data_1AYJ
# 
_entry.id   1AYJ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.320 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1AYJ         
WWPDB D_1000171412 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1AYJ 
_pdbx_database_status.recvd_initial_deposition_date   1997-11-05 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    BNL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Fant, F.'          1 
'Borremans, F.A.M.' 2 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Determination of the three-dimensional solution structure of Raphanus sativus antifungal protein 1 by 1H NMR.' 
J.Mol.Biol.         279 257 270 1998 JMOBAK UK 0022-2836 0070 ? 9636715 10.1006/jmbi.1998.1767 
1       
;Solution Conformation of Raphanus Sativus Antifungal Protein 1 (Rs-Afp1) by 1H Nuclear Magnetic Resonance. Resonance Assignments, Secondary Structure and Global Fold
;
Bull.Soc.Chim.Belg. 106 51  ?   1997 BSCBAG BE 0037-9646 0054 ? ?       ?                      
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Fant, F.'          1 ? 
primary 'Vranken, W.'       2 ? 
primary 'Broekaert, W.'     3 ? 
primary 'Borremans, F.'     4 ? 
1       'Fant, F.'          5 ? 
1       'Vranken, W.F.'     6 ? 
1       'Martins, J.C.'     7 ? 
1       'Borremans, F.A.M.' 8 ? 
# 
_cell.entry_id           1AYJ 
_cell.length_a           1.000 
_cell.length_b           1.000 
_cell.length_c           1.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1AYJ 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 nat 
_entity.pdbx_description           'ANTIFUNGAL PROTEIN 1' 
_entity.formula_weight             5685.550 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              ? 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        RS-AFP1 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   yes 
_entity_poly.pdbx_seq_one_letter_code       '(PCA)KLCERPSGTWSGVCGNNNACKNQCINLEKARHGSCNYVFPAHKCICYFPC' 
_entity_poly.pdbx_seq_one_letter_code_can   QKLCERPSGTWSGVCGNNNACKNQCINLEKARHGSCNYVFPAHKCICYFPC 
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  PCA n 
1 2  LYS n 
1 3  LEU n 
1 4  CYS n 
1 5  GLU n 
1 6  ARG n 
1 7  PRO n 
1 8  SER n 
1 9  GLY n 
1 10 THR n 
1 11 TRP n 
1 12 SER n 
1 13 GLY n 
1 14 VAL n 
1 15 CYS n 
1 16 GLY n 
1 17 ASN n 
1 18 ASN n 
1 19 ASN n 
1 20 ALA n 
1 21 CYS n 
1 22 LYS n 
1 23 ASN n 
1 24 GLN n 
1 25 CYS n 
1 26 ILE n 
1 27 ASN n 
1 28 LEU n 
1 29 GLU n 
1 30 LYS n 
1 31 ALA n 
1 32 ARG n 
1 33 HIS n 
1 34 GLY n 
1 35 SER n 
1 36 CYS n 
1 37 ASN n 
1 38 TYR n 
1 39 VAL n 
1 40 PHE n 
1 41 PRO n 
1 42 ALA n 
1 43 HIS n 
1 44 LYS n 
1 45 CYS n 
1 46 ILE n 
1 47 CYS n 
1 48 TYR n 
1 49 PHE n 
1 50 PRO n 
1 51 CYS n 
# 
_entity_src_nat.entity_id                  1 
_entity_src_nat.pdbx_src_id                1 
_entity_src_nat.pdbx_alt_source_flag       sample 
_entity_src_nat.pdbx_beg_seq_num           ? 
_entity_src_nat.pdbx_end_seq_num           ? 
_entity_src_nat.common_name                'Chinese radish' 
_entity_src_nat.pdbx_organism_scientific   'Raphanus sativus var. niger' 
_entity_src_nat.pdbx_ncbi_taxonomy_id      41679 
_entity_src_nat.genus                      Raphanus 
_entity_src_nat.species                    'Raphanus sativus' 
_entity_src_nat.strain                     'var. niger' 
_entity_src_nat.tissue                     ? 
_entity_src_nat.tissue_fraction            ? 
_entity_src_nat.pdbx_secretion             ? 
_entity_src_nat.pdbx_fragment              ? 
_entity_src_nat.pdbx_variant               ? 
_entity_src_nat.pdbx_cell_line             ? 
_entity_src_nat.pdbx_atcc                  ? 
_entity_src_nat.pdbx_cellular_location     ? 
_entity_src_nat.pdbx_organ                 SEED 
_entity_src_nat.pdbx_organelle             ? 
_entity_src_nat.pdbx_cell                  ? 
_entity_src_nat.pdbx_plasmid_name          ? 
_entity_src_nat.pdbx_plasmid_details       ? 
_entity_src_nat.details                    ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    AFP1_SINAL 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P30231 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   QKLCERPSGTWSGVCGNNNACKNQCINLEKARHGSCNYVFPAHKCICYFPC 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1AYJ 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 2 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 51 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P30231 
_struct_ref_seq.db_align_beg                  2 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  51 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       2 
_struct_ref_seq.pdbx_auth_seq_align_end       51 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE             ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE            ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE          ? 'C4 H8 N2 O3'    132.118 
CYS 'L-peptide linking' y CYSTEINE            ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE           ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'     ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE             ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE           ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE          ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE             ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE              ? 'C6 H15 N2 O2 1' 147.195 
PCA 'L-peptide linking' n 'PYROGLUTAMIC ACID' ? 'C5 H7 N O3'     129.114 
PHE 'L-peptide linking' y PHENYLALANINE       ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE             ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE              ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE           ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN          ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE            ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE              ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
_pdbx_nmr_exptl.solution_id 
1 1 DQF-COSY 1 
2 1 E.COSY   1 
3 1 NOESY    1 
4 1 TOCSY    1 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         305 
_pdbx_nmr_exptl_sample_conditions.pressure            ? 
_pdbx_nmr_exptl_sample_conditions.pH                  4.2 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      ? 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.model             AM500 
_pdbx_nmr_spectrometer.manufacturer      Bruker 
_pdbx_nmr_spectrometer.field_strength    500 
# 
_pdbx_nmr_refine.entry_id           1AYJ 
_pdbx_nmr_refine.method             'DIANA AND SIMULATED ANNEALING' 
_pdbx_nmr_refine.details            
'SIMULATED ANNEALING PROTOCOL ADOPTED NILGES ET AL. 1988, FEBS LETTERS, VOL. 239, PP129-136. INSIGHT II ALSO WAS USED.' 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.entry_id                             1AYJ 
_pdbx_nmr_ensemble.conformers_calculated_total_number   500 
_pdbx_nmr_ensemble.conformers_submitted_total_number    20 
_pdbx_nmr_ensemble.conformer_selection_criteria         'LEAST RESTRAINT VIOLATION AND ENERGY' 
# 
loop_
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
refinement           Discover           ? 'MSI/BIOSYM TECHNOLOGIES' 1 
'structure solution' DIANA/REDAC        ? ?                         2 
'structure solution' INSIGHTII/DISCOVER ? ?                         3 
# 
_exptl.entry_id          1AYJ 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_struct.entry_id                  1AYJ 
_struct.title                     
;DETERMINATION OF THE THREE-DIMENSIONAL SOLUTION STRUCTURE OF RAPHANUS SATIVUS ANTIFUNGAL PROTEIN 1 (RS-AFP1) BY 1H NMR, 20 STRUCTURES
;
_struct.pdbx_descriptor           'ANTIFUNGAL PROTEIN 1' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1AYJ 
_struct_keywords.pdbx_keywords   FUNGICIDE 
_struct_keywords.text            'FUNGICIDE, PLANT DEFENSIN, CYSTEINE-STABILIZED ALFA/BETA MOTIF' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   Y 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id   1 
# 
_struct_conf.conf_type_id            HELX_P 
_struct_conf.id                      HELX_P1 
_struct_conf.pdbx_PDB_helix_id       1 
_struct_conf.beg_label_comp_id       ASN 
_struct_conf.beg_label_asym_id       A 
_struct_conf.beg_label_seq_id        18 
_struct_conf.pdbx_beg_PDB_ins_code   ? 
_struct_conf.end_label_comp_id       LEU 
_struct_conf.end_label_asym_id       A 
_struct_conf.end_label_seq_id        28 
_struct_conf.pdbx_end_PDB_ins_code   ? 
_struct_conf.beg_auth_comp_id        ASN 
_struct_conf.beg_auth_asym_id        A 
_struct_conf.beg_auth_seq_id         18 
_struct_conf.end_auth_comp_id        LEU 
_struct_conf.end_auth_asym_id        A 
_struct_conf.end_auth_seq_id         28 
_struct_conf.pdbx_PDB_helix_class    1 
_struct_conf.details                 ? 
_struct_conf.pdbx_PDB_helix_length   11 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ?    ? A CYS 4  SG ? ? ? 1_555 A CYS 51 SG ? ? A CYS 4  A CYS 51 1_555 ? ? ? ? ? ? ? 2.072 ? 
disulf2 disulf ?    ? A CYS 15 SG ? ? ? 1_555 A CYS 36 SG ? ? A CYS 15 A CYS 36 1_555 ? ? ? ? ? ? ? 2.068 ? 
disulf3 disulf ?    ? A CYS 21 SG ? ? ? 1_555 A CYS 45 SG ? ? A CYS 21 A CYS 45 1_555 ? ? ? ? ? ? ? 2.079 ? 
disulf4 disulf ?    ? A CYS 25 SG ? ? ? 1_555 A CYS 47 SG ? ? A CYS 25 A CYS 47 1_555 ? ? ? ? ? ? ? 2.068 ? 
covale1 covale both ? A PCA 1  C  ? ? ? 1_555 A LYS 2  N  ? ? A PCA 1  A LYS 2  1_555 ? ? ? ? ? ? ? 1.336 ? 
hydrog1 hydrog ?    ? A GLU 29 N  ? ? ? 1_555 A CYS 25 O  ? ? A GLU 29 A CYS 25 1_555 ? ? ? ? ? ? ? ?     ? 
hydrog2 hydrog ?    ? A ILE 26 N  ? ? ? 1_555 A LYS 22 O  ? ? A ILE 26 A LYS 22 1_555 ? ? ? ? ? ? ? ?     ? 
hydrog3 hydrog ?    ? A CYS 25 N  ? ? ? 1_555 A CYS 21 O  ? ? A CYS 25 A CYS 21 1_555 ? ? ? ? ? ? ? ?     ? 
hydrog4 hydrog ?    ? A LYS 22 N  ? ? ? 1_555 A ASN 18 O  ? ? A LYS 22 A ASN 18 1_555 ? ? ? ? ? ? ? ?     ? 
hydrog5 hydrog ?    ? A GLN 24 N  ? ? ? 1_555 A ALA 20 O  ? ? A GLN 24 A ALA 20 1_555 ? ? ? ? ? ? ? ?     ? 
hydrog6 hydrog ?    ? A ARG 6  N  ? ? ? 1_555 A CYS 47 O  ? ? A ARG 6  A CYS 47 1_555 ? ? ? ? ? ? ? ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1  PHE 40 A . ? PHE 40 A PRO 41 A ? PRO 41 A 1  -9.98  
2  PHE 40 A . ? PHE 40 A PRO 41 A ? PRO 41 A 2  -10.39 
3  PHE 40 A . ? PHE 40 A PRO 41 A ? PRO 41 A 3  0.80   
4  PHE 40 A . ? PHE 40 A PRO 41 A ? PRO 41 A 4  -8.96  
5  PHE 40 A . ? PHE 40 A PRO 41 A ? PRO 41 A 5  -10.45 
6  PHE 40 A . ? PHE 40 A PRO 41 A ? PRO 41 A 6  -8.23  
7  PHE 40 A . ? PHE 40 A PRO 41 A ? PRO 41 A 7  -5.78  
8  PHE 40 A . ? PHE 40 A PRO 41 A ? PRO 41 A 8  -10.34 
9  PHE 40 A . ? PHE 40 A PRO 41 A ? PRO 41 A 9  -10.59 
10 PHE 40 A . ? PHE 40 A PRO 41 A ? PRO 41 A 10 -10.80 
11 PHE 40 A . ? PHE 40 A PRO 41 A ? PRO 41 A 11 -10.34 
12 PHE 40 A . ? PHE 40 A PRO 41 A ? PRO 41 A 12 -10.71 
13 PHE 40 A . ? PHE 40 A PRO 41 A ? PRO 41 A 13 -10.37 
14 PHE 40 A . ? PHE 40 A PRO 41 A ? PRO 41 A 14 -10.22 
15 PHE 40 A . ? PHE 40 A PRO 41 A ? PRO 41 A 15 -10.65 
16 PHE 40 A . ? PHE 40 A PRO 41 A ? PRO 41 A 16 6.06   
17 PHE 40 A . ? PHE 40 A PRO 41 A ? PRO 41 A 17 -10.70 
18 PHE 40 A . ? PHE 40 A PRO 41 A ? PRO 41 A 18 -10.66 
19 PHE 40 A . ? PHE 40 A PRO 41 A ? PRO 41 A 19 -10.66 
20 PHE 40 A . ? PHE 40 A PRO 41 A ? PRO 41 A 20 6.88   
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   3 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 CYS A 4  ? PRO A 7  ? CYS A 4  PRO A 7  
A 2 LYS A 44 ? PHE A 49 ? LYS A 44 PHE A 49 
A 3 HIS A 33 ? ASN A 37 ? HIS A 33 ASN A 37 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O CYS A 4  ? O CYS A 4  N PHE A 49 ? N PHE A 49 
A 2 3 O LYS A 44 ? O LYS A 44 N ASN A 37 ? N ASN A 37 
# 
_database_PDB_matrix.entry_id          1AYJ 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1AYJ 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
HETATM 1     N N    . PCA A 1 1  ? 1.383   2.955  5.441   1.00 1.00 ? 1  PCA A N    1  
HETATM 2     C CA   . PCA A 1 1  ? 1.929   1.614  5.444   1.00 1.00 ? 1  PCA A CA   1  
HETATM 3     C CB   . PCA A 1 1  ? 0.853   0.763  6.147   1.00 1.00 ? 1  PCA A CB   1  
HETATM 4     C CG   . PCA A 1 1  ? -0.430  1.589  5.965   1.00 1.00 ? 1  PCA A CG   1  
HETATM 5     C CD   . PCA A 1 1  ? 0.079   2.986  5.666   1.00 1.00 ? 1  PCA A CD   1  
HETATM 6     O OE   . PCA A 1 1  ? -0.632  3.986  5.625   1.00 1.00 ? 1  PCA A OE   1  
HETATM 7     C C    . PCA A 1 1  ? 2.219   1.212  3.994   1.00 1.00 ? 1  PCA A C    1  
HETATM 8     O O    . PCA A 1 1  ? 3.275   1.549  3.462   1.00 1.00 ? 1  PCA A O    1  
HETATM 9     H H    . PCA A 1 1  ? 1.931   3.766  5.199   1.00 0.00 ? 1  PCA A H    1  
HETATM 10    H HA   . PCA A 1 1  ? 2.853   1.583  6.018   1.00 1.00 ? 1  PCA A HA   1  
HETATM 11    H HB2  . PCA A 1 1  ? 0.771   -0.259 5.773   1.00 1.00 ? 1  PCA A HB2  1  
HETATM 12    H HB3  . PCA A 1 1  ? 1.089   0.731  7.212   1.00 1.00 ? 1  PCA A HB3  1  
HETATM 13    H HG2  . PCA A 1 1  ? -1.009  1.231  5.116   1.00 1.00 ? 1  PCA A HG2  1  
HETATM 14    H HG3  . PCA A 1 1  ? -1.034  1.579  6.872   1.00 1.00 ? 1  PCA A HG3  1  
ATOM   15    N N    . LYS A 1 2  ? 1.265   0.560  3.324   1.00 1.00 ? 2  LYS A N    1  
ATOM   16    C CA   . LYS A 1 2  ? 1.357   0.238  1.906   1.00 1.00 ? 2  LYS A CA   1  
ATOM   17    C C    . LYS A 1 2  ? 1.089   1.517  1.105   1.00 1.00 ? 2  LYS A C    1  
ATOM   18    O O    . LYS A 1 2  ? 0.055   1.652  0.453   1.00 1.00 ? 2  LYS A O    1  
ATOM   19    C CB   . LYS A 1 2  ? 0.374   -0.909 1.605   1.00 1.00 ? 2  LYS A CB   1  
ATOM   20    C CG   . LYS A 1 2  ? 0.280   -1.360 0.138   1.00 1.00 ? 2  LYS A CG   1  
ATOM   21    C CD   . LYS A 1 2  ? 1.638   -1.727 -0.479  1.00 1.00 ? 2  LYS A CD   1  
ATOM   22    C CE   . LYS A 1 2  ? 1.475   -2.422 -1.841  1.00 1.00 ? 2  LYS A CE   1  
ATOM   23    N NZ   . LYS A 1 2  ? 0.831   -1.560 -2.857  1.00 1.00 ? 2  LYS A NZ   1  
ATOM   24    H H    . LYS A 1 2  ? 0.403   0.343  3.799   1.00 1.00 ? 2  LYS A H    1  
ATOM   25    H HA   . LYS A 1 2  ? 2.367   -0.111 1.685   1.00 1.00 ? 2  LYS A HA   1  
ATOM   26    H HB2  . LYS A 1 2  ? 0.668   -1.771 2.206   1.00 1.00 ? 2  LYS A HB2  1  
ATOM   27    H HB3  . LYS A 1 2  ? -0.626  -0.606 1.922   1.00 1.00 ? 2  LYS A HB3  1  
ATOM   28    H HG2  . LYS A 1 2  ? -0.376  -2.233 0.114   1.00 1.00 ? 2  LYS A HG2  1  
ATOM   29    H HG3  . LYS A 1 2  ? -0.193  -0.572 -0.441  1.00 1.00 ? 2  LYS A HG3  1  
ATOM   30    H HD2  . LYS A 1 2  ? 2.256   -0.833 -0.589  1.00 1.00 ? 2  LYS A HD2  1  
ATOM   31    H HD3  . LYS A 1 2  ? 2.152   -2.416 0.196   1.00 1.00 ? 2  LYS A HD3  1  
ATOM   32    H HE2  . LYS A 1 2  ? 2.464   -2.713 -2.204  1.00 1.00 ? 2  LYS A HE2  1  
ATOM   33    H HE3  . LYS A 1 2  ? 0.881   -3.328 -1.713  1.00 1.00 ? 2  LYS A HE3  1  
ATOM   34    H HZ1  . LYS A 1 2  ? -0.089  -1.258 -2.555  1.00 1.00 ? 2  LYS A HZ1  1  
ATOM   35    H HZ2  . LYS A 1 2  ? 1.380   -0.731 -3.029  1.00 1.00 ? 2  LYS A HZ2  1  
ATOM   36    H HZ3  . LYS A 1 2  ? 0.721   -2.061 -3.727  1.00 1.00 ? 2  LYS A HZ3  1  
ATOM   37    N N    . LEU A 1 3  ? 2.026   2.465  1.168   1.00 1.00 ? 3  LEU A N    1  
ATOM   38    C CA   . LEU A 1 3  ? 1.915   3.738  0.476   1.00 1.00 ? 3  LEU A CA   1  
ATOM   39    C C    . LEU A 1 3  ? 2.670   3.683  -0.847  1.00 1.00 ? 3  LEU A C    1  
ATOM   40    O O    . LEU A 1 3  ? 3.727   3.057  -0.939  1.00 1.00 ? 3  LEU A O    1  
ATOM   41    C CB   . LEU A 1 3  ? 2.463   4.887  1.321   1.00 1.00 ? 3  LEU A CB   1  
ATOM   42    C CG   . LEU A 1 3  ? 1.726   5.072  2.657   1.00 1.00 ? 3  LEU A CG   1  
ATOM   43    C CD1  . LEU A 1 3  ? 2.691   5.649  3.696   1.00 1.00 ? 3  LEU A CD1  1  
ATOM   44    C CD2  . LEU A 1 3  ? 0.509   5.991  2.524   1.00 1.00 ? 3  LEU A CD2  1  
ATOM   45    H H    . LEU A 1 3  ? 2.837   2.295  1.756   1.00 1.00 ? 3  LEU A H    1  
ATOM   46    H HA   . LEU A 1 3  ? 0.867   3.942  0.304   1.00 1.00 ? 3  LEU A HA   1  
ATOM   47    H HB2  . LEU A 1 3  ? 3.513   4.671  1.483   1.00 1.00 ? 3  LEU A HB2  1  
ATOM   48    H HB3  . LEU A 1 3  ? 2.401   5.810  0.745   1.00 1.00 ? 3  LEU A HB3  1  
ATOM   49    H HG   . LEU A 1 3  ? 1.354   4.114  3.011   1.00 1.00 ? 3  LEU A HG   1  
ATOM   50    H HD11 . LEU A 1 3  ? 3.109   6.587  3.332   1.00 1.00 ? 3  LEU A HD11 1  
ATOM   51    H HD12 . LEU A 1 3  ? 2.165   5.831  4.632   1.00 1.00 ? 3  LEU A HD12 1  
ATOM   52    H HD13 . LEU A 1 3  ? 3.507   4.948  3.874   1.00 1.00 ? 3  LEU A HD13 1  
ATOM   53    H HD21 . LEU A 1 3  ? -0.108  5.668  1.693   1.00 1.00 ? 3  LEU A HD21 1  
ATOM   54    H HD22 . LEU A 1 3  ? -0.075  5.939  3.441   1.00 1.00 ? 3  LEU A HD22 1  
ATOM   55    H HD23 . LEU A 1 3  ? 0.811   7.023  2.362   1.00 1.00 ? 3  LEU A HD23 1  
ATOM   56    N N    . CYS A 1 4  ? 2.148   4.394  -1.844  1.00 1.00 ? 4  CYS A N    1  
ATOM   57    C CA   . CYS A 1 4  ? 2.759   4.587  -3.150  1.00 1.00 ? 4  CYS A CA   1  
ATOM   58    C C    . CYS A 1 4  ? 3.119   6.061  -3.262  1.00 1.00 ? 4  CYS A C    1  
ATOM   59    O O    . CYS A 1 4  ? 2.262   6.933  -3.105  1.00 1.00 ? 4  CYS A O    1  
ATOM   60    C CB   . CYS A 1 4  ? 1.842   4.138  -4.291  1.00 1.00 ? 4  CYS A CB   1  
ATOM   61    S SG   . CYS A 1 4  ? 1.778   2.352  -4.527  1.00 1.00 ? 4  CYS A SG   1  
ATOM   62    H H    . CYS A 1 4  ? 1.311   4.920  -1.627  1.00 1.00 ? 4  CYS A H    1  
ATOM   63    H HA   . CYS A 1 4  ? 3.670   3.991  -3.228  1.00 1.00 ? 4  CYS A HA   1  
ATOM   64    H HB2  . CYS A 1 4  ? 0.818   4.478  -4.134  1.00 1.00 ? 4  CYS A HB2  1  
ATOM   65    H HB3  . CYS A 1 4  ? 2.212   4.563  -5.224  1.00 1.00 ? 4  CYS A HB3  1  
ATOM   66    N N    . GLU A 1 5  ? 4.409   6.312  -3.480  1.00 1.00 ? 5  GLU A N    1  
ATOM   67    C CA   . GLU A 1 5  ? 5.052   7.609  -3.419  1.00 1.00 ? 5  GLU A CA   1  
ATOM   68    C C    . GLU A 1 5  ? 4.978   8.251  -4.796  1.00 1.00 ? 5  GLU A C    1  
ATOM   69    O O    . GLU A 1 5  ? 5.991   8.484  -5.454  1.00 1.00 ? 5  GLU A O    1  
ATOM   70    C CB   . GLU A 1 5  ? 6.495   7.411  -2.933  1.00 1.00 ? 5  GLU A CB   1  
ATOM   71    C CG   . GLU A 1 5  ? 6.518   6.764  -1.539  1.00 1.00 ? 5  GLU A CG   1  
ATOM   72    C CD   . GLU A 1 5  ? 6.214   5.264  -1.515  1.00 1.00 ? 5  GLU A CD   1  
ATOM   73    O OE1  . GLU A 1 5  ? 6.318   4.605  -2.548  1.00 1.00 ? 5  GLU A OE1  1  
ATOM   74    O OE2  . GLU A 1 5  ? 5.753   4.763  -0.338  1.00 1.00 ? 5  GLU A OE2  1  
ATOM   75    H H    . GLU A 1 5  ? 5.032   5.519  -3.597  1.00 1.00 ? 5  GLU A H    1  
ATOM   76    H HA   . GLU A 1 5  ? 4.532   8.254  -2.708  1.00 1.00 ? 5  GLU A HA   1  
ATOM   77    H HB2  . GLU A 1 5  ? 7.067   6.809  -3.642  1.00 1.00 ? 5  GLU A HB2  1  
ATOM   78    H HB3  . GLU A 1 5  ? 6.967   8.390  -2.862  1.00 1.00 ? 5  GLU A HB3  1  
ATOM   79    H HG2  . GLU A 1 5  ? 7.498   6.925  -1.096  1.00 1.00 ? 5  GLU A HG2  1  
ATOM   80    H HG3  . GLU A 1 5  ? 5.765   7.272  -0.943  1.00 1.00 ? 5  GLU A HG3  1  
ATOM   81    H HE2  . GLU A 1 5  ? 5.317   3.915  -0.486  1.00 1.00 ? 5  GLU A HE2  1  
ATOM   82    N N    . ARG A 1 6  ? 3.752   8.496  -5.245  1.00 1.00 ? 6  ARG A N    1  
ATOM   83    C CA   . ARG A 1 6  ? 3.510   9.055  -6.566  1.00 1.00 ? 6  ARG A CA   1  
ATOM   84    C C    . ARG A 1 6  ? 3.821   10.553 -6.529  1.00 1.00 ? 6  ARG A C    1  
ATOM   85    O O    . ARG A 1 6  ? 3.591   11.190 -5.501  1.00 1.00 ? 6  ARG A O    1  
ATOM   86    C CB   . ARG A 1 6  ? 2.033   8.842  -6.983  1.00 1.00 ? 6  ARG A CB   1  
ATOM   87    C CG   . ARG A 1 6  ? 1.843   8.113  -8.331  1.00 1.00 ? 6  ARG A CG   1  
ATOM   88    C CD   . ARG A 1 6  ? 0.798   8.706  -9.296  1.00 1.00 ? 6  ARG A CD   1  
ATOM   89    N NE   . ARG A 1 6  ? 1.047   10.127 -9.594  1.00 1.00 ? 6  ARG A NE   1  
ATOM   90    C CZ   . ARG A 1 6  ? 0.526   10.867 -10.589 1.00 1.00 ? 6  ARG A CZ   1  
ATOM   91    N NH1  . ARG A 1 6  ? -0.229  10.305 -11.538 1.00 1.00 ? 6  ARG A NH1  1  
ATOM   92    N NH2  . ARG A 1 6  ? 0.767   12.180 -10.608 1.00 1.00 ? 6  ARG A NH2  1  
ATOM   93    H H    . ARG A 1 6  ? 3.003   8.414  -4.561  1.00 1.00 ? 6  ARG A H    1  
ATOM   94    H HA   . ARG A 1 6  ? 4.171   8.551  -7.266  1.00 1.00 ? 6  ARG A HA   1  
ATOM   95    H HB2  . ARG A 1 6  ? 1.525   8.256  -6.216  1.00 1.00 ? 6  ARG A HB2  1  
ATOM   96    H HB3  . ARG A 1 6  ? 1.542   9.811  -7.017  1.00 1.00 ? 6  ARG A HB3  1  
ATOM   97    H HG2  . ARG A 1 6  ? 2.784   8.059  -8.869  1.00 1.00 ? 6  ARG A HG2  1  
ATOM   98    H HG3  . ARG A 1 6  ? 1.536   7.093  -8.099  1.00 1.00 ? 6  ARG A HG3  1  
ATOM   99    H HD2  . ARG A 1 6  ? 0.838   8.117  -10.214 1.00 1.00 ? 6  ARG A HD2  1  
ATOM   100   H HD3  . ARG A 1 6  ? -0.194  8.599  -8.861  1.00 1.00 ? 6  ARG A HD3  1  
ATOM   101   H HE   . ARG A 1 6  ? 1.617   10.631 -8.923  1.00 1.00 ? 6  ARG A HE   1  
ATOM   102   H HH11 . ARG A 1 6  ? -0.417  9.315  -11.509 1.00 1.00 ? 6  ARG A HH11 1  
ATOM   103   H HH12 . ARG A 1 6  ? -0.628  10.863 -12.278 1.00 1.00 ? 6  ARG A HH12 1  
ATOM   104   H HH21 . ARG A 1 6  ? 1.227   12.602 -9.804  1.00 1.00 ? 6  ARG A HH21 1  
ATOM   105   H HH22 . ARG A 1 6  ? 0.480   12.850 -11.324 1.00 1.00 ? 6  ARG A HH22 1  
ATOM   106   N N    . PRO A 1 7  ? 4.334   11.154 -7.616  1.00 1.00 ? 7  PRO A N    1  
ATOM   107   C CA   . PRO A 1 7  ? 4.350   12.602 -7.696  1.00 1.00 ? 7  PRO A CA   1  
ATOM   108   C C    . PRO A 1 7  ? 2.862   12.960 -7.656  1.00 1.00 ? 7  PRO A C    1  
ATOM   109   O O    . PRO A 1 7  ? 2.069   12.248 -8.268  1.00 1.00 ? 7  PRO A O    1  
ATOM   110   C CB   . PRO A 1 7  ? 5.037   12.939 -9.021  1.00 1.00 ? 7  PRO A CB   1  
ATOM   111   C CG   . PRO A 1 7  ? 4.785   11.702 -9.886  1.00 1.00 ? 7  PRO A CG   1  
ATOM   112   C CD   . PRO A 1 7  ? 4.738   10.553 -8.875  1.00 1.00 ? 7  PRO A CD   1  
ATOM   113   H HA   . PRO A 1 7  ? 4.882   13.058 -6.866  1.00 1.00 ? 7  PRO A HA   1  
ATOM   114   H HB2  . PRO A 1 7  ? 4.652   13.853 -9.473  1.00 1.00 ? 7  PRO A HB2  1  
ATOM   115   H HB3  . PRO A 1 7  ? 6.110   13.036 -8.848  1.00 1.00 ? 7  PRO A HB3  1  
ATOM   116   H HG2  . PRO A 1 7  ? 3.813   11.798 -10.372 1.00 1.00 ? 7  PRO A HG2  1  
ATOM   117   H HG3  . PRO A 1 7  ? 5.562   11.559 -10.638 1.00 1.00 ? 7  PRO A HG3  1  
ATOM   118   H HD2  . PRO A 1 7  ? 4.034   9.805  -9.228  1.00 1.00 ? 7  PRO A HD2  1  
ATOM   119   H HD3  . PRO A 1 7  ? 5.726   10.107 -8.753  1.00 1.00 ? 7  PRO A HD3  1  
ATOM   120   N N    . SER A 1 8  ? 2.456   13.961 -6.880  1.00 1.00 ? 8  SER A N    1  
ATOM   121   C CA   . SER A 1 8  ? 1.052   14.224 -6.586  1.00 1.00 ? 8  SER A CA   1  
ATOM   122   C C    . SER A 1 8  ? 0.140   14.100 -7.807  1.00 1.00 ? 8  SER A C    1  
ATOM   123   O O    . SER A 1 8  ? 0.498   14.518 -8.908  1.00 1.00 ? 8  SER A O    1  
ATOM   124   C CB   . SER A 1 8  ? 0.915   15.588 -5.928  1.00 1.00 ? 8  SER A CB   1  
ATOM   125   O OG   . SER A 1 8  ? 1.661   15.589 -4.734  1.00 1.00 ? 8  SER A OG   1  
ATOM   126   H H    . SER A 1 8  ? 3.158   14.502 -6.394  1.00 1.00 ? 8  SER A H    1  
ATOM   127   H HA   . SER A 1 8  ? 0.740   13.475 -5.856  1.00 1.00 ? 8  SER A HA   1  
ATOM   128   H HB2  . SER A 1 8  ? 1.286   16.350 -6.605  1.00 1.00 ? 8  SER A HB2  1  
ATOM   129   H HB3  . SER A 1 8  ? -0.132  15.786 -5.695  1.00 1.00 ? 8  SER A HB3  1  
ATOM   130   H HG   . SER A 1 8  ? 2.607   15.546 -4.935  1.00 1.00 ? 8  SER A HG   1  
ATOM   131   N N    . GLY A 1 9  ? -1.030  13.486 -7.607  1.00 1.00 ? 9  GLY A N    1  
ATOM   132   C CA   . GLY A 1 9  ? -2.027  13.259 -8.640  1.00 1.00 ? 9  GLY A CA   1  
ATOM   133   C C    . GLY A 1 9  ? -2.334  14.558 -9.371  1.00 1.00 ? 9  GLY A C    1  
ATOM   134   O O    . GLY A 1 9  ? -2.430  14.575 -10.594 1.00 1.00 ? 9  GLY A O    1  
ATOM   135   H H    . GLY A 1 9  ? -1.323  13.335 -6.650  1.00 1.00 ? 9  GLY A H    1  
ATOM   136   H HA2  . GLY A 1 9  ? -1.668  12.511 -9.345  1.00 1.00 ? 9  GLY A HA2  1  
ATOM   137   H HA3  . GLY A 1 9  ? -2.942  12.892 -8.174  1.00 1.00 ? 9  GLY A HA3  1  
ATOM   138   N N    . THR A 1 10 ? -2.436  15.648 -8.609  1.00 1.00 ? 10 THR A N    1  
ATOM   139   C CA   . THR A 1 10 ? -2.620  16.979 -9.147  1.00 1.00 ? 10 THR A CA   1  
ATOM   140   C C    . THR A 1 10 ? -1.250  17.550 -9.526  1.00 1.00 ? 10 THR A C    1  
ATOM   141   O O    . THR A 1 10 ? -0.905  17.663 -10.701 1.00 1.00 ? 10 THR A O    1  
ATOM   142   C CB   . THR A 1 10 ? -3.323  17.824 -8.074  1.00 1.00 ? 10 THR A CB   1  
ATOM   143   O OG1  . THR A 1 10 ? -2.632  17.738 -6.838  1.00 1.00 ? 10 THR A OG1  1  
ATOM   144   C CG2  . THR A 1 10 ? -4.747  17.322 -7.830  1.00 1.00 ? 10 THR A CG2  1  
ATOM   145   H H    . THR A 1 10 ? -2.363  15.558 -7.600  1.00 1.00 ? 10 THR A H    1  
ATOM   146   H HA   . THR A 1 10 ? -3.246  16.949 -10.041 1.00 1.00 ? 10 THR A HA   1  
ATOM   147   H HB   . THR A 1 10 ? -3.361  18.864 -8.406  1.00 1.00 ? 10 THR A HB   1  
ATOM   148   H HG1  . THR A 1 10 ? -2.799  18.575 -6.382  1.00 1.00 ? 10 THR A HG1  1  
ATOM   149   H HG21 . THR A 1 10 ? -5.324  17.386 -8.752  1.00 1.00 ? 10 THR A HG21 1  
ATOM   150   H HG22 . THR A 1 10 ? -4.739  16.286 -7.488  1.00 1.00 ? 10 THR A HG22 1  
ATOM   151   H HG23 . THR A 1 10 ? -5.220  17.941 -7.070  1.00 1.00 ? 10 THR A HG23 1  
ATOM   152   N N    . TRP A 1 11 ? -0.458  17.905 -8.513  1.00 1.00 ? 11 TRP A N    1  
ATOM   153   C CA   . TRP A 1 11 ? 0.835   18.554 -8.671  1.00 1.00 ? 11 TRP A CA   1  
ATOM   154   C C    . TRP A 1 11 ? 1.885   17.537 -9.134  1.00 1.00 ? 11 TRP A C    1  
ATOM   155   O O    . TRP A 1 11 ? 2.823   17.207 -8.409  1.00 1.00 ? 11 TRP A O    1  
ATOM   156   C CB   . TRP A 1 11 ? 1.186   19.272 -7.357  1.00 1.00 ? 11 TRP A CB   1  
ATOM   157   C CG   . TRP A 1 11 ? 2.325   20.248 -7.336  1.00 1.00 ? 11 TRP A CG   1  
ATOM   158   C CD1  . TRP A 1 11 ? 3.289   20.411 -8.271  1.00 1.00 ? 11 TRP A CD1  1  
ATOM   159   C CD2  . TRP A 1 11 ? 2.610   21.238 -6.304  1.00 1.00 ? 11 TRP A CD2  1  
ATOM   160   N NE1  . TRP A 1 11 ? 4.136   21.433 -7.895  1.00 1.00 ? 11 TRP A NE1  1  
ATOM   161   C CE2  . TRP A 1 11 ? 3.753   21.990 -6.693  1.00 1.00 ? 11 TRP A CE2  1  
ATOM   162   C CE3  . TRP A 1 11 ? 2.007   21.583 -5.078  1.00 1.00 ? 11 TRP A CE3  1  
ATOM   163   C CZ2  . TRP A 1 11 ? 4.261   23.038 -5.910  1.00 1.00 ? 11 TRP A CZ2  1  
ATOM   164   C CZ3  . TRP A 1 11 ? 2.517   22.616 -4.274  1.00 1.00 ? 11 TRP A CZ3  1  
ATOM   165   C CH2  . TRP A 1 11 ? 3.658   23.328 -4.676  1.00 1.00 ? 11 TRP A CH2  1  
ATOM   166   H H    . TRP A 1 11 ? -0.854  17.798 -7.587  1.00 1.00 ? 11 TRP A H    1  
ATOM   167   H HA   . TRP A 1 11 ? 0.741   19.322 -9.441  1.00 1.00 ? 11 TRP A HA   1  
ATOM   168   H HB2  . TRP A 1 11 ? 0.307   19.854 -7.080  1.00 1.00 ? 11 TRP A HB2  1  
ATOM   169   H HB3  . TRP A 1 11 ? 1.362   18.545 -6.567  1.00 1.00 ? 11 TRP A HB3  1  
ATOM   170   H HD1  . TRP A 1 11 ? 3.388   19.848 -9.186  1.00 1.00 ? 11 TRP A HD1  1  
ATOM   171   H HE1  . TRP A 1 11 ? 4.956   21.747 -8.407  1.00 1.00 ? 11 TRP A HE1  1  
ATOM   172   H HE3  . TRP A 1 11 ? 1.141   21.040 -4.752  1.00 1.00 ? 11 TRP A HE3  1  
ATOM   173   H HZ2  . TRP A 1 11 ? 5.108   23.614 -6.251  1.00 1.00 ? 11 TRP A HZ2  1  
ATOM   174   H HZ3  . TRP A 1 11 ? 2.026   22.859 -3.346  1.00 1.00 ? 11 TRP A HZ3  1  
ATOM   175   H HH2  . TRP A 1 11 ? 4.065   24.096 -4.037  1.00 1.00 ? 11 TRP A HH2  1  
ATOM   176   N N    . SER A 1 12 ? 1.778   17.094 -10.386 1.00 1.00 ? 12 SER A N    1  
ATOM   177   C CA   . SER A 1 12 ? 2.665   16.085 -10.942 1.00 1.00 ? 12 SER A CA   1  
ATOM   178   C C    . SER A 1 12 ? 3.895   16.796 -11.510 1.00 1.00 ? 12 SER A C    1  
ATOM   179   O O    . SER A 1 12 ? 4.128   16.761 -12.716 1.00 1.00 ? 12 SER A O    1  
ATOM   180   C CB   . SER A 1 12 ? 1.926   15.326 -12.058 1.00 1.00 ? 12 SER A CB   1  
ATOM   181   O OG   . SER A 1 12 ? 0.804   14.619 -11.561 1.00 1.00 ? 12 SER A OG   1  
ATOM   182   H H    . SER A 1 12 ? 0.956   17.376 -10.913 1.00 1.00 ? 12 SER A H    1  
ATOM   183   H HA   . SER A 1 12 ? 2.972   15.372 -10.175 1.00 1.00 ? 12 SER A HA   1  
ATOM   184   H HB2  . SER A 1 12 ? 1.593   16.034 -12.820 1.00 1.00 ? 12 SER A HB2  1  
ATOM   185   H HB3  . SER A 1 12 ? 2.612   14.619 -12.529 1.00 1.00 ? 12 SER A HB3  1  
ATOM   186   H HG   . SER A 1 12 ? 0.541   15.007 -10.712 1.00 1.00 ? 12 SER A HG   1  
ATOM   187   N N    . GLY A 1 13 ? 4.676   17.459 -10.649 1.00 1.00 ? 13 GLY A N    1  
ATOM   188   C CA   . GLY A 1 13 ? 5.802   18.251 -11.119 1.00 1.00 ? 13 GLY A CA   1  
ATOM   189   C C    . GLY A 1 13 ? 6.675   18.823 -10.003 1.00 1.00 ? 13 GLY A C    1  
ATOM   190   O O    . GLY A 1 13 ? 6.591   18.408 -8.842  1.00 1.00 ? 13 GLY A O    1  
ATOM   191   H H    . GLY A 1 13 ? 4.446   17.459 -9.659  1.00 1.00 ? 13 GLY A H    1  
ATOM   192   H HA2  . GLY A 1 13 ? 6.437   17.633 -11.754 1.00 1.00 ? 13 GLY A HA2  1  
ATOM   193   H HA3  . GLY A 1 13 ? 5.412   19.077 -11.716 1.00 1.00 ? 13 GLY A HA3  1  
ATOM   194   N N    . VAL A 1 14 ? 7.535   19.770 -10.398 1.00 1.00 ? 14 VAL A N    1  
ATOM   195   C CA   . VAL A 1 14 ? 8.501   20.437 -9.538  1.00 1.00 ? 14 VAL A CA   1  
ATOM   196   C C    . VAL A 1 14 ? 7.763   21.192 -8.435  1.00 1.00 ? 14 VAL A C    1  
ATOM   197   O O    . VAL A 1 14 ? 6.738   21.822 -8.691  1.00 1.00 ? 14 VAL A O    1  
ATOM   198   C CB   . VAL A 1 14 ? 9.404   21.375 -10.360 1.00 1.00 ? 14 VAL A CB   1  
ATOM   199   C CG1  . VAL A 1 14 ? 10.447  22.076 -9.476  1.00 1.00 ? 14 VAL A CG1  1  
ATOM   200   C CG2  . VAL A 1 14 ? 10.146  20.599 -11.459 1.00 1.00 ? 14 VAL A CG2  1  
ATOM   201   H H    . VAL A 1 14 ? 7.499   20.066 -11.362 1.00 1.00 ? 14 VAL A H    1  
ATOM   202   H HA   . VAL A 1 14 ? 9.130   19.668 -9.097  1.00 1.00 ? 14 VAL A HA   1  
ATOM   203   H HB   . VAL A 1 14 ? 8.786   22.147 -10.821 1.00 1.00 ? 14 VAL A HB   1  
ATOM   204   H HG11 . VAL A 1 14 ? 11.053  21.338 -8.950  1.00 1.00 ? 14 VAL A HG11 1  
ATOM   205   H HG12 . VAL A 1 14 ? 11.100  22.690 -10.097 1.00 1.00 ? 14 VAL A HG12 1  
ATOM   206   H HG13 . VAL A 1 14 ? 9.962   22.728 -8.750  1.00 1.00 ? 14 VAL A HG13 1  
ATOM   207   H HG21 . VAL A 1 14 ? 10.744  19.805 -11.012 1.00 1.00 ? 14 VAL A HG21 1  
ATOM   208   H HG22 . VAL A 1 14 ? 9.444   20.162 -12.169 1.00 1.00 ? 14 VAL A HG22 1  
ATOM   209   H HG23 . VAL A 1 14 ? 10.805  21.275 -12.005 1.00 1.00 ? 14 VAL A HG23 1  
ATOM   210   N N    . CYS A 1 15 ? 8.283   21.104 -7.211  1.00 1.00 ? 15 CYS A N    1  
ATOM   211   C CA   . CYS A 1 15 ? 7.622   21.576 -6.000  1.00 1.00 ? 15 CYS A CA   1  
ATOM   212   C C    . CYS A 1 15 ? 8.206   22.889 -5.491  1.00 1.00 ? 15 CYS A C    1  
ATOM   213   O O    . CYS A 1 15 ? 7.484   23.862 -5.306  1.00 1.00 ? 15 CYS A O    1  
ATOM   214   C CB   . CYS A 1 15 ? 7.686   20.500 -4.914  1.00 1.00 ? 15 CYS A CB   1  
ATOM   215   S SG   . CYS A 1 15 ? 9.285   19.712 -4.656  1.00 1.00 ? 15 CYS A SG   1  
ATOM   216   H H    . CYS A 1 15 ? 9.159   20.609 -7.118  1.00 1.00 ? 15 CYS A H    1  
ATOM   217   H HA   . CYS A 1 15 ? 6.567   21.739 -6.204  1.00 1.00 ? 15 CYS A HA   1  
ATOM   218   H HB2  . CYS A 1 15 ? 7.315   20.894 -3.968  1.00 1.00 ? 15 CYS A HB2  1  
ATOM   219   H HB3  . CYS A 1 15 ? 7.032   19.698 -5.225  1.00 1.00 ? 15 CYS A HB3  1  
ATOM   220   N N    . GLY A 1 16 ? 9.503   22.896 -5.183  1.00 1.00 ? 16 GLY A N    1  
ATOM   221   C CA   . GLY A 1 16 ? 10.160  23.997 -4.491  1.00 1.00 ? 16 GLY A CA   1  
ATOM   222   C C    . GLY A 1 16 ? 9.518   24.400 -3.152  1.00 1.00 ? 16 GLY A C    1  
ATOM   223   O O    . GLY A 1 16 ? 9.846   25.467 -2.638  1.00 1.00 ? 16 GLY A O    1  
ATOM   224   H H    . GLY A 1 16 ? 10.059  22.096 -5.444  1.00 1.00 ? 16 GLY A H    1  
ATOM   225   H HA2  . GLY A 1 16 ? 11.194  23.710 -4.296  1.00 1.00 ? 16 GLY A HA2  1  
ATOM   226   H HA3  . GLY A 1 16 ? 10.166  24.868 -5.148  1.00 1.00 ? 16 GLY A HA3  1  
ATOM   227   N N    . ASN A 1 17 ? 8.639   23.579 -2.554  1.00 1.00 ? 17 ASN A N    1  
ATOM   228   C CA   . ASN A 1 17 ? 8.001   23.907 -1.277  1.00 1.00 ? 17 ASN A CA   1  
ATOM   229   C C    . ASN A 1 17 ? 7.269   22.710 -0.656  1.00 1.00 ? 17 ASN A C    1  
ATOM   230   O O    . ASN A 1 17 ? 6.201   22.303 -1.114  1.00 1.00 ? 17 ASN A O    1  
ATOM   231   C CB   . ASN A 1 17 ? 7.034   25.090 -1.406  1.00 1.00 ? 17 ASN A CB   1  
ATOM   232   C CG   . ASN A 1 17 ? 6.650   25.562 -0.009  1.00 1.00 ? 17 ASN A CG   1  
ATOM   233   O OD1  . ASN A 1 17 ? 5.740   25.025 0.614   1.00 1.00 ? 17 ASN A OD1  1  
ATOM   234   N ND2  . ASN A 1 17 ? 7.378   26.536 0.525   1.00 1.00 ? 17 ASN A ND2  1  
ATOM   235   H H    . ASN A 1 17 ? 8.447   22.683 -2.978  1.00 1.00 ? 17 ASN A H    1  
ATOM   236   H HA   . ASN A 1 17 ? 8.797   24.214 -0.595  1.00 1.00 ? 17 ASN A HA   1  
ATOM   237   H HB2  . ASN A 1 17 ? 7.491   25.920 -1.943  1.00 1.00 ? 17 ASN A HB2  1  
ATOM   238   H HB3  . ASN A 1 17 ? 6.143   24.785 -1.956  1.00 1.00 ? 17 ASN A HB3  1  
ATOM   239   H HD21 . ASN A 1 17 ? 8.143   26.938 0.001   1.00 1.00 ? 17 ASN A HD21 1  
ATOM   240   H HD22 . ASN A 1 17 ? 7.151   26.877 1.446   1.00 1.00 ? 17 ASN A HD22 1  
ATOM   241   N N    . ASN A 1 18 ? 7.843   22.159 0.416   1.00 1.00 ? 18 ASN A N    1  
ATOM   242   C CA   . ASN A 1 18 ? 7.366   20.981 1.112   1.00 1.00 ? 18 ASN A CA   1  
ATOM   243   C C    . ASN A 1 18 ? 5.964   21.167 1.685   1.00 1.00 ? 18 ASN A C    1  
ATOM   244   O O    . ASN A 1 18 ? 5.069   20.351 1.474   1.00 1.00 ? 18 ASN A O    1  
ATOM   245   C CB   . ASN A 1 18 ? 8.379   20.678 2.220   1.00 1.00 ? 18 ASN A CB   1  
ATOM   246   C CG   . ASN A 1 18 ? 8.351   19.200 2.524   1.00 1.00 ? 18 ASN A CG   1  
ATOM   247   O OD1  . ASN A 1 18 ? 9.128   18.446 1.950   1.00 1.00 ? 18 ASN A OD1  1  
ATOM   248   N ND2  . ASN A 1 18 ? 7.410   18.757 3.338   1.00 1.00 ? 18 ASN A ND2  1  
ATOM   249   H H    . ASN A 1 18 ? 8.723   22.513 0.750   1.00 1.00 ? 18 ASN A H    1  
ATOM   250   H HA   . ASN A 1 18 ? 7.331   20.150 0.411   1.00 1.00 ? 18 ASN A HA   1  
ATOM   251   H HB2  . ASN A 1 18 ? 9.384   20.918 1.875   1.00 1.00 ? 18 ASN A HB2  1  
ATOM   252   H HB3  . ASN A 1 18 ? 8.185   21.261 3.121   1.00 1.00 ? 18 ASN A HB3  1  
ATOM   253   H HD21 . ASN A 1 18 ? 6.753   19.362 3.802   1.00 1.00 ? 18 ASN A HD21 1  
ATOM   254   H HD22 . ASN A 1 18 ? 7.352   17.750 3.421   1.00 1.00 ? 18 ASN A HD22 1  
ATOM   255   N N    . ASN A 1 19 ? 5.803   22.245 2.451   1.00 1.00 ? 19 ASN A N    1  
ATOM   256   C CA   . ASN A 1 19 ? 4.574   22.566 3.164   1.00 1.00 ? 19 ASN A CA   1  
ATOM   257   C C    . ASN A 1 19 ? 3.377   22.609 2.216   1.00 1.00 ? 19 ASN A C    1  
ATOM   258   O O    . ASN A 1 19 ? 2.356   21.959 2.476   1.00 1.00 ? 19 ASN A O    1  
ATOM   259   C CB   . ASN A 1 19 ? 4.712   23.898 3.911   1.00 1.00 ? 19 ASN A CB   1  
ATOM   260   C CG   . ASN A 1 19 ? 3.404   24.249 4.619   1.00 1.00 ? 19 ASN A CG   1  
ATOM   261   O OD1  . ASN A 1 19 ? 2.760   23.378 5.201   1.00 1.00 ? 19 ASN A OD1  1  
ATOM   262   N ND2  . ASN A 1 19 ? 2.980   25.506 4.556   1.00 1.00 ? 19 ASN A ND2  1  
ATOM   263   H H    . ASN A 1 19 ? 6.614   22.830 2.560   1.00 1.00 ? 19 ASN A H    1  
ATOM   264   H HA   . ASN A 1 19 ? 4.409   21.782 3.899   1.00 1.00 ? 19 ASN A HA   1  
ATOM   265   H HB2  . ASN A 1 19 ? 5.504   23.820 4.656   1.00 1.00 ? 19 ASN A HB2  1  
ATOM   266   H HB3  . ASN A 1 19 ? 4.971   24.688 3.205   1.00 1.00 ? 19 ASN A HB3  1  
ATOM   267   H HD21 . ASN A 1 19 ? 3.516   26.209 4.069   1.00 1.00 ? 19 ASN A HD21 1  
ATOM   268   H HD22 . ASN A 1 19 ? 2.120   25.755 5.022   1.00 1.00 ? 19 ASN A HD22 1  
ATOM   269   N N    . ALA A 1 20 ? 3.521   23.387 1.139   1.00 1.00 ? 20 ALA A N    1  
ATOM   270   C CA   . ALA A 1 20 ? 2.530   23.514 0.087   1.00 1.00 ? 20 ALA A CA   1  
ATOM   271   C C    . ALA A 1 20 ? 2.297   22.159 -0.555  1.00 1.00 ? 20 ALA A C    1  
ATOM   272   O O    . ALA A 1 20 ? 1.152   21.733 -0.633  1.00 1.00 ? 20 ALA A O    1  
ATOM   273   C CB   . ALA A 1 20 ? 2.972   24.515 -0.980  1.00 1.00 ? 20 ALA A CB   1  
ATOM   274   H H    . ALA A 1 20 ? 4.396   23.884 1.016   1.00 1.00 ? 20 ALA A H    1  
ATOM   275   H HA   . ALA A 1 20 ? 1.598   23.872 0.525   1.00 1.00 ? 20 ALA A HA   1  
ATOM   276   H HB1  . ALA A 1 20 ? 3.154   25.488 -0.529  1.00 1.00 ? 20 ALA A HB1  1  
ATOM   277   H HB2  . ALA A 1 20 ? 3.875   24.160 -1.476  1.00 1.00 ? 20 ALA A HB2  1  
ATOM   278   H HB3  . ALA A 1 20 ? 2.178   24.610 -1.723  1.00 1.00 ? 20 ALA A HB3  1  
ATOM   279   N N    . CYS A 1 21 ? 3.366   21.491 -1.007  1.00 1.00 ? 21 CYS A N    1  
ATOM   280   C CA   . CYS A 1 21 ? 3.249   20.192 -1.657  1.00 1.00 ? 21 CYS A CA   1  
ATOM   281   C C    . CYS A 1 21 ? 2.362   19.250 -0.838  1.00 1.00 ? 21 CYS A C    1  
ATOM   282   O O    . CYS A 1 21 ? 1.336   18.776 -1.328  1.00 1.00 ? 21 CYS A O    1  
ATOM   283   C CB   . CYS A 1 21 ? 4.630   19.573 -1.877  1.00 1.00 ? 21 CYS A CB   1  
ATOM   284   S SG   . CYS A 1 21 ? 4.511   17.833 -2.328  1.00 1.00 ? 21 CYS A SG   1  
ATOM   285   H H    . CYS A 1 21 ? 4.293   21.903 -0.925  1.00 1.00 ? 21 CYS A H    1  
ATOM   286   H HA   . CYS A 1 21 ? 2.785   20.344 -2.631  1.00 1.00 ? 21 CYS A HA   1  
ATOM   287   H HB2  . CYS A 1 21 ? 5.150   20.111 -2.669  1.00 1.00 ? 21 CYS A HB2  1  
ATOM   288   H HB3  . CYS A 1 21 ? 5.221   19.628 -0.966  1.00 1.00 ? 21 CYS A HB3  1  
ATOM   289   N N    . LYS A 1 22 ? 2.741   19.039 0.427   1.00 1.00 ? 22 LYS A N    1  
ATOM   290   C CA   . LYS A 1 22 ? 1.960   18.301 1.409   1.00 1.00 ? 22 LYS A CA   1  
ATOM   291   C C    . LYS A 1 22 ? 0.503   18.772 1.393   1.00 1.00 ? 22 LYS A C    1  
ATOM   292   O O    . LYS A 1 22 ? -0.408  17.980 1.144   1.00 1.00 ? 22 LYS A O    1  
ATOM   293   C CB   . LYS A 1 22 ? 2.587   18.542 2.794   1.00 1.00 ? 22 LYS A CB   1  
ATOM   294   C CG   . LYS A 1 22 ? 1.715   18.047 3.961   1.00 1.00 ? 22 LYS A CG   1  
ATOM   295   C CD   . LYS A 1 22 ? 2.318   18.374 5.334   1.00 1.00 ? 22 LYS A CD   1  
ATOM   296   C CE   . LYS A 1 22 ? 2.745   19.840 5.540   1.00 1.00 ? 22 LYS A CE   1  
ATOM   297   N NZ   . LYS A 1 22 ? 1.771   20.839 5.040   1.00 1.00 ? 22 LYS A NZ   1  
ATOM   298   H H    . LYS A 1 22 ? 3.597   19.488 0.742   1.00 1.00 ? 22 LYS A H    1  
ATOM   299   H HA   . LYS A 1 22 ? 1.996   17.235 1.166   1.00 1.00 ? 22 LYS A HA   1  
ATOM   300   H HB2  . LYS A 1 22 ? 3.563   18.068 2.843   1.00 1.00 ? 22 LYS A HB2  1  
ATOM   301   H HB3  . LYS A 1 22 ? 2.763   19.604 2.898   1.00 1.00 ? 22 LYS A HB3  1  
ATOM   302   H HG2  . LYS A 1 22 ? 0.715   18.478 3.926   1.00 1.00 ? 22 LYS A HG2  1  
ATOM   303   H HG3  . LYS A 1 22 ? 1.607   16.964 3.876   1.00 1.00 ? 22 LYS A HG3  1  
ATOM   304   H HD2  . LYS A 1 22 ? 1.587   18.099 6.098   1.00 1.00 ? 22 LYS A HD2  1  
ATOM   305   H HD3  . LYS A 1 22 ? 3.197   17.741 5.485   1.00 1.00 ? 22 LYS A HD3  1  
ATOM   306   H HE2  . LYS A 1 22 ? 2.894   20.000 6.611   1.00 1.00 ? 22 LYS A HE2  1  
ATOM   307   H HE3  . LYS A 1 22 ? 3.706   19.995 5.050   1.00 1.00 ? 22 LYS A HE3  1  
ATOM   308   H HZ1  . LYS A 1 22 ? 0.835   20.625 5.349   1.00 1.00 ? 22 LYS A HZ1  1  
ATOM   309   H HZ2  . LYS A 1 22 ? 2.026   21.758 5.386   1.00 1.00 ? 22 LYS A HZ2  1  
ATOM   310   H HZ3  . LYS A 1 22 ? 1.797   20.913 4.026   1.00 1.00 ? 22 LYS A HZ3  1  
ATOM   311   N N    . ASN A 1 23 ? 0.298   20.051 1.741   1.00 1.00 ? 23 ASN A N    1  
ATOM   312   C CA   . ASN A 1 23 ? -1.027  20.633 1.919   1.00 1.00 ? 23 ASN A CA   1  
ATOM   313   C C    . ASN A 1 23 ? -1.852  20.376 0.669   1.00 1.00 ? 23 ASN A C    1  
ATOM   314   O O    . ASN A 1 23 ? -2.769  19.569 0.696   1.00 1.00 ? 23 ASN A O    1  
ATOM   315   C CB   . ASN A 1 23 ? -0.905  22.136 2.229   1.00 1.00 ? 23 ASN A CB   1  
ATOM   316   C CG   . ASN A 1 23 ? -2.230  22.904 2.176   1.00 1.00 ? 23 ASN A CG   1  
ATOM   317   O OD1  . ASN A 1 23 ? -3.319  22.339 2.219   1.00 1.00 ? 23 ASN A OD1  1  
ATOM   318   N ND2  . ASN A 1 23 ? -2.148  24.228 2.084   1.00 1.00 ? 23 ASN A ND2  1  
ATOM   319   H H    . ASN A 1 23 ? 1.105   20.663 1.812   1.00 1.00 ? 23 ASN A H    1  
ATOM   320   H HA   . ASN A 1 23 ? -1.524  20.134 2.752   1.00 1.00 ? 23 ASN A HA   1  
ATOM   321   H HB2  . ASN A 1 23 ? -0.473  22.259 3.222   1.00 1.00 ? 23 ASN A HB2  1  
ATOM   322   H HB3  . ASN A 1 23 ? -0.229  22.591 1.506   1.00 1.00 ? 23 ASN A HB3  1  
ATOM   323   H HD21 . ASN A 1 23 ? -1.253  24.690 2.051   1.00 1.00 ? 23 ASN A HD21 1  
ATOM   324   H HD22 . ASN A 1 23 ? -3.002  24.764 2.045   1.00 1.00 ? 23 ASN A HD22 1  
ATOM   325   N N    . GLN A 1 24 ? -1.481  21.023 -0.432  1.00 1.00 ? 24 GLN A N    1  
ATOM   326   C CA   . GLN A 1 24 ? -2.096  20.885 -1.737  1.00 1.00 ? 24 GLN A CA   1  
ATOM   327   C C    . GLN A 1 24 ? -2.406  19.421 -2.043  1.00 1.00 ? 24 GLN A C    1  
ATOM   328   O O    . GLN A 1 24 ? -3.543  19.128 -2.412  1.00 1.00 ? 24 GLN A O    1  
ATOM   329   C CB   . GLN A 1 24 ? -1.162  21.571 -2.747  1.00 1.00 ? 24 GLN A CB   1  
ATOM   330   C CG   . GLN A 1 24 ? -1.709  21.708 -4.173  1.00 1.00 ? 24 GLN A CG   1  
ATOM   331   C CD   . GLN A 1 24 ? -1.838  20.387 -4.919  1.00 1.00 ? 24 GLN A CD   1  
ATOM   332   O OE1  . GLN A 1 24 ? -2.780  20.193 -5.677  1.00 1.00 ? 24 GLN A OE1  1  
ATOM   333   N NE2  . GLN A 1 24 ? -0.910  19.455 -4.721  1.00 1.00 ? 24 GLN A NE2  1  
ATOM   334   H H    . GLN A 1 24 ? -0.624  21.560 -0.386  1.00 1.00 ? 24 GLN A H    1  
ATOM   335   H HA   . GLN A 1 24 ? -3.065  21.387 -1.729  1.00 1.00 ? 24 GLN A HA   1  
ATOM   336   H HB2  . GLN A 1 24 ? -0.990  22.588 -2.390  1.00 1.00 ? 24 GLN A HB2  1  
ATOM   337   H HB3  . GLN A 1 24 ? -0.197  21.066 -2.754  1.00 1.00 ? 24 GLN A HB3  1  
ATOM   338   H HG2  . GLN A 1 24 ? -2.682  22.198 -4.139  1.00 1.00 ? 24 GLN A HG2  1  
ATOM   339   H HG3  . GLN A 1 24 ? -1.032  22.345 -4.744  1.00 1.00 ? 24 GLN A HG3  1  
ATOM   340   H HE21 . GLN A 1 24 ? -0.148  19.628 -4.080  1.00 1.00 ? 24 GLN A HE21 1  
ATOM   341   H HE22 . GLN A 1 24 ? -0.986  18.566 -5.191  1.00 1.00 ? 24 GLN A HE22 1  
ATOM   342   N N    . CYS A 1 25 ? -1.447  18.503 -1.863  1.00 1.00 ? 25 CYS A N    1  
ATOM   343   C CA   . CYS A 1 25 ? -1.723  17.104 -2.151  1.00 1.00 ? 25 CYS A CA   1  
ATOM   344   C C    . CYS A 1 25 ? -2.928  16.606 -1.363  1.00 1.00 ? 25 CYS A C    1  
ATOM   345   O O    . CYS A 1 25 ? -3.917  16.192 -1.961  1.00 1.00 ? 25 CYS A O    1  
ATOM   346   C CB   . CYS A 1 25 ? -0.542  16.175 -1.879  1.00 1.00 ? 25 CYS A CB   1  
ATOM   347   S SG   . CYS A 1 25 ? -1.013  14.489 -2.321  1.00 1.00 ? 25 CYS A SG   1  
ATOM   348   H H    . CYS A 1 25 ? -0.524  18.765 -1.527  1.00 1.00 ? 25 CYS A H    1  
ATOM   349   H HA   . CYS A 1 25 ? -1.952  17.027 -3.214  1.00 1.00 ? 25 CYS A HA   1  
ATOM   350   H HB2  . CYS A 1 25 ? 0.313   16.459 -2.475  1.00 1.00 ? 25 CYS A HB2  1  
ATOM   351   H HB3  . CYS A 1 25 ? -0.252  16.194 -0.828  1.00 1.00 ? 25 CYS A HB3  1  
ATOM   352   N N    . ILE A 1 26 ? -2.849  16.630 -0.031  1.00 1.00 ? 26 ILE A N    1  
ATOM   353   C CA   . ILE A 1 26 ? -3.866  15.979 0.797   1.00 1.00 ? 26 ILE A CA   1  
ATOM   354   C C    . ILE A 1 26 ? -5.141  16.833 0.894   1.00 1.00 ? 26 ILE A C    1  
ATOM   355   O O    . ILE A 1 26 ? -6.216  16.357 1.275   1.00 1.00 ? 26 ILE A O    1  
ATOM   356   C CB   . ILE A 1 26 ? -3.268  15.587 2.160   1.00 1.00 ? 26 ILE A CB   1  
ATOM   357   C CG1  . ILE A 1 26 ? -3.135  16.773 3.126   1.00 1.00 ? 26 ILE A CG1  1  
ATOM   358   C CG2  . ILE A 1 26 ? -1.910  14.911 1.927   1.00 1.00 ? 26 ILE A CG2  1  
ATOM   359   C CD1  . ILE A 1 26 ? -2.460  16.398 4.449   1.00 1.00 ? 26 ILE A CD1  1  
ATOM   360   H H    . ILE A 1 26 ? -2.058  17.094 0.416   1.00 1.00 ? 26 ILE A H    1  
ATOM   361   H HA   . ILE A 1 26 ? -4.144  15.041 0.313   1.00 1.00 ? 26 ILE A HA   1  
ATOM   362   H HB   . ILE A 1 26 ? -3.938  14.858 2.618   1.00 1.00 ? 26 ILE A HB   1  
ATOM   363   H HG12 . ILE A 1 26 ? -2.561  17.568 2.655   1.00 1.00 ? 26 ILE A HG12 1  
ATOM   364   H HG13 . ILE A 1 26 ? -4.133  17.137 3.365   1.00 1.00 ? 26 ILE A HG13 1  
ATOM   365   H HG21 . ILE A 1 26 ? -2.001  14.157 1.149   1.00 1.00 ? 26 ILE A HG21 1  
ATOM   366   H HG22 . ILE A 1 26 ? -1.149  15.631 1.639   1.00 1.00 ? 26 ILE A HG22 1  
ATOM   367   H HG23 . ILE A 1 26 ? -1.586  14.428 2.837   1.00 1.00 ? 26 ILE A HG23 1  
ATOM   368   H HD11 . ILE A 1 26 ? -2.954  15.531 4.887   1.00 1.00 ? 26 ILE A HD11 1  
ATOM   369   H HD12 . ILE A 1 26 ? -1.404  16.177 4.292   1.00 1.00 ? 26 ILE A HD12 1  
ATOM   370   H HD13 . ILE A 1 26 ? -2.537  17.238 5.140   1.00 1.00 ? 26 ILE A HD13 1  
ATOM   371   N N    . ASN A 1 27 ? -5.026  18.107 0.519   1.00 1.00 ? 27 ASN A N    1  
ATOM   372   C CA   . ASN A 1 27 ? -6.115  19.063 0.505   1.00 1.00 ? 27 ASN A CA   1  
ATOM   373   C C    . ASN A 1 27 ? -6.966  18.797 -0.730  1.00 1.00 ? 27 ASN A C    1  
ATOM   374   O O    . ASN A 1 27 ? -8.162  18.541 -0.599  1.00 1.00 ? 27 ASN A O    1  
ATOM   375   C CB   . ASN A 1 27 ? -5.510  20.466 0.549   1.00 1.00 ? 27 ASN A CB   1  
ATOM   376   C CG   . ASN A 1 27 ? -6.513  21.593 0.727   1.00 1.00 ? 27 ASN A CG   1  
ATOM   377   O OD1  . ASN A 1 27 ? -7.649  21.520 0.275   1.00 1.00 ? 27 ASN A OD1  1  
ATOM   378   N ND2  . ASN A 1 27 ? -6.078  22.658 1.394   1.00 1.00 ? 27 ASN A ND2  1  
ATOM   379   H H    . ASN A 1 27 ? -4.112  18.446 0.224   1.00 1.00 ? 27 ASN A H    1  
ATOM   380   H HA   . ASN A 1 27 ? -6.727  18.929 1.399   1.00 1.00 ? 27 ASN A HA   1  
ATOM   381   H HB2  . ASN A 1 27 ? -4.861  20.481 1.423   1.00 1.00 ? 27 ASN A HB2  1  
ATOM   382   H HB3  . ASN A 1 27 ? -4.922  20.657 -0.349  1.00 1.00 ? 27 ASN A HB3  1  
ATOM   383   H HD21 . ASN A 1 27 ? -5.126  22.660 1.759   1.00 1.00 ? 27 ASN A HD21 1  
ATOM   384   H HD22 . ASN A 1 27 ? -6.704  23.433 1.545   1.00 1.00 ? 27 ASN A HD22 1  
ATOM   385   N N    . LEU A 1 28 ? -6.344  18.744 -1.913  1.00 1.00 ? 28 LEU A N    1  
ATOM   386   C CA   . LEU A 1 28 ? -7.043  18.384 -3.135  1.00 1.00 ? 28 LEU A CA   1  
ATOM   387   C C    . LEU A 1 28 ? -7.305  16.872 -3.159  1.00 1.00 ? 28 LEU A C    1  
ATOM   388   O O    . LEU A 1 28 ? -8.431  16.451 -2.879  1.00 1.00 ? 28 LEU A O    1  
ATOM   389   C CB   . LEU A 1 28 ? -6.290  18.904 -4.368  1.00 1.00 ? 28 LEU A CB   1  
ATOM   390   C CG   . LEU A 1 28 ? -6.626  20.375 -4.682  1.00 1.00 ? 28 LEU A CG   1  
ATOM   391   C CD1  . LEU A 1 28 ? -5.921  21.343 -3.725  1.00 1.00 ? 28 LEU A CD1  1  
ATOM   392   C CD2  . LEU A 1 28 ? -6.239  20.705 -6.127  1.00 1.00 ? 28 LEU A CD2  1  
ATOM   393   H H    . LEU A 1 28 ? -5.340  18.893 -1.968  1.00 1.00 ? 28 LEU A H    1  
ATOM   394   H HA   . LEU A 1 28 ? -8.025  18.859 -3.130  1.00 1.00 ? 28 LEU A HA   1  
ATOM   395   H HB2  . LEU A 1 28 ? -5.212  18.782 -4.252  1.00 1.00 ? 28 LEU A HB2  1  
ATOM   396   H HB3  . LEU A 1 28 ? -6.611  18.305 -5.215  1.00 1.00 ? 28 LEU A HB3  1  
ATOM   397   H HG   . LEU A 1 28 ? -7.703  20.529 -4.601  1.00 1.00 ? 28 LEU A HG   1  
ATOM   398   H HD11 . LEU A 1 28 ? -4.848  21.161 -3.736  1.00 1.00 ? 28 LEU A HD11 1  
ATOM   399   H HD12 . LEU A 1 28 ? -6.111  22.371 -4.035  1.00 1.00 ? 28 LEU A HD12 1  
ATOM   400   H HD13 . LEU A 1 28 ? -6.299  21.220 -2.711  1.00 1.00 ? 28 LEU A HD13 1  
ATOM   401   H HD21 . LEU A 1 28 ? -5.174  20.548 -6.281  1.00 1.00 ? 28 LEU A HD21 1  
ATOM   402   H HD22 . LEU A 1 28 ? -6.796  20.068 -6.815  1.00 1.00 ? 28 LEU A HD22 1  
ATOM   403   H HD23 . LEU A 1 28 ? -6.480  21.746 -6.346  1.00 1.00 ? 28 LEU A HD23 1  
ATOM   404   N N    . GLU A 1 29 ? -6.285  16.025 -3.350  1.00 1.00 ? 29 GLU A N    1  
ATOM   405   C CA   . GLU A 1 29 ? -6.511  14.581 -3.363  1.00 1.00 ? 29 GLU A CA   1  
ATOM   406   C C    . GLU A 1 29 ? -6.443  14.111 -1.905  1.00 1.00 ? 29 GLU A C    1  
ATOM   407   O O    . GLU A 1 29 ? -6.377  14.946 -1.010  1.00 1.00 ? 29 GLU A O    1  
ATOM   408   C CB   . GLU A 1 29 ? -5.594  13.839 -4.363  1.00 1.00 ? 29 GLU A CB   1  
ATOM   409   C CG   . GLU A 1 29 ? -4.070  13.965 -4.203  1.00 1.00 ? 29 GLU A CG   1  
ATOM   410   C CD   . GLU A 1 29 ? -3.456  15.106 -5.014  1.00 1.00 ? 29 GLU A CD   1  
ATOM   411   O OE1  . GLU A 1 29 ? -2.541  14.856 -5.797  1.00 1.00 ? 29 GLU A OE1  1  
ATOM   412   O OE2  . GLU A 1 29 ? -3.978  16.348 -4.848  1.00 1.00 ? 29 GLU A OE2  1  
ATOM   413   H H    . GLU A 1 29 ? -5.325  16.364 -3.340  1.00 1.00 ? 29 GLU A H    1  
ATOM   414   H HA   . GLU A 1 29 ? -7.526  14.374 -3.708  1.00 1.00 ? 29 GLU A HA   1  
ATOM   415   H HB2  . GLU A 1 29 ? -5.836  12.777 -4.295  1.00 1.00 ? 29 GLU A HB2  1  
ATOM   416   H HB3  . GLU A 1 29 ? -5.859  14.157 -5.373  1.00 1.00 ? 29 GLU A HB3  1  
ATOM   417   H HG2  . GLU A 1 29 ? -3.802  14.039 -3.152  1.00 1.00 ? 29 GLU A HG2  1  
ATOM   418   H HG3  . GLU A 1 29 ? -3.616  13.055 -4.606  1.00 1.00 ? 29 GLU A HG3  1  
ATOM   419   H HE2  . GLU A 1 29 ? -3.559  16.950 -5.472  1.00 1.00 ? 29 GLU A HE2  1  
ATOM   420   N N    . LYS A 1 30 ? -6.594  12.816 -1.621  1.00 1.00 ? 30 LYS A N    1  
ATOM   421   C CA   . LYS A 1 30 ? -6.814  12.329 -0.252  1.00 1.00 ? 30 LYS A CA   1  
ATOM   422   C C    . LYS A 1 30 ? -5.683  11.477 0.326   1.00 1.00 ? 30 LYS A C    1  
ATOM   423   O O    . LYS A 1 30 ? -5.884  10.784 1.325   1.00 1.00 ? 30 LYS A O    1  
ATOM   424   C CB   . LYS A 1 30 ? -8.224  11.728 -0.141  1.00 1.00 ? 30 LYS A CB   1  
ATOM   425   C CG   . LYS A 1 30 ? -9.295  12.821 -0.342  1.00 1.00 ? 30 LYS A CG   1  
ATOM   426   C CD   . LYS A 1 30 ? -9.421  13.763 0.875   1.00 1.00 ? 30 LYS A CD   1  
ATOM   427   C CE   . LYS A 1 30 ? -9.763  15.222 0.519   1.00 1.00 ? 30 LYS A CE   1  
ATOM   428   N NZ   . LYS A 1 30 ? -8.657  15.946 -0.147  1.00 1.00 ? 30 LYS A NZ   1  
ATOM   429   H H    . LYS A 1 30 ? -6.678  12.154 -2.378  1.00 1.00 ? 30 LYS A H    1  
ATOM   430   H HA   . LYS A 1 30 ? -6.787  13.175 0.428   1.00 1.00 ? 30 LYS A HA   1  
ATOM   431   H HB2  . LYS A 1 30 ? -8.342  10.954 -0.901  1.00 1.00 ? 30 LYS A HB2  1  
ATOM   432   H HB3  . LYS A 1 30 ? -8.370  11.274 0.841   1.00 1.00 ? 30 LYS A HB3  1  
ATOM   433   H HG2  . LYS A 1 30 ? -9.086  13.383 -1.251  1.00 1.00 ? 30 LYS A HG2  1  
ATOM   434   H HG3  . LYS A 1 30 ? -10.259 12.329 -0.488  1.00 1.00 ? 30 LYS A HG3  1  
ATOM   435   H HD2  . LYS A 1 30 ? -10.223 13.373 1.507   1.00 1.00 ? 30 LYS A HD2  1  
ATOM   436   H HD3  . LYS A 1 30 ? -8.522  13.762 1.490   1.00 1.00 ? 30 LYS A HD3  1  
ATOM   437   H HE2  . LYS A 1 30 ? -10.655 15.258 -0.109  1.00 1.00 ? 30 LYS A HE2  1  
ATOM   438   H HE3  . LYS A 1 30 ? -9.982  15.747 1.452   1.00 1.00 ? 30 LYS A HE3  1  
ATOM   439   H HZ1  . LYS A 1 30 ? -7.745  15.798 0.290   1.00 1.00 ? 30 LYS A HZ1  1  
ATOM   440   H HZ2  . LYS A 1 30 ? -8.555  15.698 -1.127  1.00 1.00 ? 30 LYS A HZ2  1  
ATOM   441   H HZ3  . LYS A 1 30 ? -8.828  16.946 -0.144  1.00 1.00 ? 30 LYS A HZ3  1  
ATOM   442   N N    . ALA A 1 31 ? -4.521  11.495 -0.329  1.00 1.00 ? 31 ALA A N    1  
ATOM   443   C CA   . ALA A 1 31 ? -3.257  10.943 0.154   1.00 1.00 ? 31 ALA A CA   1  
ATOM   444   C C    . ALA A 1 31 ? -2.968  11.269 1.631   1.00 1.00 ? 31 ALA A C    1  
ATOM   445   O O    . ALA A 1 31 ? -3.613  12.142 2.211   1.00 1.00 ? 31 ALA A O    1  
ATOM   446   C CB   . ALA A 1 31 ? -2.163  11.564 -0.703  1.00 1.00 ? 31 ALA A CB   1  
ATOM   447   H H    . ALA A 1 31 ? -4.472  12.088 -1.143  1.00 1.00 ? 31 ALA A H    1  
ATOM   448   H HA   . ALA A 1 31 ? -3.268  9.862  0.014   1.00 1.00 ? 31 ALA A HA   1  
ATOM   449   H HB1  . ALA A 1 31 ? -2.371  11.413 -1.762  1.00 1.00 ? 31 ALA A HB1  1  
ATOM   450   H HB2  . ALA A 1 31 ? -2.156  12.635 -0.509  1.00 1.00 ? 31 ALA A HB2  1  
ATOM   451   H HB3  . ALA A 1 31 ? -1.193  11.144 -0.444  1.00 1.00 ? 31 ALA A HB3  1  
ATOM   452   N N    . ARG A 1 32 ? -2.004  10.572 2.251   1.00 1.00 ? 32 ARG A N    1  
ATOM   453   C CA   . ARG A 1 32 ? -1.733  10.722 3.682   1.00 1.00 ? 32 ARG A CA   1  
ATOM   454   C C    . ARG A 1 32 ? -0.758  11.861 3.971   1.00 1.00 ? 32 ARG A C    1  
ATOM   455   O O    . ARG A 1 32 ? -1.166  12.865 4.547   1.00 1.00 ? 32 ARG A O    1  
ATOM   456   C CB   . ARG A 1 32 ? -1.258  9.393  4.301   1.00 1.00 ? 32 ARG A CB   1  
ATOM   457   C CG   . ARG A 1 32 ? -2.267  8.234  4.218   1.00 1.00 ? 32 ARG A CG   1  
ATOM   458   C CD   . ARG A 1 32 ? -3.384  8.262  5.280   1.00 1.00 ? 32 ARG A CD   1  
ATOM   459   N NE   . ARG A 1 32 ? -4.242  9.455  5.201   1.00 1.00 ? 32 ARG A NE   1  
ATOM   460   C CZ   . ARG A 1 32 ? -4.987  9.798  4.138   1.00 1.00 ? 32 ARG A CZ   1  
ATOM   461   N NH1  . ARG A 1 32 ? -5.189  8.927  3.148   1.00 1.00 ? 32 ARG A NH1  1  
ATOM   462   N NH2  . ARG A 1 32 ? -5.497  11.026 4.036   1.00 1.00 ? 32 ARG A NH2  1  
ATOM   463   H H    . ARG A 1 32 ? -1.428  9.929  1.711   1.00 1.00 ? 32 ARG A H    1  
ATOM   464   H HA   . ARG A 1 32 ? -2.638  11.054 4.183   1.00 1.00 ? 32 ARG A HA   1  
ATOM   465   H HB2  . ARG A 1 32 ? -0.356  9.077  3.775   1.00 1.00 ? 32 ARG A HB2  1  
ATOM   466   H HB3  . ARG A 1 32 ? -0.997  9.557  5.348   1.00 1.00 ? 32 ARG A HB3  1  
ATOM   467   H HG2  . ARG A 1 32 ? -2.672  8.182  3.211   1.00 1.00 ? 32 ARG A HG2  1  
ATOM   468   H HG3  . ARG A 1 32 ? -1.709  7.312  4.387   1.00 1.00 ? 32 ARG A HG3  1  
ATOM   469   H HD2  . ARG A 1 32 ? -3.992  7.359  5.195   1.00 1.00 ? 32 ARG A HD2  1  
ATOM   470   H HD3  . ARG A 1 32 ? -2.917  8.240  6.268   1.00 1.00 ? 32 ARG A HD3  1  
ATOM   471   H HE   . ARG A 1 32 ? -4.169  10.105 5.972   1.00 1.00 ? 32 ARG A HE   1  
ATOM   472   H HH11 . ARG A 1 32 ? -4.843  7.984  3.223   1.00 1.00 ? 32 ARG A HH11 1  
ATOM   473   H HH12 . ARG A 1 32 ? -5.647  9.250  2.299   1.00 1.00 ? 32 ARG A HH12 1  
ATOM   474   H HH21 . ARG A 1 32 ? -5.316  11.737 4.728   1.00 1.00 ? 32 ARG A HH21 1  
ATOM   475   H HH22 . ARG A 1 32 ? -5.819  11.313 3.113   1.00 1.00 ? 32 ARG A HH22 1  
ATOM   476   N N    . HIS A 1 33 ? 0.535   11.673 3.695   1.00 1.00 ? 33 HIS A N    1  
ATOM   477   C CA   . HIS A 1 33 ? 1.517   12.752 3.715   1.00 1.00 ? 33 HIS A CA   1  
ATOM   478   C C    . HIS A 1 33 ? 1.949   13.096 2.289   1.00 1.00 ? 33 HIS A C    1  
ATOM   479   O O    . HIS A 1 33 ? 1.718   12.319 1.361   1.00 1.00 ? 33 HIS A O    1  
ATOM   480   C CB   . HIS A 1 33 ? 2.680   12.442 4.670   1.00 1.00 ? 33 HIS A CB   1  
ATOM   481   C CG   . HIS A 1 33 ? 3.249   11.049 4.603   1.00 1.00 ? 33 HIS A CG   1  
ATOM   482   N ND1  . HIS A 1 33 ? 2.603   9.961  5.169   1.00 1.00 ? 33 HIS A ND1  1  
ATOM   483   C CD2  . HIS A 1 33 ? 4.460   10.565 4.171   1.00 1.00 ? 33 HIS A CD2  1  
ATOM   484   C CE1  . HIS A 1 33 ? 3.418   8.902  5.045   1.00 1.00 ? 33 HIS A CE1  1  
ATOM   485   N NE2  . HIS A 1 33 ? 4.567   9.204  4.441   1.00 1.00 ? 33 HIS A NE2  1  
ATOM   486   H H    . HIS A 1 33 ? 0.792   10.847 3.175   1.00 1.00 ? 33 HIS A H    1  
ATOM   487   H HA   . HIS A 1 33 ? 1.054   13.662 4.099   1.00 1.00 ? 33 HIS A HA   1  
ATOM   488   H HB2  . HIS A 1 33 ? 3.486   13.160 4.509   1.00 1.00 ? 33 HIS A HB2  1  
ATOM   489   H HB3  . HIS A 1 33 ? 2.315   12.586 5.689   1.00 1.00 ? 33 HIS A HB3  1  
ATOM   490   H HD1  . HIS A 1 33 ? 1.701   9.971  5.622   1.00 1.00 ? 33 HIS A HD1  1  
ATOM   491   H HD2  . HIS A 1 33 ? 5.241   11.168 3.733   1.00 1.00 ? 33 HIS A HD2  1  
ATOM   492   H HE1  . HIS A 1 33 ? 3.179   7.919  5.423   1.00 1.00 ? 33 HIS A HE1  1  
ATOM   493   N N    . GLY A 1 34 ? 2.609   14.245 2.135   1.00 1.00 ? 34 GLY A N    1  
ATOM   494   C CA   . GLY A 1 34 ? 3.285   14.664 0.921   1.00 1.00 ? 34 GLY A CA   1  
ATOM   495   C C    . GLY A 1 34 ? 4.479   15.514 1.329   1.00 1.00 ? 34 GLY A C    1  
ATOM   496   O O    . GLY A 1 34 ? 4.536   15.929 2.487   1.00 1.00 ? 34 GLY A O    1  
ATOM   497   H H    . GLY A 1 34 ? 2.824   14.809 2.947   1.00 1.00 ? 34 GLY A H    1  
ATOM   498   H HA2  . GLY A 1 34 ? 3.691   13.796 0.428   1.00 1.00 ? 34 GLY A HA2  1  
ATOM   499   H HA3  . GLY A 1 34 ? 2.608   15.201 0.254   1.00 1.00 ? 34 GLY A HA3  1  
ATOM   500   N N    . SER A 1 35 ? 5.452   15.711 0.436   1.00 1.00 ? 35 SER A N    1  
ATOM   501   C CA   . SER A 1 35 ? 6.673   16.462 0.702   1.00 1.00 ? 35 SER A CA   1  
ATOM   502   C C    . SER A 1 35 ? 7.429   16.696 -0.607  1.00 1.00 ? 35 SER A C    1  
ATOM   503   O O    . SER A 1 35 ? 7.305   15.943 -1.574  1.00 1.00 ? 35 SER A O    1  
ATOM   504   C CB   . SER A 1 35 ? 7.564   15.710 1.707   1.00 1.00 ? 35 SER A CB   1  
ATOM   505   O OG   . SER A 1 35 ? 7.154   15.972 3.036   1.00 1.00 ? 35 SER A OG   1  
ATOM   506   H H    . SER A 1 35 ? 5.362   15.294 -0.491  1.00 1.00 ? 35 SER A H    1  
ATOM   507   H HA   . SER A 1 35 ? 6.408   17.448 1.108   1.00 1.00 ? 35 SER A HA   1  
ATOM   508   H HB2  . SER A 1 35 ? 7.529   14.639 1.504   1.00 1.00 ? 35 SER A HB2  1  
ATOM   509   H HB3  . SER A 1 35 ? 8.602   16.032 1.607   1.00 1.00 ? 35 SER A HB3  1  
ATOM   510   H HG   . SER A 1 35 ? 6.211   15.776 3.109   1.00 1.00 ? 35 SER A HG   1  
ATOM   511   N N    . CYS A 1 36 ? 8.238   17.752 -0.621  1.00 1.00 ? 36 CYS A N    1  
ATOM   512   C CA   . CYS A 1 36 ? 8.973   18.220 -1.782  1.00 1.00 ? 36 CYS A CA   1  
ATOM   513   C C    . CYS A 1 36 ? 10.275  17.430 -1.894  1.00 1.00 ? 36 CYS A C    1  
ATOM   514   O O    . CYS A 1 36 ? 11.376  17.970 -1.779  1.00 1.00 ? 36 CYS A O    1  
ATOM   515   C CB   . CYS A 1 36 ? 9.180   19.731 -1.632  1.00 1.00 ? 36 CYS A CB   1  
ATOM   516   S SG   . CYS A 1 36 ? 10.076  20.569 -2.948  1.00 1.00 ? 36 CYS A SG   1  
ATOM   517   H H    . CYS A 1 36 ? 8.424   18.212 0.261   1.00 1.00 ? 36 CYS A H    1  
ATOM   518   H HA   . CYS A 1 36 ? 8.372   18.030 -2.670  1.00 1.00 ? 36 CYS A HA   1  
ATOM   519   H HB2  . CYS A 1 36 ? 8.195   20.189 -1.620  1.00 1.00 ? 36 CYS A HB2  1  
ATOM   520   H HB3  . CYS A 1 36 ? 9.693   19.945 -0.694  1.00 1.00 ? 36 CYS A HB3  1  
ATOM   521   N N    . ASN A 1 37 ? 10.133  16.114 -2.056  1.00 1.00 ? 37 ASN A N    1  
ATOM   522   C CA   . ASN A 1 37 ? 11.257  15.190 -2.049  1.00 1.00 ? 37 ASN A CA   1  
ATOM   523   C C    . ASN A 1 37 ? 12.227  15.490 -3.193  1.00 1.00 ? 37 ASN A C    1  
ATOM   524   O O    . ASN A 1 37 ? 11.819  15.993 -4.243  1.00 1.00 ? 37 ASN A O    1  
ATOM   525   C CB   . ASN A 1 37 ? 10.753  13.750 -2.146  1.00 1.00 ? 37 ASN A CB   1  
ATOM   526   C CG   . ASN A 1 37 ? 11.922  12.779 -2.285  1.00 1.00 ? 37 ASN A CG   1  
ATOM   527   O OD1  . ASN A 1 37 ? 12.838  12.793 -1.469  1.00 1.00 ? 37 ASN A OD1  1  
ATOM   528   N ND2  . ASN A 1 37 ? 11.951  11.991 -3.353  1.00 1.00 ? 37 ASN A ND2  1  
ATOM   529   H H    . ASN A 1 37 ? 9.190   15.756 -2.162  1.00 1.00 ? 37 ASN A H    1  
ATOM   530   H HA   . ASN A 1 37 ? 11.785  15.309 -1.101  1.00 1.00 ? 37 ASN A HA   1  
ATOM   531   H HB2  . ASN A 1 37 ? 10.175  13.497 -1.257  1.00 1.00 ? 37 ASN A HB2  1  
ATOM   532   H HB3  . ASN A 1 37 ? 10.113  13.679 -3.020  1.00 1.00 ? 37 ASN A HB3  1  
ATOM   533   H HD21 . ASN A 1 37 ? 11.225  12.040 -4.050  1.00 1.00 ? 37 ASN A HD21 1  
ATOM   534   H HD22 . ASN A 1 37 ? 12.737  11.372 -3.470  1.00 1.00 ? 37 ASN A HD22 1  
ATOM   535   N N    . TYR A 1 38 ? 13.505  15.156 -2.974  1.00 1.00 ? 38 TYR A N    1  
ATOM   536   C CA   . TYR A 1 38 ? 14.565  15.300 -3.954  1.00 1.00 ? 38 TYR A CA   1  
ATOM   537   C C    . TYR A 1 38 ? 14.602  14.106 -4.919  1.00 1.00 ? 38 TYR A C    1  
ATOM   538   O O    . TYR A 1 38 ? 13.612  13.836 -5.602  1.00 1.00 ? 38 TYR A O    1  
ATOM   539   C CB   . TYR A 1 38 ? 15.912  15.638 -3.280  1.00 1.00 ? 38 TYR A CB   1  
ATOM   540   C CG   . TYR A 1 38 ? 17.027  15.981 -4.263  1.00 1.00 ? 38 TYR A CG   1  
ATOM   541   C CD1  . TYR A 1 38 ? 16.767  16.871 -5.321  1.00 1.00 ? 38 TYR A CD1  1  
ATOM   542   C CD2  . TYR A 1 38 ? 18.211  15.214 -4.289  1.00 1.00 ? 38 TYR A CD2  1  
ATOM   543   C CE1  . TYR A 1 38 ? 17.599  16.894 -6.449  1.00 1.00 ? 38 TYR A CE1  1  
ATOM   544   C CE2  . TYR A 1 38 ? 19.015  15.201 -5.443  1.00 1.00 ? 38 TYR A CE2  1  
ATOM   545   C CZ   . TYR A 1 38 ? 18.675  16.001 -6.546  1.00 1.00 ? 38 TYR A CZ   1  
ATOM   546   O OH   . TYR A 1 38 ? 19.376  15.901 -7.710  1.00 1.00 ? 38 TYR A OH   1  
ATOM   547   H H    . TYR A 1 38 ? 13.723  14.667 -2.114  1.00 1.00 ? 38 TYR A H    1  
ATOM   548   H HA   . TYR A 1 38 ? 14.301  16.155 -4.562  1.00 1.00 ? 38 TYR A HA   1  
ATOM   549   H HB2  . TYR A 1 38 ? 15.769  16.504 -2.636  1.00 1.00 ? 38 TYR A HB2  1  
ATOM   550   H HB3  . TYR A 1 38 ? 16.213  14.805 -2.642  1.00 1.00 ? 38 TYR A HB3  1  
ATOM   551   H HD1  . TYR A 1 38 ? 15.897  17.505 -5.305  1.00 1.00 ? 38 TYR A HD1  1  
ATOM   552   H HD2  . TYR A 1 38 ? 18.462  14.569 -3.459  1.00 1.00 ? 38 TYR A HD2  1  
ATOM   553   H HE1  . TYR A 1 38 ? 17.393  17.583 -7.249  1.00 1.00 ? 38 TYR A HE1  1  
ATOM   554   H HE2  . TYR A 1 38 ? 19.883  14.559 -5.492  1.00 1.00 ? 38 TYR A HE2  1  
ATOM   555   H HH   . TYR A 1 38 ? 18.947  16.382 -8.431  1.00 1.00 ? 38 TYR A HH   1  
ATOM   556   N N    . VAL A 1 39 ? 15.751  13.427 -5.014  1.00 1.00 ? 39 VAL A N    1  
ATOM   557   C CA   . VAL A 1 39 ? 16.098  12.433 -6.022  1.00 1.00 ? 39 VAL A CA   1  
ATOM   558   C C    . VAL A 1 39 ? 16.264  13.159 -7.366  1.00 1.00 ? 39 VAL A C    1  
ATOM   559   O O    . VAL A 1 39 ? 15.698  14.232 -7.581  1.00 1.00 ? 39 VAL A O    1  
ATOM   560   C CB   . VAL A 1 39 ? 15.107  11.246 -6.041  1.00 1.00 ? 39 VAL A CB   1  
ATOM   561   C CG1  . VAL A 1 39 ? 15.506  10.177 -7.067  1.00 1.00 ? 39 VAL A CG1  1  
ATOM   562   C CG2  . VAL A 1 39 ? 15.060  10.582 -4.657  1.00 1.00 ? 39 VAL A CG2  1  
ATOM   563   H H    . VAL A 1 39 ? 16.489  13.679 -4.379  1.00 1.00 ? 39 VAL A H    1  
ATOM   564   H HA   . VAL A 1 39 ? 17.077  12.039 -5.745  1.00 1.00 ? 39 VAL A HA   1  
ATOM   565   H HB   . VAL A 1 39 ? 14.103  11.578 -6.302  1.00 1.00 ? 39 VAL A HB   1  
ATOM   566   H HG11 . VAL A 1 39 ? 16.537  9.862  -6.905  1.00 1.00 ? 39 VAL A HG11 1  
ATOM   567   H HG12 . VAL A 1 39 ? 14.853  9.309  -6.965  1.00 1.00 ? 39 VAL A HG12 1  
ATOM   568   H HG13 . VAL A 1 39 ? 15.396  10.559 -8.081  1.00 1.00 ? 39 VAL A HG13 1  
ATOM   569   H HG21 . VAL A 1 39 ? 14.765  11.299 -3.892  1.00 1.00 ? 39 VAL A HG21 1  
ATOM   570   H HG22 . VAL A 1 39 ? 14.337  9.766  -4.663  1.00 1.00 ? 39 VAL A HG22 1  
ATOM   571   H HG23 . VAL A 1 39 ? 16.042  10.182 -4.403  1.00 1.00 ? 39 VAL A HG23 1  
ATOM   572   N N    . PHE A 1 40 ? 17.058  12.597 -8.278  1.00 1.00 ? 40 PHE A N    1  
ATOM   573   C CA   . PHE A 1 40 ? 17.275  13.176 -9.600  1.00 1.00 ? 40 PHE A CA   1  
ATOM   574   C C    . PHE A 1 40 ? 15.933  13.459 -10.303 1.00 1.00 ? 40 PHE A C    1  
ATOM   575   O O    . PHE A 1 40 ? 14.949  12.759 -10.045 1.00 1.00 ? 40 PHE A O    1  
ATOM   576   C CB   . PHE A 1 40 ? 18.152  12.211 -10.415 1.00 1.00 ? 40 PHE A CB   1  
ATOM   577   C CG   . PHE A 1 40 ? 18.345  12.531 -11.886 1.00 1.00 ? 40 PHE A CG   1  
ATOM   578   C CD1  . PHE A 1 40 ? 17.394  12.100 -12.832 1.00 1.00 ? 40 PHE A CD1  1  
ATOM   579   C CD2  . PHE A 1 40 ? 19.495  13.220 -12.318 1.00 1.00 ? 40 PHE A CD2  1  
ATOM   580   C CE1  . PHE A 1 40 ? 17.565  12.405 -14.194 1.00 1.00 ? 40 PHE A CE1  1  
ATOM   581   C CE2  . PHE A 1 40 ? 19.665  13.522 -13.680 1.00 1.00 ? 40 PHE A CE2  1  
ATOM   582   C CZ   . PHE A 1 40 ? 18.699  13.119 -14.617 1.00 1.00 ? 40 PHE A CZ   1  
ATOM   583   H H    . PHE A 1 40 ? 17.508  11.723 -8.055  1.00 1.00 ? 40 PHE A H    1  
ATOM   584   H HA   . PHE A 1 40 ? 17.826  14.102 -9.438  1.00 1.00 ? 40 PHE A HA   1  
ATOM   585   H HB2  . PHE A 1 40 ? 19.135  12.187 -9.946  1.00 1.00 ? 40 PHE A HB2  1  
ATOM   586   H HB3  . PHE A 1 40 ? 17.719  11.214 -10.356 1.00 1.00 ? 40 PHE A HB3  1  
ATOM   587   H HD1  . PHE A 1 40 ? 16.528  11.532 -12.523 1.00 1.00 ? 40 PHE A HD1  1  
ATOM   588   H HD2  . PHE A 1 40 ? 20.247  13.534 -11.608 1.00 1.00 ? 40 PHE A HD2  1  
ATOM   589   H HE1  . PHE A 1 40 ? 16.831  12.080 -14.917 1.00 1.00 ? 40 PHE A HE1  1  
ATOM   590   H HE2  . PHE A 1 40 ? 20.544  14.060 -14.008 1.00 1.00 ? 40 PHE A HE2  1  
ATOM   591   H HZ   . PHE A 1 40 ? 18.834  13.348 -15.665 1.00 1.00 ? 40 PHE A HZ   1  
ATOM   592   N N    . PRO A 1 41 ? 15.850  14.467 -11.186 1.00 1.00 ? 41 PRO A N    1  
ATOM   593   C CA   . PRO A 1 41 ? 16.864  15.481 -11.419 1.00 1.00 ? 41 PRO A CA   1  
ATOM   594   C C    . PRO A 1 41 ? 16.755  16.581 -10.358 1.00 1.00 ? 41 PRO A C    1  
ATOM   595   O O    . PRO A 1 41 ? 17.738  16.892 -9.688  1.00 1.00 ? 41 PRO A O    1  
ATOM   596   C CB   . PRO A 1 41 ? 16.584  16.002 -12.831 1.00 1.00 ? 41 PRO A CB   1  
ATOM   597   C CG   . PRO A 1 41 ? 15.081  15.791 -13.031 1.00 1.00 ? 41 PRO A CG   1  
ATOM   598   C CD   . PRO A 1 41 ? 14.743  14.606 -12.120 1.00 1.00 ? 41 PRO A CD   1  
ATOM   599   H HA   . PRO A 1 41 ? 17.868  15.062 -11.390 1.00 1.00 ? 41 PRO A HA   1  
ATOM   600   H HB2  . PRO A 1 41 ? 16.880  17.044 -12.961 1.00 1.00 ? 41 PRO A HB2  1  
ATOM   601   H HB3  . PRO A 1 41 ? 17.123  15.377 -13.545 1.00 1.00 ? 41 PRO A HB3  1  
ATOM   602   H HG2  . PRO A 1 41 ? 14.532  16.680 -12.721 1.00 1.00 ? 41 PRO A HG2  1  
ATOM   603   H HG3  . PRO A 1 41 ? 14.847  15.573 -14.075 1.00 1.00 ? 41 PRO A HG3  1  
ATOM   604   H HD2  . PRO A 1 41 ? 13.801  14.776 -11.596 1.00 1.00 ? 41 PRO A HD2  1  
ATOM   605   H HD3  . PRO A 1 41 ? 14.668  13.697 -12.719 1.00 1.00 ? 41 PRO A HD3  1  
ATOM   606   N N    . ALA A 1 42 ? 15.555  17.151 -10.210 1.00 1.00 ? 42 ALA A N    1  
ATOM   607   C CA   . ALA A 1 42 ? 15.222  18.230 -9.291  1.00 1.00 ? 42 ALA A CA   1  
ATOM   608   C C    . ALA A 1 42 ? 14.222  17.724 -8.248  1.00 1.00 ? 42 ALA A C    1  
ATOM   609   O O    . ALA A 1 42 ? 13.747  16.588 -8.336  1.00 1.00 ? 42 ALA A O    1  
ATOM   610   C CB   . ALA A 1 42 ? 14.629  19.394 -10.092 1.00 1.00 ? 42 ALA A CB   1  
ATOM   611   H H    . ALA A 1 42 ? 14.788  16.767 -10.738 1.00 1.00 ? 42 ALA A H    1  
ATOM   612   H HA   . ALA A 1 42 ? 16.116  18.596 -8.786  1.00 1.00 ? 42 ALA A HA   1  
ATOM   613   H HB1  . ALA A 1 42 ? 15.342  19.718 -10.851 1.00 1.00 ? 42 ALA A HB1  1  
ATOM   614   H HB2  . ALA A 1 42 ? 13.705  19.079 -10.580 1.00 1.00 ? 42 ALA A HB2  1  
ATOM   615   H HB3  . ALA A 1 42 ? 14.413  20.235 -9.434  1.00 1.00 ? 42 ALA A HB3  1  
ATOM   616   N N    . HIS A 1 43 ? 13.872  18.573 -7.278  1.00 1.00 ? 43 HIS A N    1  
ATOM   617   C CA   . HIS A 1 43 ? 12.818  18.260 -6.324  1.00 1.00 ? 43 HIS A CA   1  
ATOM   618   C C    . HIS A 1 43 ? 11.471  18.148 -7.042  1.00 1.00 ? 43 HIS A C    1  
ATOM   619   O O    . HIS A 1 43 ? 11.240  18.855 -8.022  1.00 1.00 ? 43 HIS A O    1  
ATOM   620   C CB   . HIS A 1 43 ? 12.737  19.335 -5.235  1.00 1.00 ? 43 HIS A CB   1  
ATOM   621   C CG   . HIS A 1 43 ? 13.891  19.375 -4.272  1.00 1.00 ? 43 HIS A CG   1  
ATOM   622   N ND1  . HIS A 1 43 ? 13.773  18.917 -2.968  1.00 1.00 ? 43 HIS A ND1  1  
ATOM   623   C CD2  . HIS A 1 43 ? 15.165  19.881 -4.366  1.00 1.00 ? 43 HIS A CD2  1  
ATOM   624   C CE1  . HIS A 1 43 ? 14.951  19.132 -2.362  1.00 1.00 ? 43 HIS A CE1  1  
ATOM   625   N NE2  . HIS A 1 43 ? 15.849  19.703 -3.168  1.00 1.00 ? 43 HIS A NE2  1  
ATOM   626   H H    . HIS A 1 43 ? 14.263  19.502 -7.272  1.00 1.00 ? 43 HIS A H    1  
ATOM   627   H HA   . HIS A 1 43 ? 13.047  17.301 -5.875  1.00 1.00 ? 43 HIS A HA   1  
ATOM   628   H HB2  . HIS A 1 43 ? 12.608  20.318 -5.690  1.00 1.00 ? 43 HIS A HB2  1  
ATOM   629   H HB3  . HIS A 1 43 ? 11.863  19.119 -4.629  1.00 1.00 ? 43 HIS A HB3  1  
ATOM   630   H HD1  . HIS A 1 43 ? 12.942  18.518 -2.540  1.00 1.00 ? 43 HIS A HD1  1  
ATOM   631   H HD2  . HIS A 1 43 ? 15.582  20.341 -5.250  1.00 1.00 ? 43 HIS A HD2  1  
ATOM   632   H HE1  . HIS A 1 43 ? 15.152  18.869 -1.334  1.00 1.00 ? 43 HIS A HE1  1  
ATOM   633   N N    . LYS A 1 44 ? 10.575  17.288 -6.548  1.00 1.00 ? 44 LYS A N    1  
ATOM   634   C CA   . LYS A 1 44 ? 9.236   17.118 -7.094  1.00 1.00 ? 44 LYS A CA   1  
ATOM   635   C C    . LYS A 1 44 ? 8.241   16.824 -5.975  1.00 1.00 ? 44 LYS A C    1  
ATOM   636   O O    . LYS A 1 44 ? 8.627   16.307 -4.926  1.00 1.00 ? 44 LYS A O    1  
ATOM   637   C CB   . LYS A 1 44 ? 9.219   16.056 -8.205  1.00 1.00 ? 44 LYS A CB   1  
ATOM   638   C CG   . LYS A 1 44 ? 9.396   14.593 -7.758  1.00 1.00 ? 44 LYS A CG   1  
ATOM   639   C CD   . LYS A 1 44 ? 10.830  14.196 -7.374  1.00 1.00 ? 44 LYS A CD   1  
ATOM   640   C CE   . LYS A 1 44 ? 11.722  14.020 -8.611  1.00 1.00 ? 44 LYS A CE   1  
ATOM   641   N NZ   . LYS A 1 44 ? 13.142  13.910 -8.235  1.00 1.00 ? 44 LYS A NZ   1  
ATOM   642   H H    . LYS A 1 44 ? 10.796  16.762 -5.706  1.00 1.00 ? 44 LYS A H    1  
ATOM   643   H HA   . LYS A 1 44 ? 8.926   18.062 -7.538  1.00 1.00 ? 44 LYS A HA   1  
ATOM   644   H HB2  . LYS A 1 44 ? 8.239   16.124 -8.678  1.00 1.00 ? 44 LYS A HB2  1  
ATOM   645   H HB3  . LYS A 1 44 ? 9.967   16.321 -8.950  1.00 1.00 ? 44 LYS A HB3  1  
ATOM   646   H HG2  . LYS A 1 44 ? 8.735   14.401 -6.915  1.00 1.00 ? 44 LYS A HG2  1  
ATOM   647   H HG3  . LYS A 1 44 ? 9.070   13.945 -8.573  1.00 1.00 ? 44 LYS A HG3  1  
ATOM   648   H HD2  . LYS A 1 44 ? 11.261  14.921 -6.688  1.00 1.00 ? 44 LYS A HD2  1  
ATOM   649   H HD3  . LYS A 1 44 ? 10.787  13.241 -6.845  1.00 1.00 ? 44 LYS A HD3  1  
ATOM   650   H HE2  . LYS A 1 44 ? 11.420  13.112 -9.135  1.00 1.00 ? 44 LYS A HE2  1  
ATOM   651   H HE3  . LYS A 1 44 ? 11.623  14.866 -9.291  1.00 1.00 ? 44 LYS A HE3  1  
ATOM   652   H HZ1  . LYS A 1 44 ? 13.262  13.443 -7.344  1.00 1.00 ? 44 LYS A HZ1  1  
ATOM   653   H HZ2  . LYS A 1 44 ? 13.690  13.432 -8.942  1.00 1.00 ? 44 LYS A HZ2  1  
ATOM   654   H HZ3  . LYS A 1 44 ? 13.559  14.828 -8.106  1.00 1.00 ? 44 LYS A HZ3  1  
ATOM   655   N N    . CYS A 1 45 ? 6.970   17.182 -6.183  1.00 1.00 ? 45 CYS A N    1  
ATOM   656   C CA   . CYS A 1 45 ? 5.972   17.079 -5.125  1.00 1.00 ? 45 CYS A CA   1  
ATOM   657   C C    . CYS A 1 45 ? 5.533   15.625 -4.923  1.00 1.00 ? 45 CYS A C    1  
ATOM   658   O O    . CYS A 1 45 ? 4.497   15.211 -5.444  1.00 1.00 ? 45 CYS A O    1  
ATOM   659   C CB   . CYS A 1 45 ? 4.765   17.985 -5.409  1.00 1.00 ? 45 CYS A CB   1  
ATOM   660   S SG   . CYS A 1 45 ? 3.486   17.895 -4.136  1.00 1.00 ? 45 CYS A SG   1  
ATOM   661   H H    . CYS A 1 45 ? 6.707   17.593 -7.077  1.00 1.00 ? 45 CYS A H    1  
ATOM   662   H HA   . CYS A 1 45 ? 6.440   17.429 -4.206  1.00 1.00 ? 45 CYS A HA   1  
ATOM   663   H HB2  . CYS A 1 45 ? 5.058   19.027 -5.490  1.00 1.00 ? 45 CYS A HB2  1  
ATOM   664   H HB3  . CYS A 1 45 ? 4.310   17.694 -6.354  1.00 1.00 ? 45 CYS A HB3  1  
ATOM   665   N N    . ILE A 1 46 ? 6.300   14.848 -4.153  1.00 1.00 ? 46 ILE A N    1  
ATOM   666   C CA   . ILE A 1 46 ? 5.981   13.448 -3.897  1.00 1.00 ? 46 ILE A CA   1  
ATOM   667   C C    . ILE A 1 46 ? 4.886   13.390 -2.843  1.00 1.00 ? 46 ILE A C    1  
ATOM   668   O O    . ILE A 1 46 ? 4.880   14.175 -1.892  1.00 1.00 ? 46 ILE A O    1  
ATOM   669   C CB   . ILE A 1 46 ? 7.222   12.657 -3.439  1.00 1.00 ? 46 ILE A CB   1  
ATOM   670   C CG1  . ILE A 1 46 ? 8.274   12.519 -4.555  1.00 1.00 ? 46 ILE A CG1  1  
ATOM   671   C CG2  . ILE A 1 46 ? 6.850   11.266 -2.888  1.00 1.00 ? 46 ILE A CG2  1  
ATOM   672   C CD1  . ILE A 1 46 ? 7.789   11.833 -5.837  1.00 1.00 ? 46 ILE A CD1  1  
ATOM   673   H H    . ILE A 1 46 ? 7.101   15.263 -3.690  1.00 1.00 ? 46 ILE A H    1  
ATOM   674   H HA   . ILE A 1 46 ? 5.593   12.986 -4.799  1.00 1.00 ? 46 ILE A HA   1  
ATOM   675   H HB   . ILE A 1 46 ? 7.685   13.204 -2.616  1.00 1.00 ? 46 ILE A HB   1  
ATOM   676   H HG12 . ILE A 1 46 ? 8.647   13.509 -4.811  1.00 1.00 ? 46 ILE A HG12 1  
ATOM   677   H HG13 . ILE A 1 46 ? 9.104   11.930 -4.167  1.00 1.00 ? 46 ILE A HG13 1  
ATOM   678   H HG21 . ILE A 1 46 ? 6.228   10.721 -3.598  1.00 1.00 ? 46 ILE A HG21 1  
ATOM   679   H HG22 . ILE A 1 46 ? 7.753   10.690 -2.687  1.00 1.00 ? 46 ILE A HG22 1  
ATOM   680   H HG23 . ILE A 1 46 ? 6.305   11.356 -1.948  1.00 1.00 ? 46 ILE A HG23 1  
ATOM   681   H HD11 . ILE A 1 46 ? 7.327   10.873 -5.613  1.00 1.00 ? 46 ILE A HD11 1  
ATOM   682   H HD12 . ILE A 1 46 ? 7.082   12.466 -6.367  1.00 1.00 ? 46 ILE A HD12 1  
ATOM   683   H HD13 . ILE A 1 46 ? 8.645   11.660 -6.490  1.00 1.00 ? 46 ILE A HD13 1  
ATOM   684   N N    . CYS A 1 47 ? 3.955   12.453 -3.026  1.00 1.00 ? 47 CYS A N    1  
ATOM   685   C CA   . CYS A 1 47 ? 2.830   12.281 -2.141  1.00 1.00 ? 47 CYS A CA   1  
ATOM   686   C C    . CYS A 1 47 ? 2.507   10.801 -1.972  1.00 1.00 ? 47 CYS A C    1  
ATOM   687   O O    . CYS A 1 47 ? 2.643   10.014 -2.906  1.00 1.00 ? 47 CYS A O    1  
ATOM   688   C CB   . CYS A 1 47 ? 1.675   13.125 -2.636  1.00 1.00 ? 47 CYS A CB   1  
ATOM   689   S SG   . CYS A 1 47 ? 0.399   13.295 -1.395  1.00 1.00 ? 47 CYS A SG   1  
ATOM   690   H H    . CYS A 1 47 ? 3.987   11.840 -3.837  1.00 1.00 ? 47 CYS A H    1  
ATOM   691   H HA   . CYS A 1 47 ? 3.102   12.647 -1.162  1.00 1.00 ? 47 CYS A HA   1  
ATOM   692   H HB2  . CYS A 1 47 ? 2.034   14.126 -2.848  1.00 1.00 ? 47 CYS A HB2  1  
ATOM   693   H HB3  . CYS A 1 47 ? 1.277   12.706 -3.554  1.00 1.00 ? 47 CYS A HB3  1  
ATOM   694   N N    . TYR A 1 48 ? 2.146   10.426 -0.745  1.00 1.00 ? 48 TYR A N    1  
ATOM   695   C CA   . TYR A 1 48 ? 2.038   9.051  -0.297  1.00 1.00 ? 48 TYR A CA   1  
ATOM   696   C C    . TYR A 1 48 ? 0.571   8.621  -0.259  1.00 1.00 ? 48 TYR A C    1  
ATOM   697   O O    . TYR A 1 48 ? -0.145  8.952  0.694   1.00 1.00 ? 48 TYR A O    1  
ATOM   698   C CB   . TYR A 1 48 ? 2.711   8.964  1.083   1.00 1.00 ? 48 TYR A CB   1  
ATOM   699   C CG   . TYR A 1 48 ? 4.207   9.244  1.101   1.00 1.00 ? 48 TYR A CG   1  
ATOM   700   C CD1  . TYR A 1 48 ? 4.698   10.551 0.905   1.00 1.00 ? 48 TYR A CD1  1  
ATOM   701   C CD2  . TYR A 1 48 ? 5.111   8.210  1.411   1.00 1.00 ? 48 TYR A CD2  1  
ATOM   702   C CE1  . TYR A 1 48 ? 6.079   10.805 0.931   1.00 1.00 ? 48 TYR A CE1  1  
ATOM   703   C CE2  . TYR A 1 48 ? 6.492   8.468  1.457   1.00 1.00 ? 48 TYR A CE2  1  
ATOM   704   C CZ   . TYR A 1 48 ? 6.977   9.760  1.200   1.00 1.00 ? 48 TYR A CZ   1  
ATOM   705   O OH   . TYR A 1 48 ? 8.319   9.992  1.214   1.00 1.00 ? 48 TYR A OH   1  
ATOM   706   H H    . TYR A 1 48 ? 1.998   11.145 -0.041  1.00 1.00 ? 48 TYR A H    1  
ATOM   707   H HA   . TYR A 1 48 ? 2.587   8.388  -0.966  1.00 1.00 ? 48 TYR A HA   1  
ATOM   708   H HB2  . TYR A 1 48 ? 2.222   9.654  1.772   1.00 1.00 ? 48 TYR A HB2  1  
ATOM   709   H HB3  . TYR A 1 48 ? 2.559   7.960  1.464   1.00 1.00 ? 48 TYR A HB3  1  
ATOM   710   H HD1  . TYR A 1 48 ? 4.026   11.377 0.756   1.00 1.00 ? 48 TYR A HD1  1  
ATOM   711   H HD2  . TYR A 1 48 ? 4.757   7.209  1.606   1.00 1.00 ? 48 TYR A HD2  1  
ATOM   712   H HE1  . TYR A 1 48 ? 6.439   11.808 0.754   1.00 1.00 ? 48 TYR A HE1  1  
ATOM   713   H HE2  . TYR A 1 48 ? 7.183   7.671  1.690   1.00 1.00 ? 48 TYR A HE2  1  
ATOM   714   H HH   . TYR A 1 48 ? 8.547   10.911 1.062   1.00 1.00 ? 48 TYR A HH   1  
ATOM   715   N N    . PHE A 1 49 ? 0.106   7.897  -1.287  1.00 1.00 ? 49 PHE A N    1  
ATOM   716   C CA   . PHE A 1 49 ? -1.266  7.403  -1.326  1.00 1.00 ? 49 PHE A CA   1  
ATOM   717   C C    . PHE A 1 49 ? -1.295  5.966  -0.791  1.00 1.00 ? 49 PHE A C    1  
ATOM   718   O O    . PHE A 1 49 ? -0.433  5.181  -1.179  1.00 1.00 ? 49 PHE A O    1  
ATOM   719   C CB   . PHE A 1 49 ? -1.873  7.401  -2.738  1.00 1.00 ? 49 PHE A CB   1  
ATOM   720   C CG   . PHE A 1 49 ? -1.399  8.387  -3.794  1.00 1.00 ? 49 PHE A CG   1  
ATOM   721   C CD1  . PHE A 1 49 ? -0.966  9.683  -3.456  1.00 1.00 ? 49 PHE A CD1  1  
ATOM   722   C CD2  . PHE A 1 49 ? -1.642  8.076  -5.145  1.00 1.00 ? 49 PHE A CD2  1  
ATOM   723   C CE1  . PHE A 1 49 ? -0.740  10.638 -4.459  1.00 1.00 ? 49 PHE A CE1  1  
ATOM   724   C CE2  . PHE A 1 49 ? -1.410  9.031  -6.148  1.00 1.00 ? 49 PHE A CE2  1  
ATOM   725   C CZ   . PHE A 1 49 ? -0.906  10.297 -5.808  1.00 1.00 ? 49 PHE A CZ   1  
ATOM   726   H H    . PHE A 1 49 ? 0.716   7.660  -2.066  1.00 1.00 ? 49 PHE A H    1  
ATOM   727   H HA   . PHE A 1 49 ? -1.879  8.071  -0.725  1.00 1.00 ? 49 PHE A HA   1  
ATOM   728   H HB2  . PHE A 1 49 ? -1.781  6.392  -3.136  1.00 1.00 ? 49 PHE A HB2  1  
ATOM   729   H HB3  . PHE A 1 49 ? -2.936  7.576  -2.615  1.00 1.00 ? 49 PHE A HB3  1  
ATOM   730   H HD1  . PHE A 1 49 ? -0.796  9.960  -2.431  1.00 1.00 ? 49 PHE A HD1  1  
ATOM   731   H HD2  . PHE A 1 49 ? -2.040  7.109  -5.421  1.00 1.00 ? 49 PHE A HD2  1  
ATOM   732   H HE1  . PHE A 1 49 ? -0.458  11.641 -4.192  1.00 1.00 ? 49 PHE A HE1  1  
ATOM   733   H HE2  . PHE A 1 49 ? -1.647  8.795  -7.172  1.00 1.00 ? 49 PHE A HE2  1  
ATOM   734   H HZ   . PHE A 1 49 ? -0.633  11.002 -6.576  1.00 1.00 ? 49 PHE A HZ   1  
ATOM   735   N N    . PRO A 1 50 ? -2.278  5.587  0.040   1.00 1.00 ? 50 PRO A N    1  
ATOM   736   C CA   . PRO A 1 50 ? -2.417  4.254  0.612   1.00 1.00 ? 50 PRO A CA   1  
ATOM   737   C C    . PRO A 1 50 ? -2.877  3.258  -0.453  1.00 1.00 ? 50 PRO A C    1  
ATOM   738   O O    . PRO A 1 50 ? -4.025  2.820  -0.495  1.00 1.00 ? 50 PRO A O    1  
ATOM   739   C CB   . PRO A 1 50 ? -3.429  4.414  1.743   1.00 1.00 ? 50 PRO A CB   1  
ATOM   740   C CG   . PRO A 1 50 ? -4.331  5.538  1.232   1.00 1.00 ? 50 PRO A CG   1  
ATOM   741   C CD   . PRO A 1 50 ? -3.343  6.449  0.501   1.00 1.00 ? 50 PRO A CD   1  
ATOM   742   H HA   . PRO A 1 50 ? -1.474  3.902  1.033   1.00 1.00 ? 50 PRO A HA   1  
ATOM   743   H HB2  . PRO A 1 50 ? -3.970  3.490  1.951   1.00 1.00 ? 50 PRO A HB2  1  
ATOM   744   H HB3  . PRO A 1 50 ? -2.895  4.746  2.633   1.00 1.00 ? 50 PRO A HB3  1  
ATOM   745   H HG2  . PRO A 1 50 ? -5.049  5.130  0.519   1.00 1.00 ? 50 PRO A HG2  1  
ATOM   746   H HG3  . PRO A 1 50 ? -4.857  6.045  2.040   1.00 1.00 ? 50 PRO A HG3  1  
ATOM   747   H HD2  . PRO A 1 50 ? -3.814  6.950  -0.347  1.00 1.00 ? 50 PRO A HD2  1  
ATOM   748   H HD3  . PRO A 1 50 ? -2.909  7.164  1.199   1.00 1.00 ? 50 PRO A HD3  1  
ATOM   749   N N    . CYS A 1 51 ? -1.952  2.886  -1.328  1.00 1.00 ? 51 CYS A N    1  
ATOM   750   C CA   . CYS A 1 51 ? -2.173  2.025  -2.481  1.00 1.00 ? 51 CYS A CA   1  
ATOM   751   C C    . CYS A 1 51 ? -2.329  0.559  -2.065  1.00 1.00 ? 51 CYS A C    1  
ATOM   752   O O    . CYS A 1 51 ? -1.579  -0.302 -2.530  1.00 1.00 ? 51 CYS A O    1  
ATOM   753   C CB   . CYS A 1 51 ? -1.025  2.253  -3.469  1.00 1.00 ? 51 CYS A CB   1  
ATOM   754   S SG   . CYS A 1 51 ? 0.623   1.756  -2.913  1.00 1.00 ? 51 CYS A SG   1  
ATOM   755   O OXT  . CYS A 1 51 ? -3.335  0.286  -1.188  1.00 0.00 ? 51 CYS A OXT  1  
ATOM   756   H H    . CYS A 1 51 ? -1.035  3.296  -1.186  1.00 1.00 ? 51 CYS A H    1  
ATOM   757   H HA   . CYS A 1 51 ? -3.095  2.334  -2.975  1.00 1.00 ? 51 CYS A HA   1  
ATOM   758   H HB2  . CYS A 1 51 ? -1.209  1.766  -4.421  1.00 1.00 ? 51 CYS A HB2  1  
ATOM   759   H HB3  . CYS A 1 51 ? -0.996  3.322  -3.672  1.00 1.00 ? 51 CYS A HB3  1  
HETATM 760   N N    . PCA A 1 1  ? 2.541   2.020  6.235   1.00 1.00 ? 1  PCA A N    2  
HETATM 761   C CA   . PCA A 1 1  ? 3.823   1.815  5.586   1.00 1.00 ? 1  PCA A CA   2  
HETATM 762   C CB   . PCA A 1 1  ? 4.507   0.700  6.399   1.00 1.00 ? 1  PCA A CB   2  
HETATM 763   C CG   . PCA A 1 1  ? 3.774   0.745  7.748   1.00 1.00 ? 1  PCA A CG   2  
HETATM 764   C CD   . PCA A 1 1  ? 2.469   1.445  7.427   1.00 1.00 ? 1  PCA A CD   2  
HETATM 765   O OE   . PCA A 1 1  ? 1.491   1.450  8.165   1.00 1.00 ? 1  PCA A OE   2  
HETATM 766   C C    . PCA A 1 1  ? 3.639   1.451  4.114   1.00 1.00 ? 1  PCA A C    2  
HETATM 767   O O    . PCA A 1 1  ? 4.286   2.022  3.237   1.00 1.00 ? 1  PCA A O    2  
HETATM 768   H H    . PCA A 1 1  ? 1.788   2.552  5.826   1.00 0.00 ? 1  PCA A H    2  
HETATM 769   H HA   . PCA A 1 1  ? 4.406   2.733  5.666   1.00 1.00 ? 1  PCA A HA   2  
HETATM 770   H HB2  . PCA A 1 1  ? 4.331   -0.270 5.934   1.00 1.00 ? 1  PCA A HB2  2  
HETATM 771   H HB3  . PCA A 1 1  ? 5.580   0.871  6.506   1.00 1.00 ? 1  PCA A HB3  2  
HETATM 772   H HG2  . PCA A 1 1  ? 3.603   -0.255 8.149   1.00 1.00 ? 1  PCA A HG2  2  
HETATM 773   H HG3  . PCA A 1 1  ? 4.331   1.351  8.464   1.00 1.00 ? 1  PCA A HG3  2  
ATOM   774   N N    . LYS A 1 2  ? 2.716   0.527  3.837   1.00 1.00 ? 2  LYS A N    2  
ATOM   775   C CA   . LYS A 1 2  ? 2.387   0.135  2.475   1.00 1.00 ? 2  LYS A CA   2  
ATOM   776   C C    . LYS A 1 2  ? 1.506   1.216  1.847   1.00 1.00 ? 2  LYS A C    2  
ATOM   777   O O    . LYS A 1 2  ? 0.311   1.003  1.660   1.00 1.00 ? 2  LYS A O    2  
ATOM   778   C CB   . LYS A 1 2  ? 1.738   -1.264 2.471   1.00 1.00 ? 2  LYS A CB   2  
ATOM   779   C CG   . LYS A 1 2  ? 1.837   -1.995 1.118   1.00 1.00 ? 2  LYS A CG   2  
ATOM   780   C CD   . LYS A 1 2  ? 0.824   -1.613 0.022   1.00 1.00 ? 2  LYS A CD   2  
ATOM   781   C CE   . LYS A 1 2  ? -0.629  -1.990 0.372   1.00 1.00 ? 2  LYS A CE   2  
ATOM   782   N NZ   . LYS A 1 2  ? -1.431  -0.831 0.814   1.00 1.00 ? 2  LYS A NZ   2  
ATOM   783   H H    . LYS A 1 2  ? 2.191   0.131  4.602   1.00 1.00 ? 2  LYS A H    2  
ATOM   784   H HA   . LYS A 1 2  ? 3.315   0.072  1.905   1.00 1.00 ? 2  LYS A HA   2  
ATOM   785   H HB2  . LYS A 1 2  ? 2.304   -1.873 3.179   1.00 1.00 ? 2  LYS A HB2  2  
ATOM   786   H HB3  . LYS A 1 2  ? 0.709   -1.226 2.826   1.00 1.00 ? 2  LYS A HB3  2  
ATOM   787   H HG2  . LYS A 1 2  ? 2.844   -1.853 0.721   1.00 1.00 ? 2  LYS A HG2  2  
ATOM   788   H HG3  . LYS A 1 2  ? 1.724   -3.063 1.314   1.00 1.00 ? 2  LYS A HG3  2  
ATOM   789   H HD2  . LYS A 1 2  ? 0.914   -0.562 -0.258  1.00 1.00 ? 2  LYS A HD2  2  
ATOM   790   H HD3  . LYS A 1 2  ? 1.099   -2.195 -0.861  1.00 1.00 ? 2  LYS A HD3  2  
ATOM   791   H HE2  . LYS A 1 2  ? -1.112  -2.400 -0.517  1.00 1.00 ? 2  LYS A HE2  2  
ATOM   792   H HE3  . LYS A 1 2  ? -0.635  -2.757 1.146   1.00 1.00 ? 2  LYS A HE3  2  
ATOM   793   H HZ1  . LYS A 1 2  ? -0.927  -0.262 1.484   1.00 1.00 ? 2  LYS A HZ1  2  
ATOM   794   H HZ2  . LYS A 1 2  ? -1.646  -0.208 0.034   1.00 1.00 ? 2  LYS A HZ2  2  
ATOM   795   H HZ3  . LYS A 1 2  ? -2.311  -1.118 1.210   1.00 1.00 ? 2  LYS A HZ3  2  
ATOM   796   N N    . LEU A 1 3  ? 2.089   2.373  1.536   1.00 1.00 ? 3  LEU A N    2  
ATOM   797   C CA   . LEU A 1 3  ? 1.453   3.408  0.735   1.00 1.00 ? 3  LEU A CA   2  
ATOM   798   C C    . LEU A 1 3  ? 2.162   3.452  -0.612  1.00 1.00 ? 3  LEU A C    2  
ATOM   799   O O    . LEU A 1 3  ? 3.361   3.185  -0.679  1.00 1.00 ? 3  LEU A O    2  
ATOM   800   C CB   . LEU A 1 3  ? 1.547   4.781  1.405   1.00 1.00 ? 3  LEU A CB   2  
ATOM   801   C CG   . LEU A 1 3  ? 0.901   4.809  2.799   1.00 1.00 ? 3  LEU A CG   2  
ATOM   802   C CD1  . LEU A 1 3  ? 2.000   4.871  3.864   1.00 1.00 ? 3  LEU A CD1  2  
ATOM   803   C CD2  . LEU A 1 3  ? -0.038  6.011  2.950   1.00 1.00 ? 3  LEU A CD2  2  
ATOM   804   H H    . LEU A 1 3  ? 3.071   2.488  1.770   1.00 1.00 ? 3  LEU A H    2  
ATOM   805   H HA   . LEU A 1 3  ? 0.404   3.172  0.584   1.00 1.00 ? 3  LEU A HA   2  
ATOM   806   H HB2  . LEU A 1 3  ? 2.596   5.050  1.459   1.00 1.00 ? 3  LEU A HB2  2  
ATOM   807   H HB3  . LEU A 1 3  ? 1.060   5.514  0.764   1.00 1.00 ? 3  LEU A HB3  2  
ATOM   808   H HG   . LEU A 1 3  ? 0.310   3.904  2.945   1.00 1.00 ? 3  LEU A HG   2  
ATOM   809   H HD11 . LEU A 1 3  ? 2.649   4.004  3.773   1.00 1.00 ? 3  LEU A HD11 2  
ATOM   810   H HD12 . LEU A 1 3  ? 2.604   5.766  3.723   1.00 1.00 ? 3  LEU A HD12 2  
ATOM   811   H HD13 . LEU A 1 3  ? 1.561   4.884  4.861   1.00 1.00 ? 3  LEU A HD13 2  
ATOM   812   H HD21 . LEU A 1 3  ? -0.812  5.980  2.185   1.00 1.00 ? 3  LEU A HD21 2  
ATOM   813   H HD22 . LEU A 1 3  ? -0.513  5.985  3.931   1.00 1.00 ? 3  LEU A HD22 2  
ATOM   814   H HD23 . LEU A 1 3  ? 0.514   6.943  2.854   1.00 1.00 ? 3  LEU A HD23 2  
ATOM   815   N N    . CYS A 1 4  ? 1.445   3.812  -1.676  1.00 1.00 ? 4  CYS A N    2  
ATOM   816   C CA   . CYS A 1 4  ? 2.085   4.070  -2.960  1.00 1.00 ? 4  CYS A CA   2  
ATOM   817   C C    . CYS A 1 4  ? 2.461   5.545  -3.005  1.00 1.00 ? 4  CYS A C    2  
ATOM   818   O O    . CYS A 1 4  ? 1.608   6.410  -2.793  1.00 1.00 ? 4  CYS A O    2  
ATOM   819   C CB   . CYS A 1 4  ? 1.216   3.656  -4.153  1.00 1.00 ? 4  CYS A CB   2  
ATOM   820   S SG   . CYS A 1 4  ? 1.019   1.860  -4.300  1.00 1.00 ? 4  CYS A SG   2  
ATOM   821   H H    . CYS A 1 4  ? 0.486   4.111  -1.521  1.00 1.00 ? 4  CYS A H    2  
ATOM   822   H HA   . CYS A 1 4  ? 2.994   3.471  -3.047  1.00 1.00 ? 4  CYS A HA   2  
ATOM   823   H HB2  . CYS A 1 4  ? 0.245   4.143  -4.096  1.00 1.00 ? 4  CYS A HB2  2  
ATOM   824   H HB3  . CYS A 1 4  ? 1.704   3.992  -5.068  1.00 1.00 ? 4  CYS A HB3  2  
ATOM   825   N N    . GLU A 1 5  ? 3.746   5.808  -3.254  1.00 1.00 ? 5  GLU A N    2  
ATOM   826   C CA   . GLU A 1 5  ? 4.298   7.127  -3.495  1.00 1.00 ? 5  GLU A CA   2  
ATOM   827   C C    . GLU A 1 5  ? 3.986   7.516  -4.937  1.00 1.00 ? 5  GLU A C    2  
ATOM   828   O O    . GLU A 1 5  ? 4.683   7.073  -5.847  1.00 1.00 ? 5  GLU A O    2  
ATOM   829   C CB   . GLU A 1 5  ? 5.818   7.080  -3.272  1.00 1.00 ? 5  GLU A CB   2  
ATOM   830   C CG   . GLU A 1 5  ? 6.152   6.928  -1.786  1.00 1.00 ? 5  GLU A CG   2  
ATOM   831   C CD   . GLU A 1 5  ? 7.656   6.930  -1.532  1.00 1.00 ? 5  GLU A CD   2  
ATOM   832   O OE1  . GLU A 1 5  ? 8.151   7.793  -0.809  1.00 1.00 ? 5  GLU A OE1  2  
ATOM   833   O OE2  . GLU A 1 5  ? 8.367   5.946  -2.141  1.00 1.00 ? 5  GLU A OE2  2  
ATOM   834   H H    . GLU A 1 5  ? 4.372   5.027  -3.382  1.00 1.00 ? 5  GLU A H    2  
ATOM   835   H HA   . GLU A 1 5  ? 3.861   7.854  -2.809  1.00 1.00 ? 5  GLU A HA   2  
ATOM   836   H HB2  . GLU A 1 5  ? 6.253   6.254  -3.838  1.00 1.00 ? 5  GLU A HB2  2  
ATOM   837   H HB3  . GLU A 1 5  ? 6.262   8.007  -3.636  1.00 1.00 ? 5  GLU A HB3  2  
ATOM   838   H HG2  . GLU A 1 5  ? 5.701   7.767  -1.261  1.00 1.00 ? 5  GLU A HG2  2  
ATOM   839   H HG3  . GLU A 1 5  ? 5.733   6.000  -1.396  1.00 1.00 ? 5  GLU A HG3  2  
ATOM   840   H HE2  . GLU A 1 5  ? 9.298   6.014  -1.921  1.00 1.00 ? 5  GLU A HE2  2  
ATOM   841   N N    . ARG A 1 6  ? 2.952   8.331  -5.158  1.00 1.00 ? 6  ARG A N    2  
ATOM   842   C CA   . ARG A 1 6  ? 2.667   8.876  -6.478  1.00 1.00 ? 6  ARG A CA   2  
ATOM   843   C C    . ARG A 1 6  ? 3.474   10.173 -6.613  1.00 1.00 ? 6  ARG A C    2  
ATOM   844   O O    . ARG A 1 6  ? 3.254   11.087 -5.814  1.00 1.00 ? 6  ARG A O    2  
ATOM   845   C CB   . ARG A 1 6  ? 1.151   9.105  -6.649  1.00 1.00 ? 6  ARG A CB   2  
ATOM   846   C CG   . ARG A 1 6  ? 0.636   8.698  -8.034  1.00 1.00 ? 6  ARG A CG   2  
