOM   4539 C C    . SER C 1 228 ? 79.115  56.021  21.484 1.00 15.39 ? 228 SER C C    1 
ATOM   4540 O O    . SER C 1 228 ? 79.451  55.452  20.446 1.00 18.70 ? 228 SER C O    1 
ATOM   4541 C CB   . SER C 1 228 ? 81.050  55.563  22.991 1.00 17.21 ? 228 SER C CB   1 
ATOM   4542 O OG   . SER C 1 228 ? 81.460  55.056  24.243 1.00 22.30 ? 228 SER C OG   1 
ATOM   4543 H H    . SER C 1 228 ? 79.480  53.397  22.443 1.00 0.00  ? 228 SER C H    1 
ATOM   4544 H HG   . SER C 1 228 ? 81.721  54.137  24.146 1.00 0.00  ? 228 SER C HG   1 
ATOM   4545 N N    . MET C 1 229 ? 78.373  57.117  21.498 1.00 16.11 ? 229 MET C N    1 
ATOM   4546 C CA   . MET C 1 229 ? 77.889  57.721  20.277 1.00 19.93 ? 229 MET C CA   1 
ATOM   4547 C C    . MET C 1 229 ? 78.191  59.201  20.241 1.00 20.67 ? 229 MET C C    1 
ATOM   4548 O O    . MET C 1 229 ? 78.301  59.858  21.276 1.00 22.27 ? 229 MET C O    1 
ATOM   4549 C CB   . MET C 1 229 ? 76.373  57.548  20.163 1.00 25.19 ? 229 MET C CB   1 
ATOM   4550 C CG   . MET C 1 229 ? 75.892  56.129  19.955 1.00 30.67 ? 229 MET C CG   1 
ATOM   4551 S SD   . MET C 1 229 ? 74.101  55.978  20.128 1.00 37.40 ? 229 MET C SD   1 
ATOM   4552 C CE   . MET C 1 229 ? 73.965  55.753  21.933 1.00 29.74 ? 229 MET C CE   1 
ATOM   4553 H H    . MET C 1 229 ? 78.151  57.541  22.337 1.00 0.00  ? 229 MET C H    1 
ATOM   4554 N N    . SER C 1 230 ? 78.249  59.711  19.023 1.00 17.84 ? 230 SER C N    1 
ATOM   4555 C CA   . SER C 1 230 ? 78.481  61.107  18.711 1.00 15.45 ? 230 SER C CA   1 
ATOM   4556 C C    . SER C 1 230 ? 77.949  61.168  17.298 1.00 21.08 ? 230 SER C C    1 
ATOM   4557 O O    . SER C 1 230 ? 77.998  60.174  16.570 1.00 23.66 ? 230 SER C O    1 
ATOM   4558 C CB   . SER C 1 230 ? 79.965  61.450  18.711 1.00 14.09 ? 230 SER C CB   1 
ATOM   4559 O OG   . SER C 1 230 ? 80.491  61.451  20.022 1.00 19.80 ? 230 SER C OG   1 
ATOM   4560 H H    . SER C 1 230 ? 78.147  59.083  18.268 1.00 0.00  ? 230 SER C H    1 
ATOM   4561 H HG   . SER C 1 230 ? 81.431  61.671  19.956 1.00 0.00  ? 230 SER C HG   1 
ATOM   4562 N N    . ALA C 1 231 ? 77.411  62.312  16.909 1.00 25.35 ? 231 ALA C N    1 
ATOM   4563 C CA   . ALA C 1 231 ? 76.849  62.454  15.580 1.00 25.12 ? 231 ALA C CA   1 
ATOM   4564 C C    . ALA C 1 231 ? 77.888  62.253  14.486 1.00 24.99 ? 231 ALA C C    1 
ATOM   4565 O O    . ALA C 1 231 ? 79.020  62.703  14.623 1.00 30.26 ? 231 ALA C O    1 
ATOM   4566 C CB   . ALA C 1 231 ? 76.195  63.821  15.447 1.00 29.26 ? 231 ALA C CB   1 
ATOM   4567 H H    . ALA C 1 231 ? 77.410  63.077  17.523 1.00 0.00  ? 231 ALA C H    1 
ATOM   4568 N N    . ASP C 1 232 ? 77.510  61.506  13.451 1.00 27.18 ? 232 ASP C N    1 
ATOM   4569 C CA   . ASP C 1 232 ? 78.354  61.251  12.285 1.00 32.43 ? 232 ASP C CA   1 
ATOM   4570 C C    . ASP C 1 232 ? 79.626  60.425  12.505 1.00 33.97 ? 232 ASP C C    1 
ATOM   4571 O O    . ASP C 1 232 ? 80.505  60.405  11.652 1.00 41.93 ? 232 ASP C O    1 
ATOM   4572 C CB   . ASP C 1 232 ? 78.701  62.578  11.600 1.00 32.03 ? 232 ASP C CB   1 
ATOM   4573 H H    . ASP C 1 232 ? 76.630  61.092  13.495 1.00 0.00  ? 232 ASP C H    1 
ATOM   4574 N N    . VAL C 1 233 ? 79.723  59.718  13.620 1.00 30.08 ? 233 VAL C N    1 
ATOM   4575 C CA   . VAL C 1 233 ? 80.916  58.917  13.867 1.00 22.74 ? 233 VAL C CA   1 
ATOM   4576 C C    . VAL C 1 233 ? 80.506  57.497  14.225 1.00 23.91 ? 233 VAL C C    1 
ATOM   4577 O O    . VAL C 1 233 ? 79.401  57.272  14.719 1.00 33.76 ? 233 VAL C O    1 
ATOM   4578 C CB   . VAL C 1 233 ? 81.781  59.522  14.990 1.00 20.56 ? 233 VAL C CB   1 
ATOM   4579 C CG1  . VAL C 1 233 ? 81.957  61.023  14.765 1.00 20.44 ? 233 VAL C CG1  1 
ATOM   4580 C CG2  . VAL C 1 233 ? 81.185  59.238  16.358 1.00 18.22 ? 233 VAL C CG2  1 
ATOM   4581 H H    . VAL C 1 233 ? 79.007  59.720  14.284 1.00 0.00  ? 233 VAL C H    1 
ATOM   4582 N N    . PRO C 1 234 ? 81.352  56.508  13.908 1.00 19.86 ? 234 PRO C N    1 
ATOM   4583 C CA   . PRO C 1 234 ? 81.029  55.117  14.222 1.00 18.74 ? 234 PRO C CA   1 
ATOM   4584 C C    . PRO C 1 234 ? 80.738  54.879  15.702 1.00 16.78 ? 234 PRO C C    1 
ATOM   4585 O O    . PRO C 1 234 ? 81.377  55.461  16.577 1.00 18.67 ? 234 PRO C O    1 
ATOM   4586 C CB   . PRO C 1 234 ? 82.285  54.372  13.772 1.00 19.36 ? 234 PRO C CB   1 
ATOM   4587 C CG   . PRO C 1 234 ? 82.723  55.167  12.590 1.00 20.03 ? 234 PRO C CG   1 
ATOM   4588 C CD   . PRO C 1 234 ? 82.592  56.584  13.115 1.00 21.20 ? 234 PRO C CD   1 
ATOM   4589 N N    . LEU C 1 235 ? 79.718  54.066  15.956 1.00 16.65 ? 235 LEU C N    1 
ATOM   4590 C CA   . LEU C 1 235 ? 79.306  53.697  17.307 1.00 7.07  ? 235 LEU C CA   1 
ATOM   4591 C C    . LEU C 1 235 ? 80.396  52.793  17.851 1.00 11.12 ? 235 LEU C C    1 
ATOM   4592 O O    . LEU C 1 235 ? 81.037  52.063  17.093 1.00 16.90 ? 235 LEU C O    1 
ATOM   4593 C CB   . LEU C 1 235 ? 77.994  52.899  17.231 1.00 8.36  ? 235 LEU C CB   1 
ATOM   4594 C CG   . LEU C 1 235 ? 77.378  52.156  18.426 1.00 4.54  ? 235 LEU C CG   1 
ATOM   4595 C CD1  . LEU C 1 235 ? 76.809  53.143  19.385 1.00 7.20  ? 235 LEU C CD1  1 
ATOM   4596 C CD2  . LEU C 1 235 ? 76.276  51.218  17.986 1.00 3.37  ? 235 LEU C CD2  1 
ATOM   4597 H H    . LEU C 1 235 ? 79.224  53.706  15.190 1.00 0.00  ? 235 LEU C H    1 
ATOM   4598 N N    . VAL C 1 236 ? 80.624  52.851  19.154 1.00 15.78 ? 236 VAL C N    1 
ATOM   4599 C CA   . VAL C 1 236 ? 81.615  51.989  19.783 1.00 11.83 ? 236 VAL C CA   1 
ATOM   4600 C C    . VAL C 1 236 ? 80.900  51.199  20.879 1.00 17.57 ? 236 VAL C C    1 
ATOM   4601 O O    . VAL C 1 236 ? 80.350  51.784  21.830 1.00 12.79 ? 236 VAL C O    1 
ATOM   4602 C CB   . VAL C 1 236 ? 82.773  52.781  20.436 1.00 11.12 ? 236 VAL C CB   1 
ATOM   4603 C CG1  . VAL C 1 236 ? 83.932  51.843  20.751 1.00 2.14  ? 236 VAL C CG1  1 
ATOM   4604 C CG2  . VAL C 1 236 ? 83.221  53.908  19.541 1.00 7.54  ? 236 VAL C CG2  1 
ATOM   4605 H H    . VAL C 1 236 ? 80.105  53.481  19.697 1.00 0.00  ? 236 VAL C H    1 
ATOM   4606 N N    . VAL C 1 237 ? 80.849  49.883  20.700 1.00 17.22 ? 237 VAL C N    1 
ATOM   4607 C CA   . VAL C 1 237 ? 80.224  48.985  21.662 1.00 16.68 ? 237 VAL C CA   1 
ATOM   4608 C C    . VAL C 1 237 ? 81.380  48.256  22.352 1.00 20.46 ? 237 VAL C C    1 
ATOM   4609 O O    . VAL C 1 237 ? 82.111  47.507  21.702 1.00 25.64 ? 237 VAL C O    1 
ATOM   4610 C CB   . VAL C 1 237 ? 79.306  47.974  20.948 1.00 11.27 ? 237 VAL C CB   1 
ATOM   4611 C CG1  . VAL C 1 237 ? 78.454  47.225  21.950 1.00 12.93 ? 237 VAL C CG1  1 
ATOM   4612 C CG2  . VAL C 1 237 ? 78.429  48.683  19.949 1.00 5.24  ? 237 VAL C CG2  1 
ATOM   4613 H H    . VAL C 1 237 ? 81.232  49.493  19.891 1.00 0.00  ? 237 VAL C H    1 
ATOM   4614 N N    . GLU C 1 238 ? 81.574  48.503  23.648 1.00 23.00 ? 238 GLU C N    1 
ATOM   4615 C CA   . GLU C 1 238 ? 82.679  47.874  24.375 1.00 24.50 ? 238 GLU C CA   1 
ATOM   4616 C C    . GLU C 1 238 ? 82.321  46.867  25.472 1.00 26.13 ? 238 GLU C C    1 
ATOM   4617 O O    . GLU C 1 238 ? 81.479  47.142  26.337 1.00 26.13 ? 238 GLU C O    1 
ATOM   4618 C CB   . GLU C 1 238 ? 83.605  48.944  24.973 1.00 26.03 ? 238 GLU C CB   1 
ATOM   4619 C CG   . GLU C 1 238 ? 84.739  48.364  25.831 1.00 31.35 ? 238 GLU C CG   1 
ATOM   4620 C CD   . GLU C 1 238 ? 85.562  49.414  26.554 1.00 36.13 ? 238 GLU C CD   1 
ATOM   4621 O OE1  . GLU C 1 238 ? 85.006  50.472  26.915 1.00 45.36 ? 238 GLU C OE1  1 
ATOM   4622 O OE2  . GLU C 1 238 ? 86.768  49.175  26.777 1.00 37.18 ? 238 GLU C OE2  1 
ATOM   4623 H H    . GLU C 1 238 ? 80.972  49.119  24.122 1.00 0.00  ? 238 GLU C H    1 
ATOM   4624 N N    . TYR C 1 239 ? 83.004  45.720  25.438 1.00 18.08 ? 239 TYR C N    1 
ATOM   4625 C CA   . TYR C 1 239 ? 82.843  44.655  26.421 1.00 13.06 ? 239 TYR C CA   1 
ATOM   4626 C C    . TYR C 1 239 ? 84.173  44.542  27.141 1.00 16.61 ? 239 TYR C C    1 
ATOM   4627 O O    . TYR C 1 239 ? 85.186  44.165  26.547 1.00 19.63 ? 239 TYR C O    1 
ATOM   4628 C CB   . TYR C 1 239 ? 82.522  43.314  25.763 1.00 7.81  ? 239 TYR C CB   1 
ATOM   4629 C CG   . TYR C 1 239 ? 81.209  43.298  25.040 1.00 12.43 ? 239 TYR C CG   1 
ATOM   4630 C CD1  . TYR C 1 239 ? 81.100  43.808  23.739 1.00 12.83 ? 239 TYR C CD1  1 
ATOM   4631 C CD2  . TYR C 1 239 ? 80.066  42.778  25.645 1.00 12.69 ? 239 TYR C CD2  1 
ATOM   4632 C CE1  . TYR C 1 239 ? 79.884  43.794  23.062 1.00 14.59 ? 239 TYR C CE1  1 
ATOM   4633 C CE2  . TYR C 1 239 ? 78.842  42.760  24.972 1.00 14.49 ? 239 TYR C CE2  1 
ATOM   4634 C CZ   . TYR C 1 239 ? 78.764  43.267  23.684 1.00 11.44 ? 239 TYR C CZ   1 
ATOM   4635 O OH   . TYR C 1 239 ? 77.578  43.213  23.005 1.00 18.60 ? 239 TYR C OH   1 
ATOM   4636 H H    . TYR C 1 239 ? 83.644  45.587  24.715 1.00 0.00  ? 239 TYR C H    1 
ATOM   4637 H HH   . TYR C 1 239 ? 76.931  42.754  23.545 1.00 0.00  ? 239 TYR C HH   1 
ATOM   4638 N N    . LYS C 1 240 ? 84.176  44.923  28.407 1.00 21.70 ? 240 LYS C N    1 
ATOM   4639 C CA   . LYS C 1 240 ? 85.379  44.869  29.214 1.00 25.56 ? 240 LYS C CA   1 
ATOM   4640 C C    . LYS C 1 240 ? 85.656  43.435  29.643 1.00 29.37 ? 240 LYS C C    1 
ATOM   4641 O O    . LYS C 1 240 ? 84.904  42.865  30.425 1.00 34.75 ? 240 LYS C O    1 
ATOM   4642 C CB   . LYS C 1 240 ? 85.213  45.720  30.476 1.00 23.64 ? 240 LYS C CB   1 
ATOM   4643 C CG   . LYS C 1 240 ? 84.833  47.153  30.226 1.00 30.09 ? 240 LYS C CG   1 
ATOM   4644 C CD   . LYS C 1 240 ? 86.028  47.978  29.828 1.00 35.96 ? 240 LYS C CD   1 
ATOM   4645 C CE   . LYS C 1 240 ? 85.724  49.453  29.975 1.00 40.99 ? 240 LYS C CE   1 
ATOM   4646 N NZ   . LYS C 1 240 ? 86.937  50.257  29.685 1.00 48.65 ? 240 LYS C NZ   1 
ATOM   4647 H H    . LYS C 1 240 ? 83.339  45.235  28.808 1.00 0.00  ? 240 LYS C H    1 
ATOM   4648 H HZ1  . LYS C 1 240 ? 87.246  50.051  28.713 1.00 0.00  ? 240 LYS C HZ1  1 
ATOM   4649 H HZ2  . LYS C 1 240 ? 86.697  51.263  29.768 1.00 0.00  ? 240 LYS C HZ2  1 
ATOM   4650 H HZ3  . LYS C 1 240 ? 87.696  50.011  30.352 1.00 0.00  ? 240 LYS C HZ3  1 
ATOM   4651 N N    . ILE C 1 241 ? 86.675  42.817  29.066 1.00 27.53 ? 241 ILE C N    1 
ATOM   4652 C CA   . ILE C 1 241 ? 87.033  41.478  29.490 1.00 27.45 ? 241 ILE C CA   1 
ATOM   4653 C C    . ILE C 1 241 ? 87.627  41.692  30.889 1.00 30.96 ? 241 ILE C C    1 
ATOM   4654 O O    . ILE C 1 241 ? 88.651  42.355  31.037 1.00 33.54 ? 241 ILE C O    1 
ATOM   4655 C CB   . ILE C 1 241 ? 88.067  40.871  28.564 1.00 23.39 ? 241 ILE C CB   1 
ATOM   4656 C CG1  . ILE C 1 241 ? 87.482  40.755  27.157 1.00 17.63 ? 241 ILE C CG1  1 
ATOM   4657 C CG2  . ILE C 1 241 ? 88.473  39.497  29.049 1.00 27.83 ? 241 ILE C CG2  1 
ATOM   4658 C CD1  . ILE C 1 241 ? 88.514  40.366  26.113 1.00 13.36 ? 241 ILE C CD1  1 
ATOM   4659 H H    . ILE C 1 241 ? 87.168  43.285  28.352 1.00 0.00  ? 241 ILE C H    1 
ATOM   4660 N N    . ALA C 1 242 ? 86.973  41.130  31.901 1.00 37.19 ? 242 ALA C N    1 
ATOM   4661 C CA   . ALA C 1 242 ? 87.365  41.304  33.298 1.00 36.98 ? 242 ALA C CA   1 
ATOM   4662 C C    . ALA C 1 242 ? 88.843  41.202  33.599 1.00 41.28 ? 242 ALA C C    1 
ATOM   4663 O O    . ALA C 1 242 ? 89.423  40.115  33.561 1.00 45.84 ? 242 ALA C O    1 
ATOM   4664 C CB   . ALA C 1 242 ? 86.594  40.357  34.184 1.00 43.86 ? 242 ALA C CB   1 
ATOM   4665 H H    . ALA C 1 242 ? 86.290  40.463  31.686 1.00 0.00  ? 242 ALA C H    1 
ATOM   4666 N N    . ASP C 1 243 ? 89.437  42.356  33.885 1.00 39.37 ? 243 ASP C N    1 
ATOM   4667 C CA   . ASP C 1 243 ? 90.846  42.470  34.233 1.00 38.36 ? 243 ASP C CA   1 
ATOM   4668 C C    . ASP C 1 243 ? 91.843  41.911  33.229 1.00 36.03 ? 243 ASP C C    1 
ATOM   4669 O O    . ASP C 1 243 ? 92.968  41.551  33.569 1.00 39.76 ? 243 ASP C O    1 
ATOM   4670 C CB   . ASP C 1 243 ? 91.084  41.885  35.622 1.00 49.55 ? 243 ASP C CB   1 
ATOM   4671 C CG   . ASP C 1 243 ? 90.346  42.645  36.710 1.00 60.49 ? 243 ASP C CG   1 
ATOM   4672 O OD1  . ASP C 1 243 ? 89.612  43.611  36.386 1.00 67.13 ? 243 ASP C OD1  1 
ATOM   4673 O OD2  . ASP C 1 243 ? 90.517  42.280  37.895 1.00 67.65 ? 243 ASP C OD2  1 
ATOM   4674 H H    . ASP C 1 243 ? 88.894  43.162  33.877 1.00 0.00  ? 243 ASP C H    1 
ATOM   4675 N N    . MET C 1 244 ? 91.427  41.878  31.976 1.00 30.59 ? 244 MET C N    1 
ATOM   4676 C CA   . MET C 1 244 ? 92.281  41.406  30.907 1.00 24.67 ? 244 MET C CA   1 
ATOM   4677 C C    . MET C 1 244 ? 92.486  42.638  30.046 1.00 24.30 ? 244 MET C C    1 
ATOM   4678 O O    . MET C 1 244 ? 93.613  43.069  29.780 1.00 24.15 ? 244 MET C O    1 
ATOM   4679 C CB   . MET C 1 244 ? 91.606  40.300  30.095 1.00 21.68 ? 244 MET C CB   1 
ATOM   4680 C CG   . MET C 1 244 ? 92.031  38.914  30.483 1.00 19.81 ? 244 MET C CG   1 
ATOM   4681 S SD   . MET C 1 244 ? 93.780  38.764  30.327 1.00 28.62 ? 244 MET C SD   1 
ATOM   4682 C CE   . MET C 1 244 ? 93.985  37.815  28.859 1.00 34.36 ? 244 MET C CE   1 
ATOM   4683 H H    . MET C 1 244 ? 90.555  42.245  31.751 1.00 0.00  ? 244 MET C H    1 
ATOM   4684 N N    . GLY C 1 245 ? 91.363  43.227  29.669 1.00 18.20 ? 245 GLY C N    1 
ATOM   4685 C CA   . GLY C 1 245 ? 91.362  44.409  28.846 1.00 19.48 ? 245 GLY C CA   1 
ATOM   4686 C C    . GLY C 1 245 ? 89.950  44.695  28.390 1.00 20.14 ? 245 GLY C C    1 
ATOM   4687 O O    . GLY C 1 245 ? 89.063  45.000  29.197 1.00 21.73 ? 245 GLY C O    1 
ATOM   4688 H H    . GLY C 1 245 ? 90.503  42.841  29.939 1.00 0.00  ? 245 GLY C H    1 
ATOM   4689 N N    . HIS C 1 246 ? 89.709  44.519  27.101 1.00 14.35 ? 246 HIS C N    1 
ATOM   4690 C CA   . HIS C 1 246 ? 88.395  44.797  26.556 1.00 15.56 ? 246 HIS C CA   1 
ATOM   4691 C C    . HIS C 1 246 ? 88.292  44.306  25.127 1.00 17.94 ? 246 HIS C C    1 
ATOM   4692 O O    . HIS C 1 246 ? 89.279  43.849  24.546 1.00 21.32 ? 246 HIS C O    1 
ATOM   4693 C CB   . HIS C 1 246 ? 88.168  46.300  26.554 1.00 13.59 ? 246 HIS C CB   1 
ATOM   4694 C CG   . HIS C 1 246 ? 89.164  47.041  25.707 1.00 13.87 ? 246 HIS C CG   1 
ATOM   4695 N ND1  . HIS C 1 246 ? 90.254  47.689  26.270 1.00 15.81 ? 246 HIS C ND1  1 
ATOM   4696 C CD2  . HIS C 1 246 ? 89.268  47.202  24.386 1.00 16.87 ? 246 HIS C CD2  1 
ATOM   4697 C CE1  . HIS C 1 246 ? 90.980  48.206  25.289 1.00 16.41 ? 246 HIS C CE1  1 
ATOM   4698 N NE2  . HIS C 1 246 ? 90.412  47.932  24.150 1.00 15.94 ? 246 HIS C NE2  1 
ATOM   4699 H H    . HIS C 1 246 ? 90.418  44.174  26.515 1.00 0.00  ? 246 HIS C H    1 
ATOM   4700 H HD1  . HIS C 1 246 ? 90.434  47.790  27.224 1.00 0.00  ? 246 HIS C HD1  1 
ATOM   4701 H HE2  . HIS C 1 246 ? 90.735  48.232  23.278 1.00 0.00  ? 246 HIS C HE2  1 
ATOM   4702 N N    . LEU C 1 247 ? 87.093  44.442  24.569 1.00 17.88 ? 247 LEU C N    1 
ATOM   4703 C CA   . LEU C 1 247 ? 86.802  44.080  23.188 1.00 14.70 ? 247 LEU C CA   1 
ATOM   4704 C C    . LEU C 1 247 ? 85.828  45.147  22.700 1.00 17.79 ? 247 LEU C C    1 
ATOM   4705 O O    . LEU C 1 247 ? 84.775  45.360  23.305 1.00 24.53 ? 247 LEU C O    1 
ATOM   4706 C CB   . LEU C 1 247 ? 86.189  42.683  23.118 1.00 9.27  ? 247 LEU C CB   1 
ATOM   4707 C CG   . LEU C 1 247 ? 85.795  42.059  21.785 1.00 10.14 ? 247 LEU C CG   1 
ATOM   4708 C CD1  . LEU C 1 247 ? 86.775  42.358  20.666 1.00 7.73  ? 247 LEU C CD1  1 
ATOM   4709 C CD2  . LEU C 1 247 ? 85.685  40.570  22.010 1.00 16.26 ? 247 LEU C CD2  1 
ATOM   4710 H H    . LEU C 1 247 ? 86.347  44.784  25.105 1.00 0.00  ? 247 LEU C H    1 
ATOM   4711 N N    . LYS C 1 248 ? 86.254  45.905  21.695 1.00 18.84 ? 248 LYS C N    1 
ATOM   4712 C CA   . LYS C 1 248 ? 85.452  46.979  21.127 1.00 13.47 ? 248 LYS C CA   1 
ATOM   4713 C C    . LYS C 1 248 ? 85.018  46.675  19.714 1.00 15.39 ? 248 LYS C C    1 
ATOM   4714 O O    . LYS C 1 248 ? 85.812  46.218  18.895 1.00 23.75 ? 248 LYS C O    1 
ATOM   4715 C CB   . LYS C 1 248 ? 86.242  48.282  21.084 1.00 4.55  ? 248 LYS C CB   1 
ATOM   4716 C CG   . LYS C 1 248 ? 86.586  48.860  22.415 1.00 6.45  ? 248 LYS C CG   1 
ATOM   4717 C CD   . LYS C 1 248 ? 87.278  50.201  22.251 1.00 6.48  ? 248 LYS C CD   1 
ATOM   4718 C CE   . LYS C 1 248 ? 87.669  50.764  23.608 1.00 10.72 ? 248 LYS C CE   1 
ATOM   4719 N NZ   . LYS C 1 248 ? 88.320  52.086  23.503 1.00 9.21  ? 248 LYS C NZ   1 
ATOM   4720 H H    . LYS C 1 248 ? 87.138  45.730  21.321 1.00 0.00  ? 248 LYS C H    1 
ATOM   4721 H HZ1  . LYS C 1 248 ? 87.680  52.760  23.038 1.00 0.00  ? 248 LYS C HZ1  1 
ATOM   4722 H HZ2  . LYS C 1 248 ? 88.565  52.418  24.455 1.00 0.00  ? 248 LYS C HZ2  1 
ATOM   4723 H HZ3  . LYS C 1 248 ? 89.186  51.968  22.939 1.00 0.00  ? 248 LYS C HZ3  1 
ATOM   4724 N N    . TYR C 1 249 ? 83.772  47.006  19.419 1.00 16.94 ? 249 TYR C N    1 
ATOM   4725 C CA   . TYR C 1 249 ? 83.202  46.810  18.102 1.00 11.29 ? 249 TYR C CA   1 
ATOM   4726 C C    . TYR C 1 249 ? 82.778  48.193  17.611 1.00 13.19 ? 249 TYR C C    1 
ATOM   4727 O O    . TYR C 1 249 ? 82.100  48.919  18.339 1.00 18.15 ? 249 TYR C O    1 
ATOM   4728 C CB   . TYR C 1 249 ? 81.962  45.923  18.202 1.00 13.49 ? 249 TYR C CB   1 
ATOM   4729 C CG   . TYR C 1 249 ? 82.198  44.492  18.663 1.00 12.20 ? 249 TYR C CG   1 
ATOM   4730 C CD1  . TYR C 1 249 ? 82.528  43.489  17.751 1.00 11.48 ? 249 TYR C CD1  1 
ATOM   4731 C CD2  . TYR C 1 249 ? 82.058  44.141  19.998 1.00 7.87  ? 249 TYR C CD2  1 
ATOM   4732 C CE1  . TYR C 1 249 ? 82.710  42.177  18.157 1.00 12.67 ? 249 TYR C CE1  1 
ATOM   4733 C CE2  . TYR C 1 249 ? 82.238  42.835  20.416 1.00 11.60 ? 249 TYR C CE2  1 
ATOM   4734 C CZ   . TYR C 1 249 ? 82.566  41.854  19.494 1.00 15.00 ? 249 TYR C CZ   1 
ATOM   4735 O OH   . TYR C 1 249 ? 82.752  40.550  19.911 1.00 13.31 ? 249 TYR C OH   1 
ATOM   4736 H H    . TYR C 1 249 ? 83.203  47.417  20.103 1.00 0.00  ? 249 TYR C H    1 
ATOM   4737 H HH   . TYR C 1 249 ? 82.745  39.970  19.141 1.00 0.00  ? 249 TYR C HH   1 
ATOM   4738 N N    . TYR C 1 250 ? 83.209  48.583  16.413 1.00 11.27 ? 250 TYR C N    1 
ATOM   4739 C CA   . TYR C 1 250 ? 82.832  49.880  15.843 1.00 6.54  ? 250 TYR C CA   1 
ATOM   4740 C C    . TYR C 1 250 ? 81.843  49.631  14.710 1.00 10.95 ? 250 TYR C C    1 
ATOM   4741 O O    . TYR C 1 250 ? 82.045  48.727  13.892 1.00 15.96 ? 250 TYR C O    1 
ATOM   4742 C CB   . TYR C 1 250 ? 84.049  50.625  15.287 1.00 4.71  ? 250 TYR C CB   1 
ATOM   4743 C CG   . TYR C 1 250 ? 85.046  51.085  16.325 1.00 4.15  ? 250 TYR C CG   1 
ATOM   4744 C CD1  . TYR C 1 250 ? 85.963  50.193  16.893 1.00 4.51  ? 250 TYR C CD1  1 
ATOM   4745 C CD2  . TYR C 1 250 ? 85.088  52.412  16.724 1.00 6.55  ? 250 TYR C CD2  1 
ATOM   4746 C CE1  . TYR C 1 250 ? 86.897  50.617  17.831 1.00 4.56  ? 250 TYR C CE1  1 
ATOM   4747 C CE2  . TYR C 1 250 ? 86.021  52.851  17.665 1.00 13.28 ? 250 TYR C CE2  1 
ATOM   4748 C CZ   . TYR C 1 250 ? 86.925  51.952  18.214 1.00 11.90 ? 250 TYR C CZ   1 
ATOM   4749 O OH   . TYR C 1 250 ? 87.864  52.409  19.122 1.00 8.05  ? 250 TYR C OH   1 
ATOM   4750 H H    . TYR C 1 250 ? 83.754  47.982  15.886 1.00 0.00  ? 250 TYR C H    1 
ATOM   4751 H HH   . TYR C 1 250 ? 87.677  53.349  19.242 1.00 0.00  ? 250 TYR C HH   1 
ATOM   4752 N N    . LEU C 1 251 ? 80.788  50.435  14.653 1.00 10.40 ? 251 LEU C N    1 
ATOM   4753 C CA   . LEU C 1 251 ? 79.765  50.290  13.621 1.00 6.69  ? 251 LEU C CA   1 
ATOM   4754 C C    . LEU C 1 251 ? 79.538  51.608  12.894 1.00 13.17 ? 251 LEU C C    1 
ATOM   4755 O O    . LEU C 1 251 ? 79.129  52.599  13.508 1.00 16.75 ? 251 LEU C O    1 
ATOM   4756 C CB   . LEU C 1 251 ? 78.450  49.832  14.254 1.00 2.00  ? 251 LEU C CB   1 
ATOM   4757 C CG   . LEU C 1 251 ? 77.299  49.560  13.291 1.00 2.56  ? 251 LEU C CG   1 
ATOM   4758 C CD1  . LEU C 1 251 ? 77.738  48.592  12.203 1.00 2.14  ? 251 LEU C CD1  1 
ATOM   4759 C CD2  . LEU C 1 251 ? 76.133  48.999  14.052 1.00 2.00  ? 251 LEU C CD2  1 
ATOM   4760 H H    . LEU C 1 251 ? 80.710  51.146  15.322 1.00 0.00  ? 251 LEU C H    1 
ATOM   4761 N N    . ALA C 1 252 ? 79.829  51.625  11.597 1.00 17.93 ? 252 ALA C N    1 
ATOM   4762 C CA   . ALA C 1 252 ? 79.644  52.815  10.770 1.00 18.02 ? 252 ALA C CA   1 
ATOM   4763 C C    . ALA C 1 252 ? 78.148  53.118  10.699 1.00 20.80 ? 252 ALA C C    1 
ATOM   4764 O O    . ALA C 1 252 ? 77.343  52.215  10.466 1.00 24.29 ? 252 ALA C O    1 
ATOM   4765 C CB   . ALA C 1 252 ? 80.190  52.558  9.375  1.00 19.29 ? 252 ALA C CB   1 
ATOM   4766 H H    . ALA C 1 252 ? 80.172  50.808  11.171 1.00 0.00  ? 252 ALA C H    1 
ATOM   4767 N N    . PRO C 1 253 ? 77.756  54.392  10.896 1.00 21.54 ? 253 PRO C N    1 
ATOM   4768 C CA   . PRO C 1 253 ? 76.350  54.816  10.859 1.00 24.72 ? 253 PRO C CA   1 
ATOM   4769 C C    . PRO C 1 253 ? 75.759  54.798  9.455  1.00 27.13 ? 253 PRO C C    1 
ATOM   4770 O O    . PRO C 1 253 ? 76.487  54.871  8.465  1.00 27.39 ? 253 PRO C O    1 
ATOM   4771 C CB   . PRO C 1 253 ? 76.415  56.239  11.415 1.00 26.00 ? 253 PRO C CB   1 
ATOM   4772 C CG   . PRO C 1 253 ? 77.739  56.724  10.930 1.00 23.01 ? 253 PRO C CG   1 
ATOM   4773 C CD   . PRO C 1 253 ? 78.636  55.535  11.196 1.00 25.67 ? 253 PRO C CD   1 
ATOM   4774 N N    . LYS C 1 254 ? 74.436  54.723  9.372  1.00 24.28 ? 254 LYS C N    1 
ATOM   4775 C CA   . LYS C 1 254 ? 73.776  54.702  8.082  1.00 26.91 ? 254 LYS C CA   1 
ATOM   4776 C C    . LYS C 1 254 ? 73.511  56.125  7.613  1.00 34.80 ? 254 LYS C C    1 
ATOM   4777 O O    . LYS C 1 254 ? 72.771  56.856  8.266  1.00 35.79 ? 254 LYS C O    1 
ATOM   4778 C CB   . LYS C 1 254 ? 72.487  53.906  8.156  1.00 25.84 ? 254 LYS C CB   1 
ATOM   4779 C CG   . LYS C 1 254 ? 72.751  52.448  8.394  1.00 28.39 ? 254 LYS C CG   1 
ATOM   4780 C CD   . LYS C 1 254 ? 71.496  51.633  8.303  1.00 30.91 ? 254 LYS C CD   1 
ATOM   4781 C CE   . LYS C 1 254 ? 70.882  51.716  6.924  1.00 31.04 ? 254 LYS C CE   1 
ATOM   4782 N NZ   . LYS C 1 254 ? 71.816  51.238  5.877  1.00 30.36 ? 254 LYS C NZ   1 
ATOM   4783 H H    . LYS C 1 254 ? 73.900  54.707  10.183 1.00 0.00  ? 254 LYS C H    1 
ATOM   4784 H HZ1  . LYS C 1 254 ? 72.054  50.248  6.081  1.00 0.00  ? 254 LYS C HZ1  1 
ATOM   4785 H HZ2  . LYS C 1 254 ? 71.330  51.303  4.961  1.00 0.00  ? 254 LYS C HZ2  1 
ATOM   4786 H HZ3  . LYS C 1 254 ? 72.669  51.830  5.866  1.00 0.00  ? 254 LYS C HZ3  1 
ATOM   4787 N N    . ILE C 1 255 ? 74.226  56.530  6.561  1.00 42.59 ? 255 ILE C N    1 
ATOM   4788 C CA   . ILE C 1 255 ? 74.114  57.848  5.933  1.00 48.01 ? 255 ILE C CA   1 
ATOM   4789 C C    . ILE C 1 255 ? 74.188  59.029  6.905  1.00 54.01 ? 255 ILE C C    1 
ATOM   4790 O O    . ILE C 1 255 ? 73.361  59.935  6.866  1.00 70.70 ? 255 ILE C O    1 
ATOM   4791 C CB   . ILE C 1 255 ? 72.832  57.941  5.082  1.00 41.87 ? 255 ILE C CB   1 
ATOM   4792 H H    . ILE C 1 255 ? 74.927  55.943  6.238  1.00 0.00  ? 255 ILE C H    1 
ATOM   4793 N N    . ARG D 2 5   ? 72.034  55.094  3.552  1.00 50.52 ? 143 ARG D N    1 
ATOM   4794 C CA   . ARG D 2 5   ? 73.270  54.708  2.879  1.00 46.85 ? 143 ARG D CA   1 
ATOM   4795 C C    . ARG D 2 5   ? 74.312  54.274  3.896  1.00 43.72 ? 143 ARG D C    1 
ATOM   4796 O O    . ARG D 2 5   ? 74.793  55.071  4.691  1.00 43.60 ? 143 ARG D O    1 
ATOM   4797 C CB   . ARG D 2 5   ? 73.804  55.859  2.035  1.00 48.40 ? 143 ARG D CB   1 
ATOM   4798 H H    . ARG D 2 5   ? 71.208  55.351  3.097  1.00 0.00  ? 143 ARG D H    1 
ATOM   4799 N N    . GLN D 2 6   ? 74.665  53.000  3.862  1.00 40.97 ? 144 GLN D N    1 
ATOM   4800 C CA   . GLN D 2 6   ? 75.648  52.455  4.782  1.00 35.34 ? 144 GLN D CA   1 
ATOM   4801 C C    . GLN D 2 6   ? 77.032  53.015  4.499  1.00 36.52 ? 144 GLN D C    1 
ATOM   4802 O O    . GLN D 2 6   ? 77.605  52.777  3.430  1.00 38.84 ? 144 GLN D O    1 
ATOM   4803 C CB   . GLN D 2 6   ? 75.679  50.933  4.667  1.00 32.77 ? 144 GLN D CB   1 
ATOM   4804 C CG   . GLN D 2 6   ? 76.648  50.255  5.603  1.00 32.51 ? 144 GLN D CG   1 
ATOM   4805 C CD   . GLN D 2 6   ? 76.274  50.447  7.047  1.00 32.27 ? 144 GLN D CD   1 
ATOM   4806 O OE1  . GLN D 2 6   ? 75.424  49.739  7.574  1.00 29.82 ? 144 GLN D OE1  1 
ATOM   4807 N NE2  . GLN D 2 6   ? 76.916  51.399  7.700  1.00 34.65 ? 144 GLN D NE2  1 
ATOM   4808 H H    . GLN D 2 6   ? 74.247  52.446  3.183  1.00 0.00  ? 144 GLN D H    1 
ATOM   4809 H HE21 . GLN D 2 6   ? 76.712  51.593  8.634  1.00 0.00  ? 144 GLN D HE21 1 
ATOM   4810 H HE22 . GLN D 2 6   ? 77.609  51.898  7.206  1.00 0.00  ? 144 GLN D HE22 1 
ATOM   4811 N N    . THR D 2 7   ? 77.553  53.796  5.438  1.00 31.17 ? 145 THR D N    1 
ATOM   4812 C CA   . THR D 2 7   ? 78.892  54.352  5.285  1.00 26.58 ? 145 THR D CA   1 
ATOM   4813 C C    . THR D 2 7   ? 79.900  53.277  5.731  1.00 27.34 ? 145 THR D C    1 
ATOM   4814 O O    . THR D 2 7   ? 79.509  52.263  6.318  1.00 29.79 ? 145 THR D O    1 
ATOM   4815 C CB   . THR D 2 7   ? 79.059  55.613  6.137  1.00 16.95 ? 145 THR D CB   1 
ATOM   4816 O OG1  . THR D 2 7   ? 78.969  55.269  7.521  1.00 19.84 ? 145 THR D OG1  1 
ATOM   4817 C CG2  . THR D 2 7   ? 77.980  56.605  5.805  1.00 17.76 ? 145 THR D CG2  1 
ATOM   4818 H H    . THR D 2 7   ? 77.027  54.019  6.231  1.00 0.00  ? 145 THR D H    1 
ATOM   4819 H HG1  . THR D 2 7   ? 78.118  54.869  7.717  1.00 0.00  ? 145 THR D HG1  1 
ATOM   4820 N N    . SER D 2 8   ? 81.182  53.480  5.448  1.00 23.21 ? 146 SER D N    1 
ATOM   4821 C CA   . SER D 2 8   ? 82.189  52.510  5.851  1.00 25.13 ? 146 SER D CA   1 
ATOM   4822 C C    . SER D 2 8   ? 83.133  53.143  6.859  1.00 22.82 ? 146 SER D C    1 
ATOM   4823 O O    . SER D 2 8   ? 83.301  54.366  6.873  1.00 19.14 ? 146 SER D O    1 
ATOM   4824 C CB   . SER D 2 8   ? 82.983  52.020  4.646  1.00 29.80 ? 146 SER D CB   1 
ATOM   4825 O OG   . SER D 2 8   ? 83.645  53.102  4.021  1.00 41.78 ? 146 SER D OG   1 
ATOM   4826 H H    . SER D 2 8   ? 81.494  54.301  5.044  1.00 0.00  ? 146 SER D H    1 
ATOM   4827 H HG   . SER D 2 8   ? 82.996  53.505  3.443  1.00 0.00  ? 146 SER D HG   1 
ATOM   4828 N N    . MET D 2 9   ? 83.772  52.299  7.668  1.00 15.49 ? 147 MET D N    1 
ATOM   4829 C CA   . MET D 2 9   ? 84.700  52.746  8.693  1.00 4.40  ? 147 MET D CA   1 
ATOM   4830 C C    . MET D 2 9   ? 85.867  53.539  8.110  1.00 8.92  ? 147 MET D C    1 
ATOM   4831 O O    . MET D 2 9   ? 86.438  54.412  8.766  1.00 13.46 ? 147 MET D O    1 
ATOM   4832 C CB   . MET D 2 9   ? 85.234  51.546  9.466  1.00 5.87  ? 147 MET D CB   1 
ATOM   4833 C CG   . MET D 2 9   ? 84.243  50.879  10.407 1.00 3.96  ? 147 MET D CG   1 
ATOM   4834 S SD   . MET D 2 9   ? 83.844  51.848  11.867 1.00 12.70 ? 147 MET D SD   1 
ATOM   4835 C CE   . MET D 2 9   ? 85.498  52.249  12.523 1.00 9.29  ? 147 MET D CE   1 
ATOM   4836 H H    . MET D 2 9   ? 83.604  51.339  7.568  1.00 0.00  ? 147 MET D H    1 
ATOM   4837 N N    . THR D 2 10  ? 86.212  53.248  6.867  1.00 10.99 ? 148 THR D N    1 
ATOM   4838 C CA   . THR D 2 10  ? 87.315  53.931  6.222  1.00 12.98 ? 148 THR D CA   1 
ATOM   4839 C C    . THR D 2 10  ? 86.965  55.368  5.851  1.00 19.25 ? 148 THR D C    1 
ATOM   4840 O O    . THR D 2 10  ? 87.842  56.155  5.494  1.00 23.55 ? 148 THR D O    1 
ATOM   4841 C CB   . THR D 2 10  ? 87.764  53.140  5.000  1.00 13.68 ? 148 THR D CB   1 
ATOM   4842 O OG1  . THR D 2 10  ? 86.618  52.732  4.247  1.00 15.12 ? 148 THR D OG1  1 
ATOM   4843 C CG2  . THR D 2 10  ? 88.501  51.891  5.442  1.00 18.56 ? 148 THR D CG2  1 
ATOM   4844 H H    . THR D 2 10  ? 85.729  52.576  6.340  1.00 0.00  ? 148 THR D H    1 
ATOM   4845 H HG1  . THR D 2 10  ? 86.406  53.323  3.504  1.00 0.00  ? 148 THR D HG1  1 
ATOM   4846 N N    . ASP D 2 11  ? 85.678  55.702  5.930  1.00 20.19 ? 149 ASP D N    1 
ATOM   4847 C CA   . ASP D 2 11  ? 85.198  57.042  5.621  1.00 14.30 ? 149 ASP D CA   1 
ATOM   4848 C C    . ASP D 2 11  ? 85.534  58.011  6.743  1.00 20.71 ? 149 ASP D C    1 
ATOM   4849 O O    . ASP D 2 11  ? 85.640  59.217  6.520  1.00 22.07 ? 149 ASP D O    1 
ATOM   4850 C CB   . ASP D 2 11  ? 83.674  57.040  5.466  1.00 19.41 ? 149 ASP D CB   1 
ATOM   4851 C CG   . ASP D 2 11  ? 83.204  56.490  4.135  1.00 22.64 ? 149 ASP D CG   1 
ATOM   4852 O OD1  . ASP D 2 11  ? 83.937  56.583  3.127  1.00 26.66 ? 149 ASP D OD1  1 
ATOM   4853 O OD2  . ASP D 2 11  ? 82.064  55.990  4.094  1.00 25.01 ? 149 ASP D OD2  1 
ATOM   4854 H H    . ASP D 2 11  ? 85.016  55.038  6.208  1.00 0.00  ? 149 ASP D H    1 
ATOM   4855 N N    . PHE D 2 12  ? 85.683  57.479  7.953  1.00 22.86 ? 150 PHE D N    1 
ATOM   4856 C CA   . PHE D 2 12  ? 85.943  58.305  9.127  1.00 20.93 ? 150 PHE D CA   1 
ATOM   4857 C C    . PHE D 2 12  ? 87.361  58.295  9.672  1.00 24.74 ? 150 PHE D C    1 
ATOM   4858 O O    . PHE D 2 12  ? 87.787  59.275  10.290 1.00 23.80 ? 150 PHE D O    1 
ATOM   4859 C CB   . PHE D 2 12  ? 84.988  57.908  10.247 1.00 18.47 ? 150 PHE D CB   1 
ATOM   4860 C CG   . PHE D 2 12  ? 83.568  57.757  9.800  1.00 20.41 ? 150 PHE D CG   1 
ATOM   4861 C CD1  . PHE D 2 12  ? 83.113  56.542  9.296  1.00 24.39 ? 150 PHE D CD1  1 
ATOM   4862 C CD2  . PHE D 2 12  ? 82.682  58.821  9.880  1.00 17.20 ? 150 PHE D CD2  1 
ATOM   4863 C CE1  . PHE D 2 12  ? 81.795  56.385  8.876  1.00 19.19 ? 150 PHE D CE1  1 
ATOM   4864 C CE2  . PHE D 2 12  ? 81.364  58.674  9.464  1.00 17.79 ? 150 PHE D CE2  1 
ATOM   4865 C CZ   . PHE D 2 12  ? 80.922  57.453  8.962  1.00 18.20 ? 150 PHE D CZ   1 
ATOM   4866 H H    . PHE D 2 12  ? 85.614  56.509  8.057  1.00 0.00  ? 150 PHE D H    1 
ATOM   4867 N N    . TYR D 2 13  ? 88.075  57.183  9.497  1.00 24.55 ? 151 TYR D N    1 
ATOM   4868 C CA   . TYR D 2 13  ? 89.435  57.084  10.014 1.00 18.62 ? 151 TYR D CA   1 
ATOM   4869 C C    . TYR D 2 13  ? 90.470  56.720  8.976  1.00 20.76 ? 151 TYR D C    1 
ATOM   4870 O O    . TYR D 2 13  ? 90.219  55.956  8.045  1.00 18.30 ? 151 TYR D O    1 
ATOM   4871 C CB   . TYR D 2 13  ? 89.517  56.089  11.172 1.00 17.11 ? 151 TYR D CB   1 
ATOM   4872 C CG   . TYR D 2 13  ? 88.509  56.346  12.262 1.00 18.66 ? 151 TYR D CG   1 
ATOM   4873 C CD1  . TYR D 2 13  ? 88.568  57.499  13.033 1.00 14.24 ? 151 TYR D CD1  1 
ATOM   4874 C CD2  . TYR D 2 13  ? 87.492  55.426  12.526 1.00 22.82 ? 151 TYR D CD2  1 
ATOM   4875 C CE1  . TYR D 2 13  ? 87.645  57.731  14.039 1.00 21.94 ? 151 TYR D CE1  1 
ATOM   4876 C CE2  . TYR D 2 13  ? 86.561  55.648  13.535 1.00 19.52 ? 151 TYR D CE2  1 
ATOM   4877 C CZ   . TYR D 2 13  ? 86.644  56.798  14.286 1.00 22.52 ? 151 TYR D CZ   1 
ATOM   4878 O OH   . TYR D 2 13  ? 85.738  57.024  15.291 1.00 29.75 ? 151 TYR D OH   1 
ATOM   4879 H H    . TYR D 2 13  ? 87.693  56.414  9.020  1.00 0.00  ? 151 TYR D H    1 
ATOM   4880 H HH   . TYR D 2 13  ? 85.255  56.213  15.526 1.00 0.00  ? 151 TYR D HH   1 
ATOM   4881 N N    . HIS D 2 14  ? 91.657  57.267  9.189  1.00 27.62 ? 152 HIS D N    1 
ATOM   4882 C CA   . HIS D 2 14  ? 92.817  57.072  8.336  1.00 28.55 ? 152 HIS D CA   1 
ATOM   4883 C C    . HIS D 2 14  ? 93.311  55.626  8.362  1.00 28.65 ? 152 HIS D C    1 
ATOM   4884 O O    . HIS D 2 14  ? 93.656  55.107  9.423  1.00 27.88 ? 152 HIS D O    1 
ATOM   4885 C CB   . HIS D 2 14  ? 93.911  58.018  8.823  1.00 29.19 ? 152 HIS D CB   1 
ATOM   4886 C CG   . HIS D 2 14  ? 95.266  57.726  8.269  1.00 25.39 ? 152 HIS D CG   1 
ATOM   4887 N ND1  . HIS D 2 14  ? 95.702  58.247  7.071  1.00 25.36 ? 152 HIS D ND1  1 
ATOM   4888 C CD2  . HIS D 2 14  ? 96.292  57.003  8.770  1.00 21.70 ? 152 HIS D CD2  1 
ATOM   4889 C CE1  . HIS D 2 14  ? 96.944  57.860  6.859  1.00 28.29 ? 152 HIS D CE1  1 
ATOM   4890 N NE2  . HIS D 2 14  ? 97.329  57.105  7.870  1.00 26.99 ? 152 HIS D NE2  1 
ATOM   4891 H H    . HIS D 2 14  ? 91.741  57.833  9.984  1.00 0.00  ? 152 HIS D H    1 
ATOM   4892 H HD1  . HIS D 2 14  ? 95.177  58.815  6.472  1.00 0.00  ? 152 HIS D HD1  1 
ATOM   4893 H HE2  . HIS D 2 14  ? 98.200  56.676  7.922  1.00 0.00  ? 152 HIS D HE2  1 
ATOM   4894 N N    . SER D 2 15  ? 93.354  54.994  7.194  1.00 29.97 ? 153 SER D N    1 
ATOM   4895 C CA   . SER D 2 15  ? 93.806  53.615  7.082  1.00 32.36 ? 153 SER D CA   1 
ATOM   4896 C C    . SER D 2 15  ? 95.274  53.501  6.707  1.00 37.59 ? 153 SER D C    1 
ATOM   4897 O O    . SER D 2 15  ? 95.813  54.357  6.003  1.00 44.51 ? 153 SER D O    1 
ATOM   4898 C CB   . SER D 2 15  ? 92.954  52.858  6.066  1.00 33.48 ? 153 SER D CB   1 
ATOM   4899 O OG   . SER D 2 15  ? 92.715  53.627  4.901  1.00 36.95 ? 153 SER D OG   1 
ATOM   4900 H H    . SER D 2 15  ? 93.086  55.436  6.364  1.00 0.00  ? 153 SER D H    1 
ATOM   4901 H HG   . SER D 2 15  ? 91.899  54.125  5.053  1.00 0.00  ? 153 SER D HG   1 
ATOM   4902 N N    . LYS D 2 16  ? 95.898  52.410  7.144  1.00 43.29 ? 154 LYS D N    1 
ATOM   4903 C CA   . LYS D 2 16  ? 97.304  52.134  6.881  1.00 42.33 ? 154 LYS D CA   1 
ATOM   4904 C C    . LYS D 2 16  ? 97.463  50.627  6.642  1.00 40.41 ? 154 LYS D C    1 
ATOM   4905 O O    . LYS D 2 16  ? 97.421  49.822  7.582  1.00 40.90 ? 154 LYS D O    1 
ATOM   4906 C CB   . LYS D 2 16  ? 98.157  52.580  8.070  1.00 46.45 ? 154 LYS D CB   1 
ATOM   4907 C CG   . LYS D 2 16  ? 99.650  52.523  7.830  1.00 53.94 ? 154 LYS D CG   1 
ATOM   4908 C CD   . LYS D 2 16  ? 100.428 52.899  9.088  1.00 59.35 ? 154 LYS D CD   1 
ATOM   4909 C CE   . LYS D 2 16  ? 101.902 53.139  8.789  1.00 62.13 ? 154 LYS D CE   1 
ATOM   4910 N NZ   . LYS D 2 16  ? 102.654 53.586  9.997  1.00 62.93 ? 154 LYS D NZ   1 
ATOM   4911 H H    . LYS D 2 16  ? 95.400  51.762  7.665  1.00 0.00  ? 154 LYS D H    1 
ATOM   4912 H HZ1  . LYS D 2 16  ? 102.236 54.463  10.355 1.00 0.00  ? 154 LYS D HZ1  1 
ATOM   4913 H HZ2  . LYS D 2 16  ? 102.616 52.841  10.716 1.00 0.00  ? 154 LYS D HZ2  1 
ATOM   4914 H HZ3  . LYS D 2 16  ? 103.642 53.747  9.725  1.00 0.00  ? 154 LYS D HZ3  1 
ATOM   4915 N N    . ARG D 2 17  ? 97.571  50.266  5.365  1.00 34.43 ? 155 ARG D N    1 
ATOM   4916 C CA   . ARG D 2 17  ? 97.733  48.887  4.908  1.00 28.06 ? 155 ARG D CA   1 
ATOM   4917 C C    . ARG D 2 17  ? 99.020  48.213  5.451  1.00 26.28 ? 155 ARG D C    1 
ATOM   4918 O O    . ARG D 2 17  ? 100.080 48.841  5.483  1.00 27.69 ? 155 ARG D O    1 
ATOM   4919 C CB   . ARG D 2 17  ? 97.735  48.889  3.379  1.00 28.27 ? 155 ARG D CB   1 
ATOM   4920 C CG   . ARG D 2 17  ? 97.650  47.529  2.736  1.00 33.20 ? 155 ARG D CG   1 
ATOM   4921 C CD   . ARG D 2 17  ? 97.095  47.630  1.314  1.00 38.37 ? 155 ARG D CD   1 
ATOM   4922 N NE   . ARG D 2 17  ? 95.689  48.045  1.285  1.00 39.62 ? 155 ARG D NE   1 
ATOM   4923 C CZ   . ARG D 2 17  ? 94.675  47.284  1.696  1.00 44.74 ? 155 ARG D CZ   1 
ATOM   4924 N NH1  . ARG D 2 17  ? 94.900  46.067  2.168  1.00 43.02 ? 155 ARG D NH1  1 
ATOM   4925 N NH2  . ARG D 2 17  ? 93.427  47.730  1.630  1.00 46.67 ? 155 ARG D NH2  1 
ATOM   4926 H H    . ARG D 2 17  ? 97.528  50.972  4.692  1.00 0.00  ? 155 ARG D H    1 
ATOM   4927 H HE   . ARG D 2 17  ? 95.462  48.929  0.916  1.00 0.00  ? 155 ARG D HE   1 
ATOM   4928 H HH11 . ARG D 2 17  ? 95.833  45.730  2.189  1.00 0.00  ? 155 ARG D HH11 1 
ATOM   4929 H HH12 . ARG D 2 17  ? 94.136  45.498  2.465  1.00 0.00  ? 155 ARG D HH12 1 
ATOM   4930 H HH21 . ARG D 2 17  ? 93.194  48.629  1.253  1.00 0.00  ? 155 ARG D HH21 1 
ATOM   4931 H HH22 . ARG D 2 17  ? 92.689  47.130  1.933  1.00 0.00  ? 155 ARG D HH22 1 
ATOM   4932 N N    . ARG D 2 18  ? 98.919  46.949  5.878  1.00 27.48 ? 156 ARG D N    1 
ATOM   4933 C CA   . ARG D 2 18  ? 100.046 46.178  6.423  1.00 29.61 ? 156 ARG D CA   1 
ATOM   4934 C C    . ARG D 2 18  ? 100.193 44.800  5.775  1.00 28.97 ? 156 ARG D C    1 
ATOM   4935 O O    . ARG D 2 18  ? 99.208  44.084  5.603  1.00 34.15 ? 156 ARG D O    1 
ATOM   4936 C CB   . ARG D 2 18  ? 99.866  45.933  7.929  1.00 30.73 ? 156 ARG D CB   1 
ATOM   4937 C CG   . ARG D 2 18  ? 99.901  47.173  8.795  1.00 34.36 ? 156 ARG D CG   1 
ATOM   4938 C CD   . ARG D 2 18  ? 99.594  46.810  10.243 1.00 30.37 ? 156 ARG D CD   1 
ATOM   4939 N NE   . ARG D 2 18  ? 100.588 45.902  10.819 1.00 23.77 ? 156 ARG D NE   1 
ATOM   4940 C CZ   . ARG D 2 18  ? 100.465 45.312  12.007 1.00 26.20 ? 156 ARG D CZ   1 
ATOM   4941 N NH1  . ARG D 2 18  ? 99.387  45.526  12.746 1.00 25.38 ? 156 ARG D NH1  1 
ATOM   4942 N NH2  . ARG D 2 18  ? 101.427 44.522  12.472 1.00 22.48 ? 156 ARG D NH2  1 
ATOM   4943 H H    . ARG D 2 18  ? 98.079  46.506  5.856  1.00 0.00  ? 156 ARG D H    1 
ATOM   4944 H HE   . ARG D 2 18  ? 101.398 45.712  10.296 1.00 0.00  ? 156 ARG D HE   1 
ATOM   4945 H HH11 . ARG D 2 18  ? 98.650  46.123  12.439 1.00 0.00  ? 156 ARG D HH11 1 
ATOM   4946 H HH12 . ARG D 2 18  ? 99.303  45.072  13.638 1.00 0.00  ? 156 ARG D HH12 1 
ATOM   4947 H HH21 . ARG D 2 18  ? 102.246 44.339  11.942 1.00 0.00  ? 156 ARG D HH21 1 
ATOM   4948 H HH22 . ARG D 2 18  ? 101.294 44.084  13.360 1.00 0.00  ? 156 ARG D HH22 1 
ATOM   4949 N N    . LEU D 2 19  ? 101.425 44.435  5.430  1.00 22.52 ? 157 LEU D N    1 
ATOM   4950 C CA   . LEU D 2 19  ? 101.714 43.130  4.852  1.00 26.73 ? 157 LEU D CA   1 
ATOM   4951 C C    . LEU D 2 19  ? 102.233 42.250  5.982  1.00 28.63 ? 157 LEU D C    1 
ATOM   4952 O O    . LEU D 2 19  ? 103.259 42.555  6.585  1.00 33.85 ? 157 LEU D O    1 
ATOM   4953 C CB   . LEU D 2 19  ? 102.787 43.228  3.775  1.00 29.68 ? 157 LEU D CB   1 
ATOM   4954 C CG   . LEU D 2 19  ? 102.331 43.709  2.404  1.00 36.26 ? 157 LEU D CG   1 
ATOM   4955 C CD1  . LEU D 2 19  ? 103.513 43.748  1.446  1.00 35.96 ? 157 LEU D CD1  1 
ATOM   4956 C CD2  . LEU D 2 19  ? 101.265 42.764  1.899  1.00 39.04 ? 157 LEU D CD2  1 
ATOM   4957 H H    . LEU D 2 19  ? 102.160 45.060  5.564  1.00 0.00  ? 157 LEU D H    1 
ATOM   4958 N N    . ILE D 2 20  ? 101.535 41.160  6.263  1.00 29.35 ? 158 ILE D N    1 
ATOM   4959 C CA   . ILE D 2 20  ? 101.934 40.259  7.330  1.00 29.09 ? 158 ILE D CA   1 
ATOM   4960 C C    . ILE D 2 20  ? 102.432 38.926  6.761  1.00 31.87 ? 158 ILE D C    1 
ATOM   4961 O O    . ILE D 2 20  ? 101.712 38.233  6.043  1.00 25.91 ? 158 ILE D O    1 
ATOM   4962 C CB   . ILE D 2 20  ? 100.761 39.976  8.292  1.00 28.38 ? 158 ILE D CB   1 
ATOM   4963 C CG1  . ILE D 2 20  ? 100.135 41.287  8.767  1.00 26.81 ? 158 ILE D CG1  1 
ATOM   4964 C CG2  . ILE D 2 20  ? 101.233 39.138  9.471  1.00 24.64 ? 158 ILE D CG2  1 
ATOM   4965 C CD1  . ILE D 2 20  ? 101.123 42.219  9.426  1.00 35.26 ? 158 ILE D CD1  1 
ATOM   4966 H H    . ILE D 2 20  ? 100.774 40.937  5.701  1.00 0.00  ? 158 ILE D H    1 
ATOM   4967 N N    . PHE D 2 21  ? 103.679 38.588  7.068  1.00 32.16 ? 159 PHE D N    1 
ATOM   4968 C CA   . PHE D 2 21  ? 104.270 37.343  6.611  1.00 34.12 ? 159 PHE D CA   1 
ATOM   4969 C C    . PHE D 2 21  ? 104.414 36.406  7.804  1.00 39.54 ? 159 PHE D C    1 
ATOM   4970 O O    . PHE D 2 21  ? 105.097 36.716  8.782  1.00 40.82 ? 159 PHE D O    1 
ATOM   4971 C CB   . PHE D 2 21  ? 105.615 37.596  5.928  1.00 25.04 ? 159 PHE D CB   1 
ATOM   4972 C CG   . PHE D 2 21  ? 105.507 38.442  4.703  1.00 20.34 ? 159 PHE D CG   1 
ATOM   4973 C CD1  . PHE D 2 21  ? 104.923 37.935  3.543  1.00 22.14 ? 159 PHE D CD1  1 
ATOM   4974 C CD2  . PHE D 2 21  ? 105.936 39.764  4.717  1.00 22.77 ? 159 PHE D CD2  1 
ATOM   4975 C CE1  . PHE D 2 21  ? 104.756 38.733  2.408  1.00 19.92 ? 159 PHE D CE1  1 
ATOM   4976 C CE2  . PHE D 2 21  ? 105.777 40.577  3.592  1.00 26.37 ? 159 PHE D CE2  1 
ATOM   4977 C CZ   . PHE D 2 21  ? 105.182 40.057  2.431  1.00 24.06 ? 159 PHE D CZ   1 
ATOM   4978 H H    . PHE D 2 21  ? 104.205 39.192  7.639  1.00 0.00  ? 159 PHE D H    1 
ATOM   4979 N N    . SER D 2 22  ? 103.747 35.263  7.708  1.00 45.60 ? 160 SER D N    1 
ATOM   4980 C CA   . SER D 2 22  ? 103.739 34.240  8.744  1.00 52.75 ? 160 SER D CA   1 
ATOM   4981 C C    . SER D 2 22  ? 102.730 33.182  8.305  1.00 59.98 ? 160 SER D C    1 
ATOM   4982 O O    . SER D 2 22  ? 102.645 32.096  8.867  1.00 69.85 ? 160 SER D O    1 
ATOM   4983 C CB   . SER D 2 22  ? 103.311 34.840  10.091 1.00 52.21 ? 160 SER D CB   1 
ATOM   4984 O OG   . SER D 2 22  ? 102.041 35.476  9.995  1.00 51.07 ? 160 SER D OG   1 
ATOM   4985 H H    . SER D 2 22  ? 103.242 35.067  6.913  1.00 0.00  ? 160 SER D H    1 
ATOM   4986 H HG   . SER D 2 22  ? 102.122 36.242  9.425  1.00 0.00  ? 160 SER D HG   1 
ATOM   4987 N N    . MET E 1 1   ? 58.223  -19.963 21.520 1.00 47.36 ? 1   MET E N    1 
ATOM   4988 C CA   . MET E 1 1   ? 57.868  -18.575 21.787 1.00 43.68 ? 1   MET E CA   1 
ATOM   4989 C C    . MET E 1 1   ? 58.898  -17.848 22.639 1.00 39.27 ? 1   MET E C    1 
ATOM   4990 O O    . MET E 1 1   ? 59.381  -18.378 23.642 1.00 35.37 ? 1   MET E O    1 
ATOM   4991 C CB   . MET E 1 1   ? 56.509  -18.487 22.478 1.00 47.94 ? 1   MET E CB   1 
ATOM   4992 C CG   . MET E 1 1   ? 56.062  -17.055 22.725 1.00 51.88 ? 1   MET E CG   1 
ATOM   4993 S SD   . MET E 1 1   ? 55.929  -16.613 24.457 1.00 53.65 ? 1   MET E SD   1 
ATOM   4994 C CE   . MET E 1 1   ? 54.219  -16.170 24.522 1.00 50.43 ? 1   MET E CE   1 
ATOM   4995 H H    . MET E 1 1   ? 59.169  -20.214 21.468 1.00 0.00  ? 1   MET E H    1 
ATOM   4996 N N    . PHE E 1 2   ? 59.203  -16.620 22.238 1.00 34.48 ? 2   PHE E N    1 
ATOM   4997 C CA   . PHE E 1 2   ? 60.160  -15.779 22.942 1.00 26.52 ? 2   PHE E CA   1 
ATOM   4998 C C    . PHE E 1 2   ? 59.460  -14.607 23.627 1.00 23.72 ? 2   PHE E C    1 
ATOM   4999 O O    . PHE E 1 2   ? 58.645  -13.915 23.021 1.00 23.27 ? 2   PHE E O    1 
ATOM   5000 C CB   . PHE E 1 2   ? 61.216  -15.255 21.961 1.00 22.26 ? 2   PHE E CB   1 
ATOM   5001 C CG   . PHE E 1 2   ? 61.936  -14.028 22.439 1.00 19.79 ? 2   PHE E CG   1 
ATOM   5002 C CD1  . PHE E 1 2   ? 62.743  -14.077 23.568 1.00 22.25 ? 2   PHE E CD1  1 
ATOM   5003 C CD2  . PHE E 1 2   ? 61.792  -12.819 21.770 1.00 14.77 ? 2   PHE E CD2  1 
ATOM   5004 C CE1  . PHE E 1 2   ? 63.398  -12.937 24.027 1.00 23.74 ? 2   PHE E CE1  1 
ATOM   5005 C CE2  . PHE E 1 2   ? 62.438  -11.681 22.218 1.00 18.36 ? 2   PHE E CE2  1 
ATOM   5006 C CZ   . PHE E 1 2   ? 63.246  -11.740 23.354 1.00 19.55 ? 2   PHE E CZ   1 
ATOM   5007 H H    . PHE E 1 2   ? 58.760  -16.258 21.448 1.00 0.00  ? 2   PHE E H    1 
ATOM   5008 N N    . GLU E 1 3   ? 59.795  -14.387 24.889 1.00 18.96 ? 3   GLU E N    1 
ATOM   5009 C CA   . GLU E 1 3   ? 59.235  -13.293 25.661 1.00 17.27 ? 3   GLU E CA   1 
ATOM   5010 C C    . GLU E 1 3   ? 60.257  -12.925 26.705 1.00 18.18 ? 3   GLU E C    1 
ATOM   5011 O O    . GLU E 1 3   ? 60.672  -13.763 27.504 1.00 26.15 ? 3   GLU E O    1 
ATOM   5012 C CB   . GLU E 1 3   ? 57.932  -13.691 26.347 1.00 20.17 ? 3   GLU E CB   1 
ATOM   5013 C CG   . GLU E 1 3   ? 57.322  -12.573 27.189 1.00 21.20 ? 3   GLU E CG   1 
ATOM   5014 C CD   . GLU E 1 3   ? 55.935  -12.909 27.697 1.00 23.41 ? 3   GLU E CD   1 
ATOM   5015 O OE1  . GLU E 1 3   ? 55.834  -13.608 28.727 1.00 30.15 ? 3   GLU E OE1  1 
ATOM   5016 O OE2  . GLU E 1 3   ? 54.944  -12.470 27.070 1.00 24.73 ? 3   GLU E OE2  1 
ATOM   5017 H H    . GLU E 1 3   ? 60.454  -14.975 25.319 1.00 0.00  ? 3   GLU E H    1 
ATOM   5018 N N    . ALA E 1 4   ? 60.694  -11.677 26.662 1.00 18.80 ? 4   ALA E N    1 
ATOM   5019 C CA   . ALA E 1 4   ? 61.675  -11.170 27.603 1.00 18.39 ? 4   ALA E CA   1 
ATOM   5020 C C    . ALA E 1 4   ? 61.104  -9.891  28.203 1.00 23.06 ? 4   ALA E C    1 
ATOM   5021 O O    . ALA E 1 4   ? 60.479  -9.093  27.501 1.00 27.69 ? 4   ALA E O    1 
ATOM   5022 C CB   . ALA E 1 4   ? 62.986  -10.890 26.885 1.00 10.26 ? 4   ALA E CB   1 
ATOM   5023 H H    . ALA E 1 4   ? 60.338  -11.070 25.986 1.00 0.00  ? 4   ALA E H    1 
ATOM   5024 N N    . ARG E 1 5   ? 61.292  -9.711  29.504 1.00 25.18 ? 5   ARG E N    1 
ATOM   5025 C CA   . ARG E 1 5   ? 60.794  -8.538  30.197 1.00 18.60 ? 5   ARG E CA   1 
ATOM   5026 C C    . ARG E 1 5   ? 61.961  -7.818  30.840 1.00 22.64 ? 5   ARG E C    1 
ATOM   5027 O O    . ARG E 1 5   ? 62.641  -8.366  31.720 1.00 26.51 ? 5   ARG E O    1 
ATOM   5028 C CB   . ARG E 1 5   ? 59.790  -8.950  31.262 1.00 16.15 ? 5   ARG E CB   1 
ATOM   5029 C CG   . ARG E 1 5   ? 59.327  -7.819  32.158 1.00 20.56 ? 5   ARG E CG   1 
ATOM   5030 C CD   . ARG E 1 5   ? 58.413  -8.363  33.240 1.00 25.20 ? 5   ARG E CD   1 
ATOM   5031 N NE   . ARG E 1 5   ? 58.138  -7.380  34.280 1.00 29.58 ? 5   ARG E NE   1 
ATOM   5032 C CZ   . ARG E 1 5   ? 57.045  -6.626  34.319 1.00 32.31 ? 5   ARG E CZ   1 
ATOM   5033 N NH1  . ARG E 1 5   ? 56.121  -6.748  33.375 1.00 29.29 ? 5   ARG E NH1  1 
ATOM   5034 N NH2  . ARG E 1 5   ? 56.885  -5.741  35.295 1.00 32.40 ? 5   ARG E NH2  1 
ATOM   5035 H H    . ARG E 1 5   ? 61.805  -10.353 30.013 1.00 0.00  ? 5   ARG E H    1 
ATOM   5036 H HE   . ARG E 1 5   ? 58.803  -7.272  34.993 1.00 0.00  ? 5   ARG E HE   1 
ATOM   5037 H HH11 . ARG E 1 5   ? 56.255  -7.404  32.634 1.00 0.00  ? 5   ARG E HH11 1 
ATOM   5038 H HH12 . ARG E 1 5   ? 55.296  -6.182  33.398 1.00 0.00  ? 5   ARG E HH12 1 
ATOM   5039 H HH21 . ARG E 1 5   ? 57.585  -5.648  36.003 1.00 0.00  ? 5   ARG E HH21 1 
ATOM   5040 H HH22 . ARG E 1 5   ? 56.059  -5.180  35.325 1.00 0.00  ? 5   ARG E HH22 1 
ATOM   5041 N N    . LEU E 1 6   ? 62.219  -6.610  30.355 1.00 23.07 ? 6   LEU E N    1 
ATOM   5042 C CA   . LEU E 1 6   ? 63.293  -5.772  30.865 1.00 22.21 ? 6   LEU E CA   1 
ATOM   5043 C C    . LEU E 1 6   ? 62.656  -4.625  31.642 1.00 25.47 ? 6   LEU E C    1 
ATOM   5044 O O    . LEU E 1 6   ? 61.986  -3.755  31.075 1.00 27.18 ? 6   LEU E O    1 
ATOM   5045 C CB   . LEU E 1 6   ? 64.146  -5.229  29.717 1.00 19.54 ? 6   LEU E CB   1 
ATOM   5046 C CG   . LEU E 1 6   ? 65.359  -4.375  30.087 1.00 13.58 ? 6   LEU E CG   1 
ATOM   5047 C CD1  . LEU E 1 6   ? 66.321  -5.178  30.929 1.00 15.21 ? 6   LEU E CD1  1 
ATOM   5048 C CD2  . LEU E 1 6   ? 66.038  -3.904  28.829 1.00 13.70 ? 6   LEU E CD2  1 
ATOM   5049 H H    . LEU E 1 6   ? 61.645  -6.251  29.650 1.00 0.00  ? 6   LEU E H    1 
ATOM   5050 N N    . VAL E 1 7   ? 62.824  -4.654  32.955 1.00 24.34 ? 7   VAL E N    1 
ATOM   5051 C CA   . VAL E 1 7   ? 62.258  -3.616  33.783 1.00 24.80 ? 7   VAL E CA   1 
ATOM   5052 C C    . VAL E 1 7   ? 62.930  -2.283  33.441 1.00 26.25 ? 7   VAL E C    1 
ATOM   5053 O O    . VAL E 1 7   ? 62.284  -1.236  33.455 1.00 28.53 ? 7   VAL E O    1 
ATOM   5054 C CB   . VAL E 1 7   ? 62.384  -3.973  35.278 1.00 24.00 ? 7   VAL E CB   1 
ATOM   5055 C CG1  . VAL E 1 7   ? 61.676  -2.928  36.138 1.00 23.70 ? 7   VAL E CG1  1 
ATOM   5056 C CG2  . VAL E 1 7   ? 61.782  -5.352  35.526 1.00 15.45 ? 7   VAL E CG2  1 
ATOM   5057 H H    . VAL E 1 7   ? 63.323  -5.387  33.367 1.00 0.00  ? 7   VAL E H    1 
ATOM   5058 N N    . GLN E 1 8   ? 64.208  -2.336  33.072 1.00 26.22 ? 8   GLN E N    1 
ATOM   5059 C CA   . GLN E 1 8   ? 64.935  -1.128  32.703 1.00 29.96 ? 8   GLN E CA   1 
ATOM   5060 C C    . GLN E 1 8   ? 64.828  -0.871  31.199 1.00 30.21 ? 8   GLN E C    1 
ATOM   5061 O O    . GLN E 1 8   ? 65.796  -1.068  30.460 1.00 33.66 ? 8   GLN E O    1 
ATOM   5062 C CB   . GLN E 1 8   ? 66.406  -1.236  33.109 1.00 35.24 ? 8   GLN E CB   1 
ATOM   5063 C CG   . GLN E 1 8   ? 66.660  -1.012  34.584 1.00 42.36 ? 8   GLN E CG   1 
ATOM   5064 C CD   . GLN E 1 8   ? 67.740  0.026   34.852 1.00 46.35 ? 8   GLN E CD   1 
ATOM   5065 O OE1  . GLN E 1 8   ? 68.361  0.559   33.926 1.00 48.02 ? 8   GLN E OE1  1 
ATOM   5066 N NE2  . GLN E 1 8   ? 67.971  0.318   36.127 1.00 47.00 ? 8   GLN E NE2  1 
ATOM   5067 H H    . GLN E 1 8   ? 64.662  -3.198  33.019 1.00 0.00  ? 8   GLN E H    1 
ATOM   5068 H HE21 . GLN E 1 8   ? 68.673  0.972   36.316 1.00 0.00  ? 8   GLN E HE21 1 
ATOM   5069 H HE22 . GLN E 1 8   ? 67.440  -0.140  36.809 1.00 0.00  ? 8   GLN E HE22 1 
ATOM   5070 N N    . GLY E 1 9   ? 63.656  -0.427  30.749 1.00 30.18 ? 9   GLY E N    1 
ATOM   5071 C CA   . GLY E 1 9   ? 63.450  -0.162  29.336 1.00 29.80 ? 9   GLY E CA   1 
ATOM   5072 C C    . GLY E 1 9   ? 64.516  0.729   28.721 1.00 33.22 ? 9   GLY E C    1 
ATOM   5073 O O    . GLY E 1 9   ? 65.018  0.454   27.621 1.00 31.45 ? 9   GLY E O    1 
ATOM   5074 H H    . GLY E 1 9   ? 62.900  -0.267  31.362 1.00 0.00  ? 9   GLY E H    1 
ATOM   5075 N N    . SER E 1 10  ? 64.899  1.765   29.465 1.00 28.00 ? 10  SER E N    1 
ATOM   5076 C CA   . SER E 1 10  ? 65.906  2.728   29.040 1.00 27.07 ? 10  SER E CA   1 
ATOM   5077 C C    . SER E 1 10  ? 67.129  2.082   28.378 1.00 29.39 ? 10  SER E C    1 
ATOM   5078 O O    . SER E 1 10  ? 67.672  2.628   27.414 1.00 26.31 ? 10  SER E O    1 
ATOM   5079 C CB   . SER E 1 10  ? 66.351  3.554   30.240 1.00 25.24 ? 10  SER E CB   1 
ATOM   5080 O OG   . SER E 1 10  ? 66.964  2.717   31.204 1.00 26.63 ? 10  SER E OG   1 
ATOM   5081 H H    . SER E 1 10  ? 64.497  1.903   30.346 1.00 0.00  ? 10  SER E H    1 
ATOM   5082 H HG   . SER E 1 10  ? 67.911  2.816   31.044 1.00 0.00  ? 10  SER E HG   1 
ATOM   5083 N N    . ILE E 1 11  ? 67.545  0.920   28.887 1.00 28.17 ? 11  ILE E N    1 
ATOM   5084 C CA   . ILE E 1 11  ? 68.697  0.197   28.347 1.00 21.69 ? 11  ILE E CA   1 
ATOM   5085 C C    . ILE E 1 11  ? 68.499  -0.106  26.875 1.00 19.81 ? 11  ILE E C    1 
ATOM   5086 O O    . ILE E 1 11  ? 69.331  0.237   26.034 1.00 19.25 ? 11  ILE E O    1 
ATOM   5087 C CB   . ILE E 1 11  ? 68.932  -1.149  29.080 1.00 17.48 ? 11  ILE E CB   1 
ATOM   5088 C CG1  . ILE E 1 11  ? 69.481  -0.893  30.483 1.00 16.19 ? 11  ILE E CG1  1 
ATOM   5089 C CG2  . ILE E 1 11  ? 69.876  -2.046  28.276 1.00 9.89  ? 11  ILE E CG2  1 
ATOM   5090 C CD1  . ILE E 1 11  ? 69.704  -2.157  31.293 1.00 13.15 ? 11  ILE E CD1  1 
