data_1AXI
# 
_entry.id   1AXI 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1AXI         
WWPDB D_1000171376 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1AXI 
_pdbx_database_status.recvd_initial_deposition_date   1997-10-15 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    BNL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Atwell, S.'   1 
'Ultsch, M.'   2 
'De Vos, A.M.' 3 
'Wells, J.A.'  4 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Structural plasticity in a remodeled protein-protein interface.'                                 Science 278 1125 1128 
1997 SCIEAS US 0036-8075 0038 ? 9353194 10.1126/science.278.5340.1125 
1       'Human Growth Hormone and Extracellular Domain of its Receptor: Crystal Structure of the Complex' Science 255 306  ?    
1992 SCIEAS US 0036-8075 0038 ? ?       ?                             
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Atwell, S.'       1 
primary 'Ultsch, M.'       2 
primary 'De Vos, A.M.'     3 
primary 'Wells, J.A.'      4 
1       'De Vos, A.M.'     5 
1       'Ultsch, M.'       6 
1       'Kossiakoff, A.A.' 7 
# 
_cell.entry_id           1AXI 
_cell.length_a           65.600 
_cell.length_b           65.600 
_cell.length_c           231.700 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1AXI 
_symmetry.space_group_name_H-M             'P 43 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                96 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'GROWTH HORMONE'          22230.113 1   ? 'G120R, K168R, D171T, K172Y, E174A, F176Y' ? ? 
2 polymer     man 'GROWTH HORMONE RECEPTOR' 27023.260 1   ? W104A                                      
'EXTRACELLULAR BINDING DOMAIN' 'HGHBP WITH FUNCTIONALLY CRITICAL TRP 104 MUTATED TO ALA' 
3 non-polymer syn 'SULFATE ION'             96.063    1   ? ?                                          ? ? 
4 water       nat water                     18.015    382 ? ?                                          ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 HGH   
2 HGHBP 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;FPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEAYIPKEQKYSFLQNPQTSLCFSESIPTPSNREETQQKSNLELLRISL
LLIQSWLEPVQFLRSVFANSLVYGASDSNVYDLLKDLEERIQTLMGRLTDGSPRTGQIFKQTYSKFDTNSHNDDALLKNY
GLLYCFRRDMTYVATYLRIVQCRSVEGSCGF
;
;FPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEAYIPKEQKYSFLQNPQTSLCFSESIPTPSNREETQQKSNLELLRISL
LLIQSWLEPVQFLRSVFANSLVYGASDSNVYDLLKDLEERIQTLMGRLTDGSPRTGQIFKQTYSKFDTNSHNDDALLKNY
GLLYCFRRDMTYVATYLRIVQCRSVEGSCGF
;
A ? 
2 'polypeptide(L)' no no 
;FSGSEATAAILSRAPWSLQSVNPGLKTNSSGEPKFTKCRSPERETFSCHWTDEVHHGTKNEGPIQLFYTRRNTQEWTQEW
KECPDYVSAGENSCYFNSSFTSIAIPYCIKLTSNGGTVDEKCFSVDEIVQPDPPIALNWTLLNVSLTGIHADIQVRWEAP
RNADIQKGWMVLEYELQYKEVNETKWKMMDPILTTSVPVYSLKVDKEYEVRVRSKQRNSGNYGEFSEVLYVTLPQM
;
;FSGSEATAAILSRAPWSLQSVNPGLKTNSSGEPKFTKCRSPERETFSCHWTDEVHHGTKNEGPIQLFYTRRNTQEWTQEW
KECPDYVSAGENSCYFNSSFTSIAIPYCIKLTSNGGTVDEKCFSVDEIVQPDPPIALNWTLLNVSLTGIHADIQVRWEAP
RNADIQKGWMVLEYELQYKEVNETKWKMMDPILTTSVPVYSLKVDKEYEVRVRSKQRNSGNYGEFSEVLYVTLPQM
;
B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   PHE n 
1 2   PRO n 
1 3   THR n 
1 4   ILE n 
1 5   PRO n 
1 6   LEU n 
1 7   SER n 
1 8   ARG n 
1 9   LEU n 
1 10  PHE n 
1 11  ASP n 
1 12  ASN n 
1 13  ALA n 
1 14  MET n 
1 15  LEU n 
1 16  ARG n 
1 17  ALA n 
1 18  HIS n 
1 19  ARG n 
1 20  LEU n 
1 21  HIS n 
1 22  GLN n 
1 23  LEU n 
1 24  ALA n 
1 25  PHE n 
1 26  ASP n 
1 27  THR n 
1 28  TYR n 
1 29  GLN n 
1 30  GLU n 
1 31  PHE n 
1 32  GLU n 
1 33  GLU n 
1 34  ALA n 
1 35  TYR n 
1 36  ILE n 
1 37  PRO n 
1 38  LYS n 
1 39  GLU n 
1 40  GLN n 
1 41  LYS n 
1 42  TYR n 
1 43  SER n 
1 44  PHE n 
1 45  LEU n 
1 46  GLN n 
1 47  ASN n 
1 48  PRO n 
1 49  GLN n 
1 50  THR n 
1 51  SER n 
1 52  LEU n 
1 53  CYS n 
1 54  PHE n 
1 55  SER n 
1 56  GLU n 
1 57  SER n 
1 58  ILE n 
1 59  PRO n 
1 60  THR n 
1 61  PRO n 
1 62  SER n 
1 63  ASN n 
1 64  ARG n 
1 65  GLU n 
1 66  GLU n 
1 67  THR n 
1 68  GLN n 
1 69  GLN n 
1 70  LYS n 
1 71  SER n 
1 72  ASN n 
1 73  LEU n 
1 74  GLU n 
1 75  LEU n 
1 76  LEU n 
1 77  ARG n 
1 78  ILE n 
1 79  SER n 
1 80  LEU n 
1 81  LEU n 
1 82  LEU n 
1 83  ILE n 
1 84  GLN n 
1 85  SER n 
1 86  TRP n 
1 87  LEU n 
1 88  GLU n 
1 89  PRO n 
1 90  VAL n 
1 91  GLN n 
1 92  PHE n 
1 93  LEU n 
1 94  ARG n 
1 95  SER n 
1 96  VAL n 
1 97  PHE n 
1 98  ALA n 
1 99  ASN n 
1 100 SER n 
1 101 LEU n 
1 102 VAL n 
1 103 TYR n 
1 104 GLY n 
1 105 ALA n 
1 106 SER n 
1 107 ASP n 
1 108 SER n 
1 109 ASN n 
1 110 VAL n 
1 111 TYR n 
1 112 ASP n 
1 113 LEU n 
1 114 LEU n 
1 115 LYS n 
1 116 ASP n 
1 117 LEU n 
1 118 GLU n 
1 119 GLU n 
1 120 ARG n 
1 121 ILE n 
1 122 GLN n 
1 123 THR n 
1 124 LEU n 
1 125 MET n 
1 126 GLY n 
1 127 ARG n 
1 128 LEU n 
1 129 THR n 
1 130 ASP n 
1 131 GLY n 
1 132 SER n 
1 133 PRO n 
1 134 ARG n 
1 135 THR n 
1 136 GLY n 
1 137 GLN n 
1 138 ILE n 
1 139 PHE n 
1 140 LYS n 
1 141 GLN n 
1 142 THR n 
1 143 TYR n 
1 144 SER n 
1 145 LYS n 
1 146 PHE n 
1 147 ASP n 
1 148 THR n 
1 149 ASN n 
1 150 SER n 
1 151 HIS n 
1 152 ASN n 
1 153 ASP n 
1 154 ASP n 
1 155 ALA n 
1 156 LEU n 
1 157 LEU n 
1 158 LYS n 
1 159 ASN n 
1 160 TYR n 
1 161 GLY n 
1 162 LEU n 
1 163 LEU n 
1 164 TYR n 
1 165 CYS n 
1 166 PHE n 
1 167 ARG n 
1 168 ARG n 
1 169 ASP n 
1 170 MET n 
1 171 THR n 
1 172 TYR n 
1 173 VAL n 
1 174 ALA n 
1 175 THR n 
1 176 TYR n 
1 177 LEU n 
1 178 ARG n 
1 179 ILE n 
1 180 VAL n 
1 181 GLN n 
1 182 CYS n 
1 183 ARG n 
1 184 SER n 
1 185 VAL n 
1 186 GLU n 
1 187 GLY n 
1 188 SER n 
1 189 CYS n 
1 190 GLY n 
1 191 PHE n 
2 1   PHE n 
2 2   SER n 
2 3   GLY n 
2 4   SER n 
2 5   GLU n 
2 6   ALA n 
2 7   THR n 
2 8   ALA n 
2 9   ALA n 
2 10  ILE n 
2 11  LEU n 
2 12  SER n 
2 13  ARG n 
2 14  ALA n 
2 15  PRO n 
2 16  TRP n 
2 17  SER n 
2 18  LEU n 
2 19  GLN n 
2 20  SER n 
2 21  VAL n 
2 22  ASN n 
2 23  PRO n 
2 24  GLY n 
2 25  LEU n 
2 26  LYS n 
2 27  THR n 
2 28  ASN n 
2 29  SER n 
2 30  SER n 
2 31  GLY n 
2 32  GLU n 
2 33  PRO n 
2 34  LYS n 
2 35  PHE n 
2 36  THR n 
2 37  LYS n 
2 38  CYS n 
2 39  ARG n 
2 40  SER n 
2 41  PRO n 
2 42  GLU n 
2 43  ARG n 
2 44  GLU n 
2 45  THR n 
2 46  PHE n 
2 47  SER n 
2 48  CYS n 
2 49  HIS n 
2 50  TRP n 
2 51  THR n 
2 52  ASP n 
2 53  GLU n 
2 54  VAL n 
2 55  HIS n 
2 56  HIS n 
2 57  GLY n 
2 58  THR n 
2 59  LYS n 
2 60  ASN n 
2 61  GLU n 
2 62  GLY n 
2 63  PRO n 
2 64  ILE n 
2 65  GLN n 
2 66  LEU n 
2 67  PHE n 
2 68  TYR n 
2 69  THR n 
2 70  ARG n 
2 71  ARG n 
2 72  ASN n 
2 73  THR n 
2 74  GLN n 
2 75  GLU n 
2 76  TRP n 
2 77  THR n 
2 78  GLN n 
2 79  GLU n 
2 80  TRP n 
2 81  LYS n 
2 82  GLU n 
2 83  CYS n 
2 84  PRO n 
2 85  ASP n 
2 86  TYR n 
2 87  VAL n 
2 88  SER n 
2 89  ALA n 
2 90  GLY n 
2 91  GLU n 
2 92  ASN n 
2 93  SER n 
2 94  CYS n 
2 95  TYR n 
2 96  PHE n 
2 97  ASN n 
2 98  SER n 
2 99  SER n 
2 100 PHE n 
2 101 THR n 
2 102 SER n 
2 103 ILE n 
2 104 ALA n 
2 105 ILE n 
2 106 PRO n 
2 107 TYR n 
2 108 CYS n 
2 109 ILE n 
2 110 LYS n 
2 111 LEU n 
2 112 THR n 
2 113 SER n 
2 114 ASN n 
2 115 GLY n 
2 116 GLY n 
2 117 THR n 
2 118 VAL n 
2 119 ASP n 
2 120 GLU n 
2 121 LYS n 
2 122 CYS n 
2 123 PHE n 
2 124 SER n 
2 125 VAL n 
2 126 ASP n 
2 127 GLU n 
2 128 ILE n 
2 129 VAL n 
2 130 GLN n 
2 131 PRO n 
2 132 ASP n 
2 133 PRO n 
2 134 PRO n 
2 135 ILE n 
2 136 ALA n 
2 137 LEU n 
2 138 ASN n 
2 139 TRP n 
2 140 THR n 
2 141 LEU n 
2 142 LEU n 
2 143 ASN n 
2 144 VAL n 
2 145 SER n 
2 146 LEU n 
2 147 THR n 
2 148 GLY n 
2 149 ILE n 
2 150 HIS n 
2 151 ALA n 
2 152 ASP n 
2 153 ILE n 
2 154 GLN n 
2 155 VAL n 
2 156 ARG n 
2 157 TRP n 
2 158 GLU n 
2 159 ALA n 
2 160 PRO n 
2 161 ARG n 
2 162 ASN n 
2 163 ALA n 
2 164 ASP n 
2 165 ILE n 
2 166 GLN n 
2 167 LYS n 
2 168 GLY n 
2 169 TRP n 
2 170 MET n 
2 171 VAL n 
2 172 LEU n 
2 173 GLU n 
2 174 TYR n 
2 175 GLU n 
2 176 LEU n 
2 177 GLN n 
2 178 TYR n 
2 179 LYS n 
2 180 GLU n 
2 181 VAL n 
2 182 ASN n 
2 183 GLU n 
2 184 THR n 
2 185 LYS n 
2 186 TRP n 
2 187 LYS n 
2 188 MET n 
2 189 MET n 
2 190 ASP n 
2 191 PRO n 
2 192 ILE n 
2 193 LEU n 
2 194 THR n 
2 195 THR n 
2 196 SER n 
2 197 VAL n 
2 198 PRO n 
2 199 VAL n 
2 200 TYR n 
2 201 SER n 
2 202 LEU n 
2 203 LYS n 
2 204 VAL n 
2 205 ASP n 
2 206 LYS n 
2 207 GLU n 
2 208 TYR n 
2 209 GLU n 
2 210 VAL n 
2 211 ARG n 
2 212 VAL n 
2 213 ARG n 
2 214 SER n 
2 215 LYS n 
2 216 GLN n 
2 217 ARG n 
2 218 ASN n 
2 219 SER n 
2 220 GLY n 
2 221 ASN n 
2 222 TYR n 
2 223 GLY n 
2 224 GLU n 
2 225 PHE n 
2 226 SER n 
2 227 GLU n 
2 228 VAL n 
2 229 LEU n 
2 230 TYR n 
2 231 VAL n 
2 232 THR n 
2 233 LEU n 
2 234 PRO n 
2 235 GLN n 
2 236 MET n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? human Homo ? ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 Escherichia ? ? ? ? ? 34B8 ? 
? ? ? ? ? PERIPLASM ? ? ? ? PB0720 ? ? 
2 1 sample ? ? ? human Homo ? ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 Escherichia ? ? ? ? ? 33B6 ? 
? ? ? ? ? PERIPLASM ? ? ? ? PB0720 ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_db_isoform 
1 UNP SOMA_HUMAN 1 P01241 1 
;MATGSRTSLLLAFGLLCLPWLQEGSAFPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEAYIPKEQKYSFLQNPQTSLCF
SESIPTPSNREETQQKSNLELLRISLLLIQSWLEPVQFLRSVFANSLVYGASDSNVYDLLKDLEEGIQTLMGRLEDGSPR
TGQIFKQTYSKFDTNSHNDDALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGF
;
? 
2 UNP GHR_HUMAN  2 P10912 1 
;MDLWQLLLTLALAGSSDAFSGSEATAAILSRAPWSLQSVNPGLKTNSSKEPKFTKCRSPERETFSCHWTDEVHHGTKNLG
PIQLFYTRRNTQEWTQEWKECPDYVSAGENSCYFNSSFTSIWIPYCIKLTSNGGTVDEKCFSVDEIVQPDPPIALNWTLL
NVSLTGIHADIQVRWEAPRNADIQKGWMVLEYELQYKEVNETKWKMMDPILTTSVPVYSLKVDKEYEVRVRSKQRNSGNY
GEFSEVLYVTLPQMSQFTCEEDFYFPWLLIIIFGIFGLTVMLFVFLFSKQQRIKMLILPPVPVPKIKGIDPDLLKEGKLE
EVNTILAIHDSYKPEFHSDDSWVEFIELDIDEPDEKTEESDTDRLLSSDHEKSHSNLGVKDGDSGRTSCCEPDILETDFN
ANDIHEGTSEVAQPQRLKGEADLLCLDQKNQNNSPYHDACPATQQPSVIQAEKNKPQPLPTEGAESTHQAAHIQLSNPSS
LSNIDFYAQVSDITPAGSVVLSPGQKNKAGMSQCDMHPEMVSLCQENFLMDNAYFCEADAKKCIPVAPHIKVESHIQPSL
NQEDIYITTESLTTAAGRPGTGEHVPGSEMPVPDYTSIHIVQSPQGLILNATALPLPDKEFLSSCGYVSTDQLNKIMP
;
? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1AXI A 1 ? 191 ? P01241 27 ? 217 ? 1 191 
2 2 1AXI B 1 ? 236 ? P10912 19 ? 254 ? 1 236 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1AXI ARG A 120 ? UNP P01241 GLY 146 ENGINEERED 120 1  
1 1AXI THR A 129 ? UNP P01241 GLU 155 CONFLICT   129 2  
1 1AXI ARG A 168 ? UNP P01241 LYS 194 ENGINEERED 168 3  
1 1AXI THR A 171 ? UNP P01241 ASP 197 ENGINEERED 171 4  
1 1AXI TYR A 172 ? UNP P01241 LYS 198 ENGINEERED 172 5  
1 1AXI ALA A 174 ? UNP P01241 GLU 200 ENGINEERED 174 6  
1 1AXI TYR A 176 ? UNP P01241 PHE 202 ENGINEERED 176 7  
2 1AXI GLY B 31  ? UNP P10912 LYS 49  CONFLICT   31  8  
2 1AXI GLU B 61  ? UNP P10912 LEU 79  CONFLICT   61  9  
2 1AXI ALA B 104 ? UNP P10912 TRP 122 ENGINEERED 104 10 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
SO4 non-polymer         . 'SULFATE ION'   ? 'O4 S -2'        96.063  
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1AXI 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.98 
_exptl_crystal.density_percent_sol   51.37 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'streak seeding' 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    
'CRYSTALLIZED BY STREAK SEEDING AT 5MG/ML COMPLEX IN 50MM BIS-TRIS (PH 6.5) 20% SATURATED AMMONIUM SULFATE, streak seeding' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   ADSC 
_diffrn_detector.pdbx_collection_date   1996-05-05 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.918 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'CHESS BEAMLINE F1' 
_diffrn_source.pdbx_synchrotron_site       CHESS 
_diffrn_source.pdbx_synchrotron_beamline   F1 
_diffrn_source.pdbx_wavelength             0.918 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1AXI 
_reflns.observed_criterion_sigma_I   0. 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             100. 
_reflns.d_resolution_high            2.1 
_reflns.number_obs                   28276 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         91.8 
_reflns.pdbx_Rmerge_I_obs            0.057 
_reflns.pdbx_Rsym_value              0.057 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        16.0 
_reflns.pdbx_redundancy              4.7 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.1 
_reflns_shell.d_res_low              2.18 
_reflns_shell.percent_possible_all   51.3 
_reflns_shell.Rmerge_I_obs           0.125 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    7.4 
_reflns_shell.pdbx_redundancy        2.3 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 1AXI 
_refine.ls_number_reflns_obs                     26402 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0. 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             7.0 
_refine.ls_d_res_high                            2.1 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.19 
_refine.ls_R_factor_R_free                       0.262 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 8. 
_refine.ls_number_reflns_R_free                  2112 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            -4.0 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            8.0 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'HGH(G120R):HGHBP STRUCTURE (IN PREPARATION)' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2934 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         5 
_refine_hist.number_atoms_solvent             382 
_refine_hist.number_atoms_total               3321 
_refine_hist.d_res_high                       2.1 
_refine_hist.d_res_low                        7.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
p_bond_d            0.014 0.02  ? ? 'X-RAY DIFFRACTION' ? 
p_angle_d           0.035 0.04  ? ? 'X-RAY DIFFRACTION' ? 
p_angle_deg         ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
p_planar_d          0.037 0.05  ? ? 'X-RAY DIFFRACTION' ? 
p_hb_or_metal_coord ?     0.05  ? ? 'X-RAY DIFFRACTION' ? 
p_mcbond_it         2.24  2.50  ? ? 'X-RAY DIFFRACTION' ? 
p_mcangle_it        3.17  3.50  ? ? 'X-RAY DIFFRACTION' ? 
p_scbond_it         2.92  2.50  ? ? 'X-RAY DIFFRACTION' ? 
p_scangle_it        4.27  3.50  ? ? 'X-RAY DIFFRACTION' ? 
p_plane_restr       0.03  0.03  ? ? 'X-RAY DIFFRACTION' ? 
p_chiral_restr      0.14  0.15  ? ? 'X-RAY DIFFRACTION' ? 
p_singtor_nbd       0.18  0.30  ? ? 'X-RAY DIFFRACTION' ? 
p_multtor_nbd       0.24  0.30  ? ? 'X-RAY DIFFRACTION' ? 
p_xhyhbond_nbd      ?     0.30  ? ? 'X-RAY DIFFRACTION' ? 
p_xyhbond_nbd       0.20  0.30  ? ? 'X-RAY DIFFRACTION' ? 
p_planar_tor        4.3   7.00  ? ? 'X-RAY DIFFRACTION' ? 
p_staggered_tor     19.8  15.00 ? ? 'X-RAY DIFFRACTION' ? 
p_orthonormal_tor   ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
p_transverse_tor    27.1  20.00 ? ? 'X-RAY DIFFRACTION' ? 
p_special_tor       0     15.00 ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  1AXI 
_struct.title                     'STRUCTURAL PLASTICITY AT THE HGH:HGHBP INTERFACE' 
_struct.pdbx_descriptor           'GROWTH HORMONE, GROWTH HORMONE RECEPTOR' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1AXI 
_struct_keywords.pdbx_keywords   'COMPLEX (HORMONE/RECEPTOR)' 
_struct_keywords.text            'COMPLEX (HORMONE-RECEPTOR), COMPLEX (HORMONE-RECEPTOR) complex' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 4 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  SER A 7   ? TYR A 35  ? SER A 7   TYR A 35  1 ? 29 
HELX_P HELX_P2  2  LYS A 38  ? GLN A 46  ? LYS A 38  GLN A 46  1 ? 9  
HELX_P HELX_P3  3  PHE A 54  ? SER A 57  ? PHE A 54  SER A 57  5 ? 4  
HELX_P HELX_P4  4  ARG A 64  ? GLN A 69  ? ARG A 64  GLN A 69  1 ? 6  
HELX_P HELX_P5  5  ASN A 72  ? ASN A 99  ? ASN A 72  ASN A 99  1 ? 28 
HELX_P HELX_P6  6  ASP A 107 ? ARG A 127 ? ASP A 107 ARG A 127 1 ? 21 
HELX_P HELX_P7  7  GLN A 137 ? LYS A 140 ? GLN A 137 LYS A 140 1 ? 4  
HELX_P HELX_P8  8  LEU A 156 ? SER A 184 ? LEU A 156 SER A 184 1 ? 29 
HELX_P HELX_P9  9  SER B 98  ? PHE B 100 ? SER B 98  PHE B 100 5 ? 3  
HELX_P HELX_P10 10 VAL B 125 ? ILE B 128 ? VAL B 125 ILE B 128 5 ? 4  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 53  SG ? ? ? 1_555 A CYS 165 SG ? ? A CYS 53  A CYS 165 1_555 ? ? ? ? ? ? ? 2.056 ? 
disulf2 disulf ? ? A CYS 182 SG ? ? ? 1_555 A CYS 189 SG ? ? A CYS 182 A CYS 189 1_555 ? ? ? ? ? ? ? 1.992 ? 
disulf3 disulf ? ? B CYS 38  SG ? ? ? 1_555 B CYS 48  SG ? ? B CYS 38  B CYS 48  1_555 ? ? ? ? ? ? ? 2.151 ? 
disulf4 disulf ? ? B CYS 83  SG ? ? ? 1_555 B CYS 94  SG ? ? B CYS 83  B CYS 94  1_555 ? ? ? ? ? ? ? 2.098 ? 
disulf5 disulf ? ? B CYS 108 SG ? ? ? 1_555 B CYS 122 SG ? ? B CYS 108 B CYS 122 1_555 ? ? ? ? ? ? ? 2.081 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 3 ? 
C ? 3 ? 
D ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 PHE B 46  ? HIS B 49  ? PHE B 46  HIS B 49  
A 2 SER B 93  ? PHE B 96  ? SER B 93  PHE B 96  
B 1 GLN B 65  ? ARG B 70  ? GLN B 65  ARG B 70  
B 2 PRO B 106 ? SER B 113 ? PRO B 106 SER B 113 
B 3 GLY B 116 ? SER B 124 ? GLY B 116 SER B 124 
C 1 ASN B 138 ? LEU B 141 ? ASN B 138 LEU B 141 
C 2 ILE B 153 ? ARG B 156 ? ILE B 153 ARG B 156 
C 3 SER B 196 ? VAL B 199 ? SER B 196 VAL B 199 
D 1 LEU B 172 ? GLU B 180 ? LEU B 172 GLU B 180 
D 2 TYR B 208 ? GLN B 216 ? TYR B 208 GLN B 216 
D 3 LEU B 229 ? VAL B 231 ? LEU B 229 VAL B 231 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O PHE B 46  ? O PHE B 46  N PHE B 96  ? N PHE B 96  
B 1 2 O GLN B 65  ? O GLN B 65  N THR B 112 ? N THR B 112 
B 2 3 O TYR B 107 ? O TYR B 107 N PHE B 123 ? N PHE B 123 
C 1 2 O ASN B 138 ? O ASN B 138 N ARG B 156 ? N ARG B 156 
C 2 3 O ILE B 153 ? O ILE B 153 N VAL B 199 ? N VAL B 199 
D 1 2 O GLU B 173 ? O GLU B 173 N LYS B 215 ? N LYS B 215 
D 2 3 O TYR B 208 ? O TYR B 208 N VAL B 231 ? N VAL B 231 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    4 
_struct_site.details              'BINDING SITE FOR RESIDUE SO4 B 237' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 4 GLY B 148 ? GLY B 148 . ? 1_555 ? 
2 AC1 4 ILE B 149 ? ILE B 149 . ? 1_555 ? 
3 AC1 4 HIS B 150 ? HIS B 150 . ? 1_555 ? 
4 AC1 4 HOH E .   ? HOH B 456 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1AXI 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1AXI 
_atom_sites.fract_transf_matrix[1][1]   0.015244 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.015244 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004316 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . THR A 1 3   ? 66.339 29.868 106.342 1.00 46.72 ? 3   THR A N   1 
ATOM   2    C CA  . THR A 1 3   ? 66.106 28.651 107.191 1.00 45.44 ? 3   THR A CA  1 
ATOM   3    C C   . THR A 1 3   ? 64.636 28.227 107.193 1.00 41.74 ? 3   THR A C   1 
ATOM   4    O O   . THR A 1 3   ? 63.758 29.068 107.050 1.00 40.25 ? 3   THR A O   1 
ATOM   5    C CB  . THR A 1 3   ? 66.503 28.771 108.673 1.00 47.65 ? 3   THR A CB  1 
ATOM   6    O OG1 . THR A 1 3   ? 65.615 29.712 109.296 1.00 49.83 ? 3   THR A OG1 1 
ATOM   7    C CG2 . THR A 1 3   ? 67.940 29.206 108.866 1.00 49.56 ? 3   THR A CG2 1 
ATOM   8    N N   . ILE A 1 4   ? 64.404 26.934 107.397 1.00 38.95 ? 4   ILE A N   1 
ATOM   9    C CA  . ILE A 1 4   ? 63.012 26.460 107.497 1.00 37.64 ? 4   ILE A CA  1 
ATOM   10   C C   . ILE A 1 4   ? 62.411 27.188 108.710 1.00 34.62 ? 4   ILE A C   1 
ATOM   11   O O   . ILE A 1 4   ? 63.126 27.363 109.690 1.00 33.76 ? 4   ILE A O   1 
ATOM   12   C CB  . ILE A 1 4   ? 62.930 24.950 107.726 1.00 35.96 ? 4   ILE A CB  1 
ATOM   13   C CG1 . ILE A 1 4   ? 63.395 24.194 106.479 1.00 36.79 ? 4   ILE A CG1 1 
ATOM   14   C CG2 . ILE A 1 4   ? 61.499 24.532 108.109 1.00 36.85 ? 4   ILE A CG2 1 
ATOM   15   C CD1 . ILE A 1 4   ? 62.500 24.311 105.251 1.00 31.75 ? 4   ILE A CD1 1 
ATOM   16   N N   . PRO A 1 5   ? 61.191 27.652 108.596 1.00 34.80 ? 5   PRO A N   1 
ATOM   17   C CA  . PRO A 1 5   ? 60.507 28.384 109.651 1.00 33.12 ? 5   PRO A CA  1 
ATOM   18   C C   . PRO A 1 5   ? 60.445 27.576 110.942 1.00 33.29 ? 5   PRO A C   1 
ATOM   19   O O   . PRO A 1 5   ? 60.233 26.365 110.843 1.00 30.69 ? 5   PRO A O   1 
ATOM   20   C CB  . PRO A 1 5   ? 59.119 28.643 109.084 1.00 35.19 ? 5   PRO A CB  1 
ATOM   21   C CG  . PRO A 1 5   ? 59.158 28.367 107.624 1.00 35.93 ? 5   PRO A CG  1 
ATOM   22   C CD  . PRO A 1 5   ? 60.347 27.497 107.373 1.00 36.72 ? 5   PRO A CD  1 
ATOM   23   N N   . LEU A 1 6   ? 60.627 28.192 112.101 1.00 31.67 ? 6   LEU A N   1 
ATOM   24   C CA  . LEU A 1 6   ? 60.674 27.456 113.369 1.00 34.43 ? 6   LEU A CA  1 
ATOM   25   C C   . LEU A 1 6   ? 59.347 27.357 114.116 1.00 31.71 ? 6   LEU A C   1 
ATOM   26   O O   . LEU A 1 6   ? 59.193 26.659 115.130 1.00 30.62 ? 6   LEU A O   1 
ATOM   27   C CB  . LEU A 1 6   ? 61.656 28.154 114.359 1.00 36.34 ? 6   LEU A CB  1 
ATOM   28   C CG  . LEU A 1 6   ? 63.155 27.945 114.106 1.00 38.57 ? 6   LEU A CG  1 
ATOM   29   C CD1 . LEU A 1 6   ? 64.055 28.680 115.089 1.00 39.48 ? 6   LEU A CD1 1 
ATOM   30   C CD2 . LEU A 1 6   ? 63.505 26.465 114.144 1.00 40.43 ? 6   LEU A CD2 1 
ATOM   31   N N   . SER A 1 7   ? 58.341 28.019 113.584 1.00 25.92 ? 7   SER A N   1 
ATOM   32   C CA  . SER A 1 7   ? 57.071 28.195 114.226 1.00 27.30 ? 7   SER A CA  1 
ATOM   33   C C   . SER A 1 7   ? 56.439 26.851 114.527 1.00 25.38 ? 7   SER A C   1 
ATOM   34   O O   . SER A 1 7   ? 55.947 26.728 115.649 1.00 24.66 ? 7   SER A O   1 
ATOM   35   C CB  . SER A 1 7   ? 56.169 29.177 113.450 1.00 27.61 ? 7   SER A CB  1 
ATOM   36   O OG  . SER A 1 7   ? 55.413 28.477 112.456 1.00 29.52 ? 7   SER A OG  1 
ATOM   37   N N   . ARG A 1 8   ? 56.446 25.902 113.599 1.00 20.97 ? 8   ARG A N   1 
ATOM   38   C CA  . ARG A 1 8   ? 55.839 24.612 113.816 1.00 21.96 ? 8   ARG A CA  1 
ATOM   39   C C   . ARG A 1 8   ? 56.523 23.844 114.973 1.00 22.16 ? 8   ARG A C   1 
ATOM   40   O O   . ARG A 1 8   ? 55.856 23.188 115.772 1.00 16.47 ? 8   ARG A O   1 
ATOM   41   C CB  . ARG A 1 8   ? 55.864 23.778 112.511 1.00 21.49 ? 8   ARG A CB  1 
ATOM   42   C CG  . ARG A 1 8   ? 55.217 22.400 112.704 1.00 21.98 ? 8   ARG A CG  1 
ATOM   43   C CD  . ARG A 1 8   ? 55.044 21.633 111.393 1.00 22.09 ? 8   ARG A CD  1 
ATOM   44   N NE  . ARG A 1 8   ? 54.163 20.492 111.535 1.00 23.44 ? 8   ARG A NE  1 
ATOM   45   C CZ  . ARG A 1 8   ? 53.994 19.451 110.723 1.00 26.31 ? 8   ARG A CZ  1 
ATOM   46   N NH1 . ARG A 1 8   ? 54.628 19.376 109.524 1.00 23.59 ? 8   ARG A NH1 1 
ATOM   47   N NH2 . ARG A 1 8   ? 53.143 18.493 111.055 1.00 21.95 ? 8   ARG A NH2 1 
ATOM   48   N N   . LEU A 1 9   ? 57.858 23.840 115.005 1.00 21.75 ? 9   LEU A N   1 
ATOM   49   C CA  . LEU A 1 9   ? 58.557 23.113 116.085 1.00 23.37 ? 9   LEU A CA  1 
ATOM   50   C C   . LEU A 1 9   ? 58.278 23.769 117.454 1.00 21.12 ? 9   LEU A C   1 
ATOM   51   O O   . LEU A 1 9   ? 58.101 23.034 118.431 1.00 18.05 ? 9   LEU A O   1 
ATOM   52   C CB  . LEU A 1 9   ? 60.033 23.168 115.825 1.00 24.55 ? 9   LEU A CB  1 
ATOM   53   C CG  . LEU A 1 9   ? 60.963 22.046 115.368 1.00 28.14 ? 9   LEU A CG  1 
ATOM   54   C CD1 . LEU A 1 9   ? 60.266 20.813 114.869 1.00 26.83 ? 9   LEU A CD1 1 
ATOM   55   C CD2 . LEU A 1 9   ? 62.009 22.579 114.404 1.00 23.46 ? 9   LEU A CD2 1 
ATOM   56   N N   . PHE A 1 10  ? 58.316 25.089 117.555 1.00 19.91 ? 10  PHE A N   1 
ATOM   57   C CA  . PHE A 1 10  ? 58.046 25.824 118.786 1.00 22.18 ? 10  PHE A CA  1 
ATOM   58   C C   . PHE A 1 10  ? 56.613 25.526 119.233 1.00 22.61 ? 10  PHE A C   1 
ATOM   59   O O   . PHE A 1 10  ? 56.383 25.325 120.432 1.00 19.29 ? 10  PHE A O   1 
ATOM   60   C CB  . PHE A 1 10  ? 58.304 27.328 118.751 1.00 22.33 ? 10  PHE A CB  1 
ATOM   61   C CG  . PHE A 1 10  ? 59.740 27.736 119.051 1.00 26.85 ? 10  PHE A CG  1 
ATOM   62   C CD1 . PHE A 1 10  ? 60.294 27.615 120.307 1.00 27.80 ? 10  PHE A CD1 1 
ATOM   63   C CD2 . PHE A 1 10  ? 60.563 28.234 118.050 1.00 28.79 ? 10  PHE A CD2 1 
ATOM   64   C CE1 . PHE A 1 10  ? 61.602 27.974 120.585 1.00 26.90 ? 10  PHE A CE1 1 
ATOM   65   C CE2 . PHE A 1 10  ? 61.874 28.599 118.307 1.00 29.68 ? 10  PHE A CE2 1 
ATOM   66   C CZ  . PHE A 1 10  ? 62.413 28.454 119.570 1.00 27.43 ? 10  PHE A CZ  1 
ATOM   67   N N   . ASP A 1 11  ? 55.656 25.456 118.287 1.00 20.50 ? 11  ASP A N   1 
ATOM   68   C CA  . ASP A 1 11  ? 54.268 25.202 118.661 1.00 22.01 ? 11  ASP A CA  1 
ATOM   69   C C   . ASP A 1 11  ? 54.114 23.803 119.286 1.00 18.60 ? 11  ASP A C   1 
ATOM   70   O O   . ASP A 1 11  ? 53.454 23.624 120.302 1.00 14.52 ? 11  ASP A O   1 
ATOM   71   C CB  . ASP A 1 11  ? 53.269 25.314 117.509 1.00 22.17 ? 11  ASP A CB  1 
ATOM   72   C CG  . ASP A 1 11  ? 53.058 26.709 116.984 1.00 30.33 ? 11  ASP A CG  1 
ATOM   73   O OD1 . ASP A 1 11  ? 53.506 27.698 117.618 1.00 31.11 ? 11  ASP A OD1 1 
ATOM   74   O OD2 . ASP A 1 11  ? 52.469 26.815 115.852 1.00 34.92 ? 11  ASP A OD2 1 
ATOM   75   N N   . ASN A 1 12  ? 54.831 22.843 118.692 1.00 16.06 ? 12  ASN A N   1 
ATOM   76   C CA  . ASN A 1 12  ? 54.754 21.477 119.167 1.00 15.93 ? 12  ASN A CA  1 
ATOM   77   C C   . ASN A 1 12  ? 55.503 21.286 120.502 1.00 16.86 ? 12  ASN A C   1 
ATOM   78   O O   . ASN A 1 12  ? 54.953 20.586 121.357 1.00 12.14 ? 12  ASN A O   1 
ATOM   79   C CB  . ASN A 1 12  ? 55.240 20.549 118.049 1.00 15.67 ? 12  ASN A CB  1 
ATOM   80   C CG  . ASN A 1 12  ? 54.080 20.246 117.106 1.00 21.47 ? 12  ASN A CG  1 
ATOM   81   O OD1 . ASN A 1 12  ? 53.160 19.477 117.427 1.00 19.61 ? 12  ASN A OD1 1 
ATOM   82   N ND2 . ASN A 1 12  ? 54.099 20.979 115.983 1.00 21.41 ? 12  ASN A ND2 1 
ATOM   83   N N   . ALA A 1 13  ? 56.663 21.912 120.687 1.00 14.93 ? 13  ALA A N   1 
ATOM   84   C CA  . ALA A 1 13  ? 57.399 21.859 121.933 1.00 17.75 ? 13  ALA A CA  1 
ATOM   85   C C   . ALA A 1 13  ? 56.571 22.558 123.050 1.00 19.59 ? 13  ALA A C   1 
ATOM   86   O O   . ALA A 1 13  ? 56.497 22.057 124.167 1.00 16.54 ? 13  ALA A O   1 
ATOM   87   C CB  . ALA A 1 13  ? 58.749 22.530 121.805 1.00 16.51 ? 13  ALA A CB  1 
ATOM   88   N N   . MET A 1 14  ? 55.886 23.660 122.738 1.00 19.53 ? 14  MET A N   1 
ATOM   89   C CA  . MET A 1 14  ? 55.109 24.405 123.735 1.00 18.56 ? 14  MET A CA  1 
ATOM   90   C C   . MET A 1 14  ? 53.863 23.670 124.183 1.00 19.57 ? 14  MET A C   1 
ATOM   91   O O   . MET A 1 14  ? 53.442 23.766 125.332 1.00 16.35 ? 14  MET A O   1 
ATOM   92   C CB  . MET A 1 14  ? 54.706 25.794 123.201 1.00 18.50 ? 14  MET A CB  1 
ATOM   93   C CG  . MET A 1 14  ? 55.753 26.853 123.331 1.00 24.00 ? 14  MET A CG  1 
ATOM   94   S SD  . MET A 1 14  ? 56.641 27.005 124.883 1.00 31.93 ? 14  MET A SD  1 
ATOM   95   C CE  . MET A 1 14  ? 55.443 27.279 126.142 1.00 22.60 ? 14  MET A CE  1 
ATOM   96   N N   . LEU A 1 15  ? 53.236 22.886 123.300 1.00 18.87 ? 15  LEU A N   1 
ATOM   97   C CA  . LEU A 1 15  ? 52.090 22.064 123.613 1.00 19.19 ? 15  LEU A CA  1 
ATOM   98   C C   . LEU A 1 15  ? 52.444 21.023 124.701 1.00 18.76 ? 15  LEU A C   1 
ATOM   99   O O   . LEU A 1 15  ? 51.659 20.843 125.634 1.00 18.15 ? 15  LEU A O   1 
ATOM   100  C CB  . LEU A 1 15  ? 51.614 21.360 122.326 1.00 19.70 ? 15  LEU A CB  1 
ATOM   101  C CG  . LEU A 1 15  ? 50.439 20.392 122.489 1.00 24.50 ? 15  LEU A CG  1 
ATOM   102  C CD1 . LEU A 1 15  ? 49.186 21.026 123.075 1.00 23.52 ? 15  LEU A CD1 1 
ATOM   103  C CD2 . LEU A 1 15  ? 50.052 19.845 121.082 1.00 23.81 ? 15  LEU A CD2 1 
ATOM   104  N N   . ARG A 1 16  ? 53.540 20.304 124.570 1.00 15.34 ? 16  ARG A N   1 
ATOM   105  C CA  . ARG A 1 16  ? 54.043 19.359 125.527 1.00 17.54 ? 16  ARG A CA  1 
ATOM   106  C C   . ARG A 1 16  ? 54.550 20.010 126.824 1.00 16.60 ? 16  ARG A C   1 
ATOM   107  O O   . ARG A 1 16  ? 54.292 19.376 127.874 1.00 16.23 ? 16  ARG A O   1 
ATOM   108  C CB  . ARG A 1 16  ? 55.119 18.463 124.883 1.00 19.18 ? 16  ARG A CB  1 
ATOM   109  C CG  . ARG A 1 16  ? 54.479 17.689 123.694 1.00 22.73 ? 16  ARG A CG  1 
ATOM   110  C CD  . ARG A 1 16  ? 55.439 17.307 122.618 1.00 21.22 ? 16  ARG A CD  1 
ATOM   111  N NE  . ARG A 1 16  ? 54.914 16.316 121.669 1.00 23.63 ? 16  ARG A NE  1 
ATOM   112  C CZ  . ARG A 1 16  ? 54.241 16.638 120.554 1.00 25.06 ? 16  ARG A CZ  1 
ATOM   113  N NH1 . ARG A 1 16  ? 54.029 17.932 120.254 1.00 18.13 ? 16  ARG A NH1 1 
ATOM   114  N NH2 . ARG A 1 16  ? 53.810 15.652 119.771 1.00 22.42 ? 16  ARG A NH2 1 
ATOM   115  N N   . ALA A 1 17  ? 55.199 21.163 126.781 1.00 12.39 ? 17  ALA A N   1 
ATOM   116  C CA  . ALA A 1 17  ? 55.620 21.846 128.002 1.00 16.09 ? 17  ALA A CA  1 
ATOM   117  C C   . ALA A 1 17  ? 54.427 22.310 128.863 1.00 17.31 ? 17  ALA A C   1 
ATOM   118  O O   . ALA A 1 17  ? 54.374 22.208 130.089 1.00 16.15 ? 17  ALA A O   1 
ATOM   119  C CB  . ALA A 1 17  ? 56.452 23.085 127.673 1.00 10.53 ? 17  ALA A CB  1 
ATOM   120  N N   . HIS A 1 18  ? 53.423 22.862 128.196 1.00 15.46 ? 18  HIS A N   1 
ATOM   121  C CA  . HIS A 1 18  ? 52.210 23.340 128.878 1.00 19.35 ? 18  HIS A CA  1 
ATOM   122  C C   . HIS A 1 18  ? 51.462 22.167 129.524 1.00 16.12 ? 18  HIS A C   1 
ATOM   123  O O   . HIS A 1 18  ? 50.834 22.297 130.566 1.00 17.33 ? 18  HIS A O   1 
ATOM   124  C CB  . HIS A 1 18  ? 51.210 24.000 127.898 1.00 19.53 ? 18  HIS A CB  1 
ATOM   125  C CG  . HIS A 1 18  ? 51.561 25.364 127.455 1.00 27.07 ? 18  HIS A CG  1 
ATOM   126  N ND1 . HIS A 1 18  ? 51.987 26.351 128.311 1.00 30.80 ? 18  HIS A ND1 1 
ATOM   127  C CD2 . HIS A 1 18  ? 51.515 25.941 126.218 1.00 27.83 ? 18  HIS A CD2 1 
ATOM   128  C CE1 . HIS A 1 18  ? 52.217 27.478 127.634 1.00 31.38 ? 18  HIS A CE1 1 
ATOM   129  N NE2 . HIS A 1 18  ? 51.936 27.232 126.368 1.00 29.41 ? 18  HIS A NE2 1 
ATOM   130  N N   . ARG A 1 19  ? 51.364 21.059 128.796 1.00 17.24 ? 19  ARG A N   1 
ATOM   131  C CA  . ARG A 1 19  ? 50.700 19.859 129.308 1.00 18.05 ? 19  ARG A CA  1 
ATOM   132  C C   . ARG A 1 19  ? 51.457 19.303 130.533 1.00 17.41 ? 19  ARG A C   1 
ATOM   133  O O   . ARG A 1 19  ? 50.854 18.857 131.524 1.00 14.67 ? 19  ARG A O   1 
ATOM   134  C CB  . ARG A 1 19  ? 50.700 18.784 128.201 1.00 19.11 ? 19  ARG A CB  1 
ATOM   135  C CG  . ARG A 1 19  ? 49.996 17.480 128.509 1.00 21.82 ? 19  ARG A CG  1 
ATOM   136  C CD  . ARG A 1 19  ? 48.536 17.647 128.964 1.00 24.95 ? 19  ARG A CD  1 
ATOM   137  N NE  . ARG A 1 19  ? 47.874 16.355 129.137 1.00 26.57 ? 19  ARG A NE  1 
ATOM   138  C CZ  . ARG A 1 19  ? 46.934 16.038 130.014 1.00 30.23 ? 19  ARG A CZ  1 
ATOM   139  N NH1 . ARG A 1 19  ? 46.421 16.898 130.897 1.00 30.17 ? 19  ARG A NH1 1 
ATOM   140  N NH2 . ARG A 1 19  ? 46.418 14.807 130.057 1.00 31.05 ? 19  ARG A NH2 1 
ATOM   141  N N   . LEU A 1 20  ? 52.802 19.271 130.457 1.00 16.10 ? 20  LEU A N   1 
ATOM   142  C CA  . LEU A 1 20  ? 53.561 18.835 131.652 1.00 16.63 ? 20  LEU A CA  1 
ATOM   143  C C   . LEU A 1 20  ? 53.326 19.769 132.846 1.00 17.34 ? 20  LEU A C   1 
ATOM   144  O O   . LEU A 1 20  ? 53.208 19.326 134.002 1.00 14.81 ? 20  LEU A O   1 
ATOM   145  C CB  . LEU A 1 20  ? 55.040 18.707 131.381 1.00 17.08 ? 20  LEU A CB  1 
ATOM   146  C CG  . LEU A 1 20  ? 55.466 17.405 130.642 1.00 19.27 ? 20  LEU A CG  1 
ATOM   147  C CD1 . LEU A 1 20  ? 56.773 17.684 129.915 1.00 18.30 ? 20  LEU A CD1 1 
ATOM   148  C CD2 . LEU A 1 20  ? 55.550 16.293 131.677 1.00 18.42 ? 20  LEU A CD2 1 
ATOM   149  N N   . HIS A 1 21  ? 53.330 21.086 132.558 1.00 16.78 ? 21  HIS A N   1 
ATOM   150  C CA  . HIS A 1 21  ? 53.092 22.084 133.604 1.00 16.09 ? 21  HIS A CA  1 
ATOM   151  C C   . HIS A 1 21  ? 51.702 21.942 134.214 1.00 17.21 ? 21  HIS A C   1 
ATOM   152  O O   . HIS A 1 21  ? 51.513 21.999 135.428 1.00 14.08 ? 21  HIS A O   1 
ATOM   153  C CB  . HIS A 1 21  ? 53.286 23.497 133.051 1.00 19.65 ? 21  HIS A CB  1 
ATOM   154  C CG  . HIS A 1 21  ? 53.010 24.603 134.016 1.00 24.43 ? 21  HIS A CG  1 
ATOM   155  N ND1 . HIS A 1 21  ? 52.393 25.773 133.636 1.00 27.45 ? 21  HIS A ND1 1 
ATOM   156  C CD2 . HIS A 1 21  ? 53.206 24.728 135.345 1.00 25.50 ? 21  HIS A CD2 1 
ATOM   157  C CE1 . HIS A 1 21  ? 52.235 26.589 134.669 1.00 26.44 ? 21  HIS A CE1 1 
ATOM   158  N NE2 . HIS A 1 21  ? 52.721 25.950 135.702 1.00 26.84 ? 21  HIS A NE2 1 
ATOM   159  N N   . GLN A 1 22  ? 50.676 21.767 133.360 1.00 16.78 ? 22  GLN A N   1 
ATOM   160  C CA  . GLN A 1 22  ? 49.311 21.595 133.836 1.00 18.85 ? 22  GLN A CA  1 
ATOM   161  C C   . GLN A 1 22  ? 49.145 20.347 134.680 1.00 17.46 ? 22  GLN A C   1 
ATOM   162  O O   . GLN A 1 22  ? 48.496 20.304 135.739 1.00 17.81 ? 22  GLN A O   1 
ATOM   163  C CB  . GLN A 1 22  ? 48.344 21.592 132.628 1.00 21.58 ? 22  GLN A CB  1 
ATOM   164  C CG  . GLN A 1 22  ? 46.958 21.165 133.042 1.00 28.91 ? 22  GLN A CG  1 
ATOM   165  C CD  . GLN A 1 22  ? 46.268 20.539 131.846 1.00 36.48 ? 22  GLN A CD  1 
ATOM   166  O OE1 . GLN A 1 22  ? 46.642 19.407 131.524 1.00 38.97 ? 22  GLN A OE1 1 
ATOM   167  N NE2 . GLN A 1 22  ? 45.374 21.340 131.256 1.00 37.14 ? 22  GLN A NE2 1 
ATOM   168  N N   . LEU A 1 23  ? 49.681 19.223 134.242 1.00 16.69 ? 23  LEU A N   1 
ATOM   169  C CA  . LEU A 1 23  ? 49.645 17.965 134.955 1.00 19.20 ? 23  LEU A CA  1 
ATOM   170  C C   . LEU A 1 23  ? 50.337 18.082 136.328 1.00 21.33 ? 23  LEU A C   1 
ATOM   171  O O   . LEU A 1 23  ? 49.835 17.535 137.339 1.00 21.05 ? 23  LEU A O   1 
ATOM   172  C CB  . LEU A 1 23  ? 50.372 16.880 134.185 1.00 18.58 ? 23  LEU A CB  1 
ATOM   173  C CG  . LEU A 1 23  ? 49.696 15.716 133.491 1.00 24.00 ? 23  LEU A CG  1 
ATOM   174  C CD1 . LEU A 1 23  ? 48.200 15.651 133.490 1.00 25.03 ? 23  LEU A CD1 1 
ATOM   175  C CD2 . LEU A 1 23  ? 50.262 15.495 132.095 1.00 24.20 ? 23  LEU A CD2 1 
ATOM   176  N N   . ALA A 1 24  ? 51.515 18.707 136.370 1.00 18.07 ? 24  ALA A N   1 
ATOM   177  C CA  . ALA A 1 24  ? 52.221 18.930 137.626 1.00 19.57 ? 24  ALA A CA  1 
ATOM   178  C C   . ALA A 1 24  ? 51.423 19.827 138.577 1.00 20.04 ? 24  ALA A C   1 
ATOM   179  O O   . ALA A 1 24  ? 51.347 19.544 139.797 1.00 19.25 ? 24  ALA A O   1 
ATOM   180  C CB  . ALA A 1 24  ? 53.577 19.648 137.396 1.00 18.02 ? 24  ALA A CB  1 
ATOM   181  N N   . PHE A 1 25  ? 50.853 20.939 138.056 1.00 17.94 ? 25  PHE A N   1 
ATOM   182  C CA  . PHE A 1 25  ? 50.109 21.825 138.949 1.00 19.90 ? 25  PHE A CA  1 
ATOM   183  C C   . PHE A 1 25  ? 48.837 21.185 139.554 1.00 20.80 ? 25  PHE A C   1 
ATOM   184  O O   . PHE A 1 25  ? 48.565 21.358 140.734 1.00 17.96 ? 25  PHE A O   1 
ATOM   185  C CB  . PHE A 1 25  ? 49.656 23.086 138.235 1.00 22.04 ? 25  PHE A CB  1 
ATOM   186  C CG  . PHE A 1 25  ? 49.484 24.294 139.077 1.00 28.10 ? 25  PHE A CG  1 
ATOM   187  C CD1 . PHE A 1 25  ? 50.537 25.140 139.358 1.00 28.82 ? 25  PHE A CD1 1 
ATOM   188  C CD2 . PHE A 1 25  ? 48.231 24.632 139.566 1.00 32.59 ? 25  PHE A CD2 1 
ATOM   189  C CE1 . PHE A 1 25  ? 50.370 26.270 140.122 1.00 29.94 ? 25  PHE A CE1 1 
ATOM   190  C CE2 . PHE A 1 25  ? 48.050 25.752 140.357 1.00 32.07 ? 25  PHE A CE2 1 
ATOM   191  C CZ  . PHE A 1 25  ? 49.125 26.573 140.611 1.00 32.85 ? 25  PHE A CZ  1 
ATOM   192  N N   . ASP A 1 26  ? 48.045 20.509 138.735 1.00 19.28 ? 26  ASP A N   1 
ATOM   193  C CA  . ASP A 1 26  ? 46.796 19.881 139.109 1.00 23.20 ? 26  ASP A CA  1 
ATOM   194  C C   . ASP A 1 26  ? 46.991 18.680 140.038 1.00 23.60 ? 26  ASP A C   1 
ATOM   195  O O   . ASP A 1 26  ? 46.240 18.554 140.989 1.00 25.45 ? 26  ASP A O   1 
ATOM   196  C CB  . ASP A 1 26  ? 46.027 19.400 137.851 1.00 24.72 ? 26  ASP A CB  1 
ATOM   197  C CG  . ASP A 1 26  ? 45.560 20.602 137.054 1.00 29.69 ? 26  ASP A CG  1 
ATOM   198  O OD1 . ASP A 1 26  ? 45.691 21.752 137.562 1.00 29.27 ? 26  ASP A OD1 1 
ATOM   199  O OD2 . ASP A 1 26  ? 45.070 20.420 135.915 1.00 29.01 ? 26  ASP A OD2 1 
ATOM   200  N N   . THR A 1 27  ? 48.032 17.905 139.838 1.00 19.48 ? 27  THR A N   1 
ATOM   201  C CA  . THR A 1 27  ? 48.417 16.774 140.656 1.00 24.55 ? 27  THR A CA  1 
ATOM   202  C C   . THR A 1 27  ? 48.938 17.191 142.015 1.00 24.30 ? 27  THR A C   1 
ATOM   203  O O   . THR A 1 27  ? 48.580 16.582 143.039 1.00 23.96 ? 27  THR A O   1 
ATOM   204  C CB  . THR A 1 27  ? 49.481 15.929 139.904 1.00 25.42 ? 27  THR A CB  1 
ATOM   205  O OG1 . THR A 1 27  ? 48.775 15.491 138.688 1.00 30.98 ? 27  THR A OG1 1 
ATOM   206  C CG2 . THR A 1 27  ? 49.809 14.726 140.737 1.00 31.19 ? 27  THR A CG2 1 
ATOM   207  N N   . TYR A 1 28  ? 49.736 18.270 142.077 1.00 21.71 ? 28  TYR A N   1 
ATOM   208  C CA  . TYR A 1 28  ? 50.155 18.834 143.347 1.00 20.04 ? 28  TYR A CA  1 
ATOM   209  C C   . TYR A 1 28  ? 48.920 19.333 144.133 1.00 21.26 ? 28  TYR A C   1 
ATOM   210  O O   . TYR A 1 28  ? 48.726 18.977 145.301 1.00 18.26 ? 28  TYR A O   1 
ATOM   211  C CB  . TYR A 1 28  ? 51.108 20.011 143.156 1.00 19.23 ? 28  TYR A CB  1 
ATOM   212  C CG  . TYR A 1 28  ? 51.523 20.691 144.445 1.00 21.75 ? 28  TYR A CG  1 
ATOM   213  C CD1 . TYR A 1 28  ? 52.586 20.125 145.144 1.00 23.63 ? 28  TYR A CD1 1 
ATOM   214  C CD2 . TYR A 1 28  ? 50.865 21.788 144.978 1.00 19.61 ? 28  TYR A CD2 1 
ATOM   215  C CE1 . TYR A 1 28  ? 53.011 20.678 146.359 1.00 25.80 ? 28  TYR A CE1 1 
ATOM   216  C CE2 . TYR A 1 28  ? 51.272 22.351 146.177 1.00 22.96 ? 28  TYR A CE2 1 
ATOM   217  C CZ  . TYR A 1 28  ? 52.354 21.807 146.839 1.00 24.98 ? 28  TYR A CZ  1 
ATOM   218  O OH  . TYR A 1 28  ? 52.816 22.305 148.016 1.00 28.81 ? 28  TYR A OH  1 
ATOM   219  N N   . GLN A 1 29  ? 48.057 20.135 143.522 1.00 18.73 ? 29  GLN A N   1 
ATOM   220  C CA  . GLN A 1 29  ? 46.899 20.689 144.191 1.00 21.45 ? 29  GLN A CA  1 
ATOM   221  C C   . GLN A 1 29  ? 45.982 19.591 144.759 1.00 24.67 ? 29  GLN A C   1 
ATOM   222  O O   . GLN A 1 29  ? 45.602 19.662 145.944 1.00 24.07 ? 29  GLN A O   1 
ATOM   223  C CB  . GLN A 1 29  ? 46.129 21.623 143.225 1.00 22.61 ? 29  GLN A CB  1 
ATOM   224  C CG  . GLN A 1 29  ? 44.827 22.108 143.853 1.00 31.46 ? 29  GLN A CG  1 
ATOM   225  C CD  . GLN A 1 29  ? 44.122 23.241 143.148 1.00 36.43 ? 29  GLN A CD  1 
ATOM   226  O OE1 . GLN A 1 29  ? 44.612 23.866 142.204 1.00 37.44 ? 29  GLN A OE1 1 
ATOM   227  N NE2 . GLN A 1 29  ? 42.904 23.573 143.596 1.00 38.45 ? 29  GLN A NE2 1 
ATOM   228  N N   . GLU A 1 30  ? 45.586 18.607 143.957 1.00 24.98 ? 30  GLU A N   1 
ATOM   229  C CA  . GLU A 1 30  ? 44.743 17.496 144.400 1.00 28.40 ? 30  GLU A CA  1 
ATOM   230  C C   . GLU A 1 30  ? 45.346 16.798 145.610 1.00 29.51 ? 30  GLU A C   1 
ATOM   231  O O   . GLU A 1 30  ? 44.693 16.602 146.638 1.00 28.31 ? 30  GLU A O   1 
ATOM   232  C CB  . GLU A 1 30  ? 44.545 16.504 143.250 1.00 33.68 ? 30  GLU A CB  1 
ATOM   233  C CG  . GLU A 1 30  ? 43.847 15.188 143.440 1.00 36.63 ? 30  GLU A CG  1 
ATOM   234  C CD  . GLU A 1 30  ? 43.874 14.228 142.265 1.00 39.73 ? 30  GLU A CD  1 
ATOM   235  O OE1 . GLU A 1 30  ? 44.970 13.791 141.808 1.00 43.23 ? 30  GLU A OE1 1 
ATOM   236  O OE2 . GLU A 1 30  ? 42.804 13.850 141.746 1.00 38.32 ? 30  GLU A OE2 1 
ATOM   237  N N   . PHE A 1 31  ? 46.623 16.395 145.486 1.00 25.75 ? 31  PHE A N   1 
ATOM   238  C CA  . PHE A 1 31  ? 47.335 15.762 146.559 1.00 24.14 ? 31  PHE A CA  1 
ATOM   239  C C   . PHE A 1 31  ? 47.308 16.594 147.846 1.00 24.87 ? 31  PHE A C   1 
ATOM   240  O O   . PHE A 1 31  ? 47.046 16.042 148.935 1.00 21.81 ? 31  PHE A O   1 
ATOM   241  C CB  . PHE A 1 31  ? 48.755 15.411 146.164 1.00 23.17 ? 31  PHE A CB  1 
ATOM   242  C CG  . PHE A 1 31  ? 49.576 14.646 147.163 1.00 22.93 ? 31  PHE A CG  1 
ATOM   243  C CD1 . PHE A 1 31  ? 50.240 15.267 148.189 1.00 22.60 ? 31  PHE A CD1 1 
ATOM   244  C CD2 . PHE A 1 31  ? 49.703 13.277 147.030 1.00 24.71 ? 31  PHE A CD2 1 
ATOM   245  C CE1 . PHE A 1 31  ? 51.002 14.558 149.085 1.00 24.89 ? 31  PHE A CE1 1 
ATOM   246  C CE2 . PHE A 1 31  ? 50.466 12.553 147.925 1.00 25.74 ? 31  PHE A CE2 1 
ATOM   247  C CZ  . PHE A 1 31  ? 51.143 13.185 148.934 1.00 22.46 ? 31  PHE A CZ  1 
ATOM   248  N N   . GLU A 1 32  ? 47.714 17.844 147.785 1.00 25.60 ? 32  GLU A N   1 
ATOM   249  C CA  . GLU A 1 32  ? 47.754 18.726 148.949 1.00 27.44 ? 32  GLU A CA  1 
ATOM   250  C C   . GLU A 1 32  ? 46.376 18.847 149.613 1.00 27.91 ? 32  GLU A C   1 
ATOM   251  O O   . GLU A 1 32  ? 46.294 18.725 150.838 1.00 26.59 ? 32  GLU A O   1 
ATOM   252  C CB  . GLU A 1 32  ? 48.377 20.075 148.645 1.00 27.24 ? 32  GLU A CB  1 
ATOM   253  C CG  . GLU A 1 32  ? 48.571 21.064 149.793 1.00 27.84 ? 32  GLU A CG  1 
ATOM   254  C CD  . GLU A 1 32  ? 49.214 22.399 149.405 1.00 28.07 ? 32  GLU A CD  1 
ATOM   255  O OE1 . GLU A 1 32  ? 48.597 23.346 148.898 1.00 27.39 ? 32  GLU A OE1 1 
ATOM   256  O OE2 . GLU A 1 32  ? 50.415 22.641 149.622 1.00 27.18 ? 32  GLU A OE2 1 
ATOM   257  N N   . GLU A 1 33  ? 45.303 19.042 148.877 1.00 28.75 ? 33  GLU A N   1 
ATOM   258  C CA  . GLU A 1 33  ? 43.937 19.177 149.316 1.00 29.23 ? 33  GLU A CA  1 
ATOM   259  C C   . GLU A 1 33  ? 43.379 17.901 149.981 1.00 32.69 ? 33  GLU A C   1 
ATOM   260  O O   . GLU A 1 33  ? 42.509 18.030 150.874 1.00 30.87 ? 33  GLU A O   1 
ATOM   261  C CB  . GLU A 1 33  ? 43.001 19.455 148.146 1.00 30.84 ? 33  GLU A CB  1 
ATOM   262  C CG  . GLU A 1 33  ? 43.000 20.840 147.520 1.00 34.45 ? 33  GLU A CG  1 
ATOM   263  C CD  . GLU A 1 33  ? 42.009 20.887 146.372 1.00 40.52 ? 33  GLU A CD  1 
ATOM   264  O OE1 . GLU A 1 33  ? 41.629 19.818 145.806 1.00 43.47 ? 33  GLU A OE1 1 
ATOM   265  O OE2 . GLU A 1 33  ? 41.589 22.001 145.978 1.00 43.00 ? 33  GLU A OE2 1 
ATOM   266  N N   . ALA A 1 34  ? 43.792 16.736 149.481 1.00 29.96 ? 34  ALA A N   1 
ATOM   267  C CA  . ALA A 1 34  ? 43.325 15.489 150.040 1.00 33.89 ? 34  ALA A CA  1 
ATOM   268  C C   . ALA A 1 34  ? 44.121 14.975 151.243 1.00 32.93 ? 34  ALA A C   1 
ATOM   269  O O   . ALA A 1 34  ? 43.497 14.446 152.197 1.00 34.62 ? 34  ALA A O   1 
ATOM   270  C CB  . ALA A 1 34  ? 43.294 14.344 149.019 1.00 34.15 ? 34  ALA A CB  1 
ATOM   271  N N   . TYR A 1 35  ? 45.437 14.999 151.192 1.00 28.79 ? 35  TYR A N   1 
ATOM   272  C CA  . TYR A 1 35  ? 46.289 14.406 152.192 1.00 28.81 ? 35  TYR A CA  1 
ATOM   273  C C   . TYR A 1 35  ? 47.020 15.299 153.173 1.00 29.70 ? 35  TYR A C   1 
ATOM   274  O O   . TYR A 1 35  ? 47.679 14.734 154.075 1.00 30.58 ? 35  TYR A O   1 
ATOM   275  C CB  . TYR A 1 35  ? 47.361 13.482 151.522 1.00 30.73 ? 35  TYR A CB  1 
ATOM   276  C CG  . TYR A 1 35  ? 46.674 12.512 150.592 1.00 33.62 ? 35  TYR A CG  1 
ATOM   277  C CD1 . TYR A 1 35  ? 45.866 11.499 151.111 1.00 36.43 ? 35  TYR A CD1 1 
ATOM   278  C CD2 . TYR A 1 35  ? 46.776 12.638 149.218 1.00 35.31 ? 35  TYR A CD2 1 
ATOM   279  C CE1 . TYR A 1 35  ? 45.174 10.630 150.276 1.00 37.62 ? 35  TYR A CE1 1 
ATOM   280  C CE2 . TYR A 1 35  ? 46.100 11.770 148.353 1.00 37.95 ? 35  TYR A CE2 1 
ATOM   281  C CZ  . TYR A 1 35  ? 45.294 10.787 148.909 1.00 39.04 ? 35  TYR A CZ  1 