ATOM   847   C CD   . ARG A 1 6  ? -0.895  8.663  -8.120  1.00 1.00 ? 6  ARG A CD   2  
ATOM   848   N NE   . ARG A 1 6  ? -1.460  9.987  -8.427  1.00 1.00 ? 6  ARG A NE   2  
ATOM   849   C CZ   . ARG A 1 6  ? -2.707  10.390 -8.137  1.00 1.00 ? 6  ARG A CZ   2  
ATOM   850   N NH1  . ARG A 1 6  ? -3.572  9.557  -7.551  1.00 1.00 ? 6  ARG A NH1  2  
ATOM   851   N NH2  . ARG A 1 6  ? -3.091  11.636 -8.414  1.00 1.00 ? 6  ARG A NH2  2  
ATOM   852   H H    . ARG A 1 6  ? 2.462   8.715  -4.355  1.00 1.00 ? 6  ARG A H    2  
ATOM   853   H HA   . ARG A 1 6  ? 2.965   8.139  -7.220  1.00 1.00 ? 6  ARG A HA   2  
ATOM   854   H HB2  . ARG A 1 6  ? 0.631   8.480  -5.923  1.00 1.00 ? 6  ARG A HB2  2  
ATOM   855   H HB3  . ARG A 1 6  ? 0.899   10.154 -6.486  1.00 1.00 ? 6  ARG A HB3  2  
ATOM   856   H HG2  . ARG A 1 6  ? 1.041   9.375  -8.785  1.00 1.00 ? 6  ARG A HG2  2  
ATOM   857   H HG3  . ARG A 1 6  ? 0.981   7.684  -8.225  1.00 1.00 ? 6  ARG A HG3  2  
ATOM   858   H HD2  . ARG A 1 6  ? -1.175  7.990  -8.935  1.00 1.00 ? 6  ARG A HD2  2  
ATOM   859   H HD3  . ARG A 1 6  ? -1.281  8.257  -7.184  1.00 1.00 ? 6  ARG A HD3  2  
ATOM   860   H HE   . ARG A 1 6  ? -0.845  10.634 -8.913  1.00 1.00 ? 6  ARG A HE   2  
ATOM   861   H HH11 . ARG A 1 6  ? -3.286  8.620  -7.315  1.00 1.00 ? 6  ARG A HH11 2  
ATOM   862   H HH12 . ARG A 1 6  ? -4.516  9.848  -7.347  1.00 1.00 ? 6  ARG A HH12 2  
ATOM   863   H HH21 . ARG A 1 6  ? -2.505  12.253 -8.974  1.00 1.00 ? 6  ARG A HH21 2  
ATOM   864   H HH22 . ARG A 1 6  ? -3.856  12.064 -7.899  1.00 1.00 ? 6  ARG A HH22 2  
ATOM   865   N N    . PRO A 1 7  ? 4.415   10.274 -7.570  1.00 1.00 ? 7  PRO A N    2  
ATOM   866   C CA   . PRO A 1 7  ? 5.090   11.526 -7.854  1.00 1.00 ? 7  PRO A CA   2  
ATOM   867   C C    . PRO A 1 7  ? 4.104   12.445 -8.572  1.00 1.00 ? 7  PRO A C    2  
ATOM   868   O O    . PRO A 1 7  ? 3.814   13.550 -8.115  1.00 1.00 ? 7  PRO A O    2  
ATOM   869   C CB   . PRO A 1 7  ? 6.308   11.161 -8.705  1.00 1.00 ? 7  PRO A CB   2  
ATOM   870   C CG   . PRO A 1 7  ? 5.915   9.852  -9.396  1.00 1.00 ? 7  PRO A CG   2  
ATOM   871   C CD   . PRO A 1 7  ? 4.894   9.215  -8.450  1.00 1.00 ? 7  PRO A CD   2  
ATOM   872   H HA   . PRO A 1 7  ? 5.420   12.008 -6.935  1.00 1.00 ? 7  PRO A HA   2  
ATOM   873   H HB2  . PRO A 1 7  ? 6.573   11.945 -9.416  1.00 1.00 ? 7  PRO A HB2  2  
ATOM   874   H HB3  . PRO A 1 7  ? 7.151   10.963 -8.042  1.00 1.00 ? 7  PRO A HB3  2  
ATOM   875   H HG2  . PRO A 1 7  ? 5.458   10.063 -10.364 1.00 1.00 ? 7  PRO A HG2  2  
ATOM   876   H HG3  . PRO A 1 7  ? 6.781   9.206  -9.546  1.00 1.00 ? 7  PRO A HG3  2  
ATOM   877   H HD2  . PRO A 1 7  ? 4.085   8.772  -9.034  1.00 1.00 ? 7  PRO A HD2  2  
ATOM   878   H HD3  . PRO A 1 7  ? 5.391   8.446  -7.857  1.00 1.00 ? 7  PRO A HD3  2  
ATOM   879   N N    . SER A 1 8  ? 3.525   11.971 -9.679  1.00 1.00 ? 8  SER A N    2  
ATOM   880   C CA   . SER A 1 8  ? 2.452   12.687 -10.333 1.00 1.00 ? 8  SER A CA   2  
ATOM   881   C C    . SER A 1 8  ? 1.198   12.561 -9.468  1.00 1.00 ? 8  SER A C    2  
ATOM   882   O O    . SER A 1 8  ? 0.327   11.728 -9.721  1.00 1.00 ? 8  SER A O    2  
ATOM   883   C CB   . SER A 1 8  ? 2.248   12.095 -11.733 1.00 1.00 ? 8  SER A CB   2  
ATOM   884   O OG   . SER A 1 8  ? 3.506   11.917 -12.358 1.00 1.00 ? 8  SER A OG   2  
ATOM   885   H H    . SER A 1 8  ? 3.796   11.080 -10.063 1.00 1.00 ? 8  SER A H    2  
ATOM   886   H HA   . SER A 1 8  ? 2.730   13.736 -10.438 1.00 1.00 ? 8  SER A HA   2  
ATOM   887   H HB2  . SER A 1 8  ? 1.761   11.120 -11.667 1.00 1.00 ? 8  SER A HB2  2  
ATOM   888   H HB3  . SER A 1 8  ? 1.613   12.761 -12.321 1.00 1.00 ? 8  SER A HB3  2  
ATOM   889   H HG   . SER A 1 8  ? 3.979   12.753 -12.354 1.00 1.00 ? 8  SER A HG   2  
ATOM   890   N N    . GLY A 1 9  ? 1.099   13.411 -8.448  1.00 1.00 ? 9  GLY A N    2  
ATOM   891   C CA   . GLY A 1 9  ? -0.080  13.514 -7.619  1.00 1.00 ? 9  GLY A CA   2  
ATOM   892   C C    . GLY A 1 9  ? -1.085  14.357 -8.389  1.00 1.00 ? 9  GLY A C    2  
ATOM   893   O O    . GLY A 1 9  ? -1.792  13.858 -9.261  1.00 1.00 ? 9  GLY A O    2  
ATOM   894   H H    . GLY A 1 9  ? 1.915   13.980 -8.236  1.00 1.00 ? 9  GLY A H    2  
ATOM   895   H HA2  . GLY A 1 9  ? -0.491  12.528 -7.407  1.00 1.00 ? 9  GLY A HA2  2  
ATOM   896   H HA3  . GLY A 1 9  ? 0.191   13.990 -6.677  1.00 1.00 ? 9  GLY A HA3  2  
ATOM   897   N N    . THR A 1 10 ? -1.116  15.643 -8.068  1.00 1.00 ? 10 THR A N    2  
ATOM   898   C CA   . THR A 1 10 ? -1.818  16.685 -8.790  1.00 1.00 ? 10 THR A CA   2  
ATOM   899   C C    . THR A 1 10 ? -0.721  17.526 -9.435  1.00 1.00 ? 10 THR A C    2  
ATOM   900   O O    . THR A 1 10 ? -0.500  17.487 -10.646 1.00 1.00 ? 10 THR A O    2  
ATOM   901   C CB   . THR A 1 10 ? -2.620  17.498 -7.764  1.00 1.00 ? 10 THR A CB   2  
ATOM   902   O OG1  . THR A 1 10 ? -1.861  17.596 -6.566  1.00 1.00 ? 10 THR A OG1  2  
ATOM   903   C CG2  . THR A 1 10 ? -3.952  16.816 -7.451  1.00 1.00 ? 10 THR A CG2  2  
ATOM   904   H H    . THR A 1 10 ? -0.564  15.964 -7.287  1.00 1.00 ? 10 THR A H    2  
ATOM   905   H HA   . THR A 1 10 ? -2.478  16.291 -9.565  1.00 1.00 ? 10 THR A HA   2  
ATOM   906   H HB   . THR A 1 10 ? -2.825  18.495 -8.159  1.00 1.00 ? 10 THR A HB   2  
ATOM   907   H HG1  . THR A 1 10 ? -2.292  18.271 -6.024  1.00 1.00 ? 10 THR A HG1  2  
ATOM   908   H HG21 . THR A 1 10 ? -3.781  15.794 -7.126  1.00 1.00 ? 10 THR A HG21 2  
ATOM   909   H HG22 . THR A 1 10 ? -4.474  17.365 -6.667  1.00 1.00 ? 10 THR A HG22 2  
ATOM   910   H HG23 . THR A 1 10 ? -4.576  16.801 -8.346  1.00 1.00 ? 10 THR A HG23 2  
ATOM   911   N N    . TRP A 1 11 ? 0.017   18.215 -8.564  1.00 1.00 ? 11 TRP A N    2  
ATOM   912   C CA   . TRP A 1 11 ? 1.185   19.030 -8.842  1.00 1.00 ? 11 TRP A CA   2  
ATOM   913   C C    . TRP A 1 11 ? 2.325   18.151 -9.366  1.00 1.00 ? 11 TRP A C    2  
ATOM   914   O O    . TRP A 1 11 ? 3.326   17.909 -8.695  1.00 1.00 ? 11 TRP A O    2  
ATOM   915   C CB   . TRP A 1 11 ? 1.538   19.743 -7.536  1.00 1.00 ? 11 TRP A CB   2  
ATOM   916   C CG   . TRP A 1 11 ? 2.599   20.798 -7.525  1.00 1.00 ? 11 TRP A CG   2  
ATOM   917   C CD1  . TRP A 1 11 ? 3.564   21.030 -8.444  1.00 1.00 ? 11 TRP A CD1  2  
ATOM   918   C CD2  . TRP A 1 11 ? 2.824   21.765 -6.465  1.00 1.00 ? 11 TRP A CD2  2  
ATOM   919   N NE1  . TRP A 1 11 ? 4.374   22.062 -8.016  1.00 1.00 ? 11 TRP A NE1  2  
ATOM   920   C CE2  . TRP A 1 11 ? 3.951   22.562 -6.802  1.00 1.00 ? 11 TRP A CE2  2  
ATOM   921   C CE3  . TRP A 1 11 ? 2.188   22.030 -5.237  1.00 1.00 ? 11 TRP A CE3  2  
ATOM   922   C CZ2  . TRP A 1 11 ? 4.423   23.572 -5.953  1.00 1.00 ? 11 TRP A CZ2  2  
ATOM   923   C CZ3  . TRP A 1 11 ? 2.677   23.005 -4.358  1.00 1.00 ? 11 TRP A CZ3  2  
ATOM   924   C CH2  . TRP A 1 11 ? 3.820   23.743 -4.695  1.00 1.00 ? 11 TRP A CH2  2  
ATOM   925   H H    . TRP A 1 11 ? -0.295  18.160 -7.601  1.00 1.00 ? 11 TRP A H    2  
ATOM   926   H HA   . TRP A 1 11 ? 0.930   19.781 -9.592  1.00 1.00 ? 11 TRP A HA   2  
ATOM   927   H HB2  . TRP A 1 11 ? 0.631   20.240 -7.192  1.00 1.00 ? 11 TRP A HB2  2  
ATOM   928   H HB3  . TRP A 1 11 ? 1.813   18.996 -6.789  1.00 1.00 ? 11 TRP A HB3  2  
ATOM   929   H HD1  . TRP A 1 11 ? 3.716   20.484 -9.362  1.00 1.00 ? 11 TRP A HD1  2  
ATOM   930   H HE1  . TRP A 1 11 ? 5.224   22.375 -8.477  1.00 1.00 ? 11 TRP A HE1  2  
ATOM   931   H HE3  . TRP A 1 11 ? 1.329   21.454 -4.960  1.00 1.00 ? 11 TRP A HE3  2  
ATOM   932   H HZ2  . TRP A 1 11 ? 5.284   24.161 -6.232  1.00 1.00 ? 11 TRP A HZ2  2  
ATOM   933   H HZ3  . TRP A 1 11 ? 2.183   23.165 -3.413  1.00 1.00 ? 11 TRP A HZ3  2  
ATOM   934   H HH2  . TRP A 1 11 ? 4.259   24.390 -3.958  1.00 1.00 ? 11 TRP A HH2  2  
ATOM   935   N N    . SER A 1 12 ? 2.183   17.709 -10.611 1.00 1.00 ? 12 SER A N    2  
ATOM   936   C CA   . SER A 1 12 ? 3.080   16.757 -11.234 1.00 1.00 ? 12 SER A CA   2  
ATOM   937   C C    . SER A 1 12 ? 4.219   17.537 -11.890 1.00 1.00 ? 12 SER A C    2  
ATOM   938   O O    . SER A 1 12 ? 4.367   17.524 -13.109 1.00 1.00 ? 12 SER A O    2  
ATOM   939   C CB   . SER A 1 12 ? 2.272   15.941 -12.250 1.00 1.00 ? 12 SER A CB   2  
ATOM   940   O OG   . SER A 1 12 ? 1.141   15.364 -11.616 1.00 1.00 ? 12 SER A OG   2  
ATOM   941   H H    . SER A 1 12 ? 1.304   17.914 -11.073 1.00 1.00 ? 12 SER A H    2  
ATOM   942   H HA   . SER A 1 12 ? 3.493   16.076 -10.487 1.00 1.00 ? 12 SER A HA   2  
ATOM   943   H HB2  . SER A 1 12 ? 1.939   16.585 -13.067 1.00 1.00 ? 12 SER A HB2  2  
ATOM   944   H HB3  . SER A 1 12 ? 2.907   15.160 -12.670 1.00 1.00 ? 12 SER A HB3  2  
ATOM   945   H HG   . SER A 1 12 ? 0.524   16.065 -11.361 1.00 1.00 ? 12 SER A HG   2  
ATOM   946   N N    . GLY A 1 13 ? 4.998   18.247 -11.069 1.00 1.00 ? 13 GLY A N    2  
ATOM   947   C CA   . GLY A 1 13 ? 6.039   19.148 -11.534 1.00 1.00 ? 13 GLY A CA   2  
ATOM   948   C C    . GLY A 1 13 ? 7.002   19.500 -10.406 1.00 1.00 ? 13 GLY A C    2  
ATOM   949   O O    . GLY A 1 13 ? 6.992   18.860 -9.353  1.00 1.00 ? 13 GLY A O    2  
ATOM   950   H H    . GLY A 1 13 ? 4.836   18.185 -10.066 1.00 1.00 ? 13 GLY A H    2  
ATOM   951   H HA2  . GLY A 1 13 ? 6.608   18.682 -12.339 1.00 1.00 ? 13 GLY A HA2  2  
ATOM   952   H HA3  . GLY A 1 13 ? 5.571   20.059 -11.910 1.00 1.00 ? 13 GLY A HA3  2  
ATOM   953   N N    . VAL A 1 14 ? 7.835   20.523 -10.630 1.00 1.00 ? 14 VAL A N    2  
ATOM   954   C CA   . VAL A 1 14 ? 8.786   20.997 -9.633  1.00 1.00 ? 14 VAL A CA   2  
ATOM   955   C C    . VAL A 1 14 ? 8.002   21.424 -8.392  1.00 1.00 ? 14 VAL A C    2  
ATOM   956   O O    . VAL A 1 14 ? 7.047   22.192 -8.491  1.00 1.00 ? 14 VAL A O    2  
ATOM   957   C CB   . VAL A 1 14 ? 9.649   22.143 -10.186 1.00 1.00 ? 14 VAL A CB   2  
ATOM   958   C CG1  . VAL A 1 14 ? 10.719  22.562 -9.168  1.00 1.00 ? 14 VAL A CG1  2  
ATOM   959   C CG2  . VAL A 1 14 ? 10.350  21.740 -11.491 1.00 1.00 ? 14 VAL A CG2  2  
ATOM   960   H H    . VAL A 1 14 ? 7.764   21.029 -11.499 1.00 1.00 ? 14 VAL A H    2  
ATOM   961   H HA   . VAL A 1 14 ? 9.441   20.160 -9.392  1.00 1.00 ? 14 VAL A HA   2  
ATOM   962   H HB   . VAL A 1 14 ? 9.004   23.001 -10.375 1.00 1.00 ? 14 VAL A HB   2  
ATOM   963   H HG11 . VAL A 1 14 ? 11.357  21.713 -8.924  1.00 1.00 ? 14 VAL A HG11 2  
ATOM   964   H HG12 . VAL A 1 14 ? 11.334  23.359 -9.588  1.00 1.00 ? 14 VAL A HG12 2  
ATOM   965   H HG13 . VAL A 1 14 ? 10.254  22.936 -8.257  1.00 1.00 ? 14 VAL A HG13 2  
ATOM   966   H HG21 . VAL A 1 14 ? 10.952  20.845 -11.329 1.00 1.00 ? 14 VAL A HG21 2  
ATOM   967   H HG22 . VAL A 1 14 ? 9.624   21.544 -12.279 1.00 1.00 ? 14 VAL A HG22 2  
ATOM   968   H HG23 . VAL A 1 14 ? 11.001  22.548 -11.824 1.00 1.00 ? 14 VAL A HG23 2  
ATOM   969   N N    . CYS A 1 15 ? 8.405   20.915 -7.230  1.00 1.00 ? 15 CYS A N    2  
ATOM   970   C CA   . CYS A 1 15 ? 7.640   21.023 -5.994  1.00 1.00 ? 15 CYS A CA   2  
ATOM   971   C C    . CYS A 1 15 ? 7.684   22.405 -5.361  1.00 1.00 ? 15 CYS A C    2  
ATOM   972   O O    . CYS A 1 15 ? 6.789   22.738 -4.592  1.00 1.00 ? 15 CYS A O    2  
ATOM   973   C CB   . CYS A 1 15 ? 8.156   20.014 -4.970  1.00 1.00 ? 15 CYS A CB   2  
ATOM   974   S SG   . CYS A 1 15 ? 9.494   20.620 -3.923  1.00 1.00 ? 15 CYS A SG   2  
ATOM   975   H H    . CYS A 1 15 ? 9.239   20.339 -7.248  1.00 1.00 ? 15 CYS A H    2  
ATOM   976   H HA   . CYS A 1 15 ? 6.601   20.774 -6.217  1.00 1.00 ? 15 CYS A HA   2  
ATOM   977   H HB2  . CYS A 1 15 ? 7.338   19.729 -4.310  1.00 1.00 ? 15 CYS A HB2  2  
ATOM   978   H HB3  . CYS A 1 15 ? 8.510   19.132 -5.487  1.00 1.00 ? 15 CYS A HB3  2  
ATOM   979   N N    . GLY A 1 16 ? 8.769   23.160 -5.552  1.00 1.00 ? 16 GLY A N    2  
ATOM   980   C CA   . GLY A 1 16 ? 8.967   24.448 -4.896  1.00 1.00 ? 16 GLY A CA   2  
ATOM   981   C C    . GLY A 1 16 ? 9.247   24.352 -3.387  1.00 1.00 ? 16 GLY A C    2  
ATOM   982   O O    . GLY A 1 16 ? 10.136  25.039 -2.890  1.00 1.00 ? 16 GLY A O    2  
ATOM   983   H H    . GLY A 1 16 ? 9.497   22.809 -6.154  1.00 1.00 ? 16 GLY A H    2  
ATOM   984   H HA2  . GLY A 1 16 ? 9.808   24.949 -5.376  1.00 1.00 ? 16 GLY A HA2  2  
ATOM   985   H HA3  . GLY A 1 16 ? 8.079   25.064 -5.042  1.00 1.00 ? 16 GLY A HA3  2  
ATOM   986   N N    . ASN A 1 17 ? 8.495   23.535 -2.641  1.00 1.00 ? 17 ASN A N    2  
ATOM   987   C CA   . ASN A 1 17 ? 8.500   23.504 -1.186  1.00 1.00 ? 17 ASN A CA   2  
ATOM   988   C C    . ASN A 1 17 ? 7.699   22.306 -0.662  1.00 1.00 ? 17 ASN A C    2  
ATOM   989   O O    . ASN A 1 17 ? 6.598   22.022 -1.135  1.00 1.00 ? 17 ASN A O    2  
ATOM   990   C CB   . ASN A 1 17 ? 7.893   24.803 -0.639  1.00 1.00 ? 17 ASN A CB   2  
ATOM   991   C CG   . ASN A 1 17 ? 7.729   24.727 0.874   1.00 1.00 ? 17 ASN A CG   2  
ATOM   992   O OD1  . ASN A 1 17 ? 6.670   24.357 1.370   1.00 1.00 ? 17 ASN A OD1  2  
ATOM   993   N ND2  . ASN A 1 17 ? 8.784   25.034 1.622   1.00 1.00 ? 17 ASN A ND2  2  
ATOM   994   H H    . ASN A 1 17 ? 7.847   22.917 -3.113  1.00 1.00 ? 17 ASN A H    2  
ATOM   995   H HA   . ASN A 1 17 ? 9.533   23.426 -0.843  1.00 1.00 ? 17 ASN A HA   2  
ATOM   996   H HB2  . ASN A 1 17 ? 8.522   25.656 -0.894  1.00 1.00 ? 17 ASN A HB2  2  
ATOM   997   H HB3  . ASN A 1 17 ? 6.910   24.955 -1.085  1.00 1.00 ? 17 ASN A HB3  2  
ATOM   998   H HD21 . ASN A 1 17 ? 9.638   25.356 1.189   1.00 1.00 ? 17 ASN A HD21 2  
ATOM   999   H HD22 . ASN A 1 17 ? 8.693   25.018 2.627   1.00 1.00 ? 17 ASN A HD22 2  
ATOM   1000  N N    . ASN A 1 18 ? 8.252   21.627 0.349   1.00 1.00 ? 18 ASN A N    2  
ATOM   1001  C CA   . ASN A 1 18 ? 7.672   20.467 1.007   1.00 1.00 ? 18 ASN A CA   2  
ATOM   1002  C C    . ASN A 1 18 ? 6.247   20.695 1.486   1.00 1.00 ? 18 ASN A C    2  
ATOM   1003  O O    . ASN A 1 18 ? 5.326   19.991 1.082   1.00 1.00 ? 18 ASN A O    2  
ATOM   1004  C CB   . ASN A 1 18 ? 8.572   20.100 2.189   1.00 1.00 ? 18 ASN A CB   2  
ATOM   1005  C CG   . ASN A 1 18 ? 8.128   18.789 2.812   1.00 1.00 ? 18 ASN A CG   2  
ATOM   1006  O OD1  . ASN A 1 18 ? 7.174   18.745 3.586   1.00 1.00 ? 18 ASN A OD1  2  
ATOM   1007  N ND2  . ASN A 1 18 ? 8.789   17.695 2.461   1.00 1.00 ? 18 ASN A ND2  2  
ATOM   1008  H H    . ASN A 1 18 ? 9.164   21.901 0.677   1.00 1.00 ? 18 ASN A H    2  
ATOM   1009  H HA   . ASN A 1 18 ? 7.637   19.646 0.303   1.00 1.00 ? 18 ASN A HA   2  
ATOM   1010  H HB2  . ASN A 1 18 ? 9.598   20.023 1.845   1.00 1.00 ? 18 ASN A HB2  2  
ATOM   1011  H HB3  . ASN A 1 18 ? 8.548   20.876 2.955   1.00 1.00 ? 18 ASN A HB3  2  
ATOM   1012  H HD21 . ASN A 1 18 ? 9.586   17.709 1.831   1.00 1.00 ? 18 ASN A HD21 2  
ATOM   1013  H HD22 . ASN A 1 18 ? 8.556   16.851 2.951   1.00 1.00 ? 18 ASN A HD22 2  
ATOM   1014  N N    . ASN A 1 19 ? 6.101   21.643 2.405   1.00 1.00 ? 19 ASN A N    2  
ATOM   1015  C CA   . ASN A 1 19 ? 4.830   21.963 3.042   1.00 1.00 ? 19 ASN A CA   2  
ATOM   1016  C C    . ASN A 1 19 ? 3.765   22.323 2.007   1.00 1.00 ? 19 ASN A C    2  
ATOM   1017  O O    . ASN A 1 19 ? 2.633   21.857 2.106   1.00 1.00 ? 19 ASN A O    2  
ATOM   1018  C CB   . ASN A 1 19 ? 5.001   23.090 4.064   1.00 1.00 ? 19 ASN A CB   2  
ATOM   1019  C CG   . ASN A 1 19 ? 3.664   23.390 4.736   1.00 1.00 ? 19 ASN A CG   2  
ATOM   1020  O OD1  . ASN A 1 19 ? 3.126   22.548 5.447   1.00 1.00 ? 19 ASN A OD1  2  
ATOM   1021  N ND2  . ASN A 1 19 ? 3.108   24.577 4.509   1.00 1.00 ? 19 ASN A ND2  2  
ATOM   1022  H H    . ASN A 1 19 ? 6.943   22.120 2.684   1.00 1.00 ? 19 ASN A H    2  
ATOM   1023  H HA   . ASN A 1 19 ? 4.497   21.077 3.583   1.00 1.00 ? 19 ASN A HA   2  
ATOM   1024  H HB2  . ASN A 1 19 ? 5.713   22.780 4.829   1.00 1.00 ? 19 ASN A HB2  2  
ATOM   1025  H HB3  . ASN A 1 19 ? 5.381   23.987 3.576   1.00 1.00 ? 19 ASN A HB3  2  
ATOM   1026  H HD21 . ASN A 1 19 ? 3.563   25.260 3.922   1.00 1.00 ? 19 ASN A HD21 2  
ATOM   1027  H HD22 . ASN A 1 19 ? 2.233   24.787 4.962   1.00 1.00 ? 19 ASN A HD22 2  
ATOM   1028  N N    . ALA A 1 20 ? 4.121   23.137 1.010   1.00 1.00 ? 20 ALA A N    2  
ATOM   1029  C CA   . ALA A 1 20 ? 3.204   23.469 -0.070  1.00 1.00 ? 20 ALA A CA   2  
ATOM   1030  C C    . ALA A 1 20 ? 2.748   22.199 -0.783  1.00 1.00 ? 20 ALA A C    2  
ATOM   1031  O O    . ALA A 1 20 ? 1.549   21.934 -0.851  1.00 1.00 ? 20 ALA A O    2  
ATOM   1032  C CB   . ALA A 1 20 ? 3.854   24.429 -1.065  1.00 1.00 ? 20 ALA A CB   2  
ATOM   1033  H H    . ALA A 1 20 ? 5.065   23.509 0.994   1.00 1.00 ? 20 ALA A H    2  
ATOM   1034  H HA   . ALA A 1 20 ? 2.329   23.963 0.360   1.00 1.00 ? 20 ALA A HA   2  
ATOM   1035  H HB1  . ALA A 1 20 ? 4.196   25.325 -0.549  1.00 1.00 ? 20 ALA A HB1  2  
ATOM   1036  H HB2  . ALA A 1 20 ? 4.693   23.947 -1.565  1.00 1.00 ? 20 ALA A HB2  2  
ATOM   1037  H HB3  . ALA A 1 20 ? 3.110   24.712 -1.811  1.00 1.00 ? 20 ALA A HB3  2  
ATOM   1038  N N    . CYS A 1 21 ? 3.706   21.420 -1.304  1.00 1.00 ? 21 CYS A N    2  
ATOM   1039  C CA   . CYS A 1 21 ? 3.427   20.172 -2.011  1.00 1.00 ? 21 CYS A CA   2  
ATOM   1040  C C    . CYS A 1 21 ? 2.479   19.293 -1.187  1.00 1.00 ? 21 CYS A C    2  
ATOM   1041  O O    . CYS A 1 21 ? 1.423   18.882 -1.668  1.00 1.00 ? 21 CYS A O    2  
ATOM   1042  C CB   . CYS A 1 21 ? 4.737   19.424 -2.298  1.00 1.00 ? 21 CYS A CB   2  
ATOM   1043  S SG   . CYS A 1 21 ? 4.627   17.612 -2.356  1.00 1.00 ? 21 CYS A SG   2  
ATOM   1044  H H    . CYS A 1 21 ? 4.678   21.705 -1.202  1.00 1.00 ? 21 CYS A H    2  
ATOM   1045  H HA   . CYS A 1 21 ? 2.964   20.445 -2.962  1.00 1.00 ? 21 CYS A HA   2  
ATOM   1046  H HB2  . CYS A 1 21 ? 5.160   19.787 -3.233  1.00 1.00 ? 21 CYS A HB2  2  
ATOM   1047  H HB3  . CYS A 1 21 ? 5.448   19.636 -1.501  1.00 1.00 ? 21 CYS A HB3  2  
ATOM   1048  N N    . LYS A 1 22 ? 2.869   19.042 0.067   1.00 1.00 ? 22 LYS A N    2  
ATOM   1049  C CA   . LYS A 1 22 ? 2.134   18.275 1.062   1.00 1.00 ? 22 LYS A CA   2  
ATOM   1050  C C    . LYS A 1 22 ? 0.692   18.772 1.158   1.00 1.00 ? 22 LYS A C    2  
ATOM   1051  O O    . LYS A 1 22 ? -0.247  18.024 0.874   1.00 1.00 ? 22 LYS A O    2  
ATOM   1052  C CB   . LYS A 1 22 ? 2.888   18.419 2.398   1.00 1.00 ? 22 LYS A CB   2  
ATOM   1053  C CG   . LYS A 1 22 ? 2.179   17.844 3.638   1.00 1.00 ? 22 LYS A CG   2  
ATOM   1054  C CD   . LYS A 1 22 ? 2.927   18.155 4.953   1.00 1.00 ? 22 LYS A CD   2  
ATOM   1055  C CE   . LYS A 1 22 ? 4.057   17.183 5.337   1.00 1.00 ? 22 LYS A CE   2  
ATOM   1056  N NZ   . LYS A 1 22 ? 5.158   17.147 4.355   1.00 1.00 ? 22 LYS A NZ   2  
ATOM   1057  H H    . LYS A 1 22 ? 3.749   19.453 0.358   1.00 1.00 ? 22 LYS A H    2  
ATOM   1058  H HA   . LYS A 1 22 ? 2.118   17.229 0.754   1.00 1.00 ? 22 LYS A HA   2  
ATOM   1059  H HB2  . LYS A 1 22 ? 3.864   17.966 2.257   1.00 1.00 ? 22 LYS A HB2  2  
ATOM   1060  H HB3  . LYS A 1 22 ? 3.049   19.475 2.590   1.00 1.00 ? 22 LYS A HB3  2  
ATOM   1061  H HG2  . LYS A 1 22 ? 1.207   18.333 3.724   1.00 1.00 ? 22 LYS A HG2  2  
ATOM   1062  H HG3  . LYS A 1 22 ? 1.992   16.777 3.527   1.00 1.00 ? 22 LYS A HG3  2  
ATOM   1063  H HD2  . LYS A 1 22 ? 3.296   19.183 4.934   1.00 1.00 ? 22 LYS A HD2  2  
ATOM   1064  H HD3  . LYS A 1 22 ? 2.188   18.101 5.758   1.00 1.00 ? 22 LYS A HD3  2  
ATOM   1065  H HE2  . LYS A 1 22 ? 4.462   17.480 6.306   1.00 1.00 ? 22 LYS A HE2  2  
ATOM   1066  H HE3  . LYS A 1 22 ? 3.642   16.177 5.433   1.00 1.00 ? 22 LYS A HE3  2  
ATOM   1067  H HZ1  . LYS A 1 22 ? 5.616   18.043 4.225   1.00 1.00 ? 22 LYS A HZ1  2  
ATOM   1068  H HZ2  . LYS A 1 22 ? 5.869   16.462 4.587   1.00 1.00 ? 22 LYS A HZ2  2  
ATOM   1069  H HZ3  . LYS A 1 22 ? 4.786   16.827 3.471   1.00 1.00 ? 22 LYS A HZ3  2  
ATOM   1070  N N    . ASN A 1 23 ? 0.536   20.026 1.596   1.00 1.00 ? 23 ASN A N    2  
ATOM   1071  C CA   . ASN A 1 23 ? -0.757  20.652 1.815   1.00 1.00 ? 23 ASN A CA   2  
ATOM   1072  C C    . ASN A 1 23 ? -1.588  20.488 0.555   1.00 1.00 ? 23 ASN A C    2  
ATOM   1073  O O    . ASN A 1 23 ? -2.585  19.777 0.569   1.00 1.00 ? 23 ASN A O    2  
ATOM   1074  C CB   . ASN A 1 23 ? -0.567  22.131 2.191   1.00 1.00 ? 23 ASN A CB   2  
ATOM   1075  C CG   . ASN A 1 23 ? -1.872  22.905 2.410   1.00 1.00 ? 23 ASN A CG   2  
ATOM   1076  O OD1  . ASN A 1 23 ? -2.910  22.642 1.807   1.00 1.00 ? 23 ASN A OD1  2  
ATOM   1077  N ND2  . ASN A 1 23 ? -1.829  23.906 3.284   1.00 1.00 ? 23 ASN A ND2  2  
ATOM   1078  H H    . ASN A 1 23 ? 1.365   20.590 1.753   1.00 1.00 ? 23 ASN A H    2  
ATOM   1079  H HA   . ASN A 1 23 ? -1.253  20.132 2.636   1.00 1.00 ? 23 ASN A HA   2  
ATOM   1080  H HB2  . ASN A 1 23 ? 0.019   22.166 3.110   1.00 1.00 ? 23 ASN A HB2  2  
ATOM   1081  H HB3  . ASN A 1 23 ? 0.000   22.642 1.412   1.00 1.00 ? 23 ASN A HB3  2  
ATOM   1082  H HD21 . ASN A 1 23 ? -0.969  24.129 3.760   1.00 1.00 ? 23 ASN A HD21 2  
ATOM   1083  H HD22 . ASN A 1 23 ? -2.668  24.441 3.453   1.00 1.00 ? 23 ASN A HD22 2  
ATOM   1084  N N    . GLN A 1 24 ? -1.137  21.096 -0.542  1.00 1.00 ? 24 GLN A N    2  
ATOM   1085  C CA   . GLN A 1 24 ? -1.814  21.055 -1.824  1.00 1.00 ? 24 GLN A CA   2  
ATOM   1086  C C    . GLN A 1 24 ? -2.252  19.634 -2.163  1.00 1.00 ? 24 GLN A C    2  
ATOM   1087  O O    . GLN A 1 24 ? -3.418  19.439 -2.500  1.00 1.00 ? 24 GLN A O    2  
ATOM   1088  C CB   . GLN A 1 24 ? -0.895  21.718 -2.862  1.00 1.00 ? 24 GLN A CB   2  
ATOM   1089  C CG   . GLN A 1 24 ? -1.446  21.748 -4.292  1.00 1.00 ? 24 GLN A CG   2  
ATOM   1090  C CD   . GLN A 1 24 ? -1.446  20.385 -4.976  1.00 1.00 ? 24 GLN A CD   2  
ATOM   1091  O OE1  . GLN A 1 24 ? -2.393  20.039 -5.670  1.00 1.00 ? 24 GLN A OE1  2  
ATOM   1092  N NE2  . GLN A 1 24 ? -0.407  19.573 -4.778  1.00 1.00 ? 24 GLN A NE2  2  
ATOM   1093  H H    . GLN A 1 24 ? -0.232  21.556 -0.501  1.00 1.00 ? 24 GLN A H    2  
ATOM   1094  H HA   . GLN A 1 24 ? -2.745  21.623 -1.755  1.00 1.00 ? 24 GLN A HA   2  
ATOM   1095  H HB2  . GLN A 1 24 ? -0.752  22.755 -2.553  1.00 1.00 ? 24 GLN A HB2  2  
ATOM   1096  H HB3  . GLN A 1 24 ? 0.083   21.238 -2.843  1.00 1.00 ? 24 GLN A HB3  2  
ATOM   1097  H HG2  . GLN A 1 24 ? -2.464  22.140 -4.277  1.00 1.00 ? 24 GLN A HG2  2  
ATOM   1098  H HG3  . GLN A 1 24 ? -0.837  22.424 -4.892  1.00 1.00 ? 24 GLN A HG3  2  
ATOM   1099  H HE21 . GLN A 1 24 ? 0.358   19.849 -4.172  1.00 1.00 ? 24 GLN A HE21 2  
ATOM   1100  H HE22 . GLN A 1 24 ? -0.414  18.663 -5.215  1.00 1.00 ? 24 GLN A HE22 2  
ATOM   1101  N N    . CYS A 1 25 ? -1.368  18.639 -2.045  1.00 1.00 ? 25 CYS A N    2  
ATOM   1102  C CA   . CYS A 1 25 ? -1.758  17.273 -2.354  1.00 1.00 ? 25 CYS A CA   2  
ATOM   1103  C C    . CYS A 1 25 ? -2.965  16.843 -1.530  1.00 1.00 ? 25 CYS A C    2  
ATOM   1104  O O    . CYS A 1 25 ? -4.002  16.507 -2.098  1.00 1.00 ? 25 CYS A O    2  
ATOM   1105  C CB   . CYS A 1 25 ? -0.636  16.270 -2.113  1.00 1.00 ? 25 CYS A CB   2  
ATOM   1106  S SG   . CYS A 1 25 ? -1.264  14.607 -2.411  1.00 1.00 ? 25 CYS A SG   2  
ATOM   1107  H H    . CYS A 1 25 ? -0.418  18.830 -1.740  1.00 1.00 ? 25 CYS A H    2  
ATOM   1108  H HA   . CYS A 1 25 ? -2.028  17.226 -3.410  1.00 1.00 ? 25 CYS A HA   2  
ATOM   1109  H HB2  . CYS A 1 25 ? 0.200   16.452 -2.773  1.00 1.00 ? 25 CYS A HB2  2  
ATOM   1110  H HB3  . CYS A 1 25 ? -0.287  16.323 -1.083  1.00 1.00 ? 25 CYS A HB3  2  
ATOM   1111  N N    . ILE A 1 26 ? -2.820  16.820 -0.200  1.00 1.00 ? 26 ILE A N    2  
ATOM   1112  C CA   . ILE A 1 26 ? -3.835  16.219 0.665   1.00 1.00 ? 26 ILE A CA   2  
ATOM   1113  C C    . ILE A 1 26 ? -5.073  17.121 0.782   1.00 1.00 ? 26 ILE A C    2  
ATOM   1114  O O    . ILE A 1 26 ? -6.153  16.686 1.199   1.00 1.00 ? 26 ILE A O    2  
ATOM   1115  C CB   . ILE A 1 26 ? -3.218  15.868 2.033   1.00 1.00 ? 26 ILE A CB   2  
ATOM   1116  C CG1  . ILE A 1 26 ? -2.970  17.114 2.904   1.00 1.00 ? 26 ILE A CG1  2  
ATOM   1117  C CG2  . ILE A 1 26 ? -1.922  15.072 1.816   1.00 1.00 ? 26 ILE A CG2  2  
ATOM   1118  C CD1  . ILE A 1 26 ? -2.301  16.785 4.241   1.00 1.00 ? 26 ILE A CD1  2  
ATOM   1119  H H    . ILE A 1 26 ? -1.977  17.213 0.214   1.00 1.00 ? 26 ILE A H    2  
ATOM   1120  H HA   . ILE A 1 26 ? -4.159  15.279 0.212   1.00 1.00 ? 26 ILE A HA   2  
ATOM   1121  H HB   . ILE A 1 26 ? -3.924  15.227 2.562   1.00 1.00 ? 26 ILE A HB   2  
ATOM   1122  H HG12 . ILE A 1 26 ? -2.345  17.825 2.369   1.00 1.00 ? 26 ILE A HG12 2  
ATOM   1123  H HG13 . ILE A 1 26 ? -3.926  17.589 3.128   1.00 1.00 ? 26 ILE A HG13 2  
ATOM   1124  H HG21 . ILE A 1 26 ? -2.098  14.265 1.107   1.00 1.00 ? 26 ILE A HG21 2  
ATOM   1125  H HG22 . ILE A 1 26 ? -1.128  15.711 1.436   1.00 1.00 ? 26 ILE A HG22 2  
ATOM   1126  H HG23 . ILE A 1 26 ? -1.589  14.643 2.755   1.00 1.00 ? 26 ILE A HG23 2  
ATOM   1127  H HD11 . ILE A 1 26 ? -2.855  15.997 4.752   1.00 1.00 ? 26 ILE A HD11 2  
ATOM   1128  H HD12 . ILE A 1 26 ? -1.270  16.466 4.085   1.00 1.00 ? 26 ILE A HD12 2  
ATOM   1129  H HD13 . ILE A 1 26 ? -2.295  17.679 4.866   1.00 1.00 ? 26 ILE A HD13 2  
ATOM   1130  N N    . ASN A 1 27 ? -4.916  18.385 0.388   1.00 1.00 ? 27 ASN A N    2  
ATOM   1131  C CA   . ASN A 1 27 ? -5.962  19.387 0.380   1.00 1.00 ? 27 ASN A CA   2  
ATOM   1132  C C    . ASN A 1 27 ? -6.822  19.164 -0.859  1.00 1.00 ? 27 ASN A C    2  
ATOM   1133  O O    . ASN A 1 27 ? -8.018  18.902 -0.731  1.00 1.00 ? 27 ASN A O    2  
ATOM   1134  C CB   . ASN A 1 27 ? -5.284  20.759 0.428   1.00 1.00 ? 27 ASN A CB   2  
ATOM   1135  C CG   . ASN A 1 27 ? -6.222  21.946 0.561   1.00 1.00 ? 27 ASN A CG   2  
ATOM   1136  O OD1  . ASN A 1 27 ? -7.403  21.874 0.241   1.00 1.00 ? 27 ASN A OD1  2  
ATOM   1137  N ND2  . ASN A 1 27 ? -5.676  23.058 1.043   1.00 1.00 ? 27 ASN A ND2  2  
ATOM   1138  H H    . ASN A 1 27 ? -3.990  18.693 0.093   1.00 1.00 ? 27 ASN A H    2  
ATOM   1139  H HA   . ASN A 1 27 ? -6.580  19.280 1.273   1.00 1.00 ? 27 ASN A HA   2  
ATOM   1140  H HB2  . ASN A 1 27 ? -4.652  20.751 1.316   1.00 1.00 ? 27 ASN A HB2  2  
ATOM   1141  H HB3  . ASN A 1 27 ? -4.669  20.908 -0.458  1.00 1.00 ? 27 ASN A HB3  2  
ATOM   1142  H HD21 . ASN A 1 27 ? -4.692  23.052 1.308   1.00 1.00 ? 27 ASN A HD21 2  
ATOM   1143  H HD22 . ASN A 1 27 ? -6.247  23.882 1.152   1.00 1.00 ? 27 ASN A HD22 2  
ATOM   1144  N N    . LEU A 1 28 ? -6.209  19.166 -2.046  1.00 1.00 ? 28 LEU A N    2  
ATOM   1145  C CA   . LEU A 1 28 ? -6.916  18.912 -3.292  1.00 1.00 ? 28 LEU A CA   2  
ATOM   1146  C C    . LEU A 1 28 ? -7.323  17.437 -3.384  1.00 1.00 ? 28 LEU A C    2  
ATOM   1147  O O    . LEU A 1 28 ? -8.506  17.125 -3.245  1.00 1.00 ? 28 LEU A O    2  
ATOM   1148  C CB   . LEU A 1 28 ? -6.088  19.387 -4.499  1.00 1.00 ? 28 LEU A CB   2  
ATOM   1149  C CG   . LEU A 1 28 ? -6.336  20.869 -4.833  1.00 1.00 ? 28 LEU A CG   2  
ATOM   1150  C CD1  . LEU A 1 28 ? -5.810  21.807 -3.741  1.00 1.00 ? 28 LEU A CD1  2  
ATOM   1151  C CD2  . LEU A 1 28 ? -5.679  21.215 -6.173  1.00 1.00 ? 28 LEU A CD2  2  
ATOM   1152  H H    . LEU A 1 28 ? -5.205  19.313 -2.090  1.00 1.00 ? 28 LEU A H    2  
ATOM   1153  H HA   . LEU A 1 28 ? -7.845  19.485 -3.284  1.00 1.00 ? 28 LEU A HA   2  
ATOM   1154  H HB2  . LEU A 1 28 ? -5.024  19.212 -4.337  1.00 1.00 ? 28 LEU A HB2  2  
ATOM   1155  H HB3  . LEU A 1 28 ? -6.393  18.806 -5.367  1.00 1.00 ? 28 LEU A HB3  2  
ATOM   1156  H HG   . LEU A 1 28 ? -7.409  21.034 -4.946  1.00 1.00 ? 28 LEU A HG   2  
ATOM   1157  H HD11 . LEU A 1 28 ? -4.759  21.600 -3.544  1.00 1.00 ? 28 LEU A HD11 2  
ATOM   1158  H HD12 . LEU A 1 28 ? -5.913  22.843 -4.066  1.00 1.00 ? 28 LEU A HD12 2  
ATOM   1159  H HD13 . LEU A 1 28 ? -6.381  21.679 -2.822  1.00 1.00 ? 28 LEU A HD13 2  
ATOM   1160  H HD21 . LEU A 1 28 ? -6.048  20.551 -6.955  1.00 1.00 ? 28 LEU A HD21 2  
ATOM   1161  H HD22 . LEU A 1 28 ? -5.916  22.243 -6.448  1.00 1.00 ? 28 LEU A HD22 2  
ATOM   1162  H HD23 . LEU A 1 28 ? -4.599  21.110 -6.100  1.00 1.00 ? 28 LEU A HD23 2  
ATOM   1163  N N    . GLU A 1 29 ? -6.373  16.508 -3.549  1.00 1.00 ? 29 GLU A N    2  
ATOM   1164  C CA   . GLU A 1 29 ? -6.717  15.087 -3.597  1.00 1.00 ? 29 GLU A CA   2  
ATOM   1165  C C    . GLU A 1 29 ? -6.703  14.560 -2.163  1.00 1.00 ? 29 GLU A C    2  
ATOM   1166  O O    . GLU A 1 29 ? -6.517  15.338 -1.233  1.00 1.00 ? 29 GLU A O    2  
ATOM   1167  C CB   . GLU A 1 29 ? -5.847  14.311 -4.604  1.00 1.00 ? 29 GLU A CB   2  
ATOM   1168  C CG   . GLU A 1 29 ? -4.329  14.351 -4.375  1.00 1.00 ? 29 GLU A CG   2  
ATOM   1169  C CD   . GLU A 1 29 ? -3.566  13.632 -5.485  1.00 1.00 ? 29 GLU A CD   2  
ATOM   1170  O OE1  . GLU A 1 29 ? -4.153  12.852 -6.237  1.00 1.00 ? 29 GLU A OE1  2  
ATOM   1171  O OE2  . GLU A 1 29 ? -2.240  13.918 -5.576  1.00 1.00 ? 29 GLU A OE2  2  
ATOM   1172  H H    . GLU A 1 29 ? -5.406  16.760 -3.366  1.00 1.00 ? 29 GLU A H    2  
ATOM   1173  H HA   . GLU A 1 29 ? -7.739  14.969 -3.961  1.00 1.00 ? 29 GLU A HA   2  
ATOM   1174  H HB2  . GLU A 1 29 ? -6.171  13.269 -4.616  1.00 1.00 ? 29 GLU A HB2  2  
ATOM   1175  H HB3  . GLU A 1 29 ? -6.045  14.729 -5.593  1.00 1.00 ? 29 GLU A HB3  2  
ATOM   1176  H HG2  . GLU A 1 29 ? -4.000  15.389 -4.359  1.00 1.00 ? 29 GLU A HG2  2  
ATOM   1177  H HG3  . GLU A 1 29 ? -4.077  13.868 -3.432  1.00 1.00 ? 29 GLU A HG3  2  
ATOM   1178  H HE2  . GLU A 1 29 ? -1.960  14.592 -4.953  1.00 1.00 ? 29 GLU A HE2  2  
ATOM   1179  N N    . LYS A 1 30 ? -7.023  13.284 -1.939  1.00 1.00 ? 30 LYS A N    2  
ATOM   1180  C CA   . LYS A 1 30 ? -7.272  12.754 -0.595  1.00 1.00 ? 30 LYS A CA   2  
ATOM   1181  C C    . LYS A 1 30 ? -6.169  11.833 -0.072  1.00 1.00 ? 30 LYS A C    2  
ATOM   1182  O O    . LYS A 1 30 ? -6.356  11.146 0.935   1.00 1.00 ? 30 LYS A O    2  
ATOM   1183  C CB   . LYS A 1 30 ? -8.703  12.206 -0.504  1.00 1.00 ? 30 LYS A CB   2  
ATOM   1184  C CG   . LYS A 1 30 ? -9.715  13.366 -0.614  1.00 1.00 ? 30 LYS A CG   2  
ATOM   1185  C CD   . LYS A 1 30 ? -9.787  14.233 0.663   1.00 1.00 ? 30 LYS A CD   2  
ATOM   1186  C CE   . LYS A 1 30 ? -9.906  15.745 0.384   1.00 1.00 ? 30 LYS A CE   2  
ATOM   1187  N NZ   . LYS A 1 30 ? -8.628  16.382 -0.011  1.00 1.00 ? 30 LYS A NZ   2  
ATOM   1188  H H    . LYS A 1 30 ? -7.203  12.679 -2.727  1.00 1.00 ? 30 LYS A H    2  
ATOM   1189  H HA   . LYS A 1 30 ? -7.220  13.571 0.119   1.00 1.00 ? 30 LYS A HA   2  
ATOM   1190  H HB2  . LYS A 1 30 ? -8.866  11.492 -1.314  1.00 1.00 ? 30 LYS A HB2  2  
ATOM   1191  H HB3  . LYS A 1 30 ? -8.857  11.694 0.447   1.00 1.00 ? 30 LYS A HB3  2  
ATOM   1192  H HG2  . LYS A 1 30 ? -9.485  13.976 -1.487  1.00 1.00 ? 30 LYS A HG2  2  
ATOM   1193  H HG3  . LYS A 1 30 ? -10.702 12.933 -0.784  1.00 1.00 ? 30 LYS A HG3  2  
ATOM   1194  H HD2  . LYS A 1 30 ? -10.684 13.925 1.206   1.00 1.00 ? 30 LYS A HD2  2  
ATOM   1195  H HD3  . LYS A 1 30 ? -8.946  14.050 1.332   1.00 1.00 ? 30 LYS A HD3  2  
ATOM   1196  H HE2  . LYS A 1 30 ? -10.649 15.912 -0.398  1.00 1.00 ? 30 LYS A HE2  2  
ATOM   1197  H HE3  . LYS A 1 30 ? -10.254 16.240 1.292   1.00 1.00 ? 30 LYS A HE3  2  
ATOM   1198  H HZ1  . LYS A 1 30 ? -8.212  15.952 -0.828  1.00 1.00 ? 30 LYS A HZ1  2  
ATOM   1199  H HZ2  . LYS A 1 30 ? -8.770  17.359 -0.244  1.00 1.00 ? 30 LYS A HZ2  2  
ATOM   1200  H HZ3  . LYS A 1 30 ? -7.908  16.349 0.707   1.00 1.00 ? 30 LYS A HZ3  2  
ATOM   1201  N N    . ALA A 1 31 ? -5.016  11.826 -0.748  1.00 1.00 ? 31 ALA A N    2  
ATOM   1202  C CA   . ALA A 1 31 ? -3.794  11.201 -0.249  1.00 1.00 ? 31 ALA A CA   2  
ATOM   1203  C C    . ALA A 1 31 ? -3.581  11.568 1.228   1.00 1.00 ? 31 ALA A C    2  
ATOM   1204  O O    . ALA A 1 31 ? -4.126  12.567 1.705   1.00 1.00 ? 31 ALA A O    2  
ATOM   1205  C CB   . ALA A 1 31 ? -2.626  11.730 -1.067  1.00 1.00 ? 31 ALA A CB   2  
ATOM   1206  H H    . ALA A 1 31 ? -4.932  12.444 -1.540  1.00 1.00 ? 31 ALA A H    2  
ATOM   1207  H HA   . ALA A 1 31 ? -3.867  10.119 -0.365  1.00 1.00 ? 31 ALA A HA   2  
ATOM   1208  H HB1  . ALA A 1 31 ? -2.781  11.575 -2.134  1.00 1.00 ? 31 ALA A HB1  2  
ATOM   1209  H HB2  . ALA A 1 31 ? -2.561  12.798 -0.868  1.00 1.00 ? 31 ALA A HB2  2  
ATOM   1210  H HB3  . ALA A 1 31 ? -1.699  11.247 -0.763  1.00 1.00 ? 31 ALA A HB3  2  
ATOM   1211  N N    . ARG A 1 32 ? -2.839  10.750 1.976   1.00 1.00 ? 32 ARG A N    2  
ATOM   1212  C CA   . ARG A 1 32 ? -2.779  10.902 3.425   1.00 1.00 ? 32 ARG A CA   2  
ATOM   1213  C C    . ARG A 1 32 ? -1.657  11.842 3.842   1.00 1.00 ? 32 ARG A C    2  
ATOM   1214  O O    . ARG A 1 32 ? -1.938  12.877 4.441   1.00 1.00 ? 32 ARG A O    2  
ATOM   1215  C CB   . ARG A 1 32 ? -2.752  9.526  4.100   1.00 1.00 ? 32 ARG A CB   2  
ATOM   1216  C CG   . ARG A 1 32 ? -3.994  8.675  3.760   1.00 1.00 ? 32 ARG A CG   2  
ATOM   1217  C CD   . ARG A 1 32 ? -5.331  9.212  4.313   1.00 1.00 ? 32 ARG A CD   2  
ATOM   1218  N NE   . ARG A 1 32 ? -5.831  10.390 3.573   1.00 1.00 ? 32 ARG A NE   2  
ATOM   1219  C CZ   . ARG A 1 32 ? -6.310  11.517 4.122   1.00 1.00 ? 32 ARG A CZ   2  
ATOM   1220  N NH1  . ARG A 1 32 ? -6.791  11.509 5.370   1.00 1.00 ? 32 ARG A NH1  2  
ATOM   1221  N NH2  . ARG A 1 32 ? -6.274  12.653 3.420   1.00 1.00 ? 32 ARG A NH2  2  
ATOM   1222  H H    . ARG A 1 32 ? -2.292  10.020 1.526   1.00 1.00 ? 32 ARG A H    2  
ATOM   1223  H HA   . ARG A 1 32 ? -3.660  11.417 3.786   1.00 1.00 ? 32 ARG A HA   2  
ATOM   1224  H HB2  . ARG A 1 32 ? -1.861  8.987  3.774   1.00 1.00 ? 32 ARG A HB2  2  
ATOM   1225  H HB3  . ARG A 1 32 ? -2.695  9.660  5.182   1.00 1.00 ? 32 ARG A HB3  2  
ATOM   1226  H HG2  . ARG A 1 32 ? -4.068  8.538  2.681   1.00 1.00 ? 32 ARG A HG2  2  
ATOM   1227  H HG3  . ARG A 1 32 ? -3.827  7.692  4.204   1.00 1.00 ? 32 ARG A HG3  2  
ATOM   1228  H HD2  . ARG A 1 32 ? -6.078  8.420  4.223   1.00 1.00 ? 32 ARG A HD2  2  
ATOM   1229  H HD3  . ARG A 1 32 ? -5.185  9.427  5.371   1.00 1.00 ? 32 ARG A HD3  2  
ATOM   1230  H HE   . ARG A 1 32 ? -5.723  10.393 2.559   1.00 1.00 ? 32 ARG A HE   2  
ATOM   1231  H HH11 . ARG A 1 32 ? -6.853  10.634 5.868   1.00 1.00 ? 32 ARG A HH11 2  
ATOM   1232  H HH12 . ARG A 1 32 ? -7.125  12.350 5.817   1.00 1.00 ? 32 ARG A HH12 2  
ATOM   1233  H HH21 . ARG A 1 32 ? -5.750  12.645 2.542   1.00 1.00 ? 32 ARG A HH21 2  
ATOM   1234  H HH22 . ARG A 1 32 ? -6.580  13.535 3.796   1.00 1.00 ? 32 ARG A HH22 2  
ATOM   1235  N N    . HIS A 1 33 ? -0.401  11.475 3.592   1.00 1.00 ? 33 HIS A N    2  
ATOM   1236  C CA   . HIS A 1 33 ? 0.719   12.398 3.725   1.00 1.00 ? 33 HIS A CA   2  
ATOM   1237  C C    . HIS A 1 33 ? 1.214   12.773 2.331   1.00 1.00 ? 33 HIS A C    2  
ATOM   1238  O O    . HIS A 1 33 ? 0.940   12.074 1.355   1.00 1.00 ? 33 HIS A O    2  
ATOM   1239  C CB   . HIS A 1 33 ? 1.810   11.870 4.670   1.00 1.00 ? 33 HIS A CB   2  
ATOM   1240  C CG   . HIS A 1 33 ? 2.087   10.392 4.620   1.00 1.00 ? 33 HIS A CG   2  
ATOM   1241  N ND1  . HIS A 1 33 ? 1.192   9.459  5.121   1.00 1.00 ? 33 HIS A ND1  2  
ATOM   1242  C CD2  . HIS A 1 33 ? 3.199   9.670  4.260   1.00 1.00 ? 33 HIS A CD2  2  
ATOM   1243  C CE1  . HIS A 1 33 ? 1.769   8.253  5.015   1.00 1.00 ? 33 HIS A CE1  2  
ATOM   1244  N NE2  . HIS A 1 33 ? 2.992   8.313  4.487   1.00 1.00 ? 33 HIS A NE2  2  
ATOM   1245  H H    . HIS A 1 33 ? -0.251  10.659 3.012   1.00 1.00 ? 33 HIS A H    2  
ATOM   1246  H HA   . HIS A 1 33 ? 0.379   13.336 4.168   1.00 1.00 ? 33 HIS A HA   2  
ATOM   1247  H HB2  . HIS A 1 33 ? 2.740   12.412 4.493   1.00 1.00 ? 33 HIS A HB2  2  
ATOM   1248  H HB3  . HIS A 1 33 ? 1.494   12.091 5.691   1.00 1.00 ? 33 HIS A HB3  2  
ATOM   1249  H HD1  . HIS A 1 33 ? 0.283   9.656  5.511   1.00 1.00 ? 33 HIS A HD1  2  
ATOM   1250  H HD2  . HIS A 1 33 ? 4.116   10.097 3.883   1.00 1.00 ? 33 HIS A HD2  2  
ATOM   1251  H HE1  . HIS A 1 33 ? 1.290   7.340  5.332   1.00 1.00 ? 33 HIS A HE1  2  
ATOM   1252  N N    . GLY A 1 34 ? 1.959   13.872 2.247   1.00 1.00 ? 34 GLY A N    2  
ATOM   1253  C CA   . GLY A 1 34 ? 2.655   14.313 1.056   1.00 1.00 ? 34 GLY A CA   2  
ATOM   1254  C C    . GLY A 1 34 ? 3.906   15.037 1.513   1.00 1.00 ? 34 GLY A C    2  
ATOM   1255  O O    . GLY A 1 34 ? 3.979   15.423 2.681   1.00 1.00 ? 34 GLY A O    2  
ATOM   1256  H H    . GLY A 1 34 ? 2.188   14.378 3.091   1.00 1.00 ? 34 GLY A H    2  
ATOM   1257  H HA2  . GLY A 1 34 ? 2.976   13.459 0.480   1.00 1.00 ? 34 GLY A HA2  2  
ATOM   1258  H HA3  . GLY A 1 34 ? 2.020   14.957 0.450   1.00 1.00 ? 34 GLY A HA3  2  
ATOM   1259  N N    . SER A 1 35 ? 4.911   15.174 0.651   1.00 1.00 ? 35 SER A N    2  
ATOM   1260  C CA   . SER A 1 35 ? 6.181   15.805 0.974   1.00 1.00 ? 35 SER A CA   2  
ATOM   1261  C C    . SER A 1 35 ? 6.957   15.995 -0.318  1.00 1.00 ? 35 SER A C    2  
ATOM   1262  O O    . SER A 1 35 ? 6.870   15.177 -1.229  1.00 1.00 ? 35 SER A O    2  
ATOM   1263  C CB   . SER A 1 35 ? 6.993   14.927 1.941   1.00 1.00 ? 35 SER A CB   2  
ATOM   1264  O OG   . SER A 1 35 ? 6.519   15.093 3.266   1.00 1.00 ? 35 SER A OG   2  
ATOM   1265  H H    . SER A 1 35 ? 4.817   14.794 -0.293  1.00 1.00 ? 35 SER A H    2  
ATOM   1266  H HA   . SER A 1 35 ? 6.010   16.793 1.416   1.00 1.00 ? 35 SER A HA   2  
ATOM   1267  H HB2  . SER A 1 35 ? 6.917   13.879 1.639   1.00 1.00 ? 35 SER A HB2  2  
ATOM   1268  H HB3  . SER A 1 35 ? 8.048   15.195 1.892   1.00 1.00 ? 35 SER A HB3  2  
ATOM   1269  H HG   . SER A 1 35 ? 5.634   14.702 3.290   1.00 1.00 ? 35 SER A HG   2  
ATOM   1270  N N    . CYS A 1 36 ? 7.733   17.069 -0.389  1.00 1.00 ? 36 CYS A N    2  
ATOM   1271  C CA   . CYS A 1 36 ? 8.674   17.242 -1.474  1.00 1.00 ? 36 CYS A CA   2  
ATOM   1272  C C    . CYS A 1 36 ? 9.928   16.443 -1.170  1.00 1.00 ? 36 CYS A C    2  
ATOM   1273  O O    . CYS A 1 36 ? 10.414  16.487 -0.039  1.00 1.00 ? 36 CYS A O    2  
ATOM   1274  C CB   . CYS A 1 36 ? 9.031   18.704 -1.663  1.00 1.00 ? 36 CYS A CB   2  
ATOM   1275  S SG   . CYS A 1 36 ? 10.185  18.896 -3.019  1.00 1.00 ? 36 CYS A SG   2  
ATOM   1276  H H    . CYS A 1 36 ? 7.819   17.655 0.425   1.00 1.00 ? 36 CYS A H    2  
ATOM   1277  H HA   . CYS A 1 36 ? 8.229   16.891 -2.403  1.00 1.00 ? 36 CYS A HA   2  
ATOM   1278  H HB2  . CYS A 1 36 ? 8.130   19.271 -1.895  1.00 1.00 ? 36 CYS A HB2  2  
ATOM   1279  H HB3  . CYS A 1 36 ? 9.511   19.104 -0.771  1.00 1.00 ? 36 CYS A HB3  2  
ATOM   1280  N N    . ASN A 1 37 ? 10.438  15.739 -2.178  1.00 1.00 ? 37 ASN A N    2  
ATOM   1281  C CA   . ASN A 1 37 ? 11.682  14.992 -2.143  1.00 1.00 ? 37 ASN A CA   2  
ATOM   1282  C C    . ASN A 1 37 ? 12.636  15.630 -3.148  1.00 1.00 ? 37 ASN A C    2  
ATOM   1283  O O    . ASN A 1 37 ? 12.181  16.225 -4.124  1.00 1.00 ? 37 ASN A O    2  
ATOM   1284  C CB   . ASN A 1 37 ? 11.377  13.544 -2.535  1.00 1.00 ? 37 ASN A CB   2  
ATOM   1285  C CG   . ASN A 1 37 ? 12.596  12.639 -2.441  1.00 1.00 ? 37 ASN A CG   2  
ATOM   1286  O OD1  . ASN A 1 37 ? 12.845  12.032 -1.406  1.00 1.00 ? 37 ASN A OD1  2  
ATOM   1287  N ND2  . ASN A 1 37 ? 13.376  12.524 -3.511  1.00 1.00 ? 37 ASN A ND2  2  
ATOM   1288  H H    . ASN A 1 37 ? 9.987   15.816 -3.088  1.00 1.00 ? 37 ASN A H    2  
ATOM   1289  H HA   . ASN A 1 37 ? 12.121  15.013 -1.144  1.00 1.00 ? 37 ASN A HA   2  
ATOM   1290  H HB2  . ASN A 1 37 ? 10.615  13.154 -1.859  1.00 1.00 ? 37 ASN A HB2  2  
ATOM   1291  H HB3  . ASN A 1 37 ? 10.990  13.518 -3.554  1.00 1.00 ? 37 ASN A HB3  2  
ATOM   1292  H HD21 . ASN A 1 37 ? 13.231  13.073 -4.354  1.00 1.00 ? 37 ASN A HD21 2  
ATOM   1293  H HD22 . ASN A 1 37 ? 14.141  11.873 -3.453  1.00 1.00 ? 37 ASN A HD22 2  
ATOM   1294  N N    . TYR A 1 38 ? 13.950  15.505 -2.933  1.00 1.00 ? 38 TYR A N    2  
ATOM   1295  C CA   . TYR A 1 38 ? 14.926  15.885 -3.945  1.00 1.00 ? 38 TYR A CA   2  
ATOM   1296  C C    . TYR A 1 38 ? 15.070  14.735 -4.952  1.00 1.00 ? 38 TYR A C    2  
ATOM   1297  O O    . TYR A 1 38 ? 14.068  14.333 -5.552  1.00 1.00 ? 38 TYR A O    2  
ATOM   1298  C CB   . TYR A 1 38 ? 16.240  16.407 -3.330  1.00 1.00 ? 38 TYR A CB   2  
ATOM   1299  C CG   . TYR A 1 38 ? 17.225  16.942 -4.366  1.00 1.00 ? 38 TYR A CG   2  
ATOM   1300  C CD1  . TYR A 1 38 ? 16.769  17.817 -5.372  1.00 1.00 ? 38 TYR A CD1  2  
ATOM   1301  C CD2  . TYR A 1 38 ? 18.495  16.345 -4.502  1.00 1.00 ? 38 TYR A CD2  2  
ATOM   1302  C CE1  . TYR A 1 38 ? 17.487  17.952 -6.570  1.00 1.00 ? 38 TYR A CE1  2  
ATOM   1303  C CE2  . TYR A 1 38 ? 19.201  16.461 -5.713  1.00 1.00 ? 38 TYR A CE2  2  
ATOM   1304  C CZ   . TYR A 1 38 ? 18.666  17.218 -6.769  1.00 1.00 ? 38 TYR A CZ   2  
ATOM   1305  O OH   . TYR A 1 38 ? 19.284  17.227 -7.983  1.00 1.00 ? 38 TYR A OH   2  
ATOM   1306  H H    . TYR A 1 38 ? 14.262  14.981 -2.129  1.00 1.00 ? 38 TYR A H    2  
ATOM   1307  H HA   . TYR A 1 38 ? 14.509  16.718 -4.506  1.00 1.00 ? 38 TYR A HA   2  
ATOM   1308  H HB2  . TYR A 1 38 ? 15.999  17.228 -2.653  1.00 1.00 ? 38 TYR A HB2  2  
ATOM   1309  H HB3  . TYR A 1 38 ? 16.701  15.614 -2.740  1.00 1.00 ? 38 TYR A HB3  2  
ATOM   1310  H HD1  . TYR A 1 38 ? 15.840  18.350 -5.259  1.00 1.00 ? 38 TYR A HD1  2  
ATOM   1311  H HD2  . TYR A 1 38 ? 18.895  15.725 -3.713  1.00 1.00 ? 38 TYR A HD2  2  
ATOM   1312  H HE1  . TYR A 1 38 ? 17.120  18.607 -7.342  1.00 1.00 ? 38 TYR A HE1  2  
ATOM   1313  H HE2  . TYR A 1 38 ? 20.142  15.948 -5.844  1.00 1.00 ? 38 TYR A HE2  2  
ATOM   1314  H HH   . TYR A 1 38 ? 18.750  17.654 -8.667  1.00 1.00 ? 38 TYR A HH   2  
ATOM   1315  N N    . VAL A 1 39 ? 16.289  14.221 -5.151  1.00 1.00 ? 39 VAL A N    2  
ATOM   1316  C CA   . VAL A 1 39 ? 16.677  13.294 -6.209  1.00 1.00 ? 39 VAL A CA   2  
ATOM   1317  C C    . VAL A 1 39 ? 16.626  14.037 -7.552  1.00 1.00 ? 39 VAL A C    2  
ATOM   1318  O O    . VAL A 1 39 ? 15.888  15.011 -7.709  1.00 1.00 ? 39 VAL A O    2  
ATOM   1319  C CB   . VAL A 1 39 ? 15.860  11.981 -6.158  1.00 1.00 ? 39 VAL A CB   2  
ATOM   1320  C CG1  . VAL A 1 39 ? 16.157  11.040 -7.332  1.00 1.00 ? 39 VAL A CG1  2  
ATOM   1321  C CG2  . VAL A 1 39 ? 16.171  11.233 -4.855  1.00 1.00 ? 39 VAL A CG2  2  
ATOM   1322  H H    . VAL A 1 39 ? 17.037  14.567 -4.576  1.00 1.00 ? 39 VAL A H    2  
ATOM   1323  H HA   . VAL A 1 39 ? 17.722  13.036 -6.033  1.00 1.00 ? 39 VAL A HA   2  
ATOM   1324  H HB   . VAL A 1 39 ? 14.791  12.178 -6.196  1.00 1.00 ? 39 VAL A HB   2  
ATOM   1325  H HG11 . VAL A 1 39 ? 17.226  10.842 -7.399  1.00 1.00 ? 39 VAL A HG11 2  
ATOM   1326  H HG12 . VAL A 1 39 ? 15.630  10.097 -7.182  1.00 1.00 ? 39 VAL A HG12 2  
ATOM   1327  H HG13 . VAL A 1 39 ? 15.803  11.476 -8.267  1.00 1.00 ? 39 VAL A HG13 2  
ATOM   1328  H HG21 . VAL A 1 39 ? 16.050  11.887 -3.991  1.00 1.00 ? 39 VAL A HG21 2  
ATOM   1329  H HG22 . VAL A 1 39 ? 15.497  10.382 -4.748  1.00 1.00 ? 39 VAL A HG22 2  
ATOM   1330  H HG23 . VAL A 1 39 ? 17.200  10.871 -4.870  1.00 1.00 ? 39 VAL A HG23 2  
ATOM   1331  N N    . PHE A 1 40 ? 17.425  13.603 -8.528  1.00 1.00 ? 40 PHE A N    2  
ATOM   1332  C CA   . PHE A 1 40 ? 17.469  14.216 -9.850  1.00 1.00 ? 40 PHE A CA   2  
ATOM   1333  C C    . PHE A 1 40 ? 16.054  14.350 -10.449 1.00 1.00 ? 40 PHE A C    2  
ATOM   1334  O O    . PHE A 1 40 ? 15.166  13.565 -10.106 1.00 1.00 ? 40 PHE A O    2  
ATOM   1335  C CB   . PHE A 1 40 ? 18.385  13.365 -10.747 1.00 1.00 ? 40 PHE A CB   2  
ATOM   1336  C CG   . PHE A 1 40 ? 18.427  13.717 -12.223 1.00 1.00 ? 40 PHE A CG   2  
ATOM   1337  C CD1  . PHE A 1 40 ? 17.463  13.186 -13.102 1.00 1.00 ? 40 PHE A CD1  2  
ATOM   1338  C CD2  . PHE A 1 40 ? 19.454  14.538 -12.727 1.00 1.00 ? 40 PHE A CD2  2  
ATOM   1339  C CE1  . PHE A 1 40 ? 17.495  13.520 -14.467 1.00 1.00 ? 40 PHE A CE1  2  
ATOM   1340  C CE2  . PHE A 1 40 ? 19.485  14.869 -14.093 1.00 1.00 ? 40 PHE A CE2  2  
ATOM   1341  C CZ   . PHE A 1 40 ? 18.503  14.364 -14.962 1.00 1.00 ? 40 PHE A CZ   2  
ATOM   1342  H H    . PHE A 1 40 ? 18.016  12.806 -8.347  1.00 1.00 ? 40 PHE A H    2  
ATOM   1343  H HA   . PHE A 1 40 ? 17.921  15.197 -9.713  1.00 1.00 ? 40 PHE A HA   2  
ATOM   1344  H HB2  . PHE A 1 40 ? 19.397  13.448 -10.353 1.00 1.00 ? 40 PHE A HB2  2  
ATOM   1345  H HB3  . PHE A 1 40 ? 18.072  12.325 -10.673 1.00 1.00 ? 40 PHE A HB3  2  
ATOM   1346  H HD1  . PHE A 1 40 ? 16.696  12.517 -12.739 1.00 1.00 ? 40 PHE A HD1  2  
ATOM   1347  H HD2  . PHE A 1 40 ? 20.216  14.932 -12.069 1.00 1.00 ? 40 PHE A HD2  2  
ATOM   1348  H HE1  . PHE A 1 40 ? 16.751  13.117 -15.140 1.00 1.00 ? 40 PHE A HE1  2  
ATOM   1349  H HE2  . PHE A 1 40 ? 20.268  15.508 -14.476 1.00 1.00 ? 40 PHE A HE2  2  
ATOM   1350  H HZ   . PHE A 1 40 ? 18.532  14.616 -16.013 1.00 1.00 ? 40 PHE A HZ   2  
ATOM   1351  N N    . PRO A 1 41 ? 15.792  15.345 -11.309 1.00 1.00 ? 41 PRO A N    2  
ATOM   1352  C CA   . PRO A 1 41 ? 16.663  16.470 -11.594 1.00 1.00 ? 41 PRO A CA   2  
ATOM   1353  C C    . PRO A 1 41 ? 16.492  17.533 -10.503 1.00 1.00 ? 41 PRO A C    2  
ATOM   1354  O O    . PRO A 1 41 ? 17.472  17.976 -9.908  1.00 1.00 ? 41 PRO A O    2  
ATOM   1355  C CB   . PRO A 1 41 ? 16.224  16.972 -12.971 1.00 1.00 ? 41 PRO A CB   2  
ATOM   1356  C CG   . PRO A 1 41 ? 14.743  16.592 -13.066 1.00 1.00 ? 41 PRO A CG   2  
ATOM   1357  C CD   . PRO A 1 41 ? 14.612  15.363 -12.161 1.00 1.00 ? 41 PRO A CD   2  
ATOM   1358  H HA   . PRO A 1 41 ? 17.711  16.174 -11.641 1.00 1.00 ? 41 PRO A HA   2  
ATOM   1359  H HB2  . PRO A 1 41 ? 16.389  18.042 -13.102 1.00 1.00 ? 41 PRO A HB2  2  
ATOM   1360  H HB3  . PRO A 1 41 ? 16.775  16.420 -13.734 1.00 1.00 ? 41 PRO A HB3  2  
ATOM   1361  H HG2  . PRO A 1 41 ? 14.122  17.408 -12.696 1.00 1.00 ? 41 PRO A HG2  2  
ATOM   1362  H HG3  . PRO A 1 41 ? 14.457  16.365 -14.095 1.00 1.00 ? 41 PRO A HG3  2  
ATOM   1363  H HD2  . PRO A 1 41 ? 13.695  15.409 -11.572 1.00 1.00 ? 41 PRO A HD2  2  
ATOM   1364  H HD3  . PRO A 1 41 ? 14.606  14.460 -12.774 1.00 1.00 ? 41 PRO A HD3  2  
ATOM   1365  N N    . ALA A 1 42 ? 15.240  17.924 -10.245 1.00 1.00 ? 42 ALA A N    2  
ATOM   1366  C CA   . ALA A 1 42 ? 14.857  19.002 -9.347  1.00 1.00 ? 42 ALA A CA   2  
ATOM   1367  C C    . ALA A 1 42 ? 14.002  18.467 -8.194  1.00 1.00 ? 42 ALA A C    2  
ATOM   1368  O O    . ALA A 1 42 ? 13.625  17.292 -8.170  1.00 1.00 ? 42 ALA A O    2  
ATOM   1369  C CB   . ALA A 1 42 ? 14.088  20.055 -10.152 1.00 1.00 ? 42 ALA A CB   2  
ATOM   1370  H H    . ALA A 1 42 ? 14.490  17.445 -10.716 1.00 1.00 ? 42 ALA A H    2  
ATOM   1371  H HA   . ALA A 1 42 ? 15.742  19.487 -8.934  1.00 1.00 ? 42 ALA A HA   2  
ATOM   1372  H HB1  . ALA A 1 42 ? 14.703  20.400 -10.985 1.00 1.00 ? 42 ALA A HB1  2  
ATOM   1373  H HB2  . ALA A 1 42 ? 13.166  19.625 -10.544 1.00 1.00 ? 42 ALA A HB2  2  
ATOM   1374  H HB3  . ALA A 1 42 ? 13.843  20.911 -9.524  1.00 1.00 ? 42 ALA A HB3  2  
ATOM   1375  N N    . HIS A 1 43 ? 13.662  19.359 -7.262  1.00 1.00 ? 43 HIS A N    2  
ATOM   1376  C CA   . HIS A 1 43 ? 12.800  19.068 -6.128  1.00 1.00 ? 43 HIS A CA   2  
ATOM   1377  C C    . HIS A 1 43 ? 11.409  18.713 -6.656  1.00 1.00 ? 43 HIS A C    2  
ATOM   1378  O O    . HIS A 1 43 ? 10.830  19.481 -7.420  1.00 1.00 ? 43 HIS A O    2  
ATOM   1379  C CB   . HIS A 1 43 ? 12.770  20.294 -5.209  1.00 1.00 ? 43 HIS A CB   2  
ATOM   1380  C CG   . HIS A 1 43 ? 14.123  20.629 -4.636  1.00 1.00 ? 43 HIS A CG   2  
ATOM   1381  N ND1  . HIS A 1 43 ? 14.555  20.128 -3.417  1.00 1.00 ? 43 HIS A ND1  2  
ATOM   1382  C CD2  . HIS A 1 43 ? 15.173  21.376 -5.114  1.00 1.00 ? 43 HIS A CD2  2  
ATOM   1383  C CE1  . HIS A 1 43 ? 15.808  20.572 -3.223  1.00 1.00 ? 43 HIS A CE1  2  
ATOM   1384  N NE2  . HIS A 1 43 ? 16.246  21.331 -4.230  1.00 1.00 ? 43 HIS A NE2  2  
ATOM   1385  H H    . HIS A 1 43 ? 13.973  20.312 -7.377  1.00 1.00 ? 43 HIS A H    2  
ATOM   1386  H HA   . HIS A 1 43 ? 13.212  18.225 -5.577  1.00 1.00 ? 43 HIS A HA   2  
ATOM   1387  H HB2  . HIS A 1 43 ? 12.366  21.143 -5.759  1.00 1.00 ? 43 HIS A HB2  2  
ATOM   1388  H HB3  . HIS A 1 43 ? 12.107  20.123 -4.370  1.00 1.00 ? 43 HIS A HB3  2  
ATOM   1389  H HD1  . HIS A 1 43 ? 14.029  19.539 -2.788  1.00 1.00 ? 43 HIS A HD1  2  
ATOM   1390  H HD2  . HIS A 1 43 ? 15.177  21.900 -6.059  1.00 1.00 ? 43 HIS A HD2  2  
ATOM   1391  H HE1  . HIS A 1 43 ? 16.402  20.332 -2.353  1.00 1.00 ? 43 HIS A HE1  2  
ATOM   1392  N N    . LYS A 1 44 ? 10.903  17.534 -6.286  1.00 1.00 ? 44 LYS A N    2  
ATOM   1393  C CA   . LYS A 1 44 ? 9.704   16.926 -6.851  1.00 1.00 ? 44 LYS A CA   2  
ATOM   1394  C C    . LYS A 1 44 ? 8.719   16.557 -5.743  1.00 1.00 ? 44 LYS A C    2  
ATOM   1395  O O    . LYS A 1 44 ? 9.120   16.076 -4.683  1.00 1.00 ? 44 LYS A O    2  
ATOM   1396  C CB   . LYS A 1 44 ? 10.094  15.703 -7.697  1.00 1.00 ? 44 LYS A CB   2  
ATOM   1397  C CG   . LYS A 1 44 ? 10.733  14.582 -6.862  1.00 1.00 ? 44 LYS A CG   2  
ATOM   1398  C CD   . LYS A 1 44 ? 11.201  13.397 -7.718  1.00 1.00 ? 44 LYS A CD   2  
ATOM   1399  C CE   . LYS A 1 44 ? 12.264  13.753 -8.766  1.00 1.00 ? 44 LYS A CE   2  
ATOM   1400  N NZ   . LYS A 1 44 ? 13.351  14.583 -8.210  1.00 1.00 ? 44 LYS A NZ   2  
ATOM   1401  H H    . LYS A 1 44 ? 11.377  17.035 -5.542  1.00 1.00 ? 44 LYS A H    2  
ATOM   1402  H HA   . LYS A 1 44 ? 9.214   17.635 -7.521  1.00 1.00 ? 44 LYS A HA   2  
ATOM   1403  H HB2  . LYS A 1 44 ? 9.199   15.313 -8.185  1.00 1.00 ? 44 LYS A HB2  2  
ATOM   1404  H HB3  . LYS A 1 44 ? 10.787  16.041 -8.467  1.00 1.00 ? 44 LYS A HB3  2  
ATOM   1405  H HG2  . LYS A 1 44 ? 11.565  14.971 -6.276  1.00 1.00 ? 44 LYS A HG2  2  
ATOM   1406  H HG3  . LYS A 1 44 ? 9.992   14.195 -6.159  1.00 1.00 ? 44 LYS A HG3  2  
ATOM   1407  H HD2  . LYS A 1 44 ? 11.609  12.638 -7.045  1.00 1.00 ? 44 LYS A HD2  2  
ATOM   1408  H HD3  . LYS A 1 44 ? 10.338  12.958 -8.225  1.00 1.00 ? 44 LYS A HD3  2  
ATOM   1409  H HE2  . LYS A 1 44 ? 12.694  12.823 -9.143  1.00 1.00 ? 44 LYS A HE2  2  
ATOM   1410  H HE3  . LYS A 1 44 ? 11.809  14.277 -9.609  1.00 1.00 ? 44 LYS A HE3  2  
ATOM   1411  H HZ1  . LYS A 1 44 ? 13.625  14.286 -7.283  1.00 1.00 ? 44 LYS A HZ1  2  
ATOM   1412  H HZ2  . LYS A 1 44 ? 14.189  14.512 -8.780  1.00 1.00 ? 44 LYS A HZ2  2  
ATOM   1413  H HZ3  . LYS A 1 44 ? 13.108  15.566 -8.149  1.00 1.00 ? 44 LYS A HZ3  2  
ATOM   1414  N N    . CYS A 1 45 ? 7.430   16.802 -5.985  1.00 1.00 ? 45 CYS A N    2  
ATOM   1415  C CA   . CYS A 1 45 ? 6.384   16.514 -5.017  1.00 1.00 ? 45 CYS A CA   2  
ATOM   1416  C C    . CYS A 1 45 ? 6.112   15.011 -5.004  1.00 1.00 ? 45 CYS A C    2  
ATOM   1417  O O    . CYS A 1 45 ? 5.839   14.442 -6.056  1.00 1.00 ? 45 CYS A O    2  
ATOM   1418  C CB   . CYS A 1 45 ? 5.127   17.316 -5.371  1.00 1.00 ? 45 CYS A CB   2  
ATOM   1419  S SG   . CYS A 1 45 ? 3.766   17.144 -4.193  1.00 1.00 ? 45 CYS A SG   2  
ATOM   1420  H H    . CYS A 1 45 ? 7.154   17.159 -6.889  1.00 1.00 ? 45 CYS A H    2  
ATOM   1421  H HA   . CYS A 1 45 ? 6.726   16.835 -4.037  1.00 1.00 ? 45 CYS A HA   2  
ATOM   1422  H HB2  . CYS A 1 45 ? 5.381   18.374 -5.421  1.00 1.00 ? 45 CYS A HB2  2  
ATOM   1423  H HB3  . CYS A 1 45 ? 4.760   17.004 -6.350  1.00 1.00 ? 45 CYS A HB3  2  
ATOM   1424  N N    . ILE A 1 46 ? 6.218   14.360 -3.843  1.00 1.00 ? 46 ILE A N    2  
ATOM   1425  C CA   . ILE A 1 46 ? 5.790   12.981 -3.644  1.00 1.00 ? 46 ILE A CA   2  
ATOM   1426  C C    . ILE A 1 46 ? 4.524   13.033 -2.798  1.00 1.00 ? 46 ILE A C    2  
ATOM   1427  O O    . ILE A 1 46 ? 4.453   13.823 -1.850  1.00 1.00 ? 46 ILE A O    2  
ATOM   1428  C CB   . ILE A 1 46 ? 6.885   12.161 -2.929  1.00 1.00 ? 46 ILE A CB   2  
ATOM   1429  C CG1  . ILE A 1 46 ? 8.207   12.085 -3.721  1.00 1.00 ? 46 ILE A CG1  2  
ATOM   1430  C CG2  . ILE A 1 46 ? 6.371   10.752 -2.583  1.00 1.00 ? 46 ILE A CG2  2  
ATOM   1431  C CD1  . ILE A 1 46 ? 8.069   11.510 -5.134  1.00 1.00 ? 46 ILE A CD1  2  
ATOM   1432  H H    . ILE A 1 46 ? 6.445   14.873 -2.996  1.00 1.00 ? 46 ILE A H    2  
ATOM   1433  H HA   . ILE A 1 46 ? 5.547   12.503 -4.592  1.00 1.00 ? 46 ILE A HA   2  
ATOM   1434  H HB   . ILE A 1 46 ? 7.117   12.649 -1.981  1.00 1.00 ? 46 ILE A HB   2  
ATOM   1435  H HG12 . ILE A 1 46 ? 8.652   13.076 -3.805  1.00 1.00 ? 46 ILE A HG12 2  
ATOM   1436  H HG13 . ILE A 1 46 ? 8.905   11.457 -3.164  1.00 1.00 ? 46 ILE A HG13 2  
ATOM   1437  H HG21 . ILE A 1 46 ? 5.951   10.273 -3.465  1.00 1.00 ? 46 ILE A HG21 2  
ATOM   1438  H HG22 . ILE A 1 46 ? 7.180   10.139 -2.185  1.00 1.00 ? 46 ILE A HG22 2  
ATOM   1439  H HG23 . ILE A 1 46 ? 5.594   10.802 -1.821  1.00 1.00 ? 46 ILE A HG23 2  
ATOM   1440  H HD11 . ILE A 1 46 ? 7.581   10.537 -5.111  1.00 1.00 ? 46 ILE A HD11 2  
ATOM   1441  H HD12 . ILE A 1 46 ? 7.501   12.194 -5.762  1.00 1.00 ? 46 ILE A HD12 2  
ATOM   1442  H HD13 . ILE A 1 46 ? 9.063   11.393 -5.567  1.00 1.00 ? 46 ILE A HD13 2  
ATOM   1443  N N    . CYS A 1 47 ? 3.532   12.191 -3.108  1.00 1.00 ? 47 CYS A N    2  
ATOM   1444  C CA   . CYS A 1 47 ? 2.362   12.071 -2.255  1.00 1.00 ? 47 CYS A CA   2  
ATOM   1445  C C    . CYS A 1 47 ? 2.000   10.609 -2.001  1.00 1.00 ? 47 CYS A C    2  
ATOM   1446  O O    . CYS A 1 47 ? 2.189   9.772  -2.880  1.00 1.00 ? 47 CYS A O    2  
ATOM   1447  C CB   . CYS A 1 47 ? 1.235   12.939 -2.792  1.00 1.00 ? 47 CYS A CB   2  
ATOM   1448  S SG   . CYS A 1 47 ? 0.099   13.367 -1.476  1.00 1.00 ? 47 CYS A SG   2  
ATOM   1449  H H    . CYS A 1 47 ? 3.583   11.604 -3.938  1.00 1.00 ? 47 CYS A H    2  
ATOM   1450  H HA   . CYS A 1 47 ? 2.613   12.461 -1.279  1.00 1.00 ? 47 CYS A HA   2  
ATOM   1451  H HB2  . CYS A 1 47 ? 1.644   13.876 -3.170  1.00 1.00 ? 47 CYS A HB2  2  
ATOM   1452  H HB3  . CYS A 1 47 ? 0.702   12.439 -3.598  1.00 1.00 ? 47 CYS A HB3  2  
ATOM   1453  N N    . TYR A 1 48 ? 1.542   10.299 -0.781  1.00 1.00 ? 48 TYR A N    2  
ATOM   1454  C CA   . TYR A 1 48 ? 1.377   8.944  -0.270  1.00 1.00 ? 48 TYR A CA   2  
ATOM   1455  C C    . TYR A 1 48 ? -0.101  8.565  -0.140  1.00 1.00 ? 48 TYR A C    2  
ATOM   1456  O O    . TYR A 1 48 ? -0.847  9.189  0.622   1.00 1.00 ? 48 TYR A O    2  
ATOM   1457  C CB   . TYR A 1 48 ? 2.077   8.833  1.092   1.00 1.00 ? 48 TYR A CB   2  
ATOM   1458  C CG   . TYR A 1 48 ? 3.568   9.128  1.091   1.00 1.00 ? 48 TYR A CG   2  
ATOM   1459  C CD1  . TYR A 1 48 ? 4.032   10.453 0.993   1.00 1.00 ? 48 TYR A CD1  2  
ATOM   1460  C CD2  . TYR A 1 48 ? 4.492   8.086  1.296   1.00 1.00 ? 48 TYR A CD2  2  
ATOM   1461  C CE1  . TYR A 1 48 ? 5.410   10.721 0.953   1.00 1.00 ? 48 TYR A CE1  2  
ATOM   1462  C CE2  . TYR A 1 48 ? 5.871   8.359  1.289   1.00 1.00 ? 48 TYR A CE2  2  
ATOM   1463  C CZ   . TYR A 1 48 ? 6.327   9.663  1.034   1.00 1.00 ? 48 TYR A CZ   2  
ATOM   1464  O OH   . TYR A 1 48 ? 7.652   9.903  0.839   1.00 1.00 ? 48 TYR A OH   2  
ATOM   1465  H H    . TYR A 1 48 ? 1.339   11.047 -0.123  1.00 1.00 ? 48 TYR A H    2  
ATOM   1466  H HA   . TYR A 1 48 ? 1.873   8.237  -0.936  1.00 1.00 ? 48 TYR A HA   2  
ATOM   1467  H HB2  . TYR A 1 48 ? 1.590   9.503  1.801   1.00 1.00 ? 48 TYR A HB2  2  
ATOM   1468  H HB3  . TYR A 1 48 ? 1.940   7.815  1.447   1.00 1.00 ? 48 TYR A HB3  2  
ATOM   1469  H HD1  . TYR A 1 48 ? 3.336   11.269 0.937   1.00 1.00 ? 48 TYR A HD1  2  
ATOM   1470  H HD2  . TYR A 1 48 ? 4.153   7.073  1.455   1.00 1.00 ? 48 TYR A HD2  2  
ATOM   1471  H HE1  . TYR A 1 48 ? 5.762   11.731 0.809   1.00 1.00 ? 48 TYR A HE1  2  
ATOM   1472  H HE2  . TYR A 1 48 ? 6.576   7.554  1.440   1.00 1.00 ? 48 TYR A HE2  2  
ATOM   1473  H HH   . TYR A 1 48 ? 8.087   9.133  0.446   1.00 1.00 ? 48 TYR A HH   2  
ATOM   1474  N N    . PHE A 1 49 ? -0.513  7.520  -0.865  1.00 1.00 ? 49 PHE A N    2  
ATOM   1475  C CA   . PHE A 1 49 ? -1.881  7.030  -0.922  1.00 1.00 ? 49 PHE A CA   2  
ATOM   1476  C C    . PHE A 1 49 ? -1.891  5.594  -0.381  1.00 1.00 ? 49 PHE A C    2  
ATOM   1477  O O    . PHE A 1 49 ? -0.933  4.863  -0.622  1.00 1.00 ? 49 PHE A O    2  
ATOM   1478  C CB   . PHE A 1 49 ? -2.368  7.044  -2.378  1.00 1.00 ? 49 PHE A CB   2  
ATOM   1479  C CG   . PHE A 1 49 ? -2.200  8.348  -3.144  1.00 1.00 ? 49 PHE A CG   2  
ATOM   1480  C CD1  . PHE A 1 49 ? -0.915  8.800  -3.497  1.00 1.00 ? 49 PHE A CD1  2  
ATOM   1481  C CD2  . PHE A 1 49 ? -3.327  9.049  -3.618  1.00 1.00 ? 49 PHE A CD2  2  
ATOM   1482  C CE1  . PHE A 1 49 ? -0.759  9.971  -4.246  1.00 1.00 ? 49 PHE A CE1  2  
ATOM   1483  C CE2  . PHE A 1 49 ? -3.164  10.145 -4.486  1.00 1.00 ? 49 PHE A CE2  2  
ATOM   1484  C CZ   . PHE A 1 49 ? -1.872  10.570 -4.844  1.00 1.00 ? 49 PHE A CZ   2  
ATOM   1485  H H    . PHE A 1 49 ? 0.153   7.035  -1.460  1.00 1.00 ? 49 PHE A H    2  
ATOM   1486  H HA   . PHE A 1 49 ? -2.526  7.676  -0.327  1.00 1.00 ? 49 PHE A HA   2  
ATOM   1487  H HB2  . PHE A 1 49 ? -1.857  6.247  -2.907  1.00 1.00 ? 49 PHE A HB2  2  
ATOM   1488  H HB3  . PHE A 1 49 ? -3.414  6.773  -2.391  1.00 1.00 ? 49 PHE A HB3  2  
ATOM   1489  H HD1  . PHE A 1 49 ? -0.028  8.253  -3.222  1.00 1.00 ? 49 PHE A HD1  2  
ATOM   1490  H HD2  . PHE A 1 49 ? -4.325  8.732  -3.348  1.00 1.00 ? 49 PHE A HD2  2  
ATOM   1491  H HE1  . PHE A 1 49 ? 0.230   10.360 -4.419  1.00 1.00 ? 49 PHE A HE1  2  
ATOM   1492  H HE2  . PHE A 1 49 ? -4.034  10.648 -4.880  1.00 1.00 ? 49 PHE A HE2  2  
ATOM   1493  H HZ   . PHE A 1 49 ? -1.699  11.316 -5.605  1.00 1.00 ? 49 PHE A HZ   2  
ATOM   1494  N N    . PRO A 1 50 ? -2.961  5.159  0.302   1.00 1.00 ? 50 PRO A N    2  
ATOM   1495  C CA   . PRO A 1 50 ? -3.048  3.867  0.980   1.00 1.00 ? 50 PRO A CA   2  
ATOM   1496  C C    . PRO A 1 50 ? -2.881  2.679  0.028   1.00 1.00 ? 50 PRO A C    2  
ATOM   1497  O O    . PRO A 1 50 ? -2.442  1.607  0.442   1.00 1.00 ? 50 PRO A O    2  
ATOM   1498  C CB   . PRO A 1 50 ? -4.416  3.863  1.671   1.00 1.00 ? 50 PRO A CB   2  
ATOM   1499  C CG   . PRO A 1 50 ? -5.247  4.829  0.826   1.00 1.00 ? 50 PRO A CG   2  
ATOM   1500  C CD   . PRO A 1 50 ? -4.217  5.873  0.397   1.00 1.00 ? 50 PRO A CD   2  
ATOM   1501  H HA   . PRO A 1 50 ? -2.263  3.799  1.731   1.00 1.00 ? 50 PRO A HA   2  
ATOM   1502  H HB2  . PRO A 1 50 ? -4.861  2.868  1.724   1.00 1.00 ? 50 PRO A HB2  2  
ATOM   1503  H HB3  . PRO A 1 50 ? -4.309  4.273  2.677   1.00 1.00 ? 50 PRO A HB3  2  
ATOM   1504  H HG2  . PRO A 1 50 ? -5.629  4.307  -0.053  1.00 1.00 ? 50 PRO A HG2  2  
ATOM   1505  H HG3  . PRO A 1 50 ? -6.073  5.266  1.389   1.00 1.00 ? 50 PRO A HG3  2  
ATOM   1506  H HD2  . PRO A 1 50 ? -4.482  6.311  -0.566  1.00 1.00 ? 50 PRO A HD2  2  
ATOM   1507  H HD3  . PRO A 1 50 ? -4.131  6.644  1.165   1.00 1.00 ? 50 PRO A HD3  2  
ATOM   1508  N N    . CYS A 1 51 ? -3.242  2.877  -1.242  1.00 1.00 ? 51 CYS A N    2  
ATOM   1509  C CA   . CYS A 1 51 ? -2.965  1.981  -2.354  1.00 1.00 ? 51 CYS A CA   2  
ATOM   1510  C C    . CYS A 1 51 ? -3.235  0.507  -2.035  1.00 1.00 ? 51 CYS A C    2  
ATOM   1511  O O    . CYS A 1 51 ? -2.310  -0.230 -1.690  1.00 1.00 ? 51 CYS A O    2  
ATOM   1512  C CB   . CYS A 1 51 ? -1.519  2.234  -2.758  1.00 1.00 ? 51 CYS A CB   2  
ATOM   1513  S SG   . CYS A 1 51 ? -1.040  1.591  -4.368  1.00 1.00 ? 51 CYS A SG   2  
ATOM   1514  O OXT  . CYS A 1 51 ? -4.537  0.114  -2.115  1.00 0.00 ? 51 CYS A OXT  2  
ATOM   1515  H H    . CYS A 1 51 ? -3.508  3.815  -1.479  1.00 1.00 ? 51 CYS A H    2  
ATOM   1516  H HA   . CYS A 1 51 ? -3.596  2.276  -3.191  1.00 1.00 ? 51 CYS A HA   2  
ATOM   1517  H HB2  . CYS A 1 51 ? -1.373  3.311  -2.809  1.00 1.00 ? 51 CYS A HB2  2  
ATOM   1518  H HB3  . CYS A 1 51 ? -0.852  1.847  -1.993  1.00 1.00 ? 51 CYS A HB3  2  
HETATM 1519  N N    . PCA A 1 1  ? -2.088  -1.967 2.729   1.00 1.00 ? 1  PCA A N    3  
HETATM 1520  C CA   . PCA A 1 1  ? -2.618  -1.012 3.685   1.00 1.00 ? 1  PCA A CA   3  
HETATM 1521  C CB   . PCA A 1 1  ? -2.859  -1.828 4.969   1.00 1.00 ? 1  PCA A CB   3  
HETATM 1522  C CG   . PCA A 1 1  ? -2.017  -3.097 4.767   1.00 1.00 ? 1  PCA A CG   3  
HETATM 1523  C CD   . PCA A 1 1  ? -1.729  -3.116 3.280   1.00 1.00 ? 1  PCA A CD   3  
HETATM 1524  O OE   . PCA A 1 1  ? -1.215  -4.063 2.695   1.00 1.00 ? 1  PCA A OE   3  
HETATM 1525  C C    . PCA A 1 1  ? -1.617  0.126  3.890   1.00 1.00 ? 1  PCA A C    3  
HETATM 1526  O O    . PCA A 1 1  ? -1.904  1.274  3.555   1.00 1.00 ? 1  PCA A O    3  
HETATM 1527  H H    . PCA A 1 1  ? -2.059  -1.800 1.727   1.00 0.00 ? 1  PCA A H    3  
HETATM 1528  H HA   . PCA A 1 1  ? -3.562  -0.605 3.323   1.00 1.00 ? 1  PCA A HA   3  
HETATM 1529  H HB2  . PCA A 1 1  ? -2.588  -1.287 5.877   1.00 1.00 ? 1  PCA A HB2  3  
HETATM 1530  H HB3  . PCA A 1 1  ? -3.913  -2.108 5.011   1.00 1.00 ? 1  PCA A HB3  3  
HETATM 1531  H HG2  . PCA A 1 1  ? -1.082  -3.037 5.320   1.00 1.00 ? 1  PCA A HG2  3  
HETATM 1532  H HG3  . PCA A 1 1  ? -2.574  -3.986 5.064   1.00 1.00 ? 1  PCA A HG3  3  
ATOM   1533  N N    . LYS A 1 2  ? -0.430  -0.208 4.410   1.00 1.00 ? 2  LYS A N    3  
ATOM   1534  C CA   . LYS A 1 2  ? 0.686   0.717  4.582   1.00 1.00 ? 2  LYS A CA   3  
ATOM   1535  C C    . LYS A 1 2  ? 0.917   1.512  3.294   1.00 1.00 ? 2  LYS A C    3  
ATOM   1536  O O    . LYS A 1 2  ? 0.689   0.989  2.201   1.00 1.00 ? 2  LYS A O    3  
ATOM   1537  C CB   . LYS A 1 2  ? 1.938   -0.067 5.004   1.00 1.00 ? 2  LYS A CB   3  
ATOM   1538  C CG   . LYS A 1 2  ? 2.434   -1.008 3.893   1.00 1.00 ? 2  LYS A CG   3  
ATOM   1539  C CD   . LYS A 1 2  ? 3.622   -0.417 3.115   1.00 1.00 ? 2  LYS A CD   3  
ATOM   1540  C CE   . LYS A 1 2  ? 3.664   -0.963 1.682   1.00 1.00 ? 2  LYS A CE   3  
ATOM   1541  N NZ   . LYS A 1 2  ? 2.676   -0.284 0.819   1.00 1.00 ? 2  LYS A NZ   3  
ATOM   1542  H H    . LYS A 1 2  ? -0.288  -1.173 4.660   1.00 1.00 ? 2  LYS A H    3  
ATOM   1543  H HA   . LYS A 1 2  ? 0.423   1.408  5.384   1.00 1.00 ? 2  LYS A HA   3  
ATOM   1544  H HB2  . LYS A 1 2  ? 2.731   0.623  5.294   1.00 1.00 ? 2  LYS A HB2  3  
ATOM   1545  H HB3  . LYS A 1 2  ? 1.680   -0.664 5.880   1.00 1.00 ? 2  LYS A HB3  3  
ATOM   1546  H HG2  . LYS A 1 2  ? 2.766   -1.938 4.354   1.00 1.00 ? 2  LYS A HG2  3  
ATOM   1547  H HG3  . LYS A 1 2  ? 1.608   -1.252 3.225   1.00 1.00 ? 2  LYS A HG3  3  
ATOM   1548  H HD2  . LYS A 1 2  ? 3.583   0.674  3.089   1.00 1.00 ? 2  LYS A HD2  3  
ATOM   1549  H HD3  . LYS A 1 2  ? 4.543   -0.697 3.634   1.00 1.00 ? 2  LYS A HD3  3  
ATOM   1550  H HE2  . LYS A 1 2  ? 4.658   -0.795 1.262   1.00 1.00 ? 2  LYS A HE2  3  
ATOM   1551  H HE3  . LYS A 1 2  ? 3.474   -2.039 1.696   1.00 1.00 ? 2  LYS A HE3  3  
ATOM   1552  H HZ1  . LYS A 1 2  ? 1.781   -0.184 1.287   1.00 1.00 ? 2  LYS A HZ1  3  
ATOM   1553  H HZ2  . LYS A 1 2  ? 2.990   0.662  0.627   1.00 1.00 ? 2  LYS A HZ2  3  
ATOM   1554  H HZ3  . LYS A 1 2  ? 2.556   -0.764 -0.060  1.00 1.00 ? 2  LYS A HZ3  3  
ATOM   1555  N N    . LEU A 1 3  ? 1.380   2.757  3.412   1.00 1.00 ? 3  LEU A N    3  
ATOM   1556  C CA   . LEU A 1 3  ? 1.413   3.680  2.286   1.00 1.00 ? 3  LEU A CA   3  
ATOM   1557  C C    . LEU A 1 3  ? 2.155   3.155  1.053   1.00 1.00 ? 3  LEU A C    3  
ATOM   1558  O O    . LEU A 1 3  ? 3.092   2.364  1.154   1.00 1.00 ? 3  LEU A O    3  
ATOM   1559  C CB   . LEU A 1 3  ? 2.029   5.025  2.681   1.00 1.00 ? 3  LEU A CB   3  
ATOM   1560  C CG   . LEU A 1 3  ? 1.301   5.815  3.782   1.00 1.00 ? 3  LEU A CG   3  
ATOM   1561  C CD1  . LEU A 1 3  ? 2.231   6.923  4.293   1.00 1.00 ? 3  LEU A CD1  3  
ATOM   1562  C CD2  . LEU A 1 3  ? 0.011   6.452  3.257   1.00 1.00 ? 3  LEU A CD2  3  
ATOM   1563  H H    . LEU A 1 3  ? 1.597   3.115  4.329   1.00 1.00 ? 3  LEU A H    3  
ATOM   1564  H HA   . LEU A 1 3  ? 0.379   3.831  2.020   1.00 1.00 ? 3  LEU A HA   3  
ATOM   1565  H HB2  . LEU A 1 3  ? 3.051   4.825  2.983   1.00 1.00 ? 3  LEU A HB2  3  
ATOM   1566  H HB3  . LEU A 1 3  ? 2.073   5.646  1.790   1.00 1.00 ? 3  LEU A HB3  3  
ATOM   1567  H HG   . LEU A 1 3  ? 1.040   5.163  4.614   1.00 1.00 ? 3  LEU A HG   3  
ATOM   1568  H HD11 . LEU A 1 3  ? 2.502   7.597  3.480   1.00 1.00 ? 3  LEU A HD11 3  
ATOM   1569  H HD12 . LEU A 1 3  ? 1.736   7.496  5.078   1.00 1.00 ? 3  LEU A HD12 3  
ATOM   1570  H HD13 . LEU A 1 3  ? 3.142   6.486  4.703   1.00 1.00 ? 3  LEU A HD13 3  
ATOM   1571  H HD21 . LEU A 1 3  ? 0.226   7.095  2.405   1.00 1.00 ? 3  LEU A HD21 3  
ATOM   1572  H HD22 . LEU A 1 3  ? -0.689  5.676  2.962   1.00 1.00 ? 3  LEU A HD22 3  
ATOM   1573  H HD23 . LEU A 1 3  ? -0.444  7.048  4.047   1.00 1.00 ? 3  LEU A HD23 3  
ATOM   1574  N N    . CYS A 1 4  ? 1.725   3.624  -0.117  1.00 1.00 ? 4  CYS A N    3  
ATOM   1575  C CA   . CYS A 1 4  ? 2.387   3.472  -1.404  1.00 1.00 ? 4  CYS A CA   3  
ATOM   1576  C C    . CYS A 1 4  ? 2.491   4.883  -1.976  1.00 1.00 ? 4  CYS A C    3  
ATOM   1577  O O    . CYS A 1 4  ? 1.592   5.702  -1.762  1.00 1.00 ? 4  CYS A O    3  
ATOM   1578  C CB   . CYS A 1 4  ? 1.610   2.548  -2.352  1.00 1.00 ? 4  CYS A CB   3  
ATOM   1579  S SG   . CYS A 1 4  ? 2.046   0.791  -2.242  1.00 1.00 ? 4  CYS A SG   3  
ATOM   1580  H H    . CYS A 1 4  ? 0.946   4.277  -0.097  1.00 1.00 ? 4  CYS A H    3  
ATOM   1581  H HA   . CYS A 1 4  ? 3.394   3.074  -1.270  1.00 1.00 ? 4  CYS A HA   3  
ATOM   1582  H HB2  . CYS A 1 4  ? 0.538   2.673  -2.193  1.00 1.00 ? 4  CYS A HB2  3  
ATOM   1583  H HB3  . CYS A 1 4  ? 1.827   2.839  -3.379  1.00 1.00 ? 4  CYS A HB3  3  
ATOM   1584  N N    . GLU A 1 5  ? 3.613   5.171  -2.636  1.00 1.00 ? 5  GLU A N    3  
ATOM   1585  C CA   . GLU A 1 5  ? 4.000   6.506  -3.074  1.00 1.00 ? 5  GLU A CA   3  
ATOM   1586  C C    . GLU A 1 5  ? 3.704   6.747  -4.558  1.00 1.00 ? 5  GLU A C    3  
ATOM   1587  O O    . GLU A 1 5  ? 3.871   5.847  -5.382  1.00 1.00 ? 5  GLU A O    3  
ATOM   1588  C CB   . GLU A 1 5  ? 5.494   6.732  -2.766  1.00 1.00 ? 5  GLU A CB   3  
ATOM   1589  C CG   . GLU A 1 5  ? 6.480   6.076  -3.751  1.00 1.00 ? 5  GLU A CG   3  
ATOM   1590  C CD   . GLU A 1 5  ? 6.201   4.595  -3.993  1.00 1.00 ? 5  GLU A CD   3  
ATOM   1591  O OE1  . GLU A 1 5  ? 6.070   3.846  -3.026  1.00 1.00 ? 5  GLU A OE1  3  
ATOM   1592  O OE2  . GLU A 1 5  ? 6.010   4.218  -5.286  1.00 1.00 ? 5  GLU A OE2  3  
ATOM   1593  H H    . GLU A 1 5  ? 4.304   4.434  -2.719  1.00 1.00 ? 5  GLU A H    3  
ATOM   1594  H HA   . GLU A 1 5  ? 3.444   7.228  -2.479  1.00 1.00 ? 5  GLU A HA   3  
ATOM   1595  H HB2  . GLU A 1 5  ? 5.685   7.806  -2.772  1.00 1.00 ? 5  GLU A HB2  3  
ATOM   1596  H HB3  . GLU A 1 5  ? 5.707   6.360  -1.763  1.00 1.00 ? 5  GLU A HB3  3  
ATOM   1597  H HG2  . GLU A 1 5  ? 6.455   6.609  -4.701  1.00 1.00 ? 5  GLU A HG2  3  
ATOM   1598  H HG3  . GLU A 1 5  ? 7.488   6.169  -3.346  1.00 1.00 ? 5  GLU A HG3  3  
ATOM   1599  H HE2  . GLU A 1 5  ? 5.365   4.800  -5.704  1.00 1.00 ? 5  GLU A HE2  3  
ATOM   1600  N N    . ARG A 1 6  ? 3.329   7.980  -4.898  1.00 1.00 ? 6  ARG A N    3  
ATOM   1601  C CA   . ARG A 1 6  ? 3.221   8.491  -6.256  1.00 1.00 ? 6  ARG A CA   3  
ATOM   1602  C C    . ARG A 1 6  ? 4.056   9.771  -6.275  1.00 1.00 ? 6  ARG A C    3  
ATOM   1603  O O    . ARG A 1 6  ? 3.670   10.738 -5.615  1.00 1.00 ? 6  ARG A O    3  
ATOM   1604  C CB   . ARG A 1 6  ? 1.758   8.781  -6.632  1.00 1.00 ? 6  ARG A CB   3  
ATOM   1605  C CG   . ARG A 1 6  ? 0.993   7.466  -6.865  1.00 1.00 ? 6  ARG A CG   3  
ATOM   1606  C CD   . ARG A 1 6  ? -0.495  7.673  -7.173  1.00 1.00 ? 6  ARG A CD   3  
ATOM   1607  N NE   . ARG A 1 6  ? -0.690  8.713  -8.198  1.00 1.00 ? 6  ARG A NE   3  
ATOM   1608  C CZ   . ARG A 1 6  ? -1.438  9.819  -8.061  1.00 1.00 ? 6  ARG A CZ   3  
ATOM   1609  N NH1  . ARG A 1 6  ? -2.381  9.883  -7.121  1.00 1.00 ? 6  ARG A NH1  3  
ATOM   1610  N NH2  . ARG A 1 6  ? -1.207  10.873 -8.849  1.00 1.00 ? 6  ARG A NH2  3  
ATOM   1611  H H    . ARG A 1 6  ? 3.247   8.667  -4.157  1.00 1.00 ? 6  ARG A H    3  
ATOM   1612  H HA   . ARG A 1 6  ? 3.605   7.770  -6.976  1.00 1.00 ? 6  ARG A HA   3  
ATOM   1613  H HB2  . ARG A 1 6  ? 1.295   9.395  -5.874  1.00 1.00 ? 6  ARG A HB2  3  
ATOM   1614  H HB3  . ARG A 1 6  ? 1.721   9.392  -7.530  1.00 1.00 ? 6  ARG A HB3  3  
ATOM   1615  H HG2  . ARG A 1 6  ? 1.455   6.939  -7.701  1.00 1.00 ? 6  ARG A HG2  3  
ATOM   1616  H HG3  . ARG A 1 6  ? 1.076   6.833  -5.979  1.00 1.00 ? 6  ARG A HG3  3  
ATOM   1617  H HD2  . ARG A 1 6  ? -0.914  6.731  -7.532  1.00 1.00 ? 6  ARG A HD2  3  
ATOM   1618  H HD3  . ARG A 1 6  ? -0.988  7.917  -6.234  1.00 1.00 ? 6  ARG A HD3  3  
ATOM   1619  H HE   . ARG A 1 6  ? -0.078  8.652  -9.000  1.00 1.00 ? 6  ARG A HE   3  
ATOM   1620  H HH11 . ARG A 1 6  ? -2.577  9.081  -6.541  1.00 1.00 ? 6  ARG A HH11 3  
ATOM   1621  H HH12 . ARG A 1 6  ? -2.781  10.778 -6.858  1.00 1.00 ? 6  ARG A HH12 3  
ATOM   1622  H HH21 . ARG A 1 6  ? -0.361  10.902 -9.412  1.00 1.00 ? 6  ARG A HH21 3  
ATOM   1623  H HH22 . ARG A 1 6  ? -1.663  11.767 -8.697  1.00 1.00 ? 6  ARG A HH22 3  
ATOM   1624  N N    . PRO A 1 7  ? 5.201   9.794  -6.979  1.00 1.00 ? 7  PRO A N    3  
ATOM   1625  C CA   . PRO A 1 7  ? 5.947   11.017 -7.218  1.00 1.00 ? 7  PRO A CA   3  
ATOM   1626  C C    . PRO A 1 7  ? 5.022   12.049 -7.860  1.00 1.00 ? 7  PRO A C    3  
ATOM   1627  O O    . PRO A 1 7  ? 4.701   13.077 -7.269  1.00 1.00 ? 7  PRO A O    3  
ATOM   1628  C CB   . PRO A 1 7  ? 7.137   10.624 -8.106  1.00 1.00 ? 7  PRO A CB   3  
ATOM   1629  C CG   . PRO A 1 7  ? 7.320   9.137  -7.799  1.00 1.00 ? 7  PRO A CG   3  
ATOM   1630  C CD   . PRO A 1 7  ? 5.888   8.657  -7.568  1.00 1.00 ? 7  PRO A CD   3  
ATOM   1631  H HA   . PRO A 1 7  ? 6.322   11.387 -6.267  1.00 1.00 ? 7  PRO A HA   3  
ATOM   1632  H HB2  . PRO A 1 7  ? 6.900   10.735 -9.164  1.00 1.00 ? 7  PRO A HB2  3  
ATOM   1633  H HB3  . PRO A 1 7  ? 8.029   11.203 -7.865  1.00 1.00 ? 7  PRO A HB3  3  
ATOM   1634  H HG2  . PRO A 1 7  ? 7.814   8.600  -8.610  1.00 1.00 ? 7  PRO A HG2  3  
ATOM   1635  H HG3  . PRO A 1 7  ? 7.892   9.030  -6.875  1.00 1.00 ? 7  PRO A HG3  3  
ATOM   1636  H HD2  . PRO A 1 7  ? 5.423   8.402  -8.521  1.00 1.00 ? 7  PRO A HD2  3  
ATOM   1637  H HD3  . PRO A 1 7  ? 5.893   7.790  -6.905  1.00 1.00 ? 7  PRO A HD3  3  
ATOM   1638  N N    . SER A 1 8  ? 4.512   11.743 -9.055  1.00 1.00 ? 8  SER A N    3  
ATOM   1639  C CA   . SER A 1 8  ? 3.494   12.567 -9.662  1.00 1.00 ? 8  SER A CA   3  
ATOM   1640  C C    . SER A 1 8  ? 2.172   12.304 -8.939  1.00 1.00 ? 8  SER A C    3  
ATOM   1641  O O    . SER A 1 8  ? 1.337   11.533 -9.420  1.00 1.00 ? 8  SER A O    3  
ATOM   1642  C CB   . SER A 1 8  ? 3.419   12.190 -11.144 1.00 1.00 ? 8  SER A CB   3  
ATOM   1643  O OG   . SER A 1 8  ? 3.344   10.781 -11.248 1.00 1.00 ? 8  SER A OG   3  
ATOM   1644  H H    . SER A 1 8  ? 4.736   10.878 -9.526  1.00 1.00 ? 8  SER A H    3  
ATOM   1645  H HA   . SER A 1 8  ? 3.749   13.626 -9.584  1.00 1.00 ? 8  SER A HA   3  
ATOM   1646  H HB2  . SER A 1 8  ? 2.547   12.659 -11.607 1.00 1.00 ? 8  SER A HB2  3  
ATOM   1647  H HB3  . SER A 1 8  ? 4.315   12.544 -11.656 1.00 1.00 ? 8  SER A HB3  3  
ATOM   1648  H HG   . SER A 1 8  ? 2.518   10.508 -10.833 1.00 1.00 ? 8  SER A HG   3  
ATOM   1649  N N    . GLY A 1 9  ? 1.980   12.972 -7.800  1.00 1.00 ? 9  GLY A N    3  
ATOM   1650  C CA   . GLY A 1 9  ? 0.709   13.031 -7.095  1.00 1.00 ? 9  GLY A CA   3  
ATOM   1651  C C    . GLY A 1 9  ? -0.184  13.961 -7.912  1.00 1.00 ? 9  GLY A C    3  
ATOM   1652  O O    . GLY A 1 9  ? -1.238  13.564 -8.417  1.00 1.00 ? 9  GLY A O    3  
ATOM   1653  H H    . GLY A 1 9  ? 2.792   13.441 -7.406  1.00 1.00 ? 9  GLY A H    3  
ATOM   1654  H HA2  . GLY A 1 9  ? 0.271   12.040 -6.989  1.00 1.00 ? 9  GLY A HA2  3  
ATOM   1655  H HA3  . GLY A 1 9  ? 0.863   13.458 -6.104  1.00 1.00 ? 9  GLY A HA3  3  
ATOM   1656  N N    . THR A 1 10 ? 0.319   15.184 -8.066  1.00 1.00 ? 10 THR A N    3  
ATOM   1657  C CA   . THR A 1 10 ? -0.149  16.236 -8.951  1.00 1.00 ? 10 THR A CA   3  
ATOM   1658  C C    . THR A 1 10 ? 1.122   16.923 -9.470  1.00 1.00 ? 10 THR A C    3  
ATOM   1659  O O    . THR A 1 10 ? 1.540   16.790 -10.622 1.00 1.00 ? 10 THR A O    3  
ATOM   1660  C CB   . THR A 1 10 ? -1.030  17.237 -8.169  1.00 1.00 ? 10 THR A CB   3  
ATOM   1661  O OG1  . THR A 1 10 ? -0.415  17.598 -6.940  1.00 1.00 ? 10 THR A OG1  3  
ATOM   1662  C CG2  . THR A 1 10 ? -2.400  16.669 -7.815  1.00 1.00 ? 10 THR A CG2  3  
ATOM   1663  H H    . THR A 1 10 ? 1.170   15.387 -7.562  1.00 1.00 ? 10 THR A H    3  
ATOM   1664  H HA   . THR A 1 10 ? -0.703  15.822 -9.797  1.00 1.00 ? 10 THR A HA   3  
ATOM   1665  H HB   . THR A 1 10 ? -1.178  18.127 -8.784  1.00 1.00 ? 10 THR A HB   3  
ATOM   1666  H HG1  . THR A 1 10 ? -1.012  18.175 -6.453  1.00 1.00 ? 10 THR A HG1  3  
ATOM   1667  H HG21 . THR A 1 10 ? -2.870  16.238 -8.699  1.00 1.00 ? 10 THR A HG21 3  
ATOM   1668  H HG22 . THR A 1 10 ? -2.276  15.914 -7.042  1.00 1.00 ? 10 THR A HG22 3  
ATOM   1669  H HG23 . THR A 1 10 ? -3.038  17.464 -7.427  1.00 1.00 ? 10 THR A HG23 3  
ATOM   1670  N N    . TRP A 1 11 ? 1.752   17.631 -8.539  1.00 1.00 ? 11 TRP A N    3  
ATOM   1671  C CA   . TRP A 1 11 ? 2.846   18.556 -8.716  1.00 1.00 ? 11 TRP A CA   3  
ATOM   1672  C C    . TRP A 1 11 ? 4.133   17.836 -9.122  1.00 1.00 ? 11 TRP A C    3  
ATOM   1673  O O    . TRP A 1 11 ? 5.030   17.606 -8.316  1.00 1.00 ? 11 TRP A O    3  
ATOM   1674  C CB   . TRP A 1 11 ? 2.976   19.309 -7.394  1.00 1.00 ? 11 TRP A CB   3  
ATOM   1675  C CG   . TRP A 1 11 ? 3.792   20.553 -7.375  1.00 1.00 ? 11 TRP A CG   3  
ATOM   1676  C CD1  . TRP A 1 11 ? 4.750   20.933 -8.249  1.00 1.00 ? 11 TRP A CD1  3  
ATOM   1677  C CD2  . TRP A 1 11 ? 3.744   21.586 -6.361  1.00 1.00 ? 11 TRP A CD2  3  
ATOM   1678  N NE1  . TRP A 1 11 ? 5.291   22.132 -7.846  1.00 1.00 ? 11 TRP A NE1  3  
ATOM   1679  C CE2  . TRP A 1 11 ? 4.719   22.574 -6.670  1.00 1.00 ? 11 TRP A CE2  3  
ATOM   1680  C CE3  . TRP A 1 11 ? 2.978   21.769 -5.194  1.00 1.00 ? 11 TRP A CE3  3  
ATOM   1681  C CZ2  . TRP A 1 11 ? 4.947   23.677 -5.838  1.00 1.00 ? 11 TRP A CZ2  3  
ATOM   1682  C CZ3  . TRP A 1 11 ? 3.239   22.838 -4.327  1.00 1.00 ? 11 TRP A CZ3  3  
ATOM   1683  C CH2  . TRP A 1 11 ? 4.254   23.755 -4.619  1.00 1.00 ? 11 TRP A CH2  3  
ATOM   1684  H H    . TRP A 1 11 ? 1.291   17.649 -7.635  1.00 1.00 ? 11 TRP A H    3  
ATOM   1685  H HA   . TRP A 1 11 ? 2.571   19.273 -9.491  1.00 1.00 ? 11 TRP A HA   3  
ATOM   1686  H HB2  . TRP A 1 11 ? 1.974   19.617 -7.090  1.00 1.00 ? 11 TRP A HB2  3  
ATOM   1687  H HB3  . TRP A 1 11 ? 3.355   18.635 -6.626  1.00 1.00 ? 11 TRP A HB3  3  
ATOM   1688  H HD1  . TRP A 1 11 ? 5.074   20.383 -9.118  1.00 1.00 ? 11 TRP A HD1  3  
ATOM   1689  H HE1  . TRP A 1 11 ? 6.077   22.599 -8.292  1.00 1.00 ? 11 TRP A HE1  3  
ATOM   1690  H HE3  . TRP A 1 11 ? 2.191   21.073 -4.949  1.00 1.00 ? 11 TRP A HE3  3  
ATOM   1691  H HZ2  . TRP A 1 11 ? 5.707   24.404 -6.085  1.00 1.00 ? 11 TRP A HZ2  3  
ATOM   1692  H HZ3  . TRP A 1 11 ? 2.660   22.951 -3.427  1.00 1.00 ? 11 TRP A HZ3  3  
ATOM   1693  H HH2  . TRP A 1 11 ? 4.524   24.470 -3.866  1.00 1.00 ? 11 TRP A HH2  3  
ATOM   1694  N N    . SER A 1 12 ? 4.240   17.534 -10.412 1.00 1.00 ? 12 SER A N    3  
ATOM   1695  C CA   . SER A 1 12 ? 5.334   16.734 -10.943 1.00 1.00 ? 12 SER A CA   3  
ATOM   1696  C C    . SER A 1 12 ? 6.547   17.600 -11.332 1.00 1.00 ? 12 SER A C    3  
ATOM   1697  O O    . SER A 1 12 ? 7.619   17.057 -11.607 1.00 1.00 ? 12 SER A O    3  
ATOM   1698  C CB   . SER A 1 12 ? 4.789   15.940 -12.134 1.00 1.00 ? 12 SER A CB   3  
ATOM   1699  O OG   . SER A 1 12 ? 3.643   15.202 -11.738 1.00 1.00 ? 12 SER A OG   3  
ATOM   1700  H H    . SER A 1 12 ? 3.414   17.673 -10.981 1.00 1.00 ? 12 SER A H    3  
ATOM   1701  H HA   . SER A 1 12 ? 5.659   16.014 -10.188 1.00 1.00 ? 12 SER A HA   3  
ATOM   1702  H HB2  . SER A 1 12 ? 4.524   16.618 -12.948 1.00 1.00 ? 12 SER A HB2  3  
ATOM   1703  H HB3  . SER A 1 12 ? 5.556   15.252 -12.493 1.00 1.00 ? 12 SER A HB3  3  
ATOM   1704  H HG   . SER A 1 12 ? 2.940   15.802 -11.446 1.00 1.00 ? 12 SER A HG   3  
ATOM   1705  N N    . GLY A 1 13 ? 6.380   18.928 -11.353 1.00 1.00 ? 13 GLY A N    3  
ATOM   1706  C CA   . GLY A 1 13 ? 7.427   19.897 -11.655 1.00 1.00 ? 13 GLY A CA   3  
ATOM   1707  C C    . GLY A 1 13 ? 8.314   20.203 -10.445 1.00 1.00 ? 13 GLY A C    3  
ATOM   1708  O O    . GLY A 1 13 ? 8.389   19.413 -9.506  1.00 1.00 ? 13 GLY A O    3  
ATOM   1709  H H    . GLY A 1 13 ? 5.473   19.292 -11.107 1.00 1.00 ? 13 GLY A H    3  
ATOM   1710  H HA2  . GLY A 1 13 ? 8.054   19.537 -12.466 1.00 1.00 ? 13 GLY A HA2  3  
ATOM   1711  H HA3  . GLY A 1 13 ? 6.945   20.820 -11.979 1.00 1.00 ? 13 GLY A HA3  3  
ATOM   1712  N N    . VAL A 1 14 ? 8.985   21.362 -10.475 1.00 1.00 ? 14 VAL A N    3  
ATOM   1713  C CA   . VAL A 1 14 ? 9.780   21.858 -9.356  1.00 1.00 ? 14 VAL A CA   3  
ATOM   1714  C C    . VAL A 1 14 ? 8.851   22.043 -8.158  1.00 1.00 ? 14 VAL A C    3  
ATOM   1715  O O    . VAL A 1 14 ? 7.875   22.782 -8.251  1.00 1.00 ? 14 VAL A O    3  
ATOM   1716  C CB   . VAL A 1 14 ? 10.437  23.207 -9.696  1.00 1.00 ? 14 VAL A CB   3  
ATOM   1717  C CG1  . VAL A 1 14 ? 11.292  23.725 -8.530  1.00 1.00 ? 14 VAL A CG1  3  
ATOM   1718  C CG2  . VAL A 1 14 ? 11.317  23.162 -10.951 1.00 1.00 ? 14 VAL A CG2  3  
ATOM   1719  H H    . VAL A 1 14 ? 8.852   21.981 -11.260 1.00 1.00 ? 14 VAL A H    3  
ATOM   1720  H HA   . VAL A 1 14 ? 10.564  21.133 -9.139  1.00 1.00 ? 14 VAL A HA   3  
ATOM   1721  H HB   . VAL A 1 14 ? 9.630   23.915 -9.850  1.00 1.00 ? 14 VAL A HB   3  
ATOM   1722  H HG11 . VAL A 1 14 ? 12.046  22.985 -8.263  1.00 1.00 ? 14 VAL A HG11 3  
ATOM   1723  H HG12 . VAL A 1 14 ? 11.789  24.649 -8.822  1.00 1.00 ? 14 VAL A HG12 3  
ATOM   1724  H HG13 . VAL A 1 14 ? 10.671  23.935 -7.660  1.00 1.00 ? 14 VAL A HG13 3  
ATOM   1725  H HG21 . VAL A 1 14 ? 10.772  22.759 -11.804 1.00 1.00 ? 14 VAL A HG21 3  
ATOM   1726  H HG22 . VAL A 1 14 ? 11.640  24.174 -11.200 1.00 1.00 ? 14 VAL A HG22 3  
ATOM   1727  H HG23 . VAL A 1 14 ? 12.204  22.557 -10.762 1.00 1.00 ? 14 VAL A HG23 3  
ATOM   1728  N N    . CYS A 1 15 ? 9.156   21.389 -7.042  1.00 1.00 ? 15 CYS A N    3  
ATOM   1729  C CA   . CYS A 1 15 ? 8.277   21.340 -5.876  1.00 1.00 ? 15 CYS A CA   3  
ATOM   1730  C C    . CYS A 1 15 ? 8.275   22.650 -5.099  1.00 1.00 ? 15 CYS A C    3  
ATOM   1731  O O    . CYS A 1 15 ? 7.312   22.937 -4.398  1.00 1.00 ? 15 CYS A O    3  
ATOM   1732  C CB   . CYS A 1 15 ? 8.676   20.213 -4.923  1.00 1.00 ? 15 CYS A CB   3  
ATOM   1733  S SG   . CYS A 1 15 ? 9.855   20.686 -3.638  1.00 1.00 ? 15 CYS A SG   3  
ATOM   1734  H H    . CYS A 1 15 ? 9.989   20.816 -7.084  1.00 1.00 ? 15 CYS A H    3  
ATOM   1735  H HA   . CYS A 1 15 ? 7.264   21.130 -6.221  1.00 1.00 ? 15 CYS A HA   3  
ATOM   1736  H HB2  . CYS A 1 15 ? 7.783   19.852 -4.413  1.00 1.00 ? 15 CYS A HB2  3  
ATOM   1737  H HB3  . CYS A 1 15 ? 9.098   19.397 -5.496  1.00 1.00 ? 15 CYS A HB3  3  
ATOM   1738  N N    . GLY A 1 16 ? 9.384   23.394 -5.121  1.00 1.00 ? 16 GLY A N    3  
ATOM   1739  C CA   . GLY A 1 16 ? 9.520   24.650 -4.396  1.00 1.00 ? 16 GLY A CA   3  
ATOM   1740  C C    . GLY A 1 16 ? 9.637   24.493 -2.872  1.00 1.00 ? 16 GLY A C    3  
ATOM   1741  O O    . GLY A 1 16 ? 10.452  25.175 -2.255  1.00 1.00 ? 16 GLY A O    3  
ATOM   1742  H H    . GLY A 1 16 ? 10.166  23.069 -5.668  1.00 1.00 ? 16 GLY A H    3  
ATOM   1743  H HA2  . GLY A 1 16 ? 10.411  25.160 -4.762  1.00 1.00 ? 16 GLY A HA2  3  
ATOM   1744  H HA3  . GLY A 1 16 ? 8.656   25.281 -4.611  1.00 1.00 ? 16 GLY A HA3  3  
ATOM   1745  N N    . ASN A 1 17 ? 8.827   23.631 -2.245  1.00 1.00 ? 17 ASN A N    3  
ATOM   1746  C CA   . ASN A 1 17 ? 8.689   23.562 -0.797  1.00 1.00 ? 17 ASN A CA   3  
ATOM   1747  C C    . ASN A 1 17 ? 7.871   22.340 -0.363  1.00 1.00 ? 17 ASN A C    3  
ATOM   1748  O O    . ASN A 1 17 ? 6.794   22.076 -0.897  1.00 1.00 ? 17 ASN A O    3  
ATOM   1749  C CB   . ASN A 1 17 ? 8.007   24.837 -0.283  1.00 1.00 ? 17 ASN A CB   3  
ATOM   1750  C CG   . ASN A 1 17 ? 7.713   24.730 1.208   1.00 1.00 ? 17 ASN A CG   3  
ATOM   1751  O OD1  . ASN A 1 17 ? 6.608   24.374 1.601   1.00 1.00 ? 17 ASN A OD1  3  
ATOM   1752  N ND2  . ASN A 1 17 ? 8.706   24.996 2.050   1.00 1.00 ? 17 ASN A ND2  3  
ATOM   1753  H H    . ASN A 1 17 ? 8.240   23.027 -2.809  1.00 1.00 ? 17 ASN A H    3  
ATOM   1754  H HA   . ASN A 1 17 ? 9.688   23.499 -0.357  1.00 1.00 ? 17 ASN A HA   3  
ATOM   1755  H HB2  . ASN A 1 17 ? 8.634   25.710 -0.464  1.00 1.00 ? 17 ASN A HB2  3  
ATOM   1756  H HB3  . ASN A 1 17 ? 7.064   24.975 -0.812  1.00 1.00 ? 17 ASN A HB3  3  
ATOM   1757  H HD21 . ASN A 1 17 ? 9.600   25.310 1.699   1.00 1.00 ? 17 ASN A HD21 3  
ATOM   1758  H HD22 . ASN A 1 17 ? 8.528   24.963 3.042   1.00 1.00 ? 17 ASN A HD22 3  
ATOM   1759  N N    . ASN A 1 18 ? 8.373   21.629 0.653   1.00 1.00 ? 18 ASN A N    3  
ATOM   1760  C CA   . ASN A 1 18 ? 7.759   20.464 1.268   1.00 1.00 ? 18 ASN A CA   3  
ATOM   1761  C C    . ASN A 1 18 ? 6.294   20.674 1.631   1.00 1.00 ? 18 ASN A C    3  
ATOM   1762  O O    . ASN A 1 18 ? 5.422   19.936 1.179   1.00 1.00 ? 18 ASN A O    3  
ATOM   1763  C CB   . ASN A 1 18 ? 8.549   20.132 2.536   1.00 1.00 ? 18 ASN A CB   3  
ATOM   1764  C CG   . ASN A 1 18 ? 8.065   18.823 3.135   1.00 1.00 ? 18 ASN A CG   3  
ATOM   1765  O OD1  . ASN A 1 18 ? 7.022   18.767 3.782   1.00 1.00 ? 18 ASN A OD1  3  
ATOM   1766  N ND2  . ASN A 1 18 ? 8.800   17.745 2.906   1.00 1.00 ? 18 ASN A ND2  3  
ATOM   1767  H H    . ASN A 1 18 ? 9.269   21.897 1.032   1.00 1.00 ? 18 ASN A H    3  
ATOM   1768  H HA   . ASN A 1 18 ? 7.818   19.628 0.573   1.00 1.00 ? 18 ASN A HA   3  
ATOM   1769  H HB2  . ASN A 1 18 ? 9.603   20.068 2.289   1.00 1.00 ? 18 ASN A HB2  3  
ATOM   1770  H HB3  . ASN A 1 18 ? 8.443   20.919 3.282   1.00 1.00 ? 18 ASN A HB3  3  
ATOM   1771  H HD21 . ASN A 1 18 ? 9.692   17.799 2.426   1.00 1.00 ? 18 ASN A HD21 3  
ATOM   1772  H HD22 . ASN A 1 18 ? 8.520   16.899 3.367   1.00 1.00 ? 18 ASN A HD22 3  
ATOM   1773  N N    . ASN A 1 19 ? 6.050   21.637 2.517   1.00 1.00 ? 19 ASN A N    3  
ATOM   1774  C CA   . ASN A 1 19 ? 4.721   21.917 3.048   1.00 1.00 ? 19 ASN A CA   3  
ATOM   1775  C C    . ASN A 1 19 ? 3.738   22.235 1.927   1.00 1.00 ? 19 ASN A C    3  
ATOM   1776  O O    . ASN A 1 19 ? 2.644   21.683 1.901   1.00 1.00 ? 19 ASN A O    3  
ATOM   1777  C CB   . ASN A 1 19 ? 4.738   23.054 4.075   1.00 1.00 ? 19 ASN A CB   3  
ATOM   1778  C CG   . ASN A 1 19 ? 3.325   23.276 4.615   1.00 1.00 ? 19 ASN A CG   3  
ATOM   1779  O OD1  . ASN A 1 19 ? 2.912   22.602 5.552   1.00 1.00 ? 19 ASN A OD1  3  
ATOM   1780  N ND2  . ASN A 1 19 ? 2.564   24.196 4.026   1.00 1.00 ? 19 ASN A ND2  3  
ATOM   1781  H H    . ASN A 1 19 ? 6.854   22.142 2.855   1.00 1.00 ? 19 ASN A H    3  
ATOM   1782  H HA   . ASN A 1 19 ? 4.373   21.020 3.562   1.00 1.00 ? 19 ASN A HA   3  
ATOM   1783  H HB2  . ASN A 1 19 ? 5.394   22.781 4.902   1.00 1.00 ? 19 ASN A HB2  3  
ATOM   1784  H HB3  . ASN A 1 19 ? 5.106   23.976 3.626   1.00 1.00 ? 19 ASN A HB3  3  
ATOM   1785  H HD21 . ASN A 1 19 ? 2.904   24.743 3.250   1.00 1.00 ? 19 ASN A HD21 3  
ATOM   1786  H HD22 . ASN A 1 19 ? 1.627   24.332 4.378   1.00 1.00 ? 19 ASN A HD22 3  
ATOM   1787  N N    . ALA A 1 20 ? 4.115   23.129 1.010   1.00 1.00 ? 20 ALA A N    3  
ATOM   1788  C CA   . ALA A 1 20 ? 3.268   23.452 -0.129  1.00 1.00 ? 20 ALA A CA   3  
ATOM   1789  C C    . ALA A 1 20 ? 2.942   22.179 -0.908  1.00 1.00 ? 20 ALA A C    3  
ATOM   1790  O O    . ALA A 1 20 ? 1.772   21.903 -1.160  1.00 1.00 ? 20 ALA A O    3  
ATOM   1791  C CB   . ALA A 1 20 ? 3.937   24.489 -1.032  1.00 1.00 ? 20 ALA A CB   3  
ATOM   1792  H H    . ALA A 1 20 ? 5.032   23.558 1.088   1.00 1.00 ? 20 ALA A H    3  
ATOM   1793  H HA   . ALA A 1 20 ? 2.334   23.880 0.242   1.00 1.00 ? 20 ALA A HA   3  
ATOM   1794  H HB1  . ALA A 1 20 ? 4.182   25.382 -0.458  1.00 1.00 ? 20 ALA A HB1  3  
ATOM   1795  H HB2  . ALA A 1 20 ? 4.844   24.077 -1.475  1.00 1.00 ? 20 ALA A HB2  3  
ATOM   1796  H HB3  . ALA A 1 20 ? 3.243   24.764 -1.828  1.00 1.00 ? 20 ALA A HB3  3  
ATOM   1797  N N    . CYS A 1 21 ? 3.969   21.400 -1.272  1.00 1.00 ? 21 CYS A N    3  
ATOM   1798  C CA   . CYS A 1 21 ? 3.787   20.140 -1.987  1.00 1.00 ? 21 CYS A CA   3  
ATOM   1799  C C    . CYS A 1 21 ? 2.762   19.250 -1.270  1.00 1.00 ? 21 CYS A C    3  
ATOM   1800  O O    . CYS A 1 21 ? 1.753   18.839 -1.846  1.00 1.00 ? 21 CYS A O    3  
ATOM   1801  C CB   . CYS A 1 21 ? 5.131   19.408 -2.123  1.00 1.00 ? 21 CYS A CB   3  
ATOM   1802  S SG   . CYS A 1 21 ? 5.066   17.596 -2.038  1.00 1.00 ? 21 CYS A SG   3  
ATOM   1803  H H    . CYS A 1 21 ? 4.917   21.699 -1.051  1.00 1.00 ? 21 CYS A H    3  
ATOM   1804  H HA   . CYS A 1 21 ? 3.431   20.402 -2.983  1.00 1.00 ? 21 CYS A HA   3  
ATOM   1805  H HB2  . CYS A 1 21 ? 5.603   19.702 -3.059  1.00 1.00 ? 21 CYS A HB2  3  
ATOM   1806  H HB3  . CYS A 1 21 ? 5.790   19.705 -1.312  1.00 1.00 ? 21 CYS A HB3  3  
ATOM   1807  N N    . LYS A 1 22 ? 3.048   18.968 0.004   1.00 1.00 ? 22 LYS A N    3  
ATOM   1808  C CA   . LYS A 1 22 ? 2.254   18.146 0.903   1.00 1.00 ? 22 LYS A CA   3  
ATOM   1809  C C    . LYS A 1 22 ? 0.801   18.598 0.861   1.00 1.00 ? 22 LYS A C    3  
ATOM   1810  O O    . LYS A 1 22 ? -0.091  17.835 0.487   1.00 1.00 ? 22 LYS A O    3  
ATOM   1811  C CB   . LYS A 1 22 ? 2.873   18.296 2.304   1.00 1.00 ? 22 LYS A CB   3  
ATOM   1812  C CG   . LYS A 1 22 ? 2.057   17.713 3.469   1.00 1.00 ? 22 LYS A CG   3  
ATOM   1813  C CD   . LYS A 1 22 ? 2.687   18.011 4.847   1.00 1.00 ? 22 LYS A CD   3  
ATOM   1814  C CE   . LYS A 1 22 ? 3.827   17.080 5.301   1.00 1.00 ? 22 LYS A CE   3  
ATOM   1815  N NZ   . LYS A 1 22 ? 5.014   17.127 4.424   1.00 1.00 ? 22 LYS A NZ   3  
ATOM   1816  H H    . LYS A 1 22 ? 3.899   19.374 0.375   1.00 1.00 ? 22 LYS A H    3  
ATOM   1817  H HA   . LYS A 1 22 ? 2.295   17.108 0.573   1.00 1.00 ? 22 LYS A HA   3  
ATOM   1818  H HB2  . LYS A 1 22 ? 3.865   17.862 2.247   1.00 1.00 ? 22 LYS A HB2  3  
ATOM   1819  H HB3  . LYS A 1 22 ? 3.003   19.353 2.519   1.00 1.00 ? 22 LYS A HB3  3  
ATOM   1820  H HG2  . LYS A 1 22 ? 1.084   18.206 3.475   1.00 1.00 ? 22 LYS A HG2  3  
ATOM   1821  H HG3  . LYS A 1 22 ? 1.870   16.650 3.325   1.00 1.00 ? 22 LYS A HG3  3  
ATOM   1822  H HD2  . LYS A 1 22 ? 3.013   19.053 4.883   1.00 1.00 ? 22 LYS A HD2  3  
ATOM   1823  H HD3  . LYS A 1 22 ? 1.891   17.905 5.588   1.00 1.00 ? 22 LYS A HD3  3  
ATOM   1824  H HE2  . LYS A 1 22 ? 4.129   17.364 6.311   1.00 1.00 ? 22 LYS A HE2  3  
ATOM   1825  H HE3  . LYS A 1 22 ? 3.454   16.054 5.332   1.00 1.00 ? 22 LYS A HE3  3  