ATOM   5091 H H    . ILE E 1 11  ? 67.060  0.546   29.654 1.00 0.00  ? 11  ILE E H    1 
ATOM   5092 N N    . LEU E 1 12  ? 67.377  -0.739  26.576 1.00 18.73 ? 12  LEU E N    1 
ATOM   5093 C CA   . LEU E 1 12  ? 67.049  -1.126  25.219 1.00 18.01 ? 12  LEU E CA   1 
ATOM   5094 C C    . LEU E 1 12  ? 66.841  0.118   24.341 1.00 24.84 ? 12  LEU E C    1 
ATOM   5095 O O    . LEU E 1 12  ? 67.041  0.069   23.124 1.00 31.65 ? 12  LEU E O    1 
ATOM   5096 C CB   . LEU E 1 12  ? 65.820  -2.026  25.259 1.00 16.50 ? 12  LEU E CB   1 
ATOM   5097 C CG   . LEU E 1 12  ? 65.474  -2.939  24.095 1.00 22.78 ? 12  LEU E CG   1 
ATOM   5098 C CD1  . LEU E 1 12  ? 66.723  -3.531  23.468 1.00 24.49 ? 12  LEU E CD1  1 
ATOM   5099 C CD2  . LEU E 1 12  ? 64.556  -4.030  24.639 1.00 21.69 ? 12  LEU E CD2  1 
ATOM   5100 H H    . LEU E 1 12  ? 66.739  -0.927  27.299 1.00 0.00  ? 12  LEU E H    1 
ATOM   5101 N N    . LYS E 1 13  ? 66.467  1.236   24.963 1.00 20.19 ? 13  LYS E N    1 
ATOM   5102 C CA   . LYS E 1 13  ? 66.281  2.497   24.246 1.00 13.89 ? 13  LYS E CA   1 
ATOM   5103 C C    . LYS E 1 13  ? 67.656  3.009   23.822 1.00 17.34 ? 13  LYS E C    1 
ATOM   5104 O O    . LYS E 1 13  ? 67.879  3.389   22.663 1.00 18.97 ? 13  LYS E O    1 
ATOM   5105 C CB   . LYS E 1 13  ? 65.605  3.527   25.150 1.00 16.70 ? 13  LYS E CB   1 
ATOM   5106 C CG   . LYS E 1 13  ? 64.107  3.313   25.327 1.00 17.69 ? 13  LYS E CG   1 
ATOM   5107 C CD   . LYS E 1 13  ? 63.523  4.246   26.376 1.00 21.67 ? 13  LYS E CD   1 
ATOM   5108 C CE   . LYS E 1 13  ? 63.672  5.710   25.997 1.00 21.62 ? 13  LYS E CE   1 
ATOM   5109 N NZ   . LYS E 1 13  ? 62.926  6.063   24.761 1.00 25.56 ? 13  LYS E NZ   1 
ATOM   5110 H H    . LYS E 1 13  ? 66.297  1.201   25.928 1.00 0.00  ? 13  LYS E H    1 
ATOM   5111 H HZ1  . LYS E 1 13  ? 61.915  5.855   24.871 1.00 0.00  ? 13  LYS E HZ1  1 
ATOM   5112 H HZ2  . LYS E 1 13  ? 63.054  7.078   24.562 1.00 0.00  ? 13  LYS E HZ2  1 
ATOM   5113 H HZ3  . LYS E 1 13  ? 63.305  5.514   23.965 1.00 0.00  ? 13  LYS E HZ3  1 
ATOM   5114 N N    . LYS E 1 14  ? 68.589  2.970   24.766 1.00 18.11 ? 14  LYS E N    1 
ATOM   5115 C CA   . LYS E 1 14  ? 69.956  3.401   24.532 1.00 15.42 ? 14  LYS E CA   1 
ATOM   5116 C C    . LYS E 1 14  ? 70.665  2.512   23.526 1.00 14.92 ? 14  LYS E C    1 
ATOM   5117 O O    . LYS E 1 14  ? 71.347  3.012   22.633 1.00 20.65 ? 14  LYS E O    1 
ATOM   5118 C CB   . LYS E 1 14  ? 70.736  3.425   25.842 1.00 17.04 ? 14  LYS E CB   1 
ATOM   5119 C CG   . LYS E 1 14  ? 70.131  4.354   26.870 1.00 23.53 ? 14  LYS E CG   1 
ATOM   5120 C CD   . LYS E 1 14  ? 70.805  4.249   28.212 1.00 24.55 ? 14  LYS E CD   1 
ATOM   5121 C CE   . LYS E 1 14  ? 70.098  5.154   29.194 1.00 28.05 ? 14  LYS E CE   1 
ATOM   5122 N NZ   . LYS E 1 14  ? 70.698  5.086   30.546 1.00 38.13 ? 14  LYS E NZ   1 
ATOM   5123 H H    . LYS E 1 14  ? 68.348  2.645   25.656 1.00 0.00  ? 14  LYS E H    1 
ATOM   5124 H HZ1  . LYS E 1 14  ? 70.649  4.107   30.895 1.00 0.00  ? 14  LYS E HZ1  1 
ATOM   5125 H HZ2  . LYS E 1 14  ? 71.690  5.389   30.482 1.00 0.00  ? 14  LYS E HZ2  1 
ATOM   5126 H HZ3  . LYS E 1 14  ? 70.176  5.716   31.189 1.00 0.00  ? 14  LYS E HZ3  1 
ATOM   5127 N N    . VAL E 1 15  ? 70.475  1.201   23.632 1.00 14.79 ? 15  VAL E N    1 
ATOM   5128 C CA   . VAL E 1 15  ? 71.138  0.285   22.703 1.00 17.44 ? 15  VAL E CA   1 
ATOM   5129 C C    . VAL E 1 15  ? 70.816  0.654   21.261 1.00 12.98 ? 15  VAL E C    1 
ATOM   5130 O O    . VAL E 1 15  ? 71.714  0.757   20.427 1.00 17.97 ? 15  VAL E O    1 
ATOM   5131 C CB   . VAL E 1 15  ? 70.782  -1.213  22.964 1.00 16.01 ? 15  VAL E CB   1 
ATOM   5132 C CG1  . VAL E 1 15  ? 71.402  -2.099  21.887 1.00 14.58 ? 15  VAL E CG1  1 
ATOM   5133 C CG2  . VAL E 1 15  ? 71.299  -1.653  24.319 1.00 13.18 ? 15  VAL E CG2  1 
ATOM   5134 H H    . VAL E 1 15  ? 69.894  0.852   24.336 1.00 0.00  ? 15  VAL E H    1 
ATOM   5135 N N    . LEU E 1 16  ? 69.554  0.955   20.989 1.00 13.27 ? 16  LEU E N    1 
ATOM   5136 C CA   . LEU E 1 16  ? 69.168  1.291   19.633 1.00 15.31 ? 16  LEU E CA   1 
ATOM   5137 C C    . LEU E 1 16  ? 69.564  2.662   19.104 1.00 12.16 ? 16  LEU E C    1 
ATOM   5138 O O    . LEU E 1 16  ? 69.705  2.839   17.899 1.00 10.12 ? 16  LEU E O    1 
ATOM   5139 C CB   . LEU E 1 16  ? 67.701  0.968   19.380 1.00 12.91 ? 16  LEU E CB   1 
ATOM   5140 C CG   . LEU E 1 16  ? 67.696  -0.491  18.924 1.00 10.75 ? 16  LEU E CG   1 
ATOM   5141 C CD1  . LEU E 1 16  ? 67.266  -1.387  20.054 1.00 8.25  ? 16  LEU E CD1  1 
ATOM   5142 C CD2  . LEU E 1 16  ? 66.814  -0.655  17.717 1.00 11.66 ? 16  LEU E CD2  1 
ATOM   5143 H H    . LEU E 1 16  ? 68.877  0.944   21.700 1.00 0.00  ? 16  LEU E H    1 
ATOM   5144 N N    . GLU E 1 17  ? 69.768  3.628   19.987 1.00 15.97 ? 17  GLU E N    1 
ATOM   5145 C CA   . GLU E 1 17  ? 70.206  4.945   19.538 1.00 17.07 ? 17  GLU E CA   1 
ATOM   5146 C C    . GLU E 1 17  ? 71.700  4.859   19.203 1.00 16.59 ? 17  GLU E C    1 
ATOM   5147 O O    . GLU E 1 17  ? 72.228  5.649   18.418 1.00 19.89 ? 17  GLU E O    1 
ATOM   5148 C CB   . GLU E 1 17  ? 69.954  5.990   20.622 1.00 19.62 ? 17  GLU E CB   1 
ATOM   5149 C CG   . GLU E 1 17  ? 68.494  6.387   20.757 1.00 30.60 ? 17  GLU E CG   1 
ATOM   5150 C CD   . GLU E 1 17  ? 67.997  7.188   19.560 1.00 40.03 ? 17  GLU E CD   1 
ATOM   5151 O OE1  . GLU E 1 17  ? 67.560  6.578   18.562 1.00 40.75 ? 17  GLU E OE1  1 
ATOM   5152 O OE2  . GLU E 1 17  ? 68.044  8.435   19.615 1.00 45.21 ? 17  GLU E OE2  1 
ATOM   5153 H H    . GLU E 1 17  ? 69.639  3.448   20.942 1.00 0.00  ? 17  GLU E H    1 
ATOM   5154 N N    . ALA E 1 18  ? 72.349  3.849   19.771 1.00 12.23 ? 18  ALA E N    1 
ATOM   5155 C CA   . ALA E 1 18  ? 73.761  3.596   19.584 1.00 8.98  ? 18  ALA E CA   1 
ATOM   5156 C C    . ALA E 1 18  ? 74.067  2.705   18.385 1.00 15.22 ? 18  ALA E C    1 
ATOM   5157 O O    . ALA E 1 18  ? 75.232  2.502   18.051 1.00 26.84 ? 18  ALA E O    1 
ATOM   5158 C CB   . ALA E 1 18  ? 74.324  2.962   20.842 1.00 8.08  ? 18  ALA E CB   1 
ATOM   5159 H H    . ALA E 1 18  ? 71.866  3.244   20.371 1.00 0.00  ? 18  ALA E H    1 
ATOM   5160 N N    . LEU E 1 19  ? 73.042  2.169   17.733 1.00 18.42 ? 19  LEU E N    1 
ATOM   5161 C CA   . LEU E 1 19  ? 73.262  1.285   16.589 1.00 14.54 ? 19  LEU E CA   1 
ATOM   5162 C C    . LEU E 1 19  ? 72.695  1.787   15.273 1.00 14.14 ? 19  LEU E C    1 
ATOM   5163 O O    . LEU E 1 19  ? 73.394  1.793   14.259 1.00 10.93 ? 19  LEU E O    1 
ATOM   5164 C CB   . LEU E 1 19  ? 72.666  -0.096  16.871 1.00 13.88 ? 19  LEU E CB   1 
ATOM   5165 C CG   . LEU E 1 19  ? 73.191  -0.803  18.119 1.00 21.67 ? 19  LEU E CG   1 
ATOM   5166 C CD1  . LEU E 1 19  ? 72.433  -2.104  18.360 1.00 17.85 ? 19  LEU E CD1  1 
ATOM   5167 C CD2  . LEU E 1 19  ? 74.686  -1.053  17.965 1.00 20.97 ? 19  LEU E CD2  1 
ATOM   5168 H H    . LEU E 1 19  ? 72.131  2.368   18.026 1.00 0.00  ? 19  LEU E H    1 
ATOM   5169 N N    . LYS E 1 20  ? 71.433  2.211   15.314 1.00 16.93 ? 20  LYS E N    1 
ATOM   5170 C CA   . LYS E 1 20  ? 70.671  2.675   14.150 1.00 23.12 ? 20  LYS E CA   1 
ATOM   5171 C C    . LYS E 1 20  ? 71.423  3.438   13.066 1.00 23.46 ? 20  LYS E C    1 
ATOM   5172 O O    . LYS E 1 20  ? 71.242  3.168   11.881 1.00 31.32 ? 20  LYS E O    1 
ATOM   5173 C CB   . LYS E 1 20  ? 69.435  3.483   14.592 1.00 24.44 ? 20  LYS E CB   1 
ATOM   5174 C CG   . LYS E 1 20  ? 69.778  4.800   15.264 1.00 28.54 ? 20  LYS E CG   1 
ATOM   5175 C CD   . LYS E 1 20  ? 68.600  5.736   15.371 1.00 28.42 ? 20  LYS E CD   1 
ATOM   5176 C CE   . LYS E 1 20  ? 69.090  7.101   15.834 1.00 36.38 ? 20  LYS E CE   1 
ATOM   5177 N NZ   . LYS E 1 20  ? 67.991  8.042   16.169 1.00 42.21 ? 20  LYS E NZ   1 
ATOM   5178 H H    . LYS E 1 20  ? 70.983  2.230   16.184 1.00 0.00  ? 20  LYS E H    1 
ATOM   5179 H HZ1  . LYS E 1 20  ? 67.411  7.632   16.929 1.00 0.00  ? 20  LYS E HZ1  1 
ATOM   5180 H HZ2  . LYS E 1 20  ? 68.385  8.946   16.503 1.00 0.00  ? 20  LYS E HZ2  1 
ATOM   5181 H HZ3  . LYS E 1 20  ? 67.390  8.198   15.336 1.00 0.00  ? 20  LYS E HZ3  1 
ATOM   5182 N N    . ASP E 1 21  ? 72.242  4.403   13.461 1.00 22.04 ? 21  ASP E N    1 
ATOM   5183 C CA   . ASP E 1 21  ? 72.983  5.186   12.491 1.00 19.77 ? 21  ASP E CA   1 
ATOM   5184 C C    . ASP E 1 21  ? 74.133  4.433   11.837 1.00 24.34 ? 21  ASP E C    1 
ATOM   5185 O O    . ASP E 1 21  ? 74.451  4.689   10.679 1.00 33.94 ? 21  ASP E O    1 
ATOM   5186 C CB   . ASP E 1 21  ? 73.465  6.500   13.109 1.00 27.58 ? 21  ASP E CB   1 
ATOM   5187 C CG   . ASP E 1 21  ? 72.350  7.545   13.213 1.00 33.16 ? 21  ASP E CG   1 
ATOM   5188 O OD1  . ASP E 1 21  ? 71.587  7.721   12.231 1.00 32.74 ? 21  ASP E OD1  1 
ATOM   5189 O OD2  . ASP E 1 21  ? 72.235  8.195   14.275 1.00 38.95 ? 21  ASP E OD2  1 
ATOM   5190 H H    . ASP E 1 21  ? 72.321  4.566   14.421 1.00 0.00  ? 21  ASP E H    1 
ATOM   5191 N N    . LEU E 1 22  ? 74.761  3.513   12.564 1.00 19.61 ? 22  LEU E N    1 
ATOM   5192 C CA   . LEU E 1 22  ? 75.866  2.744   11.999 1.00 16.99 ? 22  LEU E CA   1 
ATOM   5193 C C    . LEU E 1 22  ? 75.348  1.542   11.210 1.00 18.51 ? 22  LEU E C    1 
ATOM   5194 O O    . LEU E 1 22  ? 75.903  1.191   10.164 1.00 19.67 ? 22  LEU E O    1 
ATOM   5195 C CB   . LEU E 1 22  ? 76.849  2.298   13.089 1.00 17.98 ? 22  LEU E CB   1 
ATOM   5196 C CG   . LEU E 1 22  ? 78.135  1.579   12.650 1.00 15.63 ? 22  LEU E CG   1 
ATOM   5197 C CD1  . LEU E 1 22  ? 78.945  2.464   11.722 1.00 8.22  ? 22  LEU E CD1  1 
ATOM   5198 C CD2  . LEU E 1 22  ? 78.964  1.181   13.874 1.00 16.73 ? 22  LEU E CD2  1 
ATOM   5199 H H    . LEU E 1 22  ? 74.459  3.345   13.480 1.00 0.00  ? 22  LEU E H    1 
ATOM   5200 N N    . ILE E 1 23  ? 74.307  0.891   11.719 1.00 16.58 ? 23  ILE E N    1 
ATOM   5201 C CA   . ILE E 1 23  ? 73.714  -0.254  11.028 1.00 16.81 ? 23  ILE E CA   1 
ATOM   5202 C C    . ILE E 1 23  ? 72.188  -0.062  10.913 1.00 18.49 ? 23  ILE E C    1 
ATOM   5203 O O    . ILE E 1 23  ? 71.498  0.169   11.907 1.00 16.49 ? 23  ILE E O    1 
ATOM   5204 C CB   . ILE E 1 23  ? 74.082  -1.614  11.701 1.00 15.82 ? 23  ILE E CB   1 
ATOM   5205 C CG1  . ILE E 1 23  ? 73.672  -1.626  13.171 1.00 18.62 ? 23  ILE E CG1  1 
ATOM   5206 C CG2  . ILE E 1 23  ? 75.582  -1.884  11.576 1.00 7.89  ? 23  ILE E CG2  1 
ATOM   5207 C CD1  . ILE E 1 23  ? 74.078  -2.889  13.912 1.00 25.89 ? 23  ILE E CD1  1 
ATOM   5208 H H    . ILE E 1 23  ? 73.896  1.196   12.555 1.00 0.00  ? 23  ILE E H    1 
ATOM   5209 N N    . ASN E 1 24  ? 71.685  -0.115  9.682  1.00 22.21 ? 24  ASN E N    1 
ATOM   5210 C CA   . ASN E 1 24  ? 70.262  0.080   9.399  1.00 26.26 ? 24  ASN E CA   1 
ATOM   5211 C C    . ASN E 1 24  ? 69.443  -1.206  9.454  1.00 22.34 ? 24  ASN E C    1 
ATOM   5212 O O    . ASN E 1 24  ? 68.274  -1.174  9.814  1.00 26.70 ? 24  ASN E O    1 
ATOM   5213 C CB   . ASN E 1 24  ? 70.080  0.737   8.025  1.00 30.51 ? 24  ASN E CB   1 
ATOM   5214 C CG   . ASN E 1 24  ? 71.051  1.898   7.789  1.00 35.77 ? 24  ASN E CG   1 
ATOM   5215 O OD1  . ASN E 1 24  ? 71.242  2.760   8.649  1.00 36.06 ? 24  ASN E OD1  1 
ATOM   5216 N ND2  . ASN E 1 24  ? 71.671  1.915   6.615  1.00 38.07 ? 24  ASN E ND2  1 
ATOM   5217 H H    . ASN E 1 24  ? 72.306  -0.279  8.947  1.00 0.00  ? 24  ASN E H    1 
ATOM   5218 H HD21 . ASN E 1 24  ? 72.292  2.665   6.478  1.00 0.00  ? 24  ASN E HD21 1 
ATOM   5219 H HD22 . ASN E 1 24  ? 71.494  1.222   5.946  1.00 0.00  ? 24  ASN E HD22 1 
ATOM   5220 N N    . GLU E 1 25  ? 70.051  -2.325  9.067  1.00 26.58 ? 25  GLU E N    1 
ATOM   5221 C CA   . GLU E 1 25  ? 69.393  -3.637  9.075  1.00 27.32 ? 25  GLU E CA   1 
ATOM   5222 C C    . GLU E 1 25  ? 70.300  -4.656  9.774  1.00 25.65 ? 25  GLU E C    1 
ATOM   5223 O O    . GLU E 1 25  ? 71.493  -4.748  9.472  1.00 19.81 ? 25  GLU E O    1 
ATOM   5224 C CB   . GLU E 1 25  ? 69.165  -4.137  7.653  1.00 33.15 ? 25  GLU E CB   1 
ATOM   5225 C CG   . GLU E 1 25  ? 68.591  -3.140  6.691  1.00 42.44 ? 25  GLU E CG   1 
ATOM   5226 C CD   . GLU E 1 25  ? 68.807  -3.557  5.247  1.00 50.35 ? 25  GLU E CD   1 
ATOM   5227 O OE1  . GLU E 1 25  ? 69.750  -4.343  4.983  1.00 52.61 ? 25  GLU E OE1  1 
ATOM   5228 O OE2  . GLU E 1 25  ? 68.041  -3.090  4.376  1.00 54.37 ? 25  GLU E OE2  1 
ATOM   5229 H H    . GLU E 1 25  ? 70.990  -2.324  8.788  1.00 0.00  ? 25  GLU E H    1 
ATOM   5230 N N    . ALA E 1 26  ? 69.727  -5.472  10.648 1.00 19.38 ? 26  ALA E N    1 
ATOM   5231 C CA   . ALA E 1 26  ? 70.521  -6.456  11.362 1.00 19.18 ? 26  ALA E CA   1 
ATOM   5232 C C    . ALA E 1 26  ? 69.705  -7.641  11.835 1.00 17.50 ? 26  ALA E C    1 
ATOM   5233 O O    . ALA E 1 26  ? 68.483  -7.573  11.958 1.00 17.73 ? 26  ALA E O    1 
ATOM   5234 C CB   . ALA E 1 26  ? 71.229  -5.803  12.540 1.00 20.79 ? 26  ALA E CB   1 
ATOM   5235 H H    . ALA E 1 26  ? 68.757  -5.440  10.797 1.00 0.00  ? 26  ALA E H    1 
ATOM   5236 N N    . CYS E 1 27  ? 70.397  -8.737  12.092 1.00 18.81 ? 27  CYS E N    1 
ATOM   5237 C CA   . CYS E 1 27  ? 69.762  -9.955  12.551 1.00 17.85 ? 27  CYS E CA   1 
ATOM   5238 C C    . CYS E 1 27  ? 69.844  -10.063 14.076 1.00 16.87 ? 27  CYS E C    1 
ATOM   5239 O O    . CYS E 1 27  ? 70.910  -9.876  14.675 1.00 16.96 ? 27  CYS E O    1 
ATOM   5240 C CB   . CYS E 1 27  ? 70.443  -11.159 11.889 1.00 14.18 ? 27  CYS E CB   1 
ATOM   5241 S SG   . CYS E 1 27  ? 69.739  -12.753 12.325 1.00 19.30 ? 27  CYS E SG   1 
ATOM   5242 H H    . CYS E 1 27  ? 71.372  -8.746  11.971 1.00 0.00  ? 27  CYS E H    1 
ATOM   5243 N N    . TRP E 1 28  ? 68.704  -10.320 14.704 1.00 14.66 ? 28  TRP E N    1 
ATOM   5244 C CA   . TRP E 1 28  ? 68.651  -10.479 16.145 1.00 11.32 ? 28  TRP E CA   1 
ATOM   5245 C C    . TRP E 1 28  ? 68.503  -11.962 16.487 1.00 16.68 ? 28  TRP E C    1 
ATOM   5246 O O    . TRP E 1 28  ? 67.425  -12.545 16.342 1.00 21.53 ? 28  TRP E O    1 
ATOM   5247 C CB   . TRP E 1 28  ? 67.491  -9.669  16.732 1.00 16.59 ? 28  TRP E CB   1 
ATOM   5248 C CG   . TRP E 1 28  ? 67.703  -8.181  16.651 1.00 13.90 ? 28  TRP E CG   1 
ATOM   5249 C CD1  . TRP E 1 28  ? 67.695  -7.420  15.531 1.00 19.83 ? 28  TRP E CD1  1 
ATOM   5250 C CD2  . TRP E 1 28  ? 67.996  -7.296  17.741 1.00 13.88 ? 28  TRP E CD2  1 
ATOM   5251 N NE1  . TRP E 1 28  ? 67.967  -6.112  15.842 1.00 14.84 ? 28  TRP E NE1  1 
ATOM   5252 C CE2  . TRP E 1 28  ? 68.150  -6.006  17.181 1.00 17.19 ? 28  TRP E CE2  1 
ATOM   5253 C CE3  . TRP E 1 28  ? 68.138  -7.463  19.113 1.00 19.77 ? 28  TRP E CE3  1 
ATOM   5254 C CZ2  . TRP E 1 28  ? 68.453  -4.890  17.974 1.00 21.36 ? 28  TRP E CZ2  1 
ATOM   5255 C CZ3  . TRP E 1 28  ? 68.440  -6.349  19.898 1.00 25.14 ? 28  TRP E CZ3  1 
ATOM   5256 C CH2  . TRP E 1 28  ? 68.589  -5.078  19.321 1.00 21.47 ? 28  TRP E CH2  1 
ATOM   5257 H H    . TRP E 1 28  ? 67.875  -10.396 14.186 1.00 0.00  ? 28  TRP E H    1 
ATOM   5258 H HE1  . TRP E 1 28  ? 68.034  -5.413  15.172 1.00 0.00  ? 28  TRP E HE1  1 
ATOM   5259 N N    . ASP E 1 29  ? 69.612  -12.598 16.838 1.00 17.26 ? 29  ASP E N    1 
ATOM   5260 C CA   . ASP E 1 29  ? 69.590  -14.003 17.210 1.00 11.87 ? 29  ASP E CA   1 
ATOM   5261 C C    . ASP E 1 29  ? 69.075  -14.046 18.642 1.00 20.84 ? 29  ASP E C    1 
ATOM   5262 O O    . ASP E 1 29  ? 69.547  -13.284 19.492 1.00 26.42 ? 29  ASP E O    1 
ATOM   5263 C CB   . ASP E 1 29  ? 70.999  -14.597 17.162 1.00 10.32 ? 29  ASP E CB   1 
ATOM   5264 C CG   . ASP E 1 29  ? 71.577  -14.654 15.748 1.00 15.45 ? 29  ASP E CG   1 
ATOM   5265 O OD1  . ASP E 1 29  ? 70.925  -15.220 14.843 1.00 16.00 ? 29  ASP E OD1  1 
ATOM   5266 O OD2  . ASP E 1 29  ? 72.707  -14.154 15.547 1.00 20.34 ? 29  ASP E OD2  1 
ATOM   5267 H H    . ASP E 1 29  ? 70.453  -12.095 16.875 1.00 0.00  ? 29  ASP E H    1 
ATOM   5268 N N    . ILE E 1 30  ? 68.083  -14.891 18.905 1.00 20.00 ? 30  ILE E N    1 
ATOM   5269 C CA   . ILE E 1 30  ? 67.521  -15.019 20.250 1.00 16.52 ? 30  ILE E CA   1 
ATOM   5270 C C    . ILE E 1 30  ? 67.757  -16.458 20.704 1.00 14.54 ? 30  ILE E C    1 
ATOM   5271 O O    . ILE E 1 30  ? 67.597  -17.397 19.921 1.00 16.75 ? 30  ILE E O    1 
ATOM   5272 C CB   . ILE E 1 30  ? 65.997  -14.703 20.269 1.00 15.38 ? 30  ILE E CB   1 
ATOM   5273 C CG1  . ILE E 1 30  ? 65.719  -13.384 19.555 1.00 10.34 ? 30  ILE E CG1  1 
ATOM   5274 C CG2  . ILE E 1 30  ? 65.498  -14.577 21.693 1.00 2.00  ? 30  ILE E CG2  1 
ATOM   5275 C CD1  . ILE E 1 30  ? 66.306  -12.196 20.251 1.00 21.17 ? 30  ILE E CD1  1 
ATOM   5276 H H    . ILE E 1 30  ? 67.724  -15.452 18.212 1.00 0.00  ? 30  ILE E H    1 
ATOM   5277 N N    . SER E 1 31  ? 68.122  -16.630 21.966 1.00 12.91 ? 31  SER E N    1 
ATOM   5278 C CA   . SER E 1 31  ? 68.403  -17.950 22.507 1.00 19.67 ? 31  SER E CA   1 
ATOM   5279 C C    . SER E 1 31  ? 68.198  -17.978 24.022 1.00 18.78 ? 31  SER E C    1 
ATOM   5280 O O    . SER E 1 31  ? 67.830  -16.982 24.633 1.00 16.07 ? 31  SER E O    1 
ATOM   5281 C CB   . SER E 1 31  ? 69.849  -18.335 22.172 1.00 27.13 ? 31  SER E CB   1 
ATOM   5282 O OG   . SER E 1 31  ? 70.209  -19.561 22.792 1.00 44.21 ? 31  SER E OG   1 
ATOM   5283 H H    . SER E 1 31  ? 68.185  -15.854 22.568 1.00 0.00  ? 31  SER E H    1 
ATOM   5284 H HG   . SER E 1 31  ? 69.793  -20.286 22.307 1.00 0.00  ? 31  SER E HG   1 
ATOM   5285 N N    . SER E 1 32  ? 68.457  -19.120 24.637 1.00 19.97 ? 32  SER E N    1 
ATOM   5286 C CA   . SER E 1 32  ? 68.296  -19.231 26.076 1.00 29.34 ? 32  SER E CA   1 
ATOM   5287 C C    . SER E 1 32  ? 69.330  -18.361 26.778 1.00 26.91 ? 32  SER E C    1 
ATOM   5288 O O    . SER E 1 32  ? 69.080  -17.839 27.860 1.00 26.22 ? 32  SER E O    1 
ATOM   5289 C CB   . SER E 1 32  ? 68.441  -20.687 26.503 1.00 34.31 ? 32  SER E CB   1 
ATOM   5290 O OG   . SER E 1 32  ? 67.503  -21.491 25.803 1.00 46.35 ? 32  SER E OG   1 
ATOM   5291 H H    . SER E 1 32  ? 68.801  -19.886 24.139 1.00 0.00  ? 32  SER E H    1 
ATOM   5292 H HG   . SER E 1 32  ? 67.538  -21.325 24.854 1.00 0.00  ? 32  SER E HG   1 
ATOM   5293 N N    . SER E 1 33  ? 70.479  -18.179 26.135 1.00 31.43 ? 33  SER E N    1 
ATOM   5294 C CA   . SER E 1 33  ? 71.550  -17.365 26.698 1.00 30.41 ? 33  SER E CA   1 
ATOM   5295 C C    . SER E 1 33  ? 71.212  -15.874 26.694 1.00 29.09 ? 33  SER E C    1 
ATOM   5296 O O    . SER E 1 33  ? 71.666  -15.128 27.570 1.00 31.88 ? 33  SER E O    1 
ATOM   5297 C CB   . SER E 1 33  ? 72.856  -17.622 25.943 1.00 26.23 ? 33  SER E CB   1 
ATOM   5298 O OG   . SER E 1 33  ? 72.663  -17.509 24.543 1.00 34.64 ? 33  SER E OG   1 
ATOM   5299 H H    . SER E 1 33  ? 70.652  -18.588 25.259 1.00 0.00  ? 33  SER E H    1 
ATOM   5300 H HG   . SER E 1 33  ? 72.689  -16.581 24.298 1.00 0.00  ? 33  SER E HG   1 
ATOM   5301 N N    . GLY E 1 34  ? 70.407  -15.444 25.724 1.00 23.16 ? 34  GLY E N    1 
ATOM   5302 C CA   . GLY E 1 34  ? 70.032  -14.044 25.639 1.00 16.69 ? 34  GLY E CA   1 
ATOM   5303 C C    . GLY E 1 34  ? 69.877  -13.598 24.203 1.00 11.33 ? 34  GLY E C    1 
ATOM   5304 O O    . GLY E 1 34  ? 69.637  -14.427 23.326 1.00 13.06 ? 34  GLY E O    1 
ATOM   5305 H H    . GLY E 1 34  ? 70.048  -16.050 25.046 1.00 0.00  ? 34  GLY E H    1 
ATOM   5306 N N    . VAL E 1 35  ? 70.037  -12.298 23.970 1.00 12.08 ? 35  VAL E N    1 
ATOM   5307 C CA   . VAL E 1 35  ? 69.917  -11.689 22.642 1.00 13.07 ? 35  VAL E CA   1 
ATOM   5308 C C    . VAL E 1 35  ? 71.305  -11.283 22.150 1.00 17.37 ? 35  VAL E C    1 
ATOM   5309 O O    . VAL E 1 35  ? 72.046  -10.602 22.861 1.00 20.80 ? 35  VAL E O    1 
ATOM   5310 C CB   . VAL E 1 35  ? 69.026  -10.424 22.687 1.00 14.49 ? 35  VAL E CB   1 
ATOM   5311 C CG1  . VAL E 1 35  ? 69.029  -9.732  21.356 1.00 4.93  ? 35  VAL E CG1  1 
ATOM   5312 C CG2  . VAL E 1 35  ? 67.592  -10.783 23.103 1.00 12.91 ? 35  VAL E CG2  1 
ATOM   5313 H H    . VAL E 1 35  ? 70.276  -11.711 24.720 1.00 0.00  ? 35  VAL E H    1 
ATOM   5314 N N    . ASN E 1 36  ? 71.642  -11.690 20.931 1.00 19.73 ? 36  ASN E N    1 
ATOM   5315 C CA   . ASN E 1 36  ? 72.938  -11.385 20.337 1.00 18.40 ? 36  ASN E CA   1 
ATOM   5316 C C    . ASN E 1 36  ? 72.778  -10.759 18.962 1.00 17.81 ? 36  ASN E C    1 
ATOM   5317 O O    . ASN E 1 36  ? 71.906  -11.151 18.187 1.00 13.48 ? 36  ASN E O    1 
ATOM   5318 C CB   . ASN E 1 36  ? 73.773  -12.657 20.189 1.00 24.55 ? 36  ASN E CB   1 
ATOM   5319 C CG   . ASN E 1 36  ? 74.153  -13.261 21.515 1.00 30.53 ? 36  ASN E CG   1 
ATOM   5320 O OD1  . ASN E 1 36  ? 74.733  -12.584 22.363 1.00 41.48 ? 36  ASN E OD1  1 
ATOM   5321 N ND2  . ASN E 1 36  ? 73.831  -14.541 21.710 1.00 29.80 ? 36  ASN E ND2  1 
ATOM   5322 H H    . ASN E 1 36  ? 71.000  -12.207 20.404 1.00 0.00  ? 36  ASN E H    1 
ATOM   5323 H HD21 . ASN E 1 36  ? 74.094  -14.965 22.546 1.00 0.00  ? 36  ASN E HD21 1 
ATOM   5324 H HD22 . ASN E 1 36  ? 73.330  -15.003 21.003 1.00 0.00  ? 36  ASN E HD22 1 
ATOM   5325 N N    . LEU E 1 37  ? 73.659  -9.820  18.646 1.00 15.45 ? 37  LEU E N    1 
ATOM   5326 C CA   . LEU E 1 37  ? 73.629  -9.147  17.361 1.00 14.29 ? 37  LEU E CA   1 
ATOM   5327 C C    . LEU E 1 37  ? 75.041  -8.901  16.860 1.00 15.33 ? 37  LEU E C    1 
ATOM   5328 O O    . LEU E 1 37  ? 75.888  -8.436  17.617 1.00 18.46 ? 37  LEU E O    1 
ATOM   5329 C CB   . LEU E 1 37  ? 72.898  -7.804  17.479 1.00 12.25 ? 37  LEU E CB   1 
ATOM   5330 C CG   . LEU E 1 37  ? 72.958  -6.859  16.270 1.00 10.35 ? 37  LEU E CG   1 
ATOM   5331 C CD1  . LEU E 1 37  ? 71.719  -5.996  16.216 1.00 9.68  ? 37  LEU E CD1  1 
ATOM   5332 C CD2  . LEU E 1 37  ? 74.208  -5.993  16.311 1.00 11.64 ? 37  LEU E CD2  1 
ATOM   5333 H H    . LEU E 1 37  ? 74.351  -9.575  19.297 1.00 0.00  ? 37  LEU E H    1 
ATOM   5334 N N    . GLN E 1 38  ? 75.302  -9.252  15.605 1.00 11.66 ? 38  GLN E N    1 
ATOM   5335 C CA   . GLN E 1 38  ? 76.597  -8.997  14.992 1.00 10.96 ? 38  GLN E CA   1 
ATOM   5336 C C    . GLN E 1 38  ? 76.249  -8.462  13.619 1.00 10.68 ? 38  GLN E C    1 
ATOM   5337 O O    . GLN E 1 38  ? 75.402  -9.034  12.929 1.00 16.06 ? 38  GLN E O    1 
ATOM   5338 C CB   . GLN E 1 38  ? 77.454  -10.254 14.852 1.00 10.93 ? 38  GLN E CB   1 
ATOM   5339 C CG   . GLN E 1 38  ? 78.945  -9.911  14.745 1.00 13.99 ? 38  GLN E CG   1 
ATOM   5340 C CD   . GLN E 1 38  ? 79.762  -10.920 13.961 1.00 13.99 ? 38  GLN E CD   1 
ATOM   5341 O OE1  . GLN E 1 38  ? 79.660  -11.004 12.733 1.00 22.23 ? 38  GLN E OE1  1 
ATOM   5342 N NE2  . GLN E 1 38  ? 80.605  -11.664 14.657 1.00 10.29 ? 38  GLN E NE2  1 
ATOM   5343 H H    . GLN E 1 38  ? 74.604  -9.693  15.065 1.00 0.00  ? 38  GLN E H    1 
ATOM   5344 H HE21 . GLN E 1 38  ? 81.144  -12.319 14.178 1.00 0.00  ? 38  GLN E HE21 1 
ATOM   5345 H HE22 . GLN E 1 38  ? 80.634  -11.508 15.627 1.00 0.00  ? 38  GLN E HE22 1 
ATOM   5346 N N    . SER E 1 39  ? 76.863  -7.350  13.234 1.00 8.33  ? 39  SER E N    1 
ATOM   5347 C CA   . SER E 1 39  ? 76.565  -6.754  11.946 1.00 12.04 ? 39  SER E CA   1 
ATOM   5348 C C    . SER E 1 39  ? 77.652  -5.793  11.498 1.00 16.53 ? 39  SER E C    1 
ATOM   5349 O O    . SER E 1 39  ? 78.280  -5.129  12.318 1.00 24.95 ? 39  SER E O    1 
ATOM   5350 C CB   . SER E 1 39  ? 75.235  -6.009  12.028 1.00 8.96  ? 39  SER E CB   1 
ATOM   5351 O OG   . SER E 1 39  ? 74.842  -5.508  10.767 1.00 14.62 ? 39  SER E OG   1 
ATOM   5352 H H    . SER E 1 39  ? 77.537  -6.928  13.811 1.00 0.00  ? 39  SER E H    1 
ATOM   5353 H HG   . SER E 1 39  ? 74.696  -6.266  10.180 1.00 0.00  ? 39  SER E HG   1 
ATOM   5354 N N    . MET E 1 40  ? 77.906  -5.771  10.195 1.00 18.06 ? 40  MET E N    1 
ATOM   5355 C CA   . MET E 1 40  ? 78.890  -4.872  9.616  1.00 16.22 ? 40  MET E CA   1 
ATOM   5356 C C    . MET E 1 40  ? 78.101  -3.732  8.994  1.00 19.66 ? 40  MET E C    1 
ATOM   5357 O O    . MET E 1 40  ? 76.954  -3.922  8.573  1.00 16.91 ? 40  MET E O    1 
ATOM   5358 C CB   . MET E 1 40  ? 79.675  -5.555  8.495  1.00 17.61 ? 40  MET E CB   1 
ATOM   5359 C CG   . MET E 1 40  ? 80.713  -6.580  8.913  1.00 18.40 ? 40  MET E CG   1 
ATOM   5360 S SD   . MET E 1 40  ? 81.456  -7.332  7.427  1.00 27.75 ? 40  MET E SD   1 
ATOM   5361 C CE   . MET E 1 40  ? 82.991  -6.513  7.379  1.00 29.47 ? 40  MET E CE   1 
ATOM   5362 H H    . MET E 1 40  ? 77.398  -6.378  9.622  1.00 0.00  ? 40  MET E H    1 
ATOM   5363 N N    . ASP E 1 41  ? 78.693  -2.545  8.954  1.00 18.38 ? 41  ASP E N    1 
ATOM   5364 C CA   . ASP E 1 41  ? 78.027  -1.421  8.323  1.00 17.39 ? 41  ASP E CA   1 
ATOM   5365 C C    . ASP E 1 41  ? 78.200  -1.644  6.817  1.00 21.47 ? 41  ASP E C    1 
ATOM   5366 O O    . ASP E 1 41  ? 79.033  -2.458  6.394  1.00 14.48 ? 41  ASP E O    1 
ATOM   5367 C CB   . ASP E 1 41  ? 78.671  -0.107  8.741  1.00 19.25 ? 41  ASP E CB   1 
ATOM   5368 C CG   . ASP E 1 41  ? 80.052  0.070   8.164  1.00 23.51 ? 41  ASP E CG   1 
ATOM   5369 O OD1  . ASP E 1 41  ? 80.150  0.592   7.040  1.00 26.60 ? 41  ASP E OD1  1 
ATOM   5370 O OD2  . ASP E 1 41  ? 81.036  -0.320  8.818  1.00 24.41 ? 41  ASP E OD2  1 
ATOM   5371 H H    . ASP E 1 41  ? 79.573  -2.435  9.372  1.00 0.00  ? 41  ASP E H    1 
ATOM   5372 N N    . SER E 1 42  ? 77.472  -0.871  6.020  1.00 20.58 ? 42  SER E N    1 
ATOM   5373 C CA   . SER E 1 42  ? 77.510  -0.982  4.560  1.00 20.06 ? 42  SER E CA   1 
ATOM   5374 C C    . SER E 1 42  ? 78.902  -1.123  3.927  1.00 14.68 ? 42  SER E C    1 
ATOM   5375 O O    . SER E 1 42  ? 79.116  -1.968  3.073  1.00 10.98 ? 42  SER E O    1 
ATOM   5376 C CB   . SER E 1 42  ? 76.767  0.205   3.940  1.00 21.72 ? 42  SER E CB   1 
ATOM   5377 O OG   . SER E 1 42  ? 77.225  1.440   4.475  1.00 30.60 ? 42  SER E OG   1 
ATOM   5378 H H    . SER E 1 42  ? 76.885  -0.212  6.444  1.00 0.00  ? 42  SER E H    1 
ATOM   5379 H HG   . SER E 1 42  ? 77.101  1.503   5.429  1.00 0.00  ? 42  SER E HG   1 
ATOM   5380 N N    . SER E 1 43  ? 79.847  -0.306  4.368  1.00 17.53 ? 43  SER E N    1 
ATOM   5381 C CA   . SER E 1 43  ? 81.194  -0.331  3.828  1.00 23.05 ? 43  SER E CA   1 
ATOM   5382 C C    . SER E 1 43  ? 82.060  -1.469  4.356  1.00 29.10 ? 43  SER E C    1 
ATOM   5383 O O    . SER E 1 43  ? 83.146  -1.718  3.824  1.00 32.24 ? 43  SER E O    1 
ATOM   5384 C CB   . SER E 1 43  ? 81.888  0.997   4.110  1.00 26.66 ? 43  SER E CB   1 
ATOM   5385 O OG   . SER E 1 43  ? 82.072  1.172   5.504  1.00 26.97 ? 43  SER E OG   1 
ATOM   5386 H H    . SER E 1 43  ? 79.640  0.345   5.062  1.00 0.00  ? 43  SER E H    1 
ATOM   5387 H HG   . SER E 1 43  ? 82.498  2.033   5.614  1.00 0.00  ? 43  SER E HG   1 
ATOM   5388 N N    . HIS E 1 44  ? 81.617  -2.115  5.433  1.00 25.68 ? 44  HIS E N    1 
ATOM   5389 C CA   . HIS E 1 44  ? 82.365  -3.221  6.024  1.00 22.47 ? 44  HIS E CA   1 
ATOM   5390 C C    . HIS E 1 44  ? 83.649  -2.798  6.751  1.00 20.83 ? 44  HIS E C    1 
ATOM   5391 O O    . HIS E 1 44  ? 84.522  -3.628  7.017  1.00 21.35 ? 44  HIS E O    1 
ATOM   5392 C CB   . HIS E 1 44  ? 82.689  -4.279  4.959  1.00 26.87 ? 44  HIS E CB   1 
ATOM   5393 C CG   . HIS E 1 44  ? 81.495  -5.046  4.475  1.00 31.27 ? 44  HIS E CG   1 
ATOM   5394 N ND1  . HIS E 1 44  ? 81.591  -6.073  3.563  1.00 26.43 ? 44  HIS E ND1  1 
ATOM   5395 C CD2  . HIS E 1 44  ? 80.182  -4.952  4.801  1.00 31.02 ? 44  HIS E CD2  1 
ATOM   5396 C CE1  . HIS E 1 44  ? 80.392  -6.585  3.350  1.00 27.83 ? 44  HIS E CE1  1 
ATOM   5397 N NE2  . HIS E 1 44  ? 79.519  -5.923  4.090  1.00 26.96 ? 44  HIS E NE2  1 
ATOM   5398 H H    . HIS E 1 44  ? 80.761  -1.855  5.823  1.00 0.00  ? 44  HIS E H    1 
ATOM   5399 H HD1  . HIS E 1 44  ? 82.410  -6.344  3.097  1.00 0.00  ? 44  HIS E HD1  1 
ATOM   5400 H HE2  . HIS E 1 44  ? 78.562  -6.119  4.146  1.00 0.00  ? 44  HIS E HE2  1 
ATOM   5401 N N    . VAL E 1 45  ? 83.763  -1.515  7.077  1.00 19.25 ? 45  VAL E N    1 
ATOM   5402 C CA   . VAL E 1 45  ? 84.933  -1.007  7.792  1.00 16.24 ? 45  VAL E CA   1 
ATOM   5403 C C    . VAL E 1 45  ? 84.799  -1.211  9.302  1.00 15.73 ? 45  VAL E C    1 
ATOM   5404 O O    . VAL E 1 45  ? 85.795  -1.335  10.008 1.00 21.77 ? 45  VAL E O    1 
ATOM   5405 C CB   . VAL E 1 45  ? 85.169  0.493   7.507  1.00 13.46 ? 45  VAL E CB   1 
ATOM   5406 C CG1  . VAL E 1 45  ? 86.283  1.030   8.373  1.00 15.97 ? 45  VAL E CG1  1 
ATOM   5407 C CG2  . VAL E 1 45  ? 85.528  0.694   6.062  1.00 16.89 ? 45  VAL E CG2  1 
ATOM   5408 H H    . VAL E 1 45  ? 83.056  -0.890  6.813  1.00 0.00  ? 45  VAL E H    1 
ATOM   5409 N N    . SER E 1 46  ? 83.568  -1.225  9.801  1.00 24.00 ? 46  SER E N    1 
ATOM   5410 C CA   . SER E 1 46  ? 83.330  -1.415  11.229 1.00 19.11 ? 46  SER E CA   1 
ATOM   5411 C C    . SER E 1 46  ? 82.385  -2.587  11.432 1.00 16.81 ? 46  SER E C    1 
ATOM   5412 O O    . SER E 1 46  ? 81.708  -3.017  10.498 1.00 17.42 ? 46  SER E O    1 
ATOM   5413 C CB   . SER E 1 46  ? 82.748  -0.146  11.870 1.00 12.54 ? 46  SER E CB   1 
ATOM   5414 O OG   . SER E 1 46  ? 81.436  0.119   11.415 1.00 11.27 ? 46  SER E OG   1 
ATOM   5415 H H    . SER E 1 46  ? 82.810  -1.173  9.197  1.00 0.00  ? 46  SER E H    1 
ATOM   5416 H HG   . SER E 1 46  ? 81.473  0.402   10.507 1.00 0.00  ? 46  SER E HG   1 
ATOM   5417 N N    . LEU E 1 47  ? 82.342  -3.092  12.657 1.00 21.11 ? 47  LEU E N    1 
ATOM   5418 C CA   . LEU E 1 47  ? 81.488  -4.215  13.004 1.00 15.33 ? 47  LEU E CA   1 
ATOM   5419 C C    . LEU E 1 47  ? 81.002  -4.007  14.436 1.00 15.00 ? 47  LEU E C    1 
ATOM   5420 O O    . LEU E 1 47  ? 81.746  -3.516  15.277 1.00 17.01 ? 47  LEU E O    1 
ATOM   5421 C CB   . LEU E 1 47  ? 82.295  -5.506  12.892 1.00 13.71 ? 47  LEU E CB   1 
ATOM   5422 C CG   . LEU E 1 47  ? 81.593  -6.847  13.084 1.00 16.04 ? 47  LEU E CG   1 
ATOM   5423 C CD1  . LEU E 1 47  ? 82.049  -7.799  11.987 1.00 16.02 ? 47  LEU E CD1  1 
ATOM   5424 C CD2  . LEU E 1 47  ? 81.883  -7.413  14.473 1.00 13.52 ? 47  LEU E CD2  1 
ATOM   5425 H H    . LEU E 1 47  ? 82.895  -2.704  13.366 1.00 0.00  ? 47  LEU E H    1 
ATOM   5426 N N    . VAL E 1 48  ? 79.742  -4.334  14.695 1.00 17.11 ? 48  VAL E N    1 
ATOM   5427 C CA   . VAL E 1 48  ? 79.159  -4.197  16.026 1.00 17.67 ? 48  VAL E CA   1 
ATOM   5428 C C    . VAL E 1 48  ? 78.788  -5.588  16.545 1.00 13.72 ? 48  VAL E C    1 
ATOM   5429 O O    . VAL E 1 48  ? 78.418  -6.474  15.770 1.00 13.92 ? 48  VAL E O    1 
ATOM   5430 C CB   . VAL E 1 48  ? 77.879  -3.316  15.999 1.00 19.85 ? 48  VAL E CB   1 
ATOM   5431 C CG1  . VAL E 1 48  ? 77.361  -3.097  17.391 1.00 19.34 ? 48  VAL E CG1  1 
ATOM   5432 C CG2  . VAL E 1 48  ? 78.172  -1.979  15.364 1.00 32.36 ? 48  VAL E CG2  1 
ATOM   5433 H H    . VAL E 1 48  ? 79.176  -4.682  13.978 1.00 0.00  ? 48  VAL E H    1 
ATOM   5434 N N    . GLN E 1 49  ? 78.885  -5.778  17.852 1.00 9.52  ? 49  GLN E N    1 
ATOM   5435 C CA   . GLN E 1 49  ? 78.558  -7.050  18.453 1.00 10.16 ? 49  GLN E CA   1 
ATOM   5436 C C    . GLN E 1 49  ? 77.898  -6.771  19.792 1.00 14.73 ? 49  GLN E C    1 
ATOM   5437 O O    . GLN E 1 49  ? 78.545  -6.304  20.733 1.00 17.30 ? 49  GLN E O    1 
ATOM   5438 C CB   . GLN E 1 49  ? 79.818  -7.901  18.617 1.00 14.74 ? 49  GLN E CB   1 
ATOM   5439 C CG   . GLN E 1 49  ? 79.554  -9.382  18.883 1.00 25.87 ? 49  GLN E CG   1 
ATOM   5440 C CD   . GLN E 1 49  ? 79.102  -9.671  20.312 1.00 30.39 ? 49  GLN E CD   1 
ATOM   5441 O OE1  . GLN E 1 49  ? 79.879  -9.520  21.256 1.00 30.87 ? 49  GLN E OE1  1 
ATOM   5442 N NE2  . GLN E 1 49  ? 77.853  -10.106 20.471 1.00 27.58 ? 49  GLN E NE2  1 
ATOM   5443 H H    . GLN E 1 49  ? 79.189  -5.050  18.430 1.00 0.00  ? 49  GLN E H    1 
ATOM   5444 H HE21 . GLN E 1 49  ? 77.557  -10.277 21.388 1.00 0.00  ? 49  GLN E HE21 1 
ATOM   5445 H HE22 . GLN E 1 49  ? 77.286  -10.225 19.683 1.00 0.00  ? 49  GLN E HE22 1 
ATOM   5446 N N    . LEU E 1 50  ? 76.593  -7.018  19.839 1.00 12.52 ? 50  LEU E N    1 
ATOM   5447 C CA   . LEU E 1 50  ? 75.776  -6.806  21.020 1.00 7.32  ? 50  LEU E CA   1 
ATOM   5448 C C    . LEU E 1 50  ? 75.451  -8.119  21.709 1.00 11.50 ? 50  LEU E C    1 
ATOM   5449 O O    . LEU E 1 50  ? 75.147  -9.127  21.059 1.00 7.06  ? 50  LEU E O    1 
ATOM   5450 C CB   . LEU E 1 50  ? 74.467  -6.117  20.626 1.00 7.01  ? 50  LEU E CB   1 
ATOM   5451 C CG   . LEU E 1 50  ? 73.350  -5.920  21.656 1.00 7.12  ? 50  LEU E CG   1 
ATOM   5452 C CD1  . LEU E 1 50  ? 73.776  -4.969  22.741 1.00 5.72  ? 50  LEU E CD1  1 
ATOM   5453 C CD2  . LEU E 1 50  ? 72.117  -5.370  20.976 1.00 13.36 ? 50  LEU E CD2  1 
ATOM   5454 H H    . LEU E 1 50  ? 76.163  -7.355  19.038 1.00 0.00  ? 50  LEU E H    1 
ATOM   5455 N N    . THR E 1 51  ? 75.490  -8.083  23.035 1.00 14.83 ? 51  THR E N    1 
ATOM   5456 C CA   . THR E 1 51  ? 75.176  -9.238  23.846 1.00 10.50 ? 51  THR E CA   1 
ATOM   5457 C C    . THR E 1 51  ? 74.440  -8.778  25.085 1.00 13.91 ? 51  THR E C    1 
ATOM   5458 O O    . THR E 1 51  ? 74.970  -8.001  25.884 1.00 15.38 ? 51  THR E O    1 
ATOM   5459 C CB   . THR E 1 51  ? 76.439  -10.057 24.211 1.00 7.52  ? 51  THR E CB   1 
ATOM   5460 O OG1  . THR E 1 51  ? 76.899  -10.757 23.043 1.00 16.52 ? 51  THR E OG1  1 
ATOM   5461 C CG2  . THR E 1 51  ? 76.138  -11.073 25.289 1.00 5.49  ? 51  THR E CG2  1 
ATOM   5462 H H    . THR E 1 51  ? 75.747  -7.251  23.489 1.00 0.00  ? 51  THR E H    1 
ATOM   5463 H HG1  . THR E 1 51  ? 76.184  -11.332 22.729 1.00 0.00  ? 51  THR E HG1  1 
ATOM   5464 N N    . LEU E 1 52  ? 73.167  -9.167  25.153 1.00 18.26 ? 52  LEU E N    1 
ATOM   5465 C CA   . LEU E 1 52  ? 72.282  -8.874  26.276 1.00 16.98 ? 52  LEU E CA   1 
ATOM   5466 C C    . LEU E 1 52  ? 71.956  -10.247 26.894 1.00 17.41 ? 52  LEU E C    1 
ATOM   5467 O O    . LEU E 1 52  ? 71.140  -10.997 26.358 1.00 18.27 ? 52  LEU E O    1 
ATOM   5468 C CB   . LEU E 1 52  ? 70.995  -8.180  25.788 1.00 10.17 ? 52  LEU E CB   1 
ATOM   5469 C CG   . LEU E 1 52  ? 71.043  -6.791  25.128 1.00 5.55  ? 52  LEU E CG   1 
ATOM   5470 C CD1  . LEU E 1 52  ? 69.664  -6.379  24.657 1.00 3.64  ? 52  LEU E CD1  1 
ATOM   5471 C CD2  . LEU E 1 52  ? 71.599  -5.755  26.086 1.00 8.54  ? 52  LEU E CD2  1 
ATOM   5472 H H    . LEU E 1 52  ? 72.803  -9.686  24.403 1.00 0.00  ? 52  LEU E H    1 
ATOM   5473 N N    . ARG E 1 53  ? 72.640  -10.591 27.983 1.00 20.37 ? 53  ARG E N    1 
ATOM   5474 C CA   . ARG E 1 53  ? 72.454  -11.879 28.660 1.00 24.56 ? 53  ARG E CA   1 
ATOM   5475 C C    . ARG E 1 53  ? 71.072  -12.065 29.274 1.00 25.66 ? 53  ARG E C    1 
ATOM   5476 O O    . ARG E 1 53  ? 70.505  -11.139 29.855 1.00 22.42 ? 53  ARG E O    1 
ATOM   5477 C CB   . ARG E 1 53  ? 73.519  -12.073 29.740 1.00 29.86 ? 53  ARG E CB   1 
ATOM   5478 C CG   . ARG E 1 53  ? 74.926  -12.271 29.209 1.00 38.08 ? 53  ARG E CG   1 
ATOM   5479 C CD   . ARG E 1 53  ? 75.952  -12.256 30.332 1.00 41.21 ? 53  ARG E CD   1 
ATOM   5480 N NE   . ARG E 1 53  ? 76.831  -11.088 30.265 1.00 42.56 ? 53  ARG E NE   1 
ATOM   5481 C CZ   . ARG E 1 53  ? 77.025  -10.241 31.271 1.00 46.67 ? 53  ARG E CZ   1 
ATOM   5482 N NH1  . ARG E 1 53  ? 76.396  -10.424 32.425 1.00 50.87 ? 53  ARG E NH1  1 
ATOM   5483 N NH2  . ARG E 1 53  ? 77.880  -9.232  31.139 1.00 48.72 ? 53  ARG E NH2  1 
ATOM   5484 H H    . ARG E 1 53  ? 73.269  -9.954  28.375 1.00 0.00  ? 53  ARG E H    1 
ATOM   5485 H HE   . ARG E 1 53  ? 77.315  -10.911 29.432 1.00 0.00  ? 53  ARG E HE   1 
ATOM   5486 H HH11 . ARG E 1 53  ? 75.779  -11.200 32.547 1.00 0.00  ? 53  ARG E HH11 1 
ATOM   5487 H HH12 . ARG E 1 53  ? 76.551  -9.794  33.188 1.00 0.00  ? 53  ARG E HH12 1 
ATOM   5488 H HH21 . ARG E 1 53  ? 78.395  -9.106  30.294 1.00 0.00  ? 53  ARG E HH21 1 
ATOM   5489 H HH22 . ARG E 1 53  ? 78.029  -8.614  31.912 1.00 0.00  ? 53  ARG E HH22 1 
ATOM   5490 N N    . SER E 1 54  ? 70.571  -13.293 29.206 1.00 23.69 ? 54  SER E N    1 
ATOM   5491 C CA   . SER E 1 54  ? 69.254  -13.628 29.730 1.00 27.06 ? 54  SER E CA   1 
ATOM   5492 C C    . SER E 1 54  ? 69.105  -13.296 31.209 1.00 30.09 ? 54  SER E C    1 
ATOM   5493 O O    . SER E 1 54  ? 68.012  -12.976 31.670 1.00 37.51 ? 54  SER E O    1 
ATOM   5494 C CB   . SER E 1 54  ? 68.963  -15.110 29.507 1.00 25.04 ? 54  SER E CB   1 
ATOM   5495 O OG   . SER E 1 54  ? 69.898  -15.912 30.206 1.00 34.44 ? 54  SER E OG   1 
ATOM   5496 H H    . SER E 1 54  ? 71.090  -13.976 28.774 1.00 0.00  ? 54  SER E H    1 
ATOM   5497 H HG   . SER E 1 54  ? 70.762  -15.813 29.805 1.00 0.00  ? 54  SER E HG   1 
ATOM   5498 N N    . GLU E 1 55  ? 70.212  -13.354 31.945 1.00 29.93 ? 55  GLU E N    1 
ATOM   5499 C CA   . GLU E 1 55  ? 70.197  -13.065 33.376 1.00 29.27 ? 55  GLU E CA   1 
ATOM   5500 C C    . GLU E 1 55  ? 69.849  -11.613 33.644 1.00 27.28 ? 55  GLU E C    1 
ATOM   5501 O O    . GLU E 1 55  ? 69.429  -11.265 34.743 1.00 31.09 ? 55  GLU E O    1 
ATOM   5502 C CB   . GLU E 1 55  ? 71.552  -13.381 34.019 1.00 34.00 ? 55  GLU E CB   1 
ATOM   5503 C CG   . GLU E 1 55  ? 71.967  -14.847 33.988 1.00 41.77 ? 55  GLU E CG   1 
ATOM   5504 C CD   . GLU E 1 55  ? 72.458  -15.306 32.623 1.00 49.35 ? 55  GLU E CD   1 
ATOM   5505 O OE1  . GLU E 1 55  ? 73.186  -14.534 31.964 1.00 52.96 ? 55  GLU E OE1  1 
ATOM   5506 O OE2  . GLU E 1 55  ? 72.124  -16.441 32.213 1.00 55.95 ? 55  GLU E OE2  1 
ATOM   5507 H H    . GLU E 1 55  ? 71.040  -13.602 31.496 1.00 0.00  ? 55  GLU E H    1 
ATOM   5508 N N    . GLY E 1 56  ? 70.063  -10.767 32.641 1.00 27.93 ? 56  GLY E N    1 
ATOM   5509 C CA   . GLY E 1 56  ? 69.772  -9.353  32.778 1.00 21.12 ? 56  GLY E CA   1 
ATOM   5510 C C    . GLY E 1 56  ? 68.301  -9.021  32.635 1.00 22.69 ? 56  GLY E C    1 
ATOM   5511 O O    . GLY E 1 56  ? 67.910  -7.896  32.940 1.00 26.70 ? 56  GLY E O    1 
ATOM   5512 H H    . GLY E 1 56  ? 70.412  -11.074 31.785 1.00 0.00  ? 56  GLY E H    1 
ATOM   5513 N N    . PHE E 1 57  ? 67.496  -9.975  32.159 1.00 20.96 ? 57  PHE E N    1 
ATOM   5514 C CA   . PHE E 1 57  ? 66.056  -9.774  31.977 1.00 17.68 ? 57  PHE E CA   1 
ATOM   5515 C C    . PHE E 1 57  ? 65.276  -10.298 33.179 1.00 22.08 ? 57  PHE E C    1 
ATOM   5516 O O    . PHE E 1 57  ? 65.581  -11.371 33.692 1.00 25.93 ? 57  PHE E O    1 
ATOM   5517 C CB   . PHE E 1 57  ? 65.568  -10.487 30.713 1.00 10.65 ? 57  PHE E CB   1 
ATOM   5518 C CG   . PHE E 1 57  ? 66.091  -9.894  29.437 1.00 12.75 ? 57  PHE E CG   1 
ATOM   5519 C CD1  . PHE E 1 57  ? 67.308  -10.307 28.908 1.00 15.62 ? 57  PHE E CD1  1 
ATOM   5520 C CD2  . PHE E 1 57  ? 65.359  -8.930  28.752 1.00 11.09 ? 57  PHE E CD2  1 
ATOM   5521 C CE1  . PHE E 1 57  ? 67.784  -9.768  27.714 1.00 15.27 ? 57  PHE E CE1  1 
ATOM   5522 C CE2  . PHE E 1 57  ? 65.825  -8.383  27.559 1.00 7.21  ? 57  PHE E CE2  1 
ATOM   5523 C CZ   . PHE E 1 57  ? 67.037  -8.801  27.039 1.00 11.17 ? 57  PHE E CZ   1 
ATOM   5524 H H    . PHE E 1 57  ? 67.853  -10.859 31.936 1.00 0.00  ? 57  PHE E H    1 
ATOM   5525 N N    . ASP E 1 58  ? 64.259  -9.559  33.616 1.00 24.73 ? 58  ASP E N    1 
ATOM   5526 C CA   . ASP E 1 58  ? 63.448  -9.985  34.763 1.00 35.36 ? 58  ASP E CA   1 
ATOM   5527 C C    . ASP E 1 58  ? 62.737  -11.298 34.466 1.00 32.68 ? 58  ASP E C    1 
ATOM   5528 O O    . ASP E 1 58  ? 62.537  -12.135 35.340 1.00 34.00 ? 58  ASP E O    1 
ATOM   5529 C CB   . ASP E 1 58  ? 62.403  -8.914  35.124 1.00 42.14 ? 58  ASP E CB   1 
ATOM   5530 C CG   . ASP E 1 58  ? 61.286  -9.454  36.033 1.00 47.59 ? 58  ASP E CG   1 
ATOM   5531 O OD1  . ASP E 1 58  ? 61.543  -9.722  37.229 1.00 49.75 ? 58  ASP E OD1  1 
ATOM   5532 O OD2  . ASP E 1 58  ? 60.148  -9.613  35.544 1.00 47.91 ? 58  ASP E OD2  1 
ATOM   5533 H H    . ASP E 1 58  ? 64.043  -8.726  33.154 1.00 0.00  ? 58  ASP E H    1 
ATOM   5534 N N    . THR E 1 59  ? 62.328  -11.442 33.220 1.00 32.52 ? 59  THR E N    1 
ATOM   5535 C CA   . THR E 1 59  ? 61.616  -12.614 32.764 1.00 24.00 ? 59  THR E CA   1 
ATOM   5536 C C    . THR E 1 59  ? 62.199  -12.862 31.395 1.00 18.42 ? 59  THR E C    1 
ATOM   5537 O O    . THR E 1 59  ? 62.310  -11.944 30.592 1.00 22.74 ? 59  THR E O    1 
ATOM   5538 C CB   . THR E 1 59  ? 60.091  -12.312 32.656 1.00 27.13 ? 59  THR E CB   1 
ATOM   5539 O OG1  . THR E 1 59  ? 59.500  -12.334 33.963 1.00 25.91 ? 59  THR E OG1  1 
ATOM   5540 C CG2  . THR E 1 59  ? 59.379  -13.300 31.736 1.00 27.07 ? 59  THR E CG2  1 
ATOM   5541 H H    . THR E 1 59  ? 62.544  -10.735 32.574 1.00 0.00  ? 59  THR E H    1 
ATOM   5542 H HG1  . THR E 1 59  ? 59.969  -11.721 34.544 1.00 0.00  ? 59  THR E HG1  1 
ATOM   5543 N N    . TYR E 1 60  ? 62.700  -14.064 31.184 1.00 17.54 ? 60  TYR E N    1 
ATOM   5544 C CA   . TYR E 1 60  ? 63.262  -14.416 29.904 1.00 18.16 ? 60  TYR E CA   1 
ATOM   5545 C C    . TYR E 1 60  ? 62.829  -15.820 29.624 1.00 18.16 ? 60  TYR E C    1 
ATOM   5546 O O    . TYR E 1 60  ? 62.895  -16.672 30.511 1.00 23.16 ? 60  TYR E O    1 
ATOM   5547 C CB   . TYR E 1 60  ? 64.787  -14.364 29.926 1.00 18.64 ? 60  TYR E CB   1 
ATOM   5548 C CG   . TYR E 1 60  ? 65.376  -14.421 28.537 1.00 18.45 ? 60  TYR E CG   1 
ATOM   5549 C CD1  . TYR E 1 60  ? 65.553  -13.259 27.792 1.00 19.54 ? 60  TYR E CD1  1 
ATOM   5550 C CD2  . TYR E 1 60  ? 65.724  -15.633 27.953 1.00 19.39 ? 60  TYR E CD2  1 
ATOM   5551 C CE1  . TYR E 1 60  ? 66.054  -13.302 26.509 1.00 18.34 ? 60  TYR E CE1  1 
ATOM   5552 C CE2  . TYR E 1 60  ? 66.228  -15.686 26.667 1.00 19.25 ? 60  TYR E CE2  1 
ATOM   5553 C CZ   . TYR E 1 60  ? 66.389  -14.518 25.953 1.00 18.59 ? 60  TYR E CZ   1 
ATOM   5554 O OH   . TYR E 1 60  ? 66.885  -14.560 24.680 1.00 18.48 ? 60  TYR E OH   1 
ATOM   5555 H H    . TYR E 1 60  ? 62.723  -14.740 31.894 1.00 0.00  ? 60  TYR E H    1 
ATOM   5556 H HH   . TYR E 1 60  ? 67.002  -15.470 24.414 1.00 0.00  ? 60  TYR E HH   1 
ATOM   5557 N N    . ARG E 1 61  ? 62.378  -16.057 28.401 1.00 14.97 ? 61  ARG E N    1 
ATOM   5558 C CA   . ARG E 1 61  ? 61.940  -17.377 27.992 1.00 19.56 ? 61  ARG E CA   1 
ATOM   5559 C C    . ARG E 1 61  ? 62.179  -17.503 26.506 1.00 24.68 ? 61  ARG E C    1 
ATOM   5560 O O    . ARG E 1 61  ? 61.999  -16.538 25.766 1.00 35.13 ? 61  ARG E O    1 
ATOM   5561 C CB   . ARG E 1 61  ? 60.453  -17.558 28.289 1.00 16.68 ? 61  ARG E CB   1 
ATOM   5562 C CG   . ARG E 1 61  ? 59.812  -18.719 27.557 1.00 20.30 ? 61  ARG E CG   1 
ATOM   5563 C CD   . ARG E 1 61  ? 58.304  -18.608 27.585 1.00 16.61 ? 61  ARG E CD   1 
ATOM   5564 N NE   . ARG E 1 61  ? 57.680  -19.473 26.591 1.00 21.05 ? 61  ARG E NE   1 
ATOM   5565 C CZ   . ARG E 1 61  ? 56.410  -19.862 26.640 1.00 25.16 ? 61  ARG E CZ   1 
ATOM   5566 N NH1  . ARG E 1 61  ? 55.632  -19.470 27.639 1.00 29.61 ? 61  ARG E NH1  1 
ATOM   5567 N NH2  . ARG E 1 61  ? 55.894  -20.585 25.658 1.00 24.24 ? 61  ARG E NH2  1 
ATOM   5568 H H    . ARG E 1 61  ? 62.304  -15.322 27.753 1.00 0.00  ? 61  ARG E H    1 
ATOM   5569 H HE   . ARG E 1 61  ? 58.224  -19.773 25.833 1.00 0.00  ? 61  ARG E HE   1 
ATOM   5570 H HH11 . ARG E 1 61  ? 55.990  -18.881 28.363 1.00 0.00  ? 61  ARG E HH11 1 
ATOM   5571 H HH12 . ARG E 1 61  ? 54.677  -19.770 27.664 1.00 0.00  ? 61  ARG E HH12 1 
ATOM   5572 H HH21 . ARG E 1 61  ? 56.448  -20.826 24.867 1.00 0.00  ? 61  ARG E HH21 1 
ATOM   5573 H HH22 . ARG E 1 61  ? 54.937  -20.871 25.695 1.00 0.00  ? 61  ARG E HH22 1 
ATOM   5574 N N    . CYS E 1 62  ? 62.629  -18.676 26.077 1.00 27.40 ? 62  CYS E N    1 
ATOM   5575 C CA   . CYS E 1 62  ? 62.876  -18.928 24.665 1.00 31.31 ? 62  CYS E CA   1 
ATOM   5576 C C    . CYS E 1 62  ? 62.769  -20.425 24.392 1.00 35.64 ? 62  CYS E C    1 
ATOM   5577 O O    . CYS E 1 62  ? 63.693  -21.187 24.694 1.00 44.29 ? 62  CYS E O    1 
ATOM   5578 C CB   . CYS E 1 62  ? 64.253  -18.410 24.257 1.00 27.18 ? 62  CYS E CB   1 
ATOM   5579 S SG   . CYS E 1 62  ? 64.520  -18.492 22.493 1.00 30.64 ? 62  CYS E SG   1 
ATOM   5580 H H    . CYS E 1 62  ? 62.807  -19.393 26.720 1.00 0.00  ? 62  CYS E H    1 
ATOM   5581 N N    . ASP E 1 63  ? 61.632  -20.841 23.837 1.00 36.64 ? 63  ASP E N    1 
ATOM   5582 C CA   . ASP E 1 63  ? 61.374  -22.251 23.536 1.00 36.60 ? 63  ASP E CA   1 
ATOM   5583 C C    . ASP E 1 63  ? 62.197  -22.741 22.365 1.00 33.31 ? 63  ASP E C    1 
ATOM   5584 O O    . ASP E 1 63  ? 62.600  -23.900 22.321 1.00 38.61 ? 63  ASP E O    1 
ATOM   5585 C CB   . ASP E 1 63  ? 59.894  -22.471 23.232 1.00 43.82 ? 63  ASP E CB   1 
ATOM   5586 C CG   . ASP E 1 63  ? 58.989  -21.863 24.281 1.00 51.44 ? 63  ASP E CG   1 
ATOM   5587 O OD1  . ASP E 1 63  ? 59.306  -21.951 25.489 1.00 55.34 ? 63  ASP E OD1  1 
ATOM   5588 O OD2  . ASP E 1 63  ? 57.958  -21.280 23.890 1.00 57.02 ? 63  ASP E OD2  1 
ATOM   5589 H H    . ASP E 1 63  ? 60.955  -20.166 23.609 1.00 0.00  ? 63  ASP E H    1 
ATOM   5590 N N    . ARG E 1 64  ? 62.415  -21.857 21.401 1.00 28.93 ? 64  ARG E N    1 
ATOM   5591 C CA   . ARG E 1 64  ? 63.192  -22.179 20.215 1.00 30.32 ? 64  ARG E CA   1 
ATOM   5592 C C    . ARG E 1 64  ? 63.973  -20.943 19.776 1.00 28.00 ? 64  ARG E C    1 
ATOM   5593 O O    . ARG E 1 64  ? 63.495  -19.815 19.931 1.00 30.26 ? 64  ARG E O    1 
ATOM   5594 C CB   . ARG E 1 64  ? 62.270  -22.655 19.093 1.00 37.50 ? 64  ARG E CB   1 
ATOM   5595 C CG   . ARG E 1 64  ? 61.516  -23.930 19.411 1.00 42.35 ? 64  ARG E CG   1 
ATOM   5596 C CD   . ARG E 1 64  ? 60.672  -24.373 18.234 1.00 51.71 ? 64  ARG E CD   1 
ATOM   5597 N NE   . ARG E 1 64  ? 59.393  -24.925 18.674 1.00 56.85 ? 64  ARG E NE   1 
ATOM   5598 C CZ   . ARG E 1 64  ? 59.243  -26.106 19.264 1.00 55.38 ? 64  ARG E CZ   1 
ATOM   5599 N NH1  . ARG E 1 64  ? 60.291  -26.889 19.488 1.00 54.86 ? 64  ARG E NH1  1 
ATOM   5600 N NH2  . ARG E 1 64  ? 58.041  -26.479 19.671 1.00 55.62 ? 64  ARG E NH2  1 
ATOM   5601 H H    . ARG E 1 64  ? 62.043  -20.968 21.523 1.00 0.00  ? 64  ARG E H    1 
ATOM   5602 H HE   . ARG E 1 64  ? 58.587  -24.383 18.535 1.00 0.00  ? 64  ARG E HE   1 
ATOM   5603 H HH11 . ARG E 1 64  ? 61.207  -26.597 19.213 1.00 0.00  ? 64  ARG E HH11 1 
ATOM   5604 H HH12 . ARG E 1 64  ? 60.159  -27.772 19.934 1.00 0.00  ? 64  ARG E HH12 1 
ATOM   5605 H HH21 . ARG E 1 64  ? 57.259  -25.868 19.534 1.00 0.00  ? 64  ARG E HH21 1 
ATOM   5606 H HH22 . ARG E 1 64  ? 57.901  -27.364 20.109 1.00 0.00  ? 64  ARG E HH22 1 
ATOM   5607 N N    . ASN E 1 65  ? 65.171  -21.161 19.241 1.00 16.63 ? 65  ASN E N    1 
ATOM   5608 C CA   . ASN E 1 65  ? 66.040  -20.072 18.795 1.00 21.09 ? 65  ASN E CA   1 
ATOM   5609 C C    . ASN E 1 65  ? 65.513  -19.327 17.589 1.00 24.76 ? 65  ASN E C    1 
ATOM   5610 O O    . ASN E 1 65  ? 65.096  -19.948 16.608 1.00 28.91 ? 65  ASN E O    1 
ATOM   5611 C CB   . ASN E 1 65  ? 67.438  -20.591 18.489 1.00 17.00 ? 65  ASN E CB   1 
ATOM   5612 C CG   . ASN E 1 65  ? 68.163  -21.085 19.724 1.00 21.19 ? 65  ASN E CG   1 
ATOM   5613 O OD1  . ASN E 1 65  ? 69.309  -21.511 19.636 1.00 26.14 ? 65  ASN E OD1  1 
ATOM   5614 N ND2  . ASN E 1 65  ? 67.505  -21.029 20.883 1.00 19.27 ? 65  ASN E ND2  1 
ATOM   5615 H H    . ASN E 1 65  ? 65.463  -22.090 19.134 1.00 0.00  ? 65  ASN E H    1 
ATOM   5616 H HD21 . ASN E 1 65  ? 67.971  -21.393 21.666 1.00 0.00  ? 65  ASN E HD21 1 
ATOM   5617 H HD22 . ASN E 1 65  ? 66.601  -20.667 20.967 1.00 0.00  ? 65  ASN E HD22 1 
ATOM   5618 N N    . LEU E 1 66  ? 65.586  -17.995 17.650 1.00 23.18 ? 66  LEU E N    1 
ATOM   5619 C CA   . LEU E 1 66  ? 65.104  -17.131 16.576 1.00 15.34 ? 66  LEU E CA   1 
ATOM   5620 C C    . LEU E 1 66  ? 66.187  -16.251 15.954 1.00 16.70 ? 66  LEU E C    1 
ATOM   5621 O O    . LEU E 1 66  ? 67.162  -15.877 16.608 1.00 14.62 ? 66  LEU E O    1 
ATOM   5622 C CB   . LEU E 1 66  ? 63.982  -16.240 17.096 1.00 18.17 ? 66  LEU E CB   1 
ATOM   5623 C CG   . LEU E 1 66  ? 62.721  -16.931 17.607 1.00 25.57 ? 66  LEU E CG   1 
ATOM   5624 C CD1  . LEU E 1 66  ? 62.223  -16.219 18.842 1.00 29.77 ? 66  LEU E CD1  1 
ATOM   5625 C CD2  . LEU E 1 66  ? 61.657  -16.950 16.528 1.00 28.04 ? 66  LEU E CD2  1 
ATOM   5626 H H    . LEU E 1 66  ? 65.988  -17.581 18.446 1.00 0.00  ? 66  LEU E H    1 
ATOM   5627 N N    . ALA E 1 67  ? 66.013  -15.955 14.671 1.00 14.86 ? 67  ALA E N    1 
ATOM   5628 C CA   . ALA E 1 67  ? 66.920  -15.101 13.917 1.00 15.62 ? 67  ALA E CA   1 
ATOM   5629 C C    . ALA E 1 67  ? 65.973  -14.142 13.242 1.00 23.69 ? 67  ALA E C    1 
ATOM   5630 O O    . ALA E 1 67  ? 65.478  -14.418 12.148 1.00 30.77 ? 67  ALA E O    1 
ATOM   5631 C CB   . ALA E 1 67  ? 67.668  -15.896 12.873 1.00 7.09  ? 67  ALA E CB   1 
ATOM   5632 H H    . ALA E 1 67  ? 65.229  -16.315 14.205 1.00 0.00  ? 67  ALA E H    1 
ATOM   5633 N N    . MET E 1 68  ? 65.661  -13.051 13.931 1.00 30.58 ? 68  MET E N    1 
ATOM   5634 C CA   . MET E 1 68  ? 64.733  -12.054 13.410 1.00 26.29 ? 68  MET E CA   1 
ATOM   5635 C C    . MET E 1 68  ? 65.419  -10.968 12.606 1.00 22.64 ? 68  MET E C    1 
ATOM   5636 O O    . MET E 1 68  ? 66.235  -10.216 13.143 1.00 24.80 ? 68  MET E O    1 
ATOM   5637 C CB   . MET E 1 68  ? 63.947  -11.411 14.556 1.00 26.24 ? 68  MET E CB   1 
ATOM   5638 C CG   . MET E 1 68  ? 63.233  -12.396 15.463 1.00 25.40 ? 68  MET E CG   1 
ATOM   5639 S SD   . MET E 1 68  ? 62.300  -11.546 16.743 1.00 33.07 ? 68  MET E SD   1 
ATOM   5640 C CE   . MET E 1 68  ? 63.575  -11.116 17.875 1.00 29.34 ? 68  MET E CE   1 
ATOM   5641 H H    . MET E 1 68  ? 66.077  -12.911 14.811 1.00 0.00  ? 68  MET E H    1 
ATOM   5642 N N    . GLY E 1 69  ? 65.118  -10.922 11.312 1.00 21.85 ? 69  GLY E N    1 
ATOM   5643 C CA   . GLY E 1 69  ? 65.675  -9.893  10.453 1.00 21.82 ? 69  GLY E CA   1 