ATOM   282  O OH  . TYR A 1 35  ? 44.627 9.948  148.060 1.00 43.41 ? 35  TYR A OH  1 
ATOM   283  N N   . ILE A 1 36  ? 46.986 16.631 153.055 1.00 27.31 ? 36  ILE A N   1 
ATOM   284  C CA  . ILE A 1 36  ? 47.887 17.423 153.892 1.00 28.11 ? 36  ILE A CA  1 
ATOM   285  C C   . ILE A 1 36  ? 47.122 18.484 154.656 1.00 29.05 ? 36  ILE A C   1 
ATOM   286  O O   . ILE A 1 36  ? 46.647 19.455 154.092 1.00 30.50 ? 36  ILE A O   1 
ATOM   287  C CB  . ILE A 1 36  ? 48.977 18.089 153.008 1.00 29.86 ? 36  ILE A CB  1 
ATOM   288  C CG1 . ILE A 1 36  ? 49.827 17.114 152.217 1.00 31.38 ? 36  ILE A CG1 1 
ATOM   289  C CG2 . ILE A 1 36  ? 49.868 19.049 153.812 1.00 32.21 ? 36  ILE A CG2 1 
ATOM   290  C CD1 . ILE A 1 36  ? 50.867 16.244 152.876 1.00 31.11 ? 36  ILE A CD1 1 
ATOM   291  N N   . PRO A 1 37  ? 46.929 18.289 155.958 1.00 31.32 ? 37  PRO A N   1 
ATOM   292  C CA  . PRO A 1 37  ? 46.251 19.291 156.778 1.00 34.24 ? 37  PRO A CA  1 
ATOM   293  C C   . PRO A 1 37  ? 47.087 20.584 156.801 1.00 36.76 ? 37  PRO A C   1 
ATOM   294  O O   . PRO A 1 37  ? 48.293 20.558 156.565 1.00 35.88 ? 37  PRO A O   1 
ATOM   295  C CB  . PRO A 1 37  ? 46.119 18.632 158.134 1.00 32.60 ? 37  PRO A CB  1 
ATOM   296  C CG  . PRO A 1 37  ? 46.677 17.278 158.032 1.00 31.28 ? 37  PRO A CG  1 
ATOM   297  C CD  . PRO A 1 37  ? 47.456 17.151 156.740 1.00 28.67 ? 37  PRO A CD  1 
ATOM   298  N N   . LYS A 1 38  ? 46.495 21.730 157.082 1.00 41.71 ? 38  LYS A N   1 
ATOM   299  C CA  . LYS A 1 38  ? 47.126 23.029 157.107 1.00 46.38 ? 38  LYS A CA  1 
ATOM   300  C C   . LYS A 1 38  ? 48.322 23.201 158.022 1.00 47.18 ? 38  LYS A C   1 
ATOM   301  O O   . LYS A 1 38  ? 49.215 23.981 157.652 1.00 48.29 ? 38  LYS A O   1 
ATOM   302  C CB  . LYS A 1 38  ? 46.092 24.140 157.360 1.00 49.26 ? 38  LYS A CB  1 
ATOM   303  C CG  . LYS A 1 38  ? 45.188 23.894 158.557 1.00 53.17 ? 38  LYS A CG  1 
ATOM   304  C CD  . LYS A 1 38  ? 44.870 25.200 159.281 1.00 54.82 ? 38  LYS A CD  1 
ATOM   305  C CE  . LYS A 1 38  ? 43.843 24.935 160.378 1.00 56.80 ? 38  LYS A CE  1 
ATOM   306  N NZ  . LYS A 1 38  ? 42.536 25.602 160.083 1.00 57.70 ? 38  LYS A NZ  1 
ATOM   307  N N   . GLU A 1 39  ? 48.454 22.487 159.128 1.00 48.06 ? 39  GLU A N   1 
ATOM   308  C CA  . GLU A 1 39  ? 49.609 22.614 160.014 1.00 48.28 ? 39  GLU A CA  1 
ATOM   309  C C   . GLU A 1 39  ? 50.821 21.901 159.456 1.00 44.81 ? 39  GLU A C   1 
ATOM   310  O O   . GLU A 1 39  ? 51.954 22.325 159.675 1.00 45.38 ? 39  GLU A O   1 
ATOM   311  C CB  . GLU A 1 39  ? 49.255 22.034 161.396 1.00 53.63 ? 39  GLU A CB  1 
ATOM   312  C CG  . GLU A 1 39  ? 50.343 21.323 162.169 1.00 57.80 ? 39  GLU A CG  1 
ATOM   313  C CD  . GLU A 1 39  ? 50.582 19.852 161.901 1.00 60.83 ? 39  GLU A CD  1 
ATOM   314  O OE1 . GLU A 1 39  ? 49.631 19.051 161.761 1.00 63.02 ? 39  GLU A OE1 1 
ATOM   315  O OE2 . GLU A 1 39  ? 51.775 19.451 161.841 1.00 62.02 ? 39  GLU A OE2 1 
ATOM   316  N N   . GLN A 1 40  ? 50.615 20.759 158.806 1.00 42.67 ? 40  GLN A N   1 
ATOM   317  C CA  . GLN A 1 40  ? 51.709 20.032 158.178 1.00 40.81 ? 40  GLN A CA  1 
ATOM   318  C C   . GLN A 1 40  ? 52.152 20.851 156.931 1.00 40.39 ? 40  GLN A C   1 
ATOM   319  O O   . GLN A 1 40  ? 53.348 20.807 156.638 1.00 39.30 ? 40  GLN A O   1 
ATOM   320  C CB  . GLN A 1 40  ? 51.406 18.620 157.746 1.00 38.99 ? 40  GLN A CB  1 
ATOM   321  N N   . LYS A 1 41  ? 51.202 21.514 156.280 1.00 38.05 ? 41  LYS A N   1 
ATOM   322  C CA  . LYS A 1 41  ? 51.566 22.385 155.151 1.00 39.02 ? 41  LYS A CA  1 
ATOM   323  C C   . LYS A 1 41  ? 52.504 23.525 155.596 1.00 36.71 ? 41  LYS A C   1 
ATOM   324  O O   . LYS A 1 41  ? 53.559 23.712 155.042 1.00 33.02 ? 41  LYS A O   1 
ATOM   325  C CB  . LYS A 1 41  ? 50.329 23.034 154.549 1.00 37.65 ? 41  LYS A CB  1 
ATOM   326  C CG  . LYS A 1 41  ? 50.673 23.965 153.376 1.00 40.32 ? 41  LYS A CG  1 
ATOM   327  C CD  . LYS A 1 41  ? 49.388 24.585 152.810 1.00 39.76 ? 41  LYS A CD  1 
ATOM   328  C CE  . LYS A 1 41  ? 49.737 25.597 151.730 1.00 42.97 ? 41  LYS A CE  1 
ATOM   329  N NZ  . LYS A 1 41  ? 48.536 26.210 151.101 1.00 43.87 ? 41  LYS A NZ  1 
ATOM   330  N N   . TYR A 1 42  ? 52.122 24.257 156.654 1.00 39.79 ? 42  TYR A N   1 
ATOM   331  C CA  . TYR A 1 42  ? 52.978 25.335 157.162 1.00 39.35 ? 42  TYR A CA  1 
ATOM   332  C C   . TYR A 1 42  ? 54.366 24.824 157.561 1.00 37.43 ? 42  TYR A C   1 
ATOM   333  O O   . TYR A 1 42  ? 55.384 25.421 157.159 1.00 33.89 ? 42  TYR A O   1 
ATOM   334  C CB  . TYR A 1 42  ? 52.271 26.046 158.299 1.00 41.03 ? 42  TYR A CB  1 
ATOM   335  C CG  . TYR A 1 42  ? 50.929 26.684 158.034 1.00 41.68 ? 42  TYR A CG  1 
ATOM   336  C CD1 . TYR A 1 42  ? 50.526 27.116 156.777 1.00 42.17 ? 42  TYR A CD1 1 
ATOM   337  C CD2 . TYR A 1 42  ? 50.057 26.863 159.090 1.00 41.68 ? 42  TYR A CD2 1 
ATOM   338  C CE1 . TYR A 1 42  ? 49.284 27.694 156.583 1.00 42.94 ? 42  TYR A CE1 1 
ATOM   339  C CE2 . TYR A 1 42  ? 48.819 27.452 158.920 1.00 44.07 ? 42  TYR A CE2 1 
ATOM   340  C CZ  . TYR A 1 42  ? 48.439 27.862 157.654 1.00 45.14 ? 42  TYR A CZ  1 
ATOM   341  O OH  . TYR A 1 42  ? 47.176 28.418 157.490 1.00 46.16 ? 42  TYR A OH  1 
ATOM   342  N N   . SER A 1 43  ? 54.437 23.730 158.316 1.00 35.45 ? 43  SER A N   1 
ATOM   343  C CA  . SER A 1 43  ? 55.744 23.192 158.691 1.00 39.85 ? 43  SER A CA  1 
ATOM   344  C C   . SER A 1 43  ? 56.546 22.872 157.425 1.00 38.91 ? 43  SER A C   1 
ATOM   345  O O   . SER A 1 43  ? 57.711 23.240 157.339 1.00 37.56 ? 43  SER A O   1 
ATOM   346  C CB  . SER A 1 43  ? 55.736 21.939 159.584 1.00 41.03 ? 43  SER A CB  1 
ATOM   347  O OG  . SER A 1 43  ? 54.407 21.501 159.859 1.00 44.66 ? 43  SER A OG  1 
ATOM   348  N N   . PHE A 1 44  ? 55.938 22.162 156.474 1.00 39.61 ? 44  PHE A N   1 
ATOM   349  C CA  . PHE A 1 44  ? 56.630 21.827 155.228 1.00 41.13 ? 44  PHE A CA  1 
ATOM   350  C C   . PHE A 1 44  ? 57.121 23.074 154.490 1.00 38.31 ? 44  PHE A C   1 
ATOM   351  O O   . PHE A 1 44  ? 58.311 23.134 154.198 1.00 37.02 ? 44  PHE A O   1 
ATOM   352  C CB  . PHE A 1 44  ? 55.726 20.972 154.328 1.00 43.73 ? 44  PHE A CB  1 
ATOM   353  C CG  . PHE A 1 44  ? 56.395 20.470 153.072 1.00 46.20 ? 44  PHE A CG  1 
ATOM   354  C CD1 . PHE A 1 44  ? 57.157 19.316 153.077 1.00 47.49 ? 44  PHE A CD1 1 
ATOM   355  C CD2 . PHE A 1 44  ? 56.253 21.163 151.876 1.00 47.12 ? 44  PHE A CD2 1 
ATOM   356  C CE1 . PHE A 1 44  ? 57.777 18.871 151.923 1.00 47.89 ? 44  PHE A CE1 1 
ATOM   357  C CE2 . PHE A 1 44  ? 56.857 20.713 150.710 1.00 48.65 ? 44  PHE A CE2 1 
ATOM   358  C CZ  . PHE A 1 44  ? 57.640 19.572 150.738 1.00 48.66 ? 44  PHE A CZ  1 
ATOM   359  N N   . LEU A 1 45  ? 56.269 24.074 154.280 1.00 37.65 ? 45  LEU A N   1 
ATOM   360  C CA  . LEU A 1 45  ? 56.652 25.252 153.491 1.00 39.77 ? 45  LEU A CA  1 
ATOM   361  C C   . LEU A 1 45  ? 57.546 26.248 154.211 1.00 41.19 ? 45  LEU A C   1 
ATOM   362  O O   . LEU A 1 45  ? 58.278 27.020 153.560 1.00 40.98 ? 45  LEU A O   1 
ATOM   363  C CB  . LEU A 1 45  ? 55.410 25.958 152.923 1.00 36.82 ? 45  LEU A CB  1 
ATOM   364  C CG  . LEU A 1 45  ? 54.518 25.091 152.031 1.00 37.90 ? 45  LEU A CG  1 
ATOM   365  C CD1 . LEU A 1 45  ? 53.215 25.764 151.619 1.00 37.80 ? 45  LEU A CD1 1 
ATOM   366  C CD2 . LEU A 1 45  ? 55.264 24.687 150.761 1.00 38.31 ? 45  LEU A CD2 1 
ATOM   367  N N   . GLN A 1 46  ? 57.588 26.212 155.540 1.00 43.10 ? 46  GLN A N   1 
ATOM   368  C CA  . GLN A 1 46  ? 58.458 27.040 156.358 1.00 46.04 ? 46  GLN A CA  1 
ATOM   369  C C   . GLN A 1 46  ? 59.894 26.493 156.386 1.00 49.01 ? 46  GLN A C   1 
ATOM   370  O O   . GLN A 1 46  ? 60.836 27.239 156.684 1.00 47.59 ? 46  GLN A O   1 
ATOM   371  C CB  . GLN A 1 46  ? 57.983 27.108 157.823 1.00 45.88 ? 46  GLN A CB  1 
ATOM   372  C CG  . GLN A 1 46  ? 56.791 28.039 158.056 1.00 47.29 ? 46  GLN A CG  1 
ATOM   373  C CD  . GLN A 1 46  ? 56.380 28.028 159.510 1.00 48.81 ? 46  GLN A CD  1 
ATOM   374  O OE1 . GLN A 1 46  ? 57.239 27.859 160.382 1.00 51.38 ? 46  GLN A OE1 1 
ATOM   375  N NE2 . GLN A 1 46  ? 55.118 28.215 159.856 1.00 47.94 ? 46  GLN A NE2 1 
ATOM   376  N N   . ASN A 1 47  ? 60.038 25.197 156.089 1.00 50.30 ? 47  ASN A N   1 
ATOM   377  C CA  . ASN A 1 47  ? 61.372 24.598 156.158 1.00 54.27 ? 47  ASN A CA  1 
ATOM   378  C C   . ASN A 1 47  ? 62.107 24.638 154.825 1.00 55.71 ? 47  ASN A C   1 
ATOM   379  O O   . ASN A 1 47  ? 61.617 24.182 153.803 1.00 56.65 ? 47  ASN A O   1 
ATOM   380  C CB  . ASN A 1 47  ? 61.233 23.201 156.758 1.00 54.55 ? 47  ASN A CB  1 
ATOM   381  C CG  . ASN A 1 47  ? 62.348 22.232 156.481 1.00 57.03 ? 47  ASN A CG  1 
ATOM   382  O OD1 . ASN A 1 47  ? 62.096 21.015 156.486 1.00 58.37 ? 47  ASN A OD1 1 
ATOM   383  N ND2 . ASN A 1 47  ? 63.577 22.683 156.243 1.00 56.75 ? 47  ASN A ND2 1 
ATOM   384  N N   . PRO A 1 48  ? 63.318 25.202 154.833 1.00 56.74 ? 48  PRO A N   1 
ATOM   385  C CA  . PRO A 1 48  ? 64.186 25.317 153.682 1.00 56.73 ? 48  PRO A CA  1 
ATOM   386  C C   . PRO A 1 48  ? 65.019 24.090 153.396 1.00 56.71 ? 48  PRO A C   1 
ATOM   387  O O   . PRO A 1 48  ? 64.660 23.167 152.690 1.00 59.21 ? 48  PRO A O   1 
ATOM   388  C CB  . PRO A 1 48  ? 65.157 26.429 154.117 1.00 56.51 ? 48  PRO A CB  1 
ATOM   389  C CG  . PRO A 1 48  ? 65.353 26.117 155.563 1.00 56.49 ? 48  PRO A CG  1 
ATOM   390  C CD  . PRO A 1 48  ? 63.962 25.782 156.053 1.00 56.34 ? 48  PRO A CD  1 
ATOM   391  N N   . SER A 1 51  ? 62.210 23.123 150.969 1.00 59.09 ? 51  SER A N   1 
ATOM   392  C CA  . SER A 1 51  ? 62.182 22.799 149.539 1.00 56.79 ? 51  SER A CA  1 
ATOM   393  C C   . SER A 1 51  ? 63.484 23.004 148.787 1.00 56.07 ? 51  SER A C   1 
ATOM   394  O O   . SER A 1 51  ? 63.542 23.770 147.815 1.00 57.85 ? 51  SER A O   1 
ATOM   395  C CB  . SER A 1 51  ? 61.080 23.613 148.870 1.00 58.22 ? 51  SER A CB  1 
ATOM   396  N N   . LEU A 1 52  ? 64.571 22.330 149.186 1.00 53.05 ? 52  LEU A N   1 
ATOM   397  C CA  . LEU A 1 52  ? 65.787 22.406 148.348 1.00 49.97 ? 52  LEU A CA  1 
ATOM   398  C C   . LEU A 1 52  ? 65.688 21.131 147.495 1.00 47.70 ? 52  LEU A C   1 
ATOM   399  O O   . LEU A 1 52  ? 65.873 19.999 147.951 1.00 49.32 ? 52  LEU A O   1 
ATOM   400  C CB  . LEU A 1 52  ? 67.043 22.577 149.176 1.00 50.23 ? 52  LEU A CB  1 
ATOM   401  C CG  . LEU A 1 52  ? 67.406 24.020 149.554 1.00 49.74 ? 52  LEU A CG  1 
ATOM   402  C CD1 . LEU A 1 52  ? 68.022 24.107 150.946 1.00 49.87 ? 52  LEU A CD1 1 
ATOM   403  C CD2 . LEU A 1 52  ? 68.368 24.626 148.539 1.00 50.56 ? 52  LEU A CD2 1 
ATOM   404  N N   . CYS A 1 53  ? 65.204 21.245 146.276 1.00 40.23 ? 53  CYS A N   1 
ATOM   405  C CA  . CYS A 1 53  ? 64.932 20.102 145.407 1.00 35.76 ? 53  CYS A CA  1 
ATOM   406  C C   . CYS A 1 53  ? 66.215 19.457 144.968 1.00 31.06 ? 53  CYS A C   1 
ATOM   407  O O   . CYS A 1 53  ? 67.234 20.148 144.921 1.00 29.05 ? 53  CYS A O   1 
ATOM   408  C CB  . CYS A 1 53  ? 64.069 20.646 144.229 1.00 34.73 ? 53  CYS A CB  1 
ATOM   409  S SG  . CYS A 1 53  ? 62.461 21.208 144.937 1.00 36.29 ? 53  CYS A SG  1 
ATOM   410  N N   . PHE A 1 54  ? 66.227 18.198 144.555 1.00 31.02 ? 54  PHE A N   1 
ATOM   411  C CA  . PHE A 1 54  ? 67.439 17.600 143.983 1.00 31.49 ? 54  PHE A CA  1 
ATOM   412  C C   . PHE A 1 54  ? 67.909 18.415 142.786 1.00 32.80 ? 54  PHE A C   1 
ATOM   413  O O   . PHE A 1 54  ? 69.134 18.438 142.558 1.00 32.65 ? 54  PHE A O   1 
ATOM   414  C CB  . PHE A 1 54  ? 67.235 16.112 143.669 1.00 32.25 ? 54  PHE A CB  1 
ATOM   415  C CG  . PHE A 1 54  ? 66.291 15.794 142.536 1.00 30.62 ? 54  PHE A CG  1 
ATOM   416  C CD1 . PHE A 1 54  ? 64.933 15.634 142.754 1.00 29.60 ? 54  PHE A CD1 1 
ATOM   417  C CD2 . PHE A 1 54  ? 66.778 15.659 141.245 1.00 29.48 ? 54  PHE A CD2 1 
ATOM   418  C CE1 . PHE A 1 54  ? 64.060 15.367 141.722 1.00 28.55 ? 54  PHE A CE1 1 
ATOM   419  C CE2 . PHE A 1 54  ? 65.898 15.402 140.194 1.00 28.17 ? 54  PHE A CE2 1 
ATOM   420  C CZ  . PHE A 1 54  ? 64.550 15.256 140.435 1.00 28.67 ? 54  PHE A CZ  1 
ATOM   421  N N   . SER A 1 55  ? 67.076 19.175 142.053 1.00 32.40 ? 55  SER A N   1 
ATOM   422  C CA  . SER A 1 55  ? 67.585 19.969 140.934 1.00 34.31 ? 55  SER A CA  1 
ATOM   423  C C   . SER A 1 55  ? 68.256 21.290 141.262 1.00 34.65 ? 55  SER A C   1 
ATOM   424  O O   . SER A 1 55  ? 68.635 22.013 140.319 1.00 35.57 ? 55  SER A O   1 
ATOM   425  C CB  . SER A 1 55  ? 66.467 20.282 139.900 1.00 32.18 ? 55  SER A CB  1 
ATOM   426  O OG  . SER A 1 55  ? 65.331 20.767 140.590 1.00 31.08 ? 55  SER A OG  1 
ATOM   427  N N   . GLU A 1 56  ? 68.495 21.665 142.499 1.00 36.49 ? 56  GLU A N   1 
ATOM   428  C CA  . GLU A 1 56  ? 69.148 22.909 142.892 1.00 38.17 ? 56  GLU A CA  1 
ATOM   429  C C   . GLU A 1 56  ? 70.569 23.075 142.423 1.00 37.76 ? 56  GLU A C   1 
ATOM   430  O O   . GLU A 1 56  ? 71.019 24.239 142.356 1.00 41.43 ? 56  GLU A O   1 
ATOM   431  C CB  . GLU A 1 56  ? 69.046 23.163 144.404 1.00 41.82 ? 56  GLU A CB  1 
ATOM   432  C CG  . GLU A 1 56  ? 67.574 23.068 144.825 1.00 47.33 ? 56  GLU A CG  1 
ATOM   433  C CD  . GLU A 1 56  ? 66.943 24.351 145.289 1.00 50.60 ? 56  GLU A CD  1 
ATOM   434  O OE1 . GLU A 1 56  ? 67.469 25.437 144.921 1.00 54.03 ? 56  GLU A OE1 1 
ATOM   435  O OE2 . GLU A 1 56  ? 65.932 24.282 146.036 1.00 52.14 ? 56  GLU A OE2 1 
ATOM   436  N N   . SER A 1 57  ? 71.254 22.056 141.909 1.00 35.57 ? 57  SER A N   1 
ATOM   437  C CA  . SER A 1 57  ? 72.561 22.249 141.300 1.00 34.48 ? 57  SER A CA  1 
ATOM   438  C C   . SER A 1 57  ? 72.401 22.960 139.954 1.00 33.18 ? 57  SER A C   1 
ATOM   439  O O   . SER A 1 57  ? 73.379 23.510 139.437 1.00 33.39 ? 57  SER A O   1 
ATOM   440  C CB  . SER A 1 57  ? 73.299 20.912 141.112 1.00 35.33 ? 57  SER A CB  1 
ATOM   441  O OG  . SER A 1 57  ? 72.450 19.911 140.546 1.00 37.27 ? 57  SER A OG  1 
ATOM   442  N N   . ILE A 1 58  ? 71.229 22.868 139.316 1.00 29.00 ? 58  ILE A N   1 
ATOM   443  C CA  . ILE A 1 58  ? 71.032 23.557 138.030 1.00 28.49 ? 58  ILE A CA  1 
ATOM   444  C C   . ILE A 1 58  ? 70.603 24.989 138.363 1.00 29.21 ? 58  ILE A C   1 
ATOM   445  O O   . ILE A 1 58  ? 69.650 25.295 139.091 1.00 24.65 ? 58  ILE A O   1 
ATOM   446  C CB  . ILE A 1 58  ? 69.995 22.855 137.149 1.00 27.42 ? 58  ILE A CB  1 
ATOM   447  C CG1 . ILE A 1 58  ? 70.490 21.433 136.806 1.00 27.05 ? 58  ILE A CG1 1 
ATOM   448  C CG2 . ILE A 1 58  ? 69.690 23.642 135.888 1.00 27.35 ? 58  ILE A CG2 1 
ATOM   449  C CD1 . ILE A 1 58  ? 69.327 20.530 136.402 1.00 28.17 ? 58  ILE A CD1 1 
ATOM   450  N N   . PRO A 1 59  ? 71.359 25.943 137.850 1.00 29.41 ? 59  PRO A N   1 
ATOM   451  C CA  . PRO A 1 59  ? 71.095 27.344 138.185 1.00 31.38 ? 59  PRO A CA  1 
ATOM   452  C C   . PRO A 1 59  ? 69.877 27.814 137.419 1.00 31.35 ? 59  PRO A C   1 
ATOM   453  O O   . PRO A 1 59  ? 69.837 27.680 136.202 1.00 35.31 ? 59  PRO A O   1 
ATOM   454  C CB  . PRO A 1 59  ? 72.448 27.979 137.865 1.00 33.39 ? 59  PRO A CB  1 
ATOM   455  C CG  . PRO A 1 59  ? 73.026 27.156 136.756 1.00 32.71 ? 59  PRO A CG  1 
ATOM   456  C CD  . PRO A 1 59  ? 72.539 25.747 136.984 1.00 31.34 ? 59  PRO A CD  1 
ATOM   457  N N   . THR A 1 60  ? 68.817 28.257 138.059 1.00 29.12 ? 60  THR A N   1 
ATOM   458  C CA  . THR A 1 60  ? 67.556 28.647 137.505 1.00 27.52 ? 60  THR A CA  1 
ATOM   459  C C   . THR A 1 60  ? 67.139 30.059 137.902 1.00 28.07 ? 60  THR A C   1 
ATOM   460  O O   . THR A 1 60  ? 66.739 30.269 139.052 1.00 27.90 ? 60  THR A O   1 
ATOM   461  C CB  . THR A 1 60  ? 66.448 27.702 138.063 1.00 27.34 ? 60  THR A CB  1 
ATOM   462  O OG1 . THR A 1 60  ? 66.593 27.536 139.485 1.00 24.83 ? 60  THR A OG1 1 
ATOM   463  C CG2 . THR A 1 60  ? 66.467 26.321 137.441 1.00 26.08 ? 60  THR A CG2 1 
ATOM   464  N N   . PRO A 1 61  ? 67.155 31.042 136.993 1.00 25.53 ? 61  PRO A N   1 
ATOM   465  C CA  . PRO A 1 61  ? 66.749 32.399 137.312 1.00 23.22 ? 61  PRO A CA  1 
ATOM   466  C C   . PRO A 1 61  ? 65.272 32.395 137.727 1.00 24.88 ? 61  PRO A C   1 
ATOM   467  O O   . PRO A 1 61  ? 64.529 31.579 137.125 1.00 22.31 ? 61  PRO A O   1 
ATOM   468  C CB  . PRO A 1 61  ? 66.904 33.172 136.014 1.00 22.87 ? 61  PRO A CB  1 
ATOM   469  C CG  . PRO A 1 61  ? 67.086 32.161 134.930 1.00 25.29 ? 61  PRO A CG  1 
ATOM   470  C CD  . PRO A 1 61  ? 67.634 30.910 135.600 1.00 24.89 ? 61  PRO A CD  1 
ATOM   471  N N   . SER A 1 62  ? 64.881 33.278 138.635 1.00 21.56 ? 62  SER A N   1 
ATOM   472  C CA  . SER A 1 62  ? 63.506 33.254 139.140 1.00 25.72 ? 62  SER A CA  1 
ATOM   473  C C   . SER A 1 62  ? 62.742 34.555 139.196 1.00 22.71 ? 62  SER A C   1 
ATOM   474  O O   . SER A 1 62  ? 61.758 34.697 139.919 1.00 23.89 ? 62  SER A O   1 
ATOM   475  C CB  . SER A 1 62  ? 63.487 32.561 140.533 1.00 28.55 ? 62  SER A CB  1 
ATOM   476  O OG  . SER A 1 62  ? 64.226 33.401 141.439 1.00 33.78 ? 62  SER A OG  1 
ATOM   477  N N   . ASN A 1 63  ? 63.103 35.570 138.439 1.00 19.99 ? 63  ASN A N   1 
ATOM   478  C CA  . ASN A 1 63  ? 62.419 36.828 138.296 1.00 22.95 ? 63  ASN A CA  1 
ATOM   479  C C   . ASN A 1 63  ? 62.630 37.232 136.825 1.00 22.82 ? 63  ASN A C   1 
ATOM   480  O O   . ASN A 1 63  ? 63.463 36.655 136.110 1.00 20.61 ? 63  ASN A O   1 
ATOM   481  C CB  . ASN A 1 63  ? 62.802 37.958 139.250 1.00 26.90 ? 63  ASN A CB  1 
ATOM   482  C CG  . ASN A 1 63  ? 64.285 38.288 138.980 1.00 27.47 ? 63  ASN A CG  1 
ATOM   483  O OD1 . ASN A 1 63  ? 64.656 38.989 138.068 1.00 26.74 ? 63  ASN A OD1 1 
ATOM   484  N ND2 . ASN A 1 63  ? 65.133 37.657 139.770 1.00 32.49 ? 63  ASN A ND2 1 
ATOM   485  N N   . ARG A 1 64  ? 61.736 38.082 136.356 1.00 21.72 ? 64  ARG A N   1 
ATOM   486  C CA  . ARG A 1 64  ? 61.667 38.460 134.980 1.00 24.64 ? 64  ARG A CA  1 
ATOM   487  C C   . ARG A 1 64  ? 62.971 39.054 134.435 1.00 23.93 ? 64  ARG A C   1 
ATOM   488  O O   . ARG A 1 64  ? 63.472 38.555 133.424 1.00 20.35 ? 64  ARG A O   1 
ATOM   489  C CB  . ARG A 1 64  ? 60.479 39.450 134.697 1.00 23.24 ? 64  ARG A CB  1 
ATOM   490  C CG  . ARG A 1 64  ? 60.508 39.734 133.188 1.00 23.14 ? 64  ARG A CG  1 
ATOM   491  C CD  . ARG A 1 64  ? 59.207 40.340 132.697 1.00 23.64 ? 64  ARG A CD  1 
ATOM   492  N NE  . ARG A 1 64  ? 59.125 41.757 133.087 1.00 25.17 ? 64  ARG A NE  1 
ATOM   493  C CZ  . ARG A 1 64  ? 59.482 42.672 132.169 1.00 28.17 ? 64  ARG A CZ  1 
ATOM   494  N NH1 . ARG A 1 64  ? 59.887 42.344 130.944 1.00 26.69 ? 64  ARG A NH1 1 
ATOM   495  N NH2 . ARG A 1 64  ? 59.410 43.953 132.465 1.00 28.59 ? 64  ARG A NH2 1 
ATOM   496  N N   . GLU A 1 65  ? 63.526 40.045 135.131 1.00 25.34 ? 65  GLU A N   1 
ATOM   497  C CA  . GLU A 1 65  ? 64.747 40.671 134.619 1.00 29.54 ? 65  GLU A CA  1 
ATOM   498  C C   . GLU A 1 65  ? 65.893 39.672 134.503 1.00 29.32 ? 65  GLU A C   1 
ATOM   499  O O   . GLU A 1 65  ? 66.489 39.656 133.429 1.00 30.70 ? 65  GLU A O   1 
ATOM   500  C CB  . GLU A 1 65  ? 65.242 41.870 135.430 1.00 31.90 ? 65  GLU A CB  1 
ATOM   501  N N   . GLU A 1 66  ? 66.161 38.864 135.528 1.00 29.24 ? 66  GLU A N   1 
ATOM   502  C CA  . GLU A 1 66  ? 67.293 37.948 135.429 1.00 29.18 ? 66  GLU A CA  1 
ATOM   503  C C   . GLU A 1 66  ? 67.093 36.879 134.368 1.00 26.78 ? 66  GLU A C   1 
ATOM   504  O O   . GLU A 1 66  ? 68.045 36.402 133.777 1.00 25.53 ? 66  GLU A O   1 
ATOM   505  C CB  . GLU A 1 66  ? 67.580 37.275 136.768 1.00 34.59 ? 66  GLU A CB  1 
ATOM   506  C CG  . GLU A 1 66  ? 68.257 38.100 137.829 1.00 41.86 ? 66  GLU A CG  1 
ATOM   507  C CD  . GLU A 1 66  ? 68.324 37.415 139.186 1.00 47.46 ? 66  GLU A CD  1 
ATOM   508  O OE1 . GLU A 1 66  ? 68.434 36.165 139.245 1.00 50.67 ? 66  GLU A OE1 1 
ATOM   509  O OE2 . GLU A 1 66  ? 68.261 38.134 140.210 1.00 48.38 ? 66  GLU A OE2 1 
ATOM   510  N N   . THR A 1 67  ? 65.858 36.444 134.145 1.00 24.89 ? 67  THR A N   1 
ATOM   511  C CA  . THR A 1 67  ? 65.585 35.388 133.197 1.00 20.64 ? 67  THR A CA  1 
ATOM   512  C C   . THR A 1 67  ? 65.795 35.971 131.803 1.00 23.41 ? 67  THR A C   1 
ATOM   513  O O   . THR A 1 67  ? 66.515 35.353 130.995 1.00 21.88 ? 67  THR A O   1 
ATOM   514  C CB  . THR A 1 67  ? 64.180 34.777 133.345 1.00 20.15 ? 67  THR A CB  1 
ATOM   515  O OG1 . THR A 1 67  ? 63.981 34.407 134.743 1.00 19.99 ? 67  THR A OG1 1 
ATOM   516  C CG2 . THR A 1 67  ? 63.914 33.557 132.475 1.00 16.99 ? 67  THR A CG2 1 
ATOM   517  N N   . GLN A 1 68  ? 65.203 37.139 131.541 1.00 22.56 ? 68  GLN A N   1 
ATOM   518  C CA  . GLN A 1 68  ? 65.345 37.690 130.189 1.00 26.46 ? 68  GLN A CA  1 
ATOM   519  C C   . GLN A 1 68  ? 66.754 38.132 129.837 1.00 28.32 ? 68  GLN A C   1 
ATOM   520  O O   . GLN A 1 68  ? 67.040 38.326 128.651 1.00 28.67 ? 68  GLN A O   1 
ATOM   521  C CB  . GLN A 1 68  ? 64.250 38.770 129.964 1.00 24.47 ? 68  GLN A CB  1 
ATOM   522  C CG  . GLN A 1 68  ? 62.885 38.053 129.953 1.00 26.84 ? 68  GLN A CG  1 
ATOM   523  C CD  . GLN A 1 68  ? 61.627 38.867 129.924 1.00 25.24 ? 68  GLN A CD  1 
ATOM   524  O OE1 . GLN A 1 68  ? 61.558 40.065 130.208 1.00 24.67 ? 68  GLN A OE1 1 
ATOM   525  N NE2 . GLN A 1 68  ? 60.507 38.211 129.586 1.00 26.48 ? 68  GLN A NE2 1 
ATOM   526  N N   . GLN A 1 69  ? 67.709 38.299 130.737 1.00 29.31 ? 69  GLN A N   1 
ATOM   527  C CA  . GLN A 1 69  ? 69.089 38.601 130.489 1.00 29.72 ? 69  GLN A CA  1 
ATOM   528  C C   . GLN A 1 69  ? 69.829 37.394 129.908 1.00 30.39 ? 69  GLN A C   1 
ATOM   529  O O   . GLN A 1 69  ? 70.883 37.544 129.266 1.00 27.66 ? 69  GLN A O   1 
ATOM   530  C CB  . GLN A 1 69  ? 69.763 39.023 131.809 1.00 35.61 ? 69  GLN A CB  1 
ATOM   531  C CG  . GLN A 1 69  ? 69.548 40.490 132.151 1.00 40.59 ? 69  GLN A CG  1 
ATOM   532  C CD  . GLN A 1 69  ? 69.934 40.898 133.561 1.00 43.86 ? 69  GLN A CD  1 
ATOM   533  O OE1 . GLN A 1 69  ? 70.421 40.117 134.387 1.00 44.93 ? 69  GLN A OE1 1 
ATOM   534  N NE2 . GLN A 1 69  ? 69.710 42.184 133.887 1.00 45.29 ? 69  GLN A NE2 1 
ATOM   535  N N   . LYS A 1 70  ? 69.329 36.181 130.147 1.00 28.34 ? 70  LYS A N   1 
ATOM   536  C CA  . LYS A 1 70  ? 69.928 34.965 129.607 1.00 27.99 ? 70  LYS A CA  1 
ATOM   537  C C   . LYS A 1 70  ? 69.777 34.873 128.092 1.00 27.91 ? 70  LYS A C   1 
ATOM   538  O O   . LYS A 1 70  ? 68.773 35.376 127.606 1.00 29.20 ? 70  LYS A O   1 
ATOM   539  C CB  . LYS A 1 70  ? 69.257 33.702 130.199 1.00 29.44 ? 70  LYS A CB  1 
ATOM   540  C CG  . LYS A 1 70  ? 69.336 33.595 131.704 1.00 30.77 ? 70  LYS A CG  1 
ATOM   541  C CD  . LYS A 1 70  ? 70.744 33.533 132.240 1.00 34.25 ? 70  LYS A CD  1 
ATOM   542  C CE  . LYS A 1 70  ? 70.798 32.785 133.574 1.00 37.39 ? 70  LYS A CE  1 
ATOM   543  N NZ  . LYS A 1 70  ? 72.193 32.649 134.061 1.00 39.73 ? 70  LYS A NZ  1 
ATOM   544  N N   . SER A 1 71  ? 70.682 34.248 127.374 1.00 25.34 ? 71  SER A N   1 
ATOM   545  C CA  . SER A 1 71  ? 70.599 33.988 125.957 1.00 26.34 ? 71  SER A CA  1 
ATOM   546  C C   . SER A 1 71  ? 69.610 32.856 125.642 1.00 25.17 ? 71  SER A C   1 
ATOM   547  O O   . SER A 1 71  ? 69.162 32.115 126.540 1.00 22.01 ? 71  SER A O   1 
ATOM   548  C CB  . SER A 1 71  ? 71.980 33.571 125.438 1.00 30.32 ? 71  SER A CB  1 
ATOM   549  O OG  . SER A 1 71  ? 72.229 32.167 125.538 1.00 28.11 ? 71  SER A OG  1 
ATOM   550  N N   . ASN A 1 72  ? 69.268 32.666 124.377 1.00 23.50 ? 72  ASN A N   1 
ATOM   551  C CA  . ASN A 1 72  ? 68.334 31.636 123.981 1.00 23.58 ? 72  ASN A CA  1 
ATOM   552  C C   . ASN A 1 72  ? 68.863 30.228 124.272 1.00 24.97 ? 72  ASN A C   1 
ATOM   553  O O   . ASN A 1 72  ? 68.098 29.372 124.747 1.00 20.76 ? 72  ASN A O   1 
ATOM   554  C CB  . ASN A 1 72  ? 67.953 31.683 122.518 1.00 24.15 ? 72  ASN A CB  1 
ATOM   555  C CG  . ASN A 1 72  ? 67.033 32.870 122.231 1.00 27.43 ? 72  ASN A CG  1 
ATOM   556  O OD1 . ASN A 1 72  ? 66.262 33.310 123.089 1.00 28.34 ? 72  ASN A OD1 1 
ATOM   557  N ND2 . ASN A 1 72  ? 67.153 33.342 120.986 1.00 30.08 ? 72  ASN A ND2 1 
ATOM   558  N N   . LEU A 1 73  ? 70.139 30.041 123.959 1.00 25.06 ? 73  LEU A N   1 
ATOM   559  C CA  . LEU A 1 73  ? 70.807 28.759 124.173 1.00 27.21 ? 73  LEU A CA  1 
ATOM   560  C C   . LEU A 1 73  ? 70.969 28.444 125.651 1.00 25.58 ? 73  LEU A C   1 
ATOM   561  O O   . LEU A 1 73  ? 70.831 27.252 126.023 1.00 24.19 ? 73  LEU A O   1 
ATOM   562  C CB  . LEU A 1 73  ? 72.158 28.690 123.446 1.00 28.59 ? 73  LEU A CB  1 
ATOM   563  C CG  . LEU A 1 73  ? 72.165 28.551 121.913 1.00 33.66 ? 73  LEU A CG  1 
ATOM   564  C CD1 . LEU A 1 73  ? 73.623 28.518 121.399 1.00 34.49 ? 73  LEU A CD1 1 
ATOM   565  C CD2 . LEU A 1 73  ? 71.467 27.303 121.397 1.00 34.23 ? 73  LEU A CD2 1 
ATOM   566  N N   . GLU A 1 74  ? 71.224 29.432 126.509 1.00 24.28 ? 74  GLU A N   1 
ATOM   567  C CA  . GLU A 1 74  ? 71.293 29.169 127.937 1.00 25.94 ? 74  GLU A CA  1 
ATOM   568  C C   . GLU A 1 74  ? 69.921 28.697 128.454 1.00 23.46 ? 74  GLU A C   1 
ATOM   569  O O   . GLU A 1 74  ? 69.820 27.691 129.158 1.00 20.12 ? 74  GLU A O   1 
ATOM   570  C CB  . GLU A 1 74  ? 71.767 30.359 128.789 1.00 28.17 ? 74  GLU A CB  1 
ATOM   571  C CG  . GLU A 1 74  ? 73.056 31.012 128.352 1.00 35.49 ? 74  GLU A CG  1 
ATOM   572  C CD  . GLU A 1 74  ? 73.406 32.253 129.166 1.00 39.55 ? 74  GLU A CD  1 
ATOM   573  O OE1 . GLU A 1 74  ? 72.914 33.377 128.888 1.00 37.69 ? 74  GLU A OE1 1 
ATOM   574  O OE2 . GLU A 1 74  ? 74.207 32.044 130.127 1.00 42.73 ? 74  GLU A OE2 1 
ATOM   575  N N   . LEU A 1 75  ? 68.857 29.415 128.076 1.00 23.13 ? 75  LEU A N   1 
ATOM   576  C CA  . LEU A 1 75  ? 67.497 29.064 128.557 1.00 24.17 ? 75  LEU A CA  1 
ATOM   577  C C   . LEU A 1 75  ? 67.050 27.701 128.021 1.00 22.92 ? 75  LEU A C   1 
ATOM   578  O O   . LEU A 1 75  ? 66.464 26.927 128.771 1.00 21.19 ? 75  LEU A O   1 
ATOM   579  C CB  . LEU A 1 75  ? 66.529 30.160 128.175 1.00 25.65 ? 75  LEU A CB  1 
ATOM   580  C CG  . LEU A 1 75  ? 66.034 31.222 129.154 1.00 28.19 ? 75  LEU A CG  1 
ATOM   581  C CD1 . LEU A 1 75  ? 66.654 31.279 130.538 1.00 26.50 ? 75  LEU A CD1 1 
ATOM   582  C CD2 . LEU A 1 75  ? 66.024 32.563 128.458 1.00 27.47 ? 75  LEU A CD2 1 
ATOM   583  N N   . LEU A 1 76  ? 67.426 27.336 126.778 1.00 19.37 ? 76  LEU A N   1 
ATOM   584  C CA  . LEU A 1 76  ? 67.085 26.027 126.274 1.00 20.39 ? 76  LEU A CA  1 
ATOM   585  C C   . LEU A 1 76  ? 67.926 24.959 127.032 1.00 21.96 ? 76  LEU A C   1 
ATOM   586  O O   . LEU A 1 76  ? 67.471 23.835 127.281 1.00 19.63 ? 76  LEU A O   1 
ATOM   587  C CB  . LEU A 1 76  ? 67.369 25.940 124.764 1.00 18.58 ? 76  LEU A CB  1 
ATOM   588  C CG  . LEU A 1 76  ? 66.472 26.686 123.790 1.00 21.01 ? 76  LEU A CG  1 
ATOM   589  C CD1 . LEU A 1 76  ? 66.899 26.487 122.334 1.00 16.19 ? 76  LEU A CD1 1 
ATOM   590  C CD2 . LEU A 1 76  ? 65.008 26.252 123.918 1.00 21.81 ? 76  LEU A CD2 1 
ATOM   591  N N   . ARG A 1 77  ? 69.183 25.257 127.314 1.00 20.44 ? 77  ARG A N   1 
ATOM   592  C CA  . ARG A 1 77  ? 70.091 24.305 127.959 1.00 22.87 ? 77  ARG A CA  1 
ATOM   593  C C   . ARG A 1 77  ? 69.618 24.028 129.399 1.00 22.19 ? 77  ARG A C   1 
ATOM   594  O O   . ARG A 1 77  ? 69.692 22.910 129.885 1.00 22.63 ? 77  ARG A O   1 
ATOM   595  C CB  . ARG A 1 77  ? 71.554 24.761 127.970 1.00 24.29 ? 77  ARG A CB  1 
ATOM   596  C CG  . ARG A 1 77  ? 72.480 23.893 128.847 1.00 27.09 ? 77  ARG A CG  1 
ATOM   597  C CD  . ARG A 1 77  ? 72.839 22.556 128.215 1.00 25.86 ? 77  ARG A CD  1 
ATOM   598  N NE  . ARG A 1 77  ? 73.841 21.829 129.017 1.00 26.35 ? 77  ARG A NE  1 
ATOM   599  C CZ  . ARG A 1 77  ? 74.183 20.566 128.750 1.00 28.26 ? 77  ARG A CZ  1 
ATOM   600  N NH1 . ARG A 1 77  ? 73.596 19.928 127.748 1.00 27.33 ? 77  ARG A NH1 1 
ATOM   601  N NH2 . ARG A 1 77  ? 75.062 19.848 129.471 1.00 26.85 ? 77  ARG A NH2 1 
ATOM   602  N N   . ILE A 1 78  ? 69.213 25.074 130.124 1.00 19.84 ? 78  ILE A N   1 
ATOM   603  C CA  . ILE A 1 78  ? 68.689 24.871 131.463 1.00 21.56 ? 78  ILE A CA  1 
ATOM   604  C C   . ILE A 1 78  ? 67.415 24.043 131.360 1.00 20.72 ? 78  ILE A C   1 
ATOM   605  O O   . ILE A 1 78  ? 67.351 23.077 132.130 1.00 20.92 ? 78  ILE A O   1 
ATOM   606  C CB  . ILE A 1 78  ? 68.447 26.163 132.255 1.00 24.67 ? 78  ILE A CB  1 
ATOM   607  C CG1 . ILE A 1 78  ? 69.787 26.875 132.484 1.00 22.29 ? 78  ILE A CG1 1 
ATOM   608  C CG2 . ILE A 1 78  ? 67.757 25.876 133.591 1.00 22.47 ? 78  ILE A CG2 1 
ATOM   609  C CD1 . ILE A 1 78  ? 69.623 28.367 132.741 1.00 26.08 ? 78  ILE A CD1 1 
ATOM   610  N N   . SER A 1 79  ? 66.522 24.315 130.403 1.00 19.81 ? 79  SER A N   1 
ATOM   611  C CA  . SER A 1 79  ? 65.306 23.531 130.234 1.00 18.27 ? 79  SER A CA  1 
ATOM   612  C C   . SER A 1 79  ? 65.582 22.078 129.956 1.00 17.19 ? 79  SER A C   1 
ATOM   613  O O   . SER A 1 79  ? 64.895 21.170 130.476 1.00 15.52 ? 79  SER A O   1 
ATOM   614  C CB  . SER A 1 79  ? 64.415 24.026 129.062 1.00 19.53 ? 79  SER A CB  1 
ATOM   615  O OG  . SER A 1 79  ? 63.987 25.334 129.387 1.00 18.92 ? 79  SER A OG  1 
ATOM   616  N N   . LEU A 1 80  ? 66.617 21.862 129.136 1.00 16.45 ? 80  LEU A N   1 
ATOM   617  C CA  . LEU A 1 80  ? 67.029 20.520 128.787 1.00 15.98 ? 80  LEU A CA  1 
ATOM   618  C C   . LEU A 1 80  ? 67.475 19.746 130.030 1.00 15.59 ? 80  LEU A C   1 
ATOM   619  O O   . LEU A 1 80  ? 66.982 18.640 130.267 1.00 19.26 ? 80  LEU A O   1 
ATOM   620  C CB  . LEU A 1 80  ? 68.138 20.519 127.704 1.00 16.90 ? 80  LEU A CB  1 
ATOM   621  C CG  . LEU A 1 80  ? 68.661 19.142 127.330 1.00 18.13 ? 80  LEU A CG  1 
ATOM   622  C CD1 . LEU A 1 80  ? 67.531 18.394 126.617 1.00 17.68 ? 80  LEU A CD1 1 
ATOM   623  C CD2 . LEU A 1 80  ? 69.845 19.121 126.359 1.00 22.28 ? 80  LEU A CD2 1 
ATOM   624  N N   . LEU A 1 81  ? 68.314 20.315 130.869 1.00 16.14 ? 81  LEU A N   1 
ATOM   625  C CA  . LEU A 1 81  ? 68.788 19.656 132.085 1.00 18.08 ? 81  LEU A CA  1 
ATOM   626  C C   . LEU A 1 81  ? 67.665 19.451 133.107 1.00 18.89 ? 81  LEU A C   1 
ATOM   627  O O   . LEU A 1 81  ? 67.671 18.404 133.748 1.00 17.75 ? 81  LEU A O   1 
ATOM   628  C CB  . LEU A 1 81  ? 69.872 20.518 132.737 1.00 19.38 ? 81  LEU A CB  1 
ATOM   629  C CG  . LEU A 1 81  ? 71.210 20.479 131.974 1.00 23.18 ? 81  LEU A CG  1 
ATOM   630  C CD1 . LEU A 1 81  ? 72.207 21.466 132.553 1.00 22.21 ? 81  LEU A CD1 1 
ATOM   631  C CD2 . LEU A 1 81  ? 71.802 19.095 131.889 1.00 21.39 ? 81  LEU A CD2 1 
ATOM   632  N N   . LEU A 1 82  ? 66.698 20.373 133.220 1.00 15.88 ? 82  LEU A N   1 
ATOM   633  C CA  . LEU A 1 82  ? 65.574 20.122 134.123 1.00 16.18 ? 82  LEU A CA  1 
ATOM   634  C C   . LEU A 1 82  ? 64.745 18.919 133.700 1.00 17.39 ? 82  LEU A C   1 
ATOM   635  O O   . LEU A 1 82  ? 64.392 18.042 134.514 1.00 17.79 ? 82  LEU A O   1 
ATOM   636  C CB  . LEU A 1 82  ? 64.681 21.378 134.224 1.00 17.15 ? 82  LEU A CB  1 
ATOM   637  C CG  . LEU A 1 82  ? 65.313 22.566 134.950 1.00 18.97 ? 82  LEU A CG  1 
ATOM   638  C CD1 . LEU A 1 82  ? 64.510 23.867 134.889 1.00 18.21 ? 82  LEU A CD1 1 
ATOM   639  C CD2 . LEU A 1 82  ? 65.544 22.223 136.430 1.00 17.37 ? 82  LEU A CD2 1 
ATOM   640  N N   . ILE A 1 83  ? 64.407 18.810 132.409 1.00 15.56 ? 83  ILE A N   1 
ATOM   641  C CA  . ILE A 1 83  ? 63.624 17.708 131.874 1.00 18.64 ? 83  ILE A CA  1 
ATOM   642  C C   . ILE A 1 83  ? 64.370 16.380 132.057 1.00 17.37 ? 83  ILE A C   1 
ATOM   643  O O   . ILE A 1 83  ? 63.817 15.395 132.552 1.00 19.12 ? 83  ILE A O   1 
ATOM   644  C CB  . ILE A 1 83  ? 63.348 17.935 130.356 1.00 16.57 ? 83  ILE A CB  1 
ATOM   645  C CG1 . ILE A 1 83  ? 62.496 19.179 130.067 1.00 16.39 ? 83  ILE A CG1 1 
ATOM   646  C CG2 . ILE A 1 83  ? 62.761 16.688 129.721 1.00 18.42 ? 83  ILE A CG2 1 
ATOM   647  C CD1 . ILE A 1 83  ? 61.133 19.106 130.737 1.00 18.37 ? 83  ILE A CD1 1 
ATOM   648  N N   . GLN A 1 84  ? 65.665 16.379 131.722 1.00 17.23 ? 84  GLN A N   1 
ATOM   649  C CA  . GLN A 1 84  ? 66.461 15.153 131.880 1.00 18.86 ? 84  GLN A CA  1 
ATOM   650  C C   . GLN A 1 84  ? 66.597 14.717 133.325 1.00 20.61 ? 84  GLN A C   1 
ATOM   651  O O   . GLN A 1 84  ? 66.608 13.492 133.545 1.00 18.59 ? 84  GLN A O   1 
ATOM   652  C CB  . GLN A 1 84  ? 67.859 15.318 131.286 1.00 21.79 ? 84  GLN A CB  1 
ATOM   653  C CG  . GLN A 1 84  ? 67.872 15.499 129.767 1.00 22.58 ? 84  GLN A CG  1 
ATOM   654  C CD  . GLN A 1 84  ? 69.294 15.727 129.246 1.00 25.13 ? 84  GLN A CD  1 
ATOM   655  O OE1 . GLN A 1 84  ? 70.139 16.357 129.908 1.00 24.95 ? 84  GLN A OE1 1 
ATOM   656  N NE2 . GLN A 1 84  ? 69.582 15.225 128.060 1.00 24.02 ? 84  GLN A NE2 1 
ATOM   657  N N   . SER A 1 85  ? 66.608 15.659 134.295 1.00 21.41 ? 85  SER A N   1 
ATOM   658  C CA  . SER A 1 85  ? 66.673 15.295 135.706 1.00 21.19 ? 85  SER A CA  1 
ATOM   659  C C   . SER A 1 85  ? 65.453 14.490 136.174 1.00 22.57 ? 85  SER A C   1 
ATOM   660  O O   . SER A 1 85  ? 65.521 13.825 137.206 1.00 21.92 ? 85  SER A O   1 
ATOM   661  C CB  . SER A 1 85  ? 66.779 16.518 136.613 1.00 20.51 ? 85  SER A CB  1 
ATOM   662  O OG  . SER A 1 85  ? 67.891 17.345 136.302 1.00 20.65 ? 85  SER A OG  1 
ATOM   663  N N   . TRP A 1 86  ? 64.317 14.535 135.490 1.00 20.64 ? 86  TRP A N   1 
ATOM   664  C CA  . TRP A 1 86  ? 63.092 13.870 135.883 1.00 19.96 ? 86  TRP A CA  1 
ATOM   665  C C   . TRP A 1 86  ? 62.813 12.545 135.187 1.00 19.15 ? 86  TRP A C   1 
ATOM   666  O O   . TRP A 1 86  ? 61.932 11.780 135.575 1.00 20.40 ? 86  TRP A O   1 
ATOM   667  C CB  . TRP A 1 86  ? 61.903 14.855 135.665 1.00 17.14 ? 86  TRP A CB  1 
ATOM   668  C CG  . TRP A 1 86  ? 61.827 15.790 136.856 1.00 18.84 ? 86  TRP A CG  1 
ATOM   669  C CD1 . TRP A 1 86  ? 62.312 17.066 136.939 1.00 17.08 ? 86  TRP A CD1 1 
ATOM   670  C CD2 . TRP A 1 86  ? 61.250 15.495 138.120 1.00 19.41 ? 86  TRP A CD2 1 
ATOM   671  N NE1 . TRP A 1 86  ? 62.055 17.572 138.171 1.00 20.57 ? 86  TRP A NE1 1 
ATOM   672  C CE2 . TRP A 1 86  ? 61.406 16.618 138.929 1.00 20.40 ? 86  TRP A CE2 1 
ATOM   673  C CE3 . TRP A 1 86  ? 60.631 14.353 138.677 1.00 22.58 ? 86  TRP A CE3 1 
ATOM   674  C CZ2 . TRP A 1 86  ? 60.950 16.675 140.253 1.00 18.29 ? 86  TRP A CZ2 1 
ATOM   675  C CZ3 . TRP A 1 86  ? 60.155 14.397 139.985 1.00 20.71 ? 86  TRP A CZ3 1 
ATOM   676  C CH2 . TRP A 1 86  ? 60.337 15.564 140.762 1.00 19.33 ? 86  TRP A CH2 1 
ATOM   677  N N   . LEU A 1 87  ? 63.636 12.119 134.253 1.00 21.35 ? 87  LEU A N   1 
ATOM   678  C CA  . LEU A 1 87  ? 63.502 10.867 133.494 1.00 23.76 ? 87  LEU A CA  1 
ATOM   679  C C   . LEU A 1 87  ? 63.503 9.631  134.382 1.00 24.56 ? 87  LEU A C   1 
ATOM   680  O O   . LEU A 1 87  ? 62.687 8.732  134.195 1.00 23.68 ? 87  LEU A O   1 
ATOM   681  C CB  . LEU A 1 87  ? 64.641 10.832 132.472 1.00 22.84 ? 87  LEU A CB  1 
ATOM   682  C CG  . LEU A 1 87  ? 64.420 11.244 131.029 1.00 26.09 ? 87  LEU A CG  1 
ATOM   683  C CD1 . LEU A 1 87  ? 63.148 11.987 130.727 1.00 25.45 ? 87  LEU A CD1 1 
ATOM   684  C CD2 . LEU A 1 87  ? 65.600 11.941 130.375 1.00 26.57 ? 87  LEU A CD2 1 
ATOM   685  N N   . GLU A 1 88  ? 64.398 9.589  135.367 1.00 26.36 ? 88  GLU A N   1 
ATOM   686  C CA  . GLU A 1 88  ? 64.428 8.469  136.335 1.00 27.32 ? 88  GLU A CA  1 
ATOM   687  C C   . GLU A 1 88  ? 63.516 8.660  137.518 1.00 27.48 ? 88  GLU A C   1 
ATOM   688  O O   . GLU A 1 88  ? 62.671 7.796  137.822 1.00 29.40 ? 88  GLU A O   1 
ATOM   689  C CB  . GLU A 1 88  ? 65.880 8.277  136.790 1.00 25.08 ? 88  GLU A CB  1 
ATOM   690  N N   . PRO A 1 89  ? 63.583 9.790  138.237 1.00 27.81 ? 89  PRO A N   1 
ATOM   691  C CA  . PRO A 1 89  ? 62.751 10.077 139.392 1.00 28.65 ? 89  PRO A CA  1 
ATOM   692  C C   . PRO A 1 89  ? 61.253 10.057 139.266 1.00 29.65 ? 89  PRO A C   1 
ATOM   693  O O   . PRO A 1 89  ? 60.547 9.790  140.263 1.00 28.03 ? 89  PRO A O   1 
ATOM   694  C CB  . PRO A 1 89  ? 63.186 11.485 139.852 1.00 27.52 ? 89  PRO A CB  1 
ATOM   695  C CG  . PRO A 1 89  ? 64.615 11.510 139.436 1.00 27.80 ? 89  PRO A CG  1 
ATOM   696  C CD  . PRO A 1 89  ? 64.556 10.873 138.040 1.00 27.92 ? 89  PRO A CD  1 
ATOM   697  N N   . VAL A 1 90  ? 60.712 10.316 138.061 1.00 29.74 ? 90  VAL A N   1 
ATOM   698  C CA  . VAL A 1 90  ? 59.302 10.333 137.781 1.00 32.30 ? 90  VAL A CA  1 
ATOM   699  C C   . VAL A 1 90  ? 58.693 8.966  138.083 1.00 36.42 ? 90  VAL A C   1 
ATOM   700  O O   . VAL A 1 90  ? 57.527 8.922  138.507 1.00 36.03 ? 90  VAL A O   1 
ATOM   701  C CB  . VAL A 1 90  ? 58.907 10.770 136.351 1.00 31.16 ? 90  VAL A CB  1 
ATOM   702  C CG1 . VAL A 1 90  ? 59.241 9.724  135.287 1.00 29.53 ? 90  VAL A CG1 1 
ATOM   703  C CG2 . VAL A 1 90  ? 57.418 11.078 136.304 1.00 30.58 ? 90  VAL A CG2 1 
ATOM   704  N N   . GLN A 1 91  ? 59.473 7.877  137.990 1.00 38.81 ? 91  GLN A N   1 
ATOM   705  C CA  . GLN A 1 91  ? 58.921 6.573  138.375 1.00 44.26 ? 91  GLN A CA  1 
ATOM   706  C C   . GLN A 1 91  ? 58.599 6.461  139.862 1.00 44.89 ? 91  GLN A C   1 
ATOM   707  O O   . GLN A 1 91  ? 57.752 5.641  140.268 1.00 44.40 ? 91  GLN A O   1 
ATOM   708  C CB  . GLN A 1 91  ? 59.801 5.427  137.860 1.00 46.67 ? 91  GLN A CB  1 
ATOM   709  C CG  . GLN A 1 91  ? 59.299 4.829  136.558 1.00 49.89 ? 91  GLN A CG  1 
ATOM   710  C CD  . GLN A 1 91  ? 59.836 5.407  135.267 1.00 53.50 ? 91  GLN A CD  1 
ATOM   711  O OE1 . GLN A 1 91  ? 59.116 5.313  134.248 1.00 54.07 ? 91  GLN A OE1 1 
ATOM   712  N NE2 . GLN A 1 91  ? 61.052 5.983  135.274 1.00 52.25 ? 91  GLN A NE2 1 
ATOM   713  N N   . PHE A 1 92  ? 59.112 7.318  140.731 1.00 44.86 ? 92  PHE A N   1 
ATOM   714  C CA  . PHE A 1 92  ? 58.763 7.412  142.126 1.00 46.43 ? 92  PHE A CA  1 
ATOM   715  C C   . PHE A 1 92  ? 57.447 8.142  142.376 1.00 48.01 ? 92  PHE A C   1 
ATOM   716  O O   . PHE A 1 92  ? 57.054 8.357  143.525 1.00 49.51 ? 92  PHE A O   1 
ATOM   717  C CB  . PHE A 1 92  ? 59.864 8.130  142.936 1.00 46.68 ? 92  PHE A CB  1 
ATOM   718  C CG  . PHE A 1 92  ? 61.113 7.295  142.850 1.00 48.54 ? 92  PHE A CG  1 
ATOM   719  C CD1 . PHE A 1 92  ? 61.160 6.063  143.490 1.00 49.74 ? 92  PHE A CD1 1 
ATOM   720  C CD2 . PHE A 1 92  ? 62.197 7.714  142.106 1.00 48.08 ? 92  PHE A CD2 1 
ATOM   721  C CE1 . PHE A 1 92  ? 62.293 5.275  143.403 1.00 50.61 ? 92  PHE A CE1 1 
ATOM   722  C CE2 . PHE A 1 92  ? 63.329 6.932  142.013 1.00 48.94 ? 92  PHE A CE2 1 
ATOM   723  C CZ  . PHE A 1 92  ? 63.379 5.715  142.662 1.00 50.77 ? 92  PHE A CZ  1 
ATOM   724  N N   . LEU A 1 93  ? 56.728 8.559  141.345 1.00 46.78 ? 93  LEU A N   1 
ATOM   725  C CA  . LEU A 1 93  ? 55.442 9.213  141.517 1.00 47.40 ? 93  LEU A CA  1 
ATOM   726  C C   . LEU A 1 93  ? 54.386 8.269  140.954 1.00 49.78 ? 93  LEU A C   1 
ATOM   727  O O   . LEU A 1 93  ? 53.242 8.652  140.733 1.00 50.13 ? 93  LEU A O   1 
ATOM   728  C CB  . LEU A 1 93  ? 55.447 10.594 140.854 1.00 43.98 ? 93  LEU A CB  1 
ATOM   729  C CG  . LEU A 1 93  ? 56.147 11.677 141.679 1.00 43.54 ? 93  LEU A CG  1 
ATOM   730  C CD1 . LEU A 1 93  ? 56.456 12.892 140.830 1.00 41.70 ? 93  LEU A CD1 1 
ATOM   731  C CD2 . LEU A 1 93  ? 55.295 12.071 142.897 1.00 43.64 ? 93  LEU A CD2 1 
ATOM   732  N N   . ARG A 1 94  ? 54.793 7.017  140.729 1.00 52.95 ? 94  ARG A N   1 
ATOM   733  C CA  . ARG A 1 94  ? 53.897 6.009  140.168 1.00 56.86 ? 94  ARG A CA  1 
ATOM   734  C C   . ARG A 1 94  ? 52.603 5.870  140.962 1.00 57.23 ? 94  ARG A C   1 
ATOM   735  O O   . ARG A 1 94  ? 51.524 6.010  140.382 1.00 56.50 ? 94  ARG A O   1 
ATOM   736  C CB  . ARG A 1 94  ? 54.609 4.665  140.075 1.00 59.44 ? 94  ARG A CB  1 
ATOM   737  C CG  . ARG A 1 94  ? 53.778 3.478  139.625 1.00 62.10 ? 94  ARG A CG  1 
ATOM   738  C CD  . ARG A 1 94  ? 54.621 2.341  139.068 1.00 64.50 ? 94  ARG A CD  1 
ATOM   739  N NE  . ARG A 1 94  ? 56.033 2.666  138.913 1.00 66.91 ? 94  ARG A NE  1 
ATOM   740  C CZ  . ARG A 1 94  ? 56.930 2.067  138.148 1.00 68.75 ? 94  ARG A CZ  1 
ATOM   741  N NH1 . ARG A 1 94  ? 56.626 1.024  137.379 1.00 69.63 ? 94  ARG A NH1 1 
ATOM   742  N NH2 . ARG A 1 94  ? 58.192 2.486  138.125 1.00 69.51 ? 94  ARG A NH2 1 
ATOM   743  N N   . SER A 1 95  ? 52.710 5.640  142.271 1.00 58.30 ? 95  SER A N   1 
ATOM   744  C CA  . SER A 1 95  ? 51.506 5.490  143.091 1.00 58.95 ? 95  SER A CA  1 
ATOM   745  C C   . SER A 1 95  ? 50.767 6.814  143.221 1.00 57.97 ? 95  SER A C   1 
ATOM   746  O O   . SER A 1 95  ? 49.532 6.823  143.155 1.00 59.04 ? 95  SER A O   1 
ATOM   747  C CB  . SER A 1 95  ? 51.810 4.853  144.445 1.00 60.10 ? 95  SER A CB  1 
ATOM   748  O OG  . SER A 1 95  ? 51.984 5.812  145.475 1.00 61.43 ? 95  SER A OG  1 
ATOM   749  N N   . VAL A 1 96  ? 51.478 7.938  143.339 1.00 56.32 ? 96  VAL A N   1 
ATOM   750  C CA  . VAL A 1 96  ? 50.798 9.225  143.358 1.00 54.71 ? 96  VAL A CA  1 
ATOM   751  C C   . VAL A 1 96  ? 49.872 9.345  142.147 1.00 53.21 ? 96  VAL A C   1 
ATOM   752  O O   . VAL A 1 96  ? 48.673 9.539  142.299 1.00 52.99 ? 96  VAL A O   1 
ATOM   753  C CB  . VAL A 1 96  ? 51.747 10.430 143.338 1.00 55.30 ? 96  VAL A CB  1 
ATOM   754  C CG1 . VAL A 1 96  ? 50.967 11.722 143.109 1.00 55.93 ? 96  VAL A CG1 1 
ATOM   755  C CG2 . VAL A 1 96  ? 52.552 10.535 144.626 1.00 56.80 ? 96  VAL A CG2 1 
ATOM   756  N N   . PHE A 1 97  ? 50.425 9.253  140.942 1.00 52.36 ? 97  PHE A N   1 
ATOM   757  C CA  . PHE A 1 97  ? 49.669 9.442  139.716 1.00 52.02 ? 97  PHE A CA  1 
ATOM   758  C C   . PHE A 1 97  ? 48.621 8.370  139.443 1.00 51.76 ? 97  PHE A C   1 
ATOM   759  O O   . PHE A 1 97  ? 47.685 8.644  138.689 1.00 51.37 ? 97  PHE A O   1 
ATOM   760  C CB  . PHE A 1 97  ? 50.613 9.529  138.522 1.00 51.64 ? 97  PHE A CB  1 
ATOM   761  C CG  . PHE A 1 97  ? 51.556 10.680 138.379 1.00 50.62 ? 97  PHE A CG  1 
ATOM   762  C CD1 . PHE A 1 97  ? 51.147 12.000 138.483 1.00 50.64 ? 97  PHE A CD1 1 
ATOM   763  C CD2 . PHE A 1 97  ? 52.899 10.447 138.099 1.00 48.37 ? 97  PHE A CD2 1 
ATOM   764  C CE1 . PHE A 1 97  ? 52.030 13.049 138.314 1.00 49.27 ? 97  PHE A CE1 1 
ATOM   765  C CE2 . PHE A 1 97  ? 53.783 11.483 137.954 1.00 46.72 ? 97  PHE A CE2 1 
ATOM   766  C CZ  . PHE A 1 97  ? 53.362 12.790 138.056 1.00 48.03 ? 97  PHE A CZ  1 
ATOM   767  N N   . ALA A 1 98  ? 48.741 7.160  139.978 1.00 52.05 ? 98  ALA A N   1 
ATOM   768  C CA  . ALA A 1 98  ? 47.743 6.121  139.709 1.00 52.42 ? 98  ALA A CA  1 
ATOM   769  C C   . ALA A 1 98  ? 46.493 6.339  140.553 1.00 50.50 ? 98  ALA A C   1 
ATOM   770  O O   . ALA A 1 98  ? 45.384 6.134  140.086 1.00 49.49 ? 98  ALA A O   1 
ATOM   771  C CB  . ALA A 1 98  ? 48.329 4.738  139.947 1.00 53.49 ? 98  ALA A CB  1 
ATOM   772  N N   . ASN A 1 99  ? 46.669 6.843  141.769 1.00 50.97 ? 99  ASN A N   1 
ATOM   773  C CA  . ASN A 1 99  ? 45.571 7.167  142.660 1.00 50.84 ? 99  ASN A CA  1 
ATOM   774  C C   . ASN A 1 99  ? 44.894 8.489  142.315 1.00 51.32 ? 99  ASN A C   1 
ATOM   775  O O   . ASN A 1 99  ? 43.813 8.782  142.845 1.00 50.72 ? 99  ASN A O   1 
ATOM   776  C CB  . ASN A 1 99  ? 46.079 7.219  144.101 1.00 50.65 ? 99  ASN A CB  1 
ATOM   777  N N   . SER A 1 100 ? 45.505 9.309  141.463 1.00 49.84 ? 100 SER A N   1 