ATOM   1826  H HZ1  . LYS A 1 22 ? 5.429   18.049 4.338   1.00 1.00 ? 22 LYS A HZ1  3  
ATOM   1827  H HZ2  . LYS A 1 22 ? 5.741   16.483 4.718   1.00 1.00 ? 22 LYS A HZ2  3  
ATOM   1828  H HZ3  . LYS A 1 22 ? 4.747   16.792 3.508   1.00 1.00 ? 22 LYS A HZ3  3  
ATOM   1829  N N    . ASN A 1 23 ? 0.601   19.852 1.266   1.00 1.00 ? 23 ASN A N    3  
ATOM   1830  C CA   . ASN A 1 23 ? -0.683  20.514 1.310   1.00 1.00 ? 23 ASN A CA   3  
ATOM   1831  C C    . ASN A 1 23 ? -1.388  20.301 -0.018  1.00 1.00 ? 23 ASN A C    3  
ATOM   1832  O O    . ASN A 1 23 ? -2.395  19.604 -0.061  1.00 1.00 ? 23 ASN A O    3  
ATOM   1833  C CB   . ASN A 1 23 ? -0.449  22.000 1.624   1.00 1.00 ? 23 ASN A CB   3  
ATOM   1834  C CG   . ASN A 1 23 ? -1.653  22.925 1.458   1.00 1.00 ? 23 ASN A CG   3  
ATOM   1835  O OD1  . ASN A 1 23 ? -2.783  22.516 1.194   1.00 1.00 ? 23 ASN A OD1  3  
ATOM   1836  N ND2  . ASN A 1 23 ? -1.393  24.220 1.610   1.00 1.00 ? 23 ASN A ND2  3  
ATOM   1837  H H    . ASN A 1 23 ? 1.417   20.407 1.500   1.00 1.00 ? 23 ASN A H    3  
ATOM   1838  H HA   . ASN A 1 23 ? -1.268  20.043 2.104   1.00 1.00 ? 23 ASN A HA   3  
ATOM   1839  H HB2  . ASN A 1 23 ? -0.085  22.083 2.649   1.00 1.00 ? 23 ASN A HB2  3  
ATOM   1840  H HB3  . ASN A 1 23 ? 0.324   22.378 0.957   1.00 1.00 ? 23 ASN A HB3  3  
ATOM   1841  H HD21 . ASN A 1 23 ? -0.453  24.524 1.813   1.00 1.00 ? 23 ASN A HD21 3  
ATOM   1842  H HD22 . ASN A 1 23 ? -2.132  24.894 1.514   1.00 1.00 ? 23 ASN A HD22 3  
ATOM   1843  N N    . GLN A 1 24 ? -0.837  20.839 -1.107  1.00 1.00 ? 24 GLN A N    3  
ATOM   1844  C CA   . GLN A 1 24 ? -1.458  20.742 -2.415  1.00 1.00 ? 24 GLN A CA   3  
ATOM   1845  C C    . GLN A 1 24 ? -1.852  19.305 -2.747  1.00 1.00 ? 24 GLN A C    3  
ATOM   1846  O O    . GLN A 1 24 ? -2.983  19.097 -3.173  1.00 1.00 ? 24 GLN A O    3  
ATOM   1847  C CB   . GLN A 1 24 ? -0.583  21.392 -3.491  1.00 1.00 ? 24 GLN A CB   3  
ATOM   1848  C CG   . GLN A 1 24 ? -0.614  22.919 -3.307  1.00 1.00 ? 24 GLN A CG   3  
ATOM   1849  C CD   . GLN A 1 24 ? 0.164   23.715 -4.350  1.00 1.00 ? 24 GLN A CD   3  
ATOM   1850  O OE1  . GLN A 1 24 ? 0.679   24.786 -4.052  1.00 1.00 ? 24 GLN A OE1  3  
ATOM   1851  N NE2  . GLN A 1 24 ? 0.261   23.219 -5.580  1.00 1.00 ? 24 GLN A NE2  3  
ATOM   1852  H H    . GLN A 1 24 ? 0.064   21.300 -1.031  1.00 1.00 ? 24 GLN A H    3  
ATOM   1853  H HA   . GLN A 1 24 ? -2.400  21.293 -2.385  1.00 1.00 ? 24 GLN A HA   3  
ATOM   1854  H HB2  . GLN A 1 24 ? 0.437   21.012 -3.422  1.00 1.00 ? 24 GLN A HB2  3  
ATOM   1855  H HB3  . GLN A 1 24 ? -1.003  21.131 -4.464  1.00 1.00 ? 24 GLN A HB3  3  
ATOM   1856  H HG2  . GLN A 1 24 ? -1.646  23.261 -3.353  1.00 1.00 ? 24 GLN A HG2  3  
ATOM   1857  H HG3  . GLN A 1 24 ? -0.205  23.170 -2.329  1.00 1.00 ? 24 GLN A HG3  3  
ATOM   1858  H HE21 . GLN A 1 24 ? -0.113  22.312 -5.798  1.00 1.00 ? 24 GLN A HE21 3  
ATOM   1859  H HE22 . GLN A 1 24 ? 0.797   23.739 -6.258  1.00 1.00 ? 24 GLN A HE22 3  
ATOM   1860  N N    . CYS A 1 25 ? -0.994  18.303 -2.520  1.00 1.00 ? 25 CYS A N    3  
ATOM   1861  C CA   . CYS A 1 25 ? -1.422  16.941 -2.824  1.00 1.00 ? 25 CYS A CA   3  
ATOM   1862  C C    . CYS A 1 25 ? -2.658  16.531 -2.020  1.00 1.00 ? 25 CYS A C    3  
ATOM   1863  O O    . CYS A 1 25 ? -3.677  16.166 -2.610  1.00 1.00 ? 25 CYS A O    3  
ATOM   1864  C CB   . CYS A 1 25 ? -0.337  15.886 -2.634  1.00 1.00 ? 25 CYS A CB   3  
ATOM   1865  S SG   . CYS A 1 25 ? -0.896  14.371 -3.456  1.00 1.00 ? 25 CYS A SG   3  
ATOM   1866  H H    . CYS A 1 25 ? -0.067  18.485 -2.142  1.00 1.00 ? 25 CYS A H    3  
ATOM   1867  H HA   . CYS A 1 25 ? -1.690  16.924 -3.883  1.00 1.00 ? 25 CYS A HA   3  
ATOM   1868  H HB2  . CYS A 1 25 ? 0.607   16.207 -3.059  1.00 1.00 ? 25 CYS A HB2  3  
ATOM   1869  H HB3  . CYS A 1 25 ? -0.184  15.683 -1.573  1.00 1.00 ? 25 CYS A HB3  3  
ATOM   1870  N N    . ILE A 1 26 ? -2.573  16.581 -0.682  1.00 1.00 ? 26 ILE A N    3  
ATOM   1871  C CA   . ILE A 1 26 ? -3.633  16.053 0.185   1.00 1.00 ? 26 ILE A CA   3  
ATOM   1872  C C    . ILE A 1 26 ? -4.876  16.960 0.184   1.00 1.00 ? 26 ILE A C    3  
ATOM   1873  O O    . ILE A 1 26 ? -5.965  16.562 0.612   1.00 1.00 ? 26 ILE A O    3  
ATOM   1874  C CB   . ILE A 1 26 ? -3.096  15.801 1.610   1.00 1.00 ? 26 ILE A CB   3  
ATOM   1875  C CG1  . ILE A 1 26 ? -2.899  17.104 2.404   1.00 1.00 ? 26 ILE A CG1  3  
ATOM   1876  C CG2  . ILE A 1 26 ? -1.800  14.978 1.555   1.00 1.00 ? 26 ILE A CG2  3  
ATOM   1877  C CD1  . ILE A 1 26 ? -2.295  16.883 3.794   1.00 1.00 ? 26 ILE A CD1  3  
ATOM   1878  H H    . ILE A 1 26 ? -1.750  17.006 -0.255  1.00 1.00 ? 26 ILE A H    3  
ATOM   1879  H HA   . ILE A 1 26 ? -3.944  15.086 -0.213  1.00 1.00 ? 26 ILE A HA   3  
ATOM   1880  H HB   . ILE A 1 26 ? -3.841  15.208 2.141   1.00 1.00 ? 26 ILE A HB   3  
ATOM   1881  H HG12 . ILE A 1 26 ? -2.253  17.779 1.851   1.00 1.00 ? 26 ILE A HG12 3  
ATOM   1882  H HG13 . ILE A 1 26 ? -3.868  17.580 2.547   1.00 1.00 ? 26 ILE A HG13 3  
ATOM   1883  H HG21 . ILE A 1 26 ? -1.946  14.097 0.936   1.00 1.00 ? 26 ILE A HG21 3  
ATOM   1884  H HG22 . ILE A 1 26 ? -0.977  15.563 1.148   1.00 1.00 ? 26 ILE A HG22 3  
ATOM   1885  H HG23 . ILE A 1 26 ? -1.527  14.649 2.553   1.00 1.00 ? 26 ILE A HG23 3  
ATOM   1886  H HD11 . ILE A 1 26 ? -2.865  16.125 4.333   1.00 1.00 ? 26 ILE A HD11 3  
ATOM   1887  H HD12 . ILE A 1 26 ? -1.254  16.574 3.716   1.00 1.00 ? 26 ILE A HD12 3  
ATOM   1888  H HD13 . ILE A 1 26 ? -2.335  17.820 4.352   1.00 1.00 ? 26 ILE A HD13 3  
ATOM   1889  N N    . ASN A 1 27 ? -4.707  18.189 -0.301  1.00 1.00 ? 27 ASN A N    3  
ATOM   1890  C CA   . ASN A 1 27 ? -5.742  19.195 -0.436  1.00 1.00 ? 27 ASN A CA   3  
ATOM   1891  C C    . ASN A 1 27 ? -6.496  18.953 -1.742  1.00 1.00 ? 27 ASN A C    3  
ATOM   1892  O O    . ASN A 1 27 ? -7.705  18.725 -1.708  1.00 1.00 ? 27 ASN A O    3  
ATOM   1893  C CB   . ASN A 1 27 ? -5.068  20.568 -0.363  1.00 1.00 ? 27 ASN A CB   3  
ATOM   1894  C CG   . ASN A 1 27 ? -6.010  21.757 -0.312  1.00 1.00 ? 27 ASN A CG   3  
ATOM   1895  O OD1  . ASN A 1 27 ? -7.157  21.689 -0.738  1.00 1.00 ? 27 ASN A OD1  3  
ATOM   1896  N ND2  . ASN A 1 27 ? -5.509  22.867 0.222   1.00 1.00 ? 27 ASN A ND2  3  
ATOM   1897  H H    . ASN A 1 27 ? -3.763  18.471 -0.548  1.00 1.00 ? 27 ASN A H    3  
ATOM   1898  H HA   . ASN A 1 27 ? -6.438  19.117 0.401   1.00 1.00 ? 27 ASN A HA   3  
ATOM   1899  H HB2  . ASN A 1 27 ? -4.499  20.584 0.566   1.00 1.00 ? 27 ASN A HB2  3  
ATOM   1900  H HB3  . ASN A 1 27 ? -4.396  20.703 -1.209  1.00 1.00 ? 27 ASN A HB3  3  
ATOM   1901  H HD21 . ASN A 1 27 ? -4.554  22.860 0.581   1.00 1.00 ? 27 ASN A HD21 3  
ATOM   1902  H HD22 . ASN A 1 27 ? -6.089  23.689 0.285   1.00 1.00 ? 27 ASN A HD22 3  
ATOM   1903  N N    . LEU A 1 28 ? -5.787  18.909 -2.875  1.00 1.00 ? 28 LEU A N    3  
ATOM   1904  C CA   . LEU A 1 28 ? -6.394  18.683 -4.181  1.00 1.00 ? 28 LEU A CA   3  
ATOM   1905  C C    . LEU A 1 28 ? -6.899  17.242 -4.287  1.00 1.00 ? 28 LEU A C    3  
ATOM   1906  O O    . LEU A 1 28 ? -8.108  17.028 -4.358  1.00 1.00 ? 28 LEU A O    3  
ATOM   1907  C CB   . LEU A 1 28 ? -5.410  19.028 -5.311  1.00 1.00 ? 28 LEU A CB   3  
ATOM   1908  C CG   . LEU A 1 28 ? -5.392  20.519 -5.693  1.00 1.00 ? 28 LEU A CG   3  
ATOM   1909  C CD1  . LEU A 1 28 ? -5.073  21.458 -4.523  1.00 1.00 ? 28 LEU A CD1  3  
ATOM   1910  C CD2  . LEU A 1 28 ? -4.358  20.731 -6.804  1.00 1.00 ? 28 LEU A CD2  3  
ATOM   1911  H H    . LEU A 1 28 ? -4.780  19.026 -2.839  1.00 1.00 ? 28 LEU A H    3  
ATOM   1912  H HA   . LEU A 1 28 ? -7.264  19.336 -4.284  1.00 1.00 ? 28 LEU A HA   3  
ATOM   1913  H HB2  . LEU A 1 28 ? -4.407  18.688 -5.059  1.00 1.00 ? 28 LEU A HB2  3  
ATOM   1914  H HB3  . LEU A 1 28 ? -5.721  18.484 -6.200  1.00 1.00 ? 28 LEU A HB3  3  
ATOM   1915  H HG   . LEU A 1 28 ? -6.375  20.788 -6.084  1.00 1.00 ? 28 LEU A HG   3  
ATOM   1916  H HD11 . LEU A 1 28 ? -4.110  21.204 -4.088  1.00 1.00 ? 28 LEU A HD11 3  
ATOM   1917  H HD12 . LEU A 1 28 ? -5.034  22.486 -4.884  1.00 1.00 ? 28 LEU A HD12 3  
ATOM   1918  H HD13 . LEU A 1 28 ? -5.848  21.397 -3.760  1.00 1.00 ? 28 LEU A HD13 3  
ATOM   1919  H HD21 . LEU A 1 28 ? -4.596  20.096 -7.659  1.00 1.00 ? 28 LEU A HD21 3  
ATOM   1920  H HD22 . LEU A 1 28 ? -4.369  21.771 -7.128  1.00 1.00 ? 28 LEU A HD22 3  
ATOM   1921  H HD23 . LEU A 1 28 ? -3.360  20.481 -6.440  1.00 1.00 ? 28 LEU A HD23 3  
ATOM   1922  N N    . GLU A 1 29 ? -6.003  16.246 -4.268  1.00 1.00 ? 29 GLU A N    3  
ATOM   1923  C CA   . GLU A 1 29 ? -6.433  14.851 -4.177  1.00 1.00 ? 29 GLU A CA   3  
ATOM   1924  C C    . GLU A 1 29 ? -6.519  14.491 -2.696  1.00 1.00 ? 29 GLU A C    3  
ATOM   1925  O O    . GLU A 1 29 ? -6.384  15.369 -1.851  1.00 1.00 ? 29 GLU A O    3  
ATOM   1926  C CB   . GLU A 1 29 ? -5.601  13.921 -5.078  1.00 1.00 ? 29 GLU A CB   3  
ATOM   1927  C CG   . GLU A 1 29 ? -4.072  13.971 -4.947  1.00 1.00 ? 29 GLU A CG   3  
ATOM   1928  C CD   . GLU A 1 29 ? -3.411  13.348 -6.173  1.00 1.00 ? 29 GLU A CD   3  
ATOM   1929  O OE1  . GLU A 1 29 ? -2.671  12.375 -6.043  1.00 1.00 ? 29 GLU A OE1  3  
ATOM   1930  O OE2  . GLU A 1 29 ? -3.708  13.918 -7.370  1.00 1.00 ? 29 GLU A OE2  3  
ATOM   1931  H H    . GLU A 1 29 ? -5.053  16.457 -3.970  1.00 1.00 ? 29 GLU A H    3  
ATOM   1932  H HA   . GLU A 1 29 ? -7.450  14.756 -4.558  1.00 1.00 ? 29 GLU A HA   3  
ATOM   1933  H HB2  . GLU A 1 29 ? -5.930  12.890 -4.950  1.00 1.00 ? 29 GLU A HB2  3  
ATOM   1934  H HB3  . GLU A 1 29 ? -5.857  14.216 -6.097  1.00 1.00 ? 29 GLU A HB3  3  
ATOM   1935  H HG2  . GLU A 1 29 ? -3.731  15.003 -4.893  1.00 1.00 ? 29 GLU A HG2  3  
ATOM   1936  H HG3  . GLU A 1 29 ? -3.736  13.431 -4.059  1.00 1.00 ? 29 GLU A HG3  3  
ATOM   1937  H HE2  . GLU A 1 29 ? -3.007  13.755 -8.010  1.00 1.00 ? 29 GLU A HE2  3  
ATOM   1938  N N    . LYS A 1 30 ? -6.863  13.249 -2.354  1.00 1.00 ? 30 LYS A N    3  
ATOM   1939  C CA   . LYS A 1 30 ? -7.209  12.862 -0.984  1.00 1.00 ? 30 LYS A CA   3  
ATOM   1940  C C    . LYS A 1 30 ? -6.162  11.979 -0.304  1.00 1.00 ? 30 LYS A C    3  
ATOM   1941  O O    . LYS A 1 30 ? -6.465  11.362 0.718   1.00 1.00 ? 30 LYS A O    3  
ATOM   1942  C CB   . LYS A 1 30 ? -8.646  12.327 -0.938  1.00 1.00 ? 30 LYS A CB   3  
ATOM   1943  C CG   . LYS A 1 30 ? -9.642  13.486 -1.134  1.00 1.00 ? 30 LYS A CG   3  
ATOM   1944  C CD   . LYS A 1 30 ? -9.767  14.377 0.122   1.00 1.00 ? 30 LYS A CD   3  
ATOM   1945  C CE   . LYS A 1 30 ? -9.774  15.886 -0.187  1.00 1.00 ? 30 LYS A CE   3  
ATOM   1946  N NZ   . LYS A 1 30 ? -8.441  16.421 -0.542  1.00 1.00 ? 30 LYS A NZ   3  
ATOM   1947  H H    . LYS A 1 30 ? -7.000  12.565 -3.082  1.00 1.00 ? 30 LYS A H    3  
ATOM   1948  H HA   . LYS A 1 30 ? -7.190  13.747 -0.351  1.00 1.00 ? 30 LYS A HA   3  
ATOM   1949  H HB2  . LYS A 1 30 ? -8.779  11.584 -1.726  1.00 1.00 ? 30 LYS A HB2  3  
ATOM   1950  H HB3  . LYS A 1 30 ? -8.855  11.851 0.022   1.00 1.00 ? 30 LYS A HB3  3  
ATOM   1951  H HG2  . LYS A 1 30 ? -9.357  14.072 -2.008  1.00 1.00 ? 30 LYS A HG2  3  
ATOM   1952  H HG3  . LYS A 1 30 ? -10.623 13.054 -1.344  1.00 1.00 ? 30 LYS A HG3  3  
ATOM   1953  H HD2  . LYS A 1 30 ? -10.719 14.131 0.598   1.00 1.00 ? 30 LYS A HD2  3  
ATOM   1954  H HD3  . LYS A 1 30 ? -8.990  14.157 0.855   1.00 1.00 ? 30 LYS A HD3  3  
ATOM   1955  H HE2  . LYS A 1 30 ? -10.472 16.085 -1.003  1.00 1.00 ? 30 LYS A HE2  3  
ATOM   1956  H HE3  . LYS A 1 30 ? -10.125 16.421 0.696   1.00 1.00 ? 30 LYS A HE3  3  
ATOM   1957  H HZ1  . LYS A 1 30 ? -8.024  15.942 -1.327  1.00 1.00 ? 30 LYS A HZ1  3  
ATOM   1958  H HZ2  . LYS A 1 30 ? -8.506  17.398 -0.814  1.00 1.00 ? 30 LYS A HZ2  3  
ATOM   1959  H HZ3  . LYS A 1 30 ? -7.754  16.361 0.206   1.00 1.00 ? 30 LYS A HZ3  3  
ATOM   1960  N N    . ALA A 1 31 ? -4.964  11.884 -0.889  1.00 1.00 ? 31 ALA A N    3  
ATOM   1961  C CA   . ALA A 1 31 ? -3.772  11.277 -0.298  1.00 1.00 ? 31 ALA A CA   3  
ATOM   1962  C C    . ALA A 1 31 ? -3.619  11.582 1.200   1.00 1.00 ? 31 ALA A C    3  
ATOM   1963  O O    . ALA A 1 31 ? -4.156  12.575 1.690   1.00 1.00 ? 31 ALA A O    3  
ATOM   1964  C CB   . ALA A 1 31 ? -2.561  11.840 -1.033  1.00 1.00 ? 31 ALA A CB   3  
ATOM   1965  H H    . ALA A 1 31 ? -4.825  12.427 -1.728  1.00 1.00 ? 31 ALA A H    3  
ATOM   1966  H HA   . ALA A 1 31 ? -3.815  10.197 -0.446  1.00 1.00 ? 31 ALA A HA   3  
ATOM   1967  H HB1  . ALA A 1 31 ? -2.643  11.644 -2.098  1.00 1.00 ? 31 ALA A HB1  3  
ATOM   1968  H HB2  . ALA A 1 31 ? -2.514  12.921 -0.893  1.00 1.00 ? 31 ALA A HB2  3  
ATOM   1969  H HB3  . ALA A 1 31 ? -1.647  11.390 -0.649  1.00 1.00 ? 31 ALA A HB3  3  
ATOM   1970  N N    . ARG A 1 32 ? -2.886  10.735 1.935   1.00 1.00 ? 32 ARG A N    3  
ATOM   1971  C CA   . ARG A 1 32 ? -2.679  10.934 3.367   1.00 1.00 ? 32 ARG A CA   3  
ATOM   1972  C C    . ARG A 1 32 ? -1.469  11.821 3.612   1.00 1.00 ? 32 ARG A C    3  
ATOM   1973  O O    . ARG A 1 32 ? -1.590  12.843 4.281   1.00 1.00 ? 32 ARG A O    3  
ATOM   1974  C CB   . ARG A 1 32 ? -2.506  9.600  4.115   1.00 1.00 ? 32 ARG A CB   3  
ATOM   1975  C CG   . ARG A 1 32 ? -3.712  8.653  4.103   1.00 1.00 ? 32 ARG A CG   3  
ATOM   1976  C CD   . ARG A 1 32 ? -4.833  8.997  5.105   1.00 1.00 ? 32 ARG A CD   3  
ATOM   1977  N NE   . ARG A 1 32 ? -5.468  10.298 4.845   1.00 1.00 ? 32 ARG A NE   3  
ATOM   1978  C CZ   . ARG A 1 32 ? -6.075  10.635 3.697   1.00 1.00 ? 32 ARG A CZ   3  
ATOM   1979  N NH1  . ARG A 1 32 ? -6.415  9.694  2.815   1.00 1.00 ? 32 ARG A NH1  3  
ATOM   1980  N NH2  . ARG A 1 32 ? -6.299  11.916 3.402   1.00 1.00 ? 32 ARG A NH2  3  
ATOM   1981  H H    . ARG A 1 32 ? -2.334  10.028 1.453   1.00 1.00 ? 32 ARG A H    3  
ATOM   1982  H HA   . ARG A 1 32 ? -3.515  11.484 3.794   1.00 1.00 ? 32 ARG A HA   3  
ATOM   1983  H HB2  . ARG A 1 32 ? -1.670  9.071  3.658   1.00 1.00 ? 32 ARG A HB2  3  
ATOM   1984  H HB3  . ARG A 1 32 ? -2.248  9.807  5.155   1.00 1.00 ? 32 ARG A HB3  3  
ATOM   1985  H HG2  . ARG A 1 32 ? -4.090  8.587  3.086   1.00 1.00 ? 32 ARG A HG2  3  
ATOM   1986  H HG3  . ARG A 1 32 ? -3.336  7.668  4.388   1.00 1.00 ? 32 ARG A HG3  3  
ATOM   1987  H HD2  . ARG A 1 32 ? -5.589  8.210  5.095   1.00 1.00 ? 32 ARG A HD2  3  
ATOM   1988  H HD3  . ARG A 1 32 ? -4.404  9.018  6.110   1.00 1.00 ? 32 ARG A HD3  3  
ATOM   1989  H HE   . ARG A 1 32 ? -5.308  11.016 5.539   1.00 1.00 ? 32 ARG A HE   3  
ATOM   1990  H HH11 . ARG A 1 32 ? -6.293  8.717  3.034   1.00 1.00 ? 32 ARG A HH11 3  
ATOM   1991  H HH12 . ARG A 1 32 ? -6.721  9.982  1.889   1.00 1.00 ? 32 ARG A HH12 3  
ATOM   1992  H HH21 . ARG A 1 32 ? -5.996  12.661 4.012   1.00 1.00 ? 32 ARG A HH21 3  
ATOM   1993  H HH22 . ARG A 1 32 ? -6.467  12.132 2.423   1.00 1.00 ? 32 ARG A HH22 3  
ATOM   1994  N N    . HIS A 1 33 ? -0.295  11.382 3.154   1.00 1.00 ? 33 HIS A N    3  
ATOM   1995  C CA   . HIS A 1 33 ? 0.929   12.159 3.281   1.00 1.00 ? 33 HIS A CA   3  
ATOM   1996  C C    . HIS A 1 33 ? 1.324   12.729 1.927   1.00 1.00 ? 33 HIS A C    3  
ATOM   1997  O O    . HIS A 1 33 ? 0.885   12.262 0.876   1.00 1.00 ? 33 HIS A O    3  
ATOM   1998  C CB   . HIS A 1 33 ? 2.076   11.318 3.864   1.00 1.00 ? 33 HIS A CB   3  
ATOM   1999  C CG   . HIS A 1 33 ? 1.883   10.871 5.286   1.00 1.00 ? 33 HIS A CG   3  
ATOM   2000  N ND1  . HIS A 1 33 ? 0.737   10.228 5.724   1.00 1.00 ? 33 HIS A ND1  3  
ATOM   2001  C CD2  . HIS A 1 33 ? 2.718   10.909 6.376   1.00 1.00 ? 33 HIS A CD2  3  
ATOM   2002  C CE1  . HIS A 1 33 ? 0.908   9.939  7.023   1.00 1.00 ? 33 HIS A CE1  3  
ATOM   2003  N NE2  . HIS A 1 33 ? 2.101   10.326 7.481   1.00 1.00 ? 33 HIS A NE2  3  
ATOM   2004  H H    . HIS A 1 33 ? -0.290  10.608 2.499   1.00 1.00 ? 33 HIS A H    3  
ATOM   2005  H HA   . HIS A 1 33 ? 0.781   13.010 3.948   1.00 1.00 ? 33 HIS A HA   3  
ATOM   2006  H HB2  . HIS A 1 33 ? 2.239   10.432 3.262   1.00 1.00 ? 33 HIS A HB2  3  
ATOM   2007  H HB3  . HIS A 1 33 ? 2.993   11.908 3.838   1.00 1.00 ? 33 HIS A HB3  3  
ATOM   2008  H HD1  . HIS A 1 33 ? -0.075  10.018 5.167   1.00 1.00 ? 33 HIS A HD1  3  
ATOM   2009  H HD2  . HIS A 1 33 ? 3.718   11.320 6.358   1.00 1.00 ? 33 HIS A HD2  3  
ATOM   2010  H HE1  . HIS A 1 33 ? 0.161   9.433  7.618   1.00 1.00 ? 33 HIS A HE1  3  
ATOM   2011  N N    . GLY A 1 34 ? 2.223   13.704 1.984   1.00 1.00 ? 34 GLY A N    3  
ATOM   2012  C CA   . GLY A 1 34 ? 2.936   14.256 0.860   1.00 1.00 ? 34 GLY A CA   3  
ATOM   2013  C C    . GLY A 1 34 ? 4.116   15.009 1.451   1.00 1.00 ? 34 GLY A C    3  
ATOM   2014  O O    . GLY A 1 34 ? 4.066   15.370 2.628   1.00 1.00 ? 34 GLY A O    3  
ATOM   2015  H H    . GLY A 1 34 ? 2.536   14.039 2.887   1.00 1.00 ? 34 GLY A H    3  
ATOM   2016  H HA2  . GLY A 1 34 ? 3.332   13.433 0.279   1.00 1.00 ? 34 GLY A HA2  3  
ATOM   2017  H HA3  . GLY A 1 34 ? 2.297   14.889 0.245   1.00 1.00 ? 34 GLY A HA3  3  
ATOM   2018  N N    . SER A 1 35 ? 5.199   15.169 0.699   1.00 1.00 ? 35 SER A N    3  
ATOM   2019  C CA   . SER A 1 35 ? 6.444   15.791 1.130   1.00 1.00 ? 35 SER A CA   3  
ATOM   2020  C C    . SER A 1 35 ? 7.318   15.903 -0.110  1.00 1.00 ? 35 SER A C    3  
ATOM   2021  O O    . SER A 1 35 ? 7.164   15.112 -1.034  1.00 1.00 ? 35 SER A O    3  
ATOM   2022  C CB   . SER A 1 35 ? 7.141   14.929 2.198   1.00 1.00 ? 35 SER A CB   3  
ATOM   2023  O OG   . SER A 1 35 ? 6.540   15.133 3.464   1.00 1.00 ? 35 SER A OG   3  
ATOM   2024  H H    . SER A 1 35 ? 5.193   14.794 -0.252  1.00 1.00 ? 35 SER A H    3  
ATOM   2025  H HA   . SER A 1 35 ? 6.252   16.798 1.514   1.00 1.00 ? 35 SER A HA   3  
ATOM   2026  H HB2  . SER A 1 35 ? 7.080   13.873 1.922   1.00 1.00 ? 35 SER A HB2  3  
ATOM   2027  H HB3  . SER A 1 35 ? 8.199   15.185 2.256   1.00 1.00 ? 35 SER A HB3  3  
ATOM   2028  H HG   . SER A 1 35 ? 5.661   14.732 3.412   1.00 1.00 ? 35 SER A HG   3  
ATOM   2029  N N    . CYS A 1 36 ? 8.208   16.891 -0.151  1.00 1.00 ? 36 CYS A N    3  
ATOM   2030  C CA   . CYS A 1 36 ? 9.103   17.077 -1.282  1.00 1.00 ? 36 CYS A CA   3  
ATOM   2031  C C    . CYS A 1 36 ? 10.445  16.421 -0.995  1.00 1.00 ? 36 CYS A C    3  
ATOM   2032  O O    . CYS A 1 36 ? 10.912  16.490 0.141   1.00 1.00 ? 36 CYS A O    3  
ATOM   2033  C CB   . CYS A 1 36 ? 9.285   18.563 -1.562  1.00 1.00 ? 36 CYS A CB   3  
ATOM   2034  S SG   . CYS A 1 36 ? 10.481  18.871 -2.868  1.00 1.00 ? 36 CYS A SG   3  
ATOM   2035  H H    . CYS A 1 36 ? 8.341   17.466 0.665   1.00 1.00 ? 36 CYS A H    3  
ATOM   2036  H HA   . CYS A 1 36 ? 8.679   16.625 -2.175  1.00 1.00 ? 36 CYS A HA   3  
ATOM   2037  H HB2  . CYS A 1 36 ? 8.330   18.994 -1.857  1.00 1.00 ? 36 CYS A HB2  3  
ATOM   2038  H HB3  . CYS A 1 36 ? 9.653   19.069 -0.671  1.00 1.00 ? 36 CYS A HB3  3  
ATOM   2039  N N    . ASN A 1 37 ? 11.058  15.807 -2.012  1.00 1.00 ? 37 ASN A N    3  
ATOM   2040  C CA   . ASN A 1 37 ? 12.424  15.295 -1.945  1.00 1.00 ? 37 ASN A CA   3  
ATOM   2041  C C    . ASN A 1 37 ? 13.206  15.790 -3.163  1.00 1.00 ? 37 ASN A C    3  
ATOM   2042  O O    . ASN A 1 37 ? 12.603  16.184 -4.161  1.00 1.00 ? 37 ASN A O    3  
ATOM   2043  C CB   . ASN A 1 37 ? 12.412  13.761 -1.887  1.00 1.00 ? 37 ASN A CB   3  
ATOM   2044  C CG   . ASN A 1 37 ? 13.839  13.225 -1.963  1.00 1.00 ? 37 ASN A CG   3  
ATOM   2045  O OD1  . ASN A 1 37 ? 14.700  13.653 -1.202  1.00 1.00 ? 37 ASN A OD1  3  
ATOM   2046  N ND2  . ASN A 1 37 ? 14.136  12.386 -2.948  1.00 1.00 ? 37 ASN A ND2  3  
ATOM   2047  H H    . ASN A 1 37 ? 10.611  15.817 -2.929  1.00 1.00 ? 37 ASN A H    3  
ATOM   2048  H HA   . ASN A 1 37 ? 12.925  15.675 -1.053  1.00 1.00 ? 37 ASN A HA   3  
ATOM   2049  H HB2  . ASN A 1 37 ? 11.956  13.435 -0.952  1.00 1.00 ? 37 ASN A HB2  3  
ATOM   2050  H HB3  . ASN A 1 37 ? 11.824  13.375 -2.721  1.00 1.00 ? 37 ASN A HB3  3  
ATOM   2051  H HD21 . ASN A 1 37 ? 13.433  12.083 -3.601  1.00 1.00 ? 37 ASN A HD21 3  
ATOM   2052  H HD22 . ASN A 1 37 ? 15.108  12.157 -3.099  1.00 1.00 ? 37 ASN A HD22 3  
ATOM   2053  N N    . TYR A 1 38 ? 14.543  15.768 -3.105  1.00 1.00 ? 38 TYR A N    3  
ATOM   2054  C CA   . TYR A 1 38 ? 15.353  16.059 -4.274  1.00 1.00 ? 38 TYR A CA   3  
ATOM   2055  C C    . TYR A 1 38 ? 15.226  14.936 -5.304  1.00 1.00 ? 38 TYR A C    3  
ATOM   2056  O O    . TYR A 1 38 ? 15.862  13.892 -5.180  1.00 1.00 ? 38 TYR A O    3  
ATOM   2057  C CB   . TYR A 1 38 ? 16.815  16.348 -3.919  1.00 1.00 ? 38 TYR A CB   3  
ATOM   2058  C CG   . TYR A 1 38 ? 17.578  16.854 -5.132  1.00 1.00 ? 38 TYR A CG   3  
ATOM   2059  C CD1  . TYR A 1 38 ? 17.398  18.185 -5.552  1.00 1.00 ? 38 TYR A CD1  3  
ATOM   2060  C CD2  . TYR A 1 38 ? 18.218  15.938 -5.989  1.00 1.00 ? 38 TYR A CD2  3  
ATOM   2061  C CE1  . TYR A 1 38 ? 17.821  18.591 -6.829  1.00 1.00 ? 38 TYR A CE1  3  
ATOM   2062  C CE2  . TYR A 1 38 ? 18.627  16.341 -7.273  1.00 1.00 ? 38 TYR A CE2  3  
ATOM   2063  C CZ   . TYR A 1 38 ? 18.410  17.660 -7.702  1.00 1.00 ? 38 TYR A CZ   3  
ATOM   2064  O OH   . TYR A 1 38 ? 18.766  18.024 -8.965  1.00 1.00 ? 38 TYR A OH   3  
ATOM   2065  H H    . TYR A 1 38 ? 14.996  15.379 -2.284  1.00 1.00 ? 38 TYR A H    3  
ATOM   2066  H HA   . TYR A 1 38 ? 14.974  16.972 -4.716  1.00 1.00 ? 38 TYR A HA   3  
ATOM   2067  H HB2  . TYR A 1 38 ? 16.850  17.113 -3.142  1.00 1.00 ? 38 TYR A HB2  3  
ATOM   2068  H HB3  . TYR A 1 38 ? 17.288  15.446 -3.529  1.00 1.00 ? 38 TYR A HB3  3  
ATOM   2069  H HD1  . TYR A 1 38 ? 16.904  18.893 -4.904  1.00 1.00 ? 38 TYR A HD1  3  
ATOM   2070  H HD2  . TYR A 1 38 ? 18.353  14.910 -5.686  1.00 1.00 ? 38 TYR A HD2  3  
ATOM   2071  H HE1  . TYR A 1 38 ? 17.686  19.619 -7.131  1.00 1.00 ? 38 TYR A HE1  3  
ATOM   2072  H HE2  . TYR A 1 38 ? 19.096  15.630 -7.938  1.00 1.00 ? 38 TYR A HE2  3  
ATOM   2073  H HH   . TYR A 1 38 ? 18.533  18.926 -9.191  1.00 1.00 ? 38 TYR A HH   3  
ATOM   2074  N N    . VAL A 1 39 ? 14.405  15.174 -6.328  1.00 1.00 ? 39 VAL A N    3  
ATOM   2075  C CA   . VAL A 1 39 ? 14.284  14.360 -7.526  1.00 1.00 ? 39 VAL A CA   3  
ATOM   2076  C C    . VAL A 1 39 ? 14.147  15.359 -8.683  1.00 1.00 ? 39 VAL A C    3  
ATOM   2077  O O    . VAL A 1 39 ? 13.995  16.563 -8.441  1.00 1.00 ? 39 VAL A O    3  
ATOM   2078  C CB   . VAL A 1 39 ? 13.083  13.393 -7.404  1.00 1.00 ? 39 VAL A CB   3  
ATOM   2079  C CG1  . VAL A 1 39 ? 13.031  12.355 -8.533  1.00 1.00 ? 39 VAL A CG1  3  
ATOM   2080  C CG2  . VAL A 1 39 ? 13.079  12.636 -6.069  1.00 1.00 ? 39 VAL A CG2  3  
ATOM   2081  H H    . VAL A 1 39 ? 13.909  16.053 -6.353  1.00 1.00 ? 39 VAL A H    3  
ATOM   2082  H HA   . VAL A 1 39 ? 15.201  13.784 -7.666  1.00 1.00 ? 39 VAL A HA   3  
ATOM   2083  H HB   . VAL A 1 39 ? 12.166  13.971 -7.443  1.00 1.00 ? 39 VAL A HB   3  
ATOM   2084  H HG11 . VAL A 1 39 ? 13.999  11.864 -8.641  1.00 1.00 ? 39 VAL A HG11 3  
ATOM   2085  H HG12 . VAL A 1 39 ? 12.276  11.601 -8.314  1.00 1.00 ? 39 VAL A HG12 3  
ATOM   2086  H HG13 . VAL A 1 39 ? 12.750  12.830 -9.470  1.00 1.00 ? 39 VAL A HG13 3  
ATOM   2087  H HG21 . VAL A 1 39 ? 14.021  12.104 -5.938  1.00 1.00 ? 39 VAL A HG21 3  
ATOM   2088  H HG22 . VAL A 1 39 ? 12.927  13.336 -5.247  1.00 1.00 ? 39 VAL A HG22 3  
ATOM   2089  H HG23 . VAL A 1 39 ? 12.259  11.918 -6.048  1.00 1.00 ? 39 VAL A HG23 3  
ATOM   2090  N N    . PHE A 1 40 ? 14.225  14.878 -9.930  1.00 1.00 ? 40 PHE A N    3  
ATOM   2091  C CA   . PHE A 1 40 ? 14.081  15.716 -11.114 1.00 1.00 ? 40 PHE A CA   3  
ATOM   2092  C C    . PHE A 1 40 ? 12.733  16.456 -11.073 1.00 1.00 ? 40 PHE A C    3  
ATOM   2093  O O    . PHE A 1 40 ? 11.752  15.888 -10.592 1.00 1.00 ? 40 PHE A O    3  
ATOM   2094  C CB   . PHE A 1 40 ? 14.207  14.872 -12.398 1.00 1.00 ? 40 PHE A CB   3  
ATOM   2095  C CG   . PHE A 1 40 ? 12.912  14.248 -12.896 1.00 1.00 ? 40 PHE A CG   3  
ATOM   2096  C CD1  . PHE A 1 40 ? 12.503  12.984 -12.432 1.00 1.00 ? 40 PHE A CD1  3  
ATOM   2097  C CD2  . PHE A 1 40 ? 12.120  14.931 -13.841 1.00 1.00 ? 40 PHE A CD2  3  
ATOM   2098  C CE1  . PHE A 1 40 ? 11.312  12.408 -12.908 1.00 1.00 ? 40 PHE A CE1  3  
ATOM   2099  C CE2  . PHE A 1 40 ? 10.940  14.346 -14.332 1.00 1.00 ? 40 PHE A CE2  3  
ATOM   2100  C CZ   . PHE A 1 40 ? 10.537  13.082 -13.868 1.00 1.00 ? 40 PHE A CZ   3  
ATOM   2101  H H    . PHE A 1 40 ? 14.378  13.891 -10.056 1.00 1.00 ? 40 PHE A H    3  
ATOM   2102  H HA   . PHE A 1 40 ? 14.920  16.406 -11.086 1.00 1.00 ? 40 PHE A HA   3  
ATOM   2103  H HB2  . PHE A 1 40 ? 14.586  15.520 -13.188 1.00 1.00 ? 40 PHE A HB2  3  
ATOM   2104  H HB3  . PHE A 1 40 ? 14.961  14.096 -12.257 1.00 1.00 ? 40 PHE A HB3  3  
ATOM   2105  H HD1  . PHE A 1 40 ? 13.127  12.425 -11.750 1.00 1.00 ? 40 PHE A HD1  3  
ATOM   2106  H HD2  . PHE A 1 40 ? 12.436  15.888 -14.232 1.00 1.00 ? 40 PHE A HD2  3  
ATOM   2107  H HE1  . PHE A 1 40 ? 11.025  11.419 -12.579 1.00 1.00 ? 40 PHE A HE1  3  
ATOM   2108  H HE2  . PHE A 1 40 ? 10.376  14.844 -15.110 1.00 1.00 ? 40 PHE A HE2  3  
ATOM   2109  H HZ   . PHE A 1 40 ? 9.665   12.601 -14.292 1.00 1.00 ? 40 PHE A HZ   3  
ATOM   2110  N N    . PRO A 1 41 ? 12.614  17.675 -11.617 1.00 1.00 ? 41 PRO A N    3  
ATOM   2111  C CA   . PRO A 1 41 ? 13.655  18.428 -12.296 1.00 1.00 ? 41 PRO A CA   3  
ATOM   2112  C C    . PRO A 1 41 ? 14.708  18.938 -11.313 1.00 1.00 ? 41 PRO A C    3  
ATOM   2113  O O    . PRO A 1 41 ? 15.898  18.858 -11.603 1.00 1.00 ? 41 PRO A O    3  
ATOM   2114  C CB   . PRO A 1 41 ? 12.922  19.573 -13.004 1.00 1.00 ? 41 PRO A CB   3  
ATOM   2115  C CG   . PRO A 1 41 ? 11.674  19.788 -12.148 1.00 1.00 ? 41 PRO A CG   3  
ATOM   2116  C CD   . PRO A 1 41 ? 11.344  18.384 -11.655 1.00 1.00 ? 41 PRO A CD   3  
ATOM   2117  H HA   . PRO A 1 41 ? 14.153  17.816 -13.047 1.00 1.00 ? 41 PRO A HA   3  
ATOM   2118  H HB2  . PRO A 1 41 ? 13.531  20.475 -13.088 1.00 1.00 ? 41 PRO A HB2  3  
ATOM   2119  H HB3  . PRO A 1 41 ? 12.616  19.237 -13.995 1.00 1.00 ? 41 PRO A HB3  3  
ATOM   2120  H HG2  . PRO A 1 41 ? 11.921  20.411 -11.291 1.00 1.00 ? 41 PRO A HG2  3  
ATOM   2121  H HG3  . PRO A 1 41 ? 10.854  20.235 -12.713 1.00 1.00 ? 41 PRO A HG3  3  
ATOM   2122  H HD2  . PRO A 1 41 ? 10.875  18.423 -10.670 1.00 1.00 ? 41 PRO A HD2  3  
ATOM   2123  H HD3  . PRO A 1 41 ? 10.679  17.891 -12.365 1.00 1.00 ? 41 PRO A HD3  3  
ATOM   2124  N N    . ALA A 1 42 ? 14.278  19.417 -10.144 1.00 1.00 ? 42 ALA A N    3  
ATOM   2125  C CA   . ALA A 1 42 ? 15.167  19.922 -9.110  1.00 1.00 ? 42 ALA A CA   3  
ATOM   2126  C C    . ALA A 1 42 ? 14.340  20.208 -7.864  1.00 1.00 ? 42 ALA A C    3  
ATOM   2127  O O    . ALA A 1 42 ? 13.971  21.359 -7.640  1.00 1.00 ? 42 ALA A O    3  
ATOM   2128  C CB   . ALA A 1 42 ? 15.885  21.195 -9.576  1.00 1.00 ? 42 ALA A CB   3  
ATOM   2129  H H    . ALA A 1 42 ? 13.290  19.375 -9.936  1.00 1.00 ? 42 ALA A H    3  
ATOM   2130  H HA   . ALA A 1 42 ? 15.914  19.162 -8.879  1.00 1.00 ? 42 ALA A HA   3  
ATOM   2131  H HB1  . ALA A 1 42 ? 15.156  21.940 -9.897  1.00 1.00 ? 42 ALA A HB1  3  
ATOM   2132  H HB2  . ALA A 1 42 ? 16.467  21.603 -8.748  1.00 1.00 ? 42 ALA A HB2  3  
ATOM   2133  H HB3  . ALA A 1 42 ? 16.563  20.979 -10.400 1.00 1.00 ? 42 ALA A HB3  3  
ATOM   2134  N N    . HIS A 1 43 ? 14.061  19.160 -7.084  1.00 1.00 ? 43 HIS A N    3  
ATOM   2135  C CA   . HIS A 1 43 ? 13.126  19.138 -5.960  1.00 1.00 ? 43 HIS A CA   3  
ATOM   2136  C C    . HIS A 1 43 ? 11.757  18.796 -6.531  1.00 1.00 ? 43 HIS A C    3  
ATOM   2137  O O    . HIS A 1 43 ? 11.241  19.531 -7.370  1.00 1.00 ? 43 HIS A O    3  
ATOM   2138  C CB   . HIS A 1 43 ? 13.090  20.426 -5.120  1.00 1.00 ? 43 HIS A CB   3  
ATOM   2139  C CG   . HIS A 1 43 ? 14.430  20.862 -4.588  1.00 1.00 ? 43 HIS A CG   3  
ATOM   2140  N ND1  . HIS A 1 43 ? 15.238  21.756 -5.269  1.00 1.00 ? 43 HIS A ND1  3  
ATOM   2141  C CD2  . HIS A 1 43 ? 15.119  20.550 -3.441  1.00 1.00 ? 43 HIS A CD2  3  
ATOM   2142  C CE1  . HIS A 1 43 ? 16.350  21.935 -4.537  1.00 1.00 ? 43 HIS A CE1  3  
ATOM   2143  N NE2  . HIS A 1 43 ? 16.341  21.220 -3.409  1.00 1.00 ? 43 HIS A NE2  3  
ATOM   2144  H H    . HIS A 1 43 ? 14.333  18.253 -7.450  1.00 1.00 ? 43 HIS A H    3  
ATOM   2145  H HA   . HIS A 1 43 ? 13.433  18.342 -5.291  1.00 1.00 ? 43 HIS A HA   3  
ATOM   2146  H HB2  . HIS A 1 43 ? 12.610  21.229 -5.675  1.00 1.00 ? 43 HIS A HB2  3  
ATOM   2147  H HB3  . HIS A 1 43 ? 12.463  20.261 -4.251  1.00 1.00 ? 43 HIS A HB3  3  
ATOM   2148  H HD1  . HIS A 1 43 ? 15.016  22.154 -6.175  1.00 1.00 ? 43 HIS A HD1  3  
ATOM   2149  H HD2  . HIS A 1 43 ? 14.770  19.871 -2.677  1.00 1.00 ? 43 HIS A HD2  3  
ATOM   2150  H HE1  . HIS A 1 43 ? 17.168  22.574 -4.833  1.00 1.00 ? 43 HIS A HE1  3  
ATOM   2151  N N    . LYS A 1 44 ? 11.197  17.662 -6.115  1.00 1.00 ? 44 LYS A N    3  
ATOM   2152  C CA   . LYS A 1 44 ? 9.965   17.113 -6.654  1.00 1.00 ? 44 LYS A CA   3  
ATOM   2153  C C    . LYS A 1 44 ? 9.055   16.724 -5.500  1.00 1.00 ? 44 LYS A C    3  
ATOM   2154  O O    . LYS A 1 44 ? 9.512   16.171 -4.496  1.00 1.00 ? 44 LYS A O    3  
ATOM   2155  C CB   . LYS A 1 44 ? 10.279  15.897 -7.511  1.00 1.00 ? 44 LYS A CB   3  
ATOM   2156  C CG   . LYS A 1 44 ? 9.196   15.615 -8.558  1.00 1.00 ? 44 LYS A CG   3  
ATOM   2157  C CD   . LYS A 1 44 ? 9.492   14.245 -9.182  1.00 1.00 ? 44 LYS A CD   3  
ATOM   2158  C CE   . LYS A 1 44 ? 8.845   14.047 -10.557 1.00 1.00 ? 44 LYS A CE   3  
ATOM   2159  N NZ   . LYS A 1 44 ? 9.396   14.986 -11.555 1.00 1.00 ? 44 LYS A NZ   3  
ATOM   2160  H H    . LYS A 1 44 ? 11.637  17.142 -5.364  1.00 1.00 ? 44 LYS A H    3  
ATOM   2161  H HA   . LYS A 1 44 ? 9.471   17.834 -7.296  1.00 1.00 ? 44 LYS A HA   3  
ATOM   2162  H HB2  . LYS A 1 44 ? 11.228  16.052 -8.023  1.00 1.00 ? 44 LYS A HB2  3  
ATOM   2163  H HB3  . LYS A 1 44 ? 10.358  15.054 -6.834  1.00 1.00 ? 44 LYS A HB3  3  
ATOM   2164  H HG2  . LYS A 1 44 ? 8.205   15.592 -8.096  1.00 1.00 ? 44 LYS A HG2  3  
ATOM   2165  H HG3  . LYS A 1 44 ? 9.227   16.419 -9.293  1.00 1.00 ? 44 LYS A HG3  3  
ATOM   2166  H HD2  . LYS A 1 44 ? 10.571  14.117 -9.283  1.00 1.00 ? 44 LYS A HD2  3  
ATOM   2167  H HD3  . LYS A 1 44 ? 9.133   13.477 -8.494  1.00 1.00 ? 44 LYS A HD3  3  
ATOM   2168  H HE2  . LYS A 1 44 ? 9.062   13.029 -10.886 1.00 1.00 ? 44 LYS A HE2  3  
ATOM   2169  H HE3  . LYS A 1 44 ? 7.763   14.167 -10.486 1.00 1.00 ? 44 LYS A HE3  3  
ATOM   2170  H HZ1  . LYS A 1 44 ? 10.401  15.065 -11.438 1.00 1.00 ? 44 LYS A HZ1  3  
ATOM   2171  H HZ2  . LYS A 1 44 ? 9.201   14.674 -12.493 1.00 1.00 ? 44 LYS A HZ2  3  
ATOM   2172  H HZ3  . LYS A 1 44 ? 8.984   15.906 -11.430 1.00 1.00 ? 44 LYS A HZ3  3  
ATOM   2173  N N    . CYS A 1 45 ? 7.764   17.012 -5.657  1.00 1.00 ? 45 CYS A N    3  
ATOM   2174  C CA   . CYS A 1 45 ? 6.766   16.582 -4.702  1.00 1.00 ? 45 CYS A CA   3  
ATOM   2175  C C    . CYS A 1 45 ? 6.652   15.061 -4.754  1.00 1.00 ? 45 CYS A C    3  
ATOM   2176  O O    . CYS A 1 45 ? 6.743   14.484 -5.836  1.00 1.00 ? 45 CYS A O    3  
ATOM   2177  C CB   . CYS A 1 45 ? 5.426   17.239 -5.035  1.00 1.00 ? 45 CYS A CB   3  
ATOM   2178  S SG   . CYS A 1 45 ? 4.139   16.997 -3.796  1.00 1.00 ? 45 CYS A SG   3  
ATOM   2179  H H    . CYS A 1 45 ? 7.445   17.431 -6.520  1.00 1.00 ? 45 CYS A H    3  
ATOM   2180  H HA   . CYS A 1 45 ? 7.096   16.899 -3.718  1.00 1.00 ? 45 CYS A HA   3  
ATOM   2181  H HB2  . CYS A 1 45 ? 5.570   18.312 -5.153  1.00 1.00 ? 45 CYS A HB2  3  
ATOM   2182  H HB3  . CYS A 1 45 ? 5.053   16.827 -5.970  1.00 1.00 ? 45 CYS A HB3  3  
ATOM   2183  N N    . ILE A 1 46 ? 6.486   14.419 -3.599  1.00 1.00 ? 46 ILE A N    3  
ATOM   2184  C CA   . ILE A 1 46 ? 6.149   13.013 -3.462  1.00 1.00 ? 46 ILE A CA   3  
ATOM   2185  C C    . ILE A 1 46 ? 4.844   12.982 -2.673  1.00 1.00 ? 46 ILE A C    3  
ATOM   2186  O O    . ILE A 1 46 ? 4.684   13.769 -1.738  1.00 1.00 ? 46 ILE A O    3  
ATOM   2187  C CB   . ILE A 1 46 ? 7.254   12.242 -2.713  1.00 1.00 ? 46 ILE A CB   3  
ATOM   2188  C CG1  . ILE A 1 46 ? 8.675   12.480 -3.263  1.00 1.00 ? 46 ILE A CG1  3  
ATOM   2189  C CG2  . ILE A 1 46 ? 6.924   10.742 -2.680  1.00 1.00 ? 46 ILE A CG2  3  
ATOM   2190  C CD1  . ILE A 1 46 ? 8.899   11.976 -4.691  1.00 1.00 ? 46 ILE A CD1  3  
ATOM   2191  H H    . ILE A 1 46 ? 6.477   14.944 -2.730  1.00 1.00 ? 46 ILE A H    3  
ATOM   2192  H HA   . ILE A 1 46 ? 5.980   12.570 -4.441  1.00 1.00 ? 46 ILE A HA   3  
ATOM   2193  H HB   . ILE A 1 46 ? 7.266   12.587 -1.678  1.00 1.00 ? 46 ILE A HB   3  
ATOM   2194  H HG12 . ILE A 1 46 ? 8.907   13.545 -3.226  1.00 1.00 ? 46 ILE A HG12 3  
ATOM   2195  H HG13 . ILE A 1 46 ? 9.384   11.969 -2.610  1.00 1.00 ? 46 ILE A HG13 3  
ATOM   2196  H HG21 . ILE A 1 46 ? 6.778   10.357 -3.689  1.00 1.00 ? 46 ILE A HG21 3  
ATOM   2197  H HG22 . ILE A 1 46 ? 7.735   10.196 -2.198  1.00 1.00 ? 46 ILE A HG22 3  
ATOM   2198  H HG23 . ILE A 1 46 ? 6.010   10.572 -2.110  1.00 1.00 ? 46 ILE A HG23 3  
ATOM   2199  H HD11 . ILE A 1 46 ? 8.220   12.468 -5.381  1.00 1.00 ? 46 ILE A HD11 3  
ATOM   2200  H HD12 . ILE A 1 46 ? 9.922   12.206 -4.989  1.00 1.00 ? 46 ILE A HD12 3  
ATOM   2201  H HD13 . ILE A 1 46 ? 8.756   10.897 -4.745  1.00 1.00 ? 46 ILE A HD13 3  
ATOM   2202  N N    . CYS A 1 47 ? 3.911   12.105 -3.049  1.00 1.00 ? 47 CYS A N    3  
ATOM   2203  C CA   . CYS A 1 47 ? 2.616   11.988 -2.395  1.00 1.00 ? 47 CYS A CA   3  
ATOM   2204  C C    . CYS A 1 47 ? 2.331   10.528 -2.043  1.00 1.00 ? 47 CYS A C    3  
ATOM   2205  O O    . CYS A 1 47 ? 2.884   9.651  -2.702  1.00 1.00 ? 47 CYS A O    3  
ATOM   2206  C CB   . CYS A 1 47 ? 1.564   12.597 -3.305  1.00 1.00 ? 47 CYS A CB   3  
ATOM   2207  S SG   . CYS A 1 47 ? 0.021   12.830 -2.431  1.00 1.00 ? 47 CYS A SG   3  
ATOM   2208  H H    . CYS A 1 47 ? 4.066   11.501 -3.854  1.00 1.00 ? 47 CYS A H    3  
ATOM   2209  H HA   . CYS A 1 47 ? 2.600   12.554 -1.471  1.00 1.00 ? 47 CYS A HA   3  
ATOM   2210  H HB2  . CYS A 1 47 ? 1.904   13.580 -3.633  1.00 1.00 ? 47 CYS A HB2  3  
ATOM   2211  H HB3  . CYS A 1 47 ? 1.402   11.965 -4.177  1.00 1.00 ? 47 CYS A HB3  3  
ATOM   2212  N N    . TYR A 1 48 ? 1.539   10.248 -0.997  1.00 1.00 ? 48 TYR A N    3  
ATOM   2213  C CA   . TYR A 1 48 ? 1.388   8.896  -0.458  1.00 1.00 ? 48 TYR A CA   3  
ATOM   2214  C C    . TYR A 1 48 ? -0.058  8.570  -0.059  1.00 1.00 ? 48 TYR A C    3  
ATOM   2215  O O    . TYR A 1 48 ? -0.733  9.368  0.602   1.00 1.00 ? 48 TYR A O    3  
ATOM   2216  C CB   . TYR A 1 48 ? 2.298   8.708  0.757   1.00 1.00 ? 48 TYR A CB   3  
ATOM   2217  C CG   . TYR A 1 48 ? 3.744   9.146  0.607   1.00 1.00 ? 48 TYR A CG   3  
ATOM   2218  C CD1  . TYR A 1 48 ? 4.089   10.495 0.808   1.00 1.00 ? 48 TYR A CD1  3  
ATOM   2219  C CD2  . TYR A 1 48 ? 4.759   8.195  0.399   1.00 1.00 ? 48 TYR A CD2  3  
ATOM   2220  C CE1  . TYR A 1 48 ? 5.433   10.897 0.792   1.00 1.00 ? 48 TYR A CE1  3  
ATOM   2221  C CE2  . TYR A 1 48 ? 6.109   8.592  0.403   1.00 1.00 ? 48 TYR A CE2  3  
ATOM   2222  C CZ   . TYR A 1 48 ? 6.445   9.941  0.614   1.00 1.00 ? 48 TYR A CZ   3  
ATOM   2223  O OH   . TYR A 1 48 ? 7.749   10.334 0.638   1.00 1.00 ? 48 TYR A OH   3  
ATOM   2224  H H    . TYR A 1 48 ? 1.118   11.006 -0.466  1.00 1.00 ? 48 TYR A H    3  
ATOM   2225  H HA   . TYR A 1 48 ? 1.702   8.167  -1.204  1.00 1.00 ? 48 TYR A HA   3  
ATOM   2226  H HB2  . TYR A 1 48 ? 1.848   9.251  1.581   1.00 1.00 ? 48 TYR A HB2  3  
ATOM   2227  H HB3  . TYR A 1 48 ? 2.284   7.654  1.016   1.00 1.00 ? 48 TYR A HB3  3  
ATOM   2228  H HD1  . TYR A 1 48 ? 3.319   11.224 0.983   1.00 1.00 ? 48 TYR A HD1  3  
ATOM   2229  H HD2  . TYR A 1 48 ? 4.507   7.154  0.261   1.00 1.00 ? 48 TYR A HD2  3  
ATOM   2230  H HE1  . TYR A 1 48 ? 5.691   11.936 0.924   1.00 1.00 ? 48 TYR A HE1  3  
ATOM   2231  H HE2  . TYR A 1 48 ? 6.881   7.852  0.255   1.00 1.00 ? 48 TYR A HE2  3  
ATOM   2232  H HH   . TYR A 1 48 ? 8.365   9.608  0.524   1.00 1.00 ? 48 TYR A HH   3  
ATOM   2233  N N    . PHE A 1 49 ? -0.504  7.361  -0.418  1.00 1.00 ? 49 PHE A N    3  
ATOM   2234  C CA   . PHE A 1 49 ? -1.863  6.863  -0.284  1.00 1.00 ? 49 PHE A CA   3  
ATOM   2235  C C    . PHE A 1 49 ? -1.779  5.487  0.385   1.00 1.00 ? 49 PHE A C    3  
ATOM   2236  O O    . PHE A 1 49 ? -0.795  4.786  0.157   1.00 1.00 ? 49 PHE A O    3  
ATOM   2237  C CB   . PHE A 1 49 ? -2.491  6.700  -1.681  1.00 1.00 ? 49 PHE A CB   3  
ATOM   2238  C CG   . PHE A 1 49 ? -2.093  7.736  -2.721  1.00 1.00 ? 49 PHE A CG   3  
ATOM   2239  C CD1  . PHE A 1 49 ? -0.785  7.721  -3.230  1.00 1.00 ? 49 PHE A CD1  3  
ATOM   2240  C CD2  . PHE A 1 49 ? -2.963  8.778  -3.096  1.00 1.00 ? 49 PHE A CD2  3  
ATOM   2241  C CE1  . PHE A 1 49 ? -0.264  8.869  -3.828  1.00 1.00 ? 49 PHE A CE1  3  
ATOM   2242  C CE2  . PHE A 1 49 ? -2.495  9.815  -3.925  1.00 1.00 ? 49 PHE A CE2  3  
ATOM   2243  C CZ   . PHE A 1 49 ? -1.129  9.886  -4.264  1.00 1.00 ? 49 PHE A CZ   3  
ATOM   2244  H H    . PHE A 1 49 ? 0.115   6.731  -0.914  1.00 1.00 ? 49 PHE A H    3  
ATOM   2245  H HA   . PHE A 1 49 ? -2.449  7.564  0.310   1.00 1.00 ? 49 PHE A HA   3  
ATOM   2246  H HB2  . PHE A 1 49 ? -2.227  5.718  -2.070  1.00 1.00 ? 49 PHE A HB2  3  
ATOM   2247  H HB3  . PHE A 1 49 ? -3.564  6.703  -1.561  1.00 1.00 ? 49 PHE A HB3  3  
ATOM   2248  H HD1  . PHE A 1 49 ? -0.137  6.877  -3.052  1.00 1.00 ? 49 PHE A HD1  3  
ATOM   2249  H HD2  . PHE A 1 49 ? -3.986  8.790  -2.748  1.00 1.00 ? 49 PHE A HD2  3  
ATOM   2250  H HE1  . PHE A 1 49 ? 0.803   8.947  -3.931  1.00 1.00 ? 49 PHE A HE1  3  
ATOM   2251  H HE2  . PHE A 1 49 ? -3.170  10.598 -4.237  1.00 1.00 ? 49 PHE A HE2  3  
ATOM   2252  H HZ   . PHE A 1 49 ? -0.743  10.699 -4.868  1.00 1.00 ? 49 PHE A HZ   3  
ATOM   2253  N N    . PRO A 1 50 ? -2.778  5.076  1.182   1.00 1.00 ? 50 PRO A N    3  
ATOM   2254  C CA   . PRO A 1 50 ? -2.815  3.761  1.803   1.00 1.00 ? 50 PRO A CA   3  
ATOM   2255  C C    . PRO A 1 50 ? -2.865  2.702  0.702   1.00 1.00 ? 50 PRO A C    3  
ATOM   2256  O O    . PRO A 1 50 ? -3.727  2.751  -0.176  1.00 1.00 ? 50 PRO A O    3  
ATOM   2257  C CB   . PRO A 1 50 ? -4.070  3.752  2.681   1.00 1.00 ? 50 PRO A CB   3  
ATOM   2258  C CG   . PRO A 1 50 ? -4.982  4.780  2.010   1.00 1.00 ? 50 PRO A CG   3  
ATOM   2259  C CD   . PRO A 1 50 ? -3.993  5.809  1.461   1.00 1.00 ? 50 PRO A CD   3  
ATOM   2260  H HA   . PRO A 1 50 ? -1.936  3.612  2.429   1.00 1.00 ? 50 PRO A HA   3  
ATOM   2261  H HB2  . PRO A 1 50 ? -4.530  2.765  2.744   1.00 1.00 ? 50 PRO A HB2  3  
ATOM   2262  H HB3  . PRO A 1 50 ? -3.808  4.104  3.680   1.00 1.00 ? 50 PRO A HB3  3  
ATOM   2263  H HG2  . PRO A 1 50 ? -5.509  4.305  1.180   1.00 1.00 ? 50 PRO A HG2  3  
ATOM   2264  H HG3  . PRO A 1 50 ? -5.697  5.216  2.706   1.00 1.00 ? 50 PRO A HG3  3  
ATOM   2265  H HD2  . PRO A 1 50 ? -4.395  6.280  0.563   1.00 1.00 ? 50 PRO A HD2  3  
ATOM   2266  H HD3  . PRO A 1 50 ? -3.759  6.547  2.226   1.00 1.00 ? 50 PRO A HD3  3  
ATOM   2267  N N    . CYS A 1 51 ? -1.930  1.753  0.707   1.00 1.00 ? 51 CYS A N    3  
ATOM   2268  C CA   . CYS A 1 51 ? -1.769  0.848  -0.421  1.00 1.00 ? 51 CYS A CA   3  
ATOM   2269  C C    . CYS A 1 51 ? -2.799  -0.274 -0.361  1.00 1.00 ? 51 CYS A C    3  
ATOM   2270  O O    . CYS A 1 51 ? -2.445  -1.405 -0.032  1.00 1.00 ? 51 CYS A O    3  
ATOM   2271  C CB   . CYS A 1 51 ? -0.331  0.342  -0.476  1.00 1.00 ? 51 CYS A CB   3  
ATOM   2272  S SG   . CYS A 1 51 ? 0.202   -0.168 -2.118  1.00 1.00 ? 51 CYS A SG   3  
ATOM   2273  O OXT  . CYS A 1 51 ? -4.080  0.089  -0.645  1.00 0.00 ? 51 CYS A OXT  3  
ATOM   2274  H H    . CYS A 1 51 ? -1.304  1.665  1.503   1.00 1.00 ? 51 CYS A H    3  
ATOM   2275  H HA   . CYS A 1 51 ? -1.930  1.410  -1.344  1.00 1.00 ? 51 CYS A HA   3  
ATOM   2276  H HB2  . CYS A 1 51 ? 0.311   1.179  -0.212  1.00 1.00 ? 51 CYS A HB2  3  
ATOM   2277  H HB3  . CYS A 1 51 ? -0.168  -0.469 0.233   1.00 1.00 ? 51 CYS A HB3  3  
HETATM 2278  N N    . PCA A 1 1  ? -2.464  0.595  4.140   1.00 1.00 ? 1  PCA A N    4  
HETATM 2279  C CA   . PCA A 1 1  ? -2.109  1.000  5.487   1.00 1.00 ? 1  PCA A CA   4  
HETATM 2280  C CB   . PCA A 1 1  ? -2.140  -0.304 6.311   1.00 1.00 ? 1  PCA A CB   4  
HETATM 2281  C CG   . PCA A 1 1  ? -2.090  -1.419 5.253   1.00 1.00 ? 1  PCA A CG   4  
HETATM 2282  C CD   . PCA A 1 1  ? -2.436  -0.713 3.957   1.00 1.00 ? 1  PCA A CD   4  
HETATM 2283  O OE   . PCA A 1 1  ? -2.628  -1.281 2.885   1.00 1.00 ? 1  PCA A OE   4  
HETATM 2284  C C    . PCA A 1 1  ? -0.740  1.681  5.444   1.00 1.00 ? 1  PCA A C    4  
HETATM 2285  O O    . PCA A 1 1  ? -0.655  2.905  5.441   1.00 1.00 ? 1  PCA A O    4  
HETATM 2286  H H    . PCA A 1 1  ? -2.649  1.247  3.396   1.00 0.00 ? 1  PCA A H    4  
HETATM 2287  H HA   . PCA A 1 1  ? -2.848  1.700  5.879   1.00 1.00 ? 1  PCA A HA   4  
HETATM 2288  H HB2  . PCA A 1 1  ? -1.333  -0.377 7.042   1.00 1.00 ? 1  PCA A HB2  4  
HETATM 2289  H HB3  . PCA A 1 1  ? -3.098  -0.362 6.828   1.00 1.00 ? 1  PCA A HB3  4  
HETATM 2290  H HG2  . PCA A 1 1  ? -1.089  -1.842 5.178   1.00 1.00 ? 1  PCA A HG2  4  
HETATM 2291  H HG3  . PCA A 1 1  ? -2.815  -2.202 5.474   1.00 1.00 ? 1  PCA A HG3  4  
ATOM   2292  N N    . LYS A 1 2  ? 0.327   0.882  5.346   1.00 1.00 ? 2  LYS A N    4  
ATOM   2293  C CA   . LYS A 1 2  ? 1.673   1.364  5.073   1.00 1.00 ? 2  LYS A CA   4  
ATOM   2294  C C    . LYS A 1 2  ? 1.621   2.214  3.803   1.00 1.00 ? 2  LYS A C    4  
ATOM   2295  O O    . LYS A 1 2  ? 1.105   1.743  2.791   1.00 1.00 ? 2  LYS A O    4  
ATOM   2296  C CB   . LYS A 1 2  ? 2.580   0.141  4.858   1.00 1.00 ? 2  LYS A CB   4  
ATOM   2297  C CG   . LYS A 1 2  ? 4.007   0.493  4.390   1.00 1.00 ? 2  LYS A CG   4  
ATOM   2298  C CD   . LYS A 1 2  ? 4.633   -0.584 3.488   1.00 1.00 ? 2  LYS A CD   4  
ATOM   2299  C CE   . LYS A 1 2  ? 3.809   -0.970 2.244   1.00 1.00 ? 2  LYS A CE   4  
ATOM   2300  N NZ   . LYS A 1 2  ? 3.096   0.168  1.624   1.00 1.00 ? 2  LYS A NZ   4  
ATOM   2301  H H    . LYS A 1 2  ? 0.172   -0.113 5.349   1.00 1.00 ? 2  LYS A H    4  
ATOM   2302  H HA   . LYS A 1 2  ? 2.034   1.954  5.919   1.00 1.00 ? 2  LYS A HA   4  
ATOM   2303  H HB2  . LYS A 1 2  ? 2.648   -0.425 5.789   1.00 1.00 ? 2  LYS A HB2  4  
ATOM   2304  H HB3  . LYS A 1 2  ? 2.090   -0.497 4.125   1.00 1.00 ? 2  LYS A HB3  4  
ATOM   2305  H HG2  . LYS A 1 2  ? 4.048   1.439  3.853   1.00 1.00 ? 2  LYS A HG2  4  
ATOM   2306  H HG3  . LYS A 1 2  ? 4.633   0.615  5.277   1.00 1.00 ? 2  LYS A HG3  4  
ATOM   2307  H HD2  . LYS A 1 2  ? 5.607   -0.212 3.160   1.00 1.00 ? 2  LYS A HD2  4  
ATOM   2308  H HD3  . LYS A 1 2  ? 4.811   -1.485 4.079   1.00 1.00 ? 2  LYS A HD3  4  
ATOM   2309  H HE2  . LYS A 1 2  ? 4.477   -1.418 1.506   1.00 1.00 ? 2  LYS A HE2  4  
ATOM   2310  H HE3  . LYS A 1 2  ? 3.070   -1.726 2.517   1.00 1.00 ? 2  LYS A HE3  4  
ATOM   2311  H HZ1  . LYS A 1 2  ? 3.701   0.935  1.351   1.00 1.00 ? 2  LYS A HZ1  4  
ATOM   2312  H HZ2  . LYS A 1 2  ? 2.537   -0.137 0.834   1.00 1.00 ? 2  LYS A HZ2  4  
ATOM   2313  H HZ3  . LYS A 1 2  ? 2.393   0.550  2.244   1.00 1.00 ? 2  LYS A HZ3  4  
ATOM   2314  N N    . LEU A 1 3  ? 2.210   3.409  3.808   1.00 1.00 ? 3  LEU A N    4  
ATOM   2315  C CA   . LEU A 1 3  ? 2.205   4.266  2.629   1.00 1.00 ? 3  LEU A CA   4  
ATOM   2316  C C    . LEU A 1 3  ? 2.876   3.613  1.412   1.00 1.00 ? 3  LEU A C    4  
ATOM   2317  O O    . LEU A 1 3  ? 3.749   2.752  1.545   1.00 1.00 ? 3  LEU A O    4  
ATOM   2318  C CB   . LEU A 1 3  ? 2.902   5.598  2.917   1.00 1.00 ? 3  LEU A CB   4  
ATOM   2319  C CG   . LEU A 1 3  ? 2.267   6.452  4.026   1.00 1.00 ? 3  LEU A CG   4  
ATOM   2320  C CD1  . LEU A 1 3  ? 3.220   7.607  4.364   1.00 1.00 ? 3  LEU A CD1  4  
ATOM   2321  C CD2  . LEU A 1 3  ? 0.900   7.006  3.602   1.00 1.00 ? 3  LEU A CD2  4  
ATOM   2322  H H    . LEU A 1 3  ? 2.634   3.753  4.656   1.00 1.00 ? 3  LEU A H    4  
ATOM   2323  H HA   . LEU A 1 3  ? 1.170   4.477  2.395   1.00 1.00 ? 3  LEU A HA   4  
ATOM   2324  H HB2  . LEU A 1 3  ? 3.931   5.364  3.175   1.00 1.00 ? 3  LEU A HB2  4  
ATOM   2325  H HB3  . LEU A 1 3  ? 2.912   6.183  1.997   1.00 1.00 ? 3  LEU A HB3  4  
ATOM   2326  H HG   . LEU A 1 3  ? 2.131   5.854  4.927   1.00 1.00 ? 3  LEU A HG   4  
ATOM   2327  H HD11 . LEU A 1 3  ? 4.185   7.212  4.685   1.00 1.00 ? 3  LEU A HD11 4  
ATOM   2328  H HD12 . LEU A 1 3  ? 3.382   8.246  3.498   1.00 1.00 ? 3  LEU A HD12 4  
ATOM   2329  H HD13 . LEU A 1 3  ? 2.803   8.208  5.170   1.00 1.00 ? 3  LEU A HD13 4  
ATOM   2330  H HD21 . LEU A 1 3  ? 0.970   7.518  2.645   1.00 1.00 ? 3  LEU A HD21 4  
ATOM   2331  H HD22 . LEU A 1 3  ? 0.179   6.195  3.514   1.00 1.00 ? 3  LEU A HD22 4  
ATOM   2332  H HD23 . LEU A 1 3  ? 0.541   7.711  4.351   1.00 1.00 ? 3  LEU A HD23 4  
ATOM   2333  N N    . CYS A 1 4  ? 2.457   4.047  0.224   1.00 1.00 ? 4  CYS A N    4  
ATOM   2334  C CA   . CYS A 1 4  ? 3.063   3.789  -1.076  1.00 1.00 ? 4  CYS A CA   4  
ATOM   2335  C C    . CYS A 1 4  ? 3.217   5.159  -1.725  1.00 1.00 ? 4  CYS A C    4  
ATOM   2336  O O    . CYS A 1 4  ? 2.349   6.018  -1.542  1.00 1.00 ? 4  CYS A O    4  
ATOM   2337  C CB   . CYS A 1 4  ? 2.188   2.903  -1.971  1.00 1.00 ? 4  CYS A CB   4  
ATOM   2338  S SG   . CYS A 1 4  ? 2.101   1.160  -1.508  1.00 1.00 ? 4  CYS A SG   4  
ATOM   2339  H H    . CYS A 1 4  ? 1.676   4.694  0.225   1.00 1.00 ? 4  CYS A H    4  
ATOM   2340  H HA   . CYS A 1 4  ? 4.044   3.325  -0.955  1.00 1.00 ? 4  CYS A HA   4  
ATOM   2341  H HB2  . CYS A 1 4  ? 1.181   3.318  -2.009  1.00 1.00 ? 4  CYS A HB2  4  
ATOM   2342  H HB3  . CYS A 1 4  ? 2.589   2.929  -2.985  1.00 1.00 ? 4  CYS A HB3  4  
ATOM   2343  N N    . GLU A 1 5  ? 4.322   5.362  -2.446  1.00 1.00 ? 5  GLU A N    4  
ATOM   2344  C CA   . GLU A 1 5  ? 4.657   6.624  -3.084  1.00 1.00 ? 5  GLU A CA   4  
ATOM   2345  C C    . GLU A 1 5  ? 4.025   6.678  -4.473  1.00 1.00 ? 5  GLU A C    4  
ATOM   2346  O O    . GLU A 1 5  ? 4.142   5.723  -5.238  1.00 1.00 ? 5  GLU A O    4  
ATOM   2347  C CB   . GLU A 1 5  ? 6.183   6.761  -3.196  1.00 1.00 ? 5  GLU A CB   4  
ATOM   2348  C CG   . GLU A 1 5  ? 6.880   6.539  -1.847  1.00 1.00 ? 5  GLU A CG   4  
ATOM   2349  C CD   . GLU A 1 5  ? 8.345   6.960  -1.881  1.00 1.00 ? 5  GLU A CD   4  
ATOM   2350  O OE1  . GLU A 1 5  ? 8.770   7.758  -1.047  1.00 1.00 ? 5  GLU A OE1  4  
ATOM   2351  O OE2  . GLU A 1 5  ? 9.106   6.406  -2.862  1.00 1.00 ? 5  GLU A OE2  4  
ATOM   2352  H H    . GLU A 1 5  ? 4.954   4.591  -2.598  1.00 1.00 ? 5  GLU A H    4  
ATOM   2353  H HA   . GLU A 1 5  ? 4.283   7.448  -2.472  1.00 1.00 ? 5  GLU A HA   4  
ATOM   2354  H HB2  . GLU A 1 5  ? 6.569   6.041  -3.920  1.00 1.00 ? 5  GLU A HB2  4  
ATOM   2355  H HB3  . GLU A 1 5  ? 6.409   7.767  -3.556  1.00 1.00 ? 5  GLU A HB3  4  
ATOM   2356  H HG2  . GLU A 1 5  ? 6.360   7.121  -1.092  1.00 1.00 ? 5  GLU A HG2  4  
ATOM   2357  H HG3  . GLU A 1 5  ? 6.835   5.487  -1.568  1.00 1.00 ? 5  GLU A HG3  4  
ATOM   2358  H HE2  . GLU A 1 5  ? 10.012  6.716  -2.805  1.00 1.00 ? 5  GLU A HE2  4  
ATOM   2359  N N    . ARG A 1 6  ? 3.381   7.796  -4.806  1.00 1.00 ? 6  ARG A N    4  
ATOM   2360  C CA   . ARG A 1 6  ? 2.897   8.110  -6.140  1.00 1.00 ? 6  ARG A CA   4  
ATOM   2361  C C    . ARG A 1 6  ? 3.280   9.571  -6.401  1.00 1.00 ? 6  ARG A C    4  
ATOM   2362  O O    . ARG A 1 6  ? 2.848   10.438 -5.639  1.00 1.00 ? 6  ARG A O    4  
ATOM   2363  C CB   . ARG A 1 6  ? 1.369   7.909  -6.191  1.00 1.00 ? 6  ARG A CB   4  
ATOM   2364  C CG   . ARG A 1 6  ? 0.869   6.988  -7.312  1.00 1.00 ? 6  ARG A CG   4  
ATOM   2365  C CD   . ARG A 1 6  ? 1.080   7.560  -8.720  1.00 1.00 ? 6  ARG A CD   4  
ATOM   2366  N NE   . ARG A 1 6  ? 0.704   8.981  -8.806  1.00 1.00 ? 6  ARG A NE   4  
ATOM   2367  C CZ   . ARG A 1 6  ? -0.538  9.484  -8.827  1.00 1.00 ? 6  ARG A CZ   4  
ATOM   2368  N NH1  . ARG A 1 6  ? -1.600  8.673  -8.845  1.00 1.00 ? 6  ARG A NH1  4  
ATOM   2369  N NH2  . ARG A 1 6  ? -0.691  10.809 -8.818  1.00 1.00 ? 6  ARG A NH2  4  
ATOM   2370  H H    . ARG A 1 6  ? 3.306   8.538  -4.118  1.00 1.00 ? 6  ARG A H    4  
ATOM   2371  H HA   . ARG A 1 6  ? 3.358   7.447  -6.868  1.00 1.00 ? 6  ARG A HA   4  
ATOM   2372  H HB2  . ARG A 1 6  ? 1.038   7.448  -5.261  1.00 1.00 ? 6  ARG A HB2  4  
ATOM   2373  H HB3  . ARG A 1 6  ? 0.867   8.873  -6.271  1.00 1.00 ? 6  ARG A HB3  4  
ATOM   2374  H HG2  . ARG A 1 6  ? 1.367   6.020  -7.231  1.00 1.00 ? 6  ARG A HG2  4  
ATOM   2375  H HG3  . ARG A 1 6  ? -0.197  6.829  -7.147  1.00 1.00 ? 6  ARG A HG3  4  
ATOM   2376  H HD2  . ARG A 1 6  ? 2.135   7.469  -8.976  1.00 1.00 ? 6  ARG A HD2  4  
ATOM   2377  H HD3  . ARG A 1 6  ? 0.528   6.966  -9.451  1.00 1.00 ? 6  ARG A HD3  4  
ATOM   2378  H HE   . ARG A 1 6  ? 1.463   9.660  -8.802  1.00 1.00 ? 6  ARG A HE   4  
ATOM   2379  H HH11 . ARG A 1 6  ? -1.453  7.675  -8.831  1.00 1.00 ? 6  ARG A HH11 4  
ATOM   2380  H HH12 . ARG A 1 6  ? -2.542  9.032  -8.869  1.00 1.00 ? 6  ARG A HH12 4  
ATOM   2381  H HH21 . ARG A 1 6  ? 0.140   11.396 -8.748  1.00 1.00 ? 6  ARG A HH21 4  
ATOM   2382  H HH22 . ARG A 1 6  ? -1.583  11.279 -8.823  1.00 1.00 ? 6  ARG A HH22 4  
ATOM   2383  N N    . PRO A 1 7  ? 4.078   9.892  -7.434  1.00 1.00 ? 7  PRO A N    4  
ATOM   2384  C CA   . PRO A 1 7  ? 4.283   11.273 -7.847  1.00 1.00 ? 7  PRO A CA   4  
ATOM   2385  C C    . PRO A 1 7  ? 2.932   11.985 -7.934  1.00 1.00 ? 7  PRO A C    4  
ATOM   2386  O O    . PRO A 1 7  ? 1.981   11.412 -8.474  1.00 1.00 ? 7  PRO A O    4  
ATOM   2387  C CB   . PRO A 1 7  ? 4.994   11.191 -9.200  1.00 1.00 ? 7  PRO A CB   4  
ATOM   2388  C CG   . PRO A 1 7  ? 5.786   9.889  -9.075  1.00 1.00 ? 7  PRO A CG   4  
ATOM   2389  C CD   . PRO A 1 7  ? 4.836   8.989  -8.283  1.00 1.00 ? 7  PRO A CD   4  
ATOM   2390  H HA   . PRO A 1 7  ? 4.936   11.760 -7.123  1.00 1.00 ? 7  PRO A HA   4  
ATOM   2391  H HB2  . PRO A 1 7  ? 4.262   11.089 -10.003 1.00 1.00 ? 7  PRO A HB2  4  
ATOM   2392  H HB3  . PRO A 1 7  ? 5.634   12.055 -9.382  1.00 1.00 ? 7  PRO A HB3  4  
ATOM   2393  H HG2  . PRO A 1 7  ? 6.048   9.466  -10.045 1.00 1.00 ? 7  PRO A HG2  4  
ATOM   2394  H HG3  . PRO A 1 7  ? 6.689   10.070 -8.488  1.00 1.00 ? 7  PRO A HG3  4  
ATOM   2395  H HD2  . PRO A 1 7  ? 4.167   8.481  -8.977  1.00 1.00 ? 7  PRO A HD2  4  
ATOM   2396  H HD3  . PRO A 1 7  ? 5.403   8.260  -7.700  1.00 1.00 ? 7  PRO A HD3  4  
ATOM   2397  N N    . SER A 1 8  ? 2.824   13.181 -7.343  1.00 1.00 ? 8  SER A N    4  
ATOM   2398  C CA   . SER A 1 8  ? 1.546   13.859 -7.164  1.00 1.00 ? 8  SER A CA   4  
ATOM   2399  C C    . SER A 1 8  ? 0.707   13.848 -8.442  1.00 1.00 ? 8  SER A C    4  
ATOM   2400  O O    . SER A 1 8  ? -0.472  13.508 -8.399  1.00 1.00 ? 8  SER A O    4  
ATOM   2401  C CB   . SER A 1 8  ? 1.774   15.285 -6.660  1.00 1.00 ? 8  SER A CB   4  
ATOM   2402  O OG   . SER A 1 8  ? 2.663   15.966 -7.524  1.00 1.00 ? 8  SER A OG   4  
ATOM   2403  H H    . SER A 1 8  ? 3.639   13.606 -6.908  1.00 1.00 ? 8  SER A H    4  
ATOM   2404  H HA   . SER A 1 8  ? 0.982   13.323 -6.400  1.00 1.00 ? 8  SER A HA   4  
ATOM   2405  H HB2  . SER A 1 8  ? 0.819   15.806 -6.611  1.00 1.00 ? 8  SER A HB2  4  
ATOM   2406  H HB3  . SER A 1 8  ? 2.196   15.251 -5.655  1.00 1.00 ? 8  SER A HB3  4  
ATOM   2407  H HG   . SER A 1 8  ? 3.564   15.714 -7.272  1.00 1.00 ? 8  SER A HG   4  
ATOM   2408  N N    . GLY A 1 9  ? 1.308   14.191 -9.582  1.00 1.00 ? 9  GLY A N    4  
ATOM   2409  C CA   . GLY A 1 9  ? 0.599   14.270 -10.853 1.00 1.00 ? 9  GLY A CA   4  
ATOM   2410  C C    . GLY A 1 9  ? 0.082   15.687 -11.068 1.00 1.00 ? 9  GLY A C    4  
ATOM   2411  O O    . GLY A 1 9  ? 0.041   16.164 -12.198 1.00 1.00 ? 9  GLY A O    4  
ATOM   2412  H H    . GLY A 1 9  ? 2.270   14.507 -9.544  1.00 1.00 ? 9  GLY A H    4  
ATOM   2413  H HA2  . GLY A 1 9  ? 1.290   14.015 -11.656 1.00 1.00 ? 9  GLY A HA2  4  
ATOM   2414  H HA3  . GLY A 1 9  ? -0.238  13.570 -10.886 1.00 1.00 ? 9  GLY A HA3  4  
ATOM   2415  N N    . THR A 1 10 ? -0.225  16.390 -9.976  1.00 1.00 ? 10 THR A N    4  
ATOM   2416  C CA   . THR A 1 10 ? -0.566  17.793 -9.996  1.00 1.00 ? 10 THR A CA   4  
ATOM   2417  C C    . THR A 1 10 ? 0.734   18.591 -10.016 1.00 1.00 ? 10 THR A C    4  
ATOM   2418  O O    . THR A 1 10 ? 0.854   19.545 -10.781 1.00 1.00 ? 10 THR A O    4  
ATOM   2419  C CB   . THR A 1 10 ? -1.347  18.117 -8.714  1.00 1.00 ? 10 THR A CB   4  
ATOM   2420  O OG1  . THR A 1 10 ? -0.828  17.387 -7.616  1.00 1.00 ? 10 THR A OG1  4  
ATOM   2421  C CG2  . THR A 1 10 ? -2.826  17.760 -8.822  1.00 1.00 ? 10 THR A CG2  4  
ATOM   2422  H H    . THR A 1 10 ? -0.216  15.962 -9.062  1.00 1.00 ? 10 THR A H    4  
ATOM   2423  H HA   . THR A 1 10 ? -1.163  18.048 -10.874 1.00 1.00 ? 10 THR A HA   4  
ATOM   2424  H HB   . THR A 1 10 ? -1.273  19.190 -8.519  1.00 1.00 ? 10 THR A HB   4  
ATOM   2425  H HG1  . THR A 1 10 ? -1.058  17.906 -6.830  1.00 1.00 ? 10 THR A HG1  4  
ATOM   2426  H HG21 . THR A 1 10 ? -3.277  18.315 -9.643  1.00 1.00 ? 10 THR A HG21 4  
ATOM   2427  H HG22 . THR A 1 10 ? -2.939  16.689 -8.990  1.00 1.00 ? 10 THR A HG22 4  
ATOM   2428  H HG23 . THR A 1 10 ? -3.325  18.038 -7.891  1.00 1.00 ? 10 THR A HG23 4  
ATOM   2429  N N    . TRP A 1 11 ? 1.704   18.214 -9.173  1.00 1.00 ? 11 TRP A N    4  
ATOM   2430  C CA   . TRP A 1 11 ? 2.918   18.983 -8.967  1.00 1.00 ? 11 TRP A CA   4  
ATOM   2431  C C    . TRP A 1 11 ? 4.156   18.114 -9.202  1.00 1.00 ? 11 TRP A C    4  
ATOM   2432  O O    . TRP A 1 11 ? 5.008   17.921 -8.331  1.00 1.00 ? 11 TRP A O    4  
ATOM   2433  C CB   . TRP A 1 11 ? 2.827   19.653 -7.598  1.00 1.00 ? 11 TRP A CB   4  
ATOM   2434  C CG   . TRP A 1 11 ? 3.796   20.753 -7.310  1.00 1.00 ? 11 TRP A CG   4  
ATOM   2435  C CD1  . TRP A 1 11 ? 4.846   21.142 -8.066  1.00 1.00 ? 11 TRP A CD1  4  
ATOM   2436  C CD2  . TRP A 1 11 ? 3.774   21.654 -6.172  1.00 1.00 ? 11 TRP A CD2  4  
ATOM   2437  N NE1  . TRP A 1 11 ? 5.466   22.223 -7.482  1.00 1.00 ? 11 TRP A NE1  4  
ATOM   2438  C CE2  . TRP A 1 11 ? 4.843   22.583 -6.304  1.00 1.00 ? 11 TRP A CE2  4  
ATOM   2439  C CE3  . TRP A 1 11 ? 2.946   21.776 -5.040  1.00 1.00 ? 11 TRP A CE3  4  
ATOM   2440  C CZ2  . TRP A 1 11 ? 5.086   23.574 -5.344  1.00 1.00 ? 11 TRP A CZ2  4  
ATOM   2441  C CZ3  . TRP A 1 11 ? 3.195   22.745 -4.058  1.00 1.00 ? 11 TRP A CZ3  4  
ATOM   2442  C CH2  . TRP A 1 11 ? 4.292   23.609 -4.185  1.00 1.00 ? 11 TRP A CH2  4  
ATOM   2443  H H    . TRP A 1 11 ? 1.578   17.393 -8.590  1.00 1.00 ? 11 TRP A H    4  
ATOM   2444  H HA   . TRP A 1 11 ? 2.969   19.791 -9.700  1.00 1.00 ? 11 TRP A HA   4  
ATOM   2445  H HB2  . TRP A 1 11 ? 1.839   20.113 -7.530  1.00 1.00 ? 11 TRP A HB2  4  
ATOM   2446  H HB3  . TRP A 1 11 ? 2.878   18.905 -6.813  1.00 1.00 ? 11 TRP A HB3  4  
ATOM   2447  H HD1  . TRP A 1 11 ? 5.163   20.696 -8.995  1.00 1.00 ? 11 TRP A HD1  4  
ATOM   2448  H HE1  . TRP A 1 11 ? 6.308   22.670 -7.838  1.00 1.00 ? 11 TRP A HE1  4  
ATOM   2449  H HE3  . TRP A 1 11 ? 2.120   21.103 -4.927  1.00 1.00 ? 11 TRP A HE3  4  
ATOM   2450  H HZ2  . TRP A 1 11 ? 5.908   24.264 -5.465  1.00 1.00 ? 11 TRP A HZ2  4  
ATOM   2451  H HZ3  . TRP A 1 11 ? 2.549   22.815 -3.195  1.00 1.00 ? 11 TRP A HZ3  4  
ATOM   2452  H HH2  . TRP A 1 11 ? 4.536   24.266 -3.373  1.00 1.00 ? 11 TRP A HH2  4  
ATOM   2453  N N    . SER A 1 12 ? 4.293   17.672 -10.452 1.00 1.00 ? 12 SER A N    4  
ATOM   2454  C CA   . SER A 1 12 ? 5.450   16.928 -10.931 1.00 1.00 ? 12 SER A CA   4  
ATOM   2455  C C    . SER A 1 12 ? 6.545   17.879 -11.448 1.00 1.00 ? 12 SER A C    4  
ATOM   2456  O O    . SER A 1 12 ? 7.590   17.421 -11.920 1.00 1.00 ? 12 SER A O    4  
ATOM   2457  C CB   . SER A 1 12 ? 4.972   15.969 -12.027 1.00 1.00 ? 12 SER A CB   4  
ATOM   2458  O OG   . SER A 1 12 ? 3.891   15.194 -11.536 1.00 1.00 ? 12 SER A OG   4  
ATOM   2459  H H    . SER A 1 12 ? 3.519   17.805 -11.086 1.00 1.00 ? 12 SER A H    4  
ATOM   2460  H HA   . SER A 1 12 ? 5.866   16.330 -10.118 1.00 1.00 ? 12 SER A HA   4  
ATOM   2461  H HB2  . SER A 1 12 ? 4.645   16.542 -12.897 1.00 1.00 ? 12 SER A HB2  4  
ATOM   2462  H HB3  . SER A 1 12 ? 5.791   15.315 -12.327 1.00 1.00 ? 12 SER A HB3  4  
ATOM   2463  H HG   . SER A 1 12 ? 3.529   14.670 -12.257 1.00 1.00 ? 12 SER A HG   4  
ATOM   2464  N N    . GLY A 1 13 ? 6.310   19.194 -11.343 1.00 1.00 ? 13 GLY A N    4  
ATOM   2465  C CA   . GLY A 1 13 ? 7.295   20.240 -11.574 1.00 1.00 ? 13 GLY A CA   4  
ATOM   2466  C C    . GLY A 1 13 ? 8.257   20.351 -10.392 1.00 1.00 ? 13 GLY A C    4  
ATOM   2467  O O    . GLY A 1 13 ? 8.383   19.420 -9.599  1.00 1.00 ? 13 GLY A O    4  
ATOM   2468  H H    . GLY A 1 13 ? 5.422   19.488 -10.972 1.00 1.00 ? 13 GLY A H    4  
ATOM   2469  H HA2  . GLY A 1 13 ? 7.863   20.043 -12.478 1.00 1.00 ? 13 GLY A HA2  4  
ATOM   2470  H HA3  . GLY A 1 13 ? 6.765   21.185 -11.694 1.00 1.00 ? 13 GLY A HA3  4  
ATOM   2471  N N    . VAL A 1 14 ? 8.931   21.499 -10.271 1.00 1.00 ? 14 VAL A N    4  
ATOM   2472  C CA   . VAL A 1 14 ? 9.839   21.762 -9.163  1.00 1.00 ? 14 VAL A CA   4  
ATOM   2473  C C    . VAL A 1 14 ? 9.005   21.897 -7.888  1.00 1.00 ? 14 VAL A C    4  
ATOM   2474  O O    . VAL A 1 14 ? 8.113   22.742 -7.842  1.00 1.00 ? 14 VAL A O    4  
ATOM   2475  C CB   . VAL A 1 14 ? 10.651  23.048 -9.402  1.00 1.00 ? 14 VAL A CB   4  
ATOM   2476  C CG1  . VAL A 1 14 ? 11.876  23.063 -8.479  1.00 1.00 ? 14 VAL A CG1  4  
ATOM   2477  C CG2  . VAL A 1 14 ? 11.119  23.205 -10.856 1.00 1.00 ? 14 VAL A CG2  4  
ATOM   2478  H H    . VAL A 1 14 ? 8.744   22.246 -10.920 1.00 1.00 ? 14 VAL A H    4  
ATOM   2479  H HA   . VAL A 1 14 ? 10.534  20.929 -9.092  1.00 1.00 ? 14 VAL A HA   4  
ATOM   2480  H HB   . VAL A 1 14 ? 10.029  23.905 -9.149  1.00 1.00 ? 14 VAL A HB   4  
ATOM   2481  H HG11 . VAL A 1 14 ? 11.570  22.958 -7.439  1.00 1.00 ? 14 VAL A HG11 4  
ATOM   2482  H HG12 . VAL A 1 14 ? 12.544  22.243 -8.741  1.00 1.00 ? 14 VAL A HG12 4  
ATOM   2483  H HG13 . VAL A 1 14 ? 12.412  24.006 -8.590  1.00 1.00 ? 14 VAL A HG13 4  
ATOM   2484  H HG21 . VAL A 1 14 ? 11.605  22.292 -11.188 1.00 1.00 ? 14 VAL A HG21 4  
ATOM   2485  H HG22 . VAL A 1 14 ? 10.275  23.423 -11.511 1.00 1.00 ? 14 VAL A HG22 4  
ATOM   2486  H HG23 . VAL A 1 14 ? 11.824  24.034 -10.929 1.00 1.00 ? 14 VAL A HG23 4  
ATOM   2487  N N    . CYS A 1 15 ? 9.272   21.091 -6.859  1.00 1.00 ? 15 CYS A N    4  
ATOM   2488  C CA   . CYS A 1 15 ? 8.387   21.035 -5.692  1.00 1.00 ? 15 CYS A CA   4  
ATOM   2489  C C    . CYS A 1 15 ? 8.534   22.278 -4.816  1.00 1.00 ? 15 CYS A C    4  
ATOM   2490  O O    . CYS A 1 15 ? 7.575   22.699 -4.178  1.00 1.00 ? 15 CYS A O    4  
ATOM   2491  C CB   . CYS A 1 15 ? 8.614   19.781 -4.834  1.00 1.00 ? 15 CYS A CB   4  
ATOM   2492  S SG   . CYS A 1 15 ? 9.234   20.086 -3.158  1.00 1.00 ? 15 CYS A SG   4  
ATOM   2493  H H    . CYS A 1 15 ? 9.990   20.391 -7.002  1.00 1.00 ? 15 CYS A H    4  
ATOM   2494  H HA   . CYS A 1 15 ? 7.358   20.991 -6.044  1.00 1.00 ? 15 CYS A HA   4  
ATOM   2495  H HB2  . CYS A 1 15 ? 7.650   19.290 -4.710  1.00 1.00 ? 15 CYS A HB2  4  
ATOM   2496  H HB3  . CYS A 1 15 ? 9.290   19.093 -5.324  1.00 1.00 ? 15 CYS A HB3  4  
ATOM   2497  N N    . GLY A 1 16 ? 9.748   22.820 -4.701  1.00 1.00 ? 16 GLY A N    4  
ATOM   2498  C CA   . GLY A 1 16 ? 10.008  23.976 -3.855  1.00 1.00 ? 16 GLY A CA   4  
ATOM   2499  C C    . GLY A 1 16 ? 10.012  23.653 -2.354  1.00 1.00 ? 16 GLY A C    4  
ATOM   2500  O O    . GLY A 1 16 ? 10.928  24.077 -1.652  1.00 1.00 ? 16 GLY A O    4  
ATOM   2501  H H    . GLY A 1 16 ? 10.513  22.418 -5.221  1.00 1.00 ? 16 GLY A H    4  
ATOM   2502  H HA2  . GLY A 1 16 ? 10.980  24.386 -4.127  1.00 1.00 ? 16 GLY A HA2  4  
ATOM   2503  H HA3  . GLY A 1 16 ? 9.254   24.742 -4.044  1.00 1.00 ? 16 GLY A HA3  4  
ATOM   2504  N N    . ASN A 1 17 ? 9.002   22.944 -1.832  1.00 1.00 ? 17 ASN A N    4  
ATOM   2505  C CA   . ASN A 1 17 ? 8.820   22.780 -0.394  1.00 1.00 ? 17 ASN A CA   4  
ATOM   2506  C C    . ASN A 1 17 ? 7.878   21.625 -0.021  1.00 1.00 ? 17 ASN A C    4  
ATOM   2507  O O    . ASN A 1 17 ? 6.767   21.517 -0.541  1.00 1.00 ? 17 ASN A O    4  
ATOM   2508  C CB   . ASN A 1 17 ? 8.285   24.089 0.200   1.00 1.00 ? 17 ASN A CB   4  
ATOM   2509  C CG   . ASN A 1 17 ? 7.964   23.926 1.678   1.00 1.00 ? 17 ASN A CG   4  
ATOM   2510  O OD1  . ASN A 1 17 ? 6.813   23.714 2.047   1.00 1.00 ? 17 ASN A OD1  4  
ATOM   2511  N ND2  . ASN A 1 17 ? 8.977   23.980 2.536   1.00 1.00 ? 17 ASN A ND2  4  
ATOM   2512  H H    . ASN A 1 17 ? 8.315   22.538 -2.463  1.00 1.00 ? 17 ASN A H    4  
ATOM   2513  H HA   . ASN A 1 17 ? 9.796   22.563 0.042   1.00 1.00 ? 17 ASN A HA   4  
ATOM   2514  H HB2  . ASN A 1 17 ? 9.014   24.890 0.073   1.00 1.00 ? 17 ASN A HB2  4  
ATOM   2515  H HB3  . ASN A 1 17 ? 7.369   24.370 -0.324  1.00 1.00 ? 17 ASN A HB3  4  
ATOM   2516  H HD21 . ASN A 1 17 ? 9.911   24.181 2.207   1.00 1.00 ? 17 ASN A HD21 4  
ATOM   2517  H HD22 . ASN A 1 17 ? 8.787   23.909 3.524   1.00 1.00 ? 17 ASN A HD22 4  
ATOM   2518  N N    . ASN A 1 18 ? 8.324   20.812 0.947   1.00 1.00 ? 18 ASN A N    4  
ATOM   2519  C CA   . ASN A 1 18 ? 7.609   19.684 1.524   1.00 1.00 ? 18 ASN A CA   4  
ATOM   2520  C C    . ASN A 1 18 ? 6.176   20.031 1.912   1.00 1.00 ? 18 ASN A C    4  
ATOM   2521  O O    . ASN A 1 18 ? 5.230   19.406 1.447   1.00 1.00 ? 18 ASN A O    4  
ATOM   2522  C CB   . ASN A 1 18 ? 8.358   19.218 2.778   1.00 1.00 ? 18 ASN A CB   4  
ATOM   2523  C CG   . ASN A 1 18 ? 7.757   17.919 3.293   1.00 1.00 ? 18 ASN A CG   4  
ATOM   2524  O OD1  . ASN A 1 18 ? 6.678   17.897 3.883   1.00 1.00 ? 18 ASN A OD1  4  
ATOM   2525  N ND2  . ASN A 1 18 ? 8.430   16.808 3.049   1.00 1.00 ? 18 ASN A ND2  4  
ATOM   2526  H H    . ASN A 1 18 ? 9.253   20.966 1.308   1.00 1.00 ? 18 ASN A H    4  
ATOM   2527  H HA   . ASN A 1 18 ? 7.593   18.871 0.798   1.00 1.00 ? 18 ASN A HA   4  
ATOM   2528  H HB2  . ASN A 1 18 ? 9.406   19.076 2.529   1.00 1.00 ? 18 ASN A HB2  4  
ATOM   2529  H HB3  . ASN A 1 18 ? 8.314   19.966 3.569   1.00 1.00 ? 18 ASN A HB3  4  
ATOM   2530  H HD21 . ASN A 1 18 ? 9.364   16.824 2.666   1.00 1.00 ? 18 ASN A HD21 4  
ATOM   2531  H HD22 . ASN A 1 18 ? 7.973   15.939 3.301   1.00 1.00 ? 18 ASN A HD22 4  
ATOM   2532  N N    . ASN A 1 19 ? 6.035   20.984 2.828   1.00 1.00 ? 19 ASN A N    4  
ATOM   2533  C CA   . ASN A 1 19 ? 4.748   21.360 3.401   1.00 1.00 ? 19 ASN A CA   4  
ATOM   2534  C C    . ASN A 1 19 ? 3.764   21.833 2.332   1.00 1.00 ? 19 ASN A C    4  
ATOM   2535  O O    . ASN A 1 19 ? 2.618   21.385 2.306   1.00 1.00 ? 19 ASN A O    4  
ATOM   2536  C CB   . ASN A 1 19 ? 4.913   22.412 4.500   1.00 1.00 ? 19 ASN A CB   4  
ATOM   2537  C CG   . ASN A 1 19 ? 3.552   22.737 5.108   1.00 1.00 ? 19 ASN A CG   4  
ATOM   2538  O OD1  . ASN A 1 19 ? 3.021   21.954 5.889   1.00 1.00 ? 19 ASN A OD1  4  
ATOM   2539  N ND2  . ASN A 1 19 ? 2.967   23.874 4.746   1.00 1.00 ? 19 ASN A ND2  4  
ATOM   2540  H H    . ASN A 1 19 ? 6.889   21.388 3.182   1.00 1.00 ? 19 ASN A H    4  
ATOM   2541  H HA   . ASN A 1 19 ? 4.323   20.476 3.868   1.00 1.00 ? 19 ASN A HA   4  
ATOM   2542  H HB2  . ASN A 1 19 ? 5.560   22.017 5.283   1.00 1.00 ? 19 ASN A HB2  4  
ATOM   2543  H HB3  . ASN A 1 19 ? 5.364   23.320 4.101   1.00 1.00 ? 19 ASN A HB3  4  
ATOM   2544  H HD21 . ASN A 1 19 ? 3.414   24.508 4.102   1.00 1.00 ? 19 ASN A HD21 4  
ATOM   2545  H HD22 . ASN A 1 19 ? 2.063   24.091 5.139   1.00 1.00 ? 19 ASN A HD22 4  
ATOM   2546  N N    . ALA A 1 20 ? 4.206   22.729 1.448   1.00 1.00 ? 20 ALA A N    4  
ATOM   2547  C CA   . ALA A 1 20 ? 3.378   23.181 0.339   1.00 1.00 ? 20 ALA A CA   4  
ATOM   2548  C C    . ALA A 1 20 ? 2.904   21.981 -0.472  1.00 1.00 ? 20 ALA A C    4  
ATOM   2549  O O    . ALA A 1 20 ? 1.702   21.805 -0.671  1.00 1.00 ? 20 ALA A O    4  
ATOM   2550  C CB   . ALA A 1 20 ? 4.148   24.141 -0.563  1.00 1.00 ? 20 ALA A CB   4  
ATOM   2551  H H    . ALA A 1 20 ? 5.162   23.064 1.526   1.00 1.00 ? 20 ALA A H    4  
ATOM   2552  H HA   . ALA A 1 20 ? 2.509   23.705 0.740   1.00 1.00 ? 20 ALA A HA   4  
ATOM   2553  H HB1  . ALA A 1 20 ? 4.507   24.991 0.013   1.00 1.00 ? 20 ALA A HB1  4  
ATOM   2554  H HB2  . ALA A 1 20 ? 4.991   23.629 -1.031  1.00 1.00 ? 20 ALA A HB2  4  
ATOM   2555  H HB3  . ALA A 1 20 ? 3.470   24.495 -1.341  1.00 1.00 ? 20 ALA A HB3  4  
ATOM   2556  N N    . CYS A 1 21 ? 3.858   21.156 -0.919  1.00 1.00 ? 21 CYS A N    4  
ATOM   2557  C CA   . CYS A 1 21 ? 3.566   19.952 -1.680  1.00 1.00 ? 21 CYS A CA   4  
ATOM   2558  C C    . CYS A 1 21 ? 2.510   19.101 -0.970  1.00 1.00 ? 21 CYS A C    4  
ATOM   2559  O O    . CYS A 1 21 ? 1.502   18.733 -1.570  1.00 1.00 ? 21 CYS A O    4  
ATOM   2560  C CB   . CYS A 1 21 ? 4.842   19.128 -1.878  1.00 1.00 ? 21 CYS A CB   4  
ATOM   2561  S SG   . CYS A 1 21 ? 4.552   17.355 -2.104  1.00 1.00 ? 21 CYS A SG   4  
ATOM   2562  H H    . CYS A 1 21 ? 4.833   21.367 -0.711  1.00 1.00 ? 21 CYS A H    4  
ATOM   2563  H HA   . CYS A 1 21 ? 3.200   20.273 -2.657  1.00 1.00 ? 21 CYS A HA   4  
ATOM   2564  H HB2  . CYS A 1 21 ? 5.389   19.514 -2.737  1.00 1.00 ? 21 CYS A HB2  4  
ATOM   2565  H HB3  . CYS A 1 21 ? 5.480   19.214 -1.004  1.00 1.00 ? 21 CYS A HB3  4  
ATOM   2566  N N    . LYS A 1 22 ? 2.766   18.790 0.304   1.00 1.00 ? 22 LYS A N    4  
ATOM   2567  C CA   . LYS A 1 22 ? 1.926   17.974 1.163   1.00 1.00 ? 22 LYS A CA   4  
ATOM   2568  C C    . LYS A 1 22 ? 0.497   18.488 1.126   1.00 1.00 ? 22 LYS A C    4  
ATOM   2569  O O    . LYS A 1 22 ? -0.426  17.766 0.733   1.00 1.00 ? 22 LYS A O    4  
ATOM   2570  C CB   . LYS A 1 22 ? 2.496   18.015 2.591   1.00 1.00 ? 22 LYS A CB   4  
ATOM   2571  C CG   . LYS A 1 22 ? 1.647   17.241 3.610   1.00 1.00 ? 22 LYS A CG   4  
ATOM   2572  C CD   . LYS A 1 22 ? 2.151   17.352 5.065   1.00 1.00 ? 22 LYS A CD   4  
ATOM   2573  C CE   . LYS A 1 22 ? 3.660   17.573 5.268   1.00 1.00 ? 22 LYS A CE   4  
ATOM   2574  N NZ   . LYS A 1 22 ? 4.501   16.481 4.741   1.00 1.00 ? 22 LYS A NZ   4  
ATOM   2575  H H    . LYS A 1 22 ? 3.625   19.151 0.697   1.00 1.00 ? 22 LYS A H    4  
ATOM   2576  H HA   . LYS A 1 22 ? 1.934   16.954 0.790   1.00 1.00 ? 22 LYS A HA   4  
ATOM   2577  H HB2  . LYS A 1 22 ? 3.505   17.615 2.542   1.00 1.00 ? 22 LYS A HB2  4  
ATOM   2578  H HB3  . LYS A 1 22 ? 2.559   19.044 2.933   1.00 1.00 ? 22 LYS A HB3  4  
ATOM   2579  H HG2  . LYS A 1 22 ? 0.631   17.639 3.610   1.00 1.00 ? 22 LYS A HG2  4  
ATOM   2580  H HG3  . LYS A 1 22 ? 1.562   16.208 3.288   1.00 1.00 ? 22 LYS A HG3  4  
ATOM   2581  H HD2  . LYS A 1 22 ? 1.658   18.224 5.506   1.00 1.00 ? 22 LYS A HD2  4  
ATOM   2582  H HD3  . LYS A 1 22 ? 1.814   16.479 5.628   1.00 1.00 ? 22 LYS A HD3  4  
ATOM   2583  H HE2  . LYS A 1 22 ? 3.955   18.500 4.782   1.00 1.00 ? 22 LYS A HE2  4  
ATOM   2584  H HE3  . LYS A 1 22 ? 3.863   17.686 6.335   1.00 1.00 ? 22 LYS A HE3  4  
ATOM   2585  H HZ1  . LYS A 1 22 ? 4.214   16.235 3.801   1.00 1.00 ? 22 LYS A HZ1  4  
ATOM   2586  H HZ2  . LYS A 1 22 ? 5.462   16.803 4.677   1.00 1.00 ? 22 LYS A HZ2  4  
ATOM   2587  H HZ3  . LYS A 1 22 ? 4.454   15.660 5.324   1.00 1.00 ? 22 LYS A HZ3  4  
ATOM   2588  N N    . ASN A 1 23 ? 0.348   19.738 1.576   1.00 1.00 ? 23 ASN A N    4  
ATOM   2589  C CA   . ASN A 1 23 ? -0.941  20.386 1.665   1.00 1.00 ? 23 ASN A CA   4  
ATOM   2590  C C    . ASN A 1 23 ? -1.610  20.278 0.305   1.00 1.00 ? 23 ASN A C    4  
ATOM   2591  O O    . ASN A 1 23 ? -2.639  19.626 0.186   1.00 1.00 ? 23 ASN A O    4  
ATOM   2592  C CB   . ASN A 1 23 ? -0.779  21.853 2.095   1.00 1.00 ? 23 ASN A CB   4  
ATOM   2593  C CG   . ASN A 1 23 ? -2.013  22.710 1.792   1.00 1.00 ? 23 ASN A CG   4  
ATOM   2594  O OD1  . ASN A 1 23 ? -3.155  22.281 1.938   1.00 1.00 ? 23 ASN A OD1  4  
ATOM   2595  N ND2  . ASN A 1 23 ? -1.798  23.946 1.349   1.00 1.00 ? 23 ASN A ND2  4  
ATOM   2596  H H    . ASN A 1 23 ? 1.178   20.270 1.831   1.00 1.00 ? 23 ASN A H    4  
ATOM   2597  H HA   . ASN A 1 23 ? -1.515  19.827 2.408   1.00 1.00 ? 23 ASN A HA   4  
ATOM   2598  H HB2  . ASN A 1 23 ? -0.565  21.894 3.163   1.00 1.00 ? 23 ASN A HB2  4  
ATOM   2599  H HB3  . ASN A 1 23 ? 0.072   22.279 1.562   1.00 1.00 ? 23 ASN A HB3  4  
ATOM   2600  H HD21 . ASN A 1 23 ? -0.857  24.291 1.229   1.00 1.00 ? 23 ASN A HD21 4  
ATOM   2601  H HD22 . ASN A 1 23 ? -2.591  24.531 1.136   1.00 1.00 ? 23 ASN A HD22 4  
ATOM   2602  N N    . GLN A 1 24 ? -0.989  20.860 -0.725  1.00 1.00 ? 24 GLN A N    4  
ATOM   2603  C CA   . GLN A 1 24 ? -1.492  20.818 -2.087  1.00 1.00 ? 24 GLN A CA   4  
ATOM   2604  C C    . GLN A 1 24 ? -1.991  19.425 -2.451  1.00 1.00 ? 24 GLN A C    4  
ATOM   2605  O O    . GLN A 1 24 ? -3.134  19.308 -2.883  1.00 1.00 ? 24 GLN A O    4  
ATOM   2606  C CB   . GLN A 1 24 ? -0.416  21.366 -3.038  1.00 1.00 ? 24 GLN A CB   4  
ATOM   2607  C CG   . GLN A 1 24 ? -0.765  21.253 -4.531  1.00 1.00 ? 24 GLN A CG   4  
ATOM   2608  C CD   . GLN A 1 24 ? -0.598  19.847 -5.112  1.00 1.00 ? 24 GLN A CD   4  
ATOM   2609  O OE1  . GLN A 1 24 ? -1.437  19.381 -5.873  1.00 1.00 ? 24 GLN A OE1  4  
ATOM   2610  N NE2  . GLN A 1 24 ? 0.475   19.142 -4.765  1.00 1.00 ? 24 GLN A NE2  4  
ATOM   2611  H H    . GLN A 1 24 ? -0.080  21.287 -0.570  1.00 1.00 ? 24 GLN A H    4  
ATOM   2612  H HA   . GLN A 1 24 ? -2.376  21.458 -2.149  1.00 1.00 ? 24 GLN A HA   4  
ATOM   2613  H HB2  . GLN A 1 24 ? -0.295  22.426 -2.810  1.00 1.00 ? 24 GLN A HB2  4  
ATOM   2614  H HB3  . GLN A 1 24 ? 0.537   20.882 -2.835  1.00 1.00 ? 24 GLN A HB3  4  
ATOM   2615  H HG2  . GLN A 1 24 ? -1.792  21.586 -4.685  1.00 1.00 ? 24 GLN A HG2  4  
ATOM   2616  H HG3  . GLN A 1 24 ? -0.112  21.920 -5.093  1.00 1.00 ? 24 GLN A HG3  4  
ATOM   2617  H HE21 . GLN A 1 24 ? 1.130   19.511 -4.093  1.00 1.00 ? 24 GLN A HE21 4  
ATOM   2618  H HE22 . GLN A 1 24 ? 0.607   18.218 -5.143  1.00 1.00 ? 24 GLN A HE22 4  
ATOM   2619  N N    . CYS A 1 25 ? -1.185  18.376 -2.261  1.00 1.00 ? 25 CYS A N    4  
ATOM   2620  C CA   . CYS A 1 25 ? -1.618  17.051 -2.670  1.00 1.00 ? 25 CYS A CA   4  
ATOM   2621  C C    . CYS A 1 25 ? -2.916  16.667 -1.978  1.00 1.00 ? 25 CYS A C    4  
ATOM   2622  O O    . CYS A 1 25 ? -3.900  16.383 -2.652  1.00 1.00 ? 25 CYS A O    4  
ATOM   2623  C CB   . CYS A 1 25 ? -0.594  15.948 -2.425  1.00 1.00 ? 25 CYS A CB   4  
ATOM   2624  S SG   . CYS A 1 25 ? -1.229  14.418 -3.150  1.00 1.00 ? 25 CYS A SG   4  
ATOM   2625  H H    . CYS A 1 25 ? -0.261  18.508 -1.866  1.00 1.00 ? 25 CYS A H    4  
ATOM   2626  H HA   . CYS A 1 25 ? -1.798  17.091 -3.745  1.00 1.00 ? 25 CYS A HA   4  
ATOM   2627  H HB2  . CYS A 1 25 ? 0.352   16.185 -2.891  1.00 1.00 ? 25 CYS A HB2  4  
ATOM   2628  H HB3  . CYS A 1 25 ? -0.434  15.799 -1.356  1.00 1.00 ? 25 CYS A HB3  4  
ATOM   2629  N N    . ILE A 1 26 ? -2.929  16.646 -0.640  1.00 1.00 ? 26 ILE A N    4  
ATOM   2630  C CA   . ILE A 1 26 ? -4.102  16.127 0.066   1.00 1.00 ? 26 ILE A CA   4  
ATOM   2631  C C    . ILE A 1 26 ? -5.283  17.108 0.004   1.00 1.00 ? 26 ILE A C    4  
ATOM   2632  O O    . ILE A 1 26 ? -6.443  16.735 0.215   1.00 1.00 ? 26 ILE A O    4  
ATOM   2633  C CB   . ILE A 1 26 ? -3.723  15.741 1.507   1.00 1.00 ? 26 ILE A CB   4  
ATOM   2634  C CG1  . ILE A 1 26 ? -3.418  16.964 2.391   1.00 1.00 ? 26 ILE A CG1  4  
ATOM   2635  C CG2  . ILE A 1 26 ? -2.534  14.772 1.469   1.00 1.00 ? 26 ILE A CG2  4  
ATOM   2636  C CD1  . ILE A 1 26 ? -2.878  16.575 3.771   1.00 1.00 ? 26 ILE A CD1  4  
ATOM   2637  H H    . ILE A 1 26 ? -2.121  16.984 -0.121  1.00 1.00 ? 26 ILE A H    4  
ATOM   2638  H HA   . ILE A 1 26 ? -4.425  15.209 -0.430  1.00 1.00 ? 26 ILE A HA   4  
ATOM   2639  H HB   . ILE A 1 26 ? -4.571  15.210 1.943   1.00 1.00 ? 26 ILE A HB   4  
ATOM   2640  H HG12 . ILE A 1 26 ? -2.687  17.606 1.907   1.00 1.00 ? 26 ILE A HG12 4  
ATOM   2641  H HG13 . ILE A 1 26 ? -4.337  17.536 2.535   1.00 1.00 ? 26 ILE A HG13 4  
ATOM   2642  H HG21 . ILE A 1 26 ? -2.716  13.996 0.729   1.00 1.00 ? 26 ILE A HG21 4  
ATOM   2643  H HG22 . ILE A 1 26 ? -1.614  15.302 1.217   1.00 1.00 ? 26 ILE A HG22 4  
ATOM   2644  H HG23 . ILE A 1 26 ? -2.417  14.301 2.441   1.00 1.00 ? 26 ILE A HG23 4  
ATOM   2645  H HD11 . ILE A 1 26 ? -3.538  15.845 4.241   1.00 1.00 ? 26 ILE A HD11 4  
ATOM   2646  H HD12 . ILE A 1 26 ? -1.875  16.153 3.683   1.00 1.00 ? 26 ILE A HD12 4  
ATOM   2647  H HD13 . ILE A 1 26 ? -2.821  17.462 4.400   1.00 1.00 ? 26 ILE A HD13 4  
ATOM   2648  N N    . ASN A 1 27 ? -4.997  18.364 -0.343  1.00 1.00 ? 27 ASN A N    4  
ATOM   2649  C CA   . ASN A 1 27 ? -5.982  19.426 -0.431  1.00 1.00 ? 27 ASN A CA   4  
ATOM   2650  C C    . ASN A 1 27 ? -6.709  19.299 -1.764  1.00 1.00 ? 27 ASN A C    4  
ATOM   2651  O O    . ASN A 1 27 ? -7.930  19.140 -1.782  1.00 1.00 ? 27 ASN A O    4  
ATOM   2652  C CB   . ASN A 1 27 ? -5.255  20.759 -0.243  1.00 1.00 ? 27 ASN A CB   4  
ATOM   2653  C CG   . ASN A 1 27 ? -6.165  21.963 -0.075  1.00 1.00 ? 27 ASN A CG   4  
ATOM   2654  O OD1  . ASN A 1 27 ? -7.218  22.062 -0.694  1.00 1.00 ? 27 ASN A OD1  4  
ATOM   2655  N ND2  . ASN A 1 27 ? -5.746  22.898 0.776   1.00 1.00 ? 27 ASN A ND2  4  
ATOM   2656  H H    . ASN A 1 27 ? -4.023  18.620 -0.502  1.00 1.00 ? 27 ASN A H    4  
ATOM   2657  H HA   . ASN A 1 27 ? -6.703  19.320 0.382   1.00 1.00 ? 27 ASN A HA   4  
ATOM   2658  H HB2  . ASN A 1 27 ? -4.695  20.657 0.685   1.00 1.00 ? 27 ASN A HB2  4  
ATOM   2659  H HB3  . ASN A 1 27 ? -4.568  20.944 -1.068  1.00 1.00 ? 27 ASN A HB3  4  
ATOM   2660  H HD21 . ASN A 1 27 ? -4.869  22.759 1.277   1.00 1.00 ? 27 ASN A HD21 4  
ATOM   2661  H HD22 . ASN A 1 27 ? -6.318  23.713 0.930   1.00 1.00 ? 27 ASN A HD22 4  
ATOM   2662  N N    . LEU A 1 28 ? -5.958  19.256 -2.866  1.00 1.00 ? 28 LEU A N    4  
ATOM   2663  C CA   . LEU A 1 28 ? -6.495  19.007 -4.195  1.00 1.00 ? 28 LEU A CA   4  
ATOM   2664  C C    . LEU A 1 28 ? -6.954  17.548 -4.286  1.00 1.00 ? 28 LEU A C    4  
ATOM   2665  O O    . LEU A 1 28 ? -8.144  17.266 -4.121  1.00 1.00 ? 28 LEU A O    4  
ATOM   2666  C CB   . LEU A 1 28 ? -5.461  19.388 -5.270  1.00 1.00 ? 28 LEU A CB   4  
ATOM   2667  C CG   . LEU A 1 28 ? -5.504  20.881 -5.640  1.00 1.00 ? 28 LEU A CG   4  
ATOM   2668  C CD1  . LEU A 1 28 ? -5.162  21.798 -4.460  1.00 1.00 ? 28 LEU A CD1  4  
ATOM   2669  C CD2  . LEU A 1 28 ? -4.523  21.144 -6.789  1.00 1.00 ? 28 LEU A CD2  4  
ATOM   2670  H H    . LEU A 1 28 ? -4.948  19.309 -2.771  1.00 1.00 ? 28 LEU A H    4  
ATOM   2671  H HA   . LEU A 1 28 ? -7.380  19.629 -4.344  1.00 1.00 ? 28 LEU A HA   4  
ATOM   2672  H HB2  . LEU A 1 28 ? -4.454  19.123 -4.945  1.00 1.00 ? 28 LEU A HB2  4  
ATOM   2673  H HB3  . LEU A 1 28 ? -5.678  18.823 -6.174  1.00 1.00 ? 28 LEU A HB3  4  
ATOM   2674  H HG   . LEU A 1 28 ? -6.506  21.130 -5.993  1.00 1.00 ? 28 LEU A HG   4  
ATOM   2675  H HD11 . LEU A 1 28 ? -4.206  21.510 -4.024  1.00 1.00 ? 28 LEU A HD11 4  
ATOM   2676  H HD12 . LEU A 1 28 ? -5.099  22.831 -4.803  1.00 1.00 ? 28 LEU A HD12 4  
ATOM   2677  H HD13 . LEU A 1 28 ? -5.940  21.743 -3.699  1.00 1.00 ? 28 LEU A HD13 4  
ATOM   2678  H HD21 . LEU A 1 28 ? -4.776  20.518 -7.645  1.00 1.00 ? 28 LEU A HD21 4  
ATOM   2679  H HD22 . LEU A 1 28 ? -4.578  22.190 -7.092  1.00 1.00 ? 28 LEU A HD22 4  
ATOM   2680  H HD23 . LEU A 1 28 ? -3.506  20.918 -6.471  1.00 1.00 ? 28 LEU A HD23 4  
ATOM   2681  N N    . GLU A 1 29 ? -6.038  16.586 -4.422  1.00 1.00 ? 29 GLU A N    4  
ATOM   2682  C CA   . GLU A 1 29 ? -6.432  15.189 -4.564  1.00 1.00 ? 29 GLU A CA   4  
ATOM   2683  C C    . GLU A 1 29 ? -6.597  14.612 -3.157  1.00 1.00 ? 29 GLU A C    4  
ATOM   2684  O O    . GLU A 1 29 ? -6.491  15.331 -2.168  1.00 1.00 ? 29 GLU A O    4  
ATOM   2685  C CB   . GLU A 1 29 ? -5.488  14.398 -5.495  1.00 1.00 ? 29 GLU A CB   4  
ATOM   2686  C CG   . GLU A 1 29 ? -3.998  14.389 -5.132  1.00 1.00 ? 29 GLU A CG   4  
ATOM   2687  C CD   . GLU A 1 29 ? -3.216  15.543 -5.759  1.00 1.00 ? 29 GLU A CD   4  
ATOM   2688  O OE1  . GLU A 1 29 ? -3.597  16.698 -5.605  1.00 1.00 ? 29 GLU A OE1  4  
ATOM   2689  O OE2  . GLU A 1 29 ? -2.120  15.198 -6.486  1.00 1.00 ? 29 GLU A OE2  4  
ATOM   2690  H H    . GLU A 1 29 ? -5.045  16.812 -4.386  1.00 1.00 ? 29 GLU A H    4  
ATOM   2691  H HA   . GLU A 1 29 ? -7.412  15.137 -5.041  1.00 1.00 ? 29 GLU A HA   4  
ATOM   2692  H HB2  . GLU A 1 29 ? -5.817  13.357 -5.513  1.00 1.00 ? 29 GLU A HB2  4  
ATOM   2693  H HB3  . GLU A 1 29 ? -5.593  14.785 -6.510  1.00 1.00 ? 29 GLU A HB3  4  
ATOM   2694  H HG2  . GLU A 1 29 ? -3.888  14.381 -4.050  1.00 1.00 ? 29 GLU A HG2  4  
ATOM   2695  H HG3  . GLU A 1 29 ? -3.567  13.464 -5.516  1.00 1.00 ? 29 GLU A HG3  4  
ATOM   2696  H HE2  . GLU A 1 29 ? -1.756  15.960 -6.952  1.00 1.00 ? 29 GLU A HE2  4  
ATOM   2697  N N    . LYS A 1 30 ? -6.993  13.345 -3.049  1.00 1.00 ? 30 LYS A N    4  
ATOM   2698  C CA   . LYS A 1 30 ? -7.459  12.737 -1.804  1.00 1.00 ? 30 LYS A CA   4  
ATOM   2699  C C    . LYS A 1 30 ? -6.503  11.730 -1.165  1.00 1.00 ? 30 LYS A C    4  
ATOM   2700  O O    . LYS A 1 30 ? -6.945  10.867 -0.408  1.00 1.00 ? 30 LYS A O    4  
ATOM   2701  C CB   . LYS A 1 30 ? -8.932  12.329 -1.939  1.00 1.00 ? 30 LYS A CB   4  
ATOM   2702  C CG   . LYS A 1 30 ? -9.806  13.591 -2.138  1.00 1.00 ? 30 LYS A CG   4  
ATOM   2703  C CD   . LYS A 1 30 ? -9.953  14.445 -0.857  1.00 1.00 ? 30 LYS A CD   4  
ATOM   2704  C CE   . LYS A 1 30 ? -9.998  15.969 -1.090  1.00 1.00 ? 30 LYS A CE   4  
ATOM   2705  N NZ   . LYS A 1 30 ? -8.704  16.567 -1.498  1.00 1.00 ? 30 LYS A NZ   4  
ATOM   2706  H H    . LYS A 1 30 ? -7.088  12.799 -3.892  1.00 1.00 ? 30 LYS A H    4  
ATOM   2707  H HA   . LYS A 1 30 ? -7.440  13.507 -1.040  1.00 1.00 ? 30 LYS A HA   4  
ATOM   2708  H HB2  . LYS A 1 30 ? -9.044  11.660 -2.794  1.00 1.00 ? 30 LYS A HB2  4  
ATOM   2709  H HB3  . LYS A 1 30 ? -9.268  11.809 -1.042  1.00 1.00 ? 30 LYS A HB3  4  
ATOM   2710  H HG2  . LYS A 1 30 ? -9.413  14.190 -2.958  1.00 1.00 ? 30 LYS A HG2  4  
ATOM   2711  H HG3  . LYS A 1 30 ? -10.803 13.263 -2.440  1.00 1.00 ? 30 LYS A HG3  4  
ATOM   2712  H HD2  . LYS A 1 30 ? -10.896 14.154 -0.389  1.00 1.00 ? 30 LYS A HD2  4  
ATOM   2713  H HD3  . LYS A 1 30 ? -9.179  14.228 -0.122  1.00 1.00 ? 30 LYS A HD3  4  
ATOM   2714  H HE2  . LYS A 1 30 ? -10.759 16.210 -1.834  1.00 1.00 ? 30 LYS A HE2  4  
ATOM   2715  H HE3  . LYS A 1 30 ? -10.288 16.439 -0.147  1.00 1.00 ? 30 LYS A HE3  4  
ATOM   2716  H HZ1  . LYS A 1 30 ? -7.904  16.274 -0.934  1.00 1.00 ? 30 LYS A HZ1  4  
ATOM   2717  H HZ2  . LYS A 1 30 ? -8.470  16.368 -2.466  1.00 1.00 ? 30 LYS A HZ2  4  
ATOM   2718  H HZ3  . LYS A 1 30 ? -8.746  17.580 -1.447  1.00 1.00 ? 30 LYS A HZ3  4  
ATOM   2719  N N    . ALA A 1 31 ? -5.233  11.753 -1.584  1.00 1.00 ? 31 ALA A N    4  
ATOM   2720  C CA   . ALA A 1 31 ? -4.123  11.041 -0.947  1.00 1.00 ? 31 ALA A CA   4  
ATOM   2721  C C    . ALA A 1 31 ? -4.065  11.251 0.583   1.00 1.00 ? 31 ALA A C    4  
ATOM   2722  O O    . ALA A 1 31 ? -5.037  11.685 1.202   1.00 1.00 ? 31 ALA A O    4  
ATOM   2723  C CB   . ALA A 1 31 ? -2.832  11.552 -1.583  1.00 1.00 ? 31 ALA A CB   4  
ATOM   2724  H H    . ALA A 1 31 ? -4.992  12.467 -2.253  1.00 1.00 ? 31 ALA A H    4  
ATOM   2725  H HA   . ALA A 1 31 ? -4.228  9.976  -1.149  1.00 1.00 ? 31 ALA A HA   4  
ATOM   2726  H HB1  . ALA A 1 31 ? -2.912  11.564 -2.670  1.00 1.00 ? 31 ALA A HB1  4  
ATOM   2727  H HB2  . ALA A 1 31 ? -2.658  12.572 -1.238  1.00 1.00 ? 31 ALA A HB2  4  
ATOM   2728  H HB3  . ALA A 1 31 ? -1.988  10.924 -1.303  1.00 1.00 ? 31 ALA A HB3  4  
ATOM   2729  N N    . ARG A 1 32 ? -2.943  10.919 1.236   1.00 1.00 ? 32 ARG A N    4  
ATOM   2730  C CA   . ARG A 1 32 ? -2.900  10.894 2.698   1.00 1.00 ? 32 ARG A CA   4  
ATOM   2731  C C    . ARG A 1 32 ? -1.680  11.620 3.252   1.00 1.00 ? 32 ARG A C    4  
ATOM   2732  O O    . ARG A 1 32 ? -1.803  12.435 4.165   1.00 1.00 ? 32 ARG A O    4  
ATOM   2733  C CB   . ARG A 1 32 ? -3.030  9.437  3.159   1.00 1.00 ? 32 ARG A CB   4  
ATOM   2734  C CG   . ARG A 1 32 ? -3.823  9.236  4.459   1.00 1.00 ? 32 ARG A CG   4  
ATOM   2735  C CD   . ARG A 1 32 ? -5.209  9.913  4.474   1.00 1.00 ? 32 ARG A CD   4  
ATOM   2736  N NE   . ARG A 1 32 ? -5.891  9.845  3.166   1.00 1.00 ? 32 ARG A NE   4  
ATOM   2737  C CZ   . ARG A 1 32 ? -6.614  8.815  2.703   1.00 1.00 ? 32 ARG A CZ   4  
ATOM   2738  N NH1  . ARG A 1 32 ? -6.767  7.715  3.450   1.00 1.00 ? 32 ARG A NH1  4  
ATOM   2739  N NH2  . ARG A 1 32 ? -7.172  8.882  1.493   1.00 1.00 ? 32 ARG A NH2  4  
ATOM   2740  H H    . ARG A 1 32 ? -2.131  10.572 0.729   1.00 1.00 ? 32 ARG A H    4  
ATOM   2741  H HA   . ARG A 1 32 ? -3.731  11.471 3.095   1.00 1.00 ? 32 ARG A HA   4  
ATOM   2742  H HB2  . ARG A 1 32 ? -3.556  8.884  2.381   1.00 1.00 ? 32 ARG A HB2  4  
ATOM   2743  H HB3  . ARG A 1 32 ? -2.037  8.997  3.267   1.00 1.00 ? 32 ARG A HB3  4  
ATOM   2744  H HG2  . ARG A 1 32 ? -3.951  8.160  4.593   1.00 1.00 ? 32 ARG A HG2  4  
ATOM   2745  H HG3  . ARG A 1 32 ? -3.234  9.611  5.296   1.00 1.00 ? 32 ARG A HG3  4  
ATOM   2746  H HD2  . ARG A 1 32 ? -5.823  9.489  5.270   1.00 1.00 ? 32 ARG A HD2  4  
ATOM   2747  H HD3  . ARG A 1 32 ? -5.081  10.966 4.729   1.00 1.00 ? 32 ARG A HD3  4  
ATOM   2748  H HE   . ARG A 1 32 ? -5.761  10.650 2.554   1.00 1.00 ? 32 ARG A HE   4  
ATOM   2749  H HH11 . ARG A 1 32 ? -6.325  7.674  4.356   1.00 1.00 ? 32 ARG A HH11 4  
ATOM   2750  H HH12 . ARG A 1 32 ? -7.320  6.932  3.138   1.00 1.00 ? 32 ARG A HH12 4  
ATOM   2751  H HH21 . ARG A 1 32 ? -7.046  9.713  0.917   1.00 1.00 ? 32 ARG A HH21 4  
ATOM   2752  H HH22 . ARG A 1 32 ? -7.730  8.133  1.114   1.00 1.00 ? 32 ARG A HH22 4  
ATOM   2753  N N    . HIS A 1 33 ? -0.485  11.255 2.801   1.00 1.00 ? 33 HIS A N    4  
ATOM   2754  C CA   . HIS A 1 33 ? 0.717   12.033 3.049   1.00 1.00 ? 33 HIS A CA   4  
ATOM   2755  C C    . HIS A 1 33 ? 1.162   12.692 1.747   1.00 1.00 ? 33 HIS A C    4  
ATOM   2756  O O    . HIS A 1 33 ? 0.674   12.355 0.671   1.00 1.00 ? 33 HIS A O    4  
ATOM   2757  C CB   . HIS A 1 33 ? 1.782   11.164 3.724   1.00 1.00 ? 33 HIS A CB   4  
ATOM   2758  C CG   . HIS A 1 33 ? 1.692   11.189 5.223   1.00 1.00 ? 33 HIS A CG   4  
ATOM   2759  N ND1  . HIS A 1 33 ? 0.522   11.495 5.907   1.00 1.00 ? 33 HIS A ND1  4  
ATOM   2760  C CD2  . HIS A 1 33 ? 2.641   10.972 6.191   1.00 1.00 ? 33 HIS A CD2  4  
ATOM   2761  C CE1  . HIS A 1 33 ? 0.809   11.443 7.218   1.00 1.00 ? 33 HIS A CE1  4  
ATOM   2762  N NE2  . HIS A 1 33 ? 2.088   11.138 7.457   1.00 1.00 ? 33 HIS A NE2  4  
ATOM   2763  H H    . HIS A 1 33 ? -0.446  10.602 2.025   1.00 1.00 ? 33 HIS A H    4  
ATOM   2764  H HA   . HIS A 1 33 ? 0.498   12.884 3.699   1.00 1.00 ? 33 HIS A HA   4  
ATOM   2765  H HB2  . HIS A 1 33 ? 1.671   10.125 3.416   1.00 1.00 ? 33 HIS A HB2  4  
ATOM   2766  H HB3  . HIS A 1 33 ? 2.779   11.510 3.449   1.00 1.00 ? 33 HIS A HB3  4  
ATOM   2767  H HD1  . HIS A 1 33 ? -0.373  11.739 5.492   1.00 1.00 ? 33 HIS A HD1  4  
ATOM   2768  H HD2  . HIS A 1 33 ? 3.675   10.728 5.981   1.00 1.00 ? 33 HIS A HD2  4  
ATOM   2769  H HE1  . HIS A 1 33 ? 0.087   11.646 7.998   1.00 1.00 ? 33 HIS A HE1  4  
ATOM   2770  N N    . GLY A 1 34 ? 2.124   13.604 1.843   1.00 1.00 ? 34 GLY A N    4  
ATOM   2771  C CA   . GLY A 1 34 ? 2.815   14.170 0.704   1.00 1.00 ? 34 GLY A CA   4  
ATOM   2772  C C    . GLY A 1 34 ? 4.109   14.773 1.225   1.00 1.00 ? 34 GLY A C    4  
ATOM   2773  O O    . GLY A 1 34 ? 4.168   15.131 2.405   1.00 1.00 ? 34 GLY A O    4  
ATOM   2774  H H    . GLY A 1 34 ? 2.506   13.839 2.749   1.00 1.00 ? 34 GLY A H    4  
ATOM   2775  H HA2  . GLY A 1 34 ? 3.068   13.372 0.022   1.00 1.00 ? 34 GLY A HA2  4  
ATOM   2776  H HA3  . GLY A 1 34 ? 2.196   14.895 0.179   1.00 1.00 ? 34 GLY A HA3  4  
ATOM   2777  N N    . SER A 1 35 ? 5.159   14.799 0.406   1.00 1.00 ? 35 SER A N    4  
ATOM   2778  C CA   . SER A 1 35 ? 6.485   15.269 0.777   1.00 1.00 ? 35 SER A CA   4  
ATOM   2779  C C    . SER A 1 35 ? 7.317   15.434 -0.491  1.00 1.00 ? 35 SER A C    4  
ATOM   2780  O O    . SER A 1 35 ? 6.856   15.143 -1.592  1.00 1.00 ? 35 SER A O    4  
ATOM   2781  C CB   . SER A 1 35 ? 7.146   14.285 1.761   1.00 1.00 ? 35 SER A CB   4  
ATOM   2782  O OG   . SER A 1 35 ? 6.709   14.572 3.076   1.00 1.00 ? 35 SER A OG   4  
ATOM   2783  H H    . SER A 1 35 ? 5.064   14.458 -0.552  1.00 1.00 ? 35 SER A H    4  
ATOM   2784  H HA   . SER A 1 35 ? 6.398   16.255 1.236   1.00 1.00 ? 35 SER A HA   4  
ATOM   2785  H HB2  . SER A 1 35 ? 6.890   13.257 1.500   1.00 1.00 ? 35 SER A HB2  4  
ATOM   2786  H HB3  . SER A 1 35 ? 8.234   14.365 1.736   1.00 1.00 ? 35 SER A HB3  4  
ATOM   2787  H HG   . SER A 1 35 ? 5.750   14.477 3.074   1.00 1.00 ? 35 SER A HG   4  
ATOM   2788  N N    . CYS A 1 36 ? 8.546   15.915 -0.331  1.00 1.00 ? 36 CYS A N    4  
ATOM   2789  C CA   . CYS A 1 36 ? 9.484   16.083 -1.423  1.00 1.00 ? 36 CYS A CA   4  
ATOM   2790  C C    . CYS A 1 36 ? 10.749  15.311 -1.091  1.00 1.00 ? 36 CYS A C    4  
ATOM   2791  O O    . CYS A 1 36 ? 11.072  15.119 0.079   1.00 1.00 ? 36 CYS A O    4  
ATOM   2792  C CB   . CYS A 1 36 ? 9.802   17.563 -1.619  1.00 1.00 ? 36 CYS A CB   4  
ATOM   2793  S SG   . CYS A 1 36 ? 8.380   18.592 -2.017  1.00 1.00 ? 36 CYS A SG   4  
ATOM   2794  H H    . CYS A 1 36 ? 8.900   16.088 0.598   1.00 1.00 ? 36 CYS A H    4  
ATOM   2795  H HA   . CYS A 1 36 ? 9.073   15.696 -2.356  1.00 1.00 ? 36 CYS A HA   4  
ATOM   2796  H HB2  . CYS A 1 36 ? 10.261  17.963 -0.714  1.00 1.00 ? 36 CYS A HB2  4  
ATOM   2797  H HB3  . CYS A 1 36 ? 10.517  17.669 -2.432  1.00 1.00 ? 36 CYS A HB3  4  
ATOM   2798  N N    . ASN A 1 37 ? 11.457  14.895 -2.137  1.00 1.00 ? 37 ASN A N    4  
ATOM   2799  C CA   . ASN A 1 37 ? 12.777  14.295 -2.098  1.00 1.00 ? 37 ASN A CA   4  
ATOM   2800  C C    . ASN A 1 37 ? 13.487  14.826 -3.340  1.00 1.00 ? 37 ASN A C    4  
ATOM   2801  O O    . ASN A 1 37 ? 12.803  15.274 -4.262  1.00 1.00 ? 37 ASN A O    4  
ATOM   2802  C CB   . ASN A 1 37 ? 12.657  12.765 -2.144  1.00 1.00 ? 37 ASN A CB   4  
ATOM   2803  C CG   . ASN A 1 37 ? 14.007  12.146 -2.486  1.00 1.00 ? 37 ASN A CG   4  
ATOM   2804  O OD1  . ASN A 1 37 ? 14.992  12.389 -1.797  1.00 1.00 ? 37 ASN A OD1  4  
ATOM   2805  N ND2  . ASN A 1 37 ? 14.094  11.448 -3.613  1.00 1.00 ? 37 ASN A ND2  4  