ATOM   5644 C C    . GLY E 1 69  ? 64.943  -8.624  10.833 1.00 20.94 ? 69  GLY E C    1 
ATOM   5645 O O    . GLY E 1 69  ? 63.713  -8.561  10.709 1.00 19.24 ? 69  GLY E O    1 
ATOM   5646 H H    . GLY E 1 69  ? 64.528  -11.604 10.923 1.00 0.00  ? 69  GLY E H    1 
ATOM   5647 N N    . VAL E 1 70  ? 65.685  -7.625  11.304 1.00 17.95 ? 70  VAL E N    1 
ATOM   5648 C CA   . VAL E 1 70  ? 65.104  -6.366  11.759 1.00 15.86 ? 70  VAL E CA   1 
ATOM   5649 C C    . VAL E 1 70  ? 65.617  -5.117  11.052 1.00 18.57 ? 70  VAL E C    1 
ATOM   5650 O O    . VAL E 1 70  ? 66.747  -5.081  10.551 1.00 21.81 ? 70  VAL E O    1 
ATOM   5651 C CB   . VAL E 1 70  ? 65.362  -6.186  13.287 1.00 17.42 ? 70  VAL E CB   1 
ATOM   5652 C CG1  . VAL E 1 70  ? 65.041  -4.785  13.742 1.00 18.95 ? 70  VAL E CG1  1 
ATOM   5653 C CG2  . VAL E 1 70  ? 64.529  -7.171  14.084 1.00 22.51 ? 70  VAL E CG2  1 
ATOM   5654 H H    . VAL E 1 70  ? 66.658  -7.731  11.356 1.00 0.00  ? 70  VAL E H    1 
ATOM   5655 N N    . ASN E 1 71  ? 64.747  -4.118  10.957 1.00 11.89 ? 71  ASN E N    1 
ATOM   5656 C CA   . ASN E 1 71  ? 65.126  -2.838  10.397 1.00 14.52 ? 71  ASN E CA   1 
ATOM   5657 C C    . ASN E 1 71  ? 65.369  -1.998  11.661 1.00 17.40 ? 71  ASN E C    1 
ATOM   5658 O O    . ASN E 1 71  ? 64.426  -1.635  12.375 1.00 12.79 ? 71  ASN E O    1 
ATOM   5659 C CB   . ASN E 1 71  ? 63.996  -2.241  9.577  1.00 18.26 ? 71  ASN E CB   1 
ATOM   5660 C CG   . ASN E 1 71  ? 64.346  -0.874  9.025  1.00 19.42 ? 71  ASN E CG   1 
ATOM   5661 O OD1  . ASN E 1 71  ? 64.901  -0.035  9.732  1.00 23.96 ? 71  ASN E OD1  1 
ATOM   5662 N ND2  . ASN E 1 71  ? 64.034  -0.645  7.758  1.00 23.47 ? 71  ASN E ND2  1 
ATOM   5663 H H    . ASN E 1 71  ? 63.828  -4.240  11.288 1.00 0.00  ? 71  ASN E H    1 
ATOM   5664 H HD21 . ASN E 1 71  ? 64.263  0.240   7.409  1.00 0.00  ? 71  ASN E HD21 1 
ATOM   5665 H HD22 . ASN E 1 71  ? 63.602  -1.350  7.239  1.00 0.00  ? 71  ASN E HD22 1 
ATOM   5666 N N    . LEU E 1 72  ? 66.638  -1.738  11.964 1.00 18.88 ? 72  LEU E N    1 
ATOM   5667 C CA   . LEU E 1 72  ? 67.001  -0.994  13.160 1.00 17.74 ? 72  LEU E CA   1 
ATOM   5668 C C    . LEU E 1 72  ? 66.504  0.437   13.144 1.00 18.06 ? 72  LEU E C    1 
ATOM   5669 O O    . LEU E 1 72  ? 66.295  1.044   14.194 1.00 18.01 ? 72  LEU E O    1 
ATOM   5670 C CB   . LEU E 1 72  ? 68.510  -1.071  13.402 1.00 21.46 ? 72  LEU E CB   1 
ATOM   5671 C CG   . LEU E 1 72  ? 69.057  -2.495  13.616 1.00 20.73 ? 72  LEU E CG   1 
ATOM   5672 C CD1  . LEU E 1 72  ? 70.474  -2.448  14.139 1.00 20.01 ? 72  LEU E CD1  1 
ATOM   5673 C CD2  . LEU E 1 72  ? 68.205  -3.222  14.615 1.00 24.64 ? 72  LEU E CD2  1 
ATOM   5674 H H    . LEU E 1 72  ? 67.341  -2.028  11.349 1.00 0.00  ? 72  LEU E H    1 
ATOM   5675 N N    . THR E 1 73  ? 66.285  0.971   11.951 1.00 23.32 ? 73  THR E N    1 
ATOM   5676 C CA   . THR E 1 73  ? 65.773  2.327   11.816 1.00 23.80 ? 73  THR E CA   1 
ATOM   5677 C C    . THR E 1 73  ? 64.338  2.330   12.333 1.00 25.44 ? 73  THR E C    1 
ATOM   5678 O O    . THR E 1 73  ? 63.971  3.165   13.166 1.00 31.85 ? 73  THR E O    1 
ATOM   5679 C CB   . THR E 1 73  ? 65.794  2.787   10.357 1.00 21.30 ? 73  THR E CB   1 
ATOM   5680 O OG1  . THR E 1 73  ? 67.147  2.793   9.881  1.00 23.32 ? 73  THR E OG1  1 
ATOM   5681 C CG2  . THR E 1 73  ? 65.195  4.173   10.230 1.00 24.03 ? 73  THR E CG2  1 
ATOM   5682 H H    . THR E 1 73  ? 66.475  0.467   11.129 1.00 0.00  ? 73  THR E H    1 
ATOM   5683 H HG1  . THR E 1 73  ? 67.652  3.515   10.275 1.00 0.00  ? 73  THR E HG1  1 
ATOM   5684 N N    . SER E 1 74  ? 63.550  1.356   11.882 1.00 20.41 ? 74  SER E N    1 
ATOM   5685 C CA   . SER E 1 74  ? 62.163  1.228   12.302 1.00 16.38 ? 74  SER E CA   1 
ATOM   5686 C C    . SER E 1 74  ? 62.044  0.885   13.787 1.00 12.82 ? 74  SER E C    1 
ATOM   5687 O O    . SER E 1 74  ? 61.230  1.473   14.496 1.00 18.71 ? 74  SER E O    1 
ATOM   5688 C CB   . SER E 1 74  ? 61.463  0.181   11.453 1.00 19.36 ? 74  SER E CB   1 
ATOM   5689 O OG   . SER E 1 74  ? 61.621  0.503   10.084 1.00 25.55 ? 74  SER E OG   1 
ATOM   5690 H H    . SER E 1 74  ? 63.890  0.702   11.237 1.00 0.00  ? 74  SER E H    1 
ATOM   5691 H HG   . SER E 1 74  ? 61.192  -0.206  9.573  1.00 0.00  ? 74  SER E HG   1 
ATOM   5692 N N    . MET E 1 75  ? 62.878  -0.029  14.271 1.00 10.49 ? 75  MET E N    1 
ATOM   5693 C CA   . MET E 1 75  ? 62.851  -0.407  15.687 1.00 15.19 ? 75  MET E CA   1 
ATOM   5694 C C    . MET E 1 75  ? 63.247  0.778   16.599 1.00 18.68 ? 75  MET E C    1 
ATOM   5695 O O    . MET E 1 75  ? 62.896  0.828   17.786 1.00 16.21 ? 75  MET E O    1 
ATOM   5696 C CB   . MET E 1 75  ? 63.765  -1.604  15.922 1.00 14.12 ? 75  MET E CB   1 
ATOM   5697 C CG   . MET E 1 75  ? 63.650  -2.238  17.284 1.00 14.77 ? 75  MET E CG   1 
ATOM   5698 S SD   . MET E 1 75  ? 64.736  -3.669  17.365 1.00 22.70 ? 75  MET E SD   1 
ATOM   5699 C CE   . MET E 1 75  ? 64.403  -4.240  19.001 1.00 12.72 ? 75  MET E CE   1 
ATOM   5700 H H    . MET E 1 75  ? 63.502  -0.472  13.658 1.00 0.00  ? 75  MET E H    1 
ATOM   5701 N N    . SER E 1 76  ? 63.970  1.736   16.030 1.00 24.15 ? 76  SER E N    1 
ATOM   5702 C CA   . SER E 1 76  ? 64.390  2.929   16.756 1.00 19.93 ? 76  SER E CA   1 
ATOM   5703 C C    . SER E 1 76  ? 63.185  3.848   16.889 1.00 21.35 ? 76  SER E C    1 
ATOM   5704 O O    . SER E 1 76  ? 62.938  4.417   17.951 1.00 27.57 ? 76  SER E O    1 
ATOM   5705 C CB   . SER E 1 76  ? 65.509  3.633   15.991 1.00 19.17 ? 76  SER E CB   1 
ATOM   5706 O OG   . SER E 1 76  ? 65.716  4.942   16.477 1.00 24.38 ? 76  SER E OG   1 
ATOM   5707 H H    . SER E 1 76  ? 64.264  1.651   15.099 1.00 0.00  ? 76  SER E H    1 
ATOM   5708 H HG   . SER E 1 76  ? 65.704  4.888   17.440 1.00 0.00  ? 76  SER E HG   1 
ATOM   5709 N N    . LYS E 1 77  ? 62.432  3.991   15.802 1.00 22.22 ? 77  LYS E N    1 
ATOM   5710 C CA   . LYS E 1 77  ? 61.243  4.833   15.805 1.00 15.72 ? 77  LYS E CA   1 
ATOM   5711 C C    . LYS E 1 77  ? 60.310  4.315   16.871 1.00 13.92 ? 77  LYS E C    1 
ATOM   5712 O O    . LYS E 1 77  ? 59.851  5.065   17.719 1.00 24.94 ? 77  LYS E O    1 
ATOM   5713 C CB   . LYS E 1 77  ? 60.534  4.780   14.462 1.00 9.19  ? 77  LYS E CB   1 
ATOM   5714 C CG   . LYS E 1 77  ? 61.276  5.431   13.329 1.00 10.28 ? 77  LYS E CG   1 
ATOM   5715 C CD   . LYS E 1 77  ? 60.413  5.353   12.084 1.00 17.68 ? 77  LYS E CD   1 
ATOM   5716 C CE   . LYS E 1 77  ? 61.099  5.919   10.866 1.00 21.89 ? 77  LYS E CE   1 
ATOM   5717 N NZ   . LYS E 1 77  ? 60.214  5.761   9.679  1.00 26.76 ? 77  LYS E NZ   1 
ATOM   5718 H H    . LYS E 1 77  ? 62.698  3.522   14.981 1.00 0.00  ? 77  LYS E H    1 
ATOM   5719 H HZ1  . LYS E 1 77  ? 59.997  4.757   9.514  1.00 0.00  ? 77  LYS E HZ1  1 
ATOM   5720 H HZ2  . LYS E 1 77  ? 59.325  6.273   9.864  1.00 0.00  ? 77  LYS E HZ2  1 
ATOM   5721 H HZ3  . LYS E 1 77  ? 60.668  6.171   8.839  1.00 0.00  ? 77  LYS E HZ3  1 
ATOM   5722 N N    . ILE E 1 78  ? 60.074  3.009   16.838 1.00 18.89 ? 78  ILE E N    1 
ATOM   5723 C CA   . ILE E 1 78  ? 59.205  2.329   17.798 1.00 17.72 ? 78  ILE E CA   1 
ATOM   5724 C C    . ILE E 1 78  ? 59.692  2.474   19.239 1.00 19.83 ? 78  ILE E C    1 
ATOM   5725 O O    . ILE E 1 78  ? 58.885  2.721   20.137 1.00 22.73 ? 78  ILE E O    1 
ATOM   5726 C CB   . ILE E 1 78  ? 59.059  0.839   17.435 1.00 10.75 ? 78  ILE E CB   1 
ATOM   5727 C CG1  . ILE E 1 78  ? 58.175  0.706   16.189 1.00 14.04 ? 78  ILE E CG1  1 
ATOM   5728 C CG2  . ILE E 1 78  ? 58.541  0.047   18.606 1.00 2.00  ? 78  ILE E CG2  1 
ATOM   5729 C CD1  . ILE E 1 78  ? 57.883  -0.724  15.788 1.00 14.18 ? 78  ILE E CD1  1 
ATOM   5730 H H    . ILE E 1 78  ? 60.485  2.480   16.122 1.00 0.00  ? 78  ILE E H    1 
ATOM   5731 N N    . LEU E 1 79  ? 60.998  2.321   19.464 1.00 17.10 ? 79  LEU E N    1 
ATOM   5732 C CA   . LEU E 1 79  ? 61.547  2.462   20.813 1.00 15.37 ? 79  LEU E CA   1 
ATOM   5733 C C    . LEU E 1 79  ? 61.540  3.909   21.292 1.00 12.65 ? 79  LEU E C    1 
ATOM   5734 O O    . LEU E 1 79  ? 61.640  4.167   22.488 1.00 14.04 ? 79  LEU E O    1 
ATOM   5735 C CB   . LEU E 1 79  ? 62.947  1.847   20.924 1.00 9.55  ? 79  LEU E CB   1 
ATOM   5736 C CG   . LEU E 1 79  ? 62.945  0.331   21.172 1.00 11.31 ? 79  LEU E CG   1 
ATOM   5737 C CD1  . LEU E 1 79  ? 64.341  -0.217  21.075 1.00 12.21 ? 79  LEU E CD1  1 
ATOM   5738 C CD2  . LEU E 1 79  ? 62.358  0.001   22.535 1.00 5.35  ? 79  LEU E CD2  1 
ATOM   5739 H H    . LEU E 1 79  ? 61.603  2.119   18.720 1.00 0.00  ? 79  LEU E H    1 
ATOM   5740 N N    . LYS E 1 80  ? 61.424  4.853   20.361 1.00 16.28 ? 80  LYS E N    1 
ATOM   5741 C CA   . LYS E 1 80  ? 61.367  6.272   20.717 1.00 19.73 ? 80  LYS E CA   1 
ATOM   5742 C C    . LYS E 1 80  ? 60.037  6.566   21.399 1.00 16.94 ? 80  LYS E C    1 
ATOM   5743 O O    . LYS E 1 80  ? 59.883  7.566   22.100 1.00 18.87 ? 80  LYS E O    1 
ATOM   5744 C CB   . LYS E 1 80  ? 61.519  7.161   19.478 1.00 19.99 ? 80  LYS E CB   1 
ATOM   5745 C CG   . LYS E 1 80  ? 62.952  7.368   19.032 1.00 26.77 ? 80  LYS E CG   1 
ATOM   5746 C CD   . LYS E 1 80  ? 63.066  8.596   18.150 1.00 34.99 ? 80  LYS E CD   1 
ATOM   5747 C CE   . LYS E 1 80  ? 62.453  8.380   16.765 1.00 41.73 ? 80  LYS E CE   1 
ATOM   5748 N NZ   . LYS E 1 80  ? 63.361  7.613   15.861 1.00 49.07 ? 80  LYS E NZ   1 
ATOM   5749 H H    . LYS E 1 80  ? 61.388  4.614   19.409 1.00 0.00  ? 80  LYS E H    1 
ATOM   5750 H HZ1  . LYS E 1 80  ? 63.584  6.678   16.261 1.00 0.00  ? 80  LYS E HZ1  1 
ATOM   5751 H HZ2  . LYS E 1 80  ? 62.907  7.486   14.935 1.00 0.00  ? 80  LYS E HZ2  1 
ATOM   5752 H HZ3  . LYS E 1 80  ? 64.246  8.144   15.728 1.00 0.00  ? 80  LYS E HZ3  1 
ATOM   5753 N N    . CYS E 1 81  ? 59.075  5.679   21.174 1.00 22.96 ? 81  CYS E N    1 
ATOM   5754 C CA   . CYS E 1 81  ? 57.746  5.792   21.750 1.00 22.75 ? 81  CYS E CA   1 
ATOM   5755 C C    . CYS E 1 81  ? 57.705  5.238   23.175 1.00 23.24 ? 81  CYS E C    1 
ATOM   5756 O O    . CYS E 1 81  ? 56.634  5.123   23.762 1.00 18.10 ? 81  CYS E O    1 
ATOM   5757 C CB   . CYS E 1 81  ? 56.735  5.045   20.880 1.00 23.89 ? 81  CYS E CB   1 
ATOM   5758 S SG   . CYS E 1 81  ? 56.800  5.491   19.144 1.00 21.45 ? 81  CYS E SG   1 
ATOM   5759 H H    . CYS E 1 81  ? 59.248  4.915   20.585 1.00 0.00  ? 81  CYS E H    1 
ATOM   5760 N N    . ALA E 1 82  ? 58.859  4.847   23.711 1.00 30.54 ? 82  ALA E N    1 
ATOM   5761 C CA   . ALA E 1 82  ? 58.940  4.317   25.076 1.00 30.76 ? 82  ALA E CA   1 
ATOM   5762 C C    . ALA E 1 82  ? 59.493  5.386   26.005 1.00 29.86 ? 82  ALA E C    1 
ATOM   5763 O O    . ALA E 1 82  ? 60.271  6.247   25.589 1.00 34.64 ? 82  ALA E O    1 
ATOM   5764 C CB   . ALA E 1 82  ? 59.828  3.060   25.128 1.00 23.48 ? 82  ALA E CB   1 
ATOM   5765 H H    . ALA E 1 82  ? 59.703  4.923   23.215 1.00 0.00  ? 82  ALA E H    1 
ATOM   5766 N N    . GLY E 1 83  ? 59.037  5.367   27.248 1.00 26.92 ? 83  GLY E N    1 
ATOM   5767 C CA   . GLY E 1 83  ? 59.521  6.323   28.222 1.00 27.58 ? 83  GLY E CA   1 
ATOM   5768 C C    . GLY E 1 83  ? 60.712  5.691   28.911 1.00 34.23 ? 83  GLY E C    1 
ATOM   5769 O O    . GLY E 1 83  ? 60.783  4.465   29.012 1.00 36.24 ? 83  GLY E O    1 
ATOM   5770 H H    . GLY E 1 83  ? 58.405  4.684   27.484 1.00 0.00  ? 83  GLY E H    1 
ATOM   5771 N N    . ASN E 1 84  ? 61.637  6.505   29.405 1.00 36.97 ? 84  ASN E N    1 
ATOM   5772 C CA   . ASN E 1 84  ? 62.821  5.974   30.071 1.00 39.07 ? 84  ASN E CA   1 
ATOM   5773 C C    . ASN E 1 84  ? 62.580  5.188   31.355 1.00 39.57 ? 84  ASN E C    1 
ATOM   5774 O O    . ASN E 1 84  ? 63.485  4.512   31.852 1.00 45.05 ? 84  ASN E O    1 
ATOM   5775 C CB   . ASN E 1 84  ? 63.862  7.068   30.269 1.00 39.49 ? 84  ASN E CB   1 
ATOM   5776 C CG   . ASN E 1 84  ? 64.593  7.390   28.984 1.00 46.67 ? 84  ASN E CG   1 
ATOM   5777 O OD1  . ASN E 1 84  ? 65.686  6.880   28.733 1.00 46.58 ? 84  ASN E OD1  1 
ATOM   5778 N ND2  . ASN E 1 84  ? 63.967  8.197   28.134 1.00 48.81 ? 84  ASN E ND2  1 
ATOM   5779 H H    . ASN E 1 84  ? 61.518  7.473   29.289 1.00 0.00  ? 84  ASN E H    1 
ATOM   5780 H HD21 . ASN E 1 84  ? 64.444  8.409   27.304 1.00 0.00  ? 84  ASN E HD21 1 
ATOM   5781 H HD22 . ASN E 1 84  ? 63.077  8.547   28.339 1.00 0.00  ? 84  ASN E HD22 1 
ATOM   5782 N N    . GLU E 1 85  ? 61.358  5.249   31.875 1.00 37.24 ? 85  GLU E N    1 
ATOM   5783 C CA   . GLU E 1 85  ? 61.015  4.512   33.081 1.00 34.90 ? 85  GLU E CA   1 
ATOM   5784 C C    . GLU E 1 85  ? 60.044  3.386   32.739 1.00 34.79 ? 85  GLU E C    1 
ATOM   5785 O O    . GLU E 1 85  ? 59.505  2.728   33.627 1.00 32.02 ? 85  GLU E O    1 
ATOM   5786 C CB   . GLU E 1 85  ? 60.403  5.437   34.130 1.00 40.97 ? 85  GLU E CB   1 
ATOM   5787 C CG   . GLU E 1 85  ? 61.408  6.136   35.032 1.00 47.49 ? 85  GLU E CG   1 
ATOM   5788 C CD   . GLU E 1 85  ? 60.937  6.193   36.481 1.00 57.04 ? 85  GLU E CD   1 
ATOM   5789 O OE1  . GLU E 1 85  ? 59.900  6.845   36.751 1.00 59.50 ? 85  GLU E OE1  1 
ATOM   5790 O OE2  . GLU E 1 85  ? 61.596  5.572   37.349 1.00 60.22 ? 85  GLU E OE2  1 
ATOM   5791 H H    . GLU E 1 85  ? 60.647  5.776   31.456 1.00 0.00  ? 85  GLU E H    1 
ATOM   5792 N N    . ASP E 1 86  ? 59.815  3.185   31.442 1.00 35.54 ? 86  ASP E N    1 
ATOM   5793 C CA   . ASP E 1 86  ? 58.911  2.148   30.958 1.00 32.62 ? 86  ASP E CA   1 
ATOM   5794 C C    . ASP E 1 86  ? 59.496  0.752   31.040 1.00 34.53 ? 86  ASP E C    1 
ATOM   5795 O O    . ASP E 1 86  ? 60.685  0.541   30.788 1.00 36.12 ? 86  ASP E O    1 
ATOM   5796 C CB   . ASP E 1 86  ? 58.491  2.418   29.504 1.00 31.43 ? 86  ASP E CB   1 
ATOM   5797 C CG   . ASP E 1 86  ? 57.421  3.489   29.388 1.00 33.50 ? 86  ASP E CG   1 
ATOM   5798 O OD1  . ASP E 1 86  ? 57.047  4.092   30.422 1.00 37.06 ? 86  ASP E OD1  1 
ATOM   5799 O OD2  . ASP E 1 86  ? 56.942  3.722   28.256 1.00 34.28 ? 86  ASP E OD2  1 
ATOM   5800 H H    . ASP E 1 86  ? 60.293  3.715   30.777 1.00 0.00  ? 86  ASP E H    1 
ATOM   5801 N N    . ILE E 1 87  ? 58.640  -0.194  31.409 1.00 34.10 ? 87  ILE E N    1 
ATOM   5802 C CA   . ILE E 1 87  ? 59.007  -1.597  31.494 1.00 29.08 ? 87  ILE E CA   1 
ATOM   5803 C C    . ILE E 1 87  ? 58.790  -2.085  30.070 1.00 31.46 ? 87  ILE E C    1 
ATOM   5804 O O    . ILE E 1 87  ? 57.695  -1.914  29.522 1.00 29.78 ? 87  ILE E O    1 
ATOM   5805 C CB   . ILE E 1 87  ? 58.047  -2.345  32.413 1.00 29.32 ? 87  ILE E CB   1 
ATOM   5806 C CG1  . ILE E 1 87  ? 58.051  -1.699  33.795 1.00 30.64 ? 87  ILE E CG1  1 
ATOM   5807 C CG2  . ILE E 1 87  ? 58.420  -3.811  32.486 1.00 29.46 ? 87  ILE E CG2  1 
ATOM   5808 C CD1  . ILE E 1 87  ? 57.026  -2.281  34.733 1.00 40.72 ? 87  ILE E CD1  1 
ATOM   5809 H H    . ILE E 1 87  ? 57.721  0.075   31.616 1.00 0.00  ? 87  ILE E H    1 
ATOM   5810 N N    . ILE E 1 88  ? 59.827  -2.652  29.459 1.00 28.60 ? 88  ILE E N    1 
ATOM   5811 C CA   . ILE E 1 88  ? 59.728  -3.126  28.085 1.00 18.45 ? 88  ILE E CA   1 
ATOM   5812 C C    . ILE E 1 88  ? 59.723  -4.635  27.953 1.00 15.59 ? 88  ILE E C    1 
ATOM   5813 O O    . ILE E 1 88  ? 60.624  -5.312  28.427 1.00 18.80 ? 88  ILE E O    1 
ATOM   5814 C CB   . ILE E 1 88  ? 60.858  -2.538  27.207 1.00 19.15 ? 88  ILE E CB   1 
ATOM   5815 C CG1  . ILE E 1 88  ? 60.698  -1.019  27.104 1.00 20.47 ? 88  ILE E CG1  1 
ATOM   5816 C CG2  . ILE E 1 88  ? 60.838  -3.154  25.814 1.00 24.20 ? 88  ILE E CG2  1 
ATOM   5817 C CD1  . ILE E 1 88  ? 61.720  -0.342  26.207 1.00 16.47 ? 88  ILE E CD1  1 
ATOM   5818 H H    . ILE E 1 88  ? 60.672  -2.769  29.942 1.00 0.00  ? 88  ILE E H    1 
ATOM   5819 N N    . THR E 1 89  ? 58.691  -5.157  27.306 1.00 19.78 ? 89  THR E N    1 
ATOM   5820 C CA   . THR E 1 89  ? 58.573  -6.587  27.076 1.00 21.48 ? 89  THR E CA   1 
ATOM   5821 C C    . THR E 1 89  ? 58.702  -6.812  25.573 1.00 21.26 ? 89  THR E C    1 
ATOM   5822 O O    . THR E 1 89  ? 58.247  -5.987  24.770 1.00 16.61 ? 89  THR E O    1 
ATOM   5823 C CB   . THR E 1 89  ? 57.203  -7.145  27.548 1.00 22.01 ? 89  THR E CB   1 
ATOM   5824 O OG1  . THR E 1 89  ? 56.988  -6.816  28.927 1.00 27.84 ? 89  THR E OG1  1 
ATOM   5825 C CG2  . THR E 1 89  ? 57.155  -8.661  27.394 1.00 19.71 ? 89  THR E CG2  1 
ATOM   5826 H H    . THR E 1 89  ? 57.995  -4.565  26.948 1.00 0.00  ? 89  THR E H    1 
ATOM   5827 H HG1  . THR E 1 89  ? 56.755  -5.884  28.985 1.00 0.00  ? 89  THR E HG1  1 
ATOM   5828 N N    . LEU E 1 90  ? 59.382  -7.891  25.207 1.00 22.47 ? 90  LEU E N    1 
ATOM   5829 C CA   . LEU E 1 90  ? 59.564  -8.267  23.814 1.00 23.07 ? 90  LEU E CA   1 
ATOM   5830 C C    . LEU E 1 90  ? 59.020  -9.686  23.677 1.00 23.85 ? 90  LEU E C    1 
ATOM   5831 O O    . LEU E 1 90  ? 59.408  -10.578 24.434 1.00 27.57 ? 90  LEU E O    1 
ATOM   5832 C CB   . LEU E 1 90  ? 61.049  -8.231  23.436 1.00 20.51 ? 90  LEU E CB   1 
ATOM   5833 C CG   . LEU E 1 90  ? 61.794  -6.894  23.482 1.00 18.80 ? 90  LEU E CG   1 
ATOM   5834 C CD1  . LEU E 1 90  ? 63.244  -7.125  23.105 1.00 19.19 ? 90  LEU E CD1  1 
ATOM   5835 C CD2  . LEU E 1 90  ? 61.167  -5.885  22.531 1.00 14.68 ? 90  LEU E CD2  1 
ATOM   5836 H H    . LEU E 1 90  ? 59.779  -8.465  25.891 1.00 0.00  ? 90  LEU E H    1 
ATOM   5837 N N    . ARG E 1 91  ? 58.100  -9.891  22.743 1.00 23.22 ? 91  ARG E N    1 
ATOM   5838 C CA   . ARG E 1 91  ? 57.515  -11.210 22.542 1.00 22.62 ? 91  ARG E CA   1 
ATOM   5839 C C    . ARG E 1 91  ? 57.382  -11.539 21.060 1.00 23.17 ? 91  ARG E C    1 
ATOM   5840 O O    . ARG E 1 91  ? 56.795  -10.776 20.287 1.00 24.97 ? 91  ARG E O    1 
ATOM   5841 C CB   . ARG E 1 91  ? 56.158  -11.282 23.232 1.00 27.93 ? 91  ARG E CB   1 
ATOM   5842 C CG   . ARG E 1 91  ? 55.426  -12.602 23.087 1.00 32.43 ? 91  ARG E CG   1 
ATOM   5843 C CD   . ARG E 1 91  ? 54.113  -12.549 23.849 1.00 33.51 ? 91  ARG E CD   1 
ATOM   5844 N NE   . ARG E 1 91  ? 53.343  -11.364 23.478 1.00 35.34 ? 91  ARG E NE   1 
ATOM   5845 C CZ   . ARG E 1 91  ? 53.024  -10.377 24.311 1.00 34.58 ? 91  ARG E CZ   1 
ATOM   5846 N NH1  . ARG E 1 91  ? 53.392  -10.416 25.588 1.00 32.69 ? 91  ARG E NH1  1 
ATOM   5847 N NH2  . ARG E 1 91  ? 52.358  -9.330  23.850 1.00 34.82 ? 91  ARG E NH2  1 
ATOM   5848 H H    . ARG E 1 91  ? 57.810  -9.142  22.182 1.00 0.00  ? 91  ARG E H    1 
ATOM   5849 H HE   . ARG E 1 91  ? 53.034  -11.288 22.553 1.00 0.00  ? 91  ARG E HE   1 
ATOM   5850 H HH11 . ARG E 1 91  ? 53.910  -11.189 25.949 1.00 0.00  ? 91  ARG E HH11 1 
ATOM   5851 H HH12 . ARG E 1 91  ? 53.129  -9.669  26.203 1.00 0.00  ? 91  ARG E HH12 1 
ATOM   5852 H HH21 . ARG E 1 91  ? 52.090  -9.288  22.889 1.00 0.00  ? 91  ARG E HH21 1 
ATOM   5853 H HH22 . ARG E 1 91  ? 52.099  -8.591  24.472 1.00 0.00  ? 91  ARG E HH22 1 
ATOM   5854 N N    . ALA E 1 92  ? 57.934  -12.683 20.673 1.00 23.94 ? 92  ALA E N    1 
ATOM   5855 C CA   . ALA E 1 92  ? 57.910  -13.133 19.291 1.00 16.95 ? 92  ALA E CA   1 
ATOM   5856 C C    . ALA E 1 92  ? 57.489  -14.597 19.168 1.00 24.03 ? 92  ALA E C    1 
ATOM   5857 O O    . ALA E 1 92  ? 57.836  -15.442 20.006 1.00 24.00 ? 92  ALA E O    1 
ATOM   5858 C CB   . ALA E 1 92  ? 59.269  -12.930 18.666 1.00 8.19  ? 92  ALA E CB   1 
ATOM   5859 H H    . ALA E 1 92  ? 58.356  -13.261 21.334 1.00 0.00  ? 92  ALA E H    1 
ATOM   5860 N N    . GLU E 1 93  ? 56.727  -14.885 18.120 1.00 22.60 ? 93  GLU E N    1 
ATOM   5861 C CA   . GLU E 1 93  ? 56.258  -16.229 17.859 1.00 23.05 ? 93  GLU E CA   1 
ATOM   5862 C C    . GLU E 1 93  ? 57.215  -16.878 16.881 1.00 29.60 ? 93  GLU E C    1 
ATOM   5863 O O    . GLU E 1 93  ? 57.775  -16.206 16.009 1.00 30.56 ? 93  GLU E O    1 
ATOM   5864 C CB   . GLU E 1 93  ? 54.837  -16.201 17.300 1.00 22.63 ? 93  GLU E CB   1 
ATOM   5865 C CG   . GLU E 1 93  ? 53.803  -15.734 18.314 1.00 28.40 ? 93  GLU E CG   1 
ATOM   5866 C CD   . GLU E 1 93  ? 53.752  -16.617 19.562 1.00 34.63 ? 93  GLU E CD   1 
ATOM   5867 O OE1  . GLU E 1 93  ? 54.126  -17.806 19.474 1.00 33.42 ? 93  GLU E OE1  1 
ATOM   5868 O OE2  . GLU E 1 93  ? 53.331  -16.127 20.637 1.00 40.56 ? 93  GLU E OE2  1 
ATOM   5869 H H    . GLU E 1 93  ? 56.552  -14.175 17.472 1.00 0.00  ? 93  GLU E H    1 
ATOM   5870 N N    . ASP E 1 94  ? 57.401  -18.185 17.031 1.00 37.30 ? 94  ASP E N    1 
ATOM   5871 C CA   . ASP E 1 94  ? 58.314  -18.943 16.181 1.00 40.58 ? 94  ASP E CA   1 
ATOM   5872 C C    . ASP E 1 94  ? 58.031  -18.772 14.693 1.00 38.37 ? 94  ASP E C    1 
ATOM   5873 O O    . ASP E 1 94  ? 58.888  -18.295 13.965 1.00 41.11 ? 94  ASP E O    1 
ATOM   5874 C CB   . ASP E 1 94  ? 58.324  -20.422 16.591 1.00 43.45 ? 94  ASP E CB   1 
ATOM   5875 C CG   . ASP E 1 94  ? 58.713  -20.619 18.055 1.00 46.43 ? 94  ASP E CG   1 
ATOM   5876 O OD1  . ASP E 1 94  ? 59.666  -19.954 18.518 1.00 49.67 ? 94  ASP E OD1  1 
ATOM   5877 O OD2  . ASP E 1 94  ? 58.053  -21.422 18.749 1.00 47.89 ? 94  ASP E OD2  1 
ATOM   5878 H H    . ASP E 1 94  ? 56.918  -18.651 17.742 1.00 0.00  ? 94  ASP E H    1 
ATOM   5879 N N    . ASN E 1 95  ? 56.810  -19.070 14.257 1.00 35.98 ? 95  ASN E N    1 
ATOM   5880 C CA   . ASN E 1 95  ? 56.462  -18.930 12.843 1.00 37.39 ? 95  ASN E CA   1 
ATOM   5881 C C    . ASN E 1 95  ? 56.022  -17.509 12.462 1.00 39.26 ? 95  ASN E C    1 
ATOM   5882 O O    . ASN E 1 95  ? 55.399  -17.309 11.409 1.00 33.21 ? 95  ASN E O    1 
ATOM   5883 C CB   . ASN E 1 95  ? 55.371  -19.939 12.459 1.00 33.38 ? 95  ASN E CB   1 
ATOM   5884 C CG   . ASN E 1 95  ? 55.872  -21.377 12.461 1.00 30.28 ? 95  ASN E CG   1 
ATOM   5885 O OD1  . ASN E 1 95  ? 56.767  -21.739 11.700 1.00 28.71 ? 95  ASN E OD1  1 
ATOM   5886 N ND2  . ASN E 1 95  ? 55.298  -22.201 13.323 1.00 29.22 ? 95  ASN E ND2  1 
ATOM   5887 H H    . ASN E 1 95  ? 56.152  -19.379 14.905 1.00 0.00  ? 95  ASN E H    1 
ATOM   5888 H HD21 . ASN E 1 95  ? 55.599  -23.140 13.285 1.00 0.00  ? 95  ASN E HD21 1 
ATOM   5889 H HD22 . ASN E 1 95  ? 54.603  -21.888 13.931 1.00 0.00  ? 95  ASN E HD22 1 
ATOM   5890 N N    . ALA E 1 96  ? 56.431  -16.527 13.271 1.00 43.29 ? 96  ALA E N    1 
ATOM   5891 C CA   . ALA E 1 96  ? 56.061  -15.117 13.077 1.00 48.13 ? 96  ALA E CA   1 
ATOM   5892 C C    . ALA E 1 96  ? 56.874  -14.206 12.137 1.00 44.32 ? 96  ALA E C    1 
ATOM   5893 O O    . ALA E 1 96  ? 58.090  -14.329 11.969 1.00 42.77 ? 96  ALA E O    1 
ATOM   5894 C CB   . ALA E 1 96  ? 55.885  -14.431 14.437 1.00 50.59 ? 96  ALA E CB   1 
ATOM   5895 H H    . ALA E 1 96  ? 57.039  -16.715 14.015 1.00 0.00  ? 96  ALA E H    1 
ATOM   5896 N N    . ASP E 1 97  ? 56.164  -13.217 11.615 1.00 40.86 ? 97  ASP E N    1 
ATOM   5897 C CA   . ASP E 1 97  ? 56.695  -12.231 10.694 1.00 38.86 ? 97  ASP E CA   1 
ATOM   5898 C C    . ASP E 1 97  ? 56.797  -10.884 11.423 1.00 34.53 ? 97  ASP E C    1 
ATOM   5899 O O    . ASP E 1 97  ? 57.177  -9.875  10.825 1.00 30.29 ? 97  ASP E O    1 
ATOM   5900 C CB   . ASP E 1 97  ? 55.725  -12.133 9.505  1.00 48.85 ? 97  ASP E CB   1 
ATOM   5901 C CG   . ASP E 1 97  ? 56.260  -11.303 8.347  1.00 56.28 ? 97  ASP E CG   1 
ATOM   5902 O OD1  . ASP E 1 97  ? 57.492  -11.124 8.227  1.00 64.60 ? 97  ASP E OD1  1 
ATOM   5903 O OD2  . ASP E 1 97  ? 55.429  -10.840 7.536  1.00 58.20 ? 97  ASP E OD2  1 
ATOM   5904 H H    . ASP E 1 97  ? 55.235  -13.139 11.898 1.00 0.00  ? 97  ASP E H    1 
ATOM   5905 N N    . THR E 1 98  ? 56.493  -10.877 12.721 1.00 29.14 ? 98  THR E N    1 
ATOM   5906 C CA   . THR E 1 98  ? 56.533  -9.650  13.519 1.00 25.75 ? 98  THR E CA   1 
ATOM   5907 C C    . THR E 1 98  ? 57.126  -9.818  14.921 1.00 20.46 ? 98  THR E C    1 
ATOM   5908 O O    . THR E 1 98  ? 57.182  -10.925 15.460 1.00 17.57 ? 98  THR E O    1 
ATOM   5909 C CB   . THR E 1 98  ? 55.108  -9.046  13.708 1.00 29.28 ? 98  THR E CB   1 
ATOM   5910 O OG1  . THR E 1 98  ? 54.252  -10.008 14.338 1.00 32.78 ? 98  THR E OG1  1 
ATOM   5911 C CG2  . THR E 1 98  ? 54.500  -8.613  12.377 1.00 33.89 ? 98  THR E CG2  1 
ATOM   5912 H H    . THR E 1 98  ? 56.231  -11.697 13.182 1.00 0.00  ? 98  THR E H    1 
ATOM   5913 H HG1  . THR E 1 98  ? 54.176  -9.810  15.281 1.00 0.00  ? 98  THR E HG1  1 
ATOM   5914 N N    . LEU E 1 99  ? 57.586  -8.707  15.489 1.00 11.83 ? 99  LEU E N    1 
ATOM   5915 C CA   . LEU E 1 99  ? 58.122  -8.687  16.845 1.00 13.61 ? 99  LEU E CA   1 
ATOM   5916 C C    . LEU E 1 99  ? 57.185  -7.774  17.624 1.00 15.93 ? 99  LEU E C    1 
ATOM   5917 O O    . LEU E 1 99  ? 56.820  -6.696  17.144 1.00 11.72 ? 99  LEU E O    1 
ATOM   5918 C CB   . LEU E 1 99  ? 59.539  -8.117  16.888 1.00 9.77  ? 99  LEU E CB   1 
ATOM   5919 C CG   . LEU E 1 99  ? 60.112  -7.963  18.302 1.00 7.18  ? 99  LEU E CG   1 
ATOM   5920 C CD1  . LEU E 1 99  ? 60.231  -9.314  18.979 1.00 10.47 ? 99  LEU E CD1  1 
ATOM   5921 C CD2  . LEU E 1 99  ? 61.468  -7.292  18.245 1.00 13.41 ? 99  LEU E CD2  1 
ATOM   5922 H H    . LEU E 1 99  ? 57.557  -7.870  14.982 1.00 0.00  ? 99  LEU E H    1 
ATOM   5923 N N    . ALA E 1 100 ? 56.784  -8.211  18.812 1.00 17.32 ? 100 ALA E N    1 
ATOM   5924 C CA   . ALA E 1 100 ? 55.869  -7.435  19.638 1.00 21.81 ? 100 ALA E CA   1 
ATOM   5925 C C    . ALA E 1 100 ? 56.553  -6.725  20.807 1.00 25.22 ? 100 ALA E C    1 
ATOM   5926 O O    . ALA E 1 100 ? 57.110  -7.376  21.705 1.00 19.94 ? 100 ALA E O    1 
ATOM   5927 C CB   . ALA E 1 100 ? 54.741  -8.325  20.146 1.00 15.13 ? 100 ALA E CB   1 
ATOM   5928 H H    . ALA E 1 100 ? 57.106  -9.067  19.159 1.00 0.00  ? 100 ALA E H    1 
ATOM   5929 N N    . LEU E 1 101 ? 56.486  -5.392  20.792 1.00 22.27 ? 101 LEU E N    1 
ATOM   5930 C CA   . LEU E 1 101 ? 57.070  -4.563  21.838 1.00 18.61 ? 101 LEU E CA   1 
ATOM   5931 C C    . LEU E 1 101 ? 55.948  -3.946  22.651 1.00 16.82 ? 101 LEU E C    1 
ATOM   5932 O O    . LEU E 1 101 ? 55.106  -3.234  22.105 1.00 13.62 ? 101 LEU E O    1 
ATOM   5933 C CB   . LEU E 1 101 ? 57.933  -3.446  21.243 1.00 14.03 ? 101 LEU E CB   1 
ATOM   5934 C CG   . LEU E 1 101 ? 59.032  -3.858  20.264 1.00 18.21 ? 101 LEU E CG   1 
ATOM   5935 C CD1  . LEU E 1 101 ? 58.409  -4.106  18.884 1.00 15.94 ? 101 LEU E CD1  1 
ATOM   5936 C CD2  . LEU E 1 101 ? 60.101  -2.765  20.183 1.00 12.47 ? 101 LEU E CD2  1 
ATOM   5937 H H    . LEU E 1 101 ? 55.982  -4.952  20.074 1.00 0.00  ? 101 LEU E H    1 
ATOM   5938 N N    . VAL E 1 102 ? 55.940  -4.219  23.952 1.00 19.38 ? 102 VAL E N    1 
ATOM   5939 C CA   . VAL E 1 102 ? 54.920  -3.686  24.852 1.00 17.46 ? 102 VAL E CA   1 
ATOM   5940 C C    . VAL E 1 102 ? 55.583  -2.825  25.930 1.00 24.92 ? 102 VAL E C    1 
ATOM   5941 O O    . VAL E 1 102 ? 56.471  -3.291  26.648 1.00 30.81 ? 102 VAL E O    1 
ATOM   5942 C CB   . VAL E 1 102 ? 54.093  -4.827  25.501 1.00 18.89 ? 102 VAL E CB   1 
ATOM   5943 C CG1  . VAL E 1 102 ? 53.184  -4.281  26.601 1.00 18.23 ? 102 VAL E CG1  1 
ATOM   5944 C CG2  . VAL E 1 102 ? 53.268  -5.550  24.431 1.00 13.81 ? 102 VAL E CG2  1 
ATOM   5945 H H    . VAL E 1 102 ? 56.653  -4.775  24.327 1.00 0.00  ? 102 VAL E H    1 
ATOM   5946 N N    . PHE E 1 103 ? 55.167  -1.564  26.017 1.00 24.61 ? 103 PHE E N    1 
ATOM   5947 C CA   . PHE E 1 103 ? 55.720  -0.632  26.989 1.00 16.59 ? 103 PHE E CA   1 
ATOM   5948 C C    . PHE E 1 103 ? 54.674  -0.353  28.044 1.00 18.44 ? 103 PHE E C    1 
ATOM   5949 O O    . PHE E 1 103 ? 53.554  0.051   27.725 1.00 18.65 ? 103 PHE E O    1 
ATOM   5950 C CB   . PHE E 1 103 ? 56.082  0.703   26.329 1.00 12.73 ? 103 PHE E CB   1 
ATOM   5951 C CG   . PHE E 1 103 ? 56.862  0.573   25.057 1.00 9.69  ? 103 PHE E CG   1 
ATOM   5952 C CD1  . PHE E 1 103 ? 57.956  -0.287  24.969 1.00 12.46 ? 103 PHE E CD1  1 
ATOM   5953 C CD2  . PHE E 1 103 ? 56.518  1.333   23.951 1.00 6.16  ? 103 PHE E CD2  1 
ATOM   5954 C CE1  . PHE E 1 103 ? 58.693  -0.381  23.802 1.00 3.60  ? 103 PHE E CE1  1 
ATOM   5955 C CE2  . PHE E 1 103 ? 57.248  1.245   22.779 1.00 6.62  ? 103 PHE E CE2  1 
ATOM   5956 C CZ   . PHE E 1 103 ? 58.339  0.386   22.707 1.00 9.30  ? 103 PHE E CZ   1 
ATOM   5957 H H    . PHE E 1 103 ? 54.443  -1.265  25.439 1.00 0.00  ? 103 PHE E H    1 
ATOM   5958 N N    . GLU E 1 104 ? 55.047  -0.527  29.304 1.00 24.18 ? 104 GLU E N    1 
ATOM   5959 C CA   . GLU E 1 104 ? 54.130  -0.275  30.398 1.00 23.51 ? 104 GLU E CA   1 
ATOM   5960 C C    . GLU E 1 104 ? 54.566  0.931   31.187 1.00 31.30 ? 104 GLU E C    1 
ATOM   5961 O O    . GLU E 1 104 ? 55.617  0.914   31.833 1.00 32.56 ? 104 GLU E O    1 
ATOM   5962 C CB   . GLU E 1 104 ? 54.072  -1.462  31.336 1.00 26.39 ? 104 GLU E CB   1 
ATOM   5963 C CG   . GLU E 1 104 ? 53.202  -2.590  30.873 1.00 32.10 ? 104 GLU E CG   1 
ATOM   5964 C CD   . GLU E 1 104 ? 53.323  -3.775  31.800 1.00 39.14 ? 104 GLU E CD   1 
ATOM   5965 O OE1  . GLU E 1 104 ? 52.714  -3.736  32.891 1.00 40.14 ? 104 GLU E OE1  1 
ATOM   5966 O OE2  . GLU E 1 104 ? 54.052  -4.730  31.448 1.00 43.21 ? 104 GLU E OE2  1 
ATOM   5967 H H    . GLU E 1 104 ? 55.962  -0.832  29.497 1.00 0.00  ? 104 GLU E H    1 
ATOM   5968 N N    . ALA E 1 105 ? 53.760  1.986   31.127 1.00 41.41 ? 105 ALA E N    1 
ATOM   5969 C CA   . ALA E 1 105 ? 54.057  3.196   31.869 1.00 46.71 ? 105 ALA E CA   1 
ATOM   5970 C C    . ALA E 1 105 ? 53.894  2.827   33.346 1.00 50.32 ? 105 ALA E C    1 
ATOM   5971 O O    . ALA E 1 105 ? 52.931  2.144   33.728 1.00 48.93 ? 105 ALA E O    1 
ATOM   5972 C CB   . ALA E 1 105 ? 53.105  4.315   31.472 1.00 49.94 ? 105 ALA E CB   1 
ATOM   5973 H H    . ALA E 1 105 ? 52.926  1.914   30.619 1.00 0.00  ? 105 ALA E H    1 
ATOM   5974 N N    . PRO E 1 106 ? 54.831  3.289   34.191 1.00 54.77 ? 106 PRO E N    1 
ATOM   5975 C CA   . PRO E 1 106 ? 54.946  3.089   35.643 1.00 57.72 ? 106 PRO E CA   1 
ATOM   5976 C C    . PRO E 1 106 ? 53.682  2.859   36.488 1.00 57.96 ? 106 PRO E C    1 
ATOM   5977 O O    . PRO E 1 106 ? 53.614  1.897   37.252 1.00 58.44 ? 106 PRO E O    1 
ATOM   5978 C CB   . PRO E 1 106 ? 55.684  4.347   36.085 1.00 56.93 ? 106 PRO E CB   1 
ATOM   5979 C CG   . PRO E 1 106 ? 56.647  4.536   34.963 1.00 56.20 ? 106 PRO E CG   1 
ATOM   5980 C CD   . PRO E 1 106 ? 55.806  4.296   33.729 1.00 53.02 ? 106 PRO E CD   1 
ATOM   5981 N N    . ASN E 1 107 ? 52.694  3.735   36.356 1.00 59.22 ? 107 ASN E N    1 
ATOM   5982 C CA   . ASN E 1 107 ? 51.466  3.619   37.136 1.00 63.70 ? 107 ASN E CA   1 
ATOM   5983 C C    . ASN E 1 107 ? 50.424  2.607   36.640 1.00 66.34 ? 107 ASN E C    1 
ATOM   5984 O O    . ASN E 1 107 ? 49.355  2.476   37.246 1.00 74.98 ? 107 ASN E O    1 
ATOM   5985 C CB   . ASN E 1 107 ? 50.828  4.989   37.283 1.00 63.77 ? 107 ASN E CB   1 
ATOM   5986 H H    . ASN E 1 107 ? 52.765  4.472   35.732 1.00 0.00  ? 107 ASN E H    1 
ATOM   5987 N N    . GLN E 1 108 ? 50.729  1.897   35.554 1.00 61.84 ? 108 GLN E N    1 
ATOM   5988 C CA   . GLN E 1 108 ? 49.812  0.912   34.961 1.00 56.91 ? 108 GLN E CA   1 
ATOM   5989 C C    . GLN E 1 108 ? 48.622  1.575   34.247 1.00 50.15 ? 108 GLN E C    1 
ATOM   5990 O O    . GLN E 1 108 ? 47.684  0.893   33.807 1.00 40.10 ? 108 GLN E O    1 
ATOM   5991 C CB   . GLN E 1 108 ? 49.312  -0.081  36.029 1.00 58.10 ? 108 GLN E CB   1 
ATOM   5992 H H    . GLN E 1 108 ? 51.613  1.981   35.149 1.00 0.00  ? 108 GLN E H    1 
ATOM   5993 N N    . GLU E 1 109 ? 48.692  2.899   34.111 1.00 44.84 ? 109 GLU E N    1 
ATOM   5994 C CA   . GLU E 1 109 ? 47.643  3.686   33.469 1.00 39.93 ? 109 GLU E CA   1 
ATOM   5995 C C    . GLU E 1 109 ? 47.823  3.814   31.960 1.00 36.45 ? 109 GLU E C    1 
ATOM   5996 O O    . GLU E 1 109 ? 46.887  4.185   31.244 1.00 37.36 ? 109 GLU E O    1 
ATOM   5997 C CB   . GLU E 1 109 ? 47.563  5.062   34.102 1.00 43.68 ? 109 GLU E CB   1 
ATOM   5998 H H    . GLU E 1 109 ? 49.477  3.341   34.477 1.00 0.00  ? 109 GLU E H    1 
ATOM   5999 N N    . LYS E 1 110 ? 49.034  3.547   31.485 1.00 31.96 ? 110 LYS E N    1 
ATOM   6000 C CA   . LYS E 1 110 ? 49.329  3.616   30.061 1.00 19.60 ? 110 LYS E CA   1 
ATOM   6001 C C    . LYS E 1 110 ? 50.082  2.374   29.650 1.00 19.35 ? 110 LYS E C    1 
ATOM   6002 O O    . LYS E 1 110 ? 51.011  1.938   30.325 1.00 23.34 ? 110 LYS E O    1 
ATOM   6003 C CB   . LYS E 1 110 ? 50.174  4.839   29.729 1.00 16.79 ? 110 LYS E CB   1 
ATOM   6004 C CG   . LYS E 1 110 ? 50.352  5.063   28.231 1.00 19.26 ? 110 LYS E CG   1 
ATOM   6005 C CD   . LYS E 1 110 ? 51.399  6.128   27.971 1.00 19.34 ? 110 LYS E CD   1 
ATOM   6006 C CE   . LYS E 1 110 ? 51.448  6.516   26.511 1.00 23.03 ? 110 LYS E CE   1 
ATOM   6007 N NZ   . LYS E 1 110 ? 52.389  7.643   26.293 1.00 21.92 ? 110 LYS E NZ   1 
ATOM   6008 H H    . LYS E 1 110 ? 49.746  3.237   32.075 1.00 0.00  ? 110 LYS E H    1 
ATOM   6009 H HZ1  . LYS E 1 110 ? 52.104  8.468   26.853 1.00 0.00  ? 110 LYS E HZ1  1 
ATOM   6010 H HZ2  . LYS E 1 110 ? 53.349  7.347   26.567 1.00 0.00  ? 110 LYS E HZ2  1 
ATOM   6011 H HZ3  . LYS E 1 110 ? 52.373  7.906   25.292 1.00 0.00  ? 110 LYS E HZ3  1 
ATOM   6012 N N    . VAL E 1 111 ? 49.625  1.762   28.575 1.00 23.99 ? 111 VAL E N    1 
ATOM   6013 C CA   . VAL E 1 111 ? 50.254  0.566   28.046 1.00 21.46 ? 111 VAL E CA   1 
ATOM   6014 C C    . VAL E 1 111 ? 50.317  0.754   26.540 1.00 20.40 ? 111 VAL E C    1 
ATOM   6015 O O    . VAL E 1 111 ? 49.348  1.204   25.920 1.00 21.92 ? 111 VAL E O    1 
ATOM   6016 C CB   . VAL E 1 111 ? 49.427  -0.700  28.400 1.00 21.02 ? 111 VAL E CB   1 
ATOM   6017 C CG1  . VAL E 1 111 ? 50.029  -1.946  27.748 1.00 16.78 ? 111 VAL E CG1  1 
ATOM   6018 C CG2  . VAL E 1 111 ? 49.360  -0.865  29.914 1.00 13.62 ? 111 VAL E CG2  1 
ATOM   6019 H H    . VAL E 1 111 ? 48.797  2.081   28.150 1.00 0.00  ? 111 VAL E H    1 
ATOM   6020 N N    . SER E 1 112 ? 51.473  0.465   25.966 1.00 22.55 ? 112 SER E N    1 
ATOM   6021 C CA   . SER E 1 112 ? 51.661  0.594   24.533 1.00 24.87 ? 112 SER E CA   1 
ATOM   6022 C C    . SER E 1 112 ? 52.055  -0.746  23.931 1.00 21.51 ? 112 SER E C    1 
ATOM   6023 O O    . SER E 1 112 ? 52.848  -1.486  24.512 1.00 19.87 ? 112 SER E O    1 
ATOM   6024 C CB   . SER E 1 112 ? 52.724  1.648   24.241 1.00 26.25 ? 112 SER E CB   1 
ATOM   6025 O OG   . SER E 1 112 ? 52.318  2.899   24.760 1.00 32.19 ? 112 SER E OG   1 
ATOM   6026 H H    . SER E 1 112 ? 52.213  0.141   26.504 1.00 0.00  ? 112 SER E H    1 
ATOM   6027 H HG   . SER E 1 112 ? 52.924  3.588   24.459 1.00 0.00  ? 112 SER E HG   1 
ATOM   6028 N N    . ASP E 1 113 ? 51.430  -1.082  22.809 1.00 25.74 ? 113 ASP E N    1 
ATOM   6029 C CA   . ASP E 1 113 ? 51.700  -2.326  22.104 1.00 28.52 ? 113 ASP E CA   1 
ATOM   6030 C C    . ASP E 1 113 ? 52.028  -2.004  20.665 1.00 22.92 ? 113 ASP E C    1 
ATOM   6031 O O    . ASP E 1 113 ? 51.222  -1.413  19.941 1.00 21.01 ? 113 ASP E O    1 
ATOM   6032 C CB   . ASP E 1 113 ? 50.501  -3.277  22.150 1.00 39.58 ? 113 ASP E CB   1 
ATOM   6033 C CG   . ASP E 1 113 ? 50.642  -4.449  21.173 1.00 52.58 ? 113 ASP E CG   1 
ATOM   6034 O OD1  . ASP E 1 113 ? 51.395  -5.406  21.476 1.00 57.67 ? 113 ASP E OD1  1 
ATOM   6035 O OD2  . ASP E 1 113 ? 50.004  -4.407  20.094 1.00 56.30 ? 113 ASP E OD2  1 
ATOM   6036 H H    . ASP E 1 113 ? 50.756  -0.476  22.445 1.00 0.00  ? 113 ASP E H    1 
ATOM   6037 N N    . TYR E 1 114 ? 53.236  -2.367  20.273 1.00 18.01 ? 114 TYR E N    1 
ATOM   6038 C CA   . TYR E 1 114 ? 53.708  -2.139  18.932 1.00 13.34 ? 114 TYR E CA   1 
ATOM   6039 C C    . TYR E 1 114 ? 53.977  -3.483  18.287 1.00 17.43 ? 114 TYR E C    1 
ATOM   6040 O O    . TYR E 1 114 ? 54.329  -4.452  18.964 1.00 22.44 ? 114 TYR E O    1 
ATOM   6041 C CB   . TYR E 1 114 ? 54.959  -1.262  18.963 1.00 6.35  ? 114 TYR E CB   1 
ATOM   6042 C CG   . TYR E 1 114 ? 54.647  0.118   19.477 1.00 9.26  ? 114 TYR E CG   1 
ATOM   6043 C CD1  . TYR E 1 114 ? 54.578  0.373   20.843 1.00 7.26  ? 114 TYR E CD1  1 
ATOM   6044 C CD2  . TYR E 1 114 ? 54.330  1.150   18.598 1.00 8.57  ? 114 TYR E CD2  1 
ATOM   6045 C CE1  . TYR E 1 114 ? 54.193  1.617   21.321 1.00 11.97 ? 114 TYR E CE1  1 
ATOM   6046 C CE2  . TYR E 1 114 ? 53.940  2.399   19.061 1.00 10.08 ? 114 TYR E CE2  1 
ATOM   6047 C CZ   . TYR E 1 114 ? 53.873  2.630   20.425 1.00 17.11 ? 114 TYR E CZ   1 
ATOM   6048 O OH   . TYR E 1 114 ? 53.483  3.868   20.894 1.00 16.51 ? 114 TYR E OH   1 
ATOM   6049 H H    . TYR E 1 114 ? 53.818  -2.826  20.903 1.00 0.00  ? 114 TYR E H    1 
ATOM   6050 H HH   . TYR E 1 114 ? 53.607  3.930   21.849 1.00 0.00  ? 114 TYR E HH   1 
ATOM   6051 N N    . GLU E 1 115 ? 53.710  -3.557  16.992 1.00 22.19 ? 115 GLU E N    1 
ATOM   6052 C CA   . GLU E 1 115 ? 53.930  -4.765  16.235 1.00 23.18 ? 115 GLU E CA   1 
ATOM   6053 C C    . GLU E 1 115 ? 54.803  -4.398  15.042 1.00 22.79 ? 115 GLU E C    1 
ATOM   6054 O O    . GLU E 1 115 ? 54.313  -3.935  14.017 1.00 26.98 ? 115 GLU E O    1 
ATOM   6055 C CB   . GLU E 1 115 ? 52.598  -5.347  15.786 1.00 30.29 ? 115 GLU E CB   1 
ATOM   6056 C CG   . GLU E 1 115 ? 52.727  -6.636  15.015 1.00 47.28 ? 115 GLU E CG   1 
ATOM   6057 C CD   . GLU E 1 115 ? 51.426  -7.400  14.957 1.00 56.42 ? 115 GLU E CD   1 
ATOM   6058 O OE1  . GLU E 1 115 ? 51.112  -8.107  15.941 1.00 64.83 ? 115 GLU E OE1  1 
ATOM   6059 O OE2  . GLU E 1 115 ? 50.717  -7.290  13.933 1.00 60.30 ? 115 GLU E OE2  1 
ATOM   6060 H H    . GLU E 1 115 ? 53.357  -2.760  16.542 1.00 0.00  ? 115 GLU E H    1 
ATOM   6061 N N    . MET E 1 116 ? 56.106  -4.563  15.215 1.00 18.16 ? 116 MET E N    1 
ATOM   6062 C CA   . MET E 1 116 ? 57.091  -4.255  14.187 1.00 20.80 ? 116 MET E CA   1 
ATOM   6063 C C    . MET E 1 116 ? 57.275  -5.417  13.199 1.00 27.02 ? 116 MET E C    1 
ATOM   6064 O O    . MET E 1 116 ? 57.585  -6.536  13.611 1.00 34.72 ? 116 MET E O    1 
ATOM   6065 C CB   . MET E 1 116 ? 58.420  -3.951  14.870 1.00 11.58 ? 116 MET E CB   1 
ATOM   6066 C CG   . MET E 1 116 ? 59.569  -3.697  13.955 1.00 5.27  ? 116 MET E CG   1 
ATOM   6067 S SD   . MET E 1 116 ? 61.034  -3.468  14.935 1.00 11.01 ? 116 MET E SD   1 
ATOM   6068 C CE   . MET E 1 116 ? 61.623  -5.140  15.092 1.00 13.99 ? 116 MET E CE   1 
ATOM   6069 H H    . MET E 1 116 ? 56.420  -4.928  16.071 1.00 0.00  ? 116 MET E H    1 
ATOM   6070 N N    . LYS E 1 117 ? 57.089  -5.147  11.905 1.00 28.57 ? 117 LYS E N    1 
ATOM   6071 C CA   . LYS E 1 117 ? 57.252  -6.157  10.852 1.00 24.01 ? 117 LYS E CA   1 
ATOM   6072 C C    . LYS E 1 117 ? 58.728  -6.512  10.676 1.00 23.95 ? 117 LYS E C    1 
ATOM   6073 O O    . LYS E 1 117 ? 59.584  -5.617  10.631 1.00 21.41 ? 117 LYS E O    1 
ATOM   6074 C CB   . LYS E 1 117 ? 56.761  -5.623  9.509  1.00 26.14 ? 117 LYS E CB   1 
ATOM   6075 C CG   . LYS E 1 117 ? 55.417  -4.927  9.507  1.00 36.49 ? 117 LYS E CG   1 
ATOM   6076 C CD   . LYS E 1 117 ? 55.185  -4.281  8.138  1.00 45.20 ? 117 LYS E CD   1 
ATOM   6077 C CE   . LYS E 1 117 ? 53.803  -3.654  8.018  1.00 52.91 ? 117 LYS E CE   1 
ATOM   6078 N NZ   . LYS E 1 117 ? 53.458  -3.350  6.597  1.00 53.34 ? 117 LYS E NZ   1 
ATOM   6079 H H    . LYS E 1 117 ? 56.815  -4.240  11.670 1.00 0.00  ? 117 LYS E H    1 
ATOM   6080 H HZ1  . LYS E 1 117 ? 53.492  -4.238  6.051  1.00 0.00  ? 117 LYS E HZ1  1 
ATOM   6081 H HZ2  . LYS E 1 117 ? 52.480  -2.995  6.550  1.00 0.00  ? 117 LYS E HZ2  1 
ATOM   6082 H HZ3  . LYS E 1 117 ? 54.120  -2.662  6.188  1.00 0.00  ? 117 LYS E HZ3  1 
ATOM   6083 N N    . LEU E 1 118 ? 59.018  -7.802  10.521 1.00 20.18 ? 118 LEU E N    1 
ATOM   6084 C CA   . LEU E 1 118 ? 60.390  -8.266  10.332 1.00 13.58 ? 118 LEU E CA   1 
ATOM   6085 C C    . LEU E 1 118 ? 60.709  -8.348  8.843  1.00 21.78 ? 118 LEU E C    1 
ATOM   6086 O O    . LEU E 1 118 ? 59.820  -8.200  8.002  1.00 26.57 ? 118 LEU E O    1 
ATOM   6087 C CB   . LEU E 1 118 ? 60.593  -9.619  11.006 1.00 2.85  ? 118 LEU E CB   1 
ATOM   6088 C CG   . LEU E 1 118 ? 60.333  -9.569  12.513 1.00 7.55  ? 118 LEU E CG   1 
ATOM   6089 C CD1  . LEU E 1 118 ? 60.396  -10.955 13.109 1.00 7.02  ? 118 LEU E CD1  1 
ATOM   6090 C CD2  . LEU E 1 118 ? 61.312  -8.628  13.196 1.00 2.06  ? 118 LEU E CD2  1 
ATOM   6091 H H    . LEU E 1 118 ? 58.293  -8.452  10.495 1.00 0.00  ? 118 LEU E H    1 
ATOM   6092 N N    . MET E 1 119 ? 61.969  -8.593  8.506  1.00 23.65 ? 119 MET E N    1 
ATOM   6093 C CA   . MET E 1 119 ? 62.357  -8.656  7.106  1.00 20.48 ? 119 MET E CA   1 
ATOM   6094 C C    . MET E 1 119 ? 63.416  -9.701  6.824  1.00 25.14 ? 119 MET E C    1 
ATOM   6095 O O    . MET E 1 119 ? 64.087  -10.196 7.739  1.00 24.76 ? 119 MET E O    1 
ATOM   6096 C CB   . MET E 1 119 ? 62.878  -7.294  6.637  1.00 24.35 ? 119 MET E CB   1 
ATOM   6097 C CG   . MET E 1 119 ? 64.068  -6.775  7.437  1.00 28.29 ? 119 MET E CG   1 
ATOM   6098 S SD   . MET E 1 119 ? 65.122  -5.604  6.548  1.00 38.80 ? 119 MET E SD   1 
ATOM   6099 C CE   . MET E 1 119 ? 64.328  -4.109  6.890  1.00 43.76 ? 119 MET E CE   1 
ATOM   6100 H H    . MET E 1 119 ? 62.642  -8.762  9.196  1.00 0.00  ? 119 MET E H    1 
ATOM   6101 N N    . ASP E 1 120 ? 63.540  -10.038 5.543  1.00 22.36 ? 120 ASP E N    1 
ATOM   6102 C CA   . ASP E 1 120 ? 64.526  -11.000 5.081  1.00 21.75 ? 120 ASP E CA   1 
ATOM   6103 C C    . ASP E 1 120 ? 65.839  -10.251 4.869  1.00 23.70 ? 120 ASP E C    1 
ATOM   6104 O O    . ASP E 1 120 ? 65.857  -9.148  4.317  1.00 20.38 ? 120 ASP E O    1 
ATOM   6105 C CB   . ASP E 1 120 ? 64.091  -11.632 3.754  1.00 23.81 ? 120 ASP E CB   1 
ATOM   6106 C CG   . ASP E 1 120 ? 62.708  -12.272 3.819  1.00 33.86 ? 120 ASP E CG   1 
ATOM   6107 O OD1  . ASP E 1 120 ? 62.287  -12.754 4.899  1.00 29.34 ? 120 ASP E OD1  1 
ATOM   6108 O OD2  . ASP E 1 120 ? 62.042  -12.303 2.759  1.00 40.84 ? 120 ASP E OD2  1 
ATOM   6109 H H    . ASP E 1 120 ? 62.950  -9.630  4.882  1.00 0.00  ? 120 ASP E H    1 
ATOM   6110 N N    . LEU E 1 121 ? 66.936  -10.855 5.307  1.00 25.39 ? 121 LEU E N    1 
ATOM   6111 C CA   . LEU E 1 121 ? 68.256  -10.257 5.156  1.00 19.73 ? 121 LEU E CA   1 
ATOM   6112 C C    . LEU E 1 121 ? 69.287  -11.297 4.691  1.00 24.30 ? 121 LEU E C    1 
ATOM   6113 O O    . LEU E 1 121 ? 69.214  -12.479 5.039  1.00 24.35 ? 121 LEU E O    1 
ATOM   6114 C CB   . LEU E 1 121 ? 68.718  -9.650  6.485  1.00 10.35 ? 121 LEU E CB   1 
ATOM   6115 C CG   . LEU E 1 121 ? 67.803  -8.659  7.189  1.00 8.15  ? 121 LEU E CG   1 
ATOM   6116 C CD1  . LEU E 1 121 ? 68.302  -8.422  8.592  1.00 8.25  ? 121 LEU E CD1  1 
ATOM   6117 C CD2  . LEU E 1 121 ? 67.718  -7.366  6.413  1.00 8.15  ? 121 LEU E CD2  1 
ATOM   6118 H H    . LEU E 1 121 ? 66.842  -11.738 5.728  1.00 0.00  ? 121 LEU E H    1 
ATOM   6119 N N    . ASP E 1 122 ? 70.220  -10.854 3.861  1.00 24.22 ? 122 ASP E N    1 
ATOM   6120 C CA   . ASP E 1 122 ? 71.285  -11.709 3.384  1.00 25.77 ? 122 ASP E CA   1 
ATOM   6121 C C    . ASP E 1 122 ? 72.497  -11.233 4.174  1.00 30.79 ? 122 ASP E C    1 
ATOM   6122 O O    . ASP E 1 122 ? 73.290  -10.419 3.698  1.00 33.00 ? 122 ASP E O    1 
ATOM   6123 C CB   . ASP E 1 122 ? 71.501  -11.493 1.900  1.00 30.10 ? 122 ASP E CB   1 
ATOM   6124 C CG   . ASP E 1 122 ? 72.329  -12.576 1.279  1.00 41.01 ? 122 ASP E CG   1 
ATOM   6125 O OD1  . ASP E 1 122 ? 72.749  -13.504 2.009  1.00 43.36 ? 122 ASP E OD1  1 
ATOM   6126 O OD2  . ASP E 1 122 ? 72.546  -12.502 0.051  1.00 47.44 ? 122 ASP E OD2  1 
ATOM   6127 H H    . ASP E 1 122 ? 70.188  -9.926  3.558  1.00 0.00  ? 122 ASP E H    1 
ATOM   6128 N N    . VAL E 1 123 ? 72.554  -11.682 5.423  1.00 33.57 ? 123 VAL E N    1 
ATOM   6129 C CA   . VAL E 1 123 ? 73.595  -11.317 6.377  1.00 31.21 ? 123 VAL E CA   1 
ATOM   6130 C C    . VAL E 1 123 ? 74.911  -12.052 6.140  1.00 28.08 ? 123 VAL E C    1 
ATOM   6131 O O    . VAL E 1 123 ? 74.945  -13.113 5.539  1.00 29.22 ? 123 VAL E O    1 
ATOM   6132 C CB   . VAL E 1 123 ? 73.088  -11.573 7.826  1.00 33.53 ? 123 VAL E CB   1 
ATOM   6133 C CG1  . VAL E 1 123 ? 74.116  -11.181 8.860  1.00 34.09 ? 123 VAL E CG1  1 
ATOM   6134 C CG2  . VAL E 1 123 ? 71.807  -10.794 8.070  1.00 36.24 ? 123 VAL E CG2  1 
ATOM   6135 H H    . VAL E 1 123 ? 71.878  -12.336 5.690  1.00 0.00  ? 123 VAL E H    1 
ATOM   6136 N N    . GLU E 1 124 ? 75.999  -11.453 6.598  1.00 32.50 ? 124 GLU E N    1 
ATOM   6137 C CA   . GLU E 1 124 ? 77.335  -12.020 6.457  1.00 29.99 ? 124 GLU E CA   1 
ATOM   6138 C C    . GLU E 1 124 ? 78.030  -11.774 7.790  1.00 25.27 ? 124 GLU E C    1 
ATOM   6139 O O    . GLU E 1 124 ? 78.394  -10.639 8.103  1.00 23.45 ? 124 GLU E O    1 
ATOM   6140 C CB   . GLU E 1 124 ? 78.080  -11.287 5.345  1.00 30.39 ? 124 GLU E CB   1 
ATOM   6141 C CG   . GLU E 1 124 ? 79.457  -11.823 5.000  1.00 30.83 ? 124 GLU E CG   1 
ATOM   6142 C CD   . GLU E 1 124 ? 80.191  -10.941 3.997  1.00 35.12 ? 124 GLU E CD   1 
ATOM   6143 O OE1  . GLU E 1 124 ? 79.548  -10.046 3.390  1.00 34.99 ? 124 GLU E OE1  1 
ATOM   6144 O OE2  . GLU E 1 124 ? 81.419  -11.127 3.820  1.00 38.37 ? 124 GLU E OE2  1 
ATOM   6145 H H    . GLU E 1 124 ? 75.922  -10.590 7.053  1.00 0.00  ? 124 GLU E H    1 
ATOM   6146 N N    . GLN E 1 125 ? 78.169  -12.816 8.597  1.00 21.07 ? 125 GLN E N    1 
ATOM   6147 C CA   . GLN E 1 125 ? 78.795  -12.648 9.894  1.00 21.31 ? 125 GLN E CA   1 
ATOM   6148 C C    . GLN E 1 125 ? 80.210  -13.213 9.924  1.00 21.73 ? 125 GLN E C    1 
ATOM   6149 O O    . GLN E 1 125 ? 80.518  -14.170 9.206  1.00 19.07 ? 125 GLN E O    1 
ATOM   6150 C CB   . GLN E 1 125 ? 77.885  -13.225 10.973 1.00 25.09 ? 125 GLN E CB   1 
ATOM   6151 C CG   . GLN E 1 125 ? 76.505  -12.545 10.943 1.00 33.40 ? 125 GLN E CG   1 
ATOM   6152 C CD   . GLN E 1 125 ? 75.620  -12.884 12.119 1.00 36.74 ? 125 GLN E CD   1 
ATOM   6153 O OE1  . GLN E 1 125 ? 76.000  -13.657 12.999 1.00 41.81 ? 125 GLN E OE1  1 
ATOM   6154 N NE2  . GLN E 1 125 ? 74.428  -12.296 12.148 1.00 40.56 ? 125 GLN E NE2  1 
ATOM   6155 H H    . GLN E 1 125 ? 77.892  -13.720 8.312  1.00 0.00  ? 125 GLN E H    1 
ATOM   6156 H HE21 . GLN E 1 125 ? 73.864  -12.463 12.924 1.00 0.00  ? 125 GLN E HE21 1 
ATOM   6157 H HE22 . GLN E 1 125 ? 74.129  -11.690 11.439 1.00 0.00  ? 125 GLN E HE22 1 
ATOM   6158 N N    . LEU E 1 126 ? 81.099  -12.535 10.651 1.00 23.92 ? 126 LEU E N    1 
ATOM   6159 C CA   . LEU E 1 126 ? 82.504  -12.943 10.761 1.00 26.50 ? 126 LEU E CA   1 
ATOM   6160 C C    . LEU E 1 126 ? 82.851  -13.832 11.955 1.00 30.23 ? 126 LEU E C    1 
ATOM   6161 O O    . LEU E 1 126 ? 82.131  -13.871 12.957 1.00 34.77 ? 126 LEU E O    1 
ATOM   6162 C CB   . LEU E 1 126 ? 83.432  -11.713 10.793 1.00 24.83 ? 126 LEU E CB   1 
ATOM   6163 C CG   . LEU E 1 126 ? 83.348  -10.633 9.712  1.00 27.27 ? 126 LEU E CG   1 
ATOM   6164 C CD1  . LEU E 1 126 ? 84.508  -9.665  9.911  1.00 25.17 ? 126 LEU E CD1  1 
ATOM   6165 C CD2  . LEU E 1 126 ? 83.431  -11.222 8.312  1.00 19.21 ? 126 LEU E CD2  1 
ATOM   6166 H H    . LEU E 1 126 ? 80.773  -11.712 11.064 1.00 0.00  ? 126 LEU E H    1 
ATOM   6167 N N    . GLY E 1 127 ? 83.983  -14.527 11.855 1.00 28.97 ? 127 GLY E N    1 
ATOM   6168 C CA   . GLY E 1 127 ? 84.430  -15.393 12.934 1.00 25.56 ? 127 GLY E CA   1 
ATOM   6169 C C    . GLY E 1 127 ? 85.578  -14.722 13.665 1.00 20.52 ? 127 GLY E C    1 
ATOM   6170 O O    . GLY E 1 127 ? 86.719  -14.738 13.187 1.00 18.98 ? 127 GLY E O    1 
ATOM   6171 H H    . GLY E 1 127 ? 84.558  -14.445 11.084 1.00 0.00  ? 127 GLY E H    1 
ATOM   6172 N N    . ILE E 1 128 ? 85.264  -14.104 14.800 1.00 19.28 ? 128 ILE E N    1 
ATOM   6173 C CA   . ILE E 1 128 ? 86.244  -13.397 15.619 1.00 16.12 ? 128 ILE E CA   1 
ATOM   6174 C C    . ILE E 1 128 ? 86.541  -14.202 16.886 1.00 19.53 ? 128 ILE E C    1 
ATOM   6175 O O    . ILE E 1 128 ? 85.713  -14.271 17.796 1.00 20.38 ? 128 ILE E O    1 
ATOM   6176 C CB   . ILE E 1 128 ? 85.718  -11.994 16.012 1.00 15.93 ? 128 ILE E CB   1 
ATOM   6177 C CG1  . ILE E 1 128 ? 85.331  -11.206 14.750 1.00 16.03 ? 128 ILE E CG1  1 
ATOM   6178 C CG2  . ILE E 1 128 ? 86.773  -11.242 16.823 1.00 16.12 ? 128 ILE E CG2  1 
ATOM   6179 C CD1  . ILE E 1 128 ? 84.526  -9.937  14.999 1.00 7.19  ? 128 ILE E CD1  1 
ATOM   6180 H H    . ILE E 1 128 ? 84.332  -14.145 15.106 1.00 0.00  ? 128 ILE E H    1 
ATOM   6181 N N    . PRO E 1 129 ? 87.703  -14.873 16.932 1.00 21.73 ? 129 PRO E N    1 
ATOM   6182 C CA   . PRO E 1 129 ? 88.099  -15.674 18.088 1.00 23.78 ? 129 PRO E CA   1 
ATOM   6183 C C    . PRO E 1 129 ? 88.645  -14.814 19.234 1.00 28.11 ? 129 PRO E C    1 
ATOM   6184 O O    . PRO E 1 129 ? 89.153  -13.713 19.004 1.00 34.48 ? 129 PRO E O    1 
ATOM   6185 C CB   . PRO E 1 129 ? 89.182  -16.578 17.498 1.00 22.37 ? 129 PRO E CB   1 
ATOM   6186 C CG   . PRO E 1 129 ? 89.862  -15.684 16.549 1.00 19.35 ? 129 PRO E CG   1 
ATOM   6187 C CD   . PRO E 1 129 ? 88.696  -15.009 15.850 1.00 25.71 ? 129 PRO E CD   1 
ATOM   6188 N N    . GLU E 1 130 ? 88.530  -15.312 20.465 1.00 28.13 ? 130 GLU E N    1 
ATOM   6189 C CA   . GLU E 1 130 ? 89.033  -14.594 21.632 1.00 28.52 ? 130 GLU E CA   1 
ATOM   6190 C C    . GLU E 1 130 ? 90.520  -14.350 21.466 1.00 27.05 ? 130 GLU E C    1 
ATOM   6191 O O    . GLU E 1 130 ? 91.254  -15.265 21.099 1.00 30.42 ? 130 GLU E O    1 
ATOM   6192 C CB   . GLU E 1 130 ? 88.824  -15.415 22.900 1.00 33.00 ? 130 GLU E CB   1 
ATOM   6193 C CG   . GLU E 1 130 ? 87.495  -15.216 23.595 1.00 37.06 ? 130 GLU E CG   1 
ATOM   6194 C CD   . GLU E 1 130 ? 87.530  -15.700 25.037 1.00 43.15 ? 130 GLU E CD   1 
ATOM   6195 O OE1  . GLU E 1 130 ? 88.526  -15.425 25.743 1.00 44.90 ? 130 GLU E OE1  1 