ATOM   778  C CA  . SER A 1 100 ? 45.038 10.606 141.049 1.00 48.55 ? 100 SER A CA  1 
ATOM   779  C C   . SER A 1 100 ? 43.766 10.616 140.208 1.00 49.80 ? 100 SER A C   1 
ATOM   780  O O   . SER A 1 100 ? 43.635 9.783  139.308 1.00 51.36 ? 100 SER A O   1 
ATOM   781  C CB  . SER A 1 100 ? 46.104 11.270 140.124 1.00 45.78 ? 100 SER A CB  1 
ATOM   782  O OG  . SER A 1 100 ? 45.606 12.505 139.641 1.00 43.07 ? 100 SER A OG  1 
ATOM   783  N N   . LEU A 1 101 ? 42.928 11.644 140.349 1.00 49.63 ? 101 LEU A N   1 
ATOM   784  C CA  . LEU A 1 101 ? 41.777 11.763 139.476 1.00 50.26 ? 101 LEU A CA  1 
ATOM   785  C C   . LEU A 1 101 ? 42.110 12.675 138.296 1.00 49.85 ? 101 LEU A C   1 
ATOM   786  O O   . LEU A 1 101 ? 41.182 12.930 137.527 1.00 49.37 ? 101 LEU A O   1 
ATOM   787  C CB  . LEU A 1 101 ? 40.557 12.380 140.155 1.00 53.09 ? 101 LEU A CB  1 
ATOM   788  C CG  . LEU A 1 101 ? 40.126 11.823 141.504 1.00 54.72 ? 101 LEU A CG  1 
ATOM   789  C CD1 . LEU A 1 101 ? 38.927 12.605 142.017 1.00 55.36 ? 101 LEU A CD1 1 
ATOM   790  C CD2 . LEU A 1 101 ? 39.805 10.331 141.383 1.00 55.49 ? 101 LEU A CD2 1 
ATOM   791  N N   . VAL A 1 102 ? 43.348 13.124 138.150 1.00 47.45 ? 102 VAL A N   1 
ATOM   792  C CA  . VAL A 1 102 ? 43.700 13.996 137.020 1.00 45.25 ? 102 VAL A CA  1 
ATOM   793  C C   . VAL A 1 102 ? 43.790 13.205 135.720 1.00 46.41 ? 102 VAL A C   1 
ATOM   794  O O   . VAL A 1 102 ? 44.605 12.279 135.587 1.00 47.73 ? 102 VAL A O   1 
ATOM   795  C CB  . VAL A 1 102 ? 45.026 14.719 137.341 1.00 43.50 ? 102 VAL A CB  1 
ATOM   796  C CG1 . VAL A 1 102 ? 45.482 15.625 136.222 1.00 41.78 ? 102 VAL A CG1 1 
ATOM   797  C CG2 . VAL A 1 102 ? 44.897 15.506 138.646 1.00 43.23 ? 102 VAL A CG2 1 
ATOM   798  N N   . TYR A 1 103 ? 43.002 13.557 134.696 1.00 46.63 ? 103 TYR A N   1 
ATOM   799  C CA  . TYR A 1 103 ? 43.018 12.795 133.446 1.00 47.47 ? 103 TYR A CA  1 
ATOM   800  C C   . TYR A 1 103 ? 44.391 12.825 132.792 1.00 47.11 ? 103 TYR A C   1 
ATOM   801  O O   . TYR A 1 103 ? 44.890 13.927 132.557 1.00 47.03 ? 103 TYR A O   1 
ATOM   802  C CB  . TYR A 1 103 ? 41.972 13.282 132.456 1.00 48.24 ? 103 TYR A CB  1 
ATOM   803  N N   . GLY A 1 104 ? 44.970 11.653 132.522 1.00 46.70 ? 104 GLY A N   1 
ATOM   804  C CA  . GLY A 1 104 ? 46.265 11.571 131.883 1.00 46.11 ? 104 GLY A CA  1 
ATOM   805  C C   . GLY A 1 104 ? 47.461 11.408 132.803 1.00 47.31 ? 104 GLY A C   1 
ATOM   806  O O   . GLY A 1 104 ? 48.617 11.283 132.345 1.00 47.82 ? 104 GLY A O   1 
ATOM   807  N N   . ALA A 1 105 ? 47.242 11.438 134.116 1.00 47.41 ? 105 ALA A N   1 
ATOM   808  C CA  . ALA A 1 105 ? 48.363 11.285 135.033 1.00 48.30 ? 105 ALA A CA  1 
ATOM   809  C C   . ALA A 1 105 ? 48.686 9.824  135.324 1.00 49.41 ? 105 ALA A C   1 
ATOM   810  O O   . ALA A 1 105 ? 47.988 9.133  136.054 1.00 51.04 ? 105 ALA A O   1 
ATOM   811  C CB  . ALA A 1 105 ? 48.130 12.027 136.337 1.00 47.42 ? 105 ALA A CB  1 
ATOM   812  N N   . SER A 1 106 ? 49.825 9.366  134.855 1.00 49.39 ? 106 SER A N   1 
ATOM   813  C CA  . SER A 1 106 ? 50.397 8.057  135.118 1.00 49.00 ? 106 SER A CA  1 
ATOM   814  C C   . SER A 1 106 ? 51.899 8.256  134.927 1.00 49.46 ? 106 SER A C   1 
ATOM   815  O O   . SER A 1 106 ? 52.250 9.120  134.107 1.00 47.75 ? 106 SER A O   1 
ATOM   816  C CB  . SER A 1 106 ? 49.904 6.964  134.186 1.00 49.56 ? 106 SER A CB  1 
ATOM   817  O OG  . SER A 1 106 ? 50.281 7.211  132.828 1.00 50.94 ? 106 SER A OG  1 
ATOM   818  N N   . ASP A 1 107 ? 52.750 7.491  135.601 1.00 50.22 ? 107 ASP A N   1 
ATOM   819  C CA  . ASP A 1 107 ? 54.179 7.705  135.363 1.00 50.56 ? 107 ASP A CA  1 
ATOM   820  C C   . ASP A 1 107 ? 54.537 7.366  133.924 1.00 49.39 ? 107 ASP A C   1 
ATOM   821  O O   . ASP A 1 107 ? 55.412 8.050  133.369 1.00 49.54 ? 107 ASP A O   1 
ATOM   822  C CB  . ASP A 1 107 ? 55.057 7.042  136.413 1.00 53.68 ? 107 ASP A CB  1 
ATOM   823  C CG  . ASP A 1 107 ? 55.216 5.541  136.312 1.00 56.55 ? 107 ASP A CG  1 
ATOM   824  O OD1 . ASP A 1 107 ? 54.219 4.810  136.076 1.00 57.34 ? 107 ASP A OD1 1 
ATOM   825  O OD2 . ASP A 1 107 ? 56.361 5.052  136.486 1.00 56.86 ? 107 ASP A OD2 1 
ATOM   826  N N   . SER A 1 108 ? 53.926 6.373  133.277 1.00 47.38 ? 108 SER A N   1 
ATOM   827  C CA  . SER A 1 108 ? 54.257 6.032  131.893 1.00 45.13 ? 108 SER A CA  1 
ATOM   828  C C   . SER A 1 108 ? 53.973 7.185  130.921 1.00 41.31 ? 108 SER A C   1 
ATOM   829  O O   . SER A 1 108 ? 54.760 7.504  130.028 1.00 41.45 ? 108 SER A O   1 
ATOM   830  C CB  . SER A 1 108 ? 53.442 4.833  131.399 1.00 45.01 ? 108 SER A CB  1 
ATOM   831  N N   . ASN A 1 109 ? 52.757 7.724  131.054 1.00 37.88 ? 109 ASN A N   1 
ATOM   832  C CA  . ASN A 1 109 ? 52.352 8.857  130.243 1.00 35.18 ? 109 ASN A CA  1 
ATOM   833  C C   . ASN A 1 109 ? 53.290 10.031 130.532 1.00 33.14 ? 109 ASN A C   1 
ATOM   834  O O   . ASN A 1 109 ? 53.749 10.646 129.572 1.00 33.56 ? 109 ASN A O   1 
ATOM   835  C CB  . ASN A 1 109 ? 50.896 9.163  130.517 1.00 37.06 ? 109 ASN A CB  1 
ATOM   836  N N   . VAL A 1 110 ? 53.611 10.358 131.778 1.00 31.09 ? 110 VAL A N   1 
ATOM   837  C CA  . VAL A 1 110 ? 54.537 11.447 132.083 1.00 28.06 ? 110 VAL A CA  1 
ATOM   838  C C   . VAL A 1 110 ? 55.938 11.131 131.585 1.00 27.18 ? 110 VAL A C   1 
ATOM   839  O O   . VAL A 1 110 ? 56.601 11.946 130.918 1.00 24.63 ? 110 VAL A O   1 
ATOM   840  C CB  . VAL A 1 110 ? 54.548 11.786 133.587 1.00 28.18 ? 110 VAL A CB  1 
ATOM   841  C CG1 . VAL A 1 110 ? 55.480 12.968 133.878 1.00 25.38 ? 110 VAL A CG1 1 
ATOM   842  C CG2 . VAL A 1 110 ? 53.110 12.109 134.004 1.00 26.94 ? 110 VAL A CG2 1 
ATOM   843  N N   . TYR A 1 111 ? 56.466 9.941  131.857 1.00 23.95 ? 111 TYR A N   1 
ATOM   844  C CA  . TYR A 1 111 ? 57.762 9.592  131.268 1.00 25.37 ? 111 TYR A CA  1 
ATOM   845  C C   . TYR A 1 111 ? 57.791 9.858  129.752 1.00 23.54 ? 111 TYR A C   1 
ATOM   846  O O   . TYR A 1 111 ? 58.765 10.376 129.190 1.00 21.29 ? 111 TYR A O   1 
ATOM   847  C CB  . TYR A 1 111 ? 58.102 8.111  131.578 1.00 25.83 ? 111 TYR A CB  1 
ATOM   848  C CG  . TYR A 1 111 ? 59.434 7.714  130.942 1.00 27.28 ? 111 TYR A CG  1 
ATOM   849  C CD1 . TYR A 1 111 ? 60.628 8.024  131.548 1.00 28.78 ? 111 TYR A CD1 1 
ATOM   850  C CD2 . TYR A 1 111 ? 59.471 7.059  129.718 1.00 28.39 ? 111 TYR A CD2 1 
ATOM   851  C CE1 . TYR A 1 111 ? 61.849 7.715  130.962 1.00 30.76 ? 111 TYR A CE1 1 
ATOM   852  C CE2 . TYR A 1 111 ? 60.676 6.729  129.110 1.00 30.57 ? 111 TYR A CE2 1 
ATOM   853  C CZ  . TYR A 1 111 ? 61.854 7.064  129.748 1.00 31.47 ? 111 TYR A CZ  1 
ATOM   854  O OH  . TYR A 1 111 ? 63.058 6.731  129.176 1.00 34.43 ? 111 TYR A OH  1 
ATOM   855  N N   . ASP A 1 112 ? 56.770 9.436  128.997 1.00 26.09 ? 112 ASP A N   1 
ATOM   856  C CA  . ASP A 1 112 ? 56.695 9.613  127.547 1.00 27.12 ? 112 ASP A CA  1 
ATOM   857  C C   . ASP A 1 112 ? 56.778 11.066 127.089 1.00 23.70 ? 112 ASP A C   1 
ATOM   858  O O   . ASP A 1 112 ? 57.540 11.394 126.174 1.00 23.35 ? 112 ASP A O   1 
ATOM   859  C CB  . ASP A 1 112 ? 55.360 9.099  126.960 1.00 30.93 ? 112 ASP A CB  1 
ATOM   860  C CG  . ASP A 1 112 ? 55.324 7.577  126.898 1.00 35.01 ? 112 ASP A CG  1 
ATOM   861  O OD1 . ASP A 1 112 ? 56.404 6.977  127.112 1.00 35.24 ? 112 ASP A OD1 1 
ATOM   862  O OD2 . ASP A 1 112 ? 54.209 7.036  126.634 1.00 37.97 ? 112 ASP A OD2 1 
ATOM   863  N N   . LEU A 1 113 ? 56.007 11.902 127.757 1.00 22.90 ? 113 LEU A N   1 
ATOM   864  C CA  . LEU A 1 113 ? 56.035 13.340 127.590 1.00 25.84 ? 113 LEU A CA  1 
ATOM   865  C C   . LEU A 1 113 ? 57.436 13.940 127.800 1.00 22.49 ? 113 LEU A C   1 
ATOM   866  O O   . LEU A 1 113 ? 57.821 14.769 126.991 1.00 21.43 ? 113 LEU A O   1 
ATOM   867  C CB  . LEU A 1 113 ? 55.094 14.080 128.555 1.00 26.32 ? 113 LEU A CB  1 
ATOM   868  C CG  . LEU A 1 113 ? 53.652 14.290 128.116 1.00 31.84 ? 113 LEU A CG  1 
ATOM   869  C CD1 . LEU A 1 113 ? 52.793 14.693 129.324 1.00 33.44 ? 113 LEU A CD1 1 
ATOM   870  C CD2 . LEU A 1 113 ? 53.502 15.335 127.027 1.00 33.68 ? 113 LEU A CD2 1 
ATOM   871  N N   . LEU A 1 114 ? 58.116 13.566 128.899 1.00 20.47 ? 114 LEU A N   1 
ATOM   872  C CA  . LEU A 1 114 ? 59.447 14.132 129.172 1.00 18.78 ? 114 LEU A CA  1 
ATOM   873  C C   . LEU A 1 114 ? 60.430 13.751 128.089 1.00 16.28 ? 114 LEU A C   1 
ATOM   874  O O   . LEU A 1 114 ? 61.252 14.518 127.563 1.00 16.28 ? 114 LEU A O   1 
ATOM   875  C CB  . LEU A 1 114 ? 59.878 13.586 130.577 1.00 16.93 ? 114 LEU A CB  1 
ATOM   876  C CG  . LEU A 1 114 ? 59.101 14.150 131.791 1.00 18.00 ? 114 LEU A CG  1 
ATOM   877  C CD1 . LEU A 1 114 ? 59.341 13.234 133.023 1.00 17.54 ? 114 LEU A CD1 1 
ATOM   878  C CD2 . LEU A 1 114 ? 59.559 15.560 132.148 1.00 14.46 ? 114 LEU A CD2 1 
ATOM   879  N N   . LYS A 1 115 ? 60.440 12.433 127.736 1.00 19.47 ? 115 LYS A N   1 
ATOM   880  C CA  . LYS A 1 115 ? 61.348 11.976 126.668 1.00 21.99 ? 115 LYS A CA  1 
ATOM   881  C C   . LYS A 1 115 ? 61.085 12.709 125.334 1.00 21.09 ? 115 LYS A C   1 
ATOM   882  O O   . LYS A 1 115 ? 62.009 13.168 124.646 1.00 23.20 ? 115 LYS A O   1 
ATOM   883  C CB  . LYS A 1 115 ? 61.187 10.465 126.460 1.00 28.46 ? 115 LYS A CB  1 
ATOM   884  C CG  . LYS A 1 115 ? 62.393 9.643  126.850 1.00 33.81 ? 115 LYS A CG  1 
ATOM   885  C CD  . LYS A 1 115 ? 63.465 9.728  125.740 1.00 35.50 ? 115 LYS A CD  1 
ATOM   886  C CE  . LYS A 1 115 ? 64.715 9.020  126.306 1.00 34.67 ? 115 LYS A CE  1 
ATOM   887  N NZ  . LYS A 1 115 ? 65.762 9.973  126.729 1.00 32.53 ? 115 LYS A NZ  1 
ATOM   888  N N   . ASP A 1 116 ? 59.830 12.825 124.947 1.00 18.46 ? 116 ASP A N   1 
ATOM   889  C CA  . ASP A 1 116 ? 59.421 13.555 123.741 1.00 17.93 ? 116 ASP A CA  1 
ATOM   890  C C   . ASP A 1 116 ? 59.911 14.985 123.824 1.00 19.15 ? 116 ASP A C   1 
ATOM   891  O O   . ASP A 1 116 ? 60.605 15.399 122.912 1.00 17.77 ? 116 ASP A O   1 
ATOM   892  C CB  . ASP A 1 116 ? 57.893 13.531 123.608 1.00 20.12 ? 116 ASP A CB  1 
ATOM   893  C CG  . ASP A 1 116 ? 57.405 14.153 122.294 1.00 25.35 ? 116 ASP A CG  1 
ATOM   894  O OD1 . ASP A 1 116 ? 58.183 14.640 121.470 1.00 25.18 ? 116 ASP A OD1 1 
ATOM   895  O OD2 . ASP A 1 116 ? 56.179 14.169 122.045 1.00 28.34 ? 116 ASP A OD2 1 
ATOM   896  N N   . LEU A 1 117 ? 59.651 15.724 124.942 1.00 21.36 ? 117 LEU A N   1 
ATOM   897  C CA  . LEU A 1 117 ? 60.176 17.079 125.060 1.00 16.95 ? 117 LEU A CA  1 
ATOM   898  C C   . LEU A 1 117 ? 61.687 17.179 125.039 1.00 17.77 ? 117 LEU A C   1 
ATOM   899  O O   . LEU A 1 117 ? 62.246 18.158 124.470 1.00 15.24 ? 117 LEU A O   1 
ATOM   900  C CB  . LEU A 1 117 ? 59.707 17.813 126.344 1.00 19.28 ? 117 LEU A CB  1 
ATOM   901  C CG  . LEU A 1 117 ? 59.110 19.192 126.287 1.00 23.40 ? 117 LEU A CG  1 
ATOM   902  C CD1 . LEU A 1 117 ? 59.061 19.905 127.634 1.00 18.23 ? 117 LEU A CD1 1 
ATOM   903  C CD2 . LEU A 1 117 ? 59.598 20.126 125.160 1.00 17.73 ? 117 LEU A CD2 1 
ATOM   904  N N   . GLU A 1 118 ? 62.402 16.313 125.766 1.00 19.27 ? 118 GLU A N   1 
ATOM   905  C CA  . GLU A 1 118 ? 63.901 16.331 125.709 1.00 19.53 ? 118 GLU A CA  1 
ATOM   906  C C   . GLU A 1 118 ? 64.401 16.270 124.255 1.00 20.62 ? 118 GLU A C   1 
ATOM   907  O O   . GLU A 1 118 ? 65.335 16.983 123.875 1.00 22.47 ? 118 GLU A O   1 
ATOM   908  C CB  . GLU A 1 118 ? 64.498 15.075 126.442 1.00 18.00 ? 118 GLU A CB  1 
ATOM   909  C CG  . GLU A 1 118 ? 65.959 14.795 126.174 1.00 25.29 ? 118 GLU A CG  1 
ATOM   910  C CD  . GLU A 1 118 ? 66.691 13.570 126.663 1.00 32.06 ? 118 GLU A CD  1 
ATOM   911  O OE1 . GLU A 1 118 ? 66.133 12.437 126.754 1.00 32.43 ? 118 GLU A OE1 1 
ATOM   912  O OE2 . GLU A 1 118 ? 67.921 13.644 126.983 1.00 31.31 ? 118 GLU A OE2 1 
ATOM   913  N N   . GLU A 1 119 ? 63.926 15.353 123.414 1.00 21.27 ? 119 GLU A N   1 
ATOM   914  C CA  . GLU A 1 119 ? 64.349 15.332 122.007 1.00 25.02 ? 119 GLU A CA  1 
ATOM   915  C C   . GLU A 1 119 ? 63.952 16.627 121.277 1.00 23.33 ? 119 GLU A C   1 
ATOM   916  O O   . GLU A 1 119 ? 64.773 17.155 120.521 1.00 25.05 ? 119 GLU A O   1 
ATOM   917  C CB  . GLU A 1 119 ? 63.766 14.121 121.256 1.00 30.40 ? 119 GLU A CB  1 
ATOM   918  C CG  . GLU A 1 119 ? 63.740 12.857 122.090 1.00 39.48 ? 119 GLU A CG  1 
ATOM   919  C CD  . GLU A 1 119 ? 62.947 11.645 121.656 1.00 43.64 ? 119 GLU A CD  1 
ATOM   920  O OE1 . GLU A 1 119 ? 61.876 11.679 120.990 1.00 45.06 ? 119 GLU A OE1 1 
ATOM   921  O OE2 . GLU A 1 119 ? 63.419 10.534 122.040 1.00 45.13 ? 119 GLU A OE2 1 
ATOM   922  N N   . ARG A 1 120 ? 62.770 17.205 121.556 1.00 21.24 ? 120 ARG A N   1 
ATOM   923  C CA  . ARG A 1 120 ? 62.424 18.459 120.853 1.00 20.18 ? 120 ARG A CA  1 
ATOM   924  C C   . ARG A 1 120 ? 63.304 19.619 121.239 1.00 19.98 ? 120 ARG A C   1 
ATOM   925  O O   . ARG A 1 120 ? 63.576 20.464 120.347 1.00 21.15 ? 120 ARG A O   1 
ATOM   926  C CB  . ARG A 1 120 ? 60.936 18.803 120.964 1.00 20.57 ? 120 ARG A CB  1 
ATOM   927  C CG  . ARG A 1 120 ? 60.034 17.697 120.369 1.00 20.61 ? 120 ARG A CG  1 
ATOM   928  C CD  . ARG A 1 120 ? 58.529 17.950 120.711 1.00 18.67 ? 120 ARG A CD  1 
ATOM   929  N NE  . ARG A 1 120 ? 57.780 17.022 119.860 1.00 17.17 ? 120 ARG A NE  1 
ATOM   930  C CZ  . ARG A 1 120 ? 57.546 17.241 118.550 1.00 21.82 ? 120 ARG A CZ  1 
ATOM   931  N NH1 . ARG A 1 120 ? 57.939 18.347 117.915 1.00 23.03 ? 120 ARG A NH1 1 
ATOM   932  N NH2 . ARG A 1 120 ? 56.921 16.323 117.841 1.00 23.41 ? 120 ARG A NH2 1 
ATOM   933  N N   . ILE A 1 121 ? 63.711 19.695 122.517 1.00 16.74 ? 121 ILE A N   1 
ATOM   934  C CA  . ILE A 1 121 ? 64.562 20.779 122.961 1.00 16.50 ? 121 ILE A CA  1 
ATOM   935  C C   . ILE A 1 121 ? 65.912 20.569 122.241 1.00 19.54 ? 121 ILE A C   1 
ATOM   936  O O   . ILE A 1 121 ? 66.550 21.519 121.819 1.00 19.37 ? 121 ILE A O   1 
ATOM   937  C CB  . ILE A 1 121 ? 64.702 20.842 124.488 1.00 16.54 ? 121 ILE A CB  1 
ATOM   938  C CG1 . ILE A 1 121 ? 63.375 21.174 125.224 1.00 14.65 ? 121 ILE A CG1 1 
ATOM   939  C CG2 . ILE A 1 121 ? 65.705 21.945 124.858 1.00 15.68 ? 121 ILE A CG2 1 
ATOM   940  C CD1 . ILE A 1 121 ? 63.391 20.922 126.727 1.00 10.57 ? 121 ILE A CD1 1 
ATOM   941  N N   . GLN A 1 122 ? 66.442 19.333 122.222 1.00 20.99 ? 122 GLN A N   1 
ATOM   942  C CA  . GLN A 1 122 ? 67.692 19.074 121.509 1.00 24.56 ? 122 GLN A CA  1 
ATOM   943  C C   . GLN A 1 122 ? 67.603 19.491 120.035 1.00 23.04 ? 122 GLN A C   1 
ATOM   944  O O   . GLN A 1 122 ? 68.548 20.138 119.591 1.00 24.12 ? 122 GLN A O   1 
ATOM   945  C CB  . GLN A 1 122 ? 68.111 17.605 121.579 1.00 26.76 ? 122 GLN A CB  1 
ATOM   946  C CG  . GLN A 1 122 ? 68.567 17.273 123.005 1.00 29.42 ? 122 GLN A CG  1 
ATOM   947  C CD  . GLN A 1 122 ? 68.656 15.792 123.278 1.00 31.40 ? 122 GLN A CD  1 
ATOM   948  O OE1 . GLN A 1 122 ? 69.587 15.320 123.958 1.00 32.10 ? 122 GLN A OE1 1 
ATOM   949  N NE2 . GLN A 1 122 ? 67.705 15.027 122.783 1.00 31.89 ? 122 GLN A NE2 1 
ATOM   950  N N   . THR A 1 123 ? 66.516 19.217 119.330 1.00 22.34 ? 123 THR A N   1 
ATOM   951  C CA  . THR A 1 123 ? 66.451 19.717 117.922 1.00 23.45 ? 123 THR A CA  1 
ATOM   952  C C   . THR A 1 123 ? 66.468 21.225 117.852 1.00 23.32 ? 123 THR A C   1 
ATOM   953  O O   . THR A 1 123 ? 67.089 21.823 116.965 1.00 25.78 ? 123 THR A O   1 
ATOM   954  C CB  . THR A 1 123 ? 65.143 19.257 117.241 1.00 23.08 ? 123 THR A CB  1 
ATOM   955  O OG1 . THR A 1 123 ? 65.111 17.827 117.332 1.00 23.10 ? 123 THR A OG1 1 
ATOM   956  C CG2 . THR A 1 123 ? 64.995 19.662 115.789 1.00 23.31 ? 123 THR A CG2 1 
ATOM   957  N N   . LEU A 1 124 ? 65.784 21.902 118.785 1.00 21.43 ? 124 LEU A N   1 
ATOM   958  C CA  . LEU A 1 124 ? 65.718 23.366 118.817 1.00 24.83 ? 124 LEU A CA  1 
ATOM   959  C C   . LEU A 1 124 ? 67.077 23.974 119.121 1.00 24.72 ? 124 LEU A C   1 
ATOM   960  O O   . LEU A 1 124 ? 67.470 24.987 118.516 1.00 26.67 ? 124 LEU A O   1 
ATOM   961  C CB  . LEU A 1 124 ? 64.698 23.829 119.856 1.00 24.93 ? 124 LEU A CB  1 
ATOM   962  C CG  . LEU A 1 124 ? 63.312 24.336 119.642 1.00 29.13 ? 124 LEU A CG  1 
ATOM   963  C CD1 . LEU A 1 124 ? 62.817 24.390 118.202 1.00 28.59 ? 124 LEU A CD1 1 
ATOM   964  C CD2 . LEU A 1 124 ? 62.250 23.691 120.541 1.00 28.18 ? 124 LEU A CD2 1 
ATOM   965  N N   . MET A 1 125 ? 67.890 23.374 119.988 1.00 24.50 ? 125 MET A N   1 
ATOM   966  C CA  . MET A 1 125 ? 69.235 23.885 120.243 1.00 26.56 ? 125 MET A CA  1 
ATOM   967  C C   . MET A 1 125 ? 70.121 23.703 118.995 1.00 28.86 ? 125 MET A C   1 
ATOM   968  O O   . MET A 1 125 ? 71.008 24.529 118.764 1.00 30.68 ? 125 MET A O   1 
ATOM   969  C CB  . MET A 1 125 ? 69.922 23.208 121.443 1.00 26.02 ? 125 MET A CB  1 
ATOM   970  C CG  . MET A 1 125 ? 69.215 23.547 122.757 1.00 25.98 ? 125 MET A CG  1 
ATOM   971  S SD  . MET A 1 125 ? 69.916 22.629 124.157 1.00 28.69 ? 125 MET A SD  1 
ATOM   972  C CE  . MET A 1 125 ? 71.328 23.690 124.463 1.00 24.58 ? 125 MET A CE  1 
ATOM   973  N N   . GLY A 1 126 ? 69.875 22.664 118.218 1.00 29.62 ? 126 GLY A N   1 
ATOM   974  C CA  . GLY A 1 126 ? 70.603 22.426 116.973 1.00 34.86 ? 126 GLY A CA  1 
ATOM   975  C C   . GLY A 1 126 ? 70.300 23.542 115.974 1.00 35.59 ? 126 GLY A C   1 
ATOM   976  O O   . GLY A 1 126 ? 71.215 24.150 115.416 1.00 34.60 ? 126 GLY A O   1 
ATOM   977  N N   . ARG A 1 127 ? 69.036 23.933 115.846 1.00 36.08 ? 127 ARG A N   1 
ATOM   978  C CA  . ARG A 1 127 ? 68.624 24.992 114.947 1.00 35.78 ? 127 ARG A CA  1 
ATOM   979  C C   . ARG A 1 127 ? 69.080 26.380 115.353 1.00 38.12 ? 127 ARG A C   1 
ATOM   980  O O   . ARG A 1 127 ? 69.000 27.284 114.512 1.00 38.15 ? 127 ARG A O   1 
ATOM   981  C CB  . ARG A 1 127 ? 67.098 25.078 114.814 1.00 35.69 ? 127 ARG A CB  1 
ATOM   982  C CG  . ARG A 1 127 ? 66.334 23.933 114.221 1.00 35.88 ? 127 ARG A CG  1 
ATOM   983  C CD  . ARG A 1 127 ? 66.562 23.676 112.737 1.00 37.95 ? 127 ARG A CD  1 
ATOM   984  N NE  . ARG A 1 127 ? 66.147 22.280 112.440 1.00 38.27 ? 127 ARG A NE  1 
ATOM   985  C CZ  . ARG A 1 127 ? 64.988 21.934 111.891 1.00 38.78 ? 127 ARG A CZ  1 
ATOM   986  N NH1 . ARG A 1 127 ? 64.093 22.858 111.568 1.00 40.85 ? 127 ARG A NH1 1 
ATOM   987  N NH2 . ARG A 1 127 ? 64.645 20.668 111.638 1.00 39.86 ? 127 ARG A NH2 1 
ATOM   988  N N   . LEU A 1 128 ? 69.380 26.638 116.626 1.00 38.48 ? 128 LEU A N   1 
ATOM   989  C CA  . LEU A 1 128 ? 69.747 27.998 117.010 1.00 39.29 ? 128 LEU A CA  1 
ATOM   990  C C   . LEU A 1 128 ? 71.241 28.076 117.311 1.00 40.92 ? 128 LEU A C   1 
ATOM   991  O O   . LEU A 1 128 ? 71.676 29.093 117.839 1.00 42.29 ? 128 LEU A O   1 
ATOM   992  C CB  . LEU A 1 128 ? 68.939 28.501 118.207 1.00 39.58 ? 128 LEU A CB  1 
ATOM   993  C CG  . LEU A 1 128 ? 67.443 28.740 118.089 1.00 40.05 ? 128 LEU A CG  1 
ATOM   994  C CD1 . LEU A 1 128 ? 66.924 29.457 119.351 1.00 41.96 ? 128 LEU A CD1 1 
ATOM   995  C CD2 . LEU A 1 128 ? 67.043 29.544 116.866 1.00 40.57 ? 128 LEU A CD2 1 
ATOM   996  N N   . THR A 1 129 ? 71.994 27.021 117.010 1.00 42.32 ? 129 THR A N   1 
ATOM   997  C CA  . THR A 1 129 ? 73.418 26.976 117.273 1.00 45.00 ? 129 THR A CA  1 
ATOM   998  C C   . THR A 1 129 ? 74.102 28.328 117.066 1.00 47.52 ? 129 THR A C   1 
ATOM   999  O O   . THR A 1 129 ? 74.014 28.897 115.978 1.00 49.18 ? 129 THR A O   1 
ATOM   1000 C CB  . THR A 1 129 ? 74.089 25.957 116.369 1.00 45.82 ? 129 THR A CB  1 
ATOM   1001 N N   . GLY A 1 136 ? 80.865 28.360 129.512 1.00 51.34 ? 136 GLY A N   1 
ATOM   1002 C CA  . GLY A 1 136 ? 79.902 28.550 130.607 1.00 49.53 ? 136 GLY A CA  1 
ATOM   1003 C C   . GLY A 1 136 ? 79.635 27.232 131.326 1.00 48.25 ? 136 GLY A C   1 
ATOM   1004 O O   . GLY A 1 136 ? 79.405 26.211 130.682 1.00 48.11 ? 136 GLY A O   1 
ATOM   1005 N N   . GLN A 1 137 ? 79.593 27.234 132.657 1.00 49.02 ? 137 GLN A N   1 
ATOM   1006 C CA  . GLN A 1 137 ? 79.357 26.028 133.450 1.00 48.55 ? 137 GLN A CA  1 
ATOM   1007 C C   . GLN A 1 137 ? 78.178 25.199 132.939 1.00 45.79 ? 137 GLN A C   1 
ATOM   1008 O O   . GLN A 1 137 ? 78.259 23.990 132.784 1.00 43.11 ? 137 GLN A O   1 
ATOM   1009 C CB  . GLN A 1 137 ? 79.070 26.357 134.929 1.00 50.59 ? 137 GLN A CB  1 
ATOM   1010 C CG  . GLN A 1 137 ? 79.193 25.191 135.891 1.00 52.54 ? 137 GLN A CG  1 
ATOM   1011 C CD  . GLN A 1 137 ? 79.509 25.540 137.329 1.00 54.51 ? 137 GLN A CD  1 
ATOM   1012 O OE1 . GLN A 1 137 ? 80.637 25.309 137.804 1.00 55.78 ? 137 GLN A OE1 1 
ATOM   1013 N NE2 . GLN A 1 137 ? 78.578 26.086 138.111 1.00 53.19 ? 137 GLN A NE2 1 
ATOM   1014 N N   . ILE A 1 138 ? 77.060 25.875 132.674 1.00 43.95 ? 138 ILE A N   1 
ATOM   1015 C CA  . ILE A 1 138 ? 75.827 25.241 132.223 1.00 40.40 ? 138 ILE A CA  1 
ATOM   1016 C C   . ILE A 1 138 ? 75.942 24.333 131.031 1.00 37.09 ? 138 ILE A C   1 
ATOM   1017 O O   . ILE A 1 138 ? 75.273 23.281 131.002 1.00 33.29 ? 138 ILE A O   1 
ATOM   1018 C CB  . ILE A 1 138 ? 74.774 26.362 132.130 1.00 40.63 ? 138 ILE A CB  1 
ATOM   1019 C CG1 . ILE A 1 138 ? 73.511 25.807 132.757 1.00 40.25 ? 138 ILE A CG1 1 
ATOM   1020 C CG2 . ILE A 1 138 ? 74.617 26.935 130.743 1.00 39.01 ? 138 ILE A CG2 1 
ATOM   1021 C CD1 . ILE A 1 138 ? 72.566 25.106 131.826 1.00 41.68 ? 138 ILE A CD1 1 
ATOM   1022 N N   . PHE A 1 139 ? 76.856 24.602 130.086 1.00 36.31 ? 139 PHE A N   1 
ATOM   1023 C CA  . PHE A 1 139 ? 77.117 23.648 129.003 1.00 37.39 ? 139 PHE A CA  1 
ATOM   1024 C C   . PHE A 1 139 ? 78.103 22.583 129.467 1.00 38.29 ? 139 PHE A C   1 
ATOM   1025 O O   . PHE A 1 139 ? 78.249 21.517 128.847 1.00 39.91 ? 139 PHE A O   1 
ATOM   1026 C CB  . PHE A 1 139 ? 77.571 24.375 127.738 1.00 38.44 ? 139 PHE A CB  1 
ATOM   1027 C CG  . PHE A 1 139 ? 76.573 25.425 127.301 1.00 36.53 ? 139 PHE A CG  1 
ATOM   1028 C CD1 . PHE A 1 139 ? 75.530 25.093 126.454 1.00 35.56 ? 139 PHE A CD1 1 
ATOM   1029 C CD2 . PHE A 1 139 ? 76.672 26.731 127.763 1.00 37.48 ? 139 PHE A CD2 1 
ATOM   1030 C CE1 . PHE A 1 139 ? 74.604 26.042 126.062 1.00 35.49 ? 139 PHE A CE1 1 
ATOM   1031 C CE2 . PHE A 1 139 ? 75.750 27.686 127.367 1.00 36.50 ? 139 PHE A CE2 1 
ATOM   1032 C CZ  . PHE A 1 139 ? 74.720 27.333 126.520 1.00 34.43 ? 139 PHE A CZ  1 
ATOM   1033 N N   . LYS A 1 140 ? 78.741 22.737 130.621 1.00 38.06 ? 140 LYS A N   1 
ATOM   1034 C CA  . LYS A 1 140 ? 79.644 21.735 131.165 1.00 43.01 ? 140 LYS A CA  1 
ATOM   1035 C C   . LYS A 1 140 ? 78.961 20.711 132.082 1.00 43.19 ? 140 LYS A C   1 
ATOM   1036 O O   . LYS A 1 140 ? 79.350 19.523 132.085 1.00 44.20 ? 140 LYS A O   1 
ATOM   1037 C CB  . LYS A 1 140 ? 80.792 22.404 131.947 1.00 42.37 ? 140 LYS A CB  1 
ATOM   1038 N N   . GLN A 1 141 ? 78.026 21.168 132.913 1.00 42.46 ? 141 GLN A N   1 
ATOM   1039 C CA  . GLN A 1 141 ? 77.375 20.283 133.880 1.00 41.34 ? 141 GLN A CA  1 
ATOM   1040 C C   . GLN A 1 141 ? 76.399 19.288 133.266 1.00 38.71 ? 141 GLN A C   1 
ATOM   1041 O O   . GLN A 1 141 ? 76.135 19.193 132.080 1.00 37.41 ? 141 GLN A O   1 
ATOM   1042 C CB  . GLN A 1 141 ? 76.739 21.014 135.069 1.00 40.62 ? 141 GLN A CB  1 
ATOM   1043 C CG  . GLN A 1 141 ? 75.658 22.018 134.791 1.00 40.66 ? 141 GLN A CG  1 
ATOM   1044 C CD  . GLN A 1 141 ? 75.158 22.731 136.029 1.00 40.27 ? 141 GLN A CD  1 
ATOM   1045 O OE1 . GLN A 1 141 ? 75.424 23.932 136.197 1.00 41.93 ? 141 GLN A OE1 1 
ATOM   1046 N NE2 . GLN A 1 141 ? 74.433 22.058 136.903 1.00 37.77 ? 141 GLN A NE2 1 
ATOM   1047 N N   . THR A 1 142 ? 75.901 18.403 134.142 1.00 37.11 ? 142 THR A N   1 
ATOM   1048 C CA  . THR A 1 142 ? 75.023 17.331 133.675 1.00 32.65 ? 142 THR A CA  1 
ATOM   1049 C C   . THR A 1 142 ? 73.718 17.524 134.425 1.00 29.01 ? 142 THR A C   1 
ATOM   1050 O O   . THR A 1 142 ? 73.631 18.483 135.178 1.00 26.35 ? 142 THR A O   1 
ATOM   1051 C CB  . THR A 1 142 ? 75.658 15.968 133.962 1.00 34.94 ? 142 THR A CB  1 
ATOM   1052 O OG1 . THR A 1 142 ? 74.780 14.925 133.509 1.00 38.93 ? 142 THR A OG1 1 
ATOM   1053 C CG2 . THR A 1 142 ? 75.830 15.766 135.466 1.00 35.01 ? 142 THR A CG2 1 
ATOM   1054 N N   . TYR A 1 143 ? 72.774 16.642 134.210 1.00 25.42 ? 143 TYR A N   1 
ATOM   1055 C CA  . TYR A 1 143 ? 71.501 16.695 134.901 1.00 26.80 ? 143 TYR A CA  1 
ATOM   1056 C C   . TYR A 1 143 ? 71.622 16.179 136.341 1.00 27.74 ? 143 TYR A C   1 
ATOM   1057 O O   . TYR A 1 143 ? 72.539 15.431 136.704 1.00 26.68 ? 143 TYR A O   1 
ATOM   1058 C CB  . TYR A 1 143 ? 70.444 15.903 134.108 1.00 24.06 ? 143 TYR A CB  1 
ATOM   1059 C CG  . TYR A 1 143 ? 70.826 14.439 134.006 1.00 25.89 ? 143 TYR A CG  1 
ATOM   1060 C CD1 . TYR A 1 143 ? 70.451 13.533 134.976 1.00 27.04 ? 143 TYR A CD1 1 
ATOM   1061 C CD2 . TYR A 1 143 ? 71.579 13.970 132.940 1.00 28.42 ? 143 TYR A CD2 1 
ATOM   1062 C CE1 . TYR A 1 143 ? 70.774 12.189 134.932 1.00 28.88 ? 143 TYR A CE1 1 
ATOM   1063 C CE2 . TYR A 1 143 ? 71.927 12.616 132.858 1.00 31.89 ? 143 TYR A CE2 1 
ATOM   1064 C CZ  . TYR A 1 143 ? 71.523 11.754 133.845 1.00 33.99 ? 143 TYR A CZ  1 
ATOM   1065 O OH  . TYR A 1 143 ? 71.868 10.417 133.766 1.00 38.83 ? 143 TYR A OH  1 
ATOM   1066 N N   . SER A 1 144 ? 70.695 16.596 137.188 1.00 25.07 ? 144 SER A N   1 
ATOM   1067 C CA  . SER A 1 144 ? 70.656 16.222 138.587 1.00 28.32 ? 144 SER A CA  1 
ATOM   1068 C C   . SER A 1 144 ? 70.150 14.815 138.877 1.00 30.12 ? 144 SER A C   1 
ATOM   1069 O O   . SER A 1 144 ? 69.289 14.264 138.178 1.00 29.34 ? 144 SER A O   1 
ATOM   1070 C CB  . SER A 1 144 ? 69.732 17.183 139.363 1.00 27.16 ? 144 SER A CB  1 
ATOM   1071 O OG  . SER A 1 144 ? 70.195 18.514 139.242 1.00 33.16 ? 144 SER A OG  1 
ATOM   1072 N N   . LYS A 1 145 ? 70.657 14.288 139.994 1.00 33.41 ? 145 LYS A N   1 
ATOM   1073 C CA  . LYS A 1 145 ? 70.313 12.953 140.475 1.00 34.69 ? 145 LYS A CA  1 
ATOM   1074 C C   . LYS A 1 145 ? 69.503 12.989 141.756 1.00 34.91 ? 145 LYS A C   1 
ATOM   1075 O O   . LYS A 1 145 ? 69.734 13.837 142.599 1.00 32.22 ? 145 LYS A O   1 
ATOM   1076 C CB  . LYS A 1 145 ? 71.585 12.168 140.790 1.00 36.19 ? 145 LYS A CB  1 
ATOM   1077 C CG  . LYS A 1 145 ? 72.244 11.558 139.570 1.00 38.99 ? 145 LYS A CG  1 
ATOM   1078 C CD  . LYS A 1 145 ? 73.036 12.568 138.776 1.00 39.41 ? 145 LYS A CD  1 
ATOM   1079 C CE  . LYS A 1 145 ? 73.180 12.144 137.310 1.00 37.19 ? 145 LYS A CE  1 
ATOM   1080 N NZ  . LYS A 1 145 ? 74.280 12.982 136.739 1.00 33.94 ? 145 LYS A NZ  1 
ATOM   1081 N N   . PHE A 1 146 ? 68.561 12.075 141.912 1.00 38.21 ? 146 PHE A N   1 
ATOM   1082 C CA  . PHE A 1 146 ? 67.725 12.089 143.105 1.00 42.94 ? 146 PHE A CA  1 
ATOM   1083 C C   . PHE A 1 146 ? 68.111 10.975 144.082 1.00 47.24 ? 146 PHE A C   1 
ATOM   1084 O O   . PHE A 1 146 ? 68.453 9.890  143.641 1.00 46.73 ? 146 PHE A O   1 
ATOM   1085 C CB  . PHE A 1 146 ? 66.258 11.988 142.699 1.00 39.98 ? 146 PHE A CB  1 
ATOM   1086 C CG  . PHE A 1 146 ? 65.306 11.591 143.775 1.00 39.92 ? 146 PHE A CG  1 
ATOM   1087 C CD1 . PHE A 1 146 ? 65.183 12.334 144.944 1.00 40.49 ? 146 PHE A CD1 1 
ATOM   1088 C CD2 . PHE A 1 146 ? 64.516 10.460 143.616 1.00 39.78 ? 146 PHE A CD2 1 
ATOM   1089 C CE1 . PHE A 1 146 ? 64.300 11.967 145.954 1.00 38.57 ? 146 PHE A CE1 1 
ATOM   1090 C CE2 . PHE A 1 146 ? 63.634 10.091 144.624 1.00 40.66 ? 146 PHE A CE2 1 
ATOM   1091 C CZ  . PHE A 1 146 ? 63.537 10.838 145.783 1.00 38.26 ? 146 PHE A CZ  1 
ATOM   1092 N N   . ASP A 1 147 ? 67.922 11.250 145.361 1.00 52.93 ? 147 ASP A N   1 
ATOM   1093 C CA  . ASP A 1 147 ? 68.175 10.438 146.523 1.00 58.29 ? 147 ASP A CA  1 
ATOM   1094 C C   . ASP A 1 147 ? 67.558 9.061  146.649 1.00 60.87 ? 147 ASP A C   1 
ATOM   1095 O O   . ASP A 1 147 ? 67.382 8.268  145.726 1.00 63.40 ? 147 ASP A O   1 
ATOM   1096 C CB  . ASP A 1 147 ? 67.749 11.257 147.765 1.00 57.60 ? 147 ASP A CB  1 
ATOM   1097 N N   . THR A 1 148 ? 67.260 8.665  147.884 1.00 65.75 ? 148 THR A N   1 
ATOM   1098 C CA  . THR A 1 148 ? 66.759 7.319  148.189 1.00 67.04 ? 148 THR A CA  1 
ATOM   1099 C C   . THR A 1 148 ? 65.277 7.147  147.911 1.00 67.75 ? 148 THR A C   1 
ATOM   1100 O O   . THR A 1 148 ? 64.809 7.508  146.821 1.00 68.10 ? 148 THR A O   1 
ATOM   1101 C CB  . THR A 1 148 ? 67.117 6.993  149.651 1.00 67.36 ? 148 THR A CB  1 
ATOM   1102 O OG1 . THR A 1 148 ? 66.906 8.151  150.471 1.00 66.88 ? 148 THR A OG1 1 
ATOM   1103 C CG2 . THR A 1 148 ? 68.583 6.593  149.717 1.00 67.58 ? 148 THR A CG2 1 
ATOM   1104 N N   . ALA A 1 155 ? 57.080 8.988  153.647 1.00 50.73 ? 155 ALA A N   1 
ATOM   1105 C CA  . ALA A 1 155 ? 56.461 8.343  152.494 1.00 51.98 ? 155 ALA A CA  1 
ATOM   1106 C C   . ALA A 1 155 ? 55.435 9.270  151.840 1.00 52.45 ? 155 ALA A C   1 
ATOM   1107 O O   . ALA A 1 155 ? 55.254 9.264  150.623 1.00 52.93 ? 155 ALA A O   1 
ATOM   1108 C CB  . ALA A 1 155 ? 55.724 7.064  152.851 1.00 50.85 ? 155 ALA A CB  1 
ATOM   1109 N N   . LEU A 1 156 ? 54.699 9.953  152.728 1.00 52.37 ? 156 LEU A N   1 
ATOM   1110 C CA  . LEU A 1 156 ? 53.673 10.863 152.223 1.00 51.91 ? 156 LEU A CA  1 
ATOM   1111 C C   . LEU A 1 156 ? 54.314 12.247 152.139 1.00 50.06 ? 156 LEU A C   1 
ATOM   1112 O O   . LEU A 1 156 ? 53.912 13.047 151.304 1.00 50.91 ? 156 LEU A O   1 
ATOM   1113 C CB  . LEU A 1 156 ? 52.416 10.857 153.066 1.00 53.15 ? 156 LEU A CB  1 
ATOM   1114 C CG  . LEU A 1 156 ? 51.487 12.078 152.903 1.00 53.49 ? 156 LEU A CG  1 
ATOM   1115 C CD1 . LEU A 1 156 ? 50.038 11.640 152.901 1.00 53.60 ? 156 LEU A CD1 1 
ATOM   1116 C CD2 . LEU A 1 156 ? 51.789 13.081 154.006 1.00 54.87 ? 156 LEU A CD2 1 
ATOM   1117 N N   . LEU A 1 157 ? 55.340 12.459 152.959 1.00 48.44 ? 157 LEU A N   1 
ATOM   1118 C CA  . LEU A 1 157 ? 56.043 13.743 152.924 1.00 47.15 ? 157 LEU A CA  1 
ATOM   1119 C C   . LEU A 1 157 ? 57.107 13.651 151.828 1.00 46.28 ? 157 LEU A C   1 
ATOM   1120 O O   . LEU A 1 157 ? 57.575 14.651 151.297 1.00 46.36 ? 157 LEU A O   1 
ATOM   1121 C CB  . LEU A 1 157 ? 56.676 14.096 154.253 1.00 46.47 ? 157 LEU A CB  1 
ATOM   1122 N N   . LYS A 1 158 ? 57.463 12.402 151.536 1.00 43.37 ? 158 LYS A N   1 
ATOM   1123 C CA  . LYS A 1 158 ? 58.419 12.092 150.497 1.00 42.98 ? 158 LYS A CA  1 
ATOM   1124 C C   . LYS A 1 158 ? 57.692 12.295 149.166 1.00 43.05 ? 158 LYS A C   1 
ATOM   1125 O O   . LYS A 1 158 ? 58.283 12.811 148.240 1.00 42.37 ? 158 LYS A O   1 
ATOM   1126 C CB  . LYS A 1 158 ? 58.955 10.683 150.642 1.00 41.19 ? 158 LYS A CB  1 
ATOM   1127 N N   . ASN A 1 159 ? 56.412 11.939 149.106 1.00 42.59 ? 159 ASN A N   1 
ATOM   1128 C CA  . ASN A 1 159 ? 55.641 12.151 147.895 1.00 41.05 ? 159 ASN A CA  1 
ATOM   1129 C C   . ASN A 1 159 ? 55.278 13.623 147.696 1.00 40.47 ? 159 ASN A C   1 
ATOM   1130 O O   . ASN A 1 159 ? 55.247 14.056 146.548 1.00 37.38 ? 159 ASN A O   1 
ATOM   1131 C CB  . ASN A 1 159 ? 54.374 11.297 147.907 1.00 41.92 ? 159 ASN A CB  1 
ATOM   1132 C CG  . ASN A 1 159 ? 54.600 9.902  147.375 1.00 41.78 ? 159 ASN A CG  1 
ATOM   1133 O OD1 . ASN A 1 159 ? 55.657 9.554  146.847 1.00 42.23 ? 159 ASN A OD1 1 
ATOM   1134 N ND2 . ASN A 1 159 ? 53.601 9.042  147.497 1.00 42.73 ? 159 ASN A ND2 1 
ATOM   1135 N N   . TYR A 1 160 ? 54.980 14.347 148.773 1.00 37.83 ? 160 TYR A N   1 
ATOM   1136 C CA  . TYR A 1 160 ? 54.618 15.758 148.787 1.00 34.10 ? 160 TYR A CA  1 
ATOM   1137 C C   . TYR A 1 160 ? 55.813 16.626 148.344 1.00 33.08 ? 160 TYR A C   1 
ATOM   1138 O O   . TYR A 1 160 ? 55.704 17.649 147.657 1.00 29.14 ? 160 TYR A O   1 
ATOM   1139 C CB  . TYR A 1 160 ? 54.212 16.180 150.205 1.00 32.20 ? 160 TYR A CB  1 
ATOM   1140 C CG  . TYR A 1 160 ? 53.654 17.543 150.510 1.00 32.21 ? 160 TYR A CG  1 
ATOM   1141 C CD1 . TYR A 1 160 ? 52.905 18.251 149.577 1.00 28.71 ? 160 TYR A CD1 1 
ATOM   1142 C CD2 . TYR A 1 160 ? 53.877 18.159 151.743 1.00 32.12 ? 160 TYR A CD2 1 
ATOM   1143 C CE1 . TYR A 1 160 ? 52.399 19.497 149.863 1.00 29.90 ? 160 TYR A CE1 1 
ATOM   1144 C CE2 . TYR A 1 160 ? 53.366 19.414 152.060 1.00 30.22 ? 160 TYR A CE2 1 
ATOM   1145 C CZ  . TYR A 1 160 ? 52.612 20.066 151.105 1.00 30.82 ? 160 TYR A CZ  1 
ATOM   1146 O OH  . TYR A 1 160 ? 52.093 21.317 151.333 1.00 30.41 ? 160 TYR A OH  1 
ATOM   1147 N N   . GLY A 1 161 ? 56.993 16.253 148.839 1.00 31.75 ? 161 GLY A N   1 
ATOM   1148 C CA  . GLY A 1 161 ? 58.261 16.906 148.523 1.00 31.25 ? 161 GLY A CA  1 
ATOM   1149 C C   . GLY A 1 161 ? 58.610 16.708 147.030 1.00 30.27 ? 161 GLY A C   1 
ATOM   1150 O O   . GLY A 1 161 ? 58.979 17.628 146.316 1.00 26.51 ? 161 GLY A O   1 
ATOM   1151 N N   . LEU A 1 162 ? 58.453 15.485 146.545 1.00 28.58 ? 162 LEU A N   1 
ATOM   1152 C CA  . LEU A 1 162 ? 58.655 15.172 145.160 1.00 29.41 ? 162 LEU A CA  1 
ATOM   1153 C C   . LEU A 1 162 ? 57.708 15.951 144.238 1.00 29.16 ? 162 LEU A C   1 
ATOM   1154 O O   . LEU A 1 162 ? 58.166 16.520 143.239 1.00 25.31 ? 162 LEU A O   1 
ATOM   1155 C CB  . LEU A 1 162 ? 58.493 13.688 144.920 1.00 29.51 ? 162 LEU A CB  1 
ATOM   1156 C CG  . LEU A 1 162 ? 59.791 12.850 144.978 1.00 31.43 ? 162 LEU A CG  1 
ATOM   1157 C CD1 . LEU A 1 162 ? 59.400 11.383 144.762 1.00 30.34 ? 162 LEU A CD1 1 
ATOM   1158 C CD2 . LEU A 1 162 ? 60.806 13.335 143.969 1.00 29.66 ? 162 LEU A CD2 1 
ATOM   1159 N N   . LEU A 1 163 ? 56.421 15.970 144.592 1.00 25.85 ? 163 LEU A N   1 
ATOM   1160 C CA  . LEU A 1 163 ? 55.422 16.661 143.801 1.00 25.51 ? 163 LEU A CA  1 
ATOM   1161 C C   . LEU A 1 163 ? 55.715 18.153 143.793 1.00 24.49 ? 163 LEU A C   1 
ATOM   1162 O O   . LEU A 1 163 ? 55.556 18.789 142.749 1.00 23.43 ? 163 LEU A O   1 
ATOM   1163 C CB  . LEU A 1 163 ? 54.007 16.478 144.290 1.00 26.75 ? 163 LEU A CB  1 
ATOM   1164 C CG  . LEU A 1 163 ? 53.270 15.208 143.895 1.00 28.16 ? 163 LEU A CG  1 
ATOM   1165 C CD1 . LEU A 1 163 ? 51.901 15.181 144.592 1.00 29.51 ? 163 LEU A CD1 1 
ATOM   1166 C CD2 . LEU A 1 163 ? 53.140 15.095 142.393 1.00 29.09 ? 163 LEU A CD2 1 
ATOM   1167 N N   . TYR A 1 164 ? 56.146 18.669 144.938 1.00 24.95 ? 164 TYR A N   1 
ATOM   1168 C CA  . TYR A 1 164 ? 56.546 20.055 145.056 1.00 22.95 ? 164 TYR A CA  1 
ATOM   1169 C C   . TYR A 1 164 ? 57.647 20.386 144.050 1.00 23.03 ? 164 TYR A C   1 
ATOM   1170 O O   . TYR A 1 164 ? 57.646 21.448 143.401 1.00 22.06 ? 164 TYR A O   1 
ATOM   1171 C CB  . TYR A 1 164 ? 57.067 20.375 146.501 1.00 23.46 ? 164 TYR A CB  1 
ATOM   1172 C CG  . TYR A 1 164 ? 57.388 21.844 146.534 1.00 24.54 ? 164 TYR A CG  1 
ATOM   1173 C CD1 . TYR A 1 164 ? 58.620 22.362 146.159 1.00 28.21 ? 164 TYR A CD1 1 
ATOM   1174 C CD2 . TYR A 1 164 ? 56.405 22.749 146.870 1.00 26.15 ? 164 TYR A CD2 1 
ATOM   1175 C CE1 . TYR A 1 164 ? 58.839 23.736 146.116 1.00 29.99 ? 164 TYR A CE1 1 
ATOM   1176 C CE2 . TYR A 1 164 ? 56.595 24.108 146.866 1.00 26.91 ? 164 TYR A CE2 1 
ATOM   1177 C CZ  . TYR A 1 164 ? 57.836 24.590 146.462 1.00 32.61 ? 164 TYR A CZ  1 
ATOM   1178 O OH  . TYR A 1 164 ? 58.024 25.977 146.409 1.00 37.35 ? 164 TYR A OH  1 
ATOM   1179 N N   . CYS A 1 165 ? 58.684 19.561 144.001 1.00 22.58 ? 165 CYS A N   1 
ATOM   1180 C CA  . CYS A 1 165 ? 59.823 19.775 143.105 1.00 24.49 ? 165 CYS A CA  1 
ATOM   1181 C C   . CYS A 1 165 ? 59.408 19.591 141.629 1.00 24.49 ? 165 CYS A C   1 
ATOM   1182 O O   . CYS A 1 165 ? 59.871 20.364 140.780 1.00 20.22 ? 165 CYS A O   1 
ATOM   1183 C CB  . CYS A 1 165 ? 61.003 18.901 143.546 1.00 27.40 ? 165 CYS A CB  1 
ATOM   1184 S SG  . CYS A 1 165 ? 61.568 19.383 145.253 1.00 34.16 ? 165 CYS A SG  1 
ATOM   1185 N N   . PHE A 1 166 ? 58.533 18.636 141.313 1.00 21.11 ? 166 PHE A N   1 
ATOM   1186 C CA  . PHE A 1 166 ? 58.104 18.459 139.922 1.00 21.42 ? 166 PHE A CA  1 
ATOM   1187 C C   . PHE A 1 166 ? 57.318 19.686 139.419 1.00 20.83 ? 166 PHE A C   1 
ATOM   1188 O O   . PHE A 1 166 ? 57.596 20.126 138.298 1.00 18.65 ? 166 PHE A O   1 
ATOM   1189 C CB  . PHE A 1 166 ? 57.329 17.166 139.744 1.00 19.16 ? 166 PHE A CB  1 
ATOM   1190 C CG  . PHE A 1 166 ? 56.928 16.761 138.346 1.00 20.01 ? 166 PHE A CG  1 
ATOM   1191 C CD1 . PHE A 1 166 ? 57.842 16.586 137.326 1.00 20.76 ? 166 PHE A CD1 1 
ATOM   1192 C CD2 . PHE A 1 166 ? 55.592 16.551 138.063 1.00 19.91 ? 166 PHE A CD2 1 
ATOM   1193 C CE1 . PHE A 1 166 ? 57.435 16.204 136.044 1.00 21.31 ? 166 PHE A CE1 1 
ATOM   1194 C CE2 . PHE A 1 166 ? 55.184 16.184 136.790 1.00 22.64 ? 166 PHE A CE2 1 
ATOM   1195 C CZ  . PHE A 1 166 ? 56.096 15.988 135.773 1.00 20.32 ? 166 PHE A CZ  1 
ATOM   1196 N N   . ARG A 1 167 ? 56.411 20.237 140.233 1.00 16.73 ? 167 ARG A N   1 
ATOM   1197 C CA  . ARG A 1 167 ? 55.651 21.410 139.905 1.00 17.19 ? 167 ARG A CA  1 
ATOM   1198 C C   . ARG A 1 167 ? 56.589 22.584 139.571 1.00 18.05 ? 167 ARG A C   1 
ATOM   1199 O O   . ARG A 1 167 ? 56.480 23.242 138.536 1.00 15.97 ? 167 ARG A O   1 
ATOM   1200 C CB  . ARG A 1 167 ? 54.637 21.858 140.952 1.00 14.62 ? 167 ARG A CB  1 
ATOM   1201 C CG  . ARG A 1 167 ? 53.701 22.961 140.466 1.00 18.83 ? 167 ARG A CG  1 
ATOM   1202 C CD  . ARG A 1 167 ? 52.780 23.457 141.588 1.00 20.49 ? 167 ARG A CD  1 
ATOM   1203 N NE  . ARG A 1 167 ? 53.434 24.009 142.752 1.00 19.77 ? 167 ARG A NE  1 
ATOM   1204 C CZ  . ARG A 1 167 ? 52.852 24.649 143.790 1.00 18.24 ? 167 ARG A CZ  1 
ATOM   1205 N NH1 . ARG A 1 167 ? 51.543 24.807 143.807 1.00 12.25 ? 167 ARG A NH1 1 
ATOM   1206 N NH2 . ARG A 1 167 ? 53.597 25.127 144.792 1.00 19.02 ? 167 ARG A NH2 1 
ATOM   1207 N N   . ARG A 1 168 ? 57.496 22.881 140.464 1.00 14.77 ? 168 ARG A N   1 
ATOM   1208 C CA  . ARG A 1 168 ? 58.520 23.866 140.304 1.00 19.85 ? 168 ARG A CA  1 
ATOM   1209 C C   . ARG A 1 168 ? 59.327 23.768 139.008 1.00 16.69 ? 168 ARG A C   1 
ATOM   1210 O O   . ARG A 1 168 ? 59.508 24.749 138.263 1.00 16.74 ? 168 ARG A O   1 
ATOM   1211 C CB  . ARG A 1 168 ? 59.487 23.748 141.519 1.00 21.19 ? 168 ARG A CB  1 
ATOM   1212 C CG  . ARG A 1 168 ? 60.517 24.896 141.424 1.00 28.90 ? 168 ARG A CG  1 
ATOM   1213 C CD  . ARG A 1 168 ? 61.785 24.577 142.253 1.00 31.81 ? 168 ARG A CD  1 
ATOM   1214 N NE  . ARG A 1 168 ? 62.785 23.875 141.458 1.00 39.07 ? 168 ARG A NE  1 
ATOM   1215 C CZ  . ARG A 1 168 ? 64.101 24.083 141.395 1.00 42.24 ? 168 ARG A CZ  1 
ATOM   1216 N NH1 . ARG A 1 168 ? 64.728 25.025 142.089 1.00 41.55 ? 168 ARG A NH1 1 
ATOM   1217 N NH2 . ARG A 1 168 ? 64.838 23.321 140.580 1.00 43.71 ? 168 ARG A NH2 1 
ATOM   1218 N N   . ASP A 1 169 ? 59.949 22.610 138.776 1.00 15.17 ? 169 ASP A N   1 
ATOM   1219 C CA  . ASP A 1 169 ? 60.763 22.387 137.582 1.00 16.82 ? 169 ASP A CA  1 
ATOM   1220 C C   . ASP A 1 169 ? 59.936 22.465 136.296 1.00 17.54 ? 169 ASP A C   1 
ATOM   1221 O O   . ASP A 1 169 ? 60.377 23.078 135.318 1.00 16.85 ? 169 ASP A O   1 
ATOM   1222 C CB  . ASP A 1 169 ? 61.494 21.034 137.739 1.00 16.00 ? 169 ASP A CB  1 
ATOM   1223 C CG  . ASP A 1 169 ? 62.598 21.095 138.823 1.00 21.71 ? 169 ASP A CG  1 
ATOM   1224 O OD1 . ASP A 1 169 ? 62.892 22.185 139.374 1.00 19.06 ? 169 ASP A OD1 1 
ATOM   1225 O OD2 . ASP A 1 169 ? 63.187 20.031 139.153 1.00 20.64 ? 169 ASP A OD2 1 
ATOM   1226 N N   . MET A 1 170 ? 58.722 21.902 136.241 1.00 17.57 ? 170 MET A N   1 
ATOM   1227 C CA  . MET A 1 170 ? 57.898 22.032 135.017 1.00 17.36 ? 170 MET A CA  1 
ATOM   1228 C C   . MET A 1 170 ? 57.508 23.508 134.835 1.00 19.82 ? 170 MET A C   1 
ATOM   1229 O O   . MET A 1 170 ? 57.423 23.982 133.698 1.00 19.42 ? 170 MET A O   1 
ATOM   1230 C CB  . MET A 1 170 ? 56.688 21.097 135.018 1.00 12.69 ? 170 MET A CB  1 
ATOM   1231 C CG  . MET A 1 170 ? 56.998 19.622 134.978 1.00 19.17 ? 170 MET A CG  1 
ATOM   1232 S SD  . MET A 1 170 ? 58.213 19.107 133.755 1.00 22.51 ? 170 MET A SD  1 
ATOM   1233 C CE  . MET A 1 170 ? 59.728 18.863 134.659 1.00 22.03 ? 170 MET A CE  1 
ATOM   1234 N N   . THR A 1 171 ? 57.282 24.242 135.954 1.00 19.24 ? 171 THR A N   1 
ATOM   1235 C CA  . THR A 1 171 ? 56.951 25.658 135.847 1.00 19.88 ? 171 THR A CA  1 
ATOM   1236 C C   . THR A 1 171 ? 58.065 26.440 135.125 1.00 21.33 ? 171 THR A C   1 
ATOM   1237 O O   . THR A 1 171 ? 57.824 27.264 134.247 1.00 20.76 ? 171 THR A O   1 
ATOM   1238 C CB  . THR A 1 171 ? 56.665 26.325 137.202 1.00 19.43 ? 171 THR A CB  1 
ATOM   1239 O OG1 . THR A 1 171 ? 55.550 25.580 137.769 1.00 21.01 ? 171 THR A OG1 1 
ATOM   1240 C CG2 . THR A 1 171 ? 56.249 27.788 137.001 1.00 18.50 ? 171 THR A CG2 1 
ATOM   1241 N N   . TYR A 1 172 ? 59.309 26.171 135.518 1.00 19.90 ? 172 TYR A N   1 
ATOM   1242 C CA  . TYR A 1 172 ? 60.471 26.782 134.931 1.00 19.23 ? 172 TYR A CA  1 
ATOM   1243 C C   . TYR A 1 172 ? 60.599 26.490 133.446 1.00 19.17 ? 172 TYR A C   1 
ATOM   1244 O O   . TYR A 1 172 ? 60.880 27.403 132.642 1.00 18.50 ? 172 TYR A O   1 
ATOM   1245 C CB  . TYR A 1 172 ? 61.747 26.273 135.632 1.00 21.06 ? 172 TYR A CB  1 
ATOM   1246 C CG  . TYR A 1 172 ? 62.093 27.002 136.884 1.00 20.94 ? 172 TYR A CG  1 
ATOM   1247 C CD1 . TYR A 1 172 ? 61.863 28.337 137.100 1.00 21.71 ? 172 TYR A CD1 1 
ATOM   1248 C CD2 . TYR A 1 172 ? 62.673 26.253 137.923 1.00 23.78 ? 172 TYR A CD2 1 
ATOM   1249 C CE1 . TYR A 1 172 ? 62.224 28.964 138.291 1.00 22.75 ? 172 TYR A CE1 1 
ATOM   1250 C CE2 . TYR A 1 172 ? 62.997 26.852 139.127 1.00 23.29 ? 172 TYR A CE2 1 
ATOM   1251 C CZ  . TYR A 1 172 ? 62.791 28.189 139.291 1.00 24.22 ? 172 TYR A CZ  1 
ATOM   1252 O OH  . TYR A 1 172 ? 63.120 28.735 140.513 1.00 27.25 ? 172 TYR A OH  1 
ATOM   1253 N N   . VAL A 1 173 ? 60.443 25.200 133.123 1.00 17.35 ? 173 VAL A N   1 
ATOM   1254 C CA  . VAL A 1 173 ? 60.544 24.826 131.697 1.00 19.11 ? 173 VAL A CA  1 
ATOM   1255 C C   . VAL A 1 173 ? 59.498 25.524 130.840 1.00 18.12 ? 173 VAL A C   1 
ATOM   1256 O O   . VAL A 1 173 ? 59.871 26.051 129.765 1.00 15.40 ? 173 VAL A O   1 
ATOM   1257 C CB  . VAL A 1 173 ? 60.501 23.296 131.554 1.00 17.99 ? 173 VAL A CB  1 
ATOM   1258 C CG1 . VAL A 1 173 ? 60.328 22.844 130.117 1.00 18.69 ? 173 VAL A CG1 1 
ATOM   1259 C CG2 . VAL A 1 173 ? 61.782 22.688 132.152 1.00 18.00 ? 173 VAL A CG2 1 
ATOM   1260 N N   . ALA A 1 174 ? 58.227 25.547 131.261 1.00 16.67 ? 174 ALA A N   1 
ATOM   1261 C CA  . ALA A 1 174 ? 57.211 26.212 130.448 1.00 18.73 ? 174 ALA A CA  1 
ATOM   1262 C C   . ALA A 1 174 ? 57.493 27.701 130.225 1.00 17.57 ? 174 ALA A C   1 
ATOM   1263 O O   . ALA A 1 174 ? 57.262 28.220 129.116 1.00 16.00 ? 174 ALA A O   1 
ATOM   1264 C CB  . ALA A 1 174 ? 55.805 25.971 130.942 1.00 18.73 ? 174 ALA A CB  1 
ATOM   1265 N N   . THR A 1 175 ? 57.990 28.413 131.203 1.00 19.14 ? 175 THR A N   1 
ATOM   1266 C CA  . THR A 1 175 ? 58.365 29.794 131.154 1.00 19.52 ? 175 THR A CA  1 
ATOM   1267 C C   . THR A 1 175 ? 59.599 30.071 130.287 1.00 19.38 ? 175 THR A C   1 
ATOM   1268 O O   . THR A 1 175 ? 59.526 30.909 129.389 1.00 13.45 ? 175 THR A O   1 
ATOM   1269 C CB  . THR A 1 175 ? 58.613 30.371 132.569 1.00 20.44 ? 175 THR A CB  1 
ATOM   1270 O OG1 . THR A 1 175 ? 57.358 30.255 133.232 1.00 23.16 ? 175 THR A OG1 1 
ATOM   1271 C CG2 . THR A 1 175 ? 59.007 31.852 132.515 1.00 19.88 ? 175 THR A CG2 1 
ATOM   1272 N N   . TYR A 1 176 ? 60.674 29.319 130.515 1.00 17.20 ? 176 TYR A N   1 
ATOM   1273 C CA  . TYR A 1 176 ? 61.890 29.468 129.732 1.00 19.39 ? 176 TYR A CA  1 