ATOM   2806  H H    . ASN A 1 37 ? 11.143  15.144 -3.067  1.00 1.00 ? 37 ASN A H    4  
ATOM   2807  H HA   . ASN A 1 37 ? 13.322  14.607 -1.205  1.00 1.00 ? 37 ASN A HA   4  
ATOM   2808  H HB2  . ASN A 1 37 ? 12.316  12.396 -1.177  1.00 1.00 ? 37 ASN A HB2  4  
ATOM   2809  H HB3  . ASN A 1 37 ? 11.923  12.487 -2.903  1.00 1.00 ? 37 ASN A HB3  4  
ATOM   2810  H HD21 . ASN A 1 37 ? 13.288  11.307 -4.199  1.00 1.00 ? 37 ASN A HD21 4  
ATOM   2811  H HD22 . ASN A 1 37 ? 15.014  11.194 -3.946  1.00 1.00 ? 37 ASN A HD22 4  
ATOM   2812  N N    . TYR A 1 38 ? 14.822  14.789 -3.387  1.00 1.00 ? 38 TYR A N    4  
ATOM   2813  C CA   . TYR A 1 38 ? 15.521  15.151 -4.605  1.00 1.00 ? 38 TYR A CA   4  
ATOM   2814  C C    . TYR A 1 38 ? 15.165  14.155 -5.710  1.00 1.00 ? 38 TYR A C    4  
ATOM   2815  O O    . TYR A 1 38 ? 15.597  13.003 -5.688  1.00 1.00 ? 38 TYR A O    4  
ATOM   2816  C CB   . TYR A 1 38 ? 17.039  15.244 -4.407  1.00 1.00 ? 38 TYR A CB   4  
ATOM   2817  C CG   . TYR A 1 38 ? 17.738  15.664 -5.690  1.00 1.00 ? 38 TYR A CG   4  
ATOM   2818  C CD1  . TYR A 1 38 ? 17.735  17.021 -6.068  1.00 1.00 ? 38 TYR A CD1  4  
ATOM   2819  C CD2  . TYR A 1 38 ? 18.116  14.686 -6.630  1.00 1.00 ? 38 TYR A CD2  4  
ATOM   2820  C CE1  . TYR A 1 38 ? 18.042  17.385 -7.391  1.00 1.00 ? 38 TYR A CE1  4  
ATOM   2821  C CE2  . TYR A 1 38 ? 18.363  15.048 -7.966  1.00 1.00 ? 38 TYR A CE2  4  
ATOM   2822  C CZ   . TYR A 1 38 ? 18.271  16.392 -8.358  1.00 1.00 ? 38 TYR A CZ   4  
ATOM   2823  O OH   . TYR A 1 38 ? 18.385  16.721 -9.675  1.00 1.00 ? 38 TYR A OH   4  
ATOM   2824  H H    . TYR A 1 38 ? 15.335  14.340 -2.637  1.00 1.00 ? 38 TYR A H    4  
ATOM   2825  H HA   . TYR A 1 38 ? 15.180  16.145 -4.898  1.00 1.00 ? 38 TYR A HA   4  
ATOM   2826  H HB2  . TYR A 1 38 ? 17.253  15.975 -3.626  1.00 1.00 ? 38 TYR A HB2  4  
ATOM   2827  H HB3  . TYR A 1 38 ? 17.424  14.276 -4.081  1.00 1.00 ? 38 TYR A HB3  4  
ATOM   2828  H HD1  . TYR A 1 38 ? 17.463  17.784 -5.352  1.00 1.00 ? 38 TYR A HD1  4  
ATOM   2829  H HD2  . TYR A 1 38 ? 18.145  13.643 -6.349  1.00 1.00 ? 38 TYR A HD2  4  
ATOM   2830  H HE1  . TYR A 1 38 ? 18.092  18.428 -7.667  1.00 1.00 ? 38 TYR A HE1  4  
ATOM   2831  H HE2  . TYR A 1 38 ? 18.593  14.288 -8.698  1.00 1.00 ? 38 TYR A HE2  4  
ATOM   2832  H HH   . TYR A 1 38 ? 18.028  17.595 -9.881  1.00 1.00 ? 38 TYR A HH   4  
ATOM   2833  N N    . VAL A 1 39 ? 14.382  14.621 -6.680  1.00 1.00 ? 39 VAL A N    4  
ATOM   2834  C CA   . VAL A 1 39 ? 14.083  13.953 -7.930  1.00 1.00 ? 39 VAL A CA   4  
ATOM   2835  C C    . VAL A 1 39 ? 14.165  15.068 -8.976  1.00 1.00 ? 39 VAL A C    4  
ATOM   2836  O O    . VAL A 1 39 ? 14.077  16.247 -8.617  1.00 1.00 ? 39 VAL A O    4  
ATOM   2837  C CB   . VAL A 1 39 ? 12.695  13.282 -7.876  1.00 1.00 ? 39 VAL A CB   4  
ATOM   2838  C CG1  . VAL A 1 39 ? 12.462  12.391 -9.105  1.00 1.00 ? 39 VAL A CG1  4  
ATOM   2839  C CG2  . VAL A 1 39 ? 12.536  12.401 -6.630  1.00 1.00 ? 39 VAL A CG2  4  
ATOM   2840  H H    . VAL A 1 39 ? 14.076  15.582 -6.625  1.00 1.00 ? 39 VAL A H    4  
ATOM   2841  H HA   . VAL A 1 39 ? 14.850  13.205 -8.138  1.00 1.00 ? 39 VAL A HA   4  
ATOM   2842  H HB   . VAL A 1 39 ? 11.927  14.056 -7.846  1.00 1.00 ? 39 VAL A HB   4  
ATOM   2843  H HG11 . VAL A 1 39 ? 13.236  11.624 -9.161  1.00 1.00 ? 39 VAL A HG11 4  
ATOM   2844  H HG12 . VAL A 1 39 ? 11.491  11.903 -9.028  1.00 1.00 ? 39 VAL A HG12 4  
ATOM   2845  H HG13 . VAL A 1 39 ? 12.473  12.976 -10.021 1.00 1.00 ? 39 VAL A HG13 4  
ATOM   2846  H HG21 . VAL A 1 39 ? 13.346  11.672 -6.584  1.00 1.00 ? 39 VAL A HG21 4  
ATOM   2847  H HG22 . VAL A 1 39 ? 12.544  13.009 -5.727  1.00 1.00 ? 39 VAL A HG22 4  
ATOM   2848  H HG23 . VAL A 1 39 ? 11.586  11.869 -6.668  1.00 1.00 ? 39 VAL A HG23 4  
ATOM   2849  N N    . PHE A 1 40 ? 14.383  14.719 -10.246 1.00 1.00 ? 40 PHE A N    4  
ATOM   2850  C CA   . PHE A 1 40 ? 14.591  15.713 -11.288 1.00 1.00 ? 40 PHE A CA   4  
ATOM   2851  C C    . PHE A 1 40 ? 13.405  16.692 -11.351 1.00 1.00 ? 40 PHE A C    4  
ATOM   2852  O O    . PHE A 1 40 ? 12.266  16.288 -11.106 1.00 1.00 ? 40 PHE A O    4  
ATOM   2853  C CB   . PHE A 1 40 ? 14.812  15.035 -12.652 1.00 1.00 ? 40 PHE A CB   4  
ATOM   2854  C CG   . PHE A 1 40 ? 13.539  14.698 -13.412 1.00 1.00 ? 40 PHE A CG   4  
ATOM   2855  C CD1  . PHE A 1 40 ? 12.874  13.480 -13.188 1.00 1.00 ? 40 PHE A CD1  4  
ATOM   2856  C CD2  . PHE A 1 40 ? 13.004  15.628 -14.327 1.00 1.00 ? 40 PHE A CD2  4  
ATOM   2857  C CE1  . PHE A 1 40 ? 11.698  13.180 -13.896 1.00 1.00 ? 40 PHE A CE1  4  
ATOM   2858  C CE2  . PHE A 1 40 ? 11.817  15.335 -15.020 1.00 1.00 ? 40 PHE A CE2  4  
ATOM   2859  C CZ   . PHE A 1 40 ? 11.167  14.107 -14.809 1.00 1.00 ? 40 PHE A CZ   4  
ATOM   2860  H H    . PHE A 1 40 ? 14.456  13.741 -10.482 1.00 1.00 ? 40 PHE A H    4  
ATOM   2861  H HA   . PHE A 1 40 ? 15.511  16.228 -11.016 1.00 1.00 ? 40 PHE A HA   4  
ATOM   2862  H HB2  . PHE A 1 40 ? 15.399  15.713 -13.275 1.00 1.00 ? 40 PHE A HB2  4  
ATOM   2863  H HB3  . PHE A 1 40 ? 15.418  14.136 -12.526 1.00 1.00 ? 40 PHE A HB3  4  
ATOM   2864  H HD1  . PHE A 1 40 ? 13.285  12.751 -12.503 1.00 1.00 ? 40 PHE A HD1  4  
ATOM   2865  H HD2  . PHE A 1 40 ? 13.516  16.558 -14.527 1.00 1.00 ? 40 PHE A HD2  4  
ATOM   2866  H HE1  . PHE A 1 40 ? 11.224  12.215 -13.767 1.00 1.00 ? 40 PHE A HE1  4  
ATOM   2867  H HE2  . PHE A 1 40 ? 11.440  16.028 -15.760 1.00 1.00 ? 40 PHE A HE2  4  
ATOM   2868  H HZ   . PHE A 1 40 ? 10.294  13.849 -15.394 1.00 1.00 ? 40 PHE A HZ   4  
ATOM   2869  N N    . PRO A 1 41 ? 13.622  17.958 -11.731 1.00 1.00 ? 41 PRO A N    4  
ATOM   2870  C CA   . PRO A 1 41 ? 14.920  18.578 -11.928 1.00 1.00 ? 41 PRO A CA   4  
ATOM   2871  C C    . PRO A 1 41 ? 15.558  18.905 -10.571 1.00 1.00 ? 41 PRO A C    4  
ATOM   2872  O O    . PRO A 1 41 ? 16.773  18.796 -10.417 1.00 1.00 ? 41 PRO A O    4  
ATOM   2873  C CB   . PRO A 1 41 ? 14.624  19.838 -12.742 1.00 1.00 ? 41 PRO A CB   4  
ATOM   2874  C CG   . PRO A 1 41 ? 13.235  20.249 -12.257 1.00 1.00 ? 41 PRO A CG   4  
ATOM   2875  C CD   . PRO A 1 41 ? 12.550  18.907 -11.990 1.00 1.00 ? 41 PRO A CD   4  
ATOM   2876  H HA   . PRO A 1 41 ? 15.596  17.948 -12.507 1.00 1.00 ? 41 PRO A HA   4  
ATOM   2877  H HB2  . PRO A 1 41 ? 15.370  20.621 -12.596 1.00 1.00 ? 41 PRO A HB2  4  
ATOM   2878  H HB3  . PRO A 1 41 ? 14.563  19.567 -13.797 1.00 1.00 ? 41 PRO A HB3  4  
ATOM   2879  H HG2  . PRO A 1 41 ? 13.334  20.810 -11.328 1.00 1.00 ? 41 PRO A HG2  4  
ATOM   2880  H HG3  . PRO A 1 41 ? 12.702  20.846 -12.998 1.00 1.00 ? 41 PRO A HG3  4  
ATOM   2881  H HD2  . PRO A 1 41 ? 11.864  18.984 -11.143 1.00 1.00 ? 41 PRO A HD2  4  
ATOM   2882  H HD3  . PRO A 1 41 ? 12.004  18.592 -12.880 1.00 1.00 ? 41 PRO A HD3  4  
ATOM   2883  N N    . ALA A 1 42 ? 14.737  19.290 -9.589  1.00 1.00 ? 42 ALA A N    4  
ATOM   2884  C CA   . ALA A 1 42 ? 15.200  19.755 -8.292  1.00 1.00 ? 42 ALA A CA   4  
ATOM   2885  C C    . ALA A 1 42 ? 14.052  19.724 -7.295  1.00 1.00 ? 42 ALA A C    4  
ATOM   2886  O O    . ALA A 1 42 ? 13.638  20.771 -6.801  1.00 1.00 ? 42 ALA A O    4  
ATOM   2887  C CB   . ALA A 1 42 ? 15.793  21.163 -8.408  1.00 1.00 ? 42 ALA A CB   4  
ATOM   2888  H H    . ALA A 1 42 ? 13.737  19.244 -9.741  1.00 1.00 ? 42 ALA A H    4  
ATOM   2889  H HA   . ALA A 1 42 ? 15.969  19.083 -7.922  1.00 1.00 ? 42 ALA A HA   4  
ATOM   2890  H HB1  . ALA A 1 42 ? 15.039  21.853 -8.788  1.00 1.00 ? 42 ALA A HB1  4  
ATOM   2891  H HB2  . ALA A 1 42 ? 16.117  21.498 -7.421  1.00 1.00 ? 42 ALA A HB2  4  
ATOM   2892  H HB3  . ALA A 1 42 ? 16.652  21.156 -9.076  1.00 1.00 ? 42 ALA A HB3  4  
ATOM   2893  N N    . HIS A 1 43 ? 13.584  18.509 -7.000  1.00 1.00 ? 43 HIS A N    4  
ATOM   2894  C CA   . HIS A 1 43 ? 12.482  18.168 -6.108  1.00 1.00 ? 43 HIS A CA   4  
ATOM   2895  C C    . HIS A 1 43 ? 11.188  18.068 -6.905  1.00 1.00 ? 43 HIS A C    4  
ATOM   2896  O O    . HIS A 1 43 ? 10.898  18.938 -7.720  1.00 1.00 ? 43 HIS A O    4  
ATOM   2897  C CB   . HIS A 1 43 ? 12.317  19.120 -4.909  1.00 1.00 ? 43 HIS A CB   4  
ATOM   2898  C CG   . HIS A 1 43 ? 13.543  19.203 -4.040  1.00 1.00 ? 43 HIS A CG   4  
ATOM   2899  N ND1  . HIS A 1 43 ? 14.518  20.165 -4.237  1.00 1.00 ? 43 HIS A ND1  4  
ATOM   2900  C CD2  . HIS A 1 43 ? 13.986  18.445 -2.983  1.00 1.00 ? 43 HIS A CD2  4  
ATOM   2901  C CE1  . HIS A 1 43 ? 15.486  19.947 -3.332  1.00 1.00 ? 43 HIS A CE1  4  
ATOM   2902  N NE2  . HIS A 1 43 ? 15.222  18.905 -2.539  1.00 1.00 ? 43 HIS A NE2  4  
ATOM   2903  H H    . HIS A 1 43 ? 13.967  17.742 -7.544  1.00 1.00 ? 43 HIS A H    4  
ATOM   2904  H HA   . HIS A 1 43 ? 12.713  17.185 -5.714  1.00 1.00 ? 43 HIS A HA   4  
ATOM   2905  H HB2  . HIS A 1 43 ? 12.018  20.116 -5.233  1.00 1.00 ? 43 HIS A HB2  4  
ATOM   2906  H HB3  . HIS A 1 43 ? 11.499  18.773 -4.286  1.00 1.00 ? 43 HIS A HB3  4  
ATOM   2907  H HD1  . HIS A 1 43 ? 14.494  20.872 -4.963  1.00 1.00 ? 43 HIS A HD1  4  
ATOM   2908  H HD2  . HIS A 1 43 ? 13.457  17.603 -2.565  1.00 1.00 ? 43 HIS A HD2  4  
ATOM   2909  H HE1  . HIS A 1 43 ? 16.385  20.542 -3.260  1.00 1.00 ? 43 HIS A HE1  4  
ATOM   2910  N N    . LYS A 1 44 ? 10.404  17.024 -6.637  1.00 1.00 ? 44 LYS A N    4  
ATOM   2911  C CA   . LYS A 1 44 ? 9.043   16.849 -7.121  1.00 1.00 ? 44 LYS A CA   4  
ATOM   2912  C C    . LYS A 1 44 ? 8.142   16.681 -5.912  1.00 1.00 ? 44 LYS A C    4  
ATOM   2913  O O    . LYS A 1 44 ? 8.617   16.243 -4.864  1.00 1.00 ? 44 LYS A O    4  
ATOM   2914  C CB   . LYS A 1 44 ? 8.956   15.585 -7.970  1.00 1.00 ? 44 LYS A CB   4  
ATOM   2915  C CG   . LYS A 1 44 ? 9.332   15.882 -9.416  1.00 1.00 ? 44 LYS A CG   4  
ATOM   2916  C CD   . LYS A 1 44 ? 9.483   14.543 -10.145 1.00 1.00 ? 44 LYS A CD   4  
ATOM   2917  C CE   . LYS A 1 44 ? 9.223   14.630 -11.657 1.00 1.00 ? 44 LYS A CE   4  
ATOM   2918  N NZ   . LYS A 1 44 ? 9.815   15.832 -12.275 1.00 1.00 ? 44 LYS A NZ   4  
ATOM   2919  H H    . LYS A 1 44 ? 10.684  16.392 -5.897  1.00 1.00 ? 44 LYS A H    4  
ATOM   2920  H HA   . LYS A 1 44 ? 8.701   17.710 -7.694  1.00 1.00 ? 44 LYS A HA   4  
ATOM   2921  H HB2  . LYS A 1 44 ? 9.606   14.819 -7.547  1.00 1.00 ? 44 LYS A HB2  4  
ATOM   2922  H HB3  . LYS A 1 44 ? 7.929   15.217 -7.965  1.00 1.00 ? 44 LYS A HB3  4  
ATOM   2923  H HG2  . LYS A 1 44 ? 8.531   16.486 -9.837  1.00 1.00 ? 44 LYS A HG2  4  
ATOM   2924  H HG3  . LYS A 1 44 ? 10.267  16.448 -9.448  1.00 1.00 ? 44 LYS A HG3  4  
ATOM   2925  H HD2  . LYS A 1 44 ? 10.493  14.183 -9.948  1.00 1.00 ? 44 LYS A HD2  4  
ATOM   2926  H HD3  . LYS A 1 44 ? 8.788   13.816 -9.715  1.00 1.00 ? 44 LYS A HD3  4  
ATOM   2927  H HE2  . LYS A 1 44 ? 9.635   13.735 -12.124 1.00 1.00 ? 44 LYS A HE2  4  
ATOM   2928  H HE3  . LYS A 1 44 ? 8.147   14.646 -11.836 1.00 1.00 ? 44 LYS A HE3  4  
ATOM   2929  H HZ1  . LYS A 1 44 ? 10.761  15.961 -11.940 1.00 1.00 ? 44 LYS A HZ1  4  
ATOM   2930  H HZ2  . LYS A 1 44 ? 9.842   15.734 -13.279 1.00 1.00 ? 44 LYS A HZ2  4  
ATOM   2931  H HZ3  . LYS A 1 44 ? 9.249   16.644 -12.039 1.00 1.00 ? 44 LYS A HZ3  4  
ATOM   2932  N N    . CYS A 1 45 ? 6.854   16.998 -6.059  1.00 1.00 ? 45 CYS A N    4  
ATOM   2933  C CA   . CYS A 1 45 ? 5.905   16.698 -5.005  1.00 1.00 ? 45 CYS A CA   4  
ATOM   2934  C C    . CYS A 1 45 ? 5.545   15.220 -5.091  1.00 1.00 ? 45 CYS A C    4  
ATOM   2935  O O    . CYS A 1 45 ? 4.769   14.810 -5.962  1.00 1.00 ? 45 CYS A O    4  
ATOM   2936  C CB   . CYS A 1 45 ? 4.668   17.580 -5.124  1.00 1.00 ? 45 CYS A CB   4  
ATOM   2937  S SG   . CYS A 1 45 ? 3.433   17.265 -3.850  1.00 1.00 ? 45 CYS A SG   4  
ATOM   2938  H H    . CYS A 1 45 ? 6.491   17.342 -6.944  1.00 1.00 ? 45 CYS A H    4  
ATOM   2939  H HA   . CYS A 1 45 ? 6.383   16.909 -4.049  1.00 1.00 ? 45 CYS A HA   4  
ATOM   2940  H HB2  . CYS A 1 45 ? 4.960   18.629 -5.074  1.00 1.00 ? 45 CYS A HB2  4  
ATOM   2941  H HB3  . CYS A 1 45 ? 4.199   17.385 -6.078  1.00 1.00 ? 45 CYS A HB3  4  
ATOM   2942  N N    . ILE A 1 46 ? 6.153   14.416 -4.216  1.00 1.00 ? 46 ILE A N    4  
ATOM   2943  C CA   . ILE A 1 46 ? 5.879   12.998 -4.105  1.00 1.00 ? 46 ILE A CA   4  
ATOM   2944  C C    . ILE A 1 46 ? 4.702   12.872 -3.150  1.00 1.00 ? 46 ILE A C    4  
ATOM   2945  O O    . ILE A 1 46 ? 4.774   13.348 -2.016  1.00 1.00 ? 46 ILE A O    4  
ATOM   2946  C CB   . ILE A 1 46 ? 7.116   12.240 -3.591  1.00 1.00 ? 46 ILE A CB   4  
ATOM   2947  C CG1  . ILE A 1 46 ? 8.396   12.548 -4.393  1.00 1.00 ? 46 ILE A CG1  4  
ATOM   2948  C CG2  . ILE A 1 46 ? 6.830   10.732 -3.577  1.00 1.00 ? 46 ILE A CG2  4  
ATOM   2949  C CD1  . ILE A 1 46 ? 8.253   12.364 -5.908  1.00 1.00 ? 46 ILE A CD1  4  
ATOM   2950  H H    . ILE A 1 46 ? 6.700   14.835 -3.466  1.00 1.00 ? 46 ILE A H    4  
ATOM   2951  H HA   . ILE A 1 46 ? 5.602   12.594 -5.078  1.00 1.00 ? 46 ILE A HA   4  
ATOM   2952  H HB   . ILE A 1 46 ? 7.312   12.548 -2.563  1.00 1.00 ? 46 ILE A HB   4  
ATOM   2953  H HG12 . ILE A 1 46 ? 8.706   13.575 -4.195  1.00 1.00 ? 46 ILE A HG12 4  
ATOM   2954  H HG13 . ILE A 1 46 ? 9.195   11.894 -4.039  1.00 1.00 ? 46 ILE A HG13 4  
ATOM   2955  H HG21 . ILE A 1 46 ? 6.563   10.383 -4.575  1.00 1.00 ? 46 ILE A HG21 4  
ATOM   2956  H HG22 . ILE A 1 46 ? 7.711   10.193 -3.229  1.00 1.00 ? 46 ILE A HG22 4  
ATOM   2957  H HG23 . ILE A 1 46 ? 6.003   10.512 -2.902  1.00 1.00 ? 46 ILE A HG23 4  
ATOM   2958  H HD11 . ILE A 1 46 ? 7.951   11.345 -6.144  1.00 1.00 ? 46 ILE A HD11 4  
ATOM   2959  H HD12 . ILE A 1 46 ? 7.523   13.064 -6.313  1.00 1.00 ? 46 ILE A HD12 4  
ATOM   2960  H HD13 . ILE A 1 46 ? 9.215   12.561 -6.380  1.00 1.00 ? 46 ILE A HD13 4  
ATOM   2961  N N    . CYS A 1 47 ? 3.603   12.271 -3.604  1.00 1.00 ? 47 CYS A N    4  
ATOM   2962  C CA   . CYS A 1 47 ? 2.433   12.113 -2.766  1.00 1.00 ? 47 CYS A CA   4  
ATOM   2963  C C    . CYS A 1 47 ? 2.362   10.676 -2.257  1.00 1.00 ? 47 CYS A C    4  
ATOM   2964  O O    . CYS A 1 47 ? 2.937   9.780  -2.872  1.00 1.00 ? 47 CYS A O    4  
ATOM   2965  C CB   . CYS A 1 47 ? 1.193   12.597 -3.494  1.00 1.00 ? 47 CYS A CB   4  
ATOM   2966  S SG   . CYS A 1 47 ? -0.116  12.897 -2.310  1.00 1.00 ? 47 CYS A SG   4  
ATOM   2967  H H    . CYS A 1 47 ? 3.588   11.796 -4.501  1.00 1.00 ? 47 CYS A H    4  
ATOM   2968  H HA   . CYS A 1 47 ? 2.507   12.765 -1.902  1.00 1.00 ? 47 CYS A HA   4  
ATOM   2969  H HB2  . CYS A 1 47 ? 1.416   13.550 -3.972  1.00 1.00 ? 47 CYS A HB2  4  
ATOM   2970  H HB3  . CYS A 1 47 ? 0.868   11.882 -4.246  1.00 1.00 ? 47 CYS A HB3  4  
ATOM   2971  N N    . TYR A 1 48 ? 1.741   10.453 -1.098  1.00 1.00 ? 48 TYR A N    4  
ATOM   2972  C CA   . TYR A 1 48 ? 1.794   9.181  -0.399  1.00 1.00 ? 48 TYR A CA   4  
ATOM   2973  C C    . TYR A 1 48 ? 0.384   8.766  0.025   1.00 1.00 ? 48 TYR A C    4  
ATOM   2974  O O    . TYR A 1 48 ? -0.401  9.589  0.505   1.00 1.00 ? 48 TYR A O    4  
ATOM   2975  C CB   . TYR A 1 48 ? 2.707   9.314  0.822   1.00 1.00 ? 48 TYR A CB   4  
ATOM   2976  C CG   . TYR A 1 48 ? 4.195   9.485  0.574   1.00 1.00 ? 48 TYR A CG   4  
ATOM   2977  C CD1  . TYR A 1 48 ? 4.691   10.713 0.102   1.00 1.00 ? 48 TYR A CD1  4  
ATOM   2978  C CD2  . TYR A 1 48 ? 5.101   8.505  1.023   1.00 1.00 ? 48 TYR A CD2  4  
ATOM   2979  C CE1  . TYR A 1 48 ? 6.072   10.936 0.004   1.00 1.00 ? 48 TYR A CE1  4  
ATOM   2980  C CE2  . TYR A 1 48 ? 6.485   8.740  0.955   1.00 1.00 ? 48 TYR A CE2  4  
ATOM   2981  C CZ   . TYR A 1 48 ? 6.969   9.935  0.398   1.00 1.00 ? 48 TYR A CZ   4  
ATOM   2982  O OH   . TYR A 1 48 ? 8.303   10.114 0.205   1.00 1.00 ? 48 TYR A OH   4  
ATOM   2983  H H    . TYR A 1 48 ? 1.256   11.209 -0.624  1.00 1.00 ? 48 TYR A H    4  
ATOM   2984  H HA   . TYR A 1 48 ? 2.209   8.408  -1.042  1.00 1.00 ? 48 TYR A HA   4  
ATOM   2985  H HB2  . TYR A 1 48 ? 2.372   10.178 1.383   1.00 1.00 ? 48 TYR A HB2  4  
ATOM   2986  H HB3  . TYR A 1 48 ? 2.563   8.426  1.428   1.00 1.00 ? 48 TYR A HB3  4  
ATOM   2987  H HD1  . TYR A 1 48 ? 4.014   11.490 -0.195  1.00 1.00 ? 48 TYR A HD1  4  
ATOM   2988  H HD2  . TYR A 1 48 ? 4.747   7.572  1.430   1.00 1.00 ? 48 TYR A HD2  4  
ATOM   2989  H HE1  . TYR A 1 48 ? 6.441   11.861 -0.412  1.00 1.00 ? 48 TYR A HE1  4  
ATOM   2990  H HE2  . TYR A 1 48 ? 7.176   7.985  1.302   1.00 1.00 ? 48 TYR A HE2  4  
ATOM   2991  H HH   . TYR A 1 48 ? 8.734   9.275  -0.008  1.00 1.00 ? 48 TYR A HH   4  
ATOM   2992  N N    . PHE A 1 49 ? 0.065   7.481  -0.154  1.00 1.00 ? 49 PHE A N    4  
ATOM   2993  C CA   . PHE A 1 49 ? -1.256  6.929  0.054   1.00 1.00 ? 49 PHE A CA   4  
ATOM   2994  C C    . PHE A 1 49 ? -1.084  5.584  0.767   1.00 1.00 ? 49 PHE A C    4  
ATOM   2995  O O    . PHE A 1 49 ? -0.141  4.868  0.439   1.00 1.00 ? 49 PHE A O    4  
ATOM   2996  C CB   . PHE A 1 49 ? -1.945  6.683  -1.297  1.00 1.00 ? 49 PHE A CB   4  
ATOM   2997  C CG   . PHE A 1 49 ? -1.815  7.741  -2.390  1.00 1.00 ? 49 PHE A CG   4  
ATOM   2998  C CD1  . PHE A 1 49 ? -0.555  8.078  -2.922  1.00 1.00 ? 49 PHE A CD1  4  
ATOM   2999  C CD2  . PHE A 1 49 ? -2.971  8.278  -2.995  1.00 1.00 ? 49 PHE A CD2  4  
ATOM   3000  C CE1  . PHE A 1 49 ? -0.438  9.121  -3.848  1.00 1.00 ? 49 PHE A CE1  4  
ATOM   3001  C CE2  . PHE A 1 49 ? -2.854  9.187  -4.064  1.00 1.00 ? 49 PHE A CE2  4  
ATOM   3002  C CZ   . PHE A 1 49 ? -1.584  9.617  -4.486  1.00 1.00 ? 49 PHE A CZ   4  
ATOM   3003  H H    . PHE A 1 49 ? 0.723   6.844  -0.586  1.00 1.00 ? 49 PHE A H    4  
ATOM   3004  H HA   . PHE A 1 49 ? -1.844  7.630  0.644   1.00 1.00 ? 49 PHE A HA   4  
ATOM   3005  H HB2  . PHE A 1 49 ? -1.608  5.725  -1.678  1.00 1.00 ? 49 PHE A HB2  4  
ATOM   3006  H HB3  . PHE A 1 49 ? -2.989  6.544  -1.066  1.00 1.00 ? 49 PHE A HB3  4  
ATOM   3007  H HD1  . PHE A 1 49 ? 0.340   7.547  -2.634  1.00 1.00 ? 49 PHE A HD1  4  
ATOM   3008  H HD2  . PHE A 1 49 ? -3.954  7.969  -2.672  1.00 1.00 ? 49 PHE A HD2  4  
ATOM   3009  H HE1  . PHE A 1 49 ? 0.541   9.486  -4.121  1.00 1.00 ? 49 PHE A HE1  4  
ATOM   3010  H HE2  . PHE A 1 49 ? -3.742  9.559  -4.555  1.00 1.00 ? 49 PHE A HE2  4  
ATOM   3011  H HZ   . PHE A 1 49 ? -1.459  10.280 -5.327  1.00 1.00 ? 49 PHE A HZ   4  
ATOM   3012  N N    . PRO A 1 50 ? -1.971  5.219  1.701   1.00 1.00 ? 50 PRO A N    4  
ATOM   3013  C CA   . PRO A 1 50 ? -1.954  3.938  2.392   1.00 1.00 ? 50 PRO A CA   4  
ATOM   3014  C C    . PRO A 1 50 ? -2.201  2.819  1.379   1.00 1.00 ? 50 PRO A C    4  
ATOM   3015  O O    . PRO A 1 50 ? -3.170  2.883  0.626   1.00 1.00 ? 50 PRO A O    4  
ATOM   3016  C CB   . PRO A 1 50 ? -3.077  4.039  3.431   1.00 1.00 ? 50 PRO A CB   4  
ATOM   3017  C CG   . PRO A 1 50 ? -4.064  5.024  2.803   1.00 1.00 ? 50 PRO A CG   4  
ATOM   3018  C CD   . PRO A 1 50 ? -3.146  5.984  2.052   1.00 1.00 ? 50 PRO A CD   4  
ATOM   3019  H HA   . PRO A 1 50 ? -1.001  3.785  2.899   1.00 1.00 ? 50 PRO A HA   4  
ATOM   3020  H HB2  . PRO A 1 50 ? -3.552  3.083  3.647   1.00 1.00 ? 50 PRO A HB2  4  
ATOM   3021  H HB3  . PRO A 1 50 ? -2.676  4.471  4.349   1.00 1.00 ? 50 PRO A HB3  4  
ATOM   3022  H HG2  . PRO A 1 50 ? -4.701  4.495  2.092   1.00 1.00 ? 50 PRO A HG2  4  
ATOM   3023  H HG3  . PRO A 1 50 ? -4.674  5.528  3.552   1.00 1.00 ? 50 PRO A HG3  4  
ATOM   3024  H HD2  . PRO A 1 50 ? -3.627  6.372  1.153   1.00 1.00 ? 50 PRO A HD2  4  
ATOM   3025  H HD3  . PRO A 1 50 ? -2.832  6.790  2.713   1.00 1.00 ? 50 PRO A HD3  4  
ATOM   3026  N N    . CYS A 1 51 ? -1.329  1.805  1.331   1.00 1.00 ? 51 CYS A N    4  
ATOM   3027  C CA   . CYS A 1 51 ? -1.360  0.817  0.256   1.00 1.00 ? 51 CYS A CA   4  
ATOM   3028  C C    . CYS A 1 51 ? -0.525  -0.419 0.607   1.00 1.00 ? 51 CYS A C    4  
ATOM   3029  O O    . CYS A 1 51 ? 0.679   -0.305 0.833   1.00 1.00 ? 51 CYS A O    4  
ATOM   3030  C CB   . CYS A 1 51 ? -0.887  1.504  -1.033  1.00 1.00 ? 51 CYS A CB   4  
ATOM   3031  S SG   . CYS A 1 51 ? 0.199   0.585  -2.148  1.00 1.00 ? 51 CYS A SG   4  
ATOM   3032  O OXT  . CYS A 1 51 ? -1.191  -1.603 0.673   1.00 0.00 ? 51 CYS A OXT  4  
ATOM   3033  H H    . CYS A 1 51 ? -0.501  1.822  1.921   1.00 1.00 ? 51 CYS A H    4  
ATOM   3034  H HA   . CYS A 1 51 ? -2.388  0.482  0.102   1.00 1.00 ? 51 CYS A HA   4  
ATOM   3035  H HB2  . CYS A 1 51 ? -1.756  1.821  -1.607  1.00 1.00 ? 51 CYS A HB2  4  
ATOM   3036  H HB3  . CYS A 1 51 ? -0.344  2.406  -0.759  1.00 1.00 ? 51 CYS A HB3  4  
HETATM 3037  N N    . PCA A 1 1  ? -0.743  -2.218 2.081   1.00 1.00 ? 1  PCA A N    5  
HETATM 3038  C CA   . PCA A 1 1  ? -0.072  -2.444 3.345   1.00 1.00 ? 1  PCA A CA   5  
HETATM 3039  C CB   . PCA A 1 1  ? 0.863   -3.644 3.099   1.00 1.00 ? 1  PCA A CB   5  
HETATM 3040  C CG   . PCA A 1 1  ? 0.877   -3.818 1.572   1.00 1.00 ? 1  PCA A CG   5  
HETATM 3041  C CD   . PCA A 1 1  ? -0.254  -2.935 1.084   1.00 1.00 ? 1  PCA A CD   5  
HETATM 3042  O OE   . PCA A 1 1  ? -0.635  -2.882 -0.083  1.00 1.00 ? 1  PCA A OE   5  
HETATM 3043  C C    . PCA A 1 1  ? 0.661   -1.167 3.752   1.00 1.00 ? 1  PCA A C    5  
HETATM 3044  O O    . PCA A 1 1  ? 0.305   -0.538 4.745   1.00 1.00 ? 1  PCA A O    5  
HETATM 3045  H H    . PCA A 1 1  ? -1.425  -1.477 1.941   1.00 0.00 ? 1  PCA A H    5  
HETATM 3046  H HA   . PCA A 1 1  ? -0.806  -2.694 4.114   1.00 1.00 ? 1  PCA A HA   5  
HETATM 3047  H HB2  . PCA A 1 1  ? 1.865   -3.490 3.505   1.00 1.00 ? 1  PCA A HB2  5  
HETATM 3048  H HB3  . PCA A 1 1  ? 0.421   -4.532 3.552   1.00 1.00 ? 1  PCA A HB3  5  
HETATM 3049  H HG2  . PCA A 1 1  ? 1.818   -3.463 1.150   1.00 1.00 ? 1  PCA A HG2  5  
HETATM 3050  H HG3  . PCA A 1 1  ? 0.706   -4.857 1.289   1.00 1.00 ? 1  PCA A HG3  5  
ATOM   3051  N N    . LYS A 1 2  ? 1.666   -0.774 2.963   1.00 1.00 ? 2  LYS A N    5  
ATOM   3052  C CA   . LYS A 1 2  ? 2.300   0.528  3.098   1.00 1.00 ? 2  LYS A CA   5  
ATOM   3053  C C    . LYS A 1 2  ? 1.561   1.528  2.208   1.00 1.00 ? 2  LYS A C    5  
ATOM   3054  O O    . LYS A 1 2  ? 0.770   1.135  1.354   1.00 1.00 ? 2  LYS A O    5  
ATOM   3055  C CB   . LYS A 1 2  ? 3.798   0.450  2.759   1.00 1.00 ? 2  LYS A CB   5  
ATOM   3056  C CG   . LYS A 1 2  ? 4.101   0.163  1.278   1.00 1.00 ? 2  LYS A CG   5  
ATOM   3057  C CD   . LYS A 1 2  ? 5.548   0.582  0.964   1.00 1.00 ? 2  LYS A CD   5  
ATOM   3058  C CE   . LYS A 1 2  ? 5.850   0.690  -0.538  1.00 1.00 ? 2  LYS A CE   5  
ATOM   3059  N NZ   . LYS A 1 2  ? 4.963   1.657  -1.219  1.00 1.00 ? 2  LYS A NZ   5  
ATOM   3060  H H    . LYS A 1 2  ? 1.838   -1.306 2.126   1.00 1.00 ? 2  LYS A H    5  
ATOM   3061  H HA   . LYS A 1 2  ? 2.223   0.868  4.133   1.00 1.00 ? 2  LYS A HA   5  
ATOM   3062  H HB2  . LYS A 1 2  ? 4.227   1.415  3.031   1.00 1.00 ? 2  LYS A HB2  5  
ATOM   3063  H HB3  . LYS A 1 2  ? 4.272   -0.312 3.380   1.00 1.00 ? 2  LYS A HB3  5  
ATOM   3064  H HG2  . LYS A 1 2  ? 3.963   -0.901 1.072   1.00 1.00 ? 2  LYS A HG2  5  
ATOM   3065  H HG3  . LYS A 1 2  ? 3.413   0.724  0.651   1.00 1.00 ? 2  LYS A HG3  5  
ATOM   3066  H HD2  . LYS A 1 2  ? 5.754   1.556  1.414   1.00 1.00 ? 2  LYS A HD2  5  
ATOM   3067  H HD3  . LYS A 1 2  ? 6.229   -0.141 1.418   1.00 1.00 ? 2  LYS A HD3  5  
ATOM   3068  H HE2  . LYS A 1 2  ? 6.881   1.033  -0.645  1.00 1.00 ? 2  LYS A HE2  5  
ATOM   3069  H HE3  . LYS A 1 2  ? 5.764   -0.289 -1.015  1.00 1.00 ? 2  LYS A HE3  5  
ATOM   3070  H HZ1  . LYS A 1 2  ? 4.693   2.415  -0.599  1.00 1.00 ? 2  LYS A HZ1  5  
ATOM   3071  H HZ2  . LYS A 1 2  ? 5.417   2.089  -2.019  1.00 1.00 ? 2  LYS A HZ2  5  
ATOM   3072  H HZ3  . LYS A 1 2  ? 4.108   1.215  -1.523  1.00 1.00 ? 2  LYS A HZ3  5  
ATOM   3073  N N    . LEU A 1 3  ? 1.872   2.818  2.347   1.00 1.00 ? 3  LEU A N    5  
ATOM   3074  C CA   . LEU A 1 3  ? 1.356   3.814  1.424   1.00 1.00 ? 3  LEU A CA   5  
ATOM   3075  C C    . LEU A 1 3  ? 2.001   3.633  0.052   1.00 1.00 ? 3  LEU A C    5  
ATOM   3076  O O    . LEU A 1 3  ? 3.175   3.262  -0.058  1.00 1.00 ? 3  LEU A O    5  
ATOM   3077  C CB   . LEU A 1 3  ? 1.594   5.240  1.924   1.00 1.00 ? 3  LEU A CB   5  
ATOM   3078  C CG   . LEU A 1 3  ? 1.031   5.507  3.330   1.00 1.00 ? 3  LEU A CG   5  
ATOM   3079  C CD1  . LEU A 1 3  ? 2.135   5.387  4.389   1.00 1.00 ? 3  LEU A CD1  5  
ATOM   3080  C CD2  . LEU A 1 3  ? 0.438   6.916  3.407   1.00 1.00 ? 3  LEU A CD2  5  
ATOM   3081  H H    . LEU A 1 3  ? 2.576   3.087  3.014   1.00 1.00 ? 3  LEU A H    5  
ATOM   3082  H HA   . LEU A 1 3  ? 0.280   3.687  1.332   1.00 1.00 ? 3  LEU A HA   5  
ATOM   3083  H HB2  . LEU A 1 3  ? 2.659   5.446  1.885   1.00 1.00 ? 3  LEU A HB2  5  
ATOM   3084  H HB3  . LEU A 1 3  ? 1.101   5.902  1.213   1.00 1.00 ? 3  LEU A HB3  5  
ATOM   3085  H HG   . LEU A 1 3  ? 0.221   4.807  3.542   1.00 1.00 ? 3  LEU A HG   5  
ATOM   3086  H HD11 . LEU A 1 3  ? 2.962   6.054  4.141   1.00 1.00 ? 3  LEU A HD11 5  
ATOM   3087  H HD12 . LEU A 1 3  ? 1.739   5.660  5.366   1.00 1.00 ? 3  LEU A HD12 5  
ATOM   3088  H HD13 . LEU A 1 3  ? 2.516   4.370  4.449   1.00 1.00 ? 3  LEU A HD13 5  
ATOM   3089  H HD21 . LEU A 1 3  ? -0.339  7.038  2.652   1.00 1.00 ? 3  LEU A HD21 5  
ATOM   3090  H HD22 . LEU A 1 3  ? 0.007   7.073  4.394   1.00 1.00 ? 3  LEU A HD22 5  
ATOM   3091  H HD23 . LEU A 1 3  ? 1.212   7.663  3.249   1.00 1.00 ? 3  LEU A HD23 5  
ATOM   3092  N N    . CYS A 1 4  ? 1.243   3.933  -0.998  1.00 1.00 ? 4  CYS A N    5  
ATOM   3093  C CA   . CYS A 1 4  ? 1.736   4.015  -2.359  1.00 1.00 ? 4  CYS A CA   5  
ATOM   3094  C C    . CYS A 1 4  ? 2.177   5.451  -2.592  1.00 1.00 ? 4  CYS A C    5  
ATOM   3095  O O    . CYS A 1 4  ? 1.351   6.357  -2.707  1.00 1.00 ? 4  CYS A O    5  
ATOM   3096  C CB   . CYS A 1 4  ? 0.688   3.553  -3.376  1.00 1.00 ? 4  CYS A CB   5  
ATOM   3097  S SG   . CYS A 1 4  ? 0.602   1.760  -3.559  1.00 1.00 ? 4  CYS A SG   5  
ATOM   3098  H H    . CYS A 1 4  ? 0.301   4.254  -0.807  1.00 1.00 ? 4  CYS A H    5  
ATOM   3099  H HA   . CYS A 1 4  ? 2.596   3.356  -2.489  1.00 1.00 ? 4  CYS A HA   5  
ATOM   3100  H HB2  . CYS A 1 4  ? -0.307  3.908  -3.107  1.00 1.00 ? 4  CYS A HB2  5  
ATOM   3101  H HB3  . CYS A 1 4  ? 0.949   3.954  -4.355  1.00 1.00 ? 4  CYS A HB3  5  
ATOM   3102  N N    . GLU A 1 5  ? 3.496   5.641  -2.613  1.00 1.00 ? 5  GLU A N    5  
ATOM   3103  C CA   . GLU A 1 5  ? 4.146   6.872  -3.021  1.00 1.00 ? 5  GLU A CA   5  
ATOM   3104  C C    . GLU A 1 5  ? 3.875   7.131  -4.509  1.00 1.00 ? 5  GLU A C    5  
ATOM   3105  O O    . GLU A 1 5  ? 4.235   6.305  -5.350  1.00 1.00 ? 5  GLU A O    5  
ATOM   3106  C CB   . GLU A 1 5  ? 5.647   6.791  -2.681  1.00 1.00 ? 5  GLU A CB   5  
ATOM   3107  C CG   . GLU A 1 5  ? 6.508   5.849  -3.547  1.00 1.00 ? 5  GLU A CG   5  
ATOM   3108  C CD   . GLU A 1 5  ? 5.922   4.448  -3.725  1.00 1.00 ? 5  GLU A CD   5  
ATOM   3109  O OE1  . GLU A 1 5  ? 5.674   3.762  -2.730  1.00 1.00 ? 5  GLU A OE1  5  
ATOM   3110  O OE2  . GLU A 1 5  ? 5.633   4.068  -4.997  1.00 1.00 ? 5  GLU A OE2  5  
ATOM   3111  H H    . GLU A 1 5  ? 4.087   4.850  -2.396  1.00 1.00 ? 5  GLU A H    5  
ATOM   3112  H HA   . GLU A 1 5  ? 3.726   7.683  -2.426  1.00 1.00 ? 5  GLU A HA   5  
ATOM   3113  H HB2  . GLU A 1 5  ? 6.068   7.794  -2.766  1.00 1.00 ? 5  GLU A HB2  5  
ATOM   3114  H HB3  . GLU A 1 5  ? 5.744   6.479  -1.640  1.00 1.00 ? 5  GLU A HB3  5  
ATOM   3115  H HG2  . GLU A 1 5  ? 6.664   6.304  -4.525  1.00 1.00 ? 5  GLU A HG2  5  
ATOM   3116  H HG3  . GLU A 1 5  ? 7.487   5.748  -3.076  1.00 1.00 ? 5  GLU A HG3  5  
ATOM   3117  H HE2  . GLU A 1 5  ? 5.321   4.826  -5.508  1.00 1.00 ? 5  GLU A HE2  5  
ATOM   3118  N N    . ARG A 1 6  ? 3.241   8.254  -4.840  1.00 1.00 ? 6  ARG A N    5  
ATOM   3119  C CA   . ARG A 1 6  ? 3.052   8.725  -6.206  1.00 1.00 ? 6  ARG A CA   5  
ATOM   3120  C C    . ARG A 1 6  ? 3.376   10.218 -6.199  1.00 1.00 ? 6  ARG A C    5  
ATOM   3121  O O    . ARG A 1 6  ? 3.071   10.881 -5.209  1.00 1.00 ? 6  ARG A O    5  
ATOM   3122  C CB   . ARG A 1 6  ? 1.581   8.518  -6.635  1.00 1.00 ? 6  ARG A CB   5  
ATOM   3123  C CG   . ARG A 1 6  ? 1.441   8.068  -8.101  1.00 1.00 ? 6  ARG A CG   5  
ATOM   3124  C CD   . ARG A 1 6  ? 0.254   8.663  -8.873  1.00 1.00 ? 6  ARG A CD   5  
ATOM   3125  N NE   . ARG A 1 6  ? 0.406   10.118 -9.041  1.00 1.00 ? 6  ARG A NE   5  
ATOM   3126  C CZ   . ARG A 1 6  ? 0.074   10.875 -10.100 1.00 1.00 ? 6  ARG A CZ   5  
ATOM   3127  N NH1  . ARG A 1 6  ? -0.580  10.358 -11.145 1.00 1.00 ? 6  ARG A NH1  5  
ATOM   3128  N NH2  . ARG A 1 6  ? 0.408   12.166 -10.089 1.00 1.00 ? 6  ARG A NH2  5  
ATOM   3129  H H    . ARG A 1 6  ? 2.959   8.900  -4.106  1.00 1.00 ? 6  ARG A H    5  
ATOM   3130  H HA   . ARG A 1 6  ? 3.714   8.189  -6.882  1.00 1.00 ? 6  ARG A HA   5  
ATOM   3131  H HB2  . ARG A 1 6  ? 1.119   7.753  -6.008  1.00 1.00 ? 6  ARG A HB2  5  
ATOM   3132  H HB3  . ARG A 1 6  ? 1.035   9.446  -6.468  1.00 1.00 ? 6  ARG A HB3  5  
ATOM   3133  H HG2  . ARG A 1 6  ? 2.337   8.326  -8.656  1.00 1.00 ? 6  ARG A HG2  5  
ATOM   3134  H HG3  . ARG A 1 6  ? 1.341   6.983  -8.099  1.00 1.00 ? 6  ARG A HG3  5  
ATOM   3135  H HD2  . ARG A 1 6  ? 0.227   8.163  -9.842  1.00 1.00 ? 6  ARG A HD2  5  
ATOM   3136  H HD3  . ARG A 1 6  ? -0.672  8.443  -8.344  1.00 1.00 ? 6  ARG A HD3  5  
ATOM   3137  H HE   . ARG A 1 6  ? 0.887   10.599 -8.288  1.00 1.00 ? 6  ARG A HE   5  
ATOM   3138  H HH11 . ARG A 1 6  ? -0.862  9.390  -11.134 1.00 1.00 ? 6  ARG A HH11 5  
ATOM   3139  H HH12 . ARG A 1 6  ? -0.829  10.936 -11.933 1.00 1.00 ? 6  ARG A HH12 5  
ATOM   3140  H HH21 . ARG A 1 6  ? 0.838   12.561 -9.253  1.00 1.00 ? 6  ARG A HH21 5  
ATOM   3141  H HH22 . ARG A 1 6  ? 0.255   12.835 -10.846 1.00 1.00 ? 6  ARG A HH22 5  
ATOM   3142  N N    . PRO A 1 7  ? 3.989   10.787 -7.249  1.00 1.00 ? 7  PRO A N    5  
ATOM   3143  C CA   . PRO A 1 7  ? 4.056   12.233 -7.366  1.00 1.00 ? 7  PRO A CA   5  
ATOM   3144  C C    . PRO A 1 7  ? 2.623   12.762 -7.233  1.00 1.00 ? 7  PRO A C    5  
ATOM   3145  O O    . PRO A 1 7  ? 1.711   12.095 -7.720  1.00 1.00 ? 7  PRO A O    5  
ATOM   3146  C CB   . PRO A 1 7  ? 4.646   12.502 -8.754  1.00 1.00 ? 7  PRO A CB   5  
ATOM   3147  C CG   . PRO A 1 7  ? 5.495   11.255 -9.009  1.00 1.00 ? 7  PRO A CG   5  
ATOM   3148  C CD   . PRO A 1 7  ? 4.686   10.139 -8.344  1.00 1.00 ? 7  PRO A CD   5  
ATOM   3149  H HA   . PRO A 1 7  ? 4.715   12.617 -6.594  1.00 1.00 ? 7  PRO A HA   5  
ATOM   3150  H HB2  . PRO A 1 7  ? 3.848   12.547 -9.497  1.00 1.00 ? 7  PRO A HB2  5  
ATOM   3151  H HB3  . PRO A 1 7  ? 5.233   13.421 -8.777  1.00 1.00 ? 7  PRO A HB3  5  
ATOM   3152  H HG2  . PRO A 1 7  ? 5.658   11.073 -10.072 1.00 1.00 ? 7  PRO A HG2  5  
ATOM   3153  H HG3  . PRO A 1 7  ? 6.453   11.363 -8.496  1.00 1.00 ? 7  PRO A HG3  5  
ATOM   3154  H HD2  . PRO A 1 7  ? 3.966   9.733  -9.049  1.00 1.00 ? 7  PRO A HD2  5  
ATOM   3155  H HD3  . PRO A 1 7  ? 5.357   9.352  -7.993  1.00 1.00 ? 7  PRO A HD3  5  
ATOM   3156  N N    . SER A 1 8  ? 2.392   13.883 -6.543  1.00 1.00 ? 8  SER A N    5  
ATOM   3157  C CA   . SER A 1 8  ? 1.042   14.359 -6.226  1.00 1.00 ? 8  SER A CA   5  
ATOM   3158  C C    . SER A 1 8  ? 0.078   14.201 -7.407  1.00 1.00 ? 8  SER A C    5  
ATOM   3159  O O    . SER A 1 8  ? 0.425   14.490 -8.554  1.00 1.00 ? 8  SER A O    5  
ATOM   3160  C CB   . SER A 1 8  ? 1.103   15.806 -5.740  1.00 1.00 ? 8  SER A CB   5  
ATOM   3161  O OG   . SER A 1 8  ? -0.159  16.457 -5.772  1.00 1.00 ? 8  SER A OG   5  
ATOM   3162  H H    . SER A 1 8  ? 3.194   14.377 -6.162  1.00 1.00 ? 8  SER A H    5  
ATOM   3163  H HA   . SER A 1 8  ? 0.665   13.750 -5.405  1.00 1.00 ? 8  SER A HA   5  
ATOM   3164  H HB2  . SER A 1 8  ? 1.500   15.822 -4.725  1.00 1.00 ? 8  SER A HB2  5  
ATOM   3165  H HB3  . SER A 1 8  ? 1.795   16.328 -6.394  1.00 1.00 ? 8  SER A HB3  5  
ATOM   3166  H HG   . SER A 1 8  ? -0.813  15.941 -5.275  1.00 1.00 ? 8  SER A HG   5  
ATOM   3167  N N    . GLY A 1 9  ? -1.124  13.692 -7.115  1.00 1.00 ? 9  GLY A N    5  
ATOM   3168  C CA   . GLY A 1 9  ? -2.186  13.487 -8.084  1.00 1.00 ? 9  GLY A CA   5  
ATOM   3169  C C    . GLY A 1 9  ? -2.438  14.770 -8.866  1.00 1.00 ? 9  GLY A C    5  
ATOM   3170  O O    . GLY A 1 9  ? -2.549  14.741 -10.087 1.00 1.00 ? 9  GLY A O    5  
ATOM   3171  H H    . GLY A 1 9  ? -1.380  13.617 -6.139  1.00 1.00 ? 9  GLY A H    5  
ATOM   3172  H HA2  . GLY A 1 9  ? -1.919  12.682 -8.767  1.00 1.00 ? 9  GLY A HA2  5  
ATOM   3173  H HA3  . GLY A 1 9  ? -3.100  13.212 -7.557  1.00 1.00 ? 9  GLY A HA3  5  
ATOM   3174  N N    . THR A 1 10 ? -2.482  15.898 -8.153  1.00 1.00 ? 10 THR A N    5  
ATOM   3175  C CA   . THR A 1 10 ? -2.628  17.206 -8.761  1.00 1.00 ? 10 THR A CA   5  
ATOM   3176  C C    . THR A 1 10 ? -1.253  17.707 -9.197  1.00 1.00 ? 10 THR A C    5  
ATOM   3177  O O    . THR A 1 10 ? -1.027  18.003 -10.370 1.00 1.00 ? 10 THR A O    5  
ATOM   3178  C CB   . THR A 1 10 ? -3.284  18.149 -7.741  1.00 1.00 ? 10 THR A CB   5  
ATOM   3179  O OG1  . THR A 1 10 ? -2.693  18.008 -6.459  1.00 1.00 ? 10 THR A OG1  5  
ATOM   3180  C CG2  . THR A 1 10 ? -4.766  17.804 -7.594  1.00 1.00 ? 10 THR A CG2  5  
ATOM   3181  H H    . THR A 1 10 ? -2.373  15.860 -7.143  1.00 1.00 ? 10 THR A H    5  
ATOM   3182  H HA   . THR A 1 10 ? -3.265  17.148 -9.644  1.00 1.00 ? 10 THR A HA   5  
ATOM   3183  H HB   . THR A 1 10 ? -3.197  19.183 -8.081  1.00 1.00 ? 10 THR A HB   5  
ATOM   3184  H HG1  . THR A 1 10 ? -1.846  18.467 -6.446  1.00 1.00 ? 10 THR A HG1  5  
ATOM   3185  H HG21 . THR A 1 10 ? -4.892  16.753 -7.334  1.00 1.00 ? 10 THR A HG21 5  
ATOM   3186  H HG22 . THR A 1 10 ? -5.202  18.420 -6.810  1.00 1.00 ? 10 THR A HG22 5  
ATOM   3187  H HG23 . THR A 1 10 ? -5.284  18.003 -8.532  1.00 1.00 ? 10 THR A HG23 5  
ATOM   3188  N N    . TRP A 1 11 ? -0.320  17.814 -8.251  1.00 1.00 ? 11 TRP A N    5  
ATOM   3189  C CA   . TRP A 1 11 ? 0.951   18.474 -8.487  1.00 1.00 ? 11 TRP A CA   5  
ATOM   3190  C C    . TRP A 1 11 ? 1.938   17.464 -9.071  1.00 1.00 ? 11 TRP A C    5  
ATOM   3191  O O    . TRP A 1 11 ? 2.965   17.138 -8.477  1.00 1.00 ? 11 TRP A O    5  
ATOM   3192  C CB   . TRP A 1 11 ? 1.400   19.162 -7.193  1.00 1.00 ? 11 TRP A CB   5  
ATOM   3193  C CG   . TRP A 1 11 ? 2.461   20.210 -7.291  1.00 1.00 ? 11 TRP A CG   5  
ATOM   3194  C CD1  . TRP A 1 11 ? 3.444   20.299 -8.215  1.00 1.00 ? 11 TRP A CD1  5  
ATOM   3195  C CD2  . TRP A 1 11 ? 2.675   21.322 -6.379  1.00 1.00 ? 11 TRP A CD2  5  
ATOM   3196  N NE1  . TRP A 1 11 ? 4.242   21.388 -7.939  1.00 1.00 ? 11 TRP A NE1  5  
ATOM   3197  C CE2  . TRP A 1 11 ? 3.811   22.057 -6.814  1.00 1.00 ? 11 TRP A CE2  5  
ATOM   3198  C CE3  . TRP A 1 11 ? 2.023   21.772 -5.214  1.00 1.00 ? 11 TRP A CE3  5  
ATOM   3199  C CZ2  . TRP A 1 11 ? 4.283   23.183 -6.127  1.00 1.00 ? 11 TRP A CZ2  5  
ATOM   3200  C CZ3  . TRP A 1 11 ? 2.524   22.861 -4.483  1.00 1.00 ? 11 TRP A CZ3  5  
ATOM   3201  C CH2  . TRP A 1 11 ? 3.664   23.549 -4.922  1.00 1.00 ? 11 TRP A CH2  5  
ATOM   3202  H H    . TRP A 1 11 ? -0.478  17.400 -7.337  1.00 1.00 ? 11 TRP A H    5  
ATOM   3203  H HA   . TRP A 1 11 ? 0.807   19.269 -9.222  1.00 1.00 ? 11 TRP A HA   5  
ATOM   3204  H HB2  . TRP A 1 11 ? 0.525   19.664 -6.777  1.00 1.00 ? 11 TRP A HB2  5  
ATOM   3205  H HB3  . TRP A 1 11 ? 1.730   18.438 -6.457  1.00 1.00 ? 11 TRP A HB3  5  
ATOM   3206  H HD1  . TRP A 1 11 ? 3.609   19.623 -9.039  1.00 1.00 ? 11 TRP A HD1  5  
ATOM   3207  H HE1  . TRP A 1 11 ? 5.086   21.641 -8.443  1.00 1.00 ? 11 TRP A HE1  5  
ATOM   3208  H HE3  . TRP A 1 11 ? 1.146   21.254 -4.862  1.00 1.00 ? 11 TRP A HE3  5  
ATOM   3209  H HZ2  . TRP A 1 11 ? 5.146   23.721 -6.484  1.00 1.00 ? 11 TRP A HZ2  5  
ATOM   3210  H HZ3  . TRP A 1 11 ? 2.039   23.155 -3.568  1.00 1.00 ? 11 TRP A HZ3  5  
ATOM   3211  H HH2  . TRP A 1 11 ? 4.081   24.331 -4.312  1.00 1.00 ? 11 TRP A HH2  5  
ATOM   3212  N N    . SER A 1 12 ? 1.652   17.020 -10.295 1.00 1.00 ? 12 SER A N    5  
ATOM   3213  C CA   . SER A 1 12 ? 2.488   16.067 -11.007 1.00 1.00 ? 12 SER A CA   5  
ATOM   3214  C C    . SER A 1 12 ? 3.550   16.866 -11.763 1.00 1.00 ? 12 SER A C    5  
ATOM   3215  O O    . SER A 1 12 ? 3.547   16.909 -12.991 1.00 1.00 ? 12 SER A O    5  
ATOM   3216  C CB   . SER A 1 12 ? 1.609   15.259 -11.972 1.00 1.00 ? 12 SER A CB   5  
ATOM   3217  O OG   . SER A 1 12 ? 0.652   14.495 -11.259 1.00 1.00 ? 12 SER A OG   5  
ATOM   3218  H H    . SER A 1 12 ? 0.784   17.339 -10.717 1.00 1.00 ? 12 SER A H    5  
ATOM   3219  H HA   . SER A 1 12 ? 2.974   15.377 -10.315 1.00 1.00 ? 12 SER A HA   5  
ATOM   3220  H HB2  . SER A 1 12 ? 1.095   15.939 -12.655 1.00 1.00 ? 12 SER A HB2  5  
ATOM   3221  H HB3  . SER A 1 12 ? 2.238   14.591 -12.564 1.00 1.00 ? 12 SER A HB3  5  
ATOM   3222  H HG   . SER A 1 12 ? 0.483   14.921 -10.402 1.00 1.00 ? 12 SER A HG   5  
ATOM   3223  N N    . GLY A 1 13 ? 4.442   17.521 -11.015 1.00 1.00 ? 13 GLY A N    5  
ATOM   3224  C CA   . GLY A 1 13 ? 5.450   18.409 -11.573 1.00 1.00 ? 13 GLY A CA   5  
ATOM   3225  C C    . GLY A 1 13 ? 6.527   18.738 -10.543 1.00 1.00 ? 13 GLY A C    5  
ATOM   3226  O O    . GLY A 1 13 ? 6.588   18.113 -9.482  1.00 1.00 ? 13 GLY A O    5  
ATOM   3227  H H    . GLY A 1 13 ? 4.403   17.426 -10.004 1.00 1.00 ? 13 GLY A H    5  
ATOM   3228  H HA2  . GLY A 1 13 ? 5.925   17.938 -12.434 1.00 1.00 ? 13 GLY A HA2  5  
ATOM   3229  H HA3  . GLY A 1 13 ? 4.964   19.331 -11.894 1.00 1.00 ? 13 GLY A HA3  5  
ATOM   3230  N N    . VAL A 1 14 ? 7.379   19.718 -10.868 1.00 1.00 ? 14 VAL A N    5  
ATOM   3231  C CA   . VAL A 1 14 ? 8.466   20.151 -10.000 1.00 1.00 ? 14 VAL A CA   5  
ATOM   3232  C C    . VAL A 1 14 ? 7.878   20.596 -8.657  1.00 1.00 ? 14 VAL A C    5  
ATOM   3233  O O    . VAL A 1 14 ? 6.846   21.261 -8.643  1.00 1.00 ? 14 VAL A O    5  
ATOM   3234  C CB   . VAL A 1 14 ? 9.291   21.264 -10.673 1.00 1.00 ? 14 VAL A CB   5  
ATOM   3235  C CG1  . VAL A 1 14 ? 10.453  21.718 -9.777  1.00 1.00 ? 14 VAL A CG1  5  
ATOM   3236  C CG2  . VAL A 1 14 ? 9.874   20.782 -12.009 1.00 1.00 ? 14 VAL A CG2  5  
ATOM   3237  H H    . VAL A 1 14 ? 7.242   20.210 -11.737 1.00 1.00 ? 14 VAL A H    5  
ATOM   3238  H HA   . VAL A 1 14 ? 9.105   19.285 -9.859  1.00 1.00 ? 14 VAL A HA   5  
ATOM   3239  H HB   . VAL A 1 14 ? 8.644   22.122 -10.858 1.00 1.00 ? 14 VAL A HB   5  
ATOM   3240  H HG11 . VAL A 1 14 ? 11.079  20.867 -9.514  1.00 1.00 ? 14 VAL A HG11 5  
ATOM   3241  H HG12 . VAL A 1 14 ? 11.059  22.455 -10.306 1.00 1.00 ? 14 VAL A HG12 5  
ATOM   3242  H HG13 . VAL A 1 14 ? 10.075  22.183 -8.867  1.00 1.00 ? 14 VAL A HG13 5  
ATOM   3243  H HG21 . VAL A 1 14 ? 10.496  19.902 -11.848 1.00 1.00 ? 14 VAL A HG21 5  
ATOM   3244  H HG22 . VAL A 1 14 ? 9.078   20.533 -12.713 1.00 1.00 ? 14 VAL A HG22 5  
ATOM   3245  H HG23 . VAL A 1 14 ? 10.483  21.570 -12.451 1.00 1.00 ? 14 VAL A HG23 5  
ATOM   3246  N N    . CYS A 1 15 ? 8.539   20.286 -7.536  1.00 1.00 ? 15 CYS A N    5  
ATOM   3247  C CA   . CYS A 1 15 ? 7.902   20.453 -6.228  1.00 1.00 ? 15 CYS A CA   5  
ATOM   3248  C C    . CYS A 1 15 ? 7.754   21.901 -5.784  1.00 1.00 ? 15 CYS A C    5  
ATOM   3249  O O    . CYS A 1 15 ? 6.794   22.206 -5.085  1.00 1.00 ? 15 CYS A O    5  
ATOM   3250  C CB   . CYS A 1 15 ? 8.635   19.679 -5.119  1.00 1.00 ? 15 CYS A CB   5  
ATOM   3251  S SG   . CYS A 1 15 ? 9.626   20.692 -3.983  1.00 1.00 ? 15 CYS A SG   5  
ATOM   3252  H H    . CYS A 1 15 ? 9.378   19.726 -7.634  1.00 1.00 ? 15 CYS A H    5  
ATOM   3253  H HA   . CYS A 1 15 ? 6.897   20.044 -6.313  1.00 1.00 ? 15 CYS A HA   5  
ATOM   3254  H HB2  . CYS A 1 15 ? 7.888   19.185 -4.498  1.00 1.00 ? 15 CYS A HB2  5  
ATOM   3255  H HB3  . CYS A 1 15 ? 9.275   18.916 -5.547  1.00 1.00 ? 15 CYS A HB3  5  
ATOM   3256  N N    . GLY A 1 16 ? 8.727   22.769 -6.068  1.00 1.00 ? 16 GLY A N    5  
ATOM   3257  C CA   . GLY A 1 16 ? 8.729   24.138 -5.564  1.00 1.00 ? 16 GLY A CA   5  
ATOM   3258  C C    . GLY A 1 16 ? 9.010   24.248 -4.055  1.00 1.00 ? 16 GLY A C    5  
ATOM   3259  O O    . GLY A 1 16 ? 9.855   25.042 -3.651  1.00 1.00 ? 16 GLY A O    5  
ATOM   3260  H H    . GLY A 1 16 ? 9.513   22.451 -6.614  1.00 1.00 ? 16 GLY A H    5  
ATOM   3261  H HA2  . GLY A 1 16 ? 9.494   24.699 -6.103  1.00 1.00 ? 16 GLY A HA2  5  
ATOM   3262  H HA3  . GLY A 1 16 ? 7.763   24.601 -5.773  1.00 1.00 ? 16 GLY A HA3  5  
ATOM   3263  N N    . ASN A 1 17 ? 8.299   23.490 -3.212  1.00 1.00 ? 17 ASN A N    5  
ATOM   3264  C CA   . ASN A 1 17 ? 8.307   23.637 -1.760  1.00 1.00 ? 17 ASN A CA   5  
ATOM   3265  C C    . ASN A 1 17 ? 7.550   22.491 -1.076  1.00 1.00 ? 17 ASN A C    5  
ATOM   3266  O O    . ASN A 1 17 ? 6.420   22.176 -1.446  1.00 1.00 ? 17 ASN A O    5  
ATOM   3267  C CB   . ASN A 1 17 ? 7.665   24.974 -1.362  1.00 1.00 ? 17 ASN A CB   5  
ATOM   3268  C CG   . ASN A 1 17 ? 7.542   25.082 0.153   1.00 1.00 ? 17 ASN A CG   5  
ATOM   3269  O OD1  . ASN A 1 17 ? 6.510   24.743 0.725   1.00 1.00 ? 17 ASN A OD1  5  
ATOM   3270  N ND2  . ASN A 1 17 ? 8.604   25.514 0.825   1.00 1.00 ? 17 ASN A ND2  5  
ATOM   3271  H H    . ASN A 1 17 ? 7.709   22.768 -3.613  1.00 1.00 ? 17 ASN A H    5  
ATOM   3272  H HA   . ASN A 1 17 ? 9.343   23.636 -1.421  1.00 1.00 ? 17 ASN A HA   5  
ATOM   3273  H HB2  . ASN A 1 17 ? 8.257   25.810 -1.737  1.00 1.00 ? 17 ASN A HB2  5  
ATOM   3274  H HB3  . ASN A 1 17 ? 6.668   25.037 -1.799  1.00 1.00 ? 17 ASN A HB3  5  
ATOM   3275  H HD21 . ASN A 1 17 ? 9.435   25.807 0.330   1.00 1.00 ? 17 ASN A HD21 5  
ATOM   3276  H HD22 . ASN A 1 17 ? 8.541   25.620 1.825   1.00 1.00 ? 17 ASN A HD22 5  
ATOM   3277  N N    . ASN A 1 18 ? 8.165   21.903 -0.042  1.00 1.00 ? 18 ASN A N    5  
ATOM   3278  C CA   . ASN A 1 18 ? 7.634   20.811 0.764   1.00 1.00 ? 18 ASN A CA   5  
ATOM   3279  C C    . ASN A 1 18 ? 6.216   21.056 1.263   1.00 1.00 ? 18 ASN A C    5  
ATOM   3280  O O    . ASN A 1 18 ? 5.302   20.290 0.970   1.00 1.00 ? 18 ASN A O    5  
ATOM   3281  C CB   . ASN A 1 18 ? 8.572   20.598 1.955   1.00 1.00 ? 18 ASN A CB   5  
ATOM   3282  C CG   . ASN A 1 18 ? 8.195   19.331 2.706   1.00 1.00 ? 18 ASN A CG   5  
ATOM   3283  O OD1  . ASN A 1 18 ? 7.190   19.280 3.410   1.00 1.00 ? 18 ASN A OD1  5  
ATOM   3284  N ND2  . ASN A 1 18 ? 8.982   18.277 2.540   1.00 1.00 ? 18 ASN A ND2  5  
ATOM   3285  H H    . ASN A 1 18 ? 9.096   22.209 0.199   1.00 1.00 ? 18 ASN A H    5  
ATOM   3286  H HA   . ASN A 1 18 ? 7.608   19.906 0.165   1.00 1.00 ? 18 ASN A HA   5  
ATOM   3287  H HB2  . ASN A 1 18 ? 9.594   20.527 1.596   1.00 1.00 ? 18 ASN A HB2  5  
ATOM   3288  H HB3  . ASN A 1 18 ? 8.533   21.439 2.646   1.00 1.00 ? 18 ASN A HB3  5  
ATOM   3289  H HD21 . ASN A 1 18 ? 9.845   18.335 2.014   1.00 1.00 ? 18 ASN A HD21 5  
ATOM   3290  H HD22 . ASN A 1 18 ? 8.775   17.462 3.088   1.00 1.00 ? 18 ASN A HD22 5  
ATOM   3291  N N    . ASN A 1 19 ? 6.068   22.089 2.085   1.00 1.00 ? 19 ASN A N    5  
ATOM   3292  C CA   . ASN A 1 19 ? 4.813   22.425 2.741   1.00 1.00 ? 19 ASN A CA   5  
ATOM   3293  C C    . ASN A 1 19 ? 3.700   22.652 1.721   1.00 1.00 ? 19 ASN A C    5  
ATOM   3294  O O    . ASN A 1 19 ? 2.612   22.098 1.863   1.00 1.00 ? 19 ASN A O    5  
ATOM   3295  C CB   . ASN A 1 19 ? 4.982   23.651 3.642   1.00 1.00 ? 19 ASN A CB   5  
ATOM   3296  C CG   . ASN A 1 19 ? 3.651   24.001 4.300   1.00 1.00 ? 19 ASN A CG   5  
ATOM   3297  O OD1  . ASN A 1 19 ? 3.231   23.336 5.239   1.00 1.00 ? 19 ASN A OD1  5  
ATOM   3298  N ND2  . ASN A 1 19 ? 2.969   25.031 3.806   1.00 1.00 ? 19 ASN A ND2  5  
ATOM   3299  H H    . ASN A 1 19 ? 6.905   22.607 2.295   1.00 1.00 ? 19 ASN A H    5  
ATOM   3300  H HA   . ASN A 1 19 ? 4.526   21.584 3.375   1.00 1.00 ? 19 ASN A HA   5  
ATOM   3301  H HB2  . ASN A 1 19 ? 5.711   23.425 4.423   1.00 1.00 ? 19 ASN A HB2  5  
ATOM   3302  H HB3  . ASN A 1 19 ? 5.344   24.501 3.063   1.00 1.00 ? 19 ASN A HB3  5  
ATOM   3303  H HD21 . ASN A 1 19 ? 3.328   25.571 3.033   1.00 1.00 ? 19 ASN A HD21 5  
ATOM   3304  H HD22 . ASN A 1 19 ? 2.087   25.266 4.235   1.00 1.00 ? 19 ASN A HD22 5  
ATOM   3305  N N    . ALA A 1 20 ? 3.967   23.462 0.693   1.00 1.00 ? 20 ALA A N    5  
ATOM   3306  C CA   . ALA A 1 20 ? 2.996   23.712 -0.363  1.00 1.00 ? 20 ALA A CA   5  
ATOM   3307  C C    . ALA A 1 20 ? 2.585   22.395 -1.018  1.00 1.00 ? 20 ALA A C    5  
ATOM   3308  O O    . ALA A 1 20 ? 1.395   22.094 -1.094  1.00 1.00 ? 20 ALA A O    5  
ATOM   3309  C CB   . ALA A 1 20 ? 3.560   24.692 -1.392  1.00 1.00 ? 20 ALA A CB   5  
ATOM   3310  H H    . ALA A 1 20 ? 4.885   23.887 0.630   1.00 1.00 ? 20 ALA A H    5  
ATOM   3311  H HA   . ALA A 1 20 ? 2.111   24.169 0.084   1.00 1.00 ? 20 ALA A HA   5  
ATOM   3312  H HB1  . ALA A 1 20 ? 3.865   25.616 -0.901  1.00 1.00 ? 20 ALA A HB1  5  
ATOM   3313  H HB2  . ALA A 1 20 ? 4.415   24.251 -1.902  1.00 1.00 ? 20 ALA A HB2  5  
ATOM   3314  H HB3  . ALA A 1 20 ? 2.788   24.928 -2.126  1.00 1.00 ? 20 ALA A HB3  5  
ATOM   3315  N N    . CYS A 1 21 ? 3.573   21.611 -1.470  1.00 1.00 ? 21 CYS A N    5  
ATOM   3316  C CA   . CYS A 1 21 ? 3.351   20.306 -2.084  1.00 1.00 ? 21 CYS A CA   5  
ATOM   3317  C C    . CYS A 1 21 ? 2.436   19.439 -1.212  1.00 1.00 ? 21 CYS A C    5  
ATOM   3318  O O    . CYS A 1 21 ? 1.368   19.005 -1.647  1.00 1.00 ? 21 CYS A O    5  
ATOM   3319  C CB   . CYS A 1 21 ? 4.694   19.600 -2.305  1.00 1.00 ? 21 CYS A CB   5  
ATOM   3320  S SG   . CYS A 1 21 ? 4.563   17.804 -2.463  1.00 1.00 ? 21 CYS A SG   5  
ATOM   3321  H H    . CYS A 1 21 ? 4.535   21.930 -1.378  1.00 1.00 ? 21 CYS A H    5  
ATOM   3322  H HA   . CYS A 1 21 ? 2.881   20.464 -3.053  1.00 1.00 ? 21 CYS A HA   5  
ATOM   3323  H HB2  . CYS A 1 21 ? 5.176   20.005 -3.195  1.00 1.00 ? 21 CYS A HB2  5  
ATOM   3324  H HB3  . CYS A 1 21 ? 5.349   19.774 -1.456  1.00 1.00 ? 21 CYS A HB3  5  
ATOM   3325  N N    . LYS A 1 22 ? 2.877   19.208 0.028   1.00 1.00 ? 22 LYS A N    5  
ATOM   3326  C CA   . LYS A 1 22 ? 2.186   18.448 1.057   1.00 1.00 ? 22 LYS A CA   5  
ATOM   3327  C C    . LYS A 1 22 ? 0.732   18.901 1.148   1.00 1.00 ? 22 LYS A C    5  
ATOM   3328  O O    . LYS A 1 22 ? -0.190  18.111 0.925   1.00 1.00 ? 22 LYS A O    5  
ATOM   3329  C CB   . LYS A 1 22 ? 2.944   18.692 2.374   1.00 1.00 ? 22 LYS A CB   5  
ATOM   3330  C CG   . LYS A 1 22 ? 2.280   18.120 3.638   1.00 1.00 ? 22 LYS A CG   5  
ATOM   3331  C CD   . LYS A 1 22 ? 3.047   18.476 4.929   1.00 1.00 ? 22 LYS A CD   5  
ATOM   3332  C CE   . LYS A 1 22 ? 4.230   17.558 5.287   1.00 1.00 ? 22 LYS A CE   5  
ATOM   3333  N NZ   . LYS A 1 22 ? 5.306   17.573 4.279   1.00 1.00 ? 22 LYS A NZ   5  
ATOM   3334  H H    . LYS A 1 22 ? 3.756   19.642 0.284   1.00 1.00 ? 22 LYS A H    5  
ATOM   3335  H HA   . LYS A 1 22 ? 2.212   17.386 0.793   1.00 1.00 ? 22 LYS A HA   5  
ATOM   3336  H HB2  . LYS A 1 22 ? 3.943   18.299 2.232   1.00 1.00 ? 22 LYS A HB2  5  
ATOM   3337  H HB3  . LYS A 1 22 ? 3.044   19.763 2.530   1.00 1.00 ? 22 LYS A HB3  5  
ATOM   3338  H HG2  . LYS A 1 22 ? 1.295   18.581 3.734   1.00 1.00 ? 22 LYS A HG2  5  
ATOM   3339  H HG3  . LYS A 1 22 ? 2.122   17.047 3.547   1.00 1.00 ? 22 LYS A HG3  5  
ATOM   3340  H HD2  . LYS A 1 22 ? 3.372   19.517 4.888   1.00 1.00 ? 22 LYS A HD2  5  
ATOM   3341  H HD3  . LYS A 1 22 ? 2.334   18.398 5.755   1.00 1.00 ? 22 LYS A HD3  5  
ATOM   3342  H HE2  . LYS A 1 22 ? 4.644   17.876 6.246   1.00 1.00 ? 22 LYS A HE2  5  
ATOM   3343  H HE3  . LYS A 1 22 ? 3.865   16.535 5.395   1.00 1.00 ? 22 LYS A HE3  5  
ATOM   3344  H HZ1  . LYS A 1 22 ? 5.712   18.491 4.131   1.00 1.00 ? 22 LYS A HZ1  5  
ATOM   3345  H HZ2  . LYS A 1 22 ? 6.057   16.924 4.494   1.00 1.00 ? 22 LYS A HZ2  5  
ATOM   3346  H HZ3  . LYS A 1 22 ? 4.932   17.229 3.405   1.00 1.00 ? 22 LYS A HZ3  5  
ATOM   3347  N N    . ASN A 1 23 ? 0.552   20.179 1.503   1.00 1.00 ? 23 ASN A N    5  
ATOM   3348  C CA   . ASN A 1 23 ? -0.756  20.775 1.691   1.00 1.00 ? 23 ASN A CA   5  
ATOM   3349  C C    . ASN A 1 23 ? -1.597  20.521 0.455   1.00 1.00 ? 23 ASN A C    5  
ATOM   3350  O O    . ASN A 1 23 ? -2.569  19.783 0.533   1.00 1.00 ? 23 ASN A O    5  
ATOM   3351  C CB   . ASN A 1 23 ? -0.638  22.281 1.973   1.00 1.00 ? 23 ASN A CB   5  
ATOM   3352  C CG   . ASN A 1 23 ? -1.970  23.013 1.782   1.00 1.00 ? 23 ASN A CG   5  
ATOM   3353  O OD1  . ASN A 1 23 ? -3.013  22.592 2.274   1.00 1.00 ? 23 ASN A OD1  5  
ATOM   3354  N ND2  . ASN A 1 23 ? -1.959  24.116 1.038   1.00 1.00 ? 23 ASN A ND2  5  
ATOM   3355  H H    . ASN A 1 23 ? 1.367   20.774 1.617   1.00 1.00 ? 23 ASN A H    5  
ATOM   3356  H HA   . ASN A 1 23 ? -1.231  20.276 2.537   1.00 1.00 ? 23 ASN A HA   5  
ATOM   3357  H HB2  . ASN A 1 23 ? -0.285  22.431 2.995   1.00 1.00 ? 23 ASN A HB2  5  
ATOM   3358  H HB3  . ASN A 1 23 ? 0.096   22.712 1.291   1.00 1.00 ? 23 ASN A HB3  5  
ATOM   3359  H HD21 . ASN A 1 23 ? -1.099  24.457 0.636   1.00 1.00 ? 23 ASN A HD21 5  
ATOM   3360  H HD22 . ASN A 1 23 ? -2.824  24.614 0.896   1.00 1.00 ? 23 ASN A HD22 5  
ATOM   3361  N N    . GLN A 1 24 ? -1.221  21.104 -0.684  1.00 1.00 ? 24 GLN A N    5  
ATOM   3362  C CA   . GLN A 1 24 ? -2.021  21.008 -1.893  1.00 1.00 ? 24 GLN A CA   5  
ATOM   3363  C C    . GLN A 1 24 ? -2.384  19.561 -2.196  1.00 1.00 ? 24 GLN A C    5  
ATOM   3364  O O    . GLN A 1 24 ? -3.551  19.287 -2.470  1.00 1.00 ? 24 GLN A O    5  
ATOM   3365  C CB   . GLN A 1 24 ? -1.306  21.679 -3.067  1.00 1.00 ? 24 GLN A CB   5  
ATOM   3366  C CG   . GLN A 1 24 ? -1.314  23.205 -2.886  1.00 1.00 ? 24 GLN A CG   5  
ATOM   3367  C CD   . GLN A 1 24 ? -0.585  23.957 -3.993  1.00 1.00 ? 24 GLN A CD   5  
ATOM   3368  O OE1  . GLN A 1 24 ? 0.102   24.938 -3.729  1.00 1.00 ? 24 GLN A OE1  5  
ATOM   3369  N NE2  . GLN A 1 24 ? -0.721  23.519 -5.243  1.00 1.00 ? 24 GLN A NE2  5  
ATOM   3370  H H    . GLN A 1 24 ? -0.332  21.591 -0.725  1.00 1.00 ? 24 GLN A H    5  
ATOM   3371  H HA   . GLN A 1 24 ? -2.973  21.516 -1.722  1.00 1.00 ? 24 GLN A HA   5  
ATOM   3372  H HB2  . GLN A 1 24 ? -0.284  21.309 -3.123  1.00 1.00 ? 24 GLN A HB2  5  
ATOM   3373  H HB3  . GLN A 1 24 ? -1.836  21.418 -3.983  1.00 1.00 ? 24 GLN A HB3  5  
ATOM   3374  H HG2  . GLN A 1 24 ? -2.345  23.557 -2.861  1.00 1.00 ? 24 GLN A HG2  5  
ATOM   3375  H HG3  . GLN A 1 24 ? -0.834  23.458 -1.941  1.00 1.00 ? 24 GLN A HG3  5  
ATOM   3376  H HE21 . GLN A 1 24 ? -1.271  22.699 -5.445  1.00 1.00 ? 24 GLN A HE21 5  
ATOM   3377  H HE22 . GLN A 1 24 ? -0.221  24.003 -5.972  1.00 1.00 ? 24 GLN A HE22 5  
ATOM   3378  N N    . CYS A 1 25 ? -1.426  18.631 -2.095  1.00 1.00 ? 25 CYS A N    5  
ATOM   3379  C CA   . CYS A 1 25 ? -1.748  17.236 -2.328  1.00 1.00 ? 25 CYS A CA   5  
ATOM   3380  C C    . CYS A 1 25 ? -2.902  16.766 -1.449  1.00 1.00 ? 25 CYS A C    5  
ATOM   3381  O O    . CYS A 1 25 ? -3.951  16.396 -1.968  1.00 1.00 ? 25 CYS A O    5  
ATOM   3382  C CB   . CYS A 1 25 ? -0.574  16.288 -2.104  1.00 1.00 ? 25 CYS A CB   5  
ATOM   3383  S SG   . CYS A 1 25 ? -1.116  14.618 -2.526  1.00 1.00 ? 25 CYS A SG   5  
ATOM   3384  H H    . CYS A 1 25 ? -0.478  18.891 -1.836  1.00 1.00 ? 25 CYS A H    5  
ATOM   3385  H HA   . CYS A 1 25 ? -2.041  17.148 -3.373  1.00 1.00 ? 25 CYS A HA   5  
ATOM   3386  H HB2  . CYS A 1 25 ? 0.272   16.555 -2.720  1.00 1.00 ? 25 CYS A HB2  5  
ATOM   3387  H HB3  . CYS A 1 25 ? -0.258  16.304 -1.062  1.00 1.00 ? 25 CYS A HB3  5  
ATOM   3388  N N    . ILE A 1 26 ? -2.709  16.761 -0.127  1.00 1.00 ? 26 ILE A N    5  
ATOM   3389  C CA   . ILE A 1 26 ? -3.672  16.109 0.764   1.00 1.00 ? 26 ILE A CA   5  
ATOM   3390  C C    . ILE A 1 26 ? -4.924  16.979 0.959   1.00 1.00 ? 26 ILE A C    5  
ATOM   3391  O O    . ILE A 1 26 ? -5.987  16.502 1.368   1.00 1.00 ? 26 ILE A O    5  
ATOM   3392  C CB   . ILE A 1 26 ? -2.972  15.755 2.094   1.00 1.00 ? 26 ILE A CB   5  
ATOM   3393  C CG1  . ILE A 1 26 ? -2.785  16.988 2.997   1.00 1.00 ? 26 ILE A CG1  5  
ATOM   3394  C CG2  . ILE A 1 26 ? -1.633  15.059 1.803   1.00 1.00 ? 26 ILE A CG2  5  
ATOM   3395  C CD1  . ILE A 1 26 ? -1.982  16.702 4.269   1.00 1.00 ? 26 ILE A CD1  5  
ATOM   3396  H H    . ILE A 1 26 ? -1.879  17.205 0.264   1.00 1.00 ? 26 ILE A H    5  
ATOM   3397  H HA   . ILE A 1 26 ? -3.995  15.169 0.305   1.00 1.00 ? 26 ILE A HA   5  
ATOM   3398  H HB   . ILE A 1 26 ? -3.609  15.051 2.631   1.00 1.00 ? 26 ILE A HB   5  
ATOM   3399  H HG12 . ILE A 1 26 ? -2.287  17.780 2.444   1.00 1.00 ? 26 ILE A HG12 5  
ATOM   3400  H HG13 . ILE A 1 26 ? -3.767  17.337 3.313   1.00 1.00 ? 26 ILE A HG13 5  
ATOM   3401  H HG21 . ILE A 1 26 ? -1.797  14.202 1.152   1.00 1.00 ? 26 ILE A HG21 5  
ATOM   3402  H HG22 . ILE A 1 26 ? -0.918  15.731 1.335   1.00 1.00 ? 26 ILE A HG22 5  
ATOM   3403  H HG23 . ILE A 1 26 ? -1.187  14.707 2.723   1.00 1.00 ? 26 ILE A HG23 5  
ATOM   3404  H HD11 . ILE A 1 26 ? -2.400  15.840 4.789   1.00 1.00 ? 26 ILE A HD11 5  
ATOM   3405  H HD12 . ILE A 1 26 ? -0.935  16.518 4.030   1.00 1.00 ? 26 ILE A HD12 5  
ATOM   3406  H HD13 . ILE A 1 26 ? -2.035  17.573 4.925   1.00 1.00 ? 26 ILE A HD13 5  
ATOM   3407  N N    . ASN A 1 27 ? -4.814  18.261 0.612   1.00 1.00 ? 27 ASN A N    5  
ATOM   3408  C CA   . ASN A 1 27 ? -5.892  19.225 0.706   1.00 1.00 ? 27 ASN A CA   5  
ATOM   3409  C C    . ASN A 1 27 ? -6.837  18.979 -0.461  1.00 1.00 ? 27 ASN A C    5  
ATOM   3410  O O    . ASN A 1 27 ? -8.008  18.672 -0.239  1.00 1.00 ? 27 ASN A O    5  
ATOM   3411  C CB   . ASN A 1 27 ? -5.290  20.632 0.727   1.00 1.00 ? 27 ASN A CB   5  
ATOM   3412  C CG   . ASN A 1 27 ? -6.288  21.745 1.001   1.00 1.00 ? 27 ASN A CG   5  
ATOM   3413  O OD1  . ASN A 1 27 ? -7.450  21.673 0.617   1.00 1.00 ? 27 ASN A OD1  5  
ATOM   3414  N ND2  . ASN A 1 27 ? -5.825  22.797 1.670   1.00 1.00 ? 27 ASN A ND2  5  
ATOM   3415  H H    . ASN A 1 27 ? -3.915  18.600 0.282   1.00 1.00 ? 27 ASN A H    5  
ATOM   3416  H HA   . ASN A 1 27 ? -6.432  19.074 1.642   1.00 1.00 ? 27 ASN A HA   5  
ATOM   3417  H HB2  . ASN A 1 27 ? -4.569  20.641 1.545   1.00 1.00 ? 27 ASN A HB2  5  
ATOM   3418  H HB3  . ASN A 1 27 ? -4.783  20.845 -0.214  1.00 1.00 ? 27 ASN A HB3  5  
ATOM   3419  H HD21 . ASN A 1 27 ? -4.855  22.804 1.982   1.00 1.00 ? 27 ASN A HD21 5  
ATOM   3420  H HD22 . ASN A 1 27 ? -6.451  23.558 1.883   1.00 1.00 ? 27 ASN A HD22 5  
ATOM   3421  N N    . LEU A 1 28 ? -6.316  18.999 -1.694  1.00 1.00 ? 28 LEU A N    5  
ATOM   3422  C CA   . LEU A 1 28 ? -7.108  18.707 -2.877  1.00 1.00 ? 28 LEU A CA   5  
ATOM   3423  C C    . LEU A 1 28 ? -7.436  17.210 -2.914  1.00 1.00 ? 28 LEU A C    5  
ATOM   3424  O O    . LEU A 1 28 ? -8.573  16.831 -2.623  1.00 1.00 ? 28 LEU A O    5  
ATOM   3425  C CB   . LEU A 1 28 ? -6.399  19.205 -4.145  1.00 1.00 ? 28 LEU A CB   5  
ATOM   3426  C CG   . LEU A 1 28 ? -6.604  20.709 -4.413  1.00 1.00 ? 28 LEU A CG   5  
ATOM   3427  C CD1  . LEU A 1 28 ? -6.038  21.610 -3.308  1.00 1.00 ? 28 LEU A CD1  5  
ATOM   3428  C CD2  . LEU A 1 28 ? -5.942  21.080 -5.743  1.00 1.00 ? 28 LEU A CD2  5  
ATOM   3429  H H    . LEU A 1 28 ? -5.321  19.164 -1.824  1.00 1.00 ? 28 LEU A H    5  
ATOM   3430  H HA   . LEU A 1 28 ? -8.058  19.239 -2.804  1.00 1.00 ? 28 LEU A HA   5  
ATOM   3431  H HB2  . LEU A 1 28 ? -5.337  18.976 -4.105  1.00 1.00 ? 28 LEU A HB2  5  
ATOM   3432  H HB3  . LEU A 1 28 ? -6.824  18.668 -4.989  1.00 1.00 ? 28 LEU A HB3  5  
ATOM   3433  H HG   . LEU A 1 28 ? -7.674  20.909 -4.502  1.00 1.00 ? 28 LEU A HG   5  
ATOM   3434  H HD11 . LEU A 1 28 ? -4.985  21.384 -3.144  1.00 1.00 ? 28 LEU A HD11 5  
ATOM   3435  H HD12 . LEU A 1 28 ? -6.132  22.654 -3.605  1.00 1.00 ? 28 LEU A HD12 5  
ATOM   3436  H HD13 . LEU A 1 28 ? -6.593  21.475 -2.382  1.00 1.00 ? 28 LEU A HD13 5  
ATOM   3437  H HD21 . LEU A 1 28 ? -6.392  20.507 -6.554  1.00 1.00 ? 28 LEU A HD21 5  
ATOM   3438  H HD22 . LEU A 1 28 ? -6.089  22.141 -5.948  1.00 1.00 ? 28 LEU A HD22 5  
ATOM   3439  H HD23 . LEU A 1 28 ? -4.873  20.869 -5.702  1.00 1.00 ? 28 LEU A HD23 5  
ATOM   3440  N N    . GLU A 1 29 ? -6.460  16.329 -3.160  1.00 1.00 ? 29 GLU A N    5  
ATOM   3441  C CA   . GLU A 1 29 ? -6.731  14.898 -3.246  1.00 1.00 ? 29 GLU A CA   5  
ATOM   3442  C C    . GLU A 1 29 ? -6.635  14.315 -1.834  1.00 1.00 ? 29 GLU A C    5  
ATOM   3443  O O    . GLU A 1 29 ? -6.212  14.985 -0.901  1.00 1.00 ? 29 GLU A O    5  
ATOM   3444  C CB   . GLU A 1 29 ? -5.866  14.183 -4.308  1.00 1.00 ? 29 GLU A CB   5  
ATOM   3445  C CG   . GLU A 1 29 ? -4.340  14.197 -4.131  1.00 1.00 ? 29 GLU A CG   5  
ATOM   3446  C CD   . GLU A 1 29 ? -3.638  15.383 -4.792  1.00 1.00 ? 29 GLU A CD   5  
ATOM   3447  O OE1  . GLU A 1 29 ? -2.538  15.204 -5.314  1.00 1.00 ? 29 GLU A OE1  5  
ATOM   3448  O OE2  . GLU A 1 29 ? -4.282  16.578 -4.781  1.00 1.00 ? 29 GLU A OE2  5  
ATOM   3449  H H    . GLU A 1 29 ? -5.489  16.636 -3.192  1.00 1.00 ? 29 GLU A H    5  
ATOM   3450  H HA   . GLU A 1 29 ? -7.761  14.754 -3.578  1.00 1.00 ? 29 GLU A HA   5  
ATOM   3451  H HB2  . GLU A 1 29 ? -6.169  13.135 -4.314  1.00 1.00 ? 29 GLU A HB2  5  
ATOM   3452  H HB3  . GLU A 1 29 ? -6.110  14.590 -5.291  1.00 1.00 ? 29 GLU A HB3  5  
ATOM   3453  H HG2  . GLU A 1 29 ? -4.078  14.139 -3.076  1.00 1.00 ? 29 GLU A HG2  5  
ATOM   3454  H HG3  . GLU A 1 29 ? -3.940  13.312 -4.632  1.00 1.00 ? 29 GLU A HG3  5  
ATOM   3455  H HE2  . GLU A 1 29 ? -3.767  17.241 -5.256  1.00 1.00 ? 29 GLU A HE2  5  
ATOM   3456  N N    . LYS A 1 30 ? -7.147  13.107 -1.627  1.00 1.00 ? 30 LYS A N    5  
ATOM   3457  C CA   . LYS A 1 30 ? -7.365  12.516 -0.309  1.00 1.00 ? 30 LYS A CA   5  
ATOM   3458  C C    . LYS A 1 30 ? -6.180  11.701 0.220   1.00 1.00 ? 30 LYS A C    5  
ATOM   3459  O O    . LYS A 1 30 ? -6.341  10.951 1.185   1.00 1.00 ? 30 LYS A O    5  
ATOM   3460  C CB   . LYS A 1 30 ? -8.715  11.782 -0.308  1.00 1.00 ? 30 LYS A CB   5  
ATOM   3461  C CG   . LYS A 1 30 ? -9.867  12.652 0.236   1.00 1.00 ? 30 LYS A CG   5  
ATOM   3462  C CD   . LYS A 1 30 ? -9.953  14.096 -0.304  1.00 1.00 ? 30 LYS A CD   5  
ATOM   3463  C CE   . LYS A 1 30 ? -9.449  15.179 0.682   1.00 1.00 ? 30 LYS A CE   5  
ATOM   3464  N NZ   . LYS A 1 30 ? -8.478  16.119 0.082   1.00 1.00 ? 30 LYS A NZ   5  
ATOM   3465  H H    . LYS A 1 30 ? -7.468  12.587 -2.426  1.00 1.00 ? 30 LYS A H    5  
ATOM   3466  H HA   . LYS A 1 30 ? -7.450  13.317 0.423   1.00 1.00 ? 30 LYS A HA   5  
ATOM   3467  H HB2  . LYS A 1 30 ? -8.958  11.454 -1.320  1.00 1.00 ? 30 LYS A HB2  5  
ATOM   3468  H HB3  . LYS A 1 30 ? -8.666  10.889 0.318   1.00 1.00 ? 30 LYS A HB3  5  
ATOM   3469  H HG2  . LYS A 1 30 ? -10.794 12.135 -0.026  1.00 1.00 ? 30 LYS A HG2  5  
ATOM   3470  H HG3  . LYS A 1 30 ? -9.810  12.664 1.324   1.00 1.00 ? 30 LYS A HG3  5  
ATOM   3471  H HD2  . LYS A 1 30 ? -9.473  14.167 -1.280  1.00 1.00 ? 30 LYS A HD2  5  
ATOM   3472  H HD3  . LYS A 1 30 ? -11.013 14.306 -0.477  1.00 1.00 ? 30 LYS A HD3  5  
ATOM   3473  H HE2  . LYS A 1 30 ? -10.312 15.760 1.014   1.00 1.00 ? 30 LYS A HE2  5  
ATOM   3474  H HE3  . LYS A 1 30 ? -8.987  14.738 1.568   1.00 1.00 ? 30 LYS A HE3  5  
ATOM   3475  H HZ1  . LYS A 1 30 ? -8.724  16.365 -0.873  1.00 1.00 ? 30 LYS A HZ1  5  
ATOM   3476  H HZ2  . LYS A 1 30 ? -8.431  17.005 0.577   1.00 1.00 ? 30 LYS A HZ2  5  
ATOM   3477  H HZ3  . LYS A 1 30 ? -7.527  15.752 0.092   1.00 1.00 ? 30 LYS A HZ3  5  
ATOM   3478  N N    . ALA A 1 31 ? -5.011  11.819 -0.415  1.00 1.00 ? 31 ALA A N    5  
ATOM   3479  C CA   . ALA A 1 31 ? -3.735  11.291 0.065   1.00 1.00 ? 31 ALA A CA   5  
ATOM   3480  C C    . ALA A 1 31 ? -3.499  11.566 1.561   1.00 1.00 ? 31 ALA A C    5  
ATOM   3481  O O    . ALA A 1 31 ? -4.140  12.443 2.139   1.00 1.00 ? 31 ALA A O    5  
ATOM   3482  C CB   . ALA A 1 31 ? -2.628  11.950 -0.751  1.00 1.00 ? 31 ALA A CB   5  
ATOM   3483  H H    . ALA A 1 31 ? -4.975  12.457 -1.193  1.00 1.00 ? 31 ALA A H    5  
ATOM   3484  H HA   . ALA A 1 31 ? -3.718  10.215 -0.108  1.00 1.00 ? 31 ALA A HA   5  
ATOM   3485  H HB1  . ALA A 1 31 ? -2.770  11.768 -1.817  1.00 1.00 ? 31 ALA A HB1  5  
ATOM   3486  H HB2  . ALA A 1 31 ? -2.650  13.028 -0.584  1.00 1.00 ? 31 ALA A HB2  5  
ATOM   3487  H HB3  . ALA A 1 31 ? -1.663  11.553 -0.436  1.00 1.00 ? 31 ALA A HB3  5  
ATOM   3488  N N    . ARG A 1 32 ? -2.596  10.811 2.202   1.00 1.00 ? 32 ARG A N    5  
ATOM   3489  C CA   . ARG A 1 32 ? -2.348  10.937 3.637   1.00 1.00 ? 32 ARG A CA   5  
ATOM   3490  C C    . ARG A 1 32 ? -1.372  12.071 3.927   1.00 1.00 ? 32 ARG A C    5  
ATOM   3491  O O    . ARG A 1 32 ? -1.794  13.117 4.411   1.00 1.00 ? 32 ARG A O    5  
ATOM   3492  C CB   . ARG A 1 32 ? -1.874  9.603  4.246   1.00 1.00 ? 32 ARG A CB   5  
ATOM   3493  C CG   . ARG A 1 32 ? -2.870  8.436  4.136   1.00 1.00 ? 32 ARG A CG   5  
ATOM   3494  C CD   . ARG A 1 32 ? -3.999  8.446  5.185   1.00 1.00 ? 32 ARG A CD   5  
ATOM   3495  N NE   . ARG A 1 32 ? -4.861  9.635  5.100   1.00 1.00 ? 32 ARG A NE   5  
ATOM   3496  C CZ   . ARG A 1 32 ? -5.583  9.980  4.024   1.00 1.00 ? 32 ARG A CZ   5  
ATOM   3497  N NH1  . ARG A 1 32 ? -5.797  9.096  3.047   1.00 1.00 ? 32 ARG A NH1  5  
ATOM   3498  N NH2  . ARG A 1 32 ? -6.055  11.221 3.896   1.00 1.00 ? 32 ARG A NH2  5  
ATOM   3499  H H    . ARG A 1 32 ? -2.014  10.169 1.668   1.00 1.00 ? 32 ARG A H    5  
ATOM   3500  H HA   . ARG A 1 32 ? -3.257  11.261 4.134   1.00 1.00 ? 32 ARG A HA   5  
ATOM   3501  H HB2  . ARG A 1 32 ? -0.966  9.301  3.723   1.00 1.00 ? 32 ARG A HB2  5  
ATOM   3502  H HB3  . ARG A 1 32 ? -1.623  9.755  5.297   1.00 1.00 ? 32 ARG A HB3  5  
ATOM   3503  H HG2  . ARG A 1 32 ? -3.260  8.402  3.123   1.00 1.00 ? 32 ARG A HG2  5  
ATOM   3504  H HG3  . ARG A 1 32 ? -2.312  7.513  4.293   1.00 1.00 ? 32 ARG A HG3  5  
ATOM   3505  H HD2  . ARG A 1 32 ? -4.602  7.540  5.086   1.00 1.00 ? 32 ARG A HD2  5  
ATOM   3506  H HD3  . ARG A 1 32 ? -3.547  8.421  6.178   1.00 1.00 ? 32 ARG A HD3  5  
ATOM   3507  H HE   . ARG A 1 32 ? -4.792  10.288 5.869   1.00 1.00 ? 32 ARG A HE   5  
ATOM   3508  H HH11 . ARG A 1 32 ? -5.483  8.145  3.144   1.00 1.00 ? 32 ARG A HH11 5  
ATOM   3509  H HH12 . ARG A 1 32 ? -6.218  9.422  2.180   1.00 1.00 ? 32 ARG A HH12 5  
ATOM   3510  H HH21 . ARG A 1 32 ? -5.854  11.939 4.575   1.00 1.00 ? 32 ARG A HH21 5  
ATOM   3511  H HH22 . ARG A 1 32 ? -6.351  11.504 2.964   1.00 1.00 ? 32 ARG A HH22 5  
ATOM   3512  N N    . HIS A 1 33 ? -0.073  11.836 3.732   1.00 1.00 ? 33 HIS A N    5  
ATOM   3513  C CA   . HIS A 1 33 ? 0.945   12.877 3.754   1.00 1.00 ? 33 HIS A CA   5  
ATOM   3514  C C    . HIS A 1 33 ? 1.452   13.138 2.336   1.00 1.00 ? 33 HIS A C    5  
ATOM   3515  O O    . HIS A 1 33 ? 1.202   12.353 1.418   1.00 1.00 ? 33 HIS A O    5  
ATOM   3516  C CB   . HIS A 1 33 ? 2.054   12.549 4.765   1.00 1.00 ? 33 HIS A CB   5  
ATOM   3517  C CG   . HIS A 1 33 ? 2.621   11.157 4.677   1.00 1.00 ? 33 HIS A CG   5  
ATOM   3518  N ND1  . HIS A 1 33 ? 1.996   10.069 5.265   1.00 1.00 ? 33 HIS A ND1  5  
ATOM   3519  C CD2  . HIS A 1 33 ? 3.801   10.667 4.171   1.00 1.00 ? 33 HIS A CD2  5  
ATOM   3520  C CE1  . HIS A 1 33 ? 2.792   9.005  5.083   1.00 1.00 ? 33 HIS A CE1  5  
ATOM   3521  N NE2  . HIS A 1 33 ? 3.902   9.299  4.404   1.00 1.00 ? 33 HIS A NE2  5  
ATOM   3522  H H    . HIS A 1 33 ? 0.184   10.980 3.263   1.00 1.00 ? 33 HIS A H    5  
ATOM   3523  H HA   . HIS A 1 33 ? 0.507   13.816 4.095   1.00 1.00 ? 33 HIS A HA   5  
ATOM   3524  H HB2  . HIS A 1 33 ? 2.868   13.267 4.661   1.00 1.00 ? 33 HIS A HB2  5  
ATOM   3525  H HB3  . HIS A 1 33 ? 1.637   12.668 5.766   1.00 1.00 ? 33 HIS A HB3  5  
ATOM   3526  H HD1  . HIS A 1 33 ? 1.120   10.082 5.766   1.00 1.00 ? 33 HIS A HD1  5  
ATOM   3527  H HD2  . HIS A 1 33 ? 4.560   11.268 3.692   1.00 1.00 ? 33 HIS A HD2  5  
ATOM   3528  H HE1  . HIS A 1 33 ? 2.556   8.020  5.454   1.00 1.00 ? 33 HIS A HE1  5  
ATOM   3529  N N    . GLY A 1 34 ? 2.206   14.227 2.183   1.00 1.00 ? 34 GLY A N    5  
ATOM   3530  C CA   . GLY A 1 34 ? 2.964   14.561 0.994   1.00 1.00 ? 34 GLY A CA   5  
ATOM   3531  C C    . GLY A 1 34 ? 4.175   15.364 1.434   1.00 1.00 ? 34 GLY A C    5  
ATOM   3532  O O    . GLY A 1 34 ? 4.208   15.806 2.584   1.00 1.00 ? 34 GLY A O    5  
ATOM   3533  H H    . GLY A 1 34 ? 2.409   14.799 2.990   1.00 1.00 ? 34 GLY A H    5  
ATOM   3534  H HA2  . GLY A 1 34 ? 3.357   13.658 0.558   1.00 1.00 ? 34 GLY A HA2  5  
ATOM   3535  H HA3  . GLY A 1 34 ? 2.357   15.105 0.270   1.00 1.00 ? 34 GLY A HA3  5  
ATOM   3536  N N    . SER A 1 35 ? 5.192   15.499 0.582   1.00 1.00 ? 35 SER A N    5  
ATOM   3537  C CA   . SER A 1 35 ? 6.442   16.184 0.881   1.00 1.00 ? 35 SER A CA   5  
ATOM   3538  C C    . SER A 1 35 ? 7.245   16.328 -0.410  1.00 1.00 ? 35 SER A C    5  
ATOM   3539  O O    . SER A 1 35 ? 7.057   15.583 -1.370  1.00 1.00 ? 35 SER A O    5  
ATOM   3540  C CB   . SER A 1 35 ? 7.265   15.396 1.916   1.00 1.00 ? 35 SER A CB   5  
ATOM   3541  O OG   . SER A 1 35 ? 6.739   15.577 3.219   1.00 1.00 ? 35 SER A OG   5  
ATOM   3542  H H    . SER A 1 35 ? 5.113   15.090 -0.350  1.00 1.00 ? 35 SER A H    5  
ATOM   3543  H HA   . SER A 1 35 ? 6.233   17.191 1.258   1.00 1.00 ? 35 SER A HA   5  
ATOM   3544  H HB2  . SER A 1 35 ? 7.267   14.336 1.653   1.00 1.00 ? 35 SER A HB2  5  
ATOM   3545  H HB3  . SER A 1 35 ? 8.302   15.734 1.902   1.00 1.00 ? 35 SER A HB3  5  
ATOM   3546  H HG   . SER A 1 35 ? 5.870   15.152 3.225   1.00 1.00 ? 35 SER A HG   5  
ATOM   3547  N N    . CYS A 1 36 ? 8.160   17.291 -0.406  1.00 1.00 ? 36 CYS A N    5  
ATOM   3548  C CA   . CYS A 1 36 ? 9.070   17.517 -1.508  1.00 1.00 ? 36 CYS A CA   5  
ATOM   3549  C C    . CYS A 1 36 ? 10.310  16.650 -1.331  1.00 1.00 ? 36 CYS A C    5  
ATOM   3550  O O    . CYS A 1 36 ? 10.962  16.731 -0.291  1.00 1.00 ? 36 CYS A O    5  
ATOM   3551  C CB   . CYS A 1 36 ? 9.473   18.982 -1.539  1.00 1.00 ? 36 CYS A CB   5  
ATOM   3552  S SG   . CYS A 1 36 ? 10.666  19.319 -2.831  1.00 1.00 ? 36 CYS A SG   5  
ATOM   3553  H H    . CYS A 1 36 ? 8.304   17.817 0.441   1.00 1.00 ? 36 CYS A H    5  
ATOM   3554  H HA   . CYS A 1 36 ? 8.578   17.290 -2.454  1.00 1.00 ? 36 CYS A HA   5  
ATOM   3555  H HB2  . CYS A 1 36 ? 8.590   19.583 -1.748  1.00 1.00 ? 36 CYS A HB2  5  
ATOM   3556  H HB3  . CYS A 1 36 ? 9.911   19.280 -0.588  1.00 1.00 ? 36 CYS A HB3  5  
ATOM   3557  N N    . ASN A 1 37 ? 10.631  15.839 -2.337  1.00 1.00 ? 37 ASN A N    5  
ATOM   3558  C CA   . ASN A 1 37 ? 11.858  15.059 -2.418  1.00 1.00 ? 37 ASN A CA   5  
ATOM   3559  C C    . ASN A 1 37 ? 12.822  15.748 -3.384  1.00 1.00 ? 37 ASN A C    5  
ATOM   3560  O O    . ASN A 1 37 ? 12.371  16.446 -4.292  1.00 1.00 ? 37 ASN A O    5  
ATOM   3561  C CB   . ASN A 1 37 ? 11.517  13.659 -2.936  1.00 1.00 ? 37 ASN A CB   5  
ATOM   3562  C CG   . ASN A 1 37 ? 12.772  12.913 -3.356  1.00 1.00 ? 37 ASN A CG   5  
ATOM   3563  O OD1  . ASN A 1 37 ? 13.025  12.746 -4.545  1.00 1.00 ? 37 ASN A OD1  5  
ATOM   3564  N ND2  . ASN A 1 37 ? 13.609  12.546 -2.390  1.00 1.00 ? 37 ASN A ND2  5  
ATOM   3565  H H    . ASN A 1 37 ? 10.052  15.867 -3.170  1.00 1.00 ? 37 ASN A H    5  
ATOM   3566  H HA   . ASN A 1 37 ? 12.328  14.973 -1.437  1.00 1.00 ? 37 ASN A HA   5  
ATOM   3567  H HB2  . ASN A 1 37 ? 10.980  13.097 -2.172  1.00 1.00 ? 37 ASN A HB2  5  
ATOM   3568  H HB3  . ASN A 1 37 ? 10.891  13.760 -3.820  1.00 1.00 ? 37 ASN A HB3  5  
ATOM   3569  H HD21 . ASN A 1 37 ? 13.366  12.688 -1.421  1.00 1.00 ? 37 ASN A HD21 5  
ATOM   3570  H HD22 . ASN A 1 37 ? 14.467  12.078 -2.638  1.00 1.00 ? 37 ASN A HD22 5  
ATOM   3571  N N    . TYR A 1 38 ? 14.133  15.527 -3.216  1.00 1.00 ? 38 TYR A N    5  
ATOM   3572  C CA   . TYR A 1 38 ? 15.150  16.044 -4.118  1.00 1.00 ? 38 TYR A CA   5  
ATOM   3573  C C    . TYR A 1 38 ? 16.065  14.972 -4.726  1.00 1.00 ? 38 TYR A C    5  
ATOM   3574  O O    . TYR A 1 38 ? 17.284  15.123 -4.740  1.00 1.00 ? 38 TYR A O    5  
ATOM   3575  C CB   . TYR A 1 38 ? 15.932  17.178 -3.440  1.00 1.00 ? 38 TYR A CB   5  
ATOM   3576  C CG   . TYR A 1 38 ? 16.808  17.970 -4.402  1.00 1.00 ? 38 TYR A CG   5  
ATOM   3577  C CD1  . TYR A 1 38 ? 16.235  18.499 -5.573  1.00 1.00 ? 38 TYR A CD1  5  
ATOM   3578  C CD2  . TYR A 1 38 ? 18.211  17.942 -4.277  1.00 1.00 ? 38 TYR A CD2  5  
ATOM   3579  C CE1  . TYR A 1 38 ? 17.044  18.909 -6.642  1.00 1.00 ? 38 TYR A CE1  5  
ATOM   3580  C CE2  . TYR A 1 38 ? 19.023  18.352 -5.351  1.00 1.00 ? 38 TYR A CE2  5  
ATOM   3581  C CZ   . TYR A 1 38 ? 18.436  18.773 -6.555  1.00 1.00 ? 38 TYR A CZ   5  
ATOM   3582  O OH   . TYR A 1 38 ? 19.213  19.027 -7.646  1.00 1.00 ? 38 TYR A OH   5  
ATOM   3583  H H    . TYR A 1 38 ? 14.443  14.972 -2.434  1.00 1.00 ? 38 TYR A H    5  
ATOM   3584  H HA   . TYR A 1 38 ? 14.640  16.455 -4.984  1.00 1.00 ? 38 TYR A HA   5  
ATOM   3585  H HB2  . TYR A 1 38 ? 15.208  17.849 -2.980  1.00 1.00 ? 38 TYR A HB2  5  
ATOM   3586  H HB3  . TYR A 1 38 ? 16.545  16.756 -2.642  1.00 1.00 ? 38 TYR A HB3  5  
ATOM   3587  H HD1  . TYR A 1 38 ? 15.167  18.545 -5.676  1.00 1.00 ? 38 TYR A HD1  5  
ATOM   3588  H HD2  . TYR A 1 38 ? 18.671  17.540 -3.387  1.00 1.00 ? 38 TYR A HD2  5  
ATOM   3589  H HE1  . TYR A 1 38 ? 16.587  19.307 -7.533  1.00 1.00 ? 38 TYR A HE1  5  
ATOM   3590  H HE2  . TYR A 1 38 ? 20.099  18.288 -5.271  1.00 1.00 ? 38 TYR A HE2  5  
ATOM   3591  H HH   . TYR A 1 38 ? 18.690  19.027 -8.460  1.00 1.00 ? 38 TYR A HH   5  
ATOM   3592  N N    . VAL A 1 39 ? 15.503  13.879 -5.248  1.00 1.00 ? 39 VAL A N    5  
ATOM   3593  C CA   . VAL A 1 39 ? 16.307  13.000 -6.093  1.00 1.00 ? 39 VAL A CA   5  
ATOM   3594  C C    . VAL A 1 39 ? 16.586  13.839 -7.348  1.00 1.00 ? 39 VAL A C    5  
ATOM   3595  O O    . VAL A 1 39 ? 15.745  14.655 -7.731  1.00 1.00 ? 39 VAL A O    5  
ATOM   3596  C CB   . VAL A 1 39 ? 15.552  11.695 -6.409  1.00 1.00 ? 39 VAL A CB   5  
ATOM   3597  C CG1  . VAL A 1 39 ? 16.177  10.917 -7.575  1.00 1.00 ? 39 VAL A CG1  5  
ATOM   3598  C CG2  . VAL A 1 39 ? 15.560  10.776 -5.183  1.00 1.00 ? 39 VAL A CG2  5  
ATOM   3599  H H    . VAL A 1 39 ? 14.504  13.723 -5.179  1.00 1.00 ? 39 VAL A H    5  
ATOM   3600  H HA   . VAL A 1 39 ? 17.251  12.757 -5.601  1.00 1.00 ? 39 VAL A HA   5  
ATOM   3601  H HB   . VAL A 1 39 ? 14.519  11.929 -6.675  1.00 1.00 ? 39 VAL A HB   5  
ATOM   3602  H HG11 . VAL A 1 39 ? 17.236  10.738 -7.385  1.00 1.00 ? 39 VAL A HG11 5  
ATOM   3603  H HG12 . VAL A 1 39 ? 15.672  9.958  -7.688  1.00 1.00 ? 39 VAL A HG12 5  
ATOM   3604  H HG13 . VAL A 1 39 ? 16.067  11.466 -8.510  1.00 1.00 ? 39 VAL A HG13 5  
ATOM   3605  H HG21 . VAL A 1 39 ? 15.181  11.303 -4.313  1.00 1.00 ? 39 VAL A HG21 5  
ATOM   3606  H HG22 . VAL A 1 39 ? 14.929  9.905  -5.368  1.00 1.00 ? 39 VAL A HG22 5  
ATOM   3607  H HG23 . VAL A 1 39 ? 16.576  10.442 -4.972  1.00 1.00 ? 39 VAL A HG23 5  
ATOM   3608  N N    . PHE A 1 40 ? 17.741  13.671 -7.989  1.00 1.00 ? 40 PHE A N    5  
ATOM   3609  C CA   . PHE A 1 40 ? 18.122  14.471 -9.151  1.00 1.00 ? 40 PHE A CA   5  
ATOM   3610  C C    . PHE A 1 40 ? 17.076  14.360 -10.284 1.00 1.00 ? 40 PHE A C    5  
ATOM   3611  O O    . PHE A 1 40 ? 16.259  13.435 -10.291 1.00 1.00 ? 40 PHE A O    5  
ATOM   3612  C CB   . PHE A 1 40 ? 19.517  14.022 -9.620  1.00 1.00 ? 40 PHE A CB   5  
ATOM   3613  C CG   . PHE A 1 40 ? 19.540  12.666 -10.300 1.00 1.00 ? 40 PHE A CG   5  
ATOM   3614  C CD1  . PHE A 1 40 ? 19.695  11.489 -9.542  1.00 1.00 ? 40 PHE A CD1  5  
ATOM   3615  C CD2  . PHE A 1 40 ? 19.358  12.578 -11.694 1.00 1.00 ? 40 PHE A CD2  5  
ATOM   3616  C CE1  . PHE A 1 40 ? 19.626  10.234 -10.169 1.00 1.00 ? 40 PHE A CE1  5  
ATOM   3617  C CE2  . PHE A 1 40 ? 19.291  11.323 -12.320 1.00 1.00 ? 40 PHE A CE2  5  
ATOM   3618  C CZ   . PHE A 1 40 ? 19.417  10.150 -11.556 1.00 1.00 ? 40 PHE A CZ   5  
ATOM   3619  H H    . PHE A 1 40 ? 18.387  12.975 -7.653  1.00 1.00 ? 40 PHE A H    5  
ATOM   3620  H HA   . PHE A 1 40 ? 18.184  15.506 -8.814  1.00 1.00 ? 40 PHE A HA   5  
ATOM   3621  H HB2  . PHE A 1 40 ? 19.924  14.749 -10.322 1.00 1.00 ? 40 PHE A HB2  5  
ATOM   3622  H HB3  . PHE A 1 40 ? 20.195  14.010 -8.766  1.00 1.00 ? 40 PHE A HB3  5  
ATOM   3623  H HD1  . PHE A 1 40 ? 19.880  11.537 -8.479  1.00 1.00 ? 40 PHE A HD1  5  
ATOM   3624  H HD2  . PHE A 1 40 ? 19.268  13.472 -12.295 1.00 1.00 ? 40 PHE A HD2  5  
ATOM   3625  H HE1  . PHE A 1 40 ? 19.741  9.330  -9.587  1.00 1.00 ? 40 PHE A HE1  5  
ATOM   3626  H HE2  . PHE A 1 40 ? 19.146  11.258 -13.389 1.00 1.00 ? 40 PHE A HE2  5  
ATOM   3627  H HZ   . PHE A 1 40 ? 19.366  9.184  -12.039 1.00 1.00 ? 40 PHE A HZ   5  
ATOM   3628  N N    . PRO A 1 41 ? 17.036  15.292 -11.248 1.00 1.00 ? 41 PRO A N    5  
ATOM   3629  C CA   . PRO A 1 41 ? 17.743  16.563 -11.272 1.00 1.00 ? 41 PRO A CA   5  
ATOM   3630  C C    . PRO A 1 41 ? 16.962  17.619 -10.479 1.00 1.00 ? 41 PRO A C    5  
ATOM   3631  O O    . PRO A 1 41 ? 17.563  18.400 -9.743  1.00 1.00 ? 41 PRO A O    5  
ATOM   3632  C CB   . PRO A 1 41 ? 17.841  16.919 -12.757 1.00 1.00 ? 41 PRO A CB   5  
ATOM   3633  C CG   . PRO A 1 41 ? 16.575  16.315 -13.367 1.00 1.00 ? 41 PRO A CG   5  
ATOM   3634  C CD   . PRO A 1 41 ? 16.318  15.080 -12.498 1.00 1.00 ? 41 PRO A CD   5  
ATOM   3635  H HA   . PRO A 1 41 ? 18.751  16.500 -10.868 1.00 1.00 ? 41 PRO A HA   5  
ATOM   3636  H HB2  . PRO A 1 41 ? 17.918  17.993 -12.930 1.00 1.00 ? 41 PRO A HB2  5  
ATOM   3637  H HB3  . PRO A 1 41 ? 18.710  16.410 -13.180 1.00 1.00 ? 41 PRO A HB3  5  
ATOM   3638  H HG2  . PRO A 1 41 ? 15.748  17.020 -13.280 1.00 1.00 ? 41 PRO A HG2  5  
ATOM   3639  H HG3  . PRO A 1 41 ? 16.718  16.052 -14.415 1.00 1.00 ? 41 PRO A HG3  5  
ATOM   3640  H HD2  . PRO A 1 41 ? 15.249  14.939 -12.333 1.00 1.00 ? 41 PRO A HD2  5  
ATOM   3641  H HD3  . PRO A 1 41 ? 16.726  14.197 -12.994 1.00 1.00 ? 41 PRO A HD3  5  
ATOM   3642  N N    . ALA A 1 42 ? 15.633  17.642 -10.637 1.00 1.00 ? 42 ALA A N    5  
ATOM   3643  C CA   . ALA A 1 42 ? 14.737  18.641 -10.069 1.00 1.00 ? 42 ALA A CA   5  
ATOM   3644  C C    . ALA A 1 42 ? 13.874  18.049 -8.951  1.00 1.00 ? 42 ALA A C    5  
ATOM   3645  O O    . ALA A 1 42 ? 13.662  16.832 -8.893  1.00 1.00 ? 42 ALA A O    5  
ATOM   3646  C CB   . ALA A 1 42 ? 13.852  19.207 -11.184 1.00 1.00 ? 42 ALA A CB   5  
ATOM   3647  H H    . ALA A 1 42 ? 15.216  16.943 -11.231 1.00 1.00 ? 42 ALA A H    5  
ATOM   3648  H HA   . ALA A 1 42 ? 15.319  19.469 -9.661  1.00 1.00 ? 42 ALA A HA   5  
ATOM   3649  H HB1  . ALA A 1 42 ? 14.478  19.632 -11.971 1.00 1.00 ? 42 ALA A HB1  5  
ATOM   3650  H HB2  . ALA A 1 42 ? 13.231  18.417 -11.608 1.00 1.00 ? 42 ALA A HB2  5  
ATOM   3651  H HB3  . ALA A 1 42 ? 13.208  19.991 -10.786 1.00 1.00 ? 42 ALA A HB3  5  
ATOM   3652  N N    . HIS A 1 43 ? 13.359  18.942 -8.096  1.00 1.00 ? 43 HIS A N    5  
ATOM   3653  C CA   . HIS A 1 43 ? 12.554  18.640 -6.919  1.00 1.00 ? 43 HIS A CA   5  
ATOM   3654  C C    . HIS A 1 43 ? 11.229  17.994 -7.311  1.00 1.00 ? 43 HIS A C    5  
ATOM   3655  O O    . HIS A 1 43 ? 10.605  18.437 -8.270  1.00 1.00 ? 43 HIS A O    5  
ATOM   3656  C CB   . HIS A 1 43 ? 12.262  19.945 -6.169  1.00 1.00 ? 43 HIS A CB   5  
ATOM   3657  C CG   . HIS A 1 43 ? 13.473  20.650 -5.614  1.00 1.00 ? 43 HIS A CG   5  
ATOM   3658  N ND1  . HIS A 1 43 ? 13.846  20.551 -4.280  1.00 1.00 ? 43 HIS A ND1  5  
ATOM   3659  C CD2  . HIS A 1 43 ? 14.402  21.483 -6.189  1.00 1.00 ? 43 HIS A CD2  5  
ATOM   3660  C CE1  . HIS A 1 43 ? 14.957  21.289 -4.122  1.00 1.00 ? 43 HIS A CE1  5  
ATOM   3661  N NE2  . HIS A 1 43 ? 15.348  21.882 -5.251  1.00 1.00 ? 43 HIS A NE2  5  
ATOM   3662  H H    . HIS A 1 43 ? 13.554  19.915 -8.273  1.00 1.00 ? 43 HIS A H    5  
ATOM   3663  H HA   . HIS A 1 43 ? 13.104  17.957 -6.274  1.00 1.00 ? 43 HIS A HA   5  
ATOM   3664  H HB2  . HIS A 1 43 ? 11.707  20.640 -6.803  1.00 1.00 ? 43 HIS A HB2  5  
ATOM   3665  H HB3  . HIS A 1 43 ? 11.618  19.695 -5.338  1.00 1.00 ? 43 HIS A HB3  5  
ATOM   3666  H HD1  . HIS A 1 43 ? 13.377  20.021 -3.559  1.00 1.00 ? 43 HIS A HD1  5  
ATOM   3667  H HD2  . HIS A 1 43 ? 14.406  21.780 -7.227  1.00 1.00 ? 43 HIS A HD2  5  
ATOM   3668  H HE1  . HIS A 1 43 ? 15.479  21.391 -3.181  1.00 1.00 ? 43 HIS A HE1  5  
ATOM   3669  N N    . LYS A 1 44 ? 10.775  16.985 -6.561  1.00 1.00 ? 44 LYS A N    5  
ATOM   3670  C CA   . LYS A 1 44 ? 9.604   16.178 -6.886  1.00 1.00 ? 44 LYS A CA   5  
ATOM   3671  C C    . LYS A 1 44 ? 8.594   16.253 -5.741  1.00 1.00 ? 44 LYS A C    5  
ATOM   3672  O O    . LYS A 1 44 ? 8.943   15.944 -4.603  1.00 1.00 ? 44 LYS A O    5  
ATOM   3673  C CB   . LYS A 1 44 ? 10.050  14.726 -7.110  1.00 1.00 ? 44 LYS A CB   5  
ATOM   3674  C CG   . LYS A 1 44 ? 11.112  14.652 -8.211  1.00 1.00 ? 44 LYS A CG   5  
ATOM   3675  C CD   . LYS A 1 44 ? 11.648  13.226 -8.363  1.00 1.00 ? 44 LYS A CD   5  
ATOM   3676  C CE   . LYS A 1 44 ? 12.667  13.137 -9.510  1.00 1.00 ? 44 LYS A CE   5  
ATOM   3677  N NZ   . LYS A 1 44 ? 13.772  14.110 -9.375  1.00 1.00 ? 44 LYS A NZ   5  
ATOM   3678  H H    . LYS A 1 44 ? 11.295  16.730 -5.728  1.00 1.00 ? 44 LYS A H    5  
ATOM   3679  H HA   . LYS A 1 44 ? 9.129   16.533 -7.802  1.00 1.00 ? 44 LYS A HA   5  
ATOM   3680  H HB2  . LYS A 1 44 ? 10.468  14.331 -6.184  1.00 1.00 ? 44 LYS A HB2  5  
ATOM   3681  H HB3  . LYS A 1 44 ? 9.185   14.124 -7.392  1.00 1.00 ? 44 LYS A HB3  5  
ATOM   3682  H HG2  . LYS A 1 44 ? 10.680  15.003 -9.151  1.00 1.00 ? 44 LYS A HG2  5  
ATOM   3683  H HG3  . LYS A 1 44 ? 11.940  15.298 -7.932  1.00 1.00 ? 44 LYS A HG3  5  
ATOM   3684  H HD2  . LYS A 1 44 ? 12.108  12.912 -7.422  1.00 1.00 ? 44 LYS A HD2  5  
ATOM   3685  H HD3  . LYS A 1 44 ? 10.816  12.548 -8.570  1.00 1.00 ? 44 LYS A HD3  5  
ATOM   3686  H HE2  . LYS A 1 44 ? 13.087  12.129 -9.522  1.00 1.00 ? 44 LYS A HE2  5  
ATOM   3687  H HE3  . LYS A 1 44 ? 12.160  13.307 -10.461 1.00 1.00 ? 44 LYS A HE3  5  
ATOM   3688  H HZ1  . LYS A 1 44 ? 14.218  14.048 -8.467  1.00 1.00 ? 44 LYS A HZ1  5  
ATOM   3689  H HZ2  . LYS A 1 44 ? 14.509  13.910 -10.043 1.00 1.00 ? 44 LYS A HZ2  5  
ATOM   3690  H HZ3  . LYS A 1 44 ? 13.481  15.079 -9.467  1.00 1.00 ? 44 LYS A HZ3  5  
ATOM   3691  N N    . CYS A 1 45 ? 7.354   16.663 -6.025  1.00 1.00 ? 45 CYS A N    5  
ATOM   3692  C CA   . CYS A 1 45 ? 6.290   16.664 -5.026  1.00 1.00 ? 45 CYS A CA   5  
ATOM   3693  C C    . CYS A 1 45 ? 5.767   15.242 -4.833  1.00 1.00 ? 45 CYS A C    5  
ATOM   3694  O O    . CYS A 1 45 ? 4.878   14.811 -5.568  1.00 1.00 ? 45 CYS A O    5  
ATOM   3695  C CB   . CYS A 1 45 ? 5.154   17.604 -5.445  1.00 1.00 ? 45 CYS A CB   5  
ATOM   3696  S SG   . CYS A 1 45 ? 3.724   17.551 -4.341  1.00 1.00 ? 45 CYS A SG   5  
ATOM   3697  H H    . CYS A 1 45 ? 7.115   16.910 -6.977  1.00 1.00 ? 45 CYS A H    5  
ATOM   3698  H HA   . CYS A 1 45 ? 6.695   17.024 -4.080  1.00 1.00 ? 45 CYS A HA   5  
ATOM   3699  H HB2  . CYS A 1 45 ? 5.511   18.629 -5.443  1.00 1.00 ? 45 CYS A HB2  5  
ATOM   3700  H HB3  . CYS A 1 45 ? 4.811   17.353 -6.448  1.00 1.00 ? 45 CYS A HB3  5  
ATOM   3701  N N    . ILE A 1 46 ? 6.325   14.500 -3.875  1.00 1.00 ? 46 ILE A N    5  
ATOM   3702  C CA   . ILE A 1 46 ? 5.885   13.142 -3.585  1.00 1.00 ? 46 ILE A CA   5  
ATOM   3703  C C    . ILE A 1 46 ? 4.660   13.222 -2.684  1.00 1.00 ? 46 ILE A C    5  
ATOM   3704  O O    . ILE A 1 46 ? 4.586   14.072 -1.795  1.00 1.00 ? 46 ILE A O    5  
ATOM   3705  C CB   . ILE A 1 46 ? 7.004   12.313 -2.928  1.00 1.00 ? 46 ILE A CB   5  
ATOM   3706  C CG1  . ILE A 1 46 ? 8.297   12.320 -3.761  1.00 1.00 ? 46 ILE A CG1  5  
ATOM   3707  C CG2  . ILE A 1 46 ? 6.539   10.869 -2.658  1.00 1.00 ? 46 ILE A CG2  5  
ATOM   3708  C CD1  . ILE A 1 46 ? 8.141   11.808 -5.198  1.00 1.00 ? 46 ILE A CD1  5  
ATOM   3709  H H    . ILE A 1 46 ? 6.954   14.942 -3.209  1.00 1.00 ? 46 ILE A H    5  
ATOM   3710  H HA   . ILE A 1 46 ? 5.598   12.645 -4.509  1.00 1.00 ? 46 ILE A HA   5  
ATOM   3711  H HB   . ILE A 1 46 ? 7.242   12.763 -1.962  1.00 1.00 ? 46 ILE A HB   5  
ATOM   3712  H HG12 . ILE A 1 46 ? 8.678   13.339 -3.806  1.00 1.00 ? 46 ILE A HG12 5  
ATOM   3713  H HG13 . ILE A 1 46 ? 9.042   11.705 -3.256  1.00 1.00 ? 46 ILE A HG13 5  
ATOM   3714  H HG21 . ILE A 1 46 ? 6.164   10.400 -3.568  1.00 1.00 ? 46 ILE A HG21 5  
ATOM   3715  H HG22 . ILE A 1 46 ? 7.364   10.276 -2.266  1.00 1.00 ? 46 ILE A HG22 5  
ATOM   3716  H HG23 . ILE A 1 46 ? 5.739   10.856 -1.918  1.00 1.00 ? 46 ILE A HG23 5  
ATOM   3717  H HD11 . ILE A 1 46 ? 7.746   10.793 -5.205  1.00 1.00 ? 46 ILE A HD11 5  
ATOM   3718  H HD12 . ILE A 1 46 ? 7.482   12.461 -5.770  1.00 1.00 ? 46 ILE A HD12 5  
ATOM   3719  H HD13 . ILE A 1 46 ? 9.120   11.804 -5.678  1.00 1.00 ? 46 ILE A HD13 5  
ATOM   3720  N N    . CYS A 1 47 ? 3.702   12.324 -2.905  1.00 1.00 ? 47 CYS A N    5  
ATOM   3721  C CA   . CYS A 1 47 ? 2.533   12.207 -2.067  1.00 1.00 ? 47 CYS A CA   5  
ATOM   3722  C C    . CYS A 1 47 ? 2.225   10.738 -1.822  1.00 1.00 ? 47 CYS A C    5  
ATOM   3723  O O    . CYS A 1 47 ? 2.568   9.898  -2.650  1.00 1.00 ? 47 CYS A O    5  
ATOM   3724  C CB   . CYS A 1 47 ? 1.394   12.988 -2.690  1.00 1.00 ? 47 CYS A CB   5  
ATOM   3725  S SG   . CYS A 1 47 ? 0.143   13.373 -1.472  1.00 1.00 ? 47 CYS A SG   5  
ATOM   3726  H H    . CYS A 1 47 ? 3.769   11.654 -3.668  1.00 1.00 ? 47 CYS A H    5  
ATOM   3727  H HA   . CYS A 1 47 ? 2.740   12.641 -1.100  1.00 1.00 ? 47 CYS A HA   5  
ATOM   3728  H HB2  . CYS A 1 47 ? 1.768   13.937 -3.071  1.00 1.00 ? 47 CYS A HB2  5  
ATOM   3729  H HB3  . CYS A 1 47 ? 0.962   12.419 -3.510  1.00 1.00 ? 47 CYS A HB3  5  
ATOM   3730  N N    . TYR A 1 48 ? 1.653   10.410 -0.662  1.00 1.00 ? 48 TYR A N    5  
ATOM   3731  C CA   . TYR A 1 48 ? 1.533   9.032  -0.213  1.00 1.00 ? 48 TYR A CA   5  
ATOM   3732  C C    . TYR A 1 48 ? 0.063   8.666  -0.017  1.00 1.00 ? 48 TYR A C    5  
ATOM   3733  O O    . TYR A 1 48 ? -0.619  9.245  0.834   1.00 1.00 ? 48 TYR A O    5  
ATOM   3734  C CB   . TYR A 1 48 ? 2.371   8.874  1.060   1.00 1.00 ? 48 TYR A CB   5  
ATOM   3735  C CG   . TYR A 1 48 ? 3.837   9.235  0.894   1.00 1.00 ? 48 TYR A CG   5  
ATOM   3736  C CD1  . TYR A 1 48 ? 4.251   10.578 0.988   1.00 1.00 ? 48 TYR A CD1  5  
ATOM   3737  C CD2  . TYR A 1 48 ? 4.794   8.229  0.661   1.00 1.00 ? 48 TYR A CD2  5  
ATOM   3738  C CE1  . TYR A 1 48 ? 5.609   10.912 0.867   1.00 1.00 ? 48 TYR A CE1  5  
ATOM   3739  C CE2  . TYR A 1 48 ? 6.155   8.563  0.548   1.00 1.00 ? 48 TYR A CE2  5  
ATOM   3740  C CZ   . TYR A 1 48 ? 6.562   9.904  0.659   1.00 1.00 ? 48 TYR A CZ   5  
ATOM   3741  O OH   . TYR A 1 48 ? 7.880   10.236 0.557   1.00 1.00 ? 48 TYR A OH   5  
ATOM   3742  H H    . TYR A 1 48 ? 1.389   11.139 -0.005  1.00 1.00 ? 48 TYR A H    5  
ATOM   3743  H HA   . TYR A 1 48 ? 1.956   8.343  -0.943  1.00 1.00 ? 48 TYR A HA   5  
ATOM   3744  H HB2  . TYR A 1 48 ? 1.944   9.493  1.852   1.00 1.00 ? 48 TYR A HB2  5  
ATOM   3745  H HB3  . TYR A 1 48 ? 2.320   7.835  1.368   1.00 1.00 ? 48 TYR A HB3  5  
ATOM   3746  H HD1  . TYR A 1 48 ? 3.529   11.354 1.175   1.00 1.00 ? 48 TYR A HD1  5  
ATOM   3747  H HD2  . TYR A 1 48 ? 4.488   7.196  0.583   1.00 1.00 ? 48 TYR A HD2  5  
ATOM   3748  H HE1  . TYR A 1 48 ? 5.921   11.943 0.937   1.00 1.00 ? 48 TYR A HE1  5  
ATOM   3749  H HE2  . TYR A 1 48 ? 6.884   7.782  0.387   1.00 1.00 ? 48 TYR A HE2  5  
ATOM   3750  H HH   . TYR A 1 48 ? 8.454   9.475  0.461   1.00 1.00 ? 48 TYR A HH   5  
ATOM   3751  N N    . PHE A 1 49 ? -0.442  7.734  -0.835  1.00 1.00 ? 49 PHE A N    5  
ATOM   3752  C CA   . PHE A 1 49 ? -1.841  7.335  -0.829  1.00 1.00 ? 49 PHE A CA   5  
ATOM   3753  C C    . PHE A 1 49 ? -1.961  6.024  -0.047  1.00 1.00 ? 49 PHE A C    5  
ATOM   3754  O O    . PHE A 1 49 ? -1.032  5.220  -0.088  1.00 1.00 ? 49 PHE A O    5  
ATOM   3755  C CB   . PHE A 1 49 ? -2.341  7.098  -2.263  1.00 1.00 ? 49 PHE A CB   5  
ATOM   3756  C CG   . PHE A 1 49 ? -2.027  8.116  -3.351  1.00 1.00 ? 49 PHE A CG   5  
ATOM   3757  C CD1  . PHE A 1 49 ? -1.619  9.433  -3.060  1.00 1.00 ? 49 PHE A CD1  5  
ATOM   3758  C CD2  . PHE A 1 49 ? -2.262  7.751  -4.689  1.00 1.00 ? 49 PHE A CD2  5  
ATOM   3759  C CE1  . PHE A 1 49 ? -1.356  10.341 -4.101  1.00 1.00 ? 49 PHE A CE1  5  
ATOM   3760  C CE2  . PHE A 1 49 ? -2.042  8.672  -5.726  1.00 1.00 ? 49 PHE A CE2  5  
ATOM   3761  C CZ   . PHE A 1 49 ? -1.538  9.951  -5.438  1.00 1.00 ? 49 PHE A CZ   5  
ATOM   3762  H H    . PHE A 1 49 ? 0.163   7.252  -1.495  1.00 1.00 ? 49 PHE A H    5  
ATOM   3763  H HA   . PHE A 1 49 ? -2.445  8.118  -0.373  1.00 1.00 ? 49 PHE A HA   5  
ATOM   3764  H HB2  . PHE A 1 49 ? -1.959  6.129  -2.579  1.00 1.00 ? 49 PHE A HB2  5  
ATOM   3765  H HB3  . PHE A 1 49 ? -3.421  6.996  -2.239  1.00 1.00 ? 49 PHE A HB3  5  
ATOM   3766  H HD1  . PHE A 1 49 ? -1.494  9.760  -2.042  1.00 1.00 ? 49 PHE A HD1  5  
ATOM   3767  H HD2  . PHE A 1 49 ? -2.628  6.763  -4.927  1.00 1.00 ? 49 PHE A HD2  5  
ATOM   3768  H HE1  . PHE A 1 49 ? -1.023  11.340 -3.870  1.00 1.00 ? 49 PHE A HE1  5  
ATOM   3769  H HE2  . PHE A 1 49 ? -2.273  8.390  -6.742  1.00 1.00 ? 49 PHE A HE2  5  
ATOM   3770  H HZ   . PHE A 1 49 ? -1.278  10.623 -6.244  1.00 1.00 ? 49 PHE A HZ   5  
ATOM   3771  N N    . PRO A 1 50 ? -3.087  5.758  0.626   1.00 1.00 ? 50 PRO A N    5  
ATOM   3772  C CA   . PRO A 1 50 ? -3.347  4.451  1.203   1.00 1.00 ? 50 PRO A CA   5  
ATOM   3773  C C    . PRO A 1 50 ? -3.483  3.447  0.052   1.00 1.00 ? 50 PRO A C    5  
ATOM   3774  O O    . PRO A 1 50 ? -4.087  3.773  -0.970  1.00 1.00 ? 50 PRO A O    5  
ATOM   3775  C CB   . PRO A 1 50 ? -4.655  4.616  1.980   1.00 1.00 ? 50 PRO A CB   5  
ATOM   3776  C CG   . PRO A 1 50 ? -5.399  5.691  1.183   1.00 1.00 ? 50 PRO A CG   5  
ATOM   3777  C CD   . PRO A 1 50 ? -4.275  6.586  0.654   1.00 1.00 ? 50 PRO A CD   5  
ATOM   3778  H HA   . PRO A 1 50 ? -2.541  4.153  1.876   1.00 1.00 ? 50 PRO A HA   5  
ATOM   3779  H HB2  . PRO A 1 50 ? -5.220  3.685  2.050   1.00 1.00 ? 50 PRO A HB2  5  
ATOM   3780  H HB3  . PRO A 1 50 ? -4.433  4.995  2.978   1.00 1.00 ? 50 PRO A HB3  5  
ATOM   3781  H HG2  . PRO A 1 50 ? -5.911  5.220  0.341   1.00 1.00 ? 50 PRO A HG2  5  
ATOM   3782  H HG3  . PRO A 1 50 ? -6.121  6.235  1.793   1.00 1.00 ? 50 PRO A HG3  5  
ATOM   3783  H HD2  . PRO A 1 50 ? -4.516  6.943  -0.347  1.00 1.00 ? 50 PRO A HD2  5  
ATOM   3784  H HD3  . PRO A 1 50 ? -4.106  7.424  1.325   1.00 1.00 ? 50 PRO A HD3  5  