ATOM   6196 O OE2  . GLU E 1 130 ? 86.562  -16.353 25.474 1.00 47.13 ? 130 GLU E OE2  1 
ATOM   6197 H H    . GLU E 1 130 ? 88.133  -16.188 20.609 1.00 0.00  ? 130 GLU E H    1 
ATOM   6198 N N    . GLN E 1 131 ? 90.966  -13.128 21.733 1.00 30.35 ? 131 GLN E N    1 
ATOM   6199 C CA   . GLN E 1 131 ? 92.382  -12.791 21.610 1.00 30.32 ? 131 GLN E CA   1 
ATOM   6200 C C    . GLN E 1 131 ? 92.866  -12.151 22.892 1.00 33.86 ? 131 GLN E C    1 
ATOM   6201 O O    . GLN E 1 131 ? 92.111  -12.002 23.850 1.00 41.29 ? 131 GLN E O    1 
ATOM   6202 C CB   . GLN E 1 131 ? 92.613  -11.749 20.519 1.00 34.43 ? 131 GLN E CB   1 
ATOM   6203 C CG   . GLN E 1 131 ? 91.869  -11.915 19.226 1.00 40.07 ? 131 GLN E CG   1 
ATOM   6204 C CD   . GLN E 1 131 ? 92.277  -10.851 18.233 1.00 40.99 ? 131 GLN E CD   1 
ATOM   6205 O OE1  . GLN E 1 131 ? 93.370  -10.290 18.330 1.00 38.02 ? 131 GLN E OE1  1 
ATOM   6206 N NE2  . GLN E 1 131 ? 91.408  -10.563 17.279 1.00 46.76 ? 131 GLN E NE2  1 
ATOM   6207 H H    . GLN E 1 131 ? 90.330  -12.441 22.029 1.00 0.00  ? 131 GLN E H    1 
ATOM   6208 H HE21 . GLN E 1 131 ? 91.635  -9.885  16.607 1.00 0.00  ? 131 GLN E HE21 1 
ATOM   6209 H HE22 . GLN E 1 131 ? 90.559  -11.045 17.258 1.00 0.00  ? 131 GLN E HE22 1 
ATOM   6210 N N    . GLU E 1 132 ? 94.133  -11.751 22.877 1.00 39.31 ? 132 GLU E N    1 
ATOM   6211 C CA   . GLU E 1 132 ? 94.771  -11.049 23.982 1.00 41.34 ? 132 GLU E CA   1 
ATOM   6212 C C    . GLU E 1 132 ? 95.540  -9.925  23.291 1.00 36.90 ? 132 GLU E C    1 
ATOM   6213 O O    . GLU E 1 132 ? 96.601  -10.149 22.700 1.00 35.59 ? 132 GLU E O    1 
ATOM   6214 C CB   . GLU E 1 132 ? 95.716  -11.960 24.769 1.00 47.66 ? 132 GLU E CB   1 
ATOM   6215 C CG   . GLU E 1 132 ? 96.341  -11.271 25.984 1.00 58.85 ? 132 GLU E CG   1 
ATOM   6216 C CD   . GLU E 1 132 ? 96.838  -12.246 27.050 1.00 69.42 ? 132 GLU E CD   1 
ATOM   6217 O OE1  . GLU E 1 132 ? 97.299  -13.359 26.703 1.00 73.57 ? 132 GLU E OE1  1 
ATOM   6218 O OE2  . GLU E 1 132 ? 96.768  -11.893 28.249 1.00 74.87 ? 132 GLU E OE2  1 
ATOM   6219 H H    . GLU E 1 132 ? 94.683  -11.940 22.089 1.00 0.00  ? 132 GLU E H    1 
ATOM   6220 N N    . TYR E 1 133 ? 94.951  -8.735  23.308 1.00 33.33 ? 133 TYR E N    1 
ATOM   6221 C CA   . TYR E 1 133 ? 95.535  -7.565  22.660 1.00 30.35 ? 133 TYR E CA   1 
ATOM   6222 C C    . TYR E 1 133 ? 96.774  -7.024  23.354 1.00 29.46 ? 133 TYR E C    1 
ATOM   6223 O O    . TYR E 1 133 ? 97.021  -7.312  24.532 1.00 30.91 ? 133 TYR E O    1 
ATOM   6224 C CB   . TYR E 1 133 ? 94.480  -6.464  22.519 1.00 25.48 ? 133 TYR E CB   1 
ATOM   6225 C CG   . TYR E 1 133 ? 93.292  -6.889  21.696 1.00 18.16 ? 133 TYR E CG   1 
ATOM   6226 C CD1  . TYR E 1 133 ? 92.255  -7.605  22.263 1.00 21.20 ? 133 TYR E CD1  1 
ATOM   6227 C CD2  . TYR E 1 133 ? 93.216  -6.590  20.342 1.00 24.35 ? 133 TYR E CD2  1 
ATOM   6228 C CE1  . TYR E 1 133 ? 91.171  -8.016  21.505 1.00 22.68 ? 133 TYR E CE1  1 
ATOM   6229 C CE2  . TYR E 1 133 ? 92.137  -7.000  19.573 1.00 22.79 ? 133 TYR E CE2  1 
ATOM   6230 C CZ   . TYR E 1 133 ? 91.117  -7.712  20.165 1.00 21.54 ? 133 TYR E CZ   1 
ATOM   6231 O OH   . TYR E 1 133 ? 90.037  -8.128  19.421 1.00 28.85 ? 133 TYR E OH   1 
ATOM   6232 H H    . TYR E 1 133 ? 94.104  -8.634  23.787 1.00 0.00  ? 133 TYR E H    1 
ATOM   6233 H HH   . TYR E 1 133 ? 90.218  -7.952  18.488 1.00 0.00  ? 133 TYR E HH   1 
ATOM   6234 N N    . SER E 1 134 ? 97.559  -6.249  22.615 1.00 27.72 ? 134 SER E N    1 
ATOM   6235 C CA   . SER E 1 134 ? 98.777  -5.666  23.155 1.00 27.34 ? 134 SER E CA   1 
ATOM   6236 C C    . SER E 1 134 ? 98.446  -4.554  24.133 1.00 29.66 ? 134 SER E C    1 
ATOM   6237 O O    . SER E 1 134 ? 99.137  -4.379  25.134 1.00 28.51 ? 134 SER E O    1 
ATOM   6238 C CB   . SER E 1 134 ? 99.656  -5.106  22.033 1.00 27.58 ? 134 SER E CB   1 
ATOM   6239 O OG   . SER E 1 134 ? 99.994  -6.101  21.084 1.00 30.66 ? 134 SER E OG   1 
ATOM   6240 H H    . SER E 1 134 ? 97.307  -6.053  21.684 1.00 0.00  ? 134 SER E H    1 
ATOM   6241 H HG   . SER E 1 134 ? 100.221 -6.920  21.532 1.00 0.00  ? 134 SER E HG   1 
ATOM   6242 N N    . CYS E 1 135 ? 97.388  -3.803  23.848 1.00 29.26 ? 135 CYS E N    1 
ATOM   6243 C CA   . CYS E 1 135 ? 96.999  -2.701  24.715 1.00 26.83 ? 135 CYS E CA   1 
ATOM   6244 C C    . CYS E 1 135 ? 95.523  -2.651  25.018 1.00 20.72 ? 135 CYS E C    1 
ATOM   6245 O O    . CYS E 1 135 ? 94.687  -2.877  24.147 1.00 19.33 ? 135 CYS E O    1 
ATOM   6246 C CB   . CYS E 1 135 ? 97.424  -1.364  24.111 1.00 30.82 ? 135 CYS E CB   1 
ATOM   6247 S SG   . CYS E 1 135 ? 99.197  -1.074  24.131 1.00 45.39 ? 135 CYS E SG   1 
ATOM   6248 H H    . CYS E 1 135 ? 96.854  -3.990  23.049 1.00 0.00  ? 135 CYS E H    1 
ATOM   6249 N N    . VAL E 1 136 ? 95.210  -2.364  26.270 1.00 16.07 ? 136 VAL E N    1 
ATOM   6250 C CA   . VAL E 1 136 ? 93.838  -2.243  26.700 1.00 17.11 ? 136 VAL E CA   1 
ATOM   6251 C C    . VAL E 1 136 ? 93.805  -1.030  27.602 1.00 20.17 ? 136 VAL E C    1 
ATOM   6252 O O    . VAL E 1 136 ? 94.510  -0.965  28.614 1.00 25.60 ? 136 VAL E O    1 
ATOM   6253 C CB   . VAL E 1 136 ? 93.357  -3.482  27.452 1.00 18.77 ? 136 VAL E CB   1 
ATOM   6254 C CG1  . VAL E 1 136 ? 91.910  -3.305  27.878 1.00 9.39  ? 136 VAL E CG1  1 
ATOM   6255 C CG2  . VAL E 1 136 ? 93.496  -4.706  26.559 1.00 23.05 ? 136 VAL E CG2  1 
ATOM   6256 H H    . VAL E 1 136 ? 95.922  -2.239  26.927 1.00 0.00  ? 136 VAL E H    1 
ATOM   6257 N N    . VAL E 1 137 ? 93.032  -0.040  27.177 1.00 21.10 ? 137 VAL E N    1 
ATOM   6258 C CA   . VAL E 1 137 ? 92.881  1.215   27.894 1.00 19.15 ? 137 VAL E CA   1 
ATOM   6259 C C    . VAL E 1 137 ? 91.479  1.315   28.447 1.00 20.89 ? 137 VAL E C    1 
ATOM   6260 O O    . VAL E 1 137 ? 90.518  1.200   27.686 1.00 25.46 ? 137 VAL E O    1 
ATOM   6261 C CB   . VAL E 1 137 ? 93.005  2.425   26.927 1.00 15.11 ? 137 VAL E CB   1 
ATOM   6262 C CG1  . VAL E 1 137 ? 93.057  3.724   27.700 1.00 7.90  ? 137 VAL E CG1  1 
ATOM   6263 C CG2  . VAL E 1 137 ? 94.199  2.265   26.012 1.00 16.35 ? 137 VAL E CG2  1 
ATOM   6264 H H    . VAL E 1 137 ? 92.541  -0.173  26.342 1.00 0.00  ? 137 VAL E H    1 
ATOM   6265 N N    . LYS E 1 138 ? 91.337  1.430   29.760 1.00 19.18 ? 138 LYS E N    1 
ATOM   6266 C CA   . LYS E 1 138 ? 90.004  1.652   30.304 1.00 20.83 ? 138 LYS E CA   1 
ATOM   6267 C C    . LYS E 1 138 ? 90.022  3.154   30.575 1.00 21.67 ? 138 LYS E C    1 
ATOM   6268 O O    . LYS E 1 138 ? 91.052  3.695   31.001 1.00 23.87 ? 138 LYS E O    1 
ATOM   6269 C CB   . LYS E 1 138 ? 89.738  0.890   31.598 1.00 20.84 ? 138 LYS E CB   1 
ATOM   6270 C CG   . LYS E 1 138 ? 88.352  1.221   32.174 1.00 30.58 ? 138 LYS E CG   1 
ATOM   6271 C CD   . LYS E 1 138 ? 87.997  0.443   33.446 1.00 32.95 ? 138 LYS E CD   1 
ATOM   6272 C CE   . LYS E 1 138 ? 88.916  0.807   34.611 1.00 33.55 ? 138 LYS E CE   1 
ATOM   6273 N NZ   . LYS E 1 138 ? 88.908  2.262   34.906 1.00 30.35 ? 138 LYS E NZ   1 
ATOM   6274 H H    . LYS E 1 138 ? 92.116  1.409   30.347 1.00 0.00  ? 138 LYS E H    1 
ATOM   6275 H HZ1  . LYS E 1 138 ? 87.951  2.583   35.153 1.00 0.00  ? 138 LYS E HZ1  1 
ATOM   6276 H HZ2  . LYS E 1 138 ? 89.558  2.435   35.699 1.00 0.00  ? 138 LYS E HZ2  1 
ATOM   6277 H HZ3  . LYS E 1 138 ? 89.253  2.782   34.073 1.00 0.00  ? 138 LYS E HZ3  1 
ATOM   6278 N N    . MET E 1 139 ? 88.939  3.841   30.236 1.00 15.13 ? 139 MET E N    1 
ATOM   6279 C CA   . MET E 1 139 ? 88.876  5.277   30.456 1.00 15.20 ? 139 MET E CA   1 
ATOM   6280 C C    . MET E 1 139 ? 87.429  5.742   30.431 1.00 14.88 ? 139 MET E C    1 
ATOM   6281 O O    . MET E 1 139 ? 86.536  4.972   30.091 1.00 17.45 ? 139 MET E O    1 
ATOM   6282 C CB   . MET E 1 139 ? 89.685  6.013   29.375 1.00 18.41 ? 139 MET E CB   1 
ATOM   6283 C CG   . MET E 1 139 ? 89.032  6.051   27.993 1.00 20.84 ? 139 MET E CG   1 
ATOM   6284 S SD   . MET E 1 139 ? 89.817  7.216   26.857 1.00 14.27 ? 139 MET E SD   1 
ATOM   6285 C CE   . MET E 1 139 ? 90.703  6.113   25.865 1.00 18.19 ? 139 MET E CE   1 
ATOM   6286 H H    . MET E 1 139 ? 88.174  3.399   29.809 1.00 0.00  ? 139 MET E H    1 
ATOM   6287 N N    . PRO E 1 140 ? 87.173  6.996   30.839 1.00 15.85 ? 140 PRO E N    1 
ATOM   6288 C CA   . PRO E 1 140 ? 85.837  7.603   30.867 1.00 11.54 ? 140 PRO E CA   1 
ATOM   6289 C C    . PRO E 1 140 ? 85.243  7.702   29.467 1.00 18.77 ? 140 PRO E C    1 
ATOM   6290 O O    . PRO E 1 140 ? 85.888  8.224   28.551 1.00 22.03 ? 140 PRO E O    1 
ATOM   6291 C CB   . PRO E 1 140 ? 86.123  8.993   31.411 1.00 6.98  ? 140 PRO E CB   1 
ATOM   6292 C CG   . PRO E 1 140 ? 87.263  8.758   32.324 1.00 2.46  ? 140 PRO E CG   1 
ATOM   6293 C CD   . PRO E 1 140 ? 88.146  7.881   31.502 1.00 10.15 ? 140 PRO E CD   1 
ATOM   6294 N N    . SER E 1 141 ? 84.006  7.237   29.303 1.00 25.37 ? 141 SER E N    1 
ATOM   6295 C CA   . SER E 1 141 ? 83.336  7.276   28.003 1.00 21.45 ? 141 SER E CA   1 
ATOM   6296 C C    . SER E 1 141 ? 83.051  8.716   27.580 1.00 19.29 ? 141 SER E C    1 
ATOM   6297 O O    . SER E 1 141 ? 82.965  9.021   26.390 1.00 22.32 ? 141 SER E O    1 
ATOM   6298 C CB   . SER E 1 141 ? 82.050  6.457   28.034 1.00 21.38 ? 141 SER E CB   1 
ATOM   6299 O OG   . SER E 1 141 ? 81.237  6.884   29.103 1.00 28.35 ? 141 SER E OG   1 
ATOM   6300 H H    . SER E 1 141 ? 83.511  6.858   30.066 1.00 0.00  ? 141 SER E H    1 
ATOM   6301 H HG   . SER E 1 141 ? 80.352  6.495   29.037 1.00 0.00  ? 141 SER E HG   1 
ATOM   6302 N N    . GLY E 1 142 ? 82.898  9.601   28.556 1.00 14.92 ? 142 GLY E N    1 
ATOM   6303 C CA   . GLY E 1 142 ? 82.671  10.995  28.236 1.00 16.90 ? 142 GLY E CA   1 
ATOM   6304 C C    . GLY E 1 142 ? 83.950  11.570  27.645 1.00 21.17 ? 142 GLY E C    1 
ATOM   6305 O O    . GLY E 1 142 ? 83.912  12.343  26.687 1.00 19.55 ? 142 GLY E O    1 
ATOM   6306 H H    . GLY E 1 142 ? 82.900  9.279   29.484 1.00 0.00  ? 142 GLY E H    1 
ATOM   6307 N N    . GLU E 1 143 ? 85.087  11.144  28.196 1.00 26.06 ? 143 GLU E N    1 
ATOM   6308 C CA   . GLU E 1 143 ? 86.406  11.590  27.755 1.00 23.04 ? 143 GLU E CA   1 
ATOM   6309 C C    . GLU E 1 143 ? 86.714  11.103  26.347 1.00 22.29 ? 143 GLU E C    1 
ATOM   6310 O O    . GLU E 1 143 ? 87.196  11.860  25.508 1.00 28.61 ? 143 GLU E O    1 
ATOM   6311 C CB   . GLU E 1 143 ? 87.477  11.087  28.714 1.00 31.45 ? 143 GLU E CB   1 
ATOM   6312 C CG   . GLU E 1 143 ? 88.810  11.760  28.538 1.00 42.82 ? 143 GLU E CG   1 
ATOM   6313 C CD   . GLU E 1 143 ? 88.682  13.267  28.608 1.00 54.02 ? 143 GLU E CD   1 
ATOM   6314 O OE1  . GLU E 1 143 ? 88.587  13.804  29.736 1.00 60.85 ? 143 GLU E OE1  1 
ATOM   6315 O OE2  . GLU E 1 143 ? 88.645  13.911  27.535 1.00 54.39 ? 143 GLU E OE2  1 
ATOM   6316 H H    . GLU E 1 143 ? 85.043  10.491  28.922 1.00 0.00  ? 143 GLU E H    1 
ATOM   6317 N N    . PHE E 1 144 ? 86.448  9.832   26.092 1.00 19.46 ? 144 PHE E N    1 
ATOM   6318 C CA   . PHE E 1 144 ? 86.679  9.261   24.773 1.00 15.60 ? 144 PHE E CA   1 
ATOM   6319 C C    . PHE E 1 144 ? 85.843  10.027  23.745 1.00 14.17 ? 144 PHE E C    1 
ATOM   6320 O O    . PHE E 1 144 ? 86.338  10.407  22.680 1.00 18.84 ? 144 PHE E O    1 
ATOM   6321 C CB   . PHE E 1 144 ? 86.286  7.780   24.783 1.00 21.54 ? 144 PHE E CB   1 
ATOM   6322 C CG   . PHE E 1 144 ? 86.685  7.033   23.542 1.00 20.94 ? 144 PHE E CG   1 
ATOM   6323 C CD1  . PHE E 1 144 ? 87.968  7.155   23.022 1.00 20.75 ? 144 PHE E CD1  1 
ATOM   6324 C CD2  . PHE E 1 144 ? 85.771  6.219   22.888 1.00 20.60 ? 144 PHE E CD2  1 
ATOM   6325 C CE1  . PHE E 1 144 ? 88.328  6.480   21.871 1.00 19.35 ? 144 PHE E CE1  1 
ATOM   6326 C CE2  . PHE E 1 144 ? 86.123  5.543   21.737 1.00 19.52 ? 144 PHE E CE2  1 
ATOM   6327 C CZ   . PHE E 1 144 ? 87.402  5.674   21.228 1.00 20.82 ? 144 PHE E CZ   1 
ATOM   6328 H H    . PHE E 1 144 ? 86.117  9.260   26.815 1.00 0.00  ? 144 PHE E H    1 
ATOM   6329 N N    . ALA E 1 145 ? 84.578  10.275  24.082 1.00 11.60 ? 145 ALA E N    1 
ATOM   6330 C CA   . ALA E 1 145 ? 83.668  10.999  23.200 1.00 6.89  ? 145 ALA E CA   1 
ATOM   6331 C C    . ALA E 1 145 ? 84.240  12.362  22.853 1.00 12.57 ? 145 ALA E C    1 
ATOM   6332 O O    . ALA E 1 145 ? 84.310  12.736  21.685 1.00 9.83  ? 145 ALA E O    1 
ATOM   6333 C CB   . ALA E 1 145 ? 82.321  11.159  23.863 1.00 7.43  ? 145 ALA E CB   1 
ATOM   6334 H H    . ALA E 1 145 ? 84.248  9.960   24.948 1.00 0.00  ? 145 ALA E H    1 
ATOM   6335 N N    . ARG E 1 146 ? 84.652  13.097  23.883 1.00 20.68 ? 146 ARG E N    1 
ATOM   6336 C CA   . ARG E 1 146 ? 85.227  14.429  23.722 1.00 17.15 ? 146 ARG E CA   1 
ATOM   6337 C C    . ARG E 1 146 ? 86.410  14.350  22.763 1.00 19.06 ? 146 ARG E C    1 
ATOM   6338 O O    . ARG E 1 146 ? 86.405  14.989  21.707 1.00 23.84 ? 146 ARG E O    1 
ATOM   6339 C CB   . ARG E 1 146 ? 85.677  14.977  25.086 1.00 20.41 ? 146 ARG E CB   1 
ATOM   6340 C CG   . ARG E 1 146 ? 86.370  16.336  25.054 1.00 21.91 ? 146 ARG E CG   1 
ATOM   6341 C CD   . ARG E 1 146 ? 85.384  17.464  24.812 1.00 32.54 ? 146 ARG E CD   1 
ATOM   6342 N NE   . ARG E 1 146 ? 86.034  18.762  24.610 1.00 39.37 ? 146 ARG E NE   1 
ATOM   6343 C CZ   . ARG E 1 146 ? 85.621  19.903  25.159 1.00 41.05 ? 146 ARG E CZ   1 
ATOM   6344 N NH1  . ARG E 1 146 ? 84.562  19.912  25.961 1.00 44.74 ? 146 ARG E NH1  1 
ATOM   6345 N NH2  . ARG E 1 146 ? 86.245  21.041  24.876 1.00 34.56 ? 146 ARG E NH2  1 
ATOM   6346 H H    . ARG E 1 146 ? 84.570  12.732  24.789 1.00 0.00  ? 146 ARG E H    1 
ATOM   6347 H HE   . ARG E 1 146 ? 86.839  18.817  24.069 1.00 0.00  ? 146 ARG E HE   1 
ATOM   6348 H HH11 . ARG E 1 146 ? 84.068  19.067  26.171 1.00 0.00  ? 146 ARG E HH11 1 
ATOM   6349 H HH12 . ARG E 1 146 ? 84.252  20.771  26.374 1.00 0.00  ? 146 ARG E HH12 1 
ATOM   6350 H HH21 . ARG E 1 146 ? 87.020  21.048  24.249 1.00 0.00  ? 146 ARG E HH21 1 
ATOM   6351 H HH22 . ARG E 1 146 ? 85.920  21.892  25.289 1.00 0.00  ? 146 ARG E HH22 1 
ATOM   6352 N N    . ILE E 1 147 ? 87.385  13.508  23.088 1.00 9.70  ? 147 ILE E N    1 
ATOM   6353 C CA   . ILE E 1 147 ? 88.568  13.368  22.248 1.00 7.51  ? 147 ILE E CA   1 
ATOM   6354 C C    . ILE E 1 147 ? 88.253  13.097  20.783 1.00 14.21 ? 147 ILE E C    1 
ATOM   6355 O O    . ILE E 1 147 ? 88.843  13.722  19.900 1.00 19.61 ? 147 ILE E O    1 
ATOM   6356 C CB   . ILE E 1 147 ? 89.502  12.273  22.770 1.00 4.49  ? 147 ILE E CB   1 
ATOM   6357 C CG1  . ILE E 1 147 ? 90.061  12.683  24.139 1.00 8.59  ? 147 ILE E CG1  1 
ATOM   6358 C CG2  . ILE E 1 147 ? 90.595  12.000  21.748 1.00 2.69  ? 147 ILE E CG2  1 
ATOM   6359 C CD1  . ILE E 1 147 ? 91.047  11.701  24.751 1.00 6.91  ? 147 ILE E CD1  1 
ATOM   6360 H H    . ILE E 1 147 ? 87.314  12.983  23.913 1.00 0.00  ? 147 ILE E H    1 
ATOM   6361 N N    . CYS E 1 148 ? 87.328  12.178  20.518 1.00 13.49 ? 148 CYS E N    1 
ATOM   6362 C CA   . CYS E 1 148 ? 86.970  11.854  19.141 1.00 14.19 ? 148 CYS E CA   1 
ATOM   6363 C C    . CYS E 1 148 ? 86.346  13.018  18.388 1.00 15.63 ? 148 CYS E C    1 
ATOM   6364 O O    . CYS E 1 148 ? 86.742  13.327  17.267 1.00 15.18 ? 148 CYS E O    1 
ATOM   6365 C CB   . CYS E 1 148 ? 86.051  10.638  19.097 1.00 7.34  ? 148 CYS E CB   1 
ATOM   6366 S SG   . CYS E 1 148 ? 86.941  9.104   19.396 1.00 18.21 ? 148 CYS E SG   1 
ATOM   6367 H H    . CYS E 1 148 ? 86.879  11.709  21.255 1.00 0.00  ? 148 CYS E H    1 
ATOM   6368 N N    . ARG E 1 149 ? 85.393  13.684  19.027 1.00 23.06 ? 149 ARG E N    1 
ATOM   6369 C CA   . ARG E 1 149 ? 84.697  14.818  18.431 1.00 22.60 ? 149 ARG E CA   1 
ATOM   6370 C C    . ARG E 1 149 ? 85.673  15.945  18.118 1.00 18.23 ? 149 ARG E C    1 
ATOM   6371 O O    . ARG E 1 149 ? 85.677  16.501  17.019 1.00 25.30 ? 149 ARG E O    1 
ATOM   6372 C CB   . ARG E 1 149 ? 83.630  15.319  19.398 1.00 28.73 ? 149 ARG E CB   1 
ATOM   6373 C CG   . ARG E 1 149 ? 82.743  16.404  18.842 1.00 35.90 ? 149 ARG E CG   1 
ATOM   6374 C CD   . ARG E 1 149 ? 82.144  17.209  19.972 1.00 38.60 ? 149 ARG E CD   1 
ATOM   6375 N NE   . ARG E 1 149 ? 83.161  18.010  20.642 1.00 41.46 ? 149 ARG E NE   1 
ATOM   6376 C CZ   . ARG E 1 149 ? 83.010  18.554  21.842 1.00 43.61 ? 149 ARG E CZ   1 
ATOM   6377 N NH1  . ARG E 1 149 ? 81.879  18.374  22.509 1.00 45.13 ? 149 ARG E NH1  1 
ATOM   6378 N NH2  . ARG E 1 149 ? 83.972  19.310  22.355 1.00 43.95 ? 149 ARG E NH2  1 
ATOM   6379 H H    . ARG E 1 149 ? 85.154  13.411  19.936 1.00 0.00  ? 149 ARG E H    1 
ATOM   6380 H HE   . ARG E 1 149 ? 84.009  18.167  20.174 1.00 0.00  ? 149 ARG E HE   1 
ATOM   6381 H HH11 . ARG E 1 149 ? 81.140  17.836  22.105 1.00 0.00  ? 149 ARG E HH11 1 
ATOM   6382 H HH12 . ARG E 1 149 ? 81.762  18.785  23.412 1.00 0.00  ? 149 ARG E HH12 1 
ATOM   6383 H HH21 . ARG E 1 149 ? 84.806  19.486  21.841 1.00 0.00  ? 149 ARG E HH21 1 
ATOM   6384 H HH22 . ARG E 1 149 ? 83.855  19.715  23.262 1.00 0.00  ? 149 ARG E HH22 1 
ATOM   6385 N N    . ASP E 1 150 ? 86.513  16.268  19.088 1.00 15.07 ? 150 ASP E N    1 
ATOM   6386 C CA   . ASP E 1 150 ? 87.489  17.326  18.919 1.00 11.73 ? 150 ASP E CA   1 
ATOM   6387 C C    . ASP E 1 150 ? 88.454  17.085  17.770 1.00 11.90 ? 150 ASP E C    1 
ATOM   6388 O O    . ASP E 1 150 ? 88.477  17.858  16.810 1.00 15.44 ? 150 ASP E O    1 
ATOM   6389 C CB   . ASP E 1 150 ? 88.227  17.558  20.228 1.00 8.48  ? 150 ASP E CB   1 
ATOM   6390 C CG   . ASP E 1 150 ? 87.322  18.130  21.304 1.00 19.08 ? 150 ASP E CG   1 
ATOM   6391 O OD1  . ASP E 1 150 ? 86.277  18.742  20.978 1.00 16.54 ? 150 ASP E OD1  1 
ATOM   6392 O OD2  . ASP E 1 150 ? 87.653  17.969  22.489 1.00 29.20 ? 150 ASP E OD2  1 
ATOM   6393 H H    . ASP E 1 150 ? 86.473  15.776  19.933 1.00 0.00  ? 150 ASP E H    1 
ATOM   6394 N N    . LEU E 1 151 ? 89.199  15.987  17.822 1.00 10.72 ? 151 LEU E N    1 
ATOM   6395 C CA   . LEU E 1 151 ? 90.158  15.674  16.767 1.00 12.60 ? 151 LEU E CA   1 
ATOM   6396 C C    . LEU E 1 151 ? 89.532  15.598  15.368 1.00 17.91 ? 151 LEU E C    1 
ATOM   6397 O O    . LEU E 1 151 ? 90.242  15.650  14.356 1.00 17.04 ? 151 LEU E O    1 
ATOM   6398 C CB   . LEU E 1 151 ? 90.924  14.397  17.109 1.00 17.23 ? 151 LEU E CB   1 
ATOM   6399 C CG   . LEU E 1 151 ? 91.830  14.513  18.344 1.00 17.03 ? 151 LEU E CG   1 
ATOM   6400 C CD1  . LEU E 1 151 ? 92.492  13.180  18.652 1.00 11.09 ? 151 LEU E CD1  1 
ATOM   6401 C CD2  . LEU E 1 151 ? 92.885  15.589  18.104 1.00 17.63 ? 151 LEU E CD2  1 
ATOM   6402 H H    . LEU E 1 151 ? 89.100  15.381  18.587 1.00 0.00  ? 151 LEU E H    1 
ATOM   6403 N N    . SER E 1 152 ? 88.204  15.491  15.318 1.00 17.68 ? 152 SER E N    1 
ATOM   6404 C CA   . SER E 1 152 ? 87.472  15.449  14.058 1.00 16.26 ? 152 SER E CA   1 
ATOM   6405 C C    . SER E 1 152 ? 87.515  16.818  13.385 1.00 20.00 ? 152 SER E C    1 
ATOM   6406 O O    . SER E 1 152 ? 87.312  16.929  12.175 1.00 22.09 ? 152 SER E O    1 
ATOM   6407 C CB   . SER E 1 152 ? 86.018  15.061  14.300 1.00 13.34 ? 152 SER E CB   1 
ATOM   6408 O OG   . SER E 1 152 ? 85.911  13.692  14.620 1.00 23.83 ? 152 SER E OG   1 
ATOM   6409 H H    . SER E 1 152 ? 87.673  15.400  16.137 1.00 0.00  ? 152 SER E H    1 
ATOM   6410 H HG   . SER E 1 152 ? 85.429  13.273  13.900 1.00 0.00  ? 152 SER E HG   1 
ATOM   6411 N N    . HIS E 1 153 ? 87.713  17.864  14.184 1.00 19.86 ? 153 HIS E N    1 
ATOM   6412 C CA   . HIS E 1 153 ? 87.797  19.223  13.664 1.00 24.50 ? 153 HIS E CA   1 
ATOM   6413 C C    . HIS E 1 153 ? 89.179  19.438  13.072 1.00 22.09 ? 153 HIS E C    1 
ATOM   6414 O O    . HIS E 1 153 ? 89.350  20.235  12.157 1.00 22.99 ? 153 HIS E O    1 
ATOM   6415 C CB   . HIS E 1 153 ? 87.614  20.257  14.780 1.00 36.07 ? 153 HIS E CB   1 
ATOM   6416 C CG   . HIS E 1 153 ? 86.379  20.072  15.603 1.00 42.25 ? 153 HIS E CG   1 
ATOM   6417 N ND1  . HIS E 1 153 ? 85.202  19.568  15.085 1.00 47.03 ? 153 HIS E ND1  1 
ATOM   6418 C CD2  . HIS E 1 153 ? 86.135  20.336  16.906 1.00 43.30 ? 153 HIS E CD2  1 
ATOM   6419 C CE1  . HIS E 1 153 ? 84.287  19.531  16.040 1.00 47.92 ? 153 HIS E CE1  1 
ATOM   6420 N NE2  . HIS E 1 153 ? 84.828  19.992  17.152 1.00 50.22 ? 153 HIS E NE2  1 
ATOM   6421 H H    . HIS E 1 153 ? 87.782  17.713  15.142 1.00 0.00  ? 153 HIS E H    1 
ATOM   6422 H HD1  . HIS E 1 153 ? 85.068  19.288  14.158 1.00 0.00  ? 153 HIS E HD1  1 
ATOM   6423 H HE2  . HIS E 1 153 ? 84.380  20.098  18.015 1.00 0.00  ? 153 HIS E HE2  1 
ATOM   6424 N N    . ILE E 1 154 ? 90.162  18.744  13.639 1.00 20.48 ? 154 ILE E N    1 
ATOM   6425 C CA   . ILE E 1 154 ? 91.559  18.844  13.230 1.00 17.24 ? 154 ILE E CA   1 
ATOM   6426 C C    . ILE E 1 154 ? 91.931  17.937  12.053 1.00 18.91 ? 154 ILE E C    1 
ATOM   6427 O O    . ILE E 1 154 ? 92.753  18.313  11.214 1.00 20.55 ? 154 ILE E O    1 
ATOM   6428 C CB   . ILE E 1 154 ? 92.484  18.525  14.425 1.00 17.33 ? 154 ILE E CB   1 
ATOM   6429 C CG1  . ILE E 1 154 ? 92.071  19.348  15.656 1.00 13.96 ? 154 ILE E CG1  1 
ATOM   6430 C CG2  . ILE E 1 154 ? 93.942  18.764  14.058 1.00 17.30 ? 154 ILE E CG2  1 
ATOM   6431 C CD1  . ILE E 1 154 ? 92.367  20.818  15.562 1.00 9.59  ? 154 ILE E CD1  1 
ATOM   6432 H H    . ILE E 1 154 ? 89.938  18.124  14.359 1.00 0.00  ? 154 ILE E H    1 
ATOM   6433 N N    . GLY E 1 155 ? 91.345  16.743  11.999 1.00 21.38 ? 155 GLY E N    1 
ATOM   6434 C CA   . GLY E 1 155 ? 91.653  15.827  10.917 1.00 20.61 ? 155 GLY E CA   1 
ATOM   6435 C C    . GLY E 1 155 ? 90.623  14.735  10.754 1.00 18.58 ? 155 GLY E C    1 
ATOM   6436 O O    . GLY E 1 155 ? 89.601  14.754  11.430 1.00 27.96 ? 155 GLY E O    1 
ATOM   6437 H H    . GLY E 1 155 ? 90.676  16.459  12.658 1.00 0.00  ? 155 GLY E H    1 
ATOM   6438 N N    . ASP E 1 156 ? 90.878  13.805  9.834  1.00 22.10 ? 156 ASP E N    1 
ATOM   6439 C CA   . ASP E 1 156 ? 89.977  12.679  9.568  1.00 23.66 ? 156 ASP E CA   1 
ATOM   6440 C C    . ASP E 1 156 ? 90.375  11.442  10.357 1.00 19.60 ? 156 ASP E C    1 
ATOM   6441 O O    . ASP E 1 156 ? 89.514  10.706  10.811 1.00 21.29 ? 156 ASP E O    1 
ATOM   6442 C CB   . ASP E 1 156 ? 89.984  12.290  8.086  1.00 31.65 ? 156 ASP E CB   1 
ATOM   6443 C CG   . ASP E 1 156 ? 89.698  13.454  7.165  1.00 44.58 ? 156 ASP E CG   1 
ATOM   6444 O OD1  . ASP E 1 156 ? 88.620  14.076  7.288  1.00 51.24 ? 156 ASP E OD1  1 
ATOM   6445 O OD2  . ASP E 1 156 ? 90.556  13.737  6.300  1.00 49.30 ? 156 ASP E OD2  1 
ATOM   6446 H H    . ASP E 1 156 ? 91.718  13.906  9.334  1.00 0.00  ? 156 ASP E H    1 
ATOM   6447 N N    . ALA E 1 157 ? 91.677  11.177  10.433 1.00 19.34 ? 157 ALA E N    1 
ATOM   6448 C CA   . ALA E 1 157 ? 92.209  10.013  11.135 1.00 14.80 ? 157 ALA E CA   1 
ATOM   6449 C C    . ALA E 1 157 ? 92.867  10.370  12.451 1.00 17.72 ? 157 ALA E C    1 
ATOM   6450 O O    . ALA E 1 157 ? 93.309  11.502  12.667 1.00 23.58 ? 157 ALA E O    1 
ATOM   6451 C CB   . ALA E 1 157 ? 93.200  9.269   10.257 1.00 11.68 ? 157 ALA E CB   1 
ATOM   6452 H H    . ALA E 1 157 ? 92.306  11.808  10.026 1.00 0.00  ? 157 ALA E H    1 
ATOM   6453 N N    . VAL E 1 158 ? 92.978  9.371   13.310 1.00 16.38 ? 158 VAL E N    1 
ATOM   6454 C CA   . VAL E 1 158 ? 93.575  9.550   14.619 1.00 16.81 ? 158 VAL E CA   1 
ATOM   6455 C C    . VAL E 1 158 ? 94.610  8.456   14.822 1.00 19.53 ? 158 VAL E C    1 
ATOM   6456 O O    . VAL E 1 158 ? 94.376  7.295   14.476 1.00 22.15 ? 158 VAL E O    1 
ATOM   6457 C CB   . VAL E 1 158 ? 92.492  9.485   15.733 1.00 11.71 ? 158 VAL E CB   1 
ATOM   6458 C CG1  . VAL E 1 158 ? 91.711  8.188   15.644 1.00 9.54  ? 158 VAL E CG1  1 
ATOM   6459 C CG2  . VAL E 1 158 ? 93.114  9.625   17.095 1.00 8.73  ? 158 VAL E CG2  1 
ATOM   6460 H H    . VAL E 1 158 ? 92.652  8.482   13.059 1.00 0.00  ? 158 VAL E H    1 
ATOM   6461 N N    . VAL E 1 159 ? 95.783  8.851   15.301 1.00 18.39 ? 159 VAL E N    1 
ATOM   6462 C CA   . VAL E 1 159 ? 96.859  7.911   15.565 1.00 18.76 ? 159 VAL E CA   1 
ATOM   6463 C C    . VAL E 1 159 ? 96.905  7.639   17.051 1.00 18.09 ? 159 VAL E C    1 
ATOM   6464 O O    . VAL E 1 159 ? 97.329  8.489   17.826 1.00 24.02 ? 159 VAL E O    1 
ATOM   6465 C CB   . VAL E 1 159 ? 98.215  8.480   15.165 1.00 16.56 ? 159 VAL E CB   1 
ATOM   6466 C CG1  . VAL E 1 159 ? 99.286  7.443   15.420 1.00 12.69 ? 159 VAL E CG1  1 
ATOM   6467 C CG2  . VAL E 1 159 ? 98.191  8.926   13.707 1.00 11.69 ? 159 VAL E CG2  1 
ATOM   6468 H H    . VAL E 1 159 ? 95.943  9.802   15.465 1.00 0.00  ? 159 VAL E H    1 
ATOM   6469 N N    . ILE E 1 160 ? 96.424  6.476   17.458 1.00 20.50 ? 160 ILE E N    1 
ATOM   6470 C CA   . ILE E 1 160 ? 96.437  6.135   18.869 1.00 21.82 ? 160 ILE E CA   1 
ATOM   6471 C C    . ILE E 1 160 ? 97.725  5.405   19.240 1.00 24.33 ? 160 ILE E C    1 
ATOM   6472 O O    . ILE E 1 160 ? 97.953  4.268   18.807 1.00 26.07 ? 160 ILE E O    1 
ATOM   6473 C CB   . ILE E 1 160 ? 95.232  5.264   19.259 1.00 20.55 ? 160 ILE E CB   1 
ATOM   6474 C CG1  . ILE E 1 160 ? 93.923  5.950   18.859 1.00 22.31 ? 160 ILE E CG1  1 
ATOM   6475 C CG2  . ILE E 1 160 ? 95.252  5.013   20.763 1.00 20.30 ? 160 ILE E CG2  1 
ATOM   6476 C CD1  . ILE E 1 160 ? 92.697  5.080   19.046 1.00 21.88 ? 160 ILE E CD1  1 
ATOM   6477 H H    . ILE E 1 160 ? 96.061  5.853   16.795 1.00 0.00  ? 160 ILE E H    1 
ATOM   6478 N N    . SER E 1 161 ? 98.576  6.082   20.003 1.00 23.36 ? 161 SER E N    1 
ATOM   6479 C CA   . SER E 1 161 ? 99.834  5.512   20.466 1.00 25.87 ? 161 SER E CA   1 
ATOM   6480 C C    . SER E 1 161 ? 99.684  5.094   21.932 1.00 29.55 ? 161 SER E C    1 
ATOM   6481 O O    . SER E 1 161 ? 99.402  5.931   22.791 1.00 30.80 ? 161 SER E O    1 
ATOM   6482 C CB   . SER E 1 161 ? 100.958 6.538   20.332 1.00 23.27 ? 161 SER E CB   1 
ATOM   6483 O OG   . SER E 1 161 ? 101.118 6.948   18.984 1.00 30.88 ? 161 SER E OG   1 
ATOM   6484 H H    . SER E 1 161 ? 98.350  7.004   20.234 1.00 0.00  ? 161 SER E H    1 
ATOM   6485 H HG   . SER E 1 161 ? 101.837 7.581   18.899 1.00 0.00  ? 161 SER E HG   1 
ATOM   6486 N N    . CYS E 1 162 ? 99.821  3.802   22.219 1.00 32.61 ? 162 CYS E N    1 
ATOM   6487 C CA   . CYS E 1 162 ? 99.698  3.339   23.594 1.00 34.87 ? 162 CYS E CA   1 
ATOM   6488 C C    . CYS E 1 162 ? 101.008 2.823   24.175 1.00 33.95 ? 162 CYS E C    1 
ATOM   6489 O O    . CYS E 1 162 ? 101.711 2.027   23.548 1.00 33.31 ? 162 CYS E O    1 
ATOM   6490 C CB   . CYS E 1 162 ? 98.614  2.276   23.737 1.00 33.38 ? 162 CYS E CB   1 
ATOM   6491 S SG   . CYS E 1 162 ? 98.292  1.841   25.473 1.00 45.33 ? 162 CYS E SG   1 
ATOM   6492 H H    . CYS E 1 162 ? 100.023 3.168   21.506 1.00 0.00  ? 162 CYS E H    1 
ATOM   6493 N N    . ALA E 1 163 ? 101.336 3.326   25.361 1.00 35.52 ? 163 ALA E N    1 
ATOM   6494 C CA   . ALA E 1 163 ? 102.539 2.955   26.090 1.00 35.03 ? 163 ALA E CA   1 
ATOM   6495 C C    . ALA E 1 163 ? 102.162 2.796   27.562 1.00 37.81 ? 163 ALA E C    1 
ATOM   6496 O O    . ALA E 1 163 ? 101.095 3.235   27.997 1.00 37.49 ? 163 ALA E O    1 
ATOM   6497 C CB   . ALA E 1 163 ? 103.622 4.008   25.922 1.00 30.59 ? 163 ALA E CB   1 
ATOM   6498 H H    . ALA E 1 163 ? 100.741 3.979   25.794 1.00 0.00  ? 163 ALA E H    1 
ATOM   6499 N N    . LYS E 1 164 ? 103.076 2.217   28.327 1.00 44.90 ? 164 LYS E N    1 
ATOM   6500 C CA   . LYS E 1 164 ? 102.874 1.924   29.742 1.00 46.63 ? 164 LYS E CA   1 
ATOM   6501 C C    . LYS E 1 164 ? 102.241 2.987   30.629 1.00 47.34 ? 164 LYS E C    1 
ATOM   6502 O O    . LYS E 1 164 ? 101.329 2.683   31.391 1.00 50.61 ? 164 LYS E O    1 
ATOM   6503 C CB   . LYS E 1 164 ? 104.190 1.455   30.359 1.00 49.24 ? 164 LYS E CB   1 
ATOM   6504 C CG   . LYS E 1 164 ? 104.067 0.935   31.780 1.00 57.07 ? 164 LYS E CG   1 
ATOM   6505 C CD   . LYS E 1 164 ? 105.420 0.499   32.331 1.00 59.17 ? 164 LYS E CD   1 
ATOM   6506 C CE   . LYS E 1 164 ? 105.294 -0.019  33.755 1.00 60.76 ? 164 LYS E CE   1 
ATOM   6507 N NZ   . LYS E 1 164 ? 104.313 -1.139  33.845 1.00 59.40 ? 164 LYS E NZ   1 
ATOM   6508 H H    . LYS E 1 164 ? 103.925 1.987   27.909 1.00 0.00  ? 164 LYS E H    1 
ATOM   6509 H HZ1  . LYS E 1 164 ? 104.608 -1.917  33.224 1.00 0.00  ? 164 LYS E HZ1  1 
ATOM   6510 H HZ2  . LYS E 1 164 ? 104.231 -1.465  34.830 1.00 0.00  ? 164 LYS E HZ2  1 
ATOM   6511 H HZ3  . LYS E 1 164 ? 103.385 -0.784  33.533 1.00 0.00  ? 164 LYS E HZ3  1 
ATOM   6512 N N    . ASP E 1 165 ? 102.719 4.222   30.541 1.00 46.71 ? 165 ASP E N    1 
ATOM   6513 C CA   . ASP E 1 165 ? 102.189 5.280   31.395 1.00 45.17 ? 165 ASP E CA   1 
ATOM   6514 C C    . ASP E 1 165 ? 101.079 6.142   30.797 1.00 42.04 ? 165 ASP E C    1 
ATOM   6515 O O    . ASP E 1 165 ? 100.531 7.009   31.480 1.00 43.12 ? 165 ASP E O    1 
ATOM   6516 C CB   . ASP E 1 165 ? 103.327 6.154   31.904 1.00 49.54 ? 165 ASP E CB   1 
ATOM   6517 H H    . ASP E 1 165 ? 103.405 4.452   29.887 1.00 0.00  ? 165 ASP E H    1 
ATOM   6518 N N    . GLY E 1 166 ? 100.731 5.906   29.540 1.00 33.49 ? 166 GLY E N    1 
ATOM   6519 C CA   . GLY E 1 166 ? 99.684  6.699   28.937 1.00 32.30 ? 166 GLY E CA   1 
ATOM   6520 C C    . GLY E 1 166 ? 99.396  6.366   27.492 1.00 32.68 ? 166 GLY E C    1 
ATOM   6521 O O    . GLY E 1 166 ? 100.140 5.625   26.848 1.00 31.38 ? 166 GLY E O    1 
ATOM   6522 H H    . GLY E 1 166 ? 101.128 5.193   28.997 1.00 0.00  ? 166 GLY E H    1 
ATOM   6523 N N    . VAL E 1 167 ? 98.290  6.901   26.993 1.00 29.78 ? 167 VAL E N    1 
ATOM   6524 C CA   . VAL E 1 167 ? 97.885  6.689   25.617 1.00 30.89 ? 167 VAL E CA   1 
ATOM   6525 C C    . VAL E 1 167 ? 97.718  8.073   24.998 1.00 30.11 ? 167 VAL E C    1 
ATOM   6526 O O    . VAL E 1 167 ? 97.236  8.997   25.658 1.00 28.60 ? 167 VAL E O    1 
ATOM   6527 C CB   . VAL E 1 167 ? 96.578  5.860   25.529 1.00 24.34 ? 167 VAL E CB   1 
ATOM   6528 C CG1  . VAL E 1 167 ? 95.482  6.504   26.344 1.00 26.56 ? 167 VAL E CG1  1 
ATOM   6529 C CG2  . VAL E 1 167 ? 96.155  5.688   24.087 1.00 21.10 ? 167 VAL E CG2  1 
ATOM   6530 H H    . VAL E 1 167 ? 97.743  7.483   27.561 1.00 0.00  ? 167 VAL E H    1 
ATOM   6531 N N    . LYS E 1 168 ? 98.187  8.229   23.763 1.00 27.13 ? 168 LYS E N    1 
ATOM   6532 C CA   . LYS E 1 168 ? 98.105  9.504   23.064 1.00 26.50 ? 168 LYS E CA   1 
ATOM   6533 C C    . LYS E 1 168 ? 97.306  9.399   21.760 1.00 28.57 ? 168 LYS E C    1 
ATOM   6534 O O    . LYS E 1 168 ? 97.425  8.409   21.028 1.00 28.17 ? 168 LYS E O    1 
ATOM   6535 C CB   . LYS E 1 168 ? 99.520  10.036  22.784 1.00 24.58 ? 168 LYS E CB   1 
ATOM   6536 C CG   . LYS E 1 168 ? 99.560  11.439  22.188 1.00 23.48 ? 168 LYS E CG   1 
ATOM   6537 C CD   . LYS E 1 168 ? 100.952 12.022  22.248 1.00 26.16 ? 168 LYS E CD   1 
ATOM   6538 C CE   . LYS E 1 168 ? 101.907 11.333  21.281 1.00 35.58 ? 168 LYS E CE   1 
ATOM   6539 N NZ   . LYS E 1 168 ? 101.742 11.769  19.864 1.00 35.79 ? 168 LYS E NZ   1 
ATOM   6540 H H    . LYS E 1 168 ? 98.582  7.474   23.295 1.00 0.00  ? 168 LYS E H    1 
ATOM   6541 H HZ1  . LYS E 1 168 ? 100.776 11.576  19.531 1.00 0.00  ? 168 LYS E HZ1  1 
ATOM   6542 H HZ2  . LYS E 1 168 ? 101.947 12.784  19.790 1.00 0.00  ? 168 LYS E HZ2  1 
ATOM   6543 H HZ3  . LYS E 1 168 ? 102.414 11.242  19.269 1.00 0.00  ? 168 LYS E HZ3  1 
ATOM   6544 N N    . PHE E 1 169 ? 96.435  10.379  21.523 1.00 21.25 ? 169 PHE E N    1 
ATOM   6545 C CA   . PHE E 1 169 ? 95.629  10.433  20.306 1.00 16.15 ? 169 PHE E CA   1 
ATOM   6546 C C    . PHE E 1 169 ? 96.158  11.632  19.527 1.00 18.38 ? 169 PHE E C    1 
ATOM   6547 O O    . PHE E 1 169 ? 96.436  12.678  20.118 1.00 22.72 ? 169 PHE E O    1 
ATOM   6548 C CB   . PHE E 1 169 ? 94.154  10.657  20.641 1.00 9.40  ? 169 PHE E CB   1 
ATOM   6549 C CG   . PHE E 1 169 ? 93.619  9.731   21.698 1.00 9.26  ? 169 PHE E CG   1 
ATOM   6550 C CD1  . PHE E 1 169 ? 93.870  9.976   23.046 1.00 7.44  ? 169 PHE E CD1  1 
ATOM   6551 C CD2  . PHE E 1 169 ? 92.852  8.618   21.347 1.00 6.27  ? 169 PHE E CD2  1 
ATOM   6552 C CE1  . PHE E 1 169 ? 93.365  9.126   24.032 1.00 7.91  ? 169 PHE E CE1  1 
ATOM   6553 C CE2  . PHE E 1 169 ? 92.344  7.762   22.319 1.00 2.15  ? 169 PHE E CE2  1 
ATOM   6554 C CZ   . PHE E 1 169 ? 92.603  8.018   23.669 1.00 8.81  ? 169 PHE E CZ   1 
ATOM   6555 H H    . PHE E 1 169 ? 96.346  11.098  22.176 1.00 0.00  ? 169 PHE E H    1 
ATOM   6556 N N    . SER E 1 170 ? 96.279  11.497  18.211 1.00 20.34 ? 170 SER E N    1 
ATOM   6557 C CA   . SER E 1 170 ? 96.791  12.584  17.377 1.00 17.24 ? 170 SER E CA   1 
ATOM   6558 C C    . SER E 1 170 ? 96.031  12.713  16.055 1.00 15.81 ? 170 SER E C    1 
ATOM   6559 O O    . SER E 1 170 ? 95.596  11.711  15.487 1.00 18.21 ? 170 SER E O    1 
ATOM   6560 C CB   . SER E 1 170 ? 98.277  12.352  17.099 1.00 18.42 ? 170 SER E CB   1 
ATOM   6561 O OG   . SER E 1 170 ? 98.946  11.904  18.265 1.00 21.18 ? 170 SER E OG   1 
ATOM   6562 H H    . SER E 1 170 ? 96.068  10.642  17.792 1.00 0.00  ? 170 SER E H    1 
ATOM   6563 H HG   . SER E 1 170 ? 99.096  12.633  18.872 1.00 0.00  ? 170 SER E HG   1 
ATOM   6564 N N    . ALA E 1 171 ? 95.885  13.946  15.569 1.00 15.35 ? 171 ALA E N    1 
ATOM   6565 C CA   . ALA E 1 171 ? 95.180  14.231  14.316 1.00 12.24 ? 171 ALA E CA   1 
ATOM   6566 C C    . ALA E 1 171 ? 95.928  15.323  13.533 1.00 19.10 ? 171 ALA E C    1 
ATOM   6567 O O    . ALA E 1 171 ? 96.561  16.205  14.125 1.00 13.56 ? 171 ALA E O    1 
ATOM   6568 C CB   . ALA E 1 171 ? 93.755  14.661  14.605 1.00 11.31 ? 171 ALA E CB   1 
ATOM   6569 H H    . ALA E 1 171 ? 96.300  14.699  16.043 1.00 0.00  ? 171 ALA E H    1 
ATOM   6570 N N    . SER E 1 172 ? 95.840  15.271  12.206 1.00 25.00 ? 172 SER E N    1 
ATOM   6571 C CA   . SER E 1 172 ? 96.527  16.224  11.344 1.00 24.60 ? 172 SER E CA   1 
ATOM   6572 C C    . SER E 1 172 ? 95.599  16.756  10.245 1.00 26.70 ? 172 SER E C    1 
ATOM   6573 O O    . SER E 1 172 ? 94.815  16.008  9.658  1.00 30.59 ? 172 SER E O    1 
ATOM   6574 C CB   . SER E 1 172 ? 97.751  15.540  10.711 1.00 27.55 ? 172 SER E CB   1 
ATOM   6575 O OG   . SER E 1 172 ? 98.515  16.435  9.916  1.00 41.08 ? 172 SER E OG   1 
ATOM   6576 H H    . SER E 1 172 ? 95.291  14.598  11.748 1.00 0.00  ? 172 SER E H    1 
ATOM   6577 H HG   . SER E 1 172 ? 97.945  16.870  9.267  1.00 0.00  ? 172 SER E HG   1 
ATOM   6578 N N    . GLY E 1 173 ? 95.724  18.043  9.943  1.00 22.28 ? 173 GLY E N    1 
ATOM   6579 C CA   . GLY E 1 173 ? 94.900  18.649  8.918  1.00 22.70 ? 173 GLY E CA   1 
ATOM   6580 C C    . GLY E 1 173 ? 95.571  19.879  8.330  1.00 22.87 ? 173 GLY E C    1 
ATOM   6581 O O    . GLY E 1 173 ? 96.728  20.174  8.631  1.00 24.48 ? 173 GLY E O    1 
ATOM   6582 H H    . GLY E 1 173 ? 96.371  18.613  10.404 1.00 0.00  ? 173 GLY E H    1 
ATOM   6583 N N    . GLU E 1 174 ? 94.838  20.612  7.501  1.00 25.78 ? 174 GLU E N    1 
ATOM   6584 C CA   . GLU E 1 174 ? 95.374  21.810  6.868  1.00 31.56 ? 174 GLU E CA   1 
ATOM   6585 C C    . GLU E 1 174 ? 95.614  22.953  7.841  1.00 26.91 ? 174 GLU E C    1 
ATOM   6586 O O    . GLU E 1 174 ? 96.524  23.755  7.648  1.00 29.36 ? 174 GLU E O    1 
ATOM   6587 C CB   . GLU E 1 174 ? 94.474  22.266  5.715  1.00 39.62 ? 174 GLU E CB   1 
ATOM   6588 C CG   . GLU E 1 174 ? 92.990  22.322  6.052  1.00 54.82 ? 174 GLU E CG   1 
ATOM   6589 C CD   . GLU E 1 174 ? 92.101  22.368  4.815  1.00 64.53 ? 174 GLU E CD   1 
ATOM   6590 O OE1  . GLU E 1 174 ? 92.577  22.016  3.706  1.00 67.83 ? 174 GLU E OE1  1 
ATOM   6591 O OE2  . GLU E 1 174 ? 90.919  22.750  4.956  1.00 69.11 ? 174 GLU E OE2  1 
ATOM   6592 H H    . GLU E 1 174 ? 93.930  20.309  7.307  1.00 0.00  ? 174 GLU E H    1 
ATOM   6593 N N    . LEU E 1 175 ? 94.807  23.026  8.890  1.00 21.68 ? 175 LEU E N    1 
ATOM   6594 C CA   . LEU E 1 175 ? 94.965  24.087  9.869  1.00 14.98 ? 175 LEU E CA   1 
ATOM   6595 C C    . LEU E 1 175 ? 96.126  23.821  10.809 1.00 12.56 ? 175 LEU E C    1 
ATOM   6596 O O    . LEU E 1 175 ? 96.618  24.736  11.458 1.00 13.87 ? 175 LEU E O    1 
ATOM   6597 C CB   . LEU E 1 175 ? 93.665  24.302  10.648 1.00 17.16 ? 175 LEU E CB   1 
ATOM   6598 C CG   . LEU E 1 175 ? 93.051  23.146  11.432 1.00 17.16 ? 175 LEU E CG   1 
ATOM   6599 C CD1  . LEU E 1 175 ? 93.708  23.050  12.813 1.00 19.82 ? 175 LEU E CD1  1 
ATOM   6600 C CD2  . LEU E 1 175 ? 91.553  23.386  11.566 1.00 12.79 ? 175 LEU E CD2  1 
ATOM   6601 H H    . LEU E 1 175 ? 94.105  22.357  9.006  1.00 0.00  ? 175 LEU E H    1 
ATOM   6602 N N    . GLY E 1 176 ? 96.573  22.572  10.857 1.00 13.14 ? 176 GLY E N    1 
ATOM   6603 C CA   . GLY E 1 176 ? 97.675  22.207  11.721 1.00 14.42 ? 176 GLY E CA   1 
ATOM   6604 C C    . GLY E 1 176 ? 97.451  20.821  12.284 1.00 16.55 ? 176 GLY E C    1 
ATOM   6605 O O    . GLY E 1 176 ? 96.804  19.988  11.647 1.00 14.39 ? 176 GLY E O    1 
ATOM   6606 H H    . GLY E 1 176 ? 96.195  21.854  10.310 1.00 0.00  ? 176 GLY E H    1 
ATOM   6607 N N    . ASN E 1 177 ? 97.976  20.565  13.477 1.00 20.66 ? 177 ASN E N    1 
ATOM   6608 C CA   . ASN E 1 177 ? 97.807  19.261  14.104 1.00 27.33 ? 177 ASN E CA   1 
ATOM   6609 C C    . ASN E 1 177 ? 97.460  19.324  15.591 1.00 27.06 ? 177 ASN E C    1 
ATOM   6610 O O    . ASN E 1 177 ? 97.796  20.284  16.292 1.00 24.83 ? 177 ASN E O    1 
ATOM   6611 C CB   . ASN E 1 177 ? 99.038  18.377  13.867 1.00 32.02 ? 177 ASN E CB   1 
ATOM   6612 C CG   . ASN E 1 177 ? 100.330 19.023  14.325 1.00 35.84 ? 177 ASN E CG   1 
ATOM   6613 O OD1  . ASN E 1 177 ? 100.748 18.856  15.470 1.00 42.25 ? 177 ASN E OD1  1 
ATOM   6614 N ND2  . ASN E 1 177 ? 100.989 19.739  13.421 1.00 39.11 ? 177 ASN E ND2  1 
ATOM   6615 H H    . ASN E 1 177 ? 98.489  21.267  13.932 1.00 0.00  ? 177 ASN E H    1 
ATOM   6616 H HD21 . ASN E 1 177 ? 101.825 20.144  13.726 1.00 0.00  ? 177 ASN E HD21 1 
ATOM   6617 H HD22 . ASN E 1 177 ? 100.628 19.823  12.513 1.00 0.00  ? 177 ASN E HD22 1 
ATOM   6618 N N    . GLY E 1 178 ? 96.733  18.309  16.042 1.00 23.42 ? 178 GLY E N    1 
ATOM   6619 C CA   . GLY E 1 178 ? 96.318  18.222  17.428 1.00 22.76 ? 178 GLY E CA   1 
ATOM   6620 C C    . GLY E 1 178 ? 96.950  17.017  18.079 1.00 18.31 ? 178 GLY E C    1 
ATOM   6621 O O    . GLY E 1 178 ? 97.269  16.041  17.397 1.00 19.44 ? 178 GLY E O    1 
ATOM   6622 H H    . GLY E 1 178 ? 96.505  17.578  15.437 1.00 0.00  ? 178 GLY E H    1 
ATOM   6623 N N    . ASN E 1 179 ? 97.073  17.042  19.398 1.00 20.95 ? 179 ASN E N    1 
ATOM   6624 C CA   . ASN E 1 179 ? 97.717  15.943  20.099 1.00 26.22 ? 179 ASN E CA   1 
ATOM   6625 C C    . ASN E 1 179 ? 97.250  15.852  21.545 1.00 17.96 ? 179 ASN E C    1 
ATOM   6626 O O    . ASN E 1 179 ? 97.590  16.700  22.363 1.00 17.03 ? 179 ASN E O    1 
ATOM   6627 C CB   . ASN E 1 179 ? 99.227  16.181  20.054 1.00 39.03 ? 179 ASN E CB   1 
ATOM   6628 C CG   . ASN E 1 179 ? 100.018 14.934  20.289 1.00 46.98 ? 179 ASN E CG   1 
ATOM   6629 O OD1  . ASN E 1 179 ? 99.517  13.824  20.116 1.00 53.41 ? 179 ASN E OD1  1 
ATOM   6630 N ND2  . ASN E 1 179 ? 101.273 15.100  20.679 1.00 55.17 ? 179 ASN E ND2  1 
ATOM   6631 H H    . ASN E 1 179 ? 96.769  17.821  19.907 1.00 0.00  ? 179 ASN E H    1 
ATOM   6632 H HD21 . ASN E 1 179 ? 101.799 14.281  20.790 1.00 0.00  ? 179 ASN E HD21 1 
ATOM   6633 H HD22 . ASN E 1 179 ? 101.613 16.006  20.813 1.00 0.00  ? 179 ASN E HD22 1 
ATOM   6634 N N    . ILE E 1 180 ? 96.480  14.825  21.870 1.00 16.12 ? 180 ILE E N    1 
ATOM   6635 C CA   . ILE E 1 180 ? 95.971  14.682  23.232 1.00 18.17 ? 180 ILE E CA   1 
ATOM   6636 C C    . ILE E 1 180 ? 96.635  13.525  23.975 1.00 20.17 ? 180 ILE E C    1 
ATOM   6637 O O    . ILE E 1 180 ? 96.688  12.396  23.477 1.00 19.65 ? 180 ILE E O    1 
ATOM   6638 C CB   . ILE E 1 180 ? 94.425  14.541  23.238 1.00 10.05 ? 180 ILE E CB   1 
ATOM   6639 C CG1  . ILE E 1 180 ? 93.804  15.728  22.488 1.00 8.69  ? 180 ILE E CG1  1 
ATOM   6640 C CG2  . ILE E 1 180 ? 93.905  14.488  24.669 1.00 7.11  ? 180 ILE E CG2  1 
ATOM   6641 C CD1  . ILE E 1 180 ? 92.325  15.612  22.221 1.00 5.55  ? 180 ILE E CD1  1 
ATOM   6642 H H    . ILE E 1 180 ? 96.260  14.155  21.196 1.00 0.00  ? 180 ILE E H    1 
ATOM   6643 N N    . LYS E 1 181 ? 97.131  13.815  25.174 1.00 20.93 ? 181 LYS E N    1 
ATOM   6644 C CA   . LYS E 1 181 ? 97.812  12.817  25.984 1.00 20.08 ? 181 LYS E CA   1 
ATOM   6645 C C    . LYS E 1 181 ? 97.142  12.527  27.317 1.00 21.40 ? 181 LYS E C    1 
ATOM   6646 O O    . LYS E 1 181 ? 97.043  13.406  28.176 1.00 24.39 ? 181 LYS E O    1 
ATOM   6647 C CB   . LYS E 1 181 ? 99.255  13.244  26.235 1.00 20.48 ? 181 LYS E CB   1 
ATOM   6648 C CG   . LYS E 1 181 ? 100.012 12.342  27.202 1.00 28.04 ? 181 LYS E CG   1 
ATOM   6649 C CD   . LYS E 1 181 ? 100.147 10.915  26.680 1.00 31.07 ? 181 LYS E CD   1 
ATOM   6650 C CE   . LYS E 1 181 ? 100.967 10.072  27.641 1.00 36.68 ? 181 LYS E CE   1 
ATOM   6651 N NZ   . LYS E 1 181 ? 101.363 8.767   27.049 1.00 37.50 ? 181 LYS E NZ   1 
ATOM   6652 H H    . LYS E 1 181 ? 97.023  14.724  25.528 1.00 0.00  ? 181 LYS E H    1 
ATOM   6653 H HZ1  . LYS E 1 181 ? 100.508 8.235   26.799 1.00 0.00  ? 181 LYS E HZ1  1 
ATOM   6654 H HZ2  . LYS E 1 181 ? 101.949 8.924   26.205 1.00 0.00  ? 181 LYS E HZ2  1 
ATOM   6655 H HZ3  . LYS E 1 181 ? 101.910 8.242   27.763 1.00 0.00  ? 181 LYS E HZ3  1 
ATOM   6656 N N    . LEU E 1 182 ? 96.700  11.285  27.490 1.00 21.26 ? 182 LEU E N    1 
ATOM   6657 C CA   . LEU E 1 182 ? 96.068  10.864  28.729 1.00 19.18 ? 182 LEU E CA   1 
ATOM   6658 C C    . LEU E 1 182 ? 97.102  10.080  29.523 1.00 20.27 ? 182 LEU E C    1 
ATOM   6659 O O    . LEU E 1 182 ? 97.727  9.162   29.004 1.00 27.52 ? 182 LEU E O    1 
ATOM   6660 C CB   . LEU E 1 182 ? 94.842  9.993   28.447 1.00 18.41 ? 182 LEU E CB   1 
ATOM   6661 C CG   . LEU E 1 182 ? 93.700  10.611  27.638 1.00 14.53 ? 182 LEU E CG   1 
ATOM   6662 C CD1  . LEU E 1 182 ? 92.468  9.744   27.770 1.00 20.14 ? 182 LEU E CD1  1 
ATOM   6663 C CD2  . LEU E 1 182 ? 93.392  12.013  28.123 1.00 19.49 ? 182 LEU E CD2  1 
ATOM   6664 H H    . LEU E 1 182 ? 96.814  10.625  26.772 1.00 0.00  ? 182 LEU E H    1 
ATOM   6665 N N    . SER E 1 183 ? 97.313  10.475  30.767 1.00 25.64 ? 183 SER E N    1 
ATOM   6666 C CA   . SER E 1 183 ? 98.277  9.811   31.629 1.00 25.95 ? 183 SER E CA   1 
ATOM   6667 C C    . SER E 1 183 ? 97.550  8.869   32.566 1.00 25.68 ? 183 SER E C    1 
ATOM   6668 O O    . SER E 1 183 ? 96.553  9.246   33.169 1.00 31.16 ? 183 SER E O    1 
ATOM   6669 C CB   . SER E 1 183 ? 99.042  10.850  32.445 1.00 32.37 ? 183 SER E CB   1 
ATOM   6670 O OG   . SER E 1 183 ? 99.683  11.791  31.594 1.00 46.78 ? 183 SER E OG   1 
ATOM   6671 H H    . SER E 1 183 ? 96.794  11.229  31.119 1.00 0.00  ? 183 SER E H    1 
ATOM   6672 H HG   . SER E 1 183 ? 99.026  12.209  31.028 1.00 0.00  ? 183 SER E HG   1 
ATOM   6673 N N    . GLN E 1 184 ? 98.052  7.646   32.686 1.00 29.59 ? 184 GLN E N    1 
ATOM   6674 C CA   . GLN E 1 184 ? 97.445  6.654   33.562 1.00 34.38 ? 184 GLN E CA   1 
ATOM   6675 C C    . GLN E 1 184 ? 97.240  7.276   34.938 1.00 36.80 ? 184 GLN E C    1 
ATOM   6676 O O    . GLN E 1 184 ? 98.169  7.824   35.521 1.00 40.89 ? 184 GLN E O    1 
ATOM   6677 C CB   . GLN E 1 184 ? 98.339  5.426   33.654 1.00 35.32 ? 184 GLN E CB   1 
ATOM   6678 C CG   . GLN E 1 184 ? 97.772  4.293   34.490 1.00 43.99 ? 184 GLN E CG   1 
ATOM   6679 C CD   . GLN E 1 184 ? 98.691  3.084   34.524 1.00 48.79 ? 184 GLN E CD   1 
ATOM   6680 O OE1  . GLN E 1 184 ? 98.858  2.388   33.526 1.00 49.04 ? 184 GLN E OE1  1 
ATOM   6681 N NE2  . GLN E 1 184 ? 99.292  2.828   35.679 1.00 54.20 ? 184 GLN E NE2  1 
ATOM   6682 H H    . GLN E 1 184 ? 98.858  7.416   32.188 1.00 0.00  ? 184 GLN E H    1 
ATOM   6683 H HE21 . GLN E 1 184 ? 99.876  2.042   35.655 1.00 0.00  ? 184 GLN E HE21 1 
ATOM   6684 H HE22 . GLN E 1 184 ? 99.132  3.404   36.448 1.00 0.00  ? 184 GLN E HE22 1 
ATOM   6685 N N    . THR E 1 185 ? 96.008  7.231   35.430 1.00 47.29 ? 185 THR E N    1 
ATOM   6686 C CA   . THR E 1 185 ? 95.678  7.819   36.723 1.00 54.33 ? 185 THR E CA   1 
ATOM   6687 C C    . THR E 1 185 ? 95.732  6.835   37.889 1.00 62.72 ? 185 THR E C    1 
ATOM   6688 O O    . THR E 1 185 ? 95.334  5.675   37.758 1.00 70.76 ? 185 THR E O    1 
ATOM   6689 C CB   . THR E 1 185 ? 94.266  8.429   36.702 1.00 49.57 ? 185 THR E CB   1 
ATOM   6690 O OG1  . THR E 1 185 ? 93.291  7.379   36.649 1.00 41.45 ? 185 THR E OG1  1 
ATOM   6691 C CG2  . THR E 1 185 ? 94.095  9.310   35.483 1.00 50.19 ? 185 THR E CG2  1 
ATOM   6692 H H    . THR E 1 185 ? 95.302  6.795   34.906 1.00 0.00  ? 185 THR E H    1 
ATOM   6693 H HG1  . THR E 1 185 ? 93.422  6.759   37.377 1.00 0.00  ? 185 THR E HG1  1 
ATOM   6694 N N    . SER E 1 186 ? 96.175  7.322   39.043 1.00 65.50 ? 186 SER E N    1 
ATOM   6695 C CA   . SER E 1 186 ? 96.246  6.504   40.241 1.00 67.82 ? 186 SER E CA   1 
ATOM   6696 C C    . SER E 1 186 ? 95.210  7.023   41.233 1.00 70.34 ? 186 SER E C    1 
ATOM   6697 O O    . SER E 1 186 ? 95.072  8.235   41.407 1.00 75.09 ? 186 SER E O    1 
ATOM   6698 C CB   . SER E 1 186 ? 97.637  6.588   40.851 1.00 69.91 ? 186 SER E CB   1 
ATOM   6699 H H    . SER E 1 186 ? 96.468  8.253   39.104 1.00 0.00  ? 186 SER E H    1 
ATOM   6700 N N    . ASN E 1 187 ? 94.459  6.101   41.834 1.00 71.20 ? 187 ASN E N    1 
ATOM   6701 C CA   . ASN E 1 187 ? 93.436  6.412   42.837 1.00 71.11 ? 187 ASN E CA   1 
ATOM   6702 C C    . ASN E 1 187 ? 92.584  7.661   42.576 1.00 70.63 ? 187 ASN E C    1 
ATOM   6703 O O    . ASN E 1 187 ? 92.860  8.738   43.105 1.00 69.95 ? 187 ASN E O    1 
ATOM   6704 C CB   . ASN E 1 187 ? 94.079  6.485   44.230 1.00 69.69 ? 187 ASN E CB   1 
ATOM   6705 H H    . ASN E 1 187 ? 94.601  5.165   41.600 1.00 0.00  ? 187 ASN E H    1 
ATOM   6706 N N    . VAL E 1 188 ? 91.525  7.502   41.791 1.00 71.44 ? 188 VAL E N    1 
ATOM   6707 C CA   . VAL E 1 188 ? 90.643  8.623   41.484 1.00 73.96 ? 188 VAL E CA   1 
ATOM   6708 C C    . VAL E 1 188 ? 89.227  8.400   42.024 1.00 77.25 ? 188 VAL E C    1 
ATOM   6709 O O    . VAL E 1 188 ? 88.842  7.274   42.364 1.00 76.94 ? 188 VAL E O    1 
ATOM   6710 C CB   . VAL E 1 188 ? 90.584  8.899   39.962 1.00 71.86 ? 188 VAL E CB   1 
ATOM   6711 C CG1  . VAL E 1 188 ? 91.965  9.275   39.437 1.00 70.04 ? 188 VAL E CG1  1 
ATOM   6712 C CG2  . VAL E 1 188 ? 90.053  7.690   39.235 1.00 70.31 ? 188 VAL E CG2  1 
ATOM   6713 H H    . VAL E 1 188 ? 91.308  6.621   41.435 1.00 0.00  ? 188 VAL E H    1 
ATOM   6714 N N    . GLU E 1 191 ? 87.150  6.413   40.252 1.00 68.98 ? 191 GLU E N    1 
ATOM   6715 C CA   . GLU E 1 191 ? 87.229  5.085   39.649 1.00 72.02 ? 191 GLU E CA   1 
ATOM   6716 C C    . GLU E 1 191 ? 86.804  5.158   38.187 1.00 71.93 ? 191 GLU E C    1 
ATOM   6717 O O    . GLU E 1 191 ? 87.428  4.569   37.304 1.00 71.41 ? 191 GLU E O    1 
ATOM   6718 C CB   . GLU E 1 191 ? 86.341  4.112   40.404 1.00 75.05 ? 191 GLU E CB   1 
ATOM   6719 H H    . GLU E 1 191 ? 87.503  6.497   41.170 1.00 0.00  ? 191 GLU E H    1 
ATOM   6720 N N    . GLU E 1 192 ? 85.728  5.891   37.943 1.00 70.32 ? 192 GLU E N    1 
ATOM   6721 C CA   . GLU E 1 192 ? 85.220  6.069   36.592 1.00 68.85 ? 192 GLU E CA   1 
ATOM   6722 C C    . GLU E 1 192 ? 86.066  7.152   35.942 1.00 65.25 ? 192 GLU E C    1 
ATOM   6723 O O    . GLU E 1 192 ? 86.057  7.314   34.721 1.00 64.55 ? 192 GLU E O    1 
ATOM   6724 C CB   . GLU E 1 192 ? 83.776  6.552   36.638 1.00 76.31 ? 192 GLU E CB   1 
ATOM   6725 C CG   . GLU E 1 192 ? 82.921  5.884   37.703 1.00 86.98 ? 192 GLU E CG   1 
ATOM   6726 C CD   . GLU E 1 192 ? 81.556  6.541   37.861 1.00 94.76 ? 192 GLU E CD   1 
ATOM   6727 O OE1  . GLU E 1 192 ? 81.420  7.742   37.533 1.00 99.06 ? 192 GLU E OE1  1 
ATOM   6728 O OE2  . GLU E 1 192 ? 80.616  5.852   38.315 1.00 99.11 ? 192 GLU E OE2  1 
ATOM   6729 H H    . GLU E 1 192 ? 85.296  6.314   38.720 1.00 0.00  ? 192 GLU E H    1 
ATOM   6730 N N    . GLU E 1 193 ? 86.814  7.867   36.782 1.00 58.02 ? 193 GLU E N    1 
ATOM   6731 C CA   . GLU E 1 193 ? 87.660  8.980   36.362 1.00 52.38 ? 193 GLU E CA   1 
ATOM   6732 C C    . GLU E 1 193 ? 89.086  8.547   36.052 1.00 44.61 ? 193 GLU E C    1 
ATOM   6733 O O    . GLU E 1 193 ? 89.949  9.374   35.748 1.00 40.64 ? 193 GLU E O    1 
ATOM   6734 C CB   . GLU E 1 193 ? 87.656  10.023  37.473 1.00 56.28 ? 193 GLU E CB   1 
ATOM   6735 C CG   . GLU E 1 193 ? 86.278  10.167  38.108 1.00 68.59 ? 193 GLU E CG   1 
ATOM   6736 C CD   . GLU E 1 193 ? 86.214  11.176  39.240 1.00 77.23 ? 193 GLU E CD   1 
ATOM   6737 O OE1  . GLU E 1 193 ? 87.275  11.568  39.780 1.00 83.38 ? 193 GLU E OE1  1 
ATOM   6738 O OE2  . GLU E 1 193 ? 85.081  11.572  39.593 1.00 79.63 ? 193 GLU E OE2  1 
ATOM   6739 H H    . GLU E 1 193 ? 86.841  7.632   37.735 1.00 0.00  ? 193 GLU E H    1 
ATOM   6740 N N    . ALA E 1 194 ? 89.307  7.238   36.107 1.00 38.73 ? 194 ALA E N    1 
ATOM   6741 C CA   . ALA E 1 194 ? 90.608  6.641   35.877 1.00 33.03 ? 194 ALA E CA   1 
ATOM   6742 C C    . ALA E 1 194 ? 90.900  6.266   34.441 1.00 30.59 ? 194 ALA E C    1 
ATOM   6743 O O    . ALA E 1 194 ? 90.002  5.998   33.652 1.00 33.82 ? 194 ALA E O    1 
ATOM   6744 C CB   . ALA E 1 194 ? 90.782  5.407   36.769 1.00 34.70 ? 194 ALA E CB   1 
ATOM   6745 H H    . ALA E 1 194 ? 88.569  6.626   36.265 1.00 0.00  ? 194 ALA E H    1 
ATOM   6746 N N    . VAL E 1 195 ? 92.182  6.288   34.116 1.00 28.10 ? 195 VAL E N    1 
ATOM   6747 C CA   . VAL E 1 195 ? 92.675  5.913   32.811 1.00 28.06 ? 195 VAL E CA   1 