ATOM   1274 C C   . TYR A 1 176 ? 61.634 29.163 128.243 1.00 18.28 ? 176 TYR A C   1 
ATOM   1275 O O   . TYR A 1 176 ? 62.183 29.888 127.417 1.00 16.31 ? 176 TYR A O   1 
ATOM   1276 C CB  . TYR A 1 176 ? 63.005 28.542 130.233 1.00 19.80 ? 176 TYR A CB  1 
ATOM   1277 C CG  . TYR A 1 176 ? 63.438 28.825 131.665 1.00 22.05 ? 176 TYR A CG  1 
ATOM   1278 C CD1 . TYR A 1 176 ? 63.123 29.981 132.357 1.00 18.32 ? 176 TYR A CD1 1 
ATOM   1279 C CD2 . TYR A 1 176 ? 64.229 27.870 132.328 1.00 21.80 ? 176 TYR A CD2 1 
ATOM   1280 C CE1 . TYR A 1 176 ? 63.540 30.202 133.655 1.00 18.74 ? 176 TYR A CE1 1 
ATOM   1281 C CE2 . TYR A 1 176 ? 64.606 28.065 133.640 1.00 20.49 ? 176 TYR A CE2 1 
ATOM   1282 C CZ  . TYR A 1 176 ? 64.279 29.219 134.295 1.00 21.22 ? 176 TYR A CZ  1 
ATOM   1283 O OH  . TYR A 1 176 ? 64.694 29.369 135.609 1.00 20.68 ? 176 TYR A OH  1 
ATOM   1284 N N   . LEU A 1 177 ? 60.792 28.162 127.970 1.00 14.17 ? 177 LEU A N   1 
ATOM   1285 C CA  . LEU A 1 177 ? 60.541 27.812 126.587 1.00 15.64 ? 177 LEU A CA  1 
ATOM   1286 C C   . LEU A 1 177 ? 59.708 28.914 125.916 1.00 16.66 ? 177 LEU A C   1 
ATOM   1287 O O   . LEU A 1 177 ? 60.045 29.211 124.768 1.00 15.84 ? 177 LEU A O   1 
ATOM   1288 C CB  . LEU A 1 177 ? 59.933 26.445 126.356 1.00 18.63 ? 177 LEU A CB  1 
ATOM   1289 C CG  . LEU A 1 177 ? 60.722 25.159 126.719 1.00 20.14 ? 177 LEU A CG  1 
ATOM   1290 C CD1 . LEU A 1 177 ? 59.924 23.942 126.265 1.00 19.40 ? 177 LEU A CD1 1 
ATOM   1291 C CD2 . LEU A 1 177 ? 62.108 25.110 126.108 1.00 22.77 ? 177 LEU A CD2 1 
ATOM   1292 N N   . ARG A 1 178 ? 58.716 29.487 126.626 1.00 13.84 ? 178 ARG A N   1 
ATOM   1293 C CA  . ARG A 1 178 ? 57.900 30.548 126.061 1.00 14.40 ? 178 ARG A CA  1 
ATOM   1294 C C   . ARG A 1 178 ? 58.734 31.775 125.722 1.00 17.11 ? 178 ARG A C   1 
ATOM   1295 O O   . ARG A 1 178 ? 58.517 32.481 124.708 1.00 19.34 ? 178 ARG A O   1 
ATOM   1296 C CB  . ARG A 1 178 ? 56.729 30.877 127.041 1.00 14.31 ? 178 ARG A CB  1 
ATOM   1297 C CG  . ARG A 1 178 ? 55.871 32.079 126.608 1.00 13.66 ? 178 ARG A CG  1 
ATOM   1298 C CD  . ARG A 1 178 ? 55.147 31.729 125.255 1.00 10.76 ? 178 ARG A CD  1 
ATOM   1299 N NE  . ARG A 1 178 ? 54.094 32.756 125.057 1.00 16.33 ? 178 ARG A NE  1 
ATOM   1300 C CZ  . ARG A 1 178 ? 53.286 32.718 123.996 1.00 22.23 ? 178 ARG A CZ  1 
ATOM   1301 N NH1 . ARG A 1 178 ? 53.422 31.799 123.028 1.00 19.99 ? 178 ARG A NH1 1 
ATOM   1302 N NH2 . ARG A 1 178 ? 52.375 33.665 123.857 1.00 21.23 ? 178 ARG A NH2 1 
ATOM   1303 N N   . ILE A 1 179 ? 59.647 32.192 126.606 1.00 15.29 ? 179 ILE A N   1 
ATOM   1304 C CA  . ILE A 1 179 ? 60.542 33.295 126.362 1.00 17.16 ? 179 ILE A CA  1 
ATOM   1305 C C   . ILE A 1 179 ? 61.356 33.129 125.080 1.00 17.82 ? 179 ILE A C   1 
ATOM   1306 O O   . ILE A 1 179 ? 61.497 34.077 124.308 1.00 17.43 ? 179 ILE A O   1 
ATOM   1307 C CB  . ILE A 1 179 ? 61.455 33.592 127.566 1.00 18.42 ? 179 ILE A CB  1 
ATOM   1308 C CG1 . ILE A 1 179 ? 60.626 34.103 128.764 1.00 20.11 ? 179 ILE A CG1 1 
ATOM   1309 C CG2 . ILE A 1 179 ? 62.518 34.625 127.241 1.00 16.93 ? 179 ILE A CG2 1 
ATOM   1310 C CD1 . ILE A 1 179 ? 61.324 33.955 130.099 1.00 20.10 ? 179 ILE A CD1 1 
ATOM   1311 N N   . VAL A 1 180 ? 61.965 31.967 124.836 1.00 16.26 ? 180 VAL A N   1 
ATOM   1312 C CA  . VAL A 1 180 ? 62.742 31.717 123.645 1.00 17.18 ? 180 VAL A CA  1 
ATOM   1313 C C   . VAL A 1 180 ? 61.811 31.790 122.437 1.00 18.54 ? 180 VAL A C   1 
ATOM   1314 O O   . VAL A 1 180 ? 62.249 32.394 121.468 1.00 17.34 ? 180 VAL A O   1 
ATOM   1315 C CB  . VAL A 1 180 ? 63.503 30.377 123.709 1.00 17.56 ? 180 VAL A CB  1 
ATOM   1316 C CG1 . VAL A 1 180 ? 64.269 30.002 122.437 1.00 16.84 ? 180 VAL A CG1 1 
ATOM   1317 C CG2 . VAL A 1 180 ? 64.505 30.452 124.868 1.00 15.35 ? 180 VAL A CG2 1 
ATOM   1318 N N   . GLN A 1 181 ? 60.639 31.200 122.454 1.00 17.31 ? 181 GLN A N   1 
ATOM   1319 C CA  . GLN A 1 181 ? 59.660 31.271 121.393 1.00 18.42 ? 181 GLN A CA  1 
ATOM   1320 C C   . GLN A 1 181 ? 59.358 32.723 121.040 1.00 20.87 ? 181 GLN A C   1 
ATOM   1321 O O   . GLN A 1 181 ? 59.384 33.054 119.831 1.00 22.96 ? 181 GLN A O   1 
ATOM   1322 C CB  . GLN A 1 181 ? 58.293 30.633 121.744 1.00 17.60 ? 181 GLN A CB  1 
ATOM   1323 C CG  . GLN A 1 181 ? 57.218 30.777 120.641 1.00 18.67 ? 181 GLN A CG  1 
ATOM   1324 C CD  . GLN A 1 181 ? 55.953 30.014 121.067 1.00 21.78 ? 181 GLN A CD  1 
ATOM   1325 O OE1 . GLN A 1 181 ? 55.536 29.980 122.236 1.00 22.04 ? 181 GLN A OE1 1 
ATOM   1326 N NE2 . GLN A 1 181 ? 55.266 29.394 120.129 1.00 20.74 ? 181 GLN A NE2 1 
ATOM   1327 N N   . CYS A 1 182 ? 58.943 33.545 122.013 1.00 19.71 ? 182 CYS A N   1 
ATOM   1328 C CA  . CYS A 1 182 ? 58.614 34.931 121.742 1.00 22.23 ? 182 CYS A CA  1 
ATOM   1329 C C   . CYS A 1 182 ? 59.797 35.660 121.083 1.00 26.25 ? 182 CYS A C   1 
ATOM   1330 O O   . CYS A 1 182 ? 59.544 36.490 120.198 1.00 25.90 ? 182 CYS A O   1 
ATOM   1331 C CB  . CYS A 1 182 ? 58.217 35.736 122.995 1.00 24.45 ? 182 CYS A CB  1 
ATOM   1332 S SG  . CYS A 1 182 ? 56.715 35.091 123.802 1.00 25.43 ? 182 CYS A SG  1 
ATOM   1333 N N   . ARG A 1 183 ? 61.033 35.390 121.481 1.00 24.90 ? 183 ARG A N   1 
ATOM   1334 C CA  . ARG A 1 183 ? 62.145 36.100 120.820 1.00 28.63 ? 183 ARG A CA  1 
ATOM   1335 C C   . ARG A 1 183 ? 62.608 35.530 119.496 1.00 28.56 ? 183 ARG A C   1 
ATOM   1336 O O   . ARG A 1 183 ? 63.322 36.217 118.755 1.00 31.02 ? 183 ARG A O   1 
ATOM   1337 C CB  . ARG A 1 183 ? 63.363 36.039 121.769 1.00 29.52 ? 183 ARG A CB  1 
ATOM   1338 C CG  . ARG A 1 183 ? 63.110 36.866 123.000 1.00 30.77 ? 183 ARG A CG  1 
ATOM   1339 C CD  . ARG A 1 183 ? 64.242 36.958 123.964 1.00 35.14 ? 183 ARG A CD  1 
ATOM   1340 N NE  . ARG A 1 183 ? 65.108 35.861 124.274 1.00 33.62 ? 183 ARG A NE  1 
ATOM   1341 C CZ  . ARG A 1 183 ? 65.852 35.830 125.383 1.00 30.58 ? 183 ARG A CZ  1 
ATOM   1342 N NH1 . ARG A 1 183 ? 65.804 36.809 126.233 1.00 29.14 ? 183 ARG A NH1 1 
ATOM   1343 N NH2 . ARG A 1 183 ? 66.695 34.827 125.622 1.00 31.09 ? 183 ARG A NH2 1 
ATOM   1344 N N   . SER A 1 184 ? 62.282 34.282 119.170 1.00 27.55 ? 184 SER A N   1 
ATOM   1345 C CA  . SER A 1 184 ? 62.809 33.608 118.014 1.00 27.98 ? 184 SER A CA  1 
ATOM   1346 C C   . SER A 1 184 ? 61.778 33.511 116.881 1.00 30.37 ? 184 SER A C   1 
ATOM   1347 O O   . SER A 1 184 ? 62.266 33.256 115.771 1.00 28.60 ? 184 SER A O   1 
ATOM   1348 C CB  . SER A 1 184 ? 63.196 32.135 118.245 1.00 25.42 ? 184 SER A CB  1 
ATOM   1349 O OG  . SER A 1 184 ? 64.100 32.045 119.304 1.00 30.37 ? 184 SER A OG  1 
ATOM   1350 N N   . VAL A 1 185 ? 60.506 33.615 117.241 1.00 26.11 ? 185 VAL A N   1 
ATOM   1351 C CA  . VAL A 1 185 ? 59.487 33.433 116.238 1.00 30.71 ? 185 VAL A CA  1 
ATOM   1352 C C   . VAL A 1 185 ? 58.724 34.735 115.995 1.00 35.83 ? 185 VAL A C   1 
ATOM   1353 O O   . VAL A 1 185 ? 58.000 35.271 116.820 1.00 33.87 ? 185 VAL A O   1 
ATOM   1354 C CB  . VAL A 1 185 ? 58.384 32.385 116.518 1.00 29.42 ? 185 VAL A CB  1 
ATOM   1355 C CG1 . VAL A 1 185 ? 57.307 32.337 115.410 1.00 26.17 ? 185 VAL A CG1 1 
ATOM   1356 C CG2 . VAL A 1 185 ? 59.024 31.012 116.663 1.00 29.43 ? 185 VAL A CG2 1 
ATOM   1357 N N   . GLU A 1 186 ? 58.844 35.062 114.718 1.00 40.57 ? 186 GLU A N   1 
ATOM   1358 C CA  . GLU A 1 186 ? 58.160 36.130 114.047 1.00 45.26 ? 186 GLU A CA  1 
ATOM   1359 C C   . GLU A 1 186 ? 57.161 36.883 114.871 1.00 43.65 ? 186 GLU A C   1 
ATOM   1360 O O   . GLU A 1 186 ? 57.601 37.859 115.495 1.00 46.96 ? 186 GLU A O   1 
ATOM   1361 C CB  . GLU A 1 186 ? 57.469 35.575 112.770 1.00 50.33 ? 186 GLU A CB  1 
ATOM   1362 C CG  . GLU A 1 186 ? 58.455 34.822 111.880 1.00 54.50 ? 186 GLU A CG  1 
ATOM   1363 C CD  . GLU A 1 186 ? 58.241 33.321 111.995 1.00 56.97 ? 186 GLU A CD  1 
ATOM   1364 O OE1 . GLU A 1 186 ? 57.035 32.955 112.014 1.00 59.90 ? 186 GLU A OE1 1 
ATOM   1365 O OE2 . GLU A 1 186 ? 59.239 32.569 112.056 1.00 57.59 ? 186 GLU A OE2 1 
ATOM   1366 N N   . GLY A 1 187 ? 55.873 36.572 114.837 1.00 43.41 ? 187 GLY A N   1 
ATOM   1367 C CA  . GLY A 1 187 ? 55.000 37.469 115.663 1.00 42.13 ? 187 GLY A CA  1 
ATOM   1368 C C   . GLY A 1 187 ? 54.277 36.600 116.677 1.00 41.52 ? 187 GLY A C   1 
ATOM   1369 O O   . GLY A 1 187 ? 53.065 36.719 116.749 1.00 41.76 ? 187 GLY A O   1 
ATOM   1370 N N   . SER A 1 188 ? 54.970 35.646 117.284 1.00 37.56 ? 188 SER A N   1 
ATOM   1371 C CA  . SER A 1 188 ? 54.333 34.692 118.170 1.00 37.72 ? 188 SER A CA  1 
ATOM   1372 C C   . SER A 1 188 ? 53.622 35.317 119.350 1.00 38.54 ? 188 SER A C   1 
ATOM   1373 O O   . SER A 1 188 ? 52.475 34.916 119.594 1.00 43.38 ? 188 SER A O   1 
ATOM   1374 C CB  . SER A 1 188 ? 55.383 33.659 118.632 1.00 37.00 ? 188 SER A CB  1 
ATOM   1375 O OG  . SER A 1 188 ? 56.538 34.374 119.118 1.00 36.67 ? 188 SER A OG  1 
ATOM   1376 N N   . CYS A 1 189 ? 54.163 36.255 120.094 1.00 37.70 ? 189 CYS A N   1 
ATOM   1377 C CA  . CYS A 1 189 ? 53.490 36.803 121.271 1.00 41.57 ? 189 CYS A CA  1 
ATOM   1378 C C   . CYS A 1 189 ? 53.106 38.268 121.211 1.00 47.07 ? 189 CYS A C   1 
ATOM   1379 O O   . CYS A 1 189 ? 53.466 39.037 122.122 1.00 49.76 ? 189 CYS A O   1 
ATOM   1380 C CB  . CYS A 1 189 ? 54.450 36.642 122.492 1.00 34.66 ? 189 CYS A CB  1 
ATOM   1381 S SG  . CYS A 1 189 ? 55.336 35.081 122.364 1.00 35.46 ? 189 CYS A SG  1 
ATOM   1382 N N   . GLY A 1 190 ? 52.412 38.774 120.200 1.00 53.49 ? 190 GLY A N   1 
ATOM   1383 C CA  . GLY A 1 190 ? 52.108 40.236 120.227 1.00 59.68 ? 190 GLY A CA  1 
ATOM   1384 C C   . GLY A 1 190 ? 52.334 40.740 118.805 1.00 63.45 ? 190 GLY A C   1 
ATOM   1385 O O   . GLY A 1 190 ? 52.704 41.850 118.459 1.00 65.37 ? 190 GLY A O   1 
ATOM   1386 N N   . PHE A 1 191 ? 52.147 39.758 117.950 1.00 65.71 ? 191 PHE A N   1 
ATOM   1387 C CA  . PHE A 1 191 ? 52.041 39.750 116.520 1.00 65.95 ? 191 PHE A CA  1 
ATOM   1388 C C   . PHE A 1 191 ? 52.248 41.105 115.868 1.00 66.10 ? 191 PHE A C   1 
ATOM   1389 O O   . PHE A 1 191 ? 53.353 41.482 115.438 1.00 66.48 ? 191 PHE A O   1 
ATOM   1390 C CB  . PHE A 1 191 ? 50.593 39.279 116.296 1.00 66.83 ? 191 PHE A CB  1 
ATOM   1391 C CG  . PHE A 1 191 ? 49.946 38.229 117.139 1.00 66.98 ? 191 PHE A CG  1 
ATOM   1392 C CD1 . PHE A 1 191 ? 50.617 37.248 117.838 1.00 67.25 ? 191 PHE A CD1 1 
ATOM   1393 C CD2 . PHE A 1 191 ? 48.556 38.192 117.217 1.00 67.35 ? 191 PHE A CD2 1 
ATOM   1394 C CE1 . PHE A 1 191 ? 49.990 36.272 118.572 1.00 68.13 ? 191 PHE A CE1 1 
ATOM   1395 C CE2 . PHE A 1 191 ? 47.891 37.228 117.946 1.00 67.41 ? 191 PHE A CE2 1 
ATOM   1396 C CZ  . PHE A 1 191 ? 48.608 36.264 118.631 1.00 68.29 ? 191 PHE A CZ  1 
ATOM   1397 N N   . GLU B 2 32  ? 42.352 37.699 166.594 1.00 47.39 ? 32  GLU B N   1 
ATOM   1398 C CA  . GLU B 2 32  ? 41.022 37.769 165.937 1.00 46.77 ? 32  GLU B CA  1 
ATOM   1399 C C   . GLU B 2 32  ? 41.138 38.297 164.520 1.00 44.30 ? 32  GLU B C   1 
ATOM   1400 O O   . GLU B 2 32  ? 40.567 37.655 163.629 1.00 49.12 ? 32  GLU B O   1 
ATOM   1401 C CB  . GLU B 2 32  ? 39.967 38.492 166.756 1.00 49.24 ? 32  GLU B CB  1 
ATOM   1402 N N   . PRO B 2 33  ? 41.893 39.348 164.257 1.00 39.95 ? 33  PRO B N   1 
ATOM   1403 C CA  . PRO B 2 33  ? 42.153 39.789 162.891 1.00 35.32 ? 33  PRO B CA  1 
ATOM   1404 C C   . PRO B 2 33  ? 42.623 38.594 162.069 1.00 32.18 ? 33  PRO B C   1 
ATOM   1405 O O   . PRO B 2 33  ? 43.271 37.705 162.630 1.00 29.69 ? 33  PRO B O   1 
ATOM   1406 C CB  . PRO B 2 33  ? 43.250 40.837 163.040 1.00 37.87 ? 33  PRO B CB  1 
ATOM   1407 C CG  . PRO B 2 33  ? 43.367 41.166 164.490 1.00 37.84 ? 33  PRO B CG  1 
ATOM   1408 C CD  . PRO B 2 33  ? 42.663 40.103 165.281 1.00 38.73 ? 33  PRO B CD  1 
ATOM   1409 N N   . LYS B 2 34  ? 42.222 38.413 160.819 1.00 29.91 ? 34  LYS B N   1 
ATOM   1410 C CA  . LYS B 2 34  ? 42.638 37.292 159.994 1.00 30.21 ? 34  LYS B CA  1 
ATOM   1411 C C   . LYS B 2 34  ? 42.986 37.792 158.576 1.00 28.95 ? 34  LYS B C   1 
ATOM   1412 O O   . LYS B 2 34  ? 42.420 38.798 158.141 1.00 26.42 ? 34  LYS B O   1 
ATOM   1413 C CB  . LYS B 2 34  ? 41.532 36.223 159.900 1.00 31.81 ? 34  LYS B CB  1 
ATOM   1414 C CG  . LYS B 2 34  ? 41.243 35.461 161.197 1.00 35.15 ? 34  LYS B CG  1 
ATOM   1415 C CD  . LYS B 2 34  ? 42.454 34.615 161.541 1.00 38.89 ? 34  LYS B CD  1 
ATOM   1416 C CE  . LYS B 2 34  ? 42.302 33.640 162.688 1.00 41.39 ? 34  LYS B CE  1 
ATOM   1417 N NZ  . LYS B 2 34  ? 43.187 32.446 162.382 1.00 45.87 ? 34  LYS B NZ  1 
ATOM   1418 N N   . PHE B 2 35  ? 43.865 37.045 157.890 1.00 25.46 ? 35  PHE B N   1 
ATOM   1419 C CA  . PHE B 2 35  ? 44.182 37.359 156.509 1.00 26.13 ? 35  PHE B CA  1 
ATOM   1420 C C   . PHE B 2 35  ? 42.955 37.153 155.616 1.00 27.83 ? 35  PHE B C   1 
ATOM   1421 O O   . PHE B 2 35  ? 42.205 36.202 155.806 1.00 29.32 ? 35  PHE B O   1 
ATOM   1422 C CB  . PHE B 2 35  ? 45.281 36.468 155.908 1.00 24.28 ? 35  PHE B CB  1 
ATOM   1423 C CG  . PHE B 2 35  ? 46.674 36.740 156.390 1.00 23.35 ? 35  PHE B CG  1 
ATOM   1424 C CD1 . PHE B 2 35  ? 47.330 37.930 156.091 1.00 22.26 ? 35  PHE B CD1 1 
ATOM   1425 C CD2 . PHE B 2 35  ? 47.343 35.790 157.142 1.00 24.08 ? 35  PHE B CD2 1 
ATOM   1426 C CE1 . PHE B 2 35  ? 48.612 38.149 156.567 1.00 20.60 ? 35  PHE B CE1 1 
ATOM   1427 C CE2 . PHE B 2 35  ? 48.632 35.977 157.609 1.00 23.68 ? 35  PHE B CE2 1 
ATOM   1428 C CZ  . PHE B 2 35  ? 49.253 37.184 157.328 1.00 24.16 ? 35  PHE B CZ  1 
ATOM   1429 N N   . THR B 2 36  ? 42.716 38.032 154.667 1.00 30.67 ? 36  THR B N   1 
ATOM   1430 C CA  . THR B 2 36  ? 41.627 37.859 153.706 1.00 33.37 ? 36  THR B CA  1 
ATOM   1431 C C   . THR B 2 36  ? 42.309 37.240 152.480 1.00 36.29 ? 36  THR B C   1 
ATOM   1432 O O   . THR B 2 36  ? 42.176 36.008 152.323 1.00 37.48 ? 36  THR B O   1 
ATOM   1433 C CB  . THR B 2 36  ? 40.912 39.161 153.385 1.00 32.75 ? 36  THR B CB  1 
ATOM   1434 O OG1 . THR B 2 36  ? 41.887 40.119 152.990 1.00 33.03 ? 36  THR B OG1 1 
ATOM   1435 C CG2 . THR B 2 36  ? 40.180 39.709 154.610 1.00 33.41 ? 36  THR B CG2 1 
ATOM   1436 N N   . LYS B 2 37  ? 43.202 37.997 151.816 1.00 34.35 ? 37  LYS B N   1 
ATOM   1437 C CA  . LYS B 2 37  ? 43.962 37.382 150.731 1.00 31.87 ? 37  LYS B CA  1 
ATOM   1438 C C   . LYS B 2 37  ? 45.303 38.001 150.333 1.00 28.74 ? 37  LYS B C   1 
ATOM   1439 O O   . LYS B 2 37  ? 45.621 39.117 150.715 1.00 22.70 ? 37  LYS B O   1 
ATOM   1440 C CB  . LYS B 2 37  ? 43.071 37.386 149.480 1.00 35.08 ? 37  LYS B CB  1 
ATOM   1441 C CG  . LYS B 2 37  ? 42.987 38.736 148.821 1.00 37.43 ? 37  LYS B CG  1 
ATOM   1442 C CD  . LYS B 2 37  ? 42.152 38.741 147.557 1.00 42.08 ? 37  LYS B CD  1 
ATOM   1443 C CE  . LYS B 2 37  ? 42.396 37.556 146.621 1.00 43.09 ? 37  LYS B CE  1 
ATOM   1444 N NZ  . LYS B 2 37  ? 41.334 37.577 145.558 1.00 45.98 ? 37  LYS B NZ  1 
ATOM   1445 N N   . CYS B 2 38  ? 46.097 37.239 149.573 1.00 22.94 ? 38  CYS B N   1 
ATOM   1446 C CA  . CYS B 2 38  ? 47.325 37.670 148.948 1.00 23.38 ? 38  CYS B CA  1 
ATOM   1447 C C   . CYS B 2 38  ? 47.161 37.558 147.420 1.00 23.23 ? 38  CYS B C   1 
ATOM   1448 O O   . CYS B 2 38  ? 46.518 36.599 146.940 1.00 15.43 ? 38  CYS B O   1 
ATOM   1449 C CB  . CYS B 2 38  ? 48.597 36.941 149.393 1.00 28.81 ? 38  CYS B CB  1 
ATOM   1450 S SG  . CYS B 2 38  ? 48.983 37.015 151.171 1.00 30.26 ? 38  CYS B SG  1 
ATOM   1451 N N   . ARG B 2 39  ? 47.714 38.533 146.689 1.00 18.81 ? 39  ARG B N   1 
ATOM   1452 C CA  . ARG B 2 39  ? 47.608 38.468 145.220 1.00 18.41 ? 39  ARG B CA  1 
ATOM   1453 C C   . ARG B 2 39  ? 48.807 39.068 144.513 1.00 17.40 ? 39  ARG B C   1 
ATOM   1454 O O   . ARG B 2 39  ? 49.280 40.110 144.955 1.00 14.69 ? 39  ARG B O   1 
ATOM   1455 C CB  . ARG B 2 39  ? 46.379 39.293 144.776 1.00 22.56 ? 39  ARG B CB  1 
ATOM   1456 C CG  . ARG B 2 39  ? 46.226 39.588 143.303 1.00 28.70 ? 39  ARG B CG  1 
ATOM   1457 C CD  . ARG B 2 39  ? 44.952 40.324 142.903 1.00 31.33 ? 39  ARG B CD  1 
ATOM   1458 N NE  . ARG B 2 39  ? 45.110 41.754 142.839 1.00 33.64 ? 39  ARG B NE  1 
ATOM   1459 C CZ  . ARG B 2 39  ? 45.289 42.559 141.801 1.00 31.92 ? 39  ARG B CZ  1 
ATOM   1460 N NH1 . ARG B 2 39  ? 45.286 42.045 140.583 1.00 28.27 ? 39  ARG B NH1 1 
ATOM   1461 N NH2 . ARG B 2 39  ? 45.445 43.871 141.995 1.00 28.37 ? 39  ARG B NH2 1 
ATOM   1462 N N   . SER B 2 40  ? 49.292 38.492 143.424 1.00 16.54 ? 40  SER B N   1 
ATOM   1463 C CA  . SER B 2 40  ? 50.283 39.078 142.526 1.00 16.01 ? 40  SER B CA  1 
ATOM   1464 C C   . SER B 2 40  ? 49.595 39.480 141.208 1.00 17.66 ? 40  SER B C   1 
ATOM   1465 O O   . SER B 2 40  ? 49.016 38.596 140.547 1.00 16.60 ? 40  SER B O   1 
ATOM   1466 C CB  . SER B 2 40  ? 51.318 38.021 142.171 1.00 10.91 ? 40  SER B CB  1 
ATOM   1467 O OG  . SER B 2 40  ? 52.241 38.499 141.176 1.00 12.00 ? 40  SER B OG  1 
ATOM   1468 N N   . PRO B 2 41  ? 49.564 40.732 140.788 1.00 17.07 ? 41  PRO B N   1 
ATOM   1469 C CA  . PRO B 2 41  ? 48.868 41.087 139.582 1.00 18.46 ? 41  PRO B CA  1 
ATOM   1470 C C   . PRO B 2 41  ? 49.629 40.689 138.295 1.00 20.14 ? 41  PRO B C   1 
ATOM   1471 O O   . PRO B 2 41  ? 49.000 40.468 137.269 1.00 19.90 ? 41  PRO B O   1 
ATOM   1472 C CB  . PRO B 2 41  ? 48.779 42.620 139.577 1.00 17.25 ? 41  PRO B CB  1 
ATOM   1473 C CG  . PRO B 2 41  ? 49.460 43.088 140.815 1.00 20.71 ? 41  PRO B CG  1 
ATOM   1474 C CD  . PRO B 2 41  ? 50.085 41.902 141.526 1.00 16.07 ? 41  PRO B CD  1 
ATOM   1475 N N   . GLU B 2 42  ? 50.952 40.625 138.301 1.00 17.32 ? 42  GLU B N   1 
ATOM   1476 C CA  . GLU B 2 42  ? 51.687 40.432 137.061 1.00 19.90 ? 42  GLU B CA  1 
ATOM   1477 C C   . GLU B 2 42  ? 52.844 39.460 137.187 1.00 19.31 ? 42  GLU B C   1 
ATOM   1478 O O   . GLU B 2 42  ? 53.752 39.507 136.363 1.00 17.85 ? 42  GLU B O   1 
ATOM   1479 C CB  . GLU B 2 42  ? 52.163 41.784 136.563 1.00 17.22 ? 42  GLU B CB  1 
ATOM   1480 C CG  . GLU B 2 42  ? 53.256 42.560 137.245 1.00 20.74 ? 42  GLU B CG  1 
ATOM   1481 C CD  . GLU B 2 42  ? 53.290 42.548 138.779 1.00 20.57 ? 42  GLU B CD  1 
ATOM   1482 O OE1 . GLU B 2 42  ? 53.336 41.458 139.388 1.00 18.82 ? 42  GLU B OE1 1 
ATOM   1483 O OE2 . GLU B 2 42  ? 53.307 43.635 139.383 1.00 22.33 ? 42  GLU B OE2 1 
ATOM   1484 N N   . ARG B 2 43  ? 52.812 38.648 138.262 1.00 17.89 ? 43  ARG B N   1 
ATOM   1485 C CA  . ARG B 2 43  ? 53.910 37.739 138.514 1.00 17.18 ? 43  ARG B CA  1 
ATOM   1486 C C   . ARG B 2 43  ? 55.204 38.458 138.806 1.00 17.99 ? 43  ARG B C   1 
ATOM   1487 O O   . ARG B 2 43  ? 56.298 37.868 138.633 1.00 18.07 ? 43  ARG B O   1 
ATOM   1488 C CB  . ARG B 2 43  ? 53.932 36.772 137.293 1.00 15.77 ? 43  ARG B CB  1 
ATOM   1489 C CG  . ARG B 2 43  ? 54.649 35.458 137.510 1.00 17.10 ? 43  ARG B CG  1 
ATOM   1490 C CD  . ARG B 2 43  ? 54.641 34.641 136.195 1.00 17.23 ? 43  ARG B CD  1 
ATOM   1491 N NE  . ARG B 2 43  ? 54.961 33.247 136.416 1.00 18.53 ? 43  ARG B NE  1 
ATOM   1492 C CZ  . ARG B 2 43  ? 55.641 32.435 135.638 1.00 19.34 ? 43  ARG B CZ  1 
ATOM   1493 N NH1 . ARG B 2 43  ? 56.087 32.828 134.438 1.00 17.19 ? 43  ARG B NH1 1 
ATOM   1494 N NH2 . ARG B 2 43  ? 55.819 31.184 136.040 1.00 16.55 ? 43  ARG B NH2 1 
ATOM   1495 N N   . GLU B 2 44  ? 55.215 39.727 139.276 1.00 11.13 ? 44  GLU B N   1 
ATOM   1496 C CA  . GLU B 2 44  ? 56.470 40.400 139.523 1.00 16.86 ? 44  GLU B CA  1 
ATOM   1497 C C   . GLU B 2 44  ? 56.497 41.064 140.905 1.00 14.74 ? 44  GLU B C   1 
ATOM   1498 O O   . GLU B 2 44  ? 57.592 41.211 141.448 1.00 15.37 ? 44  GLU B O   1 
ATOM   1499 C CB  . GLU B 2 44  ? 56.842 41.451 138.415 1.00 15.13 ? 44  GLU B CB  1 
ATOM   1500 C CG  . GLU B 2 44  ? 57.005 40.800 137.006 1.00 17.90 ? 44  GLU B CG  1 
ATOM   1501 C CD  . GLU B 2 44  ? 57.179 41.849 135.914 1.00 23.06 ? 44  GLU B CD  1 
ATOM   1502 O OE1 . GLU B 2 44  ? 57.965 42.802 136.112 1.00 27.99 ? 44  GLU B OE1 1 
ATOM   1503 O OE2 . GLU B 2 44  ? 56.521 41.854 134.841 1.00 23.07 ? 44  GLU B OE2 1 
ATOM   1504 N N   . THR B 2 45  ? 55.357 41.497 141.417 1.00 14.98 ? 45  THR B N   1 
ATOM   1505 C CA  . THR B 2 45  ? 55.199 42.077 142.742 1.00 16.89 ? 45  THR B CA  1 
ATOM   1506 C C   . THR B 2 45  ? 54.051 41.359 143.473 1.00 16.89 ? 45  THR B C   1 
ATOM   1507 O O   . THR B 2 45  ? 53.271 40.692 142.757 1.00 15.99 ? 45  THR B O   1 
ATOM   1508 C CB  . THR B 2 45  ? 54.801 43.572 142.705 1.00 16.55 ? 45  THR B CB  1 
ATOM   1509 O OG1 . THR B 2 45  ? 53.498 43.590 142.031 1.00 17.79 ? 45  THR B OG1 1 
ATOM   1510 C CG2 . THR B 2 45  ? 55.771 44.431 141.879 1.00 18.50 ? 45  THR B CG2 1 
ATOM   1511 N N   . PHE B 2 46  ? 53.762 41.597 144.739 1.00 14.97 ? 46  PHE B N   1 
ATOM   1512 C CA  . PHE B 2 46  ? 52.579 41.005 145.372 1.00 16.54 ? 46  PHE B CA  1 
ATOM   1513 C C   . PHE B 2 46  ? 52.167 41.810 146.593 1.00 16.66 ? 46  PHE B C   1 
ATOM   1514 O O   . PHE B 2 46  ? 52.986 42.577 147.108 1.00 16.37 ? 46  PHE B O   1 
ATOM   1515 C CB  . PHE B 2 46  ? 52.699 39.516 145.705 1.00 17.63 ? 46  PHE B CB  1 
ATOM   1516 C CG  . PHE B 2 46  ? 53.531 39.043 146.828 1.00 17.96 ? 46  PHE B CG  1 
ATOM   1517 C CD1 . PHE B 2 46  ? 54.876 38.772 146.622 1.00 19.80 ? 46  PHE B CD1 1 
ATOM   1518 C CD2 . PHE B 2 46  ? 53.018 38.913 148.112 1.00 16.93 ? 46  PHE B CD2 1 
ATOM   1519 C CE1 . PHE B 2 46  ? 55.687 38.340 147.656 1.00 20.56 ? 46  PHE B CE1 1 
ATOM   1520 C CE2 . PHE B 2 46  ? 53.820 38.473 149.154 1.00 18.80 ? 46  PHE B CE2 1 
ATOM   1521 C CZ  . PHE B 2 46  ? 55.163 38.185 148.930 1.00 16.73 ? 46  PHE B CZ  1 
ATOM   1522 N N   . SER B 2 47  ? 50.940 41.647 147.036 1.00 13.34 ? 47  SER B N   1 
ATOM   1523 C CA  . SER B 2 47  ? 50.475 42.295 148.250 1.00 17.62 ? 47  SER B CA  1 
ATOM   1524 C C   . SER B 2 47  ? 49.554 41.366 149.039 1.00 21.13 ? 47  SER B C   1 
ATOM   1525 O O   . SER B 2 47  ? 48.986 40.400 148.485 1.00 18.97 ? 47  SER B O   1 
ATOM   1526 C CB  . SER B 2 47  ? 49.859 43.629 147.813 1.00 21.65 ? 47  SER B CB  1 
ATOM   1527 O OG  . SER B 2 47  ? 48.548 43.377 147.322 1.00 28.04 ? 47  SER B OG  1 
ATOM   1528 N N   . CYS B 2 48  ? 49.434 41.548 150.366 1.00 18.58 ? 48  CYS B N   1 
ATOM   1529 C CA  . CYS B 2 48  ? 48.660 40.698 151.256 1.00 19.63 ? 48  CYS B CA  1 
ATOM   1530 C C   . CYS B 2 48  ? 47.742 41.596 152.084 1.00 22.93 ? 48  CYS B C   1 
ATOM   1531 O O   . CYS B 2 48  ? 48.052 42.771 152.320 1.00 21.90 ? 48  CYS B O   1 
ATOM   1532 C CB  . CYS B 2 48  ? 49.631 39.911 152.166 1.00 23.79 ? 48  CYS B CB  1 
ATOM   1533 S SG  . CYS B 2 48  ? 50.492 38.538 151.343 1.00 32.97 ? 48  CYS B SG  1 
ATOM   1534 N N   . HIS B 2 49  ? 46.537 41.188 152.485 1.00 22.46 ? 49  HIS B N   1 
ATOM   1535 C CA  . HIS B 2 49  ? 45.554 42.044 153.116 1.00 23.95 ? 49  HIS B CA  1 
ATOM   1536 C C   . HIS B 2 49  ? 44.906 41.298 154.278 1.00 23.13 ? 49  HIS B C   1 
ATOM   1537 O O   . HIS B 2 49  ? 44.920 40.064 154.210 1.00 22.13 ? 49  HIS B O   1 
ATOM   1538 C CB  . HIS B 2 49  ? 44.415 42.447 152.123 1.00 27.72 ? 49  HIS B CB  1 
ATOM   1539 C CG  . HIS B 2 49  ? 44.907 43.300 151.002 1.00 28.49 ? 49  HIS B CG  1 
ATOM   1540 N ND1 . HIS B 2 49  ? 44.859 44.659 151.021 1.00 29.98 ? 49  HIS B ND1 1 
ATOM   1541 C CD2 . HIS B 2 49  ? 45.534 42.970 149.836 1.00 31.20 ? 49  HIS B CD2 1 
ATOM   1542 C CE1 . HIS B 2 49  ? 45.412 45.169 149.926 1.00 29.41 ? 49  HIS B CE1 1 
ATOM   1543 N NE2 . HIS B 2 49  ? 45.825 44.160 149.200 1.00 30.36 ? 49  HIS B NE2 1 
ATOM   1544 N N   . TRP B 2 50  ? 44.445 42.033 155.293 1.00 21.95 ? 50  TRP B N   1 
ATOM   1545 C CA  . TRP B 2 50  ? 43.874 41.347 156.452 1.00 20.83 ? 50  TRP B CA  1 
ATOM   1546 C C   . TRP B 2 50  ? 42.654 42.140 156.944 1.00 23.17 ? 50  TRP B C   1 
ATOM   1547 O O   . TRP B 2 50  ? 42.577 43.273 156.549 1.00 20.09 ? 50  TRP B O   1 
ATOM   1548 C CB  . TRP B 2 50  ? 44.842 41.197 157.571 1.00 20.54 ? 50  TRP B CB  1 
ATOM   1549 C CG  . TRP B 2 50  ? 45.674 42.328 158.059 1.00 20.03 ? 50  TRP B CG  1 
ATOM   1550 C CD1 . TRP B 2 50  ? 45.407 43.145 159.143 1.00 21.32 ? 50  TRP B CD1 1 
ATOM   1551 C CD2 . TRP B 2 50  ? 46.932 42.756 157.545 1.00 18.34 ? 50  TRP B CD2 1 
ATOM   1552 N NE1 . TRP B 2 50  ? 46.435 44.043 159.304 1.00 20.82 ? 50  TRP B NE1 1 
ATOM   1553 C CE2 . TRP B 2 50  ? 47.401 43.796 158.355 1.00 20.03 ? 50  TRP B CE2 1 
ATOM   1554 C CE3 . TRP B 2 50  ? 47.734 42.306 156.467 1.00 20.79 ? 50  TRP B CE3 1 
ATOM   1555 C CZ2 . TRP B 2 50  ? 48.604 44.459 158.110 1.00 18.54 ? 50  TRP B CZ2 1 
ATOM   1556 C CZ3 . TRP B 2 50  ? 48.941 42.952 156.247 1.00 19.31 ? 50  TRP B CZ3 1 
ATOM   1557 C CH2 . TRP B 2 50  ? 49.362 44.004 157.068 1.00 19.49 ? 50  TRP B CH2 1 
ATOM   1558 N N   . THR B 2 51  ? 41.776 41.574 157.749 1.00 28.96 ? 51  THR B N   1 
ATOM   1559 C CA  . THR B 2 51  ? 40.559 42.248 158.201 1.00 32.28 ? 51  THR B CA  1 
ATOM   1560 C C   . THR B 2 51  ? 40.850 43.123 159.411 1.00 37.68 ? 51  THR B C   1 
ATOM   1561 O O   . THR B 2 51  ? 41.674 42.682 160.201 1.00 36.26 ? 51  THR B O   1 
ATOM   1562 C CB  . THR B 2 51  ? 39.521 41.263 158.792 1.00 32.53 ? 51  THR B CB  1 
ATOM   1563 O OG1 . THR B 2 51  ? 40.218 40.460 159.796 1.00 32.80 ? 51  THR B OG1 1 
ATOM   1564 C CG2 . THR B 2 51  ? 38.880 40.325 157.827 1.00 30.21 ? 51  THR B CG2 1 
ATOM   1565 N N   . ASP B 2 52  ? 40.108 44.210 159.571 1.00 42.80 ? 52  ASP B N   1 
ATOM   1566 C CA  . ASP B 2 52  ? 40.310 45.080 160.719 1.00 47.89 ? 52  ASP B CA  1 
ATOM   1567 C C   . ASP B 2 52  ? 39.566 44.536 161.941 1.00 51.48 ? 52  ASP B C   1 
ATOM   1568 O O   . ASP B 2 52  ? 39.265 43.316 161.913 1.00 57.08 ? 52  ASP B O   1 
ATOM   1569 C CB  . ASP B 2 52  ? 39.811 46.483 160.387 1.00 49.76 ? 52  ASP B CB  1 
ATOM   1570 N N   . GLU B 2 61  ? 45.850 42.654 171.272 1.00 43.08 ? 61  GLU B N   1 
ATOM   1571 C CA  . GLU B 2 61  ? 45.594 43.994 170.716 1.00 42.32 ? 61  GLU B CA  1 
ATOM   1572 C C   . GLU B 2 61  ? 46.862 44.740 170.303 1.00 39.60 ? 61  GLU B C   1 
ATOM   1573 O O   . GLU B 2 61  ? 47.945 44.161 170.058 1.00 38.99 ? 61  GLU B O   1 
ATOM   1574 C CB  . GLU B 2 61  ? 44.796 44.808 171.748 1.00 43.69 ? 61  GLU B CB  1 
ATOM   1575 N N   . GLY B 2 62  ? 46.717 46.055 170.218 1.00 36.90 ? 62  GLY B N   1 
ATOM   1576 C CA  . GLY B 2 62  ? 47.792 46.988 169.806 1.00 34.64 ? 62  GLY B CA  1 
ATOM   1577 C C   . GLY B 2 62  ? 47.824 46.906 168.277 1.00 31.48 ? 62  GLY B C   1 
ATOM   1578 O O   . GLY B 2 62  ? 47.018 46.104 167.789 1.00 34.73 ? 62  GLY B O   1 
ATOM   1579 N N   . PRO B 2 63  ? 48.684 47.636 167.596 1.00 26.42 ? 63  PRO B N   1 
ATOM   1580 C CA  . PRO B 2 63  ? 48.843 47.511 166.165 1.00 23.80 ? 63  PRO B CA  1 
ATOM   1581 C C   . PRO B 2 63  ? 49.179 46.090 165.696 1.00 22.67 ? 63  PRO B C   1 
ATOM   1582 O O   . PRO B 2 63  ? 49.818 45.247 166.329 1.00 20.82 ? 63  PRO B O   1 
ATOM   1583 C CB  . PRO B 2 63  ? 49.977 48.445 165.809 1.00 23.83 ? 63  PRO B CB  1 
ATOM   1584 C CG  . PRO B 2 63  ? 50.717 48.709 167.098 1.00 26.74 ? 63  PRO B CG  1 
ATOM   1585 C CD  . PRO B 2 63  ? 49.679 48.573 168.182 1.00 24.40 ? 63  PRO B CD  1 
ATOM   1586 N N   . ILE B 2 64  ? 48.571 45.759 164.543 1.00 21.45 ? 64  ILE B N   1 
ATOM   1587 C CA  . ILE B 2 64  ? 48.777 44.442 163.928 1.00 18.76 ? 64  ILE B CA  1 
ATOM   1588 C C   . ILE B 2 64  ? 50.000 44.477 163.028 1.00 17.85 ? 64  ILE B C   1 
ATOM   1589 O O   . ILE B 2 64  ? 50.144 45.327 162.158 1.00 13.16 ? 64  ILE B O   1 
ATOM   1590 C CB  . ILE B 2 64  ? 47.518 44.054 163.126 1.00 23.12 ? 64  ILE B CB  1 
ATOM   1591 C CG1 . ILE B 2 64  ? 46.276 44.057 164.061 1.00 20.78 ? 64  ILE B CG1 1 
ATOM   1592 C CG2 . ILE B 2 64  ? 47.736 42.732 162.386 1.00 18.18 ? 64  ILE B CG2 1 
ATOM   1593 C CD1 . ILE B 2 64  ? 46.447 43.235 165.332 1.00 27.56 ? 64  ILE B CD1 1 
ATOM   1594 N N   . GLN B 2 65  ? 50.928 43.540 163.188 1.00 15.93 ? 65  GLN B N   1 
ATOM   1595 C CA  . GLN B 2 65  ? 52.125 43.501 162.371 1.00 17.10 ? 65  GLN B CA  1 
ATOM   1596 C C   . GLN B 2 65  ? 52.066 42.308 161.396 1.00 17.36 ? 65  GLN B C   1 
ATOM   1597 O O   . GLN B 2 65  ? 51.458 41.251 161.687 1.00 13.22 ? 65  GLN B O   1 
ATOM   1598 C CB  . GLN B 2 65  ? 53.317 43.325 163.339 1.00 21.00 ? 65  GLN B CB  1 
ATOM   1599 C CG  . GLN B 2 65  ? 53.691 44.501 164.301 1.00 20.08 ? 65  GLN B CG  1 
ATOM   1600 C CD  . GLN B 2 65  ? 54.771 43.948 165.243 1.00 21.68 ? 65  GLN B CD  1 
ATOM   1601 O OE1 . GLN B 2 65  ? 54.509 43.050 166.074 1.00 23.24 ? 65  GLN B OE1 1 
ATOM   1602 N NE2 . GLN B 2 65  ? 56.000 44.346 165.087 1.00 17.27 ? 65  GLN B NE2 1 
ATOM   1603 N N   . LEU B 2 66  ? 52.832 42.417 160.312 1.00 15.01 ? 66  LEU B N   1 
ATOM   1604 C CA  . LEU B 2 66  ? 53.067 41.338 159.362 1.00 14.08 ? 66  LEU B CA  1 
ATOM   1605 C C   . LEU B 2 66  ? 54.546 41.007 159.334 1.00 14.63 ? 66  LEU B C   1 
ATOM   1606 O O   . LEU B 2 66  ? 55.419 41.876 159.203 1.00 16.18 ? 66  LEU B O   1 
ATOM   1607 C CB  . LEU B 2 66  ? 52.479 41.625 157.948 1.00 15.43 ? 66  LEU B CB  1 
ATOM   1608 C CG  . LEU B 2 66  ? 52.680 40.425 156.977 1.00 18.85 ? 66  LEU B CG  1 
ATOM   1609 C CD1 . LEU B 2 66  ? 51.553 40.316 155.951 1.00 18.01 ? 66  LEU B CD1 1 
ATOM   1610 C CD2 . LEU B 2 66  ? 54.011 40.487 156.230 1.00 15.15 ? 66  LEU B CD2 1 
ATOM   1611 N N   . PHE B 2 67  ? 54.900 39.725 159.449 1.00 14.65 ? 67  PHE B N   1 
ATOM   1612 C CA  . PHE B 2 67  ? 56.232 39.179 159.310 1.00 15.35 ? 67  PHE B CA  1 
ATOM   1613 C C   . PHE B 2 67  ? 56.241 38.134 158.172 1.00 16.11 ? 67  PHE B C   1 
ATOM   1614 O O   . PHE B 2 67  ? 55.251 37.371 158.035 1.00 14.33 ? 67  PHE B O   1 
ATOM   1615 C CB  . PHE B 2 67  ? 56.767 38.466 160.577 1.00 15.61 ? 67  PHE B CB  1 
ATOM   1616 C CG  . PHE B 2 67  ? 57.111 39.461 161.667 1.00 19.21 ? 67  PHE B CG  1 
ATOM   1617 C CD1 . PHE B 2 67  ? 56.138 39.946 162.511 1.00 17.34 ? 67  PHE B CD1 1 
ATOM   1618 C CD2 . PHE B 2 67  ? 58.430 39.930 161.770 1.00 19.41 ? 67  PHE B CD2 1 
ATOM   1619 C CE1 . PHE B 2 67  ? 56.471 40.864 163.507 1.00 20.49 ? 67  PHE B CE1 1 
ATOM   1620 C CE2 . PHE B 2 67  ? 58.767 40.845 162.756 1.00 19.22 ? 67  PHE B CE2 1 
ATOM   1621 C CZ  . PHE B 2 67  ? 57.782 41.324 163.617 1.00 18.92 ? 67  PHE B CZ  1 
ATOM   1622 N N   . TYR B 2 68  ? 57.322 38.050 157.416 1.00 15.68 ? 68  TYR B N   1 
ATOM   1623 C CA  . TYR B 2 68  ? 57.420 37.064 156.341 1.00 15.57 ? 68  TYR B CA  1 
ATOM   1624 C C   . TYR B 2 68  ? 58.755 36.332 156.406 1.00 20.13 ? 68  TYR B C   1 
ATOM   1625 O O   . TYR B 2 68  ? 59.763 36.829 156.941 1.00 17.83 ? 68  TYR B O   1 
ATOM   1626 C CB  . TYR B 2 68  ? 57.231 37.723 154.935 1.00 13.89 ? 68  TYR B CB  1 
ATOM   1627 C CG  . TYR B 2 68  ? 58.428 38.567 154.542 1.00 16.61 ? 68  TYR B CG  1 
ATOM   1628 C CD1 . TYR B 2 68  ? 58.669 39.809 155.073 1.00 16.20 ? 68  TYR B CD1 1 
ATOM   1629 C CD2 . TYR B 2 68  ? 59.381 38.040 153.655 1.00 16.87 ? 68  TYR B CD2 1 
ATOM   1630 C CE1 . TYR B 2 68  ? 59.792 40.547 154.737 1.00 17.59 ? 68  TYR B CE1 1 
ATOM   1631 C CE2 . TYR B 2 68  ? 60.517 38.745 153.324 1.00 20.85 ? 68  TYR B CE2 1 
ATOM   1632 C CZ  . TYR B 2 68  ? 60.703 40.021 153.854 1.00 21.37 ? 68  TYR B CZ  1 
ATOM   1633 O OH  . TYR B 2 68  ? 61.818 40.714 153.472 1.00 21.06 ? 68  TYR B OH  1 
ATOM   1634 N N   . THR B 2 69  ? 58.779 35.135 155.809 1.00 20.52 ? 69  THR B N   1 
ATOM   1635 C CA  . THR B 2 69  ? 59.976 34.313 155.655 1.00 26.57 ? 69  THR B CA  1 
ATOM   1636 C C   . THR B 2 69  ? 59.992 33.675 154.260 1.00 28.72 ? 69  THR B C   1 
ATOM   1637 O O   . THR B 2 69  ? 58.930 33.365 153.688 1.00 30.02 ? 69  THR B O   1 
ATOM   1638 C CB  . THR B 2 69  ? 60.105 33.261 156.778 1.00 28.28 ? 69  THR B CB  1 
ATOM   1639 O OG1 . THR B 2 69  ? 61.416 32.679 156.723 1.00 29.95 ? 69  THR B OG1 1 
ATOM   1640 C CG2 . THR B 2 69  ? 59.102 32.122 156.710 1.00 28.23 ? 69  THR B CG2 1 
ATOM   1641 N N   . ARG B 2 70  ? 61.117 33.657 153.578 1.00 31.05 ? 70  ARG B N   1 
ATOM   1642 C CA  . ARG B 2 70  ? 61.263 33.028 152.273 1.00 35.54 ? 70  ARG B CA  1 
ATOM   1643 C C   . ARG B 2 70  ? 62.657 32.392 152.232 1.00 38.56 ? 70  ARG B C   1 
ATOM   1644 O O   . ARG B 2 70  ? 63.551 32.932 152.876 1.00 37.23 ? 70  ARG B O   1 
ATOM   1645 C CB  . ARG B 2 70  ? 61.064 33.972 151.093 1.00 34.47 ? 70  ARG B CB  1 
ATOM   1646 C CG  . ARG B 2 70  ? 62.159 35.017 151.034 1.00 40.68 ? 70  ARG B CG  1 
ATOM   1647 C CD  . ARG B 2 70  ? 61.868 36.203 150.173 1.00 45.32 ? 70  ARG B CD  1 
ATOM   1648 N NE  . ARG B 2 70  ? 62.158 36.032 148.758 1.00 48.29 ? 70  ARG B NE  1 
ATOM   1649 C CZ  . ARG B 2 70  ? 62.988 36.800 148.048 1.00 48.88 ? 70  ARG B CZ  1 
ATOM   1650 N NH1 . ARG B 2 70  ? 63.660 37.814 148.584 1.00 49.36 ? 70  ARG B NH1 1 
ATOM   1651 N NH2 . ARG B 2 70  ? 63.122 36.549 146.756 1.00 49.23 ? 70  ARG B NH2 1 
ATOM   1652 N N   . ARG B 2 71  ? 62.836 31.293 151.502 1.00 43.66 ? 71  ARG B N   1 
ATOM   1653 C CA  . ARG B 2 71  ? 64.176 30.704 151.415 1.00 50.52 ? 71  ARG B CA  1 
ATOM   1654 C C   . ARG B 2 71  ? 65.066 31.717 150.690 1.00 52.35 ? 71  ARG B C   1 
ATOM   1655 O O   . ARG B 2 71  ? 64.868 31.921 149.487 1.00 50.47 ? 71  ARG B O   1 
ATOM   1656 C CB  . ARG B 2 71  ? 64.152 29.396 150.653 1.00 51.38 ? 71  ARG B CB  1 
ATOM   1657 C CG  . ARG B 2 71  ? 64.175 28.089 151.396 1.00 55.81 ? 71  ARG B CG  1 
ATOM   1658 C CD  . ARG B 2 71  ? 65.188 27.114 150.815 1.00 59.62 ? 71  ARG B CD  1 
ATOM   1659 N NE  . ARG B 2 71  ? 66.188 27.769 149.974 1.00 63.17 ? 71  ARG B NE  1 
ATOM   1660 C CZ  . ARG B 2 71  ? 66.304 27.582 148.659 1.00 65.08 ? 71  ARG B CZ  1 
ATOM   1661 N NH1 . ARG B 2 71  ? 65.480 26.748 148.032 1.00 66.75 ? 71  ARG B NH1 1 
ATOM   1662 N NH2 . ARG B 2 71  ? 67.231 28.223 147.949 1.00 66.05 ? 71  ARG B NH2 1 
ATOM   1663 N N   . ASN B 2 72  ? 65.983 32.395 151.357 1.00 56.16 ? 72  ASN B N   1 
ATOM   1664 C CA  . ASN B 2 72  ? 66.845 33.378 150.701 1.00 59.82 ? 72  ASN B CA  1 
ATOM   1665 C C   . ASN B 2 72  ? 67.707 34.063 151.761 1.00 61.28 ? 72  ASN B C   1 
ATOM   1666 O O   . ASN B 2 72  ? 68.878 33.749 151.982 1.00 62.98 ? 72  ASN B O   1 
ATOM   1667 C CB  . ASN B 2 72  ? 66.083 34.437 149.914 1.00 61.96 ? 72  ASN B CB  1 
ATOM   1668 C CG  . ASN B 2 72  ? 65.961 34.240 148.414 1.00 63.95 ? 72  ASN B CG  1 
ATOM   1669 O OD1 . ASN B 2 72  ? 64.876 34.421 147.835 1.00 63.52 ? 72  ASN B OD1 1 
ATOM   1670 N ND2 . ASN B 2 72  ? 67.043 33.815 147.766 1.00 65.38 ? 72  ASN B ND2 1 
ATOM   1671 N N   . GLU B 2 79  ? 65.390 33.969 157.852 1.00 53.03 ? 79  GLU B N   1 
ATOM   1672 C CA  . GLU B 2 79  ? 64.091 33.667 158.448 1.00 50.96 ? 79  GLU B CA  1 
ATOM   1673 C C   . GLU B 2 79  ? 63.173 34.864 158.632 1.00 46.95 ? 79  GLU B C   1 
ATOM   1674 O O   . GLU B 2 79  ? 62.950 35.461 157.566 1.00 46.51 ? 79  GLU B O   1 
ATOM   1675 C CB  . GLU B 2 79  ? 64.229 32.756 159.665 1.00 54.81 ? 79  GLU B CB  1 
ATOM   1676 C CG  . GLU B 2 79  ? 64.219 31.290 159.258 1.00 58.23 ? 79  GLU B CG  1 
ATOM   1677 C CD  . GLU B 2 79  ? 63.507 30.358 160.214 1.00 60.79 ? 79  GLU B CD  1 
ATOM   1678 O OE1 . GLU B 2 79  ? 64.018 30.107 161.325 1.00 61.56 ? 79  GLU B OE1 1 
ATOM   1679 O OE2 . GLU B 2 79  ? 62.420 29.824 159.880 1.00 62.08 ? 79  GLU B OE2 1 
ATOM   1680 N N   . TRP B 2 80  ? 62.576 35.216 159.770 1.00 40.88 ? 80  TRP B N   1 
ATOM   1681 C CA  . TRP B 2 80  ? 61.547 36.238 159.842 1.00 34.57 ? 80  TRP B CA  1 
ATOM   1682 C C   . TRP B 2 80  ? 61.939 37.690 159.783 1.00 30.93 ? 80  TRP B C   1 
ATOM   1683 O O   . TRP B 2 80  ? 62.807 38.157 160.504 1.00 31.76 ? 80  TRP B O   1 
ATOM   1684 C CB  . TRP B 2 80  ? 60.621 35.968 161.050 1.00 30.81 ? 80  TRP B CB  1 
ATOM   1685 C CG  . TRP B 2 80  ? 59.949 34.649 160.973 1.00 31.59 ? 80  TRP B CG  1 
ATOM   1686 C CD1 . TRP B 2 80  ? 60.432 33.478 161.526 1.00 35.17 ? 80  TRP B CD1 1 
ATOM   1687 C CD2 . TRP B 2 80  ? 58.742 34.281 160.284 1.00 30.14 ? 80  TRP B CD2 1 
ATOM   1688 N NE1 . TRP B 2 80  ? 59.582 32.429 161.237 1.00 34.51 ? 80  TRP B NE1 1 
ATOM   1689 C CE2 . TRP B 2 80  ? 58.536 32.905 160.478 1.00 31.69 ? 80  TRP B CE2 1 
ATOM   1690 C CE3 . TRP B 2 80  ? 57.810 34.977 159.530 1.00 28.34 ? 80  TRP B CE3 1 
ATOM   1691 C CZ2 . TRP B 2 80  ? 57.438 32.210 159.955 1.00 30.17 ? 80  TRP B CZ2 1 
ATOM   1692 C CZ3 . TRP B 2 80  ? 56.723 34.296 159.000 1.00 27.30 ? 80  TRP B CZ3 1 
ATOM   1693 C CH2 . TRP B 2 80  ? 56.550 32.918 159.199 1.00 27.92 ? 80  TRP B CH2 1 
ATOM   1694 N N   . LYS B 2 81  ? 61.315 38.483 158.915 1.00 25.79 ? 81  LYS B N   1 
ATOM   1695 C CA  . LYS B 2 81  ? 61.505 39.900 158.717 1.00 23.67 ? 81  LYS B CA  1 
ATOM   1696 C C   . LYS B 2 81  ? 60.149 40.611 158.720 1.00 22.38 ? 81  LYS B C   1 
ATOM   1697 O O   . LYS B 2 81  ? 59.158 40.055 158.249 1.00 20.84 ? 81  LYS B O   1 
ATOM   1698 C CB  . LYS B 2 81  ? 62.220 40.297 157.385 1.00 25.24 ? 81  LYS B CB  1 
ATOM   1699 C CG  . LYS B 2 81  ? 63.585 39.612 157.340 1.00 31.57 ? 81  LYS B CG  1 
ATOM   1700 C CD  . LYS B 2 81  ? 64.605 40.255 156.436 1.00 37.87 ? 81  LYS B CD  1 
ATOM   1701 C CE  . LYS B 2 81  ? 65.093 39.225 155.408 1.00 41.84 ? 81  LYS B CE  1 
ATOM   1702 N NZ  . LYS B 2 81  ? 65.895 38.144 156.076 1.00 43.88 ? 81  LYS B NZ  1 
ATOM   1703 N N   . GLU B 2 82  ? 60.091 41.847 159.189 1.00 20.45 ? 82  GLU B N   1 
ATOM   1704 C CA  . GLU B 2 82  ? 58.825 42.580 159.240 1.00 20.87 ? 82  GLU B CA  1 
ATOM   1705 C C   . GLU B 2 82  ? 58.450 43.070 157.830 1.00 18.51 ? 82  GLU B C   1 
ATOM   1706 O O   . GLU B 2 82  ? 59.306 43.314 157.008 1.00 16.13 ? 82  GLU B O   1 
ATOM   1707 C CB  . GLU B 2 82  ? 58.865 43.763 160.228 1.00 15.78 ? 82  GLU B CB  1 
ATOM   1708 C CG  . GLU B 2 82  ? 57.490 44.373 160.443 1.00 19.25 ? 82  GLU B CG  1 
ATOM   1709 C CD  . GLU B 2 82  ? 57.268 45.204 161.716 1.00 17.93 ? 82  GLU B CD  1 
ATOM   1710 O OE1 . GLU B 2 82  ? 58.204 45.253 162.549 1.00 16.60 ? 82  GLU B OE1 1 
ATOM   1711 O OE2 . GLU B 2 82  ? 56.172 45.800 161.817 1.00 15.00 ? 82  GLU B OE2 1 
ATOM   1712 N N   . CYS B 2 83  ? 57.180 43.209 157.547 1.00 18.70 ? 83  CYS B N   1 
ATOM   1713 C CA  . CYS B 2 83  ? 56.674 43.779 156.294 1.00 18.40 ? 83  CYS B CA  1 
ATOM   1714 C C   . CYS B 2 83  ? 57.535 44.971 155.899 1.00 22.15 ? 83  CYS B C   1 
ATOM   1715 O O   . CYS B 2 83  ? 57.759 45.955 156.657 1.00 22.27 ? 83  CYS B O   1 
ATOM   1716 C CB  . CYS B 2 83  ? 55.231 44.286 156.545 1.00 19.03 ? 83  CYS B CB  1 
ATOM   1717 S SG  . CYS B 2 83  ? 54.469 45.213 155.180 1.00 22.47 ? 83  CYS B SG  1 
ATOM   1718 N N   . PRO B 2 84  ? 57.974 44.980 154.647 1.00 19.89 ? 84  PRO B N   1 
ATOM   1719 C CA  . PRO B 2 84  ? 58.758 46.092 154.141 1.00 22.16 ? 84  PRO B CA  1 
ATOM   1720 C C   . PRO B 2 84  ? 57.927 47.317 153.826 1.00 21.19 ? 84  PRO B C   1 
ATOM   1721 O O   . PRO B 2 84  ? 58.548 48.389 153.703 1.00 20.91 ? 84  PRO B O   1 
ATOM   1722 C CB  . PRO B 2 84  ? 59.441 45.555 152.853 1.00 22.18 ? 84  PRO B CB  1 
ATOM   1723 C CG  . PRO B 2 84  ? 58.428 44.568 152.362 1.00 20.37 ? 84  PRO B CG  1 
ATOM   1724 C CD  . PRO B 2 84  ? 57.919 43.882 153.654 1.00 20.57 ? 84  PRO B CD  1 
ATOM   1725 N N   . ASP B 2 85  ? 56.613 47.254 153.643 1.00 19.70 ? 85  ASP B N   1 
ATOM   1726 C CA  . ASP B 2 85  ? 55.882 48.489 153.218 1.00 18.72 ? 85  ASP B CA  1 
ATOM   1727 C C   . ASP B 2 85  ? 54.419 48.398 153.563 1.00 19.01 ? 85  ASP B C   1 
ATOM   1728 O O   . ASP B 2 85  ? 53.668 47.611 152.956 1.00 18.58 ? 85  ASP B O   1 
ATOM   1729 C CB  . ASP B 2 85  ? 56.164 48.755 151.737 1.00 15.79 ? 85  ASP B CB  1 
ATOM   1730 C CG  . ASP B 2 85  ? 55.346 49.883 151.123 1.00 20.83 ? 85  ASP B CG  1 
ATOM   1731 O OD1 . ASP B 2 85  ? 54.419 50.487 151.691 1.00 21.99 ? 85  ASP B OD1 1 
ATOM   1732 O OD2 . ASP B 2 85  ? 55.585 50.228 149.931 1.00 22.83 ? 85  ASP B OD2 1 
ATOM   1733 N N   . TYR B 2 86  ? 53.980 49.067 154.630 1.00 17.80 ? 86  TYR B N   1 
ATOM   1734 C CA  . TYR B 2 86  ? 52.593 48.999 155.069 1.00 18.03 ? 86  TYR B CA  1 
ATOM   1735 C C   . TYR B 2 86  ? 51.629 50.003 154.422 1.00 18.94 ? 86  TYR B C   1 
ATOM   1736 O O   . TYR B 2 86  ? 50.440 50.017 154.828 1.00 20.22 ? 86  TYR B O   1 
ATOM   1737 C CB  . TYR B 2 86  ? 52.526 49.306 156.578 1.00 17.80 ? 86  TYR B CB  1 
ATOM   1738 C CG  . TYR B 2 86  ? 52.966 48.192 157.509 1.00 18.78 ? 86  TYR B CG  1 
ATOM   1739 C CD1 . TYR B 2 86  ? 52.159 47.097 157.747 1.00 17.30 ? 86  TYR B CD1 1 
ATOM   1740 C CD2 . TYR B 2 86  ? 54.212 48.272 158.145 1.00 18.54 ? 86  TYR B CD2 1 
ATOM   1741 C CE1 . TYR B 2 86  ? 52.573 46.082 158.609 1.00 16.96 ? 86  TYR B CE1 1 
ATOM   1742 C CE2 . TYR B 2 86  ? 54.637 47.271 159.020 1.00 16.09 ? 86  TYR B CE2 1 
ATOM   1743 C CZ  . TYR B 2 86  ? 53.788 46.197 159.249 1.00 14.60 ? 86  TYR B CZ  1 
ATOM   1744 O OH  . TYR B 2 86  ? 54.188 45.222 160.129 1.00 14.91 ? 86  TYR B OH  1 
ATOM   1745 N N   . VAL B 2 87  ? 52.080 50.883 153.579 1.00 17.69 ? 87  VAL B N   1 
ATOM   1746 C CA  . VAL B 2 87  ? 51.270 51.905 152.926 1.00 24.19 ? 87  VAL B CA  1 
ATOM   1747 C C   . VAL B 2 87  ? 50.843 51.682 151.462 1.00 23.65 ? 87  VAL B C   1 
ATOM   1748 O O   . VAL B 2 87  ? 49.709 52.036 151.166 1.00 24.89 ? 87  VAL B O   1 
ATOM   1749 C CB  . VAL B 2 87  ? 52.043 53.247 152.674 1.00 25.67 ? 87  VAL B CB  1 
ATOM   1750 C CG1 . VAL B 2 87  ? 51.006 54.359 152.483 1.00 30.38 ? 87  VAL B CG1 1 
ATOM   1751 C CG2 . VAL B 2 87  ? 53.012 53.605 153.757 1.00 27.61 ? 87  VAL B CG2 1 
ATOM   1752 N N   . SER B 2 88  ? 51.735 51.262 150.564 1.00 22.79 ? 88  SER B N   1 
ATOM   1753 C CA  . SER B 2 88  ? 51.394 51.209 149.150 1.00 25.47 ? 88  SER B CA  1 
ATOM   1754 C C   . SER B 2 88  ? 50.120 50.451 148.799 1.00 25.53 ? 88  SER B C   1 
ATOM   1755 O O   . SER B 2 88  ? 49.417 50.942 147.905 1.00 26.26 ? 88  SER B O   1 
ATOM   1756 C CB  . SER B 2 88  ? 52.508 50.646 148.257 1.00 24.40 ? 88  SER B CB  1 
ATOM   1757 O OG  . SER B 2 88  ? 53.703 51.377 148.471 1.00 24.56 ? 88  SER B OG  1 
ATOM   1758 N N   . ALA B 2 89  ? 49.802 49.325 149.428 1.00 22.48 ? 89  ALA B N   1 
ATOM   1759 C CA  . ALA B 2 89  ? 48.597 48.580 149.023 1.00 22.39 ? 89  ALA B CA  1 
ATOM   1760 C C   . ALA B 2 89  ? 47.372 48.929 149.828 1.00 21.08 ? 89  ALA B C   1 
ATOM   1761 O O   . ALA B 2 89  ? 46.398 48.196 149.935 1.00 24.77 ? 89  ALA B O   1 
ATOM   1762 C CB  . ALA B 2 89  ? 48.980 47.103 149.143 1.00 23.92 ? 89  ALA B CB  1 
ATOM   1763 N N   . GLY B 2 90  ? 47.414 50.025 150.591 1.00 23.41 ? 90  GLY B N   1 
ATOM   1764 C CA  . GLY B 2 90  ? 46.297 50.517 151.380 1.00 23.90 ? 90  GLY B CA  1 
ATOM   1765 C C   . GLY B 2 90  ? 46.321 50.062 152.835 1.00 27.95 ? 90  GLY B C   1 
ATOM   1766 O O   . GLY B 2 90  ? 47.322 49.544 153.366 1.00 28.20 ? 90  GLY B O   1 
ATOM   1767 N N   . GLU B 2 91  ? 45.176 50.262 153.470 1.00 25.08 ? 91  GLU B N   1 
ATOM   1768 C CA  . GLU B 2 91  ? 44.982 49.953 154.893 1.00 26.41 ? 91  GLU B CA  1 
ATOM   1769 C C   . GLU B 2 91  ? 45.009 48.470 155.194 1.00 23.41 ? 91  GLU B C   1 