ATOM   3785  N N    . CYS A 1 51 ? -2.901  2.253  0.184   1.00 1.00 ? 51 CYS A N    5  
ATOM   3786  C CA   . CYS A 1 51 ? -2.918  1.245  -0.869  1.00 1.00 ? 51 CYS A CA   5  
ATOM   3787  C C    . CYS A 1 51 ? -2.512  -0.108 -0.288  1.00 1.00 ? 51 CYS A C    5  
ATOM   3788  O O    . CYS A 1 51 ? -2.259  -0.192 0.914   1.00 1.00 ? 51 CYS A O    5  
ATOM   3789  C CB   . CYS A 1 51 ? -1.970  1.649  -2.003  1.00 1.00 ? 51 CYS A CB   5  
ATOM   3790  S SG   . CYS A 1 51 ? -0.245  1.178  -1.757  1.00 1.00 ? 51 CYS A SG   5  
ATOM   3791  O OXT  . CYS A 1 51 ? -2.453  -1.147 -1.166  1.00 0.00 ? 51 CYS A OXT  5  
ATOM   3792  H H    . CYS A 1 51 ? -2.408  1.998  1.030   1.00 1.00 ? 51 CYS A H    5  
ATOM   3793  H HA   . CYS A 1 51 ? -3.931  1.163  -1.264  1.00 1.00 ? 51 CYS A HA   5  
ATOM   3794  H HB2  . CYS A 1 51 ? -2.280  1.184  -2.935  1.00 1.00 ? 51 CYS A HB2  5  
ATOM   3795  H HB3  . CYS A 1 51 ? -2.016  2.725  -2.160  1.00 1.00 ? 51 CYS A HB3  5  
HETATM 3796  N N    . PCA A 1 1  ? -0.744  -2.505 0.575   1.00 1.00 ? 1  PCA A N    6  
HETATM 3797  C CA   . PCA A 1 1  ? -0.797  -2.026 1.944   1.00 1.00 ? 1  PCA A CA   6  
HETATM 3798  C CB   . PCA A 1 1  ? -0.423  -3.245 2.808   1.00 1.00 ? 1  PCA A CB   6  
HETATM 3799  C CG   . PCA A 1 1  ? 0.208   -4.234 1.817   1.00 1.00 ? 1  PCA A CG   6  
HETATM 3800  C CD   . PCA A 1 1  ? -0.189  -3.702 0.456   1.00 1.00 ? 1  PCA A CD   6  
HETATM 3801  O OE   . PCA A 1 1  ? 0.025   -4.287 -0.599  1.00 1.00 ? 1  PCA A OE   6  
HETATM 3802  C C    . PCA A 1 1  ? 0.171   -0.857 2.141   1.00 1.00 ? 1  PCA A C    6  
HETATM 3803  O O    . PCA A 1 1  ? -0.164  0.125  2.799   1.00 1.00 ? 1  PCA A O    6  
HETATM 3804  H H    . PCA A 1 1  ? -1.050  -1.947 -0.213  1.00 0.00 ? 1  PCA A H    6  
HETATM 3805  H HA   . PCA A 1 1  ? -1.808  -1.698 2.188   1.00 1.00 ? 1  PCA A HA   6  
HETATM 3806  H HB2  . PCA A 1 1  ? 0.256   -2.990 3.624   1.00 1.00 ? 1  PCA A HB2  6  
HETATM 3807  H HB3  . PCA A 1 1  ? -1.336  -3.683 3.214   1.00 1.00 ? 1  PCA A HB3  6  
HETATM 3808  H HG2  . PCA A 1 1  ? 1.294   -4.222 1.903   1.00 1.00 ? 1  PCA A HG2  6  
HETATM 3809  H HG3  . PCA A 1 1  ? -0.173  -5.244 1.968   1.00 1.00 ? 1  PCA A HG3  6  
ATOM   3810  N N    . LYS A 1 2  ? 1.365   -0.960 1.548   1.00 1.00 ? 2  LYS A N    6  
ATOM   3811  C CA   . LYS A 1 2  ? 2.399   0.062  1.633   1.00 1.00 ? 2  LYS A CA   6  
ATOM   3812  C C    . LYS A 1 2  ? 1.890   1.426  1.163   1.00 1.00 ? 2  LYS A C    6  
ATOM   3813  O O    . LYS A 1 2  ? 0.905   1.516  0.426   1.00 1.00 ? 2  LYS A O    6  
ATOM   3814  C CB   . LYS A 1 2  ? 3.639   -0.362 0.825   1.00 1.00 ? 2  LYS A CB   6  
ATOM   3815  C CG   . LYS A 1 2  ? 3.360   -0.554 -0.678  1.00 1.00 ? 2  LYS A CG   6  
ATOM   3816  C CD   . LYS A 1 2  ? 4.636   -0.888 -1.474  1.00 1.00 ? 2  LYS A CD   6  
ATOM   3817  C CE   . LYS A 1 2  ? 5.627   0.281  -1.637  1.00 1.00 ? 2  LYS A CE   6  
ATOM   3818  N NZ   . LYS A 1 2  ? 5.063   1.403  -2.415  1.00 1.00 ? 2  LYS A NZ   6  
ATOM   3819  H H    . LYS A 1 2  ? 1.555   -1.799 1.023   1.00 1.00 ? 2  LYS A H    6  
ATOM   3820  H HA   . LYS A 1 2  ? 2.689   0.150  2.682   1.00 1.00 ? 2  LYS A HA   6  
ATOM   3821  H HB2  . LYS A 1 2  ? 4.401   0.405  0.961   1.00 1.00 ? 2  LYS A HB2  6  
ATOM   3822  H HB3  . LYS A 1 2  ? 4.023   -1.296 1.238   1.00 1.00 ? 2  LYS A HB3  6  
ATOM   3823  H HG2  . LYS A 1 2  ? 2.672   -1.393 -0.794  1.00 1.00 ? 2  LYS A HG2  6  
ATOM   3824  H HG3  . LYS A 1 2  ? 2.872   0.326  -1.096  1.00 1.00 ? 2  LYS A HG3  6  
ATOM   3825  H HD2  . LYS A 1 2  ? 5.148   -1.711 -0.970  1.00 1.00 ? 2  LYS A HD2  6  
ATOM   3826  H HD3  . LYS A 1 2  ? 4.342   -1.248 -2.463  1.00 1.00 ? 2  LYS A HD3  6  
ATOM   3827  H HE2  . LYS A 1 2  ? 5.941   0.644  -0.658  1.00 1.00 ? 2  LYS A HE2  6  
ATOM   3828  H HE3  . LYS A 1 2  ? 6.514   -0.089 -2.156  1.00 1.00 ? 2  LYS A HE3  6  
ATOM   3829  H HZ1  . LYS A 1 2  ? 4.240   1.762  -1.946  1.00 1.00 ? 2  LYS A HZ1  6  
ATOM   3830  H HZ2  . LYS A 1 2  ? 5.701   2.192  -2.461  1.00 1.00 ? 2  LYS A HZ2  6  
ATOM   3831  H HZ3  . LYS A 1 2  ? 4.816   1.123  -3.352  1.00 1.00 ? 2  LYS A HZ3  6  
ATOM   3832  N N    . LEU A 1 3  ? 2.600   2.492  1.536   1.00 1.00 ? 3  LEU A N    6  
ATOM   3833  C CA   . LEU A 1 3  ? 2.340   3.803  0.968   1.00 1.00 ? 3  LEU A CA   6  
ATOM   3834  C C    . LEU A 1 3  ? 2.668   3.774  -0.523  1.00 1.00 ? 3  LEU A C    6  
ATOM   3835  O O    . LEU A 1 3  ? 3.564   3.043  -0.945  1.00 1.00 ? 3  LEU A O    6  
ATOM   3836  C CB   . LEU A 1 3  ? 3.207   4.880  1.627   1.00 1.00 ? 3  LEU A CB   6  
ATOM   3837  C CG   . LEU A 1 3  ? 3.060   5.003  3.151   1.00 1.00 ? 3  LEU A CG   6  
ATOM   3838  C CD1  . LEU A 1 3  ? 4.187   5.897  3.681   1.00 1.00 ? 3  LEU A CD1  6  
ATOM   3839  C CD2  . LEU A 1 3  ? 1.704   5.603  3.531   1.00 1.00 ? 3  LEU A CD2  6  
ATOM   3840  H H    . LEU A 1 3  ? 3.409   2.371  2.126   1.00 1.00 ? 3  LEU A H    6  
ATOM   3841  H HA   . LEU A 1 3  ? 1.298   4.046  1.119   1.00 1.00 ? 3  LEU A HA   6  
ATOM   3842  H HB2  . LEU A 1 3  ? 4.236   4.640  1.380   1.00 1.00 ? 3  LEU A HB2  6  
ATOM   3843  H HB3  . LEU A 1 3  ? 2.975   5.846  1.174   1.00 1.00 ? 3  LEU A HB3  6  
ATOM   3844  H HG   . LEU A 1 3  ? 3.155   4.024  3.623   1.00 1.00 ? 3  LEU A HG   6  
ATOM   3845  H HD11 . LEU A 1 3  ? 4.138   6.879  3.213   1.00 1.00 ? 3  LEU A HD11 6  
ATOM   3846  H HD12 . LEU A 1 3  ? 4.099   6.010  4.762   1.00 1.00 ? 3  LEU A HD12 6  
ATOM   3847  H HD13 . LEU A 1 3  ? 5.155   5.448  3.456   1.00 1.00 ? 3  LEU A HD13 6  
ATOM   3848  H HD21 . LEU A 1 3  ? 1.567   6.568  3.042   1.00 1.00 ? 3  LEU A HD21 6  
ATOM   3849  H HD22 . LEU A 1 3  ? 0.907   4.925  3.232   1.00 1.00 ? 3  LEU A HD22 6  
ATOM   3850  H HD23 . LEU A 1 3  ? 1.651   5.736  4.611   1.00 1.00 ? 3  LEU A HD23 6  
ATOM   3851  N N    . CYS A 1 4  ? 1.970   4.581  -1.314  1.00 1.00 ? 4  CYS A N    6  
ATOM   3852  C CA   . CYS A 1 4  ? 2.313   4.852  -2.701  1.00 1.00 ? 4  CYS A CA   6  
ATOM   3853  C C    . CYS A 1 4  ? 3.000   6.204  -2.679  1.00 1.00 ? 4  CYS A C    6  
ATOM   3854  O O    . CYS A 1 4  ? 2.356   7.212  -2.392  1.00 1.00 ? 4  CYS A O    6  
ATOM   3855  C CB   . CYS A 1 4  ? 1.083   4.882  -3.617  1.00 1.00 ? 4  CYS A CB   6  
ATOM   3856  S SG   . CYS A 1 4  ? 0.741   3.312  -4.436  1.00 1.00 ? 4  CYS A SG   6  
ATOM   3857  H H    . CYS A 1 4  ? 1.245   5.142  -0.885  1.00 1.00 ? 4  CYS A H    6  
ATOM   3858  H HA   . CYS A 1 4  ? 3.005   4.106  -3.097  1.00 1.00 ? 4  CYS A HA   6  
ATOM   3859  H HB2  . CYS A 1 4  ? 0.192   5.184  -3.066  1.00 1.00 ? 4  CYS A HB2  6  
ATOM   3860  H HB3  . CYS A 1 4  ? 1.253   5.603  -4.416  1.00 1.00 ? 4  CYS A HB3  6  
ATOM   3861  N N    . GLU A 1 5  ? 4.309   6.221  -2.943  1.00 1.00 ? 5  GLU A N    6  
ATOM   3862  C CA   . GLU A 1 5  ? 5.083   7.448  -3.033  1.00 1.00 ? 5  GLU A CA   6  
ATOM   3863  C C    . GLU A 1 5  ? 4.738   8.125  -4.364  1.00 1.00 ? 5  GLU A C    6  
ATOM   3864  O O    . GLU A 1 5  ? 5.536   8.134  -5.297  1.00 1.00 ? 5  GLU A O    6  
ATOM   3865  C CB   . GLU A 1 5  ? 6.581   7.128  -2.903  1.00 1.00 ? 5  GLU A CB   6  
ATOM   3866  C CG   . GLU A 1 5  ? 6.874   6.114  -1.786  1.00 1.00 ? 5  GLU A CG   6  
ATOM   3867  C CD   . GLU A 1 5  ? 7.080   4.706  -2.342  1.00 1.00 ? 5  GLU A CD   6  
ATOM   3868  O OE1  . GLU A 1 5  ? 6.106   3.983  -2.577  1.00 1.00 ? 5  GLU A OE1  6  
ATOM   3869  O OE2  . GLU A 1 5  ? 8.372   4.346  -2.567  1.00 1.00 ? 5  GLU A OE2  6  
ATOM   3870  H H    . GLU A 1 5  ? 4.788   5.342  -3.097  1.00 1.00 ? 5  GLU A H    6  
ATOM   3871  H HA   . GLU A 1 5  ? 4.798   8.106  -2.205  1.00 1.00 ? 5  GLU A HA   6  
ATOM   3872  H HB2  . GLU A 1 5  ? 6.977   6.740  -3.843  1.00 1.00 ? 5  GLU A HB2  6  
ATOM   3873  H HB3  . GLU A 1 5  ? 7.100   8.061  -2.683  1.00 1.00 ? 5  GLU A HB3  6  
ATOM   3874  H HG2  . GLU A 1 5  ? 7.798   6.410  -1.294  1.00 1.00 ? 5  GLU A HG2  6  
ATOM   3875  H HG3  . GLU A 1 5  ? 6.077   6.121  -1.040  1.00 1.00 ? 5  GLU A HG3  6  
ATOM   3876  H HE2  . GLU A 1 5  ? 8.451   3.497  -3.003  1.00 1.00 ? 5  GLU A HE2  6  
ATOM   3877  N N    . ARG A 1 6  ? 3.512   8.633  -4.456  1.00 1.00 ? 6  ARG A N    6  
ATOM   3878  C CA   . ARG A 1 6  ? 2.873   9.130  -5.665  1.00 1.00 ? 6  ARG A CA   6  
ATOM   3879  C C    . ARG A 1 6  ? 3.672   10.285 -6.273  1.00 1.00 ? 6  ARG A C    6  
ATOM   3880  O O    . ARG A 1 6  ? 3.643   11.377 -5.701  1.00 1.00 ? 6  ARG A O    6  
ATOM   3881  C CB   . ARG A 1 6  ? 1.456   9.601  -5.305  1.00 1.00 ? 6  ARG A CB   6  
ATOM   3882  C CG   . ARG A 1 6  ? 0.676   10.158 -6.510  1.00 1.00 ? 6  ARG A CG   6  
ATOM   3883  C CD   . ARG A 1 6  ? 0.122   11.581 -6.302  1.00 1.00 ? 6  ARG A CD   6  
ATOM   3884  N NE   . ARG A 1 6  ? 1.178   12.610 -6.286  1.00 1.00 ? 6  ARG A NE   6  
ATOM   3885  C CZ   . ARG A 1 6  ? 0.983   13.932 -6.430  1.00 1.00 ? 6  ARG A CZ   6  
ATOM   3886  N NH1  . ARG A 1 6  ? -0.260  14.428 -6.373  1.00 1.00 ? 6  ARG A NH1  6  
ATOM   3887  N NH2  . ARG A 1 6  ? 2.030   14.736 -6.631  1.00 1.00 ? 6  ARG A NH2  6  
ATOM   3888  H H    . ARG A 1 6  ? 2.995   8.670  -3.577  1.00 1.00 ? 6  ARG A H    6  
ATOM   3889  H HA   . ARG A 1 6  ? 2.774   8.299  -6.363  1.00 1.00 ? 6  ARG A HA   6  
ATOM   3890  H HB2  . ARG A 1 6  ? 0.906   8.756  -4.887  1.00 1.00 ? 6  ARG A HB2  6  
ATOM   3891  H HB3  . ARG A 1 6  ? 1.534   10.360 -4.532  1.00 1.00 ? 6  ARG A HB3  6  
ATOM   3892  H HG2  . ARG A 1 6  ? 1.299   10.142 -7.403  1.00 1.00 ? 6  ARG A HG2  6  
ATOM   3893  H HG3  . ARG A 1 6  ? -0.164  9.490  -6.705  1.00 1.00 ? 6  ARG A HG3  6  
ATOM   3894  H HD2  . ARG A 1 6  ? -0.545  11.780 -7.142  1.00 1.00 ? 6  ARG A HD2  6  
ATOM   3895  H HD3  . ARG A 1 6  ? -0.463  11.629 -5.386  1.00 1.00 ? 6  ARG A HD3  6  
ATOM   3896  H HE   . ARG A 1 6  ? 2.141   12.283 -6.275  1.00 1.00 ? 6  ARG A HE   6  
ATOM   3897  H HH11 . ARG A 1 6  ? -1.033  13.828 -6.095  1.00 1.00 ? 6  ARG A HH11 6  
ATOM   3898  H HH12 . ARG A 1 6  ? -0.481  15.418 -6.481  1.00 1.00 ? 6  ARG A HH12 6  
ATOM   3899  H HH21 . ARG A 1 6  ? 2.971   14.336 -6.703  1.00 1.00 ? 6  ARG A HH21 6  
ATOM   3900  H HH22 . ARG A 1 6  ? 1.960   15.687 -6.979  1.00 1.00 ? 6  ARG A HH22 6  
ATOM   3901  N N    . PRO A 1 7  ? 4.301   10.111 -7.448  1.00 1.00 ? 7  PRO A N    6  
ATOM   3902  C CA   . PRO A 1 7  ? 4.889   11.221 -8.165  1.00 1.00 ? 7  PRO A CA   6  
ATOM   3903  C C    . PRO A 1 7  ? 3.762   12.057 -8.775  1.00 1.00 ? 7  PRO A C    6  
ATOM   3904  O O    . PRO A 1 7  ? 3.410   13.101 -8.231  1.00 1.00 ? 7  PRO A O    6  
ATOM   3905  C CB   . PRO A 1 7  ? 5.830   10.593 -9.196  1.00 1.00 ? 7  PRO A CB   6  
ATOM   3906  C CG   . PRO A 1 7  ? 5.269   9.188  -9.446  1.00 1.00 ? 7  PRO A CG   6  
ATOM   3907  C CD   . PRO A 1 7  ? 4.400   8.879  -8.221  1.00 1.00 ? 7  PRO A CD   6  
ATOM   3908  H HA   . PRO A 1 7  ? 5.464   11.856 -7.492  1.00 1.00 ? 7  PRO A HA   6  
ATOM   3909  H HB2  . PRO A 1 7  ? 5.911   11.181 -10.113 1.00 1.00 ? 7  PRO A HB2  6  
ATOM   3910  H HB3  . PRO A 1 7  ? 6.817   10.492 -8.743  1.00 1.00 ? 7  PRO A HB3  6  
ATOM   3911  H HG2  . PRO A 1 7  ? 4.664   9.166  -10.352 1.00 1.00 ? 7  PRO A HG2  6  
ATOM   3912  H HG3  . PRO A 1 7  ? 6.077   8.463  -9.545  1.00 1.00 ? 7  PRO A HG3  6  
ATOM   3913  H HD2  . PRO A 1 7  ? 3.413   8.552  -8.552  1.00 1.00 ? 7  PRO A HD2  6  
ATOM   3914  H HD3  . PRO A 1 7  ? 4.872   8.089  -7.640  1.00 1.00 ? 7  PRO A HD3  6  
ATOM   3915  N N    . SER A 1 8  ? 3.184   11.590 -9.883  1.00 1.00 ? 8  SER A N    6  
ATOM   3916  C CA   . SER A 1 8  ? 2.176   12.305 -10.647 1.00 1.00 ? 8  SER A CA   6  
ATOM   3917  C C    . SER A 1 8  ? 0.768   12.112 -10.083 1.00 1.00 ? 8  SER A C    6  
ATOM   3918  O O    . SER A 1 8  ? 0.452   11.070 -9.515  1.00 1.00 ? 8  SER A O    6  
ATOM   3919  C CB   . SER A 1 8  ? 2.230   11.829 -12.102 1.00 1.00 ? 8  SER A CB   6  
ATOM   3920  O OG   . SER A 1 8  ? 3.569   11.870 -12.561 1.00 1.00 ? 8  SER A OG   6  
ATOM   3921  H H    . SER A 1 8  ? 3.533   10.743 -10.295 1.00 1.00 ? 8  SER A H    6  
ATOM   3922  H HA   . SER A 1 8  ? 2.423   13.364 -10.625 1.00 1.00 ? 8  SER A HA   6  
ATOM   3923  H HB2  . SER A 1 8  ? 1.854   10.804 -12.162 1.00 1.00 ? 8  SER A HB2  6  
ATOM   3924  H HB3  . SER A 1 8  ? 1.597   12.470 -12.718 1.00 1.00 ? 8  SER A HB3  6  
ATOM   3925  H HG   . SER A 1 8  ? 3.596   11.586 -13.479 1.00 1.00 ? 8  SER A HG   6  
ATOM   3926  N N    . GLY A 1 9  ? -0.090  13.108 -10.292 1.00 1.00 ? 9  GLY A N    6  
ATOM   3927  C CA   . GLY A 1 9  ? -1.511  13.070 -10.000 1.00 1.00 ? 9  GLY A CA   6  
ATOM   3928  C C    . GLY A 1 9  ? -2.032  14.491 -10.163 1.00 1.00 ? 9  GLY A C    6  
ATOM   3929  O O    . GLY A 1 9  ? -2.458  14.878 -11.247 1.00 1.00 ? 9  GLY A O    6  
ATOM   3930  H H    . GLY A 1 9  ? 0.248   13.925 -10.791 1.00 1.00 ? 9  GLY A H    6  
ATOM   3931  H HA2  . GLY A 1 9  ? -2.012  12.412 -10.711 1.00 1.00 ? 9  GLY A HA2  6  
ATOM   3932  H HA3  . GLY A 1 9  ? -1.693  12.712 -8.987  1.00 1.00 ? 9  GLY A HA3  6  
ATOM   3933  N N    . THR A 1 10 ? -1.935  15.280 -9.093  1.00 1.00 ? 10 THR A N    6  
ATOM   3934  C CA   . THR A 1 10 ? -2.174  16.710 -9.127  1.00 1.00 ? 10 THR A CA   6  
ATOM   3935  C C    . THR A 1 10 ? -0.862  17.387 -9.531  1.00 1.00 ? 10 THR A C    6  
ATOM   3936  O O    . THR A 1 10 ? -0.511  17.454 -10.708 1.00 1.00 ? 10 THR A O    6  
ATOM   3937  C CB   . THR A 1 10 ? -2.662  17.159 -7.739  1.00 1.00 ? 10 THR A CB   6  
ATOM   3938  O OG1  . THR A 1 10 ? -1.830  16.602 -6.725  1.00 1.00 ? 10 THR A OG1  6  
ATOM   3939  C CG2  . THR A 1 10 ? -4.103  16.708 -7.506  1.00 1.00 ? 10 THR A CG2  6  
ATOM   3940  H H    . THR A 1 10 ? -1.602  14.897 -8.225  1.00 1.00 ? 10 THR A H    6  
ATOM   3941  H HA   . THR A 1 10 ? -2.930  16.963 -9.873  1.00 1.00 ? 10 THR A HA   6  
ATOM   3942  H HB   . THR A 1 10 ? -2.649  18.250 -7.681  1.00 1.00 ? 10 THR A HB   6  
ATOM   3943  H HG1  . THR A 1 10 ? -2.357  16.563 -5.913  1.00 1.00 ? 10 THR A HG1  6  
ATOM   3944  H HG21 . THR A 1 10 ? -4.738  17.078 -8.310  1.00 1.00 ? 10 THR A HG21 6  
ATOM   3945  H HG22 . THR A 1 10 ? -4.160  15.621 -7.465  1.00 1.00 ? 10 THR A HG22 6  
ATOM   3946  H HG23 . THR A 1 10 ? -4.463  17.128 -6.569  1.00 1.00 ? 10 THR A HG23 6  
ATOM   3947  N N    . TRP A 1 11 ? -0.109  17.842 -8.529  1.00 1.00 ? 11 TRP A N    6  
ATOM   3948  C CA   . TRP A 1 11 ? 1.188   18.464 -8.705  1.00 1.00 ? 11 TRP A CA   6  
ATOM   3949  C C    . TRP A 1 11 ? 2.158   17.395 -9.189  1.00 1.00 ? 11 TRP A C    6  
ATOM   3950  O O    . TRP A 1 11 ? 2.745   16.680 -8.379  1.00 1.00 ? 11 TRP A O    6  
ATOM   3951  C CB   . TRP A 1 11 ? 1.616   19.079 -7.373  1.00 1.00 ? 11 TRP A CB   6  
ATOM   3952  C CG   . TRP A 1 11 ? 2.798   20.001 -7.378  1.00 1.00 ? 11 TRP A CG   6  
ATOM   3953  C CD1  . TRP A 1 11 ? 3.857   19.999 -8.220  1.00 1.00 ? 11 TRP A CD1  6  
ATOM   3954  C CD2  . TRP A 1 11 ? 3.030   21.103 -6.463  1.00 1.00 ? 11 TRP A CD2  6  
ATOM   3955  N NE1  . TRP A 1 11 ? 4.716   21.029 -7.896  1.00 1.00 ? 11 TRP A NE1  6  
ATOM   3956  C CE2  . TRP A 1 11 ? 4.248   21.750 -6.815  1.00 1.00 ? 11 TRP A CE2  6  
ATOM   3957  C CE3  . TRP A 1 11 ? 2.313   21.624 -5.371  1.00 1.00 ? 11 TRP A CE3  6  
ATOM   3958  C CZ2  . TRP A 1 11 ? 4.727   22.866 -6.110  1.00 1.00 ? 11 TRP A CZ2  6  
ATOM   3959  C CZ3  . TRP A 1 11 ? 2.799   22.719 -4.642  1.00 1.00 ? 11 TRP A CZ3  6  
ATOM   3960  C CH2  . TRP A 1 11 ? 4.018   23.317 -4.986  1.00 1.00 ? 11 TRP A CH2  6  
ATOM   3961  H H    . TRP A 1 11 ? -0.445  17.685 -7.586  1.00 1.00 ? 11 TRP A H    6  
ATOM   3962  H HA   . TRP A 1 11 ? 1.106   19.265 -9.443  1.00 1.00 ? 11 TRP A HA   6  
ATOM   3963  H HB2  . TRP A 1 11 ? 0.774   19.670 -7.010  1.00 1.00 ? 11 TRP A HB2  6  
ATOM   3964  H HB3  . TRP A 1 11 ? 1.790   18.288 -6.645  1.00 1.00 ? 11 TRP A HB3  6  
ATOM   3965  H HD1  . TRP A 1 11 ? 4.023   19.314 -9.037  1.00 1.00 ? 11 TRP A HD1  6  
ATOM   3966  H HE1  . TRP A 1 11 ? 5.588   21.239 -8.377  1.00 1.00 ? 11 TRP A HE1  6  
ATOM   3967  H HE3  . TRP A 1 11 ? 1.385   21.157 -5.083  1.00 1.00 ? 11 TRP A HE3  6  
ATOM   3968  H HZ2  . TRP A 1 11 ? 5.624   23.381 -6.419  1.00 1.00 ? 11 TRP A HZ2  6  
ATOM   3969  H HZ3  . TRP A 1 11 ? 2.229   23.095 -3.810  1.00 1.00 ? 11 TRP A HZ3  6  
ATOM   3970  H HH2  . TRP A 1 11 ? 4.405   24.119 -4.381  1.00 1.00 ? 11 TRP A HH2  6  
ATOM   3971  N N    . SER A 1 12 ? 2.282   17.271 -10.506 1.00 1.00 ? 12 SER A N    6  
ATOM   3972  C CA   . SER A 1 12 ? 3.046   16.227 -11.166 1.00 1.00 ? 12 SER A CA   6  
ATOM   3973  C C    . SER A 1 12 ? 4.352   16.804 -11.705 1.00 1.00 ? 12 SER A C    6  
ATOM   3974  O O    . SER A 1 12 ? 4.554   16.842 -12.917 1.00 1.00 ? 12 SER A O    6  
ATOM   3975  C CB   . SER A 1 12 ? 2.178   15.641 -12.286 1.00 1.00 ? 12 SER A CB   6  
ATOM   3976  O OG   . SER A 1 12 ? 0.909   15.277 -11.769 1.00 1.00 ? 12 SER A OG   6  
ATOM   3977  H H    . SER A 1 12 ? 1.674   17.841 -11.079 1.00 1.00 ? 12 SER A H    6  
ATOM   3978  H HA   . SER A 1 12 ? 3.293   15.433 -10.462 1.00 1.00 ? 12 SER A HA   6  
ATOM   3979  H HB2  . SER A 1 12 ? 2.040   16.377 -13.081 1.00 1.00 ? 12 SER A HB2  6  
ATOM   3980  H HB3  . SER A 1 12 ? 2.683   14.771 -12.711 1.00 1.00 ? 12 SER A HB3  6  
ATOM   3981  H HG   . SER A 1 12 ? 0.403   16.081 -11.573 1.00 1.00 ? 12 SER A HG   6  
ATOM   3982  N N    . GLY A 1 13 ? 5.237   17.278 -10.823 1.00 1.00 ? 13 GLY A N    6  
ATOM   3983  C CA   . GLY A 1 13 ? 6.461   17.918 -11.270 1.00 1.00 ? 13 GLY A CA   6  
ATOM   3984  C C    . GLY A 1 13 ? 7.316   18.417 -10.113 1.00 1.00 ? 13 GLY A C    6  
ATOM   3985  O O    . GLY A 1 13 ? 7.098   18.045 -8.956  1.00 1.00 ? 13 GLY A O    6  
ATOM   3986  H H    . GLY A 1 13 ? 5.064   17.216 -9.828  1.00 1.00 ? 13 GLY A H    6  
ATOM   3987  H HA2  . GLY A 1 13 ? 7.049   17.208 -11.851 1.00 1.00 ? 13 GLY A HA2  6  
ATOM   3988  H HA3  . GLY A 1 13 ? 6.201   18.766 -11.907 1.00 1.00 ? 13 GLY A HA3  6  
ATOM   3989  N N    . VAL A 1 14 ? 8.300   19.254 -10.461 1.00 1.00 ? 14 VAL A N    6  
ATOM   3990  C CA   . VAL A 1 14 ? 9.196   19.917 -9.525  1.00 1.00 ? 14 VAL A CA   6  
ATOM   3991  C C    . VAL A 1 14 ? 8.371   20.767 -8.561  1.00 1.00 ? 14 VAL A C    6  
ATOM   3992  O O    . VAL A 1 14 ? 7.308   21.272 -8.924  1.00 1.00 ? 14 VAL A O    6  
ATOM   3993  C CB   . VAL A 1 14 ? 10.248  20.747 -10.285 1.00 1.00 ? 14 VAL A CB   6  
ATOM   3994  C CG1  . VAL A 1 14 ? 11.227  21.439 -9.326  1.00 1.00 ? 14 VAL A CG1  6  
ATOM   3995  C CG2  . VAL A 1 14 ? 11.060  19.855 -11.235 1.00 1.00 ? 14 VAL A CG2  6  
ATOM   3996  H H    . VAL A 1 14 ? 8.369   19.526 -11.430 1.00 1.00 ? 14 VAL A H    6  
ATOM   3997  H HA   . VAL A 1 14 ? 9.714   19.146 -8.961  1.00 1.00 ? 14 VAL A HA   6  
ATOM   3998  H HB   . VAL A 1 14 ? 9.741   21.520 -10.863 1.00 1.00 ? 14 VAL A HB   6  
ATOM   3999  H HG11 . VAL A 1 14 ? 11.676  20.703 -8.660  1.00 1.00 ? 14 VAL A HG11 6  
ATOM   4000  H HG12 . VAL A 1 14 ? 12.017  21.930 -9.894  1.00 1.00 ? 14 VAL A HG12 6  
ATOM   4001  H HG13 . VAL A 1 14 ? 10.717  22.199 -8.735  1.00 1.00 ? 14 VAL A HG13 6  
ATOM   4002  H HG21 . VAL A 1 14 ? 11.547  19.061 -10.668 1.00 1.00 ? 14 VAL A HG21 6  
ATOM   4003  H HG22 . VAL A 1 14 ? 10.419  19.410 -11.996 1.00 1.00 ? 14 VAL A HG22 6  
ATOM   4004  H HG23 . VAL A 1 14 ? 11.822  20.451 -11.739 1.00 1.00 ? 14 VAL A HG23 6  
ATOM   4005  N N    . CYS A 1 15 ? 8.851   20.883 -7.322  1.00 1.00 ? 15 CYS A N    6  
ATOM   4006  C CA   . CYS A 1 15 ? 8.113   21.464 -6.209  1.00 1.00 ? 15 CYS A CA   6  
ATOM   4007  C C    . CYS A 1 15 ? 8.818   22.674 -5.610  1.00 1.00 ? 15 CYS A C    6  
ATOM   4008  O O    . CYS A 1 15 ? 8.218   23.736 -5.480  1.00 1.00 ? 15 CYS A O    6  
ATOM   4009  C CB   . CYS A 1 15 ? 7.851   20.391 -5.150  1.00 1.00 ? 15 CYS A CB   6  
ATOM   4010  S SG   . CYS A 1 15 ? 9.258   19.345 -4.722  1.00 1.00 ? 15 CYS A SG   6  
ATOM   4011  H H    . CYS A 1 15 ? 9.746   20.457 -7.126  1.00 1.00 ? 15 CYS A H    6  
ATOM   4012  H HA   . CYS A 1 15 ? 7.143   21.802 -6.555  1.00 1.00 ? 15 CYS A HA   6  
ATOM   4013  H HB2  . CYS A 1 15 ? 7.441   20.842 -4.247  1.00 1.00 ? 15 CYS A HB2  6  
ATOM   4014  H HB3  . CYS A 1 15 ? 7.105   19.720 -5.564  1.00 1.00 ? 15 CYS A HB3  6  
ATOM   4015  N N    . GLY A 1 16 ? 10.069  22.501 -5.184  1.00 1.00 ? 16 GLY A N    6  
ATOM   4016  C CA   . GLY A 1 16 ? 10.809  23.502 -4.426  1.00 1.00 ? 16 GLY A CA   6  
ATOM   4017  C C    . GLY A 1 16 ? 10.079  24.032 -3.179  1.00 1.00 ? 16 GLY A C    6  
ATOM   4018  O O    . GLY A 1 16 ? 10.439  25.101 -2.689  1.00 1.00 ? 16 GLY A O    6  
ATOM   4019  H H    . GLY A 1 16 ? 10.533  21.630 -5.397  1.00 1.00 ? 16 GLY A H    6  
ATOM   4020  H HA2  . GLY A 1 16 ? 11.752  23.060 -4.103  1.00 1.00 ? 16 GLY A HA2  6  
ATOM   4021  H HA3  . GLY A 1 16 ? 11.034  24.343 -5.083  1.00 1.00 ? 16 GLY A HA3  6  
ATOM   4022  N N    . ASN A 1 17 ? 9.088   23.312 -2.634  1.00 1.00 ? 17 ASN A N    6  
ATOM   4023  C CA   . ASN A 1 17 ? 8.370   23.745 -1.435  1.00 1.00 ? 17 ASN A CA   6  
ATOM   4024  C C    . ASN A 1 17 ? 7.544   22.613 -0.812  1.00 1.00 ? 17 ASN A C    6  
ATOM   4025  O O    . ASN A 1 17 ? 6.500   22.222 -1.337  1.00 1.00 ? 17 ASN A O    6  
ATOM   4026  C CB   . ASN A 1 17 ? 7.468   24.951 -1.716  1.00 1.00 ? 17 ASN A CB   6  
ATOM   4027  C CG   . ASN A 1 17 ? 6.978   25.519 -0.388  1.00 1.00 ? 17 ASN A CG   6  
ATOM   4028  O OD1  . ASN A 1 17 ? 5.982   25.066 0.166   1.00 1.00 ? 17 ASN A OD1  6  
ATOM   4029  N ND2  . ASN A 1 17 ? 7.707   26.479 0.168   1.00 1.00 ? 17 ASN A ND2  6  
ATOM   4030  H H    . ASN A 1 17 ? 8.848   22.425 -3.050  1.00 1.00 ? 17 ASN A H    6  
ATOM   4031  H HA   . ASN A 1 17 ? 9.119   24.063 -0.708  1.00 1.00 ? 17 ASN A HA   6  
ATOM   4032  H HB2  . ASN A 1 17 ? 8.010   25.729 -2.254  1.00 1.00 ? 17 ASN A HB2  6  
ATOM   4033  H HB3  . ASN A 1 17 ? 6.617   24.648 -2.327  1.00 1.00 ? 17 ASN A HB3  6  
ATOM   4034  H HD21 . ASN A 1 17 ? 8.540   26.814 -0.296  1.00 1.00 ? 17 ASN A HD21 6  
ATOM   4035  H HD22 . ASN A 1 17 ? 7.409   26.880 1.045   1.00 1.00 ? 17 ASN A HD22 6  
ATOM   4036  N N    . ASN A 1 18 ? 8.016   22.092 0.324   1.00 1.00 ? 18 ASN A N    6  
ATOM   4037  C CA   . ASN A 1 18 ? 7.406   20.983 1.040   1.00 1.00 ? 18 ASN A CA   6  
ATOM   4038  C C    . ASN A 1 18 ? 5.943   21.230 1.385   1.00 1.00 ? 18 ASN A C    6  
ATOM   4039  O O    . ASN A 1 18 ? 5.062   20.469 1.001   1.00 1.00 ? 18 ASN A O    6  
ATOM   4040  C CB   . ASN A 1 18 ? 8.210   20.719 2.316   1.00 1.00 ? 18 ASN A CB   6  
ATOM   4041  C CG   . ASN A 1 18 ? 7.738   19.423 2.946   1.00 1.00 ? 18 ASN A CG   6  
ATOM   4042  O OD1  . ASN A 1 18 ? 6.755   19.384 3.681   1.00 1.00 ? 18 ASN A OD1  6  
ATOM   4043  N ND2  . ASN A 1 18 ? 8.403   18.325 2.624   1.00 1.00 ? 18 ASN A ND2  6  
ATOM   4044  H H    . ASN A 1 18 ? 8.891   22.436 0.689   1.00 1.00 ? 18 ASN A H    6  
ATOM   4045  H HA   . ASN A 1 18 ? 7.439   20.106 0.405   1.00 1.00 ? 18 ASN A HA   6  
ATOM   4046  H HB2  . ASN A 1 18 ? 9.267   20.650 2.066   1.00 1.00 ? 18 ASN A HB2  6  
ATOM   4047  H HB3  . ASN A 1 18 ? 8.095   21.533 3.032   1.00 1.00 ? 18 ASN A HB3  6  
ATOM   4048  H HD21 . ASN A 1 18 ? 9.271   18.362 2.110   1.00 1.00 ? 18 ASN A HD21 6  
ATOM   4049  H HD22 . ASN A 1 18 ? 8.044   17.451 2.991   1.00 1.00 ? 18 ASN A HD22 6  
ATOM   4050  N N    . ASN A 1 19 ? 5.729   22.284 2.162   1.00 1.00 ? 19 ASN A N    6  
ATOM   4051  C CA   . ASN A 1 19 ? 4.439   22.696 2.700   1.00 1.00 ? 19 ASN A CA   6  
ATOM   4052  C C    . ASN A 1 19 ? 3.379   22.786 1.607   1.00 1.00 ? 19 ASN A C    6  
ATOM   4053  O O    . ASN A 1 19 ? 2.298   22.218 1.741   1.00 1.00 ? 19 ASN A O    6  
ATOM   4054  C CB   . ASN A 1 19 ? 4.579   24.041 3.420   1.00 1.00 ? 19 ASN A CB   6  
ATOM   4055  C CG   . ASN A 1 19 ? 3.213   24.553 3.869   1.00 1.00 ? 19 ASN A CG   6  
ATOM   4056  O OD1  . ASN A 1 19 ? 2.668   24.082 4.860   1.00 1.00 ? 19 ASN A OD1  6  
ATOM   4057  N ND2  . ASN A 1 19 ? 2.642   25.506 3.137   1.00 1.00 ? 19 ASN A ND2  6  
ATOM   4058  H H    . ASN A 1 19 ? 6.563   22.769 2.434   1.00 1.00 ? 19 ASN A H    6  
ATOM   4059  H HA   . ASN A 1 19 ? 4.111   21.956 3.430   1.00 1.00 ? 19 ASN A HA   6  
ATOM   4060  H HB2  . ASN A 1 19 ? 5.214   23.915 4.297   1.00 1.00 ? 19 ASN A HB2  6  
ATOM   4061  H HB3  . ASN A 1 19 ? 5.045   24.773 2.759   1.00 1.00 ? 19 ASN A HB3  6  
ATOM   4062  H HD21 . ASN A 1 19 ? 3.100   25.880 2.319   1.00 1.00 ? 19 ASN A HD21 6  
ATOM   4063  H HD22 . ASN A 1 19 ? 1.743   25.859 3.430   1.00 1.00 ? 19 ASN A HD22 6  
ATOM   4064  N N    . ALA A 1 20 ? 3.680   23.514 0.533   1.00 1.00 ? 20 ALA A N    6  
ATOM   4065  C CA   . ALA A 1 20 ? 2.736   23.691 -0.558  1.00 1.00 ? 20 ALA A CA   6  
ATOM   4066  C C    . ALA A 1 20 ? 2.433   22.342 -1.202  1.00 1.00 ? 20 ALA A C    6  
ATOM   4067  O O    . ALA A 1 20 ? 1.265   21.997 -1.364  1.00 1.00 ? 20 ALA A O    6  
ATOM   4068  C CB   . ALA A 1 20 ? 3.269   24.692 -1.583  1.00 1.00 ? 20 ALA A CB   6  
ATOM   4069  H H    . ALA A 1 20 ? 4.600   23.938 0.472   1.00 1.00 ? 20 ALA A H    6  
ATOM   4070  H HA   . ALA A 1 20 ? 1.808   24.095 -0.147  1.00 1.00 ? 20 ALA A HA   6  
ATOM   4071  H HB1  . ALA A 1 20 ? 3.480   25.645 -1.100  1.00 1.00 ? 20 ALA A HB1  6  
ATOM   4072  H HB2  . ALA A 1 20 ? 4.178   24.306 -2.044  1.00 1.00 ? 20 ALA A HB2  6  
ATOM   4073  H HB3  . ALA A 1 20 ? 2.515   24.856 -2.355  1.00 1.00 ? 20 ALA A HB3  6  
ATOM   4074  N N    . CYS A 1 21 ? 3.473   21.574 -1.554  1.00 1.00 ? 21 CYS A N    6  
ATOM   4075  C CA   . CYS A 1 21 ? 3.293   20.253 -2.152  1.00 1.00 ? 21 CYS A CA   6  
ATOM   4076  C C    . CYS A 1 21 ? 2.376   19.384 -1.287  1.00 1.00 ? 21 CYS A C    6  
ATOM   4077  O O    . CYS A 1 21 ? 1.358   18.871 -1.756  1.00 1.00 ? 21 CYS A O    6  
ATOM   4078  C CB   . CYS A 1 21 ? 4.643   19.558 -2.350  1.00 1.00 ? 21 CYS A CB   6  
ATOM   4079  S SG   . CYS A 1 21 ? 4.490   17.773 -2.609  1.00 1.00 ? 21 CYS A SG   6  
ATOM   4080  H H    . CYS A 1 21 ? 4.419   21.908 -1.391  1.00 1.00 ? 21 CYS A H    6  
ATOM   4081  H HA   . CYS A 1 21 ? 2.836   20.384 -3.129  1.00 1.00 ? 21 CYS A HA   6  
ATOM   4082  H HB2  . CYS A 1 21 ? 5.158   19.998 -3.202  1.00 1.00 ? 21 CYS A HB2  6  
ATOM   4083  H HB3  . CYS A 1 21 ? 5.260   19.692 -1.464  1.00 1.00 ? 21 CYS A HB3  6  
ATOM   4084  N N    . LYS A 1 22 ? 2.749   19.244 -0.012  1.00 1.00 ? 22 LYS A N    6  
ATOM   4085  C CA   . LYS A 1 22 ? 2.002   18.533 1.010   1.00 1.00 ? 22 LYS A CA   6  
ATOM   4086  C C    . LYS A 1 22 ? 0.543   18.967 0.981   1.00 1.00 ? 22 LYS A C    6  
ATOM   4087  O O    . LYS A 1 22 ? -0.350  18.149 0.754   1.00 1.00 ? 22 LYS A O    6  
ATOM   4088  C CB   . LYS A 1 22 ? 2.641   18.846 2.372   1.00 1.00 ? 22 LYS A CB   6  
ATOM   4089  C CG   . LYS A 1 22 ? 1.902   18.213 3.561   1.00 1.00 ? 22 LYS A CG   6  
ATOM   4090  C CD   . LYS A 1 22 ? 2.444   18.668 4.929   1.00 1.00 ? 22 LYS A CD   6  
ATOM   4091  C CE   . LYS A 1 22 ? 3.955   18.949 4.997   1.00 1.00 ? 22 LYS A CE   6  
ATOM   4092  N NZ   . LYS A 1 22 ? 4.791   17.783 4.654   1.00 1.00 ? 22 LYS A NZ   6  
ATOM   4093  H H    . LYS A 1 22 ? 3.589   19.732 0.276   1.00 1.00 ? 22 LYS A H    6  
ATOM   4094  H HA   . LYS A 1 22 ? 2.059   17.463 0.809   1.00 1.00 ? 22 LYS A HA   6  
ATOM   4095  H HB2  . LYS A 1 22 ? 3.671   18.503 2.330   1.00 1.00 ? 22 LYS A HB2  6  
ATOM   4096  H HB3  . LYS A 1 22 ? 2.656   19.922 2.527   1.00 1.00 ? 22 LYS A HB3  6  
ATOM   4097  H HG2  . LYS A 1 22 ? 0.850   18.502 3.539   1.00 1.00 ? 22 LYS A HG2  6  
ATOM   4098  H HG3  . LYS A 1 22 ? 1.921   17.132 3.460   1.00 1.00 ? 22 LYS A HG3  6  
ATOM   4099  H HD2  . LYS A 1 22 ? 1.943   19.607 5.180   1.00 1.00 ? 22 LYS A HD2  6  
ATOM   4100  H HD3  . LYS A 1 22 ? 2.157   17.938 5.690   1.00 1.00 ? 22 LYS A HD3  6  
ATOM   4101  H HE2  . LYS A 1 22 ? 4.198   19.765 4.315   1.00 1.00 ? 22 LYS A HE2  6  
ATOM   4102  H HE3  . LYS A 1 22 ? 4.212   19.281 6.004   1.00 1.00 ? 22 LYS A HE3  6  
ATOM   4103  H HZ1  . LYS A 1 22 ? 4.472   17.351 3.792   1.00 1.00 ? 22 LYS A HZ1  6  
ATOM   4104  H HZ2  . LYS A 1 22 ? 5.740   18.108 4.494   1.00 1.00 ? 22 LYS A HZ2  6  
ATOM   4105  H HZ3  . LYS A 1 22 ? 4.784   17.093 5.390   1.00 1.00 ? 22 LYS A HZ3  6  
ATOM   4106  N N    . ASN A 1 23 ? 0.324   20.257 1.258   1.00 1.00 ? 23 ASN A N    6  
ATOM   4107  C CA   . ASN A 1 23 ? -0.998  20.826 1.398   1.00 1.00 ? 23 ASN A CA   6  
ATOM   4108  C C    . ASN A 1 23 ? -1.792  20.494 0.147   1.00 1.00 ? 23 ASN A C    6  
ATOM   4109  O O    . ASN A 1 23 ? -2.768  19.758 0.221   1.00 1.00 ? 23 ASN A O    6  
ATOM   4110  C CB   . ASN A 1 23 ? -0.907  22.344 1.621   1.00 1.00 ? 23 ASN A CB   6  
ATOM   4111  C CG   . ASN A 1 23 ? -2.267  23.041 1.754   1.00 1.00 ? 23 ASN A CG   6  
ATOM   4112  O OD1  . ASN A 1 23 ? -3.233  22.746 1.052   1.00 1.00 ? 23 ASN A OD1  6  
ATOM   4113  N ND2  . ASN A 1 23 ? -2.351  24.011 2.658   1.00 1.00 ? 23 ASN A ND2  6  
ATOM   4114  H H    . ASN A 1 23 ? 1.123   20.871 1.388   1.00 1.00 ? 23 ASN A H    6  
ATOM   4115  H HA   . ASN A 1 23 ? -1.451  20.347 2.269   1.00 1.00 ? 23 ASN A HA   6  
ATOM   4116  H HB2  . ASN A 1 23 ? -0.333  22.512 2.534   1.00 1.00 ? 23 ASN A HB2  6  
ATOM   4117  H HB3  . ASN A 1 23 ? -0.368  22.809 0.795   1.00 1.00 ? 23 ASN A HB3  6  
ATOM   4118  H HD21 . ASN A 1 23 ? -1.544  24.263 3.209   1.00 1.00 ? 23 ASN A HD21 6  
ATOM   4119  H HD22 . ASN A 1 23 ? -3.228  24.497 2.771   1.00 1.00 ? 23 ASN A HD22 6  
ATOM   4120  N N    . GLN A 1 24 ? -1.337  20.986 -1.007  1.00 1.00 ? 24 GLN A N    6  
ATOM   4121  C CA   . GLN A 1 24 ? -2.026  20.781 -2.265  1.00 1.00 ? 24 GLN A CA   6  
ATOM   4122  C C    . GLN A 1 24 ? -2.347  19.308 -2.481  1.00 1.00 ? 24 GLN A C    6  
ATOM   4123  O O    . GLN A 1 24 ? -3.468  18.998 -2.878  1.00 1.00 ? 24 GLN A O    6  
ATOM   4124  C CB   . GLN A 1 24 ? -1.228  21.367 -3.431  1.00 1.00 ? 24 GLN A CB   6  
ATOM   4125  C CG   . GLN A 1 24 ? -1.291  22.902 -3.394  1.00 1.00 ? 24 GLN A CG   6  
ATOM   4126  C CD   . GLN A 1 24 ? -0.519  23.563 -4.531  1.00 1.00 ? 24 GLN A CD   6  
ATOM   4127  O OE1  . GLN A 1 24 ? 0.127   24.586 -4.333  1.00 1.00 ? 24 GLN A OE1  6  
ATOM   4128  N NE2  . GLN A 1 24 ? -0.576  22.997 -5.734  1.00 1.00 ? 24 GLN A NE2  6  
ATOM   4129  H H    . GLN A 1 24 ? -0.453  21.486 -1.016  1.00 1.00 ? 24 GLN A H    6  
ATOM   4130  H HA   . GLN A 1 24 ? -2.982  21.304 -2.214  1.00 1.00 ? 24 GLN A HA   6  
ATOM   4131  H HB2  . GLN A 1 24 ? -0.195  21.021 -3.381  1.00 1.00 ? 24 GLN A HB2  6  
ATOM   4132  H HB3  . GLN A 1 24 ? -1.682  21.007 -4.355  1.00 1.00 ? 24 GLN A HB3  6  
ATOM   4133  H HG2  . GLN A 1 24 ? -2.331  23.223 -3.464  1.00 1.00 ? 24 GLN A HG2  6  
ATOM   4134  H HG3  . GLN A 1 24 ? -0.883  23.263 -2.449  1.00 1.00 ? 24 GLN A HG3  6  
ATOM   4135  H HE21 . GLN A 1 24 ? -1.090  22.143 -5.877  1.00 1.00 ? 24 GLN A HE21 6  
ATOM   4136  H HE22 . GLN A 1 24 ? -0.057  23.426 -6.484  1.00 1.00 ? 24 GLN A HE22 6  
ATOM   4137  N N    . CYS A 1 25 ? -1.417  18.391 -2.191  1.00 1.00 ? 25 CYS A N    6  
ATOM   4138  C CA   . CYS A 1 25 ? -1.752  16.984 -2.330  1.00 1.00 ? 25 CYS A CA   6  
ATOM   4139  C C    . CYS A 1 25 ? -2.969  16.608 -1.486  1.00 1.00 ? 25 CYS A C    6  
ATOM   4140  O O    . CYS A 1 25 ? -3.998  16.211 -2.038  1.00 1.00 ? 25 CYS A O    6  
ATOM   4141  C CB   . CYS A 1 25 ? -0.615  16.029 -1.997  1.00 1.00 ? 25 CYS A CB   6  
ATOM   4142  S SG   . CYS A 1 25 ? -1.217  14.348 -2.282  1.00 1.00 ? 25 CYS A SG   6  
ATOM   4143  H H    . CYS A 1 25 ? -0.495  18.665 -1.859  1.00 1.00 ? 25 CYS A H    6  
ATOM   4144  H HA   . CYS A 1 25 ? -1.974  16.833 -3.382  1.00 1.00 ? 25 CYS A HA   6  
ATOM   4145  H HB2  . CYS A 1 25 ? 0.245   16.214 -2.629  1.00 1.00 ? 25 CYS A HB2  6  
ATOM   4146  H HB3  . CYS A 1 25 ? -0.314  16.124 -0.954  1.00 1.00 ? 25 CYS A HB3  6  
ATOM   4147  N N    . ILE A 1 26 ? -2.837  16.715 -0.160  1.00 1.00 ? 26 ILE A N    6  
ATOM   4148  C CA   . ILE A 1 26 ? -3.829  16.204 0.790   1.00 1.00 ? 26 ILE A CA   6  
ATOM   4149  C C    . ILE A 1 26 ? -5.115  17.046 0.772   1.00 1.00 ? 26 ILE A C    6  
ATOM   4150  O O    . ILE A 1 26 ? -6.164  16.633 1.275   1.00 1.00 ? 26 ILE A O    6  
ATOM   4151  C CB   . ILE A 1 26 ? -3.209  16.086 2.197   1.00 1.00 ? 26 ILE A CB   6  
ATOM   4152  C CG1  . ILE A 1 26 ? -3.047  17.450 2.888   1.00 1.00 ? 26 ILE A CG1  6  
ATOM   4153  C CG2  . ILE A 1 26 ? -1.869  15.337 2.116   1.00 1.00 ? 26 ILE A CG2  6  
ATOM   4154  C CD1  . ILE A 1 26 ? -2.400  17.361 4.275   1.00 1.00 ? 26 ILE A CD1  6  
ATOM   4155  H H    . ILE A 1 26 ? -1.999  17.165 0.204   1.00 1.00 ? 26 ILE A H    6  
ATOM   4156  H HA   . ILE A 1 26 ? -4.105  15.196 0.476   1.00 1.00 ? 26 ILE A HA   6  
ATOM   4157  H HB   . ILE A 1 26 ? -3.889  15.496 2.811   1.00 1.00 ? 26 ILE A HB   6  
ATOM   4158  H HG12 . ILE A 1 26 ? -2.446  18.107 2.267   1.00 1.00 ? 26 ILE A HG12 6  
ATOM   4159  H HG13 . ILE A 1 26 ? -4.033  17.891 3.027   1.00 1.00 ? 26 ILE A HG13 6  
ATOM   4160  H HG21 . ILE A 1 26 ? -2.011  14.380 1.622   1.00 1.00 ? 26 ILE A HG21 6  
ATOM   4161  H HG22 . ILE A 1 26 ? -1.121  15.908 1.572   1.00 1.00 ? 26 ILE A HG22 6  
ATOM   4162  H HG23 . ILE A 1 26 ? -1.485  15.157 3.112   1.00 1.00 ? 26 ILE A HG23 6  
ATOM   4163  H HD11 . ILE A 1 26 ? -2.914  16.614 4.879   1.00 1.00 ? 26 ILE A HD11 6  
ATOM   4164  H HD12 . ILE A 1 26 ? -1.345  17.105 4.191   1.00 1.00 ? 26 ILE A HD12 6  
ATOM   4165  H HD13 . ILE A 1 26 ? -2.480  18.331 4.767   1.00 1.00 ? 26 ILE A HD13 6  
ATOM   4166  N N    . ASN A 1 27 ? -5.026  18.235 0.177   1.00 1.00 ? 27 ASN A N    6  
ATOM   4167  C CA   . ASN A 1 27 ? -6.116  19.167 -0.020  1.00 1.00 ? 27 ASN A CA   6  
ATOM   4168  C C    . ASN A 1 27 ? -6.899  18.762 -1.269  1.00 1.00 ? 27 ASN A C    6  
ATOM   4169  O O    . ASN A 1 27 ? -8.070  18.398 -1.157  1.00 1.00 ? 27 ASN A O    6  
ATOM   4170  C CB   . ASN A 1 27 ? -5.504  20.568 -0.100  1.00 1.00 ? 27 ASN A CB   6  
ATOM   4171  C CG   . ASN A 1 27 ? -6.496  21.715 -0.158  1.00 1.00 ? 27 ASN A CG   6  
ATOM   4172  O OD1  . ASN A 1 27 ? -7.665  21.539 -0.479  1.00 1.00 ? 27 ASN A OD1  6  
ATOM   4173  N ND2  . ASN A 1 27 ? -6.009  22.911 0.163   1.00 1.00 ? 27 ASN A ND2  6  
ATOM   4174  H H    . ASN A 1 27 ? -4.105  18.543 -0.124  1.00 1.00 ? 27 ASN A H    6  
ATOM   4175  H HA   . ASN A 1 27 ? -6.781  19.138 0.846   1.00 1.00 ? 27 ASN A HA   6  
ATOM   4176  H HB2  . ASN A 1 27 ? -4.918  20.702 0.810   1.00 1.00 ? 27 ASN A HB2  6  
ATOM   4177  H HB3  . ASN A 1 27 ? -4.851  20.642 -0.968  1.00 1.00 ? 27 ASN A HB3  6  
ATOM   4178  H HD21 . ASN A 1 27 ? -5.030  22.989 0.441   1.00 1.00 ? 27 ASN A HD21 6  
ATOM   4179  H HD22 . ASN A 1 27 ? -6.616  23.714 0.141   1.00 1.00 ? 27 ASN A HD22 6  
ATOM   4180  N N    . LEU A 1 28 ? -6.257  18.750 -2.442  1.00 1.00 ? 28 LEU A N    6  
ATOM   4181  C CA   . LEU A 1 28 ? -6.928  18.462 -3.705  1.00 1.00 ? 28 LEU A CA   6  
ATOM   4182  C C    . LEU A 1 28 ? -7.333  16.987 -3.802  1.00 1.00 ? 28 LEU A C    6  
ATOM   4183  O O    . LEU A 1 28 ? -8.455  16.696 -4.206  1.00 1.00 ? 28 LEU A O    6  
ATOM   4184  C CB   . LEU A 1 28 ? -6.053  18.878 -4.895  1.00 1.00 ? 28 LEU A CB   6  
ATOM   4185  C CG   . LEU A 1 28 ? -6.145  20.371 -5.257  1.00 1.00 ? 28 LEU A CG   6  
ATOM   4186  C CD1  . LEU A 1 28 ? -5.775  21.312 -4.104  1.00 1.00 ? 28 LEU A CD1  6  
ATOM   4187  C CD2  . LEU A 1 28 ? -5.221  20.648 -6.448  1.00 1.00 ? 28 LEU A CD2  6  
ATOM   4188  H H    . LEU A 1 28 ? -5.267  18.975 -2.478  1.00 1.00 ? 28 LEU A H    6  
ATOM   4189  H HA   . LEU A 1 28 ? -7.849  19.046 -3.752  1.00 1.00 ? 28 LEU A HA   6  
ATOM   4190  H HB2  . LEU A 1 28 ? -5.018  18.593 -4.718  1.00 1.00 ? 28 LEU A HB2  6  
ATOM   4191  H HB3  . LEU A 1 28 ? -6.403  18.327 -5.765  1.00 1.00 ? 28 LEU A HB3  6  
ATOM   4192  H HG   . LEU A 1 28 ? -7.170  20.593 -5.561  1.00 1.00 ? 28 LEU A HG   6  
ATOM   4193  H HD11 . LEU A 1 28 ? -4.778  21.082 -3.740  1.00 1.00 ? 28 LEU A HD11 6  
ATOM   4194  H HD12 . LEU A 1 28 ? -5.792  22.344 -4.457  1.00 1.00 ? 28 LEU A HD12 6  
ATOM   4195  H HD13 . LEU A 1 28 ? -6.495  21.221 -3.292  1.00 1.00 ? 28 LEU A HD13 6  
ATOM   4196  H HD21 . LEU A 1 28 ? -5.497  20.011 -7.289  1.00 1.00 ? 28 LEU A HD21 6  
ATOM   4197  H HD22 . LEU A 1 28 ? -5.315  21.691 -6.755  1.00 1.00 ? 28 LEU A HD22 6  
ATOM   4198  H HD23 . LEU A 1 28 ? -4.185  20.449 -6.171  1.00 1.00 ? 28 LEU A HD23 6  
ATOM   4199  N N    . GLU A 1 29 ? -6.440  16.055 -3.437  1.00 1.00 ? 29 GLU A N    6  
ATOM   4200  C CA   . GLU A 1 29 ? -6.804  14.647 -3.281  1.00 1.00 ? 29 GLU A CA   6  
ATOM   4201  C C    . GLU A 1 29 ? -6.855  14.361 -1.781  1.00 1.00 ? 29 GLU A C    6  
ATOM   4202  O O    . GLU A 1 29 ? -6.621  15.262 -0.984  1.00 1.00 ? 29 GLU A O    6  
ATOM   4203  C CB   . GLU A 1 29 ? -5.922  13.693 -4.116  1.00 1.00 ? 29 GLU A CB   6  
ATOM   4204  C CG   . GLU A 1 29 ? -4.431  13.567 -3.765  1.00 1.00 ? 29 GLU A CG   6  
ATOM   4205  C CD   . GLU A 1 29 ? -3.522  14.344 -4.716  1.00 1.00 ? 29 GLU A CD   6  
ATOM   4206  O OE1  . GLU A 1 29 ? -2.736  13.736 -5.445  1.00 1.00 ? 29 GLU A OE1  6  
ATOM   4207  O OE2  . GLU A 1 29 ? -3.624  15.697 -4.680  1.00 1.00 ? 29 GLU A OE2  6  
ATOM   4208  H H    . GLU A 1 29 ? -5.636  16.373 -2.906  1.00 1.00 ? 29 GLU A H    6  
ATOM   4209  H HA   . GLU A 1 29 ? -7.820  14.484 -3.645  1.00 1.00 ? 29 GLU A HA   6  
ATOM   4210  H HB2  . GLU A 1 29 ? -6.349  12.693 -4.009  1.00 1.00 ? 29 GLU A HB2  6  
ATOM   4211  H HB3  . GLU A 1 29 ? -6.021  13.962 -5.170  1.00 1.00 ? 29 GLU A HB3  6  
ATOM   4212  H HG2  . GLU A 1 29 ? -4.243  13.839 -2.729  1.00 1.00 ? 29 GLU A HG2  6  
ATOM   4213  H HG3  . GLU A 1 29 ? -4.156  12.521 -3.891  1.00 1.00 ? 29 GLU A HG3  6  
ATOM   4214  H HE2  . GLU A 1 29 ? -4.052  15.980 -3.865  1.00 1.00 ? 29 GLU A HE2  6  
ATOM   4215  N N    . LYS A 1 30 ? -7.234  13.154 -1.364  1.00 1.00 ? 30 LYS A N    6  
ATOM   4216  C CA   . LYS A 1 30 ? -7.530  12.848 0.037   1.00 1.00 ? 30 LYS A CA   6  
ATOM   4217  C C    . LYS A 1 30 ? -6.378  12.160 0.777   1.00 1.00 ? 30 LYS A C    6  
ATOM   4218  O O    . LYS A 1 30 ? -6.598  11.602 1.853   1.00 1.00 ? 30 LYS A O    6  
ATOM   4219  C CB   . LYS A 1 30 ? -8.862  12.099 0.134   1.00 1.00 ? 30 LYS A CB   6  
ATOM   4220  C CG   . LYS A 1 30 ? -10.040 12.944 -0.380  1.00 1.00 ? 30 LYS A CG   6  
ATOM   4221  C CD   . LYS A 1 30 ? -10.284 14.244 0.418   1.00 1.00 ? 30 LYS A CD   6  
ATOM   4222  C CE   . LYS A 1 30 ? -9.820  15.545 -0.279  1.00 1.00 ? 30 LYS A CE   6  
ATOM   4223  N NZ   . LYS A 1 30 ? -8.730  16.266 0.420   1.00 1.00 ? 30 LYS A NZ   6  
ATOM   4224  H H    . LYS A 1 30 ? -7.419  12.438 -2.051  1.00 1.00 ? 30 LYS A H    6  
ATOM   4225  H HA   . LYS A 1 30 ? -7.665  13.773 0.591   1.00 1.00 ? 30 LYS A HA   6  
ATOM   4226  H HB2  . LYS A 1 30 ? -8.799  11.175 -0.443  1.00 1.00 ? 30 LYS A HB2  6  
ATOM   4227  H HB3  . LYS A 1 30 ? -9.060  11.838 1.174   1.00 1.00 ? 30 LYS A HB3  6  
ATOM   4228  H HG2  . LYS A 1 30 ? -9.931  13.148 -1.446  1.00 1.00 ? 30 LYS A HG2  6  
ATOM   4229  H HG3  . LYS A 1 30 ? -10.928 12.319 -0.269  1.00 1.00 ? 30 LYS A HG3  6  
ATOM   4230  H HD2  . LYS A 1 30 ? -11.368 14.330 0.523   1.00 1.00 ? 30 LYS A HD2  6  
ATOM   4231  H HD3  . LYS A 1 30 ? -9.884  14.154 1.429   1.00 1.00 ? 30 LYS A HD3  6  
ATOM   4232  H HE2  . LYS A 1 30 ? -9.523  15.363 -1.314  1.00 1.00 ? 30 LYS A HE2  6  
ATOM   4233  H HE3  . LYS A 1 30 ? -10.673 16.227 -0.311  1.00 1.00 ? 30 LYS A HE3  6  
ATOM   4234  H HZ1  . LYS A 1 30 ? -8.904  16.391 1.404   1.00 1.00 ? 30 LYS A HZ1  6  
ATOM   4235  H HZ2  . LYS A 1 30 ? -7.810  15.841 0.296   1.00 1.00 ? 30 LYS A HZ2  6  
ATOM   4236  H HZ3  . LYS A 1 30 ? -8.640  17.183 -0.004  1.00 1.00 ? 30 LYS A HZ3  6  
ATOM   4237  N N    . ALA A 1 31 ? -5.179  12.147 0.186   1.00 1.00 ? 31 ALA A N    6  
ATOM   4238  C CA   . ALA A 1 31 ? -3.961  11.577 0.755   1.00 1.00 ? 31 ALA A CA   6  
ATOM   4239  C C    . ALA A 1 31 ? -3.692  11.978 2.212   1.00 1.00 ? 31 ALA A C    6  
ATOM   4240  O O    . ALA A 1 31 ? -4.274  12.933 2.720   1.00 1.00 ? 31 ALA A O    6  
ATOM   4241  C CB   . ALA A 1 31 ? -2.780  12.024 -0.102  1.00 1.00 ? 31 ALA A CB   6  
ATOM   4242  H H    . ALA A 1 31 ? -5.095  12.626 -0.696  1.00 1.00 ? 31 ALA A H    6  
ATOM   4243  H HA   . ALA A 1 31 ? -4.054  10.493 0.703   1.00 1.00 ? 31 ALA A HA   6  
ATOM   4244  H HB1  . ALA A 1 31 ? -2.752  13.111 -0.138  1.00 1.00 ? 31 ALA A HB1  6  
ATOM   4245  H HB2  . ALA A 1 31 ? -1.849  11.671 0.339   1.00 1.00 ? 31 ALA A HB2  6  
ATOM   4246  H HB3  . ALA A 1 31 ? -2.887  11.635 -1.113  1.00 1.00 ? 31 ALA A HB3  6  
ATOM   4247  N N    . ARG A 1 32 ? -2.798  11.237 2.880   1.00 1.00 ? 32 ARG A N    6  
ATOM   4248  C CA   . ARG A 1 32 ? -2.442  11.463 4.276   1.00 1.00 ? 32 ARG A CA   6  
ATOM   4249  C C    . ARG A 1 32 ? -1.300  12.472 4.401   1.00 1.00 ? 32 ARG A C    6  
ATOM   4250  O O    . ARG A 1 32 ? -1.540  13.566 4.905   1.00 1.00 ? 32 ARG A O    6  
ATOM   4251  C CB   . ARG A 1 32 ? -2.097  10.138 4.984   1.00 1.00 ? 32 ARG A CB   6  
ATOM   4252  C CG   . ARG A 1 32 ? -3.204  9.067  4.999   1.00 1.00 ? 32 ARG A CG   6  
ATOM   4253  C CD   . ARG A 1 32 ? -4.317  9.276  6.044   1.00 1.00 ? 32 ARG A CD   6  
ATOM   4254  N NE   . ARG A 1 32 ? -5.095  10.509 5.845   1.00 1.00 ? 32 ARG A NE   6  
ATOM   4255  C CZ   . ARG A 1 32 ? -5.808  10.805 4.748   1.00 1.00 ? 32 ARG A CZ   6  
ATOM   4256  N NH1  . ARG A 1 32 ? -6.062  9.865  3.836   1.00 1.00 ? 32 ARG A NH1  6  
ATOM   4257  N NH2  . ARG A 1 32 ? -6.237  12.050 4.536   1.00 1.00 ? 32 ARG A NH2  6  
ATOM   4258  H H    . ARG A 1 32 ? -2.299  10.514 2.387   1.00 1.00 ? 32 ARG A H    6  
ATOM   4259  H HA   . ARG A 1 32 ? -3.280  11.936 4.784   1.00 1.00 ? 32 ARG A HA   6  
ATOM   4260  H HB2  . ARG A 1 32 ? -1.238  9.698  4.474   1.00 1.00 ? 32 ARG A HB2  6  
ATOM   4261  H HB3  . ARG A 1 32 ? -1.803  10.351 6.012   1.00 1.00 ? 32 ARG A HB3  6  
ATOM   4262  H HG2  . ARG A 1 32 ? -3.607  8.942  3.995   1.00 1.00 ? 32 ARG A HG2  6  
ATOM   4263  H HG3  . ARG A 1 32 ? -2.720  8.126  5.269   1.00 1.00 ? 32 ARG A HG3  6  
ATOM   4264  H HD2  . ARG A 1 32 ? -4.989  8.415  6.042   1.00 1.00 ? 32 ARG A HD2  6  
ATOM   4265  H HD3  . ARG A 1 32 ? -3.856  9.321  7.033   1.00 1.00 ? 32 ARG A HD3  6  
ATOM   4266  H HE   . ARG A 1 32 ? -4.986  11.220 6.557   1.00 1.00 ? 32 ARG A HE   6  
ATOM   4267  H HH11 . ARG A 1 32 ? -5.793  8.907  3.995   1.00 1.00 ? 32 ARG A HH11 6  
ATOM   4268  H HH12 . ARG A 1 32 ? -6.492  10.142 2.956   1.00 1.00 ? 32 ARG A HH12 6  
ATOM   4269  H HH21 . ARG A 1 32 ? -6.012  12.804 5.166   1.00 1.00 ? 32 ARG A HH21 6  
ATOM   4270  H HH22 . ARG A 1 32 ? -6.525  12.278 3.587   1.00 1.00 ? 32 ARG A HH22 6  
ATOM   4271  N N    . HIS A 1 33 ? -0.060  12.096 4.056   1.00 1.00 ? 33 HIS A N    6  
ATOM   4272  C CA   . HIS A 1 33 ? 1.061   13.034 4.001   1.00 1.00 ? 33 HIS A CA   6  
ATOM   4273  C C    . HIS A 1 33 ? 1.490   13.322 2.561   1.00 1.00 ? 33 HIS A C    6  
ATOM   4274  O O    . HIS A 1 33 ? 1.100   12.629 1.623   1.00 1.00 ? 33 HIS A O    6  
ATOM   4275  C CB   . HIS A 1 33 ? 2.198   12.621 4.951   1.00 1.00 ? 33 HIS A CB   6  
ATOM   4276  C CG   . HIS A 1 33 ? 2.738   11.219 4.830   1.00 1.00 ? 33 HIS A CG   6  
ATOM   4277  N ND1  . HIS A 1 33 ? 1.952   10.095 5.032   1.00 1.00 ? 33 HIS A ND1  6  
ATOM   4278  C CD2  . HIS A 1 33 ? 4.018   10.739 4.682   1.00 1.00 ? 33 HIS A CD2  6  
ATOM   4279  C CE1  . HIS A 1 33 ? 2.755   9.023  4.957   1.00 1.00 ? 33 HIS A CE1  6  
ATOM   4280  N NE2  . HIS A 1 33 ? 4.032   9.349  4.747   1.00 1.00 ? 33 HIS A NE2  6  
ATOM   4281  H H    . HIS A 1 33 ? 0.067   11.234 3.532   1.00 1.00 ? 33 HIS A H    6  
ATOM   4282  H HA   . HIS A 1 33 ? 0.727   14.002 4.379   1.00 1.00 ? 33 HIS A HA   6  
ATOM   4283  H HB2  . HIS A 1 33 ? 3.030   13.318 4.837   1.00 1.00 ? 33 HIS A HB2  6  
ATOM   4284  H HB3  . HIS A 1 33 ? 1.827   12.726 5.971   1.00 1.00 ? 33 HIS A HB3  6  
ATOM   4285  H HD1  . HIS A 1 33 ? 0.961   10.084 5.213   1.00 1.00 ? 33 HIS A HD1  6  
ATOM   4286  H HD2  . HIS A 1 33 ? 4.895   11.355 4.554   1.00 1.00 ? 33 HIS A HD2  6  
ATOM   4287  H HE1  . HIS A 1 33 ? 2.407   8.010  5.080   1.00 1.00 ? 33 HIS A HE1  6  
ATOM   4288  N N    . GLY A 1 34 ? 2.327   14.346 2.392   1.00 1.00 ? 34 GLY A N    6  
ATOM   4289  C CA   . GLY A 1 34 ? 2.967   14.692 1.137   1.00 1.00 ? 34 GLY A CA   6  
ATOM   4290  C C    . GLY A 1 34 ? 4.204   15.519 1.457   1.00 1.00 ? 34 GLY A C    6  
ATOM   4291  O O    . GLY A 1 34 ? 4.299   16.042 2.574   1.00 1.00 ? 34 GLY A O    6  
ATOM   4292  H H    . GLY A 1 34 ? 2.647   14.865 3.198   1.00 1.00 ? 34 GLY A H    6  
ATOM   4293  H HA2  . GLY A 1 34 ? 3.280   13.785 0.642   1.00 1.00 ? 34 GLY A HA2  6  
ATOM   4294  H HA3  . GLY A 1 34 ? 2.281   15.238 0.490   1.00 1.00 ? 34 GLY A HA3  6  
ATOM   4295  N N    . SER A 1 35 ? 5.171   15.602 0.538   1.00 1.00 ? 35 SER A N    6  
ATOM   4296  C CA   . SER A 1 35 ? 6.407   16.341 0.759   1.00 1.00 ? 35 SER A CA   6  
ATOM   4297  C C    . SER A 1 35 ? 7.161   16.542 -0.550  1.00 1.00 ? 35 SER A C    6  
ATOM   4298  O O    . SER A 1 35 ? 7.157   15.700 -1.444  1.00 1.00 ? 35 SER A O    6  
ATOM   4299  C CB   . SER A 1 35 ? 7.304   15.591 1.755   1.00 1.00 ? 35 SER A CB   6  
ATOM   4300  O OG   . SER A 1 35 ? 6.932   15.949 3.073   1.00 1.00 ? 35 SER A OG   6  
ATOM   4301  H H    . SER A 1 35 ? 5.084   15.106 -0.352  1.00 1.00 ? 35 SER A H    6  
ATOM   4302  H HA   . SER A 1 35 ? 6.168   17.340 1.155   1.00 1.00 ? 35 SER A HA   6  
ATOM   4303  H HB2  . SER A 1 35 ? 7.212   14.512 1.611   1.00 1.00 ? 35 SER A HB2  6  
ATOM   4304  H HB3  . SER A 1 35 ? 8.352   15.851 1.595   1.00 1.00 ? 35 SER A HB3  6  
ATOM   4305  H HG   . SER A 1 35 ? 6.017   15.662 3.186   1.00 1.00 ? 35 SER A HG   6  
ATOM   4306  N N    . CYS A 1 36 ? 7.874   17.663 -0.617  1.00 1.00 ? 36 CYS A N    6  
ATOM   4307  C CA   . CYS A 1 36 ? 8.756   17.998 -1.718  1.00 1.00 ? 36 CYS A CA   6  
ATOM   4308  C C    . CYS A 1 36 ? 10.048  17.201 -1.557  1.00 1.00 ? 36 CYS A C    6  
ATOM   4309  O O    . CYS A 1 36 ? 11.104  17.750 -1.246  1.00 1.00 ? 36 CYS A O    6  
ATOM   4310  C CB   . CYS A 1 36 ? 8.989   19.509 -1.706  1.00 1.00 ? 36 CYS A CB   6  
ATOM   4311  S SG   . CYS A 1 36 ? 10.070  20.143 -2.993  1.00 1.00 ? 36 CYS A SG   6  
ATOM   4312  H H    . CYS A 1 36 ? 7.885   18.254 0.198   1.00 1.00 ? 36 CYS A H    6  
ATOM   4313  H HA   . CYS A 1 36 ? 8.279   17.716 -2.657  1.00 1.00 ? 36 CYS A HA   6  
ATOM   4314  H HB2  . CYS A 1 36 ? 8.026   19.998 -1.839  1.00 1.00 ? 36 CYS A HB2  6  
ATOM   4315  H HB3  . CYS A 1 36 ? 9.425   19.807 -0.754  1.00 1.00 ? 36 CYS A HB3  6  
ATOM   4316  N N    . ASN A 1 37 ? 9.942   15.876 -1.675  1.00 1.00 ? 37 ASN A N    6  
ATOM   4317  C CA   . ASN A 1 37 ? 11.070  14.987 -1.446  1.00 1.00 ? 37 ASN A CA   6  
ATOM   4318  C C    . ASN A 1 37 ? 12.132  15.237 -2.512  1.00 1.00 ? 37 ASN A C    6  
ATOM   4319  O O    . ASN A 1 37 ? 11.794  15.574 -3.650  1.00 1.00 ? 37 ASN A O    6  
ATOM   4320  C CB   . ASN A 1 37 ? 10.612  13.525 -1.463  1.00 1.00 ? 37 ASN A CB   6  
ATOM   4321  C CG   . ASN A 1 37 ? 11.604  12.615 -0.743  1.00 1.00 ? 37 ASN A CG   6  
ATOM   4322  O OD1  . ASN A 1 37 ? 11.416  12.303 0.427   1.00 1.00 ? 37 ASN A OD1  6  
ATOM   4323  N ND2  . ASN A 1 37 ? 12.681  12.188 -1.397  1.00 1.00 ? 37 ASN A ND2  6  
ATOM   4324  H H    . ASN A 1 37 ? 9.037   15.490 -1.922  1.00 1.00 ? 37 ASN A H    6  
ATOM   4325  H HA   . ASN A 1 37 ? 11.480  15.213 -0.459  1.00 1.00 ? 37 ASN A HA   6  
ATOM   4326  H HB2  . ASN A 1 37 ? 9.661   13.455 -0.934  1.00 1.00 ? 37 ASN A HB2  6  
ATOM   4327  H HB3  . ASN A 1 37 ? 10.465  13.185 -2.489  1.00 1.00 ? 37 ASN A HB3  6  
ATOM   4328  H HD21 . ASN A 1 37 ? 12.889  12.434 -2.363  1.00 1.00 ? 37 ASN A HD21 6  
ATOM   4329  H HD22 . ASN A 1 37 ? 13.316  11.581 -0.903  1.00 1.00 ? 37 ASN A HD22 6  
ATOM   4330  N N    . TYR A 1 38 ? 13.411  15.070 -2.162  1.00 1.00 ? 38 TYR A N    6  
ATOM   4331  C CA   . TYR A 1 38 ? 14.451  15.121 -3.172  1.00 1.00 ? 38 TYR A CA   6  
ATOM   4332  C C    . TYR A 1 38 ? 14.243  13.962 -4.142  1.00 1.00 ? 38 TYR A C    6  
ATOM   4333  O O    . TYR A 1 38 ? 14.076  12.819 -3.719  1.00 1.00 ? 38 TYR A O    6  
ATOM   4334  C CB   . TYR A 1 38 ? 15.870  15.090 -2.592  1.00 1.00 ? 38 TYR A CB   6  
ATOM   4335  C CG   . TYR A 1 38 ? 16.905  15.204 -3.702  1.00 1.00 ? 38 TYR A CG   6  
ATOM   4336  C CD1  . TYR A 1 38 ? 17.127  16.459 -4.300  1.00 1.00 ? 38 TYR A CD1  6  
ATOM   4337  C CD2  . TYR A 1 38 ? 17.359  14.042 -4.355  1.00 1.00 ? 38 TYR A CD2  6  
ATOM   4338  C CE1  . TYR A 1 38 ? 17.709  16.546 -5.577  1.00 1.00 ? 38 TYR A CE1  6  
ATOM   4339  C CE2  . TYR A 1 38 ? 17.935  14.129 -5.635  1.00 1.00 ? 38 TYR A CE2  6  
ATOM   4340  C CZ   . TYR A 1 38 ? 18.072  15.377 -6.264  1.00 1.00 ? 38 TYR A CZ   6  
ATOM   4341  O OH   . TYR A 1 38 ? 18.545  15.443 -7.540  1.00 1.00 ? 38 TYR A OH   6  
ATOM   4342  H H    . TYR A 1 38 ? 13.636  14.731 -1.238  1.00 1.00 ? 38 TYR A H    6  
ATOM   4343  H HA   . TYR A 1 38 ? 14.354  16.069 -3.701  1.00 1.00 ? 38 TYR A HA   6  
ATOM   4344  H HB2  . TYR A 1 38 ? 15.994  15.923 -1.899  1.00 1.00 ? 38 TYR A HB2  6  
ATOM   4345  H HB3  . TYR A 1 38 ? 16.020  14.159 -2.043  1.00 1.00 ? 38 TYR A HB3  6  
ATOM   4346  H HD1  . TYR A 1 38 ? 16.817  17.359 -3.794  1.00 1.00 ? 38 TYR A HD1  6  
ATOM   4347  H HD2  . TYR A 1 38 ? 17.198  13.070 -3.910  1.00 1.00 ? 38 TYR A HD2  6  
ATOM   4348  H HE1  . TYR A 1 38 ? 17.876  17.513 -6.024  1.00 1.00 ? 38 TYR A HE1  6  
ATOM   4349  H HE2  . TYR A 1 38 ? 18.249  13.233 -6.149  1.00 1.00 ? 38 TYR A HE2  6  
ATOM   4350  H HH   . TYR A 1 38 ? 18.413  16.307 -7.957  1.00 1.00 ? 38 TYR A HH   6  
ATOM   4351  N N    . VAL A 1 39 ? 14.259  14.278 -5.432  1.00 1.00 ? 39 VAL A N    6  
ATOM   4352  C CA   . VAL A 1 39 ? 14.294  13.369 -6.558  1.00 1.00 ? 39 VAL A CA   6  
ATOM   4353  C C    . VAL A 1 39 ? 14.990  14.193 -7.643  1.00 1.00 ? 39 VAL A C    6  
ATOM   4354  O O    . VAL A 1 39 ? 15.032  15.425 -7.538  1.00 1.00 ? 39 VAL A O    6  
ATOM   4355  C CB   . VAL A 1 39 ? 12.872  12.943 -6.989  1.00 1.00 ? 39 VAL A CB   6  
ATOM   4356  C CG1  . VAL A 1 39 ? 12.928  11.861 -8.080  1.00 1.00 ? 39 VAL A CG1  6  
ATOM   4357  C CG2  . VAL A 1 39 ? 12.031  12.382 -5.834  1.00 1.00 ? 39 VAL A CG2  6  
ATOM   4358  H H    . VAL A 1 39 ? 14.452  15.238 -5.683  1.00 1.00 ? 39 VAL A H    6  
ATOM   4359  H HA   . VAL A 1 39 ? 14.897  12.497 -6.302  1.00 1.00 ? 39 VAL A HA   6  
ATOM   4360  H HB   . VAL A 1 39 ? 12.351  13.817 -7.382  1.00 1.00 ? 39 VAL A HB   6  
ATOM   4361  H HG11 . VAL A 1 39 ? 13.562  11.036 -7.753  1.00 1.00 ? 39 VAL A HG11 6  
ATOM   4362  H HG12 . VAL A 1 39 ? 11.929  11.474 -8.277  1.00 1.00 ? 39 VAL A HG12 6  
ATOM   4363  H HG13 . VAL A 1 39 ? 13.317  12.271 -9.010  1.00 1.00 ? 39 VAL A HG13 6  
ATOM   4364  H HG21 . VAL A 1 39 ? 12.553  11.551 -5.359  1.00 1.00 ? 39 VAL A HG21 6  
ATOM   4365  H HG22 . VAL A 1 39 ? 11.818  13.157 -5.099  1.00 1.00 ? 39 VAL A HG22 6  
ATOM   4366  H HG23 . VAL A 1 39 ? 11.079  12.018 -6.214  1.00 1.00 ? 39 VAL A HG23 6  
ATOM   4367  N N    . PHE A 1 40 ? 15.527  13.550 -8.680  1.00 1.00 ? 40 PHE A N    6  
ATOM   4368  C CA   . PHE A 1 40 ? 16.018  14.295 -9.829  1.00 1.00 ? 40 PHE A CA   6  
ATOM   4369  C C    . PHE A 1 40 ? 14.861  15.125 -10.411 1.00 1.00 ? 40 PHE A C    6  
ATOM   4370  O O    . PHE A 1 40 ? 13.715  14.671 -10.361 1.00 1.00 ? 40 PHE A O    6  
ATOM   4371  C CB   . PHE A 1 40 ? 16.602  13.341 -10.883 1.00 1.00 ? 40 PHE A CB   6  
ATOM   4372  C CG   . PHE A 1 40 ? 15.579  12.720 -11.823 1.00 1.00 ? 40 PHE A CG   6  
ATOM   4373  C CD1  . PHE A 1 40 ? 14.942  11.510 -11.491 1.00 1.00 ? 40 PHE A CD1  6  
ATOM   4374  C CD2  . PHE A 1 40 ? 15.275  13.359 -13.041 1.00 1.00 ? 40 PHE A CD2  6  
ATOM   4375  C CE1  . PHE A 1 40 ? 14.029  10.928 -12.387 1.00 1.00 ? 40 PHE A CE1  6  
ATOM   4376  C CE2  . PHE A 1 40 ? 14.357  12.780 -13.934 1.00 1.00 ? 40 PHE A CE2  6  
ATOM   4377  C CZ   . PHE A 1 40 ? 13.743  11.558 -13.613 1.00 1.00 ? 40 PHE A CZ   6  
ATOM   4378  H H    . PHE A 1 40 ? 15.484  12.544 -8.723  1.00 1.00 ? 40 PHE A H    6  
ATOM   4379  H HA   . PHE A 1 40 ? 16.821  14.932 -9.464  1.00 1.00 ? 40 PHE A HA   6  
ATOM   4380  H HB2  . PHE A 1 40 ? 17.309  13.906 -11.491 1.00 1.00 ? 40 PHE A HB2  6  
ATOM   4381  H HB3  . PHE A 1 40 ? 17.179  12.557 -10.390 1.00 1.00 ? 40 PHE A HB3  6  
ATOM   4382  H HD1  . PHE A 1 40 ? 15.193  10.991 -10.577 1.00 1.00 ? 40 PHE A HD1  6  
ATOM   4383  H HD2  . PHE A 1 40 ? 15.775  14.276 -13.321 1.00 1.00 ? 40 PHE A HD2  6  
ATOM   4384  H HE1  . PHE A 1 40 ? 13.596  9.961  -12.162 1.00 1.00 ? 40 PHE A HE1  6  
ATOM   4385  H HE2  . PHE A 1 40 ? 14.175  13.243 -14.895 1.00 1.00 ? 40 PHE A HE2  6  
ATOM   4386  H HZ   . PHE A 1 40 ? 13.099  11.072 -14.333 1.00 1.00 ? 40 PHE A HZ   6  
ATOM   4387  N N    . PRO A 1 41 ? 15.115  16.296 -11.008 1.00 1.00 ? 41 PRO A N    6  
ATOM   4388  C CA   . PRO A 1 41 ? 16.394  16.979 -11.030 1.00 1.00 ? 41 PRO A CA   6  
ATOM   4389  C C    . PRO A 1 41 ? 16.639  17.668 -9.683  1.00 1.00 ? 41 PRO A C    6  
ATOM   4390  O O    . PRO A 1 41 ? 17.719  17.539 -9.109  1.00 1.00 ? 41 PRO A O    6  
ATOM   4391  C CB   . PRO A 1 41 ? 16.275  17.966 -12.193 1.00 1.00 ? 41 PRO A CB   6  
ATOM   4392  C CG   . PRO A 1 41 ? 14.787  18.320 -12.237 1.00 1.00 ? 41 PRO A CG   6  
ATOM   4393  C CD   . PRO A 1 41 ? 14.109  17.035 -11.756 1.00 1.00 ? 41 PRO A CD   6  
ATOM   4394  H HA   . PRO A 1 41 ? 17.218  16.298 -11.246 1.00 1.00 ? 41 PRO A HA   6  
ATOM   4395  H HB2  . PRO A 1 41 ? 16.915  18.841 -12.075 1.00 1.00 ? 41 PRO A HB2  6  
ATOM   4396  H HB3  . PRO A 1 41 ? 16.527  17.435 -13.115 1.00 1.00 ? 41 PRO A HB3  6  
ATOM   4397  H HG2  . PRO A 1 41 ? 14.579  19.142 -11.550 1.00 1.00 ? 41 PRO A HG2  6  
ATOM   4398  H HG3  . PRO A 1 41 ? 14.466  18.599 -13.241 1.00 1.00 ? 41 PRO A HG3  6  
ATOM   4399  H HD2  . PRO A 1 41 ? 13.241  17.263 -11.136 1.00 1.00 ? 41 PRO A HD2  6  
ATOM   4400  H HD3  . PRO A 1 41 ? 13.800  16.441 -12.617 1.00 1.00 ? 41 PRO A HD3  6  
ATOM   4401  N N    . ALA A 1 42 ? 15.627  18.376 -9.173  1.00 1.00 ? 42 ALA A N    6  
ATOM   4402  C CA   . ALA A 1 42 ? 15.724  19.209 -7.985  1.00 1.00 ? 42 ALA A CA   6  
ATOM   4403  C C    . ALA A 1 42 ? 14.416  19.135 -7.210  1.00 1.00 ? 42 ALA A C    6  
ATOM   4404  O O    . ALA A 1 42 ? 13.696  20.125 -7.107  1.00 1.00 ? 42 ALA A O    6  
ATOM   4405  C CB   . ALA A 1 42 ? 16.051  20.649 -8.387  1.00 1.00 ? 42 ALA A CB   6  
ATOM   4406  H H    . ALA A 1 42 ? 14.731  18.345 -9.639  1.00 1.00 ? 42 ALA A H    6  
ATOM   4407  H HA   . ALA A 1 42 ? 16.521  18.855 -7.332  1.00 1.00 ? 42 ALA A HA   6  
ATOM   4408  H HB1  . ALA A 1 42 ? 15.268  21.040 -9.039  1.00 1.00 ? 42 ALA A HB1  6  
ATOM   4409  H HB2  . ALA A 1 42 ? 16.112  21.269 -7.491  1.00 1.00 ? 42 ALA A HB2  6  
ATOM   4410  H HB3  . ALA A 1 42 ? 17.007  20.678 -8.906  1.00 1.00 ? 42 ALA A HB3  6  
ATOM   4411  N N    . HIS A 1 43 ? 14.132  17.950 -6.664  1.00 1.00 ? 43 HIS A N    6  
ATOM   4412  C CA   . HIS A 1 43 ? 12.928  17.639 -5.907  1.00 1.00 ? 43 HIS A CA   6  
ATOM   4413  C C    . HIS A 1 43 ? 11.722  17.458 -6.829  1.00 1.00 ? 43 HIS A C    6  
ATOM   4414  O O    . HIS A 1 43 ? 11.685  17.991 -7.937  1.00 1.00 ? 43 HIS A O    6  
ATOM   4415  C CB   . HIS A 1 43 ? 12.631  18.661 -4.796  1.00 1.00 ? 43 HIS A CB   6  
ATOM   4416  C CG   . HIS A 1 43 ? 13.719  18.857 -3.773  1.00 1.00 ? 43 HIS A CG   6  
ATOM   4417  N ND1  . HIS A 1 43 ? 13.540  18.517 -2.441  1.00 1.00 ? 43 HIS A ND1  6  
ATOM   4418  C CD2  . HIS A 1 43 ? 14.968  19.426 -3.834  1.00 1.00 ? 43 HIS A CD2  6  
ATOM   4419  C CE1  . HIS A 1 43 ? 14.669  18.834 -1.789  1.00 1.00 ? 43 HIS A CE1  6  
ATOM   4420  N NE2  . HIS A 1 43 ? 15.582  19.395 -2.584  1.00 1.00 ? 43 HIS A NE2  6  
ATOM   4421  H H    . HIS A 1 43 ? 14.738  17.172 -6.908  1.00 1.00 ? 43 HIS A H    6  
ATOM   4422  H HA   . HIS A 1 43 ? 13.100  16.681 -5.435  1.00 1.00 ? 43 HIS A HA   6  
ATOM   4423  H HB2  . HIS A 1 43 ? 12.349  19.628 -5.208  1.00 1.00 ? 43 HIS A HB2  6  
ATOM   4424  H HB3  . HIS A 1 43 ? 11.769  18.285 -4.258  1.00 1.00 ? 43 HIS A HB3  6  
ATOM   4425  H HD1  . HIS A 1 43 ? 12.702  18.123 -2.027  1.00 1.00 ? 43 HIS A HD1  6  
ATOM   4426  H HD2  . HIS A 1 43 ? 15.421  19.841 -4.721  1.00 1.00 ? 43 HIS A HD2  6  
ATOM   4427  H HE1  . HIS A 1 43 ? 14.816  18.672 -0.730  1.00 1.00 ? 43 HIS A HE1  6  
ATOM   4428  N N    . LYS A 1 44 ? 10.735  16.687 -6.367  1.00 1.00 ? 44 LYS A N    6  
ATOM   4429  C CA   . LYS A 1 44 ? 9.454   16.498 -7.036  1.00 1.00 ? 44 LYS A CA   6  
ATOM   4430  C C    . LYS A 1 44 ? 8.370   16.436 -5.965  1.00 1.00 ? 44 LYS A C    6  
ATOM   4431  O O    . LYS A 1 44 ? 8.654   16.033 -4.836  1.00 1.00 ? 44 LYS A O    6  
ATOM   4432  C CB   . LYS A 1 44 ? 9.470   15.212 -7.877  1.00 1.00 ? 44 LYS A CB   6  
ATOM   4433  C CG   . LYS A 1 44 ? 10.228  15.396 -9.198  1.00 1.00 ? 44 LYS A CG   6  
ATOM   4434  C CD   . LYS A 1 44 ? 10.354  14.055 -9.932  1.00 1.00 ? 44 LYS A CD   6  
ATOM   4435  C CE   . LYS A 1 44 ? 10.889  14.253 -11.365 1.00 1.00 ? 44 LYS A CE   6  
ATOM   4436  N NZ   . LYS A 1 44 ? 11.915  13.254 -11.734 1.00 1.00 ? 44 LYS A NZ   6  
ATOM   4437  H H    . LYS A 1 44 ? 10.820  16.285 -5.435  1.00 1.00 ? 44 LYS A H    6  
ATOM   4438  H HA   . LYS A 1 44 ? 9.237   17.347 -7.680  1.00 1.00 ? 44 LYS A HA   6  
ATOM   4439  H HB2  . LYS A 1 44 ? 9.918   14.410 -7.290  1.00 1.00 ? 44 LYS A HB2  6  
ATOM   4440  H HB3  . LYS A 1 44 ? 8.440   14.936 -8.114  1.00 1.00 ? 44 LYS A HB3  6  
ATOM   4441  H HG2  . LYS A 1 44 ? 9.688   16.119 -9.813  1.00 1.00 ? 44 LYS A HG2  6  
ATOM   4442  H HG3  . LYS A 1 44 ? 11.231  15.775 -9.004  1.00 1.00 ? 44 LYS A HG3  6  
ATOM   4443  H HD2  . LYS A 1 44 ? 11.027  13.434 -9.341  1.00 1.00 ? 44 LYS A HD2  6  
ATOM   4444  H HD3  . LYS A 1 44 ? 9.378   13.567 -9.963  1.00 1.00 ? 44 LYS A HD3  6  
ATOM   4445  H HE2  . LYS A 1 44 ? 10.055  14.205 -12.068 1.00 1.00 ? 44 LYS A HE2  6  
ATOM   4446  H HE3  . LYS A 1 44 ? 11.348  15.240 -11.451 1.00 1.00 ? 44 LYS A HE3  6  
ATOM   4447  H HZ1  . LYS A 1 44 ? 11.582  12.309 -11.620 1.00 1.00 ? 44 LYS A HZ1  6  
ATOM   4448  H HZ2  . LYS A 1 44 ? 12.220  13.383 -12.688 1.00 1.00 ? 44 LYS A HZ2  6  
ATOM   4449  H HZ3  . LYS A 1 44 ? 12.732  13.396 -11.146 1.00 1.00 ? 44 LYS A HZ3  6  
ATOM   4450  N N    . CYS A 1 45 ? 7.142   16.856 -6.291  1.00 1.00 ? 45 CYS A N    6  
ATOM   4451  C CA   . CYS A 1 45 ? 6.056   16.780 -5.319  1.00 1.00 ? 45 CYS A CA   6  
ATOM   4452  C C    . CYS A 1 45 ? 5.599   15.331 -5.154  1.00 1.00 ? 45 CYS A C    6  
ATOM   4453  O O    . CYS A 1 45 ? 4.653   14.884 -5.804  1.00 1.00 ? 45 CYS A O    6  
ATOM   4454  C CB   . CYS A 1 45 ? 4.875   17.688 -5.671  1.00 1.00 ? 45 CYS A CB   6  
ATOM   4455  S SG   . CYS A 1 45 ? 3.535   17.592 -4.453  1.00 1.00 ? 45 CYS A SG   6  
ATOM   4456  H H    . CYS A 1 45 ? 6.962   17.210 -7.228  1.00 1.00 ? 45 CYS A H    6  
ATOM   4457  H HA   . CYS A 1 45 ? 6.455   17.130 -4.369  1.00 1.00 ? 45 CYS A HA   6  
ATOM   4458  H HB2  . CYS A 1 45 ? 5.195   18.726 -5.717  1.00 1.00 ? 45 CYS A HB2  6  
ATOM   4459  H HB3  . CYS A 1 45 ? 4.478   17.409 -6.645  1.00 1.00 ? 45 CYS A HB3  6  
ATOM   4460  N N    . ILE A 1 46 ? 6.296   14.591 -4.292  1.00 1.00 ? 46 ILE A N    6  
ATOM   4461  C CA   . ILE A 1 46 ? 5.938   13.222 -3.972  1.00 1.00 ? 46 ILE A CA   6  
ATOM   4462  C C    . ILE A 1 46 ? 4.873   13.253 -2.874  1.00 1.00 ? 46 ILE A C    6  
ATOM   4463  O O    . ILE A 1 46 ? 5.054   13.892 -1.833  1.00 1.00 ? 46 ILE A O    6  
ATOM   4464  C CB   . ILE A 1 46 ? 7.176   12.397 -3.581  1.00 1.00 ? 46 ILE A CB   6  
ATOM   4465  C CG1  . ILE A 1 46 ? 8.333   12.521 -4.593  1.00 1.00 ? 46 ILE A CG1  6  
ATOM   4466  C CG2  . ILE A 1 46 ? 6.783   10.921 -3.438  1.00 1.00 ? 46 ILE A CG2  6  
ATOM   4467  C CD1  . ILE A 1 46 ? 7.930   12.239 -6.045  1.00 1.00 ? 46 ILE A CD1  6  
ATOM   4468  H H    . ILE A 1 46 ? 7.079   15.018 -3.807  1.00 1.00 ? 46 ILE A H    6  
ATOM   4469  H HA   . ILE A 1 46 ? 5.513   12.760 -4.862  1.00 1.00 ? 46 ILE A HA   6  
ATOM   4470  H HB   . ILE A 1 46 ? 7.545   12.750 -2.617  1.00 1.00 ? 46 ILE A HB   6  
ATOM   4471  H HG12 . ILE A 1 46 ? 8.754   13.523 -4.539  1.00 1.00 ? 46 ILE A HG12 6  
ATOM   4472  H HG13 . ILE A 1 46 ? 9.121   11.822 -4.311  1.00 1.00 ? 46 ILE A HG13 6  
ATOM   4473  H HG21 . ILE A 1 46 ? 6.335   10.557 -4.361  1.00 1.00 ? 46 ILE A HG21 6  
ATOM   4474  H HG22 . ILE A 1 46 ? 7.670   10.327 -3.218  1.00 1.00 ? 46 ILE A HG22 6  
ATOM   4475  H HG23 . ILE A 1 46 ? 6.063   10.793 -2.633  1.00 1.00 ? 46 ILE A HG23 6  
ATOM   4476  H HD11 . ILE A 1 46 ? 7.490   11.247 -6.140  1.00 1.00 ? 46 ILE A HD11 6  
ATOM   4477  H HD12 . ILE A 1 46 ? 7.225   12.991 -6.396  1.00 1.00 ? 46 ILE A HD12 6  
ATOM   4478  H HD13 . ILE A 1 46 ? 8.814   12.281 -6.680  1.00 1.00 ? 46 ILE A HD13 6  
ATOM   4479  N N    . CYS A 1 47 ? 3.746   12.581 -3.111  1.00 1.00 ? 47 CYS A N    6  
ATOM   4480  C CA   . CYS A 1 47 ? 2.695   12.448 -2.114  1.00 1.00 ? 47 CYS A CA   6  
ATOM   4481  C C    . CYS A 1 47 ? 2.706   11.039 -1.534  1.00 1.00 ? 47 CYS A C    6  
ATOM   4482  O O    . CYS A 1 47 ? 3.099   10.109 -2.231  1.00 1.00 ? 47 CYS A O    6  
ATOM   4483  C CB   . CYS A 1 47 ? 1.348   12.839 -2.695  1.00 1.00 ? 47 CYS A CB   6  
ATOM   4484  S SG   . CYS A 1 47 ? 0.174   13.136 -1.369  1.00 1.00 ? 47 CYS A SG   6  
ATOM   4485  H H    . CYS A 1 47 ? 3.667   12.045 -3.971  1.00 1.00 ? 47 CYS A H    6  
ATOM   4486  H HA   . CYS A 1 47 ? 2.873   13.150 -1.309  1.00 1.00 ? 47 CYS A HA   6  
ATOM   4487  H HB2  . CYS A 1 47 ? 1.445   13.760 -3.264  1.00 1.00 ? 47 CYS A HB2  6  
ATOM   4488  H HB3  . CYS A 1 47 ? 0.967   12.067 -3.358  1.00 1.00 ? 47 CYS A HB3  6  
ATOM   4489  N N    . TYR A 1 48 ? 2.330   10.872 -0.261  1.00 1.00 ? 48 TYR A N    6  
ATOM   4490  C CA   . TYR A 1 48 ? 2.510   9.620  0.461   1.00 1.00 ? 48 TYR A CA   6  
ATOM   4491  C C    . TYR A 1 48 ? 1.200   9.225  1.150   1.00 1.00 ? 48 TYR A C    6  
ATOM   4492  O O    . TYR A 1 48 ? 0.804   9.814  2.162   1.00 1.00 ? 48 TYR A O    6  
ATOM   4493  C CB   . TYR A 1 48 ? 3.640   9.801  1.475   1.00 1.00 ? 48 TYR A CB   6  
ATOM   4494  C CG   . TYR A 1 48 ? 5.006   10.084 0.873   1.00 1.00 ? 48 TYR A CG   6  
ATOM   4495  C CD1  . TYR A 1 48 ? 5.414   11.411 0.644   1.00 1.00 ? 48 TYR A CD1  6  
ATOM   4496  C CD2  . TYR A 1 48 ? 5.892   9.028  0.590   1.00 1.00 ? 48 TYR A CD2  6  
ATOM   4497  C CE1  . TYR A 1 48 ? 6.678   11.682 0.098   1.00 1.00 ? 48 TYR A CE1  6  
ATOM   4498  C CE2  . TYR A 1 48 ? 7.176   9.301  0.086   1.00 1.00 ? 48 TYR A CE2  6  
ATOM   4499  C CZ   . TYR A 1 48 ? 7.565   10.628 -0.171  1.00 1.00 ? 48 TYR A CZ   6  
ATOM   4500  O OH   . TYR A 1 48 ? 8.796   10.899 -0.686  1.00 1.00 ? 48 TYR A OH   6  
ATOM   4501  H H    . TYR A 1 48 ? 1.957   11.650 0.275   1.00 1.00 ? 48 TYR A H    6  
ATOM   4502  H HA   . TYR A 1 48 ? 2.814   8.815  -0.215  1.00 1.00 ? 48 TYR A HA   6  
ATOM   4503  H HB2  . TYR A 1 48 ? 3.371   10.631 2.127   1.00 1.00 ? 48 TYR A HB2  6  
ATOM   4504  H HB3  . TYR A 1 48 ? 3.706   8.898  2.080   1.00 1.00 ? 48 TYR A HB3  6  
ATOM   4505  H HD1  . TYR A 1 48 ? 4.761   12.226 0.897   1.00 1.00 ? 48 TYR A HD1  6  
ATOM   4506  H HD2  . TYR A 1 48 ? 5.595   8.007  0.777   1.00 1.00 ? 48 TYR A HD2  6  
ATOM   4507  H HE1  . TYR A 1 48 ? 6.970   12.699 -0.117  1.00 1.00 ? 48 TYR A HE1  6  
ATOM   4508  H HE2  . TYR A 1 48 ? 7.862   8.489  -0.096  1.00 1.00 ? 48 TYR A HE2  6  
ATOM   4509  H HH   . TYR A 1 48 ? 9.382   10.139 -0.690  1.00 1.00 ? 48 TYR A HH   6  
ATOM   4510  N N    . PHE A 1 49 ? 0.513   8.225  0.591   1.00 1.00 ? 49 PHE A N    6  
ATOM   4511  C CA   . PHE A 1 49 ? -0.756  7.719  1.097   1.00 1.00 ? 49 PHE A CA   6  
ATOM   4512  C C    . PHE A 1 49 ? -0.782  6.194  1.009   1.00 1.00 ? 49 PHE A C    6  
ATOM   4513  O O    . PHE A 1 49 ? -0.176  5.653  0.087   1.00 1.00 ? 49 PHE A O    6  
ATOM   4514  C CB   . PHE A 1 49 ? -1.924  8.309  0.304   1.00 1.00 ? 49 PHE A CB   6  
ATOM   4515  C CG   . PHE A 1 49 ? -1.687  8.510  -1.179  1.00 1.00 ? 49 PHE A CG   6  
ATOM   4516  C CD1  . PHE A 1 49 ? -1.083  9.703  -1.606  1.00 1.00 ? 49 PHE A CD1  6  
ATOM   4517  C CD2  . PHE A 1 49 ? -2.238  7.629  -2.129  1.00 1.00 ? 49 PHE A CD2  6  
ATOM   4518  C CE1  . PHE A 1 49 ? -1.217  10.117 -2.934  1.00 1.00 ? 49 PHE A CE1  6  
ATOM   4519  C CE2  . PHE A 1 49 ? -2.248  7.991  -3.491  1.00 1.00 ? 49 PHE A CE2  6  
ATOM   4520  C CZ   . PHE A 1 49 ? -1.768  9.254  -3.886  1.00 1.00 ? 49 PHE A CZ   6  
ATOM   4521  H H    . PHE A 1 49 ? 0.870   7.787  -0.251  1.00 1.00 ? 49 PHE A H    6  
ATOM   4522  H HA   . PHE A 1 49 ? -0.857  8.039  2.128   1.00 1.00 ? 49 PHE A HA   6  
ATOM   4523  H HB2  . PHE A 1 49 ? -2.815  7.696  0.452   1.00 1.00 ? 49 PHE A HB2  6  
ATOM   4524  H HB3  . PHE A 1 49 ? -2.128  9.286  0.728   1.00 1.00 ? 49 PHE A HB3  6  
ATOM   4525  H HD1  . PHE A 1 49 ? -0.571  10.339 -0.903  1.00 1.00 ? 49 PHE A HD1  6  
ATOM   4526  H HD2  . PHE A 1 49 ? -2.665  6.685  -1.820  1.00 1.00 ? 49 PHE A HD2  6  
ATOM   4527  H HE1  . PHE A 1 49 ? -0.936  11.115 -3.215  1.00 1.00 ? 49 PHE A HE1  6  
ATOM   4528  H HE2  . PHE A 1 49 ? -2.656  7.311  -4.227  1.00 1.00 ? 49 PHE A HE2  6  
ATOM   4529  H HZ   . PHE A 1 49 ? -1.793  9.584  -4.912  1.00 1.00 ? 49 PHE A HZ   6  
ATOM   4530  N N    . PRO A 1 50 ? -1.468  5.501  1.937   1.00 1.00 ? 50 PRO A N    6  
ATOM   4531  C CA   . PRO A 1 50 ? -1.647  4.056  1.891   1.00 1.00 ? 50 PRO A CA   6  
ATOM   4532  C C    . PRO A 1 50 ? -2.209  3.616  0.540   1.00 1.00 ? 50 PRO A C    6  
ATOM   4533  O O    . PRO A 1 50 ? -3.095  4.281  0.004   1.00 1.00 ? 50 PRO A O    6  
ATOM   4534  C CB   . PRO A 1 50 ? -2.619  3.718  3.026   1.00 1.00 ? 50 PRO A CB   6  
ATOM   4535  C CG   . PRO A 1 50 ? -2.420  4.867  4.012   1.00 1.00 ? 50 PRO A CG   6  
ATOM   4536  C CD   . PRO A 1 50 ? -2.172  6.054  3.084   1.00 1.00 ? 50 PRO A CD   6  
ATOM   4537  H HA   . PRO A 1 50 ? -0.694  3.567  2.089   1.00 1.00 ? 50 PRO A HA   6  
ATOM   4538  H HB2  . PRO A 1 50 ? -3.647  3.744  2.659   1.00 1.00 ? 50 PRO A HB2  6  
ATOM   4539  H HB3  . PRO A 1 50 ? -2.408  2.745  3.472   1.00 1.00 ? 50 PRO A HB3  6  
ATOM   4540  H HG2  . PRO A 1 50 ? -3.287  5.015  4.657   1.00 1.00 ? 50 PRO A HG2  6  
ATOM   4541  H HG3  . PRO A 1 50 ? -1.529  4.678  4.613   1.00 1.00 ? 50 PRO A HG3  6  
ATOM   4542  H HD2  . PRO A 1 50 ? -3.126  6.466  2.751   1.00 1.00 ? 50 PRO A HD2  6  
ATOM   4543  H HD3  . PRO A 1 50 ? -1.598  6.814  3.611   1.00 1.00 ? 50 PRO A HD3  6  
ATOM   4544  N N    . CYS A 1 51 ? -1.694  2.512  -0.009  1.00 1.00 ? 51 CYS A N    6  
ATOM   4545  C CA   . CYS A 1 51 ? -2.148  2.001  -1.301  1.00 1.00 ? 51 CYS A CA   6  
ATOM   4546  C C    . CYS A 1 51 ? -1.990  0.484  -1.416  1.00 1.00 ? 51 CYS A C    6  
ATOM   4547  O O    . CYS A 1 51 ? -2.874  -0.167 -1.963  1.00 1.00 ? 51 CYS A O    6  
ATOM   4548  C CB   . CYS A 1 51 ? -1.422  2.728  -2.433  1.00 1.00 ? 51 CYS A CB   6  
ATOM   4549  S SG   . CYS A 1 51 ? 0.219   2.099  -2.840  1.00 1.00 ? 51 CYS A SG   6  
ATOM   4550  O OXT  . CYS A 1 51 ? -0.871  -0.075 -0.879  1.00 0.00 ? 51 CYS A OXT  6  
ATOM   4551  H H    . CYS A 1 51 ? -0.900  2.075  0.446   1.00 1.00 ? 51 CYS A H    6  
ATOM   4552  H HA   . CYS A 1 51 ? -3.213  2.218  -1.404  1.00 1.00 ? 51 CYS A HA   6  
ATOM   4553  H HB2  . CYS A 1 51 ? -2.009  2.666  -3.347  1.00 1.00 ? 51 CYS A HB2  6  
ATOM   4554  H HB3  . CYS A 1 51 ? -1.339  3.784  -2.178  1.00 1.00 ? 51 CYS A HB3  6  
HETATM 4555  N N    . PCA A 1 1  ? 0.727   -1.852 2.240   1.00 1.00 ? 1  PCA A N    7  
HETATM 4556  C CA   . PCA A 1 1  ? 1.609   -1.851 3.385   1.00 1.00 ? 1  PCA A CA   7  
HETATM 4557  C CB   . PCA A 1 1  ? 2.475   -3.116 3.216   1.00 1.00 ? 1  PCA A CB   7  
HETATM 4558  C CG   . PCA A 1 1  ? 2.273   -3.522 1.746   1.00 1.00 ? 1  PCA A CG   7  
HETATM 4559  C CD   . PCA A 1 1  ? 1.079   -2.705 1.295   1.00 1.00 ? 1  PCA A CD   7  
HETATM 4560  O OE   . PCA A 1 1  ? 0.549   -2.798 0.188   1.00 1.00 ? 1  PCA A OE   7  
HETATM 4561  C C    . PCA A 1 1  ? 2.401   -0.542 3.377   1.00 1.00 ? 1  PCA A C    7  
HETATM 4562  O O    . PCA A 1 1  ? 2.089   0.382  4.123   1.00 1.00 ? 1  PCA A O    7  
HETATM 4563  H H    . PCA A 1 1  ? 0.038   -1.124 2.081   1.00 0.00 ? 1  PCA A H    7  
HETATM 4564  H HA   . PCA A 1 1  ? 1.029   -1.917 4.306   1.00 1.00 ? 1  PCA A HA   7  
HETATM 4565  H HB2  . PCA A 1 1  ? 3.525   -2.958 3.468   1.00 1.00 ? 1  PCA A HB2  7  
HETATM 4566  H HB3  . PCA A 1 1  ? 2.067   -3.901 3.853   1.00 1.00 ? 1  PCA A HB3  7  
HETATM 4567  H HG2  . PCA A 1 1  ? 3.141   -3.256 1.145   1.00 1.00 ? 1  PCA A HG2  7  
HETATM 4568  H HG3  . PCA A 1 1  ? 2.065   -4.589 1.659   1.00 1.00 ? 1  PCA A HG3  7  
ATOM   4569  N N    . LYS A 1 2  ? 3.400   -0.447 2.497   1.00 1.00 ? 2  LYS A N    7  
ATOM   4570  C CA   . LYS A 1 2  ? 4.133   0.789  2.284   1.00 1.00 ? 2  LYS A CA   7  
ATOM   4571  C C    . LYS A 1 2  ? 3.299   1.737  1.417   1.00 1.00 ? 2  LYS A C    7  
ATOM   4572  O O    . LYS A 1 2  ? 2.938   1.372  0.296   1.00 1.00 ? 2  LYS A O    7  
ATOM   4573  C CB   . LYS A 1 2  ? 5.501   0.496  1.648   1.00 1.00 ? 2  LYS A CB   7  
ATOM   4574  C CG   . LYS A 1 2  ? 5.441   -0.383 0.380   1.00 1.00 ? 2  LYS A CG   7  
ATOM   4575  C CD   . LYS A 1 2  ? 6.466   0.016  -0.696  1.00 1.00 ? 2  LYS A CD   7  
ATOM   4576  C CE   . LYS A 1 2  ? 6.329   1.456  -1.226  1.00 1.00 ? 2  LYS A CE   7  
ATOM   4577  N NZ   . LYS A 1 2  ? 4.955   1.810  -1.641  1.00 1.00 ? 2  LYS A NZ   7  
ATOM   4578  H H    . LYS A 1 2  ? 3.580   -1.230 1.892   1.00 1.00 ? 2  LYS A H    7  
ATOM   4579  H HA   . LYS A 1 2  ? 4.323   1.265  3.249   1.00 1.00 ? 2  LYS A HA   7  
ATOM   4580  H HB2  . LYS A 1 2  ? 5.969   1.456  1.444   1.00 1.00 ? 2  LYS A HB2  7  
ATOM   4581  H HB3  . LYS A 1 2  ? 6.126   -0.015 2.383   1.00 1.00 ? 2  LYS A HB3  7  
ATOM   4582  H HG2  . LYS A 1 2  ? 5.654   -1.409 0.684   1.00 1.00 ? 2  LYS A HG2  7  
ATOM   4583  H HG3  . LYS A 1 2  ? 4.448   -0.399 -0.064  1.00 1.00 ? 2  LYS A HG3  7  
ATOM   4584  H HD2  . LYS A 1 2  ? 7.470   -0.102 -0.281  1.00 1.00 ? 2  LYS A HD2  7  
ATOM   4585  H HD3  . LYS A 1 2  ? 6.371   -0.681 -1.531  1.00 1.00 ? 2  LYS A HD3  7  
ATOM   4586  H HE2  . LYS A 1 2  ? 6.652   2.167  -0.464  1.00 1.00 ? 2  LYS A HE2  7  
ATOM   4587  H HE3  . LYS A 1 2  ? 6.995   1.582  -2.082  1.00 1.00 ? 2  LYS A HE3  7  
ATOM   4588  H HZ1  . LYS A 1 2  ? 4.284   1.648  -0.897  1.00 1.00 ? 2  LYS A HZ1  7  
ATOM   4589  H HZ2  . LYS A 1 2  ? 4.923   2.814  -1.822  1.00 1.00 ? 2  LYS A HZ2  7  
ATOM   4590  H HZ3  . LYS A 1 2  ? 4.669   1.312  -2.468  1.00 1.00 ? 2  LYS A HZ3  7  
ATOM   4591  N N    . LEU A 1 3  ? 3.059   2.968  1.877   1.00 1.00 ? 3  LEU A N    7  
ATOM   4592  C CA   . LEU A 1 3  ? 2.254   3.938  1.142   1.00 1.00 ? 3  LEU A CA   7  
ATOM   4593  C C    . LEU A 1 3  ? 2.788   4.119  -0.278  1.00 1.00 ? 3  LEU A C    7  
ATOM   4594  O O    . LEU A 1 3  ? 3.989   4.001  -0.527  1.00 1.00 ? 3  LEU A O    7  
ATOM   4595  C CB   . LEU A 1 3  ? 2.265   5.301  1.836   1.00 1.00 ? 3  LEU A CB   7  
ATOM   4596  C CG   . LEU A 1 3  ? 1.725   5.277  3.275   1.00 1.00 ? 3  LEU A CG   7  
ATOM   4597  C CD1  . LEU A 1 3  ? 2.880   5.453  4.270   1.00 1.00 ? 3  LEU A CD1  7  
ATOM   4598  C CD2  . LEU A 1 3  ? 0.702   6.401  3.480   1.00 1.00 ? 3  LEU A CD2  7  
ATOM   4599  H H    . LEU A 1 3  ? 3.386   3.214  2.799   1.00 1.00 ? 3  LEU A H    7  
ATOM   4600  H HA   . LEU A 1 3  ? 1.222   3.591  1.105   1.00 1.00 ? 3  LEU A HA   7  
ATOM   4601  H HB2  . LEU A 1 3  ? 3.287   5.666  1.811   1.00 1.00 ? 3  LEU A HB2  7  
ATOM   4602  H HB3  . LEU A 1 3  ? 1.664   5.986  1.240   1.00 1.00 ? 3  LEU A HB3  7  
ATOM   4603  H HG   . LEU A 1 3  ? 1.213   4.333  3.465   1.00 1.00 ? 3  LEU A HG   7  
ATOM   4604  H HD11 . LEU A 1 3  ? 3.611   4.656  4.154   1.00 1.00 ? 3  LEU A HD11 7  
ATOM   4605  H HD12 . LEU A 1 3  ? 3.377   6.408  4.097   1.00 1.00 ? 3  LEU A HD12 7  
ATOM   4606  H HD13 . LEU A 1 3  ? 2.496   5.432  5.290   1.00 1.00 ? 3  LEU A HD13 7  
ATOM   4607  H HD21 . LEU A 1 3  ? -0.126  6.281  2.785   1.00 1.00 ? 3  LEU A HD21 7  
ATOM   4608  H HD22 . LEU A 1 3  ? 0.311   6.360  4.495   1.00 1.00 ? 3  LEU A HD22 7  
ATOM   4609  H HD23 . LEU A 1 3  ? 1.165   7.372  3.313   1.00 1.00 ? 3  LEU A HD23 7  
ATOM   4610  N N    . CYS A 1 4  ? 1.885   4.378  -1.218  1.00 1.00 ? 4  CYS A N    7  
ATOM   4611  C CA   . CYS A 1 4  ? 2.202   4.580  -2.619  1.00 1.00 ? 4  CYS A CA   7  
ATOM   4612  C C    . CYS A 1 4  ? 2.613   6.035  -2.792  1.00 1.00 ? 4  CYS A C    7  
ATOM   4613  O O    . CYS A 1 4  ? 1.812   6.946  -2.574  1.00 1.00 ? 4  CYS A O    7  
ATOM   4614  C CB   . CYS A 1 4  ? 1.035   4.165  -3.522  1.00 1.00 ? 4  CYS A CB   7  
ATOM   4615  S SG   . CYS A 1 4  ? 1.011   2.394  -3.876  1.00 1.00 ? 4  CYS A SG   7  
ATOM   4616  H H    . CYS A 1 4  ? 0.931   4.511  -0.909  1.00 1.00 ? 4  CYS A H    7  
ATOM   4617  H HA   . CYS A 1 4  ? 3.042   3.942  -2.895  1.00 1.00 ? 4  CYS A HA   7  
ATOM   4618  H HB2  . CYS A 1 4  ? 0.073   4.417  -3.075  1.00 1.00 ? 4  CYS A HB2  7  
ATOM   4619  H HB3  . CYS A 1 4  ? 1.127   4.679  -4.480  1.00 1.00 ? 4  CYS A HB3  7  
ATOM   4620  N N    . GLU A 1 5  ? 3.892   6.222  -3.117  1.00 1.00 ? 5  GLU A N    7  
ATOM   4621  C CA   . GLU A 1 5  ? 4.585   7.494  -3.186  1.00 1.00 ? 5  GLU A CA   7  
ATOM   4622  C C    . GLU A 1 5  ? 4.256   8.172  -4.517  1.00 1.00 ? 5  GLU A C    7  
ATOM   4623  O O    . GLU A 1 5  ? 5.098   8.242  -5.411  1.00 1.00 ? 5  GLU A O    7  
ATOM   4624  C CB   . GLU A 1 5  ? 6.089   7.222  -3.032  1.00 1.00 ? 5  GLU A CB   7  
ATOM   4625  C CG   . GLU A 1 5  ? 6.402   6.409  -1.766  1.00 1.00 ? 5  GLU A CG   7  
ATOM   4626  C CD   . GLU A 1 5  ? 6.648   4.925  -2.045  1.00 1.00 ? 5  GLU A CD   7  
ATOM   4627  O OE1  . GLU A 1 5  ? 5.795   4.261  -2.642  1.00 1.00 ? 5  GLU A OE1  7  
ATOM   4628  O OE2  . GLU A 1 5  ? 7.824   4.407  -1.592  1.00 1.00 ? 5  GLU A OE2  7  
ATOM   4629  H H    . GLU A 1 5  ? 4.467   5.398  -3.234  1.00 1.00 ? 5  GLU A H    7  
ATOM   4630  H HA   . GLU A 1 5  ? 4.261   8.137  -2.367  1.00 1.00 ? 5  GLU A HA   7  
ATOM   4631  H HB2  . GLU A 1 5  ? 6.476   6.698  -3.908  1.00 1.00 ? 5  GLU A HB2  7  
ATOM   4632  H HB3  . GLU A 1 5  ? 6.602   8.179  -2.962  1.00 1.00 ? 5  GLU A HB3  7  
ATOM   4633  H HG2  . GLU A 1 5  ? 7.294   6.838  -1.312  1.00 1.00 ? 5  GLU A HG2  7  
ATOM   4634  H HG3  . GLU A 1 5  ? 5.582   6.501  -1.055  1.00 1.00 ? 5  GLU A HG3  7  
ATOM   4635  H HE2  . GLU A 1 5  ? 8.395   5.066  -1.192  1.00 1.00 ? 5  GLU A HE2  7  
ATOM   4636  N N    . ARG A 1 6  ? 3.016   8.633  -4.668  1.00 1.00 ? 6  ARG A N    7  
ATOM   4637  C CA   . ARG A 1 6  ? 2.539   9.170  -5.934  1.00 1.00 ? 6  ARG A CA   7  
ATOM   4638  C C    . ARG A 1 6  ? 3.182   10.543 -6.165  1.00 1.00 ? 6  ARG A C    7  
ATOM   4639  O O    . ARG A 1 6  ? 3.036   11.413 -5.309  1.00 1.00 ? 6  ARG A O    7  
ATOM   4640  C CB   . ARG A 1 6  ? 0.999   9.240  -5.951  1.00 1.00 ? 6  ARG A CB   7  
ATOM   4641  C CG   . ARG A 1 6  ? 0.418   8.876  -7.330  1.00 1.00 ? 6  ARG A CG   7  
ATOM   4642  C CD   . ARG A 1 6  ? 0.540   9.980  -8.394  1.00 1.00 ? 6  ARG A CD   7  
ATOM   4643  N NE   . ARG A 1 6  ? -0.735  10.684 -8.593  1.00 1.00 ? 6  ARG A NE   7  
ATOM   4644  C CZ   . ARG A 1 6  ? -1.185  11.764 -7.936  1.00 1.00 ? 6  ARG A CZ   7  
ATOM   4645  N NH1  . ARG A 1 6  ? -0.386  12.496 -7.150  1.00 1.00 ? 6  ARG A NH1  7  
ATOM   4646  N NH2  . ARG A 1 6  ? -2.467  12.100 -8.075  1.00 1.00 ? 6  ARG A NH2  7  
ATOM   4647  H H    . ARG A 1 6  ? 2.432   8.672  -3.834  1.00 1.00 ? 6  ARG A H    7  
ATOM   4648  H HA   . ARG A 1 6  ? 2.849   8.451  -6.690  1.00 1.00 ? 6  ARG A HA   7  
ATOM   4649  H HB2  . ARG A 1 6  ? 0.604   8.508  -5.243  1.00 1.00 ? 6  ARG A HB2  7  
ATOM   4650  H HB3  . ARG A 1 6  ? 0.648   10.223 -5.632  1.00 1.00 ? 6  ARG A HB3  7  
ATOM   4651  H HG2  . ARG A 1 6  ? 0.918   7.975  -7.689  1.00 1.00 ? 6  ARG A HG2  7  
ATOM   4652  H HG3  . ARG A 1 6  ? -0.633  8.617  -7.204  1.00 1.00 ? 6  ARG A HG3  7  
ATOM   4653  H HD2  . ARG A 1 6  ? 1.348   10.667 -8.173  1.00 1.00 ? 6  ARG A HD2  7  
ATOM   4654  H HD3  . ARG A 1 6  ? 0.781   9.499  -9.344  1.00 1.00 ? 6  ARG A HD3  7  
ATOM   4655  H HE   . ARG A 1 6  ? -1.369  10.233 -9.238  1.00 1.00 ? 6  ARG A HE   7  
ATOM   4656  H HH11 . ARG A 1 6  ? 0.627   12.378 -7.178  1.00 1.00 ? 6  ARG A HH11 7  
ATOM   4657  H HH12 . ARG A 1 6  ? -0.783  13.207 -6.544  1.00 1.00 ? 6  ARG A HH12 7  
ATOM   4658  H HH21 . ARG A 1 6  ? -3.089  11.588 -8.683  1.00 1.00 ? 6  ARG A HH21 7  
ATOM   4659  H HH22 . ARG A 1 6  ? -2.860  12.913 -7.587  1.00 1.00 ? 6  ARG A HH22 7  
ATOM   4660  N N    . PRO A 1 7  ? 3.885   10.761 -7.290  1.00 1.00 ? 7  PRO A N    7  
ATOM   4661  C CA   . PRO A 1 7  ? 4.514   12.037 -7.597  1.00 1.00 ? 7  PRO A CA   7  
ATOM   4662  C C    . PRO A 1 7  ? 3.474   13.061 -8.082  1.00 1.00 ? 7  PRO A C    7  
ATOM   4663  O O    . PRO A 1 7  ? 2.265   12.898 -7.874  1.00 1.00 ? 7  PRO A O    7  
ATOM   4664  C CB   . PRO A 1 7  ? 5.568   11.690 -8.660  1.00 1.00 ? 7  PRO A CB   7  
ATOM   4665  C CG   . PRO A 1 7  ? 4.905   10.552 -9.432  1.00 1.00 ? 7  PRO A CG   7  
ATOM   4666  C CD   . PRO A 1 7  ? 4.195   9.779  -8.322  1.00 1.00 ? 7  PRO A CD   7  
ATOM   4667  H HA   . PRO A 1 7  ? 5.019   12.439 -6.721  1.00 1.00 ? 7  PRO A HA   7  
ATOM   4668  H HB2  . PRO A 1 7  ? 5.856   12.512 -9.315  1.00 1.00 ? 7  PRO A HB2  7  
ATOM   4669  H HB3  . PRO A 1 7  ? 6.456   11.300 -8.160  1.00 1.00 ? 7  PRO A HB3  7  
ATOM   4670  H HG2  . PRO A 1 7  ? 4.170   10.961 -10.127 1.00 1.00 ? 7  PRO A HG2  7  
ATOM   4671  H HG3  . PRO A 1 7  ? 5.628   9.936  -9.968  1.00 1.00 ? 7  PRO A HG3  7  
ATOM   4672  H HD2  . PRO A 1 7  ? 3.305   9.297  -8.726  1.00 1.00 ? 7  PRO A HD2  7  
ATOM   4673  H HD3  . PRO A 1 7  ? 4.875   9.030  -7.915  1.00 1.00 ? 7  PRO A HD3  7  
ATOM   4674  N N    . SER A 1 8  ? 3.950   14.113 -8.756  1.00 1.00 ? 8  SER A N    7  
ATOM   4675  C CA   . SER A 1 8  ? 3.149   15.166 -9.355  1.00 1.00 ? 8  SER A CA   7  
ATOM   4676  C C    . SER A 1 8  ? 2.168   14.615 -10.404 1.00 1.00 ? 8  SER A C    7  
ATOM   4677  O O    . SER A 1 8  ? 2.424   14.690 -11.602 1.00 1.00 ? 8  SER A O    7  
ATOM   4678  C CB   . SER A 1 8  ? 4.127   16.165 -9.995  1.00 1.00 ? 8  SER A CB   7  
ATOM   4679  O OG   . SER A 1 8  ? 5.181   16.496 -9.105  1.00 1.00 ? 8  SER A OG   7  
ATOM   4680  H H    . SER A 1 8  ? 4.947   14.257 -8.813  1.00 1.00 ? 8  SER A H    7  
ATOM   4681  H HA   . SER A 1 8  ? 2.591   15.676 -8.571  1.00 1.00 ? 8  SER A HA   7  
ATOM   4682  H HB2  . SER A 1 8  ? 4.567   15.731 -10.895 1.00 1.00 ? 8  SER A HB2  7  
ATOM   4683  H HB3  . SER A 1 8  ? 3.591   17.068 -10.285 1.00 1.00 ? 8  SER A HB3  7  
ATOM   4684  H HG   . SER A 1 8  ? 5.650   17.254 -9.487  1.00 1.00 ? 8  SER A HG   7  
ATOM   4685  N N    . GLY A 1 9  ? 1.014   14.128 -9.940  1.00 1.00 ? 9  GLY A N    7  
ATOM   4686  C CA   . GLY A 1 9  ? -0.137  13.737 -10.753 1.00 1.00 ? 9  GLY A CA   7  
ATOM   4687  C C    . GLY A 1 9  ? -1.388  14.484 -10.309 1.00 1.00 ? 9  GLY A C    7  
ATOM   4688  O O    . GLY A 1 9  ? -2.506  13.984 -10.433 1.00 1.00 ? 9  GLY A O    7  
ATOM   4689  H H    . GLY A 1 9  ? 0.982   13.962 -8.941  1.00 1.00 ? 9  GLY A H    7  
ATOM   4690  H HA2  . GLY A 1 9  ? 0.036   13.915 -11.815 1.00 1.00 ? 9  GLY A HA2  7  
ATOM   4691  H HA3  . GLY A 1 9  ? -0.345  12.685 -10.586 1.00 1.00 ? 9  GLY A HA3  7  
ATOM   4692  N N    . THR A 1 10 ? -1.184  15.643 -9.692  1.00 1.00 ? 10 THR A N    7  
ATOM   4693  C CA   . THR A 1 10 ? -2.215  16.537 -9.197  1.00 1.00 ? 10 THR A CA   7  
ATOM   4694  C C    . THR A 1 10 ? -1.529  17.893 -9.158  1.00 1.00 ? 10 THR A C    7  
ATOM   4695  O O    . THR A 1 10 ? -1.928  18.843 -9.826  1.00 1.00 ? 10 THR A O    7  
ATOM   4696  C CB   . THR A 1 10 ? -2.722  16.057 -7.828  1.00 1.00 ? 10 THR A CB   7  
ATOM   4697  O OG1  . THR A 1 10 ? -3.068  14.690 -7.901  1.00 1.00 ? 10 THR A OG1  7  
ATOM   4698  C CG2  . THR A 1 10 ? -3.960  16.843 -7.419  1.00 1.00 ? 10 THR A CG2  7  
ATOM   4699  H H    . THR A 1 10 ? -0.239  16.008 -9.725  1.00 1.00 ? 10 THR A H    7  
ATOM   4700  H HA   . THR A 1 10 ? -3.040  16.573 -9.912  1.00 1.00 ? 10 THR A HA   7  
ATOM   4701  H HB   . THR A 1 10 ? -1.955  16.179 -7.063  1.00 1.00 ? 10 THR A HB   7  
ATOM   4702  H HG1  . THR A 1 10 ? -3.323  14.510 -8.820  1.00 1.00 ? 10 THR A HG1  7  
ATOM   4703  H HG21 . THR A 1 10 ? -4.738  16.709 -8.171  1.00 1.00 ? 10 THR A HG21 7  
ATOM   4704  H HG22 . THR A 1 10 ? -4.316  16.474 -6.457  1.00 1.00 ? 10 THR A HG22 7  
ATOM   4705  H HG23 . THR A 1 10 ? -3.711  17.900 -7.334  1.00 1.00 ? 10 THR A HG23 7  
ATOM   4706  N N    . TRP A 1 11 ? -0.435  17.939 -8.394  1.00 1.00 ? 11 TRP A N    7  
ATOM   4707  C CA   . TRP A 1 11 ? 0.494   19.040 -8.461  1.00 1.00 ? 11 TRP A CA   7  
ATOM   4708  C C    . TRP A 1 11 ? 1.091   18.971 -9.867  1.00 1.00 ? 11 TRP A C    7  
ATOM   4709  O O    . TRP A 1 11 ? 1.282   17.867 -10.385 1.00 1.00 ? 11 TRP A O    7  
ATOM   4710  C CB   . TRP A 1 11 ? 1.590   18.833 -7.419  1.00 1.00 ? 11 TRP A CB   7  
ATOM   4711  C CG   . TRP A 1 11 ? 2.638   19.895 -7.416  1.00 1.00 ? 11 TRP A CG   7  
ATOM   4712  C CD1  . TRP A 1 11 ? 3.648   20.023 -8.306  1.00 1.00 ? 11 TRP A CD1  7  
ATOM   4713  C CD2  . TRP A 1 11 ? 2.785   21.005 -6.491  1.00 1.00 ? 11 TRP A CD2  7  
ATOM   4714  N NE1  . TRP A 1 11 ? 4.344   21.184 -8.056  1.00 1.00 ? 11 TRP A NE1  7  
ATOM   4715  C CE2  . TRP A 1 11 ? 3.874   21.814 -6.925  1.00 1.00 ? 11 TRP A CE2  7  
ATOM   4716  C CE3  . TRP A 1 11 ? 2.106   21.410 -5.325  1.00 1.00 ? 11 TRP A CE3  7  
ATOM   4717  C CZ2  . TRP A 1 11 ? 4.270   22.965 -6.233  1.00 1.00 ? 11 TRP A CZ2  7  
ATOM   4718  C CZ3  . TRP A 1 11 ? 2.560   22.504 -4.573  1.00 1.00 ? 11 TRP A CZ3  7  
ATOM   4719  C CH2  . TRP A 1 11 ? 3.648   23.269 -5.014  1.00 1.00 ? 11 TRP A CH2  7  
ATOM   4720  H H    . TRP A 1 11 ? -0.150  17.118 -7.883  1.00 1.00 ? 11 TRP A H    7  
ATOM   4721  H HA   . TRP A 1 11 ? -0.023  19.988 -8.294  1.00 1.00 ? 11 TRP A HA   7  
ATOM   4722  H HB2  . TRP A 1 11 ? 1.129   18.799 -6.432  1.00 1.00 ? 11 TRP A HB2  7  
ATOM   4723  H HB3  . TRP A 1 11 ? 2.071   17.875 -7.606  1.00 1.00 ? 11 TRP A HB3  7  
ATOM   4724  H HD1  . TRP A 1 11 ? 3.848   19.354 -9.129  1.00 1.00 ? 11 TRP A HD1  7  
ATOM   4725  H HE1  . TRP A 1 11 ? 5.134   21.530 -8.595  1.00 1.00 ? 11 TRP A HE1  7  
ATOM   4726  H HE3  . TRP A 1 11 ? 1.248   20.853 -4.983  1.00 1.00 ? 11 TRP A HE3  7  
ATOM   4727  H HZ2  . TRP A 1 11 ? 5.092   23.565 -6.595  1.00 1.00 ? 11 TRP A HZ2  7  
ATOM   4728  H HZ3  . TRP A 1 11 ? 2.075   22.757 -3.645  1.00 1.00 ? 11 TRP A HZ3  7  
ATOM   4729  H HH2  . TRP A 1 11 ? 4.021   24.058 -4.389  1.00 1.00 ? 11 TRP A HH2  7  
ATOM   4730  N N    . SER A 1 12 ? 1.387   20.119 -10.474 1.00 1.00 ? 12 SER A N    7  
ATOM   4731  C CA   . SER A 1 12 ? 1.919   20.173 -11.824 1.00 1.00 ? 12 SER A CA   7  
ATOM   4732  C C    . SER A 1 12 ? 3.438   20.328 -11.807 1.00 1.00 ? 12 SER A C    7  
ATOM   4733  O O    . SER A 1 12 ? 3.956   21.337 -11.336 1.00 1.00 ? 12 SER A O    7  
ATOM   4734  C CB   . SER A 1 12 ? 1.253   21.324 -12.582 1.00 1.00 ? 12 SER A CB   7  
ATOM   4735  O OG   . SER A 1 12 ? -0.145  21.111 -12.630 1.00 1.00 ? 12 SER A OG   7  
ATOM   4736  H H    . SER A 1 12 ? 1.277   20.987 -9.969  1.00 1.00 ? 12 SER A H    7  
ATOM   4737  H HA   . SER A 1 12 ? 1.677   19.242 -12.336 1.00 1.00 ? 12 SER A HA   7  
ATOM   4738  H HB2  . SER A 1 12 ? 1.470   22.272 -12.088 1.00 1.00 ? 12 SER A HB2  7  
ATOM   4739  H HB3  . SER A 1 12 ? 1.642   21.366 -13.601 1.00 1.00 ? 12 SER A HB3  7  
ATOM   4740  H HG   . SER A 1 12 ? -0.460  20.843 -11.760 1.00 1.00 ? 12 SER A HG   7  
ATOM   4741  N N    . GLY A 1 13 ? 4.149   19.338 -12.352 1.00 1.00 ? 13 GLY A N    7  
ATOM   4742  C CA   . GLY A 1 13 ? 5.576   19.437 -12.605 1.00 1.00 ? 13 GLY A CA   7  
ATOM   4743  C C    . GLY A 1 13 ? 6.407   19.503 -11.323 1.00 1.00 ? 13 GLY A C    7  
ATOM   4744  O O    . GLY A 1 13 ? 6.194   18.716 -10.399 1.00 1.00 ? 13 GLY A O    7  
ATOM   4745  H H    . GLY A 1 13 ? 3.666   18.520 -12.691 1.00 1.00 ? 13 GLY A H    7  
ATOM   4746  H HA2  . GLY A 1 13 ? 5.891   18.559 -13.167 1.00 1.00 ? 13 GLY A HA2  7  
ATOM   4747  H HA3  . GLY A 1 13 ? 5.763   20.320 -13.219 1.00 1.00 ? 13 GLY A HA3  7  
ATOM   4748  N N    . VAL A 1 14 ? 7.395   20.401 -11.304 1.00 1.00 ? 14 VAL A N    7  
ATOM   4749  C CA   . VAL A 1 14 ? 8.407   20.459 -10.259 1.00 1.00 ? 14 VAL A CA   7  
ATOM   4750  C C    . VAL A 1 14 ? 7.759   20.869 -8.935  1.00 1.00 ? 14 VAL A C    7  
ATOM   4751  O O    . VAL A 1 14 ? 6.906   21.755 -8.913  1.00 1.00 ? 14 VAL A O    7  
ATOM   4752  C CB   . VAL A 1 14 ? 9.543   21.416 -10.671 1.00 1.00 ? 14 VAL A CB   7  
ATOM   4753  C CG1  . VAL A 1 14 ? 10.656  21.458 -9.614  1.00 1.00 ? 14 VAL A CG1  7  
ATOM   4754  C CG2  . VAL A 1 14 ? 10.163  20.987 -12.009 1.00 1.00 ? 14 VAL A CG2  7  
ATOM   4755  H H    . VAL A 1 14 ? 7.464   21.063 -12.062 1.00 1.00 ? 14 VAL A H    7  
ATOM   4756  H HA   . VAL A 1 14 ? 8.820   19.457 -10.169 1.00 1.00 ? 14 VAL A HA   7  
ATOM   4757  H HB   . VAL A 1 14 ? 9.136   22.422 -10.778 1.00 1.00 ? 14 VAL A HB   7  
ATOM   4758  H HG11 . VAL A 1 14 ? 11.049  20.456 -9.444  1.00 1.00 ? 14 VAL A HG11 7  
ATOM   4759  H HG12 . VAL A 1 14 ? 11.465  22.101 -9.960  1.00 1.00 ? 14 VAL A HG12 7  
ATOM   4760  H HG13 . VAL A 1 14 ? 10.278  21.864 -8.678  1.00 1.00 ? 14 VAL A HG13 7  
ATOM   4761  H HG21 . VAL A 1 14 ? 10.522  19.959 -11.940 1.00 1.00 ? 14 VAL A HG21 7  
ATOM   4762  H HG22 . VAL A 1 14 ? 9.435   21.057 -12.816 1.00 1.00 ? 14 VAL A HG22 7  
ATOM   4763  H HG23 . VAL A 1 14 ? 11.001  21.640 -12.252 1.00 1.00 ? 14 VAL A HG23 7  
ATOM   4764  N N    . CYS A 1 15 ? 8.155   20.234 -7.829  1.00 1.00 ? 15 CYS A N    7  