ATOM   6748 C C    . VAL E 1 195 ? 93.676  4.840   33.201 1.00 32.71 ? 195 VAL E C    1 
ATOM   6749 O O    . VAL E 1 195 ? 94.776  5.145   33.657 1.00 40.93 ? 195 VAL E O    1 
ATOM   6750 C CB   . VAL E 1 195 ? 93.439  7.071   32.114 1.00 29.61 ? 195 VAL E CB   1 
ATOM   6751 C CG1  . VAL E 1 195 ? 94.016  6.593   30.790 1.00 28.16 ? 195 VAL E CG1  1 
ATOM   6752 C CG2  . VAL E 1 195 ? 92.526  8.275   31.888 1.00 29.33 ? 195 VAL E CG2  1 
ATOM   6753 H H    . VAL E 1 195 ? 92.827  6.566   34.800 1.00 0.00  ? 195 VAL E H    1 
ATOM   6754 N N    . THR E 1 196 ? 93.251  3.592   33.172 1.00 31.85 ? 196 THR E N    1 
ATOM   6755 C CA   . THR E 1 196 ? 94.152  2.516   33.525 1.00 32.73 ? 196 THR E CA   1 
ATOM   6756 C C    . THR E 1 196 ? 94.493  1.796   32.243 1.00 32.51 ? 196 THR E C    1 
ATOM   6757 O O    . THR E 1 196 ? 93.666  1.720   31.331 1.00 32.08 ? 196 THR E O    1 
ATOM   6758 C CB   . THR E 1 196 ? 93.531  1.581   34.566 1.00 34.67 ? 196 THR E CB   1 
ATOM   6759 O OG1  . THR E 1 196 ? 92.246  1.142   34.115 1.00 43.22 ? 196 THR E OG1  1 
ATOM   6760 C CG2  . THR E 1 196 ? 93.356  2.318   35.886 1.00 37.11 ? 196 THR E CG2  1 
ATOM   6761 H H    . THR E 1 196 ? 92.339  3.382   32.876 1.00 0.00  ? 196 THR E H    1 
ATOM   6762 H HG1  . THR E 1 196 ? 92.319  0.703   33.261 1.00 0.00  ? 196 THR E HG1  1 
ATOM   6763 N N    . ILE E 1 197 ? 95.726  1.314   32.154 1.00 35.28 ? 197 ILE E N    1 
ATOM   6764 C CA   . ILE E 1 197 ? 96.209  0.630   30.958 1.00 31.38 ? 197 ILE E CA   1 
ATOM   6765 C C    . ILE E 1 197 ? 96.698  -0.790  31.251 1.00 35.94 ? 197 ILE E C    1 
ATOM   6766 O O    . ILE E 1 197 ? 97.110  -1.112  32.369 1.00 35.25 ? 197 ILE E O    1 
ATOM   6767 C CB   . ILE E 1 197 ? 97.365  1.447   30.310 1.00 22.42 ? 197 ILE E CB   1 
ATOM   6768 C CG1  . ILE E 1 197 ? 96.895  2.872   30.014 1.00 18.53 ? 197 ILE E CG1  1 
ATOM   6769 C CG2  . ILE E 1 197 ? 97.879  0.770   29.048 1.00 24.62 ? 197 ILE E CG2  1 
ATOM   6770 C CD1  . ILE E 1 197 ? 97.918  3.725   29.310 1.00 20.38 ? 197 ILE E CD1  1 
ATOM   6771 H H    . ILE E 1 197 ? 96.369  1.389   32.892 1.00 0.00  ? 197 ILE E H    1 
ATOM   6772 N N    . GLU E 1 198 ? 96.578  -1.649  30.249 1.00 40.37 ? 198 GLU E N    1 
ATOM   6773 C CA   . GLU E 1 198 ? 97.034  -3.031  30.329 1.00 42.98 ? 198 GLU E CA   1 
ATOM   6774 C C    . GLU E 1 198 ? 97.770  -3.186  29.011 1.00 45.27 ? 198 GLU E C    1 
ATOM   6775 O O    . GLU E 1 198 ? 97.153  -3.181  27.944 1.00 48.15 ? 198 GLU E O    1 
ATOM   6776 C CB   . GLU E 1 198 ? 95.855  -3.983  30.405 1.00 45.18 ? 198 GLU E CB   1 
ATOM   6777 H H    . GLU E 1 198 ? 96.160  -1.363  29.414 1.00 0.00  ? 198 GLU E H    1 
ATOM   6778 N N    . MET E 1 199 ? 99.096  -3.215  29.081 1.00 48.14 ? 199 MET E N    1 
ATOM   6779 C CA   . MET E 1 199 ? 99.923  -3.316  27.884 1.00 46.26 ? 199 MET E CA   1 
ATOM   6780 C C    . MET E 1 199 ? 100.950 -4.446  27.937 1.00 43.34 ? 199 MET E C    1 
ATOM   6781 O O    . MET E 1 199 ? 101.663 -4.610  28.925 1.00 42.58 ? 199 MET E O    1 
ATOM   6782 C CB   . MET E 1 199 ? 100.638 -1.977  27.639 1.00 44.71 ? 199 MET E CB   1 
ATOM   6783 C CG   . MET E 1 199 ? 101.552 -1.971  26.430 1.00 47.35 ? 199 MET E CG   1 
ATOM   6784 S SD   . MET E 1 199 ? 102.913 -0.801  26.589 1.00 44.47 ? 199 MET E SD   1 
ATOM   6785 C CE   . MET E 1 199 ? 103.825 -1.520  27.975 1.00 40.37 ? 199 MET E CE   1 
ATOM   6786 H H    . MET E 1 199 ? 99.543  -3.187  29.949 1.00 0.00  ? 199 MET E H    1 
ATOM   6787 N N    . ASN E 1 200 ? 100.976 -5.243  26.875 1.00 40.59 ? 200 ASN E N    1 
ATOM   6788 C CA   . ASN E 1 200 ? 101.913 -6.346  26.725 1.00 38.48 ? 200 ASN E CA   1 
ATOM   6789 C C    . ASN E 1 200 ? 103.056 -5.798  25.904 1.00 37.72 ? 200 ASN E C    1 
ATOM   6790 O O    . ASN E 1 200 ? 104.183 -6.275  25.987 1.00 45.37 ? 200 ASN E O    1 
ATOM   6791 C CB   . ASN E 1 200 ? 101.276 -7.505  25.963 1.00 39.67 ? 200 ASN E CB   1 
ATOM   6792 C CG   . ASN E 1 200 ? 100.227 -8.225  26.771 1.00 43.76 ? 200 ASN E CG   1 
ATOM   6793 O OD1  . ASN E 1 200 ? 100.250 -8.208  28.003 1.00 48.31 ? 200 ASN E OD1  1 
ATOM   6794 N ND2  . ASN E 1 200 ? 99.305  -8.881  26.083 1.00 43.86 ? 200 ASN E ND2  1 
ATOM   6795 H H    . ASN E 1 200 ? 100.321 -5.106  26.187 1.00 0.00  ? 200 ASN E H    1 
ATOM   6796 H HD21 . ASN E 1 200 ? 98.622  -9.333  26.613 1.00 0.00  ? 200 ASN E HD21 1 
ATOM   6797 H HD22 . ASN E 1 200 ? 99.351  -8.889  25.103 1.00 0.00  ? 200 ASN E HD22 1 
ATOM   6798 N N    . GLU E 1 201 ? 102.736 -4.823  25.066 1.00 34.97 ? 201 GLU E N    1 
ATOM   6799 C CA   . GLU E 1 201 ? 103.718 -4.177  24.217 1.00 38.15 ? 201 GLU E CA   1 
ATOM   6800 C C    . GLU E 1 201 ? 103.094 -2.986  23.511 1.00 34.54 ? 201 GLU E C    1 
ATOM   6801 O O    . GLU E 1 201 ? 101.928 -3.025  23.123 1.00 32.39 ? 201 GLU E O    1 
ATOM   6802 C CB   . GLU E 1 201 ? 104.317 -5.162  23.210 1.00 43.34 ? 201 GLU E CB   1 
ATOM   6803 C CG   . GLU E 1 201 ? 103.321 -5.953  22.393 1.00 54.18 ? 201 GLU E CG   1 
ATOM   6804 C CD   . GLU E 1 201 ? 104.008 -6.877  21.403 1.00 61.76 ? 201 GLU E CD   1 
ATOM   6805 O OE1  . GLU E 1 201 ? 104.648 -7.858  21.849 1.00 66.78 ? 201 GLU E OE1  1 
ATOM   6806 O OE2  . GLU E 1 201 ? 103.924 -6.615  20.181 1.00 65.33 ? 201 GLU E OE2  1 
ATOM   6807 H H    . GLU E 1 201 ? 101.812 -4.497  25.000 1.00 0.00  ? 201 GLU E H    1 
ATOM   6808 N N    . PRO E 1 202 ? 103.846 -1.882  23.409 1.00 34.74 ? 202 PRO E N    1 
ATOM   6809 C CA   . PRO E 1 202 ? 103.406 -0.646  22.765 1.00 32.37 ? 202 PRO E CA   1 
ATOM   6810 C C    . PRO E 1 202 ? 102.786 -0.876  21.393 1.00 33.19 ? 202 PRO E C    1 
ATOM   6811 O O    . PRO E 1 202 ? 103.205 -1.769  20.651 1.00 30.92 ? 202 PRO E O    1 
ATOM   6812 C CB   . PRO E 1 202 ? 104.702 0.144   22.656 1.00 32.07 ? 202 PRO E CB   1 
ATOM   6813 C CG   . PRO E 1 202 ? 105.415 -0.251  23.903 1.00 34.53 ? 202 PRO E CG   1 
ATOM   6814 C CD   . PRO E 1 202 ? 105.223 -1.739  23.918 1.00 32.88 ? 202 PRO E CD   1 
ATOM   6815 N N    . VAL E 1 203 ? 101.776 -0.070  21.078 1.00 33.14 ? 203 VAL E N    1 
ATOM   6816 C CA   . VAL E 1 203 ? 101.077 -0.137  19.799 1.00 29.83 ? 203 VAL E CA   1 
ATOM   6817 C C    . VAL E 1 203 ? 100.823 1.298   19.367 1.00 26.30 ? 203 VAL E C    1 
ATOM   6818 O O    . VAL E 1 203 ? 100.869 2.218   20.184 1.00 16.11 ? 203 VAL E O    1 
ATOM   6819 C CB   . VAL E 1 203 ? 99.708  -0.856  19.911 1.00 30.96 ? 203 VAL E CB   1 
ATOM   6820 C CG1  . VAL E 1 203 ? 99.106  -1.065  18.533 1.00 35.17 ? 203 VAL E CG1  1 
ATOM   6821 C CG2  . VAL E 1 203 ? 99.862  -2.187  20.603 1.00 36.05 ? 203 VAL E CG2  1 
ATOM   6822 H H    . VAL E 1 203 ? 101.496 0.613   21.722 1.00 0.00  ? 203 VAL E H    1 
ATOM   6823 N N    . GLN E 1 204 ? 100.584 1.480   18.077 1.00 26.26 ? 204 GLN E N    1 
ATOM   6824 C CA   . GLN E 1 204 ? 100.309 2.782   17.503 1.00 25.05 ? 204 GLN E CA   1 
ATOM   6825 C C    . GLN E 1 204 ? 99.537  2.453   16.245 1.00 26.45 ? 204 GLN E C    1 
ATOM   6826 O O    . GLN E 1 204 ? 100.072 1.824   15.328 1.00 28.02 ? 204 GLN E O    1 
ATOM   6827 C CB   . GLN E 1 204 ? 101.616 3.488   17.162 1.00 28.16 ? 204 GLN E CB   1 
ATOM   6828 C CG   . GLN E 1 204 ? 101.451 4.842   16.518 1.00 32.22 ? 204 GLN E CG   1 
ATOM   6829 C CD   . GLN E 1 204 ? 102.785 5.497   16.231 1.00 35.13 ? 204 GLN E CD   1 
ATOM   6830 O OE1  . GLN E 1 204 ? 103.573 5.751   17.146 1.00 37.25 ? 204 GLN E OE1  1 
ATOM   6831 N NE2  . GLN E 1 204 ? 103.056 5.763   14.954 1.00 38.55 ? 204 GLN E NE2  1 
ATOM   6832 H H    . GLN E 1 204 ? 100.619 0.725   17.451 1.00 0.00  ? 204 GLN E H    1 
ATOM   6833 H HE21 . GLN E 1 204 ? 103.910 6.188   14.750 1.00 0.00  ? 204 GLN E HE21 1 
ATOM   6834 H HE22 . GLN E 1 204 ? 102.405 5.539   14.252 1.00 0.00  ? 204 GLN E HE22 1 
ATOM   6835 N N    . LEU E 1 205 ? 98.258  2.808   16.236 1.00 29.30 ? 205 LEU E N    1 
ATOM   6836 C CA   . LEU E 1 205 ? 97.395  2.524   15.097 1.00 27.36 ? 205 LEU E CA   1 
ATOM   6837 C C    . LEU E 1 205 ? 96.695  3.782   14.590 1.00 29.66 ? 205 LEU E C    1 
ATOM   6838 O O    . LEU E 1 205 ? 96.614  4.787   15.302 1.00 33.31 ? 205 LEU E O    1 
ATOM   6839 C CB   . LEU E 1 205 ? 96.366  1.466   15.496 1.00 30.72 ? 205 LEU E CB   1 
ATOM   6840 C CG   . LEU E 1 205 ? 96.936  0.079   15.821 1.00 34.56 ? 205 LEU E CG   1 
ATOM   6841 C CD1  . LEU E 1 205 ? 95.956  -0.739  16.629 1.00 35.35 ? 205 LEU E CD1  1 
ATOM   6842 C CD2  . LEU E 1 205 ? 97.307  -0.643  14.541 1.00 38.81 ? 205 LEU E CD2  1 
ATOM   6843 H H    . LEU E 1 205 ? 97.892  3.307   17.000 1.00 0.00  ? 205 LEU E H    1 
ATOM   6844 N N    . THR E 1 206 ? 96.247  3.743   13.340 1.00 25.70 ? 206 THR E N    1 
ATOM   6845 C CA   . THR E 1 206 ? 95.538  4.867   12.737 1.00 22.35 ? 206 THR E CA   1 
ATOM   6846 C C    . THR E 1 206 ? 94.122  4.403   12.416 1.00 21.07 ? 206 THR E C    1 
ATOM   6847 O O    . THR E 1 206 ? 93.915  3.276   11.951 1.00 24.12 ? 206 THR E O    1 
ATOM   6848 C CB   . THR E 1 206 ? 96.221  5.345   11.432 1.00 18.36 ? 206 THR E CB   1 
ATOM   6849 O OG1  . THR E 1 206 ? 97.594  5.662   11.689 1.00 21.78 ? 206 THR E OG1  1 
ATOM   6850 C CG2  . THR E 1 206 ? 95.529  6.576   10.886 1.00 18.35 ? 206 THR E CG2  1 
ATOM   6851 H H    . THR E 1 206 ? 96.385  2.929   12.804 1.00 0.00  ? 206 THR E H    1 
ATOM   6852 H HG1  . THR E 1 206 ? 98.073  4.829   11.749 1.00 0.00  ? 206 THR E HG1  1 
ATOM   6853 N N    . PHE E 1 207 ? 93.146  5.264   12.667 1.00 22.54 ? 207 PHE E N    1 
ATOM   6854 C CA   . PHE E 1 207 ? 91.754  4.922   12.405 1.00 24.56 ? 207 PHE E CA   1 
ATOM   6855 C C    . PHE E 1 207 ? 90.995  6.118   11.847 1.00 21.24 ? 207 PHE E C    1 
ATOM   6856 O O    . PHE E 1 207 ? 91.423  7.258   12.012 1.00 32.28 ? 207 PHE E O    1 
ATOM   6857 C CB   . PHE E 1 207 ? 91.086  4.432   13.699 1.00 24.15 ? 207 PHE E CB   1 
ATOM   6858 C CG   . PHE E 1 207 ? 91.727  3.200   14.284 1.00 30.77 ? 207 PHE E CG   1 
ATOM   6859 C CD1  . PHE E 1 207 ? 91.555  1.952   13.685 1.00 34.39 ? 207 PHE E CD1  1 
ATOM   6860 C CD2  . PHE E 1 207 ? 92.520  3.288   15.421 1.00 35.66 ? 207 PHE E CD2  1 
ATOM   6861 C CE1  . PHE E 1 207 ? 92.164  0.811   14.208 1.00 33.88 ? 207 PHE E CE1  1 
ATOM   6862 C CE2  . PHE E 1 207 ? 93.135  2.150   15.952 1.00 39.42 ? 207 PHE E CE2  1 
ATOM   6863 C CZ   . PHE E 1 207 ? 92.955  0.910   15.341 1.00 36.96 ? 207 PHE E CZ   1 
ATOM   6864 H H    . PHE E 1 207 ? 93.362  6.140   13.058 1.00 0.00  ? 207 PHE E H    1 
ATOM   6865 N N    . ALA E 1 208 ? 89.884  5.854   11.172 1.00 21.42 ? 208 ALA E N    1 
ATOM   6866 C CA   . ALA E 1 208 ? 89.037  6.905   10.607 1.00 18.70 ? 208 ALA E CA   1 
ATOM   6867 C C    . ALA E 1 208 ? 88.096  7.443   11.688 1.00 19.37 ? 208 ALA E C    1 
ATOM   6868 O O    . ALA E 1 208 ? 87.232  6.712   12.190 1.00 27.84 ? 208 ALA E O    1 
ATOM   6869 C CB   . ALA E 1 208 ? 88.231  6.347   9.454  1.00 19.61 ? 208 ALA E CB   1 
ATOM   6870 H H    . ALA E 1 208 ? 89.619  4.918   11.058 1.00 0.00  ? 208 ALA E H    1 
ATOM   6871 N N    . LEU E 1 209 ? 88.256  8.716   12.038 1.00 11.87 ? 209 LEU E N    1 
ATOM   6872 C CA   . LEU E 1 209 ? 87.438  9.365   13.066 1.00 13.44 ? 209 LEU E CA   1 
ATOM   6873 C C    . LEU E 1 209 ? 85.918  9.371   12.822 1.00 21.32 ? 209 LEU E C    1 
ATOM   6874 O O    . LEU E 1 209 ? 85.142  9.339   13.784 1.00 22.46 ? 209 LEU E O    1 
ATOM   6875 C CB   . LEU E 1 209 ? 87.930  10.794  13.313 1.00 9.64  ? 209 LEU E CB   1 
ATOM   6876 C CG   . LEU E 1 209 ? 89.273  10.892  14.028 1.00 9.32  ? 209 LEU E CG   1 
ATOM   6877 C CD1  . LEU E 1 209 ? 89.868  12.270  13.920 1.00 10.35 ? 209 LEU E CD1  1 
ATOM   6878 C CD2  . LEU E 1 209 ? 89.062  10.528  15.459 1.00 15.32 ? 209 LEU E CD2  1 
ATOM   6879 H H    . LEU E 1 209 ? 88.964  9.212   11.595 1.00 0.00  ? 209 LEU E H    1 
ATOM   6880 N N    . ARG E 1 210 ? 85.483  9.420   11.560 1.00 22.10 ? 210 ARG E N    1 
ATOM   6881 C CA   . ARG E 1 210 ? 84.054  9.417   11.275 1.00 16.43 ? 210 ARG E CA   1 
ATOM   6882 C C    . ARG E 1 210 ? 83.392  8.195   11.888 1.00 17.45 ? 210 ARG E C    1 
ATOM   6883 O O    . ARG E 1 210 ? 82.287  8.288   12.411 1.00 21.79 ? 210 ARG E O    1 
ATOM   6884 C CB   . ARG E 1 210 ? 83.746  9.451   9.777  1.00 24.49 ? 210 ARG E CB   1 
ATOM   6885 C CG   . ARG E 1 210 ? 82.237  9.359   9.531  1.00 33.03 ? 210 ARG E CG   1 
ATOM   6886 C CD   . ARG E 1 210 ? 81.784  9.521   8.096  1.00 39.74 ? 210 ARG E CD   1 
ATOM   6887 N NE   . ARG E 1 210 ? 80.321  9.429   8.038  1.00 51.16 ? 210 ARG E NE   1 
ATOM   6888 C CZ   . ARG E 1 210 ? 79.586  9.597   6.941  1.00 56.23 ? 210 ARG E CZ   1 
ATOM   6889 N NH1  . ARG E 1 210 ? 80.162  9.873   5.778  1.00 66.38 ? 210 ARG E NH1  1 
ATOM   6890 N NH2  . ARG E 1 210 ? 78.267  9.480   7.005  1.00 56.30 ? 210 ARG E NH2  1 
ATOM   6891 H H    . ARG E 1 210 ? 86.146  9.470   10.837 1.00 0.00  ? 210 ARG E H    1 
ATOM   6892 H HE   . ARG E 1 210 ? 79.833  9.212   8.858  1.00 0.00  ? 210 ARG E HE   1 
ATOM   6893 H HH11 . ARG E 1 210 ? 81.157  9.955   5.722  1.00 0.00  ? 210 ARG E HH11 1 
ATOM   6894 H HH12 . ARG E 1 210 ? 79.603  10.001  4.960  1.00 0.00  ? 210 ARG E HH12 1 
ATOM   6895 H HH21 . ARG E 1 210 ? 77.809  9.265   7.869  1.00 0.00  ? 210 ARG E HH21 1 
ATOM   6896 H HH22 . ARG E 1 210 ? 77.724  9.612   6.175  1.00 0.00  ? 210 ARG E HH22 1 
ATOM   6897 N N    . TYR E 1 211 ? 84.066  7.052   11.810 1.00 16.00 ? 211 TYR E N    1 
ATOM   6898 C CA   . TYR E 1 211 ? 83.542  5.814   12.371 1.00 17.61 ? 211 TYR E CA   1 
ATOM   6899 C C    . TYR E 1 211 ? 83.515  5.869   13.897 1.00 18.33 ? 211 TYR E C    1 
ATOM   6900 O O    . TYR E 1 211 ? 82.489  5.594   14.509 1.00 21.37 ? 211 TYR E O    1 
ATOM   6901 C CB   . TYR E 1 211 ? 84.382  4.625   11.907 1.00 17.58 ? 211 TYR E CB   1 
ATOM   6902 C CG   . TYR E 1 211 ? 84.178  4.262   10.454 1.00 20.35 ? 211 TYR E CG   1 
ATOM   6903 C CD1  . TYR E 1 211 ? 84.960  4.838   9.452  1.00 25.75 ? 211 TYR E CD1  1 
ATOM   6904 C CD2  . TYR E 1 211 ? 83.200  3.345   10.081 1.00 20.41 ? 211 TYR E CD2  1 
ATOM   6905 C CE1  . TYR E 1 211 ? 84.777  4.511   8.107  1.00 24.37 ? 211 TYR E CE1  1 
ATOM   6906 C CE2  . TYR E 1 211 ? 83.007  3.007   8.747  1.00 27.83 ? 211 TYR E CE2  1 
ATOM   6907 C CZ   . TYR E 1 211 ? 83.797  3.593   7.763  1.00 29.99 ? 211 TYR E CZ   1 
ATOM   6908 O OH   . TYR E 1 211 ? 83.593  3.249   6.445  1.00 30.14 ? 211 TYR E OH   1 
ATOM   6909 H H    . TYR E 1 211 ? 84.947  7.034   11.376 1.00 0.00  ? 211 TYR E H    1 
ATOM   6910 H HH   . TYR E 1 211 ? 84.201  3.710   5.849  1.00 0.00  ? 211 TYR E HH   1 
ATOM   6911 N N    . LEU E 1 212 ? 84.628  6.264   14.512 1.00 18.17 ? 212 LEU E N    1 
ATOM   6912 C CA   . LEU E 1 212 ? 84.708  6.338   15.971 1.00 11.50 ? 212 LEU E CA   1 
ATOM   6913 C C    . LEU E 1 212 ? 83.625  7.234   16.570 1.00 12.41 ? 212 LEU E C    1 
ATOM   6914 O O    . LEU E 1 212 ? 83.108  6.952   17.648 1.00 17.36 ? 212 LEU E O    1 
ATOM   6915 C CB   . LEU E 1 212 ? 86.108  6.782   16.423 1.00 10.40 ? 212 LEU E CB   1 
ATOM   6916 C CG   . LEU E 1 212 ? 87.245  5.773   16.220 1.00 9.35  ? 212 LEU E CG   1 
ATOM   6917 C CD1  . LEU E 1 212 ? 88.604  6.421   16.415 1.00 5.16  ? 212 LEU E CD1  1 
ATOM   6918 C CD2  . LEU E 1 212 ? 87.078  4.618   17.178 1.00 8.95  ? 212 LEU E CD2  1 
ATOM   6919 H H    . LEU E 1 212 ? 85.407  6.513   13.971 1.00 0.00  ? 212 LEU E H    1 
ATOM   6920 N N    . ASN E 1 213 ? 83.237  8.284   15.858 1.00 13.65 ? 213 ASN E N    1 
ATOM   6921 C CA   . ASN E 1 213 ? 82.194  9.172   16.366 1.00 14.10 ? 213 ASN E CA   1 
ATOM   6922 C C    . ASN E 1 213 ? 80.796  8.563   16.294 1.00 15.41 ? 213 ASN E C    1 
ATOM   6923 O O    . ASN E 1 213 ? 79.814  9.216   16.637 1.00 22.49 ? 213 ASN E O    1 
ATOM   6924 C CB   . ASN E 1 213 ? 82.236  10.541  15.682 1.00 16.82 ? 213 ASN E CB   1 
ATOM   6925 C CG   . ASN E 1 213 ? 83.397  11.403  16.170 1.00 20.21 ? 213 ASN E CG   1 
ATOM   6926 O OD1  . ASN E 1 213 ? 83.461  11.779  17.345 1.00 21.69 ? 213 ASN E OD1  1 
ATOM   6927 N ND2  . ASN E 1 213 ? 84.324  11.709  15.271 1.00 16.53 ? 213 ASN E ND2  1 
ATOM   6928 H H    . ASN E 1 213 ? 83.669  8.469   14.998 1.00 0.00  ? 213 ASN E H    1 
ATOM   6929 H HD21 . ASN E 1 213 ? 85.087  12.246  15.584 1.00 0.00  ? 213 ASN E HD21 1 
ATOM   6930 H HD22 . ASN E 1 213 ? 84.228  11.403  14.344 1.00 0.00  ? 213 ASN E HD22 1 
ATOM   6931 N N    . PHE E 1 214 ? 80.702  7.333   15.796 1.00 15.77 ? 214 PHE E N    1 
ATOM   6932 C CA   . PHE E 1 214 ? 79.431  6.614   15.731 1.00 14.35 ? 214 PHE E CA   1 
ATOM   6933 C C    . PHE E 1 214 ? 79.410  5.738   16.970 1.00 13.96 ? 214 PHE E C    1 
ATOM   6934 O O    . PHE E 1 214 ? 78.386  5.610   17.635 1.00 20.12 ? 214 PHE E O    1 
ATOM   6935 C CB   . PHE E 1 214 ? 79.345  5.709   14.500 1.00 18.92 ? 214 PHE E CB   1 
ATOM   6936 C CG   . PHE E 1 214 ? 78.830  6.393   13.278 1.00 22.94 ? 214 PHE E CG   1 
ATOM   6937 C CD1  . PHE E 1 214 ? 77.558  6.954   13.269 1.00 23.32 ? 214 PHE E CD1  1 
ATOM   6938 C CD2  . PHE E 1 214 ? 79.616  6.485   12.134 1.00 25.17 ? 214 PHE E CD2  1 
ATOM   6939 C CE1  . PHE E 1 214 ? 77.073  7.602   12.142 1.00 20.91 ? 214 PHE E CE1  1 
ATOM   6940 C CE2  . PHE E 1 214 ? 79.140  7.134   10.999 1.00 26.77 ? 214 PHE E CE2  1 
ATOM   6941 C CZ   . PHE E 1 214 ? 77.861  7.695   11.005 1.00 24.49 ? 214 PHE E CZ   1 
ATOM   6942 H H    . PHE E 1 214 ? 81.496  6.891   15.453 1.00 0.00  ? 214 PHE E H    1 
ATOM   6943 N N    . PHE E 1 215 ? 80.554  5.133   17.274 1.00 6.90  ? 215 PHE E N    1 
ATOM   6944 C CA   . PHE E 1 215 ? 80.677  4.268   18.441 1.00 9.82  ? 215 PHE E CA   1 
ATOM   6945 C C    . PHE E 1 215 ? 80.328  5.074   19.689 1.00 5.41  ? 215 PHE E C    1 
ATOM   6946 O O    . PHE E 1 215 ? 79.541  4.630   20.511 1.00 9.06  ? 215 PHE E O    1 
ATOM   6947 C CB   . PHE E 1 215 ? 82.104  3.721   18.575 1.00 11.60 ? 215 PHE E CB   1 
ATOM   6948 C CG   . PHE E 1 215 ? 82.623  3.006   17.343 1.00 12.21 ? 215 PHE E CG   1 
ATOM   6949 C CD1  . PHE E 1 215 ? 81.798  2.746   16.250 1.00 13.86 ? 215 PHE E CD1  1 
ATOM   6950 C CD2  . PHE E 1 215 ? 83.943  2.569   17.294 1.00 9.52  ? 215 PHE E CD2  1 
ATOM   6951 C CE1  . PHE E 1 215 ? 82.283  2.064   15.137 1.00 10.96 ? 215 PHE E CE1  1 
ATOM   6952 C CE2  . PHE E 1 215 ? 84.433  1.890   16.184 1.00 11.04 ? 215 PHE E CE2  1 
ATOM   6953 C CZ   . PHE E 1 215 ? 83.599  1.636   15.106 1.00 7.48  ? 215 PHE E CZ   1 
ATOM   6954 H H    . PHE E 1 215 ? 81.335  5.295   16.703 1.00 0.00  ? 215 PHE E H    1 
ATOM   6955 N N    . THR E 1 216 ? 80.862  6.288   19.787 1.00 6.11  ? 216 THR E N    1 
ATOM   6956 C CA   . THR E 1 216 ? 80.599  7.161   20.930 1.00 8.36  ? 216 THR E CA   1 
ATOM   6957 C C    . THR E 1 216 ? 79.111  7.453   21.139 1.00 11.54 ? 216 THR E C    1 
ATOM   6958 O O    . THR E 1 216 ? 78.727  8.130   22.094 1.00 15.52 ? 216 THR E O    1 
ATOM   6959 C CB   . THR E 1 216 ? 81.361  8.491   20.819 1.00 5.86  ? 216 THR E CB   1 
ATOM   6960 O OG1  . THR E 1 216 ? 80.821  9.266   19.741 1.00 11.41 ? 216 THR E OG1  1 
ATOM   6961 C CG2  . THR E 1 216 ? 82.840  8.229   20.561 1.00 5.90  ? 216 THR E CG2  1 
ATOM   6962 H H    . THR E 1 216 ? 81.470  6.626   19.095 1.00 0.00  ? 216 THR E H    1 
ATOM   6963 H HG1  . THR E 1 216 ? 81.171  10.161  19.800 1.00 0.00  ? 216 THR E HG1  1 
ATOM   6964 N N    . LYS E 1 217 ? 78.264  6.965   20.243 1.00 11.59 ? 217 LYS E N    1 
ATOM   6965 C CA   . LYS E 1 217 ? 76.839  7.171   20.413 1.00 12.85 ? 217 LYS E CA   1 
ATOM   6966 C C    . LYS E 1 217 ? 76.328  6.203   21.461 1.00 13.43 ? 217 LYS E C    1 
ATOM   6967 O O    . LYS E 1 217 ? 75.194  6.315   21.913 1.00 27.70 ? 217 LYS E O    1 
ATOM   6968 C CB   . LYS E 1 217 ? 76.095  6.985   19.098 1.00 13.92 ? 217 LYS E CB   1 
ATOM   6969 C CG   . LYS E 1 217 ? 76.027  8.252   18.273 1.00 15.61 ? 217 LYS E CG   1 
ATOM   6970 C CD   . LYS E 1 217 ? 75.382  7.992   16.931 1.00 21.34 ? 217 LYS E CD   1 
ATOM   6971 C CE   . LYS E 1 217 ? 75.264  9.276   16.153 1.00 21.69 ? 217 LYS E CE   1 
ATOM   6972 N NZ   . LYS E 1 217 ? 74.958  8.983   14.740 1.00 33.45 ? 217 LYS E NZ   1 
ATOM   6973 H H    . LYS E 1 217 ? 78.571  6.482   19.454 1.00 0.00  ? 217 LYS E H    1 
ATOM   6974 H HZ1  . LYS E 1 217 ? 75.705  8.383   14.332 1.00 0.00  ? 217 LYS E HZ1  1 
ATOM   6975 H HZ2  . LYS E 1 217 ? 74.055  8.478   14.700 1.00 0.00  ? 217 LYS E HZ2  1 
ATOM   6976 H HZ3  . LYS E 1 217 ? 74.899  9.870   14.200 1.00 0.00  ? 217 LYS E HZ3  1 
ATOM   6977 N N    . ALA E 1 218 ? 77.173  5.258   21.859 1.00 8.12  ? 218 ALA E N    1 
ATOM   6978 C CA   . ALA E 1 218 ? 76.813  4.285   22.880 1.00 5.60  ? 218 ALA E CA   1 
ATOM   6979 C C    . ALA E 1 218 ? 77.325  4.762   24.231 1.00 13.22 ? 218 ALA E C    1 
ATOM   6980 O O    . ALA E 1 218 ? 77.332  4.003   25.205 1.00 20.57 ? 218 ALA E O    1 
ATOM   6981 C CB   . ALA E 1 218 ? 77.409  2.941   22.547 1.00 2.80  ? 218 ALA E CB   1 
ATOM   6982 H H    . ALA E 1 218 ? 78.068  5.206   21.474 1.00 0.00  ? 218 ALA E H    1 
ATOM   6983 N N    . THR E 1 219 ? 77.749  6.024   24.293 1.00 14.56 ? 219 THR E N    1 
ATOM   6984 C CA   . THR E 1 219 ? 78.270  6.606   25.526 1.00 15.17 ? 219 THR E CA   1 
ATOM   6985 C C    . THR E 1 219 ? 77.331  6.496   26.732 1.00 15.08 ? 219 THR E C    1 
ATOM   6986 O O    . THR E 1 219 ? 77.783  6.155   27.816 1.00 20.00 ? 219 THR E O    1 
ATOM   6987 C CB   . THR E 1 219 ? 78.724  8.056   25.307 1.00 12.50 ? 219 THR E CB   1 
ATOM   6988 O OG1  . THR E 1 219 ? 79.767  8.068   24.330 1.00 5.48  ? 219 THR E OG1  1 
ATOM   6989 C CG2  . THR E 1 219 ? 79.262  8.650   26.597 1.00 16.99 ? 219 THR E CG2  1 
ATOM   6990 H H    . THR E 1 219 ? 77.739  6.605   23.498 1.00 0.00  ? 219 THR E H    1 
ATOM   6991 H HG1  . THR E 1 219 ? 80.462  7.455   24.590 1.00 0.00  ? 219 THR E HG1  1 
ATOM   6992 N N    . PRO E 1 220 ? 76.022  6.795   26.565 1.00 17.48 ? 220 PRO E N    1 
ATOM   6993 C CA   . PRO E 1 220 ? 75.073  6.695   27.683 1.00 12.79 ? 220 PRO E CA   1 
ATOM   6994 C C    . PRO E 1 220 ? 74.935  5.287   28.280 1.00 16.09 ? 220 PRO E C    1 
ATOM   6995 O O    . PRO E 1 220 ? 74.387  5.111   29.373 1.00 17.58 ? 220 PRO E O    1 
ATOM   6996 C CB   . PRO E 1 220 ? 73.753  7.158   27.054 1.00 18.20 ? 220 PRO E CB   1 
ATOM   6997 C CG   . PRO E 1 220 ? 73.938  6.902   25.581 1.00 16.77 ? 220 PRO E CG   1 
ATOM   6998 C CD   . PRO E 1 220 ? 75.349  7.368   25.381 1.00 15.68 ? 220 PRO E CD   1 
ATOM   6999 N N    . LEU E 1 221 ? 75.427  4.280   27.570 1.00 16.83 ? 221 LEU E N    1 
ATOM   7000 C CA   . LEU E 1 221 ? 75.344  2.914   28.069 1.00 13.62 ? 221 LEU E CA   1 
ATOM   7001 C C    . LEU E 1 221 ? 76.299  2.637   29.224 1.00 15.89 ? 221 LEU E C    1 
ATOM   7002 O O    . LEU E 1 221 ? 75.971  1.836   30.098 1.00 26.44 ? 221 LEU E O    1 
ATOM   7003 C CB   . LEU E 1 221 ? 75.586  1.901   26.941 1.00 7.95  ? 221 LEU E CB   1 
ATOM   7004 C CG   . LEU E 1 221 ? 74.452  1.730   25.923 1.00 6.88  ? 221 LEU E CG   1 
ATOM   7005 C CD1  . LEU E 1 221 ? 74.893  0.883   24.748 1.00 2.16  ? 221 LEU E CD1  1 
ATOM   7006 C CD2  . LEU E 1 221 ? 73.253  1.104   26.608 1.00 7.35  ? 221 LEU E CD2  1 
ATOM   7007 H H    . LEU E 1 221 ? 75.855  4.443   26.707 1.00 0.00  ? 221 LEU E H    1 
ATOM   7008 N N    . SER E 1 222 ? 77.446  3.313   29.269 1.00 10.41 ? 222 SER E N    1 
ATOM   7009 C CA   . SER E 1 222 ? 78.414  3.055   30.336 1.00 14.18 ? 222 SER E CA   1 
ATOM   7010 C C    . SER E 1 222 ? 79.252  4.271   30.742 1.00 16.53 ? 222 SER E C    1 
ATOM   7011 O O    . SER E 1 222 ? 79.491  5.163   29.935 1.00 14.78 ? 222 SER E O    1 
ATOM   7012 C CB   . SER E 1 222 ? 79.335  1.911   29.891 1.00 19.59 ? 222 SER E CB   1 
ATOM   7013 O OG   . SER E 1 222 ? 80.265  1.522   30.890 1.00 28.12 ? 222 SER E OG   1 
ATOM   7014 H H    . SER E 1 222 ? 77.662  4.018   28.617 1.00 0.00  ? 222 SER E H    1 
ATOM   7015 H HG   . SER E 1 222 ? 79.820  1.198   31.682 1.00 0.00  ? 222 SER E HG   1 
ATOM   7016 N N    . SER E 1 223 ? 79.689  4.294   32.001 1.00 21.56 ? 223 SER E N    1 
ATOM   7017 C CA   . SER E 1 223 ? 80.529  5.371   32.531 1.00 29.72 ? 223 SER E CA   1 
ATOM   7018 C C    . SER E 1 223 ? 81.929  5.279   31.930 1.00 33.39 ? 223 SER E C    1 
ATOM   7019 O O    . SER E 1 223 ? 82.625  6.286   31.773 1.00 34.71 ? 223 SER E O    1 
ATOM   7020 C CB   . SER E 1 223 ? 80.668  5.252   34.051 1.00 31.20 ? 223 SER E CB   1 
ATOM   7021 O OG   . SER E 1 223 ? 79.429  5.411   34.721 1.00 46.63 ? 223 SER E OG   1 
ATOM   7022 H H    . SER E 1 223 ? 79.446  3.564   32.598 1.00 0.00  ? 223 SER E H    1 
ATOM   7023 H HG   . SER E 1 223 ? 78.905  4.614   34.612 1.00 0.00  ? 223 SER E HG   1 
ATOM   7024 N N    . THR E 1 224 ? 82.355  4.053   31.651 1.00 36.56 ? 224 THR E N    1 
ATOM   7025 C CA   . THR E 1 224 ? 83.673  3.807   31.092 1.00 35.70 ? 224 THR E CA   1 
ATOM   7026 C C    . THR E 1 224 ? 83.601  3.198   29.694 1.00 27.94 ? 224 THR E C    1 
ATOM   7027 O O    . THR E 1 224 ? 82.534  2.807   29.226 1.00 27.94 ? 224 THR E O    1 
ATOM   7028 C CB   . THR E 1 224 ? 84.494  2.862   32.008 1.00 40.32 ? 224 THR E CB   1 
ATOM   7029 O OG1  . THR E 1 224 ? 83.813  1.606   32.148 1.00 48.30 ? 224 THR E OG1  1 
ATOM   7030 C CG2  . THR E 1 224 ? 84.679  3.487   33.393 1.00 42.22 ? 224 THR E CG2  1 
ATOM   7031 H H    . THR E 1 224 ? 81.788  3.265   31.812 1.00 0.00  ? 224 THR E H    1 
ATOM   7032 H HG1  . THR E 1 224 ? 83.683  1.141   31.312 1.00 0.00  ? 224 THR E HG1  1 
ATOM   7033 N N    . VAL E 1 225 ? 84.747  3.135   29.034 1.00 19.74 ? 225 VAL E N    1 
ATOM   7034 C CA   . VAL E 1 225 ? 84.857  2.559   27.710 1.00 14.70 ? 225 VAL E CA   1 
ATOM   7035 C C    . VAL E 1 225 ? 86.272  1.989   27.648 1.00 16.82 ? 225 VAL E C    1 
ATOM   7036 O O    . VAL E 1 225 ? 87.217  2.635   28.121 1.00 17.75 ? 225 VAL E O    1 
ATOM   7037 C CB   . VAL E 1 225 ? 84.652  3.632   26.619 1.00 15.18 ? 225 VAL E CB   1 
ATOM   7038 C CG1  . VAL E 1 225 ? 85.684  4.729   26.740 1.00 14.41 ? 225 VAL E CG1  1 
ATOM   7039 C CG2  . VAL E 1 225 ? 84.710  3.005   25.251 1.00 17.22 ? 225 VAL E CG2  1 
ATOM   7040 H H    . VAL E 1 225 ? 85.565  3.503   29.438 1.00 0.00  ? 225 VAL E H    1 
ATOM   7041 N N    . THR E 1 226 ? 86.416  0.758   27.160 1.00 9.37  ? 226 THR E N    1 
ATOM   7042 C CA   . THR E 1 226 ? 87.735  0.148   27.072 1.00 11.74 ? 226 THR E CA   1 
ATOM   7043 C C    . THR E 1 226 ? 88.143  -0.088  25.618 1.00 12.00 ? 226 THR E C    1 
ATOM   7044 O O    . THR E 1 226 ? 87.354  -0.617  24.837 1.00 21.67 ? 226 THR E O    1 
ATOM   7045 C CB   . THR E 1 226 ? 87.808  -1.190  27.874 1.00 14.93 ? 226 THR E CB   1 
ATOM   7046 O OG1  . THR E 1 226 ? 87.082  -2.220  27.193 1.00 15.28 ? 226 THR E OG1  1 
ATOM   7047 C CG2  . THR E 1 226 ? 87.210  -1.012  29.266 1.00 11.72 ? 226 THR E CG2  1 
ATOM   7048 H H    . THR E 1 226 ? 85.637  0.255   26.853 1.00 0.00  ? 226 THR E H    1 
ATOM   7049 H HG1  . THR E 1 226 ? 87.432  -2.281  26.296 1.00 0.00  ? 226 THR E HG1  1 
ATOM   7050 N N    . LEU E 1 227 ? 89.356  0.317   25.250 1.00 9.13  ? 227 LEU E N    1 
ATOM   7051 C CA   . LEU E 1 227 ? 89.852  0.126   23.888 1.00 11.54 ? 227 LEU E CA   1 
ATOM   7052 C C    . LEU E 1 227 ? 90.931  -0.948  23.908 1.00 14.77 ? 227 LEU E C    1 
ATOM   7053 O O    . LEU E 1 227 ? 91.842  -0.888  24.728 1.00 18.93 ? 227 LEU E O    1 
ATOM   7054 C CB   . LEU E 1 227 ? 90.494  1.403   23.355 1.00 11.42 ? 227 LEU E CB   1 
ATOM   7055 C CG   . LEU E 1 227 ? 89.831  2.762   23.531 1.00 8.93  ? 227 LEU E CG   1 
ATOM   7056 C CD1  . LEU E 1 227 ? 90.783  3.830   23.003 1.00 7.98  ? 227 LEU E CD1  1 
ATOM   7057 C CD2  . LEU E 1 227 ? 88.533  2.803   22.791 1.00 11.47 ? 227 LEU E CD2  1 
ATOM   7058 H H    . LEU E 1 227 ? 89.946  0.727   25.914 1.00 0.00  ? 227 LEU E H    1 
ATOM   7059 N N    . SER E 1 228 ? 90.830  -1.931  23.022 1.00 18.29 ? 228 SER E N    1 
ATOM   7060 C CA   . SER E 1 228 ? 91.825  -2.997  22.945 1.00 12.94 ? 228 SER E CA   1 
ATOM   7061 C C    . SER E 1 228 ? 92.446  -2.925  21.564 1.00 15.94 ? 228 SER E C    1 
ATOM   7062 O O    . SER E 1 228 ? 91.730  -2.919  20.559 1.00 22.08 ? 228 SER E O    1 
ATOM   7063 C CB   . SER E 1 228 ? 91.180  -4.369  23.139 1.00 11.00 ? 228 SER E CB   1 
ATOM   7064 O OG   . SER E 1 228 ? 90.519  -4.464  24.388 1.00 8.46  ? 228 SER E OG   1 
ATOM   7065 H H    . SER E 1 228 ? 90.060  -1.952  22.417 1.00 0.00  ? 228 SER E H    1 
ATOM   7066 H HG   . SER E 1 228 ? 89.615  -4.222  24.203 1.00 0.00  ? 228 SER E HG   1 
ATOM   7067 N N    . MET E 1 229 ? 93.773  -2.874  21.512 1.00 16.31 ? 229 MET E N    1 
ATOM   7068 C CA   . MET E 1 229 ? 94.489  -2.781  20.253 1.00 13.38 ? 229 MET E CA   1 
ATOM   7069 C C    . MET E 1 229 ? 95.632  -3.772  20.168 1.00 14.94 ? 229 MET E C    1 
ATOM   7070 O O    . MET E 1 229 ? 96.147  -4.243  21.179 1.00 21.45 ? 229 MET E O    1 
ATOM   7071 C CB   . MET E 1 229 ? 95.086  -1.388  20.099 1.00 16.47 ? 229 MET E CB   1 
ATOM   7072 C CG   . MET E 1 229 ? 94.101  -0.262  20.203 1.00 23.08 ? 229 MET E CG   1 
ATOM   7073 S SD   . MET E 1 229 ? 94.929  1.333   20.276 1.00 37.40 ? 229 MET E SD   1 
ATOM   7074 C CE   . MET E 1 229 ? 94.739  1.745   22.051 1.00 30.00 ? 229 MET E CE   1 
ATOM   7075 H H    . MET E 1 229 ? 94.287  -2.930  22.339 1.00 0.00  ? 229 MET E H    1 
ATOM   7076 N N    . SER E 1 230 ? 96.053  -4.024  18.941 1.00 15.13 ? 230 SER E N    1 
ATOM   7077 C CA   . SER E 1 230 ? 97.166  -4.902  18.618 1.00 16.66 ? 230 SER E CA   1 
ATOM   7078 C C    . SER E 1 230 ? 97.519  -4.510  17.187 1.00 20.13 ? 230 SER E C    1 
ATOM   7079 O O    . SER E 1 230 ? 96.675  -3.986  16.454 1.00 25.76 ? 230 SER E O    1 
ATOM   7080 C CB   . SER E 1 230 ? 96.760  -6.372  18.699 1.00 20.51 ? 230 SER E CB   1 
ATOM   7081 O OG   . SER E 1 230 ? 96.572  -6.781  20.047 1.00 18.42 ? 230 SER E OG   1 
ATOM   7082 H H    . SER E 1 230 ? 95.569  -3.616  18.186 1.00 0.00  ? 230 SER E H    1 
ATOM   7083 H HG   . SER E 1 230 ? 96.244  -7.689  19.973 1.00 0.00  ? 230 SER E HG   1 
ATOM   7084 N N    . ALA E 1 231 ? 98.769  -4.696  16.797 1.00 19.83 ? 231 ALA E N    1 
ATOM   7085 C CA   . ALA E 1 231 ? 99.181  -4.318  15.457 1.00 20.20 ? 231 ALA E CA   1 
ATOM   7086 C C    . ALA E 1 231 ? 98.436  -5.047  14.352 1.00 24.21 ? 231 ALA E C    1 
ATOM   7087 O O    . ALA E 1 231 ? 98.069  -6.208  14.503 1.00 25.15 ? 231 ALA E O    1 
ATOM   7088 C CB   . ALA E 1 231 ? 100.669 -4.518  15.295 1.00 23.61 ? 231 ALA E CB   1 
ATOM   7089 H H    . ALA E 1 231 ? 99.411  -5.107  17.417 1.00 0.00  ? 231 ALA E H    1 
ATOM   7090 N N    . ASP E 1 232 ? 98.159  -4.320  13.275 1.00 29.80 ? 232 ASP E N    1 
ATOM   7091 C CA   . ASP E 1 232 ? 97.502  -4.857  12.091 1.00 35.11 ? 232 ASP E CA   1 
ATOM   7092 C C    . ASP E 1 232 ? 96.178  -5.598  12.300 1.00 37.25 ? 232 ASP E C    1 
ATOM   7093 O O    . ASP E 1 232 ? 95.832  -6.478  11.521 1.00 41.40 ? 232 ASP E O    1 
ATOM   7094 C CB   . ASP E 1 232 ? 98.488  -5.739  11.317 1.00 35.68 ? 232 ASP E CB   1 
ATOM   7095 H H    . ASP E 1 232 ? 98.368  -3.370  13.317 1.00 0.00  ? 232 ASP E H    1 
ATOM   7096 N N    . VAL E 1 233 ? 95.419  -5.232  13.323 1.00 33.79 ? 233 VAL E N    1 
ATOM   7097 C CA   . VAL E 1 233 ? 94.131  -5.882  13.558 1.00 24.44 ? 233 VAL E CA   1 
ATOM   7098 C C    . VAL E 1 233 ? 93.130  -4.812  14.008 1.00 26.62 ? 233 VAL E C    1 
ATOM   7099 O O    . VAL E 1 233 ? 93.533  -3.758  14.505 1.00 26.40 ? 233 VAL E O    1 
ATOM   7100 C CB   . VAL E 1 233 ? 94.241  -7.008  14.614 1.00 21.17 ? 233 VAL E CB   1 
ATOM   7101 C CG1  . VAL E 1 233 ? 95.396  -7.946  14.289 1.00 21.47 ? 233 VAL E CG1  1 
ATOM   7102 C CG2  . VAL E 1 233 ? 94.397  -6.436  16.002 1.00 29.29 ? 233 VAL E CG2  1 
ATOM   7103 H H    . VAL E 1 233 ? 95.700  -4.527  13.940 1.00 0.00  ? 233 VAL E H    1 
ATOM   7104 N N    . PRO E 1 234 ? 91.820  -5.036  13.788 1.00 27.54 ? 234 PRO E N    1 
ATOM   7105 C CA   . PRO E 1 234 ? 90.761  -4.092  14.170 1.00 25.80 ? 234 PRO E CA   1 
ATOM   7106 C C    . PRO E 1 234 ? 90.690  -3.737  15.657 1.00 27.12 ? 234 PRO E C    1 
ATOM   7107 O O    . PRO E 1 234 ? 90.812  -4.606  16.523 1.00 28.48 ? 234 PRO E O    1 
ATOM   7108 C CB   . PRO E 1 234 ? 89.489  -4.811  13.717 1.00 23.48 ? 234 PRO E CB   1 
ATOM   7109 C CG   . PRO E 1 234 ? 89.944  -5.539  12.496 1.00 23.24 ? 234 PRO E CG   1 
ATOM   7110 C CD   . PRO E 1 234 ? 91.257  -6.131  12.974 1.00 27.40 ? 234 PRO E CD   1 
ATOM   7111 N N    . LEU E 1 235 ? 90.511  -2.446  15.926 1.00 22.74 ? 235 LEU E N    1 
ATOM   7112 C CA   . LEU E 1 235 ? 90.388  -1.903  17.278 1.00 11.91 ? 235 LEU E CA   1 
ATOM   7113 C C    . LEU E 1 235 ? 89.063  -2.388  17.858 1.00 13.75 ? 235 LEU E C    1 
ATOM   7114 O O    . LEU E 1 235 ? 88.126  -2.657  17.107 1.00 18.04 ? 235 LEU E O    1 
ATOM   7115 C CB   . LEU E 1 235 ? 90.337  -0.367  17.199 1.00 9.00  ? 235 LEU E CB   1 
ATOM   7116 C CG   . LEU E 1 235 ? 89.960  0.439   18.450 1.00 2.71  ? 235 LEU E CG   1 
ATOM   7117 C CD1  . LEU E 1 235 ? 91.190  0.660   19.241 1.00 2.28  ? 235 LEU E CD1  1 
ATOM   7118 C CD2  . LEU E 1 235 ? 89.332  1.781   18.115 1.00 2.00  ? 235 LEU E CD2  1 
ATOM   7119 H H    . LEU E 1 235 ? 90.444  -1.824  15.169 1.00 0.00  ? 235 LEU E H    1 
ATOM   7120 N N    . VAL E 1 236 ? 88.976  -2.493  19.184 1.00 15.08 ? 236 VAL E N    1 
ATOM   7121 C CA   . VAL E 1 236 ? 87.733  -2.904  19.840 1.00 7.49  ? 236 VAL E CA   1 
ATOM   7122 C C    . VAL E 1 236 ? 87.364  -1.919  20.952 1.00 11.77 ? 236 VAL E C    1 
ATOM   7123 O O    . VAL E 1 236 ? 88.055  -1.814  21.974 1.00 11.48 ? 236 VAL E O    1 
ATOM   7124 C CB   . VAL E 1 236 ? 87.812  -4.323  20.448 1.00 5.58  ? 236 VAL E CB   1 
ATOM   7125 C CG1  . VAL E 1 236 ? 86.403  -4.870  20.682 1.00 2.00  ? 236 VAL E CG1  1 
ATOM   7126 C CG2  . VAL E 1 236 ? 88.606  -5.248  19.539 1.00 4.41  ? 236 VAL E CG2  1 
ATOM   7127 H H    . VAL E 1 236 ? 89.772  -2.323  19.734 1.00 0.00  ? 236 VAL E H    1 
ATOM   7128 N N    . VAL E 1 237 ? 86.300  -1.163  20.720 1.00 5.80  ? 237 VAL E N    1 
ATOM   7129 C CA   . VAL E 1 237 ? 85.806  -0.203  21.689 1.00 3.76  ? 237 VAL E CA   1 
ATOM   7130 C C    . VAL E 1 237 ? 84.590  -0.882  22.296 1.00 8.12  ? 237 VAL E C    1 
ATOM   7131 O O    . VAL E 1 237 ? 83.624  -1.155  21.590 1.00 18.20 ? 237 VAL E O    1 
ATOM   7132 C CB   . VAL E 1 237 ? 85.370  1.079   20.998 1.00 5.18  ? 237 VAL E CB   1 
ATOM   7133 C CG1  . VAL E 1 237 ? 85.001  2.132   22.029 1.00 8.84  ? 237 VAL E CG1  1 
ATOM   7134 C CG2  . VAL E 1 237 ? 86.466  1.566   20.069 1.00 2.00  ? 237 VAL E CG2  1 
ATOM   7135 H H    . VAL E 1 237 ? 85.814  -1.274  19.878 1.00 0.00  ? 237 VAL E H    1 
ATOM   7136 N N    . GLU E 1 238 ? 84.634  -1.177  23.588 1.00 7.94  ? 238 GLU E N    1 
ATOM   7137 C CA   . GLU E 1 238 ? 83.525  -1.875  24.233 1.00 9.98  ? 238 GLU E CA   1 
ATOM   7138 C C    . GLU E 1 238 ? 82.835  -1.124  25.366 1.00 14.99 ? 238 GLU E C    1 
ATOM   7139 O O    . GLU E 1 238 ? 83.492  -0.621  26.284 1.00 20.34 ? 238 GLU E O    1 
ATOM   7140 C CB   . GLU E 1 238 ? 84.010  -3.231  24.756 1.00 11.27 ? 238 GLU E CB   1 
ATOM   7141 C CG   . GLU E 1 238 ? 82.987  -3.972  25.595 1.00 20.08 ? 238 GLU E CG   1 
ATOM   7142 C CD   . GLU E 1 238 ? 83.499  -5.278  26.159 1.00 28.42 ? 238 GLU E CD   1 
ATOM   7143 O OE1  . GLU E 1 238 ? 84.712  -5.541  26.080 1.00 38.17 ? 238 GLU E OE1  1 
ATOM   7144 O OE2  . GLU E 1 238 ? 82.679  -6.054  26.695 1.00 35.78 ? 238 GLU E OE2  1 
ATOM   7145 H H    . GLU E 1 238 ? 85.417  -0.914  24.116 1.00 0.00  ? 238 GLU E H    1 
ATOM   7146 N N    . TYR E 1 239 ? 81.506  -1.069  25.304 1.00 15.02 ? 239 TYR E N    1 
ATOM   7147 C CA   . TYR E 1 239 ? 80.700  -0.427  26.336 1.00 13.62 ? 239 TYR E CA   1 
ATOM   7148 C C    . TYR E 1 239 ? 79.997  -1.537  27.084 1.00 15.61 ? 239 TYR E C    1 
ATOM   7149 O O    . TYR E 1 239 ? 79.190  -2.266  26.511 1.00 20.71 ? 239 TYR E O    1 
ATOM   7150 C CB   . TYR E 1 239 ? 79.648  0.517   25.733 1.00 7.43  ? 239 TYR E CB   1 
ATOM   7151 C CG   . TYR E 1 239 ? 80.246  1.696   25.018 1.00 9.33  ? 239 TYR E CG   1 
ATOM   7152 C CD1  . TYR E 1 239 ? 80.631  1.593   23.684 1.00 10.17 ? 239 TYR E CD1  1 
ATOM   7153 C CD2  . TYR E 1 239 ? 80.516  2.885   25.693 1.00 9.51  ? 239 TYR E CD2  1 
ATOM   7154 C CE1  . TYR E 1 239 ? 81.280  2.634   23.039 1.00 11.29 ? 239 TYR E CE1  1 
ATOM   7155 C CE2  . TYR E 1 239 ? 81.167  3.934   25.057 1.00 13.48 ? 239 TYR E CE2  1 
ATOM   7156 C CZ   . TYR E 1 239 ? 81.552  3.792   23.726 1.00 11.11 ? 239 TYR E CZ   1 
ATOM   7157 O OH   . TYR E 1 239 ? 82.243  4.787   23.083 1.00 16.02 ? 239 TYR E OH   1 
ATOM   7158 H H    . TYR E 1 239 ? 81.051  -1.465  24.534 1.00 0.00  ? 239 TYR E H    1 
ATOM   7159 H HH   . TYR E 1 239 ? 82.326  5.552   23.670 1.00 0.00  ? 239 TYR E HH   1 
ATOM   7160 N N    . LYS E 1 240 ? 80.347  -1.716  28.346 1.00 17.72 ? 240 LYS E N    1 
ATOM   7161 C CA   . LYS E 1 240 ? 79.697  -2.742  29.139 1.00 21.46 ? 240 LYS E CA   1 
ATOM   7162 C C    . LYS E 1 240 ? 78.320  -2.232  29.542 1.00 24.77 ? 240 LYS E C    1 
ATOM   7163 O O    . LYS E 1 240 ? 78.201  -1.235  30.259 1.00 26.10 ? 240 LYS E O    1 
ATOM   7164 C CB   . LYS E 1 240 ? 80.493  -3.046  30.403 1.00 16.84 ? 240 LYS E CB   1 
ATOM   7165 C CG   . LYS E 1 240 ? 81.886  -3.570  30.169 1.00 22.75 ? 240 LYS E CG   1 
ATOM   7166 C CD   . LYS E 1 240 ? 81.934  -5.086  30.087 1.00 25.05 ? 240 LYS E CD   1 
ATOM   7167 C CE   . LYS E 1 240 ? 83.361  -5.565  30.243 1.00 22.08 ? 240 LYS E CE   1 
ATOM   7168 N NZ   . LYS E 1 240 ? 84.251  -4.839  29.289 1.00 30.12 ? 240 LYS E NZ   1 
ATOM   7169 H H    . LYS E 1 240 ? 81.028  -1.143  28.752 1.00 0.00  ? 240 LYS E H    1 
ATOM   7170 H HZ1  . LYS E 1 240 ? 84.221  -3.811  29.435 1.00 0.00  ? 240 LYS E HZ1  1 
ATOM   7171 H HZ2  . LYS E 1 240 ? 85.234  -5.172  29.368 1.00 0.00  ? 240 LYS E HZ2  1 
ATOM   7172 H HZ3  . LYS E 1 240 ? 83.912  -5.046  28.330 1.00 0.00  ? 240 LYS E HZ3  1 
ATOM   7173 N N    . ILE E 1 241 ? 77.284  -2.879  29.024 1.00 29.28 ? 241 ILE E N    1 
ATOM   7174 C CA   . ILE E 1 241 ? 75.911  -2.535  29.367 1.00 23.86 ? 241 ILE E CA   1 
ATOM   7175 C C    . ILE E 1 241 ? 75.765  -3.225  30.720 1.00 26.88 ? 241 ILE E C    1 
ATOM   7176 O O    . ILE E 1 241 ? 75.420  -4.409  30.794 1.00 29.47 ? 241 ILE E O    1 
ATOM   7177 C CB   . ILE E 1 241 ? 74.910  -3.142  28.357 1.00 18.45 ? 241 ILE E CB   1 
ATOM   7178 C CG1  . ILE E 1 241 ? 75.223  -2.664  26.946 1.00 12.75 ? 241 ILE E CG1  1 
ATOM   7179 C CG2  . ILE E 1 241 ? 73.500  -2.739  28.697 1.00 15.53 ? 241 ILE E CG2  1 
ATOM   7180 C CD1  . ILE E 1 241 ? 74.356  -3.321  25.915 1.00 19.48 ? 241 ILE E CD1  1 
ATOM   7181 H H    . ILE E 1 241 ? 77.455  -3.632  28.423 1.00 0.00  ? 241 ILE E H    1 
ATOM   7182 N N    . ALA E 1 242 ? 76.141  -2.503  31.768 1.00 27.92 ? 242 ALA E N    1 
ATOM   7183 C CA   . ALA E 1 242 ? 76.111  -2.999  33.134 1.00 29.60 ? 242 ALA E CA   1 
ATOM   7184 C C    . ALA E 1 242 ? 75.042  -4.029  33.412 1.00 34.66 ? 242 ALA E C    1 
ATOM   7185 O O    . ALA E 1 242 ? 73.867  -3.792  33.141 1.00 38.02 ? 242 ALA E O    1 
ATOM   7186 C CB   . ALA E 1 242 ? 75.974  -1.846  34.101 1.00 34.16 ? 242 ALA E CB   1 
ATOM   7187 H H    . ALA E 1 242 ? 76.443  -1.583  31.605 1.00 0.00  ? 242 ALA E H    1 
ATOM   7188 N N    . ASP E 1 243 ? 75.487  -5.193  33.888 1.00 38.10 ? 243 ASP E N    1 
ATOM   7189 C CA   . ASP E 1 243 ? 74.628  -6.319  34.265 1.00 46.37 ? 243 ASP E CA   1 
ATOM   7190 C C    . ASP E 1 243 ? 73.874  -7.047  33.144 1.00 44.06 ? 243 ASP E C    1 
ATOM   7191 O O    . ASP E 1 243 ? 73.363  -8.149  33.347 1.00 46.54 ? 243 ASP E O    1 
ATOM   7192 C CB   . ASP E 1 243 ? 73.651  -5.902  35.382 1.00 55.24 ? 243 ASP E CB   1 
ATOM   7193 C CG   . ASP E 1 243 ? 74.364  -5.388  36.639 1.00 62.31 ? 243 ASP E CG   1 
ATOM   7194 O OD1  . ASP E 1 243 ? 75.359  -6.016  37.071 1.00 64.49 ? 243 ASP E OD1  1 
ATOM   7195 O OD2  . ASP E 1 243 ? 73.923  -4.355  37.196 1.00 62.99 ? 243 ASP E OD2  1 
ATOM   7196 H H    . ASP E 1 243 ? 76.455  -5.310  33.976 1.00 0.00  ? 243 ASP E H    1 
ATOM   7197 N N    . MET E 1 244 ? 73.777  -6.432  31.974 1.00 41.69 ? 244 MET E N    1 
ATOM   7198 C CA   . MET E 1 244 ? 73.089  -7.065  30.859 1.00 32.50 ? 244 MET E CA   1 
ATOM   7199 C C    . MET E 1 244 ? 74.090  -7.887  30.071 1.00 31.87 ? 244 MET E C    1 
ATOM   7200 O O    . MET E 1 244 ? 73.936  -9.096  29.923 1.00 33.00 ? 244 MET E O    1 
ATOM   7201 C CB   . MET E 1 244 ? 72.463  -6.013  29.944 1.00 31.84 ? 244 MET E CB   1 
ATOM   7202 C CG   . MET E 1 244 ? 71.086  -5.593  30.349 1.00 27.36 ? 244 MET E CG   1 
ATOM   7203 S SD   . MET E 1 244 ? 70.078  -7.045  30.451 1.00 33.23 ? 244 MET E SD   1 
ATOM   7204 C CE   . MET E 1 244 ? 69.687  -7.288  28.807 1.00 33.03 ? 244 MET E CE   1 
ATOM   7205 H H    . MET E 1 244 ? 74.161  -5.540  31.857 1.00 0.00  ? 244 MET E H    1 
ATOM   7206 N N    . GLY E 1 245 ? 75.116  -7.208  29.572 1.00 26.34 ? 245 GLY E N    1 
ATOM   7207 C CA   . GLY E 1 245 ? 76.143  -7.849  28.779 1.00 18.36 ? 245 GLY E CA   1 
ATOM   7208 C C    . GLY E 1 245 ? 77.108  -6.770  28.337 1.00 16.80 ? 245 GLY E C    1 
ATOM   7209 O O    . GLY E 1 245 ? 77.788  -6.164  29.167 1.00 15.16 ? 245 GLY E O    1 
ATOM   7210 H H    . GLY E 1 245 ? 75.203  -6.245  29.745 1.00 0.00  ? 245 GLY E H    1 
ATOM   7211 N N    . HIS E 1 246 ? 77.120  -6.469  27.044 1.00 14.55 ? 246 HIS E N    1 
ATOM   7212 C CA   . HIS E 1 246 ? 78.015  -5.452  26.519 1.00 14.88 ? 246 HIS E CA   1 
ATOM   7213 C C    . HIS E 1 246 ? 77.653  -5.129  25.088 1.00 18.37 ? 246 HIS E C    1 
ATOM   7214 O O    . HIS E 1 246 ? 76.817  -5.806  24.488 1.00 21.84 ? 246 HIS E O    1 
ATOM   7215 C CB   . HIS E 1 246 ? 79.458  -5.960  26.537 1.00 18.39 ? 246 HIS E CB   1 
ATOM   7216 C CG   . HIS E 1 246 ? 79.698  -7.128  25.629 1.00 18.81 ? 246 HIS E CG   1 
ATOM   7217 N ND1  . HIS E 1 246 ? 80.106  -8.357  26.098 1.00 21.18 ? 246 HIS E ND1  1 
ATOM   7218 C CD2  . HIS E 1 246 ? 79.565  -7.260  24.288 1.00 19.29 ? 246 HIS E CD2  1 
ATOM   7219 C CE1  . HIS E 1 246 ? 80.212  -9.197  25.083 1.00 20.13 ? 246 HIS E CE1  1 
ATOM   7220 N NE2  . HIS E 1 246 ? 79.892  -8.558  23.976 1.00 19.00 ? 246 HIS E NE2  1 
ATOM   7221 H H    . HIS E 1 246 ? 76.512  -6.921  26.418 1.00 0.00  ? 246 HIS E H    1 
ATOM   7222 H HD1  . HIS E 1 246 ? 80.314  -8.577  27.025 1.00 0.00  ? 246 HIS E HD1  1 
ATOM   7223 H HE2  . HIS E 1 246 ? 79.905  -8.930  23.076 1.00 0.00  ? 246 HIS E HE2  1 
ATOM   7224 N N    . LEU E 1 247 ? 78.364  -4.148  24.537 1.00 15.21 ? 247 LEU E N    1 
ATOM   7225 C CA   . LEU E 1 247 ? 78.207  -3.701  23.165 1.00 9.54  ? 247 LEU E CA   1 
ATOM   7226 C C    . LEU E 1 247 ? 79.616  -3.379  22.664 1.00 16.44 ? 247 LEU E C    1 
ATOM   7227 O O    . LEU E 1 247 ? 80.288  -2.504  23.218 1.00 20.14 ? 247 LEU E O    1 
ATOM   7228 C CB   . LEU E 1 247 ? 77.323  -2.461  23.123 1.00 6.17  ? 247 LEU E CB   1 
ATOM   7229 C CG   . LEU E 1 247 ? 77.097  -1.757  21.792 1.00 5.67  ? 247 LEU E CG   1 
ATOM   7230 C CD1  . LEU E 1 247 ? 76.834  -2.744  20.685 1.00 6.83  ? 247 LEU E CD1  1 
ATOM   7231 C CD2  . LEU E 1 247 ? 75.927  -0.810  21.945 1.00 15.84 ? 247 LEU E CD2  1 
ATOM   7232 H H    . LEU E 1 247 ? 79.031  -3.669  25.074 1.00 0.00  ? 247 LEU E H    1 
ATOM   7233 N N    . LYS E 1 248 ? 80.093  -4.139  21.679 1.00 15.64 ? 248 LYS E N    1 
ATOM   7234 C CA   . LYS E 1 248 ? 81.430  -3.929  21.128 1.00 13.34 ? 248 LYS E CA   1 
ATOM   7235 C C    . LYS E 1 248 ? 81.409  -3.402  19.701 1.00 13.82 ? 248 LYS E C    1 
ATOM   7236 O O    . LYS E 1 248 ? 80.591  -3.820  18.888 1.00 18.20 ? 248 LYS E O    1 
ATOM   7237 C CB   . LYS E 1 248 ? 82.239  -5.225  21.149 1.00 10.76 ? 248 LYS E CB   1 
ATOM   7238 C CG   . LYS E 1 248 ? 82.369  -5.861  22.502 1.00 12.36 ? 248 LYS E CG   1 
ATOM   7239 C CD   . LYS E 1 248 ? 83.201  -7.118  22.412 1.00 15.26 ? 248 LYS E CD   1 
ATOM   7240 C CE   . LYS E 1 248 ? 83.272  -7.825  23.751 1.00 16.98 ? 248 LYS E CE   1 
ATOM   7241 N NZ   . LYS E 1 248 ? 84.144  -9.024  23.670 1.00 19.96 ? 248 LYS E NZ   1 
ATOM   7242 H H    . LYS E 1 248 ? 79.541  -4.854  21.309 1.00 0.00  ? 248 LYS E H    1 
ATOM   7243 H HZ1  . LYS E 1 248 ? 83.770  -9.665  22.940 1.00 0.00  ? 248 LYS E HZ1  1 
ATOM   7244 H HZ2  . LYS E 1 248 ? 85.103  -8.723  23.406 1.00 0.00  ? 248 LYS E HZ2  1 
ATOM   7245 H HZ3  . LYS E 1 248 ? 84.159  -9.511  24.589 1.00 0.00  ? 248 LYS E HZ3  1 
ATOM   7246 N N    . TYR E 1 249 ? 82.345  -2.506  19.405 1.00 14.99 ? 249 TYR E N    1 
ATOM   7247 C CA   . TYR E 1 249 ? 82.494  -1.912  18.088 1.00 6.76  ? 249 TYR E CA   1 
ATOM   7248 C C    . TYR E 1 249 ? 83.908  -2.188  17.627 1.00 10.19 ? 249 TYR E C    1 
ATOM   7249 O O    . TYR E 1 249 ? 84.855  -1.862  18.340 1.00 16.02 ? 249 TYR E O    1 
ATOM   7250 C CB   . TYR E 1 249 ? 82.354  -0.404  18.176 1.00 10.11 ? 249 TYR E CB   1 
ATOM   7251 C CG   . TYR E 1 249 ? 81.012  0.103   18.633 1.00 12.00 ? 249 TYR E CG   1 
ATOM   7252 C CD1  . TYR E 1 249 ? 80.000  0.373   17.708 1.00 7.80  ? 249 TYR E CD1  1 
ATOM   7253 C CD2  . TYR E 1 249 ? 80.772  0.371   19.977 1.00 3.23  ? 249 TYR E CD2  1 
ATOM   7254 C CE1  . TYR E 1 249 ? 78.788  0.897   18.110 1.00 10.74 ? 249 TYR E CE1  1 
ATOM   7255 C CE2  . TYR E 1 249 ? 79.558  0.894   20.388 1.00 9.91  ? 249 TYR E CE2  1 
ATOM   7256 C CZ   . TYR E 1 249 ? 78.570  1.156   19.450 1.00 6.51  ? 249 TYR E CZ   1 
ATOM   7257 O OH   . TYR E 1 249 ? 77.360  1.671   19.849 1.00 5.54  ? 249 TYR E OH   1 
ATOM   7258 H H    . TYR E 1 249 ? 82.980  -2.220  20.095 1.00 0.00  ? 249 TYR E H    1 
ATOM   7259 H HH   . TYR E 1 249 ? 76.846  1.951   19.077 1.00 0.00  ? 249 TYR E HH   1 
ATOM   7260 N N    . TYR E 1 250 ? 84.064  -2.803  16.461 1.00 11.35 ? 250 TYR E N    1 
ATOM   7261 C CA   . TYR E 1 250 ? 85.388  -3.076  15.916 1.00 7.15  ? 250 TYR E CA   1 
ATOM   7262 C C    . TYR E 1 250 ? 85.567  -2.122  14.754 1.00 12.05 ? 250 TYR E C    1 
ATOM   7263 O O    . TYR E 1 250 ? 84.623  -1.895  13.995 1.00 17.10 ? 250 TYR E O    1 
ATOM   7264 C CB   . TYR E 1 250 ? 85.496  -4.502  15.381 1.00 6.06  ? 250 TYR E CB   1 
ATOM   7265 C CG   . TYR E 1 250 ? 85.374  -5.595  16.408 1.00 3.55  ? 250 TYR E CG   1 
ATOM   7266 C CD1  . TYR E 1 250 ? 84.139  -5.926  16.970 1.00 7.77  ? 250 TYR E CD1  1 
ATOM   7267 C CD2  . TYR E 1 250 ? 86.480  -6.324  16.787 1.00 4.26  ? 250 TYR E CD2  1 
ATOM   7268 C CE1  . TYR E 1 250 ? 84.017  -6.968  17.887 1.00 5.70  ? 250 TYR E CE1  1 
ATOM   7269 C CE2  . TYR E 1 250 ? 86.373  -7.363  17.698 1.00 12.19 ? 250 TYR E CE2  1 
ATOM   7270 C CZ   . TYR E 1 250 ? 85.142  -7.683  18.243 1.00 12.45 ? 250 TYR E CZ   1 
ATOM   7271 O OH   . TYR E 1 250 ? 85.063  -8.733  19.133 1.00 20.00 ? 250 TYR E OH   1 
ATOM   7272 H H    . TYR E 1 250 ? 83.289  -3.058  15.949 1.00 0.00  ? 250 TYR E H    1 
ATOM   7273 H HH   . TYR E 1 250 ? 84.170  -9.103  19.162 1.00 0.00  ? 250 TYR E HH   1 
ATOM   7274 N N    . LEU E 1 251 ? 86.771  -1.579  14.608 1.00 15.14 ? 251 LEU E N    1 
ATOM   7275 C CA   . LEU E 1 251 ? 87.078  -0.653  13.523 1.00 15.04 ? 251 LEU E CA   1 
ATOM   7276 C C    . LEU E 1 251 ? 88.410  -1.042  12.890 1.00 21.08 ? 251 LEU E C    1 
ATOM   7277 O O    . LEU E 1 251 ? 89.448  -1.046  13.561 1.00 22.06 ? 251 LEU E O    1 
ATOM   7278 C CB   . LEU E 1 251 ? 87.140  0.789   14.041 1.00 14.31 ? 251 LEU E CB   1 
ATOM   7279 C CG   . LEU E 1 251 ? 87.613  1.883   13.072 1.00 15.58 ? 251 LEU E CG   1 
ATOM   7280 C CD1  . LEU E 1 251 ? 86.828  1.841   11.773 1.00 10.36 ? 251 LEU E CD1  1 
ATOM   7281 C CD2  . LEU E 1 251 ? 87.496  3.245   13.732 1.00 13.36 ? 251 LEU E CD2  1 
ATOM   7282 H H    . LEU E 1 251 ? 87.470  -1.819  15.252 1.00 0.00  ? 251 LEU E H    1 
ATOM   7283 N N    . ALA E 1 252 ? 88.359  -1.407  11.607 1.00 20.32 ? 252 ALA E N    1 
ATOM   7284 C CA   . ALA E 1 252 ? 89.533  -1.812  10.852 1.00 10.73 ? 252 ALA E CA   1 
ATOM   7285 C C    . ALA E 1 252 ? 90.488  -0.629  10.771 1.00 15.35 ? 252 ALA E C    1 
ATOM   7286 O O    . ALA E 1 252 ? 90.070  0.508   10.542 1.00 13.46 ? 252 ALA E O    1 
ATOM   7287 C CB   . ALA E 1 252 ? 89.124  -2.262  9.459  1.00 17.61 ? 252 ALA E CB   1 
ATOM   7288 H H    . ALA E 1 252 ? 87.480  -1.390  11.160 1.00 0.00  ? 252 ALA E H    1 
ATOM   7289 N N    . PRO E 1 253 ? 91.782  -0.869  10.952 1.00 15.80 ? 253 PRO E N    1 
ATOM   7290 C CA   . PRO E 1 253 ? 92.829  0.140   10.929 1.00 16.74 ? 253 PRO E CA   1 
ATOM   7291 C C    . PRO E 1 253 ? 93.153  0.613   9.532  1.00 19.14 ? 253 PRO E C    1 
ATOM   7292 O O    . PRO E 1 253 ? 92.678  0.050   8.529  1.00 16.92 ? 253 PRO E O    1 
ATOM   7293 C CB   . PRO E 1 253 ? 94.021  -0.580  11.541 1.00 17.33 ? 253 PRO E CB   1 
ATOM   7294 C CG   . PRO E 1 253 ? 93.837  -1.973  11.032 1.00 19.15 ? 253 PRO E CG   1 
ATOM   7295 C CD   . PRO E 1 253 ? 92.362  -2.211  11.215 1.00 15.51 ? 253 PRO E CD   1 
ATOM   7296 N N    . LYS E 1 254 ? 93.960  1.654   9.465  1.00 16.62 ? 254 LYS E N    1 
ATOM   7297 C CA   . LYS E 1 254 ? 94.378  2.156   8.168  1.00 22.39 ? 254 LYS E CA   1 
ATOM   7298 C C    . LYS E 1 254 ? 95.771  1.651   7.869  1.00 32.68 ? 254 LYS E C    1 
ATOM   7299 O O    . LYS E 1 254 ? 96.675  1.780   8.696  1.00 27.80 ? 254 LYS E O    1 