ATOM   1770 O O   . GLU B 2 91  ? 44.582 47.668 154.337 1.00 23.04 ? 91  GLU B O   1 
ATOM   1771 C CB  . GLU B 2 91  ? 43.602 50.529 155.249 1.00 26.13 ? 91  GLU B CB  1 
ATOM   1772 N N   . ASN B 2 92  ? 45.551 48.029 156.327 1.00 21.73 ? 92  ASN B N   1 
ATOM   1773 C CA  . ASN B 2 92  ? 45.644 46.614 156.641 1.00 22.04 ? 92  ASN B CA  1 
ATOM   1774 C C   . ASN B 2 92  ? 46.171 45.768 155.476 1.00 19.85 ? 92  ASN B C   1 
ATOM   1775 O O   . ASN B 2 92  ? 45.570 44.750 155.084 1.00 21.35 ? 92  ASN B O   1 
ATOM   1776 C CB  . ASN B 2 92  ? 44.304 46.034 157.123 1.00 24.62 ? 92  ASN B CB  1 
ATOM   1777 C CG  . ASN B 2 92  ? 43.771 46.809 158.332 1.00 29.49 ? 92  ASN B CG  1 
ATOM   1778 O OD1 . ASN B 2 92  ? 42.556 47.030 158.430 1.00 32.95 ? 92  ASN B OD1 1 
ATOM   1779 N ND2 . ASN B 2 92  ? 44.596 47.260 159.233 1.00 29.26 ? 92  ASN B ND2 1 
ATOM   1780 N N   . SER B 2 93  ? 47.315 46.165 154.971 1.00 19.54 ? 93  SER B N   1 
ATOM   1781 C CA  . SER B 2 93  ? 48.025 45.527 153.875 1.00 22.18 ? 93  SER B CA  1 
ATOM   1782 C C   . SER B 2 93  ? 49.548 45.633 153.956 1.00 19.60 ? 93  SER B C   1 
ATOM   1783 O O   . SER B 2 93  ? 50.107 46.413 154.746 1.00 22.41 ? 93  SER B O   1 
ATOM   1784 C CB  . SER B 2 93  ? 47.586 46.174 152.518 1.00 19.89 ? 93  SER B CB  1 
ATOM   1785 O OG  . SER B 2 93  ? 48.416 47.377 152.388 1.00 21.69 ? 93  SER B OG  1 
ATOM   1786 N N   . CYS B 2 94  ? 50.258 44.793 153.225 1.00 18.75 ? 94  CYS B N   1 
ATOM   1787 C CA  . CYS B 2 94  ? 51.715 44.795 153.076 1.00 16.69 ? 94  CYS B CA  1 
ATOM   1788 C C   . CYS B 2 94  ? 52.025 44.691 151.573 1.00 19.56 ? 94  CYS B C   1 
ATOM   1789 O O   . CYS B 2 94  ? 51.376 43.843 150.910 1.00 17.58 ? 94  CYS B O   1 
ATOM   1790 C CB  . CYS B 2 94  ? 52.370 43.608 153.755 1.00 19.06 ? 94  CYS B CB  1 
ATOM   1791 S SG  . CYS B 2 94  ? 54.210 43.700 153.750 1.00 23.85 ? 94  CYS B SG  1 
ATOM   1792 N N   . TYR B 2 95  ? 52.922 45.482 151.042 1.00 16.52 ? 95  TYR B N   1 
ATOM   1793 C CA  . TYR B 2 95  ? 53.302 45.497 149.653 1.00 17.02 ? 95  TYR B CA  1 
ATOM   1794 C C   . TYR B 2 95  ? 54.747 45.040 149.432 1.00 17.90 ? 95  TYR B C   1 
ATOM   1795 O O   . TYR B 2 95  ? 55.668 45.550 150.064 1.00 18.03 ? 95  TYR B O   1 
ATOM   1796 C CB  . TYR B 2 95  ? 53.083 46.847 148.971 1.00 16.73 ? 95  TYR B CB  1 
ATOM   1797 C CG  . TYR B 2 95  ? 53.619 46.908 147.535 1.00 19.51 ? 95  TYR B CG  1 
ATOM   1798 C CD1 . TYR B 2 95  ? 53.038 46.238 146.477 1.00 20.37 ? 95  TYR B CD1 1 
ATOM   1799 C CD2 . TYR B 2 95  ? 54.750 47.681 147.284 1.00 20.52 ? 95  TYR B CD2 1 
ATOM   1800 C CE1 . TYR B 2 95  ? 53.541 46.317 145.176 1.00 20.89 ? 95  TYR B CE1 1 
ATOM   1801 C CE2 . TYR B 2 95  ? 55.288 47.817 145.998 1.00 21.20 ? 95  TYR B CE2 1 
ATOM   1802 C CZ  . TYR B 2 95  ? 54.663 47.118 144.972 1.00 23.83 ? 95  TYR B CZ  1 
ATOM   1803 O OH  . TYR B 2 95  ? 55.232 47.193 143.726 1.00 25.89 ? 95  TYR B OH  1 
ATOM   1804 N N   . PHE B 2 96  ? 54.924 44.070 148.518 1.00 12.22 ? 96  PHE B N   1 
ATOM   1805 C CA  . PHE B 2 96  ? 56.230 43.516 148.239 1.00 16.41 ? 96  PHE B CA  1 
ATOM   1806 C C   . PHE B 2 96  ? 56.636 43.806 146.807 1.00 17.88 ? 96  PHE B C   1 
ATOM   1807 O O   . PHE B 2 96  ? 55.947 43.261 145.892 1.00 15.53 ? 96  PHE B O   1 
ATOM   1808 C CB  . PHE B 2 96  ? 56.206 41.979 148.452 1.00 16.80 ? 96  PHE B CB  1 
ATOM   1809 C CG  . PHE B 2 96  ? 56.074 41.507 149.868 1.00 20.06 ? 96  PHE B CG  1 
ATOM   1810 C CD1 . PHE B 2 96  ? 54.853 41.357 150.505 1.00 21.57 ? 96  PHE B CD1 1 
ATOM   1811 C CD2 . PHE B 2 96  ? 57.231 41.238 150.597 1.00 20.70 ? 96  PHE B CD2 1 
ATOM   1812 C CE1 . PHE B 2 96  ? 54.771 40.933 151.836 1.00 22.46 ? 96  PHE B CE1 1 
ATOM   1813 C CE2 . PHE B 2 96  ? 57.166 40.787 151.910 1.00 22.57 ? 96  PHE B CE2 1 
ATOM   1814 C CZ  . PHE B 2 96  ? 55.948 40.632 152.533 1.00 20.49 ? 96  PHE B CZ  1 
ATOM   1815 N N   . ASN B 2 97  ? 57.599 44.726 146.650 1.00 16.09 ? 97  ASN B N   1 
ATOM   1816 C CA  . ASN B 2 97  ? 58.029 45.083 145.312 1.00 19.67 ? 97  ASN B CA  1 
ATOM   1817 C C   . ASN B 2 97  ? 58.824 43.973 144.623 1.00 18.35 ? 97  ASN B C   1 
ATOM   1818 O O   . ASN B 2 97  ? 59.014 42.897 145.153 1.00 16.57 ? 97  ASN B O   1 
ATOM   1819 C CB  . ASN B 2 97  ? 58.743 46.454 145.299 1.00 18.92 ? 97  ASN B CB  1 
ATOM   1820 C CG  . ASN B 2 97  ? 60.102 46.416 145.970 1.00 18.04 ? 97  ASN B CG  1 
ATOM   1821 O OD1 . ASN B 2 97  ? 60.809 45.428 146.031 1.00 19.74 ? 97  ASN B OD1 1 
ATOM   1822 N ND2 . ASN B 2 97  ? 60.553 47.545 146.497 1.00 21.29 ? 97  ASN B ND2 1 
ATOM   1823 N N   . SER B 2 98  ? 59.322 44.202 143.408 1.00 18.91 ? 98  SER B N   1 
ATOM   1824 C CA  . SER B 2 98  ? 60.029 43.238 142.591 1.00 20.82 ? 98  SER B CA  1 
ATOM   1825 C C   . SER B 2 98  ? 61.339 42.816 143.217 1.00 22.29 ? 98  SER B C   1 
ATOM   1826 O O   . SER B 2 98  ? 61.686 41.636 143.021 1.00 20.50 ? 98  SER B O   1 
ATOM   1827 C CB  . SER B 2 98  ? 60.233 43.685 141.122 1.00 22.95 ? 98  SER B CB  1 
ATOM   1828 O OG  . SER B 2 98  ? 61.296 44.640 141.018 1.00 27.87 ? 98  SER B OG  1 
ATOM   1829 N N   . SER B 2 99  ? 61.977 43.657 144.081 1.00 21.11 ? 99  SER B N   1 
ATOM   1830 C CA  . SER B 2 99  ? 63.147 43.100 144.766 1.00 20.81 ? 99  SER B CA  1 
ATOM   1831 C C   . SER B 2 99  ? 62.777 42.010 145.780 1.00 22.42 ? 99  SER B C   1 
ATOM   1832 O O   . SER B 2 99  ? 63.727 41.315 146.175 1.00 23.84 ? 99  SER B O   1 
ATOM   1833 C CB  . SER B 2 99  ? 63.974 44.184 145.494 1.00 20.26 ? 99  SER B CB  1 
ATOM   1834 O OG  . SER B 2 99  ? 63.344 44.535 146.750 1.00 20.13 ? 99  SER B OG  1 
ATOM   1835 N N   . PHE B 2 100 ? 61.560 41.779 146.245 1.00 20.54 ? 100 PHE B N   1 
ATOM   1836 C CA  . PHE B 2 100 ? 61.313 40.717 147.230 1.00 23.20 ? 100 PHE B CA  1 
ATOM   1837 C C   . PHE B 2 100 ? 60.579 39.514 146.622 1.00 25.40 ? 100 PHE B C   1 
ATOM   1838 O O   . PHE B 2 100 ? 60.210 38.544 147.307 1.00 26.00 ? 100 PHE B O   1 
ATOM   1839 C CB  . PHE B 2 100 ? 60.400 41.278 148.354 1.00 24.46 ? 100 PHE B CB  1 
ATOM   1840 C CG  . PHE B 2 100 ? 60.961 42.452 149.127 1.00 26.14 ? 100 PHE B CG  1 
ATOM   1841 C CD1 . PHE B 2 100 ? 61.863 42.247 150.180 1.00 27.44 ? 100 PHE B CD1 1 
ATOM   1842 C CD2 . PHE B 2 100 ? 60.617 43.751 148.815 1.00 24.51 ? 100 PHE B CD2 1 
ATOM   1843 C CE1 . PHE B 2 100 ? 62.409 43.310 150.895 1.00 24.56 ? 100 PHE B CE1 1 
ATOM   1844 C CE2 . PHE B 2 100 ? 61.149 44.825 149.563 1.00 25.68 ? 100 PHE B CE2 1 
ATOM   1845 C CZ  . PHE B 2 100 ? 62.056 44.606 150.590 1.00 22.28 ? 100 PHE B CZ  1 
ATOM   1846 N N   . THR B 2 101 ? 60.325 39.546 145.295 1.00 21.91 ? 101 THR B N   1 
ATOM   1847 C CA  . THR B 2 101 ? 59.420 38.610 144.652 1.00 20.55 ? 101 THR B CA  1 
ATOM   1848 C C   . THR B 2 101 ? 60.120 37.692 143.660 1.00 22.84 ? 101 THR B C   1 
ATOM   1849 O O   . THR B 2 101 ? 60.681 38.083 142.609 1.00 20.08 ? 101 THR B O   1 
ATOM   1850 C CB  . THR B 2 101 ? 58.294 39.382 143.937 1.00 18.50 ? 101 THR B CB  1 
ATOM   1851 O OG1 . THR B 2 101 ? 57.630 40.290 144.859 1.00 17.09 ? 101 THR B OG1 1 
ATOM   1852 C CG2 . THR B 2 101 ? 57.213 38.487 143.351 1.00 19.57 ? 101 THR B CG2 1 
ATOM   1853 N N   . SER B 2 102 ? 59.986 36.399 143.971 1.00 23.09 ? 102 SER B N   1 
ATOM   1854 C CA  . SER B 2 102 ? 60.617 35.359 143.147 1.00 25.41 ? 102 SER B CA  1 
ATOM   1855 C C   . SER B 2 102 ? 59.676 34.180 142.944 1.00 26.18 ? 102 SER B C   1 
ATOM   1856 O O   . SER B 2 102 ? 58.951 33.755 143.831 1.00 24.79 ? 102 SER B O   1 
ATOM   1857 C CB  . SER B 2 102 ? 61.967 35.017 143.800 1.00 24.73 ? 102 SER B CB  1 
ATOM   1858 O OG  . SER B 2 102 ? 62.310 33.645 143.535 1.00 32.13 ? 102 SER B OG  1 
ATOM   1859 N N   . ILE B 2 103 ? 59.599 33.631 141.731 1.00 26.01 ? 103 ILE B N   1 
ATOM   1860 C CA  . ILE B 2 103 ? 58.745 32.513 141.400 1.00 27.74 ? 103 ILE B CA  1 
ATOM   1861 C C   . ILE B 2 103 ? 59.364 31.210 141.882 1.00 29.19 ? 103 ILE B C   1 
ATOM   1862 O O   . ILE B 2 103 ? 60.477 31.072 142.363 1.00 31.20 ? 103 ILE B O   1 
ATOM   1863 C CB  . ILE B 2 103 ? 58.384 32.382 139.900 1.00 27.32 ? 103 ILE B CB  1 
ATOM   1864 C CG1 . ILE B 2 103 ? 59.615 32.177 139.011 1.00 24.90 ? 103 ILE B CG1 1 
ATOM   1865 C CG2 . ILE B 2 103 ? 57.582 33.588 139.424 1.00 25.06 ? 103 ILE B CG2 1 
ATOM   1866 C CD1 . ILE B 2 103 ? 59.168 31.632 137.653 1.00 27.50 ? 103 ILE B CD1 1 
ATOM   1867 N N   . ALA B 2 104 ? 58.565 30.170 141.967 1.00 33.55 ? 104 ALA B N   1 
ATOM   1868 C CA  . ALA B 2 104 ? 58.969 28.859 142.393 1.00 35.39 ? 104 ALA B CA  1 
ATOM   1869 C C   . ALA B 2 104 ? 59.319 28.718 143.866 1.00 37.45 ? 104 ALA B C   1 
ATOM   1870 O O   . ALA B 2 104 ? 59.017 27.586 144.293 1.00 39.86 ? 104 ALA B O   1 
ATOM   1871 C CB  . ALA B 2 104 ? 60.104 28.372 141.494 1.00 38.30 ? 104 ALA B CB  1 
ATOM   1872 N N   . ILE B 2 105 ? 59.798 29.661 144.658 1.00 34.70 ? 105 ILE B N   1 
ATOM   1873 C CA  . ILE B 2 105 ? 60.078 29.523 146.071 1.00 30.02 ? 105 ILE B CA  1 
ATOM   1874 C C   . ILE B 2 105 ? 58.905 29.801 147.000 1.00 25.79 ? 105 ILE B C   1 
ATOM   1875 O O   . ILE B 2 105 ? 58.063 30.652 146.745 1.00 25.03 ? 105 ILE B O   1 
ATOM   1876 C CB  . ILE B 2 105 ? 61.241 30.483 146.349 1.00 35.32 ? 105 ILE B CB  1 
ATOM   1877 C CG1 . ILE B 2 105 ? 61.833 30.282 147.765 1.00 34.21 ? 105 ILE B CG1 1 
ATOM   1878 C CG2 . ILE B 2 105 ? 60.865 31.954 146.159 1.00 36.08 ? 105 ILE B CG2 1 
ATOM   1879 C CD1 . ILE B 2 105 ? 63.354 30.148 147.692 1.00 33.83 ? 105 ILE B CD1 1 
ATOM   1880 N N   . PRO B 2 106 ? 58.713 29.076 148.096 1.00 24.09 ? 106 PRO B N   1 
ATOM   1881 C CA  . PRO B 2 106 ? 57.625 29.249 149.022 1.00 22.44 ? 106 PRO B CA  1 
ATOM   1882 C C   . PRO B 2 106 ? 57.809 30.437 149.982 1.00 22.00 ? 106 PRO B C   1 
ATOM   1883 O O   . PRO B 2 106 ? 58.935 30.680 150.419 1.00 22.38 ? 106 PRO B O   1 
ATOM   1884 C CB  . PRO B 2 106 ? 57.691 28.002 149.926 1.00 25.35 ? 106 PRO B CB  1 
ATOM   1885 C CG  . PRO B 2 106 ? 59.061 27.492 149.793 1.00 23.27 ? 106 PRO B CG  1 
ATOM   1886 C CD  . PRO B 2 106 ? 59.626 27.954 148.495 1.00 23.35 ? 106 PRO B CD  1 
ATOM   1887 N N   . TYR B 2 107 ? 56.765 31.176 150.234 1.00 19.46 ? 107 TYR B N   1 
ATOM   1888 C CA  . TYR B 2 107 ? 56.700 32.280 151.183 1.00 20.11 ? 107 TYR B CA  1 
ATOM   1889 C C   . TYR B 2 107 ? 55.819 31.919 152.373 1.00 19.49 ? 107 TYR B C   1 
ATOM   1890 O O   . TYR B 2 107 ? 54.827 31.214 152.201 1.00 17.63 ? 107 TYR B O   1 
ATOM   1891 C CB  . TYR B 2 107 ? 56.114 33.556 150.539 1.00 20.98 ? 107 TYR B CB  1 
ATOM   1892 C CG  . TYR B 2 107 ? 57.039 34.250 149.557 1.00 18.48 ? 107 TYR B CG  1 
ATOM   1893 C CD1 . TYR B 2 107 ? 57.190 33.718 148.267 1.00 18.81 ? 107 TYR B CD1 1 
ATOM   1894 C CD2 . TYR B 2 107 ? 57.769 35.359 149.880 1.00 19.93 ? 107 TYR B CD2 1 
ATOM   1895 C CE1 . TYR B 2 107 ? 58.020 34.337 147.341 1.00 20.97 ? 107 TYR B CE1 1 
ATOM   1896 C CE2 . TYR B 2 107 ? 58.617 36.020 148.983 1.00 21.10 ? 107 TYR B CE2 1 
ATOM   1897 C CZ  . TYR B 2 107 ? 58.745 35.461 147.717 1.00 23.29 ? 107 TYR B CZ  1 
ATOM   1898 O OH  . TYR B 2 107 ? 59.562 36.032 146.796 1.00 25.62 ? 107 TYR B OH  1 
ATOM   1899 N N   . CYS B 2 108 ? 56.138 32.345 153.610 1.00 19.89 ? 108 CYS B N   1 
ATOM   1900 C CA  . CYS B 2 108 ? 55.180 32.139 154.679 1.00 19.56 ? 108 CYS B CA  1 
ATOM   1901 C C   . CYS B 2 108 ? 55.063 33.506 155.372 1.00 20.62 ? 108 CYS B C   1 
ATOM   1902 O O   . CYS B 2 108 ? 56.051 34.213 155.502 1.00 20.17 ? 108 CYS B O   1 
ATOM   1903 C CB  . CYS B 2 108 ? 55.457 31.049 155.703 1.00 25.78 ? 108 CYS B CB  1 
ATOM   1904 S SG  . CYS B 2 108 ? 55.473 29.365 155.082 1.00 33.16 ? 108 CYS B SG  1 
ATOM   1905 N N   . ILE B 2 109 ? 53.853 33.869 155.712 1.00 18.43 ? 109 ILE B N   1 
ATOM   1906 C CA  . ILE B 2 109 ? 53.519 35.122 156.372 1.00 21.06 ? 109 ILE B CA  1 
ATOM   1907 C C   . ILE B 2 109 ? 52.754 34.835 157.675 1.00 21.65 ? 109 ILE B C   1 
ATOM   1908 O O   . ILE B 2 109 ? 51.981 33.862 157.750 1.00 17.18 ? 109 ILE B O   1 
ATOM   1909 C CB  . ILE B 2 109 ? 52.705 36.108 155.497 1.00 19.89 ? 109 ILE B CB  1 
ATOM   1910 C CG1 . ILE B 2 109 ? 51.368 35.453 155.105 1.00 22.39 ? 109 ILE B CG1 1 
ATOM   1911 C CG2 . ILE B 2 109 ? 53.540 36.517 154.276 1.00 20.77 ? 109 ILE B CG2 1 
ATOM   1912 C CD1 . ILE B 2 109 ? 50.430 36.343 154.284 1.00 24.59 ? 109 ILE B CD1 1 
ATOM   1913 N N   . LYS B 2 110 ? 52.989 35.728 158.657 1.00 20.51 ? 110 LYS B N   1 
ATOM   1914 C CA  . LYS B 2 110 ? 52.322 35.614 159.965 1.00 18.09 ? 110 LYS B CA  1 
ATOM   1915 C C   . LYS B 2 110 ? 51.801 36.956 160.442 1.00 17.73 ? 110 LYS B C   1 
ATOM   1916 O O   . LYS B 2 110 ? 52.474 38.003 160.238 1.00 19.21 ? 110 LYS B O   1 
ATOM   1917 C CB  . LYS B 2 110 ? 53.306 35.057 160.999 1.00 20.60 ? 110 LYS B CB  1 
ATOM   1918 C CG  . LYS B 2 110 ? 53.286 33.569 161.174 1.00 25.46 ? 110 LYS B CG  1 
ATOM   1919 C CD  . LYS B 2 110 ? 54.341 33.078 162.183 1.00 28.06 ? 110 LYS B CD  1 
ATOM   1920 C CE  . LYS B 2 110 ? 54.083 31.583 162.373 1.00 30.33 ? 110 LYS B CE  1 
ATOM   1921 N NZ  . LYS B 2 110 ? 54.973 30.959 163.386 1.00 31.95 ? 110 LYS B NZ  1 
ATOM   1922 N N   . LEU B 2 111 ? 50.550 37.015 160.878 1.00 16.07 ? 111 LEU B N   1 
ATOM   1923 C CA  . LEU B 2 111 ? 49.962 38.262 161.367 1.00 19.59 ? 111 LEU B CA  1 
ATOM   1924 C C   . LEU B 2 111 ? 50.145 38.183 162.920 1.00 21.90 ? 111 LEU B C   1 
ATOM   1925 O O   . LEU B 2 111 ? 49.912 37.097 163.492 1.00 19.14 ? 111 LEU B O   1 
ATOM   1926 C CB  . LEU B 2 111 ? 48.487 38.459 161.174 1.00 19.79 ? 111 LEU B CB  1 
ATOM   1927 C CG  . LEU B 2 111 ? 47.731 39.289 160.197 1.00 24.71 ? 111 LEU B CG  1 
ATOM   1928 C CD1 . LEU B 2 111 ? 46.345 39.639 160.721 1.00 27.15 ? 111 LEU B CD1 1 
ATOM   1929 C CD2 . LEU B 2 111 ? 48.476 40.543 159.707 1.00 24.63 ? 111 LEU B CD2 1 
ATOM   1930 N N   . THR B 2 112 ? 50.636 39.248 163.540 1.00 23.02 ? 112 THR B N   1 
ATOM   1931 C CA  . THR B 2 112 ? 50.922 39.223 164.963 1.00 23.79 ? 112 THR B CA  1 
ATOM   1932 C C   . THR B 2 112 ? 50.386 40.451 165.697 1.00 23.52 ? 112 THR B C   1 
ATOM   1933 O O   . THR B 2 112 ? 50.433 41.584 165.259 1.00 21.27 ? 112 THR B O   1 
ATOM   1934 C CB  . THR B 2 112 ? 52.430 39.114 165.274 1.00 26.05 ? 112 THR B CB  1 
ATOM   1935 O OG1 . THR B 2 112 ? 53.008 40.362 164.900 1.00 30.26 ? 112 THR B OG1 1 
ATOM   1936 C CG2 . THR B 2 112 ? 53.172 37.975 164.573 1.00 22.26 ? 112 THR B CG2 1 
ATOM   1937 N N   . SER B 2 113 ? 49.904 40.218 166.894 1.00 24.37 ? 113 SER B N   1 
ATOM   1938 C CA  . SER B 2 113 ? 49.383 41.210 167.839 1.00 25.71 ? 113 SER B CA  1 
ATOM   1939 C C   . SER B 2 113 ? 50.307 41.334 169.044 1.00 23.23 ? 113 SER B C   1 
ATOM   1940 O O   . SER B 2 113 ? 51.391 40.732 169.125 1.00 25.15 ? 113 SER B O   1 
ATOM   1941 C CB  . SER B 2 113 ? 47.966 40.764 168.286 1.00 23.57 ? 113 SER B CB  1 
ATOM   1942 O OG  . SER B 2 113 ? 48.156 39.643 169.154 1.00 25.92 ? 113 SER B OG  1 
ATOM   1943 N N   . ASN B 2 114 ? 49.884 42.074 170.076 1.00 27.33 ? 114 ASN B N   1 
ATOM   1944 C CA  . ASN B 2 114 ? 50.749 42.286 171.241 1.00 29.49 ? 114 ASN B CA  1 
ATOM   1945 C C   . ASN B 2 114 ? 50.803 41.101 172.202 1.00 28.19 ? 114 ASN B C   1 
ATOM   1946 O O   . ASN B 2 114 ? 51.707 41.062 173.067 1.00 23.71 ? 114 ASN B O   1 
ATOM   1947 C CB  . ASN B 2 114 ? 50.474 43.624 171.940 1.00 31.18 ? 114 ASN B CB  1 
ATOM   1948 C CG  . ASN B 2 114 ? 49.314 43.669 172.894 1.00 34.48 ? 114 ASN B CG  1 
ATOM   1949 O OD1 . ASN B 2 114 ? 48.513 42.715 172.966 1.00 37.77 ? 114 ASN B OD1 1 
ATOM   1950 N ND2 . ASN B 2 114 ? 49.200 44.772 173.624 1.00 33.43 ? 114 ASN B ND2 1 
ATOM   1951 N N   . GLY B 2 115 ? 49.956 40.119 171.966 1.00 27.88 ? 115 GLY B N   1 
ATOM   1952 C CA  . GLY B 2 115 ? 49.867 38.870 172.679 1.00 28.76 ? 115 GLY B CA  1 
ATOM   1953 C C   . GLY B 2 115 ? 50.302 37.668 171.849 1.00 30.90 ? 115 GLY B C   1 
ATOM   1954 O O   . GLY B 2 115 ? 50.508 36.579 172.402 1.00 30.45 ? 115 GLY B O   1 
ATOM   1955 N N   . GLY B 2 116 ? 50.615 37.841 170.555 1.00 29.23 ? 116 GLY B N   1 
ATOM   1956 C CA  . GLY B 2 116 ? 51.151 36.701 169.811 1.00 26.51 ? 116 GLY B CA  1 
ATOM   1957 C C   . GLY B 2 116 ? 50.732 36.590 168.351 1.00 24.71 ? 116 GLY B C   1 
ATOM   1958 O O   . GLY B 2 116 ? 50.299 37.575 167.773 1.00 24.75 ? 116 GLY B O   1 
ATOM   1959 N N   . THR B 2 117 ? 50.830 35.407 167.765 1.00 25.15 ? 117 THR B N   1 
ATOM   1960 C CA  . THR B 2 117 ? 50.518 35.183 166.365 1.00 23.72 ? 117 THR B CA  1 
ATOM   1961 C C   . THR B 2 117 ? 49.041 34.999 166.155 1.00 24.69 ? 117 THR B C   1 
ATOM   1962 O O   . THR B 2 117 ? 48.576 34.013 166.748 1.00 25.90 ? 117 THR B O   1 
ATOM   1963 C CB  . THR B 2 117 ? 51.249 33.907 165.868 1.00 25.02 ? 117 THR B CB  1 
ATOM   1964 O OG1 . THR B 2 117 ? 52.655 34.133 165.931 1.00 24.17 ? 117 THR B OG1 1 
ATOM   1965 C CG2 . THR B 2 117 ? 50.861 33.590 164.419 1.00 23.60 ? 117 THR B CG2 1 
ATOM   1966 N N   . VAL B 2 118 ? 48.326 35.830 165.388 1.00 23.85 ? 118 VAL B N   1 
ATOM   1967 C CA  . VAL B 2 118 ? 46.904 35.548 165.205 1.00 25.10 ? 118 VAL B CA  1 
ATOM   1968 C C   . VAL B 2 118 ? 46.521 34.863 163.893 1.00 27.46 ? 118 VAL B C   1 
ATOM   1969 O O   . VAL B 2 118 ? 45.387 34.346 163.820 1.00 26.05 ? 118 VAL B O   1 
ATOM   1970 C CB  . VAL B 2 118 ? 46.047 36.820 165.396 1.00 23.01 ? 118 VAL B CB  1 
ATOM   1971 C CG1 . VAL B 2 118 ? 46.181 37.318 166.864 1.00 22.24 ? 118 VAL B CG1 1 
ATOM   1972 C CG2 . VAL B 2 118 ? 46.410 37.875 164.406 1.00 21.69 ? 118 VAL B CG2 1 
ATOM   1973 N N   . ASP B 2 119 ? 47.369 34.812 162.861 1.00 25.99 ? 119 ASP B N   1 
ATOM   1974 C CA  . ASP B 2 119 ? 47.046 34.123 161.608 1.00 26.38 ? 119 ASP B CA  1 
ATOM   1975 C C   . ASP B 2 119 ? 48.324 33.767 160.831 1.00 26.26 ? 119 ASP B C   1 
ATOM   1976 O O   . ASP B 2 119 ? 49.348 34.417 161.090 1.00 22.77 ? 119 ASP B O   1 
ATOM   1977 C CB  . ASP B 2 119 ? 46.156 34.907 160.656 1.00 26.72 ? 119 ASP B CB  1 
ATOM   1978 C CG  . ASP B 2 119 ? 45.407 33.982 159.682 1.00 32.10 ? 119 ASP B CG  1 
ATOM   1979 O OD1 . ASP B 2 119 ? 45.544 32.729 159.799 1.00 34.63 ? 119 ASP B OD1 1 
ATOM   1980 O OD2 . ASP B 2 119 ? 44.697 34.523 158.815 1.00 28.17 ? 119 ASP B OD2 1 
ATOM   1981 N N   . GLU B 2 120 ? 48.256 32.709 160.000 1.00 24.95 ? 120 GLU B N   1 
ATOM   1982 C CA  . GLU B 2 120 ? 49.426 32.316 159.195 1.00 26.68 ? 120 GLU B CA  1 
ATOM   1983 C C   . GLU B 2 120 ? 49.024 31.822 157.804 1.00 27.45 ? 120 GLU B C   1 
ATOM   1984 O O   . GLU B 2 120 ? 47.950 31.224 157.618 1.00 27.10 ? 120 GLU B O   1 
ATOM   1985 C CB  . GLU B 2 120 ? 50.300 31.229 159.829 1.00 26.60 ? 120 GLU B CB  1 
ATOM   1986 C CG  . GLU B 2 120 ? 51.448 30.789 158.933 1.00 32.76 ? 120 GLU B CG  1 
ATOM   1987 C CD  . GLU B 2 120 ? 52.415 29.790 159.516 1.00 38.11 ? 120 GLU B CD  1 
ATOM   1988 O OE1 . GLU B 2 120 ? 52.195 29.294 160.654 1.00 39.01 ? 120 GLU B OE1 1 
ATOM   1989 O OE2 . GLU B 2 120 ? 53.430 29.512 158.834 1.00 39.41 ? 120 GLU B OE2 1 
ATOM   1990 N N   . LYS B 2 121 ? 49.847 32.071 156.788 1.00 27.36 ? 121 LYS B N   1 
ATOM   1991 C CA  . LYS B 2 121 ? 49.555 31.550 155.455 1.00 30.42 ? 121 LYS B CA  1 
ATOM   1992 C C   . LYS B 2 121 ? 50.891 31.210 154.770 1.00 29.36 ? 121 LYS B C   1 
ATOM   1993 O O   . LYS B 2 121 ? 51.801 32.019 154.953 1.00 24.80 ? 121 LYS B O   1 
ATOM   1994 C CB  . LYS B 2 121 ? 48.928 32.505 154.484 1.00 34.22 ? 121 LYS B CB  1 
ATOM   1995 C CG  . LYS B 2 121 ? 47.606 33.178 154.525 1.00 39.62 ? 121 LYS B CG  1 
ATOM   1996 C CD  . LYS B 2 121 ? 47.703 34.397 153.602 1.00 44.35 ? 121 LYS B CD  1 
ATOM   1997 C CE  . LYS B 2 121 ? 46.910 34.198 152.317 1.00 47.69 ? 121 LYS B CE  1 
ATOM   1998 N NZ  . LYS B 2 121 ? 47.568 33.295 151.332 1.00 50.07 ? 121 LYS B NZ  1 
ATOM   1999 N N   . CYS B 2 122 ? 50.852 30.195 153.905 1.00 25.57 ? 122 CYS B N   1 
ATOM   2000 C CA  . CYS B 2 122 ? 52.027 29.868 153.114 1.00 25.52 ? 122 CYS B CA  1 
ATOM   2001 C C   . CYS B 2 122 ? 51.592 29.741 151.643 1.00 25.57 ? 122 CYS B C   1 
ATOM   2002 O O   . CYS B 2 122 ? 50.475 29.297 151.364 1.00 24.33 ? 122 CYS B O   1 
ATOM   2003 C CB  . CYS B 2 122 ? 52.740 28.627 153.633 1.00 29.89 ? 122 CYS B CB  1 
ATOM   2004 S SG  . CYS B 2 122 ? 53.487 28.769 155.255 1.00 35.21 ? 122 CYS B SG  1 
ATOM   2005 N N   . PHE B 2 123 ? 52.390 30.213 150.689 1.00 22.34 ? 123 PHE B N   1 
ATOM   2006 C CA  . PHE B 2 123 ? 52.009 30.179 149.274 1.00 22.13 ? 123 PHE B CA  1 
ATOM   2007 C C   . PHE B 2 123 ? 53.246 30.353 148.393 1.00 19.56 ? 123 PHE B C   1 
ATOM   2008 O O   . PHE B 2 123 ? 54.312 30.711 148.864 1.00 18.57 ? 123 PHE B O   1 
ATOM   2009 C CB  . PHE B 2 123 ? 50.976 31.298 148.902 1.00 21.58 ? 123 PHE B CB  1 
ATOM   2010 C CG  . PHE B 2 123 ? 51.540 32.654 149.327 1.00 23.08 ? 123 PHE B CG  1 
ATOM   2011 C CD1 . PHE B 2 123 ? 52.343 33.405 148.483 1.00 22.23 ? 123 PHE B CD1 1 
ATOM   2012 C CD2 . PHE B 2 123 ? 51.252 33.130 150.603 1.00 23.69 ? 123 PHE B CD2 1 
ATOM   2013 C CE1 . PHE B 2 123 ? 52.873 34.621 148.955 1.00 24.08 ? 123 PHE B CE1 1 
ATOM   2014 C CE2 . PHE B 2 123 ? 51.766 34.296 151.099 1.00 22.76 ? 123 PHE B CE2 1 
ATOM   2015 C CZ  . PHE B 2 123 ? 52.569 35.051 150.250 1.00 24.37 ? 123 PHE B CZ  1 
ATOM   2016 N N   . SER B 2 124 ? 53.110 30.070 147.098 1.00 16.29 ? 124 SER B N   1 
ATOM   2017 C CA  . SER B 2 124 ? 54.094 30.402 146.114 1.00 19.82 ? 124 SER B CA  1 
ATOM   2018 C C   . SER B 2 124 ? 53.512 31.513 145.239 1.00 16.53 ? 124 SER B C   1 
ATOM   2019 O O   . SER B 2 124 ? 52.296 31.542 145.151 1.00 14.95 ? 124 SER B O   1 
ATOM   2020 C CB  . SER B 2 124 ? 54.459 29.207 145.194 1.00 22.56 ? 124 SER B CB  1 
ATOM   2021 O OG  . SER B 2 124 ? 55.078 28.337 146.195 1.00 32.35 ? 124 SER B OG  1 
ATOM   2022 N N   . VAL B 2 125 ? 54.338 32.323 144.602 1.00 16.80 ? 125 VAL B N   1 
ATOM   2023 C CA  . VAL B 2 125 ? 53.767 33.394 143.777 1.00 16.18 ? 125 VAL B CA  1 
ATOM   2024 C C   . VAL B 2 125 ? 52.818 32.904 142.717 1.00 16.60 ? 125 VAL B C   1 
ATOM   2025 O O   . VAL B 2 125 ? 51.766 33.523 142.473 1.00 17.59 ? 125 VAL B O   1 
ATOM   2026 C CB  . VAL B 2 125 ? 54.960 34.201 143.164 1.00 18.63 ? 125 VAL B CB  1 
ATOM   2027 C CG1 . VAL B 2 125 ? 54.521 35.200 142.109 1.00 21.56 ? 125 VAL B CG1 1 
ATOM   2028 C CG2 . VAL B 2 125 ? 55.759 34.935 144.237 1.00 17.26 ? 125 VAL B CG2 1 
ATOM   2029 N N   . ASP B 2 126 ? 53.097 31.846 141.965 1.00 17.48 ? 126 ASP B N   1 
ATOM   2030 C CA  . ASP B 2 126 ? 52.182 31.388 140.907 1.00 21.13 ? 126 ASP B CA  1 
ATOM   2031 C C   . ASP B 2 126 ? 50.840 30.933 141.449 1.00 23.56 ? 126 ASP B C   1 
ATOM   2032 O O   . ASP B 2 126 ? 49.811 31.130 140.756 1.00 24.61 ? 126 ASP B O   1 
ATOM   2033 C CB  . ASP B 2 126 ? 52.867 30.308 140.031 1.00 25.02 ? 126 ASP B CB  1 
ATOM   2034 C CG  . ASP B 2 126 ? 53.754 30.976 138.968 1.00 28.69 ? 126 ASP B CG  1 
ATOM   2035 O OD1 . ASP B 2 126 ? 53.342 31.997 138.363 1.00 32.56 ? 126 ASP B OD1 1 
ATOM   2036 O OD2 . ASP B 2 126 ? 54.894 30.557 138.659 1.00 29.37 ? 126 ASP B OD2 1 
ATOM   2037 N N   . GLU B 2 127 ? 50.713 30.509 142.712 1.00 19.23 ? 127 GLU B N   1 
ATOM   2038 C CA  . GLU B 2 127 ? 49.404 30.168 143.250 1.00 20.55 ? 127 GLU B CA  1 
ATOM   2039 C C   . GLU B 2 127 ? 48.587 31.434 143.497 1.00 19.79 ? 127 GLU B C   1 
ATOM   2040 O O   . GLU B 2 127 ? 47.377 31.373 143.626 1.00 19.46 ? 127 GLU B O   1 
ATOM   2041 C CB  . GLU B 2 127 ? 49.458 29.359 144.554 1.00 20.52 ? 127 GLU B CB  1 
ATOM   2042 C CG  . GLU B 2 127 ? 50.233 28.050 144.459 1.00 25.04 ? 127 GLU B CG  1 
ATOM   2043 C CD  . GLU B 2 127 ? 50.526 27.395 145.823 1.00 25.81 ? 127 GLU B CD  1 
ATOM   2044 O OE1 . GLU B 2 127 ? 50.988 28.028 146.783 1.00 24.47 ? 127 GLU B OE1 1 
ATOM   2045 O OE2 . GLU B 2 127 ? 50.271 26.182 145.950 1.00 25.93 ? 127 GLU B OE2 1 
ATOM   2046 N N   . ILE B 2 128 ? 49.191 32.611 143.634 1.00 16.68 ? 128 ILE B N   1 
ATOM   2047 C CA  . ILE B 2 128 ? 48.397 33.800 143.951 1.00 15.73 ? 128 ILE B CA  1 
ATOM   2048 C C   . ILE B 2 128 ? 48.288 34.795 142.780 1.00 15.56 ? 128 ILE B C   1 
ATOM   2049 O O   . ILE B 2 128 ? 47.841 35.936 142.984 1.00 15.44 ? 128 ILE B O   1 
ATOM   2050 C CB  . ILE B 2 128 ? 48.942 34.466 145.226 1.00 15.99 ? 128 ILE B CB  1 
ATOM   2051 C CG1 . ILE B 2 128 ? 50.351 35.007 144.974 1.00 15.86 ? 128 ILE B CG1 1 
ATOM   2052 C CG2 . ILE B 2 128 ? 48.909 33.515 146.442 1.00 17.88 ? 128 ILE B CG2 1 
ATOM   2053 C CD1 . ILE B 2 128 ? 50.736 36.001 146.118 1.00 14.61 ? 128 ILE B CD1 1 
ATOM   2054 N N   . VAL B 2 129 ? 48.699 34.443 141.593 1.00 12.82 ? 129 VAL B N   1 
ATOM   2055 C CA  . VAL B 2 129 ? 48.574 35.350 140.422 1.00 16.37 ? 129 VAL B CA  1 
ATOM   2056 C C   . VAL B 2 129 ? 47.123 35.551 140.061 1.00 17.34 ? 129 VAL B C   1 
ATOM   2057 O O   . VAL B 2 129 ? 46.328 34.607 140.009 1.00 16.80 ? 129 VAL B O   1 
ATOM   2058 C CB  . VAL B 2 129 ? 49.368 34.801 139.204 1.00 17.18 ? 129 VAL B CB  1 
ATOM   2059 C CG1 . VAL B 2 129 ? 49.114 35.567 137.913 1.00 18.80 ? 129 VAL B CG1 1 
ATOM   2060 C CG2 . VAL B 2 129 ? 50.870 34.878 139.511 1.00 16.10 ? 129 VAL B CG2 1 
ATOM   2061 N N   . GLN B 2 130 ? 46.683 36.793 139.907 1.00 18.07 ? 130 GLN B N   1 
ATOM   2062 C CA  . GLN B 2 130 ? 45.300 37.098 139.569 1.00 22.18 ? 130 GLN B CA  1 
ATOM   2063 C C   . GLN B 2 130 ? 45.430 38.389 138.764 1.00 21.51 ? 130 GLN B C   1 
ATOM   2064 O O   . GLN B 2 130 ? 45.592 39.452 139.367 1.00 20.45 ? 130 GLN B O   1 
ATOM   2065 C CB  . GLN B 2 130 ? 44.385 37.448 140.746 1.00 23.13 ? 130 GLN B CB  1 
ATOM   2066 C CG  . GLN B 2 130 ? 43.665 36.321 141.417 1.00 31.55 ? 130 GLN B CG  1 
ATOM   2067 C CD  . GLN B 2 130 ? 42.854 36.769 142.631 1.00 34.67 ? 130 GLN B CD  1 
ATOM   2068 O OE1 . GLN B 2 130 ? 41.711 37.216 142.506 1.00 36.91 ? 130 GLN B OE1 1 
ATOM   2069 N NE2 . GLN B 2 130 ? 43.440 36.670 143.807 1.00 35.87 ? 130 GLN B NE2 1 
ATOM   2070 N N   . PRO B 2 131 ? 45.431 38.272 137.458 1.00 20.18 ? 131 PRO B N   1 
ATOM   2071 C CA  . PRO B 2 131 ? 45.699 39.410 136.608 1.00 19.16 ? 131 PRO B CA  1 
ATOM   2072 C C   . PRO B 2 131 ? 44.699 40.531 136.658 1.00 17.95 ? 131 PRO B C   1 
ATOM   2073 O O   . PRO B 2 131 ? 43.547 40.322 136.984 1.00 16.60 ? 131 PRO B O   1 
ATOM   2074 C CB  . PRO B 2 131 ? 45.826 38.810 135.183 1.00 21.72 ? 131 PRO B CB  1 
ATOM   2075 C CG  . PRO B 2 131 ? 46.184 37.380 135.441 1.00 20.43 ? 131 PRO B CG  1 
ATOM   2076 C CD  . PRO B 2 131 ? 45.310 37.010 136.668 1.00 21.62 ? 131 PRO B CD  1 
ATOM   2077 N N   . ASP B 2 132 ? 45.163 41.766 136.431 1.00 18.11 ? 132 ASP B N   1 
ATOM   2078 C CA  . ASP B 2 132 ? 44.317 42.926 136.258 1.00 18.63 ? 132 ASP B CA  1 
ATOM   2079 C C   . ASP B 2 132 ? 43.462 42.661 135.018 1.00 18.63 ? 132 ASP B C   1 
ATOM   2080 O O   . ASP B 2 132 ? 43.767 41.861 134.117 1.00 16.46 ? 132 ASP B O   1 
ATOM   2081 C CB  . ASP B 2 132 ? 45.192 44.188 136.098 1.00 23.51 ? 132 ASP B CB  1 
ATOM   2082 C CG  . ASP B 2 132 ? 45.783 44.585 137.451 1.00 28.91 ? 132 ASP B CG  1 
ATOM   2083 O OD1 . ASP B 2 132 ? 45.135 44.289 138.496 1.00 30.08 ? 132 ASP B OD1 1 
ATOM   2084 O OD2 . ASP B 2 132 ? 46.893 45.135 137.535 1.00 30.40 ? 132 ASP B OD2 1 
ATOM   2085 N N   . PRO B 2 133 ? 42.352 43.356 134.909 1.00 20.57 ? 133 PRO B N   1 
ATOM   2086 C CA  . PRO B 2 133 ? 41.484 43.149 133.745 1.00 20.05 ? 133 PRO B CA  1 
ATOM   2087 C C   . PRO B 2 133 ? 41.954 43.800 132.482 1.00 19.20 ? 133 PRO B C   1 
ATOM   2088 O O   . PRO B 2 133 ? 42.686 44.776 132.577 1.00 18.61 ? 133 PRO B O   1 
ATOM   2089 C CB  . PRO B 2 133 ? 40.206 43.845 134.200 1.00 19.91 ? 133 PRO B CB  1 
ATOM   2090 C CG  . PRO B 2 133 ? 40.689 44.946 135.009 1.00 21.58 ? 133 PRO B CG  1 
ATOM   2091 C CD  . PRO B 2 133 ? 41.830 44.353 135.876 1.00 19.53 ? 133 PRO B CD  1 
ATOM   2092 N N   . PRO B 2 134 ? 41.477 43.280 131.361 1.00 19.14 ? 134 PRO B N   1 
ATOM   2093 C CA  . PRO B 2 134 ? 41.662 43.874 130.057 1.00 18.82 ? 134 PRO B CA  1 
ATOM   2094 C C   . PRO B 2 134 ? 40.977 45.250 130.037 1.00 17.92 ? 134 PRO B C   1 
ATOM   2095 O O   . PRO B 2 134 ? 40.099 45.572 130.833 1.00 14.85 ? 134 PRO B O   1 
ATOM   2096 C CB  . PRO B 2 134 ? 40.997 42.931 129.075 1.00 20.04 ? 134 PRO B CB  1 
ATOM   2097 C CG  . PRO B 2 134 ? 40.113 42.021 129.860 1.00 17.60 ? 134 PRO B CG  1 
ATOM   2098 C CD  . PRO B 2 134 ? 40.569 42.107 131.286 1.00 20.21 ? 134 PRO B CD  1 
ATOM   2099 N N   . ILE B 2 135 ? 41.515 46.104 129.186 1.00 18.88 ? 135 ILE B N   1 
ATOM   2100 C CA  . ILE B 2 135 ? 41.091 47.504 129.054 1.00 19.89 ? 135 ILE B CA  1 
ATOM   2101 C C   . ILE B 2 135 ? 40.820 47.780 127.562 1.00 19.67 ? 135 ILE B C   1 
ATOM   2102 O O   . ILE B 2 135 ? 40.885 46.865 126.715 1.00 15.19 ? 135 ILE B O   1 
ATOM   2103 C CB  . ILE B 2 135 ? 42.232 48.457 129.524 1.00 19.65 ? 135 ILE B CB  1 
ATOM   2104 C CG1 . ILE B 2 135 ? 43.485 48.079 128.720 1.00 21.58 ? 135 ILE B CG1 1 
ATOM   2105 C CG2 . ILE B 2 135 ? 42.518 48.246 131.014 1.00 20.90 ? 135 ILE B CG2 1 
ATOM   2106 C CD1 . ILE B 2 135 ? 44.616 49.097 128.725 1.00 25.25 ? 135 ILE B CD1 1 
ATOM   2107 N N   . ALA B 2 136 ? 40.308 48.993 127.326 1.00 17.48 ? 136 ALA B N   1 
ATOM   2108 C CA  . ALA B 2 136 ? 39.958 49.447 125.990 1.00 15.65 ? 136 ALA B CA  1 
ATOM   2109 C C   . ALA B 2 136 ? 39.022 48.533 125.219 1.00 15.61 ? 136 ALA B C   1 
ATOM   2110 O O   . ALA B 2 136 ? 39.296 48.199 124.057 1.00 16.14 ? 136 ALA B O   1 
ATOM   2111 C CB  . ALA B 2 136 ? 41.272 49.608 125.175 1.00 17.13 ? 136 ALA B CB  1 
ATOM   2112 N N   . LEU B 2 137 ? 37.938 48.082 125.804 1.00 15.95 ? 137 LEU B N   1 
ATOM   2113 C CA  . LEU B 2 137 ? 36.916 47.281 125.189 1.00 16.35 ? 137 LEU B CA  1 
ATOM   2114 C C   . LEU B 2 137 ? 36.229 48.076 124.081 1.00 15.55 ? 137 LEU B C   1 
ATOM   2115 O O   . LEU B 2 137 ? 35.901 49.241 124.334 1.00 13.40 ? 137 LEU B O   1 
ATOM   2116 C CB  . LEU B 2 137 ? 35.862 46.892 126.259 1.00 16.77 ? 137 LEU B CB  1 
ATOM   2117 C CG  . LEU B 2 137 ? 36.098 45.547 126.953 1.00 17.89 ? 137 LEU B CG  1 
ATOM   2118 C CD1 . LEU B 2 137 ? 37.335 45.668 127.861 1.00 18.05 ? 137 LEU B CD1 1 
ATOM   2119 C CD2 . LEU B 2 137 ? 34.919 44.968 127.726 1.00 16.19 ? 137 LEU B CD2 1 
ATOM   2120 N N   . ASN B 2 138 ? 35.949 47.469 122.926 1.00 12.84 ? 138 ASN B N   1 
ATOM   2121 C CA  . ASN B 2 138 ? 35.195 48.152 121.883 1.00 15.69 ? 138 ASN B CA  1 
ATOM   2122 C C   . ASN B 2 138 ? 34.440 47.085 121.070 1.00 15.74 ? 138 ASN B C   1 
ATOM   2123 O O   . ASN B 2 138 ? 34.864 45.933 121.213 1.00 14.56 ? 138 ASN B O   1 
ATOM   2124 C CB  . ASN B 2 138 ? 36.155 48.822 120.866 1.00 20.04 ? 138 ASN B CB  1 
ATOM   2125 C CG  . ASN B 2 138 ? 36.476 50.256 121.152 1.00 26.72 ? 138 ASN B CG  1 
ATOM   2126 O OD1 . ASN B 2 138 ? 35.619 51.153 121.103 1.00 29.87 ? 138 ASN B OD1 1 
ATOM   2127 N ND2 . ASN B 2 138 ? 37.741 50.535 121.498 1.00 31.86 ? 138 ASN B ND2 1 
ATOM   2128 N N   . TRP B 2 139 ? 33.403 47.418 120.311 1.00 11.04 ? 139 TRP B N   1 
ATOM   2129 C CA  . TRP B 2 139 ? 32.763 46.406 119.488 1.00 15.31 ? 139 TRP B CA  1 
ATOM   2130 C C   . TRP B 2 139 ? 32.580 46.978 118.065 1.00 16.80 ? 139 TRP B C   1 
ATOM   2131 O O   . TRP B 2 139 ? 32.553 48.215 117.994 1.00 18.10 ? 139 TRP B O   1 
ATOM   2132 C CB  . TRP B 2 139 ? 31.377 46.005 120.001 1.00 12.36 ? 139 TRP B CB  1 
ATOM   2133 C CG  . TRP B 2 139 ? 30.363 47.096 120.061 1.00 15.42 ? 139 TRP B CG  1 
ATOM   2134 C CD1 . TRP B 2 139 ? 30.162 48.047 121.061 1.00 19.33 ? 139 TRP B CD1 1 
ATOM   2135 C CD2 . TRP B 2 139 ? 29.359 47.384 119.093 1.00 16.84 ? 139 TRP B CD2 1 
ATOM   2136 N NE1 . TRP B 2 139 ? 29.072 48.854 120.761 1.00 17.29 ? 139 TRP B NE1 1 
ATOM   2137 C CE2 . TRP B 2 139 ? 28.590 48.471 119.541 1.00 16.55 ? 139 TRP B CE2 1 
ATOM   2138 C CE3 . TRP B 2 139 ? 29.043 46.779 117.868 1.00 18.12 ? 139 TRP B CE3 1 
ATOM   2139 C CZ2 . TRP B 2 139 ? 27.494 48.962 118.819 1.00 17.00 ? 139 TRP B CZ2 1 
ATOM   2140 C CZ3 . TRP B 2 139 ? 27.997 47.285 117.128 1.00 20.77 ? 139 TRP B CZ3 1 
ATOM   2141 C CH2 . TRP B 2 139 ? 27.247 48.369 117.625 1.00 20.95 ? 139 TRP B CH2 1 
ATOM   2142 N N   . THR B 2 140 ? 32.307 46.104 117.105 1.00 15.35 ? 140 THR B N   1 
ATOM   2143 C CA  . THR B 2 140 ? 31.892 46.621 115.792 1.00 20.38 ? 140 THR B CA  1 
ATOM   2144 C C   . THR B 2 140 ? 31.042 45.573 115.108 1.00 16.91 ? 140 THR B C   1 
ATOM   2145 O O   . THR B 2 140 ? 31.078 44.412 115.566 1.00 18.16 ? 140 THR B O   1 
ATOM   2146 C CB  . THR B 2 140 ? 33.154 47.033 114.971 1.00 24.51 ? 140 THR B CB  1 
ATOM   2147 O OG1 . THR B 2 140 ? 32.692 47.680 113.807 1.00 24.75 ? 140 THR B OG1 1 
ATOM   2148 C CG2 . THR B 2 140 ? 34.024 45.838 114.627 1.00 21.88 ? 140 THR B CG2 1 
ATOM   2149 N N   . LEU B 2 141 ? 30.192 45.914 114.139 1.00 16.84 ? 141 LEU B N   1 
ATOM   2150 C CA  . LEU B 2 141 ? 29.383 44.935 113.457 1.00 18.05 ? 141 LEU B CA  1 
ATOM   2151 C C   . LEU B 2 141 ? 30.230 43.960 112.639 1.00 16.61 ? 141 LEU B C   1 
ATOM   2152 O O   . LEU B 2 141 ? 31.202 44.317 111.984 1.00 17.97 ? 141 LEU B O   1 
ATOM   2153 C CB  . LEU B 2 141 ? 28.350 45.537 112.502 1.00 21.43 ? 141 LEU B CB  1 
ATOM   2154 C CG  . LEU B 2 141 ? 27.105 46.170 113.100 1.00 25.25 ? 141 LEU B CG  1 
ATOM   2155 C CD1 . LEU B 2 141 ? 26.343 47.037 112.079 1.00 27.52 ? 141 LEU B CD1 1 
ATOM   2156 C CD2 . LEU B 2 141 ? 26.197 45.031 113.605 1.00 23.77 ? 141 LEU B CD2 1 
ATOM   2157 N N   . LEU B 2 142 ? 29.868 42.697 112.694 1.00 17.06 ? 142 LEU B N   1 
ATOM   2158 C CA  . LEU B 2 142 ? 30.549 41.631 111.969 1.00 19.17 ? 142 LEU B CA  1 
ATOM   2159 C C   . LEU B 2 142 ? 29.780 41.244 110.695 1.00 22.52 ? 142 LEU B C   1 
ATOM   2160 O O   . LEU B 2 142 ? 30.365 41.173 109.607 1.00 19.66 ? 142 LEU B O   1 
ATOM   2161 C CB  . LEU B 2 142 ? 30.619 40.412 112.912 1.00 20.37 ? 142 LEU B CB  1 
ATOM   2162 C CG  . LEU B 2 142 ? 31.381 39.189 112.400 1.00 22.70 ? 142 LEU B CG  1 
ATOM   2163 C CD1 . LEU B 2 142 ? 32.852 39.509 112.143 1.00 19.73 ? 142 LEU B CD1 1 
ATOM   2164 C CD2 . LEU B 2 142 ? 31.336 38.057 113.409 1.00 21.37 ? 142 LEU B CD2 1 
ATOM   2165 N N   . ASN B 2 143 ? 28.462 41.041 110.762 1.00 21.64 ? 143 ASN B N   1 
ATOM   2166 C CA  . ASN B 2 143 ? 27.680 40.586 109.614 1.00 27.55 ? 143 ASN B CA  1 
ATOM   2167 C C   . ASN B 2 143 ? 27.358 41.746 108.688 1.00 30.03 ? 143 ASN B C   1 
ATOM   2168 O O   . ASN B 2 143 ? 27.339 42.889 109.145 1.00 26.20 ? 143 ASN B O   1 
ATOM   2169 C CB  . ASN B 2 143 ? 26.456 39.766 110.087 1.00 28.29 ? 143 ASN B CB  1 
ATOM   2170 C CG  . ASN B 2 143 ? 25.387 40.685 110.658 1.00 32.04 ? 143 ASN B CG  1 
ATOM   2171 O OD1 . ASN B 2 143 ? 25.564 41.446 111.617 1.00 28.18 ? 143 ASN B OD1 1 
ATOM   2172 N ND2 . ASN B 2 143 ? 24.220 40.616 109.996 1.00 34.96 ? 143 ASN B ND2 1 
ATOM   2173 N N   . VAL B 2 144 ? 27.079 41.501 107.380 1.00 31.09 ? 144 VAL B N   1 
ATOM   2174 C CA  . VAL B 2 144 ? 26.917 42.607 106.463 1.00 33.50 ? 144 VAL B CA  1 
ATOM   2175 C C   . VAL B 2 144 ? 25.491 42.985 106.071 1.00 36.82 ? 144 VAL B C   1 
ATOM   2176 O O   . VAL B 2 144 ? 25.305 43.937 105.274 1.00 36.76 ? 144 VAL B O   1 
ATOM   2177 C CB  . VAL B 2 144 ? 27.753 42.416 105.167 1.00 35.49 ? 144 VAL B CB  1 
ATOM   2178 C CG1 . VAL B 2 144 ? 29.077 41.708 105.422 1.00 32.57 ? 144 VAL B CG1 1 
ATOM   2179 C CG2 . VAL B 2 144 ? 26.990 41.667 104.091 1.00 35.94 ? 144 VAL B CG2 1 
ATOM   2180 N N   . SER B 2 145 ? 24.474 42.340 106.580 1.00 33.89 ? 145 SER B N   1 
ATOM   2181 C CA  . SER B 2 145 ? 23.081 42.624 106.349 1.00 35.18 ? 145 SER B CA  1 
ATOM   2182 C C   . SER B 2 145 ? 22.568 43.993 106.830 1.00 34.20 ? 145 SER B C   1 
ATOM   2183 O O   . SER B 2 145 ? 22.872 44.503 107.902 1.00 31.36 ? 145 SER B O   1 
ATOM   2184 C CB  . SER B 2 145 ? 22.205 41.612 107.118 1.00 37.10 ? 145 SER B CB  1 
ATOM   2185 O OG  . SER B 2 145 ? 20.852 42.048 107.107 1.00 39.44 ? 145 SER B OG  1 
ATOM   2186 N N   . LEU B 2 146 ? 21.571 44.453 106.076 1.00 31.63 ? 146 LEU B N   1 
ATOM   2187 C CA  . LEU B 2 146 ? 20.907 45.722 106.332 1.00 33.11 ? 146 LEU B CA  1 
ATOM   2188 C C   . LEU B 2 146 ? 19.463 45.518 106.761 1.00 35.05 ? 146 LEU B C   1 
ATOM   2189 O O   . LEU B 2 146 ? 18.842 46.511 107.107 1.00 37.22 ? 146 LEU B O   1 
ATOM   2190 C CB  . LEU B 2 146 ? 20.917 46.573 105.035 1.00 30.81 ? 146 LEU B CB  1 
ATOM   2191 C CG  . LEU B 2 146 ? 22.292 46.979 104.521 1.00 29.18 ? 146 LEU B CG  1 
ATOM   2192 C CD1 . LEU B 2 146 ? 22.152 47.809 103.238 1.00 26.23 ? 146 LEU B CD1 1 
ATOM   2193 C CD2 . LEU B 2 146 ? 23.069 47.741 105.606 1.00 27.67 ? 146 LEU B CD2 1 
ATOM   2194 N N   . THR B 2 147 ? 18.916 44.304 106.784 1.00 34.80 ? 147 THR B N   1 
ATOM   2195 C CA  . THR B 2 147 ? 17.517 44.100 107.139 1.00 35.96 ? 147 THR B CA  1 
ATOM   2196 C C   . THR B 2 147 ? 17.248 43.081 108.250 1.00 36.91 ? 147 THR B C   1 
ATOM   2197 O O   . THR B 2 147 ? 16.085 42.726 108.545 1.00 36.71 ? 147 THR B O   1 
ATOM   2198 C CB  . THR B 2 147 ? 16.789 43.603 105.863 1.00 37.50 ? 147 THR B CB  1 
ATOM   2199 O OG1 . THR B 2 147 ? 17.560 42.498 105.327 1.00 40.00 ? 147 THR B OG1 1 
ATOM   2200 C CG2 . THR B 2 147 ? 16.626 44.655 104.779 1.00 36.43 ? 147 THR B CG2 1 
ATOM   2201 N N   . GLY B 2 148 ? 18.291 42.494 108.851 1.00 33.74 ? 148 GLY B N   1 
ATOM   2202 C CA  . GLY B 2 148 ? 18.010 41.493 109.881 1.00 34.05 ? 148 GLY B CA  1 
ATOM   2203 C C   . GLY B 2 148 ? 17.340 42.059 111.143 1.00 31.93 ? 148 GLY B C   1 
ATOM   2204 O O   . GLY B 2 148 ? 17.439 43.199 111.592 1.00 31.47 ? 148 GLY B O   1 
ATOM   2205 N N   . ILE B 2 149 ? 16.680 41.135 111.834 1.00 27.77 ? 149 ILE B N   1 
ATOM   2206 C CA  . ILE B 2 149 ? 16.097 41.399 113.144 1.00 29.29 ? 149 ILE B CA  1 
ATOM   2207 C C   . ILE B 2 149 ? 17.223 41.112 114.167 1.00 28.03 ? 149 ILE B C   1 
ATOM   2208 O O   . ILE B 2 149 ? 17.107 41.511 115.304 1.00 24.11 ? 149 ILE B O   1 
ATOM   2209 C CB  . ILE B 2 149 ? 14.857 40.535 113.350 1.00 29.01 ? 149 ILE B CB  1 
ATOM   2210 C CG1 . ILE B 2 149 ? 13.686 41.280 112.652 1.00 30.54 ? 149 ILE B CG1 1 
ATOM   2211 C CG2 . ILE B 2 149 ? 14.494 40.226 114.787 1.00 30.21 ? 149 ILE B CG2 1 
ATOM   2212 C CD1 . ILE B 2 149 ? 13.493 40.753 111.243 1.00 33.67 ? 149 ILE B CD1 1 
ATOM   2213 N N   . HIS B 2 150 ? 18.224 40.346 113.736 1.00 25.22 ? 150 HIS B N   1 
ATOM   2214 C CA  . HIS B 2 150 ? 19.377 40.003 114.531 1.00 26.56 ? 150 HIS B CA  1 
ATOM   2215 C C   . HIS B 2 150 ? 20.681 40.542 113.941 1.00 24.80 ? 150 HIS B C   1 
ATOM   2216 O O   . HIS B 2 150 ? 20.716 40.841 112.753 1.00 23.18 ? 150 HIS B O   1 
ATOM   2217 C CB  . HIS B 2 150 ? 19.538 38.494 114.629 1.00 27.62 ? 150 HIS B CB  1 
ATOM   2218 C CG  . HIS B 2 150 ? 18.473 37.776 115.383 1.00 30.20 ? 150 HIS B CG  1 
ATOM   2219 N ND1 . HIS B 2 150 ? 17.416 37.122 114.753 1.00 32.79 ? 150 HIS B ND1 1 
ATOM   2220 C CD2 . HIS B 2 150 ? 18.298 37.553 116.698 1.00 29.96 ? 150 HIS B CD2 1 
ATOM   2221 C CE1 . HIS B 2 150 ? 16.624 36.575 115.657 1.00 30.31 ? 150 HIS B CE1 1 
ATOM   2222 N NE2 . HIS B 2 150 ? 17.161 36.824 116.856 1.00 30.57 ? 150 HIS B NE2 1 
ATOM   2223 N N   . ALA B 2 151 ? 21.740 40.573 114.747 1.00 19.19 ? 151 ALA B N   1 
ATOM   2224 C CA  . ALA B 2 151 ? 23.044 40.985 114.262 1.00 19.97 ? 151 ALA B CA  1 
ATOM   2225 C C   . ALA B 2 151 ? 24.130 40.259 115.038 1.00 19.41 ? 151 ALA B C   1 
ATOM   2226 O O   . ALA B 2 151 ? 23.958 39.870 116.203 1.00 20.01 ? 151 ALA B O   1 
ATOM   2227 C CB  . ALA B 2 151 ? 23.198 42.506 114.375 1.00 19.66 ? 151 ALA B CB  1 
ATOM   2228 N N   . ASP B 2 152 ? 25.265 40.041 114.408 1.00 17.79 ? 152 ASP B N   1 
ATOM   2229 C CA  . ASP B 2 152 ? 26.462 39.517 115.017 1.00 17.89 ? 152 ASP B CA  1 
ATOM   2230 C C   . ASP B 2 152 ? 27.451 40.713 115.144 1.00 16.94 ? 152 ASP B C   1 
ATOM   2231 O O   . ASP B 2 152 ? 27.626 41.557 114.260 1.00 16.33 ? 152 ASP B O   1 
ATOM   2232 C CB  . ASP B 2 152 ? 27.150 38.398 114.252 1.00 21.73 ? 152 ASP B CB  1 
ATOM   2233 C CG  . ASP B 2 152 ? 26.253 37.255 113.829 1.00 26.02 ? 152 ASP B CG  1 
ATOM   2234 O OD1 . ASP B 2 152 ? 25.282 36.915 114.535 1.00 24.72 ? 152 ASP B OD1 1 
ATOM   2235 O OD2 . ASP B 2 152 ? 26.525 36.672 112.744 1.00 27.29 ? 152 ASP B OD2 1 
ATOM   2236 N N   . ILE B 2 153 ? 28.184 40.713 116.235 1.00 14.36 ? 153 ILE B N   1 
ATOM   2237 C CA  . ILE B 2 153 ? 29.222 41.672 116.502 1.00 15.23 ? 153 ILE B CA  1 
ATOM   2238 C C   . ILE B 2 153 ? 30.574 40.996 116.729 1.00 16.56 ? 153 ILE B C   1 
ATOM   2239 O O   . ILE B 2 153 ? 30.709 39.824 117.007 1.00 17.76 ? 153 ILE B O   1 
ATOM   2240 C CB  . ILE B 2 153 ? 28.893 42.545 117.738 1.00 15.55 ? 153 ILE B CB  1 
ATOM   2241 C CG1 . ILE B 2 153 ? 28.763 41.748 119.041 1.00 13.08 ? 153 ILE B CG1 1 
ATOM   2242 C CG2 . ILE B 2 153 ? 27.637 43.408 117.445 1.00 13.93 ? 153 ILE B CG2 1 
ATOM   2243 C CD1 . ILE B 2 153 ? 28.635 42.695 120.280 1.00 11.85 ? 153 ILE B CD1 1 
ATOM   2244 N N   . GLN B 2 154 ? 31.663 41.766 116.757 1.00 16.53 ? 154 GLN B N   1 
ATOM   2245 C CA  . GLN B 2 154 ? 32.965 41.336 117.185 1.00 15.51 ? 154 GLN B CA  1 
ATOM   2246 C C   . GLN B 2 154 ? 33.404 42.298 118.319 1.00 15.52 ? 154 GLN B C   1 
ATOM   2247 O O   . GLN B 2 154 ? 33.373 43.531 118.142 1.00 14.20 ? 154 GLN B O   1 
ATOM   2248 C CB  . GLN B 2 154 ? 33.997 41.342 116.035 1.00 17.35 ? 154 GLN B CB  1 
ATOM   2249 C CG  . GLN B 2 154 ? 35.368 40.863 116.580 1.00 20.91 ? 154 GLN B CG  1 
ATOM   2250 C CD  . GLN B 2 154 ? 35.981 39.983 115.484 1.00 28.79 ? 154 GLN B CD  1 
ATOM   2251 O OE1 . GLN B 2 154 ? 35.634 38.790 115.365 1.00 31.36 ? 154 GLN B OE1 1 
ATOM   2252 N NE2 . GLN B 2 154 ? 36.833 40.537 114.638 1.00 22.07 ? 154 GLN B NE2 1 
ATOM   2253 N N   . VAL B 2 155 ? 33.811 41.758 119.431 1.00 12.38 ? 155 VAL B N   1 
ATOM   2254 C CA  . VAL B 2 155 ? 34.284 42.522 120.586 1.00 13.43 ? 155 VAL B CA  1 
ATOM   2255 C C   . VAL B 2 155 ? 35.808 42.383 120.682 1.00 15.66 ? 155 VAL B C   1 
ATOM   2256 O O   . VAL B 2 155 ? 36.327 41.280 120.445 1.00 13.77 ? 155 VAL B O   1 
ATOM   2257 C CB  . VAL B 2 155 ? 33.661 41.959 121.888 1.00 12.36 ? 155 VAL B CB  1 
ATOM   2258 C CG1 . VAL B 2 155 ? 34.115 42.629 123.168 1.00 10.24 ? 155 VAL B CG1 1 
ATOM   2259 C CG2 . VAL B 2 155 ? 32.131 42.153 121.788 1.00 12.82 ? 155 VAL B CG2 1 
ATOM   2260 N N   . ARG B 2 156 ? 36.511 43.459 121.028 1.00 9.53  ? 156 ARG B N   1 
ATOM   2261 C CA  . ARG B 2 156 ? 37.960 43.408 121.140 1.00 16.51 ? 156 ARG B CA  1 
ATOM   2262 C C   . ARG B 2 156 ? 38.477 44.191 122.350 1.00 12.78 ? 156 ARG B C   1 
ATOM   2263 O O   . ARG B 2 156 ? 37.773 45.070 122.871 1.00 12.65 ? 156 ARG B O   1 
ATOM   2264 C CB  . ARG B 2 156 ? 38.673 43.911 119.836 1.00 14.56 ? 156 ARG B CB  1 
ATOM   2265 C CG  . ARG B 2 156 ? 38.511 45.401 119.679 1.00 22.24 ? 156 ARG B CG  1 