ATOM   4765  C CA   . CYS A 1 15 ? 7.451   20.395 -6.556  1.00 1.00 ? 15 CYS A CA   7  
ATOM   4766  C C    . CYS A 1 15 ? 7.722   21.744 -5.898  1.00 1.00 ? 15 CYS A C    7  
ATOM   4767  O O    . CYS A 1 15 ? 6.867   22.257 -5.183  1.00 1.00 ? 15 CYS A O    7  
ATOM   4768  C CB   . CYS A 1 15 ? 7.793   19.273 -5.574  1.00 1.00 ? 15 CYS A CB   7  
ATOM   4769  S SG   . CYS A 1 15 ? 8.830   19.740 -4.168  1.00 1.00 ? 15 CYS A SG   7  
ATOM   4770  H H    . CYS A 1 15 ? 8.854   19.506 -7.935  1.00 1.00 ? 15 CYS A H    7  
ATOM   4771  H HA   . CYS A 1 15 ? 6.383   20.319 -6.749  1.00 1.00 ? 15 CYS A HA   7  
ATOM   4772  H HB2  . CYS A 1 15 ? 6.862   18.910 -5.147  1.00 1.00 ? 15 CYS A HB2  7  
ATOM   4773  H HB3  . CYS A 1 15 ? 8.277   18.454 -6.098  1.00 1.00 ? 15 CYS A HB3  7  
ATOM   4774  N N    . GLY A 1 16 ? 8.933   22.285 -6.046  1.00 1.00 ? 16 GLY A N    7  
ATOM   4775  C CA   . GLY A 1 16 ? 9.314   23.548 -5.429  1.00 1.00 ? 16 GLY A CA   7  
ATOM   4776  C C    . GLY A 1 16 ? 9.544   23.445 -3.915  1.00 1.00 ? 16 GLY A C    7  
ATOM   4777  O O    . GLY A 1 16 ? 10.583  23.884 -3.429  1.00 1.00 ? 16 GLY A O    7  
ATOM   4778  H H    . GLY A 1 16 ? 9.615   21.793 -6.603  1.00 1.00 ? 16 GLY A H    7  
ATOM   4779  H HA2  . GLY A 1 16 ? 10.234  23.894 -5.900  1.00 1.00 ? 16 GLY A HA2  7  
ATOM   4780  H HA3  . GLY A 1 16 ? 8.539   24.292 -5.615  1.00 1.00 ? 16 GLY A HA3  7  
ATOM   4781  N N    . ASN A 1 17 ? 8.584   22.906 -3.154  1.00 1.00 ? 17 ASN A N    7  
ATOM   4782  C CA   . ASN A 1 17 ? 8.598   22.954 -1.696  1.00 1.00 ? 17 ASN A CA   7  
ATOM   4783  C C    . ASN A 1 17 ? 7.758   21.839 -1.062  1.00 1.00 ? 17 ASN A C    7  
ATOM   4784  O O    . ASN A 1 17 ? 6.603   21.625 -1.436  1.00 1.00 ? 17 ASN A O    7  
ATOM   4785  C CB   . ASN A 1 17 ? 8.081   24.321 -1.232  1.00 1.00 ? 17 ASN A CB   7  
ATOM   4786  C CG   . ASN A 1 17 ? 7.966   24.366 0.286   1.00 1.00 ? 17 ASN A CG   7  
ATOM   4787  O OD1  . ASN A 1 17 ? 6.897   24.133 0.839   1.00 1.00 ? 17 ASN A OD1  7  
ATOM   4788  N ND2  . ASN A 1 17 ? 9.072   24.624 0.978   1.00 1.00 ? 17 ASN A ND2  7  
ATOM   4789  H H    . ASN A 1 17 ? 7.770   22.512 -3.615  1.00 1.00 ? 17 ASN A H    7  
ATOM   4790  H HA   . ASN A 1 17 ? 9.628   22.846 -1.352  1.00 1.00 ? 17 ASN A HA   7  
ATOM   4791  H HB2  . ASN A 1 17 ? 8.750   25.111 -1.574  1.00 1.00 ? 17 ASN A HB2  7  
ATOM   4792  H HB3  . ASN A 1 17 ? 7.094   24.495 -1.661  1.00 1.00 ? 17 ASN A HB3  7  
ATOM   4793  H HD21 . ASN A 1 17 ? 9.937   24.831 0.498   1.00 1.00 ? 17 ASN A HD21 7  
ATOM   4794  H HD22 . ASN A 1 17 ? 9.018   24.687 1.983   1.00 1.00 ? 17 ASN A HD22 7  
ATOM   4795  N N    . ASN A 1 18 ? 8.339   21.176 -0.054  1.00 1.00 ? 18 ASN A N    7  
ATOM   4796  C CA   . ASN A 1 18 ? 7.727   20.140 0.764   1.00 1.00 ? 18 ASN A CA   7  
ATOM   4797  C C    . ASN A 1 18 ? 6.314   20.486 1.215   1.00 1.00 ? 18 ASN A C    7  
ATOM   4798  O O    . ASN A 1 18 ? 5.366   19.770 0.913   1.00 1.00 ? 18 ASN A O    7  
ATOM   4799  C CB   . ASN A 1 18 ? 8.605   19.893 1.991   1.00 1.00 ? 18 ASN A CB   7  
ATOM   4800  C CG   . ASN A 1 18 ? 8.050   18.716 2.775   1.00 1.00 ? 18 ASN A CG   7  
ATOM   4801  O OD1  . ASN A 1 18 ? 7.201   18.884 3.648   1.00 1.00 ? 18 ASN A OD1  7  
ATOM   4802  N ND2  . ASN A 1 18 ? 8.471   17.506 2.435   1.00 1.00 ? 18 ASN A ND2  7  
ATOM   4803  H H    . ASN A 1 18 ? 9.297   21.392 0.176   1.00 1.00 ? 18 ASN A H    7  
ATOM   4804  H HA   . ASN A 1 18 ? 7.681   19.215 0.204   1.00 1.00 ? 18 ASN A HA   7  
ATOM   4805  H HB2  . ASN A 1 18 ? 9.621   19.691 1.672   1.00 1.00 ? 18 ASN A HB2  7  
ATOM   4806  H HB3  . ASN A 1 18 ? 8.636   20.770 2.639   1.00 1.00 ? 18 ASN A HB3  7  
ATOM   4807  H HD21 . ASN A 1 18 ? 9.152   17.357 1.689   1.00 1.00 ? 18 ASN A HD21 7  
ATOM   4808  H HD22 . ASN A 1 18 ? 8.097   16.723 2.954   1.00 1.00 ? 18 ASN A HD22 7  
ATOM   4809  N N    . ASN A 1 19 ? 6.214   21.548 2.009   1.00 1.00 ? 19 ASN A N    7  
ATOM   4810  C CA   . ASN A 1 19 ? 4.979   21.961 2.660   1.00 1.00 ? 19 ASN A CA   7  
ATOM   4811  C C    . ASN A 1 19 ? 3.897   22.330 1.644   1.00 1.00 ? 19 ASN A C    7  
ATOM   4812  O O    . ASN A 1 19 ? 2.744   21.936 1.800   1.00 1.00 ? 19 ASN A O    7  
ATOM   4813  C CB   . ASN A 1 19 ? 5.226   23.118 3.629   1.00 1.00 ? 19 ASN A CB   7  
ATOM   4814  C CG   . ASN A 1 19 ? 3.925   23.471 4.344   1.00 1.00 ? 19 ASN A CG   7  
ATOM   4815  O OD1  . ASN A 1 19 ? 3.468   22.720 5.199   1.00 1.00 ? 19 ASN A OD1  7  
ATOM   4816  N ND2  . ASN A 1 19 ? 3.307   24.594 3.990   1.00 1.00 ? 19 ASN A ND2  7  
ATOM   4817  H H    . ASN A 1 19 ? 7.076   22.028 2.207   1.00 1.00 ? 19 ASN A H    7  
ATOM   4818  H HA   . ASN A 1 19 ? 4.623   21.120 3.254   1.00 1.00 ? 19 ASN A HA   7  
ATOM   4819  H HB2  . ASN A 1 19 ? 5.963   22.814 4.374   1.00 1.00 ? 19 ASN A HB2  7  
ATOM   4820  H HB3  . ASN A 1 19 ? 5.607   23.988 3.095   1.00 1.00 ? 19 ASN A HB3  7  
ATOM   4821  H HD21 . ASN A 1 19 ? 3.693   25.200 3.282   1.00 1.00 ? 19 ASN A HD21 7  
ATOM   4822  H HD22 . ASN A 1 19 ? 2.441   24.827 4.453   1.00 1.00 ? 19 ASN A HD22 7  
ATOM   4823  N N    . ALA A 1 20 ? 4.259   23.083 0.603   1.00 1.00 ? 20 ALA A N    7  
ATOM   4824  C CA   . ALA A 1 20 ? 3.313   23.409 -0.456  1.00 1.00 ? 20 ALA A CA   7  
ATOM   4825  C C    . ALA A 1 20 ? 2.782   22.123 -1.086  1.00 1.00 ? 20 ALA A C    7  
ATOM   4826  O O    . ALA A 1 20 ? 1.568   21.923 -1.148  1.00 1.00 ? 20 ALA A O    7  
ATOM   4827  C CB   . ALA A 1 20 ? 3.954   24.314 -1.509  1.00 1.00 ? 20 ALA A CB   7  
ATOM   4828  H H    . ALA A 1 20 ? 5.221   23.398 0.532   1.00 1.00 ? 20 ALA A H    7  
ATOM   4829  H HA   . ALA A 1 20 ? 2.475   23.953 -0.015  1.00 1.00 ? 20 ALA A HA   7  
ATOM   4830  H HB1  . ALA A 1 20 ? 4.350   25.213 -1.039  1.00 1.00 ? 20 ALA A HB1  7  
ATOM   4831  H HB2  . ALA A 1 20 ? 4.755   23.786 -2.027  1.00 1.00 ? 20 ALA A HB2  7  
ATOM   4832  H HB3  . ALA A 1 20 ? 3.191   24.604 -2.233  1.00 1.00 ? 20 ALA A HB3  7  
ATOM   4833  N N    . CYS A 1 21 ? 3.691   21.247 -1.531  1.00 1.00 ? 21 CYS A N    7  
ATOM   4834  C CA   . CYS A 1 21 ? 3.314   19.974 -2.135  1.00 1.00 ? 21 CYS A CA   7  
ATOM   4835  C C    . CYS A 1 21 ? 2.391   19.184 -1.203  1.00 1.00 ? 21 CYS A C    7  
ATOM   4836  O O    . CYS A 1 21 ? 1.320   18.742 -1.610  1.00 1.00 ? 21 CYS A O    7  
ATOM   4837  C CB   . CYS A 1 21 ? 4.553   19.144 -2.482  1.00 1.00 ? 21 CYS A CB   7  
ATOM   4838  S SG   . CYS A 1 21 ? 4.180   17.394 -2.764  1.00 1.00 ? 21 CYS A SG   7  
ATOM   4839  H H    . CYS A 1 21 ? 4.681   21.469 -1.448  1.00 1.00 ? 21 CYS A H    7  
ATOM   4840  H HA   . CYS A 1 21 ? 2.786   20.200 -3.061  1.00 1.00 ? 21 CYS A HA   7  
ATOM   4841  H HB2  . CYS A 1 21 ? 5.034   19.557 -3.369  1.00 1.00 ? 21 CYS A HB2  7  
ATOM   4842  H HB3  . CYS A 1 21 ? 5.258   19.183 -1.653  1.00 1.00 ? 21 CYS A HB3  7  
ATOM   4843  N N    . LYS A 1 22 ? 2.814   19.026 0.055   1.00 1.00 ? 22 LYS A N    7  
ATOM   4844  C CA   . LYS A 1 22 ? 2.075   18.370 1.126   1.00 1.00 ? 22 LYS A CA   7  
ATOM   4845  C C    . LYS A 1 22 ? 0.644   18.894 1.185   1.00 1.00 ? 22 LYS A C    7  
ATOM   4846  O O    . LYS A 1 22 ? -0.304  18.128 1.002   1.00 1.00 ? 22 LYS A O    7  
ATOM   4847  C CB   . LYS A 1 22 ? 2.838   18.615 2.440   1.00 1.00 ? 22 LYS A CB   7  
ATOM   4848  C CG   . LYS A 1 22 ? 2.109   18.219 3.738   1.00 1.00 ? 22 LYS A CG   7  
ATOM   4849  C CD   . LYS A 1 22 ? 2.880   18.632 5.010   1.00 1.00 ? 22 LYS A CD   7  
ATOM   4850  C CE   . LYS A 1 22 ? 3.994   17.675 5.470   1.00 1.00 ? 22 LYS A CE   7  
ATOM   4851  N NZ   . LYS A 1 22 ? 5.056   17.497 4.463   1.00 1.00 ? 22 LYS A NZ   7  
ATOM   4852  H H    . LYS A 1 22 ? 3.711   19.432 0.290   1.00 1.00 ? 22 LYS A H    7  
ATOM   4853  H HA   . LYS A 1 22 ? 2.038   17.302 0.915   1.00 1.00 ? 22 LYS A HA   7  
ATOM   4854  H HB2  . LYS A 1 22 ? 3.790   18.110 2.337   1.00 1.00 ? 22 LYS A HB2  7  
ATOM   4855  H HB3  . LYS A 1 22 ? 3.043   19.675 2.521   1.00 1.00 ? 22 LYS A HB3  7  
ATOM   4856  H HG2  . LYS A 1 22 ? 1.165   18.767 3.774   1.00 1.00 ? 22 LYS A HG2  7  
ATOM   4857  H HG3  . LYS A 1 22 ? 1.862   17.159 3.746   1.00 1.00 ? 22 LYS A HG3  7  
ATOM   4858  H HD2  . LYS A 1 22 ? 3.274   19.645 4.890   1.00 1.00 ? 22 LYS A HD2  7  
ATOM   4859  H HD3  . LYS A 1 22 ? 2.152   18.675 5.825   1.00 1.00 ? 22 LYS A HD3  7  
ATOM   4860  H HE2  . LYS A 1 22 ? 4.440   18.066 6.387   1.00 1.00 ? 22 LYS A HE2  7  
ATOM   4861  H HE3  . LYS A 1 22 ? 3.555   16.700 5.690   1.00 1.00 ? 22 LYS A HE3  7  
ATOM   4862  H HZ1  . LYS A 1 22 ? 5.530   18.357 4.212   1.00 1.00 ? 22 LYS A HZ1  7  
ATOM   4863  H HZ2  . LYS A 1 22 ? 5.773   16.829 4.736   1.00 1.00 ? 22 LYS A HZ2  7  
ATOM   4864  H HZ3  . LYS A 1 22 ? 4.643   17.077 3.642   1.00 1.00 ? 22 LYS A HZ3  7  
ATOM   4865  N N    . ASN A 1 23 ? 0.503   20.193 1.465   1.00 1.00 ? 23 ASN A N    7  
ATOM   4866  C CA   . ASN A 1 23 ? -0.793  20.844 1.560   1.00 1.00 ? 23 ASN A CA   7  
ATOM   4867  C C    . ASN A 1 23 ? -1.591  20.530 0.306   1.00 1.00 ? 23 ASN A C    7  
ATOM   4868  O O    . ASN A 1 23 ? -2.606  19.848 0.380   1.00 1.00 ? 23 ASN A O    7  
ATOM   4869  C CB   . ASN A 1 23 ? -0.621  22.362 1.743   1.00 1.00 ? 23 ASN A CB   7  
ATOM   4870  C CG   . ASN A 1 23 ? -1.894  23.167 1.448   1.00 1.00 ? 23 ASN A CG   7  
ATOM   4871  O OD1  . ASN A 1 23 ? -3.019  22.713 1.642   1.00 1.00 ? 23 ASN A OD1  7  
ATOM   4872  N ND2  . ASN A 1 23 ? -1.727  24.390 0.952   1.00 1.00 ? 23 ASN A ND2  7  
ATOM   4873  H H    . ASN A 1 23 ? 1.338   20.765 1.568   1.00 1.00 ? 23 ASN A H    7  
ATOM   4874  H HA   . ASN A 1 23 ? -1.325  20.427 2.417   1.00 1.00 ? 23 ASN A HA   7  
ATOM   4875  H HB2  . ASN A 1 23 ? -0.298  22.565 2.764   1.00 1.00 ? 23 ASN A HB2  7  
ATOM   4876  H HB3  . ASN A 1 23 ? 0.159   22.706 1.063   1.00 1.00 ? 23 ASN A HB3  7  
ATOM   4877  H HD21 . ASN A 1 23 ? -0.801  24.758 0.798   1.00 1.00 ? 23 ASN A HD21 7  
ATOM   4878  H HD22 . ASN A 1 23 ? -2.541  24.948 0.746   1.00 1.00 ? 23 ASN A HD22 7  
ATOM   4879  N N    . GLN A 1 24 ? -1.120  21.004 -0.847  1.00 1.00 ? 24 GLN A N    7  
ATOM   4880  C CA   . GLN A 1 24 ? -1.879  20.892 -2.079  1.00 1.00 ? 24 GLN A CA   7  
ATOM   4881  C C    . GLN A 1 24 ? -2.292  19.446 -2.345  1.00 1.00 ? 24 GLN A C    7  
ATOM   4882  O O    . GLN A 1 24 ? -3.441  19.211 -2.713  1.00 1.00 ? 24 GLN A O    7  
ATOM   4883  C CB   . GLN A 1 24 ? -1.109  21.522 -3.241  1.00 1.00 ? 24 GLN A CB   7  
ATOM   4884  C CG   . GLN A 1 24 ? -1.088  23.049 -3.070  1.00 1.00 ? 24 GLN A CG   7  
ATOM   4885  C CD   . GLN A 1 24 ? -0.353  23.807 -4.171  1.00 1.00 ? 24 GLN A CD   7  
ATOM   4886  O OE1  . GLN A 1 24 ? 0.295   24.813 -3.902  1.00 1.00 ? 24 GLN A OE1  7  
ATOM   4887  N NE2  . GLN A 1 24 ? -0.433  23.345 -5.414  1.00 1.00 ? 24 GLN A NE2  7  
ATOM   4888  H H    . GLN A 1 24 ? -0.206  21.450 -0.871  1.00 1.00 ? 24 GLN A H    7  
ATOM   4889  H HA   . GLN A 1 24 ? -2.806  21.450 -1.940  1.00 1.00 ? 24 GLN A HA   7  
ATOM   4890  H HB2  . GLN A 1 24 ? -0.094  21.127 -3.252  1.00 1.00 ? 24 GLN A HB2  7  
ATOM   4891  H HB3  . GLN A 1 24 ? -1.616  21.259 -4.170  1.00 1.00 ? 24 GLN A HB3  7  
ATOM   4892  H HG2  . GLN A 1 24 ? -2.114  23.416 -3.050  1.00 1.00 ? 24 GLN A HG2  7  
ATOM   4893  H HG3  . GLN A 1 24 ? -0.606  23.296 -2.124  1.00 1.00 ? 24 GLN A HG3  7  
ATOM   4894  H HE21 . GLN A 1 24 ? -0.924  22.491 -5.612  1.00 1.00 ? 24 GLN A HE21 7  
ATOM   4895  H HE22 . GLN A 1 24 ? 0.072   23.837 -6.136  1.00 1.00 ? 24 GLN A HE22 7  
ATOM   4896  N N    . CYS A 1 25 ? -1.407  18.474 -2.107  1.00 1.00 ? 25 CYS A N    7  
ATOM   4897  C CA   . CYS A 1 25 ? -1.787  17.077 -2.221  1.00 1.00 ? 25 CYS A CA   7  
ATOM   4898  C C    . CYS A 1 25 ? -2.985  16.746 -1.340  1.00 1.00 ? 25 CYS A C    7  
ATOM   4899  O O    . CYS A 1 25 ? -4.045  16.417 -1.863  1.00 1.00 ? 25 CYS A O    7  
ATOM   4900  C CB   . CYS A 1 25 ? -0.666  16.106 -1.852  1.00 1.00 ? 25 CYS A CB   7  
ATOM   4901  S SG   . CYS A 1 25 ? -1.321  14.424 -1.917  1.00 1.00 ? 25 CYS A SG   7  
ATOM   4902  H H    . CYS A 1 25 ? -0.476  18.709 -1.778  1.00 1.00 ? 25 CYS A H    7  
ATOM   4903  H HA   . CYS A 1 25 ? -2.060  16.888 -3.260  1.00 1.00 ? 25 CYS A HA   7  
ATOM   4904  H HB2  . CYS A 1 25 ? 0.163   16.187 -2.544  1.00 1.00 ? 25 CYS A HB2  7  
ATOM   4905  H HB3  . CYS A 1 25 ? -0.298  16.297 -0.844  1.00 1.00 ? 25 CYS A HB3  7  
ATOM   4906  N N    . ILE A 1 26 ? -2.807  16.791 -0.016  1.00 1.00 ? 26 ILE A N    7  
ATOM   4907  C CA   . ILE A 1 26 ? -3.812  16.267 0.908   1.00 1.00 ? 26 ILE A CA   7  
ATOM   4908  C C    . ILE A 1 26 ? -5.060  17.159 0.943   1.00 1.00 ? 26 ILE A C    7  
ATOM   4909  O O    . ILE A 1 26 ? -6.122  16.756 1.423   1.00 1.00 ? 26 ILE A O    7  
ATOM   4910  C CB   . ILE A 1 26 ? -3.190  16.008 2.295   1.00 1.00 ? 26 ILE A CB   7  
ATOM   4911  C CG1  . ILE A 1 26 ? -3.003  17.301 3.102   1.00 1.00 ? 26 ILE A CG1  7  
ATOM   4912  C CG2  . ILE A 1 26 ? -1.870  15.235 2.134   1.00 1.00 ? 26 ILE A CG2  7  
ATOM   4913  C CD1  . ILE A 1 26 ? -2.261  17.097 4.425   1.00 1.00 ? 26 ILE A CD1  7  
ATOM   4914  H H    . ILE A 1 26 ? -1.956  17.207 0.360   1.00 1.00 ? 26 ILE A H    7  
ATOM   4915  H HA   . ILE A 1 26 ? -4.134  15.296 0.528   1.00 1.00 ? 26 ILE A HA   7  
ATOM   4916  H HB   . ILE A 1 26 ? -3.877  15.373 2.856   1.00 1.00 ? 26 ILE A HB   7  
ATOM   4917  H HG12 . ILE A 1 26 ? -2.458  18.030 2.506   1.00 1.00 ? 26 ILE A HG12 7  
ATOM   4918  H HG13 . ILE A 1 26 ? -3.989  17.695 3.343   1.00 1.00 ? 26 ILE A HG13 7  
ATOM   4919  H HG21 . ILE A 1 26 ? -2.041  14.341 1.536   1.00 1.00 ? 26 ILE A HG21 7  
ATOM   4920  H HG22 . ILE A 1 26 ? -1.105  15.842 1.657   1.00 1.00 ? 26 ILE A HG22 7  
ATOM   4921  H HG23 . ILE A 1 26 ? -1.493  14.932 3.104   1.00 1.00 ? 26 ILE A HG23 7  
ATOM   4922  H HD11 . ILE A 1 26 ? -2.724  16.288 4.992   1.00 1.00 ? 26 ILE A HD11 7  
ATOM   4923  H HD12 . ILE A 1 26 ? -1.211  16.867 4.245   1.00 1.00 ? 26 ILE A HD12 7  
ATOM   4924  H HD13 . ILE A 1 26 ? -2.315  18.016 5.009   1.00 1.00 ? 26 ILE A HD13 7  
ATOM   4925  N N    . ASN A 1 27 ? -4.932  18.377 0.416   1.00 1.00 ? 27 ASN A N    7  
ATOM   4926  C CA   . ASN A 1 27 ? -6.004  19.340 0.272   1.00 1.00 ? 27 ASN A CA   7  
ATOM   4927  C C    . ASN A 1 27 ? -6.828  19.000 -0.973  1.00 1.00 ? 27 ASN A C    7  
ATOM   4928  O O    . ASN A 1 27 ? -7.997  18.625 -0.841  1.00 1.00 ? 27 ASN A O    7  
ATOM   4929  C CB   . ASN A 1 27 ? -5.355  20.725 0.235   1.00 1.00 ? 27 ASN A CB   7  
ATOM   4930  C CG   . ASN A 1 27 ? -6.319  21.894 0.325   1.00 1.00 ? 27 ASN A CG   7  
ATOM   4931  O OD1  . ASN A 1 27 ? -7.479  21.800 -0.061  1.00 1.00 ? 27 ASN A OD1  7  
ATOM   4932  N ND2  . ASN A 1 27 ? -5.822  23.014 0.846   1.00 1.00 ? 27 ASN A ND2  7  
ATOM   4933  H H    . ASN A 1 27 ? -4.009  18.673 0.107   1.00 1.00 ? 27 ASN A H    7  
ATOM   4934  H HA   . ASN A 1 27 ? -6.649  19.296 1.151   1.00 1.00 ? 27 ASN A HA   7  
ATOM   4935  H HB2  . ASN A 1 27 ? -4.711  20.782 1.113   1.00 1.00 ? 27 ASN A HB2  7  
ATOM   4936  H HB3  . ASN A 1 27 ? -4.751  20.842 -0.664  1.00 1.00 ? 27 ASN A HB3  7  
ATOM   4937  H HD21 . ASN A 1 27 ? -4.856  23.023 1.173   1.00 1.00 ? 27 ASN A HD21 7  
ATOM   4938  H HD22 . ASN A 1 27 ? -6.417  23.821 0.938   1.00 1.00 ? 27 ASN A HD22 7  
ATOM   4939  N N    . LEU A 1 28 ? -6.223  19.065 -2.166  1.00 1.00 ? 28 LEU A N    7  
ATOM   4940  C CA   . LEU A 1 28 ? -6.926  18.847 -3.425  1.00 1.00 ? 28 LEU A CA   7  
ATOM   4941  C C    . LEU A 1 28 ? -7.291  17.372 -3.590  1.00 1.00 ? 28 LEU A C    7  
ATOM   4942  O O    . LEU A 1 28 ? -8.469  17.052 -3.740  1.00 1.00 ? 28 LEU A O    7  
ATOM   4943  C CB   . LEU A 1 28 ? -6.096  19.344 -4.619  1.00 1.00 ? 28 LEU A CB   7  
ATOM   4944  C CG   . LEU A 1 28 ? -6.180  20.861 -4.863  1.00 1.00 ? 28 LEU A CG   7  
ATOM   4945  C CD1  . LEU A 1 28 ? -5.719  21.706 -3.670  1.00 1.00 ? 28 LEU A CD1  7  
ATOM   4946  C CD2  . LEU A 1 28 ? -5.324  21.213 -6.084  1.00 1.00 ? 28 LEU A CD2  7  
ATOM   4947  H H    . LEU A 1 28 ? -5.230  19.268 -2.221  1.00 1.00 ? 28 LEU A H    7  
ATOM   4948  H HA   . LEU A 1 28 ? -7.859  19.414 -3.409  1.00 1.00 ? 28 LEU A HA   7  
ATOM   4949  H HB2  . LEU A 1 28 ? -5.060  19.027 -4.521  1.00 1.00 ? 28 LEU A HB2  7  
ATOM   4950  H HB3  . LEU A 1 28 ? -6.494  18.863 -5.511  1.00 1.00 ? 28 LEU A HB3  7  
ATOM   4951  H HG   . LEU A 1 28 ? -7.215  21.123 -5.086  1.00 1.00 ? 28 LEU A HG   7  
ATOM   4952  H HD11 . LEU A 1 28 ? -4.712  21.419 -3.375  1.00 1.00 ? 28 LEU A HD11 7  
ATOM   4953  H HD12 . LEU A 1 28 ? -5.719  22.761 -3.946  1.00 1.00 ? 28 LEU A HD12 7  
ATOM   4954  H HD13 . LEU A 1 28 ? -6.400  21.579 -2.829  1.00 1.00 ? 28 LEU A HD13 7  
ATOM   4955  H HD21 . LEU A 1 28 ? -5.662  20.645 -6.952  1.00 1.00 ? 28 LEU A HD21 7  
ATOM   4956  H HD22 . LEU A 1 28 ? -5.413  22.277 -6.306  1.00 1.00 ? 28 LEU A HD22 7  
ATOM   4957  H HD23 . LEU A 1 28 ? -4.277  20.977 -5.888  1.00 1.00 ? 28 LEU A HD23 7  
ATOM   4958  N N    . GLU A 1 29 ? -6.307  16.465 -3.535  1.00 1.00 ? 29 GLU A N    7  
ATOM   4959  C CA   . GLU A 1 29 ? -6.606  15.039 -3.467  1.00 1.00 ? 29 GLU A CA   7  
ATOM   4960  C C    . GLU A 1 29 ? -6.730  14.685 -1.984  1.00 1.00 ? 29 GLU A C    7  
ATOM   4961  O O    . GLU A 1 29 ? -6.572  15.551 -1.129  1.00 1.00 ? 29 GLU A O    7  
ATOM   4962  C CB   . GLU A 1 29 ? -5.632  14.195 -4.313  1.00 1.00 ? 29 GLU A CB   7  
ATOM   4963  C CG   . GLU A 1 29 ? -4.127  14.381 -4.073  1.00 1.00 ? 29 GLU A CG   7  
ATOM   4964  C CD   . GLU A 1 29 ? -3.290  13.637 -5.112  1.00 1.00 ? 29 GLU A CD   7  
ATOM   4965  O OE1  . GLU A 1 29 ? -3.834  12.832 -5.862  1.00 1.00 ? 29 GLU A OE1  7  
ATOM   4966  O OE2  . GLU A 1 29 ? -1.952  13.912 -5.161  1.00 1.00 ? 29 GLU A OE2  7  
ATOM   4967  H H    . GLU A 1 29 ? -5.399  16.759 -3.185  1.00 1.00 ? 29 GLU A H    7  
ATOM   4968  H HA   . GLU A 1 29 ? -7.587  14.846 -3.903  1.00 1.00 ? 29 GLU A HA   7  
ATOM   4969  H HB2  . GLU A 1 29 ? -5.878  13.140 -4.187  1.00 1.00 ? 29 GLU A HB2  7  
ATOM   4970  H HB3  . GLU A 1 29 ? -5.828  14.454 -5.356  1.00 1.00 ? 29 GLU A HB3  7  
ATOM   4971  H HG2  . GLU A 1 29 ? -3.877  15.438 -4.143  1.00 1.00 ? 29 GLU A HG2  7  
ATOM   4972  H HG3  . GLU A 1 29 ? -3.874  13.992 -3.089  1.00 1.00 ? 29 GLU A HG3  7  
ATOM   4973  H HE2  . GLU A 1 29 ? -1.688  14.529 -4.474  1.00 1.00 ? 29 GLU A HE2  7  
ATOM   4974  N N    . LYS A 1 30 ? -7.135  13.461 -1.646  1.00 1.00 ? 30 LYS A N    7  
ATOM   4975  C CA   . LYS A 1 30 ? -7.527  13.098 -0.281  1.00 1.00 ? 30 LYS A CA   7  
ATOM   4976  C C    . LYS A 1 30 ? -6.529  12.181 0.430   1.00 1.00 ? 30 LYS A C    7  
ATOM   4977  O O    . LYS A 1 30 ? -6.874  11.574 1.445   1.00 1.00 ? 30 LYS A O    7  
ATOM   4978  C CB   . LYS A 1 30 ? -8.993  12.642 -0.259  1.00 1.00 ? 30 LYS A CB   7  
ATOM   4979  C CG   . LYS A 1 30 ? -9.954  13.750 -0.752  1.00 1.00 ? 30 LYS A CG   7  
ATOM   4980  C CD   . LYS A 1 30 ? -10.519 14.707 0.320   1.00 1.00 ? 30 LYS A CD   7  
ATOM   4981  C CE   . LYS A 1 30 ? -9.526  15.509 1.183   1.00 1.00 ? 30 LYS A CE   7  
ATOM   4982  N NZ   . LYS A 1 30 ? -8.614  16.384 0.412   1.00 1.00 ? 30 LYS A NZ   7  
ATOM   4983  H H    . LYS A 1 30 ? -7.284  12.779 -2.377  1.00 1.00 ? 30 LYS A H    7  
ATOM   4984  H HA   . LYS A 1 30 ? -7.482  13.979 0.348   1.00 1.00 ? 30 LYS A HA   7  
ATOM   4985  H HB2  . LYS A 1 30 ? -9.084  11.775 -0.916  1.00 1.00 ? 30 LYS A HB2  7  
ATOM   4986  H HB3  . LYS A 1 30 ? -9.284  12.339 0.747   1.00 1.00 ? 30 LYS A HB3  7  
ATOM   4987  H HG2  . LYS A 1 30 ? -9.518  14.324 -1.570  1.00 1.00 ? 30 LYS A HG2  7  
ATOM   4988  H HG3  . LYS A 1 30 ? -10.820 13.234 -1.175  1.00 1.00 ? 30 LYS A HG3  7  
ATOM   4989  H HD2  . LYS A 1 30 ? -11.189 15.410 -0.182  1.00 1.00 ? 30 LYS A HD2  7  
ATOM   4990  H HD3  . LYS A 1 30 ? -11.133 14.112 0.999   1.00 1.00 ? 30 LYS A HD3  7  
ATOM   4991  H HE2  . LYS A 1 30 ? -10.095 16.138 1.871   1.00 1.00 ? 30 LYS A HE2  7  
ATOM   4992  H HE3  . LYS A 1 30 ? -8.938  14.818 1.787   1.00 1.00 ? 30 LYS A HE3  7  
ATOM   4993  H HZ1  . LYS A 1 30 ? -8.121  15.875 -0.306  1.00 1.00 ? 30 LYS A HZ1  7  
ATOM   4994  H HZ2  . LYS A 1 30 ? -9.041  17.191 -0.034  1.00 1.00 ? 30 LYS A HZ2  7  
ATOM   4995  H HZ3  . LYS A 1 30 ? -7.877  16.741 1.011   1.00 1.00 ? 30 LYS A HZ3  7  
ATOM   4996  N N    . ALA A 1 31 ? -5.322  12.045 -0.130  1.00 1.00 ? 31 ALA A N    7  
ATOM   4997  C CA   . ALA A 1 31 ? -4.161  11.403 0.488   1.00 1.00 ? 31 ALA A CA   7  
ATOM   4998  C C    . ALA A 1 31 ? -3.987  11.778 1.969   1.00 1.00 ? 31 ALA A C    7  
ATOM   4999  O O    . ALA A 1 31 ? -4.539  12.777 2.430   1.00 1.00 ? 31 ALA A O    7  
ATOM   5000  C CB   . ALA A 1 31 ? -2.924  11.869 -0.276  1.00 1.00 ? 31 ALA A CB   7  
ATOM   5001  H H    . ALA A 1 31 ? -5.152  12.569 -0.974  1.00 1.00 ? 31 ALA A H    7  
ATOM   5002  H HA   . ALA A 1 31 ? -4.263  10.322 0.390   1.00 1.00 ? 31 ALA A HA   7  
ATOM   5003  H HB1  . ALA A 1 31 ? -3.035  11.660 -1.339  1.00 1.00 ? 31 ALA A HB1  7  
ATOM   5004  H HB2  . ALA A 1 31 ? -2.826  12.945 -0.139  1.00 1.00 ? 31 ALA A HB2  7  
ATOM   5005  H HB3  . ALA A 1 31 ? -2.027  11.381 0.108   1.00 1.00 ? 31 ALA A HB3  7  
ATOM   5006  N N    . ARG A 1 32 ? -3.218  10.978 2.719   1.00 1.00 ? 32 ARG A N    7  
ATOM   5007  C CA   . ARG A 1 32 ? -3.020  11.198 4.148   1.00 1.00 ? 32 ARG A CA   7  
ATOM   5008  C C    . ARG A 1 32 ? -1.933  12.238 4.401   1.00 1.00 ? 32 ARG A C    7  
ATOM   5009  O O    . ARG A 1 32 ? -2.255  13.354 4.796   1.00 1.00 ? 32 ARG A O    7  
ATOM   5010  C CB   . ARG A 1 32 ? -2.727  9.872  4.880   1.00 1.00 ? 32 ARG A CB   7  
ATOM   5011  C CG   . ARG A 1 32 ? -3.814  8.789  4.764   1.00 1.00 ? 32 ARG A CG   7  
ATOM   5012  C CD   . ARG A 1 32 ? -5.022  8.973  5.703   1.00 1.00 ? 32 ARG A CD   7  
ATOM   5013  N NE   . ARG A 1 32 ? -5.742  10.240 5.496   1.00 1.00 ? 32 ARG A NE   7  
ATOM   5014  C CZ   . ARG A 1 32 ? -6.335  10.613 4.351   1.00 1.00 ? 32 ARG A CZ   7  
ATOM   5015  N NH1  . ARG A 1 32 ? -6.539  9.725  3.375   1.00 1.00 ? 32 ARG A NH1  7  
ATOM   5016  N NH2  . ARG A 1 32 ? -6.688  11.884 4.158   1.00 1.00 ? 32 ARG A NH2  7  
ATOM   5017  H H    . ARG A 1 32 ? -2.720  10.219 2.276   1.00 1.00 ? 32 ARG A H    7  
ATOM   5018  H HA   . ARG A 1 32 ? -3.906  11.666 4.568   1.00 1.00 ? 32 ARG A HA   7  
ATOM   5019  H HB2  . ARG A 1 32 ? -1.813  9.446  4.461   1.00 1.00 ? 32 ARG A HB2  7  
ATOM   5020  H HB3  . ARG A 1 32 ? -2.546  10.079 5.936   1.00 1.00 ? 32 ARG A HB3  7  
ATOM   5021  H HG2  . ARG A 1 32 ? -4.127  8.698  3.726   1.00 1.00 ? 32 ARG A HG2  7  
ATOM   5022  H HG3  . ARG A 1 32 ? -3.346  7.842  5.041   1.00 1.00 ? 32 ARG A HG3  7  
ATOM   5023  H HD2  . ARG A 1 32 ? -5.709  8.131  5.588   1.00 1.00 ? 32 ARG A HD2  7  
ATOM   5024  H HD3  . ARG A 1 32 ? -4.660  8.952  6.733   1.00 1.00 ? 32 ARG A HD3  7  
ATOM   5025  H HE   . ARG A 1 32 ? -5.679  10.912 6.249   1.00 1.00 ? 32 ARG A HE   7  
ATOM   5026  H HH11 . ARG A 1 32 ? -6.317  8.752  3.512   1.00 1.00 ? 32 ARG A HH11 7  
ATOM   5027  H HH12 . ARG A 1 32 ? -6.879  10.058 2.476   1.00 1.00 ? 32 ARG A HH12 7  
ATOM   5028  H HH21 . ARG A 1 32 ? -6.496  12.600 4.841   1.00 1.00 ? 32 ARG A HH21 7  
ATOM   5029  H HH22 . ARG A 1 32 ? -6.898  12.163 3.201   1.00 1.00 ? 32 ARG A HH22 7  
ATOM   5030  N N    . HIS A 1 33 ? -0.660  11.862 4.254   1.00 1.00 ? 33 HIS A N    7  
ATOM   5031  C CA   . HIS A 1 33 ? 0.452   12.800 4.282   1.00 1.00 ? 33 HIS A CA   7  
ATOM   5032  C C    . HIS A 1 33 ? 1.025   12.984 2.879   1.00 1.00 ? 33 HIS A C    7  
ATOM   5033  O O    . HIS A 1 33 ? 0.938   12.095 2.029   1.00 1.00 ? 33 HIS A O    7  
ATOM   5034  C CB   . HIS A 1 33 ? 1.503   12.396 5.325   1.00 1.00 ? 33 HIS A CB   7  
ATOM   5035  C CG   . HIS A 1 33 ? 1.987   10.972 5.247   1.00 1.00 ? 33 HIS A CG   7  
ATOM   5036  N ND1  . HIS A 1 33 ? 1.248   9.913  5.750   1.00 1.00 ? 33 HIS A ND1  7  
ATOM   5037  C CD2  . HIS A 1 33 ? 3.174   10.420 4.828   1.00 1.00 ? 33 HIS A CD2  7  
ATOM   5038  C CE1  . HIS A 1 33 ? 1.987   8.803  5.600   1.00 1.00 ? 33 HIS A CE1  7  
ATOM   5039  N NE2  . HIS A 1 33 ? 3.171   9.044  5.034   1.00 1.00 ? 33 HIS A NE2  7  
ATOM   5040  H H    . HIS A 1 33 ? -0.468  10.959 3.842   1.00 1.00 ? 33 HIS A H    7  
ATOM   5041  H HA   . HIS A 1 33 ? 0.095   13.781 4.598   1.00 1.00 ? 33 HIS A HA   7  
ATOM   5042  H HB2  . HIS A 1 33 ? 2.363   13.062 5.241   1.00 1.00 ? 33 HIS A HB2  7  
ATOM   5043  H HB3  . HIS A 1 33 ? 1.068   12.541 6.315   1.00 1.00 ? 33 HIS A HB3  7  
ATOM   5044  H HD1  . HIS A 1 33 ? 0.335   9.969  6.175   1.00 1.00 ? 33 HIS A HD1  7  
ATOM   5045  H HD2  . HIS A 1 33 ? 4.006   10.980 4.427   1.00 1.00 ? 33 HIS A HD2  7  
ATOM   5046  H HE1  . HIS A 1 33 ? 1.657   7.824  5.914   1.00 1.00 ? 33 HIS A HE1  7  
ATOM   5047  N N    . GLY A 1 34 ? 1.648   14.141 2.659   1.00 1.00 ? 34 GLY A N    7  
ATOM   5048  C CA   . GLY A 1 34 ? 2.440   14.430 1.482   1.00 1.00 ? 34 GLY A CA   7  
ATOM   5049  C C    . GLY A 1 34 ? 3.717   15.103 1.948   1.00 1.00 ? 34 GLY A C    7  
ATOM   5050  O O    . GLY A 1 34 ? 3.746   15.645 3.052   1.00 1.00 ? 34 GLY A O    7  
ATOM   5051  H H    . GLY A 1 34 ? 1.741   14.799 3.420   1.00 1.00 ? 34 GLY A H    7  
ATOM   5052  H HA2  . GLY A 1 34 ? 2.722   13.501 1.012   1.00 1.00 ? 34 GLY A HA2  7  
ATOM   5053  H HA3  . GLY A 1 34 ? 1.887   15.054 0.782   1.00 1.00 ? 34 GLY A HA3  7  
ATOM   5054  N N    . SER A 1 35 ? 4.792   15.026 1.167   1.00 1.00 ? 35 SER A N    7  
ATOM   5055  C CA   . SER A 1 35 ? 6.107   15.500 1.574   1.00 1.00 ? 35 SER A CA   7  
ATOM   5056  C C    . SER A 1 35 ? 7.043   15.271 0.391   1.00 1.00 ? 35 SER A C    7  
ATOM   5057  O O    . SER A 1 35 ? 7.532   14.160 0.181   1.00 1.00 ? 35 SER A O    7  
ATOM   5058  C CB   . SER A 1 35 ? 6.617   14.767 2.841   1.00 1.00 ? 35 SER A CB   7  
ATOM   5059  O OG   . SER A 1 35 ? 6.875   15.671 3.909   1.00 1.00 ? 35 SER A OG   7  
ATOM   5060  H H    . SER A 1 35 ? 4.722   14.571 0.254   1.00 1.00 ? 35 SER A H    7  
ATOM   5061  H HA   . SER A 1 35 ? 6.042   16.576 1.772   1.00 1.00 ? 35 SER A HA   7  
ATOM   5062  H HB2  . SER A 1 35 ? 5.898   14.021 3.184   1.00 1.00 ? 35 SER A HB2  7  
ATOM   5063  H HB3  . SER A 1 35 ? 7.548   14.238 2.623   1.00 1.00 ? 35 SER A HB3  7  
ATOM   5064  H HG   . SER A 1 35 ? 7.333   15.178 4.603   1.00 1.00 ? 35 SER A HG   7  
ATOM   5065  N N    . CYS A 1 36 ? 7.306   16.338 -0.357  1.00 1.00 ? 36 CYS A N    7  
ATOM   5066  C CA   . CYS A 1 36 ? 8.241   16.300 -1.462  1.00 1.00 ? 36 CYS A CA   7  
ATOM   5067  C C    . CYS A 1 36 ? 9.669   16.234 -0.927  1.00 1.00 ? 36 CYS A C    7  
ATOM   5068  O O    . CYS A 1 36 ? 9.969   16.793 0.129   1.00 1.00 ? 36 CYS A O    7  
ATOM   5069  C CB   . CYS A 1 36 ? 8.064   17.553 -2.311  1.00 1.00 ? 36 CYS A CB   7  
ATOM   5070  S SG   . CYS A 1 36 ? 9.412   17.896 -3.443  1.00 1.00 ? 36 CYS A SG   7  
ATOM   5071  H H    . CYS A 1 36 ? 6.868   17.216 -0.124  1.00 1.00 ? 36 CYS A H    7  
ATOM   5072  H HA   . CYS A 1 36 ? 8.040   15.427 -2.085  1.00 1.00 ? 36 CYS A HA   7  
ATOM   5073  H HB2  . CYS A 1 36 ? 7.140   17.482 -2.874  1.00 1.00 ? 36 CYS A HB2  7  
ATOM   5074  H HB3  . CYS A 1 36 ? 8.006   18.432 -1.682  1.00 1.00 ? 36 CYS A HB3  7  
ATOM   5075  N N    . ASN A 1 37 ? 10.517  15.517 -1.667  1.00 1.00 ? 37 ASN A N    7  
ATOM   5076  C CA   . ASN A 1 37 ? 11.922  15.275 -1.388  1.00 1.00 ? 37 ASN A CA   7  
ATOM   5077  C C    . ASN A 1 37 ? 12.724  15.666 -2.632  1.00 1.00 ? 37 ASN A C    7  
ATOM   5078  O O    . ASN A 1 37 ? 12.147  15.866 -3.704  1.00 1.00 ? 37 ASN A O    7  
ATOM   5079  C CB   . ASN A 1 37 ? 12.097  13.780 -1.073  1.00 1.00 ? 37 ASN A CB   7  
ATOM   5080  C CG   . ASN A 1 37 ? 13.574  13.409 -0.987  1.00 1.00 ? 37 ASN A CG   7  
ATOM   5081  O OD1  . ASN A 1 37 ? 14.335  14.069 -0.287  1.00 1.00 ? 37 ASN A OD1  7  
ATOM   5082  N ND2  . ASN A 1 37 ? 14.018  12.439 -1.778  1.00 1.00 ? 37 ASN A ND2  7  
ATOM   5083  H H    . ASN A 1 37 ? 10.184  15.168 -2.555  1.00 1.00 ? 37 ASN A H    7  
ATOM   5084  H HA   . ASN A 1 37 ? 12.259  15.874 -0.540  1.00 1.00 ? 37 ASN A HA   7  
ATOM   5085  H HB2  . ASN A 1 37 ? 11.607  13.550 -0.127  1.00 1.00 ? 37 ASN A HB2  7  
ATOM   5086  H HB3  . ASN A 1 37 ? 11.614  13.194 -1.858  1.00 1.00 ? 37 ASN A HB3  7  
ATOM   5087  H HD21 . ASN A 1 37 ? 13.391  11.928 -2.377  1.00 1.00 ? 37 ASN A HD21 7  
ATOM   5088  H HD22 . ASN A 1 37 ? 15.009  12.241 -1.779  1.00 1.00 ? 37 ASN A HD22 7  
ATOM   5089  N N    . TYR A 1 38 ? 14.051  15.774 -2.520  1.00 1.00 ? 38 TYR A N    7  
ATOM   5090  C CA   . TYR A 1 38 ? 14.921  15.921 -3.676  1.00 1.00 ? 38 TYR A CA   7  
ATOM   5091  C C    . TYR A 1 38 ? 15.051  14.578 -4.397  1.00 1.00 ? 38 TYR A C    7  
ATOM   5092  O O    . TYR A 1 38 ? 16.109  13.954 -4.425  1.00 1.00 ? 38 TYR A O    7  
ATOM   5093  C CB   . TYR A 1 38 ? 16.280  16.504 -3.260  1.00 1.00 ? 38 TYR A CB   7  
ATOM   5094  C CG   . TYR A 1 38 ? 17.194  16.781 -4.440  1.00 1.00 ? 38 TYR A CG   7  
ATOM   5095  C CD1  . TYR A 1 38 ? 16.824  17.758 -5.383  1.00 1.00 ? 38 TYR A CD1  7  
ATOM   5096  C CD2  . TYR A 1 38 ? 18.297  15.945 -4.702  1.00 1.00 ? 38 TYR A CD2  7  
ATOM   5097  C CE1  . TYR A 1 38 ? 17.501  17.847 -6.608  1.00 1.00 ? 38 TYR A CE1  7  
ATOM   5098  C CE2  . TYR A 1 38 ? 18.970  16.030 -5.933  1.00 1.00 ? 38 TYR A CE2  7  
ATOM   5099  C CZ   . TYR A 1 38 ? 18.540  16.949 -6.904  1.00 1.00 ? 38 TYR A CZ   7  
ATOM   5100  O OH   . TYR A 1 38 ? 19.114  16.949 -8.138  1.00 1.00 ? 38 TYR A OH   7  
ATOM   5101  H H    . TYR A 1 38 ? 14.482  15.568 -1.623  1.00 1.00 ? 38 TYR A H    7  
ATOM   5102  H HA   . TYR A 1 38 ? 14.456  16.597 -4.397  1.00 1.00 ? 38 TYR A HA   7  
ATOM   5103  H HB2  . TYR A 1 38 ? 16.119  17.444 -2.732  1.00 1.00 ? 38 TYR A HB2  7  
ATOM   5104  H HB3  . TYR A 1 38 ? 16.768  15.815 -2.570  1.00 1.00 ? 38 TYR A HB3  7  
ATOM   5105  H HD1  . TYR A 1 38 ? 15.999  18.422 -5.183  1.00 1.00 ? 38 TYR A HD1  7  
ATOM   5106  H HD2  . TYR A 1 38 ? 18.596  15.197 -3.982  1.00 1.00 ? 38 TYR A HD2  7  
ATOM   5107  H HE1  . TYR A 1 38 ? 17.206  18.601 -7.323  1.00 1.00 ? 38 TYR A HE1  7  
ATOM   5108  H HE2  . TYR A 1 38 ? 19.796  15.368 -6.144  1.00 1.00 ? 38 TYR A HE2  7  
ATOM   5109  H HH   . TYR A 1 38 ? 18.565  17.431 -8.769  1.00 1.00 ? 38 TYR A HH   7  
ATOM   5110  N N    . VAL A 1 39 ? 13.955  14.127 -5.004  1.00 1.00 ? 39 VAL A N    7  
ATOM   5111  C CA   . VAL A 1 39 ? 14.015  12.995 -5.908  1.00 1.00 ? 39 VAL A CA   7  
ATOM   5112  C C    . VAL A 1 39 ? 14.647  13.529 -7.190  1.00 1.00 ? 39 VAL A C    7  
ATOM   5113  O O    . VAL A 1 39 ? 13.958  14.177 -7.973  1.00 1.00 ? 39 VAL A O    7  
ATOM   5114  C CB   . VAL A 1 39 ? 12.615  12.407 -6.151  1.00 1.00 ? 39 VAL A CB   7  
ATOM   5115  C CG1  . VAL A 1 39 ? 12.710  11.193 -7.086  1.00 1.00 ? 39 VAL A CG1  7  
ATOM   5116  C CG2  . VAL A 1 39 ? 11.991  11.962 -4.825  1.00 1.00 ? 39 VAL A CG2  7  
ATOM   5117  H H    . VAL A 1 39 ? 13.102  14.670 -4.928  1.00 1.00 ? 39 VAL A H    7  
ATOM   5118  H HA   . VAL A 1 39 ? 14.643  12.209 -5.483  1.00 1.00 ? 39 VAL A HA   7  
ATOM   5119  H HB   . VAL A 1 39 ? 11.966  13.158 -6.603  1.00 1.00 ? 39 VAL A HB   7  
ATOM   5120  H HG11 . VAL A 1 39 ? 13.367  10.438 -6.651  1.00 1.00 ? 39 VAL A HG11 7  
ATOM   5121  H HG12 . VAL A 1 39 ? 11.721  10.757 -7.230  1.00 1.00 ? 39 VAL A HG12 7  
ATOM   5122  H HG13 . VAL A 1 39 ? 13.106  11.481 -8.059  1.00 1.00 ? 39 VAL A HG13 7  
ATOM   5123  H HG21 . VAL A 1 39 ? 12.660  11.269 -4.314  1.00 1.00 ? 39 VAL A HG21 7  
ATOM   5124  H HG22 . VAL A 1 39 ? 11.806  12.828 -4.191  1.00 1.00 ? 39 VAL A HG22 7  
ATOM   5125  H HG23 . VAL A 1 39 ? 11.044  11.460 -5.015  1.00 1.00 ? 39 VAL A HG23 7  
ATOM   5126  N N    . PHE A 1 40 ? 15.945  13.288 -7.386  1.00 1.00 ? 40 PHE A N    7  
ATOM   5127  C CA   . PHE A 1 40 ? 16.729  13.712 -8.546  1.00 1.00 ? 40 PHE A CA   7  
ATOM   5128  C C    . PHE A 1 40 ? 15.974  13.546 -9.885  1.00 1.00 ? 40 PHE A C    7  
ATOM   5129  O O    . PHE A 1 40 ? 15.132  12.653 -10.019 1.00 1.00 ? 40 PHE A O    7  
ATOM   5130  C CB   . PHE A 1 40 ? 18.038  12.902 -8.527  1.00 1.00 ? 40 PHE A CB   7  
ATOM   5131  C CG   . PHE A 1 40 ? 18.960  13.040 -9.724  1.00 1.00 ? 40 PHE A CG   7  
ATOM   5132  C CD1  . PHE A 1 40 ? 18.759  12.240 -10.867 1.00 1.00 ? 40 PHE A CD1  7  
ATOM   5133  C CD2  . PHE A 1 40 ? 20.048  13.933 -9.682  1.00 1.00 ? 40 PHE A CD2  7  
ATOM   5134  C CE1  . PHE A 1 40 ? 19.609  12.370 -11.978 1.00 1.00 ? 40 PHE A CE1  7  
ATOM   5135  C CE2  . PHE A 1 40 ? 20.897  14.063 -10.794 1.00 1.00 ? 40 PHE A CE2  7  
ATOM   5136  C CZ   . PHE A 1 40 ? 20.677  13.284 -11.943 1.00 1.00 ? 40 PHE A CZ   7  
ATOM   5137  H H    . PHE A 1 40 ? 16.437  12.847 -6.621  1.00 1.00 ? 40 PHE A H    7  
ATOM   5138  H HA   . PHE A 1 40 ? 16.963  14.764 -8.382  1.00 1.00 ? 40 PHE A HA   7  
ATOM   5139  H HB2  . PHE A 1 40 ? 18.596  13.199 -7.641  1.00 1.00 ? 40 PHE A HB2  7  
ATOM   5140  H HB3  . PHE A 1 40 ? 17.790  11.845 -8.430  1.00 1.00 ? 40 PHE A HB3  7  
ATOM   5141  H HD1  . PHE A 1 40 ? 17.954  11.519 -10.898 1.00 1.00 ? 40 PHE A HD1  7  
ATOM   5142  H HD2  . PHE A 1 40 ? 20.226  14.543 -8.807  1.00 1.00 ? 40 PHE A HD2  7  
ATOM   5143  H HE1  . PHE A 1 40 ? 19.452  11.759 -12.855 1.00 1.00 ? 40 PHE A HE1  7  
ATOM   5144  H HE2  . PHE A 1 40 ? 21.722  14.762 -10.763 1.00 1.00 ? 40 PHE A HE2  7  
ATOM   5145  H HZ   . PHE A 1 40 ? 21.335  13.382 -12.796 1.00 1.00 ? 40 PHE A HZ   7  
ATOM   5146  N N    . PRO A 1 41 ? 16.236  14.378 -10.907 1.00 1.00 ? 41 PRO A N    7  
ATOM   5147  C CA   . PRO A 1 41 ? 17.105  15.544 -10.875 1.00 1.00 ? 41 PRO A CA   7  
ATOM   5148  C C    . PRO A 1 41 ? 16.372  16.777 -10.348 1.00 1.00 ? 41 PRO A C    7  
ATOM   5149  O O    . PRO A 1 41 ? 16.972  17.584 -9.643  1.00 1.00 ? 41 PRO A O    7  
ATOM   5150  C CB   . PRO A 1 41 ? 17.560  15.740 -12.323 1.00 1.00 ? 41 PRO A CB   7  
ATOM   5151  C CG   . PRO A 1 41 ? 16.371  15.233 -13.139 1.00 1.00 ? 41 PRO A CG   7  
ATOM   5152  C CD   . PRO A 1 41 ? 15.806  14.105 -12.272 1.00 1.00 ? 41 PRO A CD   7  
ATOM   5153  H HA   . PRO A 1 41 ? 17.971  15.374 -10.242 1.00 1.00 ? 41 PRO A HA   7  
ATOM   5154  H HB2  . PRO A 1 41 ? 17.812  16.778 -12.550 1.00 1.00 ? 41 PRO A HB2  7  
ATOM   5155  H HB3  . PRO A 1 41 ? 18.422  15.100 -12.514 1.00 1.00 ? 41 PRO A HB3  7  
ATOM   5156  H HG2  . PRO A 1 41 ? 15.633  16.029 -13.249 1.00 1.00 ? 41 PRO A HG2  7  
ATOM   5157  H HG3  . PRO A 1 41 ? 16.676  14.878 -14.125 1.00 1.00 ? 41 PRO A HG3  7  
ATOM   5158  H HD2  . PRO A 1 41 ? 14.721  14.061 -12.359 1.00 1.00 ? 41 PRO A HD2  7  
ATOM   5159  H HD3  . PRO A 1 41 ? 16.237  13.154 -12.592 1.00 1.00 ? 41 PRO A HD3  7  
ATOM   5160  N N    . ALA A 1 42 ? 15.087  16.924 -10.684 1.00 1.00 ? 42 ALA A N    7  
ATOM   5161  C CA   . ALA A 1 42 ? 14.227  17.998 -10.207 1.00 1.00 ? 42 ALA A CA   7  
ATOM   5162  C C    . ALA A 1 42 ? 13.197  17.423 -9.235  1.00 1.00 ? 42 ALA A C    7  
ATOM   5163  O O    . ALA A 1 42 ? 12.750  16.285 -9.418  1.00 1.00 ? 42 ALA A O    7  
ATOM   5164  C CB   . ALA A 1 42 ? 13.537  18.665 -11.399 1.00 1.00 ? 42 ALA A CB   7  
ATOM   5165  H H    . ALA A 1 42 ? 14.660  16.217 -11.259 1.00 1.00 ? 42 ALA A H    7  
ATOM   5166  H HA   . ALA A 1 42 ? 14.819  18.758 -9.693  1.00 1.00 ? 42 ALA A HA   7  
ATOM   5167  H HB1  . ALA A 1 42 ? 14.287  19.061 -12.084 1.00 1.00 ? 42 ALA A HB1  7  
ATOM   5168  H HB2  . ALA A 1 42 ? 12.913  17.942 -11.926 1.00 1.00 ? 42 ALA A HB2  7  
ATOM   5169  H HB3  . ALA A 1 42 ? 12.911  19.486 -11.047 1.00 1.00 ? 42 ALA A HB3  7  
ATOM   5170  N N    . HIS A 1 43 ? 12.803  18.229 -8.241  1.00 1.00 ? 43 HIS A N    7  
ATOM   5171  C CA   . HIS A 1 43 ? 11.929  17.833 -7.146  1.00 1.00 ? 43 HIS A CA   7  
ATOM   5172  C C    . HIS A 1 43 ? 10.553  17.442 -7.691  1.00 1.00 ? 43 HIS A C    7  
ATOM   5173  O O    . HIS A 1 43 ? 10.005  18.150 -8.531  1.00 1.00 ? 43 HIS A O    7  
ATOM   5174  C CB   . HIS A 1 43 ? 11.701  19.040 -6.230  1.00 1.00 ? 43 HIS A CB   7  
ATOM   5175  C CG   . HIS A 1 43 ? 12.784  19.331 -5.231  1.00 1.00 ? 43 HIS A CG   7  
ATOM   5176  N ND1  . HIS A 1 43 ? 12.875  18.637 -4.036  1.00 1.00 ? 43 HIS A ND1  7  
ATOM   5177  C CD2  . HIS A 1 43 ? 13.746  20.308 -5.161  1.00 1.00 ? 43 HIS A CD2  7  
ATOM   5178  C CE1  . HIS A 1 43 ? 13.842  19.219 -3.309  1.00 1.00 ? 43 HIS A CE1  7  
ATOM   5179  N NE2  . HIS A 1 43 ? 14.424  20.236 -3.948  1.00 1.00 ? 43 HIS A NE2  7  
ATOM   5180  H H    . HIS A 1 43 ? 13.192  19.159 -8.206  1.00 1.00 ? 43 HIS A H    7  
ATOM   5181  H HA   . HIS A 1 43 ? 12.386  17.018 -6.573  1.00 1.00 ? 43 HIS A HA   7  
ATOM   5182  H HB2  . HIS A 1 43 ? 11.478  19.935 -6.811  1.00 1.00 ? 43 HIS A HB2  7  
ATOM   5183  H HB3  . HIS A 1 43 ? 10.818  18.820 -5.648  1.00 1.00 ? 43 HIS A HB3  7  
ATOM   5184  H HD1  . HIS A 1 43 ? 12.324  17.827 -3.770  1.00 1.00 ? 43 HIS A HD1  7  
ATOM   5185  H HD2  . HIS A 1 43 ? 13.920  21.058 -5.919  1.00 1.00 ? 43 HIS A HD2  7  
ATOM   5186  H HE1  . HIS A 1 43 ? 14.130  18.888 -2.322  1.00 1.00 ? 43 HIS A HE1  7  
ATOM   5187  N N    . LYS A 1 44 ? 9.973   16.357 -7.177  1.00 1.00 ? 44 LYS A N    7  
ATOM   5188  C CA   . LYS A 1 44 ? 8.680   15.828 -7.602  1.00 1.00 ? 44 LYS A CA   7  
ATOM   5189  C C    . LYS A 1 44 ? 7.746   15.842 -6.398  1.00 1.00 ? 44 LYS A C    7  
ATOM   5190  O O    . LYS A 1 44 ? 8.186   15.557 -5.283  1.00 1.00 ? 44 LYS A O    7  
ATOM   5191  C CB   . LYS A 1 44 ? 8.864   14.395 -8.112  1.00 1.00 ? 44 LYS A CB   7  
ATOM   5192  C CG   . LYS A 1 44 ? 9.807   14.353 -9.320  1.00 1.00 ? 44 LYS A CG   7  
ATOM   5193  C CD   . LYS A 1 44 ? 10.258  12.913 -9.590  1.00 1.00 ? 44 LYS A CD   7  
ATOM   5194  C CE   . LYS A 1 44 ? 11.418  12.857 -10.596 1.00 1.00 ? 44 LYS A CE   7  
ATOM   5195  N NZ   . LYS A 1 44 ? 12.604  13.609 -10.133 1.00 1.00 ? 44 LYS A NZ   7  
ATOM   5196  H H    . LYS A 1 44 ? 10.412  15.899 -6.389  1.00 1.00 ? 44 LYS A H    7  
ATOM   5197  H HA   . LYS A 1 44 ? 8.248   16.434 -8.401  1.00 1.00 ? 44 LYS A HA   7  
ATOM   5198  H HB2  . LYS A 1 44 ? 9.290   13.805 -7.301  1.00 1.00 ? 44 LYS A HB2  7  
ATOM   5199  H HB3  . LYS A 1 44 ? 7.897   13.971 -8.387  1.00 1.00 ? 44 LYS A HB3  7  
ATOM   5200  H HG2  . LYS A 1 44 ? 9.306   14.772 -10.194 1.00 1.00 ? 44 LYS A HG2  7  
ATOM   5201  H HG3  . LYS A 1 44 ? 10.674  14.964 -9.096  1.00 1.00 ? 44 LYS A HG3  7  
ATOM   5202  H HD2  . LYS A 1 44 ? 10.572  12.448 -8.653  1.00 1.00 ? 44 LYS A HD2  7  
ATOM   5203  H HD3  . LYS A 1 44 ? 9.409   12.341 -9.972  1.00 1.00 ? 44 LYS A HD3  7  
ATOM   5204  H HE2  . LYS A 1 44 ? 11.702  11.810 -10.724 1.00 1.00 ? 44 LYS A HE2  7  
ATOM   5205  H HE3  . LYS A 1 44 ? 11.095  13.246 -11.563 1.00 1.00 ? 44 LYS A HE3  7  
ATOM   5206  H HZ1  . LYS A 1 44 ? 12.809  13.429 -9.157  1.00 1.00 ? 44 LYS A HZ1  7  
ATOM   5207  H HZ2  . LYS A 1 44 ? 13.447  13.322 -10.619 1.00 1.00 ? 44 LYS A HZ2  7  
ATOM   5208  H HZ3  . LYS A 1 44 ? 12.498  14.618 -10.188 1.00 1.00 ? 44 LYS A HZ3  7  
ATOM   5209  N N    . CYS A 1 45 ? 6.474   16.194 -6.596  1.00 1.00 ? 45 CYS A N    7  
ATOM   5210  C CA   . CYS A 1 45 ? 5.546   16.324 -5.486  1.00 1.00 ? 45 CYS A CA   7  
ATOM   5211  C C    . CYS A 1 45 ? 5.154   14.943 -4.971  1.00 1.00 ? 45 CYS A C    7  
ATOM   5212  O O    . CYS A 1 45 ? 4.115   14.409 -5.348  1.00 1.00 ? 45 CYS A O    7  
ATOM   5213  C CB   . CYS A 1 45 ? 4.329   17.171 -5.872  1.00 1.00 ? 45 CYS A CB   7  
ATOM   5214  S SG   . CYS A 1 45 ? 3.096   17.350 -4.548  1.00 1.00 ? 45 CYS A SG   7  
ATOM   5215  H H    . CYS A 1 45 ? 6.124   16.365 -7.534  1.00 1.00 ? 45 CYS A H    7  
ATOM   5216  H HA   . CYS A 1 45 ? 6.062   16.848 -4.688  1.00 1.00 ? 45 CYS A HA   7  
ATOM   5217  H HB2  . CYS A 1 45 ? 4.659   18.167 -6.170  1.00 1.00 ? 45 CYS A HB2  7  
ATOM   5218  H HB3  . CYS A 1 45 ? 3.833   16.715 -6.730  1.00 1.00 ? 45 CYS A HB3  7  
ATOM   5219  N N    . ILE A 1 46 ? 5.993   14.362 -4.109  1.00 1.00 ? 46 ILE A N    7  
ATOM   5220  C CA   . ILE A 1 46 ? 5.753   13.021 -3.600  1.00 1.00 ? 46 ILE A CA   7  
ATOM   5221  C C    . ILE A 1 46 ? 4.689   13.110 -2.511  1.00 1.00 ? 46 ILE A C    7  
ATOM   5222  O O    . ILE A 1 46 ? 4.858   13.806 -1.503  1.00 1.00 ? 46 ILE A O    7  
ATOM   5223  C CB   . ILE A 1 46 ? 7.024   12.356 -3.039  1.00 1.00 ? 46 ILE A CB   7  
ATOM   5224  C CG1  . ILE A 1 46 ? 8.251   12.414 -3.966  1.00 1.00 ? 46 ILE A CG1  7  
ATOM   5225  C CG2  . ILE A 1 46 ? 6.699   10.893 -2.699  1.00 1.00 ? 46 ILE A CG2  7  
ATOM   5226  C CD1  . ILE A 1 46 ? 7.960   11.959 -5.402  1.00 1.00 ? 46 ILE A CD1  7  
ATOM   5227  H H    . ILE A 1 46 ? 6.886   14.810 -3.945  1.00 1.00 ? 46 ILE A H    7  
ATOM   5228  H HA   . ILE A 1 46 ? 5.388   12.397 -4.415  1.00 1.00 ? 46 ILE A HA   7  
ATOM   5229  H HB   . ILE A 1 46 ? 7.306   12.858 -2.113  1.00 1.00 ? 46 ILE A HB   7  
ATOM   5230  H HG12 . ILE A 1 46 ? 8.649   13.427 -3.979  1.00 1.00 ? 46 ILE A HG12 7  
ATOM   5231  H HG13 . ILE A 1 46 ? 9.028   11.775 -3.547  1.00 1.00 ? 46 ILE A HG13 7  
ATOM   5232  H HG21 . ILE A 1 46 ? 6.347   10.369 -3.587  1.00 1.00 ? 46 ILE A HG21 7  
ATOM   5233  H HG22 . ILE A 1 46 ? 7.585   10.389 -2.313  1.00 1.00 ? 46 ILE A HG22 7  
ATOM   5234  H HG23 . ILE A 1 46 ? 5.916   10.834 -1.944  1.00 1.00 ? 46 ILE A HG23 7  
ATOM   5235  H HD11 . ILE A 1 46 ? 7.520   10.963 -5.412  1.00 1.00 ? 46 ILE A HD11 7  
ATOM   5236  H HD12 . ILE A 1 46 ? 7.284   12.659 -5.890  1.00 1.00 ? 46 ILE A HD12 7  
ATOM   5237  H HD13 . ILE A 1 46 ? 8.892   11.927 -5.962  1.00 1.00 ? 46 ILE A HD13 7  
ATOM   5238  N N    . CYS A 1 47 ? 3.592   12.383 -2.726  1.00 1.00 ? 47 CYS A N    7  
ATOM   5239  C CA   . CYS A 1 47 ? 2.509   12.257 -1.777  1.00 1.00 ? 47 CYS A CA   7  
ATOM   5240  C C    . CYS A 1 47 ? 2.256   10.785 -1.473  1.00 1.00 ? 47 CYS A C    7  
ATOM   5241  O O    . CYS A 1 47 ? 2.373   9.949  -2.364  1.00 1.00 ? 47 CYS A O    7  
ATOM   5242  C CB   . CYS A 1 47 ? 1.289   12.989 -2.299  1.00 1.00 ? 47 CYS A CB   7  
ATOM   5243  S SG   . CYS A 1 47 ? 0.088   13.233 -0.991  1.00 1.00 ? 47 CYS A SG   7  
ATOM   5244  H H    . CYS A 1 47 ? 3.497   11.868 -3.597  1.00 1.00 ? 47 CYS A H    7  
ATOM   5245  H HA   . CYS A 1 47 ? 2.811   12.732 -0.857  1.00 1.00 ? 47 CYS A HA   7  
ATOM   5246  H HB2  . CYS A 1 47 ? 1.588   13.975 -2.654  1.00 1.00 ? 47 CYS A HB2  7  
ATOM   5247  H HB3  . CYS A 1 47 ? 0.846   12.437 -3.127  1.00 1.00 ? 47 CYS A HB3  7  
ATOM   5248  N N    . TYR A 1 48 ? 1.959   10.458 -0.212  1.00 1.00 ? 48 TYR A N    7  
ATOM   5249  C CA   . TYR A 1 48 ? 1.941   9.086  0.270   1.00 1.00 ? 48 TYR A CA   7  
ATOM   5250  C C    . TYR A 1 48 ? 0.501   8.619  0.465   1.00 1.00 ? 48 TYR A C    7  
ATOM   5251  O O    . TYR A 1 48 ? -0.156  9.014  1.430   1.00 1.00 ? 48 TYR A O    7  
ATOM   5252  C CB   . TYR A 1 48 ? 2.771   9.028  1.562   1.00 1.00 ? 48 TYR A CB   7  
ATOM   5253  C CG   . TYR A 1 48 ? 4.166   9.611  1.412   1.00 1.00 ? 48 TYR A CG   7  
ATOM   5254  C CD1  . TYR A 1 48 ? 4.362   10.992 1.582   1.00 1.00 ? 48 TYR A CD1  7  
ATOM   5255  C CD2  . TYR A 1 48 ? 5.230   8.812  0.955   1.00 1.00 ? 48 TYR A CD2  7  
ATOM   5256  C CE1  . TYR A 1 48 ? 5.577   11.583 1.205   1.00 1.00 ? 48 TYR A CE1  7  
ATOM   5257  C CE2  . TYR A 1 48 ? 6.465   9.401  0.623   1.00 1.00 ? 48 TYR A CE2  7  
ATOM   5258  C CZ   . TYR A 1 48 ? 6.627   10.794 0.715   1.00 1.00 ? 48 TYR A CZ   7  
ATOM   5259  O OH   . TYR A 1 48 ? 7.791   11.382 0.320   1.00 1.00 ? 48 TYR A OH   7  
ATOM   5260  H H    . TYR A 1 48 ? 1.756   11.181 0.475   1.00 1.00 ? 48 TYR A H    7  
ATOM   5261  H HA   . TYR A 1 48 ? 2.435   8.423  -0.443  1.00 1.00 ? 48 TYR A HA   7  
ATOM   5262  H HB2  . TYR A 1 48 ? 2.242   9.578  2.340   1.00 1.00 ? 48 TYR A HB2  7  
ATOM   5263  H HB3  . TYR A 1 48 ? 2.862   7.994  1.885   1.00 1.00 ? 48 TYR A HB3  7  
ATOM   5264  H HD1  . TYR A 1 48 ? 3.566   11.605 1.971   1.00 1.00 ? 48 TYR A HD1  7  
ATOM   5265  H HD2  . TYR A 1 48 ? 5.096   7.745  0.854   1.00 1.00 ? 48 TYR A HD2  7  
ATOM   5266  H HE1  . TYR A 1 48 ? 5.699   12.647 1.274   1.00 1.00 ? 48 TYR A HE1  7  
ATOM   5267  H HE2  . TYR A 1 48 ? 7.283   8.791  0.275   1.00 1.00 ? 48 TYR A HE2  7  
ATOM   5268  H HH   . TYR A 1 48 ? 7.735   12.346 0.273   1.00 1.00 ? 48 TYR A HH   7  
ATOM   5269  N N    . PHE A 1 49 ? -0.012  7.797  -0.458  1.00 1.00 ? 49 PHE A N    7  
ATOM   5270  C CA   . PHE A 1 49 ? -1.378  7.304  -0.374  1.00 1.00 ? 49 PHE A CA   7  
ATOM   5271  C C    . PHE A 1 49 ? -1.343  5.942  0.318   1.00 1.00 ? 49 PHE A C    7  
ATOM   5272  O O    . PHE A 1 49 ? -0.418  5.172  0.069   1.00 1.00 ? 49 PHE A O    7  
ATOM   5273  C CB   . PHE A 1 49 ? -2.002  7.115  -1.761  1.00 1.00 ? 49 PHE A CB   7  
ATOM   5274  C CG   . PHE A 1 49 ? -1.907  8.229  -2.789  1.00 1.00 ? 49 PHE A CG   7  
ATOM   5275  C CD1  . PHE A 1 49 ? -1.522  9.539  -2.442  1.00 1.00 ? 49 PHE A CD1  7  
ATOM   5276  C CD2  . PHE A 1 49 ? -2.373  7.968  -4.091  1.00 1.00 ? 49 PHE A CD2  7  
ATOM   5277  C CE1  . PHE A 1 49 ? -1.570  10.564 -3.399  1.00 1.00 ? 49 PHE A CE1  7  
ATOM   5278  C CE2  . PHE A 1 49 ? -2.459  9.002  -5.036  1.00 1.00 ? 49 PHE A CE2  7  
ATOM   5279  C CZ   . PHE A 1 49 ? -2.044  10.298 -4.690  1.00 1.00 ? 49 PHE A CZ   7  
ATOM   5280  H H    . PHE A 1 49 ? 0.564   7.455  -1.223  1.00 1.00 ? 49 PHE A H    7  
ATOM   5281  H HA   . PHE A 1 49 ? -1.988  8.019  0.177   1.00 1.00 ? 49 PHE A HA   7  
ATOM   5282  H HB2  . PHE A 1 49 ? -1.596  6.201  -2.180  1.00 1.00 ? 49 PHE A HB2  7  
ATOM   5283  H HB3  . PHE A 1 49 ? -3.060  6.922  -1.620  1.00 1.00 ? 49 PHE A HB3  7  
ATOM   5284  H HD1  . PHE A 1 49 ? -1.202  9.788  -1.444  1.00 1.00 ? 49 PHE A HD1  7  
ATOM   5285  H HD2  . PHE A 1 49 ? -2.701  6.973  -4.362  1.00 1.00 ? 49 PHE A HD2  7  
ATOM   5286  H HE1  . PHE A 1 49 ? -1.273  11.565 -3.132  1.00 1.00 ? 49 PHE A HE1  7  
ATOM   5287  H HE2  . PHE A 1 49 ? -2.858  8.803  -6.020  1.00 1.00 ? 49 PHE A HE2  7  
ATOM   5288  H HZ   . PHE A 1 49 ? -2.102  11.096 -5.406  1.00 1.00 ? 49 PHE A HZ   7  
ATOM   5289  N N    . PRO A 1 50 ? -2.342  5.594  1.133   1.00 1.00 ? 50 PRO A N    7  
ATOM   5290  C CA   . PRO A 1 50 ? -2.468  4.250  1.653   1.00 1.00 ? 50 PRO A CA   7  
ATOM   5291  C C    . PRO A 1 50 ? -2.693  3.310  0.466   1.00 1.00 ? 50 PRO A C    7  
ATOM   5292  O O    . PRO A 1 50 ? -3.495  3.609  -0.418  1.00 1.00 ? 50 PRO A O    7  
ATOM   5293  C CB   . PRO A 1 50 ? -3.672  4.303  2.596   1.00 1.00 ? 50 PRO A CB   7  
ATOM   5294  C CG   . PRO A 1 50 ? -4.552  5.395  1.982   1.00 1.00 ? 50 PRO A CG   7  
ATOM   5295  C CD   . PRO A 1 50 ? -3.541  6.368  1.368   1.00 1.00 ? 50 PRO A CD   7  
ATOM   5296  H HA   . PRO A 1 50 ? -1.559  3.965  2.191   1.00 1.00 ? 50 PRO A HA   7  
ATOM   5297  H HB2  . PRO A 1 50 ? -4.189  3.344  2.669   1.00 1.00 ? 50 PRO A HB2  7  
ATOM   5298  H HB3  . PRO A 1 50 ? -3.338  4.624  3.584   1.00 1.00 ? 50 PRO A HB3  7  
ATOM   5299  H HG2  . PRO A 1 50 ? -5.162  4.960  1.189   1.00 1.00 ? 50 PRO A HG2  7  
ATOM   5300  H HG3  . PRO A 1 50 ? -5.193  5.872  2.723   1.00 1.00 ? 50 PRO A HG3  7  
ATOM   5301  H HD2  . PRO A 1 50 ? -3.912  6.761  0.419   1.00 1.00 ? 50 PRO A HD2  7  
ATOM   5302  H HD3  . PRO A 1 50 ? -3.308  7.171  2.067   1.00 1.00 ? 50 PRO A HD3  7  
ATOM   5303  N N    . CYS A 1 51 ? -1.942  2.212  0.411   1.00 1.00 ? 51 CYS A N    7  
ATOM   5304  C CA   . CYS A 1 51 ? -1.933  1.277  -0.703  1.00 1.00 ? 51 CYS A CA   7  
ATOM   5305  C C    . CYS A 1 51 ? -1.204  0.022  -0.227  1.00 1.00 ? 51 CYS A C    7  
ATOM   5306  O O    . CYS A 1 51 ? -0.653  0.055  0.874   1.00 1.00 ? 51 CYS A O    7  
ATOM   5307  C CB   . CYS A 1 51 ? -1.226  1.903  -1.914  1.00 1.00 ? 51 CYS A CB   7  
ATOM   5308  S SG   . CYS A 1 51 ? 0.545   1.577  -2.025  1.00 1.00 ? 51 CYS A SG   7  
ATOM   5309  O OXT  . CYS A 1 51 ? -1.209  -1.058 -1.055  1.00 0.00 ? 51 CYS A OXT  7  
ATOM   5310  H H    . CYS A 1 51 ? -1.306  1.980  1.166   1.00 1.00 ? 51 CYS A H    7  
ATOM   5311  H HA   . CYS A 1 51 ? -2.961  1.024  -0.968  1.00 1.00 ? 51 CYS A HA   7  
ATOM   5312  H HB2  . CYS A 1 51 ? -1.657  1.528  -2.838  1.00 1.00 ? 51 CYS A HB2  7  
ATOM   5313  H HB3  . CYS A 1 51 ? -1.375  2.982  -1.918  1.00 1.00 ? 51 CYS A HB3  7  
HETATM 5314  N N    . PCA A 1 1  ? -2.824  1.091  4.840   1.00 1.00 ? 1  PCA A N    8  
HETATM 5315  C CA   . PCA A 1 1  ? -1.960  0.793  5.963   1.00 1.00 ? 1  PCA A CA   8  
HETATM 5316  C CB   . PCA A 1 1  ? -2.225  -0.692 6.278   1.00 1.00 ? 1  PCA A CB   8  
HETATM 5317  C CG   . PCA A 1 1  ? -2.830  -1.237 4.974   1.00 1.00 ? 1  PCA A CG   8  
HETATM 5318  C CD   . PCA A 1 1  ? -3.257  0.006  4.219   1.00 1.00 ? 1  PCA A CD   8  
HETATM 5319  O OE   . PCA A 1 1  ? -3.866  -0.011 3.152   1.00 1.00 ? 1  PCA A OE   8  
HETATM 5320  C C    . PCA A 1 1  ? -0.531  1.105  5.520   1.00 1.00 ? 1  PCA A C    8  
HETATM 5321  O O    . PCA A 1 1  ? -0.069  2.232  5.678   1.00 1.00 ? 1  PCA A O    8  
HETATM 5322  H H    . PCA A 1 1  ? -2.955  2.028  4.495   1.00 0.00 ? 1  PCA A H    8  
HETATM 5323  H HA   . PCA A 1 1  ? -2.223  1.408  6.823   1.00 1.00 ? 1  PCA A HA   8  
HETATM 5324  H HB2  . PCA A 1 1  ? -1.341  -1.240 6.606   1.00 1.00 ? 1  PCA A HB2  8  
HETATM 5325  H HB3  . PCA A 1 1  ? -2.987  -0.745 7.058   1.00 1.00 ? 1  PCA A HB3  8  
HETATM 5326  H HG2  . PCA A 1 1  ? -2.086  -1.777 4.391   1.00 1.00 ? 1  PCA A HG2  8  
HETATM 5327  H HG3  . PCA A 1 1  ? -3.687  -1.877 5.182   1.00 1.00 ? 1  PCA A HG3  8  
ATOM   5328  N N    . LYS A 1 2  ? 0.144   0.139  4.892   1.00 1.00 ? 2  LYS A N    8  
ATOM   5329  C CA   . LYS A 1 2  ? 1.411   0.388  4.232   1.00 1.00 ? 2  LYS A CA   8  
ATOM   5330  C C    . LYS A 1 2  ? 1.145   1.375  3.094   1.00 1.00 ? 2  LYS A C    8  
ATOM   5331  O O    . LYS A 1 2  ? 0.382   1.057  2.179   1.00 1.00 ? 2  LYS A O    8  
ATOM   5332  C CB   . LYS A 1 2  ? 1.968   -0.931 3.676   1.00 1.00 ? 2  LYS A CB   8  
ATOM   5333  C CG   . LYS A 1 2  ? 3.325   -0.729 2.974   1.00 1.00 ? 2  LYS A CG   8  
ATOM   5334  C CD   . LYS A 1 2  ? 3.596   -1.738 1.846   1.00 1.00 ? 2  LYS A CD   8  
ATOM   5335  C CE   . LYS A 1 2  ? 2.525   -1.790 0.740   1.00 1.00 ? 2  LYS A CE   8  
ATOM   5336  N NZ   . LYS A 1 2  ? 1.951   -0.470 0.404   1.00 1.00 ? 2  LYS A NZ   8  
ATOM   5337  H H    . LYS A 1 2  ? -0.292  -0.761 4.771   1.00 1.00 ? 2  LYS A H    8  
ATOM   5338  H HA   . LYS A 1 2  ? 2.121   0.806  4.949   1.00 1.00 ? 2  LYS A HA   8  
ATOM   5339  H HB2  . LYS A 1 2  ? 2.099   -1.644 4.491   1.00 1.00 ? 2  LYS A HB2  8  
ATOM   5340  H HB3  . LYS A 1 2  ? 1.231   -1.345 2.989   1.00 1.00 ? 2  LYS A HB3  8  
ATOM   5341  H HG2  . LYS A 1 2  ? 3.425   0.274  2.562   1.00 1.00 ? 2  LYS A HG2  8  
ATOM   5342  H HG3  . LYS A 1 2  ? 4.110   -0.831 3.727   1.00 1.00 ? 2  LYS A HG3  8  
ATOM   5343  H HD2  . LYS A 1 2  ? 4.554   -1.476 1.392   1.00 1.00 ? 2  LYS A HD2  8  
ATOM   5344  H HD3  . LYS A 1 2  ? 3.701   -2.737 2.277   1.00 1.00 ? 2  LYS A HD3  8  
ATOM   5345  H HE2  . LYS A 1 2  ? 2.969   -2.227 -0.158  1.00 1.00 ? 2  LYS A HE2  8  
ATOM   5346  H HE3  . LYS A 1 2  ? 1.709   -2.444 1.054   1.00 1.00 ? 2  LYS A HE3  8  
ATOM   5347  H HZ1  . LYS A 1 2  ? 2.638   0.228  0.134   1.00 1.00 ? 2  LYS A HZ1  8  
ATOM   5348  H HZ2  . LYS A 1 2  ? 1.243   -0.564 -0.317  1.00 1.00 ? 2  LYS A HZ2  8  
ATOM   5349  H HZ3  . LYS A 1 2  ? 1.429   -0.093 1.185   1.00 1.00 ? 2  LYS A HZ3  8  
ATOM   5350  N N    . LEU A 1 3  ? 1.805   2.531  3.098   1.00 1.00 ? 3  LEU A N    8  
ATOM   5351  C CA   . LEU A 1 3  ? 1.674   3.491  2.014   1.00 1.00 ? 3  LEU A CA   8  
ATOM   5352  C C    . LEU A 1 3  ? 2.163   2.921  0.675   1.00 1.00 ? 3  LEU A C    8  
ATOM   5353  O O    . LEU A 1 3  ? 2.952   1.975  0.639   1.00 1.00 ? 3  LEU A O    8  
ATOM   5354  C CB   . LEU A 1 3  ? 2.490   4.750  2.317   1.00 1.00 ? 3  LEU A CB   8  
ATOM   5355  C CG   . LEU A 1 3  ? 2.018   5.582  3.521   1.00 1.00 ? 3  LEU A CG   8  
ATOM   5356  C CD1  . LEU A 1 3  ? 3.135   6.559  3.908   1.00 1.00 ? 3  LEU A CD1  8  
ATOM   5357  C CD2  . LEU A 1 3  ? 0.750   6.376  3.195   1.00 1.00 ? 3  LEU A CD2  8  
ATOM   5358  H H    . LEU A 1 3  ? 2.403   2.759  3.879   1.00 1.00 ? 3  LEU A H    8  
ATOM   5359  H HA   . LEU A 1 3  ? 0.629   3.760  1.944   1.00 1.00 ? 3  LEU A HA   8  
ATOM   5360  H HB2  . LEU A 1 3  ? 3.515   4.428  2.474   1.00 1.00 ? 3  LEU A HB2  8  
ATOM   5361  H HB3  . LEU A 1 3  ? 2.479   5.387  1.435   1.00 1.00 ? 3  LEU A HB3  8  
ATOM   5362  H HG   . LEU A 1 3  ? 1.807   4.934  4.372   1.00 1.00 ? 3  LEU A HG   8  
ATOM   5363  H HD11 . LEU A 1 3  ? 4.043   6.009  4.162   1.00 1.00 ? 3  LEU A HD11 8  
ATOM   5364  H HD12 . LEU A 1 3  ? 3.353   7.235  3.083   1.00 1.00 ? 3  LEU A HD12 8  
ATOM   5365  H HD13 . LEU A 1 3  ? 2.829   7.141  4.776   1.00 1.00 ? 3  LEU A HD13 8  
ATOM   5366  H HD21 . LEU A 1 3  ? 0.897   6.975  2.299   1.00 1.00 ? 3  LEU A HD21 8  
ATOM   5367  H HD22 . LEU A 1 3  ? -0.082  5.693  3.042   1.00 1.00 ? 3  LEU A HD22 8  
ATOM   5368  H HD23 . LEU A 1 3  ? 0.506   7.040  4.025   1.00 1.00 ? 3  LEU A HD23 8  
ATOM   5369  N N    . CYS A 1 4  ? 1.681   3.502  -0.423  1.00 1.00 ? 4  CYS A N    8  
ATOM   5370  C CA   . CYS A 1 4  ? 2.196   3.308  -1.777  1.00 1.00 ? 4  CYS A CA   8  
ATOM   5371  C C    . CYS A 1 4  ? 2.558   4.710  -2.256  1.00 1.00 ? 4  CYS A C    8  
ATOM   5372  O O    . CYS A 1 4  ? 1.811   5.652  -1.982  1.00 1.00 ? 4  CYS A O    8  
ATOM   5373  C CB   . CYS A 1 4  ? 1.179   2.672  -2.733  1.00 1.00 ? 4  CYS A CB   8  
ATOM   5374  S SG   . CYS A 1 4  ? 0.937   0.883  -2.570  1.00 1.00 ? 4  CYS A SG   8  
ATOM   5375  H H    . CYS A 1 4  ? 0.979   4.227  -0.296  1.00 1.00 ? 4  CYS A H    8  
ATOM   5376  H HA   . CYS A 1 4  ? 3.093   2.688  -1.763  1.00 1.00 ? 4  CYS A HA   8  
ATOM   5377  H HB2  . CYS A 1 4  ? 0.222   3.183  -2.631  1.00 1.00 ? 4  CYS A HB2  8  
ATOM   5378  H HB3  . CYS A 1 4  ? 1.525   2.831  -3.756  1.00 1.00 ? 4  CYS A HB3  8  
ATOM   5379  N N    . GLU A 1 5  ? 3.714   4.851  -2.903  1.00 1.00 ? 5  GLU A N    8  
ATOM   5380  C CA   . GLU A 1 5  ? 4.301   6.128  -3.279  1.00 1.00 ? 5  GLU A CA   8  
ATOM   5381  C C    . GLU A 1 5  ? 3.947   6.448  -4.732  1.00 1.00 ? 5  GLU A C    8  
ATOM   5382  O O    . GLU A 1 5  ? 4.012   5.562  -5.582  1.00 1.00 ? 5  GLU A O    8  
ATOM   5383  C CB   . GLU A 1 5  ? 5.834   6.084  -3.116  1.00 1.00 ? 5  GLU A CB   8  
ATOM   5384  C CG   . GLU A 1 5  ? 6.345   5.239  -1.934  1.00 1.00 ? 5  GLU A CG   8  
ATOM   5385  C CD   . GLU A 1 5  ? 6.630   3.794  -2.337  1.00 1.00 ? 5  GLU A CD   8  
ATOM   5386  O OE1  . GLU A 1 5  ? 5.694   3.011  -2.486  1.00 1.00 ? 5  GLU A OE1  8  
ATOM   5387  O OE2  . GLU A 1 5  ? 7.937   3.466  -2.522  1.00 1.00 ? 5  GLU A OE2  8  
ATOM   5388  H H    . GLU A 1 5  ? 4.265   4.019  -3.084  1.00 1.00 ? 5  GLU A H    8  
ATOM   5389  H HA   . GLU A 1 5  ? 3.910   6.908  -2.623  1.00 1.00 ? 5  GLU A HA   8  
ATOM   5390  H HB2  . GLU A 1 5  ? 6.291   5.702  -4.031  1.00 1.00 ? 5  GLU A HB2  8  
ATOM   5391  H HB3  . GLU A 1 5  ? 6.175   7.113  -2.987  1.00 1.00 ? 5  GLU A HB3  8  
ATOM   5392  H HG2  . GLU A 1 5  ? 7.281   5.673  -1.581  1.00 1.00 ? 5  GLU A HG2  8  
ATOM   5393  H HG3  . GLU A 1 5  ? 5.634   5.247  -1.110  1.00 1.00 ? 5  GLU A HG3  8  
ATOM   5394  H HE2  . GLU A 1 5  ? 8.023   2.548  -2.788  1.00 1.00 ? 5  GLU A HE2  8  
ATOM   5395  N N    . ARG A 1 6  ? 3.586   7.698  -5.027  1.00 1.00 ? 6  ARG A N    8  
ATOM   5396  C CA   . ARG A 1 6  ? 3.436   8.200  -6.385  1.00 1.00 ? 6  ARG A CA   8  
ATOM   5397  C C    . ARG A 1 6  ? 4.072   9.583  -6.492  1.00 1.00 ? 6  ARG A C    8  
ATOM   5398  O O    . ARG A 1 6  ? 4.187   10.282 -5.485  1.00 1.00 ? 6  ARG A O    8  
ATOM   5399  C CB   . ARG A 1 6  ? 1.953   8.402  -6.725  1.00 1.00 ? 6  ARG A CB   8  
ATOM   5400  C CG   . ARG A 1 6  ? 1.174   7.122  -7.057  1.00 1.00 ? 6  ARG A CG   8  
ATOM   5401  C CD   . ARG A 1 6  ? -0.286  7.450  -7.422  1.00 1.00 ? 6  ARG A CD   8  
ATOM   5402  N NE   . ARG A 1 6  ? -0.357  8.644  -8.287  1.00 1.00 ? 6  ARG A NE   8  
ATOM   5403  C CZ   . ARG A 1 6  ? -0.911  9.810  -7.920  1.00 1.00 ? 6  ARG A CZ   8  
ATOM   5404  N NH1  . ARG A 1 6  ? -2.062  9.818  -7.244  1.00 1.00 ? 6  ARG A NH1  8  
ATOM   5405  N NH2  . ARG A 1 6  ? -0.291  10.959 -8.200  1.00 1.00 ? 6  ARG A NH2  8  
ATOM   5406  H H    . ARG A 1 6  ? 3.554   8.395  -4.287  1.00 1.00 ? 6  ARG A H    8  
ATOM   5407  H HA   . ARG A 1 6  ? 3.903   7.521  -7.099  1.00 1.00 ? 6  ARG A HA   8  
ATOM   5408  H HB2  . ARG A 1 6  ? 1.478   8.960  -5.927  1.00 1.00 ? 6  ARG A HB2  8  
ATOM   5409  H HB3  . ARG A 1 6  ? 1.916   9.060  -7.587  1.00 1.00 ? 6  ARG A HB3  8  
ATOM   5410  H HG2  . ARG A 1 6  ? 1.657   6.631  -7.904  1.00 1.00 ? 6  ARG A HG2  8  
ATOM   5411  H HG3  . ARG A 1 6  ? 1.196   6.439  -6.205  1.00 1.00 ? 6  ARG A HG3  8  
ATOM   5412  H HD2  . ARG A 1 6  ? -0.727  6.593  -7.937  1.00 1.00 ? 6  ARG A HD2  8  
ATOM   5413  H HD3  . ARG A 1 6  ? -0.837  7.604  -6.493  1.00 1.00 ? 6  ARG A HD3  8  
ATOM   5414  H HE   . ARG A 1 6  ? 0.321   8.667  -9.037  1.00 1.00 ? 6  ARG A HE   8  
ATOM   5415  H HH11 . ARG A 1 6  ? -2.523  8.948  -7.024  1.00 1.00 ? 6  ARG A HH11 8  
ATOM   5416  H HH12 . ARG A 1 6  ? -2.449  10.692 -6.900  1.00 1.00 ? 6  ARG A HH12 8  
ATOM   5417  H HH21 . ARG A 1 6  ? 0.682   10.974 -8.509  1.00 1.00 ? 6  ARG A HH21 8  
ATOM   5418  H HH22 . ARG A 1 6  ? -0.653  11.857 -7.886  1.00 1.00 ? 6  ARG A HH22 8  
ATOM   5419  N N    . PRO A 1 7  ? 4.446   10.017 -7.704  1.00 1.00 ? 7  PRO A N    8  
ATOM   5420  C CA   . PRO A 1 7  ? 4.771   11.408 -7.925  1.00 1.00 ? 7  PRO A CA   8  
ATOM   5421  C C    . PRO A 1 7  ? 3.426   12.150 -7.857  1.00 1.00 ? 7  PRO A C    8  
ATOM   5422  O O    . PRO A 1 7  ? 2.385   11.567 -8.183  1.00 1.00 ? 7  PRO A O    8  
ATOM   5423  C CB   . PRO A 1 7  ? 5.390   11.462 -9.323  1.00 1.00 ? 7  PRO A CB   8  
ATOM   5424  C CG   . PRO A 1 7  ? 4.711   10.298 -10.050 1.00 1.00 ? 7  PRO A CG   8  
ATOM   5425  C CD   . PRO A 1 7  ? 4.514   9.258  -8.944  1.00 1.00 ? 7  PRO A CD   8  
ATOM   5426  H HA   . PRO A 1 7  ? 5.469   11.789 -7.178  1.00 1.00 ? 7  PRO A HA   8  
ATOM   5427  H HB2  . PRO A 1 7  ? 5.220   12.419 -9.820  1.00 1.00 ? 7  PRO A HB2  8  
ATOM   5428  H HB3  . PRO A 1 7  ? 6.460   11.262 -9.248  1.00 1.00 ? 7  PRO A HB3  8  
ATOM   5429  H HG2  . PRO A 1 7  ? 3.738   10.624 -10.420 1.00 1.00 ? 7  PRO A HG2  8  
ATOM   5430  H HG3  . PRO A 1 7  ? 5.314   9.917  -10.875 1.00 1.00 ? 7  PRO A HG3  8  
ATOM   5431  H HD2  . PRO A 1 7  ? 3.610   8.680  -9.138  1.00 1.00 ? 7  PRO A HD2  8  
ATOM   5432  H HD3  . PRO A 1 7  ? 5.379   8.594  -8.907  1.00 1.00 ? 7  PRO A HD3  8  
ATOM   5433  N N    . SER A 1 8  ? 3.447   13.410 -7.418  1.00 1.00 ? 8  SER A N    8  
ATOM   5434  C CA   . SER A 1 8  ? 2.298   14.294 -7.250  1.00 1.00 ? 8  SER A CA   8  
ATOM   5435  C C    . SER A 1 8  ? 1.089   13.955 -8.131  1.00 1.00 ? 8  SER A C    8  
ATOM   5436  O O    . SER A 1 8  ? 0.030   13.575 -7.631  1.00 1.00 ? 8  SER A O    8  
ATOM   5437  C CB   . SER A 1 8  ? 2.771   15.711 -7.569  1.00 1.00 ? 8  SER A CB   8  
ATOM   5438  O OG   . SER A 1 8  ? 3.408   15.710 -8.836  1.00 1.00 ? 8  SER A OG   8  
ATOM   5439  H H    . SER A 1 8  ? 4.342   13.811 -7.149  1.00 1.00 ? 8  SER A H    8  
ATOM   5440  H HA   . SER A 1 8  ? 1.982   14.258 -6.206  1.00 1.00 ? 8  SER A HA   8  
ATOM   5441  H HB2  . SER A 1 8  ? 1.921   16.391 -7.561  1.00 1.00 ? 8  SER A HB2  8  
ATOM   5442  H HB3  . SER A 1 8  ? 3.477   16.025 -6.804  1.00 1.00 ? 8  SER A HB3  8  
ATOM   5443  H HG   . SER A 1 8  ? 3.766   16.590 -9.015  1.00 1.00 ? 8  SER A HG   8  
ATOM   5444  N N    . GLY A 1 9  ? 1.217   14.165 -9.441  1.00 1.00 ? 9  GLY A N    8  
ATOM   5445  C CA   . GLY A 1 9  ? 0.126   14.033 -10.401 1.00 1.00 ? 9  GLY A CA   8  
ATOM   5446  C C    . GLY A 1 9  ? -0.685  15.327 -10.502 1.00 1.00 ? 9  GLY A C    8  
ATOM   5447  O O    . GLY A 1 9  ? -1.149  15.687 -11.578 1.00 1.00 ? 9  GLY A O    8  
ATOM   5448  H H    . GLY A 1 9  ? 2.103   14.568 -9.737  1.00 1.00 ? 9  GLY A H    8  
ATOM   5449  H HA2  . GLY A 1 9  ? 0.550   13.807 -11.379 1.00 1.00 ? 9  GLY A HA2  8  
ATOM   5450  H HA3  . GLY A 1 9  ? -0.539  13.216 -10.119 1.00 1.00 ? 9  GLY A HA3  8  
ATOM   5451  N N    . THR A 1 10 ? -0.825  16.047 -9.387  1.00 1.00 ? 10 THR A N    8  
ATOM   5452  C CA   . THR A 1 10 ? -1.396  17.377 -9.330  1.00 1.00 ? 10 THR A CA   8  
ATOM   5453  C C    . THR A 1 10 ? -0.270  18.353 -9.677  1.00 1.00 ? 10 THR A C    8  
ATOM   5454  O O    . THR A 1 10 ? -0.220  18.919 -10.769 1.00 1.00 ? 10 THR A O    8  
ATOM   5455  C CB   . THR A 1 10 ? -1.876  17.594 -7.882  1.00 1.00 ? 10 THR A CB   8  
ATOM   5456  O OG1  . THR A 1 10 ? -0.913  17.027 -7.001  1.00 1.00 ? 10 THR A OG1  8  
ATOM   5457  C CG2  . THR A 1 10 ? -3.229  16.927 -7.628  1.00 1.00 ? 10 THR A CG2  8  
ATOM   5458  H H    . THR A 1 10 ? -0.480  15.700 -8.505  1.00 1.00 ? 10 THR A H    8  
ATOM   5459  H HA   . THR A 1 10 ? -2.221  17.497 -10.033 1.00 1.00 ? 10 THR A HA   8  
ATOM   5460  H HB   . THR A 1 10 ? -1.983  18.664 -7.682  1.00 1.00 ? 10 THR A HB   8  
ATOM   5461  H HG1  . THR A 1 10 ? -1.303  16.955 -6.124  1.00 1.00 ? 10 THR A HG1  8  
ATOM   5462  H HG21 . THR A 1 10 ? -3.187  15.871 -7.890  1.00 1.00 ? 10 THR A HG21 8  
ATOM   5463  H HG22 . THR A 1 10 ? -3.497  17.028 -6.575  1.00 1.00 ? 10 THR A HG22 8  
ATOM   5464  H HG23 . THR A 1 10 ? -3.995  17.414 -8.231  1.00 1.00 ? 10 THR A HG23 8  
ATOM   5465  N N    . TRP A 1 11 ? 0.654   18.508 -8.728  1.00 1.00 ? 11 TRP A N    8  
ATOM   5466  C CA   . TRP A 1 11 ? 1.817   19.374 -8.807  1.00 1.00 ? 11 TRP A CA   8  
ATOM   5467  C C    . TRP A 1 11 ? 2.772   18.878 -9.897  1.00 1.00 ? 11 TRP A C    8  
ATOM   5468  O O    . TRP A 1 11 ? 3.808   18.273 -9.620  1.00 1.00 ? 11 TRP A O    8  
ATOM   5469  C CB   . TRP A 1 11 ? 2.480   19.439 -7.426  1.00 1.00 ? 11 TRP A CB   8  
ATOM   5470  C CG   . TRP A 1 11 ? 3.433   20.573 -7.216  1.00 1.00 ? 11 TRP A CG   8  
ATOM   5471  C CD1  . TRP A 1 11 ? 4.525   20.853 -7.964  1.00 1.00 ? 11 TRP A CD1  8  
ATOM   5472  C CD2  . TRP A 1 11 ? 3.405   21.583 -6.167  1.00 1.00 ? 11 TRP A CD2  8  
ATOM   5473  N NE1  . TRP A 1 11 ? 5.147   21.979 -7.482  1.00 1.00 ? 11 TRP A NE1  8  
ATOM   5474  C CE2  . TRP A 1 11 ? 4.508   22.465 -6.365  1.00 1.00 ? 11 TRP A CE2  8  
ATOM   5475  C CE3  . TRP A 1 11 ? 2.568   21.842 -5.061  1.00 1.00 ? 11 TRP A CE3  8  
ATOM   5476  C CZ2  . TRP A 1 11 ? 4.772   23.539 -5.511  1.00 1.00 ? 11 TRP A CZ2  8  
ATOM   5477  C CZ3  . TRP A 1 11 ? 2.871   22.872 -4.155  1.00 1.00 ? 11 TRP A CZ3  8  
ATOM   5478  C CH2  . TRP A 1 11 ? 3.993   23.689 -4.359  1.00 1.00 ? 11 TRP A CH2  8  
ATOM   5479  H H    . TRP A 1 11 ? 0.484   18.002 -7.865  1.00 1.00 ? 11 TRP A H    8  
ATOM   5480  H HA   . TRP A 1 11 ? 1.477   20.379 -9.064  1.00 1.00 ? 11 TRP A HA   8  
ATOM   5481  H HB2  . TRP A 1 11 ? 1.692   19.549 -6.681  1.00 1.00 ? 11 TRP A HB2  8  
ATOM   5482  H HB3  . TRP A 1 11 ? 3.002   18.508 -7.213  1.00 1.00 ? 11 TRP A HB3  8  
ATOM   5483  H HD1  . TRP A 1 11 ? 4.881   20.301 -8.817  1.00 1.00 ? 11 TRP A HD1  8  
ATOM   5484  H HE1  . TRP A 1 11 ? 6.002   22.377 -7.859  1.00 1.00 ? 11 TRP A HE1  8  
ATOM   5485  H HE3  . TRP A 1 11 ? 1.699   21.229 -4.876  1.00 1.00 ? 11 TRP A HE3  8  
ATOM   5486  H HZ2  . TRP A 1 11 ? 5.612   24.192 -5.692  1.00 1.00 ? 11 TRP A HZ2  8  
ATOM   5487  H HZ3  . TRP A 1 11 ? 2.252   23.021 -3.287  1.00 1.00 ? 11 TRP A HZ3  8  
ATOM   5488  H HH2  . TRP A 1 11 ? 4.287   24.395 -3.609  1.00 1.00 ? 11 TRP A HH2  8  
ATOM   5489  N N    . SER A 1 12 ? 2.435   19.150 -11.151 1.00 1.00 ? 12 SER A N    8  
ATOM   5490  C CA   . SER A 1 12 ? 3.126   18.581 -12.293 1.00 1.00 ? 12 SER A CA   8  
ATOM   5491  C C    . SER A 1 12 ? 4.303   19.484 -12.660 1.00 1.00 ? 12 SER A C    8  
ATOM   5492  O O    . SER A 1 12 ? 4.330   20.075 -13.736 1.00 1.00 ? 12 SER A O    8  
ATOM   5493  C CB   . SER A 1 12 ? 2.119   18.435 -13.437 1.00 1.00 ? 12 SER A CB   8  
ATOM   5494  O OG   . SER A 1 12 ? 1.023   17.647 -13.004 1.00 1.00 ? 12 SER A OG   8  
ATOM   5495  H H    . SER A 1 12 ? 1.526   19.574 -11.299 1.00 1.00 ? 12 SER A H    8  
ATOM   5496  H HA   . SER A 1 12 ? 3.504   17.585 -12.051 1.00 1.00 ? 12 SER A HA   8  
ATOM   5497  H HB2  . SER A 1 12 ? 1.764   19.417 -13.757 1.00 1.00 ? 12 SER A HB2  8  
ATOM   5498  H HB3  . SER A 1 12 ? 2.604   17.949 -14.285 1.00 1.00 ? 12 SER A HB3  8  
ATOM   5499  H HG   . SER A 1 12 ? 0.531   18.105 -12.308 1.00 1.00 ? 12 SER A HG   8  
ATOM   5500  N N    . GLY A 1 13 ? 5.270   19.595 -11.746 1.00 1.00 ? 13 GLY A N    8  
ATOM   5501  C CA   . GLY A 1 13 ? 6.425   20.462 -11.911 1.00 1.00 ? 13 GLY A CA   8  
ATOM   5502  C C    . GLY A 1 13 ? 7.416   20.275 -10.765 1.00 1.00 ? 13 GLY A C    8  
ATOM   5503  O O    . GLY A 1 13 ? 7.247   19.385 -9.931  1.00 1.00 ? 13 GLY A O    8  
ATOM   5504  H H    . GLY A 1 13 ? 5.191   19.075 -10.876 1.00 1.00 ? 13 GLY A H    8  
ATOM   5505  H HA2  . GLY A 1 13 ? 6.926   20.229 -12.851 1.00 1.00 ? 13 GLY A HA2  8  
ATOM   5506  H HA3  . GLY A 1 13 ? 6.090   21.499 -11.930 1.00 1.00 ? 13 GLY A HA3  8  
ATOM   5507  N N    . VAL A 1 14 ? 8.447   21.123 -10.732 1.00 1.00 ? 14 VAL A N    8  
ATOM   5508  C CA   . VAL A 1 14 ? 9.434   21.161 -9.658  1.00 1.00 ? 14 VAL A CA   8  
ATOM   5509  C C    . VAL A 1 14 ? 8.706   21.433 -8.336  1.00 1.00 ? 14 VAL A C    8  
ATOM   5510  O O    . VAL A 1 14 ? 7.729   22.178 -8.324  1.00 1.00 ? 14 VAL A O    8  
ATOM   5511  C CB   . VAL A 1 14 ? 10.495  22.231 -9.978  1.00 1.00 ? 14 VAL A CB   8  
ATOM   5512  C CG1  . VAL A 1 14 ? 11.570  22.304 -8.886  1.00 1.00 ? 14 VAL A CG1  8  
ATOM   5513  C CG2  . VAL A 1 14 ? 11.192  21.922 -11.311 1.00 1.00 ? 14 VAL A CG2  8  
ATOM   5514  H H    . VAL A 1 14 ? 8.491   21.849 -11.431 1.00 1.00 ? 14 VAL A H    8  
ATOM   5515  H HA   . VAL A 1 14 ? 9.913   20.183 -9.610  1.00 1.00 ? 14 VAL A HA   8  
ATOM   5516  H HB   . VAL A 1 14 ? 10.014  23.208 -10.052 1.00 1.00 ? 14 VAL A HB   8  
ATOM   5517  H HG11 . VAL A 1 14 ? 12.020  21.321 -8.761  1.00 1.00 ? 14 VAL A HG11 8  
ATOM   5518  H HG12 . VAL A 1 14 ? 12.345  23.015 -9.173  1.00 1.00 ? 14 VAL A HG12 8  
ATOM   5519  H HG13 . VAL A 1 14 ? 11.141  22.631 -7.941  1.00 1.00 ? 14 VAL A HG13 8  
ATOM   5520  H HG21 . VAL A 1 14 ? 11.633  20.926 -11.275 1.00 1.00 ? 14 VAL A HG21 8  
ATOM   5521  H HG22 . VAL A 1 14 ? 10.486  21.969 -12.140 1.00 1.00 ? 14 VAL A HG22 8  
ATOM   5522  H HG23 . VAL A 1 14 ? 11.980  22.653 -11.495 1.00 1.00 ? 14 VAL A HG23 8  
ATOM   5523  N N    . CYS A 1 15 ? 9.185   20.880 -7.217  1.00 1.00 ? 15 CYS A N    8  
ATOM   5524  C CA   . CYS A 1 15 ? 8.407   20.894 -5.976  1.00 1.00 ? 15 CYS A CA   8  
ATOM   5525  C C    . CYS A 1 15 ? 8.336   22.266 -5.319  1.00 1.00 ? 15 CYS A C    8  
ATOM   5526  O O    . CYS A 1 15 ? 7.340   22.558 -4.668  1.00 1.00 ? 15 CYS A O    8  
ATOM   5527  C CB   . CYS A 1 15 ? 8.979   19.904 -4.948  1.00 1.00 ? 15 CYS A CB   8  
ATOM   5528  S SG   . CYS A 1 15 ? 9.932   20.655 -3.599  1.00 1.00 ? 15 CYS A SG   8  
ATOM   5529  H H    . CYS A 1 15 ? 10.001  20.279 -7.297  1.00 1.00 ? 15 CYS A H    8  
ATOM   5530  H HA   . CYS A 1 15 ? 7.381   20.593 -6.199  1.00 1.00 ? 15 CYS A HA   8  
ATOM   5531  H HB2  . CYS A 1 15 ? 8.148   19.380 -4.477  1.00 1.00 ? 15 CYS A HB2  8  
ATOM   5532  H HB3  . CYS A 1 15 ? 9.611   19.171 -5.439  1.00 1.00 ? 15 CYS A HB3  8  
ATOM   5533  N N    . GLY A 1 16 ? 9.401   23.067 -5.378  1.00 1.00 ? 16 GLY A N    8  
ATOM   5534  C CA   . GLY A 1 16 ? 9.451   24.357 -4.700  1.00 1.00 ? 16 GLY A CA   8  
ATOM   5535  C C    . GLY A 1 16 ? 9.527   24.279 -3.164  1.00 1.00 ? 16 GLY A C    8  
ATOM   5536  O O    . GLY A 1 16 ? 10.302  25.022 -2.566  1.00 1.00 ? 16 GLY A O    8  
ATOM   5537  H H    . GLY A 1 16 ? 10.213  22.757 -5.891  1.00 1.00 ? 16 GLY A H    8  
ATOM   5538  H HA2  . GLY A 1 16 ? 10.326  24.896 -5.063  1.00 1.00 ? 16 GLY A HA2  8  
ATOM   5539  H HA3  . GLY A 1 16 ? 8.566   24.935 -4.969  1.00 1.00 ? 16 GLY A HA3  8  
ATOM   5540  N N    . ASN A 1 17 ? 8.729   23.428 -2.505  1.00 1.00 ? 17 ASN A N    8  
ATOM   5541  C CA   . ASN A 1 17 ? 8.563   23.433 -1.053  1.00 1.00 ? 17 ASN A CA   8  
ATOM   5542  C C    . ASN A 1 17 ? 7.740   22.237 -0.553  1.00 1.00 ? 17 ASN A C    8  
ATOM   5543  O O    . ASN A 1 17 ? 6.646   21.967 -1.050  1.00 1.00 ? 17 ASN A O    8  
ATOM   5544  C CB   . ASN A 1 17 ? 7.876   24.731 -0.607  1.00 1.00 ? 17 ASN A CB   8  
ATOM   5545  C CG   . ASN A 1 17 ? 7.635   24.719 0.897   1.00 1.00 ? 17 ASN A CG   8  
ATOM   5546  O OD1  . ASN A 1 17 ? 6.563   24.339 1.356   1.00 1.00 ? 17 ASN A OD1  8  
ATOM   5547  N ND2  . ASN A 1 17 ? 8.641   25.091 1.681   1.00 1.00 ? 17 ASN A ND2  8  
ATOM   5548  H H    . ASN A 1 17 ? 8.208   22.743 -3.047  1.00 1.00 ? 17 ASN A H    8  
ATOM   5549  H HA   . ASN A 1 17 ? 9.555   23.396 -0.599  1.00 1.00 ? 17 ASN A HA   8  
ATOM   5550  H HB2  . ASN A 1 17 ? 8.482   25.600 -0.862  1.00 1.00 ? 17 ASN A HB2  8  
ATOM   5551  H HB3  . ASN A 1 17 ? 6.916   24.821 -1.117  1.00 1.00 ? 17 ASN A HB3  8  
ATOM   5552  H HD21 . ASN A 1 17 ? 9.508   25.418 1.277   1.00 1.00 ? 17 ASN A HD21 8  
ATOM   5553  H HD22 . ASN A 1 17 ? 8.500   25.115 2.680   1.00 1.00 ? 17 ASN A HD22 8  
ATOM   5554  N N    . ASN A 1 18 ? 8.257   21.553 0.476   1.00 1.00 ? 18 ASN A N    8  
ATOM   5555  C CA   . ASN A 1 18 ? 7.663   20.378 1.097   1.00 1.00 ? 18 ASN A CA   8  
ATOM   5556  C C    . ASN A 1 18 ? 6.240   20.599 1.591   1.00 1.00 ? 18 ASN A C    8  
ATOM   5557  O O    . ASN A 1 18 ? 5.325   19.897 1.184   1.00 1.00 ? 18 ASN A O    8  
ATOM   5558  C CB   . ASN A 1 18 ? 8.564   19.928 2.250   1.00 1.00 ? 18 ASN A CB   8  
ATOM   5559  C CG   . ASN A 1 18 ? 8.130   18.564 2.758   1.00 1.00 ? 18 ASN A CG   8  
ATOM   5560  O OD1  . ASN A 1 18 ? 7.216   18.453 3.571   1.00 1.00 ? 18 ASN A OD1  8  
ATOM   5561  N ND2  . ASN A 1 18 ? 8.732   17.495 2.256   1.00 1.00 ? 18 ASN A ND2  8  
ATOM   5562  H H    . ASN A 1 18 ? 9.163   21.823 0.825   1.00 1.00 ? 18 ASN A H    8  
ATOM   5563  H HA   . ASN A 1 18 ? 7.591   19.594 0.353   1.00 1.00 ? 18 ASN A HA   8  
ATOM   5564  H HB2  . ASN A 1 18 ? 9.595   19.888 1.910   1.00 1.00 ? 18 ASN A HB2  8  
ATOM   5565  H HB3  . ASN A 1 18 ? 8.523   20.639 3.075   1.00 1.00 ? 18 ASN A HB3  8  
ATOM   5566  H HD21 . ASN A 1 18 ? 9.511   17.512 1.599   1.00 1.00 ? 18 ASN A HD21 8  
ATOM   5567  H HD22 . ASN A 1 18 ? 8.378   16.605 2.575   1.00 1.00 ? 18 ASN A HD22 8  
ATOM   5568  N N    . ASN A 1 19 ? 6.082   21.535 2.514   1.00 1.00 ? 19 ASN A N    8  
ATOM   5569  C CA   . ASN A 1 19 ? 4.802   21.883 3.128   1.00 1.00 ? 19 ASN A CA   8  
ATOM   5570  C C    . ASN A 1 19 ? 3.729   22.198 2.082   1.00 1.00 ? 19 ASN A C    8  
ATOM   5571  O O    . ASN A 1 19 ? 2.611   21.690 2.161   1.00 1.00 ? 19 ASN A O    8  
ATOM   5572  C CB   . ASN A 1 19 ? 4.969   23.052 4.103   1.00 1.00 ? 19 ASN A CB   8  
ATOM   5573  C CG   . ASN A 1 19 ? 3.623   23.413 4.722   1.00 1.00 ? 19 ASN A CG   8  
ATOM   5574  O OD1  . ASN A 1 19 ? 3.160   22.738 5.634   1.00 1.00 ? 19 ASN A OD1  8  
ATOM   5575  N ND2  . ASN A 1 19 ? 2.975   24.464 4.226   1.00 1.00 ? 19 ASN A ND2  8  
ATOM   5576  H H    . ASN A 1 19 ? 6.940   21.950 2.829   1.00 1.00 ? 19 ASN A H    8  
ATOM   5577  H HA   . ASN A 1 19 ? 4.458   21.029 3.709   1.00 1.00 ? 19 ASN A HA   8  
ATOM   5578  H HB2  . ASN A 1 19 ? 5.655   22.760 4.899   1.00 1.00 ? 19 ASN A HB2  8  
ATOM   5579  H HB3  . ASN A 1 19 ? 5.382   23.921 3.591   1.00 1.00 ? 19 ASN A HB3  8  
ATOM   5580  H HD21 . ASN A 1 19 ? 3.367   25.010 3.474   1.00 1.00 ? 19 ASN A HD21 8  
ATOM   5581  H HD22 . ASN A 1 19 ? 2.082   24.704 4.628   1.00 1.00 ? 19 ASN A HD22 8  
ATOM   5582  N N    . ALA A 1 20 ? 4.059   23.041 1.105   1.00 1.00 ? 20 ALA A N    8  
ATOM   5583  C CA   . ALA A 1 20 ? 3.120   23.385 0.045   1.00 1.00 ? 20 ALA A CA   8  
ATOM   5584  C C    . ALA A 1 20 ? 2.738   22.131 -0.741  1.00 1.00 ? 20 ALA A C    8  
ATOM   5585  O O    . ALA A 1 20 ? 1.551   21.830 -0.877  1.00 1.00 ? 20 ALA A O    8  
ATOM   5586  C CB   . ALA A 1 20 ? 3.709   24.456 -0.871  1.00 1.00 ? 20 ALA A CB   8  
ATOM   5587  H H    . ALA A 1 20 ? 4.997   23.428 1.093   1.00 1.00 ? 20 ALA A H    8  
ATOM   5588  H HA   . ALA A 1 20 ? 2.218   23.797 0.500   1.00 1.00 ? 20 ALA A HA   8  
ATOM   5589  H HB1  . ALA A 1 20 ? 3.954   25.347 -0.295  1.00 1.00 ? 20 ALA A HB1  8  
ATOM   5590  H HB2  . ALA A 1 20 ? 4.607   24.076 -1.357  1.00 1.00 ? 20 ALA A HB2  8  
ATOM   5591  H HB3  . ALA A 1 20 ? 2.969   24.721 -1.629  1.00 1.00 ? 20 ALA A HB3  8  
ATOM   5592  N N    . CYS A 1 21 ? 3.746   21.401 -1.238  1.00 1.00 ? 21 CYS A N    8  
ATOM   5593  C CA   . CYS A 1 21 ? 3.547   20.138 -1.948  1.00 1.00 ? 21 CYS A CA   8  
ATOM   5594  C C    . CYS A 1 21 ? 2.593   19.228 -1.172  1.00 1.00 ? 21 CYS A C    8  
ATOM   5595  O O    . CYS A 1 21 ? 1.587   18.755 -1.700  1.00 1.00 ? 21 CYS A O    8  
ATOM   5596  C CB   . CYS A 1 21 ? 4.895   19.433 -2.149  1.00 1.00 ? 21 CYS A CB   8  
ATOM   5597  S SG   . CYS A 1 21 ? 4.791   17.634 -2.341  1.00 1.00 ? 21 CYS A SG   8  
ATOM   5598  H H    . CYS A 1 21 ? 4.703   21.717 -1.093  1.00 1.00 ? 21 CYS A H    8  
ATOM   5599  H HA   . CYS A 1 21 ? 3.122   20.364 -2.925  1.00 1.00 ? 21 CYS A HA   8  
ATOM   5600  H HB2  . CYS A 1 21 ? 5.402   19.860 -3.014  1.00 1.00 ? 21 CYS A HB2  8  
ATOM   5601  H HB3  . CYS A 1 21 ? 5.524   19.594 -1.279  1.00 1.00 ? 21 CYS A HB3  8  
ATOM   5602  N N    . LYS A 1 22 ? 2.934   19.010 0.098   1.00 1.00 ? 22 LYS A N    8  
ATOM   5603  C CA   . LYS A 1 22 ? 2.214   18.194 1.052   1.00 1.00 ? 22 LYS A CA   8  
ATOM   5604  C C    . LYS A 1 22 ? 0.753   18.601 1.087   1.00 1.00 ? 22 LYS A C    8  
ATOM   5605  O O    . LYS A 1 22 ? -0.112  17.795 0.744   1.00 1.00 ? 22 LYS A O    8  
ATOM   5606  C CB   . LYS A 1 22 ? 2.901   18.338 2.420   1.00 1.00 ? 22 LYS A CB   8  
ATOM   5607  C CG   . LYS A 1 22 ? 2.195   17.633 3.587   1.00 1.00 ? 22 LYS A CG   8  
ATOM   5608  C CD   . LYS A 1 22 ? 2.912   17.839 4.939   1.00 1.00 ? 22 LYS A CD   8  
ATOM   5609  C CE   . LYS A 1 22 ? 4.446   17.996 4.900   1.00 1.00 ? 22 LYS A CE   8  
ATOM   5610  N NZ   . LYS A 1 22 ? 5.161   16.827 4.351   1.00 1.00 ? 22 LYS A NZ   8  
ATOM   5611  H H    . LYS A 1 22 ? 3.770   19.473 0.426   1.00 1.00 ? 22 LYS A H    8  
ATOM   5612  H HA   . LYS A 1 22 ? 2.259   17.163 0.716   1.00 1.00 ? 22 LYS A HA   8  
ATOM   5613  H HB2  . LYS A 1 22 ? 3.911   17.956 2.296   1.00 1.00 ? 22 LYS A HB2  8  
ATOM   5614  H HB3  . LYS A 1 22 ? 2.973   19.387 2.682   1.00 1.00 ? 22 LYS A HB3  8  
ATOM   5615  H HG2  . LYS A 1 22 ? 1.189   18.045 3.697   1.00 1.00 ? 22 LYS A HG2  8  
ATOM   5616  H HG3  . LYS A 1 22 ? 2.067   16.578 3.360   1.00 1.00 ? 22 LYS A HG3  8  
ATOM   5617  H HD2  . LYS A 1 22 ? 2.523   18.766 5.368   1.00 1.00 ? 22 LYS A HD2  8  
ATOM   5618  H HD3  . LYS A 1 22 ? 2.632   17.030 5.617   1.00 1.00 ? 22 LYS A HD3  8  
ATOM   5619  H HE2  . LYS A 1 22 ? 4.703   18.868 4.301   1.00 1.00 ? 22 LYS A HE2  8  
ATOM   5620  H HE3  . LYS A 1 22 ? 4.810   18.181 5.913   1.00 1.00 ? 22 LYS A HE3  8  
ATOM   5621  H HZ1  . LYS A 1 22 ? 4.739   16.523 3.483   1.00 1.00 ? 22 LYS A HZ1  8  
ATOM   5622  H HZ2  . LYS A 1 22 ? 6.124   17.076 4.137   1.00 1.00 ? 22 LYS A HZ2  8  
ATOM   5623  H HZ3  . LYS A 1 22 ? 5.153   16.047 4.989   1.00 1.00 ? 22 LYS A HZ3  8  
ATOM   5624  N N    . ASN A 1 23 ? 0.495   19.842 1.512   1.00 1.00 ? 23 ASN A N    8  
ATOM   5625  C CA   . ASN A 1 23 ? -0.856  20.358 1.621   1.00 1.00 ? 23 ASN A CA   8  
ATOM   5626  C C    . ASN A 1 23 ? -1.585  20.123 0.307   1.00 1.00 ? 23 ASN A C    8  
ATOM   5627  O O    . ASN A 1 23 ? -2.558  19.378 0.275   1.00 1.00 ? 23 ASN A O    8  
ATOM   5628  C CB   . ASN A 1 23 ? -0.844  21.852 1.981   1.00 1.00 ? 23 ASN A CB   8  
ATOM   5629  C CG   . ASN A 1 23 ? -2.185  22.552 1.719   1.00 1.00 ? 23 ASN A CG   8  
ATOM   5630  O OD1  . ASN A 1 23 ? -3.263  21.984 1.879   1.00 1.00 ? 23 ASN A OD1  8  
ATOM   5631  N ND2  . ASN A 1 23 ? -2.133  23.811 1.293   1.00 1.00 ? 23 ASN A ND2  8  
ATOM   5632  H H    . ASN A 1 23 ? 1.273   20.461 1.730   1.00 1.00 ? 23 ASN A H    8  
ATOM   5633  H HA   . ASN A 1 23 ? -1.357  19.788 2.406   1.00 1.00 ? 23 ASN A HA   8  
ATOM   5634  H HB2  . ASN A 1 23 ? -0.577  21.969 3.031   1.00 1.00 ? 23 ASN A HB2  8  
ATOM   5635  H HB3  . ASN A 1 23 ? -0.079  22.345 1.378   1.00 1.00 ? 23 ASN A HB3  8  
ATOM   5636  H HD21 . ASN A 1 23 ? -1.246  24.274 1.165   1.00 1.00 ? 23 ASN A HD21 8  
ATOM   5637  H HD22 . ASN A 1 23 ? -2.996  24.299 1.111   1.00 1.00 ? 23 ASN A HD22 8  
ATOM   5638  N N    . GLN A 1 24 ? -1.099  20.728 -0.779  1.00 1.00 ? 24 GLN A N    8  
ATOM   5639  C CA   . GLN A 1 24 ? -1.795  20.660 -2.051  1.00 1.00 ? 24 GLN A CA   8  
ATOM   5640  C C    . GLN A 1 24 ? -2.107  19.221 -2.429  1.00 1.00 ? 24 GLN A C    8  
ATOM   5641  O O    . GLN A 1 24 ? -3.244  18.935 -2.793  1.00 1.00 ? 24 GLN A O    8  
ATOM   5642  C CB   . GLN A 1 24 ? -1.014  21.385 -3.152  1.00 1.00 ? 24 GLN A CB   8  
ATOM   5643  C CG   . GLN A 1 24 ? -1.010  22.899 -2.895  1.00 1.00 ? 24 GLN A CG   8  
ATOM   5644  C CD   . GLN A 1 24 ? -0.309  23.725 -3.972  1.00 1.00 ? 24 GLN A CD   8  
ATOM   5645  O OE1  . GLN A 1 24 ? 0.187   24.809 -3.690  1.00 1.00 ? 24 GLN A OE1  8  
ATOM   5646  N NE2  . GLN A 1 24 ? -0.252  23.237 -5.207  1.00 1.00 ? 24 GLN A NE2  8  
ATOM   5647  H H    . GLN A 1 24 ? -0.213  21.226 -0.725  1.00 1.00 ? 24 GLN A H    8  
ATOM   5648  H HA   . GLN A 1 24 ? -2.771  21.135 -1.924  1.00 1.00 ? 24 GLN A HA   8  
ATOM   5649  H HB2  . GLN A 1 24 ? 0.007   21.003 -3.194  1.00 1.00 ? 24 GLN A HB2  8  
ATOM   5650  H HB3  . GLN A 1 24 ? -1.518  21.176 -4.096  1.00 1.00 ? 24 GLN A HB3  8  
ATOM   5651  H HG2  . GLN A 1 24 ? -2.039  23.249 -2.833  1.00 1.00 ? 24 GLN A HG2  8  
ATOM   5652  H HG3  . GLN A 1 24 ? -0.509  23.101 -1.949  1.00 1.00 ? 24 GLN A HG3  8  
ATOM   5653  H HE21 . GLN A 1 24 ? -0.612  22.322 -5.418  1.00 1.00 ? 24 GLN A HE21 8  
ATOM   5654  H HE22 . GLN A 1 24 ? 0.230   23.780 -5.907  1.00 1.00 ? 24 GLN A HE22 8  
ATOM   5655  N N    . CYS A 1 25 ? -1.147  18.302 -2.305  1.00 1.00 ? 25 CYS A N    8  
ATOM   5656  C CA   . CYS A 1 25 ? -1.442  16.913 -2.599  1.00 1.00 ? 25 CYS A CA   8  
ATOM   5657  C C    . CYS A 1 25 ? -2.596  16.391 -1.741  1.00 1.00 ? 25 CYS A C    8  
ATOM   5658  O O    . CYS A 1 25 ? -3.652  16.049 -2.271  1.00 1.00 ? 25 CYS A O    8  
ATOM   5659  C CB   . CYS A 1 25 ? -0.233  16.003 -2.419  1.00 1.00 ? 25 CYS A CB   8  
ATOM   5660  S SG   . CYS A 1 25 ? -0.685  14.363 -3.011  1.00 1.00 ? 25 CYS A SG   8  
ATOM   5661  H H    . CYS A 1 25 ? -0.224  18.563 -1.967  1.00 1.00 ? 25 CYS A H    8  
ATOM   5662  H HA   . CYS A 1 25 ? -1.743  16.853 -3.646  1.00 1.00 ? 25 CYS A HA   8  
ATOM   5663  H HB2  . CYS A 1 25 ? 0.627   16.363 -2.970  1.00 1.00 ? 25 CYS A HB2  8  
ATOM   5664  H HB3  . CYS A 1 25 ? 0.042   15.936 -1.367  1.00 1.00 ? 25 CYS A HB3  8  
ATOM   5665  N N    . ILE A 1 26 ? -2.410  16.331 -0.418  1.00 1.00 ? 26 ILE A N    8  
ATOM   5666  C CA   . ILE A 1 26 ? -3.365  15.645 0.454   1.00 1.00 ? 26 ILE A CA   8  
ATOM   5667  C C    . ILE A 1 26 ? -4.706  16.385 0.538   1.00 1.00 ? 26 ILE A C    8  
ATOM   5668  O O    . ILE A 1 26 ? -5.698  15.820 1.012   1.00 1.00 ? 26 ILE A O    8  
ATOM   5669  C CB   . ILE A 1 26 ? -2.749  15.404 1.847   1.00 1.00 ? 26 ILE A CB   8  
ATOM   5670  C CG1  . ILE A 1 26 ? -2.667  16.697 2.679   1.00 1.00 ? 26 ILE A CG1  8  
ATOM   5671  C CG2  . ILE A 1 26 ? -1.381  14.717 1.710   1.00 1.00 ? 26 ILE A CG2  8  
ATOM   5672  C CD1  . ILE A 1 26 ? -1.963  16.498 4.025   1.00 1.00 ? 26 ILE A CD1  8  
ATOM   5673  H H    . ILE A 1 26 ? -1.588  16.772 -0.007  1.00 1.00 ? 26 ILE A H    8  
ATOM   5674  H HA   . ILE A 1 26 ? -3.578  14.674 0.000   1.00 1.00 ? 26 ILE A HA   8  
ATOM   5675  H HB   . ILE A 1 26 ? -3.405  14.720 2.386   1.00 1.00 ? 26 ILE A HB   8  
ATOM   5676  H HG12 . ILE A 1 26 ? -2.145  17.471 2.123   1.00 1.00 ? 26 ILE A HG12 8  
ATOM   5677  H HG13 . ILE A 1 26 ? -3.675  17.052 2.890   1.00 1.00 ? 26 ILE A HG13 8  
ATOM   5678  H HG21 . ILE A 1 26 ? -1.454  13.873 1.025   1.00 1.00 ? 26 ILE A HG21 8  
ATOM   5679  H HG22 . ILE A 1 26 ? -0.630  15.408 1.334   1.00 1.00 ? 26 ILE A HG22 8  
ATOM   5680  H HG23 . ILE A 1 26 ? -1.056  14.347 2.678   1.00 1.00 ? 26 ILE A HG23 8  
ATOM   5681  H HD11 . ILE A 1 26 ? -2.419  15.669 4.565   1.00 1.00 ? 26 ILE A HD11 8  
ATOM   5682  H HD12 . ILE A 1 26 ? -0.902  16.300 3.875   1.00 1.00 ? 26 ILE A HD12 8  
ATOM   5683  H HD13 . ILE A 1 26 ? -2.064  17.408 4.618   1.00 1.00 ? 26 ILE A HD13 8  
ATOM   5684  N N    . ASN A 1 27 ? -4.717  17.649 0.102   1.00 1.00 ? 27 ASN A N    8  
ATOM   5685  C CA   . ASN A 1 27 ? -5.883  18.509 0.049   1.00 1.00 ? 27 ASN A CA   8  
ATOM   5686  C C    . ASN A 1 27 ? -6.650  18.232 -1.245  1.00 1.00 ? 27 ASN A C    8  
ATOM   5687  O O    . ASN A 1 27 ? -7.810  17.819 -1.198  1.00 1.00 ? 27 ASN A O    8  
ATOM   5688  C CB   . ASN A 1 27 ? -5.381  19.952 0.165   1.00 1.00 ? 27 ASN A CB   8  
ATOM   5689  C CG   . ASN A 1 27 ? -6.458  21.001 0.364   1.00 1.00 ? 27 ASN A CG   8  
ATOM   5690  O OD1  . ASN A 1 27 ? -7.594  20.846 -0.070  1.00 1.00 ? 27 ASN A OD1  8  
ATOM   5691  N ND2  . ASN A 1 27 ? -6.087  22.089 1.034   1.00 1.00 ? 27 ASN A ND2  8  
ATOM   5692  H H    . ASN A 1 27 ? -3.834  18.072 -0.183  1.00 1.00 ? 27 ASN A H    8  
ATOM   5693  H HA   . ASN A 1 27 ? -6.530  18.301 0.903   1.00 1.00 ? 27 ASN A HA   8  
ATOM   5694  H HB2  . ASN A 1 27 ? -4.748  19.989 1.051   1.00 1.00 ? 27 ASN A HB2  8  
ATOM   5695  H HB3  . ASN A 1 27 ? -4.791  20.224 -0.711  1.00 1.00 ? 27 ASN A HB3  8  
ATOM   5696  H HD21 . ASN A 1 27 ? -5.133  22.154 1.390   1.00 1.00 ? 27 ASN A HD21 8  
ATOM   5697  H HD22 . ASN A 1 27 ? -6.761  22.819 1.202   1.00 1.00 ? 27 ASN A HD22 8  
ATOM   5698  N N    . LEU A 1 28 ? -5.997  18.396 -2.402  1.00 1.00 ? 28 LEU A N    8  
ATOM   5699  C CA   . LEU A 1 28 ? -6.622  18.200 -3.703  1.00 1.00 ? 28 LEU A CA   8  
ATOM   5700  C C    . LEU A 1 28 ? -6.908  16.714 -3.925  1.00 1.00 ? 28 LEU A C    8  
ATOM   5701  O O    . LEU A 1 28 ? -8.076  16.316 -3.963  1.00 1.00 ? 28 LEU A O    8  
ATOM   5702  C CB   . LEU A 1 28 ? -5.756  18.789 -4.828  1.00 1.00 ? 28 LEU A CB   8  
ATOM   5703  C CG   . LEU A 1 28 ? -5.954  20.300 -5.043  1.00 1.00 ? 28 LEU A CG   8  
ATOM   5704  C CD1  . LEU A 1 28 ? -5.697  21.147 -3.791  1.00 1.00 ? 28 LEU A CD1  8  
ATOM   5705  C CD2  . LEU A 1 28 ? -5.020  20.767 -6.166  1.00 1.00 ? 28 LEU A CD2  8  
ATOM   5706  H H    . LEU A 1 28 ? -5.015  18.655 -2.391  1.00 1.00 ? 28 LEU A H    8  
ATOM   5707  H HA   . LEU A 1 28 ? -7.583  18.719 -3.716  1.00 1.00 ? 28 LEU A HA   8  
ATOM   5708  H HB2  . LEU A 1 28 ? -4.705  18.564 -4.658  1.00 1.00 ? 28 LEU A HB2  8  
ATOM   5709  H HB3  . LEU A 1 28 ? -6.043  18.302 -5.757  1.00 1.00 ? 28 LEU A HB3  8  
ATOM   5710  H HG   . LEU A 1 28 ? -6.984  20.473 -5.363  1.00 1.00 ? 28 LEU A HG   8  
ATOM   5711  H HD11 . LEU A 1 28 ? -4.692  20.968 -3.415  1.00 1.00 ? 28 LEU A HD11 8  
ATOM   5712  H HD12 . LEU A 1 28 ? -5.796  22.205 -4.040  1.00 1.00 ? 28 LEU A HD12 8  
ATOM   5713  H HD13 . LEU A 1 28 ? -6.426  20.915 -3.016  1.00 1.00 ? 28 LEU A HD13 8  
ATOM   5714  H HD21 . LEU A 1 28 ? -5.218  20.198 -7.075  1.00 1.00 ? 28 LEU A HD21 8  
ATOM   5715  H HD22 . LEU A 1 28 ? -5.188  21.825 -6.372  1.00 1.00 ? 28 LEU A HD22 8  
ATOM   5716  H HD23 . LEU A 1 28 ? -3.980  20.622 -5.871  1.00 1.00 ? 28 LEU A HD23 8  
ATOM   5717  N N    . GLU A 1 29 ? -5.876  15.863 -3.988  1.00 1.00 ? 29 GLU A N    8  
ATOM   5718  C CA   . GLU A 1 29 ? -6.110  14.425 -4.094  1.00 1.00 ? 29 GLU A CA   8  
ATOM   5719  C C    . GLU A 1 29 ? -6.227  13.888 -2.668  1.00 1.00 ? 29 GLU A C    8  
ATOM   5720  O O    . GLU A 1 29 ? -6.290  14.669 -1.717  1.00 1.00 ? 29 GLU A O    8  
ATOM   5721  C CB   . GLU A 1 29 ? -5.090  13.727 -5.019  1.00 1.00 ? 29 GLU A CB   8  
ATOM   5722  C CG   . GLU A 1 29 ? -3.642  13.665 -4.526  1.00 1.00 ? 29 GLU A CG   8  
ATOM   5723  C CD   . GLU A 1 29 ? -2.657  13.436 -5.662  1.00 1.00 ? 29 GLU A CD   8  
ATOM   5724  O OE1  . GLU A 1 29 ? -2.533  12.315 -6.156  1.00 1.00 ? 29 GLU A OE1  8  
ATOM   5725  O OE2  . GLU A 1 29 ? -1.951  14.534 -6.035  1.00 1.00 ? 29 GLU A OE2  8  
ATOM   5726  H H    . GLU A 1 29 ? -4.962  16.179 -3.671  1.00 1.00 ? 29 GLU A H    8  
ATOM   5727  H HA   . GLU A 1 29 ? -7.074  14.247 -4.575  1.00 1.00 ? 29 GLU A HA   8  
ATOM   5728  H HB2  . GLU A 1 29 ? -5.420  12.707 -5.218  1.00 1.00 ? 29 GLU A HB2  8  
ATOM   5729  H HB3  . GLU A 1 29 ? -5.105  14.267 -5.968  1.00 1.00 ? 29 GLU A HB3  8  
ATOM   5730  H HG2  . GLU A 1 29 ? -3.383  14.617 -4.082  1.00 1.00 ? 29 GLU A HG2  8  
ATOM   5731  H HG3  . GLU A 1 29 ? -3.501  12.869 -3.798  1.00 1.00 ? 29 GLU A HG3  8  
ATOM   5732  H HE2  . GLU A 1 29 ? -1.280  14.307 -6.685  1.00 1.00 ? 29 GLU A HE2  8  
ATOM   5733  N N    . LYS A 1 30 ? -6.402  12.580 -2.502  1.00 1.00 ? 30 LYS A N    8  
ATOM   5734  C CA   . LYS A 1 30 ? -6.763  12.003 -1.209  1.00 1.00 ? 30 LYS A CA   8  
ATOM   5735  C C    . LYS A 1 30 ? -5.619  11.214 -0.575  1.00 1.00 ? 30 LYS A C    8  
ATOM   5736  O O    . LYS A 1 30 ? -5.811  10.562 0.452   1.00 1.00 ? 30 LYS A O    8  
ATOM   5737  C CB   . LYS A 1 30 ? -8.107  11.273 -1.328  1.00 1.00 ? 30 LYS A CB   8  
ATOM   5738  C CG   . LYS A 1 30 ? -9.234  12.256 -1.719  1.00 1.00 ? 30 LYS A CG   8  
ATOM   5739  C CD   . LYS A 1 30 ? -9.640  13.204 -0.570  1.00 1.00 ? 30 LYS A CD   8  
ATOM   5740  C CE   . LYS A 1 30 ? -10.015 14.636 -1.003  1.00 1.00 ? 30 LYS A CE   8  
ATOM   5741  N NZ   . LYS A 1 30 ? -8.873  15.416 -1.537  1.00 1.00 ? 30 LYS A NZ   8  
ATOM   5742  H H    . LYS A 1 30 ? -6.352  11.968 -3.301  1.00 1.00 ? 30 LYS A H    8  
ATOM   5743  H HA   . LYS A 1 30 ? -6.910  12.798 -0.483  1.00 1.00 ? 30 LYS A HA   8  