ATOM   7300 C CB   . LYS E 1 254 ? 94.287  3.683   8.105  1.00 16.61 ? 254 LYS E CB   1 
ATOM   7301 C CG   . LYS E 1 254 ? 92.855  4.171   8.194  1.00 10.65 ? 254 LYS E CG   1 
ATOM   7302 C CD   . LYS E 1 254 ? 92.761  5.670   8.355  1.00 9.99  ? 254 LYS E CD   1 
ATOM   7303 C CE   . LYS E 1 254 ? 93.127  6.392   7.081  1.00 15.04 ? 254 LYS E CE   1 
ATOM   7304 N NZ   . LYS E 1 254 ? 92.087  6.213   6.027  1.00 13.22 ? 254 LYS E NZ   1 
ATOM   7305 H H    . LYS E 1 254 ? 94.270  2.085   10.280 1.00 0.00  ? 254 LYS E H    1 
ATOM   7306 H HZ1  . LYS E 1 254 ? 91.169  6.548   6.376  1.00 0.00  ? 254 LYS E HZ1  1 
ATOM   7307 H HZ2  . LYS E 1 254 ? 92.374  6.767   5.202  1.00 0.00  ? 254 LYS E HZ2  1 
ATOM   7308 H HZ3  . LYS E 1 254 ? 92.028  5.207   5.781  1.00 0.00  ? 254 LYS E HZ3  1 
ATOM   7309 N N    . ILE E 1 255 ? 95.894  0.955   6.736  1.00 43.95 ? 255 ILE E N    1 
ATOM   7310 C CA   . ILE E 1 255 ? 97.161  0.356   6.272  1.00 48.15 ? 255 ILE E CA   1 
ATOM   7311 C C    . ILE E 1 255 ? 97.476  -0.927  6.996  1.00 50.86 ? 255 ILE E C    1 
ATOM   7312 O O    . ILE E 1 255 ? 98.523  -1.530  6.755  1.00 59.54 ? 255 ILE E O    1 
ATOM   7313 C CB   . ILE E 1 255 ? 98.310  1.331   6.410  1.00 47.15 ? 255 ILE E CB   1 
ATOM   7314 H H    . ILE E 1 255 ? 95.096  0.768   6.210  1.00 0.00  ? 255 ILE E H    1 
ATOM   7315 N N    . ARG F 2 5   ? 95.436  3.923   3.359  1.00 46.22 ? 143 ARG F N    1 
ATOM   7316 C CA   . ARG F 2 5   ? 94.440  3.014   2.795  1.00 44.52 ? 143 ARG F CA   1 
ATOM   7317 C C    . ARG F 2 5   ? 93.581  2.361   3.874  1.00 41.28 ? 143 ARG F C    1 
ATOM   7318 O O    . ARG F 2 5   ? 94.095  1.802   4.846  1.00 37.56 ? 143 ARG F O    1 
ATOM   7319 C CB   . ARG F 2 5   ? 95.112  1.947   1.946  1.00 41.74 ? 143 ARG F CB   1 
ATOM   7320 H H    . ARG F 2 5   ? 96.222  3.548   3.794  1.00 0.00  ? 143 ARG F H    1 
ATOM   7321 N N    . GLN F 2 6   ? 92.268  2.456   3.700  1.00 36.21 ? 144 GLN F N    1 
ATOM   7322 C CA   . GLN F 2 6   ? 91.318  1.883   4.642  1.00 35.89 ? 144 GLN F CA   1 
ATOM   7323 C C    . GLN F 2 6   ? 91.090  0.405   4.367  1.00 36.68 ? 144 GLN F C    1 
ATOM   7324 O O    . GLN F 2 6   ? 90.722  0.013   3.253  1.00 38.96 ? 144 GLN F O    1 
ATOM   7325 C CB   . GLN F 2 6   ? 89.982  2.623   4.561  1.00 37.35 ? 144 GLN F CB   1 
ATOM   7326 C CG   . GLN F 2 6   ? 88.901  2.080   5.474  1.00 32.39 ? 144 GLN F CG   1 
ATOM   7327 C CD   . GLN F 2 6   ? 89.241  2.252   6.931  1.00 31.08 ? 144 GLN F CD   1 
ATOM   7328 O OE1  . GLN F 2 6   ? 89.252  3.371   7.450  1.00 33.79 ? 144 GLN F OE1  1 
ATOM   7329 N NE2  . GLN F 2 6   ? 89.503  1.145   7.610  1.00 30.65 ? 144 GLN F NE2  1 
ATOM   7330 H H    . GLN F 2 6   ? 91.919  2.923   2.916  1.00 0.00  ? 144 GLN F H    1 
ATOM   7331 H HE21 . GLN F 2 6   ? 89.729  1.218   8.559  1.00 0.00  ? 144 GLN F HE21 1 
ATOM   7332 H HE22 . GLN F 2 6   ? 89.451  0.286   7.151  1.00 0.00  ? 144 GLN F HE22 1 
ATOM   7333 N N    . THR F 2 7   ? 91.327  -0.415  5.382  1.00 32.26 ? 145 THR F N    1 
ATOM   7334 C CA   . THR F 2 7   ? 91.117  -1.851  5.263  1.00 23.00 ? 145 THR F CA   1 
ATOM   7335 C C    . THR F 2 7   ? 89.666  -2.123  5.674  1.00 23.68 ? 145 THR F C    1 
ATOM   7336 O O    . THR F 2 7   ? 88.985  -1.221  6.173  1.00 26.76 ? 145 THR F O    1 
ATOM   7337 C CB   . THR F 2 7   ? 92.061  -2.608  6.196  1.00 15.46 ? 145 THR F CB   1 
ATOM   7338 O OG1  . THR F 2 7   ? 91.743  -2.276  7.547  1.00 22.89 ? 145 THR F OG1  1 
ATOM   7339 C CG2  . THR F 2 7   ? 93.504  -2.216  5.934  1.00 10.24 ? 145 THR F CG2  1 
ATOM   7340 H H    . THR F 2 7   ? 91.650  -0.043  6.227  1.00 0.00  ? 145 THR F H    1 
ATOM   7341 H HG1  . THR F 2 7   ? 91.906  -1.340  7.689  1.00 0.00  ? 145 THR F HG1  1 
ATOM   7342 N N    . SER F 2 8   ? 89.174  -3.335  5.438  1.00 22.27 ? 146 SER F N    1 
ATOM   7343 C CA   . SER F 2 8   ? 87.809  -3.675  5.832  1.00 16.52 ? 146 SER F CA   1 
ATOM   7344 C C    . SER F 2 8   ? 87.889  -4.856  6.785  1.00 19.64 ? 146 SER F C    1 
ATOM   7345 O O    . SER F 2 8   ? 88.818  -5.662  6.698  1.00 18.26 ? 146 SER F O    1 
ATOM   7346 C CB   . SER F 2 8   ? 86.933  -4.009  4.619  1.00 22.42 ? 146 SER F CB   1 
ATOM   7347 O OG   . SER F 2 8   ? 87.390  -5.157  3.920  1.00 22.72 ? 146 SER F OG   1 
ATOM   7348 H H    . SER F 2 8   ? 89.724  -4.030  5.039  1.00 0.00  ? 146 SER F H    1 
ATOM   7349 H HG   . SER F 2 8   ? 88.267  -4.985  3.575  1.00 0.00  ? 146 SER F HG   1 
ATOM   7350 N N    . MET F 2 9   ? 86.923  -4.949  7.693  1.00 19.59 ? 147 MET F N    1 
ATOM   7351 C CA   . MET F 2 9   ? 86.873  -6.011  8.688  1.00 17.94 ? 147 MET F CA   1 
ATOM   7352 C C    . MET F 2 9   ? 87.041  -7.405  8.088  1.00 20.50 ? 147 MET F C    1 
ATOM   7353 O O    . MET F 2 9   ? 87.652  -8.293  8.690  1.00 24.56 ? 147 MET F O    1 
ATOM   7354 C CB   . MET F 2 9   ? 85.545  -5.950  9.450  1.00 17.07 ? 147 MET F CB   1 
ATOM   7355 C CG   . MET F 2 9   ? 85.391  -4.799  10.428 1.00 12.51 ? 147 MET F CG   1 
ATOM   7356 S SD   . MET F 2 9   ? 86.520  -4.924  11.803 1.00 14.02 ? 147 MET F SD   1 
ATOM   7357 C CE   . MET F 2 9   ? 86.176  -6.606  12.375 1.00 11.47 ? 147 MET F CE   1 
ATOM   7358 H H    . MET F 2 9   ? 86.214  -4.275  7.678  1.00 0.00  ? 147 MET F H    1 
ATOM   7359 N N    . THR F 2 10  ? 86.508  -7.591  6.891  1.00 19.70 ? 148 THR F N    1 
ATOM   7360 C CA   . THR F 2 10  ? 86.579  -8.876  6.222  1.00 21.96 ? 148 THR F CA   1 
ATOM   7361 C C    . THR F 2 10  ? 87.994  -9.300  5.818  1.00 21.69 ? 148 THR F C    1 
ATOM   7362 O O    . THR F 2 10  ? 88.227  -10.455 5.471  1.00 29.55 ? 148 THR F O    1 
ATOM   7363 C CB   . THR F 2 10  ? 85.625  -8.897  5.017  1.00 24.93 ? 148 THR F CB   1 
ATOM   7364 O OG1  . THR F 2 10  ? 85.654  -7.622  4.360  1.00 26.20 ? 148 THR F OG1  1 
ATOM   7365 C CG2  . THR F 2 10  ? 84.194  -9.193  5.478  1.00 25.51 ? 148 THR F CG2  1 
ATOM   7366 H H    . THR F 2 10  ? 86.055  -6.871  6.402  1.00 0.00  ? 148 THR F H    1 
ATOM   7367 H HG1  . THR F 2 10  ? 86.410  -7.583  3.763  1.00 0.00  ? 148 THR F HG1  1 
ATOM   7368 N N    . ASP F 2 11  ? 88.936  -8.368  5.874  1.00 18.42 ? 149 ASP F N    1 
ATOM   7369 C CA   . ASP F 2 11  ? 90.319  -8.652  5.534  1.00 11.72 ? 149 ASP F CA   1 
ATOM   7370 C C    . ASP F 2 11  ? 91.007  -9.361  6.688  1.00 11.56 ? 149 ASP F C    1 
ATOM   7371 O O    . ASP F 2 11  ? 92.105  -9.873  6.529  1.00 18.31 ? 149 ASP F O    1 
ATOM   7372 C CB   . ASP F 2 11  ? 91.090  -7.351  5.286  1.00 13.72 ? 149 ASP F CB   1 
ATOM   7373 C CG   . ASP F 2 11  ? 90.695  -6.651  4.004  1.00 18.39 ? 149 ASP F CG   1 
ATOM   7374 O OD1  . ASP F 2 11  ? 90.158  -7.289  3.076  1.00 17.34 ? 149 ASP F OD1  1 
ATOM   7375 O OD2  . ASP F 2 11  ? 90.960  -5.437  3.915  1.00 25.22 ? 149 ASP F OD2  1 
ATOM   7376 H H    . ASP F 2 11  ? 88.696  -7.471  6.166  1.00 0.00  ? 149 ASP F H    1 
ATOM   7377 N N    . PHE F 2 12  ? 90.402  -9.322  7.871  1.00 19.51 ? 150 PHE F N    1 
ATOM   7378 C CA   . PHE F 2 12  ? 91.011  -9.929  9.055  1.00 17.88 ? 150 PHE F CA   1 
ATOM   7379 C C    . PHE F 2 12  ? 90.334  -11.197 9.583  1.00 21.99 ? 150 PHE F C    1 
ATOM   7380 O O    . PHE F 2 12  ? 91.009  -12.066 10.145 1.00 18.47 ? 150 PHE F O    1 
ATOM   7381 C CB   . PHE F 2 12  ? 91.097  -8.905  10.195 1.00 12.89 ? 150 PHE F CB   1 
ATOM   7382 C CG   . PHE F 2 12  ? 91.687  -7.573  9.791  1.00 16.38 ? 150 PHE F CG   1 
ATOM   7383 C CD1  . PHE F 2 12  ? 90.913  -6.623  9.131  1.00 17.12 ? 150 PHE F CD1  1 
ATOM   7384 C CD2  . PHE F 2 12  ? 93.002  -7.252  10.101 1.00 19.14 ? 150 PHE F CD2  1 
ATOM   7385 C CE1  . PHE F 2 12  ? 91.436  -5.382  8.791  1.00 12.53 ? 150 PHE F CE1  1 
ATOM   7386 C CE2  . PHE F 2 12  ? 93.532  -6.005  9.762  1.00 18.19 ? 150 PHE F CE2  1 
ATOM   7387 C CZ   . PHE F 2 12  ? 92.745  -5.074  9.106  1.00 12.49 ? 150 PHE F CZ   1 
ATOM   7388 H H    . PHE F 2 12  ? 89.538  -8.874  7.965  1.00 0.00  ? 150 PHE F H    1 
ATOM   7389 N N    . TYR F 2 13  ? 89.010  -11.290 9.449  1.00 23.59 ? 151 TYR F N    1 
ATOM   7390 C CA   . TYR F 2 13  ? 88.279  -12.459 9.947  1.00 24.39 ? 151 TYR F CA   1 
ATOM   7391 C C    . TYR F 2 13  ? 87.517  -13.254 8.894  1.00 28.15 ? 151 TYR F C    1 
ATOM   7392 O O    . TYR F 2 13  ? 87.222  -12.766 7.802  1.00 31.78 ? 151 TYR F O    1 
ATOM   7393 C CB   . TYR F 2 13  ? 87.337  -12.070 11.091 1.00 14.84 ? 151 TYR F CB   1 
ATOM   7394 C CG   . TYR F 2 13  ? 88.047  -11.370 12.214 1.00 14.26 ? 151 TYR F CG   1 
ATOM   7395 C CD1  . TYR F 2 13  ? 89.093  -11.986 12.888 1.00 15.81 ? 151 TYR F CD1  1 
ATOM   7396 C CD2  . TYR F 2 13  ? 87.717  -10.064 12.566 1.00 20.34 ? 151 TYR F CD2  1 
ATOM   7397 C CE1  . TYR F 2 13  ? 89.798  -11.321 13.880 1.00 20.78 ? 151 TYR F CE1  1 
ATOM   7398 C CE2  . TYR F 2 13  ? 88.415  -9.386  13.561 1.00 21.17 ? 151 TYR F CE2  1 
ATOM   7399 C CZ   . TYR F 2 13  ? 89.456  -10.020 14.212 1.00 22.33 ? 151 TYR F CZ   1 
ATOM   7400 O OH   . TYR F 2 13  ? 90.161  -9.359  15.189 1.00 26.81 ? 151 TYR F OH   1 
ATOM   7401 H H    . TYR F 2 13  ? 88.510  -10.584 8.991  1.00 0.00  ? 151 TYR F H    1 
ATOM   7402 H HH   . TYR F 2 13  ? 89.676  -8.580  15.496 1.00 0.00  ? 151 TYR F HH   1 
ATOM   7403 N N    . HIS F 2 14  ? 87.220  -14.500 9.241  1.00 33.40 ? 152 HIS F N    1 
ATOM   7404 C CA   . HIS F 2 14  ? 86.501  -15.410 8.359  1.00 35.82 ? 152 HIS F CA   1 
ATOM   7405 C C    . HIS F 2 14  ? 85.038  -14.979 8.311  1.00 34.90 ? 152 HIS F C    1 
ATOM   7406 O O    . HIS F 2 14  ? 84.463  -14.622 9.339  1.00 32.07 ? 152 HIS F O    1 
ATOM   7407 C CB   . HIS F 2 14  ? 86.615  -16.840 8.902  1.00 40.04 ? 152 HIS F CB   1 
ATOM   7408 C CG   . HIS F 2 14  ? 85.995  -17.873 8.019  1.00 44.11 ? 152 HIS F CG   1 
ATOM   7409 N ND1  . HIS F 2 14  ? 84.806  -18.506 8.344  1.00 44.05 ? 152 HIS F ND1  1 
ATOM   7410 C CD2  . HIS F 2 14  ? 86.378  -18.378 6.829  1.00 47.35 ? 152 HIS F CD2  1 
ATOM   7411 C CE1  . HIS F 2 14  ? 84.493  -19.353 7.376  1.00 49.34 ? 152 HIS F CE1  1 
ATOM   7412 N NE2  . HIS F 2 14  ? 85.425  -19.294 6.448  1.00 50.72 ? 152 HIS F NE2  1 
ATOM   7413 H H    . HIS F 2 14  ? 87.481  -14.805 10.132 1.00 0.00  ? 152 HIS F H    1 
ATOM   7414 H HD1  . HIS F 2 14  ? 84.257  -18.299 9.119  1.00 0.00  ? 152 HIS F HD1  1 
ATOM   7415 H HE2  . HIS F 2 14  ? 85.430  -19.794 5.604  1.00 0.00  ? 152 HIS F HE2  1 
ATOM   7416 N N    . SER F 2 15  ? 84.453  -14.974 7.120  1.00 27.28 ? 153 SER F N    1 
ATOM   7417 C CA   . SER F 2 15  ? 83.064  -14.592 6.968  1.00 27.22 ? 153 SER F CA   1 
ATOM   7418 C C    . SER F 2 15  ? 82.213  -15.772 6.507  1.00 30.46 ? 153 SER F C    1 
ATOM   7419 O O    . SER F 2 15  ? 82.653  -16.621 5.722  1.00 28.48 ? 153 SER F O    1 
ATOM   7420 C CB   . SER F 2 15  ? 82.940  -13.441 5.968  1.00 25.69 ? 153 SER F CB   1 
ATOM   7421 O OG   . SER F 2 15  ? 83.481  -13.802 4.716  1.00 36.36 ? 153 SER F OG   1 
ATOM   7422 H H    . SER F 2 15  ? 84.920  -15.237 6.299  1.00 0.00  ? 153 SER F H    1 
ATOM   7423 H HG   . SER F 2 15  ? 83.955  -13.077 4.287  1.00 0.00  ? 153 SER F HG   1 
ATOM   7424 N N    . LYS F 2 16  ? 81.000  -15.829 7.037  1.00 33.63 ? 154 LYS F N    1 
ATOM   7425 C CA   . LYS F 2 16  ? 80.039  -16.855 6.695  1.00 34.94 ? 154 LYS F CA   1 
ATOM   7426 C C    . LYS F 2 16  ? 78.733  -16.095 6.465  1.00 34.33 ? 154 LYS F C    1 
ATOM   7427 O O    . LYS F 2 16  ? 78.336  -15.248 7.275  1.00 37.72 ? 154 LYS F O    1 
ATOM   7428 C CB   . LYS F 2 16  ? 79.892  -17.851 7.845  1.00 41.06 ? 154 LYS F CB   1 
ATOM   7429 C CG   . LYS F 2 16  ? 79.073  -19.079 7.495  1.00 49.65 ? 154 LYS F CG   1 
ATOM   7430 C CD   . LYS F 2 16  ? 78.968  -20.033 8.677  1.00 54.82 ? 154 LYS F CD   1 
ATOM   7431 C CE   . LYS F 2 16  ? 79.031  -21.482 8.213  1.00 56.04 ? 154 LYS F CE   1 
ATOM   7432 N NZ   . LYS F 2 16  ? 78.979  -22.441 9.349  1.00 58.03 ? 154 LYS F NZ   1 
ATOM   7433 H H    . LYS F 2 16  ? 80.724  -15.187 7.709  1.00 0.00  ? 154 LYS F H    1 
ATOM   7434 H HZ1  . LYS F 2 16  ? 79.735  -22.234 10.034 1.00 0.00  ? 154 LYS F HZ1  1 
ATOM   7435 H HZ2  . LYS F 2 16  ? 78.042  -22.379 9.790  1.00 0.00  ? 154 LYS F HZ2  1 
ATOM   7436 H HZ3  . LYS F 2 16  ? 79.126  -23.389 8.949  1.00 0.00  ? 154 LYS F HZ3  1 
ATOM   7437 N N    . ARG F 2 17  ? 78.098  -16.356 5.334  1.00 29.00 ? 155 ARG F N    1 
ATOM   7438 C CA   . ARG F 2 17  ? 76.855  -15.688 4.991  1.00 30.93 ? 155 ARG F CA   1 
ATOM   7439 C C    . ARG F 2 17  ? 75.622  -16.447 5.504  1.00 34.05 ? 155 ARG F C    1 
ATOM   7440 O O    . ARG F 2 17  ? 75.602  -17.680 5.519  1.00 30.04 ? 155 ARG F O    1 
ATOM   7441 C CB   . ARG F 2 17  ? 76.802  -15.493 3.477  1.00 30.52 ? 155 ARG F CB   1 
ATOM   7442 C CG   . ARG F 2 17  ? 75.581  -14.776 2.971  1.00 33.04 ? 155 ARG F CG   1 
ATOM   7443 C CD   . ARG F 2 17  ? 75.758  -14.384 1.521  1.00 35.78 ? 155 ARG F CD   1 
ATOM   7444 N NE   . ARG F 2 17  ? 76.815  -13.393 1.344  1.00 36.42 ? 155 ARG F NE   1 
ATOM   7445 C CZ   . ARG F 2 17  ? 76.726  -12.121 1.727  1.00 42.19 ? 155 ARG F CZ   1 
ATOM   7446 N NH1  . ARG F 2 17  ? 75.626  -11.661 2.314  1.00 42.38 ? 155 ARG F NH1  1 
ATOM   7447 N NH2  . ARG F 2 17  ? 77.748  -11.303 1.534  1.00 44.67 ? 155 ARG F NH2  1 
ATOM   7448 H H    . ARG F 2 17  ? 78.470  -17.018 4.719  1.00 0.00  ? 155 ARG F H    1 
ATOM   7449 H HE   . ARG F 2 17  ? 77.642  -13.691 0.908  1.00 0.00  ? 155 ARG F HE   1 
ATOM   7450 H HH11 . ARG F 2 17  ? 74.853  -12.272 2.478  1.00 0.00  ? 155 ARG F HH11 1 
ATOM   7451 H HH12 . ARG F 2 17  ? 75.584  -10.706 2.603  1.00 0.00  ? 155 ARG F HH12 1 
ATOM   7452 H HH21 . ARG F 2 17  ? 78.581  -11.651 1.100  1.00 0.00  ? 155 ARG F HH21 1 
ATOM   7453 H HH22 . ARG F 2 17  ? 77.696  -10.348 1.824  1.00 0.00  ? 155 ARG F HH22 1 
ATOM   7454 N N    . ARG F 2 18  ? 74.605  -15.698 5.927  1.00 36.15 ? 156 ARG F N    1 
ATOM   7455 C CA   . ARG F 2 18  ? 73.354  -16.251 6.448  1.00 34.42 ? 156 ARG F CA   1 
ATOM   7456 C C    . ARG F 2 18  ? 72.148  -15.586 5.780  1.00 31.07 ? 156 ARG F C    1 
ATOM   7457 O O    . ARG F 2 18  ? 72.117  -14.371 5.602  1.00 34.76 ? 156 ARG F O    1 
ATOM   7458 C CB   . ARG F 2 18  ? 73.262  -16.014 7.959  1.00 34.85 ? 156 ARG F CB   1 
ATOM   7459 C CG   . ARG F 2 18  ? 74.434  -16.542 8.777  1.00 36.94 ? 156 ARG F CG   1 
ATOM   7460 C CD   . ARG F 2 18  ? 74.305  -16.114 10.231 1.00 34.48 ? 156 ARG F CD   1 
ATOM   7461 N NE   . ARG F 2 18  ? 73.026  -16.523 10.805 1.00 28.95 ? 156 ARG F NE   1 
ATOM   7462 C CZ   . ARG F 2 18  ? 72.512  -16.030 11.930 1.00 29.39 ? 156 ARG F CZ   1 
ATOM   7463 N NH1  . ARG F 2 18  ? 73.158  -15.098 12.619 1.00 24.89 ? 156 ARG F NH1  1 
ATOM   7464 N NH2  . ARG F 2 18  ? 71.347  -16.480 12.374 1.00 30.46 ? 156 ARG F NH2  1 
ATOM   7465 H H    . ARG F 2 18  ? 74.656  -14.748 5.876  1.00 0.00  ? 156 ARG F H    1 
ATOM   7466 H HE   . ARG F 2 18  ? 72.500  -17.195 10.323 1.00 0.00  ? 156 ARG F HE   1 
ATOM   7467 H HH11 . ARG F 2 18  ? 74.041  -14.758 12.300 1.00 0.00  ? 156 ARG F HH11 1 
ATOM   7468 H HH12 . ARG F 2 18  ? 72.759  -14.737 13.461 1.00 0.00  ? 156 ARG F HH12 1 
ATOM   7469 H HH21 . ARG F 2 18  ? 70.858  -17.181 11.854 1.00 0.00  ? 156 ARG F HH21 1 
ATOM   7470 H HH22 . ARG F 2 18  ? 70.944  -16.114 13.208 1.00 0.00  ? 156 ARG F HH22 1 
ATOM   7471 N N    . LEU F 2 19  ? 71.147  -16.385 5.435  1.00 31.21 ? 157 LEU F N    1 
ATOM   7472 C CA   . LEU F 2 19  ? 69.929  -15.877 4.811  1.00 36.17 ? 157 LEU F CA   1 
ATOM   7473 C C    . LEU F 2 19  ? 68.783  -15.908 5.813  1.00 37.02 ? 157 LEU F C    1 
ATOM   7474 O O    . LEU F 2 19  ? 68.241  -16.977 6.114  1.00 41.93 ? 157 LEU F O    1 
ATOM   7475 C CB   . LEU F 2 19  ? 69.558  -16.730 3.602  1.00 40.38 ? 157 LEU F CB   1 
ATOM   7476 C CG   . LEU F 2 19  ? 70.207  -16.335 2.285  1.00 44.32 ? 157 LEU F CG   1 
ATOM   7477 C CD1  . LEU F 2 19  ? 70.072  -17.466 1.284  1.00 46.97 ? 157 LEU F CD1  1 
ATOM   7478 C CD2  . LEU F 2 19  ? 69.547  -15.068 1.775  1.00 49.05 ? 157 LEU F CD2  1 
ATOM   7479 H H    . LEU F 2 19  ? 71.208  -17.341 5.627  1.00 0.00  ? 157 LEU F H    1 
ATOM   7480 N N    . ILE F 2 20  ? 68.414  -14.742 6.329  1.00 30.67 ? 158 ILE F N    1 
ATOM   7481 C CA   . ILE F 2 20  ? 67.335  -14.652 7.303  1.00 28.40 ? 158 ILE F CA   1 
ATOM   7482 C C    . ILE F 2 20  ? 65.961  -14.521 6.630  1.00 34.05 ? 158 ILE F C    1 
ATOM   7483 O O    . ILE F 2 20  ? 65.750  -13.655 5.779  1.00 31.75 ? 158 ILE F O    1 
ATOM   7484 C CB   . ILE F 2 20  ? 67.547  -13.462 8.252  1.00 20.29 ? 158 ILE F CB   1 
ATOM   7485 C CG1  . ILE F 2 20  ? 69.002  -13.414 8.714  1.00 17.16 ? 158 ILE F CG1  1 
ATOM   7486 C CG2  . ILE F 2 20  ? 66.617  -13.570 9.436  1.00 16.27 ? 158 ILE F CG2  1 
ATOM   7487 C CD1  . ILE F 2 20  ? 69.493  -14.691 9.335  1.00 22.55 ? 158 ILE F CD1  1 
ATOM   7488 H H    . ILE F 2 20  ? 68.861  -13.934 6.034  1.00 0.00  ? 158 ILE F H    1 
ATOM   7489 N N    . PHE F 2 21  ? 65.048  -15.420 6.977  1.00 35.67 ? 159 PHE F N    1 
ATOM   7490 C CA   . PHE F 2 21  ? 63.706  -15.379 6.424  1.00 38.36 ? 159 PHE F CA   1 
ATOM   7491 C C    . PHE F 2 21  ? 62.763  -15.176 7.591  1.00 44.38 ? 159 PHE F C    1 
ATOM   7492 O O    . PHE F 2 21  ? 62.554  -16.081 8.397  1.00 47.37 ? 159 PHE F O    1 
ATOM   7493 C CB   . PHE F 2 21  ? 63.377  -16.672 5.671  1.00 32.78 ? 159 PHE F CB   1 
ATOM   7494 C CG   . PHE F 2 21  ? 64.187  -16.862 4.420  1.00 29.27 ? 159 PHE F CG   1 
ATOM   7495 C CD1  . PHE F 2 21  ? 63.825  -16.220 3.236  1.00 24.30 ? 159 PHE F CD1  1 
ATOM   7496 C CD2  . PHE F 2 21  ? 65.332  -17.653 4.429  1.00 29.30 ? 159 PHE F CD2  1 
ATOM   7497 C CE1  . PHE F 2 21  ? 64.588  -16.357 2.079  1.00 17.75 ? 159 PHE F CE1  1 
ATOM   7498 C CE2  . PHE F 2 21  ? 66.106  -17.800 3.273  1.00 27.89 ? 159 PHE F CE2  1 
ATOM   7499 C CZ   . PHE F 2 21  ? 65.729  -17.147 2.095  1.00 23.27 ? 159 PHE F CZ   1 
ATOM   7500 H H    . PHE F 2 21  ? 65.254  -16.122 7.628  1.00 0.00  ? 159 PHE F H    1 
ATOM   7501 N N    . SER F 2 22  ? 62.253  -13.959 7.716  1.00 49.74 ? 160 SER F N    1 
ATOM   7502 C CA   . SER F 2 22  ? 61.340  -13.621 8.798  1.00 52.98 ? 160 SER F CA   1 
ATOM   7503 C C    . SER F 2 22  ? 60.084  -12.974 8.223  1.00 55.18 ? 160 SER F C    1 
ATOM   7504 O O    . SER F 2 22  ? 60.111  -12.413 7.122  1.00 55.61 ? 160 SER F O    1 
ATOM   7505 C CB   . SER F 2 22  ? 62.024  -12.663 9.780  1.00 52.60 ? 160 SER F CB   1 
ATOM   7506 O OG   . SER F 2 22  ? 63.262  -13.177 10.245 1.00 45.11 ? 160 SER F OG   1 
ATOM   7507 H H    . SER F 2 22  ? 62.467  -13.255 7.072  1.00 0.00  ? 160 SER F H    1 
ATOM   7508 H HG   . SER F 2 22  ? 63.131  -13.921 10.858 1.00 0.00  ? 160 SER F HG   1 
HETATM 7509 O O    . HOH G 3 .   ? 33.824  14.352  17.455 1.00 15.21 ? 262 HOH A O    1 
HETATM 7510 H H1   . HOH G 3 .   ? 33.964  15.291  17.297 1.00 0.00  ? 262 HOH A H1   1 
HETATM 7511 H H2   . HOH G 3 .   ? 33.752  13.980  16.578 1.00 0.00  ? 262 HOH A H2   1 
HETATM 7512 O O    . HOH G 3 .   ? 41.476  14.404  10.279 1.00 11.75 ? 263 HOH A O    1 
HETATM 7513 H H1   . HOH G 3 .   ? 41.669  14.540  9.344  1.00 0.00  ? 263 HOH A H1   1 
HETATM 7514 H H2   . HOH G 3 .   ? 40.593  14.771  10.378 1.00 0.00  ? 263 HOH A H2   1 
HETATM 7515 O O    . HOH G 3 .   ? 38.815  35.001  11.289 1.00 6.65  ? 264 HOH A O    1 
HETATM 7516 H H1   . HOH G 3 .   ? 37.879  34.992  11.534 1.00 0.00  ? 264 HOH A H1   1 
HETATM 7517 H H2   . HOH G 3 .   ? 39.095  34.169  11.685 1.00 0.00  ? 264 HOH A H2   1 
HETATM 7518 O O    . HOH G 3 .   ? 48.611  54.122  21.037 1.00 30.64 ? 265 HOH A O    1 
HETATM 7519 H H1   . HOH G 3 .   ? 48.050  53.350  20.926 1.00 0.00  ? 265 HOH A H1   1 
HETATM 7520 H H2   . HOH G 3 .   ? 48.016  54.850  20.881 1.00 0.00  ? 265 HOH A H2   1 
HETATM 7521 O O    . HOH G 3 .   ? 51.910  42.274  7.619  1.00 28.98 ? 266 HOH A O    1 
HETATM 7522 H H1   . HOH G 3 .   ? 51.851  43.055  7.065  1.00 0.00  ? 266 HOH A H1   1 
HETATM 7523 H H2   . HOH G 3 .   ? 52.563  42.514  8.277  1.00 0.00  ? 266 HOH A H2   1 
HETATM 7524 O O    . HOH G 3 .   ? 37.217  35.656  14.451 1.00 9.08  ? 267 HOH A O    1 
HETATM 7525 H H1   . HOH G 3 .   ? 37.830  36.043  15.085 1.00 0.00  ? 267 HOH A H1   1 
HETATM 7526 H H2   . HOH G 3 .   ? 36.560  35.212  14.978 1.00 0.00  ? 267 HOH A H2   1 
HETATM 7527 O O    . HOH G 3 .   ? 35.239  26.892  28.682 1.00 21.03 ? 268 HOH A O    1 
HETATM 7528 H H1   . HOH G 3 .   ? 34.536  26.273  28.896 1.00 0.00  ? 268 HOH A H1   1 
HETATM 7529 H H2   . HOH G 3 .   ? 35.803  26.398  28.086 1.00 0.00  ? 268 HOH A H2   1 
HETATM 7530 O O    . HOH G 3 .   ? 33.216  37.463  29.402 1.00 26.76 ? 269 HOH A O    1 
HETATM 7531 H H1   . HOH G 3 .   ? 33.829  38.166  29.187 1.00 0.00  ? 269 HOH A H1   1 
HETATM 7532 H H2   . HOH G 3 .   ? 33.297  37.298  30.336 1.00 0.00  ? 269 HOH A H2   1 
HETATM 7533 O O    . HOH G 3 .   ? 48.427  18.679  24.576 1.00 39.29 ? 270 HOH A O    1 
HETATM 7534 H H1   . HOH G 3 .   ? 47.890  17.895  24.706 1.00 0.00  ? 270 HOH A H1   1 
HETATM 7535 H H2   . HOH G 3 .   ? 49.260  18.439  25.010 1.00 0.00  ? 270 HOH A H2   1 
HETATM 7536 O O    . HOH G 3 .   ? 48.573  52.034  17.339 1.00 31.50 ? 271 HOH A O    1 
HETATM 7537 H H1   . HOH G 3 .   ? 48.150  51.656  18.120 1.00 0.00  ? 271 HOH A H1   1 
HETATM 7538 H H2   . HOH G 3 .   ? 49.331  52.477  17.735 1.00 0.00  ? 271 HOH A H2   1 
HETATM 7539 O O    . HOH G 3 .   ? 32.447  21.941  23.139 1.00 40.20 ? 272 HOH A O    1 
HETATM 7540 H H1   . HOH G 3 .   ? 32.225  21.492  22.318 1.00 0.00  ? 272 HOH A H1   1 
HETATM 7541 H H2   . HOH G 3 .   ? 32.139  21.330  23.815 1.00 0.00  ? 272 HOH A H2   1 
HETATM 7542 O O    . HOH G 3 .   ? 29.331  22.704  22.297 1.00 40.84 ? 273 HOH A O    1 
HETATM 7543 H H1   . HOH G 3 .   ? 29.743  22.290  23.061 1.00 0.00  ? 273 HOH A H1   1 
HETATM 7544 H H2   . HOH G 3 .   ? 29.979  23.382  22.035 1.00 0.00  ? 273 HOH A H2   1 
HETATM 7545 O O    . HOH G 3 .   ? 46.830  -1.543  16.361 1.00 57.59 ? 274 HOH A O    1 
HETATM 7546 H H1   . HOH G 3 .   ? 47.184  -0.661  16.510 1.00 0.00  ? 274 HOH A H1   1 
HETATM 7547 H H2   . HOH G 3 .   ? 47.580  -2.014  15.974 1.00 0.00  ? 274 HOH A H2   1 
HETATM 7548 O O    . HOH G 3 .   ? 45.346  54.541  21.023 1.00 5.73  ? 275 HOH A O    1 
HETATM 7549 H H1   . HOH G 3 .   ? 45.028  55.092  20.308 1.00 0.00  ? 275 HOH A H1   1 
HETATM 7550 H H2   . HOH G 3 .   ? 44.543  54.238  21.454 1.00 0.00  ? 275 HOH A H2   1 
HETATM 7551 O O    . HOH G 3 .   ? 60.119  44.352  23.535 1.00 22.59 ? 276 HOH A O    1 
HETATM 7552 H H1   . HOH G 3 .   ? 60.086  43.518  23.055 1.00 0.00  ? 276 HOH A H1   1 
HETATM 7553 H H2   . HOH G 3 .   ? 60.200  44.014  24.435 1.00 0.00  ? 276 HOH A H2   1 
HETATM 7554 O O    . HOH G 3 .   ? 61.267  35.543  27.975 1.00 20.81 ? 277 HOH A O    1 
HETATM 7555 H H1   . HOH G 3 .   ? 60.806  36.117  27.343 1.00 0.00  ? 277 HOH A H1   1 
HETATM 7556 H H2   . HOH G 3 .   ? 62.176  35.852  27.930 1.00 0.00  ? 277 HOH A H2   1 
HETATM 7557 O O    . HOH G 3 .   ? 59.749  39.708  31.735 1.00 40.60 ? 278 HOH A O    1 
HETATM 7558 H H1   . HOH G 3 .   ? 59.381  40.491  31.321 1.00 0.00  ? 278 HOH A H1   1 
HETATM 7559 H H2   . HOH G 3 .   ? 60.376  40.068  32.367 1.00 0.00  ? 278 HOH A H2   1 
HETATM 7560 O O    . HOH G 3 .   ? 59.594  46.049  27.784 1.00 5.44  ? 279 HOH A O    1 
HETATM 7561 H H1   . HOH G 3 .   ? 59.521  45.957  28.734 1.00 0.00  ? 279 HOH A H1   1 
HETATM 7562 H H2   . HOH G 3 .   ? 58.811  46.545  27.549 1.00 0.00  ? 279 HOH A H2   1 
HETATM 7563 O O    . HOH G 3 .   ? 48.626  41.878  10.900 1.00 27.37 ? 280 HOH A O    1 
HETATM 7564 H H1   . HOH G 3 .   ? 49.431  41.974  11.416 1.00 0.00  ? 280 HOH A H1   1 
HETATM 7565 H H2   . HOH G 3 .   ? 48.481  42.782  10.593 1.00 0.00  ? 280 HOH A H2   1 
HETATM 7566 O O    . HOH G 3 .   ? 29.513  13.493  27.405 1.00 14.70 ? 281 HOH A O    1 
HETATM 7567 H H1   . HOH G 3 .   ? 30.021  12.681  27.325 1.00 0.00  ? 281 HOH A H1   1 
HETATM 7568 H H2   . HOH G 3 .   ? 29.124  13.616  26.541 1.00 0.00  ? 281 HOH A H2   1 
HETATM 7569 O O    . HOH G 3 .   ? 46.558  52.323  19.064 1.00 47.29 ? 282 HOH A O    1 
HETATM 7570 H H1   . HOH G 3 .   ? 46.718  52.336  18.116 1.00 0.00  ? 282 HOH A H1   1 
HETATM 7571 H H2   . HOH G 3 .   ? 46.246  51.423  19.240 1.00 0.00  ? 282 HOH A H2   1 
HETATM 7572 O O    . HOH G 3 .   ? 63.281  43.676  24.036 1.00 16.53 ? 283 HOH A O    1 
HETATM 7573 H H1   . HOH G 3 .   ? 62.361  43.764  24.287 1.00 0.00  ? 283 HOH A H1   1 
HETATM 7574 H H2   . HOH G 3 .   ? 63.301  42.920  23.452 1.00 0.00  ? 283 HOH A H2   1 
HETATM 7575 O O    . HOH G 3 .   ? 32.778  26.901  18.928 1.00 10.73 ? 284 HOH A O    1 
HETATM 7576 H H1   . HOH G 3 .   ? 32.005  26.820  18.363 1.00 0.00  ? 284 HOH A H1   1 
HETATM 7577 H H2   . HOH G 3 .   ? 32.790  27.851  19.068 1.00 0.00  ? 284 HOH A H2   1 
HETATM 7578 O O    . HOH G 3 .   ? 59.866  35.069  25.355 1.00 25.86 ? 285 HOH A O    1 
HETATM 7579 H H1   . HOH G 3 .   ? 59.945  34.268  25.871 1.00 0.00  ? 285 HOH A H1   1 
HETATM 7580 H H2   . HOH G 3 .   ? 60.153  34.827  24.471 1.00 0.00  ? 285 HOH A H2   1 
HETATM 7581 O O    . HOH G 3 .   ? 36.608  18.918  24.597 1.00 19.18 ? 286 HOH A O    1 
HETATM 7582 H H1   . HOH G 3 .   ? 36.349  18.805  23.678 1.00 0.00  ? 286 HOH A H1   1 
HETATM 7583 H H2   . HOH G 3 .   ? 37.462  19.357  24.488 1.00 0.00  ? 286 HOH A H2   1 
HETATM 7584 O O    . HOH G 3 .   ? 51.698  12.389  10.103 1.00 18.79 ? 287 HOH A O    1 
HETATM 7585 H H1   . HOH G 3 .   ? 51.631  11.601  10.651 1.00 0.00  ? 287 HOH A H1   1 
HETATM 7586 H H2   . HOH G 3 .   ? 51.670  12.038  9.213  1.00 0.00  ? 287 HOH A H2   1 
HETATM 7587 O O    . HOH G 3 .   ? 44.642  52.254  17.072 1.00 13.40 ? 288 HOH A O    1 
HETATM 7588 H H1   . HOH G 3 .   ? 44.544  53.039  17.606 1.00 0.00  ? 288 HOH A H1   1 
HETATM 7589 H H2   . HOH G 3 .   ? 45.401  52.429  16.515 1.00 0.00  ? 288 HOH A H2   1 
HETATM 7590 O O    . HOH G 3 .   ? 29.981  25.189  22.645 1.00 34.28 ? 289 HOH A O    1 
HETATM 7591 H H1   . HOH G 3 .   ? 29.742  26.092  22.853 1.00 0.00  ? 289 HOH A H1   1 
HETATM 7592 H H2   . HOH G 3 .   ? 29.361  24.650  23.145 1.00 0.00  ? 289 HOH A H2   1 
HETATM 7593 O O    . HOH G 3 .   ? 42.251  30.372  6.266  1.00 54.39 ? 290 HOH A O    1 
HETATM 7594 H H1   . HOH G 3 .   ? 42.270  29.916  5.420  1.00 0.00  ? 290 HOH A H1   1 
HETATM 7595 H H2   . HOH G 3 .   ? 41.984  29.682  6.893  1.00 0.00  ? 290 HOH A H2   1 
HETATM 7596 O O    . HOH G 3 .   ? 52.307  16.473  20.300 1.00 8.05  ? 291 HOH A O    1 
HETATM 7597 H H1   . HOH G 3 .   ? 52.918  15.738  20.387 1.00 0.00  ? 291 HOH A H1   1 
HETATM 7598 H H2   . HOH G 3 .   ? 52.629  16.856  19.480 1.00 0.00  ? 291 HOH A H2   1 
HETATM 7599 O O    . HOH G 3 .   ? 31.881  45.653  15.213 1.00 44.67 ? 292 HOH A O    1 
HETATM 7600 H H1   . HOH G 3 .   ? 32.432  44.873  15.160 1.00 0.00  ? 292 HOH A H1   1 
HETATM 7601 H H2   . HOH G 3 .   ? 32.418  46.285  15.705 1.00 0.00  ? 292 HOH A H2   1 
HETATM 7602 O O    . HOH G 3 .   ? 24.799  13.022  24.492 1.00 30.79 ? 293 HOH A O    1 
HETATM 7603 H H1   . HOH G 3 .   ? 24.447  13.591  25.175 1.00 0.00  ? 293 HOH A H1   1 
HETATM 7604 H H2   . HOH G 3 .   ? 25.306  13.603  23.920 1.00 0.00  ? 293 HOH A H2   1 
HETATM 7605 O O    . HOH G 3 .   ? 51.216  27.686  23.643 1.00 7.91  ? 294 HOH A O    1 
HETATM 7606 H H1   . HOH G 3 .   ? 51.287  26.946  23.030 1.00 0.00  ? 294 HOH A H1   1 
HETATM 7607 H H2   . HOH G 3 .   ? 50.878  28.395  23.096 1.00 0.00  ? 294 HOH A H2   1 
HETATM 7608 O O    . HOH G 3 .   ? 48.827  12.916  8.826  1.00 29.36 ? 295 HOH A O    1 
HETATM 7609 H H1   . HOH G 3 .   ? 49.208  13.590  8.256  1.00 0.00  ? 295 HOH A H1   1 
HETATM 7610 H H2   . HOH G 3 .   ? 49.337  12.131  8.608  1.00 0.00  ? 295 HOH A H2   1 
HETATM 7611 O O    . HOH G 3 .   ? 27.740  15.675  19.662 1.00 27.87 ? 296 HOH A O    1 
HETATM 7612 H H1   . HOH G 3 .   ? 27.666  16.584  19.339 1.00 0.00  ? 296 HOH A H1   1 
HETATM 7613 H H2   . HOH G 3 .   ? 27.153  15.652  20.428 1.00 0.00  ? 296 HOH A H2   1 
HETATM 7614 O O    . HOH G 3 .   ? 35.777  29.264  29.395 1.00 25.26 ? 297 HOH A O    1 
HETATM 7615 H H1   . HOH G 3 .   ? 35.100  28.638  29.114 1.00 0.00  ? 297 HOH A H1   1 
HETATM 7616 H H2   . HOH G 3 .   ? 36.566  28.796  29.118 1.00 0.00  ? 297 HOH A H2   1 
HETATM 7617 O O    . HOH G 3 .   ? 55.867  15.253  23.006 1.00 26.30 ? 298 HOH A O    1 
HETATM 7618 H H1   . HOH G 3 .   ? 55.031  15.056  22.576 1.00 0.00  ? 298 HOH A H1   1 
HETATM 7619 H H2   . HOH G 3 .   ? 55.913  16.213  23.014 1.00 0.00  ? 298 HOH A H2   1 
HETATM 7620 O O    . HOH G 3 .   ? 54.831  15.806  25.877 1.00 43.99 ? 299 HOH A O    1 
HETATM 7621 H H1   . HOH G 3 .   ? 54.851  15.620  24.933 1.00 0.00  ? 299 HOH A H1   1 
HETATM 7622 H H2   . HOH G 3 .   ? 53.994  15.438  26.173 1.00 0.00  ? 299 HOH A H2   1 
HETATM 7623 O O    . HOH G 3 .   ? 54.128  34.353  20.827 1.00 12.57 ? 300 HOH A O    1 
HETATM 7624 H H1   . HOH G 3 .   ? 54.735  34.119  20.129 1.00 0.00  ? 300 HOH A H1   1 
HETATM 7625 H H2   . HOH G 3 .   ? 53.669  33.556  21.086 1.00 0.00  ? 300 HOH A H2   1 
HETATM 7626 O O    . HOH G 3 .   ? 32.626  31.590  18.635 1.00 39.40 ? 301 HOH A O    1 
HETATM 7627 H H1   . HOH G 3 .   ? 32.367  32.485  18.864 1.00 0.00  ? 301 HOH A H1   1 
HETATM 7628 H H2   . HOH G 3 .   ? 33.204  31.346  19.363 1.00 0.00  ? 301 HOH A H2   1 
HETATM 7629 O O    . HOH G 3 .   ? 31.177  42.590  17.701 1.00 5.82  ? 302 HOH A O    1 
HETATM 7630 H H1   . HOH G 3 .   ? 32.007  42.754  18.158 1.00 0.00  ? 302 HOH A H1   1 
HETATM 7631 H H2   . HOH G 3 .   ? 30.541  43.013  18.291 1.00 0.00  ? 302 HOH A H2   1 
HETATM 7632 O O    . HOH G 3 .   ? 36.075  50.738  21.104 1.00 67.26 ? 303 HOH A O    1 
HETATM 7633 H H1   . HOH G 3 .   ? 35.831  49.793  21.178 1.00 0.00  ? 303 HOH A H1   1 
HETATM 7634 H H2   . HOH G 3 .   ? 35.979  50.811  20.144 1.00 0.00  ? 303 HOH A H2   1 
HETATM 7635 O O    . HOH G 3 .   ? 35.355  21.156  24.327 1.00 20.54 ? 304 HOH A O    1 
HETATM 7636 H H1   . HOH G 3 .   ? 35.377  20.371  24.885 1.00 0.00  ? 304 HOH A H1   1 
HETATM 7637 H H2   . HOH G 3 .   ? 35.694  21.838  24.902 1.00 0.00  ? 304 HOH A H2   1 
HETATM 7638 O O    . HOH G 3 .   ? 31.357  47.101  23.242 1.00 53.65 ? 305 HOH A O    1 
HETATM 7639 H H1   . HOH G 3 .   ? 31.431  47.819  22.604 1.00 0.00  ? 305 HOH A H1   1 
HETATM 7640 H H2   . HOH G 3 .   ? 31.797  47.513  24.003 1.00 0.00  ? 305 HOH A H2   1 
HETATM 7641 O O    . HOH G 3 .   ? 32.343  28.749  17.092 1.00 19.64 ? 306 HOH A O    1 
HETATM 7642 H H1   . HOH G 3 .   ? 31.785  28.996  16.343 1.00 0.00  ? 306 HOH A H1   1 
HETATM 7643 H H2   . HOH G 3 .   ? 33.046  29.404  17.125 1.00 0.00  ? 306 HOH A H2   1 
HETATM 7644 O O    . HOH G 3 .   ? 44.627  18.037  4.291  1.00 44.00 ? 307 HOH A O    1 
HETATM 7645 H H1   . HOH G 3 .   ? 45.062  17.387  4.843  1.00 0.00  ? 307 HOH A H1   1 
HETATM 7646 H H2   . HOH G 3 .   ? 44.605  17.626  3.421  1.00 0.00  ? 307 HOH A H2   1 
HETATM 7647 O O    . HOH G 3 .   ? 50.999  27.653  16.086 1.00 29.29 ? 308 HOH A O    1 
HETATM 7648 H H1   . HOH G 3 .   ? 50.324  27.343  16.697 1.00 0.00  ? 308 HOH A H1   1 
HETATM 7649 H H2   . HOH G 3 .   ? 51.747  27.848  16.671 1.00 0.00  ? 308 HOH A H2   1 
HETATM 7650 O O    . HOH G 3 .   ? 45.989  28.091  7.608  1.00 37.58 ? 309 HOH A O    1 
HETATM 7651 H H1   . HOH G 3 .   ? 46.347  27.796  8.459  1.00 0.00  ? 309 HOH A H1   1 
HETATM 7652 H H2   . HOH G 3 .   ? 45.356  28.771  7.856  1.00 0.00  ? 309 HOH A H2   1 
HETATM 7653 O O    . HOH G 3 .   ? 36.218  8.893   11.591 1.00 34.51 ? 310 HOH A O    1 
HETATM 7654 H H1   . HOH G 3 .   ? 36.333  9.006   10.639 1.00 0.00  ? 310 HOH A H1   1 
HETATM 7655 H H2   . HOH G 3 .   ? 35.400  8.391   11.651 1.00 0.00  ? 310 HOH A H2   1 
HETATM 7656 O O    . HOH G 3 .   ? 36.007  35.060  33.595 1.00 41.70 ? 311 HOH A O    1 
HETATM 7657 H H1   . HOH G 3 .   ? 36.835  35.448  33.877 1.00 0.00  ? 311 HOH A H1   1 
HETATM 7658 H H2   . HOH G 3 .   ? 35.527  35.758  33.158 1.00 0.00  ? 311 HOH A H2   1 
HETATM 7659 O O    . HOH G 3 .   ? 34.317  34.888  16.627 1.00 46.18 ? 312 HOH A O    1 
HETATM 7660 H H1   . HOH G 3 .   ? 34.305  35.714  16.135 1.00 0.00  ? 312 HOH A H1   1 
HETATM 7661 H H2   . HOH G 3 .   ? 33.558  34.406  16.290 1.00 0.00  ? 312 HOH A H2   1 
HETATM 7662 O O    . HOH G 3 .   ? 29.143  30.578  16.239 1.00 42.66 ? 313 HOH A O    1 
HETATM 7663 H H1   . HOH G 3 .   ? 29.350  31.507  16.185 1.00 0.00  ? 313 HOH A H1   1 
HETATM 7664 H H2   . HOH G 3 .   ? 28.852  30.427  17.143 1.00 0.00  ? 313 HOH A H2   1 
HETATM 7665 O O    . HOH G 3 .   ? 52.655  50.974  11.775 1.00 18.26 ? 314 HOH A O    1 
HETATM 7666 H H1   . HOH G 3 .   ? 52.458  51.744  12.308 1.00 0.00  ? 314 HOH A H1   1 
HETATM 7667 H H2   . HOH G 3 .   ? 52.711  50.250  12.408 1.00 0.00  ? 314 HOH A H2   1 
HETATM 7668 O O    . HOH G 3 .   ? 42.406  31.943  8.349  1.00 56.47 ? 315 HOH A O    1 
HETATM 7669 H H1   . HOH G 3 .   ? 43.069  32.532  7.982  1.00 0.00  ? 315 HOH A H1   1 
HETATM 7670 H H2   . HOH G 3 .   ? 42.300  31.287  7.638  1.00 0.00  ? 315 HOH A H2   1 
HETATM 7671 O O    . HOH G 3 .   ? 54.698  17.800  20.192 1.00 42.13 ? 316 HOH A O    1 
HETATM 7672 H H1   . HOH G 3 .   ? 53.924  18.330  19.972 1.00 0.00  ? 316 HOH A H1   1 
HETATM 7673 H H2   . HOH G 3 .   ? 55.402  18.405  19.941 1.00 0.00  ? 316 HOH A H2   1 
HETATM 7674 O O    . HOH G 3 .   ? 38.410  1.915   12.159 1.00 28.66 ? 317 HOH A O    1 
HETATM 7675 H H1   . HOH G 3 .   ? 38.523  2.854   11.977 1.00 0.00  ? 317 HOH A H1   1 
HETATM 7676 H H2   . HOH G 3 .   ? 38.347  1.529   11.283 1.00 0.00  ? 317 HOH A H2   1 
HETATM 7677 O O    . HOH G 3 .   ? 61.924  12.303  19.255 1.00 44.93 ? 318 HOH A O    1 
HETATM 7678 H H1   . HOH G 3 .   ? 62.764  11.868  19.403 1.00 0.00  ? 318 HOH A H1   1 
HETATM 7679 H H2   . HOH G 3 .   ? 62.143  13.094  18.755 1.00 0.00  ? 318 HOH A H2   1 
HETATM 7680 O O    . HOH G 3 .   ? 45.732  53.528  11.909 1.00 48.90 ? 319 HOH A O    1 
HETATM 7681 H H1   . HOH G 3 .   ? 46.278  53.057  12.548 1.00 0.00  ? 319 HOH A H1   1 
HETATM 7682 H H2   . HOH G 3 .   ? 45.769  54.441  12.201 1.00 0.00  ? 319 HOH A H2   1 
HETATM 7683 O O    . HOH G 3 .   ? 41.835  0.104   15.168 1.00 27.72 ? 320 HOH A O    1 
HETATM 7684 H H1   . HOH G 3 .   ? 42.251  -0.460  14.514 1.00 0.00  ? 320 HOH A H1   1 
HETATM 7685 H H2   . HOH G 3 .   ? 40.897  -0.068  15.082 1.00 0.00  ? 320 HOH A H2   1 
HETATM 7686 O O    . HOH G 3 .   ? 33.498  42.300  16.201 1.00 25.45 ? 321 HOH A O    1 
HETATM 7687 H H1   . HOH G 3 .   ? 33.290  41.462  15.788 1.00 0.00  ? 321 HOH A H1   1 
HETATM 7688 H H2   . HOH G 3 .   ? 32.617  42.631  16.431 1.00 0.00  ? 321 HOH A H2   1 
HETATM 7689 O O    . HOH G 3 .   ? 47.476  22.094  27.602 1.00 43.16 ? 322 HOH A O    1 
HETATM 7690 H H1   . HOH G 3 .   ? 48.280  22.566  27.818 1.00 0.00  ? 322 HOH A H1   1 
HETATM 7691 H H2   . HOH G 3 .   ? 47.172  21.795  28.457 1.00 0.00  ? 322 HOH A H2   1 
HETATM 7692 O O    . HOH G 3 .   ? 57.669  28.462  21.165 1.00 45.83 ? 323 HOH A O    1 
HETATM 7693 H H1   . HOH G 3 .   ? 57.616  29.245  21.714 1.00 0.00  ? 323 HOH A H1   1 
HETATM 7694 H H2   . HOH G 3 .   ? 57.249  28.714  20.340 1.00 0.00  ? 323 HOH A H2   1 
HETATM 7695 O O    . HOH G 3 .   ? 47.368  14.632  7.069  1.00 31.91 ? 324 HOH A O    1 
HETATM 7696 H H1   . HOH G 3 .   ? 46.414  14.723  7.112  1.00 0.00  ? 324 HOH A H1   1 
HETATM 7697 H H2   . HOH G 3 .   ? 47.541  13.912  7.690  1.00 0.00  ? 324 HOH A H2   1 
HETATM 7698 O O    . HOH G 3 .   ? 62.399  11.448  16.367 1.00 15.07 ? 325 HOH A O    1 
HETATM 7699 H H1   . HOH G 3 .   ? 62.108  12.262  15.954 1.00 0.00  ? 325 HOH A H1   1 
HETATM 7700 H H2   . HOH G 3 .   ? 63.310  11.597  16.616 1.00 0.00  ? 325 HOH A H2   1 
HETATM 7701 O O    . HOH G 3 .   ? 51.662  43.378  10.780 1.00 38.74 ? 326 HOH A O    1 
HETATM 7702 H H1   . HOH G 3 .   ? 52.178  44.137  11.070 1.00 0.00  ? 326 HOH A H1   1 
HETATM 7703 H H2   . HOH G 3 .   ? 50.779  43.769  10.723 1.00 0.00  ? 326 HOH A H2   1 
HETATM 7704 O O    . HOH G 3 .   ? 63.895  33.485  19.401 1.00 66.90 ? 327 HOH A O    1 
HETATM 7705 H H1   . HOH G 3 .   ? 63.749  34.434  19.566 1.00 0.00  ? 327 HOH A H1   1 
HETATM 7706 H H2   . HOH G 3 .   ? 64.749  33.456  18.973 1.00 0.00  ? 327 HOH A H2   1 
HETATM 7707 O O    . HOH G 3 .   ? 62.596  34.013  16.056 1.00 48.23 ? 328 HOH A O    1 
HETATM 7708 H H1   . HOH G 3 .   ? 63.455  34.432  16.068 1.00 0.00  ? 328 HOH A H1   1 
HETATM 7709 H H2   . HOH G 3 .   ? 62.773  33.092  15.872 1.00 0.00  ? 328 HOH A H2   1 
HETATM 7710 O O    . HOH G 3 .   ? 59.528  11.062  19.642 1.00 47.44 ? 329 HOH A O    1 
HETATM 7711 H H1   . HOH G 3 .   ? 59.882  11.782  19.108 1.00 0.00  ? 329 HOH A H1   1 
HETATM 7712 H H2   . HOH G 3 .   ? 60.326  10.587  19.861 1.00 0.00  ? 329 HOH A H2   1 
HETATM 7713 O O    . HOH G 3 .   ? 51.576  21.701  29.949 1.00 17.16 ? 330 HOH A O    1 
HETATM 7714 H H1   . HOH G 3 .   ? 51.440  21.189  30.744 1.00 0.00  ? 330 HOH A H1   1 
HETATM 7715 H H2   . HOH G 3 .   ? 50.700  22.036  29.727 1.00 0.00  ? 330 HOH A H2   1 
HETATM 7716 O O    . HOH G 3 .   ? 39.549  32.683  9.237  1.00 18.73 ? 331 HOH A O    1 
HETATM 7717 H H1   . HOH G 3 .   ? 40.393  32.369  8.875  1.00 0.00  ? 331 HOH A H1   1 
HETATM 7718 H H2   . HOH G 3 .   ? 39.139  33.091  8.475  1.00 0.00  ? 331 HOH A H2   1 
HETATM 7719 O O    . HOH G 3 .   ? 32.071  19.455  24.735 1.00 66.48 ? 332 HOH A O    1 
HETATM 7720 H H1   . HOH G 3 .   ? 32.517  18.634  24.488 1.00 0.00  ? 332 HOH A H1   1 
HETATM 7721 H H2   . HOH G 3 .   ? 32.708  19.866  25.321 1.00 0.00  ? 332 HOH A H2   1 
HETATM 7722 O O    . HOH G 3 .   ? 54.712  20.526  21.566 1.00 17.86 ? 333 HOH A O    1 
HETATM 7723 H H1   . HOH G 3 .   ? 53.750  20.472  21.537 1.00 0.00  ? 333 HOH A H1   1 
HETATM 7724 H H2   . HOH G 3 .   ? 54.858  21.151  22.281 1.00 0.00  ? 333 HOH A H2   1 
HETATM 7725 O O    . HOH G 3 .   ? 42.597  58.216  21.287 1.00 40.81 ? 334 HOH A O    1 
HETATM 7726 H H1   . HOH G 3 .   ? 42.807  57.285  21.312 1.00 0.00  ? 334 HOH A H1   1 
HETATM 7727 H H2   . HOH G 3 .   ? 42.028  58.310  20.524 1.00 0.00  ? 334 HOH A H2   1 
HETATM 7728 O O    . HOH G 3 .   ? 28.362  8.462   18.930 1.00 19.08 ? 335 HOH A O    1 
HETATM 7729 H H1   . HOH G 3 .   ? 28.331  7.823   18.220 1.00 0.00  ? 335 HOH A H1   1 
HETATM 7730 H H2   . HOH G 3 .   ? 27.626  8.169   19.482 1.00 0.00  ? 335 HOH A H2   1 
HETATM 7731 O O    . HOH G 3 .   ? 44.354  3.886   10.371 1.00 29.83 ? 336 HOH A O    1 
HETATM 7732 H H1   . HOH G 3 .   ? 43.701  3.468   9.808  1.00 0.00  ? 336 HOH A H1   1 
HETATM 7733 H H2   . HOH G 3 .   ? 44.869  3.116   10.686 1.00 0.00  ? 336 HOH A H2   1 
HETATM 7734 O O    . HOH G 3 .   ? 60.320  15.044  18.852 1.00 36.87 ? 337 HOH A O    1 
HETATM 7735 H H1   . HOH G 3 .   ? 60.954  15.762  18.808 1.00 0.00  ? 337 HOH A H1   1 
HETATM 7736 H H2   . HOH G 3 .   ? 60.417  14.693  19.742 1.00 0.00  ? 337 HOH A H2   1 
HETATM 7737 O O    . HOH G 3 .   ? 46.914  4.738   11.031 1.00 35.54 ? 338 HOH A O    1 
HETATM 7738 H H1   . HOH G 3 .   ? 46.548  5.492   11.506 1.00 0.00  ? 338 HOH A H1   1 
HETATM 7739 H H2   . HOH G 3 .   ? 46.122  4.302   10.692 1.00 0.00  ? 338 HOH A H2   1 
HETATM 7740 O O    . HOH G 3 .   ? 59.536  -0.865  6.185  1.00 23.29 ? 339 HOH A O    1 
HETATM 7741 H H1   . HOH G 3 .   ? 58.757  -0.603  6.682  1.00 0.00  ? 339 HOH A H1   1 
HETATM 7742 H H2   . HOH G 3 .   ? 59.150  -1.194  5.371  1.00 0.00  ? 339 HOH A H2   1 
HETATM 7743 O O    . HOH G 3 .   ? 62.932  44.166  36.934 1.00 40.52 ? 340 HOH A O    1 
HETATM 7744 H H1   . HOH G 3 .   ? 62.642  44.640  36.153 1.00 0.00  ? 340 HOH A H1   1 
HETATM 7745 H H2   . HOH G 3 .   ? 62.103  44.031  37.388 1.00 0.00  ? 340 HOH A H2   1 
HETATM 7746 O O    . HOH G 3 .   ? 44.884  1.709   11.762 1.00 23.16 ? 341 HOH A O    1 
HETATM 7747 H H1   . HOH G 3 .   ? 43.977  1.509   11.479 1.00 0.00  ? 341 HOH A H1   1 
HETATM 7748 H H2   . HOH G 3 .   ? 44.730  2.250   12.553 1.00 0.00  ? 341 HOH A H2   1 
HETATM 7749 O O    . HOH G 3 .   ? 53.914  39.278  35.411 1.00 24.15 ? 342 HOH A O    1 
HETATM 7750 H H1   . HOH G 3 .   ? 54.691  39.078  35.928 1.00 0.00  ? 342 HOH A H1   1 
HETATM 7751 H H2   . HOH G 3 .   ? 54.242  39.868  34.723 1.00 0.00  ? 342 HOH A H2   1 
HETATM 7752 O O    . HOH G 3 .   ? 57.208  40.511  38.063 1.00 23.43 ? 343 HOH A O    1 
HETATM 7753 H H1   . HOH G 3 .   ? 58.027  40.281  37.624 1.00 0.00  ? 343 HOH A H1   1 
HETATM 7754 H H2   . HOH G 3 .   ? 56.765  39.671  38.189 1.00 0.00  ? 343 HOH A H2   1 
HETATM 7755 O O    . HOH G 3 .   ? 41.646  4.785   10.462 1.00 41.07 ? 344 HOH A O    1 
HETATM 7756 H H1   . HOH G 3 .   ? 41.524  4.270   9.659  1.00 0.00  ? 344 HOH A H1   1 
HETATM 7757 H H2   . HOH G 3 .   ? 42.606  4.802   10.593 1.00 0.00  ? 344 HOH A H2   1 
HETATM 7758 O O    . HOH G 3 .   ? 39.505  1.763   33.905 1.00 35.90 ? 345 HOH A O    1 
HETATM 7759 H H1   . HOH G 3 .   ? 39.654  2.575   33.425 1.00 0.00  ? 345 HOH A H1   1 
HETATM 7760 H H2   . HOH G 3 .   ? 38.986  1.251   33.286 1.00 0.00  ? 345 HOH A H2   1 
HETATM 7761 O O    . HOH G 3 .   ? 37.067  29.446  0.946  1.00 31.19 ? 346 HOH A O    1 
HETATM 7762 H H1   . HOH G 3 .   ? 36.758  28.975  0.174  1.00 0.00  ? 346 HOH A H1   1 
HETATM 7763 H H2   . HOH G 3 .   ? 36.333  29.408  1.558  1.00 0.00  ? 346 HOH A H2   1 
HETATM 7764 O O    . HOH G 3 .   ? 34.178  9.558   34.823 1.00 44.94 ? 347 HOH A O    1 
HETATM 7765 H H1   . HOH G 3 .   ? 34.414  9.591   35.750 1.00 0.00  ? 347 HOH A H1   1 
HETATM 7766 H H2   . HOH G 3 .   ? 33.368  10.061  34.757 1.00 0.00  ? 347 HOH A H2   1 
HETATM 7767 O O    . HOH G 3 .   ? 42.151  28.580  1.601  1.00 49.17 ? 348 HOH A O    1 
HETATM 7768 H H1   . HOH G 3 .   ? 42.952  29.003  1.902  1.00 0.00  ? 348 HOH A H1   1 
HETATM 7769 H H2   . HOH G 3 .   ? 42.125  27.746  2.074  1.00 0.00  ? 348 HOH A H2   1 
HETATM 7770 O O    . HOH H 3 .   ? 30.574  37.557  15.113 1.00 25.46 ? 25  HOH B O    1 
HETATM 7771 H H1   . HOH H 3 .   ? 30.013  38.322  14.967 1.00 0.00  ? 25  HOH B H1   1 
HETATM 7772 H H2   . HOH H 3 .   ? 31.454  37.926  15.185 1.00 0.00  ? 25  HOH B H2   1 
HETATM 7773 O O    . HOH H 3 .   ? 32.530  19.391  16.918 1.00 15.24 ? 27  HOH B O    1 
HETATM 7774 H H1   . HOH H 3 .   ? 33.055  19.624  17.689 1.00 0.00  ? 27  HOH B H1   1 
HETATM 7775 H H2   . HOH H 3 .   ? 32.944  18.567  16.627 1.00 0.00  ? 27  HOH B H2   1 
HETATM 7776 O O    . HOH H 3 .   ? 43.929  14.793  5.788  1.00 18.34 ? 29  HOH B O    1 
HETATM 7777 H H1   . HOH H 3 .   ? 44.496  15.405  5.324  1.00 0.00  ? 29  HOH B H1   1 
HETATM 7778 H H2   . HOH H 3 .   ? 43.345  15.331  6.333  1.00 0.00  ? 29  HOH B H2   1 
HETATM 7779 O O    . HOH H 3 .   ? 35.887  17.344  2.039  1.00 31.55 ? 54  HOH B O    1 
HETATM 7780 H H1   . HOH H 3 .   ? 35.287  18.041  1.698  1.00 0.00  ? 54  HOH B H1   1 
HETATM 7781 H H2   . HOH H 3 .   ? 36.599  17.389  1.393  1.00 0.00  ? 54  HOH B H2   1 
HETATM 7782 O O    . HOH H 3 .   ? 25.040  33.251  6.335  1.00 32.15 ? 209 HOH B O    1 
HETATM 7783 H H1   . HOH H 3 .   ? 24.131  33.069  6.089  1.00 0.00  ? 209 HOH B H1   1 
HETATM 7784 H H2   . HOH H 3 .   ? 25.041  34.185  6.563  1.00 0.00  ? 209 HOH B H2   1 
HETATM 7785 O O    . HOH H 3 .   ? 25.321  32.453  9.107  1.00 31.32 ? 210 HOH B O    1 
HETATM 7786 H H1   . HOH H 3 .   ? 25.884  31.796  8.694  1.00 0.00  ? 210 HOH B H1   1 
HETATM 7787 H H2   . HOH H 3 .   ? 25.119  33.010  8.354  1.00 0.00  ? 210 HOH B H2   1 
HETATM 7788 O O    . HOH H 3 .   ? 35.896  14.828  1.245  1.00 44.08 ? 271 HOH B O    1 
HETATM 7789 H H1   . HOH H 3 .   ? 35.360  15.528  1.631  1.00 0.00  ? 271 HOH B H1   1 
HETATM 7790 H H2   . HOH H 3 .   ? 36.699  14.912  1.782  1.00 0.00  ? 271 HOH B H2   1 
HETATM 7791 O O    . HOH H 3 .   ? 30.814  18.998  0.813  1.00 31.17 ? 275 HOH B O    1 
HETATM 7792 H H1   . HOH H 3 .   ? 31.373  18.331  1.208  1.00 0.00  ? 275 HOH B H1   1 
HETATM 7793 H H2   . HOH H 3 .   ? 31.037  19.817  1.255  1.00 0.00  ? 275 HOH B H2   1 
HETATM 7794 O O    . HOH H 3 .   ? 33.703  18.424  1.436  1.00 42.30 ? 276 HOH B O    1 
HETATM 7795 H H1   . HOH H 3 .   ? 33.277  18.796  2.198  1.00 0.00  ? 276 HOH B H1   1 
HETATM 7796 H H2   . HOH H 3 .   ? 33.799  17.485  1.643  1.00 0.00  ? 276 HOH B H2   1 
HETATM 7797 O O    . HOH H 3 .   ? 28.322  38.178  6.949  1.00 46.48 ? 278 HOH B O    1 
HETATM 7798 H H1   . HOH H 3 .   ? 28.993  37.679  6.482  1.00 0.00  ? 278 HOH B H1   1 
HETATM 7799 H H2   . HOH H 3 .   ? 28.223  38.965  6.415  1.00 0.00  ? 278 HOH B H2   1 
HETATM 7800 O O    . HOH H 3 .   ? 33.703  13.083  2.020  1.00 32.17 ? 293 HOH B O    1 
HETATM 7801 H H1   . HOH H 3 .   ? 34.247  12.524  2.587  1.00 0.00  ? 293 HOH B H1   1 
HETATM 7802 H H2   . HOH H 3 .   ? 34.367  13.568  1.504  1.00 0.00  ? 293 HOH B H2   1 
HETATM 7803 O O    . HOH I 3 .   ? 63.217  36.154  19.707 1.00 53.42 ? 262 HOH C O    1 
HETATM 7804 H H1   . HOH I 3 .   ? 62.515  36.550  20.229 1.00 0.00  ? 262 HOH C H1   1 
HETATM 7805 H H2   . HOH I 3 .   ? 63.821  36.889  19.569 1.00 0.00  ? 262 HOH C H2   1 
HETATM 7806 O O    . HOH I 3 .   ? 79.207  57.217  17.656 1.00 26.80 ? 263 HOH C O    1 
HETATM 7807 H H1   . HOH I 3 .   ? 79.935  56.613  17.844 1.00 0.00  ? 263 HOH C H1   1 
HETATM 7808 H H2   . HOH I 3 .   ? 79.212  57.254  16.694 1.00 0.00  ? 263 HOH C H2   1 
HETATM 7809 O O    . HOH I 3 .   ? 93.884  42.423  10.954 1.00 5.54  ? 264 HOH C O    1 
HETATM 7810 H H1   . HOH I 3 .   ? 93.016  42.099  10.719 1.00 0.00  ? 264 HOH C H1   1 
HETATM 7811 H H2   . HOH I 3 .   ? 93.723  43.100  11.626 1.00 0.00  ? 264 HOH C H2   1 
HETATM 7812 O O    . HOH I 3 .   ? 105.632 24.600  20.748 1.00 33.05 ? 265 HOH C O    1 
HETATM 7813 H H1   . HOH I 3 .   ? 106.530 24.875  20.558 1.00 0.00  ? 265 HOH C H1   1 
HETATM 7814 H H2   . HOH I 3 .   ? 105.145 25.423  20.701 1.00 0.00  ? 265 HOH C H2   1 
HETATM 7815 O O    . HOH I 3 .   ? 93.949  27.249  7.755  1.00 53.73 ? 266 HOH C O    1 
HETATM 7816 H H1   . HOH I 3 .   ? 94.694  26.912  7.254  1.00 0.00  ? 266 HOH C H1   1 
HETATM 7817 H H2   . HOH I 3 .   ? 93.879  26.620  8.477  1.00 0.00  ? 266 HOH C H2   1 
HETATM 7818 O O    . HOH I 3 .   ? 96.117  43.751  14.590 1.00 17.61 ? 267 HOH C O    1 
HETATM 7819 H H1   . HOH I 3 .   ? 96.952  43.833  15.039 1.00 0.00  ? 267 HOH C H1   1 
HETATM 7820 H H2   . HOH I 3 .   ? 95.993  42.797  14.562 1.00 0.00  ? 267 HOH C H2   1 
HETATM 7821 O O    . HOH I 3 .   ? 89.284  49.693  28.736 1.00 23.13 ? 268 HOH C O    1 
HETATM 7822 H H1   . HOH I 3 .   ? 88.981  50.457  29.236 1.00 0.00  ? 268 HOH C H1   1 
HETATM 7823 H H2   . HOH I 3 .   ? 88.550  49.520  28.147 1.00 0.00  ? 268 HOH C H2   1 
HETATM 7824 O O    . HOH I 3 .   ? 99.574  46.253  29.486 1.00 53.94 ? 269 HOH C O    1 
HETATM 7825 H H1   . HOH I 3 .   ? 99.649  45.340  29.213 1.00 0.00  ? 269 HOH C H1   1 
HETATM 7826 H H2   . HOH I 3 .   ? 99.352  46.241  30.414 1.00 0.00  ? 269 HOH C H2   1 
HETATM 7827 O O    . HOH I 3 .   ? 75.623  42.131  24.690 1.00 25.52 ? 270 HOH C O    1 
HETATM 7828 H H1   . HOH I 3 .   ? 75.400  43.069  24.691 1.00 0.00  ? 270 HOH C H1   1 
HETATM 7829 H H2   . HOH I 3 .   ? 74.921  41.760  25.234 1.00 0.00  ? 270 HOH C H2   1 
HETATM 7830 O O    . HOH I 3 .   ? 104.289 25.507  17.016 1.00 36.83 ? 271 HOH C O    1 
HETATM 7831 H H1   . HOH I 3 .   ? 104.244 26.233  17.641 1.00 0.00  ? 271 HOH C H1   1 
HETATM 7832 H H2   . HOH I 3 .   ? 104.250 24.749  17.614 1.00 0.00  ? 271 HOH C H2   1 
HETATM 7833 O O    . HOH I 3 .   ? 86.375  54.240  22.955 1.00 24.13 ? 272 HOH C O    1 
HETATM 7834 H H1   . HOH I 3 .   ? 85.949  54.914  22.418 1.00 0.00  ? 272 HOH C H1   1 
HETATM 7835 H H2   . HOH I 3 .   ? 86.203  54.525  23.853 1.00 0.00  ? 272 HOH C H2   1 
HETATM 7836 O O    . HOH I 3 .   ? 88.175  56.838  22.136 1.00 20.74 ? 273 HOH C O    1 
HETATM 7837 H H1   . HOH I 3 .   ? 87.719  56.771  22.982 1.00 0.00  ? 273 HOH C H1   1 
HETATM 7838 H H2   . HOH I 3 .   ? 88.614  55.966  22.088 1.00 0.00  ? 273 HOH C H2   1 
HETATM 7839 O O    . HOH I 3 .   ? 59.074  53.633  15.577 1.00 57.69 ? 274 HOH C O    1 
HETATM 7840 H H1   . HOH I 3 .   ? 59.544  52.943  16.052 1.00 0.00  ? 274 HOH C H1   1 
HETATM 7841 H H2   . HOH I 3 .   ? 58.158  53.335  15.626 1.00 0.00  ? 274 HOH C H2   1 
HETATM 7842 O O    . HOH I 3 .   ? 107.750 26.834  20.815 1.00 14.63 ? 275 HOH C O    1 
HETATM 7843 H H1   . HOH I 3 .   ? 107.024 27.441  20.634 1.00 0.00  ? 275 HOH C H1   1 
HETATM 7844 H H2   . HOH I 3 .   ? 108.522 27.382  20.728 1.00 0.00  ? 275 HOH C H2   1 
HETATM 7845 O O    . HOH I 3 .   ? 91.900  19.517  23.497 1.00 34.16 ? 276 HOH C O    1 
HETATM 7846 H H1   . HOH I 3 .   ? 91.101  19.895  23.128 1.00 0.00  ? 276 HOH C H1   1 
HETATM 7847 H H2   . HOH I 3 .   ? 91.740  19.655  24.437 1.00 0.00  ? 276 HOH C H2   1 
HETATM 7848 O O    . HOH I 3 .   ? 83.522  22.874  28.091 1.00 22.35 ? 277 HOH C O    1 
HETATM 7849 H H1   . HOH I 3 .   ? 83.196  21.970  28.050 1.00 0.00  ? 277 HOH C H1   1 
HETATM 7850 H H2   . HOH I 3 .   ? 82.857  23.315  28.623 1.00 0.00  ? 277 HOH C H2   1 
HETATM 7851 O O    . HOH I 3 .   ? 88.118  22.285  31.500 1.00 40.48 ? 278 HOH C O    1 
HETATM 7852 H H1   . HOH I 3 .   ? 88.929  22.316  30.991 1.00 0.00  ? 278 HOH C H1   1 