ATOM   2266 C CD  . ARG B 2 156 ? 39.009 45.945 118.308 1.00 26.76 ? 156 ARG B CD  1 
ATOM   2267 N NE  . ARG B 2 156 ? 38.990 47.412 118.291 1.00 29.48 ? 156 ARG B NE  1 
ATOM   2268 C CZ  . ARG B 2 156 ? 37.897 48.079 117.860 1.00 35.02 ? 156 ARG B CZ  1 
ATOM   2269 N NH1 . ARG B 2 156 ? 36.802 47.440 117.420 1.00 31.85 ? 156 ARG B NH1 1 
ATOM   2270 N NH2 . ARG B 2 156 ? 37.922 49.423 117.837 1.00 34.53 ? 156 ARG B NH2 1 
ATOM   2271 N N   . TRP B 2 157 ? 39.673 43.814 122.791 1.00 14.13 ? 157 TRP B N   1 
ATOM   2272 C CA  . TRP B 2 157 ? 40.246 44.453 123.964 1.00 15.59 ? 157 TRP B CA  1 
ATOM   2273 C C   . TRP B 2 157 ? 41.751 44.409 123.918 1.00 18.37 ? 157 TRP B C   1 
ATOM   2274 O O   . TRP B 2 157 ? 42.408 43.859 123.035 1.00 15.95 ? 157 TRP B O   1 
ATOM   2275 C CB  . TRP B 2 157 ? 39.737 43.811 125.273 1.00 15.80 ? 157 TRP B CB  1 
ATOM   2276 C CG  . TRP B 2 157 ? 39.955 42.328 125.354 1.00 14.74 ? 157 TRP B CG  1 
ATOM   2277 C CD1 . TRP B 2 157 ? 41.053 41.662 125.829 1.00 15.76 ? 157 TRP B CD1 1 
ATOM   2278 C CD2 . TRP B 2 157 ? 39.037 41.330 124.899 1.00 13.92 ? 157 TRP B CD2 1 
ATOM   2279 N NE1 . TRP B 2 157 ? 40.866 40.307 125.745 1.00 14.73 ? 157 TRP B NE1 1 
ATOM   2280 C CE2 . TRP B 2 157 ? 39.630 40.079 125.153 1.00 15.52 ? 157 TRP B CE2 1 
ATOM   2281 C CE3 . TRP B 2 157 ? 37.781 41.382 124.288 1.00 13.75 ? 157 TRP B CE3 1 
ATOM   2282 C CZ2 . TRP B 2 157 ? 39.009 38.885 124.796 1.00 14.52 ? 157 TRP B CZ2 1 
ATOM   2283 C CZ3 . TRP B 2 157 ? 37.143 40.200 123.934 1.00 15.57 ? 157 TRP B CZ3 1 
ATOM   2284 C CH2 . TRP B 2 157 ? 37.752 38.950 124.193 1.00 14.73 ? 157 TRP B CH2 1 
ATOM   2285 N N   . GLU B 2 158 ? 42.318 44.978 124.990 1.00 20.83 ? 158 GLU B N   1 
ATOM   2286 C CA  . GLU B 2 158 ? 43.792 44.895 125.126 1.00 23.75 ? 158 GLU B CA  1 
ATOM   2287 C C   . GLU B 2 158 ? 44.135 44.208 126.441 1.00 20.58 ? 158 GLU B C   1 
ATOM   2288 O O   . GLU B 2 158 ? 43.353 44.306 127.376 1.00 19.66 ? 158 GLU B O   1 
ATOM   2289 C CB  . GLU B 2 158 ? 44.370 46.294 124.999 1.00 25.42 ? 158 GLU B CB  1 
ATOM   2290 C CG  . GLU B 2 158 ? 44.479 46.882 123.616 1.00 32.44 ? 158 GLU B CG  1 
ATOM   2291 C CD  . GLU B 2 158 ? 44.789 48.361 123.678 1.00 36.58 ? 158 GLU B CD  1 
ATOM   2292 O OE1 . GLU B 2 158 ? 45.428 48.817 124.652 1.00 39.76 ? 158 GLU B OE1 1 
ATOM   2293 O OE2 . GLU B 2 158 ? 44.375 49.112 122.773 1.00 40.21 ? 158 GLU B OE2 1 
ATOM   2294 N N   . ALA B 2 159 ? 45.274 43.557 126.572 1.00 18.28 ? 159 ALA B N   1 
ATOM   2295 C CA  . ALA B 2 159 ? 45.708 42.953 127.827 1.00 18.09 ? 159 ALA B CA  1 
ATOM   2296 C C   . ALA B 2 159 ? 46.012 44.107 128.828 1.00 17.67 ? 159 ALA B C   1 
ATOM   2297 O O   . ALA B 2 159 ? 46.393 45.185 128.378 1.00 16.38 ? 159 ALA B O   1 
ATOM   2298 C CB  . ALA B 2 159 ? 47.019 42.212 127.558 1.00 17.25 ? 159 ALA B CB  1 
ATOM   2299 N N   . PRO B 2 160 ? 45.938 43.828 130.100 1.00 18.05 ? 160 PRO B N   1 
ATOM   2300 C CA  . PRO B 2 160 ? 46.286 44.781 131.164 1.00 20.14 ? 160 PRO B CA  1 
ATOM   2301 C C   . PRO B 2 160 ? 47.700 45.297 130.884 1.00 20.42 ? 160 PRO B C   1 
ATOM   2302 O O   . PRO B 2 160 ? 48.522 44.469 130.491 1.00 19.20 ? 160 PRO B O   1 
ATOM   2303 C CB  . PRO B 2 160 ? 46.192 44.000 132.489 1.00 17.73 ? 160 PRO B CB  1 
ATOM   2304 C CG  . PRO B 2 160 ? 46.237 42.550 132.036 1.00 19.67 ? 160 PRO B CG  1 
ATOM   2305 C CD  . PRO B 2 160 ? 45.543 42.517 130.686 1.00 16.45 ? 160 PRO B CD  1 
ATOM   2306 N N   . ARG B 2 161 ? 47.983 46.581 131.101 1.00 19.32 ? 161 ARG B N   1 
ATOM   2307 C CA  . ARG B 2 161 ? 49.287 47.132 130.727 1.00 23.32 ? 161 ARG B CA  1 
ATOM   2308 C C   . ARG B 2 161 ? 50.444 46.571 131.550 1.00 22.27 ? 161 ARG B C   1 
ATOM   2309 O O   . ARG B 2 161 ? 51.532 46.639 130.977 1.00 18.22 ? 161 ARG B O   1 
ATOM   2310 C CB  . ARG B 2 161 ? 49.409 48.658 130.851 1.00 29.14 ? 161 ARG B CB  1 
ATOM   2311 C CG  . ARG B 2 161 ? 48.350 49.505 130.133 1.00 36.95 ? 161 ARG B CG  1 
ATOM   2312 C CD  . ARG B 2 161 ? 48.743 50.004 128.763 1.00 41.27 ? 161 ARG B CD  1 
ATOM   2313 N NE  . ARG B 2 161 ? 47.661 50.548 127.933 1.00 47.42 ? 161 ARG B NE  1 
ATOM   2314 C CZ  . ARG B 2 161 ? 47.139 50.047 126.801 1.00 48.74 ? 161 ARG B CZ  1 
ATOM   2315 N NH1 . ARG B 2 161 ? 47.502 48.911 126.208 1.00 46.27 ? 161 ARG B NH1 1 
ATOM   2316 N NH2 . ARG B 2 161 ? 46.137 50.714 126.184 1.00 51.72 ? 161 ARG B NH2 1 
ATOM   2317 N N   . ASN B 2 162 ? 50.257 46.174 132.804 1.00 17.50 ? 162 ASN B N   1 
ATOM   2318 C CA  . ASN B 2 162 ? 51.429 45.687 133.573 1.00 21.69 ? 162 ASN B CA  1 
ATOM   2319 C C   . ASN B 2 162 ? 51.826 44.245 133.277 1.00 22.26 ? 162 ASN B C   1 
ATOM   2320 O O   . ASN B 2 162 ? 52.805 43.743 133.851 1.00 22.52 ? 162 ASN B O   1 
ATOM   2321 C CB  . ASN B 2 162 ? 51.127 45.888 135.076 1.00 19.19 ? 162 ASN B CB  1 
ATOM   2322 C CG  . ASN B 2 162 ? 49.878 45.154 135.517 1.00 21.21 ? 162 ASN B CG  1 
ATOM   2323 O OD1 . ASN B 2 162 ? 49.186 44.482 134.717 1.00 20.22 ? 162 ASN B OD1 1 
ATOM   2324 N ND2 . ASN B 2 162 ? 49.497 45.239 136.784 1.00 19.52 ? 162 ASN B ND2 1 
ATOM   2325 N N   . ALA B 2 163 ? 51.191 43.517 132.361 1.00 19.46 ? 163 ALA B N   1 
ATOM   2326 C CA  . ALA B 2 163 ? 51.509 42.099 132.153 1.00 19.73 ? 163 ALA B CA  1 
ATOM   2327 C C   . ALA B 2 163 ? 52.560 41.924 131.066 1.00 21.24 ? 163 ALA B C   1 
ATOM   2328 O O   . ALA B 2 163 ? 52.332 42.471 129.978 1.00 21.14 ? 163 ALA B O   1 
ATOM   2329 C CB  . ALA B 2 163 ? 50.248 41.312 131.766 1.00 13.41 ? 163 ALA B CB  1 
ATOM   2330 N N   . ASP B 2 164 ? 53.589 41.094 131.259 1.00 21.04 ? 164 ASP B N   1 
ATOM   2331 C CA  . ASP B 2 164 ? 54.562 41.010 130.163 1.00 21.68 ? 164 ASP B CA  1 
ATOM   2332 C C   . ASP B 2 164 ? 54.233 39.818 129.275 1.00 20.35 ? 164 ASP B C   1 
ATOM   2333 O O   . ASP B 2 164 ? 54.837 38.759 129.366 1.00 20.63 ? 164 ASP B O   1 
ATOM   2334 C CB  . ASP B 2 164 ? 56.033 41.042 130.583 1.00 23.16 ? 164 ASP B CB  1 
ATOM   2335 C CG  . ASP B 2 164 ? 56.928 40.608 129.413 1.00 26.94 ? 164 ASP B CG  1 
ATOM   2336 O OD1 . ASP B 2 164 ? 56.740 41.062 128.244 1.00 25.56 ? 164 ASP B OD1 1 
ATOM   2337 O OD2 . ASP B 2 164 ? 57.757 39.690 129.637 1.00 24.21 ? 164 ASP B OD2 1 
ATOM   2338 N N   . ILE B 2 165 ? 53.346 40.068 128.319 1.00 18.53 ? 165 ILE B N   1 
ATOM   2339 C CA  . ILE B 2 165 ? 52.989 39.107 127.302 1.00 22.16 ? 165 ILE B CA  1 
ATOM   2340 C C   . ILE B 2 165 ? 54.015 39.066 126.178 1.00 22.74 ? 165 ILE B C   1 
ATOM   2341 O O   . ILE B 2 165 ? 54.461 37.978 125.777 1.00 22.08 ? 165 ILE B O   1 
ATOM   2342 C CB  . ILE B 2 165 ? 51.551 39.415 126.840 1.00 22.31 ? 165 ILE B CB  1 
ATOM   2343 C CG1 . ILE B 2 165 ? 50.627 39.032 128.038 1.00 26.24 ? 165 ILE B CG1 1 
ATOM   2344 C CG2 . ILE B 2 165 ? 51.062 38.607 125.639 1.00 22.83 ? 165 ILE B CG2 1 
ATOM   2345 C CD1 . ILE B 2 165 ? 49.358 39.847 127.857 1.00 28.13 ? 165 ILE B CD1 1 
ATOM   2346 N N   . GLN B 2 166 ? 54.442 40.213 125.675 1.00 21.11 ? 166 GLN B N   1 
ATOM   2347 C CA  . GLN B 2 166 ? 55.341 40.293 124.529 1.00 24.06 ? 166 GLN B CA  1 
ATOM   2348 C C   . GLN B 2 166 ? 56.689 39.608 124.672 1.00 25.20 ? 166 GLN B C   1 
ATOM   2349 O O   . GLN B 2 166 ? 57.164 39.108 123.665 1.00 23.65 ? 166 GLN B O   1 
ATOM   2350 C CB  . GLN B 2 166 ? 55.558 41.751 124.143 1.00 24.25 ? 166 GLN B CB  1 
ATOM   2351 N N   . LYS B 2 167 ? 57.260 39.448 125.864 1.00 24.24 ? 167 LYS B N   1 
ATOM   2352 C CA  . LYS B 2 167 ? 58.510 38.750 126.045 1.00 22.04 ? 167 LYS B CA  1 
ATOM   2353 C C   . LYS B 2 167 ? 58.356 37.435 126.790 1.00 21.39 ? 167 LYS B C   1 
ATOM   2354 O O   . LYS B 2 167 ? 59.354 36.795 127.135 1.00 18.43 ? 167 LYS B O   1 
ATOM   2355 C CB  . LYS B 2 167 ? 59.520 39.675 126.752 1.00 25.79 ? 167 LYS B CB  1 
ATOM   2356 C CG  . LYS B 2 167 ? 60.172 40.624 125.704 1.00 30.92 ? 167 LYS B CG  1 
ATOM   2357 C CD  . LYS B 2 167 ? 61.095 41.591 126.447 1.00 35.01 ? 167 LYS B CD  1 
ATOM   2358 C CE  . LYS B 2 167 ? 61.415 42.808 125.579 1.00 38.82 ? 167 LYS B CE  1 
ATOM   2359 N NZ  . LYS B 2 167 ? 61.433 44.059 126.403 1.00 39.88 ? 167 LYS B NZ  1 
ATOM   2360 N N   . GLY B 2 168 ? 57.111 36.954 126.969 1.00 19.30 ? 168 GLY B N   1 
ATOM   2361 C CA  . GLY B 2 168 ? 56.923 35.620 127.475 1.00 19.91 ? 168 GLY B CA  1 
ATOM   2362 C C   . GLY B 2 168 ? 56.879 35.355 128.971 1.00 19.60 ? 168 GLY B C   1 
ATOM   2363 O O   . GLY B 2 168 ? 56.738 34.170 129.284 1.00 16.46 ? 168 GLY B O   1 
ATOM   2364 N N   . TRP B 2 169 ? 56.885 36.368 129.839 1.00 13.68 ? 169 TRP B N   1 
ATOM   2365 C CA  . TRP B 2 169 ? 56.816 36.211 131.270 1.00 17.15 ? 169 TRP B CA  1 
ATOM   2366 C C   . TRP B 2 169 ? 55.406 35.811 131.693 1.00 17.47 ? 169 TRP B C   1 
ATOM   2367 O O   . TRP B 2 169 ? 55.269 34.978 132.606 1.00 17.93 ? 169 TRP B O   1 
ATOM   2368 C CB  . TRP B 2 169 ? 57.306 37.430 132.089 1.00 14.79 ? 169 TRP B CB  1 
ATOM   2369 C CG  . TRP B 2 169 ? 57.602 37.086 133.540 1.00 16.89 ? 169 TRP B CG  1 
ATOM   2370 C CD1 . TRP B 2 169 ? 56.979 37.619 134.634 1.00 14.27 ? 169 TRP B CD1 1 
ATOM   2371 C CD2 . TRP B 2 169 ? 58.604 36.206 134.052 1.00 14.77 ? 169 TRP B CD2 1 
ATOM   2372 N NE1 . TRP B 2 169 ? 57.480 37.083 135.801 1.00 14.95 ? 169 TRP B NE1 1 
ATOM   2373 C CE2 . TRP B 2 169 ? 58.483 36.212 135.465 1.00 17.74 ? 169 TRP B CE2 1 
ATOM   2374 C CE3 . TRP B 2 169 ? 59.543 35.377 133.459 1.00 15.82 ? 169 TRP B CE3 1 
ATOM   2375 C CZ2 . TRP B 2 169 ? 59.291 35.460 136.328 1.00 15.95 ? 169 TRP B CZ2 1 
ATOM   2376 C CZ3 . TRP B 2 169 ? 60.377 34.620 134.281 1.00 16.87 ? 169 TRP B CZ3 1 
ATOM   2377 C CH2 . TRP B 2 169 ? 60.229 34.676 135.695 1.00 20.87 ? 169 TRP B CH2 1 
ATOM   2378 N N   . MET B 2 170 ? 54.372 36.302 131.007 1.00 16.41 ? 170 MET B N   1 
ATOM   2379 C CA  . MET B 2 170 ? 53.008 35.831 131.306 1.00 17.83 ? 170 MET B CA  1 
ATOM   2380 C C   . MET B 2 170 ? 52.302 35.309 130.065 1.00 17.67 ? 170 MET B C   1 
ATOM   2381 O O   . MET B 2 170 ? 52.585 35.843 128.966 1.00 17.61 ? 170 MET B O   1 
ATOM   2382 C CB  . MET B 2 170 ? 52.203 37.050 131.852 1.00 19.08 ? 170 MET B CB  1 
ATOM   2383 C CG  . MET B 2 170 ? 52.538 37.366 133.308 1.00 21.02 ? 170 MET B CG  1 
ATOM   2384 S SD  . MET B 2 170 ? 51.354 38.536 134.010 1.00 24.25 ? 170 MET B SD  1 
ATOM   2385 C CE  . MET B 2 170 ? 50.073 37.373 134.632 1.00 16.64 ? 170 MET B CE  1 
ATOM   2386 N N   . VAL B 2 171 ? 51.386 34.358 130.142 1.00 18.09 ? 171 VAL B N   1 
ATOM   2387 C CA  . VAL B 2 171 ? 50.523 33.926 129.044 1.00 18.65 ? 171 VAL B CA  1 
ATOM   2388 C C   . VAL B 2 171 ? 49.079 33.959 129.558 1.00 18.02 ? 171 VAL B C   1 
ATOM   2389 O O   . VAL B 2 171 ? 48.814 33.329 130.587 1.00 18.61 ? 171 VAL B O   1 
ATOM   2390 C CB  . VAL B 2 171 ? 50.784 32.541 128.444 1.00 19.34 ? 171 VAL B CB  1 
ATOM   2391 C CG1 . VAL B 2 171 ? 49.918 32.465 127.170 1.00 20.29 ? 171 VAL B CG1 1 
ATOM   2392 C CG2 . VAL B 2 171 ? 52.247 32.341 128.071 1.00 20.25 ? 171 VAL B CG2 1 
ATOM   2393 N N   . LEU B 2 172 ? 48.210 34.765 128.951 1.00 18.66 ? 172 LEU B N   1 
ATOM   2394 C CA  . LEU B 2 172 ? 46.861 34.926 129.495 1.00 19.61 ? 172 LEU B CA  1 
ATOM   2395 C C   . LEU B 2 172 ? 45.776 34.184 128.712 1.00 20.17 ? 172 LEU B C   1 
ATOM   2396 O O   . LEU B 2 172 ? 45.990 33.892 127.537 1.00 18.14 ? 172 LEU B O   1 
ATOM   2397 C CB  . LEU B 2 172 ? 46.480 36.408 129.568 1.00 17.23 ? 172 LEU B CB  1 
ATOM   2398 C CG  . LEU B 2 172 ? 47.349 37.253 130.555 1.00 17.91 ? 172 LEU B CG  1 
ATOM   2399 C CD1 . LEU B 2 172 ? 46.944 38.712 130.443 1.00 16.61 ? 172 LEU B CD1 1 
ATOM   2400 C CD2 . LEU B 2 172 ? 47.271 36.756 132.014 1.00 12.66 ? 172 LEU B CD2 1 
ATOM   2401 N N   . GLU B 2 173 ? 44.673 33.891 129.410 1.00 15.29 ? 173 GLU B N   1 
ATOM   2402 C CA  . GLU B 2 173 ? 43.457 33.409 128.765 1.00 18.50 ? 173 GLU B CA  1 
ATOM   2403 C C   . GLU B 2 173 ? 42.374 34.387 129.231 1.00 18.68 ? 173 GLU B C   1 
ATOM   2404 O O   . GLU B 2 173 ? 42.585 34.973 130.290 1.00 14.97 ? 173 GLU B O   1 
ATOM   2405 C CB  . GLU B 2 173 ? 43.086 31.965 129.100 1.00 18.62 ? 173 GLU B CB  1 
ATOM   2406 C CG  . GLU B 2 173 ? 42.728 31.709 130.551 1.00 27.97 ? 173 GLU B CG  1 
ATOM   2407 C CD  . GLU B 2 173 ? 42.574 30.208 130.810 1.00 35.34 ? 173 GLU B CD  1 
ATOM   2408 O OE1 . GLU B 2 173 ? 43.550 29.447 130.660 1.00 38.55 ? 173 GLU B OE1 1 
ATOM   2409 O OE2 . GLU B 2 173 ? 41.445 29.744 131.117 1.00 40.19 ? 173 GLU B OE2 1 
ATOM   2410 N N   . TYR B 2 174 ? 41.267 34.580 128.551 1.00 14.70 ? 174 TYR B N   1 
ATOM   2411 C CA  . TYR B 2 174 ? 40.263 35.551 128.821 1.00 14.90 ? 174 TYR B CA  1 
ATOM   2412 C C   . TYR B 2 174 ? 38.881 34.925 128.854 1.00 16.84 ? 174 TYR B C   1 
ATOM   2413 O O   . TYR B 2 174 ? 38.577 34.109 127.949 1.00 16.14 ? 174 TYR B O   1 
ATOM   2414 C CB  . TYR B 2 174 ? 40.265 36.654 127.706 1.00 14.56 ? 174 TYR B CB  1 
ATOM   2415 C CG  . TYR B 2 174 ? 41.587 37.377 127.591 1.00 15.36 ? 174 TYR B CG  1 
ATOM   2416 C CD1 . TYR B 2 174 ? 41.942 38.367 128.508 1.00 9.85  ? 174 TYR B CD1 1 
ATOM   2417 C CD2 . TYR B 2 174 ? 42.493 37.032 126.585 1.00 14.19 ? 174 TYR B CD2 1 
ATOM   2418 C CE1 . TYR B 2 174 ? 43.159 39.037 128.391 1.00 13.70 ? 174 TYR B CE1 1 
ATOM   2419 C CE2 . TYR B 2 174 ? 43.722 37.684 126.487 1.00 14.61 ? 174 TYR B CE2 1 
ATOM   2420 C CZ  . TYR B 2 174 ? 44.036 38.701 127.389 1.00 15.21 ? 174 TYR B CZ  1 
ATOM   2421 O OH  . TYR B 2 174 ? 45.241 39.368 127.277 1.00 17.07 ? 174 TYR B OH  1 
ATOM   2422 N N   . GLU B 2 175 ? 38.039 35.313 129.795 1.00 16.64 ? 175 GLU B N   1 
ATOM   2423 C CA  . GLU B 2 175 ? 36.633 34.816 129.763 1.00 15.71 ? 175 GLU B CA  1 
ATOM   2424 C C   . GLU B 2 175 ? 35.683 35.989 129.596 1.00 15.33 ? 175 GLU B C   1 
ATOM   2425 O O   . GLU B 2 175 ? 35.703 36.918 130.422 1.00 12.47 ? 175 GLU B O   1 
ATOM   2426 C CB  . GLU B 2 175 ? 36.295 34.022 131.037 1.00 22.78 ? 175 GLU B CB  1 
ATOM   2427 C CG  . GLU B 2 175 ? 34.793 34.079 131.354 1.00 35.17 ? 175 GLU B CG  1 
ATOM   2428 C CD  . GLU B 2 175 ? 34.348 33.383 132.617 1.00 42.51 ? 175 GLU B CD  1 
ATOM   2429 O OE1 . GLU B 2 175 ? 35.267 32.848 133.330 1.00 46.19 ? 175 GLU B OE1 1 
ATOM   2430 O OE2 . GLU B 2 175 ? 33.107 33.360 132.814 1.00 44.42 ? 175 GLU B OE2 1 
ATOM   2431 N N   . LEU B 2 176 ? 34.891 36.034 128.534 1.00 14.85 ? 176 LEU B N   1 
ATOM   2432 C CA  . LEU B 2 176 ? 33.936 37.069 128.206 1.00 13.23 ? 176 LEU B CA  1 
ATOM   2433 C C   . LEU B 2 176 ? 32.545 36.669 128.691 1.00 13.82 ? 176 LEU B C   1 
ATOM   2434 O O   . LEU B 2 176 ? 32.184 35.493 128.594 1.00 12.69 ? 176 LEU B O   1 
ATOM   2435 C CB  . LEU B 2 176 ? 33.862 37.347 126.685 1.00 13.56 ? 176 LEU B CB  1 
ATOM   2436 C CG  . LEU B 2 176 ? 32.877 38.420 126.186 1.00 13.57 ? 176 LEU B CG  1 
ATOM   2437 C CD1 . LEU B 2 176 ? 33.400 39.089 124.861 1.00 14.57 ? 176 LEU B CD1 1 
ATOM   2438 C CD2 . LEU B 2 176 ? 31.477 37.894 125.906 1.00 11.30 ? 176 LEU B CD2 1 
ATOM   2439 N N   . GLN B 2 177 ? 31.777 37.610 129.228 1.00 12.53 ? 177 GLN B N   1 
ATOM   2440 C CA  . GLN B 2 177 ? 30.376 37.435 129.628 1.00 12.16 ? 177 GLN B CA  1 
ATOM   2441 C C   . GLN B 2 177 ? 29.509 38.514 128.974 1.00 13.80 ? 177 GLN B C   1 
ATOM   2442 O O   . GLN B 2 177 ? 30.038 39.610 128.763 1.00 11.69 ? 177 GLN B O   1 
ATOM   2443 C CB  . GLN B 2 177 ? 30.153 37.586 131.180 1.00 11.97 ? 177 GLN B CB  1 
ATOM   2444 C CG  . GLN B 2 177 ? 31.069 36.579 131.915 1.00 19.86 ? 177 GLN B CG  1 
ATOM   2445 C CD  . GLN B 2 177 ? 30.743 36.508 133.416 1.00 22.96 ? 177 GLN B CD  1 
ATOM   2446 O OE1 . GLN B 2 177 ? 30.039 37.382 133.907 1.00 21.57 ? 177 GLN B OE1 1 
ATOM   2447 N NE2 . GLN B 2 177 ? 31.252 35.438 134.033 1.00 22.98 ? 177 GLN B NE2 1 
ATOM   2448 N N   . TYR B 2 178 ? 28.217 38.273 128.687 1.00 13.21 ? 178 TYR B N   1 
ATOM   2449 C CA  . TYR B 2 178 ? 27.360 39.315 128.166 1.00 15.65 ? 178 TYR B CA  1 
ATOM   2450 C C   . TYR B 2 178 ? 25.889 39.044 128.552 1.00 15.75 ? 178 TYR B C   1 
ATOM   2451 O O   . TYR B 2 178 ? 25.595 37.910 128.928 1.00 16.32 ? 178 TYR B O   1 
ATOM   2452 C CB  . TYR B 2 178 ? 27.434 39.422 126.630 1.00 17.29 ? 178 TYR B CB  1 
ATOM   2453 C CG  . TYR B 2 178 ? 26.930 38.231 125.872 1.00 17.53 ? 178 TYR B CG  1 
ATOM   2454 C CD1 . TYR B 2 178 ? 27.678 37.084 125.736 1.00 20.77 ? 178 TYR B CD1 1 
ATOM   2455 C CD2 . TYR B 2 178 ? 25.658 38.268 125.288 1.00 20.04 ? 178 TYR B CD2 1 
ATOM   2456 C CE1 . TYR B 2 178 ? 27.209 35.997 125.014 1.00 24.92 ? 178 TYR B CE1 1 
ATOM   2457 C CE2 . TYR B 2 178 ? 25.151 37.219 124.565 1.00 22.01 ? 178 TYR B CE2 1 
ATOM   2458 C CZ  . TYR B 2 178 ? 25.944 36.088 124.447 1.00 28.41 ? 178 TYR B CZ  1 
ATOM   2459 O OH  . TYR B 2 178 ? 25.482 35.015 123.700 1.00 33.70 ? 178 TYR B OH  1 
ATOM   2460 N N   . LYS B 2 179 ? 25.019 40.018 128.495 1.00 14.58 ? 179 LYS B N   1 
ATOM   2461 C CA  . LYS B 2 179 ? 23.600 39.780 128.800 1.00 16.73 ? 179 LYS B CA  1 
ATOM   2462 C C   . LYS B 2 179 ? 22.829 41.005 128.321 1.00 18.51 ? 179 LYS B C   1 
ATOM   2463 O O   . LYS B 2 179 ? 23.506 42.021 128.040 1.00 19.08 ? 179 LYS B O   1 
ATOM   2464 C CB  . LYS B 2 179 ? 23.325 39.608 130.309 1.00 15.56 ? 179 LYS B CB  1 
ATOM   2465 C CG  . LYS B 2 179 ? 23.829 40.808 131.135 1.00 17.80 ? 179 LYS B CG  1 
ATOM   2466 C CD  . LYS B 2 179 ? 23.421 40.647 132.589 1.00 18.20 ? 179 LYS B CD  1 
ATOM   2467 C CE  . LYS B 2 179 ? 23.533 41.808 133.543 1.00 18.37 ? 179 LYS B CE  1 
ATOM   2468 N NZ  . LYS B 2 179 ? 22.486 42.816 133.413 1.00 23.91 ? 179 LYS B NZ  1 
ATOM   2469 N N   . GLU B 2 180 ? 21.516 40.928 128.201 1.00 16.72 ? 180 GLU B N   1 
ATOM   2470 C CA  . GLU B 2 180 ? 20.649 42.056 127.869 1.00 18.95 ? 180 GLU B CA  1 
ATOM   2471 C C   . GLU B 2 180 ? 20.621 42.960 129.095 1.00 18.18 ? 180 GLU B C   1 
ATOM   2472 O O   . GLU B 2 180 ? 20.759 42.451 130.214 1.00 17.27 ? 180 GLU B O   1 
ATOM   2473 C CB  . GLU B 2 180 ? 19.318 41.484 127.386 1.00 23.27 ? 180 GLU B CB  1 
ATOM   2474 C CG  . GLU B 2 180 ? 18.299 42.377 126.715 1.00 28.44 ? 180 GLU B CG  1 
ATOM   2475 C CD  . GLU B 2 180 ? 17.335 43.044 127.699 1.00 32.58 ? 180 GLU B CD  1 
ATOM   2476 O OE1 . GLU B 2 180 ? 17.097 42.534 128.821 1.00 35.26 ? 180 GLU B OE1 1 
ATOM   2477 O OE2 . GLU B 2 180 ? 16.808 44.144 127.420 1.00 34.12 ? 180 GLU B OE2 1 
ATOM   2478 N N   . VAL B 2 181 ? 20.574 44.300 128.995 1.00 18.00 ? 181 VAL B N   1 
ATOM   2479 C CA  . VAL B 2 181 ? 20.831 45.155 130.171 1.00 21.57 ? 181 VAL B CA  1 
ATOM   2480 C C   . VAL B 2 181 ? 19.769 45.026 131.283 1.00 22.44 ? 181 VAL B C   1 
ATOM   2481 O O   . VAL B 2 181 ? 20.099 45.344 132.419 1.00 21.89 ? 181 VAL B O   1 
ATOM   2482 C CB  . VAL B 2 181 ? 21.003 46.638 129.801 1.00 20.34 ? 181 VAL B CB  1 
ATOM   2483 C CG1 . VAL B 2 181 ? 22.101 46.719 128.715 1.00 14.83 ? 181 VAL B CG1 1 
ATOM   2484 C CG2 . VAL B 2 181 ? 19.693 47.225 129.229 1.00 18.75 ? 181 VAL B CG2 1 
ATOM   2485 N N   . ASN B 2 182 ? 18.596 44.529 130.938 1.00 22.19 ? 182 ASN B N   1 
ATOM   2486 C CA  . ASN B 2 182 ? 17.526 44.301 131.892 1.00 25.18 ? 182 ASN B CA  1 
ATOM   2487 C C   . ASN B 2 182 ? 17.584 42.948 132.562 1.00 24.74 ? 182 ASN B C   1 
ATOM   2488 O O   . ASN B 2 182 ? 16.708 42.656 133.390 1.00 26.12 ? 182 ASN B O   1 
ATOM   2489 C CB  . ASN B 2 182 ? 16.171 44.485 131.166 1.00 24.06 ? 182 ASN B CB  1 
ATOM   2490 C CG  . ASN B 2 182 ? 16.137 45.923 130.645 1.00 28.01 ? 182 ASN B CG  1 
ATOM   2491 O OD1 . ASN B 2 182 ? 16.324 46.769 131.543 1.00 27.97 ? 182 ASN B OD1 1 
ATOM   2492 N ND2 . ASN B 2 182 ? 15.972 46.221 129.356 1.00 25.72 ? 182 ASN B ND2 1 
ATOM   2493 N N   . GLU B 2 183 ? 18.506 42.065 132.209 1.00 23.71 ? 183 GLU B N   1 
ATOM   2494 C CA  . GLU B 2 183 ? 18.585 40.736 132.787 1.00 24.58 ? 183 GLU B CA  1 
ATOM   2495 C C   . GLU B 2 183 ? 19.418 40.693 134.056 1.00 23.47 ? 183 GLU B C   1 
ATOM   2496 O O   . GLU B 2 183 ? 20.337 41.498 134.145 1.00 23.85 ? 183 GLU B O   1 
ATOM   2497 C CB  . GLU B 2 183 ? 19.152 39.742 131.767 1.00 28.06 ? 183 GLU B CB  1 
ATOM   2498 C CG  . GLU B 2 183 ? 18.328 39.387 130.560 1.00 32.37 ? 183 GLU B CG  1 
ATOM   2499 C CD  . GLU B 2 183 ? 19.038 38.547 129.493 1.00 38.11 ? 183 GLU B CD  1 
ATOM   2500 O OE1 . GLU B 2 183 ? 20.245 38.566 129.109 1.00 34.31 ? 183 GLU B OE1 1 
ATOM   2501 O OE2 . GLU B 2 183 ? 18.245 37.718 128.936 1.00 41.93 ? 183 GLU B OE2 1 
ATOM   2502 N N   . THR B 2 184 ? 19.201 39.758 134.999 1.00 24.57 ? 184 THR B N   1 
ATOM   2503 C CA  . THR B 2 184 ? 20.048 39.689 136.177 1.00 26.02 ? 184 THR B CA  1 
ATOM   2504 C C   . THR B 2 184 ? 21.179 38.683 135.978 1.00 26.04 ? 184 THR B C   1 
ATOM   2505 O O   . THR B 2 184 ? 22.285 38.886 136.475 1.00 26.19 ? 184 THR B O   1 
ATOM   2506 C CB  . THR B 2 184 ? 19.252 39.274 137.441 1.00 29.52 ? 184 THR B CB  1 
ATOM   2507 O OG1 . THR B 2 184 ? 18.796 37.919 137.283 1.00 29.51 ? 184 THR B OG1 1 
ATOM   2508 C CG2 . THR B 2 184 ? 18.030 40.160 137.590 1.00 29.28 ? 184 THR B CG2 1 
ATOM   2509 N N   . LYS B 2 185 ? 20.957 37.636 135.164 1.00 25.97 ? 185 LYS B N   1 
ATOM   2510 C CA  . LYS B 2 185 ? 22.062 36.700 134.945 1.00 27.46 ? 185 LYS B CA  1 
ATOM   2511 C C   . LYS B 2 185 ? 22.866 36.941 133.657 1.00 22.64 ? 185 LYS B C   1 
ATOM   2512 O O   . LYS B 2 185 ? 22.315 37.374 132.659 1.00 23.84 ? 185 LYS B O   1 
ATOM   2513 C CB  . LYS B 2 185 ? 21.588 35.240 134.918 1.00 32.78 ? 185 LYS B CB  1 
ATOM   2514 C CG  . LYS B 2 185 ? 21.884 34.621 136.299 1.00 40.03 ? 185 LYS B CG  1 
ATOM   2515 C CD  . LYS B 2 185 ? 20.583 34.533 137.092 1.00 41.96 ? 185 LYS B CD  1 
ATOM   2516 C CE  . LYS B 2 185 ? 20.028 33.106 137.007 1.00 45.27 ? 185 LYS B CE  1 
ATOM   2517 N NZ  . LYS B 2 185 ? 18.891 32.946 137.978 1.00 47.33 ? 185 LYS B NZ  1 
ATOM   2518 N N   . TRP B 2 186 ? 24.137 36.624 133.689 1.00 22.28 ? 186 TRP B N   1 
ATOM   2519 C CA  . TRP B 2 186 ? 25.060 36.843 132.575 1.00 24.46 ? 186 TRP B CA  1 
ATOM   2520 C C   . TRP B 2 186 ? 25.312 35.547 131.810 1.00 24.15 ? 186 TRP B C   1 
ATOM   2521 O O   . TRP B 2 186 ? 25.445 34.553 132.528 1.00 24.62 ? 186 TRP B O   1 
ATOM   2522 C CB  . TRP B 2 186 ? 26.433 37.268 133.147 1.00 20.58 ? 186 TRP B CB  1 
ATOM   2523 C CG  . TRP B 2 186 ? 26.524 38.638 133.749 1.00 21.77 ? 186 TRP B CG  1 
ATOM   2524 C CD1 . TRP B 2 186 ? 26.250 39.015 135.038 1.00 21.05 ? 186 TRP B CD1 1 
ATOM   2525 C CD2 . TRP B 2 186 ? 26.984 39.834 133.070 1.00 19.54 ? 186 TRP B CD2 1 
ATOM   2526 N NE1 . TRP B 2 186 ? 26.467 40.372 135.183 1.00 20.94 ? 186 TRP B NE1 1 
ATOM   2527 C CE2 . TRP B 2 186 ? 26.901 40.899 133.988 1.00 20.52 ? 186 TRP B CE2 1 
ATOM   2528 C CE3 . TRP B 2 186 ? 27.397 40.094 131.765 1.00 17.44 ? 186 TRP B CE3 1 
ATOM   2529 C CZ2 . TRP B 2 186 ? 27.277 42.209 133.663 1.00 19.39 ? 186 TRP B CZ2 1 
ATOM   2530 C CZ3 . TRP B 2 186 ? 27.753 41.387 131.399 1.00 17.08 ? 186 TRP B CZ3 1 
ATOM   2531 C CH2 . TRP B 2 186 ? 27.704 42.414 132.375 1.00 20.15 ? 186 TRP B CH2 1 
ATOM   2532 N N   . LYS B 2 187 ? 25.430 35.560 130.501 1.00 22.14 ? 187 LYS B N   1 
ATOM   2533 C CA  . LYS B 2 187 ? 25.768 34.318 129.782 1.00 24.21 ? 187 LYS B CA  1 
ATOM   2534 C C   . LYS B 2 187 ? 27.286 34.223 129.753 1.00 24.64 ? 187 LYS B C   1 
ATOM   2535 O O   . LYS B 2 187 ? 27.939 35.241 129.515 1.00 23.03 ? 187 LYS B O   1 
ATOM   2536 C CB  . LYS B 2 187 ? 25.193 34.349 128.364 1.00 27.64 ? 187 LYS B CB  1 
ATOM   2537 C CG  . LYS B 2 187 ? 23.726 34.791 128.362 1.00 36.88 ? 187 LYS B CG  1 
ATOM   2538 C CD  . LYS B 2 187 ? 23.320 35.604 127.130 1.00 40.17 ? 187 LYS B CD  1 
ATOM   2539 C CE  . LYS B 2 187 ? 22.204 36.598 127.456 1.00 43.93 ? 187 LYS B CE  1 
ATOM   2540 N NZ  . LYS B 2 187 ? 21.436 37.079 126.265 1.00 43.07 ? 187 LYS B NZ  1 
ATOM   2541 N N   . MET B 2 188 ? 27.879 33.055 129.934 1.00 25.01 ? 188 MET B N   1 
ATOM   2542 C CA  . MET B 2 188 ? 29.327 32.925 130.090 1.00 27.53 ? 188 MET B CA  1 
ATOM   2543 C C   . MET B 2 188 ? 29.950 32.127 128.961 1.00 27.34 ? 188 MET B C   1 
ATOM   2544 O O   . MET B 2 188 ? 29.422 31.051 128.734 1.00 27.63 ? 188 MET B O   1 
ATOM   2545 C CB  . MET B 2 188 ? 29.651 32.244 131.431 1.00 29.24 ? 188 MET B CB  1 
ATOM   2546 C CG  . MET B 2 188 ? 29.095 33.043 132.614 1.00 36.25 ? 188 MET B CG  1 
ATOM   2547 S SD  . MET B 2 188 ? 29.065 32.136 134.172 1.00 42.83 ? 188 MET B SD  1 
ATOM   2548 C CE  . MET B 2 188 ? 27.800 30.909 133.834 1.00 41.48 ? 188 MET B CE  1 
ATOM   2549 N N   . MET B 2 189 ? 30.945 32.669 128.263 1.00 24.59 ? 189 MET B N   1 
ATOM   2550 C CA  . MET B 2 189 ? 31.572 31.946 127.176 1.00 22.10 ? 189 MET B CA  1 
ATOM   2551 C C   . MET B 2 189 ? 32.756 31.137 127.728 1.00 23.87 ? 189 MET B C   1 
ATOM   2552 O O   . MET B 2 189 ? 33.367 31.537 128.738 1.00 18.79 ? 189 MET B O   1 
ATOM   2553 C CB  . MET B 2 189 ? 32.153 32.871 126.093 1.00 25.97 ? 189 MET B CB  1 
ATOM   2554 C CG  . MET B 2 189 ? 31.305 33.839 125.340 1.00 26.05 ? 189 MET B CG  1 
ATOM   2555 S SD  . MET B 2 189 ? 31.997 34.618 123.846 1.00 35.27 ? 189 MET B SD  1 
ATOM   2556 C CE  . MET B 2 189 ? 33.718 34.162 123.956 1.00 32.24 ? 189 MET B CE  1 
ATOM   2557 N N   . ASP B 2 190 ? 33.175 30.090 127.015 1.00 22.75 ? 190 ASP B N   1 
ATOM   2558 C CA  . ASP B 2 190 ? 34.382 29.373 127.362 1.00 25.47 ? 190 ASP B CA  1 
ATOM   2559 C C   . ASP B 2 190 ? 35.572 30.332 127.098 1.00 23.27 ? 190 ASP B C   1 
ATOM   2560 O O   . ASP B 2 190 ? 35.491 31.225 126.262 1.00 20.92 ? 190 ASP B O   1 
ATOM   2561 C CB  . ASP B 2 190 ? 34.578 28.138 126.473 1.00 30.95 ? 190 ASP B CB  1 
ATOM   2562 C CG  . ASP B 2 190 ? 33.525 27.076 126.760 1.00 36.73 ? 190 ASP B CG  1 
ATOM   2563 O OD1 . ASP B 2 190 ? 33.257 26.805 127.952 1.00 37.69 ? 190 ASP B OD1 1 
ATOM   2564 O OD2 . ASP B 2 190 ? 32.987 26.579 125.743 1.00 40.62 ? 190 ASP B OD2 1 
ATOM   2565 N N   . PRO B 2 191 ? 36.636 30.134 127.832 1.00 22.73 ? 191 PRO B N   1 
ATOM   2566 C CA  . PRO B 2 191 ? 37.806 30.978 127.777 1.00 22.49 ? 191 PRO B CA  1 
ATOM   2567 C C   . PRO B 2 191 ? 38.538 30.897 126.441 1.00 20.59 ? 191 PRO B C   1 
ATOM   2568 O O   . PRO B 2 191 ? 38.473 29.871 125.758 1.00 19.99 ? 191 PRO B O   1 
ATOM   2569 C CB  . PRO B 2 191 ? 38.696 30.487 128.917 1.00 22.39 ? 191 PRO B CB  1 
ATOM   2570 C CG  . PRO B 2 191 ? 38.202 29.114 129.251 1.00 26.17 ? 191 PRO B CG  1 
ATOM   2571 C CD  . PRO B 2 191 ? 36.731 29.042 128.886 1.00 24.49 ? 191 PRO B CD  1 
ATOM   2572 N N   . ILE B 2 192 ? 39.184 31.986 126.021 1.00 15.91 ? 192 ILE B N   1 
ATOM   2573 C CA  . ILE B 2 192 ? 39.906 32.012 124.748 1.00 15.28 ? 192 ILE B CA  1 
ATOM   2574 C C   . ILE B 2 192 ? 41.303 32.561 124.944 1.00 15.06 ? 192 ILE B C   1 
ATOM   2575 O O   . ILE B 2 192 ? 41.558 33.218 126.001 1.00 12.82 ? 192 ILE B O   1 
ATOM   2576 C CB  . ILE B 2 192 ? 39.129 32.842 123.691 1.00 16.73 ? 192 ILE B CB  1 
ATOM   2577 C CG1 . ILE B 2 192 ? 38.876 34.287 124.184 1.00 18.12 ? 192 ILE B CG1 1 
ATOM   2578 C CG2 . ILE B 2 192 ? 37.768 32.193 123.370 1.00 9.84  ? 192 ILE B CG2 1 
ATOM   2579 C CD1 . ILE B 2 192 ? 38.314 35.142 123.044 1.00 20.09 ? 192 ILE B CD1 1 
ATOM   2580 N N   . LEU B 2 193 ? 42.145 32.436 123.955 1.00 14.94 ? 193 LEU B N   1 
ATOM   2581 C CA  . LEU B 2 193 ? 43.516 32.911 123.974 1.00 17.00 ? 193 LEU B CA  1 
ATOM   2582 C C   . LEU B 2 193 ? 43.723 34.252 123.308 1.00 15.91 ? 193 LEU B C   1 
ATOM   2583 O O   . LEU B 2 193 ? 44.779 34.851 123.496 1.00 17.52 ? 193 LEU B O   1 
ATOM   2584 C CB  . LEU B 2 193 ? 44.456 31.924 123.278 1.00 18.63 ? 193 LEU B CB  1 
ATOM   2585 C CG  . LEU B 2 193 ? 44.553 30.511 123.935 1.00 20.05 ? 193 LEU B CG  1 
ATOM   2586 C CD1 . LEU B 2 193 ? 45.587 29.639 123.202 1.00 16.98 ? 193 LEU B CD1 1 
ATOM   2587 C CD2 . LEU B 2 193 ? 45.021 30.643 125.368 1.00 17.99 ? 193 LEU B CD2 1 
ATOM   2588 N N   . THR B 2 194 ? 42.758 34.710 122.522 1.00 16.01 ? 194 THR B N   1 
ATOM   2589 C CA  . THR B 2 194 ? 42.949 35.941 121.737 1.00 16.28 ? 194 THR B CA  1 
ATOM   2590 C C   . THR B 2 194 ? 42.379 37.149 122.460 1.00 17.44 ? 194 THR B C   1 
ATOM   2591 O O   . THR B 2 194 ? 41.633 36.988 123.428 1.00 14.38 ? 194 THR B O   1 
ATOM   2592 C CB  . THR B 2 194 ? 42.220 35.773 120.377 1.00 17.39 ? 194 THR B CB  1 
ATOM   2593 O OG1 . THR B 2 194 ? 40.885 35.289 120.685 1.00 16.88 ? 194 THR B OG1 1 
ATOM   2594 C CG2 . THR B 2 194 ? 42.906 34.719 119.514 1.00 17.09 ? 194 THR B CG2 1 
ATOM   2595 N N   . THR B 2 195 ? 42.617 38.353 121.912 1.00 18.26 ? 195 THR B N   1 
ATOM   2596 C CA  . THR B 2 195 ? 42.038 39.544 122.494 1.00 18.51 ? 195 THR B CA  1 
ATOM   2597 C C   . THR B 2 195 ? 40.849 40.074 121.692 1.00 19.12 ? 195 THR B C   1 
ATOM   2598 O O   . THR B 2 195 ? 40.566 41.286 121.714 1.00 16.99 ? 195 THR B O   1 
ATOM   2599 C CB  . THR B 2 195 ? 43.107 40.643 122.684 1.00 21.64 ? 195 THR B CB  1 
ATOM   2600 O OG1 . THR B 2 195 ? 43.707 40.919 121.399 1.00 17.63 ? 195 THR B OG1 1 
ATOM   2601 C CG2 . THR B 2 195 ? 44.159 40.146 123.683 1.00 18.48 ? 195 THR B CG2 1 
ATOM   2602 N N   . SER B 2 196 ? 40.168 39.185 120.993 1.00 18.23 ? 196 SER B N   1 
ATOM   2603 C CA  . SER B 2 196 ? 38.942 39.514 120.290 1.00 21.13 ? 196 SER B CA  1 
ATOM   2604 C C   . SER B 2 196 ? 38.133 38.248 120.006 1.00 20.66 ? 196 SER B C   1 
ATOM   2605 O O   . SER B 2 196 ? 38.711 37.170 119.822 1.00 21.63 ? 196 SER B O   1 
ATOM   2606 C CB  . SER B 2 196 ? 39.245 40.348 119.018 1.00 20.84 ? 196 SER B CB  1 
ATOM   2607 O OG  . SER B 2 196 ? 39.400 39.427 117.953 1.00 29.12 ? 196 SER B OG  1 
ATOM   2608 N N   . VAL B 2 197 ? 36.814 38.369 119.878 1.00 19.79 ? 197 VAL B N   1 
ATOM   2609 C CA  . VAL B 2 197 ? 35.859 37.299 119.653 1.00 17.58 ? 197 VAL B CA  1 
ATOM   2610 C C   . VAL B 2 197 ? 34.486 37.802 119.221 1.00 17.13 ? 197 VAL B C   1 
ATOM   2611 O O   . VAL B 2 197 ? 33.978 38.816 119.635 1.00 17.19 ? 197 VAL B O   1 
ATOM   2612 C CB  . VAL B 2 197 ? 35.775 36.421 120.920 1.00 19.16 ? 197 VAL B CB  1 
ATOM   2613 C CG1 . VAL B 2 197 ? 34.958 37.042 122.097 1.00 18.37 ? 197 VAL B CG1 1 
ATOM   2614 C CG2 . VAL B 2 197 ? 35.155 35.047 120.690 1.00 17.48 ? 197 VAL B CG2 1 
ATOM   2615 N N   . PRO B 2 198 ? 33.745 37.072 118.361 1.00 16.64 ? 198 PRO B N   1 
ATOM   2616 C CA  . PRO B 2 198 ? 32.407 37.388 117.987 1.00 16.12 ? 198 PRO B CA  1 
ATOM   2617 C C   . PRO B 2 198 ? 31.382 37.072 119.076 1.00 16.43 ? 198 PRO B C   1 
ATOM   2618 O O   . PRO B 2 198 ? 31.542 36.129 119.846 1.00 15.16 ? 198 PRO B O   1 
ATOM   2619 C CB  . PRO B 2 198 ? 32.053 36.449 116.772 1.00 17.13 ? 198 PRO B CB  1 
ATOM   2620 C CG  . PRO B 2 198 ? 33.429 35.948 116.352 1.00 18.51 ? 198 PRO B CG  1 
ATOM   2621 C CD  . PRO B 2 198 ? 34.218 35.832 117.672 1.00 16.65 ? 198 PRO B CD  1 
ATOM   2622 N N   . VAL B 2 199 ? 30.248 37.797 119.044 1.00 11.78 ? 199 VAL B N   1 
ATOM   2623 C CA  . VAL B 2 199 ? 29.114 37.456 119.877 1.00 12.45 ? 199 VAL B CA  1 
ATOM   2624 C C   . VAL B 2 199 ? 27.957 37.377 118.864 1.00 15.95 ? 199 VAL B C   1 
ATOM   2625 O O   . VAL B 2 199 ? 27.796 38.350 118.101 1.00 15.62 ? 199 VAL B O   1 
ATOM   2626 C CB  . VAL B 2 199 ? 28.837 38.544 120.933 1.00 13.43 ? 199 VAL B CB  1 
ATOM   2627 C CG1 . VAL B 2 199 ? 27.528 38.184 121.664 1.00 16.34 ? 199 VAL B CG1 1 
ATOM   2628 C CG2 . VAL B 2 199 ? 30.028 38.723 121.864 1.00 13.12 ? 199 VAL B CG2 1 
ATOM   2629 N N   . TYR B 2 200 ? 27.213 36.301 118.787 1.00 15.02 ? 200 TYR B N   1 
ATOM   2630 C CA  . TYR B 2 200 ? 26.303 36.069 117.681 1.00 19.26 ? 200 TYR B CA  1 
ATOM   2631 C C   . TYR B 2 200 ? 24.819 36.234 118.048 1.00 19.65 ? 200 TYR B C   1 
ATOM   2632 O O   . TYR B 2 200 ? 24.486 36.055 119.197 1.00 17.81 ? 200 TYR B O   1 
ATOM   2633 C CB  . TYR B 2 200 ? 26.486 34.586 117.243 1.00 20.87 ? 200 TYR B CB  1 
ATOM   2634 C CG  . TYR B 2 200 ? 27.845 34.216 116.674 1.00 22.71 ? 200 TYR B CG  1 
ATOM   2635 C CD1 . TYR B 2 200 ? 28.225 34.563 115.395 1.00 23.20 ? 200 TYR B CD1 1 
ATOM   2636 C CD2 . TYR B 2 200 ? 28.724 33.416 117.436 1.00 23.59 ? 200 TYR B CD2 1 
ATOM   2637 C CE1 . TYR B 2 200 ? 29.487 34.205 114.877 1.00 22.38 ? 200 TYR B CE1 1 
ATOM   2638 C CE2 . TYR B 2 200 ? 29.963 33.042 116.930 1.00 22.86 ? 200 TYR B CE2 1 
ATOM   2639 C CZ  . TYR B 2 200 ? 30.321 33.432 115.664 1.00 22.05 ? 200 TYR B CZ  1 
ATOM   2640 O OH  . TYR B 2 200 ? 31.562 33.055 115.190 1.00 21.37 ? 200 TYR B OH  1 
ATOM   2641 N N   . SER B 2 201 ? 23.974 36.529 117.096 1.00 21.67 ? 201 SER B N   1 
ATOM   2642 C CA  . SER B 2 201 ? 22.555 36.571 117.208 1.00 23.52 ? 201 SER B CA  1 
ATOM   2643 C C   . SER B 2 201 ? 21.972 37.482 118.273 1.00 21.96 ? 201 SER B C   1 
ATOM   2644 O O   . SER B 2 201 ? 21.054 37.075 118.972 1.00 22.04 ? 201 SER B O   1 
ATOM   2645 C CB  . SER B 2 201 ? 22.008 35.126 117.438 1.00 26.13 ? 201 SER B CB  1 
ATOM   2646 O OG  . SER B 2 201 ? 22.378 34.426 116.275 1.00 34.67 ? 201 SER B OG  1 
ATOM   2647 N N   . LEU B 2 202 ? 22.417 38.709 118.371 1.00 20.26 ? 202 LEU B N   1 
ATOM   2648 C CA  . LEU B 2 202 ? 21.883 39.676 119.325 1.00 18.50 ? 202 LEU B CA  1 
ATOM   2649 C C   . LEU B 2 202 ? 20.658 40.299 118.661 1.00 19.88 ? 202 LEU B C   1 
ATOM   2650 O O   . LEU B 2 202 ? 20.692 40.485 117.443 1.00 16.17 ? 202 LEU B O   1 
ATOM   2651 C CB  . LEU B 2 202 ? 22.947 40.748 119.559 1.00 18.12 ? 202 LEU B CB  1 
ATOM   2652 C CG  . LEU B 2 202 ? 24.260 40.357 120.248 1.00 17.96 ? 202 LEU B CG  1 
ATOM   2653 C CD1 . LEU B 2 202 ? 25.148 41.603 120.425 1.00 18.68 ? 202 LEU B CD1 1 
ATOM   2654 C CD2 . LEU B 2 202 ? 24.015 39.724 121.612 1.00 18.61 ? 202 LEU B CD2 1 
ATOM   2655 N N   . LYS B 2 203 ? 19.585 40.571 119.390 1.00 20.59 ? 203 LYS B N   1 
ATOM   2656 C CA  . LYS B 2 203 ? 18.418 41.247 118.827 1.00 20.84 ? 203 LYS B CA  1 
ATOM   2657 C C   . LYS B 2 203 ? 18.731 42.726 118.658 1.00 19.42 ? 203 LYS B C   1 
ATOM   2658 O O   . LYS B 2 203 ? 19.058 43.356 119.671 1.00 19.43 ? 203 LYS B O   1 
ATOM   2659 C CB  . LYS B 2 203 ? 17.228 41.093 119.791 1.00 21.36 ? 203 LYS B CB  1 
ATOM   2660 C CG  . LYS B 2 203 ? 16.714 39.664 119.865 1.00 24.61 ? 203 LYS B CG  1 
ATOM   2661 C CD  . LYS B 2 203 ? 15.871 39.473 121.124 1.00 30.33 ? 203 LYS B CD  1 
ATOM   2662 C CE  . LYS B 2 203 ? 15.841 37.983 121.400 1.00 34.31 ? 203 LYS B CE  1 
ATOM   2663 N NZ  . LYS B 2 203 ? 16.647 37.685 122.614 1.00 39.75 ? 203 LYS B NZ  1 
ATOM   2664 N N   . VAL B 2 204 ? 18.469 43.321 117.491 1.00 20.45 ? 204 VAL B N   1 
ATOM   2665 C CA  . VAL B 2 204 ? 18.797 44.728 117.247 1.00 21.73 ? 204 VAL B CA  1 
ATOM   2666 C C   . VAL B 2 204 ? 17.940 45.694 118.048 1.00 25.80 ? 204 VAL B C   1 
ATOM   2667 O O   . VAL B 2 204 ? 18.236 46.855 118.296 1.00 26.62 ? 204 VAL B O   1 
ATOM   2668 C CB  . VAL B 2 204 ? 18.777 45.136 115.769 1.00 24.23 ? 204 VAL B CB  1 
ATOM   2669 C CG1 . VAL B 2 204 ? 19.611 44.196 114.899 1.00 22.95 ? 204 VAL B CG1 1 
ATOM   2670 C CG2 . VAL B 2 204 ? 17.384 45.210 115.147 1.00 23.76 ? 204 VAL B CG2 1 
ATOM   2671 N N   . ASP B 2 205 ? 16.820 45.224 118.538 1.00 25.38 ? 205 ASP B N   1 
ATOM   2672 C CA  . ASP B 2 205 ? 15.836 45.878 119.333 1.00 30.47 ? 205 ASP B CA  1 
ATOM   2673 C C   . ASP B 2 205 ? 16.245 45.977 120.799 1.00 27.93 ? 205 ASP B C   1 
ATOM   2674 O O   . ASP B 2 205 ? 15.503 46.611 121.547 1.00 27.57 ? 205 ASP B O   1 
ATOM   2675 C CB  . ASP B 2 205 ? 14.656 44.859 119.238 1.00 38.33 ? 205 ASP B CB  1 
ATOM   2676 C CG  . ASP B 2 205 ? 13.347 45.442 119.667 1.00 46.10 ? 205 ASP B CG  1 
ATOM   2677 O OD1 . ASP B 2 205 ? 13.356 46.686 119.878 1.00 50.69 ? 205 ASP B OD1 1 
ATOM   2678 O OD2 . ASP B 2 205 ? 12.355 44.678 119.798 1.00 50.52 ? 205 ASP B OD2 1 
ATOM   2679 N N   . LYS B 2 206 ? 17.262 45.250 121.246 1.00 23.08 ? 206 LYS B N   1 
ATOM   2680 C CA  . LYS B 2 206 ? 17.589 45.238 122.664 1.00 25.49 ? 206 LYS B CA  1 
ATOM   2681 C C   . LYS B 2 206 ? 18.980 45.847 122.937 1.00 25.14 ? 206 LYS B C   1 
ATOM   2682 O O   . LYS B 2 206 ? 19.853 45.677 122.082 1.00 24.78 ? 206 LYS B O   1 
ATOM   2683 C CB  . LYS B 2 206 ? 17.595 43.842 123.261 1.00 26.80 ? 206 LYS B CB  1 
ATOM   2684 C CG  . LYS B 2 206 ? 16.331 43.017 123.228 1.00 33.39 ? 206 LYS B CG  1 
ATOM   2685 C CD  . LYS B 2 206 ? 15.136 43.678 123.879 1.00 35.64 ? 206 LYS B CD  1 
ATOM   2686 C CE  . LYS B 2 206 ? 13.842 42.874 123.694 1.00 37.39 ? 206 LYS B CE  1 
ATOM   2687 N NZ  . LYS B 2 206 ? 12.861 43.244 124.784 1.00 36.19 ? 206 LYS B NZ  1 
ATOM   2688 N N   . GLU B 2 207 ? 19.221 46.394 124.122 1.00 21.42 ? 207 GLU B N   1 
ATOM   2689 C CA  . GLU B 2 207 ? 20.563 46.828 124.476 1.00 17.98 ? 207 GLU B CA  1 
ATOM   2690 C C   . GLU B 2 207 ? 21.256 45.716 125.266 1.00 16.97 ? 207 GLU B C   1 
ATOM   2691 O O   . GLU B 2 207 ? 20.717 45.062 126.153 1.00 14.13 ? 207 GLU B O   1 
ATOM   2692 C CB  . GLU B 2 207 ? 20.605 48.182 125.189 1.00 21.12 ? 207 GLU B CB  1 
ATOM   2693 C CG  . GLU B 2 207 ? 22.001 48.654 125.600 1.00 19.72 ? 207 GLU B CG  1 
ATOM   2694 C CD  . GLU B 2 207 ? 22.098 49.994 126.305 1.00 21.48 ? 207 GLU B CD  1 
ATOM   2695 O OE1 . GLU B 2 207 ? 21.079 50.539 126.804 1.00 20.65 ? 207 GLU B OE1 1 
ATOM   2696 O OE2 . GLU B 2 207 ? 23.234 50.507 126.413 1.00 17.52 ? 207 GLU B OE2 1 
ATOM   2697 N N   . TYR B 2 208 ? 22.549 45.481 124.970 1.00 12.41 ? 208 TYR B N   1 
ATOM   2698 C CA  . TYR B 2 208 ? 23.372 44.491 125.616 1.00 11.63 ? 208 TYR B CA  1 
ATOM   2699 C C   . TYR B 2 208 ? 24.567 45.101 126.356 1.00 13.28 ? 208 TYR B C   1 
ATOM   2700 O O   . TYR B 2 208 ? 24.886 46.273 126.159 1.00 12.57 ? 208 TYR B O   1 
ATOM   2701 C CB  . TYR B 2 208 ? 23.964 43.468 124.613 1.00 11.39 ? 208 TYR B CB  1 
ATOM   2702 C CG  . TYR B 2 208 ? 22.839 42.644 123.986 1.00 15.03 ? 208 TYR B CG  1 
ATOM   2703 C CD1 . TYR B 2 208 ? 22.160 43.136 122.875 1.00 12.15 ? 208 TYR B CD1 1 
ATOM   2704 C CD2 . TYR B 2 208 ? 22.471 41.436 124.573 1.00 14.11 ? 208 TYR B CD2 1 
ATOM   2705 C CE1 . TYR B 2 208 ? 21.117 42.368 122.355 1.00 17.10 ? 208 TYR B CE1 1 
ATOM   2706 C CE2 . TYR B 2 208 ? 21.401 40.700 124.055 1.00 17.27 ? 208 TYR B CE2 1 
ATOM   2707 C CZ  . TYR B 2 208 ? 20.735 41.179 122.942 1.00 16.39 ? 208 TYR B CZ  1 
ATOM   2708 O OH  . TYR B 2 208 ? 19.705 40.473 122.385 1.00 17.42 ? 208 TYR B OH  1 
ATOM   2709 N N   . GLU B 2 209 ? 25.233 44.315 127.213 1.00 12.45 ? 209 GLU B N   1 
ATOM   2710 C CA  . GLU B 2 209 ? 26.420 44.778 127.920 1.00 14.81 ? 209 GLU B CA  1 
ATOM   2711 C C   . GLU B 2 209 ? 27.385 43.595 128.070 1.00 15.54 ? 209 GLU B C   1 
ATOM   2712 O O   . GLU B 2 209 ? 26.957 42.462 128.029 1.00 13.17 ? 209 GLU B O   1 
ATOM   2713 C CB  . GLU B 2 209 ? 26.170 45.401 129.293 1.00 14.68 ? 209 GLU B CB  1 
ATOM   2714 C CG  . GLU B 2 209 ? 25.348 44.477 130.200 1.00 16.35 ? 209 GLU B CG  1 
ATOM   2715 C CD  . GLU B 2 209 ? 25.087 45.201 131.533 1.00 21.57 ? 209 GLU B CD  1 
ATOM   2716 O OE1 . GLU B 2 209 ? 26.032 45.851 132.048 1.00 19.01 ? 209 GLU B OE1 1 
ATOM   2717 O OE2 . GLU B 2 209 ? 23.952 45.073 132.015 1.00 22.74 ? 209 GLU B OE2 1 
ATOM   2718 N N   . VAL B 2 210 ? 28.696 43.862 127.973 1.00 14.02 ? 210 VAL B N   1 
ATOM   2719 C CA  . VAL B 2 210 ? 29.712 42.839 127.890 1.00 12.34 ? 210 VAL B CA  1 
ATOM   2720 C C   . VAL B 2 210 ? 30.857 43.063 128.874 1.00 13.56 ? 210 VAL B C   1 
ATOM   2721 O O   . VAL B 2 210 ? 31.133 44.258 129.172 1.00 13.25 ? 210 VAL B O   1 
ATOM   2722 C CB  . VAL B 2 210 ? 30.259 42.937 126.428 1.00 17.41 ? 210 VAL B CB  1 
ATOM   2723 C CG1 . VAL B 2 210 ? 31.508 42.074 126.261 1.00 17.04 ? 210 VAL B CG1 1 
ATOM   2724 C CG2 . VAL B 2 210 ? 29.167 42.581 125.400 1.00 12.11 ? 210 VAL B CG2 1 
ATOM   2725 N N   . ARG B 2 211 ? 31.422 42.051 129.520 1.00 12.11 ? 211 ARG B N   1 
ATOM   2726 C CA  . ARG B 2 211 ? 32.553 42.320 130.432 1.00 13.77 ? 211 ARG B CA  1 
ATOM   2727 C C   . ARG B 2 211 ? 33.572 41.176 130.259 1.00 13.51 ? 211 ARG B C   1 
ATOM   2728 O O   . ARG B 2 211 ? 33.130 40.085 129.864 1.00 13.58 ? 211 ARG B O   1 
ATOM   2729 C CB  . ARG B 2 211 ? 32.204 42.453 131.917 1.00 13.34 ? 211 ARG B CB  1 
ATOM   2730 C CG  . ARG B 2 211 ? 31.304 41.312 132.436 1.00 17.56 ? 211 ARG B CG  1 
ATOM   2731 C CD  . ARG B 2 211 ? 30.922 41.534 133.904 1.00 19.82 ? 211 ARG B CD  1 
ATOM   2732 N NE  . ARG B 2 211 ? 30.412 40.245 134.475 1.00 21.71 ? 211 ARG B NE  1 
ATOM   2733 C CZ  . ARG B 2 211 ? 29.916 40.266 135.745 1.00 27.08 ? 211 ARG B CZ  1 
ATOM   2734 N NH1 . ARG B 2 211 ? 29.861 41.382 136.501 1.00 24.39 ? 211 ARG B NH1 1 
ATOM   2735 N NH2 . ARG B 2 211 ? 29.478 39.110 136.235 1.00 23.72 ? 211 ARG B NH2 1 
ATOM   2736 N N   . VAL B 2 212 ? 34.847 41.387 130.512 1.00 12.06 ? 212 VAL B N   1 
ATOM   2737 C CA  . VAL B 2 212 ? 35.875 40.371 130.306 1.00 12.77 ? 212 VAL B CA  1 
ATOM   2738 C C   . VAL B 2 212 ? 36.842 40.235 131.466 1.00 13.61 ? 212 VAL B C   1 
ATOM   2739 O O   . VAL B 2 212 ? 37.228 41.279 131.984 1.00 9.90  ? 212 VAL B O   1 
ATOM   2740 C CB  . VAL B 2 212 ? 36.683 40.737 129.023 1.00 14.01 ? 212 VAL B CB  1 
ATOM   2741 C CG1 . VAL B 2 212 ? 37.672 39.632 128.642 1.00 10.27 ? 212 VAL B CG1 1 
ATOM   2742 C CG2 . VAL B 2 212 ? 35.792 40.919 127.746 1.00 13.47 ? 212 VAL B CG2 1 
ATOM   2743 N N   . ARG B 2 213 ? 37.369 39.038 131.820 1.00 13.07 ? 213 ARG B N   1 
ATOM   2744 C CA  . ARG B 2 213 ? 38.360 39.012 132.894 1.00 13.31 ? 213 ARG B CA  1 
ATOM   2745 C C   . ARG B 2 213 ? 39.524 38.136 132.442 1.00 15.82 ? 213 ARG B C   1 
ATOM   2746 O O   . ARG B 2 213 ? 39.287 37.348 131.526 1.00 15.03 ? 213 ARG B O   1 
ATOM   2747 C CB  . ARG B 2 213 ? 37.732 38.493 134.201 1.00 16.17 ? 213 ARG B CB  1 
ATOM   2748 C CG  . ARG B 2 213 ? 37.182 37.050 134.106 1.00 15.44 ? 213 ARG B CG  1 
ATOM   2749 C CD  . ARG B 2 213 ? 36.530 36.661 135.430 1.00 19.85 ? 213 ARG B CD  1 
ATOM   2750 N NE  . ARG B 2 213 ? 35.782 35.415 135.350 1.00 21.61 ? 213 ARG B NE  1 
ATOM   2751 C CZ  . ARG B 2 213 ? 35.151 34.745 136.326 1.00 25.79 ? 213 ARG B CZ  1 
ATOM   2752 N NH1 . ARG B 2 213 ? 35.098 35.146 137.587 1.00 29.76 ? 213 ARG B NH1 1 
ATOM   2753 N NH2 . ARG B 2 213 ? 34.484 33.607 136.091 1.00 25.79 ? 213 ARG B NH2 1 
ATOM   2754 N N   . SER B 2 214 ? 40.679 38.108 133.088 1.00 13.79 ? 214 SER B N   1 
ATOM   2755 C CA  . SER B 2 214 ? 41.757 37.257 132.637 1.00 16.32 ? 214 SER B CA  1 
ATOM   2756 C C   . SER B 2 214 ? 42.326 36.311 133.683 1.00 16.44 ? 214 SER B C   1 
ATOM   2757 O O   . SER B 2 214 ? 42.175 36.611 134.873 1.00 16.70 ? 214 SER B O   1 
ATOM   2758 C CB  . SER B 2 214 ? 43.018 38.076 132.261 1.00 19.16 ? 214 SER B CB  1 
ATOM   2759 O OG  . SER B 2 214 ? 42.768 39.464 132.402 1.00 26.80 ? 214 SER B OG  1 
ATOM   2760 N N   . LYS B 2 215 ? 43.192 35.408 133.211 1.00 16.67 ? 215 LYS B N   1 
ATOM   2761 C CA  . LYS B 2 215 ? 43.878 34.527 134.171 1.00 19.39 ? 215 LYS B CA  1 