ATOM   5744  H HB2  . LYS A 1 30 ? -8.023  10.495 -2.090  1.00 1.00 ? 30 LYS A HB2  8  
ATOM   5745  H HB3  . LYS A 1 30 ? -8.361  10.798 -0.379  1.00 1.00 ? 30 LYS A HB3  8  
ATOM   5746  H HG2  . LYS A 1 30 ? -8.946  12.819 -2.606  1.00 1.00 ? 30 LYS A HG2  8  
ATOM   5747  H HG3  . LYS A 1 30 ? -10.112 11.667 -1.994  1.00 1.00 ? 30 LYS A HG3  8  
ATOM   5748  H HD2  . LYS A 1 30 ? -10.512 12.764 -0.080  1.00 1.00 ? 30 LYS A HD2  8  
ATOM   5749  H HD3  . LYS A 1 30 ? -8.866  13.266 0.194   1.00 1.00 ? 30 LYS A HD3  8  
ATOM   5750  H HE2  . LYS A 1 30 ? -10.820 14.613 -1.740  1.00 1.00 ? 30 LYS A HE2  8  
ATOM   5751  H HE3  . LYS A 1 30 ? -10.383 15.157 -0.118  1.00 1.00 ? 30 LYS A HE3  8  
ATOM   5752  H HZ1  . LYS A 1 30 ? -7.978  15.135 -1.146  1.00 1.00 ? 30 LYS A HZ1  8  
ATOM   5753  H HZ2  . LYS A 1 30 ? -8.792  15.356 -2.546  1.00 1.00 ? 30 LYS A HZ2  8  
ATOM   5754  H HZ3  . LYS A 1 30 ? -8.960  16.410 -1.337  1.00 1.00 ? 30 LYS A HZ3  8  
ATOM   5755  N N    . ALA A 1 31 ? -4.414  11.342 -1.139  1.00 1.00 ? 31 ALA A N    8  
ATOM   5756  C CA   . ALA A 1 31 ? -3.179  10.870 -0.526  1.00 1.00 ? 31 ALA A CA   8  
ATOM   5757  C C    . ALA A 1 31 ? -3.151  11.339 0.923   1.00 1.00 ? 31 ALA A C    8  
ATOM   5758  O O    . ALA A 1 31 ? -3.664  12.422 1.200   1.00 1.00 ? 31 ALA A O    8  
ATOM   5759  C CB   . ALA A 1 31 ? -2.014  11.537 -1.242  1.00 1.00 ? 31 ALA A CB   8  
ATOM   5760  H H    . ALA A 1 31 ? -4.327  11.953 -1.934  1.00 1.00 ? 31 ALA A H    8  
ATOM   5761  H HA   . ALA A 1 31 ? -3.110  9.784  -0.588  1.00 1.00 ? 31 ALA A HA   8  
ATOM   5762  H HB1  . ALA A 1 31 ? -2.052  11.386 -2.315  1.00 1.00 ? 31 ALA A HB1  8  
ATOM   5763  H HB2  . ALA A 1 31 ? -2.056  12.611 -1.052  1.00 1.00 ? 31 ALA A HB2  8  
ATOM   5764  H HB3  . ALA A 1 31 ? -1.078  11.139 -0.855  1.00 1.00 ? 31 ALA A HB3  8  
ATOM   5765  N N    . ARG A 1 32 ? -2.607  10.558 1.854   1.00 1.00 ? 32 ARG A N    8  
ATOM   5766  C CA   . ARG A 1 32 ? -2.596  10.971 3.253   1.00 1.00 ? 32 ARG A CA   8  
ATOM   5767  C C    . ARG A 1 32 ? -1.286  11.643 3.613   1.00 1.00 ? 32 ARG A C    8  
ATOM   5768  O O    . ARG A 1 32 ? -1.282  12.487 4.507   1.00 1.00 ? 32 ARG A O    8  
ATOM   5769  C CB   . ARG A 1 32 ? -2.938  9.814  4.194   1.00 1.00 ? 32 ARG A CB   8  
ATOM   5770  C CG   . ARG A 1 32 ? -4.388  9.323  4.055   1.00 1.00 ? 32 ARG A CG   8  
ATOM   5771  C CD   . ARG A 1 32 ? -5.484  10.380 4.325   1.00 1.00 ? 32 ARG A CD   8  
ATOM   5772  N NE   . ARG A 1 32 ? -5.730  11.268 3.168   1.00 1.00 ? 32 ARG A NE   8  
ATOM   5773  C CZ   . ARG A 1 32 ? -6.141  12.549 3.222   1.00 1.00 ? 32 ARG A CZ   8  
ATOM   5774  N NH1  . ARG A 1 32 ? -6.696  13.029 4.339   1.00 1.00 ? 32 ARG A NH1  8  
ATOM   5775  N NH2  . ARG A 1 32 ? -5.974  13.343 2.159   1.00 1.00 ? 32 ARG A NH2  8  
ATOM   5776  H H    . ARG A 1 32 ? -2.057  9.758  1.558   1.00 1.00 ? 32 ARG A H    8  
ATOM   5777  H HA   . ARG A 1 32 ? -3.332  11.747 3.438   1.00 1.00 ? 32 ARG A HA   8  
ATOM   5778  H HB2  . ARG A 1 32 ? -2.252  8.985  4.009   1.00 1.00 ? 32 ARG A HB2  8  
ATOM   5779  H HB3  . ARG A 1 32 ? -2.793  10.150 5.222   1.00 1.00 ? 32 ARG A HB3  8  
ATOM   5780  H HG2  . ARG A 1 32 ? -4.526  8.883  3.069   1.00 1.00 ? 32 ARG A HG2  8  
ATOM   5781  H HG3  . ARG A 1 32 ? -4.497  8.531  4.801   1.00 1.00 ? 32 ARG A HG3  8  
ATOM   5782  H HD2  . ARG A 1 32 ? -6.415  9.850  4.540   1.00 1.00 ? 32 ARG A HD2  8  
ATOM   5783  H HD3  . ARG A 1 32 ? -5.193  10.949 5.210   1.00 1.00 ? 32 ARG A HD3  8  
ATOM   5784  H HE   . ARG A 1 32 ? -5.500  10.891 2.250   1.00 1.00 ? 32 ARG A HE   8  
ATOM   5785  H HH11 . ARG A 1 32 ? -6.842  12.411 5.124   1.00 1.00 ? 32 ARG A HH11 8  
ATOM   5786  H HH12 . ARG A 1 32 ? -6.987  13.992 4.411   1.00 1.00 ? 32 ARG A HH12 8  
ATOM   5787  H HH21 . ARG A 1 32 ? -5.327  13.014 1.449   1.00 1.00 ? 32 ARG A HH21 8  
ATOM   5788  H HH22 . ARG A 1 32 ? -6.198  14.336 2.119   1.00 1.00 ? 32 ARG A HH22 8  
ATOM   5789  N N    . HIS A 1 33 ? -0.155  11.217 3.048   1.00 1.00 ? 33 HIS A N    8  
ATOM   5790  C CA   . HIS A 1 33 ? 1.074   11.991 3.174   1.00 1.00 ? 33 HIS A CA   8  
ATOM   5791  C C    . HIS A 1 33 ? 1.380   12.617 1.826   1.00 1.00 ? 33 HIS A C    8  
ATOM   5792  O O    . HIS A 1 33 ? 1.044   12.047 0.790   1.00 1.00 ? 33 HIS A O    8  
ATOM   5793  C CB   . HIS A 1 33 ? 2.243   11.164 3.713   1.00 1.00 ? 33 HIS A CB   8  
ATOM   5794  C CG   . HIS A 1 33 ? 1.991   10.517 5.048   1.00 1.00 ? 33 HIS A CG   8  
ATOM   5795  N ND1  . HIS A 1 33 ? 0.780   10.589 5.720   1.00 1.00 ? 33 HIS A ND1  8  
ATOM   5796  C CD2  . HIS A 1 33 ? 2.797   9.742  5.841   1.00 1.00 ? 33 HIS A CD2  8  
ATOM   5797  C CE1  . HIS A 1 33 ? 0.836   9.717  6.736   1.00 1.00 ? 33 HIS A CE1  8  
ATOM   5798  N NE2  . HIS A 1 33 ? 2.056   9.191  6.886   1.00 1.00 ? 33 HIS A NE2  8  
ATOM   5799  H H    . HIS A 1 33 ? -0.198  10.539 2.290   1.00 1.00 ? 33 HIS A H    8  
ATOM   5800  H HA   . HIS A 1 33 ? 0.946   12.825 3.867   1.00 1.00 ? 33 HIS A HA   8  
ATOM   5801  H HB2  . HIS A 1 33 ? 2.483   10.377 3.007   1.00 1.00 ? 33 HIS A HB2  8  
ATOM   5802  H HB3  . HIS A 1 33 ? 3.116   11.810 3.809   1.00 1.00 ? 33 HIS A HB3  8  
ATOM   5803  H HD1  . HIS A 1 33 ? -0.018  11.155 5.463   1.00 1.00 ? 33 HIS A HD1  8  
ATOM   5804  H HD2  . HIS A 1 33 ? 3.830   9.525  5.600   1.00 1.00 ? 33 HIS A HD2  8  
ATOM   5805  H HE1  . HIS A 1 33 ? -0.027  9.482  7.347   1.00 1.00 ? 33 HIS A HE1  8  
ATOM   5806  N N    . GLY A 1 34 ? 2.060   13.756 1.847   1.00 1.00 ? 34 GLY A N    8  
ATOM   5807  C CA   . GLY A 1 34 ? 2.636   14.390 0.683   1.00 1.00 ? 34 GLY A CA   8  
ATOM   5808  C C    . GLY A 1 34 ? 3.907   15.051 1.181   1.00 1.00 ? 34 GLY A C    8  
ATOM   5809  O O    . GLY A 1 34 ? 3.973   15.399 2.362   1.00 1.00 ? 34 GLY A O    8  
ATOM   5810  H H    . GLY A 1 34 ? 2.346   14.149 2.734   1.00 1.00 ? 34 GLY A H    8  
ATOM   5811  H HA2  . GLY A 1 34 ? 2.912   13.646 -0.048  1.00 1.00 ? 34 GLY A HA2  8  
ATOM   5812  H HA3  . GLY A 1 34 ? 1.937   15.095 0.239   1.00 1.00 ? 34 GLY A HA3  8  
ATOM   5813  N N    . SER A 1 35 ? 4.947   15.149 0.360   1.00 1.00 ? 35 SER A N    8  
ATOM   5814  C CA   . SER A 1 35 ? 6.234   15.642 0.818   1.00 1.00 ? 35 SER A CA   8  
ATOM   5815  C C    . SER A 1 35 ? 7.130   15.825 -0.406  1.00 1.00 ? 35 SER A C    8  
ATOM   5816  O O    . SER A 1 35 ? 7.218   14.958 -1.272  1.00 1.00 ? 35 SER A O    8  
ATOM   5817  C CB   . SER A 1 35 ? 6.843   14.656 1.843   1.00 1.00 ? 35 SER A CB   8  
ATOM   5818  O OG   . SER A 1 35 ? 7.175   15.319 3.055   1.00 1.00 ? 35 SER A OG   8  
ATOM   5819  H H    . SER A 1 35 ? 4.887   14.791 -0.595  1.00 1.00 ? 35 SER A H    8  
ATOM   5820  H HA   . SER A 1 35 ? 6.087   16.628 1.287   1.00 1.00 ? 35 SER A HA   8  
ATOM   5821  H HB2  . SER A 1 35 ? 6.141   13.854 2.092   1.00 1.00 ? 35 SER A HB2  8  
ATOM   5822  H HB3  . SER A 1 35 ? 7.732   14.174 1.428   1.00 1.00 ? 35 SER A HB3  8  
ATOM   5823  H HG   . SER A 1 35 ? 7.616   14.681 3.629   1.00 1.00 ? 35 SER A HG   8  
ATOM   5824  N N    . CYS A 1 36 ? 7.794   16.971 -0.475  1.00 1.00 ? 36 CYS A N    8  
ATOM   5825  C CA   . CYS A 1 36 ? 8.834   17.213 -1.452  1.00 1.00 ? 36 CYS A CA   8  
ATOM   5826  C C    . CYS A 1 36 ? 10.083  16.452 -1.047  1.00 1.00 ? 36 CYS A C    8  
ATOM   5827  O O    . CYS A 1 36 ? 10.421  16.456 0.138   1.00 1.00 ? 36 CYS A O    8  
ATOM   5828  C CB   . CYS A 1 36 ? 9.181   18.692 -1.474  1.00 1.00 ? 36 CYS A CB   8  
ATOM   5829  S SG   . CYS A 1 36 ? 10.601  19.040 -2.505  1.00 1.00 ? 36 CYS A SG   8  
ATOM   5830  H H    . CYS A 1 36 ? 7.700   17.613 0.293   1.00 1.00 ? 36 CYS A H    8  
ATOM   5831  H HA   . CYS A 1 36 ? 8.503   16.903 -2.438  1.00 1.00 ? 36 CYS A HA   8  
ATOM   5832  H HB2  . CYS A 1 36 ? 8.326   19.268 -1.828  1.00 1.00 ? 36 CYS A HB2  8  
ATOM   5833  H HB3  . CYS A 1 36 ? 9.474   19.016 -0.479  1.00 1.00 ? 36 CYS A HB3  8  
ATOM   5834  N N    . ASN A 1 37 ? 10.777  15.861 -2.023  1.00 1.00 ? 37 ASN A N    8  
ATOM   5835  C CA   . ASN A 1 37 ? 12.097  15.280 -1.826  1.00 1.00 ? 37 ASN A CA   8  
ATOM   5836  C C    . ASN A 1 37 ? 12.997  15.753 -2.964  1.00 1.00 ? 37 ASN A C    8  
ATOM   5837  O O    . ASN A 1 37 ? 12.501  16.043 -4.057  1.00 1.00 ? 37 ASN A O    8  
ATOM   5838  C CB   . ASN A 1 37 ? 11.994  13.750 -1.794  1.00 1.00 ? 37 ASN A CB   8  
ATOM   5839  C CG   . ASN A 1 37 ? 13.196  13.120 -1.094  1.00 1.00 ? 37 ASN A CG   8  
ATOM   5840  O OD1  . ASN A 1 37 ? 13.128  12.812 0.089   1.00 1.00 ? 37 ASN A OD1  8  
ATOM   5841  N ND2  . ASN A 1 37 ? 14.311  12.922 -1.791  1.00 1.00 ? 37 ASN A ND2  8  
ATOM   5842  H H    . ASN A 1 37 ? 10.451  15.952 -2.986  1.00 1.00 ? 37 ASN A H    8  
ATOM   5843  H HA   . ASN A 1 37 ? 12.516  15.629 -0.880  1.00 1.00 ? 37 ASN A HA   8  
ATOM   5844  H HB2  . ASN A 1 37 ? 11.105  13.471 -1.225  1.00 1.00 ? 37 ASN A HB2  8  
ATOM   5845  H HB3  . ASN A 1 37 ? 11.891  13.353 -2.805  1.00 1.00 ? 37 ASN A HB3  8  
ATOM   5846  H HD21 . ASN A 1 37 ? 14.395  13.154 -2.778  1.00 1.00 ? 37 ASN A HD21 8  
ATOM   5847  H HD22 . ASN A 1 37 ? 15.089  12.488 -1.317  1.00 1.00 ? 37 ASN A HD22 8  
ATOM   5848  N N    . TYR A 1 38 ? 14.312  15.833 -2.727  1.00 1.00 ? 38 TYR A N    8  
ATOM   5849  C CA   . TYR A 1 38 ? 15.239  16.063 -3.823  1.00 1.00 ? 38 TYR A CA   8  
ATOM   5850  C C    . TYR A 1 38 ? 15.179  14.865 -4.766  1.00 1.00 ? 38 TYR A C    8  
ATOM   5851  O O    . TYR A 1 38 ? 15.161  13.720 -4.317  1.00 1.00 ? 38 TYR A O    8  
ATOM   5852  C CB   . TYR A 1 38 ? 16.680  16.311 -3.355  1.00 1.00 ? 38 TYR A CB   8  
ATOM   5853  C CG   . TYR A 1 38 ? 17.602  16.582 -4.535  1.00 1.00 ? 38 TYR A CG   8  
ATOM   5854  C CD1  . TYR A 1 38 ? 17.606  17.860 -5.128  1.00 1.00 ? 38 TYR A CD1  8  
ATOM   5855  C CD2  . TYR A 1 38 ? 18.173  15.501 -5.235  1.00 1.00 ? 38 TYR A CD2  8  
ATOM   5856  C CE1  . TYR A 1 38 ? 18.080  18.030 -6.441  1.00 1.00 ? 38 TYR A CE1  8  
ATOM   5857  C CE2  . TYR A 1 38 ? 18.576  15.659 -6.574  1.00 1.00 ? 38 TYR A CE2  8  
ATOM   5858  C CZ   . TYR A 1 38 ? 18.464  16.911 -7.201  1.00 1.00 ? 38 TYR A CZ   8  
ATOM   5859  O OH   . TYR A 1 38 ? 18.715  17.015 -8.540  1.00 1.00 ? 38 TYR A OH   8  
ATOM   5860  H H    . TYR A 1 38 ? 14.682  15.554 -1.830  1.00 1.00 ? 38 TYR A H    8  
ATOM   5861  H HA   . TYR A 1 38 ? 14.923  16.962 -4.350  1.00 1.00 ? 38 TYR A HA   8  
ATOM   5862  H HB2  . TYR A 1 38 ? 16.695  17.170 -2.683  1.00 1.00 ? 38 TYR A HB2  8  
ATOM   5863  H HB3  . TYR A 1 38 ? 17.038  15.439 -2.805  1.00 1.00 ? 38 TYR A HB3  8  
ATOM   5864  H HD1  . TYR A 1 38 ? 17.216  18.708 -4.587  1.00 1.00 ? 38 TYR A HD1  8  
ATOM   5865  H HD2  . TYR A 1 38 ? 18.207  14.519 -4.784  1.00 1.00 ? 38 TYR A HD2  8  
ATOM   5866  H HE1  . TYR A 1 38 ? 18.159  19.023 -6.853  1.00 1.00 ? 38 TYR A HE1  8  
ATOM   5867  H HE2  . TYR A 1 38 ? 18.940  14.810 -7.133  1.00 1.00 ? 38 TYR A HE2  8  
ATOM   5868  H HH   . TYR A 1 38 ? 18.380  17.812 -8.976  1.00 1.00 ? 38 TYR A HH   8  
ATOM   5869  N N    . VAL A 1 39 ? 15.164  15.150 -6.062  1.00 1.00 ? 39 VAL A N    8  
ATOM   5870  C CA   . VAL A 1 39 ? 15.284  14.217 -7.167  1.00 1.00 ? 39 VAL A CA   8  
ATOM   5871  C C    . VAL A 1 39 ? 15.343  15.111 -8.408  1.00 1.00 ? 39 VAL A C    8  
ATOM   5872  O O    . VAL A 1 39 ? 15.104  16.320 -8.302  1.00 1.00 ? 39 VAL A O    8  
ATOM   5873  C CB   . VAL A 1 39 ? 14.137  13.181 -7.158  1.00 1.00 ? 39 VAL A CB   8  
ATOM   5874  C CG1  . VAL A 1 39 ? 12.766  13.844 -7.034  1.00 1.00 ? 39 VAL A CG1  8  
ATOM   5875  C CG2  . VAL A 1 39 ? 14.141  12.250 -8.376  1.00 1.00 ? 39 VAL A CG2  8  
ATOM   5876  H H    . VAL A 1 39 ? 15.162  16.121 -6.346  1.00 1.00 ? 39 VAL A H    8  
ATOM   5877  H HA   . VAL A 1 39 ? 16.235  13.689 -7.075  1.00 1.00 ? 39 VAL A HA   8  
ATOM   5878  H HB   . VAL A 1 39 ? 14.268  12.533 -6.292  1.00 1.00 ? 39 VAL A HB   8  
ATOM   5879  H HG11 . VAL A 1 39 ? 12.650  14.590 -7.819  1.00 1.00 ? 39 VAL A HG11 8  
ATOM   5880  H HG12 . VAL A 1 39 ? 11.991  13.083 -7.126  1.00 1.00 ? 39 VAL A HG12 8  
ATOM   5881  H HG13 . VAL A 1 39 ? 12.659  14.326 -6.064  1.00 1.00 ? 39 VAL A HG13 8  
ATOM   5882  H HG21 . VAL A 1 39 ? 15.138  11.835 -8.527  1.00 1.00 ? 39 VAL A HG21 8  
ATOM   5883  H HG22 . VAL A 1 39 ? 13.448  11.426 -8.201  1.00 1.00 ? 39 VAL A HG22 8  
ATOM   5884  H HG23 . VAL A 1 39 ? 13.818  12.782 -9.270  1.00 1.00 ? 39 VAL A HG23 8  
ATOM   5885  N N    . PHE A 1 40 ? 15.705  14.545 -9.562  1.00 1.00 ? 40 PHE A N    8  
ATOM   5886  C CA   . PHE A 1 40 ? 15.850  15.320 -10.782 1.00 1.00 ? 40 PHE A CA   8  
ATOM   5887  C C    . PHE A 1 40 ? 14.548  16.078 -11.093 1.00 1.00 ? 40 PHE A C    8  
ATOM   5888  O O    . PHE A 1 40 ? 13.463  15.587 -10.778 1.00 1.00 ? 40 PHE A O    8  
ATOM   5889  C CB   . PHE A 1 40 ? 16.250  14.410 -11.956 1.00 1.00 ? 40 PHE A CB   8  
ATOM   5890  C CG   . PHE A 1 40 ? 15.087  13.754 -12.686 1.00 1.00 ? 40 PHE A CG   8  
ATOM   5891  C CD1  . PHE A 1 40 ? 14.560  12.529 -12.238 1.00 1.00 ? 40 PHE A CD1  8  
ATOM   5892  C CD2  . PHE A 1 40 ? 14.545  14.371 -13.831 1.00 1.00 ? 40 PHE A CD2  8  
ATOM   5893  C CE1  . PHE A 1 40 ? 13.512  11.914 -12.945 1.00 1.00 ? 40 PHE A CE1  8  
ATOM   5894  C CE2  . PHE A 1 40 ? 13.499  13.755 -14.538 1.00 1.00 ? 40 PHE A CE2  8  
ATOM   5895  C CZ   . PHE A 1 40 ? 12.986  12.524 -14.098 1.00 1.00 ? 40 PHE A CZ   8  
ATOM   5896  H H    . PHE A 1 40 ? 15.908  13.560 -9.582  1.00 1.00 ? 40 PHE A H    8  
ATOM   5897  H HA   . PHE A 1 40 ? 16.676  16.003 -10.591 1.00 1.00 ? 40 PHE A HA   8  
ATOM   5898  H HB2  . PHE A 1 40 ? 16.795  15.016 -12.680 1.00 1.00 ? 40 PHE A HB2  8  
ATOM   5899  H HB3  . PHE A 1 40 ? 16.948  13.645 -11.612 1.00 1.00 ? 40 PHE A HB3  8  
ATOM   5900  H HD1  . PHE A 1 40 ? 14.992  12.027 -11.385 1.00 1.00 ? 40 PHE A HD1  8  
ATOM   5901  H HD2  . PHE A 1 40 ? 14.960  15.298 -14.204 1.00 1.00 ? 40 PHE A HD2  8  
ATOM   5902  H HE1  . PHE A 1 40 ? 13.151  10.942 -12.635 1.00 1.00 ? 40 PHE A HE1  8  
ATOM   5903  H HE2  . PHE A 1 40 ? 13.133  14.198 -15.456 1.00 1.00 ? 40 PHE A HE2  8  
ATOM   5904  H HZ   . PHE A 1 40 ? 12.229  12.014 -14.681 1.00 1.00 ? 40 PHE A HZ   8  
ATOM   5905  N N    . PRO A 1 41 ? 14.609  17.246 -11.742 1.00 1.00 ? 41 PRO A N    8  
ATOM   5906  C CA   . PRO A 1 41 ? 15.823  17.989 -12.008 1.00 1.00 ? 41 PRO A CA   8  
ATOM   5907  C C    . PRO A 1 41 ? 16.307  18.635 -10.705 1.00 1.00 ? 41 PRO A C    8  
ATOM   5908  O O    . PRO A 1 41 ? 17.504  18.655 -10.424 1.00 1.00 ? 41 PRO A O    8  
ATOM   5909  C CB   . PRO A 1 41 ? 15.416  19.022 -13.061 1.00 1.00 ? 41 PRO A CB   8  
ATOM   5910  C CG   . PRO A 1 41 ? 13.948  19.308 -12.744 1.00 1.00 ? 41 PRO A CG   8  
ATOM   5911  C CD   . PRO A 1 41 ? 13.439  17.957 -12.235 1.00 1.00 ? 41 PRO A CD   8  
ATOM   5912  H HA   . PRO A 1 41 ? 16.611  17.364 -12.426 1.00 1.00 ? 41 PRO A HA   8  
ATOM   5913  H HB2  . PRO A 1 41 ? 16.036  19.919 -13.037 1.00 1.00 ? 41 PRO A HB2  8  
ATOM   5914  H HB3  . PRO A 1 41 ? 15.472  18.549 -14.044 1.00 1.00 ? 41 PRO A HB3  8  
ATOM   5915  H HG2  . PRO A 1 41 ? 13.884  20.059 -11.954 1.00 1.00 ? 41 PRO A HG2  8  
ATOM   5916  H HG3  . PRO A 1 41 ? 13.399  19.652 -13.621 1.00 1.00 ? 41 PRO A HG3  8  
ATOM   5917  H HD2  . PRO A 1 41 ? 12.689  18.097 -11.454 1.00 1.00 ? 41 PRO A HD2  8  
ATOM   5918  H HD3  . PRO A 1 41 ? 13.007  17.396 -13.066 1.00 1.00 ? 41 PRO A HD3  8  
ATOM   5919  N N    . ALA A 1 42 ? 15.373  19.134 -9.890  1.00 1.00 ? 42 ALA A N    8  
ATOM   5920  C CA   . ALA A 1 42 ? 15.716  19.957 -8.743  1.00 1.00 ? 42 ALA A CA   8  
ATOM   5921  C C    . ALA A 1 42 ? 14.570  20.005 -7.743  1.00 1.00 ? 42 ALA A C    8  
ATOM   5922  O O    . ALA A 1 42 ? 14.141  21.098 -7.381  1.00 1.00 ? 42 ALA A O    8  
ATOM   5923  C CB   . ALA A 1 42 ? 16.100  21.365 -9.212  1.00 1.00 ? 42 ALA A CB   8  
ATOM   5924  H H    . ALA A 1 42 ? 14.395  18.941 -10.075 1.00 1.00 ? 42 ALA A H    8  
ATOM   5925  H HA   . ALA A 1 42 ? 16.572  19.523 -8.237  1.00 1.00 ? 42 ALA A HA   8  
ATOM   5926  H HB1  . ALA A 1 42 ? 16.944  21.317 -9.899  1.00 1.00 ? 42 ALA A HB1  8  
ATOM   5927  H HB2  . ALA A 1 42 ? 15.252  21.834 -9.712  1.00 1.00 ? 42 ALA A HB2  8  
ATOM   5928  H HB3  . ALA A 1 42 ? 16.386  21.971 -8.350  1.00 1.00 ? 42 ALA A HB3  8  
ATOM   5929  N N    . HIS A 1 43 ? 14.130  18.825 -7.291  1.00 1.00 ? 43 HIS A N    8  
ATOM   5930  C CA   . HIS A 1 43 ? 13.072  18.578 -6.310  1.00 1.00 ? 43 HIS A CA   8  
ATOM   5931  C C    . HIS A 1 43 ? 11.761  18.219 -6.998  1.00 1.00 ? 43 HIS A C    8  
ATOM   5932  O O    . HIS A 1 43 ? 11.276  18.985 -7.832  1.00 1.00 ? 43 HIS A O    8  
ATOM   5933  C CB   . HIS A 1 43 ? 12.834  19.732 -5.324  1.00 1.00 ? 43 HIS A CB   8  
ATOM   5934  C CG   . HIS A 1 43 ? 14.007  20.057 -4.437  1.00 1.00 ? 43 HIS A CG   8  
ATOM   5935  N ND1  . HIS A 1 43 ? 14.920  21.044 -4.761  1.00 1.00 ? 43 HIS A ND1  8  
ATOM   5936  C CD2  . HIS A 1 43 ? 14.419  19.565 -3.222  1.00 1.00 ? 43 HIS A CD2  8  
ATOM   5937  C CE1  . HIS A 1 43 ? 15.823  21.099 -3.770  1.00 1.00 ? 43 HIS A CE1  8  
ATOM   5938  N NE2  . HIS A 1 43 ? 15.580  20.210 -2.804  1.00 1.00 ? 43 HIS A NE2  8  
ATOM   5939  H H    . HIS A 1 43 ? 14.558  17.999 -7.702  1.00 1.00 ? 43 HIS A H    8  
ATOM   5940  H HA   . HIS A 1 43 ? 13.387  17.714 -5.733  1.00 1.00 ? 43 HIS A HA   8  
ATOM   5941  H HB2  . HIS A 1 43 ? 12.470  20.628 -5.824  1.00 1.00 ? 43 HIS A HB2  8  
ATOM   5942  H HB3  . HIS A 1 43 ? 12.020  19.437 -4.680  1.00 1.00 ? 43 HIS A HB3  8  
ATOM   5943  H HD1  . HIS A 1 43 ? 14.895  21.592 -5.616  1.00 1.00 ? 43 HIS A HD1  8  
ATOM   5944  H HD2  . HIS A 1 43 ? 13.917  18.783 -2.671  1.00 1.00 ? 43 HIS A HD2  8  
ATOM   5945  H HE1  . HIS A 1 43 ? 16.666  21.776 -3.762  1.00 1.00 ? 43 HIS A HE1  8  
ATOM   5946  N N    . LYS A 1 44 ? 11.154  17.093 -6.609  1.00 1.00 ? 44 LYS A N    8  
ATOM   5947  C CA   . LYS A 1 44 ? 9.802   16.736 -7.022  1.00 1.00 ? 44 LYS A CA   8  
ATOM   5948  C C    . LYS A 1 44 ? 8.919   16.597 -5.786  1.00 1.00 ? 44 LYS A C    8  
ATOM   5949  O O    . LYS A 1 44 ? 9.391   16.251 -4.699  1.00 1.00 ? 44 LYS A O    8  
ATOM   5950  C CB   . LYS A 1 44 ? 9.781   15.426 -7.814  1.00 1.00 ? 44 LYS A CB   8  
ATOM   5951  C CG   . LYS A 1 44 ? 10.342  15.550 -9.239  1.00 1.00 ? 44 LYS A CG   8  
ATOM   5952  C CD   . LYS A 1 44 ? 10.370  14.140 -9.855  1.00 1.00 ? 44 LYS A CD   8  
ATOM   5953  C CE   . LYS A 1 44 ? 10.264  14.100 -11.388 1.00 1.00 ? 44 LYS A CE   8  
ATOM   5954  N NZ   . LYS A 1 44 ? 11.548  14.392 -12.052 1.00 1.00 ? 44 LYS A NZ   8  
ATOM   5955  H H    . LYS A 1 44 ? 11.549  16.572 -5.828  1.00 1.00 ? 44 LYS A H    8  
ATOM   5956  H HA   . LYS A 1 44 ? 9.371   17.516 -7.652  1.00 1.00 ? 44 LYS A HA   8  
ATOM   5957  H HB2  . LYS A 1 44 ? 10.311  14.666 -7.247  1.00 1.00 ? 44 LYS A HB2  8  
ATOM   5958  H HB3  . LYS A 1 44 ? 8.740   15.107 -7.900  1.00 1.00 ? 44 LYS A HB3  8  
ATOM   5959  H HG2  . LYS A 1 44 ? 9.681   16.208 -9.805  1.00 1.00 ? 44 LYS A HG2  8  
ATOM   5960  H HG3  . LYS A 1 44 ? 11.343  15.984 -9.219  1.00 1.00 ? 44 LYS A HG3  8  
ATOM   5961  H HD2  . LYS A 1 44 ? 11.267  13.623 -9.513  1.00 1.00 ? 44 LYS A HD2  8  
ATOM   5962  H HD3  . LYS A 1 44 ? 9.505   13.601 -9.468  1.00 1.00 ? 44 LYS A HD3  8  
ATOM   5963  H HE2  . LYS A 1 44 ? 9.952   13.098 -11.691 1.00 1.00 ? 44 LYS A HE2  8  
ATOM   5964  H HE3  . LYS A 1 44 ? 9.502   14.806 -11.722 1.00 1.00 ? 44 LYS A HE3  8  
ATOM   5965  H HZ1  . LYS A 1 44 ? 11.945  15.253 -11.690 1.00 1.00 ? 44 LYS A HZ1  8  
ATOM   5966  H HZ2  . LYS A 1 44 ? 12.235  13.676 -11.858 1.00 1.00 ? 44 LYS A HZ2  8  
ATOM   5967  H HZ3  . LYS A 1 44 ? 11.445  14.460 -13.054 1.00 1.00 ? 44 LYS A HZ3  8  
ATOM   5968  N N    . CYS A 1 45 ? 7.630   16.873 -5.983  1.00 1.00 ? 45 CYS A N    8  
ATOM   5969  C CA   . CYS A 1 45 ? 6.587   16.676 -4.995  1.00 1.00 ? 45 CYS A CA   8  
ATOM   5970  C C    . CYS A 1 45 ? 6.158   15.208 -5.025  1.00 1.00 ? 45 CYS A C    8  
ATOM   5971  O O    . CYS A 1 45 ? 5.527   14.772 -5.990  1.00 1.00 ? 45 CYS A O    8  
ATOM   5972  C CB   . CYS A 1 45 ? 5.424   17.621 -5.304  1.00 1.00 ? 45 CYS A CB   8  
ATOM   5973  S SG   . CYS A 1 45 ? 3.989   17.375 -4.237  1.00 1.00 ? 45 CYS A SG   8  
ATOM   5974  H H    . CYS A 1 45 ? 7.335   17.132 -6.914  1.00 1.00 ? 45 CYS A H    8  
ATOM   5975  H HA   . CYS A 1 45 ? 6.970   16.925 -4.009  1.00 1.00 ? 45 CYS A HA   8  
ATOM   5976  H HB2  . CYS A 1 45 ? 5.759   18.650 -5.178  1.00 1.00 ? 45 CYS A HB2  8  
ATOM   5977  H HB3  . CYS A 1 45 ? 5.113   17.494 -6.339  1.00 1.00 ? 45 CYS A HB3  8  
ATOM   5978  N N    . ILE A 1 46 ? 6.545   14.435 -4.007  1.00 1.00 ? 46 ILE A N    8  
ATOM   5979  C CA   . ILE A 1 46 ? 6.188   13.027 -3.892  1.00 1.00 ? 46 ILE A CA   8  
ATOM   5980  C C    . ILE A 1 46 ? 4.946   12.945 -3.010  1.00 1.00 ? 46 ILE A C    8  
ATOM   5981  O O    . ILE A 1 46 ? 4.722   13.818 -2.166  1.00 1.00 ? 46 ILE A O    8  
ATOM   5982  C CB   . ILE A 1 46 ? 7.363   12.216 -3.310  1.00 1.00 ? 46 ILE A CB   8  
ATOM   5983  C CG1  . ILE A 1 46 ? 8.702   12.517 -4.012  1.00 1.00 ? 46 ILE A CG1  8  
ATOM   5984  C CG2  . ILE A 1 46 ? 7.065   10.708 -3.356  1.00 1.00 ? 46 ILE A CG2  8  
ATOM   5985  C CD1  . ILE A 1 46 ? 8.686   12.279 -5.526  1.00 1.00 ? 46 ILE A CD1  8  
ATOM   5986  H H    . ILE A 1 46 ? 6.988   14.847 -3.191  1.00 1.00 ? 46 ILE A H    8  
ATOM   5987  H HA   . ILE A 1 46 ? 5.942   12.621 -4.874  1.00 1.00 ? 46 ILE A HA   8  
ATOM   5988  H HB   . ILE A 1 46 ? 7.486   12.493 -2.263  1.00 1.00 ? 46 ILE A HB   8  
ATOM   5989  H HG12 . ILE A 1 46 ? 8.985   13.554 -3.826  1.00 1.00 ? 46 ILE A HG12 8  
ATOM   5990  H HG13 . ILE A 1 46 ? 9.475   11.886 -3.572  1.00 1.00 ? 46 ILE A HG13 8  
ATOM   5991  H HG21 . ILE A 1 46 ? 6.822   10.391 -4.369  1.00 1.00 ? 46 ILE A HG21 8  
ATOM   5992  H HG22 . ILE A 1 46 ? 7.931   10.148 -3.003  1.00 1.00 ? 46 ILE A HG22 8  
ATOM   5993  H HG23 . ILE A 1 46 ? 6.223   10.468 -2.709  1.00 1.00 ? 46 ILE A HG23 8  
ATOM   5994  H HD11 . ILE A 1 46 ? 8.436   11.243 -5.750  1.00 1.00 ? 46 ILE A HD11 8  
ATOM   5995  H HD12 . ILE A 1 46 ? 7.969   12.940 -6.012  1.00 1.00 ? 46 ILE A HD12 8  
ATOM   5996  H HD13 . ILE A 1 46 ? 9.677   12.491 -5.925  1.00 1.00 ? 46 ILE A HD13 8  
ATOM   5997  N N    . CYS A 1 47 ? 4.112   11.923 -3.215  1.00 1.00 ? 47 CYS A N    8  
ATOM   5998  C CA   . CYS A 1 47 ? 2.880   11.797 -2.468  1.00 1.00 ? 47 CYS A CA   8  
ATOM   5999  C C    . CYS A 1 47 ? 2.532   10.340 -2.187  1.00 1.00 ? 47 CYS A C    8  
ATOM   6000  O O    . CYS A 1 47 ? 2.967   9.460  -2.928  1.00 1.00 ? 47 CYS A O    8  
ATOM   6001  C CB   . CYS A 1 47 ? 1.785   12.594 -3.163  1.00 1.00 ? 47 CYS A CB   8  
ATOM   6002  S SG   . CYS A 1 47 ? 0.552   13.095 -1.972  1.00 1.00 ? 47 CYS A SG   8  
ATOM   6003  H H    . CYS A 1 47 ? 4.305   11.219 -3.922  1.00 1.00 ? 47 CYS A H    8  
ATOM   6004  H HA   . CYS A 1 47 ? 3.049   12.221 -1.488  1.00 1.00 ? 47 CYS A HA   8  
ATOM   6005  H HB2  . CYS A 1 47 ? 2.197   13.509 -3.589  1.00 1.00 ? 47 CYS A HB2  8  
ATOM   6006  H HB3  . CYS A 1 47 ? 1.324   12.006 -3.957  1.00 1.00 ? 47 CYS A HB3  8  
ATOM   6007  N N    . TYR A 1 48 ? 1.811   10.078 -1.087  1.00 1.00 ? 48 TYR A N    8  
ATOM   6008  C CA   . TYR A 1 48 ? 1.636   8.732  -0.562  1.00 1.00 ? 48 TYR A CA   8  
ATOM   6009  C C    . TYR A 1 48 ? 0.218   8.479  -0.029  1.00 1.00 ? 48 TYR A C    8  
ATOM   6010  O O    . TYR A 1 48 ? -0.335  9.283  0.732   1.00 1.00 ? 48 TYR A O    8  
ATOM   6011  C CB   . TYR A 1 48 ? 2.666   8.491  0.550   1.00 1.00 ? 48 TYR A CB   8  
ATOM   6012  C CG   . TYR A 1 48 ? 4.056   9.073  0.337   1.00 1.00 ? 48 TYR A CG   8  
ATOM   6013  C CD1  . TYR A 1 48 ? 4.304   10.436 0.593   1.00 1.00 ? 48 TYR A CD1  8  
ATOM   6014  C CD2  . TYR A 1 48 ? 5.114   8.245  -0.077  1.00 1.00 ? 48 TYR A CD2  8  
ATOM   6015  C CE1  . TYR A 1 48 ? 5.585   10.973 0.394   1.00 1.00 ? 48 TYR A CE1  8  
ATOM   6016  C CE2  . TYR A 1 48 ? 6.409   8.773  -0.231  1.00 1.00 ? 48 TYR A CE2  8  
ATOM   6017  C CZ   . TYR A 1 48 ? 6.644   10.137 0.012   1.00 1.00 ? 48 TYR A CZ   8  
ATOM   6018  O OH   . TYR A 1 48 ? 7.896   10.660 -0.123  1.00 1.00 ? 48 TYR A OH   8  
ATOM   6019  H H    . TYR A 1 48 ? 1.452   10.840 -0.519  1.00 1.00 ? 48 TYR A H    8  
ATOM   6020  H HA   . TYR A 1 48 ? 1.838   8.017  -1.356  1.00 1.00 ? 48 TYR A HA   8  
ATOM   6021  H HB2  . TYR A 1 48 ? 2.269   8.900  1.475   1.00 1.00 ? 48 TYR A HB2  8  
ATOM   6022  H HB3  . TYR A 1 48 ? 2.756   7.417  0.683   1.00 1.00 ? 48 TYR A HB3  8  
ATOM   6023  H HD1  . TYR A 1 48 ? 3.506   11.082 0.919   1.00 1.00 ? 48 TYR A HD1  8  
ATOM   6024  H HD2  . TYR A 1 48 ? 4.933   7.199  -0.257  1.00 1.00 ? 48 TYR A HD2  8  
ATOM   6025  H HE1  . TYR A 1 48 ? 5.758   12.029 0.535   1.00 1.00 ? 48 TYR A HE1  8  
ATOM   6026  H HE2  . TYR A 1 48 ? 7.216   8.123  -0.533  1.00 1.00 ? 48 TYR A HE2  8  
ATOM   6027  H HH   . TYR A 1 48 ? 8.554   10.009 -0.374  1.00 1.00 ? 48 TYR A HH   8  
ATOM   6028  N N    . PHE A 1 49 ? -0.345  7.326  -0.399  1.00 1.00 ? 49 PHE A N    8  
ATOM   6029  C CA   . PHE A 1 49 ? -1.697  6.888  -0.097  1.00 1.00 ? 49 PHE A CA   8  
ATOM   6030  C C    . PHE A 1 49 ? -1.598  5.557  0.654   1.00 1.00 ? 49 PHE A C    8  
ATOM   6031  O O    . PHE A 1 49 ? -0.737  4.752  0.292   1.00 1.00 ? 49 PHE A O    8  
ATOM   6032  C CB   . PHE A 1 49 ? -2.500  6.667  -1.398  1.00 1.00 ? 49 PHE A CB   8  
ATOM   6033  C CG   . PHE A 1 49 ? -2.095  7.499  -2.605  1.00 1.00 ? 49 PHE A CG   8  
ATOM   6034  C CD1  . PHE A 1 49 ? -0.841  7.284  -3.198  1.00 1.00 ? 49 PHE A CD1  8  
ATOM   6035  C CD2  . PHE A 1 49 ? -2.893  8.563  -3.069  1.00 1.00 ? 49 PHE A CD2  8  
ATOM   6036  C CE1  . PHE A 1 49 ? -0.226  8.326  -3.900  1.00 1.00 ? 49 PHE A CE1  8  
ATOM   6037  C CE2  . PHE A 1 49 ? -2.356  9.489  -3.984  1.00 1.00 ? 49 PHE A CE2  8  
ATOM   6038  C CZ   . PHE A 1 49 ? -0.989  9.429  -4.320  1.00 1.00 ? 49 PHE A CZ   8  
ATOM   6039  H H    . PHE A 1 49 ? 0.182   6.693  -0.988  1.00 1.00 ? 49 PHE A H    8  
ATOM   6040  H HA   . PHE A 1 49 ? -2.181  7.658  0.502   1.00 1.00 ? 49 PHE A HA   8  
ATOM   6041  H HB2  . PHE A 1 49 ? -2.440  5.616  -1.675  1.00 1.00 ? 49 PHE A HB2  8  
ATOM   6042  H HB3  . PHE A 1 49 ? -3.538  6.860  -1.162  1.00 1.00 ? 49 PHE A HB3  8  
ATOM   6043  H HD1  . PHE A 1 49 ? -0.292  6.377  -2.999  1.00 1.00 ? 49 PHE A HD1  8  
ATOM   6044  H HD2  . PHE A 1 49 ? -3.904  8.688  -2.710  1.00 1.00 ? 49 PHE A HD2  8  
ATOM   6045  H HE1  . PHE A 1 49 ? 0.837   8.264  -4.069  1.00 1.00 ? 49 PHE A HE1  8  
ATOM   6046  H HE2  . PHE A 1 49 ? -2.968  10.299 -4.348  1.00 1.00 ? 49 PHE A HE2  8  
ATOM   6047  H HZ   . PHE A 1 49 ? -0.534  10.220 -4.903  1.00 1.00 ? 49 PHE A HZ   8  
ATOM   6048  N N    . PRO A 1 50 ? -2.460  5.296  1.651   1.00 1.00 ? 50 PRO A N    8  
ATOM   6049  C CA   . PRO A 1 50 ? -2.570  3.999  2.306   1.00 1.00 ? 50 PRO A CA   8  
ATOM   6050  C C    . PRO A 1 50 ? -2.930  2.965  1.240   1.00 1.00 ? 50 PRO A C    8  
ATOM   6051  O O    . PRO A 1 50 ? -3.865  3.185  0.473   1.00 1.00 ? 50 PRO A O    8  
ATOM   6052  C CB   . PRO A 1 50 ? -3.672  4.157  3.359   1.00 1.00 ? 50 PRO A CB   8  
ATOM   6053  C CG   . PRO A 1 50 ? -4.533  5.297  2.817   1.00 1.00 ? 50 PRO A CG   8  
ATOM   6054  C CD   . PRO A 1 50 ? -3.525  6.179  2.081   1.00 1.00 ? 50 PRO A CD   8  
ATOM   6055  H HA   . PRO A 1 50 ? -1.632  3.730  2.792   1.00 1.00 ? 50 PRO A HA   8  
ATOM   6056  H HB2  . PRO A 1 50 ? -4.262  3.249  3.494   1.00 1.00 ? 50 PRO A HB2  8  
ATOM   6057  H HB3  . PRO A 1 50 ? -3.226  4.464  4.306   1.00 1.00 ? 50 PRO A HB3  8  
ATOM   6058  H HG2  . PRO A 1 50 ? -5.250  4.895  2.100   1.00 1.00 ? 50 PRO A HG2  8  
ATOM   6059  H HG3  . PRO A 1 50 ? -5.058  5.834  3.608   1.00 1.00 ? 50 PRO A HG3  8  
ATOM   6060  H HD2  . PRO A 1 50 ? -4.015  6.656  1.230   1.00 1.00 ? 50 PRO A HD2  8  
ATOM   6061  H HD3  . PRO A 1 50 ? -3.098  6.917  2.763   1.00 1.00 ? 50 PRO A HD3  8  
ATOM   6062  N N    . CYS A 1 51 ? -2.172  1.869  1.151   1.00 1.00 ? 51 CYS A N    8  
ATOM   6063  C CA   . CYS A 1 51 ? -2.289  0.965  0.017   1.00 1.00 ? 51 CYS A CA   8  
ATOM   6064  C C    . CYS A 1 51 ? -1.705  -0.400 0.378   1.00 1.00 ? 51 CYS A C    8  
ATOM   6065  O O    . CYS A 1 51 ? -0.585  -0.727 -0.012  1.00 1.00 ? 51 CYS A O    8  
ATOM   6066  C CB   . CYS A 1 51 ? -1.562  1.655  -1.138  1.00 1.00 ? 51 CYS A CB   8  
ATOM   6067  S SG   . CYS A 1 51 ? -1.138  0.711  -2.614  1.00 1.00 ? 51 CYS A SG   8  
ATOM   6068  O OXT  . CYS A 1 51 ? -2.482  -1.178 1.181   1.00 0.00 ? 51 CYS A OXT  8  
ATOM   6069  H H    . CYS A 1 51 ? -1.363  1.752  1.755   1.00 1.00 ? 51 CYS A H    8  
ATOM   6070  H HA   . CYS A 1 51 ? -3.333  0.818  -0.264  1.00 1.00 ? 51 CYS A HA   8  
ATOM   6071  H HB2  . CYS A 1 51 ? -2.152  2.509  -1.469  1.00 1.00 ? 51 CYS A HB2  8  
ATOM   6072  H HB3  . CYS A 1 51 ? -0.625  2.039  -0.737  1.00 1.00 ? 51 CYS A HB3  8  
HETATM 6073  N N    . PCA A 1 1  ? -1.205  2.565  4.847   1.00 1.00 ? 1  PCA A N    9  
HETATM 6074  C CA   . PCA A 1 1  ? -0.367  1.518  5.401   1.00 1.00 ? 1  PCA A CA   9  
HETATM 6075  C CB   . PCA A 1 1  ? -1.324  0.624  6.219   1.00 1.00 ? 1  PCA A CB   9  
HETATM 6076  C CG   . PCA A 1 1  ? -2.575  1.498  6.401   1.00 1.00 ? 1  PCA A CG   9  
HETATM 6077  C CD   . PCA A 1 1  ? -2.427  2.584  5.355   1.00 1.00 ? 1  PCA A CD   9  
HETATM 6078  O OE   . PCA A 1 1  ? -3.324  3.349  5.018   1.00 1.00 ? 1  PCA A OE   9  
HETATM 6079  C C    . PCA A 1 1  ? 0.353   0.795  4.265   1.00 1.00 ? 1  PCA A C    9  
HETATM 6080  O O    . PCA A 1 1  ? 1.573   0.874  4.143   1.00 1.00 ? 1  PCA A O    9  
HETATM 6081  H H    . PCA A 1 1  ? -0.884  3.209  4.141   1.00 0.00 ? 1  PCA A H    9  
HETATM 6082  H HA   . PCA A 1 1  ? 0.366   1.973  6.069   1.00 1.00 ? 1  PCA A HA   9  
HETATM 6083  H HB2  . PCA A 1 1  ? -1.595  -0.277 5.667   1.00 1.00 ? 1  PCA A HB2  9  
HETATM 6084  H HB3  . PCA A 1 1  ? -0.885  0.343  7.178   1.00 1.00 ? 1  PCA A HB3  9  
HETATM 6085  H HG2  . PCA A 1 1  ? -3.491  0.926  6.253   1.00 1.00 ? 1  PCA A HG2  9  
HETATM 6086  H HG3  . PCA A 1 1  ? -2.573  1.960  7.389   1.00 1.00 ? 1  PCA A HG3  9  
ATOM   6087  N N    . LYS A 1 2  ? -0.413  0.165  3.373   1.00 1.00 ? 2  LYS A N    9  
ATOM   6088  C CA   . LYS A 1 2  ? 0.116   -0.373 2.128   1.00 1.00 ? 2  LYS A CA   9  
ATOM   6089  C C    . LYS A 1 2  ? 0.283   0.810  1.169   1.00 1.00 ? 2  LYS A C    9  
ATOM   6090  O O    . LYS A 1 2  ? -0.473  0.939  0.206   1.00 1.00 ? 2  LYS A O    9  
ATOM   6091  C CB   . LYS A 1 2  ? -0.868  -1.427 1.595   1.00 1.00 ? 2  LYS A CB   9  
ATOM   6092  C CG   . LYS A 1 2  ? -0.341  -2.136 0.337   1.00 1.00 ? 2  LYS A CG   9  
ATOM   6093  C CD   . LYS A 1 2  ? -1.473  -2.653 -0.565  1.00 1.00 ? 2  LYS A CD   9  
ATOM   6094  C CE   . LYS A 1 2  ? -1.951  -1.611 -1.592  1.00 1.00 ? 2  LYS A CE   9  
ATOM   6095  N NZ   . LYS A 1 2  ? -2.575  -0.419 -0.984  1.00 1.00 ? 2  LYS A NZ   9  
ATOM   6096  H H    . LYS A 1 2  ? -1.413  0.178  3.510   1.00 1.00 ? 2  LYS A H    9  
ATOM   6097  H HA   . LYS A 1 2  ? 1.082   -0.852 2.300   1.00 1.00 ? 2  LYS A HA   9  
ATOM   6098  H HB2  . LYS A 1 2  ? -1.027  -2.184 2.365   1.00 1.00 ? 2  LYS A HB2  9  
ATOM   6099  H HB3  . LYS A 1 2  ? -1.828  -0.947 1.412   1.00 1.00 ? 2  LYS A HB3  9  
ATOM   6100  H HG2  . LYS A 1 2  ? 0.317   -1.492 -0.249  1.00 1.00 ? 2  LYS A HG2  9  
ATOM   6101  H HG3  . LYS A 1 2  ? 0.258   -2.986 0.671   1.00 1.00 ? 2  LYS A HG3  9  
ATOM   6102  H HD2  . LYS A 1 2  ? -1.077  -3.499 -1.135  1.00 1.00 ? 2  LYS A HD2  9  
ATOM   6103  H HD3  . LYS A 1 2  ? -2.302  -3.026 0.039   1.00 1.00 ? 2  LYS A HD3  9  
ATOM   6104  H HE2  . LYS A 1 2  ? -1.100  -1.279 -2.193  1.00 1.00 ? 2  LYS A HE2  9  
ATOM   6105  H HE3  . LYS A 1 2  ? -2.677  -2.077 -2.258  1.00 1.00 ? 2  LYS A HE3  9  
ATOM   6106  H HZ1  . LYS A 1 2  ? -3.367  -0.652 -0.407  1.00 1.00 ? 2  LYS A HZ1  9  
ATOM   6107  H HZ2  . LYS A 1 2  ? -1.885  0.083  -0.440  1.00 1.00 ? 2  LYS A HZ2  9  
ATOM   6108  H HZ3  . LYS A 1 2  ? -2.890  0.222  -1.711  1.00 1.00 ? 2  LYS A HZ3  9  
ATOM   6109  N N    . LEU A 1 3  ? 1.237   1.690  1.471   1.00 1.00 ? 3  LEU A N    9  
ATOM   6110  C CA   . LEU A 1 3  ? 1.399   2.972  0.802   1.00 1.00 ? 3  LEU A CA   9  
ATOM   6111  C C    . LEU A 1 3  ? 2.026   2.828  -0.579  1.00 1.00 ? 3  LEU A C    9  
ATOM   6112  O O    . LEU A 1 3  ? 2.749   1.873  -0.855  1.00 1.00 ? 3  LEU A O    9  
ATOM   6113  C CB   . LEU A 1 3  ? 2.255   3.922  1.646   1.00 1.00 ? 3  LEU A CB   9  
ATOM   6114  C CG   . LEU A 1 3  ? 1.632   4.292  3.001   1.00 1.00 ? 3  LEU A CG   9  
ATOM   6115  C CD1  . LEU A 1 3  ? 2.692   4.990  3.858   1.00 1.00 ? 3  LEU A CD1  9  
ATOM   6116  C CD2  . LEU A 1 3  ? 0.416   5.212  2.835   1.00 1.00 ? 3  LEU A CD2  9  
ATOM   6117  H H    . LEU A 1 3  ? 1.800   1.488  2.290   1.00 1.00 ? 3  LEU A H    9  
ATOM   6118  H HA   . LEU A 1 3  ? 0.429   3.437  0.684   1.00 1.00 ? 3  LEU A HA   9  
ATOM   6119  H HB2  . LEU A 1 3  ? 3.213   3.434  1.796   1.00 1.00 ? 3  LEU A HB2  9  
ATOM   6120  H HB3  . LEU A 1 3  ? 2.433   4.844  1.088   1.00 1.00 ? 3  LEU A HB3  9  
ATOM   6121  H HG   . LEU A 1 3  ? 1.326   3.390  3.527   1.00 1.00 ? 3  LEU A HG   9  
ATOM   6122  H HD11 . LEU A 1 3  ? 3.581   4.363  3.941   1.00 1.00 ? 3  LEU A HD11 9  
ATOM   6123  H HD12 . LEU A 1 3  ? 2.970   5.941  3.407   1.00 1.00 ? 3  LEU A HD12 9  
ATOM   6124  H HD13 . LEU A 1 3  ? 2.298   5.165  4.858   1.00 1.00 ? 3  LEU A HD13 9  
ATOM   6125  H HD21 . LEU A 1 3  ? 0.683   6.084  2.237   1.00 1.00 ? 3  LEU A HD21 9  
ATOM   6126  H HD22 . LEU A 1 3  ? -0.402  4.684  2.347   1.00 1.00 ? 3  LEU A HD22 9  
ATOM   6127  H HD23 . LEU A 1 3  ? 0.075   5.549  3.814   1.00 1.00 ? 3  LEU A HD23 9  
ATOM   6128  N N    . CYS A 1 4  ? 1.765   3.825  -1.423  1.00 1.00 ? 4  CYS A N    9  
ATOM   6129  C CA   . CYS A 1 4  ? 2.413   4.037  -2.702  1.00 1.00 ? 4  CYS A CA   9  
ATOM   6130  C C    . CYS A 1 4  ? 2.898   5.479  -2.681  1.00 1.00 ? 4  CYS A C    9  
ATOM   6131  O O    . CYS A 1 4  ? 2.102   6.384  -2.430  1.00 1.00 ? 4  CYS A O    9  
ATOM   6132  C CB   . CYS A 1 4  ? 1.440   3.835  -3.865  1.00 1.00 ? 4  CYS A CB   9  
ATOM   6133  S SG   . CYS A 1 4  ? 0.587   2.250  -3.927  1.00 1.00 ? 4  CYS A SG   9  
ATOM   6134  H H    . CYS A 1 4  ? 1.106   4.541  -1.134  1.00 1.00 ? 4  CYS A H    9  
ATOM   6135  H HA   . CYS A 1 4  ? 3.254   3.352  -2.824  1.00 1.00 ? 4  CYS A HA   9  
ATOM   6136  H HB2  . CYS A 1 4  ? 0.657   4.596  -3.856  1.00 1.00 ? 4  CYS A HB2  9  
ATOM   6137  H HB3  . CYS A 1 4  ? 1.992   3.943  -4.799  1.00 1.00 ? 4  CYS A HB3  9  
ATOM   6138  N N    . GLU A 1 5  ? 4.194   5.691  -2.916  1.00 1.00 ? 5  GLU A N    9  
ATOM   6139  C CA   . GLU A 1 5  ? 4.757   7.021  -3.069  1.00 1.00 ? 5  GLU A CA   9  
ATOM   6140  C C    . GLU A 1 5  ? 4.452   7.489  -4.488  1.00 1.00 ? 5  GLU A C    9  
ATOM   6141  O O    . GLU A 1 5  ? 5.198   7.182  -5.416  1.00 1.00 ? 5  GLU A O    9  
ATOM   6142  C CB   . GLU A 1 5  ? 6.268   6.987  -2.809  1.00 1.00 ? 5  GLU A CB   9  
ATOM   6143  C CG   . GLU A 1 5  ? 6.579   6.516  -1.382  1.00 1.00 ? 5  GLU A CG   9  
ATOM   6144  C CD   . GLU A 1 5  ? 8.024   6.790  -0.969  1.00 1.00 ? 5  GLU A CD   9  
ATOM   6145  O OE1  . GLU A 1 5  ? 8.732   7.525  -1.651  1.00 1.00 ? 5  GLU A OE1  9  
ATOM   6146  O OE2  . GLU A 1 5  ? 8.442   6.179  0.170   1.00 1.00 ? 5  GLU A OE2  9  
ATOM   6147  H H    . GLU A 1 5  ? 4.796   4.905  -3.105  1.00 1.00 ? 5  GLU A H    9  
ATOM   6148  H HA   . GLU A 1 5  ? 4.295   7.705  -2.350  1.00 1.00 ? 5  GLU A HA   9  
ATOM   6149  H HB2  . GLU A 1 5  ? 6.772   6.333  -3.522  1.00 1.00 ? 5  GLU A HB2  9  
ATOM   6150  H HB3  . GLU A 1 5  ? 6.646   7.999  -2.947  1.00 1.00 ? 5  GLU A HB3  9  
ATOM   6151  H HG2  . GLU A 1 5  ? 5.923   7.044  -0.694  1.00 1.00 ? 5  GLU A HG2  9  
ATOM   6152  H HG3  . GLU A 1 5  ? 6.386   5.447  -1.296  1.00 1.00 ? 5  GLU A HG3  9  
ATOM   6153  H HE2  . GLU A 1 5  ? 9.332   6.463  0.392   1.00 1.00 ? 5  GLU A HE2  9  
ATOM   6154  N N    . ARG A 1 6  ? 3.342   8.199  -4.673  1.00 1.00 ? 6  ARG A N    9  
ATOM   6155  C CA   . ARG A 1 6  ? 2.952   8.725  -5.970  1.00 1.00 ? 6  ARG A CA   9  
ATOM   6156  C C    . ARG A 1 6  ? 3.557   10.126 -6.107  1.00 1.00 ? 6  ARG A C    9  
ATOM   6157  O O    . ARG A 1 6  ? 3.229   10.994 -5.298  1.00 1.00 ? 6  ARG A O    9  
ATOM   6158  C CB   . ARG A 1 6  ? 1.421   8.776  -6.053  1.00 1.00 ? 6  ARG A CB   9  
ATOM   6159  C CG   . ARG A 1 6  ? 0.890   9.172  -7.442  1.00 1.00 ? 6  ARG A CG   9  
ATOM   6160  C CD   . ARG A 1 6  ? 0.703   7.997  -8.419  1.00 1.00 ? 6  ARG A CD   9  
ATOM   6161  N NE   . ARG A 1 6  ? 1.942   7.611  -9.114  1.00 1.00 ? 6  ARG A NE   9  
ATOM   6162  C CZ   . ARG A 1 6  ? 2.464   8.254  -10.171 1.00 1.00 ? 6  ARG A CZ   9  
ATOM   6163  N NH1  . ARG A 1 6  ? 1.922   9.396  -10.592 1.00 1.00 ? 6  ARG A NH1  9  
ATOM   6164  N NH2  . ARG A 1 6  ? 3.543   7.764  -10.792 1.00 1.00 ? 6  ARG A NH2  9  
ATOM   6165  H H    . ARG A 1 6  ? 2.812   8.493  -3.856  1.00 1.00 ? 6  ARG A H    9  
ATOM   6166  H HA   . ARG A 1 6  ? 3.303   8.051  -6.746  1.00 1.00 ? 6  ARG A HA   9  
ATOM   6167  H HB2  . ARG A 1 6  ? 0.998   7.815  -5.760  1.00 1.00 ? 6  ARG A HB2  9  
ATOM   6168  H HB3  . ARG A 1 6  ? 1.076   9.519  -5.332  1.00 1.00 ? 6  ARG A HB3  9  
ATOM   6169  H HG2  . ARG A 1 6  ? -0.103  9.585  -7.288  1.00 1.00 ? 6  ARG A HG2  9  
ATOM   6170  H HG3  . ARG A 1 6  ? 1.502   9.960  -7.877  1.00 1.00 ? 6  ARG A HG3  9  
ATOM   6171  H HD2  . ARG A 1 6  ? 0.314   7.135  -7.874  1.00 1.00 ? 6  ARG A HD2  9  
ATOM   6172  H HD3  . ARG A 1 6  ? -0.055  8.269  -9.156  1.00 1.00 ? 6  ARG A HD3  9  
ATOM   6173  H HE   . ARG A 1 6  ? 2.380   6.759  -8.790  1.00 1.00 ? 6  ARG A HE   9  
ATOM   6174  H HH11 . ARG A 1 6  ? 1.093   9.784  -10.150 1.00 1.00 ? 6  ARG A HH11 9  
ATOM   6175  H HH12 . ARG A 1 6  ? 2.392   10.022 -11.244 1.00 1.00 ? 6  ARG A HH12 9  
ATOM   6176  H HH21 . ARG A 1 6  ? 3.964   6.895  -10.495 1.00 1.00 ? 6  ARG A HH21 9  
ATOM   6177  H HH22 . ARG A 1 6  ? 3.928   8.234  -11.599 1.00 1.00 ? 6  ARG A HH22 9  
ATOM   6178  N N    . PRO A 1 7  ? 4.422   10.384 -7.103  1.00 1.00 ? 7  PRO A N    9  
ATOM   6179  C CA   . PRO A 1 7  ? 4.861   11.733 -7.397  1.00 1.00 ? 7  PRO A CA   9  
ATOM   6180  C C    . PRO A 1 7  ? 3.702   12.519 -8.013  1.00 1.00 ? 7  PRO A C    9  
ATOM   6181  O O    . PRO A 1 7  ? 3.078   13.348 -7.352  1.00 1.00 ? 7  PRO A O    9  
ATOM   6182  C CB   . PRO A 1 7  ? 6.083   11.592 -8.312  1.00 1.00 ? 7  PRO A CB   9  
ATOM   6183  C CG   . PRO A 1 7  ? 5.935   10.207 -8.947  1.00 1.00 ? 7  PRO A CG   9  
ATOM   6184  C CD   . PRO A 1 7  ? 5.126   9.411  -7.920  1.00 1.00 ? 7  PRO A CD   9  
ATOM   6185  H HA   . PRO A 1 7  ? 5.162   12.223 -6.476  1.00 1.00 ? 7  PRO A HA   9  
ATOM   6186  H HB2  . PRO A 1 7  ? 6.152   12.391 -9.052  1.00 1.00 ? 7  PRO A HB2  9  
ATOM   6187  H HB3  . PRO A 1 7  ? 6.980   11.594 -7.693  1.00 1.00 ? 7  PRO A HB3  9  
ATOM   6188  H HG2  . PRO A 1 7  ? 5.378   10.281 -9.880  1.00 1.00 ? 7  PRO A HG2  9  
ATOM   6189  H HG3  . PRO A 1 7  ? 6.905   9.748  -9.140  1.00 1.00 ? 7  PRO A HG3  9  
ATOM   6190  H HD2  . PRO A 1 7  ? 4.454   8.735  -8.437  1.00 1.00 ? 7  PRO A HD2  9  
ATOM   6191  H HD3  . PRO A 1 7  ? 5.793   8.836  -7.279  1.00 1.00 ? 7  PRO A HD3  9  
ATOM   6192  N N    . SER A 1 8  ? 3.362   12.236 -9.274  1.00 1.00 ? 8  SER A N    9  
ATOM   6193  C CA   . SER A 1 8  ? 2.241   12.876 -9.928  1.00 1.00 ? 8  SER A CA   9  
ATOM   6194  C C    . SER A 1 8  ? 0.930   12.314 -9.365  1.00 1.00 ? 8  SER A C    9  
ATOM   6195  O O    . SER A 1 8  ? 0.313   11.425 -9.952  1.00 1.00 ? 8  SER A O    9  
ATOM   6196  C CB   . SER A 1 8  ? 2.394   12.670 -11.445 1.00 1.00 ? 8  SER A CB   9  
ATOM   6197  O OG   . SER A 1 8  ? 3.107   11.475 -11.756 1.00 1.00 ? 8  SER A OG   9  
ATOM   6198  H H    . SER A 1 8  ? 3.879   11.570 -9.829  1.00 1.00 ? 8  SER A H    9  
ATOM   6199  H HA   . SER A 1 8  ? 2.259   13.952 -9.741  1.00 1.00 ? 8  SER A HA   9  
ATOM   6200  H HB2  . SER A 1 8  ? 1.416   12.689 -11.933 1.00 1.00 ? 8  SER A HB2  9  
ATOM   6201  H HB3  . SER A 1 8  ? 2.973   13.508 -11.834 1.00 1.00 ? 8  SER A HB3  9  
ATOM   6202  H HG   . SER A 1 8  ? 3.410   11.549 -12.669 1.00 1.00 ? 8  SER A HG   9  
ATOM   6203  N N    . GLY A 1 9  ? 0.503   12.851 -8.223  1.00 1.00 ? 9  GLY A N    9  
ATOM   6204  C CA   . GLY A 1 9  ? -0.818  12.622 -7.650  1.00 1.00 ? 9  GLY A CA   9  
ATOM   6205  C C    . GLY A 1 9  ? -1.744  13.704 -8.196  1.00 1.00 ? 9  GLY A C    9  
ATOM   6206  O O    . GLY A 1 9  ? -2.817  13.432 -8.724  1.00 1.00 ? 9  GLY A O    9  
ATOM   6207  H H    . GLY A 1 9  ? 1.173   13.428 -7.721  1.00 1.00 ? 9  GLY A H    9  
ATOM   6208  H HA2  . GLY A 1 9  ? -1.205  11.640 -7.923  1.00 1.00 ? 9  GLY A HA2  9  
ATOM   6209  H HA3  . GLY A 1 9  ? -0.763  12.703 -6.564  1.00 1.00 ? 9  GLY A HA3  9  
ATOM   6210  N N    . THR A 1 10 ? -1.262  14.941 -8.093  1.00 1.00 ? 10 THR A N    9  
ATOM   6211  C CA   . THR A 1 10 ? -1.811  16.135 -8.714  1.00 1.00 ? 10 THR A CA   9  
ATOM   6212  C C    . THR A 1 10 ? -0.614  16.915 -9.248  1.00 1.00 ? 10 THR A C    9  
ATOM   6213  O O    . THR A 1 10 ? -0.485  17.128 -10.454 1.00 1.00 ? 10 THR A O    9  
ATOM   6214  C CB   . THR A 1 10 ? -2.617  16.961 -7.696  1.00 1.00 ? 10 THR A CB   9  
ATOM   6215  O OG1  . THR A 1 10 ? -2.083  16.817 -6.390  1.00 1.00 ? 10 THR A OG1  9  
ATOM   6216  C CG2  . THR A 1 10 ? -4.086  16.539 -7.682  1.00 1.00 ? 10 THR A CG2  9  
ATOM   6217  H H    . THR A 1 10 ? -0.366  15.037 -7.640  1.00 1.00 ? 10 THR A H    9  
ATOM   6218  H HA   . THR A 1 10 ? -2.444  15.871 -9.564  1.00 1.00 ? 10 THR A HA   9  
ATOM   6219  H HB   . THR A 1 10 ? -2.584  18.015 -7.981  1.00 1.00 ? 10 THR A HB   9  
ATOM   6220  H HG1  . THR A 1 10 ? -2.023  15.869 -6.193  1.00 1.00 ? 10 THR A HG1  9  
ATOM   6221  H HG21 . THR A 1 10 ? -4.513  16.686 -8.674  1.00 1.00 ? 10 THR A HG21 9  
ATOM   6222  H HG22 . THR A 1 10 ? -4.176  15.488 -7.407  1.00 1.00 ? 10 THR A HG22 9  
ATOM   6223  H HG23 . THR A 1 10 ? -4.639  17.156 -6.974  1.00 1.00 ? 10 THR A HG23 9  
ATOM   6224  N N    . TRP A 1 11 ? 0.283   17.282 -8.326  1.00 1.00 ? 11 TRP A N    9  
ATOM   6225  C CA   . TRP A 1 11 ? 1.464   18.100 -8.567  1.00 1.00 ? 11 TRP A CA   9  
ATOM   6226  C C    . TRP A 1 11 ? 2.477   17.412 -9.489  1.00 1.00 ? 11 TRP A C    9  
ATOM   6227  O O    . TRP A 1 11 ? 3.560   16.998 -9.080  1.00 1.00 ? 11 TRP A O    9  
ATOM   6228  C CB   . TRP A 1 11 ? 2.083   18.478 -7.217  1.00 1.00 ? 11 TRP A CB   9  
ATOM   6229  C CG   . TRP A 1 11 ? 2.898   19.733 -7.219  1.00 1.00 ? 11 TRP A CG   9  
ATOM   6230  C CD1  . TRP A 1 11 ? 3.852   20.080 -8.112  1.00 1.00 ? 11 TRP A CD1  9  
ATOM   6231  C CD2  . TRP A 1 11 ? 2.792   20.855 -6.301  1.00 1.00 ? 11 TRP A CD2  9  
ATOM   6232  N NE1  . TRP A 1 11 ? 4.312   21.349 -7.835  1.00 1.00 ? 11 TRP A NE1  9  
ATOM   6233  C CE2  . TRP A 1 11 ? 3.690   21.875 -6.724  1.00 1.00 ? 11 TRP A CE2  9  
ATOM   6234  C CE3  . TRP A 1 11 ? 2.019   21.109 -5.152  1.00 1.00 ? 11 TRP A CE3  9  
ATOM   6235  C CZ2  . TRP A 1 11 ? 3.810   23.091 -6.040  1.00 1.00 ? 11 TRP A CZ2  9  
ATOM   6236  C CZ3  . TRP A 1 11 ? 2.135   22.324 -4.456  1.00 1.00 ? 11 TRP A CZ3  9  
ATOM   6237  C CH2  . TRP A 1 11 ? 3.052   23.296 -4.879  1.00 1.00 ? 11 TRP A CH2  9  
ATOM   6238  H H    . TRP A 1 11 ? 0.043   17.089 -7.363  1.00 1.00 ? 11 TRP A H    9  
ATOM   6239  H HA   . TRP A 1 11 ? 1.129   19.022 -9.046  1.00 1.00 ? 11 TRP A HA   9  
ATOM   6240  H HB2  . TRP A 1 11 ? 1.270   18.647 -6.511  1.00 1.00 ? 11 TRP A HB2  9  
ATOM   6241  H HB3  . TRP A 1 11 ? 2.679   17.654 -6.829  1.00 1.00 ? 11 TRP A HB3  9  
ATOM   6242  H HD1  . TRP A 1 11 ? 4.195   19.486 -8.943  1.00 1.00 ? 11 TRP A HD1  9  
ATOM   6243  H HE1  . TRP A 1 11 ? 5.045   21.830 -8.349  1.00 1.00 ? 11 TRP A HE1  9  
ATOM   6244  H HE3  . TRP A 1 11 ? 1.344   20.348 -4.790  1.00 1.00 ? 11 TRP A HE3  9  
ATOM   6245  H HZ2  . TRP A 1 11 ? 4.506   23.844 -6.380  1.00 1.00 ? 11 TRP A HZ2  9  
ATOM   6246  H HZ3  . TRP A 1 11 ? 1.524   22.509 -3.586  1.00 1.00 ? 11 TRP A HZ3  9  
ATOM   6247  H HH2  . TRP A 1 11 ? 3.186   24.185 -4.293  1.00 1.00 ? 11 TRP A HH2  9  
ATOM   6248  N N    . SER A 1 12 ? 2.143   17.341 -10.772 1.00 1.00 ? 12 SER A N    9  
ATOM   6249  C CA   . SER A 1 12 ? 2.930   16.652 -11.774 1.00 1.00 ? 12 SER A CA   9  
ATOM   6250  C C    . SER A 1 12 ? 3.946   17.629 -12.362 1.00 1.00 ? 12 SER A C    9  
ATOM   6251  O O    . SER A 1 12 ? 3.907   17.929 -13.553 1.00 1.00 ? 12 SER A O    9  
ATOM   6252  C CB   . SER A 1 12 ? 1.962   16.095 -12.825 1.00 1.00 ? 12 SER A CB   9  
ATOM   6253  O OG   . SER A 1 12 ? 0.961   15.329 -12.174 1.00 1.00 ? 12 SER A OG   9  
ATOM   6254  H H    . SER A 1 12 ? 1.218   17.666 -11.025 1.00 1.00 ? 12 SER A H    9  
ATOM   6255  H HA   . SER A 1 12 ? 3.467   15.816 -11.324 1.00 1.00 ? 12 SER A HA   9  
ATOM   6256  H HB2  . SER A 1 12 ? 1.494   16.916 -13.374 1.00 1.00 ? 12 SER A HB2  9  
ATOM   6257  H HB3  . SER A 1 12 ? 2.513   15.477 -13.536 1.00 1.00 ? 12 SER A HB3  9  
ATOM   6258  H HG   . SER A 1 12 ? 0.394   15.920 -11.658 1.00 1.00 ? 12 SER A HG   9  
ATOM   6259  N N    . GLY A 1 13 ? 4.842   18.144 -11.516 1.00 1.00 ? 13 GLY A N    9  
ATOM   6260  C CA   . GLY A 1 13 ? 5.804   19.160 -11.909 1.00 1.00 ? 13 GLY A CA   9  
ATOM   6261  C C    . GLY A 1 13 ? 6.769   19.469 -10.768 1.00 1.00 ? 13 GLY A C    9  
ATOM   6262  O O    . GLY A 1 13 ? 6.744   18.802 -9.733  1.00 1.00 ? 13 GLY A O    9  
ATOM   6263  H H    . GLY A 1 13 ? 4.843   17.841 -10.545 1.00 1.00 ? 13 GLY A H    9  
ATOM   6264  H HA2  . GLY A 1 13 ? 6.377   18.811 -12.768 1.00 1.00 ? 13 GLY A HA2  9  
ATOM   6265  H HA3  . GLY A 1 13 ? 5.269   20.071 -12.181 1.00 1.00 ? 13 GLY A HA3  9  
ATOM   6266  N N    . VAL A 1 14 ? 7.618   20.483 -10.963 1.00 1.00 ? 14 VAL A N    9  
ATOM   6267  C CA   . VAL A 1 14 ? 8.568   20.933 -9.954  1.00 1.00 ? 14 VAL A CA   9  
ATOM   6268  C C    . VAL A 1 14 ? 7.789   21.348 -8.704  1.00 1.00 ? 14 VAL A C    9  
ATOM   6269  O O    . VAL A 1 14 ? 6.787   22.055 -8.802  1.00 1.00 ? 14 VAL A O    9  
ATOM   6270  C CB   . VAL A 1 14 ? 9.431   22.085 -10.498 1.00 1.00 ? 14 VAL A CB   9  
ATOM   6271  C CG1  . VAL A 1 14 ? 10.486  22.521 -9.472  1.00 1.00 ? 14 VAL A CG1  9  
ATOM   6272  C CG2  . VAL A 1 14 ? 10.150  21.677 -11.793 1.00 1.00 ? 14 VAL A CG2  9  
ATOM   6273  H H    . VAL A 1 14 ? 7.552   21.010 -11.820 1.00 1.00 ? 14 VAL A H    9  
ATOM   6274  H HA   . VAL A 1 14 ? 9.219   20.092 -9.716  1.00 1.00 ? 14 VAL A HA   9  
ATOM   6275  H HB   . VAL A 1 14 ? 8.786   22.938 -10.705 1.00 1.00 ? 14 VAL A HB   9  
ATOM   6276  H HG11 . VAL A 1 14 ? 11.122  21.677 -9.206  1.00 1.00 ? 14 VAL A HG11 9  
ATOM   6277  H HG12 . VAL A 1 14 ? 11.106  23.312 -9.896  1.00 1.00 ? 14 VAL A HG12 9  
ATOM   6278  H HG13 . VAL A 1 14 ? 10.008  22.909 -8.574  1.00 1.00 ? 14 VAL A HG13 9  
ATOM   6279  H HG21 . VAL A 1 14 ? 10.745  20.780 -11.621 1.00 1.00 ? 14 VAL A HG21 9  
ATOM   6280  H HG22 . VAL A 1 14 ? 9.434   21.482 -12.590 1.00 1.00 ? 14 VAL A HG22 9  
ATOM   6281  H HG23 . VAL A 1 14 ? 10.807  22.483 -12.119 1.00 1.00 ? 14 VAL A HG23 9  
ATOM   6282  N N    . CYS A 1 15 ? 8.237   20.896 -7.535  1.00 1.00 ? 15 CYS A N    9  
ATOM   6283  C CA   . CYS A 1 15 ? 7.478   21.016 -6.295  1.00 1.00 ? 15 CYS A CA   9  
ATOM   6284  C C    . CYS A 1 15 ? 7.469   22.427 -5.723  1.00 1.00 ? 15 CYS A C    9  
ATOM   6285  O O    . CYS A 1 15 ? 6.548   22.783 -4.997  1.00 1.00 ? 15 CYS A O    9  
ATOM   6286  C CB   . CYS A 1 15 ? 8.030   20.064 -5.240  1.00 1.00 ? 15 CYS A CB   9  
ATOM   6287  S SG   . CYS A 1 15 ? 9.345   20.742 -4.211  1.00 1.00 ? 15 CYS A SG   9  
ATOM   6288  H H    . CYS A 1 15 ? 9.097   20.358 -7.538  1.00 1.00 ? 15 CYS A H    9  
ATOM   6289  H HA   . CYS A 1 15 ? 6.453   20.708 -6.492  1.00 1.00 ? 15 CYS A HA   9  
ATOM   6290  H HB2  . CYS A 1 15 ? 7.224   19.776 -4.568  1.00 1.00 ? 15 CYS A HB2  9  
ATOM   6291  H HB3  . CYS A 1 15 ? 8.411   19.179 -5.730  1.00 1.00 ? 15 CYS A HB3  9  
ATOM   6292  N N    . GLY A 1 16 ? 8.541   23.194 -5.933  1.00 1.00 ? 16 GLY A N    9  
ATOM   6293  C CA   . GLY A 1 16 ? 8.710   24.498 -5.307  1.00 1.00 ? 16 GLY A CA   9  
ATOM   6294  C C    . GLY A 1 16 ? 9.027   24.419 -3.807  1.00 1.00 ? 16 GLY A C    9  
ATOM   6295  O O    . GLY A 1 16 ? 9.948   25.088 -3.346  1.00 1.00 ? 16 GLY A O    9  
ATOM   6296  H H    . GLY A 1 16 ? 9.291   22.828 -6.498  1.00 1.00 ? 16 GLY A H    9  
ATOM   6297  H HA2  . GLY A 1 16 ? 9.526   25.017 -5.811  1.00 1.00 ? 16 GLY A HA2  9  
ATOM   6298  H HA3  . GLY A 1 16 ? 7.801   25.087 -5.441  1.00 1.00 ? 16 GLY A HA3  9  
ATOM   6299  N N    . ASN A 1 17 ? 8.272   23.632 -3.028  1.00 1.00 ? 17 ASN A N    9  
ATOM   6300  C CA   . ASN A 1 17 ? 8.333   23.641 -1.573  1.00 1.00 ? 17 ASN A CA   9  
ATOM   6301  C C    . ASN A 1 17 ? 7.598   22.438 -0.962  1.00 1.00 ? 17 ASN A C    9  
ATOM   6302  O O    . ASN A 1 17 ? 6.508   22.072 -1.403  1.00 1.00 ? 17 ASN A O    9  
ATOM   6303  C CB   . ASN A 1 17 ? 7.713   24.945 -1.058  1.00 1.00 ? 17 ASN A CB   9  
ATOM   6304  C CG   . ASN A 1 17 ? 7.589   24.927 0.458   1.00 1.00 ? 17 ASN A CG   9  
ATOM   6305  O OD1  . ASN A 1 17 ? 6.534   24.595 0.987   1.00 1.00 ? 17 ASN A OD1  9  
ATOM   6306  N ND2  . ASN A 1 17 ? 8.668   25.236 1.169   1.00 1.00 ? 17 ASN A ND2  9  
ATOM   6307  H H    . ASN A 1 17 ? 7.582   23.035 -3.468  1.00 1.00 ? 17 ASN A H    9  
ATOM   6308  H HA   . ASN A 1 17 ? 9.380   23.605 -1.267  1.00 1.00 ? 17 ASN A HA   9  
ATOM   6309  H HB2  . ASN A 1 17 ? 8.316   25.802 -1.362  1.00 1.00 ? 17 ASN A HB2  9  
ATOM   6310  H HB3  . ASN A 1 17 ? 6.715   25.058 -1.482  1.00 1.00 ? 17 ASN A HB3  9  
ATOM   6311  H HD21 . ASN A 1 17 ? 9.516   25.529 0.706   1.00 1.00 ? 17 ASN A HD21 9  
ATOM   6312  H HD22 . ASN A 1 17 ? 8.600   25.260 2.176   1.00 1.00 ? 17 ASN A HD22 9  
ATOM   6313  N N    . ASN A 1 18 ? 8.192   21.850 0.085   1.00 1.00 ? 18 ASN A N    9  
ATOM   6314  C CA   . ASN A 1 18 ? 7.676   20.701 0.812   1.00 1.00 ? 18 ASN A CA   9  
ATOM   6315  C C    . ASN A 1 18 ? 6.270   20.916 1.346   1.00 1.00 ? 18 ASN A C    9  
ATOM   6316  O O    . ASN A 1 18 ? 5.355   20.165 1.021   1.00 1.00 ? 18 ASN A O    9  
ATOM   6317  C CB   . ASN A 1 18 ? 8.632   20.383 1.966   1.00 1.00 ? 18 ASN A CB   9  
ATOM   6318  C CG   . ASN A 1 18 ? 8.253   19.066 2.622   1.00 1.00 ? 18 ASN A CG   9  
ATOM   6319  O OD1  . ASN A 1 18 ? 7.372   19.007 3.477   1.00 1.00 ? 18 ASN A OD1  9  
ATOM   6320  N ND2  . ASN A 1 18 ? 8.871   17.970 2.207   1.00 1.00 ? 18 ASN A ND2  9  
ATOM   6321  H H    . ASN A 1 18 ? 9.096   22.183 0.383   1.00 1.00 ? 18 ASN A H    9  
ATOM   6322  H HA   . ASN A 1 18 ? 7.622   19.862 0.131   1.00 1.00 ? 18 ASN A HA   9  
ATOM   6323  H HB2  . ASN A 1 18 ? 9.647   20.333 1.585   1.00 1.00 ? 18 ASN A HB2  9  
ATOM   6324  H HB3  . ASN A 1 18 ? 8.608   21.170 2.720   1.00 1.00 ? 18 ASN A HB3  9  
ATOM   6325  H HD21 . ASN A 1 18 ? 9.621   17.948 1.514   1.00 1.00 ? 18 ASN A HD21 9  
ATOM   6326  H HD22 . ASN A 1 18 ? 8.566   17.118 2.654   1.00 1.00 ? 18 ASN A HD22 9  
ATOM   6327  N N    . ASN A 1 19 ? 6.129   21.916 2.209   1.00 1.00 ? 19 ASN A N    9  
ATOM   6328  C CA   . ASN A 1 19 ? 4.859   22.283 2.824   1.00 1.00 ? 19 ASN A CA   9  
ATOM   6329  C C    . ASN A 1 19 ? 3.767   22.484 1.774   1.00 1.00 ? 19 ASN A C    9  
ATOM   6330  O O    . ASN A 1 19 ? 2.673   21.949 1.926   1.00 1.00 ? 19 ASN A O    9  
ATOM   6331  C CB   . ASN A 1 19 ? 5.005   23.514 3.722   1.00 1.00 ? 19 ASN A CB   9  
ATOM   6332  C CG   . ASN A 1 19 ? 3.651   23.892 4.315   1.00 1.00 ? 19 ASN A CG   9  
ATOM   6333  O OD1  . ASN A 1 19 ? 3.137   23.194 5.183   1.00 1.00 ? 19 ASN A OD1  9  
ATOM   6334  N ND2  . ASN A 1 19 ? 3.056   24.986 3.848   1.00 1.00 ? 19 ASN A ND2  9  
ATOM   6335  H H    . ASN A 1 19 ? 6.975   22.411 2.441   1.00 1.00 ? 19 ASN A H    9  
ATOM   6336  H HA   . ASN A 1 19 ? 4.543   21.462 3.465   1.00 1.00 ? 19 ASN A HA   9  
ATOM   6337  H HB2  . ASN A 1 19 ? 5.692   23.285 4.536   1.00 1.00 ? 19 ASN A HB2  9  
ATOM   6338  H HB3  . ASN A 1 19 ? 5.402   24.357 3.161   1.00 1.00 ? 19 ASN A HB3  9  
ATOM   6339  H HD21 . ASN A 1 19 ? 3.492   25.549 3.134   1.00 1.00 ? 19 ASN A HD21 9  
ATOM   6340  H HD22 . ASN A 1 19 ? 2.169   25.254 4.245   1.00 1.00 ? 19 ASN A HD22 9  
ATOM   6341  N N    . ALA A 1 20 ? 4.056   23.232 0.707   1.00 1.00 ? 20 ALA A N    9  
ATOM   6342  C CA   . ALA A 1 20 ? 3.087   23.427 -0.363  1.00 1.00 ? 20 ALA A CA   9  
ATOM   6343  C C    . ALA A 1 20 ? 2.696   22.087 -0.986  1.00 1.00 ? 20 ALA A C    9  
ATOM   6344  O O    . ALA A 1 20 ? 1.511   21.768 -1.045  1.00 1.00 ? 20 ALA A O    9  
ATOM   6345  C CB   . ALA A 1 20 ? 3.621   24.385 -1.428  1.00 1.00 ? 20 ALA A CB   9  
ATOM   6346  H H    . ALA A 1 20 ? 4.972   23.662 0.641   1.00 1.00 ? 20 ALA A H    9  
ATOM   6347  H HA   . ALA A 1 20 ? 2.192   23.879 0.072   1.00 1.00 ? 20 ALA A HA   9  
ATOM   6348  H HB1  . ALA A 1 20 ? 3.954   25.314 -0.969  1.00 1.00 ? 20 ALA A HB1  9  
ATOM   6349  H HB2  . ALA A 1 20 ? 4.443   23.929 -1.980  1.00 1.00 ? 20 ALA A HB2  9  
ATOM   6350  H HB3  . ALA A 1 20 ? 2.808   24.610 -2.120  1.00 1.00 ? 20 ALA A HB3  9  
ATOM   6351  N N    . CYS A 1 21 ? 3.688   21.304 -1.434  1.00 1.00 ? 21 CYS A N    9  
ATOM   6352  C CA   . CYS A 1 21 ? 3.461   19.988 -2.028  1.00 1.00 ? 21 CYS A CA   9  
ATOM   6353  C C    . CYS A 1 21 ? 2.550   19.134 -1.141  1.00 1.00 ? 21 CYS A C    9  
ATOM   6354  O O    . CYS A 1 21 ? 1.486   18.683 -1.565  1.00 1.00 ? 21 CYS A O    9  
ATOM   6355  C CB   . CYS A 1 21 ? 4.799   19.275 -2.261  1.00 1.00 ? 21 CYS A CB   9  
ATOM   6356  S SG   . CYS A 1 21 ? 4.723   17.462 -2.292  1.00 1.00 ? 21 CYS A SG   9  
ATOM   6357  H H    . CYS A 1 21 ? 4.646   21.638 -1.357  1.00 1.00 ? 21 CYS A H    9  
ATOM   6358  H HA   . CYS A 1 21 ? 2.979   20.138 -2.990  1.00 1.00 ? 21 CYS A HA   9  
ATOM   6359  H HB2  . CYS A 1 21 ? 5.236   19.631 -3.192  1.00 1.00 ? 21 CYS A HB2  9  
ATOM   6360  H HB3  . CYS A 1 21 ? 5.481   19.522 -1.450  1.00 1.00 ? 21 CYS A HB3  9  
ATOM   6361  N N    . LYS A 1 22 ? 2.989   18.946 0.105   1.00 1.00 ? 22 LYS A N    9  
ATOM   6362  C CA   . LYS A 1 22 ? 2.292   18.229 1.157   1.00 1.00 ? 22 LYS A CA   9  
ATOM   6363  C C    . LYS A 1 22 ? 0.843   18.698 1.233   1.00 1.00 ? 22 LYS A C    9  
ATOM   6364  O O    . LYS A 1 22 ? -0.085  17.909 1.045   1.00 1.00 ? 22 LYS A O    9  
ATOM   6365  C CB   . LYS A 1 22 ? 3.047   18.517 2.465   1.00 1.00 ? 22 LYS A CB   9  
ATOM   6366  C CG   . LYS A 1 22 ? 2.399   17.961 3.741   1.00 1.00 ? 22 LYS A CG   9  
ATOM   6367  C CD   . LYS A 1 22 ? 3.121   18.421 5.025   1.00 1.00 ? 22 LYS A CD   9  
ATOM   6368  C CE   . LYS A 1 22 ? 4.645   18.623 4.923   1.00 1.00 ? 22 LYS A CE   9  
ATOM   6369  N NZ   . LYS A 1 22 ? 5.387   17.405 4.549   1.00 1.00 ? 22 LYS A NZ   9  
ATOM   6370  H H    . LYS A 1 22 ? 3.863   19.397 0.351   1.00 1.00 ? 22 LYS A H    9  
ATOM   6371  H HA   . LYS A 1 22 ? 2.309   17.161 0.931   1.00 1.00 ? 22 LYS A HA   9  
ATOM   6372  H HB2  . LYS A 1 22 ? 4.049   18.114 2.344   1.00 1.00 ? 22 LYS A HB2  9  
ATOM   6373  H HB3  . LYS A 1 22 ? 3.134   19.593 2.591   1.00 1.00 ? 22 LYS A HB3  9  
ATOM   6374  H HG2  . LYS A 1 22 ? 1.370   18.318 3.815   1.00 1.00 ? 22 LYS A HG2  9  
ATOM   6375  H HG3  . LYS A 1 22 ? 2.343   16.878 3.683   1.00 1.00 ? 22 LYS A HG3  9  
ATOM   6376  H HD2  . LYS A 1 22 ? 2.700   19.393 5.298   1.00 1.00 ? 22 LYS A HD2  9  
ATOM   6377  H HD3  . LYS A 1 22 ? 2.882   17.729 5.835   1.00 1.00 ? 22 LYS A HD3  9  
ATOM   6378  H HE2  . LYS A 1 22 ? 4.859   19.390 4.181   1.00 1.00 ? 22 LYS A HE2  9  
ATOM   6379  H HE3  . LYS A 1 22 ? 5.023   18.984 5.882   1.00 1.00 ? 22 LYS A HE3  9  
ATOM   6380  H HZ1  . LYS A 1 22 ? 4.956   16.942 3.761   1.00 1.00 ? 22 LYS A HZ1  9  
ATOM   6381  H HZ2  . LYS A 1 22 ? 6.332   17.648 4.255   1.00 1.00 ? 22 LYS A HZ2  9  
ATOM   6382  H HZ3  . LYS A 1 22 ? 5.434   16.743 5.307   1.00 1.00 ? 22 LYS A HZ3  9  
ATOM   6383  N N    . ASN A 1 23 ? 0.679   19.987 1.548   1.00 1.00 ? 23 ASN A N    9  
ATOM   6384  C CA   . ASN A 1 23 ? -0.614  20.593 1.780   1.00 1.00 ? 23 ASN A CA   9  
ATOM   6385  C C    . ASN A 1 23 ? -1.490  20.341 0.566   1.00 1.00 ? 23 ASN A C    9  
ATOM   6386  O O    . ASN A 1 23 ? -2.465  19.611 0.670   1.00 1.00 ? 23 ASN A O    9  
ATOM   6387  C CB   . ASN A 1 23 ? -0.451  22.094 2.074   1.00 1.00 ? 23 ASN A CB   9  
ATOM   6388  C CG   . ASN A 1 23 ? -1.770  22.830 2.334   1.00 1.00 ? 23 ASN A CG   9  
ATOM   6389  O OD1  . ASN A 1 23 ? -2.810  22.551 1.742   1.00 1.00 ? 23 ASN A OD1  9  
ATOM   6390  N ND2  . ASN A 1 23 ? -1.734  23.814 3.226   1.00 1.00 ? 23 ASN A ND2  9  
ATOM   6391  H H    . ASN A 1 23 ? 1.499   20.579 1.630   1.00 1.00 ? 23 ASN A H    9  
ATOM   6392  H HA   . ASN A 1 23 ? -1.047  20.093 2.650   1.00 1.00 ? 23 ASN A HA   9  
ATOM   6393  H HB2  . ASN A 1 23 ? 0.184   22.192 2.955   1.00 1.00 ? 23 ASN A HB2  9  
ATOM   6394  H HB3  . ASN A 1 23 ? 0.050   22.582 1.238   1.00 1.00 ? 23 ASN A HB3  9  
ATOM   6395  H HD21 . ASN A 1 23 ? -0.870  24.048 3.690   1.00 1.00 ? 23 ASN A HD21 9  
ATOM   6396  H HD22 . ASN A 1 23 ? -2.582  24.325 3.421   1.00 1.00 ? 23 ASN A HD22 9  
ATOM   6397  N N    . GLN A 1 24 ? -1.119  20.899 -0.590  1.00 1.00 ? 24 GLN A N    9  
ATOM   6398  C CA   . GLN A 1 24 ? -1.925  20.793 -1.793  1.00 1.00 ? 24 GLN A CA   9  
ATOM   6399  C C    . GLN A 1 24 ? -2.281  19.338 -2.075  1.00 1.00 ? 24 GLN A C    9  
ATOM   6400  O O    . GLN A 1 24 ? -3.444  19.069 -2.359  1.00 1.00 ? 24 GLN A O    9  
ATOM   6401  C CB   . GLN A 1 24 ? -1.237  21.492 -2.971  1.00 1.00 ? 24 GLN A CB   9  
ATOM   6402  C CG   . GLN A 1 24 ? -2.218  21.646 -4.142  1.00 1.00 ? 24 GLN A CG   9  
ATOM   6403  C CD   . GLN A 1 24 ? -1.705  22.592 -5.221  1.00 1.00 ? 24 GLN A CD   9  
ATOM   6404  O OE1  . GLN A 1 24 ? -2.203  23.701 -5.374  1.00 1.00 ? 24 GLN A OE1  9  
ATOM   6405  N NE2  . GLN A 1 24 ? -0.713  22.159 -5.986  1.00 1.00 ? 24 GLN A NE2  9  
ATOM   6406  H H    . GLN A 1 24 ? -0.229  21.384 -0.643  1.00 1.00 ? 24 GLN A H    9  
ATOM   6407  H HA   . GLN A 1 24 ? -2.875  21.299 -1.616  1.00 1.00 ? 24 GLN A HA   9  
ATOM   6408  H HB2  . GLN A 1 24 ? -0.922  22.486 -2.652  1.00 1.00 ? 24 GLN A HB2  9  
ATOM   6409  H HB3  . GLN A 1 24 ? -0.362  20.921 -3.278  1.00 1.00 ? 24 GLN A HB3  9  
ATOM   6410  H HG2  . GLN A 1 24 ? -2.420  20.671 -4.583  1.00 1.00 ? 24 GLN A HG2  9  
ATOM   6411  H HG3  . GLN A 1 24 ? -3.150  22.068 -3.771  1.00 1.00 ? 24 GLN A HG3  9  
ATOM   6412  H HE21 . GLN A 1 24 ? -0.292  21.263 -5.802  1.00 1.00 ? 24 GLN A HE21 9  
ATOM   6413  H HE22 . GLN A 1 24 ? -0.344  22.773 -6.696  1.00 1.00 ? 24 GLN A HE22 9  
ATOM   6414  N N    . CYS A 1 25 ? -1.338  18.396 -1.938  1.00 1.00 ? 25 CYS A N    9  
ATOM   6415  C CA   . CYS A 1 25 ? -1.689  16.997 -2.126  1.00 1.00 ? 25 CYS A CA   9  
ATOM   6416  C C    . CYS A 1 25 ? -2.847  16.578 -1.221  1.00 1.00 ? 25 CYS A C    9  
ATOM   6417  O O    . CYS A 1 25 ? -3.915  16.239 -1.723  1.00 1.00 ? 25 CYS A O    9  
ATOM   6418  C CB   . CYS A 1 25 ? -0.529  16.028 -1.912  1.00 1.00 ? 25 CYS A CB   9  
ATOM   6419  S SG   . CYS A 1 25 ? -1.102  14.374 -2.358  1.00 1.00 ? 25 CYS A SG   9  
ATOM   6420  H H    . CYS A 1 25 ? -0.386  18.644 -1.678  1.00 1.00 ? 25 CYS A H    9  
ATOM   6421  H HA   . CYS A 1 25 ? -2.004  16.887 -3.163  1.00 1.00 ? 25 CYS A HA   9  
ATOM   6422  H HB2  . CYS A 1 25 ? 0.316   16.291 -2.536  1.00 1.00 ? 25 CYS A HB2  9  
ATOM   6423  H HB3  . CYS A 1 25 ? -0.205  16.026 -0.871  1.00 1.00 ? 25 CYS A HB3  9  
ATOM   6424  N N    . ILE A 1 26 ? -2.643  16.587 0.102   1.00 1.00 ? 26 ILE A N    9  
ATOM   6425  C CA   . ILE A 1 26 ? -3.617  15.996 1.025   1.00 1.00 ? 26 ILE A CA   9  
ATOM   6426  C C    . ILE A 1 26 ? -4.871  16.875 1.163   1.00 1.00 ? 26 ILE A C    9  
ATOM   6427  O O    . ILE A 1 26 ? -5.934  16.429 1.605   1.00 1.00 ? 26 ILE A O    9  
ATOM   6428  C CB   . ILE A 1 26 ? -2.945  15.739 2.389   1.00 1.00 ? 26 ILE A CB   9  
ATOM   6429  C CG1  . ILE A 1 26 ? -2.706  17.036 3.182   1.00 1.00 ? 26 ILE A CG1  9  
ATOM   6430  C CG2  . ILE A 1 26 ? -1.634  14.963 2.184   1.00 1.00 ? 26 ILE A CG2  9  
ATOM   6431  C CD1  . ILE A 1 26 ? -1.958  16.808 4.500   1.00 1.00 ? 26 ILE A CD1  9  
ATOM   6432  H H    . ILE A 1 26 ? -1.784  16.995 0.469   1.00 1.00 ? 26 ILE A H    9  
ATOM   6433  H HA   . ILE A 1 26 ? -3.939  15.029 0.625   1.00 1.00 ? 26 ILE A HA   9  
ATOM   6434  H HB   . ILE A 1 26 ? -3.618  15.116 2.979   1.00 1.00 ? 26 ILE A HB   9  
ATOM   6435  H HG12 . ILE A 1 26 ? -2.139  17.744 2.582   1.00 1.00 ? 26 ILE A HG12 9  
ATOM   6436  H HG13 . ILE A 1 26 ? -3.668  17.483 3.433   1.00 1.00 ? 26 ILE A HG13 9  
ATOM   6437  H HG21 . ILE A 1 26 ? -1.810  14.106 1.539   1.00 1.00 ? 26 ILE A HG21 9  
ATOM   6438  H HG22 . ILE A 1 26 ? -0.870  15.594 1.738   1.00 1.00 ? 26 ILE A HG22 9  
ATOM   6439  H HG23 . ILE A 1 26 ? -1.264  14.604 3.139   1.00 1.00 ? 26 ILE A HG23 9  
ATOM   6440  H HD11 . ILE A 1 26 ? -2.450  16.025 5.077   1.00 1.00 ? 26 ILE A HD11 9  
ATOM   6441  H HD12 . ILE A 1 26 ? -0.923  16.527 4.309   1.00 1.00 ? 26 ILE A HD12 9  
ATOM   6442  H HD13 . ILE A 1 26 ? -1.963  17.733 5.078   1.00 1.00 ? 26 ILE A HD13 9  
ATOM   6443  N N    . ASN A 1 27 ? -4.755  18.133 0.741   1.00 1.00 ? 27 ASN A N    9  
ATOM   6444  C CA   . ASN A 1 27 ? -5.823  19.111 0.752   1.00 1.00 ? 27 ASN A CA   9  
ATOM   6445  C C    . ASN A 1 27 ? -6.748  18.810 -0.421  1.00 1.00 ? 27 ASN A C    9  
ATOM   6446  O O    . ASN A 1 27 ? -7.927  18.529 -0.208  1.00 1.00 ? 27 ASN A O    9  
ATOM   6447  C CB   . ASN A 1 27 ? -5.188  20.501 0.696   1.00 1.00 ? 27 ASN A CB   9  
ATOM   6448  C CG   . ASN A 1 27 ? -6.158  21.664 0.814   1.00 1.00 ? 27 ASN A CG   9  
ATOM   6449  O OD1  . ASN A 1 27 ? -7.356  21.532 0.594   1.00 1.00 ? 27 ASN A OD1  9  
ATOM   6450  N ND2  . ASN A 1 27 ? -5.621  22.829 1.167   1.00 1.00 ? 27 ASN A ND2  9  
ATOM   6451  H H    . ASN A 1 27 ? -3.842  18.445 0.421   1.00 1.00 ? 27 ASN A H    9  
ATOM   6452  H HA   . ASN A 1 27 ? -6.385  19.028 1.685   1.00 1.00 ? 27 ASN A HA   9  
ATOM   6453  H HB2  . ASN A 1 27 ? -4.506  20.559 1.545   1.00 1.00 ? 27 ASN A HB2  9  
ATOM   6454  H HB3  . ASN A 1 27 ? -4.632  20.620 -0.232  1.00 1.00 ? 27 ASN A HB3  9  
ATOM   6455  H HD21 . ASN A 1 27 ? -4.620  22.875 1.351   1.00 1.00 ? 27 ASN A HD21 9  
ATOM   6456  H HD22 . ASN A 1 27 ? -6.213  23.638 1.259   1.00 1.00 ? 27 ASN A HD22 9  
ATOM   6457  N N    . LEU A 1 28 ? -6.199  18.753 -1.638  1.00 1.00 ? 28 LEU A N    9  
ATOM   6458  C CA   . LEU A 1 28 ? -6.963  18.392 -2.823  1.00 1.00 ? 28 LEU A CA   9  
ATOM   6459  C C    . LEU A 1 28 ? -7.331  16.908 -2.751  1.00 1.00 ? 28 LEU A C    9  
ATOM   6460  O O    . LEU A 1 28 ? -8.462  16.584 -2.380  1.00 1.00 ? 28 LEU A O    9  
ATOM   6461  C CB   . LEU A 1 28 ? -6.196  18.775 -4.099  1.00 1.00 ? 28 LEU A CB   9  
ATOM   6462  C CG   . LEU A 1 28 ? -6.444  20.232 -4.527  1.00 1.00 ? 28 LEU A CG   9  
ATOM   6463  C CD1  . LEU A 1 28 ? -6.088  21.242 -3.429  1.00 1.00 ? 28 LEU A CD1  9  
ATOM   6464  C CD2  . LEU A 1 28 ? -5.631  20.527 -5.793  1.00 1.00 ? 28 LEU A CD2  9  
ATOM   6465  H H    . LEU A 1 28 ? -5.199  18.902 -1.746  1.00 1.00 ? 28 LEU A H    9  
ATOM   6466  H HA   . LEU A 1 28 ? -7.902  18.948 -2.822  1.00 1.00 ? 28 LEU A HA   9  
ATOM   6467  H HB2  . LEU A 1 28 ? -5.129  18.606 -3.970  1.00 1.00 ? 28 LEU A HB2  9  
ATOM   6468  H HB3  . LEU A 1 28 ? -6.532  18.140 -4.915  1.00 1.00 ? 28 LEU A HB3  9  
ATOM   6469  H HG   . LEU A 1 28 ? -7.501  20.354 -4.771  1.00 1.00 ? 28 LEU A HG   9  
ATOM   6470  H HD11 . LEU A 1 28 ? -5.085  21.049 -3.053  1.00 1.00 ? 28 LEU A HD11 9  
ATOM   6471  H HD12 . LEU A 1 28 ? -6.130  22.256 -3.831  1.00 1.00 ? 28 LEU A HD12 9  
ATOM   6472  H HD13 . LEU A 1 28 ? -6.798  21.174 -2.606  1.00 1.00 ? 28 LEU A HD13 9  
ATOM   6473  H HD21 . LEU A 1 28 ? -5.925  19.841 -6.588  1.00 1.00 ? 28 LEU A HD21 9  
ATOM   6474  H HD22 . LEU A 1 28 ? -5.818  21.549 -6.125  1.00 1.00 ? 28 LEU A HD22 9  
ATOM   6475  H HD23 . LEU A 1 28 ? -4.568  20.405 -5.592  1.00 1.00 ? 28 LEU A HD23 9  
ATOM   6476  N N    . GLU A 1 29 ? -6.387  15.986 -2.967  1.00 1.00 ? 29 GLU A N    9  
ATOM   6477  C CA   . GLU A 1 29 ? -6.718  14.565 -2.936  1.00 1.00 ? 29 GLU A CA   9  
ATOM   6478  C C    . GLU A 1 29 ? -6.609  14.114 -1.480  1.00 1.00 ? 29 GLU A C    9  
ATOM   6479  O O    . GLU A 1 29 ? -6.139  14.859 -0.630  1.00 1.00 ? 29 GLU A O    9  
ATOM   6480  C CB   . GLU A 1 29 ? -5.863  13.739 -3.916  1.00 1.00 ? 29 GLU A CB   9  
ATOM   6481  C CG   . GLU A 1 29 ? -4.344  13.772 -3.691  1.00 1.00 ? 29 GLU A CG   9  
ATOM   6482  C CD   . GLU A 1 29 ? -3.620  14.781 -4.580  1.00 1.00 ? 29 GLU A CD   9  
ATOM   6483  O OE1  . GLU A 1 29 ? -2.672  14.405 -5.271  1.00 1.00 ? 29 GLU A OE1  9  
ATOM   6484  O OE2  . GLU A 1 29 ? -4.069  16.066 -4.566  1.00 1.00 ? 29 GLU A OE2  9  
ATOM   6485  H H    . GLU A 1 29 ? -5.407  16.258 -3.024  1.00 1.00 ? 29 GLU A H    9  
ATOM   6486  H HA   . GLU A 1 29 ? -7.752  14.425 -3.256  1.00 1.00 ? 29 GLU A HA   9  
ATOM   6487  H HB2  . GLU A 1 29 ? -6.186  12.701 -3.826  1.00 1.00 ? 29 GLU A HB2  9  
ATOM   6488  H HB3  . GLU A 1 29 ? -6.082  14.057 -4.937  1.00 1.00 ? 29 GLU A HB3  9  
ATOM   6489  H HG2  . GLU A 1 29 ? -4.112  13.952 -2.643  1.00 1.00 ? 29 GLU A HG2  9  
ATOM   6490  H HG3  . GLU A 1 29 ? -3.950  12.788 -3.948  1.00 1.00 ? 29 GLU A HG3  9  
ATOM   6491  H HE2  . GLU A 1 29 ? -3.505  16.624 -5.118  1.00 1.00 ? 29 GLU A HE2  9  
ATOM   6492  N N    . LYS A 1 30 ? -7.158  12.953 -1.131  1.00 1.00 ? 30 LYS A N    9  
ATOM   6493  C CA   . LYS A 1 30 ? -7.323  12.561 0.269   1.00 1.00 ? 30 LYS A CA   9  
ATOM   6494  C C    . LYS A 1 30 ? -6.133  11.774 0.824   1.00 1.00 ? 30 LYS A C    9  
ATOM   6495  O O    . LYS A 1 30 ? -6.242  11.161 1.888   1.00 1.00 ? 30 LYS A O    9  
ATOM   6496  C CB   . LYS A 1 30 ? -8.686  11.900 0.505   1.00 1.00 ? 30 LYS A CB   9  
ATOM   6497  C CG   . LYS A 1 30 ? -9.922  12.629 -0.073  1.00 1.00 ? 30 LYS A CG   9  
ATOM   6498  C CD   . LYS A 1 30 ? -9.878  14.148 -0.354  1.00 1.00 ? 30 LYS A CD   9  
ATOM   6499  C CE   . LYS A 1 30 ? -9.461  15.077 0.804   1.00 1.00 ? 30 LYS A CE   9  
ATOM   6500  N NZ   . LYS A 1 30 ? -8.397  16.032 0.408   1.00 1.00 ? 30 LYS A NZ   9  
ATOM   6501  H H    . LYS A 1 30 ? -7.519  12.345 -1.846  1.00 1.00 ? 30 LYS A H    9  
ATOM   6502  H HA   . LYS A 1 30 ? -7.330  13.458 0.882   1.00 1.00 ? 30 LYS A HA   9  
ATOM   6503  H HB2  . LYS A 1 30 ? -8.663  10.885 0.105   1.00 1.00 ? 30 LYS A HB2  9  
ATOM   6504  H HB3  . LYS A 1 30 ? -8.823  11.823 1.586   1.00 1.00 ? 30 LYS A HB3  9  
ATOM   6505  H HG2  . LYS A 1 30 ? -10.159 12.147 -1.025  1.00 1.00 ? 30 LYS A HG2  9  
ATOM   6506  H HG3  . LYS A 1 30 ? -10.761 12.427 0.595   1.00 1.00 ? 30 LYS A HG3  9  
ATOM   6507  H HD2  . LYS A 1 30 ? -9.273  14.335 -1.238  1.00 1.00 ? 30 LYS A HD2  9  
ATOM   6508  H HD3  . LYS A 1 30 ? -10.892 14.435 -0.645  1.00 1.00 ? 30 LYS A HD3  9  
ATOM   6509  H HE2  . LYS A 1 30 ? -10.336 15.661 1.097   1.00 1.00 ? 30 LYS A HE2  9  
ATOM   6510  H HE3  . LYS A 1 30 ? -9.145  14.504 1.675   1.00 1.00 ? 30 LYS A HE3  9  
ATOM   6511  H HZ1  . LYS A 1 30 ? -8.579  16.459 -0.500  1.00 1.00 ? 30 LYS A HZ1  9  
ATOM   6512  H HZ2  . LYS A 1 30 ? -8.309  16.808 1.052   1.00 1.00 ? 30 LYS A HZ2  9  
ATOM   6513  H HZ3  . LYS A 1 30 ? -7.471  15.609 0.373   1.00 1.00 ? 30 LYS A HZ3  9  
ATOM   6514  N N    . ALA A 1 31 ? -5.015  11.768 0.089   1.00 1.00 ? 31 ALA A N    9  
ATOM   6515  C CA   . ALA A 1 31 ? -3.722  11.262 0.528   1.00 1.00 ? 31 ALA A CA   9  
ATOM   6516  C C    . ALA A 1 31 ? -3.405  11.614 1.982   1.00 1.00 ? 31 ALA A C    9  
ATOM   6517  O O    . ALA A 1 31 ? -3.958  12.567 2.530   1.00 1.00 ? 31 ALA A O    9  
ATOM   6518  C CB   . ALA A 1 31 ? -2.647  11.848 -0.377  1.00 1.00 ? 31 ALA A CB   9  
ATOM   6519  H H    . ALA A 1 31 ? -5.025  12.294 -0.769  1.00 1.00 ? 31 ALA A H    9  
ATOM   6520  H HA   . ALA A 1 31 ? -3.736  10.179 0.437   1.00 1.00 ? 31 ALA A HA   9  
ATOM   6521  H HB1  . ALA A 1 31 ? -2.838  11.579 -1.415  1.00 1.00 ? 31 ALA A HB1  9  
ATOM   6522  H HB2  . ALA A 1 31 ? -2.654  12.934 -0.290  1.00 1.00 ? 31 ALA A HB2  9  
ATOM   6523  H HB3  . ALA A 1 31 ? -1.677  11.467 -0.059  1.00 1.00 ? 31 ALA A HB3  9  
ATOM   6524  N N    . ARG A 1 32 ? -2.543  10.820 2.625   1.00 1.00 ? 32 ARG A N    9  
ATOM   6525  C CA   . ARG A 1 32 ? -2.357  10.942 4.064   1.00 1.00 ? 32 ARG A CA   9  
ATOM   6526  C C    . ARG A 1 32 ? -1.224  11.907 4.387   1.00 1.00 ? 32 ARG A C    9  
ATOM   6527  O O    . ARG A 1 32 ? -1.474  12.954 4.979   1.00 1.00 ? 32 ARG A O    9  
ATOM   6528  C CB   . ARG A 1 32 ? -2.198  9.563  4.721   1.00 1.00 ? 32 ARG A CB   9  
ATOM   6529  C CG   . ARG A 1 32 ? -3.318  8.568  4.363   1.00 1.00 ? 32 ARG A CG   9  
ATOM   6530  C CD   . ARG A 1 32 ? -4.744  9.147  4.352   1.00 1.00 ? 32 ARG A CD   9  
ATOM   6531  N NE   . ARG A 1 32 ? -5.066  9.895  5.583   1.00 1.00 ? 32 ARG A NE   9  
ATOM   6532  C CZ   . ARG A 1 32 ? -5.642  11.110 5.666   1.00 1.00 ? 32 ARG A CZ   9  
ATOM   6533  N NH1  . ARG A 1 32 ? -5.995  11.800 4.574   1.00 1.00 ? 32 ARG A NH1  9  
ATOM   6534  N NH2  . ARG A 1 32 ? -5.857  11.646 6.873   1.00 1.00 ? 32 ARG A NH2  9  
ATOM   6535  H H    . ARG A 1 32 ? -2.006  10.125 2.110   1.00 1.00 ? 32 ARG A H    9  
ATOM   6536  H HA   . ARG A 1 32 ? -3.237  11.402 4.504   1.00 1.00 ? 32 ARG A HA   9  
ATOM   6537  H HB2  . ARG A 1 32 ? -1.247  9.119  4.426   1.00 1.00 ? 32 ARG A HB2  9  
ATOM   6538  H HB3  . ARG A 1 32 ? -2.187  9.706  5.803   1.00 1.00 ? 32 ARG A HB3  9  
ATOM   6539  H HG2  . ARG A 1 32 ? -3.116  8.163  3.370   1.00 1.00 ? 32 ARG A HG2  9  
ATOM   6540  H HG3  . ARG A 1 32 ? -3.274  7.739  5.070   1.00 1.00 ? 32 ARG A HG3  9  
ATOM   6541  H HD2  . ARG A 1 32 ? -4.856  9.752  3.458   1.00 1.00 ? 32 ARG A HD2  9  
ATOM   6542  H HD3  . ARG A 1 32 ? -5.448  8.317  4.262   1.00 1.00 ? 32 ARG A HD3  9  
ATOM   6543  H HE   . ARG A 1 32 ? -4.830  9.418  6.442   1.00 1.00 ? 32 ARG A HE   9  
ATOM   6544  H HH11 . ARG A 1 32 ? -5.842  11.434 3.635   1.00 1.00 ? 32 ARG A HH11 9  
ATOM   6545  H HH12 . ARG A 1 32 ? -6.354  12.739 4.635   1.00 1.00 ? 32 ARG A HH12 9  
ATOM   6546  H HH21 . ARG A 1 32 ? -5.596  11.151 7.713   1.00 1.00 ? 32 ARG A HH21 9  
ATOM   6547  H HH22 . ARG A 1 32 ? -6.278  12.558 6.971   1.00 1.00 ? 32 ARG A HH22 9  
ATOM   6548  N N    . HIS A 1 33 ? 0.017   11.534 4.068   1.00 1.00 ? 33 HIS A N    9  
ATOM   6549  C CA   . HIS A 1 33 ? 1.153   12.444 4.110   1.00 1.00 ? 33 HIS A CA   9  
ATOM   6550  C C    . HIS A 1 33 ? 1.590   12.794 2.688   1.00 1.00 ? 33 HIS A C    9  
ATOM   6551  O O    . HIS A 1 33 ? 1.261   12.096 1.729   1.00 1.00 ? 33 HIS A O    9  
ATOM   6552  C CB   . HIS A 1 33 ? 2.282   11.917 5.012   1.00 1.00 ? 33 HIS A CB   9  
ATOM   6553  C CG   . HIS A 1 33 ? 2.584   10.444 4.919   1.00 1.00 ? 33 HIS A CG   9  
ATOM   6554  N ND1  . HIS A 1 33 ? 1.711   9.481  5.403   1.00 1.00 ? 33 HIS A ND1  9  
ATOM   6555  C CD2  . HIS A 1 33 ? 3.705   9.751  4.528   1.00 1.00 ? 33 HIS A CD2  9  
ATOM   6556  C CE1  . HIS A 1 33 ? 2.302   8.287  5.245   1.00 1.00 ? 33 HIS A CE1  9  
ATOM   6557  N NE2  . HIS A 1 33 ? 3.523   8.383  4.717   1.00 1.00 ? 33 HIS A NE2  9  
ATOM   6558  H H    . HIS A 1 33 ? 0.126   10.707 3.495   1.00 1.00 ? 33 HIS A H    9  
ATOM   6559  H HA   . HIS A 1 33 ? 0.844   13.392 4.555   1.00 1.00 ? 33 HIS A HA   9  
ATOM   6560  H HB2  . HIS A 1 33 ? 3.196   12.478 4.817   1.00 1.00 ? 33 HIS A HB2  9  
ATOM   6561  H HB3  . HIS A 1 33 ? 1.993   12.111 6.045   1.00 1.00 ? 33 HIS A HB3  9  
ATOM   6562  H HD1  . HIS A 1 33 ? 0.805   9.650  5.812   1.00 1.00 ? 33 HIS A HD1  9  
ATOM   6563  H HD2  . HIS A 1 33 ? 4.608   10.205 4.150   1.00 1.00 ? 33 HIS A HD2  9  
ATOM   6564  H HE1  . HIS A 1 33 ? 1.846   7.356  5.542   1.00 1.00 ? 33 HIS A HE1  9  
ATOM   6565  N N    . GLY A 1 34 ? 2.358   13.874 2.566   1.00 1.00 ? 34 GLY A N    9  
ATOM   6566  C CA   . GLY A 1 34 ? 3.003   14.294 1.339   1.00 1.00 ? 34 GLY A CA   9  
ATOM   6567  C C    . GLY A 1 34 ? 4.213   15.125 1.730   1.00 1.00 ? 34 GLY A C    9  
ATOM   6568  O O    . GLY A 1 34 ? 4.296   15.567 2.876   1.00 1.00 ? 34 GLY A O    9  
ATOM   6569  H H    . GLY A 1 34 ? 2.631   14.389 3.392   1.00 1.00 ? 34 GLY A H    9  
ATOM   6570  H HA2  . GLY A 1 34 ? 3.365   13.428 0.802   1.00 1.00 ? 34 GLY A HA2  9  
ATOM   6571  H HA3  . GLY A 1 34 ? 2.314   14.861 0.713   1.00 1.00 ? 34 GLY A HA3  9  
ATOM   6572  N N    . SER A 1 35 ? 5.169   15.297 0.821   1.00 1.00 ? 35 SER A N    9  
ATOM   6573  C CA   . SER A 1 35 ? 6.414   15.999 1.075   1.00 1.00 ? 35 SER A CA   9  
ATOM   6574  C C    . SER A 1 35 ? 7.156   16.113 -0.249  1.00 1.00 ? 35 SER A C    9  
ATOM   6575  O O    . SER A 1 35 ? 7.148   15.187 -1.053  1.00 1.00 ? 35 SER A O    9  
ATOM   6576  C CB   . SER A 1 35 ? 7.281   15.218 2.084   1.00 1.00 ? 35 SER A CB   9  
ATOM   6577  O OG   . SER A 1 35 ? 7.333   15.878 3.340   1.00 1.00 ? 35 SER A OG   9  
ATOM   6578  H H    . SER A 1 35 ? 5.065   14.868 -0.099  1.00 1.00 ? 35 SER A H    9  
ATOM   6579  H HA   . SER A 1 35 ? 6.203   17.007 1.448   1.00 1.00 ? 35 SER A HA   9  
ATOM   6580  H HB2  . SER A 1 35 ? 6.895   14.205 2.211   1.00 1.00 ? 35 SER A HB2  9  
ATOM   6581  H HB3  . SER A 1 35 ? 8.301   15.127 1.701   1.00 1.00 ? 35 SER A HB3  9  
ATOM   6582  H HG   . SER A 1 35 ? 7.804   15.303 3.956   1.00 1.00 ? 35 SER A HG   9  
ATOM   6583  N N    . CYS A 1 36 ? 7.810   17.245 -0.467  1.00 1.00 ? 36 CYS A N    9  
ATOM   6584  C CA   . CYS A 1 36 ? 8.734   17.390 -1.572  1.00 1.00 ? 36 CYS A CA   9  
ATOM   6585  C C    . CYS A 1 36 ? 10.069  16.798 -1.162  1.00 1.00 ? 36 CYS A C    9  
ATOM   6586  O O    . CYS A 1 36 ? 10.491  17.017 -0.024  1.00 1.00 ? 36 CYS A O    9  
ATOM   6587  C CB   . CYS A 1 36 ? 8.926   18.853 -1.930  1.00 1.00 ? 36 CYS A CB   9  
ATOM   6588  S SG   . CYS A 1 36 ? 10.080  19.052 -3.285  1.00 1.00 ? 36 CYS A SG   9  
ATOM   6589  H H    . CYS A 1 36 ? 7.821   17.934 0.265   1.00 1.00 ? 36 CYS A H    9  
ATOM   6590  H HA   . CYS A 1 36 ? 8.359   16.862 -2.443  1.00 1.00 ? 36 CYS A HA   9  
ATOM   6591  H HB2  . CYS A 1 36 ? 7.968   19.289 -2.214  1.00 1.00 ? 36 CYS A HB2  9  
ATOM   6592  H HB3  . CYS A 1 36 ? 9.351   19.398 -1.089  1.00 1.00 ? 36 CYS A HB3  9  
ATOM   6593  N N    . ASN A 1 37 ? 10.717  16.080 -2.082  1.00 1.00 ? 37 ASN A N    9  
ATOM   6594  C CA   . ASN A 1 37 ? 12.085  15.610 -1.930  1.00 1.00 ? 37 ASN A CA   9  
ATOM   6595  C C    . ASN A 1 37 ? 12.914  16.085 -3.127  1.00 1.00 ? 37 ASN A C    9  
ATOM   6596  O O    . ASN A 1 37 ? 12.358  16.411 -4.180  1.00 1.00 ? 37 ASN A O    9  
ATOM   6597  C CB   . ASN A 1 37 ? 12.105  14.080 -1.813  1.00 1.00 ? 37 ASN A CB   9  
ATOM   6598  C CG   . ASN A 1 37 ? 13.542  13.576 -1.724  1.00 1.00 ? 37 ASN A CG   9  
ATOM   6599  O OD1  . ASN A 1 37 ? 14.348  14.141 -0.991  1.00 1.00 ? 37 ASN A OD1  9  
ATOM   6600  N ND2  . ASN A 1 37 ? 13.906  12.587 -2.530  1.00 1.00 ? 37 ASN A ND2  9  
ATOM   6601  H H    . ASN A 1 37 ? 10.295  15.980 -3.005  1.00 1.00 ? 37 ASN A H    9  
ATOM   6602  H HA   . ASN A 1 37 ? 12.527  16.036 -1.026  1.00 1.00 ? 37 ASN A HA   9  
ATOM   6603  H HB2  . ASN A 1 37 ? 11.567  13.775 -0.915  1.00 1.00 ? 37 ASN A HB2  9  
ATOM   6604  H HB3  . ASN A 1 37 ? 11.612  13.649 -2.686  1.00 1.00 ? 37 ASN A HB3  9  
ATOM   6605  H HD21 . ASN A 1 37 ? 13.245  12.138 -3.142  1.00 1.00 ? 37 ASN A HD21 9  
ATOM   6606  H HD22 . ASN A 1 37 ? 14.894  12.372 -2.581  1.00 1.00 ? 37 ASN A HD22 9  
ATOM   6607  N N    . TYR A 1 38 ? 14.242  16.115 -2.972  1.00 1.00 ? 38 TYR A N    9  
ATOM   6608  C CA   . TYR A 1 38 ? 15.159  16.365 -4.065  1.00 1.00 ? 38 TYR A CA   9  
ATOM   6609  C C    . TYR A 1 38 ? 15.721  15.054 -4.613  1.00 1.00 ? 38 TYR A C    9  
ATOM   6610  O O    . TYR A 1 38 ? 16.186  14.195 -3.869  1.00 1.00 ? 38 TYR A O    9  
ATOM   6611  C CB   . TYR A 1 38 ? 16.306  17.287 -3.641  1.00 1.00 ? 38 TYR A CB   9  
ATOM   6612  C CG   . TYR A 1 38 ? 17.211  17.625 -4.813  1.00 1.00 ? 38 TYR A CG   9  
ATOM   6613  C CD1  . TYR A 1 38 ? 16.766  18.537 -5.787  1.00 1.00 ? 38 TYR A CD1  9  
ATOM   6614  C CD2  . TYR A 1 38 ? 18.349  16.835 -5.072  1.00 1.00 ? 38 TYR A CD2  9  
ATOM   6615  C CE1  . TYR A 1 38 ? 17.447  18.657 -7.009  1.00 1.00 ? 38 TYR A CE1  9  
ATOM   6616  C CE2  . TYR A 1 38 ? 19.013  16.936 -6.308  1.00 1.00 ? 38 TYR A CE2  9  
ATOM   6617  C CZ   . TYR A 1 38 ? 18.553  17.838 -7.282  1.00 1.00 ? 38 TYR A CZ   9  
ATOM   6618  O OH   . TYR A 1 38 ? 19.174  17.902 -8.493  1.00 1.00 ? 38 TYR A OH   9  
ATOM   6619  H H    . TYR A 1 38 ? 14.635  15.761 -2.105  1.00 1.00 ? 38 TYR A H    9  
ATOM   6620  H HA   . TYR A 1 38 ? 14.624  16.877 -4.864  1.00 1.00 ? 38 TYR A HA   9  
ATOM   6621  H HB2  . TYR A 1 38 ? 15.895  18.209 -3.232  1.00 1.00 ? 38 TYR A HB2  9  
ATOM   6622  H HB3  . TYR A 1 38 ? 16.888  16.802 -2.856  1.00 1.00 ? 38 TYR A HB3  9  
ATOM   6623  H HD1  . TYR A 1 38 ? 15.880  19.125 -5.615  1.00 1.00 ? 38 TYR A HD1  9  
ATOM   6624  H HD2  . TYR A 1 38 ? 18.688  16.113 -4.343  1.00 1.00 ? 38 TYR A HD2  9  
ATOM   6625  H HE1  . TYR A 1 38 ? 17.118  19.383 -7.734  1.00 1.00 ? 38 TYR A HE1  9  
ATOM   6626  H HE2  . TYR A 1 38 ? 19.873  16.317 -6.512  1.00 1.00 ? 38 TYR A HE2  9  
ATOM   6627  H HH   . TYR A 1 38 ? 18.702  18.464 -9.121  1.00 1.00 ? 38 TYR A HH   9  
ATOM   6628  N N    . VAL A 1 39 ? 15.684  14.948 -5.939  1.00 1.00 ? 39 VAL A N    9  
ATOM   6629  C CA   . VAL A 1 39 ? 16.331  13.962 -6.790  1.00 1.00 ? 39 VAL A CA   9  
ATOM   6630  C C    . VAL A 1 39 ? 16.512  14.748 -8.089  1.00 1.00 ? 39 VAL A C    9  
ATOM   6631  O O    . VAL A 1 39 ? 15.747  15.692 -8.308  1.00 1.00 ? 39 VAL A O    9  
ATOM   6632  C CB   . VAL A 1 39 ? 15.455  12.712 -7.018  1.00 1.00 ? 39 VAL A CB   9  
ATOM   6633  C CG1  . VAL A 1 39 ? 16.230  11.624 -7.774  1.00 1.00 ? 39 VAL A CG1  9  
ATOM   6634  C CG2  . VAL A 1 39 ? 14.917  12.107 -5.717  1.00 1.00 ? 39 VAL A CG2  9  
ATOM   6635  H H    . VAL A 1 39 ? 15.326  15.747 -6.449  1.00 1.00 ? 39 VAL A H    9  
ATOM   6636  H HA   . VAL A 1 39 ? 17.299  13.690 -6.365  1.00 1.00 ? 39 VAL A HA   9  
ATOM   6637  H HB   . VAL A 1 39 ? 14.602  12.990 -7.633  1.00 1.00 ? 39 VAL A HB   9  
ATOM   6638  H HG11 . VAL A 1 39 ? 17.144  11.371 -7.234  1.00 1.00 ? 39 VAL A HG11 9  
ATOM   6639  H HG12 . VAL A 1 39 ? 15.616  10.729 -7.867  1.00 1.00 ? 39 VAL A HG12 9  
ATOM   6640  H HG13 . VAL A 1 39 ? 16.483  11.960 -8.778  1.00 1.00 ? 39 VAL A HG13 9  
ATOM   6641  H HG21 . VAL A 1 39 ? 15.743  11.869 -5.045  1.00 1.00 ? 39 VAL A HG21 9  
ATOM   6642  H HG22 . VAL A 1 39 ? 14.236  12.806 -5.233  1.00 1.00 ? 39 VAL A HG22 9  
ATOM   6643  H HG23 . VAL A 1 39 ? 14.363  11.193 -5.933  1.00 1.00 ? 39 VAL A HG23 9  
ATOM   6644  N N    . PHE A 1 40 ? 17.453  14.393 -8.962  1.00 1.00 ? 40 PHE A N    9  
ATOM   6645  C CA   . PHE A 1 40 ? 17.614  15.114 -10.220 1.00 1.00 ? 40 PHE A CA   9  
ATOM   6646  C C    . PHE A 1 40 ? 16.289  15.153 -11.014 1.00 1.00 ? 40 PHE A C    9  
ATOM   6647  O O    . PHE A 1 40 ? 15.412  14.308 -10.809 1.00 1.00 ? 40 PHE A O    9  
ATOM   6648  C CB   . PHE A 1 40 ? 18.760  14.494 -11.040 1.00 1.00 ? 40 PHE A CB   9  
ATOM   6649  C CG   . PHE A 1 40 ? 18.373  13.245 -11.806 1.00 1.00 ? 40 PHE A CG   9  
ATOM   6650  C CD1  . PHE A 1 40 ? 18.392  11.987 -11.175 1.00 1.00 ? 40 PHE A CD1  9  
ATOM   6651  C CD2  . PHE A 1 40 ? 17.914  13.355 -13.134 1.00 1.00 ? 40 PHE A CD2  9  
ATOM   6652  C CE1  . PHE A 1 40 ? 17.927  10.851 -11.859 1.00 1.00 ? 40 PHE A CE1  9  
ATOM   6653  C CE2  . PHE A 1 40 ? 17.450  12.218 -13.816 1.00 1.00 ? 40 PHE A CE2  9  
ATOM   6654  C CZ   . PHE A 1 40 ? 17.449  10.968 -13.176 1.00 1.00 ? 40 PHE A CZ   9  
ATOM   6655  H H    . PHE A 1 40 ? 18.046  13.600 -8.767  1.00 1.00 ? 40 PHE A H    9  
ATOM   6656  H HA   . PHE A 1 40 ? 17.912  16.125 -9.947  1.00 1.00 ? 40 PHE A HA   9  
ATOM   6657  H HB2  . PHE A 1 40 ? 19.115  15.231 -11.760 1.00 1.00 ? 40 PHE A HB2  9  
ATOM   6658  H HB3  . PHE A 1 40 ? 19.603  14.276 -10.383 1.00 1.00 ? 40 PHE A HB3  9  
ATOM   6659  H HD1  . PHE A 1 40 ? 18.768  11.881 -10.169 1.00 1.00 ? 40 PHE A HD1  9  
ATOM   6660  H HD2  . PHE A 1 40 ? 17.910  14.310 -13.639 1.00 1.00 ? 40 PHE A HD2  9  
ATOM   6661  H HE1  . PHE A 1 40 ? 17.940  9.885  -11.374 1.00 1.00 ? 40 PHE A HE1  9  
ATOM   6662  H HE2  . PHE A 1 40 ? 17.096  12.304 -14.833 1.00 1.00 ? 40 PHE A HE2  9  
ATOM   6663  H HZ   . PHE A 1 40 ? 17.092  10.093 -13.701 1.00 1.00 ? 40 PHE A HZ   9  
ATOM   6664  N N    . PRO A 1 41 ? 16.070  16.146 -11.888 1.00 1.00 ? 41 PRO A N    9  
ATOM   6665  C CA   . PRO A 1 41 ? 16.868  17.351 -12.038 1.00 1.00 ? 41 PRO A CA   9  
ATOM   6666  C C    . PRO A 1 41 ? 16.534  18.338 -10.910 1.00 1.00 ? 41 PRO A C    9  
ATOM   6667  O O    . PRO A 1 41 ? 17.441  18.932 -10.331 1.00 1.00 ? 41 PRO A O    9  
ATOM   6668  C CB   . PRO A 1 41 ? 16.494  17.892 -13.419 1.00 1.00 ? 41 PRO A CB   9  
ATOM   6669  C CG   . PRO A 1 41 ? 15.045  17.447 -13.616 1.00 1.00 ? 41 PRO A CG   9  
ATOM   6670  C CD   . PRO A 1 41 ? 14.981  16.120 -12.854 1.00 1.00 ? 41 PRO A CD   9  
ATOM   6671  H HA   . PRO A 1 41 ? 17.937  17.144 -12.030 1.00 1.00 ? 41 PRO A HA   9  
ATOM   6672  H HB2  . PRO A 1 41 ? 16.617  18.975 -13.496 1.00 1.00 ? 41 PRO A HB2  9  
ATOM   6673  H HB3  . PRO A 1 41 ? 17.115  17.392 -14.165 1.00 1.00 ? 41 PRO A HB3  9  
ATOM   6674  H HG2  . PRO A 1 41 ? 14.368  18.176 -13.168 1.00 1.00 ? 41 PRO A HG2  9  
ATOM   6675  H HG3  . PRO A 1 41 ? 14.799  17.322 -14.671 1.00 1.00 ? 41 PRO A HG3  9  
ATOM   6676  H HD2  . PRO A 1 41 ? 14.010  16.000 -12.372 1.00 1.00 ? 41 PRO A HD2  9  
ATOM   6677  H HD3  . PRO A 1 41 ? 15.147  15.293 -13.547 1.00 1.00 ? 41 PRO A HD3  9  
ATOM   6678  N N    . ALA A 1 42 ? 15.242  18.502 -10.600 1.00 1.00 ? 42 ALA A N    9  
ATOM   6679  C CA   . ALA A 1 42 ? 14.722  19.518 -9.693  1.00 1.00 ? 42 ALA A CA   9  
ATOM   6680  C C    . ALA A 1 42 ? 13.900  18.902 -8.553  1.00 1.00 ? 42 ALA A C    9  
ATOM   6681  O O    . ALA A 1 42 ? 13.570  17.711 -8.573  1.00 1.00 ? 42 ALA A O    9  
ATOM   6682  C CB   . ALA A 1 42 ? 13.873  20.501 -10.504 1.00 1.00 ? 42 ALA A CB   9  
ATOM   6683  H H    . ALA A 1 42 ? 14.563  17.934 -11.078 1.00 1.00 ? 42 ALA A H    9  
ATOM   6684  H HA   . ALA A 1 42 ? 15.543  20.085 -9.253  1.00 1.00 ? 42 ALA A HA   9  
ATOM   6685  H HB1  . ALA A 1 42 ? 14.468  20.918 -11.316 1.00 1.00 ? 42 ALA A HB1  9  
ATOM   6686  H HB2  . ALA A 1 42 ? 13.008  19.986 -10.922 1.00 1.00 ? 42 ALA A HB2  9  
ATOM   6687  H HB3  . ALA A 1 42 ? 13.529  21.318 -9.869  1.00 1.00 ? 42 ALA A HB3  9  
ATOM   6688  N N    . HIS A 1 43 ? 13.526  19.752 -7.590  1.00 1.00 ? 43 HIS A N    9  
ATOM   6689  C CA   . HIS A 1 43 ? 12.761  19.393 -6.404  1.00 1.00 ? 43 HIS A CA   9  
ATOM   6690  C C    . HIS A 1 43 ? 11.386  18.896 -6.848  1.00 1.00 ? 43 HIS A C    9  
ATOM   6691  O O    . HIS A 1 43 ? 10.731  19.545 -7.664  1.00 1.00 ? 43 HIS A O    9  
ATOM   6692  C CB   . HIS A 1 43 ? 12.626  20.636 -5.513  1.00 1.00 ? 43 HIS A CB   9  
ATOM   6693  C CG   . HIS A 1 43 ? 13.926  21.097 -4.909  1.00 1.00 ? 43 HIS A CG   9  
ATOM   6694  N ND1  . HIS A 1 43 ? 14.731  22.070 -5.483  1.00 1.00 ? 43 HIS A ND1  9  
ATOM   6695  C CD2  . HIS A 1 43 ? 14.570  20.730 -3.752  1.00 1.00 ? 43 HIS A CD2  9  
ATOM   6696  C CE1  . HIS A 1 43 ? 15.811  22.208 -4.696  1.00 1.00 ? 43 HIS A CE1  9  
ATOM   6697  N NE2  . HIS A 1 43 ? 15.776  21.413 -3.626  1.00 1.00 ? 43 HIS A NE2  9  
ATOM   6698  H H    . HIS A 1 43 ? 13.791  20.718 -7.690  1.00 1.00 ? 43 HIS A H    9  
ATOM   6699  H HA   . HIS A 1 43 ? 13.283  18.608 -5.856  1.00 1.00 ? 43 HIS A HA   9  
ATOM   6700  H HB2  . HIS A 1 43 ? 12.166  21.441 -6.085  1.00 1.00 ? 43 HIS A HB2  9  
ATOM   6701  H HB3  . HIS A 1 43 ? 11.967  20.422 -4.678  1.00 1.00 ? 43 HIS A HB3  9  
ATOM   6702  H HD1  . HIS A 1 43 ? 14.546  22.593 -6.327  1.00 1.00 ? 43 HIS A HD1  9  
ATOM   6703  H HD2  . HIS A 1 43 ? 14.204  19.993 -3.052  1.00 1.00 ? 43 HIS A HD2  9  
ATOM   6704  H HE1  . HIS A 1 43 ? 16.620  22.894 -4.903  1.00 1.00 ? 43 HIS A HE1  9  
ATOM   6705  N N    . LYS A 1 44 ? 10.966  17.733 -6.341  1.00 1.00 ? 44 LYS A N    9  
ATOM   6706  C CA   . LYS A 1 44 ? 9.800   17.012 -6.833  1.00 1.00 ? 44 LYS A CA   9  
ATOM   6707  C C    . LYS A 1 44 ? 8.886   16.569 -5.689  1.00 1.00 ? 44 LYS A C    9  
ATOM   6708  O O    . LYS A 1 44 ? 9.348   16.104 -4.646  1.00 1.00 ? 44 LYS A O    9  
ATOM   6709  C CB   . LYS A 1 44 ? 10.259  15.838 -7.705  1.00 1.00 ? 44 LYS A CB   9  
ATOM   6710  C CG   . LYS A 1 44 ? 11.320  14.967 -7.014  1.00 1.00 ? 44 LYS A CG   9  
ATOM   6711  C CD   . LYS A 1 44 ? 11.684  13.745 -7.865  1.00 1.00 ? 44 LYS A CD   9  
ATOM   6712  C CE   . LYS A 1 44 ? 12.254  14.077 -9.255  1.00 1.00 ? 44 LYS A CE   9  
ATOM   6713  N NZ   . LYS A 1 44 ? 13.329  15.092 -9.237  1.00 1.00 ? 44 LYS A NZ   9  
ATOM   6714  H H    . LYS A 1 44 ? 11.489  17.311 -5.579  1.00 1.00 ? 44 LYS A H    9  
ATOM   6715  H HA   . LYS A 1 44 ? 9.212   17.662 -7.483  1.00 1.00 ? 44 LYS A HA   9  
ATOM   6716  H HB2  . LYS A 1 44 ? 9.393   15.228 -7.962  1.00 1.00 ? 44 LYS A HB2  9  
ATOM   6717  H HB3  . LYS A 1 44 ? 10.676  16.252 -8.623  1.00 1.00 ? 44 LYS A HB3  9  
ATOM   6718  H HG2  . LYS A 1 44 ? 12.216  15.548 -6.797  1.00 1.00 ? 44 LYS A HG2  9  
ATOM   6719  H HG3  . LYS A 1 44 ? 10.920  14.609 -6.063  1.00 1.00 ? 44 LYS A HG3  9  
ATOM   6720  H HD2  . LYS A 1 44 ? 12.398  13.144 -7.302  1.00 1.00 ? 44 LYS A HD2  9  
ATOM   6721  H HD3  . LYS A 1 44 ? 10.788  13.133 -7.998  1.00 1.00 ? 44 LYS A HD3  9  
ATOM   6722  H HE2  . LYS A 1 44 ? 12.657  13.156 -9.681  1.00 1.00 ? 44 LYS A HE2  9  
ATOM   6723  H HE3  . LYS A 1 44 ? 11.452  14.424 -9.910  1.00 1.00 ? 44 LYS A HE3  9  