HETATM 7853 H H2   . HOH I 3 .   ? 88.264  21.547  32.103 1.00 0.00  ? 278 HOH C H2   1 
HETATM 7854 O O    . HOH I 3 .   ? 93.585  19.234  27.665 1.00 27.90 ? 279 HOH C O    1 
HETATM 7855 H H1   . HOH I 3 .   ? 94.409  19.719  27.751 1.00 0.00  ? 279 HOH C H1   1 
HETATM 7856 H H2   . HOH I 3 .   ? 93.101  19.429  28.464 1.00 0.00  ? 279 HOH C H2   1 
HETATM 7857 O O    . HOH I 3 .   ? 95.804  30.431  11.397 1.00 16.91 ? 280 HOH C O    1 
HETATM 7858 H H1   . HOH I 3 .   ? 95.413  29.593  11.645 1.00 0.00  ? 280 HOH C H1   1 
HETATM 7859 H H2   . HOH I 3 .   ? 96.715  30.205  11.189 1.00 0.00  ? 280 HOH C H2   1 
HETATM 7860 O O    . HOH I 3 .   ? 79.983  61.852  27.547 1.00 32.24 ? 281 HOH C O    1 
HETATM 7861 H H1   . HOH I 3 .   ? 79.126  61.419  27.528 1.00 0.00  ? 281 HOH C H1   1 
HETATM 7862 H H2   . HOH I 3 .   ? 80.235  61.913  26.623 1.00 0.00  ? 281 HOH C H2   1 
HETATM 7863 O O    . HOH I 3 .   ? 89.874  63.507  19.585 1.00 47.89 ? 282 HOH C O    1 
HETATM 7864 H H1   . HOH I 3 .   ? 90.042  62.748  20.157 1.00 0.00  ? 282 HOH C H1   1 
HETATM 7865 H H2   . HOH I 3 .   ? 89.985  64.251  20.177 1.00 0.00  ? 282 HOH C H2   1 
HETATM 7866 O O    . HOH I 3 .   ? 105.298 27.197  19.335 1.00 19.23 ? 283 HOH C O    1 
HETATM 7867 H H1   . HOH I 3 .   ? 105.268 27.499  18.418 1.00 0.00  ? 283 HOH C H1   1 
HETATM 7868 H H2   . HOH I 3 .   ? 104.697 27.818  19.758 1.00 0.00  ? 283 HOH C H2   1 
HETATM 7869 O O    . HOH I 3 .   ? 89.980  16.912  23.822 1.00 19.58 ? 284 HOH C O    1 
HETATM 7870 H H1   . HOH I 3 .   ? 90.356  17.724  24.152 1.00 0.00  ? 284 HOH C H1   1 
HETATM 7871 H H2   . HOH I 3 .   ? 89.183  17.186  23.376 1.00 0.00  ? 284 HOH C H2   1 
HETATM 7872 O O    . HOH I 3 .   ? 90.875  51.558  19.731 1.00 8.26  ? 285 HOH C O    1 
HETATM 7873 H H1   . HOH I 3 .   ? 89.908  51.486  19.736 1.00 0.00  ? 285 HOH C H1   1 
HETATM 7874 H H2   . HOH I 3 .   ? 91.016  52.440  19.381 1.00 0.00  ? 285 HOH C H2   1 
HETATM 7875 O O    . HOH I 3 .   ? 83.920  24.216  25.275 1.00 47.07 ? 286 HOH C O    1 
HETATM 7876 H H1   . HOH I 3 .   ? 83.767  24.514  26.168 1.00 0.00  ? 286 HOH C H1   1 
HETATM 7877 H H2   . HOH I 3 .   ? 83.057  24.127  24.877 1.00 0.00  ? 286 HOH C H2   1 
HETATM 7878 O O    . HOH I 3 .   ? 59.196  56.589  18.694 1.00 61.13 ? 287 HOH C O    1 
HETATM 7879 H H1   . HOH I 3 .   ? 59.787  56.695  17.946 1.00 0.00  ? 287 HOH C H1   1 
HETATM 7880 H H2   . HOH I 3 .   ? 58.505  57.235  18.538 1.00 0.00  ? 287 HOH C H2   1 
HETATM 7881 O O    . HOH I 3 .   ? 81.685  51.955  24.231 1.00 26.69 ? 288 HOH C O    1 
HETATM 7882 H H1   . HOH I 3 .   ? 81.686  52.198  23.303 1.00 0.00  ? 288 HOH C H1   1 
HETATM 7883 H H2   . HOH I 3 .   ? 82.503  52.363  24.567 1.00 0.00  ? 288 HOH C H2   1 
HETATM 7884 O O    . HOH I 3 .   ? 68.612  42.596  9.747  1.00 30.05 ? 289 HOH C O    1 
HETATM 7885 H H1   . HOH I 3 .   ? 68.567  43.480  10.125 1.00 0.00  ? 289 HOH C H1   1 
HETATM 7886 H H2   . HOH I 3 .   ? 68.002  42.633  9.007  1.00 0.00  ? 289 HOH C H2   1 
HETATM 7887 O O    . HOH I 3 .   ? 106.221 28.689  17.237 1.00 26.44 ? 290 HOH C O    1 
HETATM 7888 H H1   . HOH I 3 .   ? 106.895 28.669  17.918 1.00 0.00  ? 290 HOH C H1   1 
HETATM 7889 H H2   . HOH I 3 .   ? 106.330 27.862  16.756 1.00 0.00  ? 290 HOH C H2   1 
HETATM 7890 O O    . HOH I 3 .   ? 89.834  55.023  22.952 1.00 80.35 ? 291 HOH C O    1 
HETATM 7891 H H1   . HOH I 3 .   ? 90.023  55.823  23.447 1.00 0.00  ? 291 HOH C H1   1 
HETATM 7892 H H2   . HOH I 3 .   ? 90.638  54.498  23.071 1.00 0.00  ? 291 HOH C H2   1 
HETATM 7893 O O    . HOH I 3 .   ? 89.253  42.044  5.903  1.00 42.82 ? 292 HOH C O    1 
HETATM 7894 H H1   . HOH I 3 .   ? 90.075  41.759  6.310  1.00 0.00  ? 292 HOH C H1   1 
HETATM 7895 H H2   . HOH I 3 .   ? 89.402  41.927  4.964  1.00 0.00  ? 292 HOH C H2   1 
HETATM 7896 O O    . HOH I 3 .   ? 71.515  39.839  20.199 1.00 25.55 ? 293 HOH C O    1 
HETATM 7897 H H1   . HOH I 3 .   ? 70.590  39.830  20.470 1.00 0.00  ? 293 HOH C H1   1 
HETATM 7898 H H2   . HOH I 3 .   ? 71.591  39.022  19.684 1.00 0.00  ? 293 HOH C H2   1 
HETATM 7899 O O    . HOH I 3 .   ? 107.290 42.723  14.701 1.00 40.36 ? 294 HOH C O    1 
HETATM 7900 H H1   . HOH I 3 .   ? 106.335 42.731  14.646 1.00 0.00  ? 294 HOH C H1   1 
HETATM 7901 H H2   . HOH I 3 .   ? 107.485 42.079  15.387 1.00 0.00  ? 294 HOH C H2   1 
HETATM 7902 O O    . HOH I 3 .   ? 81.840  65.479  23.930 1.00 74.96 ? 295 HOH C O    1 
HETATM 7903 H H1   . HOH I 3 .   ? 82.153  64.590  23.721 1.00 0.00  ? 295 HOH C H1   1 
HETATM 7904 H H2   . HOH I 3 .   ? 82.527  66.022  23.531 1.00 0.00  ? 295 HOH C H2   1 
HETATM 7905 O O    . HOH I 3 .   ? 81.561  34.773  23.370 1.00 37.83 ? 296 HOH C O    1 
HETATM 7906 H H1   . HOH I 3 .   ? 82.398  34.972  22.941 1.00 0.00  ? 296 HOH C H1   1 
HETATM 7907 H H2   . HOH I 3 .   ? 80.928  35.296  22.870 1.00 0.00  ? 296 HOH C H2   1 
HETATM 7908 O O    . HOH I 3 .   ? 70.213  44.927  9.239  1.00 35.57 ? 297 HOH C O    1 
HETATM 7909 H H1   . HOH I 3 .   ? 70.376  44.234  8.586  1.00 0.00  ? 297 HOH C H1   1 
HETATM 7910 H H2   . HOH I 3 .   ? 69.286  45.143  9.105  1.00 0.00  ? 297 HOH C H2   1 
HETATM 7911 O O    . HOH I 3 .   ? 83.237  61.924  20.033 1.00 45.58 ? 298 HOH C O    1 
HETATM 7912 H H1   . HOH I 3 .   ? 83.793  61.586  19.316 1.00 0.00  ? 298 HOH C H1   1 
HETATM 7913 H H2   . HOH I 3 .   ? 83.855  62.268  20.679 1.00 0.00  ? 298 HOH C H2   1 
HETATM 7914 O O    . HOH I 3 .   ? 91.421  48.326  29.059 1.00 19.51 ? 299 HOH C O    1 
HETATM 7915 H H1   . HOH I 3 .   ? 91.931  49.131  29.043 1.00 0.00  ? 299 HOH C H1   1 
HETATM 7916 H H2   . HOH I 3 .   ? 90.545  48.637  28.765 1.00 0.00  ? 299 HOH C H2   1 
HETATM 7917 O O    . HOH I 3 .   ? 69.406  37.290  23.149 1.00 42.66 ? 300 HOH C O    1 
HETATM 7918 H H1   . HOH I 3 .   ? 69.451  37.460  24.108 1.00 0.00  ? 300 HOH C H1   1 
HETATM 7919 H H2   . HOH I 3 .   ? 69.433  38.175  22.793 1.00 0.00  ? 300 HOH C H2   1 
HETATM 7920 O O    . HOH I 3 .   ? 69.315  38.328  25.565 1.00 87.65 ? 301 HOH C O    1 
HETATM 7921 H H1   . HOH I 3 .   ? 69.575  39.182  25.929 1.00 0.00  ? 301 HOH C H1   1 
HETATM 7922 H H2   . HOH I 3 .   ? 69.266  37.769  26.349 1.00 0.00  ? 301 HOH C H2   1 
HETATM 7923 O O    . HOH I 3 .   ? 86.464  29.280  21.012 1.00 13.36 ? 302 HOH C O    1 
HETATM 7924 H H1   . HOH I 3 .   ? 85.849  29.031  20.323 1.00 0.00  ? 302 HOH C H1   1 
HETATM 7925 H H2   . HOH I 3 .   ? 86.084  30.073  21.394 1.00 0.00  ? 302 HOH C H2   1 
HETATM 7926 O O    . HOH I 3 .   ? 104.661 45.326  17.609 1.00 28.32 ? 303 HOH C O    1 
HETATM 7927 H H1   . HOH I 3 .   ? 104.241 44.497  17.867 1.00 0.00  ? 303 HOH C H1   1 
HETATM 7928 H H2   . HOH I 3 .   ? 105.415 45.415  18.201 1.00 0.00  ? 303 HOH C H2   1 
HETATM 7929 O O    . HOH I 3 .   ? 109.264 37.040  21.089 1.00 41.41 ? 304 HOH C O    1 
HETATM 7930 H H1   . HOH I 3 .   ? 109.636 36.645  20.300 1.00 0.00  ? 304 HOH C H1   1 
HETATM 7931 H H2   . HOH I 3 .   ? 108.774 37.794  20.736 1.00 0.00  ? 304 HOH C H2   1 
HETATM 7932 O O    . HOH I 3 .   ? 84.161  52.768  24.567 1.00 59.51 ? 305 HOH C O    1 
HETATM 7933 H H1   . HOH I 3 .   ? 84.175  52.241  25.374 1.00 0.00  ? 305 HOH C H1   1 
HETATM 7934 H H2   . HOH I 3 .   ? 84.947  52.472  24.088 1.00 0.00  ? 305 HOH C H2   1 
HETATM 7935 O O    . HOH I 3 .   ? 108.535 42.791  23.131 1.00 42.75 ? 306 HOH C O    1 
HETATM 7936 H H1   . HOH I 3 .   ? 109.270 42.455  22.587 1.00 0.00  ? 306 HOH C H1   1 
HETATM 7937 H H2   . HOH I 3 .   ? 108.757 42.326  23.964 1.00 0.00  ? 306 HOH C H2   1 
HETATM 7938 O O    . HOH I 3 .   ? 92.502  51.100  17.416 1.00 25.22 ? 307 HOH C O    1 
HETATM 7939 H H1   . HOH I 3 .   ? 92.272  51.117  18.357 1.00 0.00  ? 307 HOH C H1   1 
HETATM 7940 H H2   . HOH I 3 .   ? 92.606  52.033  17.202 1.00 0.00  ? 307 HOH C H2   1 
HETATM 7941 O O    . HOH I 3 .   ? 76.242  45.585  4.384  1.00 56.16 ? 308 HOH C O    1 
HETATM 7942 H H1   . HOH I 3 .   ? 75.600  45.589  5.091  1.00 0.00  ? 308 HOH C H1   1 
HETATM 7943 H H2   . HOH I 3 .   ? 75.727  45.743  3.590  1.00 0.00  ? 308 HOH C H2   1 
HETATM 7944 O O    . HOH I 3 .   ? 81.373  35.445  16.159 1.00 21.81 ? 309 HOH C O    1 
HETATM 7945 H H1   . HOH I 3 .   ? 80.834  34.744  15.795 1.00 0.00  ? 309 HOH C H1   1 
HETATM 7946 H H2   . HOH I 3 .   ? 81.543  35.137  17.052 1.00 0.00  ? 309 HOH C H2   1 
HETATM 7947 O O    . HOH I 3 .   ? 84.435  39.780  7.712  1.00 11.08 ? 310 HOH C O    1 
HETATM 7948 H H1   . HOH I 3 .   ? 83.875  39.417  8.412  1.00 0.00  ? 310 HOH C H1   1 
HETATM 7949 H H2   . HOH I 3 .   ? 85.159  40.156  8.225  1.00 0.00  ? 310 HOH C H2   1 
HETATM 7950 O O    . HOH I 3 .   ? 73.030  57.487  11.275 1.00 32.44 ? 311 HOH C O    1 
HETATM 7951 H H1   . HOH I 3 .   ? 72.919  57.337  10.328 1.00 0.00  ? 311 HOH C H1   1 
HETATM 7952 H H2   . HOH I 3 .   ? 73.092  58.447  11.336 1.00 0.00  ? 311 HOH C H2   1 
HETATM 7953 O O    . HOH I 3 .   ? 95.943  44.548  33.683 1.00 75.28 ? 312 HOH C O    1 
HETATM 7954 H H1   . HOH I 3 .   ? 96.564  44.611  32.960 1.00 0.00  ? 312 HOH C H1   1 
HETATM 7955 H H2   . HOH I 3 .   ? 96.395  44.940  34.431 1.00 0.00  ? 312 HOH C H2   1 
HETATM 7956 O O    . HOH I 3 .   ? 95.156  53.296  15.804 1.00 58.96 ? 313 HOH C O    1 
HETATM 7957 H H1   . HOH I 3 .   ? 94.881  52.847  14.994 1.00 0.00  ? 313 HOH C H1   1 
HETATM 7958 H H2   . HOH I 3 .   ? 96.008  52.920  16.013 1.00 0.00  ? 313 HOH C H2   1 
HETATM 7959 O O    . HOH I 3 .   ? 89.291  40.540  8.260  1.00 27.11 ? 314 HOH C O    1 
HETATM 7960 H H1   . HOH I 3 .   ? 88.775  40.994  7.573  1.00 0.00  ? 314 HOH C H1   1 
HETATM 7961 H H2   . HOH I 3 .   ? 89.371  41.226  8.931  1.00 0.00  ? 314 HOH C H2   1 
HETATM 7962 O O    . HOH I 3 .   ? 71.536  37.176  19.571 1.00 64.81 ? 315 HOH C O    1 
HETATM 7963 H H1   . HOH I 3 .   ? 71.928  36.554  20.194 1.00 0.00  ? 315 HOH C H1   1 
HETATM 7964 H H2   . HOH I 3 .   ? 70.661  36.811  19.406 1.00 0.00  ? 315 HOH C H2   1 
HETATM 7965 O O    . HOH I 3 .   ? 66.089  59.651  12.418 1.00 45.37 ? 316 HOH C O    1 
HETATM 7966 H H1   . HOH I 3 .   ? 66.575  58.985  11.924 1.00 0.00  ? 316 HOH C H1   1 
HETATM 7967 H H2   . HOH I 3 .   ? 65.416  59.937  11.793 1.00 0.00  ? 316 HOH C H2   1 
HETATM 7968 O O    . HOH I 3 .   ? 106.817 27.165  11.814 1.00 38.77 ? 317 HOH C O    1 
HETATM 7969 H H1   . HOH I 3 .   ? 106.166 26.957  12.497 1.00 0.00  ? 317 HOH C H1   1 
HETATM 7970 H H2   . HOH I 3 .   ? 107.587 26.658  12.076 1.00 0.00  ? 317 HOH C H2   1 
HETATM 7971 O O    . HOH I 3 .   ? 62.907  57.039  15.127 1.00 54.12 ? 318 HOH C O    1 
HETATM 7972 H H1   . HOH I 3 .   ? 62.381  56.553  14.483 1.00 0.00  ? 318 HOH C H1   1 
HETATM 7973 H H2   . HOH I 3 .   ? 63.150  57.849  14.677 1.00 0.00  ? 318 HOH C H2   1 
HETATM 7974 O O    . HOH I 3 .   ? 103.509 43.519  15.943 1.00 20.39 ? 319 HOH C O    1 
HETATM 7975 H H1   . HOH I 3 .   ? 104.162 44.229  15.941 1.00 0.00  ? 319 HOH C H1   1 
HETATM 7976 H H2   . HOH I 3 .   ? 102.732 43.942  15.575 1.00 0.00  ? 319 HOH C H2   1 
HETATM 7977 O O    . HOH I 3 .   ? 78.910  29.374  21.149 1.00 72.52 ? 320 HOH C O    1 
HETATM 7978 H H1   . HOH I 3 .   ? 79.529  29.367  21.882 1.00 0.00  ? 320 HOH C H1   1 
HETATM 7979 H H2   . HOH I 3 .   ? 79.465  29.384  20.371 1.00 0.00  ? 320 HOH C H2   1 
HETATM 7980 O O    . HOH I 3 .   ? 72.318  45.219  7.031  1.00 73.32 ? 321 HOH C O    1 
HETATM 7981 H H1   . HOH I 3 .   ? 72.277  45.912  6.371  1.00 0.00  ? 321 HOH C H1   1 
HETATM 7982 H H2   . HOH I 3 .   ? 71.687  45.530  7.691  1.00 0.00  ? 321 HOH C H2   1 
HETATM 7983 O O    . HOH I 3 .   ? 74.464  47.682  33.426 1.00 18.32 ? 322 HOH C O    1 
HETATM 7984 H H1   . HOH I 3 .   ? 74.903  47.342  32.655 1.00 0.00  ? 322 HOH C H1   1 
HETATM 7985 H H2   . HOH I 3 .   ? 73.760  48.243  33.110 1.00 0.00  ? 322 HOH C H2   1 
HETATM 7986 O O    . HOH I 3 .   ? 100.374 43.861  21.354 1.00 9.03  ? 323 HOH C O    1 
HETATM 7987 H H1   . HOH I 3 .   ? 100.244 42.968  21.684 1.00 0.00  ? 323 HOH C H1   1 
HETATM 7988 H H2   . HOH I 3 .   ? 100.228 43.735  20.412 1.00 0.00  ? 323 HOH C H2   1 
HETATM 7989 O O    . HOH I 3 .   ? 64.498  56.547  18.369 1.00 19.51 ? 324 HOH C O    1 
HETATM 7990 H H1   . HOH I 3 .   ? 64.857  57.419  18.149 1.00 0.00  ? 324 HOH C H1   1 
HETATM 7991 H H2   . HOH I 3 .   ? 63.844  56.440  17.668 1.00 0.00  ? 324 HOH C H2   1 
HETATM 7992 O O    . HOH I 3 .   ? 87.782  50.780  2.089  1.00 19.91 ? 325 HOH C O    1 
HETATM 7993 H H1   . HOH I 3 .   ? 88.682  50.727  2.403  1.00 0.00  ? 325 HOH C H1   1 
HETATM 7994 H H2   . HOH I 3 .   ? 87.320  51.326  2.731  1.00 0.00  ? 325 HOH C H2   1 
HETATM 7995 O O    . HOH I 3 .   ? 87.386  54.977  20.208 1.00 34.35 ? 326 HOH C O    1 
HETATM 7996 H H1   . HOH I 3 .   ? 88.156  54.480  20.507 1.00 0.00  ? 326 HOH C H1   1 
HETATM 7997 H H2   . HOH I 3 .   ? 87.536  55.827  20.649 1.00 0.00  ? 326 HOH C H2   1 
HETATM 7998 O O    . HOH I 3 .   ? 73.427  36.577  16.745 1.00 37.46 ? 327 HOH C O    1 
HETATM 7999 H H1   . HOH I 3 .   ? 73.079  36.377  17.614 1.00 0.00  ? 327 HOH C H1   1 
HETATM 8000 H H2   . HOH I 3 .   ? 73.913  37.392  16.899 1.00 0.00  ? 327 HOH C H2   1 
HETATM 8001 O O    . HOH I 3 .   ? 78.315  34.001  21.919 1.00 21.42 ? 328 HOH C O    1 
HETATM 8002 H H1   . HOH I 3 .   ? 78.548  33.286  21.328 1.00 0.00  ? 328 HOH C H1   1 
HETATM 8003 H H2   . HOH I 3 .   ? 78.958  34.685  21.717 1.00 0.00  ? 328 HOH C H2   1 
HETATM 8004 O O    . HOH I 3 .   ? 89.730  27.049  29.686 1.00 39.94 ? 329 HOH C O    1 
HETATM 8005 H H1   . HOH I 3 .   ? 89.526  26.140  29.457 1.00 0.00  ? 329 HOH C H1   1 
HETATM 8006 H H2   . HOH I 3 .   ? 90.520  26.990  30.223 1.00 0.00  ? 329 HOH C H2   1 
HETATM 8007 O O    . HOH I 3 .   ? 94.907  47.112  19.244 1.00 29.80 ? 330 HOH C O    1 
HETATM 8008 H H1   . HOH I 3 .   ? 95.461  47.073  20.033 1.00 0.00  ? 330 HOH C H1   1 
HETATM 8009 H H2   . HOH I 3 .   ? 95.274  47.839  18.738 1.00 0.00  ? 330 HOH C H2   1 
HETATM 8010 O O    . HOH I 3 .   ? 73.750  41.683  31.079 1.00 14.66 ? 331 HOH C O    1 
HETATM 8011 H H1   . HOH I 3 .   ? 74.647  41.643  30.718 1.00 0.00  ? 331 HOH C H1   1 
HETATM 8012 H H2   . HOH I 3 .   ? 73.908  42.127  31.923 1.00 0.00  ? 331 HOH C H2   1 
HETATM 8013 O O    . HOH I 3 .   ? 80.628  42.466  34.272 1.00 16.43 ? 332 HOH C O    1 
HETATM 8014 H H1   . HOH I 3 .   ? 80.412  42.122  35.147 1.00 0.00  ? 332 HOH C H1   1 
HETATM 8015 H H2   . HOH I 3 .   ? 81.424  42.984  34.440 1.00 0.00  ? 332 HOH C H2   1 
HETATM 8016 O O    . HOH I 3 .   ? 94.711  57.897  27.747 1.00 21.02 ? 333 HOH C O    1 
HETATM 8017 H H1   . HOH I 3 .   ? 93.917  58.382  27.521 1.00 0.00  ? 333 HOH C H1   1 
HETATM 8018 H H2   . HOH I 3 .   ? 94.762  57.196  27.100 1.00 0.00  ? 333 HOH C H2   1 
HETATM 8019 O O    . HOH I 3 .   ? 88.272  31.333  7.544  1.00 28.16 ? 334 HOH C O    1 
HETATM 8020 H H1   . HOH I 3 .   ? 88.760  31.348  6.719  1.00 0.00  ? 334 HOH C H1   1 
HETATM 8021 H H2   . HOH I 3 .   ? 88.943  31.203  8.225  1.00 0.00  ? 334 HOH C H2   1 
HETATM 8022 O O    . HOH I 3 .   ? 87.328  38.790  7.770  1.00 22.10 ? 335 HOH C O    1 
HETATM 8023 H H1   . HOH I 3 .   ? 88.205  39.077  8.090  1.00 0.00  ? 335 HOH C H1   1 
HETATM 8024 H H2   . HOH I 3 .   ? 87.257  39.279  6.946  1.00 0.00  ? 335 HOH C H2   1 
HETATM 8025 O O    . HOH I 3 .   ? 69.924  37.863  17.019 1.00 27.56 ? 336 HOH C O    1 
HETATM 8026 H H1   . HOH I 3 .   ? 70.443  38.667  17.144 1.00 0.00  ? 336 HOH C H1   1 
HETATM 8027 H H2   . HOH I 3 .   ? 70.583  37.168  17.090 1.00 0.00  ? 336 HOH C H2   1 
HETATM 8028 O O    . HOH I 3 .   ? 63.994  35.153  24.080 1.00 26.82 ? 337 HOH C O    1 
HETATM 8029 H H1   . HOH I 3 .   ? 63.100  35.448  23.902 1.00 0.00  ? 337 HOH C H1   1 
HETATM 8030 H H2   . HOH I 3 .   ? 63.902  34.395  24.656 1.00 0.00  ? 337 HOH C H2   1 
HETATM 8031 O O    . HOH I 3 .   ? 91.130  44.997  8.686  1.00 21.48 ? 338 HOH C O    1 
HETATM 8032 H H1   . HOH I 3 .   ? 90.519  44.312  8.402  1.00 0.00  ? 338 HOH C H1   1 
HETATM 8033 H H2   . HOH I 3 .   ? 91.515  44.731  9.518  1.00 0.00  ? 338 HOH C H2   1 
HETATM 8034 O O    . HOH I 3 .   ? 72.212  36.521  26.253 1.00 28.88 ? 339 HOH C O    1 
HETATM 8035 H H1   . HOH I 3 .   ? 72.876  37.076  25.836 1.00 0.00  ? 339 HOH C H1   1 
HETATM 8036 H H2   . HOH I 3 .   ? 72.527  35.628  26.107 1.00 0.00  ? 339 HOH C H2   1 
HETATM 8037 O O    . HOH I 3 .   ? 83.113  23.282  13.997 1.00 70.55 ? 340 HOH C O    1 
HETATM 8038 H H1   . HOH I 3 .   ? 82.858  22.476  13.545 1.00 0.00  ? 340 HOH C H1   1 
HETATM 8039 H H2   . HOH I 3 .   ? 82.414  23.900  13.783 1.00 0.00  ? 340 HOH C H2   1 
HETATM 8040 O O    . HOH J 3 .   ? 75.167  50.359  10.068 1.00 14.67 ? 72  HOH D O    1 
HETATM 8041 H H1   . HOH J 3 .   ? 75.945  50.880  9.876  1.00 0.00  ? 72  HOH D H1   1 
HETATM 8042 H H2   . HOH J 3 .   ? 74.918  49.960  9.234  1.00 0.00  ? 72  HOH D H2   1 
HETATM 8043 O O    . HOH J 3 .   ? 100.829 48.137  14.928 1.00 34.43 ? 97  HOH D O    1 
HETATM 8044 H H1   . HOH J 3 .   ? 100.310 47.358  15.130 1.00 0.00  ? 97  HOH D H1   1 
HETATM 8045 H H2   . HOH J 3 .   ? 100.268 48.864  15.204 1.00 0.00  ? 97  HOH D H2   1 
HETATM 8046 O O    . HOH J 3 .   ? 84.359  55.327  16.906 1.00 29.01 ? 99  HOH D O    1 
HETATM 8047 H H1   . HOH J 3 .   ? 83.744  54.649  17.191 1.00 0.00  ? 99  HOH D H1   1 
HETATM 8048 H H2   . HOH J 3 .   ? 84.524  55.822  17.721 1.00 0.00  ? 99  HOH D H2   1 
HETATM 8049 O O    . HOH J 3 .   ? 74.031  48.001  5.978  1.00 50.23 ? 101 HOH D O    1 
HETATM 8050 H H1   . HOH J 3 .   ? 73.910  47.203  5.475  1.00 0.00  ? 101 HOH D H1   1 
HETATM 8051 H H2   . HOH J 3 .   ? 74.896  47.926  6.392  1.00 0.00  ? 101 HOH D H2   1 
HETATM 8052 O O    . HOH J 3 .   ? 80.673  54.496  1.887  1.00 73.03 ? 125 HOH D O    1 
HETATM 8053 H H1   . HOH J 3 .   ? 80.041  54.262  2.575  1.00 0.00  ? 125 HOH D H1   1 
HETATM 8054 H H2   . HOH J 3 .   ? 81.304  55.083  2.298  1.00 0.00  ? 125 HOH D H2   1 
HETATM 8055 O O    . HOH J 3 .   ? 99.098  55.494  9.216  1.00 36.79 ? 211 HOH D O    1 
HETATM 8056 H H1   . HOH J 3 .   ? 99.383  55.154  10.060 1.00 0.00  ? 211 HOH D H1   1 
HETATM 8057 H H2   . HOH J 3 .   ? 98.359  54.930  8.974  1.00 0.00  ? 211 HOH D H2   1 
HETATM 8058 O O    . HOH J 3 .   ? 90.402  55.161  5.433  1.00 11.22 ? 226 HOH D O    1 
HETATM 8059 H H1   . HOH J 3 .   ? 89.850  55.247  4.650  1.00 0.00  ? 226 HOH D H1   1 
HETATM 8060 H H2   . HOH J 3 .   ? 89.874  55.610  6.107  1.00 0.00  ? 226 HOH D H2   1 
HETATM 8061 O O    . HOH J 3 .   ? 85.803  54.771  2.191  1.00 28.23 ? 244 HOH D O    1 
HETATM 8062 H H1   . HOH J 3 .   ? 85.270  54.935  2.971  1.00 0.00  ? 244 HOH D H1   1 
HETATM 8063 H H2   . HOH J 3 .   ? 85.518  55.431  1.559  1.00 0.00  ? 244 HOH D H2   1 
HETATM 8064 O O    . HOH J 3 .   ? 87.829  57.556  2.645  1.00 40.72 ? 269 HOH D O    1 
HETATM 8065 H H1   . HOH J 3 .   ? 86.890  57.530  2.475  1.00 0.00  ? 269 HOH D H1   1 
HETATM 8066 H H2   . HOH J 3 .   ? 87.916  57.223  3.546  1.00 0.00  ? 269 HOH D H2   1 
HETATM 8067 O O    . HOH J 3 .   ? 101.805 52.576  12.380 1.00 23.68 ? 273 HOH D O    1 
HETATM 8068 H H1   . HOH J 3 .   ? 100.987 52.932  12.705 1.00 0.00  ? 273 HOH D H1   1 
HETATM 8069 H H2   . HOH J 3 .   ? 101.578 52.132  11.548 1.00 0.00  ? 273 HOH D H2   1 
HETATM 8070 O O    . HOH J 3 .   ? 101.332 50.434  10.956 1.00 31.00 ? 279 HOH D O    1 
HETATM 8071 H H1   . HOH J 3 .   ? 100.366 50.421  10.968 1.00 0.00  ? 279 HOH D H1   1 
HETATM 8072 H H2   . HOH J 3 .   ? 101.589 50.539  11.883 1.00 0.00  ? 279 HOH D H2   1 
HETATM 8073 O O    . HOH J 3 .   ? 72.632  51.417  2.449  1.00 48.49 ? 282 HOH D O    1 
HETATM 8074 H H1   . HOH J 3 .   ? 71.914  50.868  2.126  1.00 0.00  ? 282 HOH D H1   1 
HETATM 8075 H H2   . HOH J 3 .   ? 73.418  50.937  2.189  1.00 0.00  ? 282 HOH D H2   1 
HETATM 8076 O O    . HOH J 3 .   ? 93.973  50.504  0.832  1.00 42.80 ? 288 HOH D O    1 
HETATM 8077 H H1   . HOH J 3 .   ? 93.408  50.571  1.602  1.00 0.00  ? 288 HOH D H1   1 
HETATM 8078 H H2   . HOH J 3 .   ? 94.225  51.404  0.635  1.00 0.00  ? 288 HOH D H2   1 
HETATM 8079 O O    . HOH J 3 .   ? 77.392  57.875  2.242  1.00 39.26 ? 294 HOH D O    1 
HETATM 8080 H H1   . HOH J 3 .   ? 77.836  58.472  1.633  1.00 0.00  ? 294 HOH D H1   1 
HETATM 8081 H H2   . HOH J 3 .   ? 77.777  57.011  2.071  1.00 0.00  ? 294 HOH D H2   1 
HETATM 8082 O O    . HOH K 3 .   ? 59.337  -2.752  10.774 1.00 11.25 ? 262 HOH E O    1 
HETATM 8083 H H1   . HOH K 3 .   ? 58.557  -2.331  11.149 1.00 0.00  ? 262 HOH E H1   1 
HETATM 8084 H H2   . HOH K 3 .   ? 59.173  -3.693  10.875 1.00 0.00  ? 262 HOH E H2   1 
HETATM 8085 O O    . HOH K 3 .   ? 101.144 22.367  12.075 1.00 35.65 ? 263 HOH E O    1 
HETATM 8086 H H1   . HOH K 3 .   ? 102.056 22.227  12.321 1.00 0.00  ? 263 HOH E H1   1 
HETATM 8087 H H2   . HOH K 3 .   ? 100.724 22.730  12.862 1.00 0.00  ? 263 HOH E H2   1 
HETATM 8088 O O    . HOH K 3 .   ? 82.784  20.665  19.542 1.00 91.29 ? 264 HOH E O    1 
HETATM 8089 H H1   . HOH K 3 .   ? 82.075  20.518  18.911 1.00 0.00  ? 264 HOH E H1   1 
HETATM 8090 H H2   . HOH K 3 .   ? 82.747  21.610  19.683 1.00 0.00  ? 264 HOH E H2   1 
HETATM 8091 O O    . HOH K 3 .   ? 93.321  -3.943  17.465 1.00 26.09 ? 265 HOH E O    1 
HETATM 8092 H H1   . HOH K 3 .   ? 93.463  -3.819  16.520 1.00 0.00  ? 265 HOH E H1   1 
HETATM 8093 H H2   . HOH K 3 .   ? 92.402  -4.213  17.526 1.00 0.00  ? 265 HOH E H2   1 
HETATM 8094 O O    . HOH K 3 .   ? 89.585  3.204   10.264 1.00 15.54 ? 266 HOH E O    1 
HETATM 8095 H H1   . HOH K 3 .   ? 89.469  3.537   9.363  1.00 0.00  ? 266 HOH E H1   1 
HETATM 8096 H H2   . HOH K 3 .   ? 89.737  2.267   10.133 1.00 0.00  ? 266 HOH E H2   1 
HETATM 8097 O O    . HOH K 3 .   ? 73.101  -9.341  11.186 1.00 4.18  ? 267 HOH E O    1 
HETATM 8098 H H1   . HOH K 3 .   ? 73.428  -8.480  10.879 1.00 0.00  ? 267 HOH E H1   1 
HETATM 8099 H H2   . HOH K 3 .   ? 73.757  -9.561  11.857 1.00 0.00  ? 267 HOH E H2   1 
HETATM 8100 O O    . HOH K 3 .   ? 52.057  -10.122 20.785 1.00 24.03 ? 268 HOH E O    1 
HETATM 8101 H H1   . HOH K 3 .   ? 51.524  -10.914 20.694 1.00 0.00  ? 268 HOH E H1   1 
HETATM 8102 H H2   . HOH K 3 .   ? 52.949  -10.446 20.611 1.00 0.00  ? 268 HOH E H2   1 
HETATM 8103 O O    . HOH K 3 .   ? 60.447  -1.754  8.597  1.00 21.43 ? 269 HOH E O    1 
HETATM 8104 H H1   . HOH K 3 .   ? 60.532  -2.694  8.444  1.00 0.00  ? 269 HOH E H1   1 
HETATM 8105 H H2   . HOH K 3 .   ? 59.618  -1.548  8.156  1.00 0.00  ? 269 HOH E H2   1 
HETATM 8106 O O    . HOH K 3 .   ? 73.219  -11.394 14.336 1.00 20.18 ? 270 HOH E O    1 
HETATM 8107 H H1   . HOH K 3 .   ? 73.248  -12.267 14.723 1.00 0.00  ? 270 HOH E H1   1 
HETATM 8108 H H2   . HOH K 3 .   ? 72.354  -11.066 14.616 1.00 0.00  ? 270 HOH E H2   1 
HETATM 8109 O O    . HOH K 3 .   ? 81.998  -8.685  28.554 1.00 22.54 ? 271 HOH E O    1 
HETATM 8110 H H1   . HOH K 3 .   ? 82.706  -9.266  28.842 1.00 0.00  ? 271 HOH E H1   1 
HETATM 8111 H H2   . HOH K 3 .   ? 82.463  -8.001  28.067 1.00 0.00  ? 271 HOH E H2   1 
HETATM 8112 O O    . HOH K 3 .   ? 73.503  -15.918 29.333 1.00 16.55 ? 272 HOH E O    1 
HETATM 8113 H H1   . HOH K 3 .   ? 73.805  -15.721 30.218 1.00 0.00  ? 272 HOH E H1   1 
HETATM 8114 H H2   . HOH K 3 .   ? 72.784  -15.316 29.150 1.00 0.00  ? 272 HOH E H2   1 
HETATM 8115 O O    . HOH K 3 .   ? 82.303  7.311   24.661 1.00 8.19  ? 273 HOH E O    1 
HETATM 8116 H H1   . HOH K 3 .   ? 81.973  8.108   25.096 1.00 0.00  ? 273 HOH E H1   1 
HETATM 8117 H H2   . HOH K 3 .   ? 83.212  7.264   24.968 1.00 0.00  ? 273 HOH E H2   1 
HETATM 8118 O O    . HOH K 3 .   ? 53.292  -9.538  17.308 1.00 22.19 ? 274 HOH E O    1 
HETATM 8119 H H1   . HOH K 3 .   ? 52.497  -9.038  17.519 1.00 0.00  ? 274 HOH E H1   1 
HETATM 8120 H H2   . HOH K 3 .   ? 53.640  -9.728  18.192 1.00 0.00  ? 274 HOH E H2   1 
HETATM 8121 O O    . HOH K 3 .   ? 87.421  -8.658  23.086 1.00 36.42 ? 275 HOH E O    1 
HETATM 8122 H H1   . HOH K 3 .   ? 87.902  -8.488  22.270 1.00 0.00  ? 275 HOH E H1   1 
HETATM 8123 H H2   . HOH K 3 .   ? 88.061  -8.509  23.778 1.00 0.00  ? 275 HOH E H2   1 
HETATM 8124 O O    . HOH K 3 .   ? 88.560  -11.792 22.266 1.00 33.99 ? 276 HOH E O    1 
HETATM 8125 H H1   . HOH K 3 .   ? 87.697  -11.701 21.833 1.00 0.00  ? 276 HOH E H1   1 
HETATM 8126 H H2   . HOH K 3 .   ? 88.437  -11.206 23.019 1.00 0.00  ? 276 HOH E H2   1 
HETATM 8127 O O    . HOH K 3 .   ? 100.147 15.463  15.631 1.00 36.74 ? 277 HOH E O    1 
HETATM 8128 H H1   . HOH K 3 .   ? 100.481 16.365  15.595 1.00 0.00  ? 277 HOH E H1   1 
HETATM 8129 H H2   . HOH K 3 .   ? 99.367  15.549  16.186 1.00 0.00  ? 277 HOH E H2   1 
HETATM 8130 O O    . HOH K 3 .   ? 52.876  -13.301 20.507 1.00 19.90 ? 278 HOH E O    1 
HETATM 8131 H H1   . HOH K 3 .   ? 53.598  -12.659 20.411 1.00 0.00  ? 278 HOH E H1   1 
HETATM 8132 H H2   . HOH K 3 .   ? 53.334  -14.138 20.577 1.00 0.00  ? 278 HOH E H2   1 
HETATM 8133 O O    . HOH K 3 .   ? 54.240  4.695   23.357 1.00 16.36 ? 279 HOH E O    1 
HETATM 8134 H H1   . HOH K 3 .   ? 55.086  4.669   22.908 1.00 0.00  ? 279 HOH E H1   1 
HETATM 8135 H H2   . HOH K 3 .   ? 54.535  4.891   24.255 1.00 0.00  ? 279 HOH E H2   1 
HETATM 8136 O O    . HOH K 3 .   ? 61.428  9.420   28.761 1.00 60.39 ? 280 HOH E O    1 
HETATM 8137 H H1   . HOH K 3 .   ? 60.652  9.978   28.614 1.00 0.00  ? 280 HOH E H1   1 
HETATM 8138 H H2   . HOH K 3 .   ? 61.997  9.996   29.283 1.00 0.00  ? 280 HOH E H2   1 
HETATM 8139 O O    . HOH K 3 .   ? 58.610  6.077   31.929 1.00 23.66 ? 281 HOH E O    1 
HETATM 8140 H H1   . HOH K 3 .   ? 58.373  5.145   31.969 1.00 0.00  ? 281 HOH E H1   1 
HETATM 8141 H H2   . HOH K 3 .   ? 57.973  6.440   31.308 1.00 0.00  ? 281 HOH E H2   1 
HETATM 8142 O O    . HOH K 3 .   ? 53.415  3.302   27.543 1.00 33.15 ? 282 HOH E O    1 
HETATM 8143 H H1   . HOH K 3 .   ? 53.727  3.408   28.440 1.00 0.00  ? 282 HOH E H1   1 
HETATM 8144 H H2   . HOH K 3 .   ? 53.343  2.351   27.426 1.00 0.00  ? 282 HOH E H2   1 
HETATM 8145 O O    . HOH K 3 .   ? 61.812  -4.353  11.582 1.00 30.49 ? 283 HOH E O    1 
HETATM 8146 H H1   . HOH K 3 .   ? 61.306  -3.610  11.230 1.00 0.00  ? 283 HOH E H1   1 
HETATM 8147 H H2   . HOH K 3 .   ? 61.222  -5.096  11.417 1.00 0.00  ? 283 HOH E H2   1 
HETATM 8148 O O    . HOH K 3 .   ? 96.839  -6.694  27.094 1.00 23.08 ? 284 HOH E O    1 
HETATM 8149 H H1   . HOH K 3 .   ? 96.920  -6.545  26.156 1.00 0.00  ? 284 HOH E H1   1 
HETATM 8150 H H2   . HOH K 3 .   ? 96.655  -7.626  27.167 1.00 0.00  ? 284 HOH E H2   1 
HETATM 8151 O O    . HOH K 3 .   ? 93.486  -16.202 19.490 1.00 44.86 ? 285 HOH E O    1 
HETATM 8152 H H1   . HOH K 3 .   ? 92.623  -15.839 19.723 1.00 0.00  ? 285 HOH E H1   1 
HETATM 8153 H H2   . HOH K 3 .   ? 93.769  -16.579 20.324 1.00 0.00  ? 285 HOH E H2   1 
HETATM 8154 O O    . HOH K 3 .   ? 54.014  -11.277 19.158 1.00 27.73 ? 286 HOH E O    1 
HETATM 8155 H H1   . HOH K 3 .   ? 53.605  -11.421 18.293 1.00 0.00  ? 286 HOH E H1   1 
HETATM 8156 H H2   . HOH K 3 .   ? 54.957  -11.205 18.929 1.00 0.00  ? 286 HOH E H2   1 
HETATM 8157 O O    . HOH K 3 .   ? 53.081  7.198   23.866 1.00 20.07 ? 287 HOH E O    1 
HETATM 8158 H H1   . HOH K 3 .   ? 53.366  6.292   24.026 1.00 0.00  ? 287 HOH E H1   1 
HETATM 8159 H H2   . HOH K 3 .   ? 53.781  7.572   23.333 1.00 0.00  ? 287 HOH E H2   1 
HETATM 8160 O O    . HOH K 3 .   ? 82.986  -10.537 19.156 1.00 11.19 ? 288 HOH E O    1 
HETATM 8161 H H1   . HOH K 3 .   ? 83.435  -11.260 18.713 1.00 0.00  ? 288 HOH E H1   1 
HETATM 8162 H H2   . HOH K 3 .   ? 82.169  -10.886 19.524 1.00 0.00  ? 288 HOH E H2   1 
HETATM 8163 O O    . HOH K 3 .   ? 102.635 13.869  18.320 1.00 37.89 ? 289 HOH E O    1 
HETATM 8164 H H1   . HOH K 3 .   ? 103.515 14.134  18.052 1.00 0.00  ? 289 HOH E H1   1 
HETATM 8165 H H2   . HOH K 3 .   ? 102.368 13.211  17.675 1.00 0.00  ? 289 HOH E H2   1 
HETATM 8166 O O    . HOH K 3 .   ? 88.112  -3.360  24.415 1.00 14.61 ? 290 HOH E O    1 
HETATM 8167 H H1   . HOH K 3 .   ? 87.713  -3.582  25.257 1.00 0.00  ? 290 HOH E H1   1 
HETATM 8168 H H2   . HOH K 3 .   ? 87.512  -2.718  24.005 1.00 0.00  ? 290 HOH E H2   1 
HETATM 8169 O O    . HOH K 3 .   ? 86.011  12.634  10.180 1.00 25.32 ? 291 HOH E O    1 
HETATM 8170 H H1   . HOH K 3 .   ? 86.306  13.239  9.494  1.00 0.00  ? 291 HOH E H1   1 
HETATM 8171 H H2   . HOH K 3 .   ? 86.823  12.198  10.455 1.00 0.00  ? 291 HOH E H2   1 
HETATM 8172 O O    . HOH K 3 .   ? 55.244  -12.934 17.104 1.00 40.70 ? 292 HOH E O    1 
HETATM 8173 H H1   . HOH K 3 .   ? 54.444  -13.423 17.303 1.00 0.00  ? 292 HOH E H1   1 
HETATM 8174 H H2   . HOH K 3 .   ? 54.990  -12.332 16.394 1.00 0.00  ? 292 HOH E H2   1 
HETATM 8175 O O    . HOH K 3 .   ? 86.119  -12.057 23.369 1.00 79.85 ? 293 HOH E O    1 
HETATM 8176 H H1   . HOH K 3 .   ? 86.937  -12.397 23.728 1.00 0.00  ? 293 HOH E H1   1 
HETATM 8177 H H2   . HOH K 3 .   ? 85.500  -12.791 23.418 1.00 0.00  ? 293 HOH E H2   1 
HETATM 8178 O O    . HOH K 3 .   ? 75.299  -4.399  6.210  1.00 30.51 ? 294 HOH E O    1 
HETATM 8179 H H1   . HOH K 3 .   ? 75.864  -4.282  6.982  1.00 0.00  ? 294 HOH E H1   1 
HETATM 8180 H H2   . HOH K 3 .   ? 74.511  -4.833  6.556  1.00 0.00  ? 294 HOH E H2   1 
HETATM 8181 O O    . HOH K 3 .   ? 82.398  11.519  19.960 1.00 7.34  ? 295 HOH E O    1 
HETATM 8182 H H1   . HOH K 3 .   ? 82.527  12.054  20.750 1.00 0.00  ? 295 HOH E H1   1 
HETATM 8183 H H2   . HOH K 3 .   ? 82.982  11.935  19.310 1.00 0.00  ? 295 HOH E H2   1 
HETATM 8184 O O    . HOH K 3 .   ? 67.086  -20.698 14.877 1.00 75.38 ? 296 HOH E O    1 
HETATM 8185 H H1   . HOH K 3 .   ? 67.774  -20.063 14.681 1.00 0.00  ? 296 HOH E H1   1 
HETATM 8186 H H2   . HOH K 3 .   ? 66.492  -20.231 15.464 1.00 0.00  ? 296 HOH E H2   1 
HETATM 8187 O O    . HOH K 3 .   ? 99.410  -10.050 23.482 1.00 48.75 ? 297 HOH E O    1 
HETATM 8188 H H1   . HOH K 3 .   ? 98.469  -9.856  23.393 1.00 0.00  ? 297 HOH E H1   1 
HETATM 8189 H H2   . HOH K 3 .   ? 99.466  -10.916 23.071 1.00 0.00  ? 297 HOH E H2   1 
HETATM 8190 O O    . HOH K 3 .   ? 72.877  5.177   23.337 1.00 10.26 ? 298 HOH E O    1 
HETATM 8191 H H1   . HOH K 3 .   ? 73.599  5.473   22.770 1.00 0.00  ? 298 HOH E H1   1 
HETATM 8192 H H2   . HOH K 3 .   ? 72.541  4.407   22.879 1.00 0.00  ? 298 HOH E H2   1 
HETATM 8193 O O    . HOH K 3 .   ? 87.116  10.212  9.297  1.00 36.91 ? 299 HOH E O    1 
HETATM 8194 H H1   . HOH K 3 .   ? 86.475  10.422  8.609  1.00 0.00  ? 299 HOH E H1   1 
HETATM 8195 H H2   . HOH K 3 .   ? 87.797  10.878  9.156  1.00 0.00  ? 299 HOH E H2   1 
HETATM 8196 O O    . HOH K 3 .   ? 95.650  -9.395  19.406 1.00 56.21 ? 300 HOH E O    1 
HETATM 8197 H H1   . HOH K 3 .   ? 95.007  -9.967  18.977 1.00 0.00  ? 300 HOH E H1   1 
HETATM 8198 H H2   . HOH K 3 .   ? 96.375  -9.981  19.622 1.00 0.00  ? 300 HOH E H2   1 
HETATM 8199 O O    . HOH K 3 .   ? 79.463  -9.379  28.592 1.00 37.33 ? 301 HOH E O    1 
HETATM 8200 H H1   . HOH K 3 .   ? 80.345  -9.662  28.322 1.00 0.00  ? 301 HOH E H1   1 
HETATM 8201 H H2   . HOH K 3 .   ? 79.578  -8.428  28.588 1.00 0.00  ? 301 HOH E H2   1 
HETATM 8202 O O    . HOH K 3 .   ? 81.535  15.462  23.026 1.00 22.94 ? 302 HOH E O    1 
HETATM 8203 H H1   . HOH K 3 .   ? 82.175  14.820  22.723 1.00 0.00  ? 302 HOH E H1   1 
HETATM 8204 H H2   . HOH K 3 .   ? 80.740  14.933  23.115 1.00 0.00  ? 302 HOH E H2   1 
HETATM 8205 O O    . HOH K 3 .   ? 81.663  13.902  25.432 1.00 32.14 ? 303 HOH E O    1 
HETATM 8206 H H1   . HOH K 3 .   ? 82.413  13.463  25.845 1.00 0.00  ? 303 HOH E H1   1 
HETATM 8207 H H2   . HOH K 3 .   ? 81.161  14.214  26.188 1.00 0.00  ? 303 HOH E H2   1 
HETATM 8208 O O    . HOH K 3 .   ? 65.556  4.643   21.805 1.00 92.34 ? 304 HOH E O    1 
HETATM 8209 H H1   . HOH K 3 .   ? 66.342  4.181   22.094 1.00 0.00  ? 304 HOH E H1   1 
HETATM 8210 H H2   . HOH K 3 .   ? 65.901  5.388   21.318 1.00 0.00  ? 304 HOH E H2   1 
HETATM 8211 O O    . HOH K 3 .   ? 70.806  -20.198 17.449 1.00 21.93 ? 305 HOH E O    1 
HETATM 8212 H H1   . HOH K 3 .   ? 70.769  -19.347 17.000 1.00 0.00  ? 305 HOH E H1   1 
HETATM 8213 H H2   . HOH K 3 .   ? 70.152  -20.101 18.139 1.00 0.00  ? 305 HOH E H2   1 
HETATM 8214 O O    . HOH K 3 .   ? 60.992  -19.606 20.990 1.00 85.72 ? 306 HOH E O    1 
HETATM 8215 H H1   . HOH K 3 .   ? 60.246  -19.569 20.393 1.00 0.00  ? 306 HOH E H1   1 
HETATM 8216 H H2   . HOH K 3 .   ? 61.740  -19.549 20.384 1.00 0.00  ? 306 HOH E H2   1 
HETATM 8217 O O    . HOH K 3 .   ? 86.623  -5.487  24.059 1.00 40.31 ? 307 HOH E O    1 
HETATM 8218 H H1   . HOH K 3 .   ? 87.523  -5.170  24.198 1.00 0.00  ? 307 HOH E H1   1 
HETATM 8219 H H2   . HOH K 3 .   ? 86.239  -5.444  24.925 1.00 0.00  ? 307 HOH E H2   1 
HETATM 8220 O O    . HOH K 3 .   ? 66.510  -21.726 23.353 1.00 43.14 ? 308 HOH E O    1 
HETATM 8221 H H1   . HOH K 3 .   ? 65.849  -21.941 22.687 1.00 0.00  ? 308 HOH E H1   1 
HETATM 8222 H H2   . HOH K 3 .   ? 65.945  -21.708 24.146 1.00 0.00  ? 308 HOH E H2   1 
HETATM 8223 O O    . HOH K 3 .   ? 81.497  -11.911 17.210 1.00 30.60 ? 309 HOH E O    1 
HETATM 8224 H H1   . HOH K 3 .   ? 81.918  -11.912 18.068 1.00 0.00  ? 309 HOH E H1   1 
HETATM 8225 H H2   . HOH K 3 .   ? 82.043  -12.518 16.700 1.00 0.00  ? 309 HOH E H2   1 
HETATM 8226 O O    . HOH K 3 .   ? 85.337  4.404   4.106  1.00 42.20 ? 310 HOH E O    1 
HETATM 8227 H H1   . HOH K 3 .   ? 85.532  5.044   4.793  1.00 0.00  ? 310 HOH E H1   1 
HETATM 8228 H H2   . HOH K 3 .   ? 85.757  4.762   3.324  1.00 0.00  ? 310 HOH E H2   1 
HETATM 8229 O O    . HOH K 3 .   ? 73.187  4.691   16.069 1.00 60.46 ? 311 HOH E O    1 
HETATM 8230 H H1   . HOH K 3 .   ? 72.998  5.315   16.776 1.00 0.00  ? 311 HOH E H1   1 
HETATM 8231 H H2   . HOH K 3 .   ? 73.789  5.196   15.508 1.00 0.00  ? 311 HOH E H2   1 
HETATM 8232 O O    . HOH K 3 .   ? 75.700  0.838   7.627  1.00 19.79 ? 312 HOH E O    1 
HETATM 8233 H H1   . HOH K 3 .   ? 76.234  1.292   8.291  1.00 0.00  ? 312 HOH E H1   1 
HETATM 8234 H H2   . HOH K 3 .   ? 74.987  0.534   8.194  1.00 0.00  ? 312 HOH E H2   1 
HETATM 8235 O O    . HOH K 3 .   ? 97.241  1.342   11.624 1.00 55.15 ? 313 HOH E O    1 
HETATM 8236 H H1   . HOH K 3 .   ? 97.094  1.478   10.676 1.00 0.00  ? 313 HOH E H1   1 
HETATM 8237 H H2   . HOH K 3 .   ? 98.074  0.860   11.641 1.00 0.00  ? 313 HOH E H2   1 
HETATM 8238 O O    . HOH K 3 .   ? 74.480  -12.131 33.567 1.00 39.08 ? 314 HOH E O    1 
HETATM 8239 H H1   . HOH K 3 .   ? 73.833  -11.610 33.088 1.00 0.00  ? 314 HOH E H1   1 
HETATM 8240 H H2   . HOH K 3 .   ? 74.340  -13.038 33.316 1.00 0.00  ? 314 HOH E H2   1 
HETATM 8241 O O    . HOH K 3 .   ? 76.835  -14.401 15.759 1.00 71.56 ? 315 HOH E O    1 
HETATM 8242 H H1   . HOH K 3 .   ? 75.968  -14.455 16.163 1.00 0.00  ? 315 HOH E H1   1 
HETATM 8243 H H2   . HOH K 3 .   ? 76.629  -14.076 14.869 1.00 0.00  ? 315 HOH E H2   1 
HETATM 8244 O O    . HOH K 3 .   ? 81.587  -15.084 15.790 1.00 40.67 ? 316 HOH E O    1 
HETATM 8245 H H1   . HOH K 3 .   ? 81.473  -14.741 14.894 1.00 0.00  ? 316 HOH E H1   1 
HETATM 8246 H H2   . HOH K 3 .   ? 80.709  -15.366 16.045 1.00 0.00  ? 316 HOH E H2   1 
HETATM 8247 O O    . HOH K 3 .   ? 52.507  -5.461  11.513 1.00 50.11 ? 317 HOH E O    1 
HETATM 8248 H H1   . HOH K 3 .   ? 51.804  -6.074  11.736 1.00 0.00  ? 317 HOH E H1   1 
HETATM 8249 H H2   . HOH K 3 .   ? 52.849  -5.160  12.359 1.00 0.00  ? 317 HOH E H2   1 
HETATM 8250 O O    . HOH K 3 .   ? 95.273  27.228  10.462 1.00 46.02 ? 318 HOH E O    1 
HETATM 8251 H H1   . HOH K 3 .   ? 95.812  28.027  10.425 1.00 0.00  ? 318 HOH E H1   1 
HETATM 8252 H H2   . HOH K 3 .   ? 95.894  26.592  10.835 1.00 0.00  ? 318 HOH E H2   1 
HETATM 8253 O O    . HOH K 3 .   ? 73.705  -3.766  8.292  1.00 56.83 ? 319 HOH E O    1 
HETATM 8254 H H1   . HOH K 3 .   ? 74.332  -3.423  7.648  1.00 0.00  ? 319 HOH E H1   1 
HETATM 8255 H H2   . HOH K 3 .   ? 74.255  -4.246  8.928  1.00 0.00  ? 319 HOH E H2   1 
HETATM 8256 O O    . HOH K 3 .   ? 80.075  13.039  20.040 1.00 53.23 ? 320 HOH E O    1 
HETATM 8257 H H1   . HOH K 3 .   ? 80.660  12.439  19.559 1.00 0.00  ? 320 HOH E H1   1 
HETATM 8258 H H2   . HOH K 3 .   ? 79.467  12.430  20.468 1.00 0.00  ? 320 HOH E H2   1 
HETATM 8259 O O    . HOH K 3 .   ? 102.176 6.372   12.168 1.00 56.43 ? 321 HOH E O    1 
HETATM 8260 H H1   . HOH K 3 .   ? 101.230 6.278   12.032 1.00 0.00  ? 321 HOH E H1   1 
HETATM 8261 H H2   . HOH K 3 .   ? 102.489 6.633   11.295 1.00 0.00  ? 321 HOH E H2   1 
HETATM 8262 O O    . HOH K 3 .   ? 53.449  -12.719 11.748 1.00 47.26 ? 322 HOH E O    1 
HETATM 8263 H H1   . HOH K 3 .   ? 52.651  -13.235 11.870 1.00 0.00  ? 322 HOH E H1   1 
HETATM 8264 H H2   . HOH K 3 .   ? 53.734  -12.931 10.855 1.00 0.00  ? 322 HOH E H2   1 
HETATM 8265 O O    . HOH K 3 .   ? 101.971 10.483  15.255 1.00 46.81 ? 323 HOH E O    1 
HETATM 8266 H H1   . HOH K 3 .   ? 102.116 11.047  14.492 1.00 0.00  ? 323 HOH E H1   1 
HETATM 8267 H H2   . HOH K 3 .   ? 102.440 9.672   15.070 1.00 0.00  ? 323 HOH E H2   1 
HETATM 8268 O O    . HOH K 3 .   ? 69.347  -17.846 16.082 1.00 27.56 ? 324 HOH E O    1 
HETATM 8269 H H1   . HOH K 3 .   ? 70.125  -17.559 15.596 1.00 0.00  ? 324 HOH E H1   1 
HETATM 8270 H H2   . HOH K 3 .   ? 68.811  -17.046 16.134 1.00 0.00  ? 324 HOH E H2   1 
HETATM 8271 O O    . HOH K 3 .   ? 69.345  10.257  21.434 1.00 24.65 ? 325 HOH E O    1 
HETATM 8272 H H1   . HOH K 3 .   ? 69.943  9.509   21.445 1.00 0.00  ? 325 HOH E H1   1 
HETATM 8273 H H2   . HOH K 3 .   ? 68.662  10.021  20.811 1.00 0.00  ? 325 HOH E H2   1 
HETATM 8274 O O    . HOH K 3 .   ? 81.440  21.890  17.179 1.00 39.29 ? 326 HOH E O    1 
HETATM 8275 H H1   . HOH K 3 .   ? 81.120  21.445  16.388 1.00 0.00  ? 326 HOH E H1   1 
HETATM 8276 H H2   . HOH K 3 .   ? 80.941  22.713  17.173 1.00 0.00  ? 326 HOH E H2   1 
HETATM 8277 O O    . HOH K 3 .   ? 87.514  4.683   33.765 1.00 7.81  ? 327 HOH E O    1 
HETATM 8278 H H1   . HOH K 3 .   ? 86.771  5.231   34.024 1.00 0.00  ? 327 HOH E H1   1 
HETATM 8279 H H2   . HOH K 3 .   ? 88.266  5.280   33.785 1.00 0.00  ? 327 HOH E H2   1 
HETATM 8280 O O    . HOH K 3 .   ? 74.833  -8.092  9.528  1.00 28.89 ? 328 HOH E O    1 
HETATM 8281 H H1   . HOH K 3 .   ? 75.024  -8.418  8.641  1.00 0.00  ? 328 HOH E H1   1 
HETATM 8282 H H2   . HOH K 3 .   ? 75.183  -8.805  10.082 1.00 0.00  ? 328 HOH E H2   1 
HETATM 8283 O O    . HOH K 3 .   ? 69.785  -6.120  34.053 1.00 13.69 ? 329 HOH E O    1 
HETATM 8284 H H1   . HOH K 3 .   ? 70.588  -6.617  33.909 1.00 0.00  ? 329 HOH E H1   1 
HETATM 8285 H H2   . HOH K 3 .   ? 69.090  -6.694  33.725 1.00 0.00  ? 329 HOH E H2   1 
HETATM 8286 O O    . HOH K 3 .   ? 67.621  6.342   7.406  1.00 11.16 ? 330 HOH E O    1 
HETATM 8287 H H1   . HOH K 3 .   ? 68.306  6.870   6.997  1.00 0.00  ? 330 HOH E H1   1 
HETATM 8288 H H2   . HOH K 3 .   ? 68.113  5.637   7.837  1.00 0.00  ? 330 HOH E H2   1 
HETATM 8289 O O    . HOH K 3 .   ? 76.087  4.505   16.059 1.00 9.75  ? 331 HOH E O    1 
HETATM 8290 H H1   . HOH K 3 .   ? 76.725  4.677   16.764 1.00 0.00  ? 331 HOH E H1   1 
HETATM 8291 H H2   . HOH K 3 .   ? 75.551  3.812   16.457 1.00 0.00  ? 331 HOH E H2   1 
HETATM 8292 O O    . HOH K 3 .   ? 77.456  -8.251  8.601  1.00 20.81 ? 332 HOH E O    1 
HETATM 8293 H H1   . HOH K 3 .   ? 78.085  -8.922  8.310  1.00 0.00  ? 332 HOH E H1   1 
HETATM 8294 H H2   . HOH K 3 .   ? 77.822  -7.482  8.158  1.00 0.00  ? 332 HOH E H2   1 
HETATM 8295 O O    . HOH K 3 .   ? 92.951  14.841  8.242  1.00 26.05 ? 333 HOH E O    1 
HETATM 8296 H H1   . HOH K 3 .   ? 92.433  15.092  7.477  1.00 0.00  ? 333 HOH E H1   1 
HETATM 8297 H H2   . HOH K 3 .   ? 93.531  15.595  8.392  1.00 0.00  ? 333 HOH E H2   1 
HETATM 8298 O O    . HOH K 3 .   ? 84.038  -1.008  28.888 1.00 19.43 ? 334 HOH E O    1 
HETATM 8299 H H1   . HOH K 3 .   ? 84.429  -1.178  28.026 1.00 0.00  ? 334 HOH E H1   1 
HETATM 8300 H H2   . HOH K 3 .   ? 83.212  -0.588  28.657 1.00 0.00  ? 334 HOH E H2   1 
HETATM 8301 O O    . HOH K 3 .   ? 71.240  -14.272 21.257 1.00 55.87 ? 335 HOH E O    1 
HETATM 8302 H H1   . HOH K 3 .   ? 70.417  -14.224 21.745 1.00 0.00  ? 335 HOH E H1   1 
HETATM 8303 H H2   . HOH K 3 .   ? 70.971  -14.006 20.378 1.00 0.00  ? 335 HOH E H2   1 
HETATM 8304 O O    . HOH K 3 .   ? 65.131  6.722   13.934 1.00 15.67 ? 336 HOH E O    1 
HETATM 8305 H H1   . HOH K 3 .   ? 64.735  6.600   13.071 1.00 0.00  ? 336 HOH E H1   1 
HETATM 8306 H H2   . HOH K 3 .   ? 65.097  5.859   14.358 1.00 0.00  ? 336 HOH E H2   1 
HETATM 8307 O O    . HOH K 3 .   ? 102.707 7.324   25.359 1.00 38.89 ? 337 HOH E O    1 
HETATM 8308 H H1   . HOH K 3 .   ? 103.419 7.804   24.936 1.00 0.00  ? 337 HOH E H1   1 
HETATM 8309 H H2   . HOH K 3 .   ? 102.096 7.116   24.654 1.00 0.00  ? 337 HOH E H2   1 
HETATM 8310 O O    . HOH K 3 .   ? 56.062  -23.227 23.504 1.00 9.87  ? 338 HOH E O    1 
HETATM 8311 H H1   . HOH K 3 .   ? 56.763  -23.340 24.140 1.00 0.00  ? 338 HOH E H1   1 
HETATM 8312 H H2   . HOH K 3 .   ? 56.262  -22.392 23.078 1.00 0.00  ? 338 HOH E H2   1 
HETATM 8313 O O    . HOH K 3 .   ? 94.971  13.052  10.716 1.00 36.14 ? 339 HOH E O    1 
HETATM 8314 H H1   . HOH K 3 .   ? 94.464  12.541  11.360 1.00 0.00  ? 339 HOH E H1   1 
HETATM 8315 H H2   . HOH K 3 .   ? 95.661  12.450  10.423 1.00 0.00  ? 339 HOH E H2   1 
HETATM 8316 O O    . HOH K 3 .   ? 78.989  2.190   33.741 1.00 13.92 ? 340 HOH E O    1 
HETATM 8317 H H1   . HOH K 3 .   ? 79.048  1.365   33.221 1.00 0.00  ? 340 HOH E H1   1 
HETATM 8318 H H2   . HOH K 3 .   ? 78.480  1.840   34.478 1.00 0.00  ? 340 HOH E H2   1 
HETATM 8319 O O    . HOH K 3 .   ? 69.637  2.251   31.269 1.00 66.06 ? 341 HOH E O    1 
HETATM 8320 H H1   . HOH K 3 .   ? 70.504  1.939   31.541 1.00 0.00  ? 341 HOH E H1   1 
HETATM 8321 H H2   . HOH K 3 .   ? 69.062  1.860   31.943 1.00 0.00  ? 341 HOH E H2   1 
HETATM 8322 O O    . HOH K 3 .   ? 90.029  15.048  4.021  1.00 22.77 ? 342 HOH E O    1 
HETATM 8323 H H1   . HOH K 3 .   ? 89.383  15.040  4.726  1.00 0.00  ? 342 HOH E H1   1 
HETATM 8324 H H2   . HOH K 3 .   ? 90.770  14.554  4.365  1.00 0.00  ? 342 HOH E H2   1 
HETATM 8325 O O    . HOH K 3 .   ? 57.378  -8.674  6.752  1.00 29.37 ? 343 HOH E O    1 
HETATM 8326 H H1   . HOH K 3 .   ? 56.926  -9.502  6.893  1.00 0.00  ? 343 HOH E H1   1 
HETATM 8327 H H2   . HOH K 3 .   ? 58.177  -8.749  7.277  1.00 0.00  ? 343 HOH E H2   1 
HETATM 8328 O O    . HOH K 3 .   ? 90.529  14.037  32.115 1.00 22.06 ? 344 HOH E O    1 
HETATM 8329 H H1   . HOH K 3 .   ? 90.206  14.034  31.214 1.00 0.00  ? 344 HOH E H1   1 
HETATM 8330 H H2   . HOH K 3 .   ? 89.758  13.887  32.663 1.00 0.00  ? 344 HOH E H2   1 
HETATM 8331 O O    . HOH K 3 .   ? 92.446  11.380  32.958 1.00 19.01 ? 345 HOH E O    1 
HETATM 8332 H H1   . HOH K 3 .   ? 91.908  10.932  33.614 1.00 0.00  ? 345 HOH E H1   1 
HETATM 8333 H H2   . HOH K 3 .   ? 91.854  11.555  32.230 1.00 0.00  ? 345 HOH E H2   1 
HETATM 8334 O O    . HOH K 3 .   ? 65.608  4.706   19.223 1.00 27.86 ? 346 HOH E O    1 
HETATM 8335 H H1   . HOH K 3 .   ? 65.320  4.380   20.093 1.00 0.00  ? 346 HOH E H1   1 
HETATM 8336 H H2   . HOH K 3 .   ? 66.289  5.336   19.435 1.00 0.00  ? 346 HOH E H2   1 
HETATM 8337 O O    . HOH K 3 .   ? 78.899  -0.214  32.722 1.00 4.94  ? 347 HOH E O    1 
HETATM 8338 H H1   . HOH K 3 .   ? 78.872  -0.360  31.768 1.00 0.00  ? 347 HOH E H1   1 
HETATM 8339 H H2   . HOH K 3 .   ? 78.341  -0.928  33.040 1.00 0.00  ? 347 HOH E H2   1 
HETATM 8340 O O    . HOH K 3 .   ? 76.297  0.641   32.261 1.00 25.48 ? 348 HOH E O    1 
HETATM 8341 H H1   . HOH K 3 .   ? 76.554  0.588   31.336 1.00 0.00  ? 348 HOH E H1   1 
HETATM 8342 H H2   . HOH K 3 .   ? 75.711  1.401   32.228 1.00 0.00  ? 348 HOH E H2   1 
HETATM 8343 O O    . HOH K 3 .   ? 86.154  15.663  28.562 1.00 39.11 ? 349 HOH E O    1 
HETATM 8344 H H1   . HOH K 3 .   ? 85.993  15.743  29.503 1.00 0.00  ? 349 HOH E H1   1 
HETATM 8345 H H2   . HOH K 3 .   ? 86.934  15.115  28.491 1.00 0.00  ? 349 HOH E H2   1 
HETATM 8346 O O    . HOH K 3 .   ? 79.291  10.529  10.417 1.00 31.79 ? 350 HOH E O    1 
HETATM 8347 H H1   . HOH K 3 .   ? 78.612  10.971  10.928 1.00 0.00  ? 350 HOH E H1   1 
HETATM 8348 H H2   . HOH K 3 .   ? 79.857  10.182  11.110 1.00 0.00  ? 350 HOH E H2   1 
HETATM 8349 O O    . HOH K 3 .   ? 83.698  12.222  12.498 1.00 33.42 ? 351 HOH E O    1 
HETATM 8350 H H1   . HOH K 3 .   ? 83.342  13.001  12.063 1.00 0.00  ? 351 HOH E H1   1 
HETATM 8351 H H2   . HOH K 3 .   ? 83.294  11.521  11.986 1.00 0.00  ? 351 HOH E H2   1 
HETATM 8352 O O    . HOH K 3 .   ? 81.010  11.144  12.516 1.00 46.23 ? 352 HOH E O    1 
HETATM 8353 H H1   . HOH K 3 .   ? 81.707  11.648  12.950 1.00 0.00  ? 352 HOH E H1   1 
HETATM 8354 H H2   . HOH K 3 .   ? 81.332  10.234  12.522 1.00 0.00  ? 352 HOH E H2   1 
HETATM 8355 O O    . HOH L 3 .   ? 74.740  -17.907 14.899 1.00 19.16 ? 165 HOH F O    1 
HETATM 8356 H H1   . HOH L 3 .   ? 74.640  -16.986 15.133 1.00 0.00  ? 165 HOH F H1   1 
HETATM 8357 H H2   . HOH L 3 .   ? 75.666  -18.097 15.061 1.00 0.00  ? 165 HOH F H2   1 
HETATM 8358 O O    . HOH L 3 .   ? 89.722  -7.183  16.788 1.00 26.04 ? 167 HOH F O    1 
HETATM 8359 H H1   . HOH L 3 .   ? 89.184  -6.881  17.527 1.00 0.00  ? 167 HOH F H1   1 
HETATM 8360 H H2   . HOH L 3 .   ? 90.215  -6.382  16.564 1.00 0.00  ? 167 HOH F H2   1 
HETATM 8361 O O    . HOH L 3 .   ? 87.996  5.506   5.924  1.00 83.55 ? 169 HOH F O    1 
HETATM 8362 H H1   . HOH L 3 .   ? 87.597  6.149   5.336  1.00 0.00  ? 169 HOH F H1   1 
HETATM 8363 H H2   . HOH L 3 .   ? 87.322  4.845   6.091  1.00 0.00  ? 169 HOH F H2   1 
HETATM 8364 O O    . HOH L 3 .   ? 90.732  -2.932  1.746  1.00 46.63 ? 193 HOH F O    1 
HETATM 8365 H H1   . HOH L 3 .   ? 90.783  -3.714  2.291  1.00 0.00  ? 193 HOH F H1   1 
HETATM 8366 H H2   . HOH L 3 .   ? 90.698  -2.186  2.354  1.00 0.00  ? 193 HOH F H2   1 
HETATM 8367 O O    . HOH L 3 .   ? 86.621  7.932   6.978  1.00 46.86 ? 205 HOH F O    1 
HETATM 8368 H H1   . HOH L 3 .   ? 86.504  8.485   7.758  1.00 0.00  ? 205 HOH F H1   1 
HETATM 8369 H H2   . HOH L 3 .   ? 87.213  7.239   7.299  1.00 0.00  ? 205 HOH F H2   1 
HETATM 8370 O O    . HOH L 3 .   ? 87.855  -8.439  2.616  1.00 27.10 ? 257 HOH F O    1 
HETATM 8371 H H1   . HOH L 3 .   ? 88.249  -7.797  3.205  1.00 0.00  ? 257 HOH F H1   1 
HETATM 8372 H H2   . HOH L 3 .   ? 88.575  -8.688  2.034  1.00 0.00  ? 257 HOH F H2   1 
HETATM 8373 O O    . HOH L 3 .   ? 82.143  -19.264 9.226  1.00 54.29 ? 263 HOH F O    1 
HETATM 8374 H H1   . HOH L 3 .   ? 81.984  -19.528 10.130 1.00 0.00  ? 263 HOH F H1   1 
HETATM 8375 H H2   . HOH L 3 .   ? 81.909  -18.338 9.213  1.00 0.00  ? 263 HOH F H2   1 
HETATM 8376 O O    . HOH L 3 .   ? 74.670  -21.771 4.739  1.00 40.37 ? 280 HOH F O    1 
HETATM 8377 H H1   . HOH L 3 .   ? 74.973  -20.883 4.947  1.00 0.00  ? 280 HOH F H1   1 
HETATM 8378 H H2   . HOH L 3 .   ? 75.242  -22.041 4.022  1.00 0.00  ? 280 HOH F H2   1 
HETATM 8379 O O    . HOH L 3 .   ? 75.121  -19.919 6.904  1.00 33.60 ? 281 HOH F O    1 
HETATM 8380 H H1   . HOH L 3 .   ? 75.073  -19.240 6.231  1.00 0.00  ? 281 HOH F H1   1 
HETATM 8381 H H2   . HOH L 3 .   ? 74.527  -20.618 6.612  1.00 0.00  ? 281 HOH F H2   1 
HETATM 8382 O O    . HOH L 3 .   ? 79.802  -13.657 1.107  1.00 58.85 ? 290 HOH F O    1 
HETATM 8383 H H1   . HOH L 3 .   ? 80.221  -13.000 1.666  1.00 0.00  ? 290 HOH F H1   1 
HETATM 8384 H H2   . HOH L 3 .   ? 80.496  -14.290 0.930  1.00 0.00  ? 290 HOH F H2   1 
HETATM 8385 O O    . HOH L 3 .   ? 85.575  -12.524 3.580  1.00 42.50 ? 291 HOH F O    1 
HETATM 8386 H H1   . HOH L 3 .   ? 86.049  -12.493 2.744  1.00 0.00  ? 291 HOH F H1   1 
HETATM 8387 H H2   . HOH L 3 .   ? 86.209  -12.127 4.192  1.00 0.00  ? 291 HOH F H2   1 
HETATM 8388 O O    . HOH L 3 .   ? 62.024  -14.976 12.853 1.00 30.92 ? 292 HOH F O    1 
HETATM 8389 H H1   . HOH L 3 .   ? 61.172  -14.836 12.435 1.00 0.00  ? 292 HOH F H1   1 
HETATM 8390 H H2   . HOH L 3 .   ? 61.787  -15.588 13.555 1.00 0.00  ? 292 HOH F H2   1 
HETATM 8391 O O    . HOH L 3 .   ? 94.993  -2.063  1.833  1.00 35.72 ? 295 HOH F O    1 
HETATM 8392 H H1   . HOH L 3 .   ? 95.501  -2.645  1.265  1.00 0.00  ? 295 HOH F H1   1 
HETATM 8393 H H2   . HOH L 3 .   ? 94.082  -2.198  1.563  1.00 0.00  ? 295 HOH F H2   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   1   MET MET A . n 
A 1 2   PHE 2   2   2   PHE PHE A . n 
A 1 3   GLU 3   3   3   GLU GLU A . n 
A 1 4   ALA 4   4   4   ALA ALA A . n 
A 1 5   ARG 5   5   5   ARG ARG A . n 
A 1 6   LEU 6   6   6   LEU LEU A . n 
A 1 7   VAL 7   7   7   VAL VAL A . n 
A 1 8   GLN 8   8   8   GLN GLN A . n 
A 1 9   GLY 9   9   9   GLY GLY A . n 
A 1 10  SER 10  10  10  SER SER A . n 
A 1 11  ILE 11  11  11  ILE ILE A . n 
A 1 12  LEU 12  12  12  LEU LEU A . n 
A 1 13  LYS 13  13  13  LYS LYS A . n 
A 1 14  LYS 14  14  14  LYS LYS A . n 
A 1 15  VAL 15  15  15  VAL VAL A . n 
A 1 16  LEU 16  16  16  LEU LEU A . n 
A 1 17  GLU 17  17  17  GLU GLU A . n 
A 1 18  ALA 18  18  18  ALA ALA A . n 
A 1 19  LEU 19  19  19  LEU LEU A . n 
A 1 20  LYS 20  20  20  LYS LYS A . n 
A 1 21  ASP 21  21  21  ASP ASP A . n 
A 1 22  LEU 22  22  22  LEU LEU A . n 
A 1 23  ILE 23  23  23  ILE ILE A . n 
A 1 24  ASN 24  24  24  ASN ASN A . n 