ATOM   2762 C C   . LYS B 2 215 ? 45.165 34.101 133.475 1.00 19.70 ? 215 LYS B C   1 
ATOM   2763 O O   . LYS B 2 215 ? 45.139 33.961 132.247 1.00 14.86 ? 215 LYS B O   1 
ATOM   2764 C CB  . LYS B 2 215 ? 42.929 33.327 134.332 1.00 22.07 ? 215 LYS B CB  1 
ATOM   2765 C CG  . LYS B 2 215 ? 43.441 32.164 135.125 1.00 28.02 ? 215 LYS B CG  1 
ATOM   2766 C CD  . LYS B 2 215 ? 42.498 30.961 134.922 1.00 29.69 ? 215 LYS B CD  1 
ATOM   2767 C CE  . LYS B 2 215 ? 42.998 29.839 135.847 1.00 29.85 ? 215 LYS B CE  1 
ATOM   2768 N NZ  . LYS B 2 215 ? 44.429 29.536 135.549 1.00 29.38 ? 215 LYS B NZ  1 
ATOM   2769 N N   . GLN B 2 216 ? 46.179 33.766 134.240 1.00 18.00 ? 216 GLN B N   1 
ATOM   2770 C CA  . GLN B 2 216 ? 47.415 33.172 133.770 1.00 17.88 ? 216 GLN B CA  1 
ATOM   2771 C C   . GLN B 2 216 ? 47.109 31.698 133.472 1.00 19.35 ? 216 GLN B C   1 
ATOM   2772 O O   . GLN B 2 216 ? 46.407 31.017 134.225 1.00 17.81 ? 216 GLN B O   1 
ATOM   2773 C CB  . GLN B 2 216 ? 48.503 33.361 134.822 1.00 20.74 ? 216 GLN B CB  1 
ATOM   2774 C CG  . GLN B 2 216 ? 49.726 32.506 134.785 1.00 27.30 ? 216 GLN B CG  1 
ATOM   2775 C CD  . GLN B 2 216 ? 50.791 32.954 135.770 1.00 31.95 ? 216 GLN B CD  1 
ATOM   2776 O OE1 . GLN B 2 216 ? 51.630 33.800 135.409 1.00 37.48 ? 216 GLN B OE1 1 
ATOM   2777 N NE2 . GLN B 2 216 ? 50.827 32.459 136.995 1.00 34.65 ? 216 GLN B NE2 1 
ATOM   2778 N N   . ARG B 2 217 ? 47.577 31.208 132.337 1.00 17.91 ? 217 ARG B N   1 
ATOM   2779 C CA  . ARG B 2 217 ? 47.268 29.835 131.936 1.00 24.10 ? 217 ARG B CA  1 
ATOM   2780 C C   . ARG B 2 217 ? 47.767 28.794 132.947 1.00 25.13 ? 217 ARG B C   1 
ATOM   2781 O O   . ARG B 2 217 ? 48.908 28.814 133.375 1.00 20.55 ? 217 ARG B O   1 
ATOM   2782 C CB  . ARG B 2 217 ? 47.879 29.453 130.605 1.00 23.87 ? 217 ARG B CB  1 
ATOM   2783 C CG  . ARG B 2 217 ? 47.239 30.097 129.386 1.00 29.47 ? 217 ARG B CG  1 
ATOM   2784 C CD  . ARG B 2 217 ? 46.893 28.901 128.479 1.00 34.46 ? 217 ARG B CD  1 
ATOM   2785 N NE  . ARG B 2 217 ? 47.774 28.779 127.351 1.00 36.52 ? 217 ARG B NE  1 
ATOM   2786 C CZ  . ARG B 2 217 ? 47.673 27.817 126.423 1.00 35.59 ? 217 ARG B CZ  1 
ATOM   2787 N NH1 . ARG B 2 217 ? 46.772 26.855 126.466 1.00 32.60 ? 217 ARG B NH1 1 
ATOM   2788 N NH2 . ARG B 2 217 ? 48.549 27.933 125.453 1.00 34.22 ? 217 ARG B NH2 1 
ATOM   2789 N N   . ASN B 2 218 ? 46.849 27.905 133.280 1.00 28.72 ? 218 ASN B N   1 
ATOM   2790 C CA  . ASN B 2 218 ? 47.038 26.858 134.262 1.00 34.34 ? 218 ASN B CA  1 
ATOM   2791 C C   . ASN B 2 218 ? 47.434 27.261 135.660 1.00 34.62 ? 218 ASN B C   1 
ATOM   2792 O O   . ASN B 2 218 ? 47.881 26.321 136.360 1.00 38.10 ? 218 ASN B O   1 
ATOM   2793 C CB  . ASN B 2 218 ? 48.040 25.800 133.683 1.00 37.82 ? 218 ASN B CB  1 
ATOM   2794 C CG  . ASN B 2 218 ? 47.320 25.167 132.483 1.00 40.13 ? 218 ASN B CG  1 
ATOM   2795 O OD1 . ASN B 2 218 ? 47.598 25.505 131.334 1.00 41.71 ? 218 ASN B OD1 1 
ATOM   2796 N ND2 . ASN B 2 218 ? 46.338 24.315 132.715 1.00 40.50 ? 218 ASN B ND2 1 
ATOM   2797 N N   . SER B 2 219 ? 47.281 28.494 136.146 1.00 33.25 ? 219 SER B N   1 
ATOM   2798 C CA  . SER B 2 219 ? 47.666 28.758 137.537 1.00 31.01 ? 219 SER B CA  1 
ATOM   2799 C C   . SER B 2 219 ? 46.981 29.976 138.141 1.00 30.39 ? 219 SER B C   1 
ATOM   2800 O O   . SER B 2 219 ? 46.374 30.745 137.413 1.00 26.30 ? 219 SER B O   1 
ATOM   2801 C CB  . SER B 2 219 ? 49.179 28.803 137.675 1.00 33.32 ? 219 SER B CB  1 
ATOM   2802 O OG  . SER B 2 219 ? 49.808 29.794 136.883 1.00 35.05 ? 219 SER B OG  1 
ATOM   2803 N N   . GLY B 2 220 ? 46.996 30.127 139.477 1.00 26.03 ? 220 GLY B N   1 
ATOM   2804 C CA  . GLY B 2 220 ? 46.306 31.233 140.111 1.00 24.88 ? 220 GLY B CA  1 
ATOM   2805 C C   . GLY B 2 220 ? 44.827 31.223 139.767 1.00 25.78 ? 220 GLY B C   1 
ATOM   2806 O O   . GLY B 2 220 ? 44.193 30.192 139.487 1.00 26.99 ? 220 GLY B O   1 
ATOM   2807 N N   . ASN B 2 221 ? 44.167 32.354 139.892 1.00 23.93 ? 221 ASN B N   1 
ATOM   2808 C CA  . ASN B 2 221 ? 42.747 32.457 139.621 1.00 25.30 ? 221 ASN B CA  1 
ATOM   2809 C C   . ASN B 2 221 ? 42.410 33.591 138.642 1.00 21.13 ? 221 ASN B C   1 
ATOM   2810 O O   . ASN B 2 221 ? 43.236 34.458 138.390 1.00 21.07 ? 221 ASN B O   1 
ATOM   2811 C CB  . ASN B 2 221 ? 42.025 32.718 140.949 1.00 27.22 ? 221 ASN B CB  1 
ATOM   2812 C CG  . ASN B 2 221 ? 42.032 31.465 141.827 1.00 33.44 ? 221 ASN B CG  1 
ATOM   2813 O OD1 . ASN B 2 221 ? 41.361 30.471 141.491 1.00 35.59 ? 221 ASN B OD1 1 
ATOM   2814 N ND2 . ASN B 2 221 ? 42.848 31.584 142.865 1.00 30.04 ? 221 ASN B ND2 1 
ATOM   2815 N N   . TYR B 2 222 ? 41.181 33.627 138.156 1.00 20.37 ? 222 TYR B N   1 
ATOM   2816 C CA  . TYR B 2 222 ? 40.734 34.818 137.390 1.00 20.03 ? 222 TYR B CA  1 
ATOM   2817 C C   . TYR B 2 222 ? 40.792 36.071 138.273 1.00 20.84 ? 222 TYR B C   1 
ATOM   2818 O O   . TYR B 2 222 ? 40.350 35.997 139.408 1.00 18.07 ? 222 TYR B O   1 
ATOM   2819 C CB  . TYR B 2 222 ? 39.280 34.687 136.932 1.00 20.67 ? 222 TYR B CB  1 
ATOM   2820 C CG  . TYR B 2 222 ? 39.191 33.853 135.666 1.00 23.96 ? 222 TYR B CG  1 
ATOM   2821 C CD1 . TYR B 2 222 ? 39.664 34.356 134.462 1.00 24.34 ? 222 TYR B CD1 1 
ATOM   2822 C CD2 . TYR B 2 222 ? 38.716 32.552 135.700 1.00 24.86 ? 222 TYR B CD2 1 
ATOM   2823 C CE1 . TYR B 2 222 ? 39.653 33.630 133.286 1.00 25.01 ? 222 TYR B CE1 1 
ATOM   2824 C CE2 . TYR B 2 222 ? 38.695 31.794 134.529 1.00 27.19 ? 222 TYR B CE2 1 
ATOM   2825 C CZ  . TYR B 2 222 ? 39.167 32.329 133.355 1.00 26.52 ? 222 TYR B CZ  1 
ATOM   2826 O OH  . TYR B 2 222 ? 39.158 31.547 132.232 1.00 31.43 ? 222 TYR B OH  1 
ATOM   2827 N N   . GLY B 2 223 ? 41.106 37.229 137.736 1.00 18.21 ? 223 GLY B N   1 
ATOM   2828 C CA  . GLY B 2 223 ? 41.066 38.515 138.367 1.00 15.27 ? 223 GLY B CA  1 
ATOM   2829 C C   . GLY B 2 223 ? 39.680 39.167 138.208 1.00 15.72 ? 223 GLY B C   1 
ATOM   2830 O O   . GLY B 2 223 ? 38.717 38.540 137.790 1.00 15.03 ? 223 GLY B O   1 
ATOM   2831 N N   . GLU B 2 224 ? 39.575 40.443 138.521 1.00 17.22 ? 224 GLU B N   1 
ATOM   2832 C CA  . GLU B 2 224 ? 38.333 41.190 138.401 1.00 19.90 ? 224 GLU B CA  1 
ATOM   2833 C C   . GLU B 2 224 ? 37.919 41.434 136.935 1.00 18.31 ? 224 GLU B C   1 
ATOM   2834 O O   . GLU B 2 224 ? 38.789 41.516 136.061 1.00 16.25 ? 224 GLU B O   1 
ATOM   2835 C CB  . GLU B 2 224 ? 38.607 42.582 138.998 1.00 25.06 ? 224 GLU B CB  1 
ATOM   2836 C CG  . GLU B 2 224 ? 39.141 42.491 140.438 1.00 32.17 ? 224 GLU B CG  1 
ATOM   2837 C CD  . GLU B 2 224 ? 37.916 42.521 141.336 1.00 38.04 ? 224 GLU B CD  1 
ATOM   2838 O OE1 . GLU B 2 224 ? 37.266 41.481 141.508 1.00 42.01 ? 224 GLU B OE1 1 
ATOM   2839 O OE2 . GLU B 2 224 ? 37.586 43.631 141.806 1.00 44.71 ? 224 GLU B OE2 1 
ATOM   2840 N N   . PHE B 2 225 ? 36.640 41.642 136.714 1.00 19.23 ? 225 PHE B N   1 
ATOM   2841 C CA  . PHE B 2 225 ? 36.078 42.010 135.435 1.00 19.89 ? 225 PHE B CA  1 
ATOM   2842 C C   . PHE B 2 225 ? 36.488 43.413 135.003 1.00 21.08 ? 225 PHE B C   1 
ATOM   2843 O O   . PHE B 2 225 ? 36.634 44.334 135.800 1.00 20.16 ? 225 PHE B O   1 
ATOM   2844 C CB  . PHE B 2 225 ? 34.555 41.922 135.369 1.00 17.28 ? 225 PHE B CB  1 
ATOM   2845 C CG  . PHE B 2 225 ? 34.019 40.515 135.321 1.00 19.11 ? 225 PHE B CG  1 
ATOM   2846 C CD1 . PHE B 2 225 ? 34.078 39.760 134.151 1.00 20.88 ? 225 PHE B CD1 1 
ATOM   2847 C CD2 . PHE B 2 225 ? 33.490 39.932 136.447 1.00 20.17 ? 225 PHE B CD2 1 
ATOM   2848 C CE1 . PHE B 2 225 ? 33.584 38.473 134.140 1.00 24.80 ? 225 PHE B CE1 1 
ATOM   2849 C CE2 . PHE B 2 225 ? 33.008 38.647 136.433 1.00 23.33 ? 225 PHE B CE2 1 
ATOM   2850 C CZ  . PHE B 2 225 ? 33.072 37.890 135.291 1.00 22.34 ? 225 PHE B CZ  1 
ATOM   2851 N N   . SER B 2 226 ? 36.607 43.620 133.689 1.00 16.74 ? 226 SER B N   1 
ATOM   2852 C CA  . SER B 2 226 ? 36.860 44.905 133.079 1.00 15.68 ? 226 SER B CA  1 
ATOM   2853 C C   . SER B 2 226 ? 35.663 45.828 133.337 1.00 17.12 ? 226 SER B C   1 
ATOM   2854 O O   . SER B 2 226 ? 34.638 45.308 133.777 1.00 15.27 ? 226 SER B O   1 
ATOM   2855 C CB  . SER B 2 226 ? 36.869 44.771 131.526 1.00 16.65 ? 226 SER B CB  1 
ATOM   2856 O OG  . SER B 2 226 ? 35.585 44.342 131.046 1.00 15.34 ? 226 SER B OG  1 
ATOM   2857 N N   . GLU B 2 227 ? 35.769 47.101 132.949 1.00 19.03 ? 227 GLU B N   1 
ATOM   2858 C CA  . GLU B 2 227 ? 34.545 47.949 133.010 1.00 22.83 ? 227 GLU B CA  1 
ATOM   2859 C C   . GLU B 2 227 ? 33.545 47.403 131.981 1.00 18.42 ? 227 GLU B C   1 
ATOM   2860 O O   . GLU B 2 227 ? 33.986 46.763 131.007 1.00 18.50 ? 227 GLU B O   1 
ATOM   2861 C CB  . GLU B 2 227 ? 34.874 49.407 132.645 1.00 23.50 ? 227 GLU B CB  1 
ATOM   2862 N N   . VAL B 2 228 ? 32.247 47.592 132.172 1.00 20.08 ? 228 VAL B N   1 
ATOM   2863 C CA  . VAL B 2 228 ? 31.306 47.073 131.216 1.00 21.51 ? 228 VAL B CA  1 
ATOM   2864 C C   . VAL B 2 228 ? 31.304 47.899 129.905 1.00 21.87 ? 228 VAL B C   1 
ATOM   2865 O O   . VAL B 2 228 ? 31.427 49.110 129.955 1.00 17.14 ? 228 VAL B O   1 
ATOM   2866 C CB  . VAL B 2 228 ? 29.886 46.816 131.699 1.00 25.62 ? 228 VAL B CB  1 
ATOM   2867 C CG1 . VAL B 2 228 ? 29.818 46.282 133.156 1.00 23.05 ? 228 VAL B CG1 1 
ATOM   2868 C CG2 . VAL B 2 228 ? 28.966 47.994 131.545 1.00 28.59 ? 228 VAL B CG2 1 
ATOM   2869 N N   . LEU B 2 229 ? 31.105 47.157 128.799 1.00 13.57 ? 229 LEU B N   1 
ATOM   2870 C CA  . LEU B 2 229 ? 30.920 47.805 127.519 1.00 15.18 ? 229 LEU B CA  1 
ATOM   2871 C C   . LEU B 2 229 ? 29.454 47.665 127.125 1.00 14.65 ? 229 LEU B C   1 
ATOM   2872 O O   . LEU B 2 229 ? 28.913 46.546 127.051 1.00 13.73 ? 229 LEU B O   1 
ATOM   2873 C CB  . LEU B 2 229 ? 31.829 47.113 126.463 1.00 13.95 ? 229 LEU B CB  1 
ATOM   2874 C CG  . LEU B 2 229 ? 31.586 47.519 124.995 1.00 18.04 ? 229 LEU B CG  1 
ATOM   2875 C CD1 . LEU B 2 229 ? 32.216 48.922 124.773 1.00 15.94 ? 229 LEU B CD1 1 
ATOM   2876 C CD2 . LEU B 2 229 ? 32.216 46.513 124.037 1.00 15.57 ? 229 LEU B CD2 1 
ATOM   2877 N N   . TYR B 2 230 ? 28.801 48.782 126.871 1.00 14.43 ? 230 TYR B N   1 
ATOM   2878 C CA  . TYR B 2 230 ? 27.407 48.784 126.419 1.00 12.81 ? 230 TYR B CA  1 
ATOM   2879 C C   . TYR B 2 230 ? 27.279 48.568 124.896 1.00 14.59 ? 230 TYR B C   1 
ATOM   2880 O O   . TYR B 2 230 ? 27.983 49.242 124.151 1.00 11.51 ? 230 TYR B O   1 
ATOM   2881 C CB  . TYR B 2 230 ? 26.686 50.066 126.809 1.00 12.18 ? 230 TYR B CB  1 
ATOM   2882 C CG  . TYR B 2 230 ? 26.285 50.070 128.273 1.00 15.35 ? 230 TYR B CG  1 
ATOM   2883 C CD1 . TYR B 2 230 ? 25.412 49.110 128.787 1.00 16.38 ? 230 TYR B CD1 1 
ATOM   2884 C CD2 . TYR B 2 230 ? 26.853 50.946 129.155 1.00 16.79 ? 230 TYR B CD2 1 
ATOM   2885 C CE1 . TYR B 2 230 ? 25.062 49.066 130.119 1.00 17.13 ? 230 TYR B CE1 1 
ATOM   2886 C CE2 . TYR B 2 230 ? 26.545 50.930 130.527 1.00 16.08 ? 230 TYR B CE2 1 
ATOM   2887 C CZ  . TYR B 2 230 ? 25.661 49.964 130.974 1.00 19.23 ? 230 TYR B CZ  1 
ATOM   2888 O OH  . TYR B 2 230 ? 25.332 49.954 132.298 1.00 20.19 ? 230 TYR B OH  1 
ATOM   2889 N N   . VAL B 2 231 ? 26.349 47.757 124.437 1.00 14.45 ? 231 VAL B N   1 
ATOM   2890 C CA  . VAL B 2 231 ? 26.142 47.519 123.003 1.00 14.62 ? 231 VAL B CA  1 
ATOM   2891 C C   . VAL B 2 231 ? 24.740 47.939 122.572 1.00 14.63 ? 231 VAL B C   1 
ATOM   2892 O O   . VAL B 2 231 ? 23.755 47.307 122.945 1.00 15.93 ? 231 VAL B O   1 
ATOM   2893 C CB  . VAL B 2 231 ? 26.335 46.041 122.622 1.00 16.05 ? 231 VAL B CB  1 
ATOM   2894 C CG1 . VAL B 2 231 ? 26.124 45.825 121.119 1.00 14.54 ? 231 VAL B CG1 1 
ATOM   2895 C CG2 . VAL B 2 231 ? 27.733 45.557 123.032 1.00 11.89 ? 231 VAL B CG2 1 
ATOM   2896 N N   . THR B 2 232 ? 24.660 48.972 121.768 1.00 15.28 ? 232 THR B N   1 
ATOM   2897 C CA  . THR B 2 232 ? 23.384 49.435 121.218 1.00 20.09 ? 232 THR B CA  1 
ATOM   2898 C C   . THR B 2 232 ? 23.481 49.374 119.697 1.00 18.18 ? 232 THR B C   1 
ATOM   2899 O O   . THR B 2 232 ? 24.230 50.130 119.092 1.00 16.28 ? 232 THR B O   1 
ATOM   2900 C CB  . THR B 2 232 ? 23.069 50.861 121.727 1.00 24.26 ? 232 THR B CB  1 
ATOM   2901 O OG1 . THR B 2 232 ? 23.082 50.896 123.178 1.00 27.44 ? 232 THR B OG1 1 
ATOM   2902 C CG2 . THR B 2 232 ? 21.681 51.332 121.400 1.00 29.32 ? 232 THR B CG2 1 
ATOM   2903 N N   . LEU B 2 233 ? 22.757 48.479 119.062 1.00 16.97 ? 233 LEU B N   1 
ATOM   2904 C CA  . LEU B 2 233 ? 22.806 48.204 117.633 1.00 20.13 ? 233 LEU B CA  1 
ATOM   2905 C C   . LEU B 2 233 ? 21.894 49.147 116.857 1.00 18.58 ? 233 LEU B C   1 
ATOM   2906 O O   . LEU B 2 233 ? 20.877 49.507 117.422 1.00 23.12 ? 233 LEU B O   1 
ATOM   2907 C CB  . LEU B 2 233 ? 22.347 46.749 117.391 1.00 16.18 ? 233 LEU B CB  1 
ATOM   2908 C CG  . LEU B 2 233 ? 23.264 45.736 118.110 1.00 21.48 ? 233 LEU B CG  1 
ATOM   2909 C CD1 . LEU B 2 233 ? 22.483 44.465 118.494 1.00 21.57 ? 233 LEU B CD1 1 
ATOM   2910 C CD2 . LEU B 2 233 ? 24.467 45.401 117.283 1.00 18.34 ? 233 LEU B CD2 1 
ATOM   2911 N N   . PRO B 2 234 ? 22.257 49.655 115.704 1.00 19.72 ? 234 PRO B N   1 
ATOM   2912 C CA  . PRO B 2 234 ? 21.332 50.441 114.897 1.00 20.56 ? 234 PRO B CA  1 
ATOM   2913 C C   . PRO B 2 234 ? 20.119 49.592 114.504 1.00 21.02 ? 234 PRO B C   1 
ATOM   2914 O O   . PRO B 2 234 ? 20.194 48.359 114.417 1.00 18.57 ? 234 PRO B O   1 
ATOM   2915 C CB  . PRO B 2 234 ? 22.139 50.855 113.682 1.00 21.36 ? 234 PRO B CB  1 
ATOM   2916 C CG  . PRO B 2 234 ? 23.175 49.788 113.540 1.00 22.84 ? 234 PRO B CG  1 
ATOM   2917 C CD  . PRO B 2 234 ? 23.467 49.238 114.925 1.00 20.48 ? 234 PRO B CD  1 
ATOM   2918 N N   . GLN B 2 235 ? 18.971 50.225 114.259 1.00 21.79 ? 235 GLN B N   1 
ATOM   2919 C CA  . GLN B 2 235 ? 17.813 49.462 113.836 1.00 25.55 ? 235 GLN B CA  1 
ATOM   2920 C C   . GLN B 2 235 ? 16.873 50.303 112.978 1.00 27.40 ? 235 GLN B C   1 
ATOM   2921 O O   . GLN B 2 235 ? 16.692 51.474 113.287 1.00 26.45 ? 235 GLN B O   1 
ATOM   2922 C CB  . GLN B 2 235 ? 17.016 48.940 115.038 1.00 28.00 ? 235 GLN B CB  1 
ATOM   2923 C CG  . GLN B 2 235 ? 16.429 49.997 115.957 1.00 34.17 ? 235 GLN B CG  1 
ATOM   2924 C CD  . GLN B 2 235 ? 17.311 50.590 117.036 1.00 38.22 ? 235 GLN B CD  1 
ATOM   2925 O OE1 . GLN B 2 235 ? 17.584 51.794 117.153 1.00 39.58 ? 235 GLN B OE1 1 
ATOM   2926 N NE2 . GLN B 2 235 ? 17.810 49.795 117.992 1.00 38.92 ? 235 GLN B NE2 1 
ATOM   2927 N N   . MET B 2 236 ? 16.134 49.610 112.110 1.00 29.77 ? 236 MET B N   1 
ATOM   2928 C CA  . MET B 2 236 ? 15.125 50.328 111.325 1.00 35.32 ? 236 MET B CA  1 
ATOM   2929 C C   . MET B 2 236 ? 13.929 49.405 111.003 1.00 36.98 ? 236 MET B C   1 
ATOM   2930 O O   . MET B 2 236 ? 12.827 50.033 110.895 1.00 39.56 ? 236 MET B O   1 
ATOM   2931 C CB  . MET B 2 236 ? 15.769 50.974 110.106 1.00 33.87 ? 236 MET B CB  1 
ATOM   2932 C CG  . MET B 2 236 ? 15.741 50.299 108.782 1.00 32.64 ? 236 MET B CG  1 
ATOM   2933 S SD  . MET B 2 236 ? 16.692 51.122 107.464 1.00 35.43 ? 236 MET B SD  1 
ATOM   2934 C CE  . MET B 2 236 ? 17.530 49.671 106.801 1.00 33.11 ? 236 MET B CE  1 
HETATM 2935 S S   . SO4 C 3 .   ? 17.243 37.610 110.949 1.00 51.08 ? 237 SO4 B S   1 
HETATM 2936 O O1  . SO4 C 3 .   ? 16.802 36.679 112.010 1.00 50.36 ? 237 SO4 B O1  1 
HETATM 2937 O O2  . SO4 C 3 .   ? 17.519 36.890 109.653 1.00 55.01 ? 237 SO4 B O2  1 
HETATM 2938 O O3  . SO4 C 3 .   ? 18.449 38.432 111.268 1.00 50.21 ? 237 SO4 B O3  1 
HETATM 2939 O O4  . SO4 C 3 .   ? 16.119 38.593 110.596 1.00 52.91 ? 237 SO4 B O4  1 
HETATM 2940 O O   . HOH D 4 .   ? 49.309 23.459 142.223 1.00 16.35 ? 192 HOH A O   1 
HETATM 2941 O O   . HOH D 4 .   ? 59.188 20.469 118.799 1.00 19.74 ? 193 HOH A O   1 
HETATM 2942 O O   . HOH D 4 .   ? 52.229 19.945 113.792 1.00 23.15 ? 194 HOH A O   1 
HETATM 2943 O O   . HOH D 4 .   ? 59.467 24.420 112.371 1.00 21.50 ? 195 HOH A O   1 
HETATM 2944 O O   . HOH D 4 .   ? 66.850 11.218 135.205 1.00 23.40 ? 196 HOH A O   1 
HETATM 2945 O O   . HOH D 4 .   ? 61.912 20.406 118.100 1.00 23.94 ? 197 HOH A O   1 
HETATM 2946 O O   . HOH D 4 .   ? 52.140 24.909 114.145 1.00 26.14 ? 198 HOH A O   1 
HETATM 2947 O O   . HOH D 4 .   ? 51.200 25.167 121.176 1.00 26.77 ? 199 HOH A O   1 
HETATM 2948 O O   . HOH D 4 .   ? 55.754 29.333 117.388 1.00 25.19 ? 200 HOH A O   1 
HETATM 2949 O O   . HOH D 4 .   ? 59.498 38.615 138.318 1.00 24.25 ? 201 HOH A O   1 
HETATM 2950 O O   . HOH D 4 .   ? 55.387 28.801 133.737 1.00 28.34 ? 202 HOH A O   1 
HETATM 2951 O O   . HOH D 4 .   ? 59.294 29.679 153.519 1.00 30.22 ? 203 HOH A O   1 
HETATM 2952 O O   . HOH D 4 .   ? 56.120 23.942 143.546 1.00 29.17 ? 204 HOH A O   1 
HETATM 2953 O O   . HOH D 4 .   ? 66.246 41.653 131.466 1.00 36.50 ? 205 HOH A O   1 
HETATM 2954 O O   . HOH D 4 .   ? 54.677 29.650 129.665 1.00 29.85 ? 206 HOH A O   1 
HETATM 2955 O O   . HOH D 4 .   ? 42.004 16.177 146.410 1.00 29.37 ? 207 HOH A O   1 
HETATM 2956 O O   . HOH D 4 .   ? 72.694 16.358 141.289 1.00 34.30 ? 208 HOH A O   1 
HETATM 2957 O O   . HOH D 4 .   ? 62.238 17.773 117.209 1.00 33.65 ? 209 HOH A O   1 
HETATM 2958 O O   . HOH D 4 .   ? 53.257 26.173 147.622 1.00 34.41 ? 210 HOH A O   1 
HETATM 2959 O O   . HOH D 4 .   ? 68.515 20.435 114.839 1.00 32.81 ? 211 HOH A O   1 
HETATM 2960 O O   . HOH D 4 .   ? 60.428 13.826 120.060 1.00 31.44 ? 212 HOH A O   1 
HETATM 2961 O O   . HOH D 4 .   ? 64.666 35.979 142.005 1.00 31.83 ? 213 HOH A O   1 
HETATM 2962 O O   . HOH D 4 .   ? 49.251 27.806 148.990 1.00 31.64 ? 214 HOH A O   1 
HETATM 2963 O O   . HOH D 4 .   ? 40.983 14.318 145.183 1.00 37.95 ? 215 HOH A O   1 
HETATM 2964 O O   . HOH D 4 .   ? 66.125 18.193 111.797 1.00 39.62 ? 216 HOH A O   1 
HETATM 2965 O O   . HOH D 4 .   ? 71.462 32.057 122.055 1.00 37.96 ? 217 HOH A O   1 
HETATM 2966 O O   . HOH D 4 .   ? 63.578 42.094 130.924 1.00 40.33 ? 218 HOH A O   1 
HETATM 2967 O O   . HOH D 4 .   ? 43.218 21.519 134.706 1.00 40.11 ? 219 HOH A O   1 
HETATM 2968 O O   . HOH D 4 .   ? 64.396 16.679 146.132 1.00 33.42 ? 220 HOH A O   1 
HETATM 2969 O O   . HOH D 4 .   ? 51.577 26.531 131.165 1.00 37.43 ? 221 HOH A O   1 
HETATM 2970 O O   . HOH D 4 .   ? 77.383 12.270 137.359 1.00 40.89 ? 222 HOH A O   1 
HETATM 2971 O O   . HOH D 4 .   ? 53.593 31.163 116.205 1.00 42.09 ? 223 HOH A O   1 
HETATM 2972 O O   . HOH D 4 .   ? 41.815 18.773 142.735 1.00 47.01 ? 224 HOH A O   1 
HETATM 2973 O O   . HOH D 4 .   ? 56.020 13.209 119.232 1.00 41.61 ? 225 HOH A O   1 
HETATM 2974 O O   . HOH D 4 .   ? 61.665 21.445 110.339 1.00 42.17 ? 226 HOH A O   1 
HETATM 2975 O O   . HOH D 4 .   ? 70.045 34.891 122.539 1.00 40.22 ? 227 HOH A O   1 
HETATM 2976 O O   . HOH D 4 .   ? 60.238 10.202 122.218 1.00 52.97 ? 228 HOH A O   1 
HETATM 2977 O O   . HOH D 4 .   ? 53.664 26.842 112.105 1.00 41.38 ? 229 HOH A O   1 
HETATM 2978 O O   . HOH D 4 .   ? 75.612 12.308 134.652 1.00 40.66 ? 230 HOH A O   1 
HETATM 2979 O O   . HOH D 4 .   ? 73.683 19.463 137.854 1.00 43.87 ? 231 HOH A O   1 
HETATM 2980 O O   . HOH D 4 .   ? 72.915 16.271 126.526 1.00 53.10 ? 232 HOH A O   1 
HETATM 2981 O O   . HOH D 4 .   ? 57.146 23.422 109.243 1.00 40.91 ? 233 HOH A O   1 
HETATM 2982 O O   . HOH D 4 .   ? 60.659 13.798 148.410 1.00 43.74 ? 234 HOH A O   1 
HETATM 2983 O O   . HOH D 4 .   ? 50.462 35.744 124.664 1.00 40.84 ? 235 HOH A O   1 
HETATM 2984 O O   . HOH D 4 .   ? 43.456 23.829 146.662 1.00 44.30 ? 236 HOH A O   1 
HETATM 2985 O O   . HOH D 4 .   ? 52.292 27.790 121.012 1.00 45.35 ? 237 HOH A O   1 
HETATM 2986 O O   . HOH D 4 .   ? 51.530 32.533 120.204 1.00 55.41 ? 238 HOH A O   1 
HETATM 2987 O O   . HOH D 4 .   ? 38.839 10.960 137.357 1.00 39.53 ? 239 HOH A O   1 
HETATM 2988 O O   . HOH D 4 .   ? 68.943 10.787 128.213 1.00 63.57 ? 240 HOH A O   1 
HETATM 2989 O O   . HOH D 4 .   ? 65.779 7.679  129.737 1.00 62.11 ? 241 HOH A O   1 
HETATM 2990 O O   . HOH D 4 .   ? 67.842 12.287 137.830 1.00 35.86 ? 242 HOH A O   1 
HETATM 2991 O O   . HOH D 4 .   ? 67.426 25.265 140.574 1.00 35.71 ? 243 HOH A O   1 
HETATM 2992 O O   . HOH D 4 .   ? 66.597 34.898 139.937 1.00 38.51 ? 244 HOH A O   1 
HETATM 2993 O O   . HOH D 4 .   ? 46.732 23.676 135.797 1.00 33.19 ? 245 HOH A O   1 
HETATM 2994 O O   . HOH D 4 .   ? 47.401 13.960 143.269 1.00 39.66 ? 246 HOH A O   1 
HETATM 2995 O O   . HOH D 4 .   ? 53.356 18.009 140.696 1.00 29.12 ? 247 HOH A O   1 
HETATM 2996 O O   . HOH D 4 .   ? 62.055 41.207 137.662 1.00 46.03 ? 248 HOH A O   1 
HETATM 2997 O O   . HOH D 4 .   ? 47.504 10.740 144.283 1.00 39.57 ? 249 HOH A O   1 
HETATM 2998 O O   . HOH D 4 .   ? 63.595 38.258 126.416 1.00 55.02 ? 250 HOH A O   1 
HETATM 2999 O O   . HOH D 4 .   ? 54.524 27.610 142.071 1.00 28.60 ? 251 HOH A O   1 
HETATM 3000 O O   . HOH D 4 .   ? 50.355 34.058 121.721 1.00 39.95 ? 252 HOH A O   1 
HETATM 3001 O O   . HOH D 4 .   ? 61.241 15.369 117.894 1.00 53.94 ? 253 HOH A O   1 
HETATM 3002 O O   . HOH D 4 .   ? 43.701 19.601 140.856 1.00 43.20 ? 254 HOH A O   1 
HETATM 3003 O O   . HOH D 4 .   ? 58.280 9.565  124.112 1.00 33.98 ? 255 HOH A O   1 
HETATM 3004 O O   . HOH D 4 .   ? 48.702 13.384 127.937 1.00 56.02 ? 256 HOH A O   1 
HETATM 3005 O O   . HOH D 4 .   ? 45.867 18.768 134.097 1.00 39.67 ? 257 HOH A O   1 
HETATM 3006 O O   . HOH D 4 .   ? 64.125 18.896 141.598 1.00 31.84 ? 258 HOH A O   1 
HETATM 3007 O O   . HOH D 4 .   ? 51.328 5.976  137.761 1.00 49.72 ? 259 HOH A O   1 
HETATM 3008 O O   . HOH D 4 .   ? 64.507 40.491 126.431 1.00 57.79 ? 260 HOH A O   1 
HETATM 3009 O O   . HOH D 4 .   ? 46.625 23.049 146.735 1.00 44.71 ? 261 HOH A O   1 
HETATM 3010 O O   . HOH D 4 .   ? 50.184 36.470 122.404 1.00 46.57 ? 262 HOH A O   1 
HETATM 3011 O O   . HOH D 4 .   ? 50.674 25.081 148.430 1.00 45.71 ? 263 HOH A O   1 
HETATM 3012 O O   . HOH D 4 .   ? 65.377 33.378 115.106 1.00 50.21 ? 264 HOH A O   1 
HETATM 3013 O O   . HOH D 4 .   ? 60.612 4.110  131.891 1.00 48.89 ? 265 HOH A O   1 
HETATM 3014 O O   . HOH D 4 .   ? 45.956 12.705 144.831 1.00 46.92 ? 266 HOH A O   1 
HETATM 3015 O O   . HOH D 4 .   ? 63.558 39.257 119.021 1.00 64.72 ? 267 HOH A O   1 
HETATM 3016 O O   . HOH D 4 .   ? 43.504 10.093 136.751 1.00 52.01 ? 268 HOH A O   1 
HETATM 3017 O O   . HOH D 4 .   ? 51.842 29.191 114.629 1.00 48.70 ? 269 HOH A O   1 
HETATM 3018 O O   . HOH D 4 .   ? 68.120 10.277 139.726 1.00 27.19 ? 270 HOH A O   1 
HETATM 3019 O O   . HOH D 4 .   ? 66.181 25.181 107.653 1.00 65.03 ? 271 HOH A O   1 
HETATM 3020 O O   . HOH D 4 .   ? 70.515 40.521 138.333 1.00 49.79 ? 272 HOH A O   1 
HETATM 3021 O O   . HOH D 4 .   ? 44.295 16.377 132.819 1.00 42.46 ? 273 HOH A O   1 
HETATM 3022 O O   . HOH D 4 .   ? 66.558 8.778  140.745 1.00 47.98 ? 274 HOH A O   1 
HETATM 3023 O O   . HOH D 4 .   ? 76.224 25.341 138.109 1.00 56.19 ? 275 HOH A O   1 
HETATM 3024 O O   . HOH D 4 .   ? 75.543 31.874 125.632 1.00 61.48 ? 276 HOH A O   1 
HETATM 3025 O O   . HOH D 4 .   ? 72.178 36.514 122.981 1.00 53.76 ? 277 HOH A O   1 
HETATM 3026 O O   . HOH D 4 .   ? 55.884 8.926  123.125 1.00 58.58 ? 278 HOH A O   1 
HETATM 3027 O O   . HOH D 4 .   ? 62.337 18.259 148.110 1.00 41.31 ? 279 HOH A O   1 
HETATM 3028 O O   . HOH D 4 .   ? 66.764 32.019 141.549 1.00 49.12 ? 280 HOH A O   1 
HETATM 3029 O O   . HOH D 4 .   ? 68.621 9.734  133.328 1.00 58.40 ? 281 HOH A O   1 
HETATM 3030 O O   . HOH D 4 .   ? 48.978 24.221 121.851 1.00 49.92 ? 282 HOH A O   1 
HETATM 3031 O O   . HOH D 4 .   ? 69.294 37.726 126.112 1.00 43.70 ? 283 HOH A O   1 
HETATM 3032 O O   . HOH D 4 .   ? 50.055 33.330 117.345 1.00 53.30 ? 284 HOH A O   1 
HETATM 3033 O O   . HOH D 4 .   ? 76.824 30.442 129.388 1.00 50.94 ? 285 HOH A O   1 
HETATM 3034 O O   . HOH D 4 .   ? 59.469 6.888  125.360 1.00 47.33 ? 286 HOH A O   1 
HETATM 3035 O O   . HOH D 4 .   ? 53.822 26.684 139.728 1.00 37.62 ? 287 HOH A O   1 
HETATM 3036 O O   . HOH D 4 .   ? 61.861 30.759 112.257 1.00 53.29 ? 288 HOH A O   1 
HETATM 3037 O O   . HOH D 4 .   ? 69.217 13.796 146.353 1.00 47.15 ? 289 HOH A O   1 
HETATM 3038 O O   . HOH D 4 .   ? 66.942 31.645 113.952 1.00 57.11 ? 290 HOH A O   1 
HETATM 3039 O O   . HOH D 4 .   ? 63.458 3.649  129.801 1.00 70.35 ? 291 HOH A O   1 
HETATM 3040 O O   . HOH D 4 .   ? 73.287 16.246 129.448 1.00 50.90 ? 292 HOH A O   1 
HETATM 3041 O O   . HOH D 4 .   ? 57.069 22.178 131.371 1.00 37.52 ? 293 HOH A O   1 
HETATM 3042 O O   . HOH D 4 .   ? 54.113 44.752 115.005 1.00 65.94 ? 294 HOH A O   1 
HETATM 3043 O O   . HOH D 4 .   ? 43.537 9.237  132.866 1.00 61.31 ? 295 HOH A O   1 
HETATM 3044 O O   . HOH D 4 .   ? 66.822 16.169 147.126 1.00 56.91 ? 296 HOH A O   1 
HETATM 3045 O O   . HOH D 4 .   ? 61.662 43.498 135.254 1.00 55.36 ? 297 HOH A O   1 
HETATM 3046 O O   . HOH D 4 .   ? 64.226 40.595 123.848 1.00 62.32 ? 298 HOH A O   1 
HETATM 3047 O O   . HOH D 4 .   ? 66.612 36.497 144.091 1.00 52.20 ? 299 HOH A O   1 
HETATM 3048 O O   . HOH D 4 .   ? 72.312 39.782 128.788 1.00 45.65 ? 300 HOH A O   1 
HETATM 3049 O O   . HOH D 4 .   ? 74.357 32.543 122.412 1.00 57.72 ? 301 HOH A O   1 
HETATM 3050 O O   . HOH D 4 .   ? 53.055 28.960 123.184 1.00 52.69 ? 302 HOH A O   1 
HETATM 3051 O O   . HOH D 4 .   ? 67.439 28.273 143.835 1.00 52.84 ? 303 HOH A O   1 
HETATM 3052 O O   . HOH D 4 .   ? 56.522 39.715 116.802 1.00 59.76 ? 304 HOH A O   1 
HETATM 3053 O O   . HOH D 4 .   ? 72.418 37.131 126.015 1.00 58.67 ? 305 HOH A O   1 
HETATM 3054 O O   . HOH D 4 .   ? 71.085 19.350 120.465 1.00 42.89 ? 306 HOH A O   1 
HETATM 3055 O O   . HOH D 4 .   ? 64.838 25.668 110.509 1.00 65.68 ? 307 HOH A O   1 
HETATM 3056 O O   . HOH D 4 .   ? 70.739 43.443 136.007 1.00 55.05 ? 308 HOH A O   1 
HETATM 3057 O O   . HOH D 4 .   ? 70.756 32.165 137.197 1.00 57.17 ? 309 HOH A O   1 
HETATM 3058 O O   . HOH D 4 .   ? 53.921 7.338  144.187 1.00 62.43 ? 310 HOH A O   1 
HETATM 3059 O O   . HOH D 4 .   ? 76.298 17.088 129.572 1.00 54.73 ? 311 HOH A O   1 
HETATM 3060 O O   . HOH D 4 .   ? 51.844 4.097  134.270 1.00 53.69 ? 312 HOH A O   1 
HETATM 3061 O O   . HOH D 4 .   ? 53.680 12.621 123.819 1.00 68.83 ? 313 HOH A O   1 
HETATM 3062 O O   . HOH D 4 .   ? 56.731 37.640 119.279 1.00 43.44 ? 314 HOH A O   1 
HETATM 3063 O O   . HOH D 4 .   ? 62.851 28.911 154.974 1.00 59.94 ? 315 HOH A O   1 
HETATM 3064 O O   . HOH D 4 .   ? 63.803 18.809 155.731 1.00 71.74 ? 316 HOH A O   1 
HETATM 3065 O O   . HOH D 4 .   ? 44.043 23.143 139.202 1.00 62.98 ? 317 HOH A O   1 
HETATM 3066 O O   . HOH D 4 .   ? 65.553 39.396 121.540 1.00 56.80 ? 318 HOH A O   1 
HETATM 3067 O O   . HOH E 4 .   ? 57.190 31.915 144.597 1.00 13.86 ? 238 HOH B O   1 
HETATM 3068 O O   . HOH E 4 .   ? 45.857 33.519 137.163 1.00 13.81 ? 239 HOH B O   1 
HETATM 3069 O O   . HOH E 4 .   ? 51.120 48.292 151.747 1.00 13.31 ? 240 HOH B O   1 
HETATM 3070 O O   . HOH E 4 .   ? 53.439 35.332 126.332 1.00 16.39 ? 241 HOH B O   1 
HETATM 3071 O O   . HOH E 4 .   ? 40.919 39.934 135.322 1.00 15.67 ? 242 HOH B O   1 
HETATM 3072 O O   . HOH E 4 .   ? 54.573 40.426 133.794 1.00 14.43 ? 243 HOH B O   1 
HETATM 3073 O O   . HOH E 4 .   ? 57.995 46.558 148.934 1.00 17.68 ? 244 HOH B O   1 
HETATM 3074 O O   . HOH E 4 .   ? 47.925 42.098 135.131 1.00 18.76 ? 245 HOH B O   1 
HETATM 3075 O O   . HOH E 4 .   ? 46.877 43.235 123.870 1.00 19.77 ? 246 HOH B O   1 
HETATM 3076 O O   . HOH E 4 .   ? 46.953 38.577 125.499 1.00 18.65 ? 247 HOH B O   1 
HETATM 3077 O O   . HOH E 4 .   ? 48.594 36.031 126.323 1.00 21.72 ? 248 HOH B O   1 
HETATM 3078 O O   . HOH E 4 .   ? 26.996 51.035 121.758 1.00 21.64 ? 249 HOH B O   1 
HETATM 3079 O O   . HOH E 4 .   ? 49.065 48.492 156.323 1.00 21.28 ? 250 HOH B O   1 
HETATM 3080 O O   . HOH E 4 .   ? 59.923 39.912 140.646 1.00 19.93 ? 251 HOH B O   1 
HETATM 3081 O O   . HOH E 4 .   ? 35.721 34.147 126.494 1.00 22.35 ? 252 HOH B O   1 
HETATM 3082 O O   . HOH E 4 .   ? 46.962 34.005 125.193 1.00 20.97 ? 253 HOH B O   1 
HETATM 3083 O O   . HOH E 4 .   ? 42.194 41.526 139.316 1.00 23.55 ? 254 HOH B O   1 
HETATM 3084 O O   . HOH E 4 .   ? 49.436 49.823 162.025 1.00 22.47 ? 255 HOH B O   1 
HETATM 3085 O O   . HOH E 4 .   ? 18.547 50.557 127.961 1.00 25.01 ? 256 HOH B O   1 
HETATM 3086 O O   . HOH E 4 .   ? 58.762 46.738 141.709 1.00 26.25 ? 257 HOH B O   1 
HETATM 3087 O O   . HOH E 4 .   ? 38.684 47.734 131.978 1.00 24.06 ? 258 HOH B O   1 
HETATM 3088 O O   . HOH E 4 .   ? 50.481 43.913 128.433 1.00 27.57 ? 259 HOH B O   1 
HETATM 3089 O O   . HOH E 4 .   ? 16.911 46.526 125.943 1.00 25.47 ? 260 HOH B O   1 
HETATM 3090 O O   . HOH E 4 .   ? 45.851 48.022 132.817 1.00 20.95 ? 261 HOH B O   1 
HETATM 3091 O O   . HOH E 4 .   ? 36.415 37.619 138.671 1.00 23.70 ? 262 HOH B O   1 
HETATM 3092 O O   . HOH E 4 .   ? 47.333 48.239 162.972 1.00 30.42 ? 263 HOH B O   1 
HETATM 3093 O O   . HOH E 4 .   ? 43.886 46.846 133.860 1.00 21.53 ? 264 HOH B O   1 
HETATM 3094 O O   . HOH E 4 .   ? 32.095 46.683 111.376 1.00 25.02 ? 265 HOH B O   1 
HETATM 3095 O O   . HOH E 4 .   ? 48.234 40.645 124.229 1.00 28.24 ? 266 HOH B O   1 
HETATM 3096 O O   . HOH E 4 .   ? 55.397 32.221 130.700 1.00 23.78 ? 267 HOH B O   1 
HETATM 3097 O O   . HOH E 4 .   ? 57.719 49.310 148.558 1.00 26.11 ? 268 HOH B O   1 
HETATM 3098 O O   . HOH E 4 .   ? 30.208 51.390 127.119 1.00 25.65 ? 269 HOH B O   1 
HETATM 3099 O O   . HOH E 4 .   ? 58.252 44.140 167.038 1.00 25.72 ? 270 HOH B O   1 
HETATM 3100 O O   . HOH E 4 .   ? 58.493 46.309 165.315 1.00 27.61 ? 271 HOH B O   1 
HETATM 3101 O O   . HOH E 4 .   ? 53.406 42.555 126.667 1.00 27.24 ? 272 HOH B O   1 
HETATM 3102 O O   . HOH E 4 .   ? 37.195 49.415 128.319 1.00 28.17 ? 273 HOH B O   1 
HETATM 3103 O O   . HOH E 4 .   ? 27.626 34.150 120.795 1.00 29.38 ? 274 HOH B O   1 
HETATM 3104 O O   . HOH E 4 .   ? 55.718 30.348 141.981 1.00 31.30 ? 275 HOH B O   1 
HETATM 3105 O O   . HOH E 4 .   ? 22.536 46.823 133.711 1.00 26.99 ? 276 HOH B O   1 
HETATM 3106 O O   . HOH E 4 .   ? 33.228 50.355 120.475 1.00 29.13 ? 277 HOH B O   1 
HETATM 3107 O O   . HOH E 4 .   ? 41.795 40.183 141.570 1.00 27.87 ? 278 HOH B O   1 
HETATM 3108 O O   . HOH E 4 .   ? 45.245 43.284 121.803 1.00 29.36 ? 279 HOH B O   1 
HETATM 3109 O O   . HOH E 4 .   ? 17.983 36.735 133.987 1.00 33.73 ? 280 HOH B O   1 
HETATM 3110 O O   . HOH E 4 .   ? 48.185 46.190 126.670 1.00 31.10 ? 281 HOH B O   1 
HETATM 3111 O O   . HOH E 4 .   ? 25.254 47.476 133.892 1.00 28.67 ? 282 HOH B O   1 
HETATM 3112 O O   . HOH E 4 .   ? 37.005 42.797 115.167 1.00 33.29 ? 283 HOH B O   1 
HETATM 3113 O O   . HOH E 4 .   ? 47.900 47.599 134.373 1.00 29.70 ? 284 HOH B O   1 
HETATM 3114 O O   . HOH E 4 .   ? 49.353 48.174 159.242 1.00 26.25 ? 285 HOH B O   1 
HETATM 3115 O O   . HOH E 4 .   ? 47.440 46.991 160.441 1.00 34.19 ? 286 HOH B O   1 
HETATM 3116 O O   . HOH E 4 .   ? 60.591 44.575 162.996 1.00 26.92 ? 287 HOH B O   1 
HETATM 3117 O O   . HOH E 4 .   ? 51.042 44.197 143.770 1.00 34.89 ? 288 HOH B O   1 
HETATM 3118 O O   . HOH E 4 .   ? 35.073 41.633 139.181 1.00 32.24 ? 289 HOH B O   1 
HETATM 3119 O O   . HOH E 4 .   ? 44.046 27.954 132.900 1.00 34.57 ? 290 HOH B O   1 
HETATM 3120 O O   . HOH E 4 .   ? 21.237 36.388 130.506 1.00 39.55 ? 291 HOH B O   1 
HETATM 3121 O O   . HOH E 4 .   ? 35.815 44.897 117.569 1.00 31.29 ? 292 HOH B O   1 
HETATM 3122 O O   . HOH E 4 .   ? 20.075 47.723 120.359 1.00 30.37 ? 293 HOH B O   1 
HETATM 3123 O O   . HOH E 4 .   ? 46.150 37.313 123.276 1.00 28.65 ? 294 HOH B O   1 
HETATM 3124 O O   . HOH E 4 .   ? 35.131 30.499 120.918 1.00 33.24 ? 295 HOH B O   1 
HETATM 3125 O O   . HOH E 4 .   ? 30.595 43.881 136.159 1.00 36.01 ? 296 HOH B O   1 
HETATM 3126 O O   . HOH E 4 .   ? 23.448 44.869 135.654 1.00 32.91 ? 297 HOH B O   1 
HETATM 3127 O O   . HOH E 4 .   ? 56.949 48.972 143.112 1.00 35.52 ? 298 HOH B O   1 
HETATM 3128 O O   . HOH E 4 .   ? 34.659 48.930 128.759 1.00 38.60 ? 299 HOH B O   1 
HETATM 3129 O O   . HOH E 4 .   ? 29.154 51.319 133.779 1.00 37.26 ? 300 HOH B O   1 
HETATM 3130 O O   . HOH E 4 .   ? 15.489 46.634 134.283 1.00 41.18 ? 301 HOH B O   1 
HETATM 3131 O O   . HOH E 4 .   ? 48.486 45.232 124.405 1.00 33.90 ? 302 HOH B O   1 
HETATM 3132 O O   . HOH E 4 .   ? 41.003 48.038 121.928 1.00 35.99 ? 303 HOH B O   1 
HETATM 3133 O O   . HOH E 4 .   ? 28.513 49.530 135.194 1.00 37.16 ? 304 HOH B O   1 
HETATM 3134 O O   . HOH E 4 .   ? 46.511 37.773 170.512 1.00 32.00 ? 305 HOH B O   1 
HETATM 3135 O O   . HOH E 4 .   ? 37.751 47.079 136.076 1.00 35.98 ? 306 HOH B O   1 
HETATM 3136 O O   . HOH E 4 .   ? 31.502 48.979 134.800 1.00 37.51 ? 307 HOH B O   1 
HETATM 3137 O O   . HOH E 4 .   ? 32.189 33.615 112.897 1.00 37.79 ? 308 HOH B O   1 
HETATM 3138 O O   . HOH E 4 .   ? 51.590 45.982 139.023 1.00 39.01 ? 309 HOH B O   1 
HETATM 3139 O O   . HOH E 4 .   ? 29.328 51.622 124.164 1.00 39.30 ? 310 HOH B O   1 
HETATM 3140 O O   . HOH E 4 .   ? 54.404 39.121 168.775 1.00 36.44 ? 311 HOH B O   1 
HETATM 3141 O O   . HOH E 4 .   ? 39.428 31.612 139.192 1.00 36.75 ? 312 HOH B O   1 
HETATM 3142 O O   . HOH E 4 .   ? 26.248 47.469 108.350 1.00 35.22 ? 313 HOH B O   1 
HETATM 3143 O O   . HOH E 4 .   ? 54.557 32.475 166.013 1.00 41.49 ? 314 HOH B O   1 
HETATM 3144 O O   . HOH E 4 .   ? 47.445 51.248 165.033 1.00 38.53 ? 315 HOH B O   1 
HETATM 3145 O O   . HOH E 4 .   ? 44.890 35.316 145.234 1.00 35.55 ? 316 HOH B O   1 
HETATM 3146 O O   . HOH E 4 .   ? 16.969 47.047 111.532 1.00 35.50 ? 317 HOH B O   1 
HETATM 3147 O O   . HOH E 4 .   ? 17.373 40.158 106.175 1.00 44.02 ? 318 HOH B O   1 
HETATM 3148 O O   . HOH E 4 .   ? 30.810 35.175 137.027 1.00 32.65 ? 319 HOH B O   1 
HETATM 3149 O O   . HOH E 4 .   ? 49.656 30.196 124.580 1.00 39.71 ? 320 HOH B O   1 
HETATM 3150 O O   . HOH E 4 .   ? 27.762 39.415 138.864 1.00 41.58 ? 321 HOH B O   1 
HETATM 3151 O O   . HOH E 4 .   ? 31.993 29.634 124.610 1.00 42.16 ? 322 HOH B O   1 
HETATM 3152 O O   . HOH E 4 .   ? 30.568 49.972 116.582 1.00 41.58 ? 323 HOH B O   1 
HETATM 3153 O O   . HOH E 4 .   ? 63.776 39.816 152.153 1.00 36.89 ? 324 HOH B O   1 
HETATM 3154 O O   . HOH E 4 .   ? 20.952 34.998 113.924 1.00 49.01 ? 325 HOH B O   1 
HETATM 3155 O O   . HOH E 4 .   ? 55.222 45.344 138.072 1.00 41.45 ? 326 HOH B O   1 
HETATM 3156 O O   . HOH E 4 .   ? 34.174 32.721 139.279 1.00 44.70 ? 327 HOH B O   1 
HETATM 3157 O O   . HOH E 4 .   ? 30.821 51.231 131.918 1.00 39.16 ? 328 HOH B O   1 
HETATM 3158 O O   . HOH E 4 .   ? 34.345 39.226 139.900 1.00 47.05 ? 329 HOH B O   1 
HETATM 3159 O O   . HOH E 4 .   ? 48.047 24.517 145.178 1.00 40.44 ? 330 HOH B O   1 
HETATM 3160 O O   . HOH E 4 .   ? 42.092 48.550 134.584 1.00 36.88 ? 331 HOH B O   1 
HETATM 3161 O O   . HOH E 4 .   ? 48.793 32.409 123.914 1.00 38.91 ? 332 HOH B O   1 
HETATM 3162 O O   . HOH E 4 .   ? 32.575 45.401 135.608 1.00 37.69 ? 333 HOH B O   1 
HETATM 3163 O O   . HOH E 4 .   ? 44.382 23.742 134.182 1.00 39.83 ? 334 HOH B O   1 
HETATM 3164 O O   . HOH E 4 .   ? 58.369 50.699 145.533 1.00 42.39 ? 335 HOH B O   1 
HETATM 3165 O O   . HOH E 4 .   ? 62.057 44.804 157.031 1.00 46.49 ? 336 HOH B O   1 
HETATM 3166 O O   . HOH E 4 .   ? 39.434 48.561 134.576 1.00 46.06 ? 337 HOH B O   1 
HETATM 3167 O O   . HOH E 4 .   ? 37.883 36.964 114.742 1.00 39.08 ? 338 HOH B O   1 
HETATM 3168 O O   . HOH E 4 .   ? 45.204 44.414 145.389 1.00 45.22 ? 339 HOH B O   1 
HETATM 3169 O O   . HOH E 4 .   ? 29.711 48.933 113.886 1.00 36.51 ? 340 HOH B O   1 
HETATM 3170 O O   . HOH E 4 .   ? 20.254 42.962 103.650 1.00 41.01 ? 341 HOH B O   1 
HETATM 3171 O O   . HOH E 4 .   ? 25.883 30.967 130.489 1.00 44.37 ? 342 HOH B O   1 
HETATM 3172 O O   . HOH E 4 .   ? 46.227 28.240 142.004 1.00 49.21 ? 343 HOH B O   1 
HETATM 3173 O O   . HOH E 4 .   ? 62.486 42.957 160.645 1.00 39.41 ? 344 HOH B O   1 
HETATM 3174 O O   . HOH E 4 .   ? 44.449 37.988 119.410 1.00 40.89 ? 345 HOH B O   1 
HETATM 3175 O O   . HOH E 4 .   ? 58.290 51.523 152.787 1.00 43.00 ? 346 HOH B O   1 
HETATM 3176 O O   . HOH E 4 .   ? 10.037 42.568 126.452 1.00 61.50 ? 347 HOH B O   1 
HETATM 3177 O O   . HOH E 4 .   ? 19.819 46.456 112.135 1.00 42.80 ? 348 HOH B O   1 
HETATM 3178 O O   . HOH E 4 .   ? 52.157 29.103 130.932 1.00 50.03 ? 349 HOH B O   1 
HETATM 3179 O O   . HOH E 4 .   ? 52.815 29.404 136.355 1.00 56.58 ? 350 HOH B O   1 
HETATM 3180 O O   . HOH E 4 .   ? 47.197 30.843 150.146 1.00 44.00 ? 351 HOH B O   1 
HETATM 3181 O O   . HOH E 4 .   ? 40.398 51.679 128.826 1.00 43.44 ? 352 HOH B O   1 
HETATM 3182 O O   . HOH E 4 .   ? 52.255 48.949 134.237 1.00 45.46 ? 353 HOH B O   1 
HETATM 3183 O O   . HOH E 4 .   ? 35.983 51.060 126.197 1.00 46.80 ? 354 HOH B O   1 
HETATM 3184 O O   . HOH E 4 .   ? 48.734 43.092 144.599 1.00 31.31 ? 355 HOH B O   1 
HETATM 3185 O O   . HOH E 4 .   ? 43.653 47.849 151.792 1.00 39.27 ? 356 HOH B O   1 
HETATM 3186 O O   . HOH E 4 .   ? 31.098 32.705 137.781 1.00 62.04 ? 357 HOH B O   1 
HETATM 3187 O O   . HOH E 4 .   ? 26.097 41.852 137.725 1.00 53.97 ? 358 HOH B O   1 
HETATM 3188 O O   . HOH E 4 .   ? 60.477 45.407 129.223 1.00 53.72 ? 359 HOH B O   1 
HETATM 3189 O O   . HOH E 4 .   ? 13.624 48.601 131.273 1.00 44.29 ? 360 HOH B O   1 
HETATM 3190 O O   . HOH E 4 .   ? 23.980 43.659 110.758 1.00 34.11 ? 361 HOH B O   1 
HETATM 3191 O O   . HOH E 4 .   ? 57.136 26.347 143.236 1.00 42.23 ? 362 HOH B O   1 
HETATM 3192 O O   . HOH E 4 .   ? 42.719 33.598 157.145 1.00 40.99 ? 363 HOH B O   1 
HETATM 3193 O O   . HOH E 4 .   ? 42.223 44.342 139.613 1.00 29.54 ? 364 HOH B O   1 
HETATM 3194 O O   . HOH E 4 .   ? 22.844 35.833 121.658 1.00 42.71 ? 365 HOH B O   1 
HETATM 3195 O O   . HOH E 4 .   ? 22.800 37.433 113.095 1.00 43.69 ? 366 HOH B O   1 
HETATM 3196 O O   . HOH E 4 .   ? 36.951 32.279 139.688 1.00 53.86 ? 367 HOH B O   1 
HETATM 3197 O O   . HOH E 4 .   ? 15.332 42.760 117.039 1.00 37.98 ? 368 HOH B O   1 
HETATM 3198 O O   . HOH E 4 .   ? 34.311 30.680 123.497 1.00 54.11 ? 369 HOH B O   1 
HETATM 3199 O O   . HOH E 4 .   ? 42.198 45.679 120.362 1.00 51.14 ? 370 HOH B O   1 
HETATM 3200 O O   . HOH E 4 .   ? 63.312 39.734 142.748 1.00 31.21 ? 371 HOH B O   1 
HETATM 3201 O O   . HOH E 4 .   ? 64.329 38.284 145.424 1.00 43.26 ? 372 HOH B O   1 
HETATM 3202 O O   . HOH E 4 .   ? 46.193 48.137 137.005 1.00 60.87 ? 373 HOH B O   1 
HETATM 3203 O O   . HOH E 4 .   ? 38.215 35.041 140.756 1.00 42.94 ? 374 HOH B O   1 
HETATM 3204 O O   . HOH E 4 .   ? 52.348 32.616 132.421 1.00 33.28 ? 375 HOH B O   1 
HETATM 3205 O O   . HOH E 4 .   ? 24.195 38.831 107.550 1.00 41.64 ? 376 HOH B O   1 
HETATM 3206 O O   . HOH E 4 .   ? 13.450 44.491 115.520 1.00 58.41 ? 377 HOH B O   1 
HETATM 3207 O O   . HOH E 4 .   ? 30.314 52.283 119.479 1.00 56.29 ? 378 HOH B O   1 
HETATM 3208 O O   . HOH E 4 .   ? 44.215 37.689 169.478 1.00 61.00 ? 379 HOH B O   1 
HETATM 3209 O O   . HOH E 4 .   ? 18.868 38.358 123.537 1.00 43.71 ? 380 HOH B O   1 
HETATM 3210 O O   . HOH E 4 .   ? 64.089 37.114 152.940 1.00 43.99 ? 381 HOH B O   1 
HETATM 3211 O O   . HOH E 4 .   ? 41.047 51.757 131.142 1.00 52.53 ? 382 HOH B O   1 
HETATM 3212 O O   . HOH E 4 .   ? 55.023 51.911 146.193 1.00 52.05 ? 383 HOH B O   1 
HETATM 3213 O O   . HOH E 4 .   ? 62.475 40.917 162.739 1.00 50.93 ? 384 HOH B O   1 
HETATM 3214 O O   . HOH E 4 .   ? 48.467 28.457 153.800 1.00 39.25 ? 385 HOH B O   1 
HETATM 3215 O O   . HOH E 4 .   ? 21.888 42.406 110.922 1.00 37.45 ? 386 HOH B O   1 
HETATM 3216 O O   . HOH E 4 .   ? 57.682 46.130 139.300 1.00 48.67 ? 387 HOH B O   1 
HETATM 3217 O O   . HOH E 4 .   ? 47.213 34.790 121.039 1.00 53.83 ? 388 HOH B O   1 
HETATM 3218 O O   . HOH E 4 .   ? 20.500 44.510 110.364 1.00 47.95 ? 389 HOH B O   1 
HETATM 3219 O O   . HOH E 4 .   ? 50.549 48.719 145.177 1.00 61.70 ? 390 HOH B O   1 
HETATM 3220 O O   . HOH E 4 .   ? 51.338 30.419 132.791 1.00 58.79 ? 391 HOH B O   1 
HETATM 3221 O O   . HOH E 4 .   ? 46.578 46.307 146.696 1.00 51.16 ? 392 HOH B O   1 
HETATM 3222 O O   . HOH E 4 .   ? 22.184 45.963 112.116 1.00 50.22 ? 393 HOH B O   1 
HETATM 3223 O O   . HOH E 4 .   ? 49.832 24.604 130.983 1.00 43.57 ? 394 HOH B O   1 
HETATM 3224 O O   . HOH E 4 .   ? 39.460 36.712 155.764 1.00 55.88 ? 395 HOH B O   1 
HETATM 3225 O O   . HOH E 4 .   ? 27.357 49.928 114.034 1.00 44.25 ? 396 HOH B O   1 
HETATM 3226 O O   . HOH E 4 .   ? 50.972 46.683 127.321 1.00 39.68 ? 397 HOH B O   1 
HETATM 3227 O O   . HOH E 4 .   ? 45.095 25.698 123.212 1.00 42.18 ? 398 HOH B O   1 
HETATM 3228 O O   . HOH E 4 .   ? 38.830 50.151 130.215 1.00 39.79 ? 399 HOH B O   1 
HETATM 3229 O O   . HOH E 4 .   ? 30.244 53.193 129.386 1.00 52.73 ? 400 HOH B O   1 
HETATM 3230 O O   . HOH E 4 .   ? 44.959 33.333 143.020 1.00 33.49 ? 401 HOH B O   1 
HETATM 3231 O O   . HOH E 4 .   ? 38.499 27.343 125.325 1.00 40.01 ? 402 HOH B O   1 
HETATM 3232 O O   . HOH E 4 .   ? 64.606 42.946 148.470 1.00 43.20 ? 403 HOH B O   1 
HETATM 3233 O O   . HOH E 4 .   ? 62.750 29.813 143.235 1.00 52.28 ? 404 HOH B O   1 
HETATM 3234 O O   . HOH E 4 .   ? 24.408 34.615 114.201 1.00 45.95 ? 405 HOH B O   1 
HETATM 3235 O O   . HOH E 4 .   ? 56.561 43.432 127.870 1.00 40.87 ? 406 HOH B O   1 
HETATM 3236 O O   . HOH E 4 .   ? 14.149 44.140 127.289 1.00 52.78 ? 407 HOH B O   1 
HETATM 3237 O O   . HOH E 4 .   ? 28.519 36.866 111.122 1.00 32.23 ? 408 HOH B O   1 
HETATM 3238 O O   . HOH E 4 .   ? 45.270 33.934 148.782 1.00 40.09 ? 409 HOH B O   1 
HETATM 3239 O O   . HOH E 4 .   ? 66.589 41.084 152.797 1.00 66.92 ? 410 HOH B O   1 
HETATM 3240 O O   . HOH E 4 .   ? 62.078 46.772 143.037 1.00 41.41 ? 411 HOH B O   1 
HETATM 3241 O O   . HOH E 4 .   ? 38.992 28.670 136.720 1.00 52.29 ? 412 HOH B O   1 
HETATM 3242 O O   . HOH E 4 .   ? 45.414 50.742 132.470 1.00 46.53 ? 413 HOH B O   1 
HETATM 3243 O O   . HOH E 4 .   ? 38.880 25.789 130.192 1.00 60.12 ? 414 HOH B O   1 
HETATM 3244 O O   . HOH E 4 .   ? 25.583 35.796 136.700 1.00 38.01 ? 415 HOH B O   1 
HETATM 3245 O O   . HOH E 4 .   ? 61.197 29.238 151.234 1.00 45.92 ? 416 HOH B O   1 
HETATM 3246 O O   . HOH E 4 .   ? 40.969 46.490 139.074 1.00 47.03 ? 417 HOH B O   1 
HETATM 3247 O O   . HOH E 4 .   ? 43.877 40.078 168.388 1.00 53.37 ? 418 HOH B O   1 
HETATM 3248 O O   . HOH E 4 .   ? 48.868 27.955 122.587 1.00 44.96 ? 419 HOH B O   1 
HETATM 3249 O O   . HOH E 4 .   ? 14.153 34.526 114.667 1.00 59.52 ? 420 HOH B O   1 
HETATM 3250 O O   . HOH E 4 .   ? 15.958 41.338 135.494 1.00 45.81 ? 421 HOH B O   1 
HETATM 3251 O O   . HOH E 4 .   ? 32.358 42.522 139.087 1.00 57.19 ? 422 HOH B O   1 
HETATM 3252 O O   . HOH E 4 .   ? 23.409 41.020 137.741 1.00 47.33 ? 423 HOH B O   1 
HETATM 3253 O O   . HOH E 4 .   ? 58.705 36.822 139.913 1.00 53.11 ? 424 HOH B O   1 
HETATM 3254 O O   . HOH E 4 .   ? 55.797 43.670 133.330 1.00 45.59 ? 425 HOH B O   1 
HETATM 3255 O O   . HOH E 4 .   ? 58.016 45.833 168.961 1.00 53.64 ? 426 HOH B O   1 
HETATM 3256 O O   . HOH E 4 .   ? 49.651 46.708 140.524 1.00 55.81 ? 427 HOH B O   1 
HETATM 3257 O O   . HOH E 4 .   ? 62.666 36.600 155.290 1.00 51.20 ? 428 HOH B O   1 