A 1 25  GLU 25  25  25  GLU GLU A . n 
A 1 26  ALA 26  26  26  ALA ALA A . n 
A 1 27  CYS 27  27  27  CYS CYS A . n 
A 1 28  TRP 28  28  28  TRP TRP A . n 
A 1 29  ASP 29  29  29  ASP ASP A . n 
A 1 30  ILE 30  30  30  ILE ILE A . n 
A 1 31  SER 31  31  31  SER SER A . n 
A 1 32  SER 32  32  32  SER SER A . n 
A 1 33  SER 33  33  33  SER SER A . n 
A 1 34  GLY 34  34  34  GLY GLY A . n 
A 1 35  VAL 35  35  35  VAL VAL A . n 
A 1 36  ASN 36  36  36  ASN ASN A . n 
A 1 37  LEU 37  37  37  LEU LEU A . n 
A 1 38  GLN 38  38  38  GLN GLN A . n 
A 1 39  SER 39  39  39  SER SER A . n 
A 1 40  MET 40  40  40  MET MET A . n 
A 1 41  ASP 41  41  41  ASP ASP A . n 
A 1 42  SER 42  42  42  SER SER A . n 
A 1 43  SER 43  43  43  SER SER A . n 
A 1 44  HIS 44  44  44  HIS HIS A . n 
A 1 45  VAL 45  45  45  VAL VAL A . n 
A 1 46  SER 46  46  46  SER SER A . n 
A 1 47  LEU 47  47  47  LEU LEU A . n 
A 1 48  VAL 48  48  48  VAL VAL A . n 
A 1 49  GLN 49  49  49  GLN GLN A . n 
A 1 50  LEU 50  50  50  LEU LEU A . n 
A 1 51  THR 51  51  51  THR THR A . n 
A 1 52  LEU 52  52  52  LEU LEU A . n 
A 1 53  ARG 53  53  53  ARG ARG A . n 
A 1 54  SER 54  54  54  SER SER A . n 
A 1 55  GLU 55  55  55  GLU GLU A . n 
A 1 56  GLY 56  56  56  GLY GLY A . n 
A 1 57  PHE 57  57  57  PHE PHE A . n 
A 1 58  ASP 58  58  58  ASP ASP A . n 
A 1 59  THR 59  59  59  THR THR A . n 
A 1 60  TYR 60  60  60  TYR TYR A . n 
A 1 61  ARG 61  61  61  ARG ARG A . n 
A 1 62  CYS 62  62  62  CYS CYS A . n 
A 1 63  ASP 63  63  63  ASP ASP A . n 
A 1 64  ARG 64  64  64  ARG ARG A . n 
A 1 65  ASN 65  65  65  ASN ASN A . n 
A 1 66  LEU 66  66  66  LEU LEU A . n 
A 1 67  ALA 67  67  67  ALA ALA A . n 
A 1 68  MET 68  68  68  MET MET A . n 
A 1 69  GLY 69  69  69  GLY GLY A . n 
A 1 70  VAL 70  70  70  VAL VAL A . n 
A 1 71  ASN 71  71  71  ASN ASN A . n 
A 1 72  LEU 72  72  72  LEU LEU A . n 
A 1 73  THR 73  73  73  THR THR A . n 
A 1 74  SER 74  74  74  SER SER A . n 
A 1 75  MET 75  75  75  MET MET A . n 
A 1 76  SER 76  76  76  SER SER A . n 
A 1 77  LYS 77  77  77  LYS LYS A . n 
A 1 78  ILE 78  78  78  ILE ILE A . n 
A 1 79  LEU 79  79  79  LEU LEU A . n 
A 1 80  LYS 80  80  80  LYS LYS A . n 
A 1 81  CYS 81  81  81  CYS CYS A . n 
A 1 82  ALA 82  82  82  ALA ALA A . n 
A 1 83  GLY 83  83  83  GLY GLY A . n 
A 1 84  ASN 84  84  84  ASN ASN A . n 
A 1 85  GLU 85  85  85  GLU GLU A . n 
A 1 86  ASP 86  86  86  ASP ASP A . n 
A 1 87  ILE 87  87  87  ILE ILE A . n 
A 1 88  ILE 88  88  88  ILE ILE A . n 
A 1 89  THR 89  89  89  THR THR A . n 
A 1 90  LEU 90  90  90  LEU LEU A . n 
A 1 91  ARG 91  91  91  ARG ARG A . n 
A 1 92  ALA 92  92  92  ALA ALA A . n 
A 1 93  GLU 93  93  93  GLU GLU A . n 
A 1 94  ASP 94  94  94  ASP ASP A . n 
A 1 95  ASN 95  95  95  ASN ASN A . n 
A 1 96  ALA 96  96  96  ALA ALA A . n 
A 1 97  ASP 97  97  97  ASP ASP A . n 
A 1 98  THR 98  98  98  THR THR A . n 
A 1 99  LEU 99  99  99  LEU LEU A . n 
A 1 100 ALA 100 100 100 ALA ALA A . n 
A 1 101 LEU 101 101 101 LEU LEU A . n 
A 1 102 VAL 102 102 102 VAL VAL A . n 
A 1 103 PHE 103 103 103 PHE PHE A . n 
A 1 104 GLU 104 104 104 GLU GLU A . n 
A 1 105 ALA 105 105 105 ALA ALA A . n 
A 1 106 PRO 106 106 106 PRO PRO A . n 
A 1 107 ASN 107 107 ?   ?   ?   A . n 
A 1 108 GLN 108 108 ?   ?   ?   A . n 
A 1 109 GLU 109 109 109 GLU GLU A . n 
A 1 110 LYS 110 110 110 LYS LYS A . n 
A 1 111 VAL 111 111 111 VAL VAL A . n 
A 1 112 SER 112 112 112 SER SER A . n 
A 1 113 ASP 113 113 113 ASP ASP A . n 
A 1 114 TYR 114 114 114 TYR TYR A . n 
A 1 115 GLU 115 115 115 GLU GLU A . n 
A 1 116 MET 116 116 116 MET MET A . n 
A 1 117 LYS 117 117 117 LYS LYS A . n 
A 1 118 LEU 118 118 118 LEU LEU A . n 
A 1 119 MET 119 119 119 MET MET A . n 
A 1 120 ASP 120 120 120 ASP ASP A . n 
A 1 121 LEU 121 121 121 LEU LEU A . n 
A 1 122 ASP 122 122 122 ASP ASP A . n 
A 1 123 VAL 123 123 123 VAL VAL A . n 
A 1 124 GLU 124 124 124 GLU GLU A . n 
A 1 125 GLN 125 125 125 GLN GLN A . n 
A 1 126 LEU 126 126 126 LEU LEU A . n 
A 1 127 GLY 127 127 127 GLY GLY A . n 
A 1 128 ILE 128 128 128 ILE ILE A . n 
A 1 129 PRO 129 129 129 PRO PRO A . n 
A 1 130 GLU 130 130 130 GLU GLU A . n 
A 1 131 GLN 131 131 131 GLN GLN A . n 
A 1 132 GLU 132 132 132 GLU GLU A . n 
A 1 133 TYR 133 133 133 TYR TYR A . n 
A 1 134 SER 134 134 134 SER SER A . n 
A 1 135 CYS 135 135 135 CYS CYS A . n 
A 1 136 VAL 136 136 136 VAL VAL A . n 
A 1 137 VAL 137 137 137 VAL VAL A . n 
A 1 138 LYS 138 138 138 LYS LYS A . n 
A 1 139 MET 139 139 139 MET MET A . n 
A 1 140 PRO 140 140 140 PRO PRO A . n 
A 1 141 SER 141 141 141 SER SER A . n 
A 1 142 GLY 142 142 142 GLY GLY A . n 
A 1 143 GLU 143 143 143 GLU GLU A . n 
A 1 144 PHE 144 144 144 PHE PHE A . n 
A 1 145 ALA 145 145 145 ALA ALA A . n 
A 1 146 ARG 146 146 146 ARG ARG A . n 
A 1 147 ILE 147 147 147 ILE ILE A . n 
A 1 148 CYS 148 148 148 CYS CYS A . n 
A 1 149 ARG 149 149 149 ARG ARG A . n 
A 1 150 ASP 150 150 150 ASP ASP A . n 
A 1 151 LEU 151 151 151 LEU LEU A . n 
A 1 152 SER 152 152 152 SER SER A . n 
A 1 153 HIS 153 153 153 HIS HIS A . n 
A 1 154 ILE 154 154 154 ILE ILE A . n 
A 1 155 GLY 155 155 155 GLY GLY A . n 
A 1 156 ASP 156 156 156 ASP ASP A . n 
A 1 157 ALA 157 157 157 ALA ALA A . n 
A 1 158 VAL 158 158 158 VAL VAL A . n 
A 1 159 VAL 159 159 159 VAL VAL A . n 
A 1 160 ILE 160 160 160 ILE ILE A . n 
A 1 161 SER 161 161 161 SER SER A . n 
A 1 162 CYS 162 162 162 CYS CYS A . n 
A 1 163 ALA 163 163 163 ALA ALA A . n 
A 1 164 LYS 164 164 164 LYS LYS A . n 
A 1 165 ASP 165 165 165 ASP ASP A . n 
A 1 166 GLY 166 166 166 GLY GLY A . n 
A 1 167 VAL 167 167 167 VAL VAL A . n 
A 1 168 LYS 168 168 168 LYS LYS A . n 
A 1 169 PHE 169 169 169 PHE PHE A . n 
A 1 170 SER 170 170 170 SER SER A . n 
A 1 171 ALA 171 171 171 ALA ALA A . n 
A 1 172 SER 172 172 172 SER SER A . n 
A 1 173 GLY 173 173 173 GLY GLY A . n 
A 1 174 GLU 174 174 174 GLU GLU A . n 
A 1 175 LEU 175 175 175 LEU LEU A . n 
A 1 176 GLY 176 176 176 GLY GLY A . n 
A 1 177 ASN 177 177 177 ASN ASN A . n 
A 1 178 GLY 178 178 178 GLY GLY A . n 
A 1 179 ASN 179 179 179 ASN ASN A . n 
A 1 180 ILE 180 180 180 ILE ILE A . n 
A 1 181 LYS 181 181 181 LYS LYS A . n 
A 1 182 LEU 182 182 182 LEU LEU A . n 
A 1 183 SER 183 183 183 SER SER A . n 
A 1 184 GLN 184 184 184 GLN GLN A . n 
A 1 185 THR 185 185 185 THR THR A . n 
A 1 186 SER 186 186 186 SER SER A . n 
A 1 187 ASN 187 187 ?   ?   ?   A . n 
A 1 188 VAL 188 188 ?   ?   ?   A . n 
A 1 189 ASP 189 189 ?   ?   ?   A . n 
A 1 190 LYS 190 190 ?   ?   ?   A . n 
A 1 191 GLU 191 191 191 GLU GLU A . n 
A 1 192 GLU 192 192 192 GLU GLU A . n 
A 1 193 GLU 193 193 193 GLU GLU A . n 
A 1 194 ALA 194 194 194 ALA ALA A . n 
A 1 195 VAL 195 195 195 VAL VAL A . n 
A 1 196 THR 196 196 196 THR THR A . n 
A 1 197 ILE 197 197 197 ILE ILE A . n 
A 1 198 GLU 198 198 198 GLU GLU A . n 
A 1 199 MET 199 199 199 MET MET A . n 
A 1 200 ASN 200 200 200 ASN ASN A . n 
A 1 201 GLU 201 201 201 GLU GLU A . n 
A 1 202 PRO 202 202 202 PRO PRO A . n 
A 1 203 VAL 203 203 203 VAL VAL A . n 
A 1 204 GLN 204 204 204 GLN GLN A . n 
A 1 205 LEU 205 205 205 LEU LEU A . n 
A 1 206 THR 206 206 206 THR THR A . n 
A 1 207 PHE 207 207 207 PHE PHE A . n 
A 1 208 ALA 208 208 208 ALA ALA A . n 
A 1 209 LEU 209 209 209 LEU LEU A . n 
A 1 210 ARG 210 210 210 ARG ARG A . n 
A 1 211 TYR 211 211 211 TYR TYR A . n 
A 1 212 LEU 212 212 212 LEU LEU A . n 
A 1 213 ASN 213 213 213 ASN ASN A . n 
A 1 214 PHE 214 214 214 PHE PHE A . n 
A 1 215 PHE 215 215 215 PHE PHE A . n 
A 1 216 THR 216 216 216 THR THR A . n 
A 1 217 LYS 217 217 217 LYS LYS A . n 
A 1 218 ALA 218 218 218 ALA ALA A . n 
A 1 219 THR 219 219 219 THR THR A . n 
A 1 220 PRO 220 220 220 PRO PRO A . n 
A 1 221 LEU 221 221 221 LEU LEU A . n 
A 1 222 SER 222 222 222 SER SER A . n 
A 1 223 SER 223 223 223 SER SER A . n 
A 1 224 THR 224 224 224 THR THR A . n 
A 1 225 VAL 225 225 225 VAL VAL A . n 
A 1 226 THR 226 226 226 THR THR A . n 
A 1 227 LEU 227 227 227 LEU LEU A . n 
A 1 228 SER 228 228 228 SER SER A . n 
A 1 229 MET 229 229 229 MET MET A . n 
A 1 230 SER 230 230 230 SER SER A . n 
A 1 231 ALA 231 231 231 ALA ALA A . n 
A 1 232 ASP 232 232 232 ASP ASP A . n 
A 1 233 VAL 233 233 233 VAL VAL A . n 
A 1 234 PRO 234 234 234 PRO PRO A . n 
A 1 235 LEU 235 235 235 LEU LEU A . n 
A 1 236 VAL 236 236 236 VAL VAL A . n 
A 1 237 VAL 237 237 237 VAL VAL A . n 
A 1 238 GLU 238 238 238 GLU GLU A . n 
A 1 239 TYR 239 239 239 TYR TYR A . n 
A 1 240 LYS 240 240 240 LYS LYS A . n 
A 1 241 ILE 241 241 241 ILE ILE A . n 
A 1 242 ALA 242 242 242 ALA ALA A . n 
A 1 243 ASP 243 243 243 ASP ASP A . n 
A 1 244 MET 244 244 244 MET MET A . n 
A 1 245 GLY 245 245 245 GLY GLY A . n 
A 1 246 HIS 246 246 246 HIS HIS A . n 
A 1 247 LEU 247 247 247 LEU LEU A . n 
A 1 248 LYS 248 248 248 LYS LYS A . n 
A 1 249 TYR 249 249 249 TYR TYR A . n 
A 1 250 TYR 250 250 250 TYR TYR A . n 
A 1 251 LEU 251 251 251 LEU LEU A . n 
A 1 252 ALA 252 252 252 ALA ALA A . n 
A 1 253 PRO 253 253 253 PRO PRO A . n 
A 1 254 LYS 254 254 254 LYS LYS A . n 
A 1 255 ILE 255 255 255 ILE ILE A . n 
A 1 256 GLU 256 256 ?   ?   ?   A . n 
A 1 257 ASP 257 257 ?   ?   ?   A . n 
A 1 258 GLU 258 258 ?   ?   ?   A . n 
A 1 259 GLU 259 259 ?   ?   ?   A . n 
A 1 260 GLY 260 260 ?   ?   ?   A . n 
A 1 261 SER 261 261 ?   ?   ?   A . n 
B 2 1   GLY 1   139 ?   ?   ?   B . n 
B 2 2   ARG 2   140 ?   ?   ?   B . n 
B 2 3   LYS 3   141 ?   ?   ?   B . n 
B 2 4   ARG 4   142 ?   ?   ?   B . n 
B 2 5   ARG 5   143 143 ARG ARG B . n 
B 2 6   GLN 6   144 144 GLN GLN B . n 
B 2 7   THR 7   145 145 THR THR B . n 
B 2 8   SER 8   146 146 SER SER B . n 
B 2 9   MET 9   147 147 MET MET B . n 
B 2 10  THR 10  148 148 THR THR B . n 
B 2 11  ASP 11  149 149 ASP ASP B . n 
B 2 12  PHE 12  150 150 PHE PHE B . n 
B 2 13  TYR 13  151 151 TYR TYR B . n 
B 2 14  HIS 14  152 152 HIS HIS B . n 
B 2 15  SER 15  153 153 SER SER B . n 
B 2 16  LYS 16  154 154 LYS LYS B . n 
B 2 17  ARG 17  155 155 ARG ARG B . n 
B 2 18  ARG 18  156 156 ARG ARG B . n 
B 2 19  LEU 19  157 157 LEU LEU B . n 
B 2 20  ILE 20  158 158 ILE ILE B . n 
B 2 21  PHE 21  159 159 PHE PHE B . n 
B 2 22  SER 22  160 160 SER SER B . n 
C 1 1   MET 1   1   1   MET MET C . n 
C 1 2   PHE 2   2   2   PHE PHE C . n 
C 1 3   GLU 3   3   3   GLU GLU C . n 
C 1 4   ALA 4   4   4   ALA ALA C . n 
C 1 5   ARG 5   5   5   ARG ARG C . n 
C 1 6   LEU 6   6   6   LEU LEU C . n 
C 1 7   VAL 7   7   7   VAL VAL C . n 
C 1 8   GLN 8   8   8   GLN GLN C . n 
C 1 9   GLY 9   9   9   GLY GLY C . n 
C 1 10  SER 10  10  10  SER SER C . n 
C 1 11  ILE 11  11  11  ILE ILE C . n 
C 1 12  LEU 12  12  12  LEU LEU C . n 
C 1 13  LYS 13  13  13  LYS LYS C . n 
C 1 14  LYS 14  14  14  LYS LYS C . n 
C 1 15  VAL 15  15  15  VAL VAL C . n 
C 1 16  LEU 16  16  16  LEU LEU C . n 
C 1 17  GLU 17  17  17  GLU GLU C . n 
C 1 18  ALA 18  18  18  ALA ALA C . n 
C 1 19  LEU 19  19  19  LEU LEU C . n 
C 1 20  LYS 20  20  20  LYS LYS C . n 
C 1 21  ASP 21  21  21  ASP ASP C . n 
C 1 22  LEU 22  22  22  LEU LEU C . n 
C 1 23  ILE 23  23  23  ILE ILE C . n 
C 1 24  ASN 24  24  24  ASN ASN C . n 
C 1 25  GLU 25  25  25  GLU GLU C . n 
C 1 26  ALA 26  26  26  ALA ALA C . n 
C 1 27  CYS 27  27  27  CYS CYS C . n 
C 1 28  TRP 28  28  28  TRP TRP C . n 
C 1 29  ASP 29  29  29  ASP ASP C . n 
C 1 30  ILE 30  30  30  ILE ILE C . n 
C 1 31  SER 31  31  31  SER SER C . n 
C 1 32  SER 32  32  32  SER SER C . n 
C 1 33  SER 33  33  33  SER SER C . n 
C 1 34  GLY 34  34  34  GLY GLY C . n 
C 1 35  VAL 35  35  35  VAL VAL C . n 
C 1 36  ASN 36  36  36  ASN ASN C . n 
C 1 37  LEU 37  37  37  LEU LEU C . n 
C 1 38  GLN 38  38  38  GLN GLN C . n 
C 1 39  SER 39  39  39  SER SER C . n 
C 1 40  MET 40  40  40  MET MET C . n 
C 1 41  ASP 41  41  41  ASP ASP C . n 
C 1 42  SER 42  42  42  SER SER C . n 
C 1 43  SER 43  43  43  SER SER C . n 
C 1 44  HIS 44  44  44  HIS HIS C . n 
C 1 45  VAL 45  45  45  VAL VAL C . n 
C 1 46  SER 46  46  46  SER SER C . n 
C 1 47  LEU 47  47  47  LEU LEU C . n 
C 1 48  VAL 48  48  48  VAL VAL C . n 
C 1 49  GLN 49  49  49  GLN GLN C . n 
C 1 50  LEU 50  50  50  LEU LEU C . n 
C 1 51  THR 51  51  51  THR THR C . n 
C 1 52  LEU 52  52  52  LEU LEU C . n 
C 1 53  ARG 53  53  53  ARG ARG C . n 
C 1 54  SER 54  54  54  SER SER C . n 
C 1 55  GLU 55  55  55  GLU GLU C . n 
C 1 56  GLY 56  56  56  GLY GLY C . n 
C 1 57  PHE 57  57  57  PHE PHE C . n 
C 1 58  ASP 58  58  58  ASP ASP C . n 
C 1 59  THR 59  59  59  THR THR C . n 
C 1 60  TYR 60  60  60  TYR TYR C . n 
C 1 61  ARG 61  61  61  ARG ARG C . n 
C 1 62  CYS 62  62  62  CYS CYS C . n 
C 1 63  ASP 63  63  63  ASP ASP C . n 
C 1 64  ARG 64  64  64  ARG ARG C . n 
C 1 65  ASN 65  65  65  ASN ASN C . n 
C 1 66  LEU 66  66  66  LEU LEU C . n 
C 1 67  ALA 67  67  67  ALA ALA C . n 
C 1 68  MET 68  68  68  MET MET C . n 
C 1 69  GLY 69  69  69  GLY GLY C . n 
C 1 70  VAL 70  70  70  VAL VAL C . n 
C 1 71  ASN 71  71  71  ASN ASN C . n 
C 1 72  LEU 72  72  72  LEU LEU C . n 
C 1 73  THR 73  73  73  THR THR C . n 
C 1 74  SER 74  74  74  SER SER C . n 
C 1 75  MET 75  75  75  MET MET C . n 
C 1 76  SER 76  76  76  SER SER C . n 
C 1 77  LYS 77  77  77  LYS LYS C . n 
C 1 78  ILE 78  78  78  ILE ILE C . n 
C 1 79  LEU 79  79  79  LEU LEU C . n 
C 1 80  LYS 80  80  80  LYS LYS C . n 
C 1 81  CYS 81  81  81  CYS CYS C . n 
C 1 82  ALA 82  82  82  ALA ALA C . n 
C 1 83  GLY 83  83  83  GLY GLY C . n 
C 1 84  ASN 84  84  84  ASN ASN C . n 
C 1 85  GLU 85  85  85  GLU GLU C . n 
C 1 86  ASP 86  86  86  ASP ASP C . n 
C 1 87  ILE 87  87  87  ILE ILE C . n 
C 1 88  ILE 88  88  88  ILE ILE C . n 
C 1 89  THR 89  89  89  THR THR C . n 
C 1 90  LEU 90  90  90  LEU LEU C . n 
C 1 91  ARG 91  91  91  ARG ARG C . n 
C 1 92  ALA 92  92  92  ALA ALA C . n 
C 1 93  GLU 93  93  93  GLU GLU C . n 
C 1 94  ASP 94  94  94  ASP ASP C . n 
C 1 95  ASN 95  95  95  ASN ASN C . n 
C 1 96  ALA 96  96  96  ALA ALA C . n 
C 1 97  ASP 97  97  97  ASP ASP C . n 
C 1 98  THR 98  98  98  THR THR C . n 
C 1 99  LEU 99  99  99  LEU LEU C . n 
C 1 100 ALA 100 100 100 ALA ALA C . n 
C 1 101 LEU 101 101 101 LEU LEU C . n 
C 1 102 VAL 102 102 102 VAL VAL C . n 
C 1 103 PHE 103 103 103 PHE PHE C . n 
C 1 104 GLU 104 104 104 GLU GLU C . n 
C 1 105 ALA 105 105 105 ALA ALA C . n 
C 1 106 PRO 106 106 106 PRO PRO C . n 
C 1 107 ASN 107 107 ?   ?   ?   C . n 
C 1 108 GLN 108 108 ?   ?   ?   C . n 
C 1 109 GLU 109 109 109 GLU GLU C . n 
C 1 110 LYS 110 110 110 LYS LYS C . n 
C 1 111 VAL 111 111 111 VAL VAL C . n 
C 1 112 SER 112 112 112 SER SER C . n 
C 1 113 ASP 113 113 113 ASP ASP C . n 
C 1 114 TYR 114 114 114 TYR TYR C . n 
C 1 115 GLU 115 115 115 GLU GLU C . n 
C 1 116 MET 116 116 116 MET MET C . n 
C 1 117 LYS 117 117 117 LYS LYS C . n 
C 1 118 LEU 118 118 118 LEU LEU C . n 
C 1 119 MET 119 119 119 MET MET C . n 
C 1 120 ASP 120 120 120 ASP ASP C . n 
C 1 121 LEU 121 121 121 LEU LEU C . n 
C 1 122 ASP 122 122 122 ASP ASP C . n 
C 1 123 VAL 123 123 123 VAL VAL C . n 
C 1 124 GLU 124 124 124 GLU GLU C . n 
C 1 125 GLN 125 125 125 GLN GLN C . n 
C 1 126 LEU 126 126 126 LEU LEU C . n 
C 1 127 GLY 127 127 127 GLY GLY C . n 
C 1 128 ILE 128 128 128 ILE ILE C . n 
C 1 129 PRO 129 129 129 PRO PRO C . n 
C 1 130 GLU 130 130 130 GLU GLU C . n 
C 1 131 GLN 131 131 131 GLN GLN C . n 
C 1 132 GLU 132 132 132 GLU GLU C . n 
C 1 133 TYR 133 133 133 TYR TYR C . n 
C 1 134 SER 134 134 134 SER SER C . n 
C 1 135 CYS 135 135 135 CYS CYS C . n 
C 1 136 VAL 136 136 136 VAL VAL C . n 
C 1 137 VAL 137 137 137 VAL VAL C . n 
C 1 138 LYS 138 138 138 LYS LYS C . n 
C 1 139 MET 139 139 139 MET MET C . n 
C 1 140 PRO 140 140 140 PRO PRO C . n 
C 1 141 SER 141 141 141 SER SER C . n 
C 1 142 GLY 142 142 142 GLY GLY C . n 
C 1 143 GLU 143 143 143 GLU GLU C . n 
C 1 144 PHE 144 144 144 PHE PHE C . n 
C 1 145 ALA 145 145 145 ALA ALA C . n 
C 1 146 ARG 146 146 146 ARG ARG C . n 
C 1 147 ILE 147 147 147 ILE ILE C . n 
C 1 148 CYS 148 148 148 CYS CYS C . n 
C 1 149 ARG 149 149 149 ARG ARG C . n 
C 1 150 ASP 150 150 150 ASP ASP C . n 
C 1 151 LEU 151 151 151 LEU LEU C . n 
C 1 152 SER 152 152 152 SER SER C . n 
C 1 153 HIS 153 153 153 HIS HIS C . n 
C 1 154 ILE 154 154 154 ILE ILE C . n 
C 1 155 GLY 155 155 155 GLY GLY C . n 
C 1 156 ASP 156 156 156 ASP ASP C . n 
C 1 157 ALA 157 157 157 ALA ALA C . n 
C 1 158 VAL 158 158 158 VAL VAL C . n 
C 1 159 VAL 159 159 159 VAL VAL C . n 
C 1 160 ILE 160 160 160 ILE ILE C . n 
C 1 161 SER 161 161 161 SER SER C . n 
C 1 162 CYS 162 162 162 CYS CYS C . n 
C 1 163 ALA 163 163 163 ALA ALA C . n 
C 1 164 LYS 164 164 164 LYS LYS C . n 
C 1 165 ASP 165 165 165 ASP ASP C . n 
C 1 166 GLY 166 166 166 GLY GLY C . n 
C 1 167 VAL 167 167 167 VAL VAL C . n 
C 1 168 LYS 168 168 168 LYS LYS C . n 
C 1 169 PHE 169 169 169 PHE PHE C . n 
C 1 170 SER 170 170 170 SER SER C . n 
C 1 171 ALA 171 171 171 ALA ALA C . n 
C 1 172 SER 172 172 172 SER SER C . n 
C 1 173 GLY 173 173 173 GLY GLY C . n 
C 1 174 GLU 174 174 174 GLU GLU C . n 
C 1 175 LEU 175 175 175 LEU LEU C . n 
C 1 176 GLY 176 176 176 GLY GLY C . n 
C 1 177 ASN 177 177 177 ASN ASN C . n 
C 1 178 GLY 178 178 178 GLY GLY C . n 
C 1 179 ASN 179 179 179 ASN ASN C . n 
C 1 180 ILE 180 180 180 ILE ILE C . n 
C 1 181 LYS 181 181 181 LYS LYS C . n 
C 1 182 LEU 182 182 182 LEU LEU C . n 
C 1 183 SER 183 183 183 SER SER C . n 
C 1 184 GLN 184 184 184 GLN GLN C . n 
C 1 185 THR 185 185 185 THR THR C . n 
C 1 186 SER 186 186 ?   ?   ?   C . n 
C 1 187 ASN 187 187 ?   ?   ?   C . n 
C 1 188 VAL 188 188 ?   ?   ?   C . n 
C 1 189 ASP 189 189 ?   ?   ?   C . n 
C 1 190 LYS 190 190 ?   ?   ?   C . n 
C 1 191 GLU 191 191 191 GLU GLU C . n 
C 1 192 GLU 192 192 192 GLU GLU C . n 
C 1 193 GLU 193 193 193 GLU GLU C . n 
C 1 194 ALA 194 194 194 ALA ALA C . n 
C 1 195 VAL 195 195 195 VAL VAL C . n 
C 1 196 THR 196 196 196 THR THR C . n 
C 1 197 ILE 197 197 197 ILE ILE C . n 
C 1 198 GLU 198 198 198 GLU GLU C . n 
C 1 199 MET 199 199 199 MET MET C . n 
C 1 200 ASN 200 200 200 ASN ASN C . n 
C 1 201 GLU 201 201 201 GLU GLU C . n 
C 1 202 PRO 202 202 202 PRO PRO C . n 
C 1 203 VAL 203 203 203 VAL VAL C . n 
C 1 204 GLN 204 204 204 GLN GLN C . n 
C 1 205 LEU 205 205 205 LEU LEU C . n 
C 1 206 THR 206 206 206 THR THR C . n 
C 1 207 PHE 207 207 207 PHE PHE C . n 
C 1 208 ALA 208 208 208 ALA ALA C . n 
C 1 209 LEU 209 209 209 LEU LEU C . n 
C 1 210 ARG 210 210 210 ARG ARG C . n 
C 1 211 TYR 211 211 211 TYR TYR C . n 
C 1 212 LEU 212 212 212 LEU LEU C . n 
C 1 213 ASN 213 213 213 ASN ASN C . n 
C 1 214 PHE 214 214 214 PHE PHE C . n 
C 1 215 PHE 215 215 215 PHE PHE C . n 
C 1 216 THR 216 216 216 THR THR C . n 
C 1 217 LYS 217 217 217 LYS LYS C . n 
C 1 218 ALA 218 218 218 ALA ALA C . n 
C 1 219 THR 219 219 219 THR THR C . n 
C 1 220 PRO 220 220 220 PRO PRO C . n 
C 1 221 LEU 221 221 221 LEU LEU C . n 
C 1 222 SER 222 222 222 SER SER C . n 
C 1 223 SER 223 223 223 SER SER C . n 
C 1 224 THR 224 224 224 THR THR C . n 
C 1 225 VAL 225 225 225 VAL VAL C . n 
C 1 226 THR 226 226 226 THR THR C . n 
C 1 227 LEU 227 227 227 LEU LEU C . n 
C 1 228 SER 228 228 228 SER SER C . n 
C 1 229 MET 229 229 229 MET MET C . n 
C 1 230 SER 230 230 230 SER SER C . n 
C 1 231 ALA 231 231 231 ALA ALA C . n 
C 1 232 ASP 232 232 232 ASP ASP C . n 
C 1 233 VAL 233 233 233 VAL VAL C . n 
C 1 234 PRO 234 234 234 PRO PRO C . n 
C 1 235 LEU 235 235 235 LEU LEU C . n 
C 1 236 VAL 236 236 236 VAL VAL C . n 
C 1 237 VAL 237 237 237 VAL VAL C . n 
C 1 238 GLU 238 238 238 GLU GLU C . n 
C 1 239 TYR 239 239 239 TYR TYR C . n 
C 1 240 LYS 240 240 240 LYS LYS C . n 
C 1 241 ILE 241 241 241 ILE ILE C . n 
C 1 242 ALA 242 242 242 ALA ALA C . n 
C 1 243 ASP 243 243 243 ASP ASP C . n 
C 1 244 MET 244 244 244 MET MET C . n 
C 1 245 GLY 245 245 245 GLY GLY C . n 
C 1 246 HIS 246 246 246 HIS HIS C . n 
C 1 247 LEU 247 247 247 LEU LEU C . n 
C 1 248 LYS 248 248 248 LYS LYS C . n 
C 1 249 TYR 249 249 249 TYR TYR C . n 
C 1 250 TYR 250 250 250 TYR TYR C . n 
C 1 251 LEU 251 251 251 LEU LEU C . n 
C 1 252 ALA 252 252 252 ALA ALA C . n 
C 1 253 PRO 253 253 253 PRO PRO C . n 
C 1 254 LYS 254 254 254 LYS LYS C . n 
C 1 255 ILE 255 255 255 ILE ILE C . n 
C 1 256 GLU 256 256 ?   ?   ?   C . n 
C 1 257 ASP 257 257 ?   ?   ?   C . n 
C 1 258 GLU 258 258 ?   ?   ?   C . n 
C 1 259 GLU 259 259 ?   ?   ?   C . n 
C 1 260 GLY 260 260 ?   ?   ?   C . n 
C 1 261 SER 261 261 ?   ?   ?   C . n 
D 2 1   GLY 1   139 ?   ?   ?   D . n 
D 2 2   ARG 2   140 ?   ?   ?   D . n 
D 2 3   LYS 3   141 ?   ?   ?   D . n 
D 2 4   ARG 4   142 ?   ?   ?   D . n 
D 2 5   ARG 5   143 143 ARG ARG D . n 
D 2 6   GLN 6   144 144 GLN GLN D . n 
D 2 7   THR 7   145 145 THR THR D . n 
D 2 8   SER 8   146 146 SER SER D . n 
D 2 9   MET 9   147 147 MET MET D . n 
D 2 10  THR 10  148 148 THR THR D . n 
D 2 11  ASP 11  149 149 ASP ASP D . n 
D 2 12  PHE 12  150 150 PHE PHE D . n 
D 2 13  TYR 13  151 151 TYR TYR D . n 
D 2 14  HIS 14  152 152 HIS HIS D . n 
D 2 15  SER 15  153 153 SER SER D . n 
D 2 16  LYS 16  154 154 LYS LYS D . n 
D 2 17  ARG 17  155 155 ARG ARG D . n 
D 2 18  ARG 18  156 156 ARG ARG D . n 
D 2 19  LEU 19  157 157 LEU LEU D . n 
D 2 20  ILE 20  158 158 ILE ILE D . n 
D 2 21  PHE 21  159 159 PHE PHE D . n 
D 2 22  SER 22  160 160 SER SER D . n 
E 1 1   MET 1   1   1   MET MET E . n 
E 1 2   PHE 2   2   2   PHE PHE E . n 
E 1 3   GLU 3   3   3   GLU GLU E . n 
E 1 4   ALA 4   4   4   ALA ALA E . n 
E 1 5   ARG 5   5   5   ARG ARG E . n 
E 1 6   LEU 6   6   6   LEU LEU E . n 
E 1 7   VAL 7   7   7   VAL VAL E . n 
E 1 8   GLN 8   8   8   GLN GLN E . n 
E 1 9   GLY 9   9   9   GLY GLY E . n 
E 1 10  SER 10  10  10  SER SER E . n 
E 1 11  ILE 11  11  11  ILE ILE E . n 
E 1 12  LEU 12  12  12  LEU LEU E . n 
E 1 13  LYS 13  13  13  LYS LYS E . n 
E 1 14  LYS 14  14  14  LYS LYS E . n 
E 1 15  VAL 15  15  15  VAL VAL E . n 
E 1 16  LEU 16  16  16  LEU LEU E . n 
E 1 17  GLU 17  17  17  GLU GLU E . n 
E 1 18  ALA 18  18  18  ALA ALA E . n 
E 1 19  LEU 19  19  19  LEU LEU E . n 
E 1 20  LYS 20  20  20  LYS LYS E . n 
E 1 21  ASP 21  21  21  ASP ASP E . n 
E 1 22  LEU 22  22  22  LEU LEU E . n 
E 1 23  ILE 23  23  23  ILE ILE E . n 
E 1 24  ASN 24  24  24  ASN ASN E . n 
E 1 25  GLU 25  25  25  GLU GLU E . n 
E 1 26  ALA 26  26  26  ALA ALA E . n 
E 1 27  CYS 27  27  27  CYS CYS E . n 
E 1 28  TRP 28  28  28  TRP TRP E . n 
E 1 29  ASP 29  29  29  ASP ASP E . n 
E 1 30  ILE 30  30  30  ILE ILE E . n 
E 1 31  SER 31  31  31  SER SER E . n 
E 1 32  SER 32  32  32  SER SER E . n 
E 1 33  SER 33  33  33  SER SER E . n 
E 1 34  GLY 34  34  34  GLY GLY E . n 
E 1 35  VAL 35  35  35  VAL VAL E . n 
E 1 36  ASN 36  36  36  ASN ASN E . n 
E 1 37  LEU 37  37  37  LEU LEU E . n 
E 1 38  GLN 38  38  38  GLN GLN E . n 
E 1 39  SER 39  39  39  SER SER E . n 
E 1 40  MET 40  40  40  MET MET E . n 
E 1 41  ASP 41  41  41  ASP ASP E . n 
E 1 42  SER 42  42  42  SER SER E . n 
E 1 43  SER 43  43  43  SER SER E . n 
E 1 44  HIS 44  44  44  HIS HIS E . n 
E 1 45  VAL 45  45  45  VAL VAL E . n 
E 1 46  SER 46  46  46  SER SER E . n 
E 1 47  LEU 47  47  47  LEU LEU E . n 
E 1 48  VAL 48  48  48  VAL VAL E . n 
E 1 49  GLN 49  49  49  GLN GLN E . n 
E 1 50  LEU 50  50  50  LEU LEU E . n 
E 1 51  THR 51  51  51  THR THR E . n 
E 1 52  LEU 52  52  52  LEU LEU E . n 
E 1 53  ARG 53  53  53  ARG ARG E . n 
E 1 54  SER 54  54  54  SER SER E . n 
E 1 55  GLU 55  55  55  GLU GLU E . n 
E 1 56  GLY 56  56  56  GLY GLY E . n 
E 1 57  PHE 57  57  57  PHE PHE E . n 
E 1 58  ASP 58  58  58  ASP ASP E . n 
E 1 59  THR 59  59  59  THR THR E . n 
E 1 60  TYR 60  60  60  TYR TYR E . n 
E 1 61  ARG 61  61  61  ARG ARG E . n 
E 1 62  CYS 62  62  62  CYS CYS E . n 
E 1 63  ASP 63  63  63  ASP ASP E . n 
E 1 64  ARG 64  64  64  ARG ARG E . n 
E 1 65  ASN 65  65  65  ASN ASN E . n 
E 1 66  LEU 66  66  66  LEU LEU E . n 
E 1 67  ALA 67  67  67  ALA ALA E . n 
E 1 68  MET 68  68  68  MET MET E . n 
E 1 69  GLY 69  69  69  GLY GLY E . n 
E 1 70  VAL 70  70  70  VAL VAL E . n 
E 1 71  ASN 71  71  71  ASN ASN E . n 
E 1 72  LEU 72  72  72  LEU LEU E . n 
E 1 73  THR 73  73  73  THR THR E . n 
E 1 74  SER 74  74  74  SER SER E . n 
E 1 75  MET 75  75  75  MET MET E . n 
E 1 76  SER 76  76  76  SER SER E . n 
E 1 77  LYS 77  77  77  LYS LYS E . n 
E 1 78  ILE 78  78  78  ILE ILE E . n 
E 1 79  LEU 79  79  79  LEU LEU E . n 
E 1 80  LYS 80  80  80  LYS LYS E . n 
E 1 81  CYS 81  81  81  CYS CYS E . n 
E 1 82  ALA 82  82  82  ALA ALA E . n 
E 1 83  GLY 83  83  83  GLY GLY E . n 
E 1 84  ASN 84  84  84  ASN ASN E . n 
E 1 85  GLU 85  85  85  GLU GLU E . n 
E 1 86  ASP 86  86  86  ASP ASP E . n 
E 1 87  ILE 87  87  87  ILE ILE E . n 
E 1 88  ILE 88  88  88  ILE ILE E . n 
E 1 89  THR 89  89  89  THR THR E . n 
E 1 90  LEU 90  90  90  LEU LEU E . n 
E 1 91  ARG 91  91  91  ARG ARG E . n 
E 1 92  ALA 92  92  92  ALA ALA E . n 
E 1 93  GLU 93  93  93  GLU GLU E . n 
E 1 94  ASP 94  94  94  ASP ASP E . n 
E 1 95  ASN 95  95  95  ASN ASN E . n 
E 1 96  ALA 96  96  96  ALA ALA E . n 
E 1 97  ASP 97  97  97  ASP ASP E . n 
E 1 98  THR 98  98  98  THR THR E . n 
E 1 99  LEU 99  99  99  LEU LEU E . n 
E 1 100 ALA 100 100 100 ALA ALA E . n 
E 1 101 LEU 101 101 101 LEU LEU E . n 
E 1 102 VAL 102 102 102 VAL VAL E . n 
E 1 103 PHE 103 103 103 PHE PHE E . n 
E 1 104 GLU 104 104 104 GLU GLU E . n 
E 1 105 ALA 105 105 105 ALA ALA E . n 
E 1 106 PRO 106 106 106 PRO PRO E . n 
E 1 107 ASN 107 107 107 ASN ASN E . n 
E 1 108 GLN 108 108 108 GLN GLN E . n 
E 1 109 GLU 109 109 109 GLU GLU E . n 
E 1 110 LYS 110 110 110 LYS LYS E . n 
E 1 111 VAL 111 111 111 VAL VAL E . n 
E 1 112 SER 112 112 112 SER SER E . n 
E 1 113 ASP 113 113 113 ASP ASP E . n 
E 1 114 TYR 114 114 114 TYR TYR E . n 
E 1 115 GLU 115 115 115 GLU GLU E . n 
E 1 116 MET 116 116 116 MET MET E . n 
E 1 117 LYS 117 117 117 LYS LYS E . n 
E 1 118 LEU 118 118 118 LEU LEU E . n 
E 1 119 MET 119 119 119 MET MET E . n 
E 1 120 ASP 120 120 120 ASP ASP E . n 
E 1 121 LEU 121 121 121 LEU LEU E . n 
E 1 122 ASP 122 122 122 ASP ASP E . n 
E 1 123 VAL 123 123 123 VAL VAL E . n 
E 1 124 GLU 124 124 124 GLU GLU E . n 
E 1 125 GLN 125 125 125 GLN GLN E . n 
E 1 126 LEU 126 126 126 LEU LEU E . n 
E 1 127 GLY 127 127 127 GLY GLY E . n 
E 1 128 ILE 128 128 128 ILE ILE E . n 
E 1 129 PRO 129 129 129 PRO PRO E . n 
E 1 130 GLU 130 130 130 GLU GLU E . n 
E 1 131 GLN 131 131 131 GLN GLN E . n 
E 1 132 GLU 132 132 132 GLU GLU E . n 
E 1 133 TYR 133 133 133 TYR TYR E . n 
E 1 134 SER 134 134 134 SER SER E . n 
E 1 135 CYS 135 135 135 CYS CYS E . n 
E 1 136 VAL 136 136 136 VAL VAL E . n 
E 1 137 VAL 137 137 137 VAL VAL E . n 
E 1 138 LYS 138 138 138 LYS LYS E . n 
E 1 139 MET 139 139 139 MET MET E . n 
E 1 140 PRO 140 140 140 PRO PRO E . n 
E 1 141 SER 141 141 141 SER SER E . n 
E 1 142 GLY 142 142 142 GLY GLY E . n 
E 1 143 GLU 143 143 143 GLU GLU E . n 
E 1 144 PHE 144 144 144 PHE PHE E . n 
E 1 145 ALA 145 145 145 ALA ALA E . n 
E 1 146 ARG 146 146 146 ARG ARG E . n 
E 1 147 ILE 147 147 147 ILE ILE E . n 
E 1 148 CYS 148 148 148 CYS CYS E . n 
E 1 149 ARG 149 149 149 ARG ARG E . n 
E 1 150 ASP 150 150 150 ASP ASP E . n 
E 1 151 LEU 151 151 151 LEU LEU E . n 
E 1 152 SER 152 152 152 SER SER E . n 
E 1 153 HIS 153 153 153 HIS HIS E . n 
E 1 154 ILE 154 154 154 ILE ILE E . n 
E 1 155 GLY 155 155 155 GLY GLY E . n 
E 1 156 ASP 156 156 156 ASP ASP E . n 
E 1 157 ALA 157 157 157 ALA ALA E . n 
E 1 158 VAL 158 158 158 VAL VAL E . n 
E 1 159 VAL 159 159 159 VAL VAL E . n 
E 1 160 ILE 160 160 160 ILE ILE E . n 
E 1 161 SER 161 161 161 SER SER E . n 
E 1 162 CYS 162 162 162 CYS CYS E . n 
E 1 163 ALA 163 163 163 ALA ALA E . n 
E 1 164 LYS 164 164 164 LYS LYS E . n 
E 1 165 ASP 165 165 165 ASP ASP E . n 
E 1 166 GLY 166 166 166 GLY GLY E . n 
E 1 167 VAL 167 167 167 VAL VAL E . n 
E 1 168 LYS 168 168 168 LYS LYS E . n 
E 1 169 PHE 169 169 169 PHE PHE E . n 
E 1 170 SER 170 170 170 SER SER E . n 
E 1 171 ALA 171 171 171 ALA ALA E . n 
E 1 172 SER 172 172 172 SER SER E . n 
E 1 173 GLY 173 173 173 GLY GLY E . n 
E 1 174 GLU 174 174 174 GLU GLU E . n 
E 1 175 LEU 175 175 175 LEU LEU E . n 
E 1 176 GLY 176 176 176 GLY GLY E . n 
E 1 177 ASN 177 177 177 ASN ASN E . n 
E 1 178 GLY 178 178 178 GLY GLY E . n 
E 1 179 ASN 179 179 179 ASN ASN E . n 
E 1 180 ILE 180 180 180 ILE ILE E . n 
E 1 181 LYS 181 181 181 LYS LYS E . n 
E 1 182 LEU 182 182 182 LEU LEU E . n 
E 1 183 SER 183 183 183 SER SER E . n 
E 1 184 GLN 184 184 184 GLN GLN E . n 
E 1 185 THR 185 185 185 THR THR E . n 
E 1 186 SER 186 186 186 SER SER E . n 
E 1 187 ASN 187 187 187 ASN ASN E . n 
E 1 188 VAL 188 188 188 VAL VAL E . n 
E 1 189 ASP 189 189 ?   ?   ?   E . n 
E 1 190 LYS 190 190 ?   ?   ?   E . n 
E 1 191 GLU 191 191 191 GLU GLU E . n 
E 1 192 GLU 192 192 192 GLU GLU E . n 
E 1 193 GLU 193 193 193 GLU GLU E . n 
E 1 194 ALA 194 194 194 ALA ALA E . n 
E 1 195 VAL 195 195 195 VAL VAL E . n 
E 1 196 THR 196 196 196 THR THR E . n 
E 1 197 ILE 197 197 197 ILE ILE E . n 
E 1 198 GLU 198 198 198 GLU GLU E . n 
E 1 199 MET 199 199 199 MET MET E . n 
E 1 200 ASN 200 200 200 ASN ASN E . n 
E 1 201 GLU 201 201 201 GLU GLU E . n 
E 1 202 PRO 202 202 202 PRO PRO E . n 
E 1 203 VAL 203 203 203 VAL VAL E . n 
E 1 204 GLN 204 204 204 GLN GLN E . n 
E 1 205 LEU 205 205 205 LEU LEU E . n 
E 1 206 THR 206 206 206 THR THR E . n 
E 1 207 PHE 207 207 207 PHE PHE E . n 
E 1 208 ALA 208 208 208 ALA ALA E . n 
E 1 209 LEU 209 209 209 LEU LEU E . n 
E 1 210 ARG 210 210 210 ARG ARG E . n 
E 1 211 TYR 211 211 211 TYR TYR E . n 
E 1 212 LEU 212 212 212 LEU LEU E . n 
E 1 213 ASN 213 213 213 ASN ASN E . n 
E 1 214 PHE 214 214 214 PHE PHE E . n 
E 1 215 PHE 215 215 215 PHE PHE E . n 
E 1 216 THR 216 216 216 THR THR E . n 
E 1 217 LYS 217 217 217 LYS LYS E . n 
E 1 218 ALA 218 218 218 ALA ALA E . n 
E 1 219 THR 219 219 219 THR THR E . n 
E 1 220 PRO 220 220 220 PRO PRO E . n 
E 1 221 LEU 221 221 221 LEU LEU E . n 
E 1 222 SER 222 222 222 SER SER E . n 
E 1 223 SER 223 223 223 SER SER E . n 
E 1 224 THR 224 224 224 THR THR E . n 
E 1 225 VAL 225 225 225 VAL VAL E . n 
E 1 226 THR 226 226 226 THR THR E . n 
E 1 227 LEU 227 227 227 LEU LEU E . n 
E 1 228 SER 228 228 228 SER SER E . n 
E 1 229 MET 229 229 229 MET MET E . n 
E 1 230 SER 230 230 230 SER SER E . n 
E 1 231 ALA 231 231 231 ALA ALA E . n 
E 1 232 ASP 232 232 232 ASP ASP E . n 
E 1 233 VAL 233 233 233 VAL VAL E . n 
E 1 234 PRO 234 234 234 PRO PRO E . n 
E 1 235 LEU 235 235 235 LEU LEU E . n 
E 1 236 VAL 236 236 236 VAL VAL E . n 
E 1 237 VAL 237 237 237 VAL VAL E . n 
E 1 238 GLU 238 238 238 GLU GLU E . n 
E 1 239 TYR 239 239 239 TYR TYR E . n 
E 1 240 LYS 240 240 240 LYS LYS E . n 
E 1 241 ILE 241 241 241 ILE ILE E . n 
E 1 242 ALA 242 242 242 ALA ALA E . n 
E 1 243 ASP 243 243 243 ASP ASP E . n 
E 1 244 MET 244 244 244 MET MET E . n 
E 1 245 GLY 245 245 245 GLY GLY E . n 
E 1 246 HIS 246 246 246 HIS HIS E . n 
E 1 247 LEU 247 247 247 LEU LEU E . n 
E 1 248 LYS 248 248 248 LYS LYS E . n 
E 1 249 TYR 249 249 249 TYR TYR E . n 
E 1 250 TYR 250 250 250 TYR TYR E . n 
E 1 251 LEU 251 251 251 LEU LEU E . n 
E 1 252 ALA 252 252 252 ALA ALA E . n 
E 1 253 PRO 253 253 253 PRO PRO E . n 
E 1 254 LYS 254 254 254 LYS LYS E . n 
E 1 255 ILE 255 255 255 ILE ILE E . n 
E 1 256 GLU 256 256 ?   ?   ?   E . n 
E 1 257 ASP 257 257 ?   ?   ?   E . n 
E 1 258 GLU 258 258 ?   ?   ?   E . n 
E 1 259 GLU 259 259 ?   ?   ?   E . n 
E 1 260 GLY 260 260 ?   ?   ?   E . n 
E 1 261 SER 261 261 ?   ?   ?   E . n 
F 2 1   GLY 1   139 ?   ?   ?   F . n 
F 2 2   ARG 2   140 ?   ?   ?   F . n 
F 2 3   LYS 3   141 ?   ?   ?   F . n 
F 2 4   ARG 4   142 ?   ?   ?   F . n 
F 2 5   ARG 5   143 143 ARG ARG F . n 
F 2 6   GLN 6   144 144 GLN GLN F . n 
F 2 7   THR 7   145 145 THR THR F . n 
F 2 8   SER 8   146 146 SER SER F . n 
F 2 9   MET 9   147 147 MET MET F . n 
F 2 10  THR 10  148 148 THR THR F . n 
F 2 11  ASP 11  149 149 ASP ASP F . n 
F 2 12  PHE 12  150 150 PHE PHE F . n 
F 2 13  TYR 13  151 151 TYR TYR F . n 
F 2 14  HIS 14  152 152 HIS HIS F . n 
F 2 15  SER 15  153 153 SER SER F . n 
F 2 16  LYS 16  154 154 LYS LYS F . n 
F 2 17  ARG 17  155 155 ARG ARG F . n 
F 2 18  ARG 18  156 156 ARG ARG F . n 
F 2 19  LEU 19  157 157 LEU LEU F . n 
F 2 20  ILE 20  158 158 ILE ILE F . n 
F 2 21  PHE 21  159 159 PHE PHE F . n 
F 2 22  SER 22  160 160 SER SER F . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
G 3 HOH 1  262 1   HOH HOH A . 
G 3 HOH 2  263 2   HOH HOH A . 
G 3 HOH 3  264 3   HOH HOH A . 
G 3 HOH 4  265 4   HOH HOH A . 
G 3 HOH 5  266 5   HOH HOH A . 
G 3 HOH 6  267 6   HOH HOH A . 
G 3 HOH 7  268 7   HOH HOH A . 
G 3 HOH 8  269 8   HOH HOH A . 
G 3 HOH 9  270 9   HOH HOH A . 
G 3 HOH 10 271 10  HOH HOH A . 
G 3 HOH 11 272 11  HOH HOH A . 
G 3 HOH 12 273 12  HOH HOH A . 
G 3 HOH 13 274 13  HOH HOH A . 
G 3 HOH 14 275 14  HOH HOH A . 
G 3 HOH 15 276 15  HOH HOH A . 
G 3 HOH 16 277 16  HOH HOH A . 
G 3 HOH 17 278 17  HOH HOH A . 
G 3 HOH 18 279 18  HOH HOH A . 
G 3 HOH 19 280 19  HOH HOH A . 
G 3 HOH 20 281 20  HOH HOH A . 
G 3 HOH 21 282 21  HOH HOH A . 
G 3 HOH 22 283 22  HOH HOH A . 
G 3 HOH 23 284 23  HOH HOH A . 
G 3 HOH 24 285 24  HOH HOH A . 
G 3 HOH 25 286 26  HOH HOH A . 
G 3 HOH 26 287 28  HOH HOH A . 
G 3 HOH 27 288 30  HOH HOH A . 
G 3 HOH 28 289 31  HOH HOH A . 
G 3 HOH 29 290 32  HOH HOH A . 
G 3 HOH 30 291 33  HOH HOH A . 
G 3 HOH 31 292 34  HOH HOH A . 
G 3 HOH 32 293 35  HOH HOH A . 
G 3 HOH 33 294 36  HOH HOH A . 
G 3 HOH 34 295 37  HOH HOH A . 
G 3 HOH 35 296 38  HOH HOH A . 
G 3 HOH 36 297 39  HOH HOH A . 
G 3 HOH 37 298 40  HOH HOH A . 
G 3 HOH 38 299 41  HOH HOH A . 
G 3 HOH 39 300 42  HOH HOH A . 
G 3 HOH 40 301 43  HOH HOH A . 
G 3 HOH 41 302 44  HOH HOH A . 
G 3 HOH 42 303 45  HOH HOH A . 
G 3 HOH 43 304 46  HOH HOH A . 
G 3 HOH 44 305 47  HOH HOH A . 
G 3 HOH 45 306 48  HOH HOH A . 
G 3 HOH 46 307 49  HOH HOH A . 
G 3 HOH 47 308 50  HOH HOH A . 
G 3 HOH 48 309 51  HOH HOH A . 
G 3 HOH 49 310 52  HOH HOH A . 
G 3 HOH 50 311 53  HOH HOH A . 
G 3 HOH 51 312 55  HOH HOH A . 
G 3 HOH 52 313 56  HOH HOH A . 
G 3 HOH 53 314 57  HOH HOH A . 
G 3 HOH 54 315 59  HOH HOH A . 
G 3 HOH 55 316 60  HOH HOH A . 
G 3 HOH 56 317 61  HOH HOH A . 
G 3 HOH 57 318 62  HOH HOH A . 
G 3 HOH 58 319 63  HOH HOH A . 
G 3 HOH 59 320 64  HOH HOH A . 
G 3 HOH 60 321 65  HOH HOH A . 
G 3 HOH 61 322 66  HOH HOH A . 
G 3 HOH 62 323 67  HOH HOH A . 
G 3 HOH 63 324 68  HOH HOH A . 
G 3 HOH 64 325 70  HOH HOH A . 
G 3 HOH 65 326 128 HOH HOH A . 
G 3 HOH 66 327 132 HOH HOH A . 
G 3 HOH 67 328 139 HOH HOH A . 
G 3 HOH 68 329 206 HOH HOH A . 
G 3 HOH 69 330 216 HOH HOH A . 
G 3 HOH 70 331 227 HOH HOH A . 
G 3 HOH 71 332 228 HOH HOH A . 
G 3 HOH 72 333 233 HOH HOH A . 
G 3 HOH 73 334 241 HOH HOH A . 
G 3 HOH 74 335 242 HOH HOH A . 
G 3 HOH 75 336 248 HOH HOH A . 
G 3 HOH 76 337 254 HOH HOH A . 
G 3 HOH 77 338 260 HOH HOH A . 
G 3 HOH 78 339 261 HOH HOH A . 
G 3 HOH 79 340 265 HOH HOH A . 
G 3 HOH 80 341 266 HOH HOH A . 
G 3 HOH 81 342 267 HOH HOH A . 
G 3 HOH 82 343 268 HOH HOH A . 
G 3 HOH 83 344 270 HOH HOH A . 
G 3 HOH 84 345 272 HOH HOH A . 
G 3 HOH 85 346 274 HOH HOH A . 
G 3 HOH 86 347 277 HOH HOH A . 
G 3 HOH 87 348 289 HOH HOH A . 
H 3 HOH 1  25  25  HOH HOH B . 
H 3 HOH 2  27  27  HOH HOH B . 
H 3 HOH 3  29  29  HOH HOH B . 
H 3 HOH 4  54  54  HOH HOH B . 
H 3 HOH 5  209 209 HOH HOH B . 
H 3 HOH 6  210 210 HOH HOH B . 
H 3 HOH 7  271 271 HOH HOH B . 
H 3 HOH 8  275 275 HOH HOH B . 
H 3 HOH 9  276 276 HOH HOH B . 
H 3 HOH 10 278 278 HOH HOH B . 
H 3 HOH 11 293 293 HOH HOH B . 
I 3 HOH 1  262 69  HOH HOH C . 
I 3 HOH 2  263 71  HOH HOH C . 
I 3 HOH 3  264 73  HOH HOH C . 
I 3 HOH 4  265 74  HOH HOH C . 
I 3 HOH 5  266 75  HOH HOH C . 
I 3 HOH 6  267 76  HOH HOH C . 
I 3 HOH 7  268 77  HOH HOH C . 
I 3 HOH 8  269 78  HOH HOH C . 
I 3 HOH 9  270 79  HOH HOH C . 
I 3 HOH 10 271 80  HOH HOH C . 
I 3 HOH 11 272 81  HOH HOH C . 
I 3 HOH 12 273 82  HOH HOH C . 
I 3 HOH 13 274 83  HOH HOH C . 
I 3 HOH 14 275 84  HOH HOH C . 
I 3 HOH 15 276 85  HOH HOH C . 
I 3 HOH 16 277 86  HOH HOH C . 
I 3 HOH 17 278 87  HOH HOH C . 
I 3 HOH 18 279 88  HOH HOH C . 
I 3 HOH 19 280 89  HOH HOH C . 
I 3 HOH 20 281 90  HOH HOH C . 
I 3 HOH 21 282 91  HOH HOH C . 
I 3 HOH 22 283 92  HOH HOH C . 
I 3 HOH 23 284 93  HOH HOH C . 
I 3 HOH 24 285 94  HOH HOH C . 
I 3 HOH 25 286 95  HOH HOH C . 
I 3 HOH 26 287 96  HOH HOH C . 
I 3 HOH 27 288 98  HOH HOH C . 
I 3 HOH 28 289 100 HOH HOH C . 
I 3 HOH 29 290 102 HOH HOH C . 
I 3 HOH 30 291 103 HOH HOH C . 
I 3 HOH 31 292 104 HOH HOH C . 
I 3 HOH 32 293 105 HOH HOH C . 
I 3 HOH 33 294 106 HOH HOH C . 
I 3 HOH 34 295 107 HOH HOH C . 
I 3 HOH 35 296 108 HOH HOH C . 
I 3 HOH 36 297 109 HOH HOH C . 
I 3 HOH 37 298 110 HOH HOH C . 
I 3 HOH 38 299 111 HOH HOH C . 
I 3 HOH 39 300 112 HOH HOH C . 
I 3 HOH 40 301 113 HOH HOH C . 
I 3 HOH 41 302 114 HOH HOH C . 
I 3 HOH 42 303 115 HOH HOH C . 
I 3 HOH 43 304 116 HOH HOH C . 
I 3 HOH 44 305 117 HOH HOH C . 
I 3 HOH 45 306 118 HOH HOH C . 
I 3 HOH 46 307 119 HOH HOH C . 
I 3 HOH 47 308 120 HOH HOH C . 
I 3 HOH 48 309 121 HOH HOH C . 
I 3 HOH 49 310 122 HOH HOH C . 
I 3 HOH 50 311 123 HOH HOH C . 
I 3 HOH 51 312 124 HOH HOH C . 
I 3 HOH 52 313 126 HOH HOH C . 
I 3 HOH 53 314 129 HOH HOH C . 
I 3 HOH 54 315 130 HOH HOH C . 
I 3 HOH 55 316 131 HOH HOH C . 
I 3 HOH 56 317 133 HOH HOH C . 
I 3 HOH 57 318 134 HOH HOH C . 
I 3 HOH 58 319 135 HOH HOH C . 
I 3 HOH 59 320 136 HOH HOH C . 
I 3 HOH 60 321 137 HOH HOH C . 
I 3 HOH 61 322 213 HOH HOH C . 
I 3 HOH 62 323 214 HOH HOH C . 
I 3 HOH 63 324 215 HOH HOH C . 
I 3 HOH 64 325 219 HOH HOH C . 
I 3 HOH 65 326 220 HOH HOH C . 
I 3 HOH 66 327 225 HOH HOH C . 
I 3 HOH 67 328 229 HOH HOH C . 
I 3 HOH 68 329 232 HOH HOH C . 
I 3 HOH 69 330 235 HOH HOH C . 
I 3 HOH 70 331 236 HOH HOH C . 
I 3 HOH 71 332 239 HOH HOH C . 
I 3 HOH 72 333 247 HOH HOH C . 
I 3 HOH 73 334 249 HOH HOH C . 
I 3 HOH 74 335 250 HOH HOH C . 
I 3 HOH 75 336 251 HOH HOH C . 
I 3 HOH 76 337 252 HOH HOH C . 
I 3 HOH 77 338 253 HOH HOH C . 
I 3 HOH 78 339 283 HOH HOH C . 
I 3 HOH 79 340 284 HOH HOH C . 
J 3 HOH 1  72  72  HOH HOH D . 
J 3 HOH 2  97  97  HOH HOH D . 
J 3 HOH 3  99  99  HOH HOH D . 
J 3 HOH 4  101 101 HOH HOH D . 
J 3 HOH 5  125 125 HOH HOH D . 
J 3 HOH 6  211 211 HOH HOH D . 
J 3 HOH 7  226 226 HOH HOH D . 
J 3 HOH 8  244 244 HOH HOH D . 
J 3 HOH 9  269 269 HOH HOH D . 
J 3 HOH 10 273 273 HOH HOH D . 
J 3 HOH 11 279 279 HOH HOH D . 
J 3 HOH 12 282 282 HOH HOH D . 
J 3 HOH 13 288 288 HOH HOH D . 
J 3 HOH 14 294 294 HOH HOH D . 
K 3 HOH 1  262 58  HOH HOH E . 
K 3 HOH 2  263 127 HOH HOH E . 
K 3 HOH 3  264 138 HOH HOH E . 
K 3 HOH 4  265 140 HOH HOH E . 
K 3 HOH 5  266 141 HOH HOH E . 
K 3 HOH 6  267 142 HOH HOH E . 
K 3 HOH 7  268 143 HOH HOH E . 
K 3 HOH 8  269 144 HOH HOH E . 
K 3 HOH 9  270 145 HOH HOH E . 
K 3 HOH 10 271 146 HOH HOH E . 
K 3 HOH 11 272 147 HOH HOH E . 
K 3 HOH 12 273 148 HOH HOH E . 
K 3 HOH 13 274 149 HOH HOH E . 
K 3 HOH 14 275 150 HOH HOH E . 
K 3 HOH 15 276 151 HOH HOH E . 
K 3 HOH 16 277 152 HOH HOH E . 
K 3 HOH 17 278 153 HOH HOH E . 
K 3 HOH 18 279 154 HOH HOH E . 
K 3 HOH 19 280 155 HOH HOH E . 
K 3 HOH 20 281 156 HOH HOH E . 
K 3 HOH 21 282 157 HOH HOH E . 
K 3 HOH 22 283 158 HOH HOH E . 
K 3 HOH 23 284 159 HOH HOH E . 
K 3 HOH 24 285 160 HOH HOH E . 
K 3 HOH 25 286 161 HOH HOH E . 
K 3 HOH 26 287 162 HOH HOH E . 
K 3 HOH 27 288 163 HOH HOH E . 
K 3 HOH 28 289 164 HOH HOH E . 
K 3 HOH 29 290 166 HOH HOH E . 
K 3 HOH 30 291 168 HOH HOH E . 
K 3 HOH 31 292 170 HOH HOH E . 
K 3 HOH 32 293 171 HOH HOH E . 
K 3 HOH 33 294 172 HOH HOH E . 
K 3 HOH 34 295 173 HOH HOH E . 
K 3 HOH 35 296 174 HOH HOH E . 
K 3 HOH 36 297 175 HOH HOH E . 
K 3 HOH 37 298 176 HOH HOH E . 
K 3 HOH 38 299 177 HOH HOH E . 
K 3 HOH 39 300 178 HOH HOH E . 
K 3 HOH 40 301 179 HOH HOH E . 
K 3 HOH 41 302 180 HOH HOH E . 
K 3 HOH 42 303 181 HOH HOH E . 
K 3 HOH 43 304 182 HOH HOH E . 
K 3 HOH 44 305 183 HOH HOH E . 
K 3 HOH 45 306 184 HOH HOH E . 
K 3 HOH 46 307 185 HOH HOH E . 
K 3 HOH 47 308 186 HOH HOH E . 
K 3 HOH 48 309 187 HOH HOH E . 
K 3 HOH 49 310 188 HOH HOH E . 
K 3 HOH 50 311 189 HOH HOH E . 
K 3 HOH 51 312 190 HOH HOH E . 
K 3 HOH 52 313 191 HOH HOH E . 
K 3 HOH 53 314 192 HOH HOH E . 
K 3 HOH 54 315 194 HOH HOH E . 
K 3 HOH 55 316 195 HOH HOH E . 
K 3 HOH 56 317 196 HOH HOH E . 
K 3 HOH 57 318 197 HOH HOH E . 
K 3 HOH 58 319 198 HOH HOH E . 
K 3 HOH 59 320 199 HOH HOH E . 
K 3 HOH 60 321 200 HOH HOH E . 
K 3 HOH 61 322 201 HOH HOH E . 
K 3 HOH 62 323 202 HOH HOH E . 
K 3 HOH 63 324 203 HOH HOH E . 
K 3 HOH 64 325 204 HOH HOH E . 
K 3 HOH 65 326 207 HOH HOH E . 
K 3 HOH 66 327 208 HOH HOH E . 
K 3 HOH 67 328 212 HOH HOH E . 
K 3 HOH 68 329 217 HOH HOH E . 
K 3 HOH 69 330 218 HOH HOH E . 
K 3 HOH 70 331 221 HOH HOH E . 
K 3 HOH 71 332 222 HOH HOH E . 
K 3 HOH 72 333 223 HOH HOH E . 
K 3 HOH 73 334 224 HOH HOH E . 
K 3 HOH 74 335 230 HOH HOH E . 
K 3 HOH 75 336 231 HOH HOH E . 
K 3 HOH 76 337 234 HOH HOH E . 
K 3 HOH 77 338 237 HOH HOH E . 
K 3 HOH 78 339 238 HOH HOH E . 
K 3 HOH 79 340 240 HOH HOH E . 
K 3 HOH 80 341 243 HOH HOH E . 
K 3 HOH 81 342 245 HOH HOH E . 
K 3 HOH 82 343 246 HOH HOH E . 
K 3 HOH 83 344 255 HOH HOH E . 
K 3 HOH 84 345 256 HOH HOH E . 
K 3 HOH 85 346 258 HOH HOH E . 
K 3 HOH 86 347 259 HOH HOH E . 
K 3 HOH 87 348 262 HOH HOH E . 
K 3 HOH 88 349 264 HOH HOH E . 
K 3 HOH 89 350 285 HOH HOH E . 
K 3 HOH 90 351 286 HOH HOH E . 
K 3 HOH 91 352 287 HOH HOH E . 
L 3 HOH 1  165 165 HOH HOH F . 
L 3 HOH 2  167 167 HOH HOH F . 
L 3 HOH 3  169 169 HOH HOH F . 
L 3 HOH 4  193 193 HOH HOH F . 
L 3 HOH 5  205 205 HOH HOH F . 
L 3 HOH 6  257 257 HOH HOH F . 
L 3 HOH 7  263 263 HOH HOH F . 
L 3 HOH 8  280 280 HOH HOH F . 
L 3 HOH 9  281 281 HOH HOH F . 
L 3 HOH 10 290 290 HOH HOH F . 
L 3 HOH 11 291 291 HOH HOH F . 
L 3 HOH 12 292 292 HOH HOH F . 
L 3 HOH 13 295 295 HOH HOH F . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   hexameric 
_pdbx_struct_assembly.oligomeric_count     6 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 10640 ? 
1 MORE         -40   ? 
1 'SSA (A^2)'  33290 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1998-01-28 
2 'Structure model' 1 1 2008-03-24 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
X-PLOR 'model building' 3.8 ? 1 
X-PLOR refinement       3.8 ? 2 
X-PLOR phasing          3.8 ? 3 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             C 
_pdbx_validate_rmsd_angle.auth_asym_id_1             E 
_pdbx_validate_rmsd_angle.auth_comp_id_1             ALA 
_pdbx_validate_rmsd_angle.auth_seq_id_1              105 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             N 
_pdbx_validate_rmsd_angle.auth_asym_id_2             E 
_pdbx_validate_rmsd_angle.auth_comp_id_2             PRO 
_pdbx_validate_rmsd_angle.auth_seq_id_2              106 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             CA 
_pdbx_validate_rmsd_angle.auth_asym_id_3             E 
_pdbx_validate_rmsd_angle.auth_comp_id_3             PRO 
_pdbx_validate_rmsd_angle.auth_seq_id_3              106 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                128.97 
_pdbx_validate_rmsd_angle.angle_target_value         119.30 
_pdbx_validate_rmsd_angle.angle_deviation            9.67 
_pdbx_validate_rmsd_angle.angle_standard_deviation   1.50 
_pdbx_validate_rmsd_angle.linker_flag                Y 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 LYS A 20  ? ? -36.14  -36.57 
2  1 GLU A 198 ? ? -100.27 75.88  
3  1 MET A 244 ? ? -128.14 -59.35 
4  1 THR C 216 ? ? -49.97  -17.58 
5  1 LYS C 217 ? ? -68.10  2.66   
6  1 ALA C 242 ? ? -43.65  107.31 
7  1 PRO E 106 ? ? -28.42  -51.92 
8  1 ASP E 122 ? ? -105.33 78.63  
9  1 ASN E 187 ? ? 39.71   84.90  
10 1 GLU E 201 ? ? -172.48 139.46 
11 1 THR E 216 ? ? -57.71  -3.88  
12 1 ALA E 242 ? ? -29.73  123.02 
13 1 ASP E 243 ? ? 67.96   -16.22 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A GLU 109 ? CG  ? A GLU 109 CG  
2  1 Y 1 A GLU 109 ? CD  ? A GLU 109 CD  
3  1 Y 1 A GLU 109 ? OE1 ? A GLU 109 OE1 
4  1 Y 1 A GLU 109 ? OE2 ? A GLU 109 OE2 
5  1 Y 1 A GLU 191 ? CG  ? A GLU 191 CG  
6  1 Y 1 A GLU 191 ? CD  ? A GLU 191 CD  
7  1 Y 1 A GLU 191 ? OE1 ? A GLU 191 OE1 
8  1 Y 1 A GLU 191 ? OE2 ? A GLU 191 OE2 
9  1 Y 1 A GLU 198 ? CG  ? A GLU 198 CG  
10 1 Y 1 A GLU 198 ? CD  ? A GLU 198 CD  
11 1 Y 1 A GLU 198 ? OE1 ? A GLU 198 OE1 
12 1 Y 1 A GLU 198 ? OE2 ? A GLU 198 OE2 
13 1 Y 1 A ASP 232 ? CG  ? A ASP 232 CG  
14 1 Y 1 A ASP 232 ? OD1 ? A ASP 232 OD1 
15 1 Y 1 A ASP 232 ? OD2 ? A ASP 232 OD2 
16 1 Y 1 A ILE 255 ? CG1 ? A ILE 255 CG1 
17 1 Y 1 A ILE 255 ? CG2 ? A ILE 255 CG2 
18 1 Y 1 A ILE 255 ? CD1 ? A ILE 255 CD1 
19 1 Y 1 B ARG 143 ? CG  ? B ARG 5   CG  
20 1 Y 1 B ARG 143 ? CD  ? B ARG 5   CD  
21 1 Y 1 B ARG 143 ? NE  ? B ARG 5   NE  
22 1 Y 1 B ARG 143 ? CZ  ? B ARG 5   CZ  
23 1 Y 1 B ARG 143 ? NH1 ? B ARG 5   NH1 
24 1 Y 1 B ARG 143 ? NH2 ? B ARG 5   NH2 
25 1 Y 1 C GLU 109 ? CG  ? C GLU 109 CG  
26 1 Y 1 C GLU 109 ? CD  ? C GLU 109 CD  
27 1 Y 1 C GLU 109 ? OE1 ? C GLU 109 OE1 
28 1 Y 1 C GLU 109 ? OE2 ? C GLU 109 OE2 
29 1 Y 1 C GLU 191 ? CG  ? C GLU 191 CG  
30 1 Y 1 C GLU 191 ? CD  ? C GLU 191 CD  
31 1 Y 1 C GLU 191 ? OE1 ? C GLU 191 OE1 
32 1 Y 1 C GLU 191 ? OE2 ? C GLU 191 OE2 
33 1 Y 1 C GLU 198 ? CG  ? C GLU 198 CG  
34 1 Y 1 C GLU 198 ? CD  ? C GLU 198 CD  
35 1 Y 1 C GLU 198 ? OE1 ? C GLU 198 OE1 
36 1 Y 1 C GLU 198 ? OE2 ? C GLU 198 OE2 
37 1 Y 1 C ARG 210 ? CG  ? C ARG 210 CG  
38 1 Y 1 C ARG 210 ? CD  ? C ARG 210 CD  
39 1 Y 1 C ARG 210 ? NE  ? C ARG 210 NE  
40 1 Y 1 C ARG 210 ? CZ  ? C ARG 210 CZ  
41 1 Y 1 C ARG 210 ? NH1 ? C ARG 210 NH1 
42 1 Y 1 C ARG 210 ? NH2 ? C ARG 210 NH2 
43 1 Y 1 C ASP 232 ? CG  ? C ASP 232 CG  
44 1 Y 1 C ASP 232 ? OD1 ? C ASP 232 OD1 
45 1 Y 1 C ASP 232 ? OD2 ? C ASP 232 OD2 
46 1 Y 1 C ILE 255 ? CG1 ? C ILE 255 CG1 
47 1 Y 1 C ILE 255 ? CG2 ? C ILE 255 CG2 
48 1 Y 1 C ILE 255 ? CD1 ? C ILE 255 CD1 
49 1 Y 1 D ARG 143 ? CG  ? D ARG 5   CG  
50 1 Y 1 D ARG 143 ? CD  ? D ARG 5   CD  
51 1 Y 1 D ARG 143 ? NE  ? D ARG 5   NE  
52 1 Y 1 D ARG 143 ? CZ  ? D ARG 5   CZ  
53 1 Y 1 D ARG 143 ? NH1 ? D ARG 5   NH1 
54 1 Y 1 D ARG 143 ? NH2 ? D ARG 5   NH2 
55 1 Y 1 E ASN 107 ? CG  ? E ASN 107 CG  
56 1 Y 1 E ASN 107 ? OD1 ? E ASN 107 OD1 
57 1 Y 1 E ASN 107 ? ND2 ? E ASN 107 ND2 
58 1 Y 1 E GLN 108 ? CG  ? E GLN 108 CG  
59 1 Y 1 E GLN 108 ? CD  ? E GLN 108 CD  
60 1 Y 1 E GLN 108 ? OE1 ? E GLN 108 OE1 
61 1 Y 1 E GLN 108 ? NE2 ? E GLN 108 NE2 
62 1 Y 1 E GLU 109 ? CG  ? E GLU 109 CG  
63 1 Y 1 E GLU 109 ? CD  ? E GLU 109 CD  
64 1 Y 1 E GLU 109 ? OE1 ? E GLU 109 OE1 
65 1 Y 1 E GLU 109 ? OE2 ? E GLU 109 OE2 
66 1 Y 1 E ASP 165 ? CG  ? E ASP 165 CG  
67 1 Y 1 E ASP 165 ? OD1 ? E ASP 165 OD1 
68 1 Y 1 E ASP 165 ? OD2 ? E ASP 165 OD2 
69 1 Y 1 E SER 186 ? OG  ? E SER 186 OG  
70 1 Y 1 E ASN 187 ? CG  ? E ASN 187 CG  
71 1 Y 1 E ASN 187 ? OD1 ? E ASN 187 OD1 
72 1 Y 1 E ASN 187 ? ND2 ? E ASN 187 ND2 
73 1 Y 1 E GLU 191 ? CG  ? E GLU 191 CG  
74 1 Y 1 E GLU 191 ? CD  ? E GLU 191 CD  
75 1 Y 1 E GLU 191 ? OE1 ? E GLU 191 OE1 
76 1 Y 1 E GLU 191 ? OE2 ? E GLU 191 OE2 
77 1 Y 1 E GLU 198 ? CG  ? E GLU 198 CG  
78 1 Y 1 E GLU 198 ? CD  ? E GLU 198 CD  
79 1 Y 1 E GLU 198 ? OE1 ? E GLU 198 OE1 
80 1 Y 1 E GLU 198 ? OE2 ? E GLU 198 OE2 
81 1 Y 1 E ASP 232 ? CG  ? E ASP 232 CG  
82 1 Y 1 E ASP 232 ? OD1 ? E ASP 232 OD1 
83 1 Y 1 E ASP 232 ? OD2 ? E ASP 232 OD2 
84 1 Y 1 E ILE 255 ? CG1 ? E ILE 255 CG1 
85 1 Y 1 E ILE 255 ? CG2 ? E ILE 255 CG2 
86 1 Y 1 E ILE 255 ? CD1 ? E ILE 255 CD1 
87 1 Y 1 F ARG 143 ? CG  ? F ARG 5   CG  
88 1 Y 1 F ARG 143 ? CD  ? F ARG 5   CD  
89 1 Y 1 F ARG 143 ? NE  ? F ARG 5   NE  
90 1 Y 1 F ARG 143 ? CZ  ? F ARG 5   CZ  
91 1 Y 1 F ARG 143 ? NH1 ? F ARG 5   NH1 
92 1 Y 1 F ARG 143 ? NH2 ? F ARG 5   NH2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A ASN 107 ? A ASN 107 
2  1 Y 1 A GLN 108 ? A GLN 108 
3  1 Y 1 A ASN 187 ? A ASN 187 
4  1 Y 1 A VAL 188 ? A VAL 188 
5  1 Y 1 A ASP 189 ? A ASP 189 
6  1 Y 1 A LYS 190 ? A LYS 190 
7  1 Y 1 A GLU 256 ? A GLU 256 
8  1 Y 1 A ASP 257 ? A ASP 257 
9  1 Y 1 A GLU 258 ? A GLU 258 
10 1 Y 1 A GLU 259 ? A GLU 259 
11 1 Y 1 A GLY 260 ? A GLY 260 
12 1 Y 1 A SER 261 ? A SER 261 
13 1 Y 1 B GLY 139 ? B GLY 1   
14 1 Y 1 B ARG 140 ? B ARG 2   
15 1 Y 1 B LYS 141 ? B LYS 3   
16 1 Y 1 B ARG 142 ? B ARG 4   
17 1 Y 1 C ASN 107 ? C ASN 107 
18 1 Y 1 C GLN 108 ? C GLN 108 
19 1 Y 1 C SER 186 ? C SER 186 
20 1 Y 1 C ASN 187 ? C ASN 187 
21 1 Y 1 C VAL 188 ? C VAL 188 
22 1 Y 1 C ASP 189 ? C ASP 189 
23 1 Y 1 C LYS 190 ? C LYS 190 
24 1 Y 1 C GLU 256 ? C GLU 256 
25 1 Y 1 C ASP 257 ? C ASP 257 
26 1 Y 1 C GLU 258 ? C GLU 258 
27 1 Y 1 C GLU 259 ? C GLU 259 
28 1 Y 1 C GLY 260 ? C GLY 260 
29 1 Y 1 C SER 261 ? C SER 261 
30 1 Y 1 D GLY 139 ? D GLY 1   
31 1 Y 1 D ARG 140 ? D ARG 2   
32 1 Y 1 D LYS 141 ? D LYS 3   
33 1 Y 1 D ARG 142 ? D ARG 4   
34 1 Y 1 E ASP 189 ? E ASP 189 
35 1 Y 1 E LYS 190 ? E LYS 190 
36 1 Y 1 E GLU 256 ? E GLU 256 
37 1 Y 1 E ASP 257 ? E ASP 257 
38 1 Y 1 E GLU 258 ? E GLU 258 
39 1 Y 1 E GLU 259 ? E GLU 259 
40 1 Y 1 E GLY 260 ? E GLY 260 
41 1 Y 1 E SER 261 ? E SER 261 
42 1 Y 1 F GLY 139 ? F GLY 1   
43 1 Y 1 F ARG 140 ? F ARG 2   
44 1 Y 1 F LYS 141 ? F LYS 3   
45 1 Y 1 F ARG 142 ? F ARG 4   
# 
_pdbx_entity_nonpoly.entity_id   3 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#