HETATM 3258 O O   . HOH E 4 .   ? 31.604 36.739 139.157 1.00 49.59 ? 429 HOH B O   1 
HETATM 3259 O O   . HOH E 4 .   ? 35.015 43.928 138.606 1.00 52.13 ? 430 HOH B O   1 
HETATM 3260 O O   . HOH E 4 .   ? 37.946 25.518 127.233 1.00 43.04 ? 431 HOH B O   1 
HETATM 3261 O O   . HOH E 4 .   ? 45.089 52.917 165.800 1.00 64.62 ? 432 HOH B O   1 
HETATM 3262 O O   . HOH E 4 .   ? 36.741 28.218 123.293 1.00 39.41 ? 433 HOH B O   1 
HETATM 3263 O O   . HOH E 4 .   ? 42.500 51.163 133.626 1.00 67.58 ? 434 HOH B O   1 
HETATM 3264 O O   . HOH E 4 .   ? 34.949 49.485 117.493 1.00 44.72 ? 435 HOH B O   1 
HETATM 3265 O O   . HOH E 4 .   ? 10.700 43.586 114.811 1.00 48.17 ? 436 HOH B O   1 
HETATM 3266 O O   . HOH E 4 .   ? 28.398 28.631 136.078 1.00 58.34 ? 437 HOH B O   1 
HETATM 3267 O O   . HOH E 4 .   ? 63.841 43.956 141.115 1.00 46.88 ? 438 HOH B O   1 
HETATM 3268 O O   . HOH E 4 .   ? 47.104 31.386 165.777 1.00 50.13 ? 439 HOH B O   1 
HETATM 3269 O O   . HOH E 4 .   ? 34.341 51.627 123.491 1.00 47.61 ? 440 HOH B O   1 
HETATM 3270 O O   . HOH E 4 .   ? 47.003 45.990 140.028 1.00 52.97 ? 441 HOH B O   1 
HETATM 3271 O O   . HOH E 4 .   ? 62.651 42.987 154.571 1.00 49.72 ? 442 HOH B O   1 
HETATM 3272 O O   . HOH E 4 .   ? 50.495 43.059 125.896 1.00 47.25 ? 443 HOH B O   1 
HETATM 3273 O O   . HOH E 4 .   ? 23.921 37.174 110.665 1.00 69.73 ? 444 HOH B O   1 
HETATM 3274 O O   . HOH E 4 .   ? 65.855 43.781 151.322 1.00 56.78 ? 445 HOH B O   1 
HETATM 3275 O O   . HOH E 4 .   ? 54.409 48.184 131.765 1.00 54.70 ? 446 HOH B O   1 
HETATM 3276 O O   . HOH E 4 .   ? 63.095 46.053 125.153 1.00 55.51 ? 447 HOH B O   1 
HETATM 3277 O O   . HOH E 4 .   ? 37.442 39.316 152.295 1.00 66.72 ? 448 HOH B O   1 
HETATM 3278 O O   . HOH E 4 .   ? 52.386 48.493 128.397 1.00 58.34 ? 449 HOH B O   1 
HETATM 3279 O O   . HOH E 4 .   ? 56.340 49.544 156.328 1.00 60.70 ? 450 HOH B O   1 
HETATM 3280 O O   . HOH E 4 .   ? 14.010 53.179 114.422 1.00 50.16 ? 451 HOH B O   1 
HETATM 3281 O O   . HOH E 4 .   ? 16.461 36.753 138.411 1.00 53.31 ? 452 HOH B O   1 
HETATM 3282 O O   . HOH E 4 .   ? 40.117 24.249 126.569 1.00 66.55 ? 453 HOH B O   1 
HETATM 3283 O O   . HOH E 4 .   ? 55.528 44.971 130.995 1.00 49.32 ? 454 HOH B O   1 
HETATM 3284 O O   . HOH E 4 .   ? 28.159 28.849 130.348 1.00 45.10 ? 455 HOH B O   1 
HETATM 3285 O O   . HOH E 4 .   ? 17.643 36.206 107.323 1.00 57.57 ? 456 HOH B O   1 
HETATM 3286 O O   . HOH E 4 .   ? 25.540 50.263 108.089 1.00 47.68 ? 457 HOH B O   1 
HETATM 3287 O O   . HOH E 4 .   ? 35.552 25.970 123.340 1.00 57.92 ? 458 HOH B O   1 
HETATM 3288 O O   . HOH E 4 .   ? 35.766 48.205 136.936 1.00 39.15 ? 459 HOH B O   1 
HETATM 3289 O O   . HOH E 4 .   ? 49.487 48.637 138.247 1.00 60.84 ? 460 HOH B O   1 
HETATM 3290 O O   . HOH E 4 .   ? 37.894 52.431 124.524 1.00 61.07 ? 461 HOH B O   1 
HETATM 3291 O O   . HOH E 4 .   ? 31.342 51.715 122.596 1.00 65.23 ? 462 HOH B O   1 
HETATM 3292 O O   . HOH E 4 .   ? 44.887 27.389 137.862 1.00 58.52 ? 463 HOH B O   1 
HETATM 3293 O O   . HOH E 4 .   ? 37.422 45.909 140.245 1.00 65.50 ? 464 HOH B O   1 
HETATM 3294 O O   . HOH E 4 .   ? 54.673 45.663 135.215 1.00 52.18 ? 465 HOH B O   1 
HETATM 3295 O O   . HOH E 4 .   ? 46.124 51.366 147.748 1.00 48.60 ? 466 HOH B O   1 
HETATM 3296 O O   . HOH E 4 .   ? 47.617 53.820 151.823 1.00 47.05 ? 467 HOH B O   1 
HETATM 3297 O O   . HOH E 4 .   ? 19.634 39.431 107.260 1.00 56.83 ? 468 HOH B O   1 
HETATM 3298 O O   . HOH E 4 .   ? 31.081 39.077 140.163 1.00 57.43 ? 469 HOH B O   1 
HETATM 3299 O O   . HOH E 4 .   ? 47.813 34.823 169.756 1.00 55.11 ? 470 HOH B O   1 
HETATM 3300 O O   . HOH E 4 .   ? 41.153 26.887 131.113 1.00 49.20 ? 471 HOH B O   1 
HETATM 3301 O O   . HOH E 4 .   ? 31.555 33.544 120.026 1.00 46.01 ? 472 HOH B O   1 
HETATM 3302 O O   . HOH E 4 .   ? 42.755 45.048 153.633 1.00 54.84 ? 473 HOH B O   1 
HETATM 3303 O O   . HOH E 4 .   ? 64.708 45.303 153.518 1.00 60.19 ? 474 HOH B O   1 
HETATM 3304 O O   . HOH E 4 .   ? 60.503 38.935 123.045 1.00 47.94 ? 475 HOH B O   1 
HETATM 3305 O O   . HOH E 4 .   ? 58.635 30.015 163.159 1.00 49.25 ? 476 HOH B O   1 
HETATM 3306 O O   . HOH E 4 .   ? 25.446 31.563 114.915 1.00 55.36 ? 477 HOH B O   1 
HETATM 3307 O O   . HOH E 4 .   ? 43.546 51.985 131.185 1.00 64.69 ? 478 HOH B O   1 
HETATM 3308 O O   . HOH E 4 .   ? 43.517 52.635 152.348 1.00 54.33 ? 479 HOH B O   1 
HETATM 3309 O O   . HOH E 4 .   ? 41.478 30.635 164.233 1.00 68.67 ? 480 HOH B O   1 
HETATM 3310 O O   . HOH E 4 .   ? 46.489 37.483 120.659 1.00 62.48 ? 481 HOH B O   1 
HETATM 3311 O O   . HOH E 4 .   ? 23.734 33.313 133.833 1.00 62.29 ? 482 HOH B O   1 
HETATM 3312 O O   . HOH E 4 .   ? 20.286 33.908 129.399 1.00 71.34 ? 483 HOH B O   1 
HETATM 3313 O O   . HOH E 4 .   ? 33.227 51.213 127.925 1.00 51.39 ? 484 HOH B O   1 
HETATM 3314 O O   . HOH E 4 .   ? 60.537 27.988 160.764 1.00 45.73 ? 485 HOH B O   1 
HETATM 3315 O O   . HOH E 4 .   ? 63.891 28.038 162.683 1.00 47.18 ? 486 HOH B O   1 
HETATM 3316 O O   . HOH E 4 .   ? 36.324 29.753 136.389 1.00 68.71 ? 487 HOH B O   1 
HETATM 3317 O O   . HOH E 4 .   ? 29.525 40.977 139.790 1.00 60.62 ? 488 HOH B O   1 
HETATM 3318 O O   . HOH E 4 .   ? 16.727 39.791 125.999 1.00 43.99 ? 489 HOH B O   1 
HETATM 3319 O O   . HOH E 4 .   ? 63.030 26.638 148.834 1.00 39.83 ? 490 HOH B O   1 
HETATM 3320 O O   . HOH E 4 .   ? 37.656 35.045 143.461 1.00 54.87 ? 491 HOH B O   1 
HETATM 3321 O O   . HOH E 4 .   ? 14.940 45.841 112.981 1.00 67.06 ? 492 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   PHE 1   1   ?   ?   ?   A . n 
A 1 2   PRO 2   2   ?   ?   ?   A . n 
A 1 3   THR 3   3   3   THR THR A . n 
A 1 4   ILE 4   4   4   ILE ILE A . n 
A 1 5   PRO 5   5   5   PRO PRO A . n 
A 1 6   LEU 6   6   6   LEU LEU A . n 
A 1 7   SER 7   7   7   SER SER A . n 
A 1 8   ARG 8   8   8   ARG ARG A . n 
A 1 9   LEU 9   9   9   LEU LEU A . n 
A 1 10  PHE 10  10  10  PHE PHE A . n 
A 1 11  ASP 11  11  11  ASP ASP A . n 
A 1 12  ASN 12  12  12  ASN ASN A . n 
A 1 13  ALA 13  13  13  ALA ALA A . n 
A 1 14  MET 14  14  14  MET MET A . n 
A 1 15  LEU 15  15  15  LEU LEU A . n 
A 1 16  ARG 16  16  16  ARG ARG A . n 
A 1 17  ALA 17  17  17  ALA ALA A . n 
A 1 18  HIS 18  18  18  HIS HIS A . n 
A 1 19  ARG 19  19  19  ARG ARG A . n 
A 1 20  LEU 20  20  20  LEU LEU A . n 
A 1 21  HIS 21  21  21  HIS HIS A . n 
A 1 22  GLN 22  22  22  GLN GLN A . n 
A 1 23  LEU 23  23  23  LEU LEU A . n 
A 1 24  ALA 24  24  24  ALA ALA A . n 
A 1 25  PHE 25  25  25  PHE PHE A . n 
A 1 26  ASP 26  26  26  ASP ASP A . n 
A 1 27  THR 27  27  27  THR THR A . n 
A 1 28  TYR 28  28  28  TYR TYR A . n 
A 1 29  GLN 29  29  29  GLN GLN A . n 
A 1 30  GLU 30  30  30  GLU GLU A . n 
A 1 31  PHE 31  31  31  PHE PHE A . n 
A 1 32  GLU 32  32  32  GLU GLU A . n 
A 1 33  GLU 33  33  33  GLU GLU A . n 
A 1 34  ALA 34  34  34  ALA ALA A . n 
A 1 35  TYR 35  35  35  TYR TYR A . n 
A 1 36  ILE 36  36  36  ILE ILE A . n 
A 1 37  PRO 37  37  37  PRO PRO A . n 
A 1 38  LYS 38  38  38  LYS LYS A . n 
A 1 39  GLU 39  39  39  GLU GLU A . n 
A 1 40  GLN 40  40  40  GLN GLN A . n 
A 1 41  LYS 41  41  41  LYS LYS A . n 
A 1 42  TYR 42  42  42  TYR TYR A . n 
A 1 43  SER 43  43  43  SER SER A . n 
A 1 44  PHE 44  44  44  PHE PHE A . n 
A 1 45  LEU 45  45  45  LEU LEU A . n 
A 1 46  GLN 46  46  46  GLN GLN A . n 
A 1 47  ASN 47  47  47  ASN ASN A . n 
A 1 48  PRO 48  48  48  PRO PRO A . n 
A 1 49  GLN 49  49  ?   ?   ?   A . n 
A 1 50  THR 50  50  ?   ?   ?   A . n 
A 1 51  SER 51  51  51  SER SER A . n 
A 1 52  LEU 52  52  52  LEU LEU A . n 
A 1 53  CYS 53  53  53  CYS CYS A . n 
A 1 54  PHE 54  54  54  PHE PHE A . n 
A 1 55  SER 55  55  55  SER SER A . n 
A 1 56  GLU 56  56  56  GLU GLU A . n 
A 1 57  SER 57  57  57  SER SER A . n 
A 1 58  ILE 58  58  58  ILE ILE A . n 
A 1 59  PRO 59  59  59  PRO PRO A . n 
A 1 60  THR 60  60  60  THR THR A . n 
A 1 61  PRO 61  61  61  PRO PRO A . n 
A 1 62  SER 62  62  62  SER SER A . n 
A 1 63  ASN 63  63  63  ASN ASN A . n 
A 1 64  ARG 64  64  64  ARG ARG A . n 
A 1 65  GLU 65  65  65  GLU GLU A . n 
A 1 66  GLU 66  66  66  GLU GLU A . n 
A 1 67  THR 67  67  67  THR THR A . n 
A 1 68  GLN 68  68  68  GLN GLN A . n 
A 1 69  GLN 69  69  69  GLN GLN A . n 
A 1 70  LYS 70  70  70  LYS LYS A . n 
A 1 71  SER 71  71  71  SER SER A . n 
A 1 72  ASN 72  72  72  ASN ASN A . n 
A 1 73  LEU 73  73  73  LEU LEU A . n 
A 1 74  GLU 74  74  74  GLU GLU A . n 
A 1 75  LEU 75  75  75  LEU LEU A . n 
A 1 76  LEU 76  76  76  LEU LEU A . n 
A 1 77  ARG 77  77  77  ARG ARG A . n 
A 1 78  ILE 78  78  78  ILE ILE A . n 
A 1 79  SER 79  79  79  SER SER A . n 
A 1 80  LEU 80  80  80  LEU LEU A . n 
A 1 81  LEU 81  81  81  LEU LEU A . n 
A 1 82  LEU 82  82  82  LEU LEU A . n 
A 1 83  ILE 83  83  83  ILE ILE A . n 
A 1 84  GLN 84  84  84  GLN GLN A . n 
A 1 85  SER 85  85  85  SER SER A . n 
A 1 86  TRP 86  86  86  TRP TRP A . n 
A 1 87  LEU 87  87  87  LEU LEU A . n 
A 1 88  GLU 88  88  88  GLU GLU A . n 
A 1 89  PRO 89  89  89  PRO PRO A . n 
A 1 90  VAL 90  90  90  VAL VAL A . n 
A 1 91  GLN 91  91  91  GLN GLN A . n 
A 1 92  PHE 92  92  92  PHE PHE A . n 
A 1 93  LEU 93  93  93  LEU LEU A . n 
A 1 94  ARG 94  94  94  ARG ARG A . n 
A 1 95  SER 95  95  95  SER SER A . n 
A 1 96  VAL 96  96  96  VAL VAL A . n 
A 1 97  PHE 97  97  97  PHE PHE A . n 
A 1 98  ALA 98  98  98  ALA ALA A . n 
A 1 99  ASN 99  99  99  ASN ASN A . n 
A 1 100 SER 100 100 100 SER SER A . n 
A 1 101 LEU 101 101 101 LEU LEU A . n 
A 1 102 VAL 102 102 102 VAL VAL A . n 
A 1 103 TYR 103 103 103 TYR TYR A . n 
A 1 104 GLY 104 104 104 GLY GLY A . n 
A 1 105 ALA 105 105 105 ALA ALA A . n 
A 1 106 SER 106 106 106 SER SER A . n 
A 1 107 ASP 107 107 107 ASP ASP A . n 
A 1 108 SER 108 108 108 SER SER A . n 
A 1 109 ASN 109 109 109 ASN ASN A . n 
A 1 110 VAL 110 110 110 VAL VAL A . n 
A 1 111 TYR 111 111 111 TYR TYR A . n 
A 1 112 ASP 112 112 112 ASP ASP A . n 
A 1 113 LEU 113 113 113 LEU LEU A . n 
A 1 114 LEU 114 114 114 LEU LEU A . n 
A 1 115 LYS 115 115 115 LYS LYS A . n 
A 1 116 ASP 116 116 116 ASP ASP A . n 
A 1 117 LEU 117 117 117 LEU LEU A . n 
A 1 118 GLU 118 118 118 GLU GLU A . n 
A 1 119 GLU 119 119 119 GLU GLU A . n 
A 1 120 ARG 120 120 120 ARG ARG A . n 
A 1 121 ILE 121 121 121 ILE ILE A . n 
A 1 122 GLN 122 122 122 GLN GLN A . n 
A 1 123 THR 123 123 123 THR THR A . n 
A 1 124 LEU 124 124 124 LEU LEU A . n 
A 1 125 MET 125 125 125 MET MET A . n 
A 1 126 GLY 126 126 126 GLY GLY A . n 
A 1 127 ARG 127 127 127 ARG ARG A . n 
A 1 128 LEU 128 128 128 LEU LEU A . n 
A 1 129 THR 129 129 129 THR THR A . n 
A 1 130 ASP 130 130 ?   ?   ?   A . n 
A 1 131 GLY 131 131 ?   ?   ?   A . n 
A 1 132 SER 132 132 ?   ?   ?   A . n 
A 1 133 PRO 133 133 ?   ?   ?   A . n 
A 1 134 ARG 134 134 ?   ?   ?   A . n 
A 1 135 THR 135 135 ?   ?   ?   A . n 
A 1 136 GLY 136 136 136 GLY GLY A . n 
A 1 137 GLN 137 137 137 GLN GLN A . n 
A 1 138 ILE 138 138 138 ILE ILE A . n 
A 1 139 PHE 139 139 139 PHE PHE A . n 
A 1 140 LYS 140 140 140 LYS LYS A . n 
A 1 141 GLN 141 141 141 GLN GLN A . n 
A 1 142 THR 142 142 142 THR THR A . n 
A 1 143 TYR 143 143 143 TYR TYR A . n 
A 1 144 SER 144 144 144 SER SER A . n 
A 1 145 LYS 145 145 145 LYS LYS A . n 
A 1 146 PHE 146 146 146 PHE PHE A . n 
A 1 147 ASP 147 147 147 ASP ASP A . n 
A 1 148 THR 148 148 148 THR THR A . n 
A 1 149 ASN 149 149 ?   ?   ?   A . n 
A 1 150 SER 150 150 ?   ?   ?   A . n 
A 1 151 HIS 151 151 ?   ?   ?   A . n 
A 1 152 ASN 152 152 ?   ?   ?   A . n 
A 1 153 ASP 153 153 ?   ?   ?   A . n 
A 1 154 ASP 154 154 ?   ?   ?   A . n 
A 1 155 ALA 155 155 155 ALA ALA A . n 
A 1 156 LEU 156 156 156 LEU LEU A . n 
A 1 157 LEU 157 157 157 LEU LEU A . n 
A 1 158 LYS 158 158 158 LYS LYS A . n 
A 1 159 ASN 159 159 159 ASN ASN A . n 
A 1 160 TYR 160 160 160 TYR TYR A . n 
A 1 161 GLY 161 161 161 GLY GLY A . n 
A 1 162 LEU 162 162 162 LEU LEU A . n 
A 1 163 LEU 163 163 163 LEU LEU A . n 
A 1 164 TYR 164 164 164 TYR TYR A . n 
A 1 165 CYS 165 165 165 CYS CYS A . n 
A 1 166 PHE 166 166 166 PHE PHE A . n 
A 1 167 ARG 167 167 167 ARG ARG A . n 
A 1 168 ARG 168 168 168 ARG ARG A . n 
A 1 169 ASP 169 169 169 ASP ASP A . n 
A 1 170 MET 170 170 170 MET MET A . n 
A 1 171 THR 171 171 171 THR THR A . n 
A 1 172 TYR 172 172 172 TYR TYR A . n 
A 1 173 VAL 173 173 173 VAL VAL A . n 
A 1 174 ALA 174 174 174 ALA ALA A . n 
A 1 175 THR 175 175 175 THR THR A . n 
A 1 176 TYR 176 176 176 TYR TYR A . n 
A 1 177 LEU 177 177 177 LEU LEU A . n 
A 1 178 ARG 178 178 178 ARG ARG A . n 
A 1 179 ILE 179 179 179 ILE ILE A . n 
A 1 180 VAL 180 180 180 VAL VAL A . n 
A 1 181 GLN 181 181 181 GLN GLN A . n 
A 1 182 CYS 182 182 182 CYS CYS A . n 
A 1 183 ARG 183 183 183 ARG ARG A . n 
A 1 184 SER 184 184 184 SER SER A . n 
A 1 185 VAL 185 185 185 VAL VAL A . n 
A 1 186 GLU 186 186 186 GLU GLU A . n 
A 1 187 GLY 187 187 187 GLY GLY A . n 
A 1 188 SER 188 188 188 SER SER A . n 
A 1 189 CYS 189 189 189 CYS CYS A . n 
A 1 190 GLY 190 190 190 GLY GLY A . n 
A 1 191 PHE 191 191 191 PHE PHE A . n 
B 2 1   PHE 1   1   ?   ?   ?   B . n 
B 2 2   SER 2   2   ?   ?   ?   B . n 
B 2 3   GLY 3   3   ?   ?   ?   B . n 
B 2 4   SER 4   4   ?   ?   ?   B . n 
B 2 5   GLU 5   5   ?   ?   ?   B . n 
B 2 6   ALA 6   6   ?   ?   ?   B . n 
B 2 7   THR 7   7   ?   ?   ?   B . n 
B 2 8   ALA 8   8   ?   ?   ?   B . n 
B 2 9   ALA 9   9   ?   ?   ?   B . n 
B 2 10  ILE 10  10  ?   ?   ?   B . n 
B 2 11  LEU 11  11  ?   ?   ?   B . n 
B 2 12  SER 12  12  ?   ?   ?   B . n 
B 2 13  ARG 13  13  ?   ?   ?   B . n 
B 2 14  ALA 14  14  ?   ?   ?   B . n 
B 2 15  PRO 15  15  ?   ?   ?   B . n 
B 2 16  TRP 16  16  ?   ?   ?   B . n 
B 2 17  SER 17  17  ?   ?   ?   B . n 
B 2 18  LEU 18  18  ?   ?   ?   B . n 
B 2 19  GLN 19  19  ?   ?   ?   B . n 
B 2 20  SER 20  20  ?   ?   ?   B . n 
B 2 21  VAL 21  21  ?   ?   ?   B . n 
B 2 22  ASN 22  22  ?   ?   ?   B . n 
B 2 23  PRO 23  23  ?   ?   ?   B . n 
B 2 24  GLY 24  24  ?   ?   ?   B . n 
B 2 25  LEU 25  25  ?   ?   ?   B . n 
B 2 26  LYS 26  26  ?   ?   ?   B . n 
B 2 27  THR 27  27  ?   ?   ?   B . n 
B 2 28  ASN 28  28  ?   ?   ?   B . n 
B 2 29  SER 29  29  ?   ?   ?   B . n 
B 2 30  SER 30  30  ?   ?   ?   B . n 
B 2 31  GLY 31  31  ?   ?   ?   B . n 
B 2 32  GLU 32  32  32  GLU GLU B . n 
B 2 33  PRO 33  33  33  PRO PRO B . n 
B 2 34  LYS 34  34  34  LYS LYS B . n 
B 2 35  PHE 35  35  35  PHE PHE B . n 
B 2 36  THR 36  36  36  THR THR B . n 
B 2 37  LYS 37  37  37  LYS LYS B . n 
B 2 38  CYS 38  38  38  CYS CYS B . n 
B 2 39  ARG 39  39  39  ARG ARG B . n 
B 2 40  SER 40  40  40  SER SER B . n 
B 2 41  PRO 41  41  41  PRO PRO B . n 
B 2 42  GLU 42  42  42  GLU GLU B . n 
B 2 43  ARG 43  43  43  ARG ARG B . n 
B 2 44  GLU 44  44  44  GLU GLU B . n 
B 2 45  THR 45  45  45  THR THR B . n 
B 2 46  PHE 46  46  46  PHE PHE B . n 
B 2 47  SER 47  47  47  SER SER B . n 
B 2 48  CYS 48  48  48  CYS CYS B . n 
B 2 49  HIS 49  49  49  HIS HIS B . n 
B 2 50  TRP 50  50  50  TRP TRP B . n 
B 2 51  THR 51  51  51  THR THR B . n 
B 2 52  ASP 52  52  52  ASP ASP B . n 
B 2 53  GLU 53  53  ?   ?   ?   B . n 
B 2 54  VAL 54  54  ?   ?   ?   B . n 
B 2 55  HIS 55  55  ?   ?   ?   B . n 
B 2 56  HIS 56  56  ?   ?   ?   B . n 
B 2 57  GLY 57  57  ?   ?   ?   B . n 
B 2 58  THR 58  58  ?   ?   ?   B . n 
B 2 59  LYS 59  59  ?   ?   ?   B . n 
B 2 60  ASN 60  60  ?   ?   ?   B . n 
B 2 61  GLU 61  61  61  GLU GLU B . n 
B 2 62  GLY 62  62  62  GLY GLY B . n 
B 2 63  PRO 63  63  63  PRO PRO B . n 
B 2 64  ILE 64  64  64  ILE ILE B . n 
B 2 65  GLN 65  65  65  GLN GLN B . n 
B 2 66  LEU 66  66  66  LEU LEU B . n 
B 2 67  PHE 67  67  67  PHE PHE B . n 
B 2 68  TYR 68  68  68  TYR TYR B . n 
B 2 69  THR 69  69  69  THR THR B . n 
B 2 70  ARG 70  70  70  ARG ARG B . n 
B 2 71  ARG 71  71  71  ARG ARG B . n 
B 2 72  ASN 72  72  72  ASN ASN B . n 
B 2 73  THR 73  73  ?   ?   ?   B . n 
B 2 74  GLN 74  74  ?   ?   ?   B . n 
B 2 75  GLU 75  75  ?   ?   ?   B . n 
B 2 76  TRP 76  76  ?   ?   ?   B . n 
B 2 77  THR 77  77  ?   ?   ?   B . n 
B 2 78  GLN 78  78  ?   ?   ?   B . n 
B 2 79  GLU 79  79  79  GLU GLU B . n 
B 2 80  TRP 80  80  80  TRP TRP B . n 
B 2 81  LYS 81  81  81  LYS LYS B . n 
B 2 82  GLU 82  82  82  GLU GLU B . n 
B 2 83  CYS 83  83  83  CYS CYS B . n 
B 2 84  PRO 84  84  84  PRO PRO B . n 
B 2 85  ASP 85  85  85  ASP ASP B . n 
B 2 86  TYR 86  86  86  TYR TYR B . n 
B 2 87  VAL 87  87  87  VAL VAL B . n 
B 2 88  SER 88  88  88  SER SER B . n 
B 2 89  ALA 89  89  89  ALA ALA B . n 
B 2 90  GLY 90  90  90  GLY GLY B . n 
B 2 91  GLU 91  91  91  GLU GLU B . n 
B 2 92  ASN 92  92  92  ASN ASN B . n 
B 2 93  SER 93  93  93  SER SER B . n 
B 2 94  CYS 94  94  94  CYS CYS B . n 
B 2 95  TYR 95  95  95  TYR TYR B . n 
B 2 96  PHE 96  96  96  PHE PHE B . n 
B 2 97  ASN 97  97  97  ASN ASN B . n 
B 2 98  SER 98  98  98  SER SER B . n 
B 2 99  SER 99  99  99  SER SER B . n 
B 2 100 PHE 100 100 100 PHE PHE B . n 
B 2 101 THR 101 101 101 THR THR B . n 
B 2 102 SER 102 102 102 SER SER B . n 
B 2 103 ILE 103 103 103 ILE ILE B . n 
B 2 104 ALA 104 104 104 ALA ALA B . n 
B 2 105 ILE 105 105 105 ILE ILE B . n 
B 2 106 PRO 106 106 106 PRO PRO B . n 
B 2 107 TYR 107 107 107 TYR TYR B . n 
B 2 108 CYS 108 108 108 CYS CYS B . n 
B 2 109 ILE 109 109 109 ILE ILE B . n 
B 2 110 LYS 110 110 110 LYS LYS B . n 
B 2 111 LEU 111 111 111 LEU LEU B . n 
B 2 112 THR 112 112 112 THR THR B . n 
B 2 113 SER 113 113 113 SER SER B . n 
B 2 114 ASN 114 114 114 ASN ASN B . n 
B 2 115 GLY 115 115 115 GLY GLY B . n 
B 2 116 GLY 116 116 116 GLY GLY B . n 
B 2 117 THR 117 117 117 THR THR B . n 
B 2 118 VAL 118 118 118 VAL VAL B . n 
B 2 119 ASP 119 119 119 ASP ASP B . n 
B 2 120 GLU 120 120 120 GLU GLU B . n 
B 2 121 LYS 121 121 121 LYS LYS B . n 
B 2 122 CYS 122 122 122 CYS CYS B . n 
B 2 123 PHE 123 123 123 PHE PHE B . n 
B 2 124 SER 124 124 124 SER SER B . n 
B 2 125 VAL 125 125 125 VAL VAL B . n 
B 2 126 ASP 126 126 126 ASP ASP B . n 
B 2 127 GLU 127 127 127 GLU GLU B . n 
B 2 128 ILE 128 128 128 ILE ILE B . n 
B 2 129 VAL 129 129 129 VAL VAL B . n 
B 2 130 GLN 130 130 130 GLN GLN B . n 
B 2 131 PRO 131 131 131 PRO PRO B . n 
B 2 132 ASP 132 132 132 ASP ASP B . n 
B 2 133 PRO 133 133 133 PRO PRO B . n 
B 2 134 PRO 134 134 134 PRO PRO B . n 
B 2 135 ILE 135 135 135 ILE ILE B . n 
B 2 136 ALA 136 136 136 ALA ALA B . n 
B 2 137 LEU 137 137 137 LEU LEU B . n 
B 2 138 ASN 138 138 138 ASN ASN B . n 
B 2 139 TRP 139 139 139 TRP TRP B . n 
B 2 140 THR 140 140 140 THR THR B . n 
B 2 141 LEU 141 141 141 LEU LEU B . n 
B 2 142 LEU 142 142 142 LEU LEU B . n 
B 2 143 ASN 143 143 143 ASN ASN B . n 
B 2 144 VAL 144 144 144 VAL VAL B . n 
B 2 145 SER 145 145 145 SER SER B . n 
B 2 146 LEU 146 146 146 LEU LEU B . n 
B 2 147 THR 147 147 147 THR THR B . n 
B 2 148 GLY 148 148 148 GLY GLY B . n 
B 2 149 ILE 149 149 149 ILE ILE B . n 
B 2 150 HIS 150 150 150 HIS HIS B . n 
B 2 151 ALA 151 151 151 ALA ALA B . n 
B 2 152 ASP 152 152 152 ASP ASP B . n 
B 2 153 ILE 153 153 153 ILE ILE B . n 
B 2 154 GLN 154 154 154 GLN GLN B . n 
B 2 155 VAL 155 155 155 VAL VAL B . n 
B 2 156 ARG 156 156 156 ARG ARG B . n 
B 2 157 TRP 157 157 157 TRP TRP B . n 
B 2 158 GLU 158 158 158 GLU GLU B . n 
B 2 159 ALA 159 159 159 ALA ALA B . n 
B 2 160 PRO 160 160 160 PRO PRO B . n 
B 2 161 ARG 161 161 161 ARG ARG B . n 
B 2 162 ASN 162 162 162 ASN ASN B . n 
B 2 163 ALA 163 163 163 ALA ALA B . n 
B 2 164 ASP 164 164 164 ASP ASP B . n 
B 2 165 ILE 165 165 165 ILE ILE B . n 
B 2 166 GLN 166 166 166 GLN GLN B . n 
B 2 167 LYS 167 167 167 LYS LYS B . n 
B 2 168 GLY 168 168 168 GLY GLY B . n 
B 2 169 TRP 169 169 169 TRP TRP B . n 
B 2 170 MET 170 170 170 MET MET B . n 
B 2 171 VAL 171 171 171 VAL VAL B . n 
B 2 172 LEU 172 172 172 LEU LEU B . n 
B 2 173 GLU 173 173 173 GLU GLU B . n 
B 2 174 TYR 174 174 174 TYR TYR B . n 
B 2 175 GLU 175 175 175 GLU GLU B . n 
B 2 176 LEU 176 176 176 LEU LEU B . n 
B 2 177 GLN 177 177 177 GLN GLN B . n 
B 2 178 TYR 178 178 178 TYR TYR B . n 
B 2 179 LYS 179 179 179 LYS LYS B . n 
B 2 180 GLU 180 180 180 GLU GLU B . n 
B 2 181 VAL 181 181 181 VAL VAL B . n 
B 2 182 ASN 182 182 182 ASN ASN B . n 
B 2 183 GLU 183 183 183 GLU GLU B . n 
B 2 184 THR 184 184 184 THR THR B . n 
B 2 185 LYS 185 185 185 LYS LYS B . n 
B 2 186 TRP 186 186 186 TRP TRP B . n 
B 2 187 LYS 187 187 187 LYS LYS B . n 
B 2 188 MET 188 188 188 MET MET B . n 
B 2 189 MET 189 189 189 MET MET B . n 
B 2 190 ASP 190 190 190 ASP ASP B . n 
B 2 191 PRO 191 191 191 PRO PRO B . n 
B 2 192 ILE 192 192 192 ILE ILE B . n 
B 2 193 LEU 193 193 193 LEU LEU B . n 
B 2 194 THR 194 194 194 THR THR B . n 
B 2 195 THR 195 195 195 THR THR B . n 
B 2 196 SER 196 196 196 SER SER B . n 
B 2 197 VAL 197 197 197 VAL VAL B . n 
B 2 198 PRO 198 198 198 PRO PRO B . n 
B 2 199 VAL 199 199 199 VAL VAL B . n 
B 2 200 TYR 200 200 200 TYR TYR B . n 
B 2 201 SER 201 201 201 SER SER B . n 
B 2 202 LEU 202 202 202 LEU LEU B . n 
B 2 203 LYS 203 203 203 LYS LYS B . n 
B 2 204 VAL 204 204 204 VAL VAL B . n 
B 2 205 ASP 205 205 205 ASP ASP B . n 
B 2 206 LYS 206 206 206 LYS LYS B . n 
B 2 207 GLU 207 207 207 GLU GLU B . n 
B 2 208 TYR 208 208 208 TYR TYR B . n 
B 2 209 GLU 209 209 209 GLU GLU B . n 
B 2 210 VAL 210 210 210 VAL VAL B . n 
B 2 211 ARG 211 211 211 ARG ARG B . n 
B 2 212 VAL 212 212 212 VAL VAL B . n 
B 2 213 ARG 213 213 213 ARG ARG B . n 
B 2 214 SER 214 214 214 SER SER B . n 
B 2 215 LYS 215 215 215 LYS LYS B . n 
B 2 216 GLN 216 216 216 GLN GLN B . n 
B 2 217 ARG 217 217 217 ARG ARG B . n 
B 2 218 ASN 218 218 218 ASN ASN B . n 
B 2 219 SER 219 219 219 SER SER B . n 
B 2 220 GLY 220 220 220 GLY GLY B . n 
B 2 221 ASN 221 221 221 ASN ASN B . n 
B 2 222 TYR 222 222 222 TYR TYR B . n 
B 2 223 GLY 223 223 223 GLY GLY B . n 
B 2 224 GLU 224 224 224 GLU GLU B . n 
B 2 225 PHE 225 225 225 PHE PHE B . n 
B 2 226 SER 226 226 226 SER SER B . n 
B 2 227 GLU 227 227 227 GLU GLU B . n 
B 2 228 VAL 228 228 228 VAL VAL B . n 
B 2 229 LEU 229 229 229 LEU LEU B . n 
B 2 230 TYR 230 230 230 TYR TYR B . n 
B 2 231 VAL 231 231 231 VAL VAL B . n 
B 2 232 THR 232 232 232 THR THR B . n 
B 2 233 LEU 233 233 233 LEU LEU B . n 
B 2 234 PRO 234 234 234 PRO PRO B . n 
B 2 235 GLN 235 235 235 GLN GLN B . n 
B 2 236 MET 236 236 236 MET MET B . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA,PQS 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 8700  ? 
1 MORE         -73   ? 
1 'SSA (A^2)'  32580 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z    1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000   
2 'crystal symmetry operation' 7_556 y,x,-z+1 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 231.7000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1998-01-28 
2 'Structure model' 1 1 2008-03-24 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Derived calculations'      
3 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
DENZO     'data reduction' . ? 1 
SCALEPACK 'data scaling'   . ? 2 
X-PLOR    'model building' . ? 3 
REFMAC    refinement       . ? 4 
X-PLOR    refinement       . ? 5 
X-PLOR    phasing          . ? 6 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 NE  A ARG 19  ? ? CZ A ARG 19  ? ? NH1 A ARG 19  ? ? 123.82 120.30 3.52   0.50 N 
2  1 CB  A TYR 28  ? ? CG A TYR 28  ? ? CD1 A TYR 28  ? ? 116.98 121.00 -4.02  0.60 N 
3  1 OE1 A GLU 32  ? ? CD A GLU 32  ? ? OE2 A GLU 32  ? ? 113.80 123.30 -9.50  1.20 N 
4  1 NE  A ARG 77  ? ? CZ A ARG 77  ? ? NH2 A ARG 77  ? ? 124.42 120.30 4.12   0.50 N 
5  1 NE  A ARG 127 ? ? CZ A ARG 127 ? ? NH2 A ARG 127 ? ? 123.31 120.30 3.01   0.50 N 
6  1 NE  A ARG 168 ? ? CZ A ARG 168 ? ? NH1 A ARG 168 ? ? 123.50 120.30 3.20   0.50 N 
7  1 CB  A TYR 172 ? ? CG A TYR 172 ? ? CD2 A TYR 172 ? ? 117.14 121.00 -3.86  0.60 N 
8  1 CB  A TYR 172 ? ? CG A TYR 172 ? ? CD1 A TYR 172 ? ? 124.73 121.00 3.73   0.60 N 
9  1 CB  A PHE 191 ? ? CG A PHE 191 ? ? CD1 A PHE 191 ? ? 125.13 120.80 4.33   0.70 N 
10 1 CB  B ASP 85  ? ? CG B ASP 85  ? ? OD1 B ASP 85  ? ? 125.17 118.30 6.87   0.90 N 
11 1 CB  B VAL 87  ? ? CA B VAL 87  ? ? C   B VAL 87  ? ? 96.18  111.40 -15.22 1.90 N 
12 1 CA  B LEU 111 ? ? CB B LEU 111 ? ? CG  B LEU 111 ? ? 131.07 115.30 15.77  2.30 N 
13 1 CA  B LYS 121 ? ? CB B LYS 121 ? ? CG  B LYS 121 ? ? 130.05 113.40 16.65  2.20 N 
14 1 NE  B ARG 161 ? ? CZ B ARG 161 ? ? NH1 B ARG 161 ? ? 125.97 120.30 5.67   0.50 N 
15 1 NE  B ARG 211 ? ? CZ B ARG 211 ? ? NH1 B ARG 211 ? ? 123.33 120.30 3.03   0.50 N 
16 1 NE  B ARG 211 ? ? CZ B ARG 211 ? ? NH2 B ARG 211 ? ? 116.72 120.30 -3.58  0.50 N 
17 1 NE  B ARG 213 ? ? CZ B ARG 213 ? ? NH1 B ARG 213 ? ? 124.08 120.30 3.78   0.50 N 
18 1 NE  B ARG 217 ? ? CZ B ARG 217 ? ? NH1 B ARG 217 ? ? 123.53 120.30 3.23   0.50 N 
19 1 NE  B ARG 217 ? ? CZ B ARG 217 ? ? NH2 B ARG 217 ? ? 113.46 120.30 -6.84  0.50 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ASP A 147 ? ? -55.55  -147.72 
2 1 GLU A 186 ? ? -3.75   -95.67  
3 1 CYS A 189 ? ? -115.42 51.94   
4 1 THR B 36  ? ? -96.84  -66.12  
5 1 GLU B 44  ? ? -131.57 -30.18  
6 1 ALA B 104 ? ? 69.98   -28.67  
7 1 ASN B 218 ? ? 57.08   18.44   
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A GLN 40  ? CG  ? A GLN 40  CG  
2  1 Y 1 A GLN 40  ? CD  ? A GLN 40  CD  
3  1 Y 1 A GLN 40  ? OE1 ? A GLN 40  OE1 
4  1 Y 1 A GLN 40  ? NE2 ? A GLN 40  NE2 
5  1 Y 1 A SER 51  ? OG  ? A SER 51  OG  
6  1 Y 1 A GLU 65  ? CG  ? A GLU 65  CG  
7  1 Y 1 A GLU 65  ? CD  ? A GLU 65  CD  
8  1 Y 1 A GLU 65  ? OE1 ? A GLU 65  OE1 
9  1 Y 1 A GLU 65  ? OE2 ? A GLU 65  OE2 
10 1 Y 1 A GLU 88  ? CG  ? A GLU 88  CG  
11 1 Y 1 A GLU 88  ? CD  ? A GLU 88  CD  
12 1 Y 1 A GLU 88  ? OE1 ? A GLU 88  OE1 
13 1 Y 1 A GLU 88  ? OE2 ? A GLU 88  OE2 
14 1 Y 1 A ASN 99  ? CG  ? A ASN 99  CG  
15 1 Y 1 A ASN 99  ? OD1 ? A ASN 99  OD1 
16 1 Y 1 A ASN 99  ? ND2 ? A ASN 99  ND2 
17 1 Y 1 A TYR 103 ? CG  ? A TYR 103 CG  
18 1 Y 1 A TYR 103 ? CD1 ? A TYR 103 CD1 
19 1 Y 1 A TYR 103 ? CD2 ? A TYR 103 CD2 
20 1 Y 1 A TYR 103 ? CE1 ? A TYR 103 CE1 
21 1 Y 1 A TYR 103 ? CE2 ? A TYR 103 CE2 
22 1 Y 1 A TYR 103 ? CZ  ? A TYR 103 CZ  
23 1 Y 1 A TYR 103 ? OH  ? A TYR 103 OH  
24 1 Y 1 A SER 108 ? OG  ? A SER 108 OG  
25 1 Y 1 A ASN 109 ? CG  ? A ASN 109 CG  
26 1 Y 1 A ASN 109 ? OD1 ? A ASN 109 OD1 
27 1 Y 1 A ASN 109 ? ND2 ? A ASN 109 ND2 
28 1 Y 1 A THR 129 ? OG1 ? A THR 129 OG1 
29 1 Y 1 A THR 129 ? CG2 ? A THR 129 CG2 
30 1 Y 1 A LYS 140 ? CG  ? A LYS 140 CG  
31 1 Y 1 A LYS 140 ? CD  ? A LYS 140 CD  
32 1 Y 1 A LYS 140 ? CE  ? A LYS 140 CE  
33 1 Y 1 A LYS 140 ? NZ  ? A LYS 140 NZ  
34 1 Y 1 A ASP 147 ? CG  ? A ASP 147 CG  
35 1 Y 1 A ASP 147 ? OD1 ? A ASP 147 OD1 
36 1 Y 1 A ASP 147 ? OD2 ? A ASP 147 OD2 
37 1 Y 1 A LEU 157 ? CG  ? A LEU 157 CG  
38 1 Y 1 A LEU 157 ? CD1 ? A LEU 157 CD1 
39 1 Y 1 A LEU 157 ? CD2 ? A LEU 157 CD2 
40 1 Y 1 A LYS 158 ? CG  ? A LYS 158 CG  
41 1 Y 1 A LYS 158 ? CD  ? A LYS 158 CD  
42 1 Y 1 A LYS 158 ? CE  ? A LYS 158 CE  
43 1 Y 1 A LYS 158 ? NZ  ? A LYS 158 NZ  
44 1 Y 1 B GLU 32  ? CG  ? B GLU 32  CG  
45 1 Y 1 B GLU 32  ? CD  ? B GLU 32  CD  
46 1 Y 1 B GLU 32  ? OE1 ? B GLU 32  OE1 
47 1 Y 1 B GLU 32  ? OE2 ? B GLU 32  OE2 
48 1 Y 1 B ASP 52  ? CG  ? B ASP 52  CG  
49 1 Y 1 B ASP 52  ? OD1 ? B ASP 52  OD1 
50 1 Y 1 B ASP 52  ? OD2 ? B ASP 52  OD2 
51 1 Y 1 B GLU 61  ? CG  ? B GLU 61  CG  
52 1 Y 1 B GLU 61  ? CD  ? B GLU 61  CD  
53 1 Y 1 B GLU 61  ? OE1 ? B GLU 61  OE1 
54 1 Y 1 B GLU 61  ? OE2 ? B GLU 61  OE2 
55 1 Y 1 B GLU 91  ? CG  ? B GLU 91  CG  
56 1 Y 1 B GLU 91  ? CD  ? B GLU 91  CD  
57 1 Y 1 B GLU 91  ? OE1 ? B GLU 91  OE1 
58 1 Y 1 B GLU 91  ? OE2 ? B GLU 91  OE2 
59 1 Y 1 B GLN 166 ? CG  ? B GLN 166 CG  
60 1 Y 1 B GLN 166 ? CD  ? B GLN 166 CD  
61 1 Y 1 B GLN 166 ? OE1 ? B GLN 166 OE1 
62 1 Y 1 B GLN 166 ? NE2 ? B GLN 166 NE2 
63 1 Y 1 B GLU 227 ? CG  ? B GLU 227 CG  
64 1 Y 1 B GLU 227 ? CD  ? B GLU 227 CD  
65 1 Y 1 B GLU 227 ? OE1 ? B GLU 227 OE1 
66 1 Y 1 B GLU 227 ? OE2 ? B GLU 227 OE2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A PHE 1   ? A PHE 1   
2  1 Y 1 A PRO 2   ? A PRO 2   
3  1 Y 1 A GLN 49  ? A GLN 49  
4  1 Y 1 A THR 50  ? A THR 50  
5  1 Y 1 A ASP 130 ? A ASP 130 
6  1 Y 1 A GLY 131 ? A GLY 131 
7  1 Y 1 A SER 132 ? A SER 132 
8  1 Y 1 A PRO 133 ? A PRO 133 
9  1 Y 1 A ARG 134 ? A ARG 134 
10 1 Y 1 A THR 135 ? A THR 135 
11 1 Y 1 A ASN 149 ? A ASN 149 
12 1 Y 1 A SER 150 ? A SER 150 
13 1 Y 1 A HIS 151 ? A HIS 151 
14 1 Y 1 A ASN 152 ? A ASN 152 
15 1 Y 1 A ASP 153 ? A ASP 153 
16 1 Y 1 A ASP 154 ? A ASP 154 
17 1 Y 1 B PHE 1   ? B PHE 1   
18 1 Y 1 B SER 2   ? B SER 2   
19 1 Y 1 B GLY 3   ? B GLY 3   
20 1 Y 1 B SER 4   ? B SER 4   
21 1 Y 1 B GLU 5   ? B GLU 5   
22 1 Y 1 B ALA 6   ? B ALA 6   
23 1 Y 1 B THR 7   ? B THR 7   
24 1 Y 1 B ALA 8   ? B ALA 8   
25 1 Y 1 B ALA 9   ? B ALA 9   
26 1 Y 1 B ILE 10  ? B ILE 10  
27 1 Y 1 B LEU 11  ? B LEU 11  
28 1 Y 1 B SER 12  ? B SER 12  
29 1 Y 1 B ARG 13  ? B ARG 13  
30 1 Y 1 B ALA 14  ? B ALA 14  
31 1 Y 1 B PRO 15  ? B PRO 15  
32 1 Y 1 B TRP 16  ? B TRP 16  
33 1 Y 1 B SER 17  ? B SER 17  
34 1 Y 1 B LEU 18  ? B LEU 18  
35 1 Y 1 B GLN 19  ? B GLN 19  
36 1 Y 1 B SER 20  ? B SER 20  
37 1 Y 1 B VAL 21  ? B VAL 21  
38 1 Y 1 B ASN 22  ? B ASN 22  
39 1 Y 1 B PRO 23  ? B PRO 23  
40 1 Y 1 B GLY 24  ? B GLY 24  
41 1 Y 1 B LEU 25  ? B LEU 25  
42 1 Y 1 B LYS 26  ? B LYS 26  
43 1 Y 1 B THR 27  ? B THR 27  
44 1 Y 1 B ASN 28  ? B ASN 28  
45 1 Y 1 B SER 29  ? B SER 29  
46 1 Y 1 B SER 30  ? B SER 30  
47 1 Y 1 B GLY 31  ? B GLY 31  
48 1 Y 1 B GLU 53  ? B GLU 53  
49 1 Y 1 B VAL 54  ? B VAL 54  
50 1 Y 1 B HIS 55  ? B HIS 55  
51 1 Y 1 B HIS 56  ? B HIS 56  
52 1 Y 1 B GLY 57  ? B GLY 57  
53 1 Y 1 B THR 58  ? B THR 58  
54 1 Y 1 B LYS 59  ? B LYS 59  
55 1 Y 1 B ASN 60  ? B ASN 60  
56 1 Y 1 B THR 73  ? B THR 73  
57 1 Y 1 B GLN 74  ? B GLN 74  
58 1 Y 1 B GLU 75  ? B GLU 75  
59 1 Y 1 B TRP 76  ? B TRP 76  
60 1 Y 1 B THR 77  ? B THR 77  
61 1 Y 1 B GLN 78  ? B GLN 78  
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 'SULFATE ION' SO4 
4 water         HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 SO4 1   237 1   SO4 SO4 B . 
D 4 HOH 1   192 9   HOH HOH A . 
D 4 HOH 2   193 15  HOH HOH A . 
D 4 HOH 3   194 18  HOH HOH A . 
D 4 HOH 4   195 19  HOH HOH A . 
D 4 HOH 5   196 24  HOH HOH A . 
D 4 HOH 6   197 25  HOH HOH A . 
D 4 HOH 7   198 31  HOH HOH A . 
D 4 HOH 8   199 36  HOH HOH A . 
D 4 HOH 9   200 38  HOH HOH A . 
D 4 HOH 10  201 44  HOH HOH A . 
D 4 HOH 11  202 48  HOH HOH A . 
D 4 HOH 12  203 49  HOH HOH A . 
D 4 HOH 13  204 58  HOH HOH A . 
D 4 HOH 14  205 64  HOH HOH A . 
D 4 HOH 15  206 68  HOH HOH A . 
D 4 HOH 16  207 69  HOH HOH A . 
D 4 HOH 17  208 71  HOH HOH A . 
D 4 HOH 18  209 72  HOH HOH A . 
D 4 HOH 19  210 73  HOH HOH A . 
D 4 HOH 20  211 74  HOH HOH A . 
D 4 HOH 21  212 79  HOH HOH A . 
D 4 HOH 22  213 83  HOH HOH A . 
D 4 HOH 23  214 90  HOH HOH A . 
D 4 HOH 24  215 97  HOH HOH A . 
D 4 HOH 25  216 99  HOH HOH A . 
D 4 HOH 26  217 102 HOH HOH A . 
D 4 HOH 27  218 103 HOH HOH A . 
D 4 HOH 28  219 104 HOH HOH A . 
D 4 HOH 29  220 110 HOH HOH A . 
D 4 HOH 30  221 111 HOH HOH A . 
D 4 HOH 31  222 115 HOH HOH A . 
D 4 HOH 32  223 117 HOH HOH A . 
D 4 HOH 33  224 120 HOH HOH A . 
D 4 HOH 34  225 122 HOH HOH A . 
D 4 HOH 35  226 125 HOH HOH A . 
D 4 HOH 36  227 134 HOH HOH A . 
D 4 HOH 37  228 137 HOH HOH A . 
D 4 HOH 38  229 139 HOH HOH A . 
D 4 HOH 39  230 140 HOH HOH A . 
D 4 HOH 40  231 144 HOH HOH A . 
D 4 HOH 41  232 146 HOH HOH A . 
D 4 HOH 42  233 148 HOH HOH A . 
D 4 HOH 43  234 150 HOH HOH A . 
D 4 HOH 44  235 151 HOH HOH A . 
D 4 HOH 45  236 154 HOH HOH A . 
D 4 HOH 46  237 155 HOH HOH A . 
D 4 HOH 47  238 159 HOH HOH A . 
D 4 HOH 48  239 161 HOH HOH A . 
D 4 HOH 49  240 162 HOH HOH A . 
D 4 HOH 50  241 170 HOH HOH A . 
D 4 HOH 51  242 173 HOH HOH A . 
D 4 HOH 52  243 174 HOH HOH A . 
D 4 HOH 53  244 175 HOH HOH A . 
D 4 HOH 54  245 176 HOH HOH A . 
D 4 HOH 55  246 180 HOH HOH A . 
D 4 HOH 56  247 183 HOH HOH A . 
D 4 HOH 57  248 192 HOH HOH A . 
D 4 HOH 58  249 194 HOH HOH A . 
D 4 HOH 59  250 195 HOH HOH A . 
D 4 HOH 60  251 198 HOH HOH A . 
D 4 HOH 61  252 201 HOH HOH A . 
D 4 HOH 62  253 203 HOH HOH A . 
D 4 HOH 63  254 205 HOH HOH A . 
D 4 HOH 64  255 211 HOH HOH A . 
D 4 HOH 65  256 215 HOH HOH A . 
D 4 HOH 66  257 216 HOH HOH A . 
D 4 HOH 67  258 220 HOH HOH A . 
D 4 HOH 68  259 223 HOH HOH A . 
D 4 HOH 69  260 224 HOH HOH A . 
D 4 HOH 70  261 225 HOH HOH A . 
D 4 HOH 71  262 230 HOH HOH A . 
D 4 HOH 72  263 233 HOH HOH A . 
D 4 HOH 73  264 235 HOH HOH A . 
D 4 HOH 74  265 236 HOH HOH A . 
D 4 HOH 75  266 239 HOH HOH A . 
D 4 HOH 76  267 240 HOH HOH A . 
D 4 HOH 77  268 241 HOH HOH A . 
D 4 HOH 78  269 242 HOH HOH A . 
D 4 HOH 79  270 245 HOH HOH A . 
D 4 HOH 80  271 246 HOH HOH A . 
D 4 HOH 81  272 248 HOH HOH A . 
D 4 HOH 82  273 250 HOH HOH A . 
D 4 HOH 83  274 251 HOH HOH A . 
D 4 HOH 84  275 256 HOH HOH A . 
D 4 HOH 85  276 258 HOH HOH A . 
D 4 HOH 86  277 263 HOH HOH A . 
D 4 HOH 87  278 265 HOH HOH A . 
D 4 HOH 88  279 266 HOH HOH A . 
D 4 HOH 89  280 271 HOH HOH A . 
D 4 HOH 90  281 272 HOH HOH A . 
D 4 HOH 91  282 273 HOH HOH A . 
D 4 HOH 92  283 276 HOH HOH A . 
D 4 HOH 93  284 279 HOH HOH A . 
D 4 HOH 94  285 280 HOH HOH A . 
D 4 HOH 95  286 281 HOH HOH A . 
D 4 HOH 96  287 282 HOH HOH A . 
D 4 HOH 97  288 283 HOH HOH A . 
D 4 HOH 98  289 284 HOH HOH A . 
D 4 HOH 99  290 285 HOH HOH A . 
D 4 HOH 100 291 286 HOH HOH A . 
D 4 HOH 101 292 292 HOH HOH A . 
D 4 HOH 102 293 293 HOH HOH A . 
D 4 HOH 103 294 297 HOH HOH A . 
D 4 HOH 104 295 299 HOH HOH A . 
D 4 HOH 105 296 310 HOH HOH A . 
D 4 HOH 106 297 313 HOH HOH A . 
D 4 HOH 107 298 316 HOH HOH A . 
D 4 HOH 108 299 319 HOH HOH A . 
D 4 HOH 109 300 321 HOH HOH A . 
D 4 HOH 110 301 323 HOH HOH A . 
D 4 HOH 111 302 327 HOH HOH A . 
D 4 HOH 112 303 329 HOH HOH A . 
D 4 HOH 113 304 332 HOH HOH A . 
D 4 HOH 114 305 333 HOH HOH A . 
D 4 HOH 115 306 340 HOH HOH A . 
D 4 HOH 116 307 343 HOH HOH A . 
D 4 HOH 117 308 347 HOH HOH A . 
D 4 HOH 118 309 348 HOH HOH A . 
D 4 HOH 119 310 353 HOH HOH A . 
D 4 HOH 120 311 355 HOH HOH A . 
D 4 HOH 121 312 356 HOH HOH A . 
D 4 HOH 122 313 365 HOH HOH A . 
D 4 HOH 123 314 368 HOH HOH A . 
D 4 HOH 124 315 376 HOH HOH A . 
D 4 HOH 125 316 381 HOH HOH A . 
D 4 HOH 126 317 384 HOH HOH A . 
D 4 HOH 127 318 386 HOH HOH A . 
E 4 HOH 1   238 2   HOH HOH B . 
E 4 HOH 2   239 3   HOH HOH B . 
E 4 HOH 3   240 4   HOH HOH B . 
E 4 HOH 4   241 5   HOH HOH B . 
E 4 HOH 5   242 6   HOH HOH B . 
E 4 HOH 6   243 7   HOH HOH B . 
E 4 HOH 7   244 8   HOH HOH B . 
E 4 HOH 8   245 10  HOH HOH B . 
E 4 HOH 9   246 11  HOH HOH B . 
E 4 HOH 10  247 12  HOH HOH B . 
E 4 HOH 11  248 13  HOH HOH B . 
E 4 HOH 12  249 14  HOH HOH B . 
E 4 HOH 13  250 16  HOH HOH B . 
E 4 HOH 14  251 17  HOH HOH B . 
E 4 HOH 15  252 20  HOH HOH B . 
E 4 HOH 16  253 21  HOH HOH B . 
E 4 HOH 17  254 22  HOH HOH B . 
E 4 HOH 18  255 23  HOH HOH B . 
E 4 HOH 19  256 26  HOH HOH B . 
E 4 HOH 20  257 27  HOH HOH B . 
E 4 HOH 21  258 28  HOH HOH B . 
E 4 HOH 22  259 29  HOH HOH B . 
E 4 HOH 23  260 30  HOH HOH B . 
E 4 HOH 24  261 32  HOH HOH B . 
E 4 HOH 25  262 33  HOH HOH B . 
E 4 HOH 26  263 34  HOH HOH B . 
E 4 HOH 27  264 35  HOH HOH B . 
E 4 HOH 28  265 37  HOH HOH B . 
E 4 HOH 29  266 39  HOH HOH B . 
E 4 HOH 30  267 40  HOH HOH B . 
E 4 HOH 31  268 41  HOH HOH B . 
E 4 HOH 32  269 42  HOH HOH B . 
E 4 HOH 33  270 43  HOH HOH B . 
E 4 HOH 34  271 45  HOH HOH B . 
E 4 HOH 35  272 46  HOH HOH B . 
E 4 HOH 36  273 47  HOH HOH B . 
E 4 HOH 37  274 50  HOH HOH B . 
E 4 HOH 38  275 51  HOH HOH B . 
E 4 HOH 39  276 52  HOH HOH B . 
E 4 HOH 40  277 53  HOH HOH B . 
E 4 HOH 41  278 54  HOH HOH B . 
E 4 HOH 42  279 55  HOH HOH B . 
E 4 HOH 43  280 56  HOH HOH B . 
E 4 HOH 44  281 57  HOH HOH B . 
E 4 HOH 45  282 59  HOH HOH B . 
E 4 HOH 46  283 60  HOH HOH B . 
E 4 HOH 47  284 61  HOH HOH B . 
E 4 HOH 48  285 62  HOH HOH B . 
E 4 HOH 49  286 63  HOH HOH B . 
E 4 HOH 50  287 65  HOH HOH B . 
E 4 HOH 51  288 66  HOH HOH B . 
E 4 HOH 52  289 67  HOH HOH B . 
E 4 HOH 53  290 70  HOH HOH B . 
E 4 HOH 54  291 75  HOH HOH B . 
E 4 HOH 55  292 76  HOH HOH B . 
E 4 HOH 56  293 77  HOH HOH B . 
E 4 HOH 57  294 78  HOH HOH B . 
E 4 HOH 58  295 80  HOH HOH B . 
E 4 HOH 59  296 81  HOH HOH B . 
E 4 HOH 60  297 82  HOH HOH B . 
E 4 HOH 61  298 84  HOH HOH B . 
E 4 HOH 62  299 85  HOH HOH B . 
E 4 HOH 63  300 86  HOH HOH B . 
E 4 HOH 64  301 87  HOH HOH B . 
E 4 HOH 65  302 88  HOH HOH B . 
E 4 HOH 66  303 89  HOH HOH B . 
E 4 HOH 67  304 91  HOH HOH B . 
E 4 HOH 68  305 92  HOH HOH B . 
E 4 HOH 69  306 93  HOH HOH B . 
E 4 HOH 70  307 94  HOH HOH B . 
E 4 HOH 71  308 95  HOH HOH B . 
E 4 HOH 72  309 96  HOH HOH B . 
E 4 HOH 73  310 98  HOH HOH B . 
E 4 HOH 74  311 100 HOH HOH B . 
E 4 HOH 75  312 101 HOH HOH B . 
E 4 HOH 76  313 105 HOH HOH B . 
E 4 HOH 77  314 106 HOH HOH B . 
E 4 HOH 78  315 107 HOH HOH B . 
E 4 HOH 79  316 108 HOH HOH B . 
E 4 HOH 80  317 109 HOH HOH B . 
E 4 HOH 81  318 112 HOH HOH B . 
E 4 HOH 82  319 113 HOH HOH B . 
E 4 HOH 83  320 114 HOH HOH B . 
E 4 HOH 84  321 116 HOH HOH B . 
E 4 HOH 85  322 118 HOH HOH B . 
E 4 HOH 86  323 119 HOH HOH B . 
E 4 HOH 87  324 121 HOH HOH B . 
E 4 HOH 88  325 123 HOH HOH B . 
E 4 HOH 89  326 124 HOH HOH B . 
E 4 HOH 90  327 126 HOH HOH B . 
E 4 HOH 91  328 127 HOH HOH B . 
E 4 HOH 92  329 128 HOH HOH B . 
E 4 HOH 93  330 129 HOH HOH B . 
E 4 HOH 94  331 130 HOH HOH B . 
E 4 HOH 95  332 131 HOH HOH B . 
E 4 HOH 96  333 132 HOH HOH B . 
E 4 HOH 97  334 133 HOH HOH B . 
E 4 HOH 98  335 135 HOH HOH B . 
E 4 HOH 99  336 136 HOH HOH B . 
E 4 HOH 100 337 138 HOH HOH B . 
E 4 HOH 101 338 141 HOH HOH B . 
E 4 HOH 102 339 142 HOH HOH B . 
E 4 HOH 103 340 143 HOH HOH B . 
E 4 HOH 104 341 145 HOH HOH B . 
E 4 HOH 105 342 147 HOH HOH B . 
E 4 HOH 106 343 149 HOH HOH B . 
E 4 HOH 107 344 152 HOH HOH B . 
E 4 HOH 108 345 153 HOH HOH B . 
E 4 HOH 109 346 156 HOH HOH B . 
E 4 HOH 110 347 157 HOH HOH B . 
E 4 HOH 111 348 158 HOH HOH B . 
E 4 HOH 112 349 160 HOH HOH B . 
E 4 HOH 113 350 163 HOH HOH B . 
E 4 HOH 114 351 164 HOH HOH B . 
E 4 HOH 115 352 165 HOH HOH B . 
E 4 HOH 116 353 166 HOH HOH B . 
E 4 HOH 117 354 167 HOH HOH B . 
E 4 HOH 118 355 168 HOH HOH B . 
E 4 HOH 119 356 169 HOH HOH B . 
E 4 HOH 120 357 171 HOH HOH B . 
E 4 HOH 121 358 172 HOH HOH B . 
E 4 HOH 122 359 177 HOH HOH B . 
E 4 HOH 123 360 178 HOH HOH B . 
E 4 HOH 124 361 179 HOH HOH B . 
E 4 HOH 125 362 181 HOH HOH B . 
E 4 HOH 126 363 182 HOH HOH B . 
E 4 HOH 127 364 184 HOH HOH B . 
E 4 HOH 128 365 185 HOH HOH B . 
E 4 HOH 129 366 186 HOH HOH B . 
E 4 HOH 130 367 187 HOH HOH B . 
E 4 HOH 131 368 188 HOH HOH B . 
E 4 HOH 132 369 189 HOH HOH B . 
E 4 HOH 133 370 190 HOH HOH B . 
E 4 HOH 134 371 191 HOH HOH B . 
E 4 HOH 135 372 193 HOH HOH B . 
E 4 HOH 136 373 196 HOH HOH B . 
E 4 HOH 137 374 197 HOH HOH B . 
E 4 HOH 138 375 199 HOH HOH B . 
E 4 HOH 139 376 200 HOH HOH B . 
E 4 HOH 140 377 202 HOH HOH B . 
E 4 HOH 141 378 204 HOH HOH B . 
E 4 HOH 142 379 206 HOH HOH B . 
E 4 HOH 143 380 207 HOH HOH B . 
E 4 HOH 144 381 208 HOH HOH B . 
E 4 HOH 145 382 209 HOH HOH B . 
E 4 HOH 146 383 210 HOH HOH B . 
E 4 HOH 147 384 212 HOH HOH B . 
E 4 HOH 148 385 213 HOH HOH B . 
E 4 HOH 149 386 214 HOH HOH B . 
E 4 HOH 150 387 217 HOH HOH B . 
E 4 HOH 151 388 218 HOH HOH B . 
E 4 HOH 152 389 219 HOH HOH B . 
E 4 HOH 153 390 221 HOH HOH B . 
E 4 HOH 154 391 222 HOH HOH B . 
E 4 HOH 155 392 226 HOH HOH B . 
E 4 HOH 156 393 227 HOH HOH B . 
E 4 HOH 157 394 228 HOH HOH B . 
E 4 HOH 158 395 229 HOH HOH B . 
E 4 HOH 159 396 231 HOH HOH B . 
E 4 HOH 160 397 232 HOH HOH B . 
E 4 HOH 161 398 234 HOH HOH B . 
E 4 HOH 162 399 237 HOH HOH B . 
E 4 HOH 163 400 238 HOH HOH B . 
E 4 HOH 164 401 243 HOH HOH B . 
E 4 HOH 165 402 244 HOH HOH B . 
E 4 HOH 166 403 247 HOH HOH B . 
E 4 HOH 167 404 249 HOH HOH B . 
E 4 HOH 168 405 252 HOH HOH B . 
E 4 HOH 169 406 253 HOH HOH B . 
E 4 HOH 170 407 254 HOH HOH B . 
E 4 HOH 171 408 255 HOH HOH B . 
E 4 HOH 172 409 257 HOH HOH B . 
E 4 HOH 173 410 259 HOH HOH B . 
E 4 HOH 174 411 260 HOH HOH B . 
E 4 HOH 175 412 261 HOH HOH B . 
E 4 HOH 176 413 262 HOH HOH B . 
E 4 HOH 177 414 264 HOH HOH B . 
E 4 HOH 178 415 267 HOH HOH B . 
E 4 HOH 179 416 268 HOH HOH B . 
E 4 HOH 180 417 269 HOH HOH B . 
E 4 HOH 181 418 270 HOH HOH B . 
E 4 HOH 182 419 274 HOH HOH B . 
E 4 HOH 183 420 275 HOH HOH B . 
E 4 HOH 184 421 277 HOH HOH B . 
E 4 HOH 185 422 278 HOH HOH B . 
E 4 HOH 186 423 287 HOH HOH B . 
E 4 HOH 187 424 288 HOH HOH B . 
E 4 HOH 188 425 289 HOH HOH B . 
E 4 HOH 189 426 290 HOH HOH B . 
E 4 HOH 190 427 291 HOH HOH B . 
E 4 HOH 191 428 294 HOH HOH B . 
E 4 HOH 192 429 295 HOH HOH B . 
E 4 HOH 193 430 296 HOH HOH B . 
E 4 HOH 194 431 298 HOH HOH B . 
E 4 HOH 195 432 300 HOH HOH B . 
E 4 HOH 196 433 301 HOH HOH B . 
E 4 HOH 197 434 302 HOH HOH B . 
E 4 HOH 198 435 303 HOH HOH B . 
E 4 HOH 199 436 304 HOH HOH B . 
E 4 HOH 200 437 305 HOH HOH B . 
E 4 HOH 201 438 306 HOH HOH B . 
E 4 HOH 202 439 307 HOH HOH B . 
E 4 HOH 203 440 308 HOH HOH B . 
E 4 HOH 204 441 309 HOH HOH B . 
E 4 HOH 205 442 311 HOH HOH B . 
E 4 HOH 206 443 312 HOH HOH B . 
E 4 HOH 207 444 314 HOH HOH B . 
E 4 HOH 208 445 315 HOH HOH B . 
E 4 HOH 209 446 317 HOH HOH B . 
E 4 HOH 210 447 318 HOH HOH B . 
E 4 HOH 211 448 320 HOH HOH B . 
E 4 HOH 212 449 322 HOH HOH B . 
E 4 HOH 213 450 324 HOH HOH B . 
E 4 HOH 214 451 325 HOH HOH B . 
E 4 HOH 215 452 326 HOH HOH B . 
E 4 HOH 216 453 330 HOH HOH B . 
E 4 HOH 217 454 331 HOH HOH B . 
E 4 HOH 218 455 334 HOH HOH B . 
E 4 HOH 219 456 335 HOH HOH B . 
E 4 HOH 220 457 336 HOH HOH B . 
E 4 HOH 221 458 337 HOH HOH B . 
E 4 HOH 222 459 339 HOH HOH B . 
E 4 HOH 223 460 341 HOH HOH B . 
E 4 HOH 224 461 342 HOH HOH B . 
E 4 HOH 225 462 344 HOH HOH B . 
E 4 HOH 226 463 345 HOH HOH B . 
E 4 HOH 227 464 346 HOH HOH B . 
E 4 HOH 228 465 349 HOH HOH B . 
E 4 HOH 229 466 350 HOH HOH B . 
E 4 HOH 230 467 351 HOH HOH B . 
E 4 HOH 231 468 352 HOH HOH B . 
E 4 HOH 232 469 354 HOH HOH B . 
E 4 HOH 233 470 357 HOH HOH B . 
E 4 HOH 234 471 358 HOH HOH B . 
E 4 HOH 235 472 359 HOH HOH B . 
E 4 HOH 236 473 360 HOH HOH B . 
E 4 HOH 237 474 361 HOH HOH B . 
E 4 HOH 238 475 363 HOH HOH B . 
E 4 HOH 239 476 364 HOH HOH B . 
E 4 HOH 240 477 366 HOH HOH B . 
E 4 HOH 241 478 367 HOH HOH B . 
E 4 HOH 242 479 369 HOH HOH B . 
E 4 HOH 243 480 370 HOH HOH B . 
E 4 HOH 244 481 371 HOH HOH B . 
E 4 HOH 245 482 372 HOH HOH B . 
E 4 HOH 246 483 373 HOH HOH B . 
E 4 HOH 247 484 374 HOH HOH B . 
E 4 HOH 248 485 375 HOH HOH B . 
E 4 HOH 249 486 377 HOH HOH B . 
E 4 HOH 250 487 378 HOH HOH B . 
E 4 HOH 251 488 379 HOH HOH B . 
E 4 HOH 252 489 380 HOH HOH B . 
E 4 HOH 253 490 382 HOH HOH B . 
E 4 HOH 254 491 385 HOH HOH B . 
E 4 HOH 255 492 387 HOH HOH B . 
#