ATOM   6724  H HZ1  . LYS A 1 44 ? 14.031  14.921 -8.528  1.00 1.00 ? 44 LYS A HZ1  9  
ATOM   6725  H HZ2  . LYS A 1 44 ? 13.845  15.055 -10.109 1.00 1.00 ? 44 LYS A HZ2  9  
ATOM   6726  H HZ3  . LYS A 1 44 ? 12.999  16.041 -9.079  1.00 1.00 ? 44 LYS A HZ3  9  
ATOM   6727  N N    . CYS A 1 45 ? 7.579   16.751 -5.897  1.00 1.00 ? 45 CYS A N    9  
ATOM   6728  C CA   . CYS A 1 45 ? 6.549   16.468 -4.913  1.00 1.00 ? 45 CYS A CA   9  
ATOM   6729  C C    . CYS A 1 45 ? 6.320   14.963 -4.832  1.00 1.00 ? 45 CYS A C    9  
ATOM   6730  O O    . CYS A 1 45 ? 6.137   14.336 -5.871  1.00 1.00 ? 45 CYS A O    9  
ATOM   6731  C CB   . CYS A 1 45 ? 5.258   17.194 -5.301  1.00 1.00 ? 45 CYS A CB   9  
ATOM   6732  S SG   . CYS A 1 45 ? 3.893   16.968 -4.135  1.00 1.00 ? 45 CYS A SG   9  
ATOM   6733  H H    . CYS A 1 45 ? 7.272   17.083 -6.800  1.00 1.00 ? 45 CYS A H    9  
ATOM   6734  H HA   . CYS A 1 45 ? 6.875   16.851 -3.953  1.00 1.00 ? 45 CYS A HA   9  
ATOM   6735  H HB2  . CYS A 1 45 ? 5.453   18.263 -5.373  1.00 1.00 ? 45 CYS A HB2  9  
ATOM   6736  H HB3  . CYS A 1 45 ? 4.923   16.836 -6.275  1.00 1.00 ? 45 CYS A HB3  9  
ATOM   6737  N N    . ILE A 1 46 ? 6.361   14.384 -3.629  1.00 1.00 ? 46 ILE A N    9  
ATOM   6738  C CA   . ILE A 1 46 ? 6.014   12.992 -3.373  1.00 1.00 ? 46 ILE A CA   9  
ATOM   6739  C C    . ILE A 1 46 ? 4.772   13.001 -2.487  1.00 1.00 ? 46 ILE A C    9  
ATOM   6740  O O    . ILE A 1 46 ? 4.702   13.790 -1.542  1.00 1.00 ? 46 ILE A O    9  
ATOM   6741  C CB   . ILE A 1 46 ? 7.179   12.265 -2.671  1.00 1.00 ? 46 ILE A CB   9  
ATOM   6742  C CG1  . ILE A 1 46 ? 8.512   12.372 -3.436  1.00 1.00 ? 46 ILE A CG1  9  
ATOM   6743  C CG2  . ILE A 1 46 ? 6.817   10.795 -2.404  1.00 1.00 ? 46 ILE A CG2  9  
ATOM   6744  C CD1  . ILE A 1 46 ? 8.486   11.749 -4.836  1.00 1.00 ? 46 ILE A CD1  9  
ATOM   6745  H H    . ILE A 1 46 ? 6.539   14.943 -2.800  1.00 1.00 ? 46 ILE A H    9  
ATOM   6746  H HA   . ILE A 1 46 ? 5.776   12.472 -4.299  1.00 1.00 ? 46 ILE A HA   9  
ATOM   6747  H HB   . ILE A 1 46 ? 7.340   12.728 -1.698  1.00 1.00 ? 46 ILE A HB   9  
ATOM   6748  H HG12 . ILE A 1 46 ? 8.796   13.421 -3.526  1.00 1.00 ? 46 ILE A HG12 9  
ATOM   6749  H HG13 . ILE A 1 46 ? 9.286   11.870 -2.854  1.00 1.00 ? 46 ILE A HG13 9  
ATOM   6750  H HG21 . ILE A 1 46 ? 6.507   10.311 -3.328  1.00 1.00 ? 46 ILE A HG21 9  
ATOM   6751  H HG22 . ILE A 1 46 ? 7.676   10.271 -1.985  1.00 1.00 ? 46 ILE A HG22 9  
ATOM   6752  H HG23 . ILE A 1 46 ? 5.998   10.730 -1.688  1.00 1.00 ? 46 ILE A HG23 9  
ATOM   6753  H HD11 . ILE A 1 46 ? 8.253   10.686 -4.780  1.00 1.00 ? 46 ILE A HD11 9  
ATOM   6754  H HD12 . ILE A 1 46 ? 7.751   12.251 -5.463  1.00 1.00 ? 46 ILE A HD12 9  
ATOM   6755  H HD13 . ILE A 1 46 ? 9.468   11.866 -5.293  1.00 1.00 ? 46 ILE A HD13 9  
ATOM   6756  N N    . CYS A 1 47 ? 3.795   12.136 -2.774  1.00 1.00 ? 47 CYS A N    9  
ATOM   6757  C CA   . CYS A 1 47 ? 2.602   12.021 -1.953  1.00 1.00 ? 47 CYS A CA   9  
ATOM   6758  C C    . CYS A 1 47 ? 2.279   10.563 -1.639  1.00 1.00 ? 47 CYS A C    9  
ATOM   6759  O O    . CYS A 1 47 ? 2.501   9.690  -2.475  1.00 1.00 ? 47 CYS A O    9  
ATOM   6760  C CB   . CYS A 1 47 ? 1.447   12.756 -2.611  1.00 1.00 ? 47 CYS A CB   9  
ATOM   6761  S SG   . CYS A 1 47 ? 0.170   13.069 -1.390  1.00 1.00 ? 47 CYS A SG   9  
ATOM   6762  H H    . CYS A 1 47 ? 3.840   11.549 -3.603  1.00 1.00 ? 47 CYS A H    9  
ATOM   6763  H HA   . CYS A 1 47 ? 2.775   12.507 -1.001  1.00 1.00 ? 47 CYS A HA   9  
ATOM   6764  H HB2  . CYS A 1 47 ? 1.783   13.720 -2.989  1.00 1.00 ? 47 CYS A HB2  9  
ATOM   6765  H HB3  . CYS A 1 47 ? 1.056   12.175 -3.448  1.00 1.00 ? 47 CYS A HB3  9  
ATOM   6766  N N    . TYR A 1 48 ? 1.808   10.299 -0.415  1.00 1.00 ? 48 TYR A N    9  
ATOM   6767  C CA   . TYR A 1 48 ? 1.660   8.960  0.137   1.00 1.00 ? 48 TYR A CA   9  
ATOM   6768  C C    . TYR A 1 48 ? 0.177   8.629  0.323   1.00 1.00 ? 48 TYR A C    9  
ATOM   6769  O O    . TYR A 1 48 ? -0.514  9.245  1.143   1.00 1.00 ? 48 TYR A O    9  
ATOM   6770  C CB   . TYR A 1 48 ? 2.401   8.885  1.478   1.00 1.00 ? 48 TYR A CB   9  
ATOM   6771  C CG   . TYR A 1 48 ? 3.909   9.064  1.394   1.00 1.00 ? 48 TYR A CG   9  
ATOM   6772  C CD1  . TYR A 1 48 ? 4.464   10.339 1.170   1.00 1.00 ? 48 TYR A CD1  9  
ATOM   6773  C CD2  . TYR A 1 48 ? 4.762   7.981  1.675   1.00 1.00 ? 48 TYR A CD2  9  
ATOM   6774  C CE1  . TYR A 1 48 ? 5.859   10.510 1.132   1.00 1.00 ? 48 TYR A CE1  9  
ATOM   6775  C CE2  . TYR A 1 48 ? 6.154   8.167  1.705   1.00 1.00 ? 48 TYR A CE2  9  
ATOM   6776  C CZ   . TYR A 1 48 ? 6.704   9.416  1.382   1.00 1.00 ? 48 TYR A CZ   9  
ATOM   6777  O OH   . TYR A 1 48 ? 8.058   9.554  1.306   1.00 1.00 ? 48 TYR A OH   9  
ATOM   6778  H H    . TYR A 1 48 ? 1.603   11.065 0.220   1.00 1.00 ? 48 TYR A H    9  
ATOM   6779  H HA   . TYR A 1 48 ? 2.120   8.224  -0.526  1.00 1.00 ? 48 TYR A HA   9  
ATOM   6780  H HB2  . TYR A 1 48 ? 1.998   9.639  2.152   1.00 1.00 ? 48 TYR A HB2  9  
ATOM   6781  H HB3  . TYR A 1 48 ? 2.192   7.912  1.923   1.00 1.00 ? 48 TYR A HB3  9  
ATOM   6782  H HD1  . TYR A 1 48 ? 3.824   11.193 1.033   1.00 1.00 ? 48 TYR A HD1  9  
ATOM   6783  H HD2  . TYR A 1 48 ? 4.357   7.002  1.881   1.00 1.00 ? 48 TYR A HD2  9  
ATOM   6784  H HE1  . TYR A 1 48 ? 6.270   11.485 0.913   1.00 1.00 ? 48 TYR A HE1  9  
ATOM   6785  H HE2  . TYR A 1 48 ? 6.801   7.340  1.958   1.00 1.00 ? 48 TYR A HE2  9  
ATOM   6786  H HH   . TYR A 1 48 ? 8.334   10.423 1.010   1.00 1.00 ? 48 TYR A HH   9  
ATOM   6787  N N    . PHE A 1 49 ? -0.312  7.645  -0.438  1.00 1.00 ? 49 PHE A N    9  
ATOM   6788  C CA   . PHE A 1 49 ? -1.662  7.113  -0.326  1.00 1.00 ? 49 PHE A CA   9  
ATOM   6789  C C    . PHE A 1 49 ? -1.619  5.592  -0.460  1.00 1.00 ? 49 PHE A C    9  
ATOM   6790  O O    . PHE A 1 49 ? -0.694  5.068  -1.084  1.00 1.00 ? 49 PHE A O    9  
ATOM   6791  C CB   . PHE A 1 49 ? -2.604  7.741  -1.368  1.00 1.00 ? 49 PHE A CB   9  
ATOM   6792  C CG   . PHE A 1 49 ? -1.997  8.301  -2.642  1.00 1.00 ? 49 PHE A CG   9  
ATOM   6793  C CD1  . PHE A 1 49 ? -1.400  9.574  -2.597  1.00 1.00 ? 49 PHE A CD1  9  
ATOM   6794  C CD2  . PHE A 1 49 ? -2.360  7.757  -3.891  1.00 1.00 ? 49 PHE A CD2  9  
ATOM   6795  C CE1  . PHE A 1 49 ? -1.307  10.357 -3.754  1.00 1.00 ? 49 PHE A CE1  9  
ATOM   6796  C CE2  . PHE A 1 49 ? -2.190  8.513  -5.066  1.00 1.00 ? 49 PHE A CE2  9  
ATOM   6797  C CZ   . PHE A 1 49 ? -1.703  9.829  -4.988  1.00 1.00 ? 49 PHE A CZ   9  
ATOM   6798  H H    . PHE A 1 49 ? 0.292   7.197  -1.120  1.00 1.00 ? 49 PHE A H    9  
ATOM   6799  H HA   . PHE A 1 49 ? -2.043  7.353  0.666   1.00 1.00 ? 49 PHE A HA   9  
ATOM   6800  H HB2  . PHE A 1 49 ? -3.394  7.035  -1.623  1.00 1.00 ? 49 PHE A HB2  9  
ATOM   6801  H HB3  . PHE A 1 49 ? -3.086  8.581  -0.880  1.00 1.00 ? 49 PHE A HB3  9  
ATOM   6802  H HD1  . PHE A 1 49 ? -1.074  9.994  -1.660  1.00 1.00 ? 49 PHE A HD1  9  
ATOM   6803  H HD2  . PHE A 1 49 ? -2.822  6.783  -3.950  1.00 1.00 ? 49 PHE A HD2  9  
ATOM   6804  H HE1  . PHE A 1 49 ? -0.975  11.380 -3.695  1.00 1.00 ? 49 PHE A HE1  9  
ATOM   6805  H HE2  . PHE A 1 49 ? -2.484  8.100  -6.020  1.00 1.00 ? 49 PHE A HE2  9  
ATOM   6806  H HZ   . PHE A 1 49 ? -1.624  10.456 -5.860  1.00 1.00 ? 49 PHE A HZ   9  
ATOM   6807  N N    . PRO A 1 50 ? -2.597  4.863  0.106   1.00 1.00 ? 50 PRO A N    9  
ATOM   6808  C CA   . PRO A 1 50 ? -2.615  3.406  0.106   1.00 1.00 ? 50 PRO A CA   9  
ATOM   6809  C C    . PRO A 1 50 ? -3.127  2.840  -1.222  1.00 1.00 ? 50 PRO A C    9  
ATOM   6810  O O    . PRO A 1 50 ? -4.007  1.981  -1.264  1.00 1.00 ? 50 PRO A O    9  
ATOM   6811  C CB   . PRO A 1 50 ? -3.486  3.031  1.296   1.00 1.00 ? 50 PRO A CB   9  
ATOM   6812  C CG   . PRO A 1 50 ? -4.507  4.167  1.347   1.00 1.00 ? 50 PRO A CG   9  
ATOM   6813  C CD   . PRO A 1 50 ? -3.684  5.385  0.924   1.00 1.00 ? 50 PRO A CD   9  
ATOM   6814  H HA   . PRO A 1 50 ? -1.618  3.024  0.276   1.00 1.00 ? 50 PRO A HA   9  
ATOM   6815  H HB2  . PRO A 1 50 ? -3.941  2.048  1.189   1.00 1.00 ? 50 PRO A HB2  9  
ATOM   6816  H HB3  . PRO A 1 50 ? -2.857  3.068  2.183   1.00 1.00 ? 50 PRO A HB3  9  
ATOM   6817  H HG2  . PRO A 1 50 ? -5.292  3.978  0.613   1.00 1.00 ? 50 PRO A HG2  9  
ATOM   6818  H HG3  . PRO A 1 50 ? -4.943  4.283  2.341   1.00 1.00 ? 50 PRO A HG3  9  
ATOM   6819  H HD2  . PRO A 1 50 ? -4.312  6.085  0.373   1.00 1.00 ? 50 PRO A HD2  9  
ATOM   6820  H HD3  . PRO A 1 50 ? -3.276  5.874  1.811   1.00 1.00 ? 50 PRO A HD3  9  
ATOM   6821  N N    . CYS A 1 51 ? -2.516  3.304  -2.306  1.00 1.00 ? 51 CYS A N    9  
ATOM   6822  C CA   . CYS A 1 51 ? -2.935  3.111  -3.693  1.00 1.00 ? 51 CYS A CA   9  
ATOM   6823  C C    . CYS A 1 51 ? -3.156  1.644  -4.078  1.00 1.00 ? 51 CYS A C    9  
ATOM   6824  O O    . CYS A 1 51 ? -2.641  0.740  -3.421  1.00 1.00 ? 51 CYS A O    9  
ATOM   6825  C CB   . CYS A 1 51 ? -1.921  3.778  -4.631  1.00 1.00 ? 51 CYS A CB   9  
ATOM   6826  S SG   . CYS A 1 51 ? -0.755  2.658  -5.446  1.00 1.00 ? 51 CYS A SG   9  
ATOM   6827  O OXT  . CYS A 1 51 ? -3.942  1.434  -5.169  1.00 0.00 ? 51 CYS A OXT  9  
ATOM   6828  H H    . CYS A 1 51 ? -1.707  3.879  -2.107  1.00 1.00 ? 51 CYS A H    9  
ATOM   6829  H HA   . CYS A 1 51 ? -3.886  3.632  -3.807  1.00 1.00 ? 51 CYS A HA   9  
ATOM   6830  H HB2  . CYS A 1 51 ? -2.415  4.298  -5.436  1.00 1.00 ? 51 CYS A HB2  9  
ATOM   6831  H HB3  . CYS A 1 51 ? -1.396  4.555  -4.088  1.00 1.00 ? 51 CYS A HB3  9  
HETATM 6832  N N    . PCA A 1 1  ? -1.394  -1.228 4.327   1.00 1.00 ? 1  PCA A N    10 
HETATM 6833  C CA   . PCA A 1 1  ? -0.766  -0.655 5.501   1.00 1.00 ? 1  PCA A CA   10 
HETATM 6834  C CB   . PCA A 1 1  ? -0.118  -1.848 6.229   1.00 1.00 ? 1  PCA A CB   10 
HETATM 6835  C CG   . PCA A 1 1  ? -0.044  -2.944 5.155   1.00 1.00 ? 1  PCA A CG   10 
HETATM 6836  C CD   . PCA A 1 1  ? -0.869  -2.399 4.006   1.00 1.00 ? 1  PCA A CD   10 
HETATM 6837  O OE   . PCA A 1 1  ? -0.907  -2.899 2.884   1.00 1.00 ? 1  PCA A OE   10 
HETATM 6838  C C    . PCA A 1 1  ? 0.247   0.361  4.972   1.00 1.00 ? 1  PCA A C    10 
HETATM 6839  O O    . PCA A 1 1  ? 0.041   1.568  5.067   1.00 1.00 ? 1  PCA A O    10 
HETATM 6840  H H    . PCA A 1 1  ? -1.928  -0.663 3.683   1.00 0.00 ? 1  PCA A H    10 
HETATM 6841  H HA   . PCA A 1 1  ? -1.500  -0.167 6.141   1.00 1.00 ? 1  PCA A HA   10 
HETATM 6842  H HB2  . PCA A 1 1  ? 0.859   -1.606 6.653   1.00 1.00 ? 1  PCA A HB2  10 
HETATM 6843  H HB3  . PCA A 1 1  ? -0.786  -2.178 7.026   1.00 1.00 ? 1  PCA A HB3  10 
HETATM 6844  H HG2  . PCA A 1 1  ? 0.983   -3.117 4.836   1.00 1.00 ? 1  PCA A HG2  10 
HETATM 6845  H HG3  . PCA A 1 1  ? -0.484  -3.870 5.526   1.00 1.00 ? 1  PCA A HG3  10 
ATOM   6846  N N    . LYS A 1 2  ? 1.310   -0.152 4.344   1.00 1.00 ? 2  LYS A N    10 
ATOM   6847  C CA   . LYS A 1 2  ? 2.250   0.641  3.573   1.00 1.00 ? 2  LYS A CA   10 
ATOM   6848  C C    . LYS A 1 2  ? 1.488   1.446  2.518   1.00 1.00 ? 2  LYS A C    10 
ATOM   6849  O O    . LYS A 1 2  ? 0.518   0.952  1.932   1.00 1.00 ? 2  LYS A O    10 
ATOM   6850  C CB   . LYS A 1 2  ? 3.322   -0.270 2.942   1.00 1.00 ? 2  LYS A CB   10 
ATOM   6851  C CG   . LYS A 1 2  ? 2.775   -1.406 2.056   1.00 1.00 ? 2  LYS A CG   10 
ATOM   6852  C CD   . LYS A 1 2  ? 2.528   -1.003 0.592   1.00 1.00 ? 2  LYS A CD   10 
ATOM   6853  C CE   . LYS A 1 2  ? 1.329   -1.735 -0.036  1.00 1.00 ? 2  LYS A CE   10 
ATOM   6854  N NZ   . LYS A 1 2  ? 0.069   -1.496 0.701   1.00 1.00 ? 2  LYS A NZ   10 
ATOM   6855  H H    . LYS A 1 2  ? 1.447   -1.147 4.384   1.00 1.00 ? 2  LYS A H    10 
ATOM   6856  H HA   . LYS A 1 2  ? 2.747   1.332  4.257   1.00 1.00 ? 2  LYS A HA   10 
ATOM   6857  H HB2  . LYS A 1 2  ? 4.025   0.334  2.367   1.00 1.00 ? 2  LYS A HB2  10 
ATOM   6858  H HB3  . LYS A 1 2  ? 3.874   -0.728 3.764   1.00 1.00 ? 2  LYS A HB3  10 
ATOM   6859  H HG2  . LYS A 1 2  ? 3.522   -2.201 2.044   1.00 1.00 ? 2  LYS A HG2  10 
ATOM   6860  H HG3  . LYS A 1 2  ? 1.877   -1.819 2.509   1.00 1.00 ? 2  LYS A HG3  10 
ATOM   6861  H HD2  . LYS A 1 2  ? 2.377   0.070  0.492   1.00 1.00 ? 2  LYS A HD2  10 
ATOM   6862  H HD3  . LYS A 1 2  ? 3.425   -1.236 0.012   1.00 1.00 ? 2  LYS A HD3  10 
ATOM   6863  H HE2  . LYS A 1 2  ? 1.207   -1.358 -1.054  1.00 1.00 ? 2  LYS A HE2  10 
ATOM   6864  H HE3  . LYS A 1 2  ? 1.523   -2.808 -0.089  1.00 1.00 ? 2  LYS A HE3  10 
ATOM   6865  H HZ1  . LYS A 1 2  ? 0.048   -0.548 1.062   1.00 1.00 ? 2  LYS A HZ1  10 
ATOM   6866  H HZ2  . LYS A 1 2  ? -0.734  -1.590 0.087   1.00 1.00 ? 2  LYS A HZ2  10 
ATOM   6867  H HZ3  . LYS A 1 2  ? -0.060  -2.141 1.471   1.00 1.00 ? 2  LYS A HZ3  10 
ATOM   6868  N N    . LEU A 1 3  ? 1.946   2.670  2.267   1.00 1.00 ? 3  LEU A N    10 
ATOM   6869  C CA   . LEU A 1 3  ? 1.374   3.557  1.271   1.00 1.00 ? 3  LEU A CA   10 
ATOM   6870  C C    . LEU A 1 3  ? 2.020   3.274  -0.088  1.00 1.00 ? 3  LEU A C    10 
ATOM   6871  O O    . LEU A 1 3  ? 2.988   2.518  -0.167  1.00 1.00 ? 3  LEU A O    10 
ATOM   6872  C CB   . LEU A 1 3  ? 1.597   5.017  1.688   1.00 1.00 ? 3  LEU A CB   10 
ATOM   6873  C CG   . LEU A 1 3  ? 1.017   5.339  3.078   1.00 1.00 ? 3  LEU A CG   10 
ATOM   6874  C CD1  . LEU A 1 3  ? 2.103   5.244  4.160   1.00 1.00 ? 3  LEU A CD1  10 
ATOM   6875  C CD2  . LEU A 1 3  ? 0.431   6.753  3.120   1.00 1.00 ? 3  LEU A CD2  10 
ATOM   6876  H H    . LEU A 1 3  ? 2.789   2.973  2.728   1.00 1.00 ? 3  LEU A H    10 
ATOM   6877  H HA   . LEU A 1 3  ? 0.303   3.379  1.215   1.00 1.00 ? 3  LEU A HA   10 
ATOM   6878  H HB2  . LEU A 1 3  ? 2.664   5.216  1.675   1.00 1.00 ? 3  LEU A HB2  10 
ATOM   6879  H HB3  . LEU A 1 3  ? 1.134   5.664  0.946   1.00 1.00 ? 3  LEU A HB3  10 
ATOM   6880  H HG   . LEU A 1 3  ? 0.204   4.647  3.304   1.00 1.00 ? 3  LEU A HG   10 
ATOM   6881  H HD11 . LEU A 1 3  ? 2.934   5.905  3.910   1.00 1.00 ? 3  LEU A HD11 10 
ATOM   6882  H HD12 . LEU A 1 3  ? 1.688   5.542  5.121   1.00 1.00 ? 3  LEU A HD12 10 
ATOM   6883  H HD13 . LEU A 1 3  ? 2.481   4.230  4.255   1.00 1.00 ? 3  LEU A HD13 10 
ATOM   6884  H HD21 . LEU A 1 3  ? -0.297  6.890  2.319   1.00 1.00 ? 3  LEU A HD21 10 
ATOM   6885  H HD22 . LEU A 1 3  ? -0.058  6.906  4.080   1.00 1.00 ? 3  LEU A HD22 10 
ATOM   6886  H HD23 . LEU A 1 3  ? 1.220   7.493  3.022   1.00 1.00 ? 3  LEU A HD23 10 
ATOM   6887  N N    . CYS A 1 4  ? 1.501   3.894  -1.151  1.00 1.00 ? 4  CYS A N    10 
ATOM   6888  C CA   . CYS A 1 4  ? 2.133   3.901  -2.469  1.00 1.00 ? 4  CYS A CA   10 
ATOM   6889  C C    . CYS A 1 4  ? 2.266   5.359  -2.890  1.00 1.00 ? 4  CYS A C    10 
ATOM   6890  O O    . CYS A 1 4  ? 1.419   6.179  -2.532  1.00 1.00 ? 4  CYS A O    10 
ATOM   6891  C CB   . CYS A 1 4  ? 1.344   3.093  -3.509  1.00 1.00 ? 4  CYS A CB   10 
ATOM   6892  S SG   . CYS A 1 4  ? 1.411   1.293  -3.293  1.00 1.00 ? 4  CYS A SG   10 
ATOM   6893  H H    . CYS A 1 4  ? 0.701   4.506  -1.012  1.00 1.00 ? 4  CYS A H    10 
ATOM   6894  H HA   . CYS A 1 4  ? 3.136   3.475  -2.410  1.00 1.00 ? 4  CYS A HA   10 
ATOM   6895  H HB2  . CYS A 1 4  ? 0.307   3.426  -3.522  1.00 1.00 ? 4  CYS A HB2  10 
ATOM   6896  H HB3  . CYS A 1 4  ? 1.768   3.296  -4.493  1.00 1.00 ? 4  CYS A HB3  10 
ATOM   6897  N N    . GLU A 1 5  ? 3.349   5.679  -3.600  1.00 1.00 ? 5  GLU A N    10 
ATOM   6898  C CA   . GLU A 1 5  ? 3.726   7.045  -3.927  1.00 1.00 ? 5  GLU A CA   10 
ATOM   6899  C C    . GLU A 1 5  ? 3.188   7.462  -5.297  1.00 1.00 ? 5  GLU A C    10 
ATOM   6900  O O    . GLU A 1 5  ? 3.033   6.633  -6.199  1.00 1.00 ? 5  GLU A O    10 
ATOM   6901  C CB   . GLU A 1 5  ? 5.259   7.162  -3.935  1.00 1.00 ? 5  GLU A CB   10 
ATOM   6902  C CG   . GLU A 1 5  ? 5.863   6.938  -2.542  1.00 1.00 ? 5  GLU A CG   10 
ATOM   6903  C CD   . GLU A 1 5  ? 7.384   7.081  -2.542  1.00 1.00 ? 5  GLU A CD   10 
ATOM   6904  O OE1  . GLU A 1 5  ? 7.933   7.810  -1.719  1.00 1.00 ? 5  GLU A OE1  10 
ATOM   6905  O OE2  . GLU A 1 5  ? 8.053   6.365  -3.484  1.00 1.00 ? 5  GLU A OE2  10 
ATOM   6906  H H    . GLU A 1 5  ? 3.986   4.947  -3.870  1.00 1.00 ? 5  GLU A H    10 
ATOM   6907  H HA   . GLU A 1 5  ? 3.337   7.716  -3.163  1.00 1.00 ? 5  GLU A HA   10 
ATOM   6908  H HB2  . GLU A 1 5  ? 5.673   6.443  -4.642  1.00 1.00 ? 5  GLU A HB2  10 
ATOM   6909  H HB3  . GLU A 1 5  ? 5.532   8.165  -4.267  1.00 1.00 ? 5  GLU A HB3  10 
ATOM   6910  H HG2  . GLU A 1 5  ? 5.439   7.678  -1.868  1.00 1.00 ? 5  GLU A HG2  10 
ATOM   6911  H HG3  . GLU A 1 5  ? 5.615   5.942  -2.177  1.00 1.00 ? 5  GLU A HG3  10 
ATOM   6912  H HE2  . GLU A 1 5  ? 8.999   6.503  -3.402  1.00 1.00 ? 5  GLU A HE2  10 
ATOM   6913  N N    . ARG A 1 6  ? 2.922   8.758  -5.461  1.00 1.00 ? 6  ARG A N    10 
ATOM   6914  C CA   . ARG A 1 6  ? 2.647   9.387  -6.743  1.00 1.00 ? 6  ARG A CA   10 
ATOM   6915  C C    . ARG A 1 6  ? 3.457   10.687 -6.765  1.00 1.00 ? 6  ARG A C    10 
ATOM   6916  O O    . ARG A 1 6  ? 3.231   11.531 -5.898  1.00 1.00 ? 6  ARG A O    10 
ATOM   6917  C CB   . ARG A 1 6  ? 1.139   9.634  -6.946  1.00 1.00 ? 6  ARG A CB   10 
ATOM   6918  C CG   . ARG A 1 6  ? 0.745   9.516  -8.426  1.00 1.00 ? 6  ARG A CG   10 
ATOM   6919  C CD   . ARG A 1 6  ? 0.295   8.099  -8.820  1.00 1.00 ? 6  ARG A CD   10 
ATOM   6920  N NE   . ARG A 1 6  ? 1.203   7.050  -8.320  1.00 1.00 ? 6  ARG A NE   10 
ATOM   6921  C CZ   . ARG A 1 6  ? 1.309   5.795  -8.783  1.00 1.00 ? 6  ARG A CZ   10 
ATOM   6922  N NH1  . ARG A 1 6  ? 0.557   5.382  -9.808  1.00 1.00 ? 6  ARG A NH1  10 
ATOM   6923  N NH2  . ARG A 1 6  ? 2.174   4.964  -8.195  1.00 1.00 ? 6  ARG A NH2  10 
ATOM   6924  H H    . ARG A 1 6  ? 2.978   9.369  -4.649  1.00 1.00 ? 6  ARG A H    10 
ATOM   6925  H HA   . ARG A 1 6  ? 2.998   8.735  -7.536  1.00 1.00 ? 6  ARG A HA   10 
ATOM   6926  H HB2  . ARG A 1 6  ? 0.545   8.922  -6.373  1.00 1.00 ? 6  ARG A HB2  10 
ATOM   6927  H HB3  . ARG A 1 6  ? 0.887   10.641 -6.604  1.00 1.00 ? 6  ARG A HB3  10 
ATOM   6928  H HG2  . ARG A 1 6  ? -0.098  10.186 -8.611  1.00 1.00 ? 6  ARG A HG2  10 
ATOM   6929  H HG3  . ARG A 1 6  ? 1.570   9.843  -9.061  1.00 1.00 ? 6  ARG A HG3  10 
ATOM   6930  H HD2  . ARG A 1 6  ? -0.698  7.923  -8.398  1.00 1.00 ? 6  ARG A HD2  10 
ATOM   6931  H HD3  . ARG A 1 6  ? 0.224   8.075  -9.909  1.00 1.00 ? 6  ARG A HD3  10 
ATOM   6932  H HE   . ARG A 1 6  ? 1.738   7.258  -7.483  1.00 1.00 ? 6  ARG A HE   10 
ATOM   6933  H HH11 . ARG A 1 6  ? -0.115  6.014  -10.216 1.00 1.00 ? 6  ARG A HH11 10 
ATOM   6934  H HH12 . ARG A 1 6  ? 0.627   4.444  -10.174 1.00 1.00 ? 6  ARG A HH12 10 
ATOM   6935  H HH21 . ARG A 1 6  ? 2.712   5.316  -7.404  1.00 1.00 ? 6  ARG A HH21 10 
ATOM   6936  H HH22 . ARG A 1 6  ? 2.306   4.011  -8.497  1.00 1.00 ? 6  ARG A HH22 10 
ATOM   6937  N N    . PRO A 1 7  ? 4.420   10.847 -7.690  1.00 1.00 ? 7  PRO A N    10 
ATOM   6938  C CA   . PRO A 1 7  ? 5.129   12.103 -7.866  1.00 1.00 ? 7  PRO A CA   10 
ATOM   6939  C C    . PRO A 1 7  ? 4.164   13.249 -8.143  1.00 1.00 ? 7  PRO A C    10 
ATOM   6940  O O    . PRO A 1 7  ? 4.211   14.289 -7.495  1.00 1.00 ? 7  PRO A O    10 
ATOM   6941  C CB   . PRO A 1 7  ? 6.110   11.880 -9.023  1.00 1.00 ? 7  PRO A CB   10 
ATOM   6942  C CG   . PRO A 1 7  ? 6.347   10.372 -8.989  1.00 1.00 ? 7  PRO A CG   10 
ATOM   6943  C CD   . PRO A 1 7  ? 4.989   9.824  -8.553  1.00 1.00 ? 7  PRO A CD   10 
ATOM   6944  H HA   . PRO A 1 7  ? 5.681   12.313 -6.958  1.00 1.00 ? 7  PRO A HA   10 
ATOM   6945  H HB2  . PRO A 1 7  ? 5.650   12.144 -9.976  1.00 1.00 ? 7  PRO A HB2  10 
ATOM   6946  H HB3  . PRO A 1 7  ? 7.031   12.449 -8.886  1.00 1.00 ? 7  PRO A HB3  10 
ATOM   6947  H HG2  . PRO A 1 7  ? 6.667   9.978  -9.955  1.00 1.00 ? 7  PRO A HG2  10 
ATOM   6948  H HG3  . PRO A 1 7  ? 7.093   10.145 -8.224  1.00 1.00 ? 7  PRO A HG3  10 
ATOM   6949  H HD2  . PRO A 1 7  ? 4.347   9.681  -9.425  1.00 1.00 ? 7  PRO A HD2  10 
ATOM   6950  H HD3  . PRO A 1 7  ? 5.141   8.877  -8.031  1.00 1.00 ? 7  PRO A HD3  10 
ATOM   6951  N N    . SER A 1 8  ? 3.275   13.046 -9.117  1.00 1.00 ? 8  SER A N    10 
ATOM   6952  C CA   . SER A 1 8  ? 2.278   14.025 -9.479  1.00 1.00 ? 8  SER A CA   10 
ATOM   6953  C C    . SER A 1 8  ? 1.236   14.123 -8.370  1.00 1.00 ? 8  SER A C    10 
ATOM   6954  O O    . SER A 1 8  ? 1.256   15.042 -7.553  1.00 1.00 ? 8  SER A O    10 
ATOM   6955  C CB   . SER A 1 8  ? 1.655   13.591 -10.811 1.00 1.00 ? 8  SER A CB   10 
ATOM   6956  O OG   . SER A 1 8  ? 1.370   12.199 -10.771 1.00 1.00 ? 8  SER A OG   10 
ATOM   6957  H H    . SER A 1 8  ? 3.231   12.166 -9.608  1.00 1.00 ? 8  SER A H    10 
ATOM   6958  H HA   . SER A 1 8  ? 2.746   15.000 -9.600  1.00 1.00 ? 8  SER A HA   10 
ATOM   6959  H HB2  . SER A 1 8  ? 0.741   14.157 -10.994 1.00 1.00 ? 8  SER A HB2  10 
ATOM   6960  H HB3  . SER A 1 8  ? 2.359   13.796 -11.620 1.00 1.00 ? 8  SER A HB3  10 
ATOM   6961  H HG   . SER A 1 8  ? 1.054   11.928 -11.638 1.00 1.00 ? 8  SER A HG   10 
ATOM   6962  N N    . GLY A 1 9  ? 0.268   13.206 -8.403  1.00 1.00 ? 9  GLY A N    10 
ATOM   6963  C CA   . GLY A 1 9  ? -0.936  13.241 -7.586  1.00 1.00 ? 9  GLY A CA   10 
ATOM   6964  C C    . GLY A 1 9  ? -1.887  14.295 -8.156  1.00 1.00 ? 9  GLY A C    10 
ATOM   6965  O O    . GLY A 1 9  ? -3.020  13.999 -8.534  1.00 1.00 ? 9  GLY A O    10 
ATOM   6966  H H    . GLY A 1 9  ? 0.315   12.560 -9.176  1.00 1.00 ? 9  GLY A H    10 
ATOM   6967  H HA2  . GLY A 1 9  ? -1.416  12.262 -7.605  1.00 1.00 ? 9  GLY A HA2  10 
ATOM   6968  H HA3  . GLY A 1 9  ? -0.668  13.491 -6.559  1.00 1.00 ? 9  GLY A HA3  10 
ATOM   6969  N N    . THR A 1 10 ? -1.366  15.513 -8.241  1.00 1.00 ? 10 THR A N    10 
ATOM   6970  C CA   . THR A 1 10 ? -1.885  16.699 -8.900  1.00 1.00 ? 10 THR A CA   10 
ATOM   6971  C C    . THR A 1 10 ? -0.667  17.444 -9.458  1.00 1.00 ? 10 THR A C    10 
ATOM   6972  O O    . THR A 1 10 ? -0.506  17.607 -10.669 1.00 1.00 ? 10 THR A O    10 
ATOM   6973  C CB   . THR A 1 10 ? -2.620  17.577 -7.876  1.00 1.00 ? 10 THR A CB   10 
ATOM   6974  O OG1  . THR A 1 10 ? -1.892  17.620 -6.661  1.00 1.00 ? 10 THR A OG1  10 
ATOM   6975  C CG2  . THR A 1 10 ? -4.028  17.061 -7.583  1.00 1.00 ? 10 THR A CG2  10 
ATOM   6976  H H    . THR A 1 10 ? -0.436  15.591 -7.852  1.00 1.00 ? 10 THR A H    10 
ATOM   6977  H HA   . THR A 1 10 ? -2.558  16.439 -9.717  1.00 1.00 ? 10 THR A HA   10 
ATOM   6978  H HB   . THR A 1 10 ? -2.712  18.590 -8.277  1.00 1.00 ? 10 THR A HB   10 
ATOM   6979  H HG1  . THR A 1 10 ? -2.377  18.222 -6.081  1.00 1.00 ? 10 THR A HG1  10 
ATOM   6980  H HG21 . THR A 1 10 ? -4.602  16.992 -8.508  1.00 1.00 ? 10 THR A HG21 10 
ATOM   6981  H HG22 . THR A 1 10 ? -3.973  16.080 -7.122  1.00 1.00 ? 10 THR A HG22 10 
ATOM   6982  H HG23 . THR A 1 10 ? -4.537  17.745 -6.902  1.00 1.00 ? 10 THR A HG23 10 
ATOM   6983  N N    . TRP A 1 11 ? 0.203   17.863 -8.536  1.00 1.00 ? 11 TRP A N    10 
ATOM   6984  C CA   . TRP A 1 11 ? 1.383   18.683 -8.766  1.00 1.00 ? 11 TRP A CA   10 
ATOM   6985  C C    . TRP A 1 11 ? 2.415   17.951 -9.628  1.00 1.00 ? 11 TRP A C    10 
ATOM   6986  O O    . TRP A 1 11 ? 3.443   17.471 -9.155  1.00 1.00 ? 11 TRP A O    10 
ATOM   6987  C CB   . TRP A 1 11 ? 1.956   19.105 -7.409  1.00 1.00 ? 11 TRP A CB   10 
ATOM   6988  C CG   . TRP A 1 11 ? 2.903   20.269 -7.389  1.00 1.00 ? 11 TRP A CG   10 
ATOM   6989  C CD1  . TRP A 1 11 ? 3.945   20.486 -8.223  1.00 1.00 ? 11 TRP A CD1  10 
ATOM   6990  C CD2  . TRP A 1 11 ? 2.930   21.369 -6.435  1.00 1.00 ? 11 TRP A CD2  10 
ATOM   6991  N NE1  . TRP A 1 11 ? 4.606   21.637 -7.855  1.00 1.00 ? 11 TRP A NE1  10 
ATOM   6992  C CE2  . TRP A 1 11 ? 4.045   22.203 -6.732  1.00 1.00 ? 11 TRP A CE2  10 
ATOM   6993  C CE3  . TRP A 1 11 ? 2.136   21.736 -5.331  1.00 1.00 ? 11 TRP A CE3  10 
ATOM   6994  C CZ2  . TRP A 1 11 ? 4.382   23.312 -5.945  1.00 1.00 ? 11 TRP A CZ2  10 
ATOM   6995  C CZ3  . TRP A 1 11 ? 2.470   22.834 -4.524  1.00 1.00 ? 11 TRP A CZ3  10 
ATOM   6996  C CH2  . TRP A 1 11 ? 3.614   23.596 -4.807  1.00 1.00 ? 11 TRP A CH2  10 
ATOM   6997  H H    . TRP A 1 11 ? -0.065  17.677 -7.575  1.00 1.00 ? 11 TRP A H    10 
ATOM   6998  H HA   . TRP A 1 11 ? 1.067   19.589 -9.286  1.00 1.00 ? 11 TRP A HA   10 
ATOM   6999  H HB2  . TRP A 1 11 ? 1.114   19.396 -6.785  1.00 1.00 ? 11 TRP A HB2  10 
ATOM   7000  H HB3  . TRP A 1 11 ? 2.435   18.251 -6.929  1.00 1.00 ? 11 TRP A HB3  10 
ATOM   7001  H HD1  . TRP A 1 11 ? 4.250   19.859 -9.043  1.00 1.00 ? 11 TRP A HD1  10 
ATOM   7002  H HE1  . TRP A 1 11 ? 5.438   22.011 -8.301  1.00 1.00 ? 11 TRP A HE1  10 
ATOM   7003  H HE3  . TRP A 1 11 ? 1.268   21.153 -5.093  1.00 1.00 ? 11 TRP A HE3  10 
ATOM   7004  H HZ2  . TRP A 1 11 ? 5.241   23.918 -6.192  1.00 1.00 ? 11 TRP A HZ2  10 
ATOM   7005  H HZ3  . TRP A 1 11 ? 1.855   23.073 -3.669  1.00 1.00 ? 11 TRP A HZ3  10 
ATOM   7006  H HH2  . TRP A 1 11 ? 3.906   24.385 -4.141  1.00 1.00 ? 11 TRP A HH2  10 
ATOM   7007  N N    . SER A 1 12 ? 2.175   17.935 -10.934 1.00 1.00 ? 12 SER A N    10 
ATOM   7008  C CA   . SER A 1 12 ? 2.978   17.180 -11.877 1.00 1.00 ? 12 SER A CA   10 
ATOM   7009  C C    . SER A 1 12 ? 4.153   18.044 -12.336 1.00 1.00 ? 12 SER A C    10 
ATOM   7010  O O    . SER A 1 12 ? 4.245   18.400 -13.508 1.00 1.00 ? 12 SER A O    10 
ATOM   7011  C CB   . SER A 1 12 ? 2.075   16.764 -13.044 1.00 1.00 ? 12 SER A CB   10 
ATOM   7012  O OG   . SER A 1 12 ? 0.941   16.071 -12.548 1.00 1.00 ? 12 SER A OG   10 
ATOM   7013  H H    . SER A 1 12 ? 1.275   18.292 -11.235 1.00 1.00 ? 12 SER A H    10 
ATOM   7014  H HA   . SER A 1 12 ? 3.373   16.276 -11.413 1.00 1.00 ? 12 SER A HA   10 
ATOM   7015  H HB2  . SER A 1 12 ? 1.750   17.646 -13.600 1.00 1.00 ? 12 SER A HB2  10 
ATOM   7016  H HB3  . SER A 1 12 ? 2.637   16.118 -13.722 1.00 1.00 ? 12 SER A HB3  10 
ATOM   7017  H HG   . SER A 1 12 ? 0.407   16.667 -12.003 1.00 1.00 ? 12 SER A HG   10 
ATOM   7018  N N    . GLY A 1 13 ? 5.048   18.385 -11.404 1.00 1.00 ? 13 GLY A N    10 
ATOM   7019  C CA   . GLY A 1 13 ? 6.193   19.227 -11.702 1.00 1.00 ? 13 GLY A CA   10 
ATOM   7020  C C    . GLY A 1 13 ? 7.063   19.480 -10.471 1.00 1.00 ? 13 GLY A C    10 
ATOM   7021  O O    . GLY A 1 13 ? 6.900   18.838 -9.433  1.00 1.00 ? 13 GLY A O    10 
ATOM   7022  H H    . GLY A 1 13 ? 4.919   18.061 -10.448 1.00 1.00 ? 13 GLY A H    10 
ATOM   7023  H HA2  . GLY A 1 13 ? 6.803   18.748 -12.468 1.00 1.00 ? 13 GLY A HA2  10 
ATOM   7024  H HA3  . GLY A 1 13 ? 5.834   20.185 -12.083 1.00 1.00 ? 13 GLY A HA3  10 
ATOM   7025  N N    . VAL A 1 14 ? 7.996   20.426 -10.609 1.00 1.00 ? 14 VAL A N    10 
ATOM   7026  C CA   . VAL A 1 14 ? 8.906   20.849 -9.552  1.00 1.00 ? 14 VAL A CA   10 
ATOM   7027  C C    . VAL A 1 14 ? 8.080   21.391 -8.383  1.00 1.00 ? 14 VAL A C    10 
ATOM   7028  O O    . VAL A 1 14 ? 7.202   22.226 -8.589  1.00 1.00 ? 14 VAL A O    10 
ATOM   7029  C CB   . VAL A 1 14 ? 9.864   21.925 -10.100 1.00 1.00 ? 14 VAL A CB   10 
ATOM   7030  C CG1  . VAL A 1 14 ? 10.890  22.393 -9.060  1.00 1.00 ? 14 VAL A CG1  10 
ATOM   7031  C CG2  . VAL A 1 14 ? 10.631  21.422 -11.333 1.00 1.00 ? 14 VAL A CG2  10 
ATOM   7032  H H    . VAL A 1 14 ? 8.030   20.933 -11.479 1.00 1.00 ? 14 VAL A H    10 
ATOM   7033  H HA   . VAL A 1 14 ? 9.488   19.983 -9.236  1.00 1.00 ? 14 VAL A HA   10 
ATOM   7034  H HB   . VAL A 1 14 ? 9.267   22.790 -10.381 1.00 1.00 ? 14 VAL A HB   10 
ATOM   7035  H HG11 . VAL A 1 14 ? 10.398  22.738 -8.151  1.00 1.00 ? 14 VAL A HG11 10 
ATOM   7036  H HG12 . VAL A 1 14 ? 11.574  21.582 -8.818  1.00 1.00 ? 14 VAL A HG12 10 
ATOM   7037  H HG13 . VAL A 1 14 ? 11.468  23.222 -9.469  1.00 1.00 ? 14 VAL A HG13 10 
ATOM   7038  H HG21 . VAL A 1 14 ? 11.170  20.507 -11.087 1.00 1.00 ? 14 VAL A HG21 10 
ATOM   7039  H HG22 . VAL A 1 14 ? 9.953   21.225 -12.163 1.00 1.00 ? 14 VAL A HG22 10 
ATOM   7040  H HG23 . VAL A 1 14 ? 11.346  22.181 -11.654 1.00 1.00 ? 14 VAL A HG23 10 
ATOM   7041  N N    . CYS A 1 15 ? 8.357   20.922 -7.166  1.00 1.00 ? 15 CYS A N    10 
ATOM   7042  C CA   . CYS A 1 15 ? 7.673   21.361 -5.954  1.00 1.00 ? 15 CYS A CA   10 
ATOM   7043  C C    . CYS A 1 15 ? 8.327   22.612 -5.381  1.00 1.00 ? 15 CYS A C    10 
ATOM   7044  O O    . CYS A 1 15 ? 7.629   23.551 -5.005  1.00 1.00 ? 15 CYS A O    10 
ATOM   7045  C CB   . CYS A 1 15 ? 7.619   20.269 -4.882  1.00 1.00 ? 15 CYS A CB   10 
ATOM   7046  S SG   . CYS A 1 15 ? 9.210   19.699 -4.286  1.00 1.00 ? 15 CYS A SG   10 
ATOM   7047  H H    . CYS A 1 15 ? 9.173   20.328 -7.088  1.00 1.00 ? 15 CYS A H    10 
ATOM   7048  H HA   . CYS A 1 15 ? 6.641   21.604 -6.193  1.00 1.00 ? 15 CYS A HA   10 
ATOM   7049  H HB2  . CYS A 1 15 ? 7.074   20.668 -4.026  1.00 1.00 ? 15 CYS A HB2  10 
ATOM   7050  H HB3  . CYS A 1 15 ? 7.089   19.397 -5.229  1.00 1.00 ? 15 CYS A HB3  10 
ATOM   7051  N N    . GLY A 1 16 ? 9.654   22.612 -5.232  1.00 1.00 ? 16 GLY A N    10 
ATOM   7052  C CA   . GLY A 1 16 ? 10.378  23.649 -4.509  1.00 1.00 ? 16 GLY A CA   10 
ATOM   7053  C C    . GLY A 1 16 ? 10.152  23.580 -2.991  1.00 1.00 ? 16 GLY A C    10 
ATOM   7054  O O    . GLY A 1 16 ? 11.112  23.498 -2.230  1.00 1.00 ? 16 GLY A O    10 
ATOM   7055  H H    . GLY A 1 16 ? 10.170  21.805 -5.554  1.00 1.00 ? 16 GLY A H    10 
ATOM   7056  H HA2  . GLY A 1 16 ? 11.442  23.532 -4.713  1.00 1.00 ? 16 GLY A HA2  10 
ATOM   7057  H HA3  . GLY A 1 16 ? 10.067  24.631 -4.868  1.00 1.00 ? 16 GLY A HA3  10 
ATOM   7058  N N    . ASN A 1 17 ? 8.890   23.636 -2.549  1.00 1.00 ? 17 ASN A N    10 
ATOM   7059  C CA   . ASN A 1 17 ? 8.487   23.799 -1.155  1.00 1.00 ? 17 ASN A CA   10 
ATOM   7060  C C    . ASN A 1 17 ? 7.655   22.614 -0.649  1.00 1.00 ? 17 ASN A C    10 
ATOM   7061  O O    . ASN A 1 17 ? 6.543   22.372 -1.123  1.00 1.00 ? 17 ASN A O    10 
ATOM   7062  C CB   . ASN A 1 17 ? 7.699   25.103 -1.002  1.00 1.00 ? 17 ASN A CB   10 
ATOM   7063  C CG   . ASN A 1 17 ? 7.318   25.320 0.457   1.00 1.00 ? 17 ASN A CG   10 
ATOM   7064  O OD1  . ASN A 1 17 ? 6.294   24.827 0.917   1.00 1.00 ? 17 ASN A OD1  10 
ATOM   7065  N ND2  . ASN A 1 17 ? 8.150   26.028 1.212   1.00 1.00 ? 17 ASN A ND2  10 
ATOM   7066  H H    . ASN A 1 17 ? 8.165   23.629 -3.255  1.00 1.00 ? 17 ASN A H    10 
ATOM   7067  H HA   . ASN A 1 17 ? 9.376   23.895 -0.529  1.00 1.00 ? 17 ASN A HA   10 
ATOM   7068  H HB2  . ASN A 1 17 ? 8.302   25.941 -1.356  1.00 1.00 ? 17 ASN A HB2  10 
ATOM   7069  H HB3  . ASN A 1 17 ? 6.790   25.054 -1.604  1.00 1.00 ? 17 ASN A HB3  10 
ATOM   7070  H HD21 . ASN A 1 17 ? 8.987   26.431 0.816   1.00 1.00 ? 17 ASN A HD21 10 
ATOM   7071  H HD22 . ASN A 1 17 ? 7.911   26.194 2.178   1.00 1.00 ? 17 ASN A HD22 10 
ATOM   7072  N N    . ASN A 1 18 ? 8.202   21.889 0.334   1.00 1.00 ? 18 ASN A N    10 
ATOM   7073  C CA   . ASN A 1 18 ? 7.606   20.714 0.950   1.00 1.00 ? 18 ASN A CA   10 
ATOM   7074  C C    . ASN A 1 18 ? 6.161   20.956 1.369   1.00 1.00 ? 18 ASN A C    10 
ATOM   7075  O O    . ASN A 1 18 ? 5.250   20.252 0.940   1.00 1.00 ? 18 ASN A O    10 
ATOM   7076  C CB   . ASN A 1 18 ? 8.443   20.343 2.179   1.00 1.00 ? 18 ASN A CB   10 
ATOM   7077  C CG   . ASN A 1 18 ? 7.954   19.036 2.781   1.00 1.00 ? 18 ASN A CG   10 
ATOM   7078  O OD1  . ASN A 1 18 ? 6.937   18.986 3.466   1.00 1.00 ? 18 ASN A OD1  10 
ATOM   7079  N ND2  . ASN A 1 18 ? 8.646   17.942 2.508   1.00 1.00 ? 18 ASN A ND2  10 
ATOM   7080  H H    . ASN A 1 18 ? 9.136   22.114 0.643   1.00 1.00 ? 18 ASN A H    10 
ATOM   7081  H HA   . ASN A 1 18 ? 7.622   19.898 0.229   1.00 1.00 ? 18 ASN A HA   10 
ATOM   7082  H HB2  . ASN A 1 18 ? 9.485   20.259 1.889   1.00 1.00 ? 18 ASN A HB2  10 
ATOM   7083  H HB3  . ASN A 1 18 ? 8.384   21.119 2.943   1.00 1.00 ? 18 ASN A HB3  10 
ATOM   7084  H HD21 . ASN A 1 18 ? 9.542   17.965 2.039   1.00 1.00 ? 18 ASN A HD21 10 
ATOM   7085  H HD22 . ASN A 1 18 ? 8.269   17.075 2.872   1.00 1.00 ? 18 ASN A HD22 10 
ATOM   7086  N N    . ASN A 1 19 ? 5.994   21.938 2.254   1.00 1.00 ? 19 ASN A N    10 
ATOM   7087  C CA   . ASN A 1 19 ? 4.716   22.290 2.855   1.00 1.00 ? 19 ASN A CA   10 
ATOM   7088  C C    . ASN A 1 19 ? 3.642   22.506 1.795   1.00 1.00 ? 19 ASN A C    10 
ATOM   7089  O O    . ASN A 1 19 ? 2.545   21.971 1.919   1.00 1.00 ? 19 ASN A O    10 
ATOM   7090  C CB   . ASN A 1 19 ? 4.853   23.522 3.754   1.00 1.00 ? 19 ASN A CB   10 
ATOM   7091  C CG   . ASN A 1 19 ? 3.494   23.896 4.338   1.00 1.00 ? 19 ASN A CG   10 
ATOM   7092  O OD1  . ASN A 1 19 ? 3.037   23.275 5.290   1.00 1.00 ? 19 ASN A OD1  10 
ATOM   7093  N ND2  . ASN A 1 19 ? 2.829   24.895 3.764   1.00 1.00 ? 19 ASN A ND2  10 
ATOM   7094  H H    . ASN A 1 19 ? 6.834   22.413 2.550   1.00 1.00 ? 19 ASN A H    10 
ATOM   7095  H HA   . ASN A 1 19 ? 4.397   21.463 3.487   1.00 1.00 ? 19 ASN A HA   10 
ATOM   7096  H HB2  . ASN A 1 19 ? 5.536   23.294 4.573   1.00 1.00 ? 19 ASN A HB2  10 
ATOM   7097  H HB3  . ASN A 1 19 ? 5.255   24.365 3.192   1.00 1.00 ? 19 ASN A HB3  10 
ATOM   7098  H HD21 . ASN A 1 19 ? 3.217   25.396 2.979   1.00 1.00 ? 19 ASN A HD21 10 
ATOM   7099  H HD22 . ASN A 1 19 ? 1.927   25.145 4.141   1.00 1.00 ? 19 ASN A HD22 10 
ATOM   7100  N N    . ALA A 1 20 ? 3.952   23.282 0.754   1.00 1.00 ? 20 ALA A N    10 
ATOM   7101  C CA   . ALA A 1 20 ? 3.012   23.529 -0.324  1.00 1.00 ? 20 ALA A CA   10 
ATOM   7102  C C    . ALA A 1 20 ? 2.606   22.214 -0.982  1.00 1.00 ? 20 ALA A C    10 
ATOM   7103  O O    . ALA A 1 20 ? 1.418   21.907 -1.026  1.00 1.00 ? 20 ALA A O    10 
ATOM   7104  C CB   . ALA A 1 20 ? 3.605   24.483 -1.356  1.00 1.00 ? 20 ALA A CB   10 
ATOM   7105  H H    . ALA A 1 20 ? 4.878   23.693 0.707   1.00 1.00 ? 20 ALA A H    10 
ATOM   7106  H HA   . ALA A 1 20 ? 2.122   24.000 0.096   1.00 1.00 ? 20 ALA A HA   10 
ATOM   7107  H HB1  . ALA A 1 20 ? 3.909   25.411 -0.876  1.00 1.00 ? 20 ALA A HB1  10 
ATOM   7108  H HB2  . ALA A 1 20 ? 4.462   24.022 -1.847  1.00 1.00 ? 20 ALA A HB2  10 
ATOM   7109  H HB3  . ALA A 1 20 ? 2.837   24.703 -2.100  1.00 1.00 ? 20 ALA A HB3  10 
ATOM   7110  N N    . CYS A 1 21 ? 3.584   21.450 -1.485  1.00 1.00 ? 21 CYS A N    10 
ATOM   7111  C CA   . CYS A 1 21 ? 3.320   20.181 -2.166  1.00 1.00 ? 21 CYS A CA   10 
ATOM   7112  C C    . CYS A 1 21 ? 2.437   19.277 -1.298  1.00 1.00 ? 21 CYS A C    10 
ATOM   7113  O O    . CYS A 1 21 ? 1.379   18.825 -1.739  1.00 1.00 ? 21 CYS A O    10 
ATOM   7114  C CB   . CYS A 1 21 ? 4.639   19.489 -2.545  1.00 1.00 ? 21 CYS A CB   10 
ATOM   7115  S SG   . CYS A 1 21 ? 4.650   17.673 -2.530  1.00 1.00 ? 21 CYS A SG   10 
ATOM   7116  H H    . CYS A 1 21 ? 4.546   21.759 -1.376  1.00 1.00 ? 21 CYS A H    10 
ATOM   7117  H HA   . CYS A 1 21 ? 2.787   20.420 -3.086  1.00 1.00 ? 21 CYS A HA   10 
ATOM   7118  H HB2  . CYS A 1 21 ? 4.942   19.828 -3.535  1.00 1.00 ? 21 CYS A HB2  10 
ATOM   7119  H HB3  . CYS A 1 21 ? 5.409   19.785 -1.832  1.00 1.00 ? 21 CYS A HB3  10 
ATOM   7120  N N    . LYS A 1 22 ? 2.864   19.069 -0.047  1.00 1.00 ? 22 LYS A N    10 
ATOM   7121  C CA   . LYS A 1 22 ? 2.145   18.315 0.970   1.00 1.00 ? 22 LYS A CA   10 
ATOM   7122  C C    . LYS A 1 22 ? 0.698   18.787 1.065   1.00 1.00 ? 22 LYS A C    10 
ATOM   7123  O O    . LYS A 1 22 ? -0.236  18.023 0.802   1.00 1.00 ? 22 LYS A O    10 
ATOM   7124  C CB   . LYS A 1 22 ? 2.865   18.524 2.316   1.00 1.00 ? 22 LYS A CB   10 
ATOM   7125  C CG   . LYS A 1 22 ? 2.166   17.855 3.514   1.00 1.00 ? 22 LYS A CG   10 
ATOM   7126  C CD   . LYS A 1 22 ? 2.736   18.291 4.877   1.00 1.00 ? 22 LYS A CD   10 
ATOM   7127  C CE   . LYS A 1 22 ? 4.253   18.525 4.920   1.00 1.00 ? 22 LYS A CE   10 
ATOM   7128  N NZ   . LYS A 1 22 ? 5.041   17.349 4.508   1.00 1.00 ? 22 LYS A NZ   10 
ATOM   7129  H H    . LYS A 1 22 ? 3.731   19.519 0.227   1.00 1.00 ? 22 LYS A H    10 
ATOM   7130  H HA   . LYS A 1 22 ? 2.151   17.259 0.696   1.00 1.00 ? 22 LYS A HA   10 
ATOM   7131  H HB2  . LYS A 1 22 ? 3.881   18.152 2.205   1.00 1.00 ? 22 LYS A HB2  10 
ATOM   7132  H HB3  . LYS A 1 22 ? 2.929   19.588 2.524   1.00 1.00 ? 22 LYS A HB3  10 
ATOM   7133  H HG2  . LYS A 1 22 ? 1.109   18.126 3.532   1.00 1.00 ? 22 LYS A HG2  10 
ATOM   7134  H HG3  . LYS A 1 22 ? 2.201   16.777 3.400   1.00 1.00 ? 22 LYS A HG3  10 
ATOM   7135  H HD2  . LYS A 1 22 ? 2.265   19.242 5.141   1.00 1.00 ? 22 LYS A HD2  10 
ATOM   7136  H HD3  . LYS A 1 22 ? 2.441   17.564 5.637   1.00 1.00 ? 22 LYS A HD3  10 
ATOM   7137  H HE2  . LYS A 1 22 ? 4.501   19.352 4.257   1.00 1.00 ? 22 LYS A HE2  10 
ATOM   7138  H HE3  . LYS A 1 22 ? 4.547   18.816 5.931   1.00 1.00 ? 22 LYS A HE3  10 
ATOM   7139  H HZ1  . LYS A 1 22 ? 4.662   16.949 3.658   1.00 1.00 ? 22 LYS A HZ1  10 
ATOM   7140  H HZ2  . LYS A 1 22 ? 5.989   17.653 4.296   1.00 1.00 ? 22 LYS A HZ2  10 
ATOM   7141  H HZ3  . LYS A 1 22 ? 5.061   16.642 5.227   1.00 1.00 ? 22 LYS A HZ3  10 
ATOM   7142  N N    . ASN A 1 23 ? 0.538   20.038 1.512   1.00 1.00 ? 23 ASN A N    10 
ATOM   7143  C CA   . ASN A 1 23 ? -0.758  20.618 1.795   1.00 1.00 ? 23 ASN A CA   10 
ATOM   7144  C C    . ASN A 1 23 ? -1.618  20.450 0.560   1.00 1.00 ? 23 ASN A C    10 
ATOM   7145  O O    . ASN A 1 23 ? -2.604  19.735 0.607   1.00 1.00 ? 23 ASN A O    10 
ATOM   7146  C CB   . ASN A 1 23 ? -0.643  22.100 2.177   1.00 1.00 ? 23 ASN A CB   10 
ATOM   7147  C CG   . ASN A 1 23 ? -1.993  22.818 2.076   1.00 1.00 ? 23 ASN A CG   10 
ATOM   7148  O OD1  . ASN A 1 23 ? -2.965  22.451 2.731   1.00 1.00 ? 23 ASN A OD1  10 
ATOM   7149  N ND2  . ASN A 1 23 ? -2.083  23.836 1.226   1.00 1.00 ? 23 ASN A ND2  10 
ATOM   7150  H H    . ASN A 1 23 ? 1.357   20.620 1.649   1.00 1.00 ? 23 ASN A H    10 
ATOM   7151  H HA   . ASN A 1 23 ? -1.197  20.058 2.624   1.00 1.00 ? 23 ASN A HA   10 
ATOM   7152  H HB2  . ASN A 1 23 ? -0.262  22.184 3.196   1.00 1.00 ? 23 ASN A HB2  10 
ATOM   7153  H HB3  . ASN A 1 23 ? 0.063   22.590 1.505   1.00 1.00 ? 23 ASN A HB3  10 
ATOM   7154  H HD21 . ASN A 1 23 ? -1.284  24.128 0.685   1.00 1.00 ? 23 ASN A HD21 10 
ATOM   7155  H HD22 . ASN A 1 23 ? -2.966  24.317 1.136   1.00 1.00 ? 23 ASN A HD22 10 
ATOM   7156  N N    . GLN A 1 24 ? -1.210  21.061 -0.550  1.00 1.00 ? 24 GLN A N    10 
ATOM   7157  C CA   . GLN A 1 24 ? -1.920  20.998 -1.814  1.00 1.00 ? 24 GLN A CA   10 
ATOM   7158  C C    . GLN A 1 24 ? -2.374  19.571 -2.111  1.00 1.00 ? 24 GLN A C    10 
ATOM   7159  O O    . GLN A 1 24 ? -3.562  19.376 -2.364  1.00 1.00 ? 24 GLN A O    10 
ATOM   7160  C CB   . GLN A 1 24 ? -1.019  21.627 -2.889  1.00 1.00 ? 24 GLN A CB   10 
ATOM   7161  C CG   . GLN A 1 24 ? -1.608  21.658 -4.304  1.00 1.00 ? 24 GLN A CG   10 
ATOM   7162  C CD   . GLN A 1 24 ? -1.672  20.289 -4.970  1.00 1.00 ? 24 GLN A CD   10 
ATOM   7163  O OE1  . GLN A 1 24 ? -2.662  19.952 -5.606  1.00 1.00 ? 24 GLN A OE1  10 
ATOM   7164  N NE2  . GLN A 1 24 ? -0.637  19.466 -4.822  1.00 1.00 ? 24 GLN A NE2  10 
ATOM   7165  H H    . GLN A 1 24 ? -0.306  21.523 -0.542  1.00 1.00 ? 24 GLN A H    10 
ATOM   7166  H HA   . GLN A 1 24 ? -2.843  21.575 -1.724  1.00 1.00 ? 24 GLN A HA   10 
ATOM   7167  H HB2  . GLN A 1 24 ? -0.838  22.662 -2.596  1.00 1.00 ? 24 GLN A HB2  10 
ATOM   7168  H HB3  . GLN A 1 24 ? -0.058  21.118 -2.900  1.00 1.00 ? 24 GLN A HB3  10 
ATOM   7169  H HG2  . GLN A 1 24 ? -2.608  22.093 -4.271  1.00 1.00 ? 24 GLN A HG2  10 
ATOM   7170  H HG3  . GLN A 1 24 ? -0.983  22.300 -4.926  1.00 1.00 ? 24 GLN A HG3  10 
ATOM   7171  H HE21 . GLN A 1 24 ? 0.158   19.726 -4.250  1.00 1.00 ? 24 GLN A HE21 10 
ATOM   7172  H HE22 . GLN A 1 24 ? -0.668  18.562 -5.281  1.00 1.00 ? 24 GLN A HE22 10 
ATOM   7173  N N    . CYS A 1 25 ? -1.477  18.579 -2.038  1.00 1.00 ? 25 CYS A N    10 
ATOM   7174  C CA   . CYS A 1 25 ? -1.877  17.209 -2.328  1.00 1.00 ? 25 CYS A CA   10 
ATOM   7175  C C    . CYS A 1 25 ? -3.060  16.788 -1.464  1.00 1.00 ? 25 CYS A C    10 
ATOM   7176  O O    . CYS A 1 25 ? -4.125  16.463 -1.988  1.00 1.00 ? 25 CYS A O    10 
ATOM   7177  C CB   . CYS A 1 25 ? -0.744  16.203 -2.134  1.00 1.00 ? 25 CYS A CB   10 
ATOM   7178  S SG   . CYS A 1 25 ? -1.326  14.560 -2.604  1.00 1.00 ? 25 CYS A SG   10 
ATOM   7179  H H    . CYS A 1 25 ? -0.509  18.772 -1.794  1.00 1.00 ? 25 CYS A H    10 
ATOM   7180  H HA   . CYS A 1 25 ? -2.183  17.164 -3.375  1.00 1.00 ? 25 CYS A HA   10 
ATOM   7181  H HB2  . CYS A 1 25 ? 0.102   16.455 -2.757  1.00 1.00 ? 25 CYS A HB2  10 
ATOM   7182  H HB3  . CYS A 1 25 ? -0.400  16.169 -1.098  1.00 1.00 ? 25 CYS A HB3  10 
ATOM   7183  N N    . ILE A 1 26 ? -2.876  16.796 -0.142  1.00 1.00 ? 26 ILE A N    10 
ATOM   7184  C CA   . ILE A 1 26 ? -3.858  16.209 0.771   1.00 1.00 ? 26 ILE A CA   10 
ATOM   7185  C C    . ILE A 1 26 ? -5.067  17.139 0.981   1.00 1.00 ? 26 ILE A C    10 
ATOM   7186  O O    . ILE A 1 26 ? -6.133  16.725 1.454   1.00 1.00 ? 26 ILE A O    10 
ATOM   7187  C CB   . ILE A 1 26 ? -3.160  15.774 2.075   1.00 1.00 ? 26 ILE A CB   10 
ATOM   7188  C CG1  . ILE A 1 26 ? -2.880  16.952 3.020   1.00 1.00 ? 26 ILE A CG1  10 
ATOM   7189  C CG2  . ILE A 1 26 ? -1.863  15.022 1.728   1.00 1.00 ? 26 ILE A CG2  10 
ATOM   7190  C CD1  . ILE A 1 26 ? -2.113  16.549 4.283   1.00 1.00 ? 26 ILE A CD1  10 
ATOM   7191  H H    . ILE A 1 26 ? -2.013  17.188 0.231   1.00 1.00 ? 26 ILE A H    10 
ATOM   7192  H HA   . ILE A 1 26 ? -4.234  15.292 0.312   1.00 1.00 ? 26 ILE A HA   10 
ATOM   7193  H HB   . ILE A 1 26 ? -3.825  15.085 2.596   1.00 1.00 ? 26 ILE A HB   10 
ATOM   7194  H HG12 . ILE A 1 26 ? -2.310  17.715 2.495   1.00 1.00 ? 26 ILE A HG12 10 
ATOM   7195  H HG13 . ILE A 1 26 ? -3.834  17.368 3.343   1.00 1.00 ? 26 ILE A HG13 10 
ATOM   7196  H HG21 . ILE A 1 26 ? -2.073  14.245 0.997   1.00 1.00 ? 26 ILE A HG21 10 
ATOM   7197  H HG22 . ILE A 1 26 ? -1.106  15.693 1.330   1.00 1.00 ? 26 ILE A HG22 10 
ATOM   7198  H HG23 . ILE A 1 26 ? -1.451  14.557 2.614   1.00 1.00 ? 26 ILE A HG23 10 
ATOM   7199  H HD11 . ILE A 1 26 ? -2.611  15.709 4.769   1.00 1.00 ? 26 ILE A HD11 10 
ATOM   7200  H HD12 . ILE A 1 26 ? -1.087  16.276 4.039   1.00 1.00 ? 26 ILE A HD12 10 
ATOM   7201  H HD13 . ILE A 1 26 ? -2.089  17.395 4.971   1.00 1.00 ? 26 ILE A HD13 10 
ATOM   7202  N N    . ASN A 1 27 ? -4.914  18.408 0.599   1.00 1.00 ? 27 ASN A N    10 
ATOM   7203  C CA   . ASN A 1 27 ? -5.929  19.440 0.707   1.00 1.00 ? 27 ASN A CA   10 
ATOM   7204  C C    . ASN A 1 27 ? -6.883  19.290 -0.469  1.00 1.00 ? 27 ASN A C    10 
ATOM   7205  O O    . ASN A 1 27 ? -8.081  19.104 -0.258  1.00 1.00 ? 27 ASN A O    10 
ATOM   7206  C CB   . ASN A 1 27 ? -5.245  20.810 0.754   1.00 1.00 ? 27 ASN A CB   10 
ATOM   7207  C CG   . ASN A 1 27 ? -6.178  21.963 1.096   1.00 1.00 ? 27 ASN A CG   10 
ATOM   7208  O OD1  . ASN A 1 27 ? -7.294  22.046 0.597   1.00 1.00 ? 27 ASN A OD1  10 
ATOM   7209  N ND2  . ASN A 1 27 ? -5.712  22.870 1.950   1.00 1.00 ? 27 ASN A ND2  10 
ATOM   7210  H H    . ASN A 1 27 ? -4.013  18.687 0.217   1.00 1.00 ? 27 ASN A H    10 
ATOM   7211  H HA   . ASN A 1 27 ? -6.483  19.307 1.639   1.00 1.00 ? 27 ASN A HA   10 
ATOM   7212  H HB2  . ASN A 1 27 ? -4.504  20.758 1.548   1.00 1.00 ? 27 ASN A HB2  10 
ATOM   7213  H HB3  . ASN A 1 27 ? -4.750  21.025 -0.193  1.00 1.00 ? 27 ASN A HB3  10 
ATOM   7214  H HD21 . ASN A 1 27 ? -4.783  22.755 2.354   1.00 1.00 ? 27 ASN A HD21 10 
ATOM   7215  H HD22 . ASN A 1 27 ? -6.303  23.643 2.211   1.00 1.00 ? 27 ASN A HD22 10 
ATOM   7216  N N    . LEU A 1 28 ? -6.351  19.256 -1.696  1.00 1.00 ? 28 LEU A N    10 
ATOM   7217  C CA   . LEU A 1 28 ? -7.151  18.969 -2.877  1.00 1.00 ? 28 LEU A CA   10 
ATOM   7218  C C    . LEU A 1 28 ? -7.576  17.498 -2.849  1.00 1.00 ? 28 LEU A C    10 
ATOM   7219  O O    . LEU A 1 28 ? -8.709  17.188 -2.476  1.00 1.00 ? 28 LEU A O    10 
ATOM   7220  C CB   . LEU A 1 28 ? -6.387  19.336 -4.162  1.00 1.00 ? 28 LEU A CB   10 
ATOM   7221  C CG   . LEU A 1 28 ? -6.580  20.804 -4.577  1.00 1.00 ? 28 LEU A CG   10 
ATOM   7222  C CD1  . LEU A 1 28 ? -5.898  21.771 -3.603  1.00 1.00 ? 28 LEU A CD1  10 
ATOM   7223  C CD2  . LEU A 1 28 ? -6.026  21.009 -5.992  1.00 1.00 ? 28 LEU A CD2  10 
ATOM   7224  H H    . LEU A 1 28 ? -5.345  19.341 -1.811  1.00 1.00 ? 28 LEU A H    10 
ATOM   7225  H HA   . LEU A 1 28 ? -8.064  19.566 -2.843  1.00 1.00 ? 28 LEU A HA   10 
ATOM   7226  H HB2  . LEU A 1 28 ? -5.325  19.111 -4.062  1.00 1.00 ? 28 LEU A HB2  10 
ATOM   7227  H HB3  . LEU A 1 28 ? -6.780  18.722 -4.970  1.00 1.00 ? 28 LEU A HB3  10 
ATOM   7228  H HG   . LEU A 1 28 ? -7.646  21.031 -4.607  1.00 1.00 ? 28 LEU A HG   10 
ATOM   7229  H HD11 . LEU A 1 28 ? -4.845  21.514 -3.497  1.00 1.00 ? 28 LEU A HD11 10 
ATOM   7230  H HD12 . LEU A 1 28 ? -5.978  22.791 -3.982  1.00 1.00 ? 28 LEU A HD12 10 
ATOM   7231  H HD13 . LEU A 1 28 ? -6.380  21.730 -2.628  1.00 1.00 ? 28 LEU A HD13 10 
ATOM   7232  H HD21 . LEU A 1 28 ? -6.528  20.340 -6.692  1.00 1.00 ? 28 LEU A HD21 10 
ATOM   7233  H HD22 . LEU A 1 28 ? -6.190  22.037 -6.313  1.00 1.00 ? 28 LEU A HD22 10 
ATOM   7234  H HD23 . LEU A 1 28 ? -4.959  20.799 -6.012  1.00 1.00 ? 28 LEU A HD23 10 
ATOM   7235  N N    . GLU A 1 29 ? -6.666  16.564 -3.137  1.00 1.00 ? 29 GLU A N    10 
ATOM   7236  C CA   . GLU A 1 29 ? -7.031  15.153 -3.167  1.00 1.00 ? 29 GLU A CA   10 
ATOM   7237  C C    . GLU A 1 29 ? -6.873  14.614 -1.748  1.00 1.00 ? 29 GLU A C    10 
ATOM   7238  O O    . GLU A 1 29 ? -6.587  15.382 -0.837  1.00 1.00 ? 29 GLU A O    10 
ATOM   7239  C CB   . GLU A 1 29 ? -6.282  14.393 -4.273  1.00 1.00 ? 29 GLU A CB   10 
ATOM   7240  C CG   . GLU A 1 29 ? -4.758  14.555 -4.270  1.00 1.00 ? 29 GLU A CG   10 
ATOM   7241  C CD   . GLU A 1 29 ? -4.099  13.887 -5.470  1.00 1.00 ? 29 GLU A CD   10 
ATOM   7242  O OE1  . GLU A 1 29 ? -2.911  13.602 -5.401  1.00 1.00 ? 29 GLU A OE1  10 
ATOM   7243  O OE2  . GLU A 1 29 ? -4.876  13.664 -6.564  1.00 1.00 ? 29 GLU A OE2  10 
ATOM   7244  H H    . GLU A 1 29 ? -5.678  16.805 -3.113  1.00 1.00 ? 29 GLU A H    10 
ATOM   7245  H HA   . GLU A 1 29 ? -8.088  15.051 -3.420  1.00 1.00 ? 29 GLU A HA   10 
ATOM   7246  H HB2  . GLU A 1 29 ? -6.529  13.333 -4.226  1.00 1.00 ? 29 GLU A HB2  10 
ATOM   7247  H HB3  . GLU A 1 29 ? -6.662  14.783 -5.219  1.00 1.00 ? 29 GLU A HB3  10 
ATOM   7248  H HG2  . GLU A 1 29 ? -4.494  15.609 -4.328  1.00 1.00 ? 29 GLU A HG2  10 
ATOM   7249  H HG3  . GLU A 1 29 ? -4.331  14.121 -3.364  1.00 1.00 ? 29 GLU A HG3  10 
ATOM   7250  H HE2  . GLU A 1 29 ? -4.330  13.538 -7.350  1.00 1.00 ? 29 GLU A HE2  10 
ATOM   7251  N N    . LYS A 1 30 ? -7.181  13.341 -1.509  1.00 1.00 ? 30 LYS A N    10 
ATOM   7252  C CA   . LYS A 1 30 ? -7.327  12.805 -0.155  1.00 1.00 ? 30 LYS A CA   10 
ATOM   7253  C C    . LYS A 1 30 ? -6.206  11.876 0.305   1.00 1.00 ? 30 LYS A C    10 
ATOM   7254  O O    . LYS A 1 30 ? -6.394  11.132 1.269   1.00 1.00 ? 30 LYS A O    10 
ATOM   7255  C CB   . LYS A 1 30 ? -8.765  12.307 0.050   1.00 1.00 ? 30 LYS A CB   10 
ATOM   7256  C CG   . LYS A 1 30 ? -9.747  13.498 -0.016  1.00 1.00 ? 30 LYS A CG   10 
ATOM   7257  C CD   . LYS A 1 30 ? -9.680  14.408 1.231   1.00 1.00 ? 30 LYS A CD   10 
ATOM   7258  C CE   . LYS A 1 30 ? -9.848  15.914 0.948   1.00 1.00 ? 30 LYS A CE   10 
ATOM   7259  N NZ   . LYS A 1 30 ? -8.705  16.531 0.233   1.00 1.00 ? 30 LYS A NZ   10 
ATOM   7260  H H    . LYS A 1 30 ? -7.432  12.744 -2.284  1.00 1.00 ? 30 LYS A H    10 
ATOM   7261  H HA   . LYS A 1 30 ? -7.194  13.620 0.549   1.00 1.00 ? 30 LYS A HA   10 
ATOM   7262  H HB2  . LYS A 1 30 ? -9.008  11.581 -0.728  1.00 1.00 ? 30 LYS A HB2  10 
ATOM   7263  H HB3  . LYS A 1 30 ? -8.867  11.823 1.023   1.00 1.00 ? 30 LYS A HB3  10 
ATOM   7264  H HG2  . LYS A 1 30 ? -9.576  14.072 -0.925  1.00 1.00 ? 30 LYS A HG2  10 
ATOM   7265  H HG3  . LYS A 1 30 ? -10.760 13.094 -0.085  1.00 1.00 ? 30 LYS A HG3  10 
ATOM   7266  H HD2  . LYS A 1 30 ? -10.495 14.105 1.894   1.00 1.00 ? 30 LYS A HD2  10 
ATOM   7267  H HD3  . LYS A 1 30 ? -8.763  14.261 1.800   1.00 1.00 ? 30 LYS A HD3  10 
ATOM   7268  H HE2  . LYS A 1 30 ? -10.765 16.089 0.383   1.00 1.00 ? 30 LYS A HE2  10 
ATOM   7269  H HE3  . LYS A 1 30 ? -9.941  16.422 1.909   1.00 1.00 ? 30 LYS A HE3  10 
ATOM   7270  H HZ1  . LYS A 1 30 ? -7.787  16.270 0.598   1.00 1.00 ? 30 LYS A HZ1  10 
ATOM   7271  H HZ2  . LYS A 1 30 ? -8.703  16.320 -0.760  1.00 1.00 ? 30 LYS A HZ2  10 
ATOM   7272  H HZ3  . LYS A 1 30 ? -8.765  17.542 0.280   1.00 1.00 ? 30 LYS A HZ3  10 
ATOM   7273  N N    . ALA A 1 31 ? -5.079  11.868 -0.413  1.00 1.00 ? 31 ALA A N    10 
ATOM   7274  C CA   . ALA A 1 31 ? -3.829  11.230 0.004   1.00 1.00 ? 31 ALA A CA   10 
ATOM   7275  C C    . ALA A 1 31 ? -3.490  11.525 1.479   1.00 1.00 ? 31 ALA A C    10 
ATOM   7276  O O    . ALA A 1 31 ? -4.066  12.428 2.084   1.00 1.00 ? 31 ALA A O    10 
ATOM   7277  C CB   . ALA A 1 31 ? -2.720  11.778 -0.889  1.00 1.00 ? 31 ALA A CB   10 
ATOM   7278  H H    . ALA A 1 31 ? -5.030  12.501 -1.196  1.00 1.00 ? 31 ALA A H    10 
ATOM   7279  H HA   . ALA A 1 31 ? -3.913  10.153 -0.144  1.00 1.00 ? 31 ALA A HA   10 
ATOM   7280  H HB1  . ALA A 1 31 ? -2.945  11.609 -1.941  1.00 1.00 ? 31 ALA A HB1  10 
ATOM   7281  H HB2  . ALA A 1 31 ? -2.644  12.852 -0.723  1.00 1.00 ? 31 ALA A HB2  10 
ATOM   7282  H HB3  . ALA A 1 31 ? -1.768  11.308 -0.650  1.00 1.00 ? 31 ALA A HB3  10 
ATOM   7283  N N    . ARG A 1 32 ? -2.575  10.754 2.082   1.00 1.00 ? 32 ARG A N    10 
ATOM   7284  C CA   . ARG A 1 32 ? -2.293  10.847 3.514   1.00 1.00 ? 32 ARG A CA   10 
ATOM   7285  C C    . ARG A 1 32 ? -1.279  11.946 3.817   1.00 1.00 ? 32 ARG A C    10 
ATOM   7286  O O    . ARG A 1 32 ? -1.658  12.973 4.374   1.00 1.00 ? 32 ARG A O    10 
ATOM   7287  C CB   . ARG A 1 32 ? -1.850  9.487  4.086   1.00 1.00 ? 32 ARG A CB   10 
ATOM   7288  C CG   . ARG A 1 32 ? -2.880  8.350  3.966   1.00 1.00 ? 32 ARG A CG   10 
ATOM   7289  C CD   . ARG A 1 32 ? -3.975  8.348  5.051   1.00 1.00 ? 32 ARG A CD   10 
ATOM   7290  N NE   . ARG A 1 32 ? -4.796  9.569  5.051   1.00 1.00 ? 32 ARG A NE   10 
ATOM   7291  C CZ   . ARG A 1 32 ? -5.536  9.993  4.016   1.00 1.00 ? 32 ARG A CZ   10 
ATOM   7292  N NH1  . ARG A 1 32 ? -5.807  9.169  3.002   1.00 1.00 ? 32 ARG A NH1  10 
ATOM   7293  N NH2  . ARG A 1 32 ? -5.968  11.255 3.965   1.00 1.00 ? 32 ARG A NH2  10 
ATOM   7294  H H    . ARG A 1 32 ? -2.021  10.112 1.518   1.00 1.00 ? 32 ARG A H    10 
ATOM   7295  H HA   . ARG A 1 32 ? -3.183  11.193 4.032   1.00 1.00 ? 32 ARG A HA   10 
ATOM   7296  H HB2  . ARG A 1 32 ? -0.959  9.173  3.541   1.00 1.00 ? 32 ARG A HB2  10 
ATOM   7297  H HB3  . ARG A 1 32 ? -1.577  9.607  5.136   1.00 1.00 ? 32 ARG A HB3  10 
ATOM   7298  H HG2  . ARG A 1 32 ? -3.305  8.361  2.966   1.00 1.00 ? 32 ARG A HG2  10 
ATOM   7299  H HG3  . ARG A 1 32 ? -2.342  7.407  4.072   1.00 1.00 ? 32 ARG A HG3  10 
ATOM   7300  H HD2  . ARG A 1 32 ? -4.612  7.470  4.932   1.00 1.00 ? 32 ARG A HD2  10 
ATOM   7301  H HD3  . ARG A 1 32 ? -3.491  8.261  6.026   1.00 1.00 ? 32 ARG A HD3  10 
ATOM   7302  H HE   . ARG A 1 32 ? -4.682  10.180 5.848   1.00 1.00 ? 32 ARG A HE   10 
ATOM   7303  H HH11 . ARG A 1 32 ? -5.518  8.206  3.040   1.00 1.00 ? 32 ARG A HH11 10 
ATOM   7304  H HH12 . ARG A 1 32 ? -6.253  9.550  2.171   1.00 1.00 ? 32 ARG A HH12 10 
ATOM   7305  H HH21 . ARG A 1 32 ? -5.734  11.928 4.678   1.00 1.00 ? 32 ARG A HH21 10 
ATOM   7306  H HH22 . ARG A 1 32 ? -6.296  11.593 3.063   1.00 1.00 ? 32 ARG A HH22 10 
ATOM   7307  N N    . HIS A 1 33 ? 0.008   11.693 3.571   1.00 1.00 ? 33 HIS A N    10 
ATOM   7308  C CA   . HIS A 1 33 ? 1.043   12.717 3.604   1.00 1.00 ? 33 HIS A CA   10 
ATOM   7309  C C    . HIS A 1 33 ? 1.519   13.027 2.185   1.00 1.00 ? 33 HIS A C    10 
ATOM   7310  O O    . HIS A 1 33 ? 1.249   12.275 1.247   1.00 1.00 ? 33 HIS A O    10 
ATOM   7311  C CB   . HIS A 1 33 ? 2.171   12.346 4.578   1.00 1.00 ? 33 HIS A CB   10 
ATOM   7312  C CG   . HIS A 1 33 ? 2.669   10.928 4.490   1.00 1.00 ? 33 HIS A CG   10 
ATOM   7313  N ND1  . HIS A 1 33 ? 2.018   9.882  5.125   1.00 1.00 ? 33 HIS A ND1  10 
ATOM   7314  C CD2  . HIS A 1 33 ? 3.802   10.373 3.947   1.00 1.00 ? 33 HIS A CD2  10 
ATOM   7315  C CE1  . HIS A 1 33 ? 2.757   8.778  4.937   1.00 1.00 ? 33 HIS A CE1  10 
ATOM   7316  N NE2  . HIS A 1 33 ? 3.851   9.007  4.208   1.00 1.00 ? 33 HIS A NE2  10 
ATOM   7317  H H    . HIS A 1 33 ? 0.230   10.856 3.052   1.00 1.00 ? 33 HIS A H    10 
ATOM   7318  H HA   . HIS A 1 33 ? 0.623   13.652 3.979   1.00 1.00 ? 33 HIS A HA   10 
ATOM   7319  H HB2  . HIS A 1 33 ? 3.014   13.024 4.443   1.00 1.00 ? 33 HIS A HB2  10 
ATOM   7320  H HB3  . HIS A 1 33 ? 1.794   12.491 5.592   1.00 1.00 ? 33 HIS A HB3  10 
ATOM   7321  H HD1  . HIS A 1 33 ? 1.163   9.944  5.658   1.00 1.00 ? 33 HIS A HD1  10 
ATOM   7322  H HD2  . HIS A 1 33 ? 4.568   10.929 3.427   1.00 1.00 ? 33 HIS A HD2  10 
ATOM   7323  H HE1  . HIS A 1 33 ? 2.491   7.814  5.340   1.00 1.00 ? 33 HIS A HE1  10 
ATOM   7324  N N    . GLY A 1 34 ? 2.272   14.117 2.054   1.00 1.00 ? 34 GLY A N    10 
ATOM   7325  C CA   . GLY A 1 34 ? 2.998   14.486 0.856   1.00 1.00 ? 34 GLY A CA   10 
ATOM   7326  C C    . GLY A 1 34 ? 4.224   15.282 1.284   1.00 1.00 ? 34 GLY A C    10 
ATOM   7327  O O    . GLY A 1 34 ? 4.318   15.669 2.454   1.00 1.00 ? 34 GLY A O    10 
ATOM   7328  H H    . GLY A 1 34 ? 2.505   14.653 2.878   1.00 1.00 ? 34 GLY A H    10 
ATOM   7329  H HA2  . GLY A 1 34 ? 3.367   13.588 0.379   1.00 1.00 ? 34 GLY A HA2  10 
ATOM   7330  H HA3  . GLY A 1 34 ? 2.357   15.046 0.170   1.00 1.00 ? 34 GLY A HA3  10 
ATOM   7331  N N    . SER A 1 35 ? 5.187   15.476 0.383   1.00 1.00 ? 35 SER A N    10 
ATOM   7332  C CA   . SER A 1 35 ? 6.441   16.159 0.660   1.00 1.00 ? 35 SER A CA   10 
ATOM   7333  C C    . SER A 1 35 ? 7.225   16.375 -0.627  1.00 1.00 ? 35 SER A C    10 
ATOM   7334  O O    . SER A 1 35 ? 7.023   15.679 -1.617  1.00 1.00 ? 35 SER A O    10 
ATOM   7335  C CB   . SER A 1 35 ? 7.301   15.326 1.625   1.00 1.00 ? 35 SER A CB   10 
ATOM   7336  O OG   . SER A 1 35 ? 6.944   15.643 2.956   1.00 1.00 ? 35 SER A OG   10 
ATOM   7337  H H    . SER A 1 35 ? 5.081   15.080 -0.551  1.00 1.00 ? 35 SER A H    10 
ATOM   7338  H HA   . SER A 1 35 ? 6.226   17.137 1.093   1.00 1.00 ? 35 SER A HA   10 
ATOM   7339  H HB2  . SER A 1 35 ? 7.158   14.260 1.431   1.00 1.00 ? 35 SER A HB2  10 
ATOM   7340  H HB3  . SER A 1 35 ? 8.363   15.534 1.473   1.00 1.00 ? 35 SER A HB3  10 
ATOM   7341  H HG   . SER A 1 35 ? 6.046   15.305 3.071   1.00 1.00 ? 35 SER A HG   10 
ATOM   7342  N N    . CYS A 1 36 ? 8.139   17.341 -0.579  1.00 1.00 ? 36 CYS A N    10 
ATOM   7343  C CA   . CYS A 1 36 ? 9.138   17.531 -1.612  1.00 1.00 ? 36 CYS A CA   10 
ATOM   7344  C C    . CYS A 1 36 ? 10.193  16.454 -1.405  1.00 1.00 ? 36 CYS A C    10 
ATOM   7345  O O    . CYS A 1 36 ? 10.632  16.249 -0.273  1.00 1.00 ? 36 CYS A O    10 
ATOM   7346  C CB   . CYS A 1 36 ? 9.850   18.880 -1.448  1.00 1.00 ? 36 CYS A CB   10 
ATOM   7347  S SG   . CYS A 1 36 ? 9.206   20.306 -2.321  1.00 1.00 ? 36 CYS A SG   10 
ATOM   7348  H H    . CYS A 1 36 ? 8.259   17.832 0.292   1.00 1.00 ? 36 CYS A H    10 
ATOM   7349  H HA   . CYS A 1 36 ? 8.689   17.447 -2.600  1.00 1.00 ? 36 CYS A HA   10 
ATOM   7350  H HB2  . CYS A 1 36 ? 9.889   19.147 -0.400  1.00 1.00 ? 36 CYS A HB2  10 
ATOM   7351  H HB3  . CYS A 1 36 ? 10.875  18.780 -1.808  1.00 1.00 ? 36 CYS A HB3  10 
ATOM   7352  N N    . ASN A 1 37 ? 10.619  15.807 -2.484  1.00 1.00 ? 37 ASN A N    10 
ATOM   7353  C CA   . ASN A 1 37 ? 11.773  14.924 -2.514  1.00 1.00 ? 37 ASN A CA   10 
ATOM   7354  C C    . ASN A 1 37 ? 12.776  15.565 -3.463  1.00 1.00 ? 37 ASN A C    10 
ATOM   7355  O O    . ASN A 1 37 ? 12.364  16.248 -4.402  1.00 1.00 ? 37 ASN A O    10 
ATOM   7356  C CB   . ASN A 1 37 ? 11.345  13.554 -3.031  1.00 1.00 ? 37 ASN A CB   10 
ATOM   7357  C CG   . ASN A 1 37 ? 12.494  12.556 -3.101  1.00 1.00 ? 37 ASN A CG   10 
ATOM   7358  O OD1  . ASN A 1 37 ? 12.706  11.784 -2.174  1.00 1.00 ? 37 ASN A OD1  10 
ATOM   7359  N ND2  . ASN A 1 37 ? 13.248  12.541 -4.195  1.00 1.00 ? 37 ASN A ND2  10 
ATOM   7360  H H    . ASN A 1 37 ? 10.184  16.014 -3.379  1.00 1.00 ? 37 ASN A H    10 
ATOM   7361  H HA   . ASN A 1 37 ? 12.217  14.816 -1.523  1.00 1.00 ? 37 ASN A HA   10 
ATOM   7362  H HB2  . ASN A 1 37 ? 10.598  13.164 -2.340  1.00 1.00 ? 37 ASN A HB2  10 
ATOM   7363  H HB3  . ASN A 1 37 ? 10.913  13.664 -4.024  1.00 1.00 ? 37 ASN A HB3  10 
ATOM   7364  H HD21 . ASN A 1 37 ? 13.142  13.220 -4.944  1.00 1.00 ? 37 ASN A HD21 10 
ATOM   7365  H HD22 . ASN A 1 37 ? 13.963  11.834 -4.249  1.00 1.00 ? 37 ASN A HD22 10 
ATOM   7366  N N    . TYR A 1 38 ? 14.074  15.349 -3.238  1.00 1.00 ? 38 TYR A N    10 
ATOM   7367  C CA   . TYR A 1 38 ? 15.086  15.778 -4.191  1.00 1.00 ? 38 TYR A CA   10 
ATOM   7368  C C    . TYR A 1 38 ? 15.144  14.780 -5.355  1.00 1.00 ? 38 TYR A C    10 
ATOM   7369  O O    . TYR A 1 38 ? 14.116  14.534 -5.992  1.00 1.00 ? 38 TYR A O    10 
ATOM   7370  C CB   . TYR A 1 38 ? 16.435  16.098 -3.517  1.00 1.00 ? 38 TYR A CB   10 
ATOM   7371  C CG   . TYR A 1 38 ? 17.448  16.731 -4.467  1.00 1.00 ? 38 TYR A CG   10 
ATOM   7372  C CD1  . TYR A 1 38 ? 17.067  17.839 -5.250  1.00 1.00 ? 38 TYR A CD1  10 
ATOM   7373  C CD2  . TYR A 1 38 ? 18.651  16.062 -4.768  1.00 1.00 ? 38 TYR A CD2  10 
ATOM   7374  C CE1  . TYR A 1 38 ? 17.777  18.154 -6.419  1.00 1.00 ? 38 TYR A CE1  10 
ATOM   7375  C CE2  . TYR A 1 38 ? 19.341  16.358 -5.957  1.00 1.00 ? 38 TYR A CE2  10 
ATOM   7376  C CZ   . TYR A 1 38 ? 18.869  17.366 -6.813  1.00 1.00 ? 38 TYR A CZ   10 
ATOM   7377  O OH   . TYR A 1 38 ? 19.463  17.568 -8.022  1.00 1.00 ? 38 TYR A OH   10 
ATOM   7378  H H    . TYR A 1 38 ? 14.339  14.749 -2.471  1.00 1.00 ? 38 TYR A H    10 
ATOM   7379  H HA   . TYR A 1 38 ? 14.743  16.715 -4.626  1.00 1.00 ? 38 TYR A HA   10 
ATOM   7380  H HB2  . TYR A 1 38 ? 16.255  16.810 -2.710  1.00 1.00 ? 38 TYR A HB2  10 
ATOM   7381  H HB3  . TYR A 1 38 ? 16.843  15.190 -3.071  1.00 1.00 ? 38 TYR A HB3  10 
ATOM   7382  H HD1  . TYR A 1 38 ? 16.201  18.425 -4.987  1.00 1.00 ? 38 TYR A HD1  10 
ATOM   7383  H HD2  . TYR A 1 38 ? 19.004  15.259 -4.136  1.00 1.00 ? 38 TYR A HD2  10 
ATOM   7384  H HE1  . TYR A 1 38 ? 17.475  18.994 -7.021  1.00 1.00 ? 38 TYR A HE1  10 
ATOM   7385  H HE2  . TYR A 1 38 ? 20.223  15.795 -6.227  1.00 1.00 ? 38 TYR A HE2  10 
ATOM   7386  H HH   . TYR A 1 38 ? 18.961  18.170 -8.590  1.00 1.00 ? 38 TYR A HH   10 
ATOM   7387  N N    . VAL A 1 39 ? 16.320  14.205 -5.635  1.00 1.00 ? 39 VAL A N    10 
ATOM   7388  C CA   . VAL A 1 39 ? 16.637  13.435 -6.834  1.00 1.00 ? 39 VAL A CA   10 
ATOM   7389  C C    . VAL A 1 39 ? 16.643  14.410 -8.019  1.00 1.00 ? 39 VAL A C    10 
ATOM   7390  O O    . VAL A 1 39 ? 15.963  15.437 -7.994  1.00 1.00 ? 39 VAL A O    10 
ATOM   7391  C CB   . VAL A 1 39 ? 15.720  12.202 -7.007  1.00 1.00 ? 39 VAL A CB   10 
ATOM   7392  C CG1  . VAL A 1 39 ? 15.985  11.451 -8.319  1.00 1.00 ? 39 VAL A CG1  10 
ATOM   7393  C CG2  . VAL A 1 39 ? 15.941  11.228 -5.843  1.00 1.00 ? 39 VAL A CG2  10 
ATOM   7394  H H    . VAL A 1 39 ? 17.090  14.404 -5.020  1.00 1.00 ? 39 VAL A H    10 
ATOM   7395  H HA   . VAL A 1 39 ? 17.659  13.070 -6.714  1.00 1.00 ? 39 VAL A HA   10 
ATOM   7396  H HB   . VAL A 1 39 ? 14.670  12.486 -7.027  1.00 1.00 ? 39 VAL A HB   10 
ATOM   7397  H HG11 . VAL A 1 39 ? 17.038  11.182 -8.395  1.00 1.00 ? 39 VAL A HG11 10 
ATOM   7398  H HG12 . VAL A 1 39 ? 15.383  10.541 -8.342  1.00 1.00 ? 39 VAL A HG12 10 
ATOM   7399  H HG13 . VAL A 1 39 ? 15.699  12.064 -9.173  1.00 1.00 ? 39 VAL A HG13 10 
ATOM   7400  H HG21 . VAL A 1 39 ? 15.841  11.738 -4.886  1.00 1.00 ? 39 VAL A HG21 10 
ATOM   7401  H HG22 . VAL A 1 39 ? 15.206  10.422 -5.891  1.00 1.00 ? 39 VAL A HG22 10 
ATOM   7402  H HG23 . VAL A 1 39 ? 16.941  10.798 -5.900  1.00 1.00 ? 39 VAL A HG23 10 
ATOM   7403  N N    . PHE A 1 40 ? 17.431  14.131 -9.056  1.00 1.00 ? 40 PHE A N    10 
ATOM   7404  C CA   . PHE A 1 40 ? 17.542  15.032 -10.196 1.00 1.00 ? 40 PHE A CA   10 
ATOM   7405  C C    . PHE A 1 40 ? 16.154  15.304 -10.815 1.00 1.00 ? 40 PHE A C    10 
ATOM   7406  O O    . PHE A 1 40 ? 15.219  14.526 -10.602 1.00 1.00 ? 40 PHE A O    10 
ATOM   7407  C CB   . PHE A 1 40 ? 18.521  14.442 -11.225 1.00 1.00 ? 40 PHE A CB   10 
ATOM   7408  C CG   . PHE A 1 40 ? 17.938  13.326 -12.070 1.00 1.00 ? 40 PHE A CG   10 
ATOM   7409  C CD1  . PHE A 1 40 ? 17.939  11.999 -11.600 1.00 1.00 ? 40 PHE A CD1  10 
ATOM   7410  C CD2  . PHE A 1 40 ? 17.322  13.631 -13.300 1.00 1.00 ? 40 PHE A CD2  10 
ATOM   7411  C CE1  . PHE A 1 40 ? 17.297  10.991 -12.340 1.00 1.00 ? 40 PHE A CE1  10 
ATOM   7412  C CE2  . PHE A 1 40 ? 16.682  12.622 -14.039 1.00 1.00 ? 40 PHE A CE2  10 
ATOM   7413  C CZ   . PHE A 1 40 ? 16.663  11.303 -13.554 1.00 1.00 ? 40 PHE A CZ   10 
ATOM   7414  H H    . PHE A 1 40 ? 17.959  13.273 -9.061  1.00 1.00 ? 40 PHE A H    10 
ATOM   7415  H HA   . PHE A 1 40 ? 17.968  15.959 -9.813  1.00 1.00 ? 40 PHE A HA   10 
ATOM   7416  H HB2  . PHE A 1 40 ? 18.852  15.231 -11.899 1.00 1.00 ? 40 PHE A HB2  10 
ATOM   7417  H HB3  . PHE A 1 40 ? 19.415  14.082 -10.713 1.00 1.00 ? 40 PHE A HB3  10 
ATOM   7418  H HD1  . PHE A 1 40 ? 18.435  11.741 -10.677 1.00 1.00 ? 40 PHE A HD1  10 
ATOM   7419  H HD2  . PHE A 1 40 ? 17.329  14.641 -13.684 1.00 1.00 ? 40 PHE A HD2  10 
ATOM   7420  H HE1  . PHE A 1 40 ? 17.295  9.973  -11.977 1.00 1.00 ? 40 PHE A HE1  10 
ATOM   7421  H HE2  . PHE A 1 40 ? 16.206  12.858 -14.979 1.00 1.00 ? 40 PHE A HE2  10 
ATOM   7422  H HZ   . PHE A 1 40 ? 16.171  10.527 -14.123 1.00 1.00 ? 40 PHE A HZ   10 
ATOM   7423  N N    . PRO A 1 41 ? 15.958  16.416 -11.537 1.00 1.00 ? 41 PRO A N    10 
ATOM   7424  C CA   . PRO A 1 41 ? 16.866  17.544 -11.639 1.00 1.00 ? 41 PRO A CA   10 
ATOM   7425  C C    . PRO A 1 41 ? 16.729  18.421 -10.387 1.00 1.00 ? 41 PRO A C    10 
ATOM   7426  O O    . PRO A 1 41 ? 17.731  18.789 -9.775  1.00 1.00 ? 41 PRO A O    10 
ATOM   7427  C CB   . PRO A 1 41 ? 16.435  18.270 -12.916 1.00 1.00 ? 41 PRO A CB   10 
ATOM   7428  C CG   . PRO A 1 41 ? 14.935  17.986 -13.028 1.00 1.00 ? 41 PRO A CG   10 
ATOM   7429  C CD   . PRO A 1 41 ? 14.781  16.611 -12.370 1.00 1.00 ? 41 PRO A CD   10 
ATOM   7430  H HA   . PRO A 1 41 ? 17.905  17.241 -11.752 1.00 1.00 ? 41 PRO A HA   10 
ATOM   7431  H HB2  . PRO A 1 41 ? 16.659  19.338 -12.892 1.00 1.00 ? 41 PRO A HB2  10 
ATOM   7432  H HB3  . PRO A 1 41 ? 16.939  17.802 -13.764 1.00 1.00 ? 41 PRO A HB3  10 
ATOM   7433  H HG2  . PRO A 1 41 ? 14.370  18.738 -12.477 1.00 1.00 ? 41 PRO A HG2  10 
ATOM   7434  H HG3  . PRO A 1 41 ? 14.605  17.976 -14.068 1.00 1.00 ? 41 PRO A HG3  10 
ATOM   7435  H HD2  . PRO A 1 41 ? 13.861  16.562 -11.786 1.00 1.00 ? 41 PRO A HD2  10 
ATOM   7436  H HD3  . PRO A 1 41 ? 14.763  15.838 -13.140 1.00 1.00 ? 41 PRO A HD3  10 
ATOM   7437  N N    . ALA A 1 42 ? 15.486  18.731 -10.003 1.00 1.00 ? 42 ALA A N    10 
ATOM   7438  C CA   . ALA A 1 42 ? 15.133  19.654 -8.935  1.00 1.00 ? 42 ALA A CA   10 
ATOM   7439  C C    . ALA A 1 42 ? 14.180  18.979 -7.943  1.00 1.00 ? 42 ALA A C    10 
ATOM   7440  O O    . ALA A 1 42 ? 13.750  17.841 -8.153  1.00 1.00 ? 42 ALA A O    10 
ATOM   7441  C CB   . ALA A 1 42 ? 14.491  20.896 -9.560  1.00 1.00 ? 42 ALA A CB   10 
ATOM   7442  H H    . ALA A 1 42 ? 14.716  18.301 -10.491 1.00 1.00 ? 42 ALA A H    10 
ATOM   7443  H HA   . ALA A 1 42 ? 16.023  19.978 -8.399  1.00 1.00 ? 42 ALA A HA   10 
ATOM   7444  H HB1  . ALA A 1 42 ? 15.183  21.347 -10.273 1.00 1.00 ? 42 ALA A HB1  10 
ATOM   7445  H HB2  . ALA A 1 42 ? 13.574  20.619 -10.083 1.00 1.00 ? 42 ALA A HB2  10 
ATOM   7446  H HB3  . ALA A 1 42 ? 14.255  21.633 -8.791  1.00 1.00 ? 42 ALA A HB3  10 
ATOM   7447  N N    . HIS A 1 43 ? 13.816  19.710 -6.884  1.00 1.00 ? 43 HIS A N    10 
ATOM   7448  C CA   . HIS A 1 43 ? 12.892  19.235 -5.865  1.00 1.00 ? 43 HIS A CA   10 
ATOM   7449  C C    . HIS A 1 43 ? 11.527  19.008 -6.505  1.00 1.00 ? 43 HIS A C    10 
ATOM   7450  O O    . HIS A 1 43 ? 10.951  19.920 -7.092  1.00 1.00 ? 43 HIS A O    10 
ATOM   7451  C CB   . HIS A 1 43 ? 12.787  20.259 -4.730  1.00 1.00 ? 43 HIS A CB   10 
ATOM   7452  C CG   . HIS A 1 43 ? 13.995  20.249 -3.831  1.00 1.00 ? 43 HIS A CG   10 
ATOM   7453  N ND1  . HIS A 1 43 ? 14.938  21.267 -3.814  1.00 1.00 ? 43 HIS A ND1  10 
ATOM   7454  C CD2  . HIS A 1 43 ? 14.436  19.329 -2.910  1.00 1.00 ? 43 HIS A CD2  10 
ATOM   7455  C CE1  . HIS A 1 43 ? 15.889  20.911 -2.934  1.00 1.00 ? 43 HIS A CE1  10 
ATOM   7456  N NE2  . HIS A 1 43 ? 15.644  19.734 -2.355  1.00 1.00 ? 43 HIS A NE2  10 
ATOM   7457  H H    . HIS A 1 43 ? 14.176  20.646 -6.794  1.00 1.00 ? 43 HIS A H    10 
ATOM   7458  H HA   . HIS A 1 43 ? 13.273  18.300 -5.463  1.00 1.00 ? 43 HIS A HA   10 
ATOM   7459  H HB2  . HIS A 1 43 ? 12.639  21.238 -5.174  1.00 1.00 ? 43 HIS A HB2  10 
ATOM   7460  H HB3  . HIS A 1 43 ? 11.917  20.062 -4.104  1.00 1.00 ? 43 HIS A HB3  10 
ATOM   7461  H HD1  . HIS A 1 43 ? 14.918  22.120 -4.352  1.00 1.00 ? 43 HIS A HD1  10 
ATOM   7462  H HD2  . HIS A 1 43 ? 13.930  18.404 -2.676  1.00 1.00 ? 43 HIS A HD2  10 
ATOM   7463  H HE1  . HIS A 1 43 ? 16.759  21.513 -2.717  1.00 1.00 ? 43 HIS A HE1  10 
ATOM   7464  N N    . LYS A 1 44 ? 11.024  17.784 -6.385  1.00 1.00 ? 44 LYS A N    10 
ATOM   7465  C CA   . LYS A 1 44 ? 9.808   17.300 -7.023  1.00 1.00 ? 44 LYS A CA   10 
ATOM   7466  C C    . LYS A 1 44 ? 8.834   16.841 -5.944  1.00 1.00 ? 44 LYS A C    10 
ATOM   7467  O O    . LYS A 1 44 ? 9.263   16.332 -4.908  1.00 1.00 ? 44 LYS A O    10 
ATOM   7468  C CB   . LYS A 1 44 ? 10.157  16.167 -7.998  1.00 1.00 ? 44 LYS A CB   10 
ATOM   7469  C CG   . LYS A 1 44 ? 10.772  14.951 -7.284  1.00 1.00 ? 44 LYS A CG   10 
ATOM   7470  C CD   . LYS A 1 44 ? 11.278  13.882 -8.259  1.00 1.00 ? 44 LYS A CD   10 
ATOM   7471  C CE   . LYS A 1 44 ? 12.352  14.379 -9.241  1.00 1.00 ? 44 LYS A CE   10 
ATOM   7472  N NZ   . LYS A 1 44 ? 13.406  15.177 -8.585  1.00 1.00 ? 44 LYS A NZ   10 
ATOM   7473  H H    . LYS A 1 44 ? 11.491  17.174 -5.724  1.00 1.00 ? 44 LYS A H    10 
ATOM   7474  H HA   . LYS A 1 44 ? 9.339   18.099 -7.597  1.00 1.00 ? 44 LYS A HA   10 
ATOM   7475  H HB2  . LYS A 1 44 ? 9.251   15.852 -8.517  1.00 1.00 ? 44 LYS A HB2  10 
ATOM   7476  H HB3  . LYS A 1 44 ? 10.853  16.572 -8.731  1.00 1.00 ? 44 LYS A HB3  10 
ATOM   7477  H HG2  . LYS A 1 44 ? 11.587  15.258 -6.631  1.00 1.00 ? 44 LYS A HG2  10 
ATOM   7478  H HG3  . LYS A 1 44 ? 10.008  14.488 -6.655  1.00 1.00 ? 44 LYS A HG3  10 
ATOM   7479  H HD2  . LYS A 1 44 ? 11.689  13.061 -7.667  1.00 1.00 ? 44 LYS A HD2  10 
ATOM   7480  H HD3  . LYS A 1 44 ? 10.431  13.490 -8.826  1.00 1.00 ? 44 LYS A HD3  10 
ATOM   7481  H HE2  . LYS A 1 44 ? 12.816  13.505 -9.703  1.00 1.00 ? 44 LYS A HE2  10 
ATOM   7482  H HE3  . LYS A 1 44 ? 11.896  14.972 -10.036 1.00 1.00 ? 44 LYS A HE3  10 
ATOM   7483  H HZ1  . LYS A 1 44 ? 13.694  14.775 -7.703  1.00 1.00 ? 44 LYS A HZ1  10 
ATOM   7484  H HZ2  . LYS A 1 44 ? 14.246  15.199 -9.159  1.00 1.00 ? 44 LYS A HZ2  10 
ATOM   7485  H HZ3  . LYS A 1 44 ? 13.138  16.139 -8.403  1.00 1.00 ? 44 LYS A HZ3  10 
ATOM   7486  N N    . CYS A 1 45 ? 7.535   17.036 -6.171  1.00 1.00 ? 45 CYS A N    10 
ATOM   7487  C CA   . CYS A 1 45 ? 6.533   16.616 -5.204  1.00 1.00 ? 45 CYS A CA   10 
ATOM   7488  C C    . CYS A 1 45 ? 6.482   15.088 -5.164  1.00 1.00 ? 45 CYS A C    10 
ATOM   7489  O O    . CYS A 1 45 ? 6.757   14.434 -6.169  1.00 1.00 ? 45 CYS A O    10 
ATOM   7490  C CB   . CYS A 1 45 ? 5.165   17.217 -5.569  1.00 1.00 ? 45 CYS A CB   10 
ATOM   7491  S SG   . CYS A 1 45 ? 3.844   17.017 -4.342  1.00 1.00 ? 45 CYS A SG   10 
ATOM   7492  H H    . CYS A 1 45 ? 7.226   17.412 -7.058  1.00 1.00 ? 45 CYS A H    10 
ATOM   7493  H HA   . CYS A 1 45 ? 6.831   16.993 -4.226  1.00 1.00 ? 45 CYS A HA   10 
ATOM   7494  H HB2  . CYS A 1 45 ? 5.263   18.287 -5.739  1.00 1.00 ? 45 CYS A HB2  10 
ATOM   7495  H HB3  . CYS A 1 45 ? 4.818   16.765 -6.498  1.00 1.00 ? 45 CYS A HB3  10 
ATOM   7496  N N    . ILE A 1 46 ? 6.205   14.522 -3.993  1.00 1.00 ? 46 ILE A N    10 
ATOM   7497  C CA   . ILE A 1 46 ? 5.884   13.120 -3.793  1.00 1.00 ? 46 ILE A CA   10 
ATOM   7498  C C    . ILE A 1 46 ? 4.670   13.151 -2.874  1.00 1.00 ? 46 ILE A C    10 
ATOM   7499  O O    . ILE A 1 46 ? 4.699   13.852 -1.859  1.00 1.00 ? 46 ILE A O    10 
ATOM   7500  C CB   . ILE A 1 46 ? 7.038   12.344 -3.129  1.00 1.00 ? 46 ILE A CB   10 
ATOM   7501  C CG1  . ILE A 1 46 ? 8.334   12.280 -3.961  1.00 1.00 ? 46 ILE A CG1  10 
ATOM   7502  C CG2  . ILE A 1 46 ? 6.581   10.924 -2.760  1.00 1.00 ? 46 ILE A CG2  10 
ATOM   7503  C CD1  . ILE A 1 46 ? 8.259   11.455 -5.248  1.00 1.00 ? 46 ILE A CD1  10 
ATOM   7504  H H    . ILE A 1 46 ? 6.131   15.106 -3.163  1.00 1.00 ? 46 ILE A H    10 
ATOM   7505  H HA   . ILE A 1 46 ? 5.607   12.650 -4.735  1.00 1.00 ? 46 ILE A HA   10 
ATOM   7506  H HB   . ILE A 1 46 ? 7.290   12.854 -2.198  1.00 1.00 ? 46 ILE A HB   10 
ATOM   7507  H HG12 . ILE A 1 46 ? 8.660   13.288 -4.216  1.00 1.00 ? 46 ILE A HG12 10 
ATOM   7508  H HG13 . ILE A 1 46 ? 9.098   11.817 -3.339  1.00 1.00 ? 46 ILE A HG13 10 
ATOM   7509  H HG21 . ILE A 1 46 ? 6.189   10.406 -3.634  1.00 1.00 ? 46 ILE A HG21 10 
ATOM   7510  H HG22 . ILE A 1 46 ? 7.418   10.361 -2.350  1.00 1.00 ? 46 ILE A HG22 10 
ATOM   7511  H HG23 . ILE A 1 46 ? 5.794   10.955 -2.008  1.00 1.00 ? 46 ILE A HG23 10 
ATOM   7512  H HD11 . ILE A 1 46 ? 7.999   10.419 -5.034  1.00 1.00 ? 46 ILE A HD11 10 
ATOM   7513  H HD12 . ILE A 1 46 ? 7.532   11.884 -5.929  1.00 1.00 ? 46 ILE A HD12 10 
ATOM   7514  H HD13 . ILE A 1 46 ? 9.236   11.473 -5.734  1.00 1.00 ? 46 ILE A HD13 10 
ATOM   7515  N N    . CYS A 1 47 ? 3.613   12.412 -3.211  1.00 1.00 ? 47 CYS A N    10 
ATOM   7516  C CA   . CYS A 1 47 ? 2.455   12.272 -2.346  1.00 1.00 ? 47 CYS A CA   10 
ATOM   7517  C C    . CYS A 1 47 ? 2.154   10.796 -2.107  1.00 1.00 ? 47 CYS A C    10 
ATOM   7518  O O    . CYS A 1 47 ? 2.430   9.981  -2.987  1.00 1.00 ? 47 CYS A O    10 
ATOM   7519  C CB   . CYS A 1 47 ? 1.287   13.061 -2.915  1.00 1.00 ? 47 CYS A CB   10 
ATOM   7520  S SG   . CYS A 1 47 ? 0.007   13.278 -1.679  1.00 1.00 ? 47 CYS A SG   10 
ATOM   7521  H H    . CYS A 1 47 ? 3.601   11.913 -4.096  1.00 1.00 ? 47 CYS A H    10 
ATOM   7522  H HA   . CYS A 1 47 ? 2.667   12.698 -1.373  1.00 1.00 ? 47 CYS A HA   10 
ATOM   7523  H HB2  . CYS A 1 47 ? 1.629   14.055 -3.203  1.00 1.00 ? 47 CYS A HB2  10 
ATOM   7524  H HB3  . CYS A 1 47 ? 0.873   12.566 -3.793  1.00 1.00 ? 47 CYS A HB3  10 
ATOM   7525  N N    . TYR A 1 48 ? 1.669   10.444 -0.908  1.00 1.00 ? 48 TYR A N    10 
ATOM   7526  C CA   . TYR A 1 48 ? 1.541   9.067  -0.442  1.00 1.00 ? 48 TYR A CA   10 
ATOM   7527  C C    . TYR A 1 48 ? 0.075   8.697  -0.205  1.00 1.00 ? 48 TYR A C    10 
ATOM   7528  O O    . TYR A 1 48 ? -0.621  9.366  0.563   1.00 1.00 ? 48 TYR A O    10 
ATOM   7529  C CB   . TYR A 1 48 ? 2.334   8.890  0.855   1.00 1.00 ? 48 TYR A CB   10 
ATOM   7530  C CG   . TYR A 1 48 ? 3.827   9.122  0.752   1.00 1.00 ? 48 TYR A CG   10 
ATOM   7531  C CD1  . TYR A 1 48 ? 4.346   10.431 0.707   1.00 1.00 ? 48 TYR A CD1  10 
ATOM   7532  C CD2  . TYR A 1 48 ? 4.708   8.026  0.805   1.00 1.00 ? 48 TYR A CD2  10 
ATOM   7533  C CE1  . TYR A 1 48 ? 5.733   10.636 0.618   1.00 1.00 ? 48 TYR A CE1  10 
ATOM   7534  C CE2  . TYR A 1 48 ? 6.092   8.233  0.702   1.00 1.00 ? 48 TYR A CE2  10 
ATOM   7535  C CZ   . TYR A 1 48 ? 6.597   9.531  0.532   1.00 1.00 ? 48 TYR A CZ   10 
ATOM   7536  O OH   . TYR A 1 48 ? 7.912   9.716  0.242   1.00 1.00 ? 48 TYR A OH   10 
ATOM   7537  H H    . TYR A 1 48 ? 1.439   11.170 -0.233  1.00 1.00 ? 48 TYR A H    10 
ATOM   7538  H HA   . TYR A 1 48 ? 1.967   8.382  -1.176  1.00 1.00 ? 48 TYR A HA   10 
ATOM   7539  H HB2  . TYR A 1 48 ? 1.926   9.543  1.628   1.00 1.00 ? 48 TYR A HB2  10 
ATOM   7540  H HB3  . TYR A 1 48 ? 2.190   7.858  1.163   1.00 1.00 ? 48 TYR A HB3  10 
ATOM   7541  H HD1  . TYR A 1 48 ? 3.684   11.279 0.746   1.00 1.00 ? 48 TYR A HD1  10 
ATOM   7542  H HD2  . TYR A 1 48 ? 4.329   7.020  0.906   1.00 1.00 ? 48 TYR A HD2  10 
ATOM   7543  H HE1  . TYR A 1 48 ? 6.130   11.637 0.548   1.00 1.00 ? 48 TYR A HE1  10 
ATOM   7544  H HE2  . TYR A 1 48 ? 6.764   7.386  0.719   1.00 1.00 ? 48 TYR A HE2  10 
ATOM   7545  H HH   . TYR A 1 48 ? 8.238   8.984  -0.300  1.00 1.00 ? 48 TYR A HH   10 
ATOM   7546  N N    . PHE A 1 49 ? -0.386  7.613  -0.837  1.00 1.00 ? 49 PHE A N    10 
ATOM   7547  C CA   . PHE A 1 49 ? -1.778  7.196  -0.855  1.00 1.00 ? 49 PHE A CA   10 
ATOM   7548  C C    . PHE A 1 49 ? -1.912  5.858  -0.117  1.00 1.00 ? 49 PHE A C    10 
ATOM   7549  O O    . PHE A 1 49 ? -0.996  5.033  -0.177  1.00 1.00 ? 49 PHE A O    10 
ATOM   7550  C CB   . PHE A 1 49 ? -2.259  7.062  -2.305  1.00 1.00 ? 49 PHE A CB   10 
ATOM   7551  C CG   . PHE A 1 49 ? -2.080  8.304  -3.163  1.00 1.00 ? 49 PHE A CG   10 
ATOM   7552  C CD1  . PHE A 1 49 ? -0.792  8.717  -3.556  1.00 1.00 ? 49 PHE A CD1  10 
ATOM   7553  C CD2  . PHE A 1 49 ? -3.197  9.077  -3.537  1.00 1.00 ? 49 PHE A CD2  10 
ATOM   7554  C CE1  . PHE A 1 49 ? -0.612  9.955  -4.185  1.00 1.00 ? 49 PHE A CE1  10 
ATOM   7555  C CE2  . PHE A 1 49 ? -3.020  10.261 -4.276  1.00 1.00 ? 49 PHE A CE2  10 
ATOM   7556  C CZ   . PHE A 1 49 ? -1.723  10.712 -4.574  1.00 1.00 ? 49 PHE A CZ   10 
ATOM   7557  H H    . PHE A 1 49 ? 0.248   7.065  -1.410  1.00 1.00 ? 49 PHE A H    10 
ATOM   7558  H HA   . PHE A 1 49 ? -2.380  7.968  -0.378  1.00 1.00 ? 49 PHE A HA   10 
ATOM   7559  H HB2  . PHE A 1 49 ? -1.757  6.212  -2.749  1.00 1.00 ? 49 PHE A HB2  10 
ATOM   7560  H HB3  . PHE A 1 49 ? -3.309  6.798  -2.310  1.00 1.00 ? 49 PHE A HB3  10 
ATOM   7561  H HD1  . PHE A 1 49 ? 0.077   8.111  -3.354  1.00 1.00 ? 49 PHE A HD1  10 
ATOM   7562  H HD2  . PHE A 1 49 ? -4.196  8.767  -3.270  1.00 1.00 ? 49 PHE A HD2  10 
ATOM   7563  H HE1  . PHE A 1 49 ? 0.383   10.312 -4.391  1.00 1.00 ? 49 PHE A HE1  10 
ATOM   7564  H HE2  . PHE A 1 49 ? -3.876  10.839 -4.591  1.00 1.00 ? 49 PHE A HE2  10 
ATOM   7565  H HZ   . PHE A 1 49 ? -1.567  11.637 -5.104  1.00 1.00 ? 49 PHE A HZ   10 
ATOM   7566  N N    . PRO A 1 50 ? -3.049  5.626  0.560   1.00 1.00 ? 50 PRO A N    10 
ATOM   7567  C CA   . PRO A 1 50 ? -3.312  4.447  1.369   1.00 1.00 ? 50 PRO A CA   10 
ATOM   7568  C C    . PRO A 1 50 ? -3.541  3.241  0.458   1.00 1.00 ? 50 PRO A C    10 
ATOM   7569  O O    . PRO A 1 50 ? -4.662  2.841  0.157   1.00 1.00 ? 50 PRO A O    10 
ATOM   7570  C CB   . PRO A 1 50 ? -4.557  4.802  2.182   1.00 1.00 ? 50 PRO A CB   10 
ATOM   7571  C CG   . PRO A 1 50 ? -5.331  5.719  1.231   1.00 1.00 ? 50 PRO A CG   10 
ATOM   7572  C CD   . PRO A 1 50 ? -4.214  6.486  0.520   1.00 1.00 ? 50 PRO A CD   10 
ATOM   7573  H HA   . PRO A 1 50 ? -2.468  4.240  2.034   1.00 1.00 ? 50 PRO A HA   10 
ATOM   7574  H HB2  . PRO A 1 50 ? -5.128  3.921  2.479   1.00 1.00 ? 50 PRO A HB2  10 
ATOM   7575  H HB3  . PRO A 1 50 ? -4.249  5.363  3.064   1.00 1.00 ? 50 PRO A HB3  10 
ATOM   7576  H HG2  . PRO A 1 50 ? -5.877  5.114  0.505   1.00 1.00 ? 50 PRO A HG2  10 
ATOM   7577  H HG3  . PRO A 1 50 ? -6.026  6.373  1.756   1.00 1.00 ? 50 PRO A HG3  10 
ATOM   7578  H HD2  . PRO A 1 50 ? -4.471  6.700  -0.519  1.00 1.00 ? 50 PRO A HD2  10 
ATOM   7579  H HD3  . PRO A 1 50 ? -4.009  7.409  1.059   1.00 1.00 ? 50 PRO A HD3  10 
ATOM   7580  N N    . CYS A 1 51 ? -2.436  2.670  0.000   1.00 1.00 ? 51 CYS A N    10 
ATOM   7581  C CA   . CYS A 1 51 ? -2.381  1.655  -1.039  1.00 1.00 ? 51 CYS A CA   10 
ATOM   7582  C C    . CYS A 1 51 ? -2.939  0.307  -0.580  1.00 1.00 ? 51 CYS A C    10 
ATOM   7583  O O    . CYS A 1 51 ? -2.171  -0.639 -0.408  1.00 1.00 ? 51 CYS A O    10 
ATOM   7584  C CB   . CYS A 1 51 ? -0.921  1.567  -1.469  1.00 1.00 ? 51 CYS A CB   10 
ATOM   7585  S SG   . CYS A 1 51 ? -0.579  0.749  -3.031  1.00 1.00 ? 51 CYS A SG   10 
ATOM   7586  O OXT  . CYS A 1 51 ? -4.283  0.244  -0.377  1.00 0.00 ? 51 CYS A OXT  10 
ATOM   7587  H H    . CYS A 1 51 ? -1.577  3.143  0.251   1.00 1.00 ? 51 CYS A H    10 
ATOM   7588  H HA   . CYS A 1 51 ? -2.961  2.000  -1.897  1.00 1.00 ? 51 CYS A HA   10 
ATOM   7589  H HB2  . CYS A 1 51 ? -0.594  2.592  -1.614  1.00 1.00 ? 51 CYS A HB2  10 
ATOM   7590  H HB3  . CYS A 1 51 ? -0.306  1.124  -0.688  1.00 1.00 ? 51 CYS A HB3  10 
HETATM 7591  N N    . PCA A 1 1  ? 2.102   1.414  7.787   1.00 1.00 ? 1  PCA A N    11 
HETATM 7592  C CA   . PCA A 1 1  ? 1.370   2.148  6.773   1.00 1.00 ? 1  PCA A CA   11 
HETATM 7593  C CB   . PCA A 1 1  ? 1.500   3.625  7.193   1.00 1.00 ? 1  PCA A CB   11 
HETATM 7594  C CG   . PCA A 1 1  ? 2.778   3.632  8.040   1.00 1.00 ? 1  PCA A CG   11 
HETATM 7595  C CD   . PCA A 1 1  ? 2.917   2.192  8.486   1.00 1.00 ? 1  PCA A CD   11 
HETATM 7596  O OE   . PCA A 1 1  ? 3.670   1.817  9.379   1.00 1.00 ? 1  PCA A OE   11 
HETATM 7597  C C    . PCA A 1 1  ? 1.990   1.857  5.404   1.00 1.00 ? 1  PCA A C    11 
HETATM 7598  O O    . PCA A 1 1  ? 2.750   2.663  4.868   1.00 1.00 ? 1  PCA A O    11 
HETATM 7599  H H    . PCA A 1 1  ? 2.046   0.415  7.915   1.00 0.00 ? 1  PCA A H    11 
HETATM 7600  H HA   . PCA A 1 1  ? 0.319   1.865  6.773   1.00 1.00 ? 1  PCA A HA   11 
HETATM 7601  H HB2  . PCA A 1 1  ? 1.547   4.319  6.353   1.00 1.00 ? 1  PCA A HB2  11 
HETATM 7602  H HB3  . PCA A 1 1  ? 0.655   3.882  7.835   1.00 1.00 ? 1  PCA A HB3  11 
HETATM 7603  H HG2  . PCA A 1 1  ? 3.636   3.893  7.419   1.00 1.00 ? 1  PCA A HG2  11 
HETATM 7604  H HG3  . PCA A 1 1  ? 2.694   4.310  8.888   1.00 1.00 ? 1  PCA A HG3  11 
ATOM   7605  N N    . LYS A 1 2  ? 1.671   0.690  4.837   1.00 1.00 ? 2  LYS A N    11 
ATOM   7606  C CA   . LYS A 1 2  ? 2.193   0.262  3.545   1.00 1.00 ? 2  LYS A CA   11 
ATOM   7607  C C    . LYS A 1 2  ? 1.489   1.028  2.416   1.00 1.00 ? 2  LYS A C    11 
ATOM   7608  O O    . LYS A 1 2  ? 0.714   0.461  1.642   1.00 1.00 ? 2  LYS A O    11 
ATOM   7609  C CB   . LYS A 1 2  ? 2.022   -1.255 3.409   1.00 1.00 ? 2  LYS A CB   11 
ATOM   7610  C CG   . LYS A 1 2  ? 2.786   -1.797 2.189   1.00 1.00 ? 2  LYS A CG   11 
ATOM   7611  C CD   . LYS A 1 2  ? 2.209   -3.123 1.672   1.00 1.00 ? 2  LYS A CD   11 
ATOM   7612  C CE   . LYS A 1 2  ? 0.758   -3.023 1.169   1.00 1.00 ? 2  LYS A CE   11 
ATOM   7613  N NZ   . LYS A 1 2  ? 0.549   -1.919 0.215   1.00 1.00 ? 2  LYS A NZ   11 
ATOM   7614  H H    . LYS A 1 2  ? 1.046   0.070  5.330   1.00 1.00 ? 2  LYS A H    11 
ATOM   7615  H HA   . LYS A 1 2  ? 3.261   0.481  3.507   1.00 1.00 ? 2  LYS A HA   11 
ATOM   7616  H HB2  . LYS A 1 2  ? 2.412   -1.749 4.301   1.00 1.00 ? 2  LYS A HB2  11 
ATOM   7617  H HB3  . LYS A 1 2  ? 0.956   -1.465 3.352   1.00 1.00 ? 2  LYS A HB3  11 
ATOM   7618  H HG2  . LYS A 1 2  ? 2.813   -1.069 1.379   1.00 1.00 ? 2  LYS A HG2  11 
ATOM   7619  H HG3  . LYS A 1 2  ? 3.823   -1.963 2.493   1.00 1.00 ? 2  LYS A HG3  11 
ATOM   7620  H HD2  . LYS A 1 2  ? 2.847   -3.481 0.860   1.00 1.00 ? 2  LYS A HD2  11 
ATOM   7621  H HD3  . LYS A 1 2  ? 2.252   -3.864 2.474   1.00 1.00 ? 2  LYS A HD3  11 
ATOM   7622  H HE2  . LYS A 1 2  ? 0.498   -3.960 0.680   1.00 1.00 ? 2  LYS A HE2  11 
ATOM   7623  H HE3  . LYS A 1 2  ? 0.075   -2.882 2.007   1.00 1.00 ? 2  LYS A HE3  11 
ATOM   7624  H HZ1  . LYS A 1 2  ? 1.176   -1.970 -0.575  1.00 1.00 ? 2  LYS A HZ1  11 
ATOM   7625  H HZ2  . LYS A 1 2  ? -0.402  -1.926 -0.136  1.00 1.00 ? 2  LYS A HZ2  11 
ATOM   7626  H HZ3  . LYS A 1 2  ? 0.674   -1.027 0.681   1.00 1.00 ? 2  LYS A HZ3  11 
ATOM   7627  N N    . LEU A 1 3  ? 1.785   2.319  2.326   1.00 1.00 ? 3  LEU A N    11 
ATOM   7628  C CA   . LEU A 1 3  ? 1.299   3.224  1.298   1.00 1.00 ? 3  LEU A CA   11 
ATOM   7629  C C    . LEU A 1 3  ? 1.940   2.893  -0.055  1.00 1.00 ? 3  LEU A C    11 
ATOM   7630  O O    . LEU A 1 3  ? 2.897   2.121  -0.128  1.00 1.00 ? 3  LEU A O    11 
ATOM   7631  C CB   . LEU A 1 3  ? 1.669   4.664  1.676   1.00 1.00 ? 3  LEU A CB   11 
ATOM   7632  C CG   . LEU A 1 3  ? 1.086   5.179  3.006   1.00 1.00 ? 3  LEU A CG   11 
ATOM   7633  C CD1  . LEU A 1 3  ? 2.102   6.105  3.692   1.00 1.00 ? 3  LEU A CD1  11 
ATOM   7634  C CD2  . LEU A 1 3  ? -0.228  5.934  2.792   1.00 1.00 ? 3  LEU A CD2  11 
ATOM   7635  H H    . LEU A 1 3  ? 2.423   2.671  3.028   1.00 1.00 ? 3  LEU A H    11 
ATOM   7636  H HA   . LEU A 1 3  ? 0.219   3.137  1.230   1.00 1.00 ? 3  LEU A HA   11 
ATOM   7637  H HB2  . LEU A 1 3  ? 2.755   4.688  1.733   1.00 1.00 ? 3  LEU A HB2  11 
ATOM   7638  H HB3  . LEU A 1 3  ? 1.359   5.326  0.869   1.00 1.00 ? 3  LEU A HB3  11 
ATOM   7639  H HG   . LEU A 1 3  ? 0.870   4.348  3.675   1.00 1.00 ? 3  LEU A HG   11 
ATOM   7640  H HD11 . LEU A 1 3  ? 2.349   6.950  3.050   1.00 1.00 ? 3  LEU A HD11 11 
ATOM   7641  H HD12 . LEU A 1 3  ? 1.692   6.482  4.628   1.00 1.00 ? 3  LEU A HD12 11 
ATOM   7642  H HD13 . LEU A 1 3  ? 3.017   5.553  3.910   1.00 1.00 ? 3  LEU A HD13 11 
ATOM   7643  H HD21 . LEU A 1 3  ? -0.086  6.788  2.132   1.00 1.00 ? 3  LEU A HD21 11 
ATOM   7644  H HD22 . LEU A 1 3  ? -0.958  5.259  2.358   1.00 1.00 ? 3  LEU A HD22 11 
ATOM   7645  H HD23 . LEU A 1 3  ? -0.601  6.287  3.752   1.00 1.00 ? 3  LEU A HD23 11 
ATOM   7646  N N    . CYS A 1 4  ? 1.423   3.506  -1.122  1.00 1.00 ? 4  CYS A N    11 
ATOM   7647  C CA   . CYS A 1 4  ? 2.015   3.526  -2.456  1.00 1.00 ? 4  CYS A CA   11 
ATOM   7648  C C    . CYS A 1 4  ? 1.972   4.987  -2.881  1.00 1.00 ? 4  CYS A C    11 
ATOM   7649  O O    . CYS A 1 4  ? 1.064   5.703  -2.452  1.00 1.00 ? 4  CYS A O    11 
ATOM   7650  C CB   . CYS A 1 4  ? 1.243   2.666  -3.464  1.00 1.00 ? 4  CYS A CB   11 
ATOM   7651  S SG   . CYS A 1 4  ? 1.324   0.882  -3.225  1.00 1.00 ? 4  CYS A SG   11 
ATOM   7652  H H    . CYS A 1 4  ? 0.610   4.104  -0.990  1.00 1.00 ? 4  CYS A H    11 
ATOM   7653  H HA   . CYS A 1 4  ? 3.053   3.190  -2.419  1.00 1.00 ? 4  CYS A HA   11 
ATOM   7654  H HB2  . CYS A 1 4  ? 0.189   2.939  -3.455  1.00 1.00 ? 4  CYS A HB2  11 
ATOM   7655  H HB3  . CYS A 1 4  ? 1.641   2.864  -4.459  1.00 1.00 ? 4  CYS A HB3  11 
ATOM   7656  N N    . GLU A 1 5  ? 2.955   5.438  -3.670  1.00 1.00 ? 5  GLU A N    11 
ATOM   7657  C CA   . GLU A 1 5  ? 3.131   6.851  -3.968  1.00 1.00 ? 5  GLU A CA   11 
ATOM   7658  C C    . GLU A 1 5  ? 2.859   7.202  -5.430  1.00 1.00 ? 5  GLU A C    11 
ATOM   7659  O O    . GLU A 1 5  ? 3.101   6.403  -6.332  1.00 1.00 ? 5  GLU A O    11 
ATOM   7660  C CB   . GLU A 1 5  ? 4.508   7.345  -3.504  1.00 1.00 ? 5  GLU A CB   11 
ATOM   7661  C CG   . GLU A 1 5  ? 5.697   6.531  -4.032  1.00 1.00 ? 5  GLU A CG   11 
ATOM   7662  C CD   . GLU A 1 5  ? 7.021   7.200  -3.665  1.00 1.00 ? 5  GLU A CD   11 
ATOM   7663  O OE1  . GLU A 1 5  ? 7.380   7.247  -2.490  1.00 1.00 ? 5  GLU A OE1  11 
ATOM   7664  O OE2  . GLU A 1 5  ? 7.728   7.733  -4.697  1.00 1.00 ? 5  GLU A OE2  11 
ATOM   7665  H H    . GLU A 1 5  ? 3.631   4.794  -4.050  1.00 1.00 ? 5  GLU A H    11 
ATOM   7666  H HA   . GLU A 1 5  ? 2.404   7.399  -3.384  1.00 1.00 ? 5  GLU A HA   11 
ATOM   7667  H HB2  . GLU A 1 5  ? 4.617   8.384  -3.814  1.00 1.00 ? 5  GLU A HB2  11 
ATOM   7668  H HB3  . GLU A 1 5  ? 4.531   7.315  -2.418  1.00 1.00 ? 5  GLU A HB3  11 
ATOM   7669  H HG2  . GLU A 1 5  ? 5.687   5.532  -3.597  1.00 1.00 ? 5  GLU A HG2  11 
ATOM   7670  H HG3  . GLU A 1 5  ? 5.633   6.446  -5.118  1.00 1.00 ? 5  GLU A HG3  11 
ATOM   7671  H HE2  . GLU A 1 5  ? 8.550   8.112  -4.381  1.00 1.00 ? 5  GLU A HE2  11 
ATOM   7672  N N    . ARG A 1 6  ? 2.379   8.430  -5.637  1.00 1.00 ? 6  ARG A N    11 
ATOM   7673  C CA   . ARG A 1 6  ? 2.184   9.089  -6.914  1.00 1.00 ? 6  ARG A CA   11 
ATOM   7674  C C    . ARG A 1 6  ? 3.051   10.355 -6.883  1.00 1.00 ? 6  ARG A C    11 
ATOM   7675  O O    . ARG A 1 6  ? 2.822   11.213 -6.028  1.00 1.00 ? 6  ARG A O    11 
ATOM   7676  C CB   . ARG A 1 6  ? 0.695   9.449  -7.065  1.00 1.00 ? 6  ARG A CB   11 
ATOM   7677  C CG   . ARG A 1 6  ? 0.292   10.054 -8.412  1.00 1.00 ? 6  ARG A CG   11 
ATOM   7678  C CD   . ARG A 1 6  ? 0.529   9.159  -9.643  1.00 1.00 ? 6  ARG A CD   11 
ATOM   7679  N NE   . ARG A 1 6  ? 1.798   9.457  -10.331 1.00 1.00 ? 6  ARG A NE   11 
ATOM   7680  C CZ   . ARG A 1 6  ? 2.106   10.642 -10.887 1.00 1.00 ? 6  ARG A CZ   11 
ATOM   7681  N NH1  . ARG A 1 6  ? 1.188   11.601 -10.969 1.00 1.00 ? 6  ARG A NH1  11 
ATOM   7682  N NH2  . ARG A 1 6  ? 3.331   10.898 -11.354 1.00 1.00 ? 6  ARG A NH2  11 
ATOM   7683  H H    . ARG A 1 6  ? 2.247   9.013  -4.818  1.00 1.00 ? 6  ARG A H    11 
ATOM   7684  H HA   . ARG A 1 6  ? 2.456   8.422  -7.730  1.00 1.00 ? 6  ARG A HA   11 
ATOM   7685  H HB2  . ARG A 1 6  ? 0.073   8.575  -6.867  1.00 1.00 ? 6  ARG A HB2  11 
ATOM   7686  H HB3  . ARG A 1 6  ? 0.451   10.215 -6.329  1.00 1.00 ? 6  ARG A HB3  11 
ATOM   7687  H HG2  . ARG A 1 6  ? -0.780  10.245 -8.347  1.00 1.00 ? 6  ARG A HG2  11 
ATOM   7688  H HG3  . ARG A 1 6  ? 0.791   11.016 -8.504  1.00 1.00 ? 6  ARG A HG3  11 
ATOM   7689  H HD2  . ARG A 1 6  ? 0.513   8.111  -9.334  1.00 1.00 ? 6  ARG A HD2  11 
ATOM   7690  H HD3  . ARG A 1 6  ? -0.292  9.294  -10.351 1.00 1.00 ? 6  ARG A HD3  11 
ATOM   7691  H HE   . ARG A 1 6  ? 2.471   8.706  -10.363 1.00 1.00 ? 6  ARG A HE   11 
ATOM   7692  H HH11 . ARG A 1 6  ? 0.265   11.456 -10.591 1.00 1.00 ? 6  ARG A HH11 11 
ATOM   7693  H HH12 . ARG A 1 6  ? 1.512   12.534 -11.202 1.00 1.00 ? 6  ARG A HH12 11 
ATOM   7694  H HH21 . ARG A 1 6  ? 4.063   10.205 -11.368 1.00 1.00 ? 6  ARG A HH21 11 
ATOM   7695  H HH22 . ARG A 1 6  ? 3.542   11.862 -11.612 1.00 1.00 ? 6  ARG A HH22 11 
ATOM   7696  N N    . PRO A 1 7  ? 4.069   10.464 -7.750  1.00 1.00 ? 7  PRO A N    11 
ATOM   7697  C CA   . PRO A 1 7  ? 4.810   11.701 -7.958  1.00 1.00 ? 7  PRO A CA   11 
ATOM   7698  C C    . PRO A 1 7  ? 3.914   12.798 -8.552  1.00 1.00 ? 7  PRO A C    11 
ATOM   7699  O O    . PRO A 1 7  ? 2.704   12.620 -8.680  1.00 1.00 ? 7  PRO A O    11 
ATOM   7700  C CB   . PRO A 1 7  ? 5.965   11.334 -8.899  1.00 1.00 ? 7  PRO A CB   11 
ATOM   7701  C CG   . PRO A 1 7  ? 6.160   9.837  -8.656  1.00 1.00 ? 7  PRO A CG   11 
ATOM   7702  C CD   . PRO A 1 7  ? 4.737   9.348  -8.394  1.00 1.00 ? 7  PRO A CD   11 
ATOM   7703  H HA   . PRO A 1 7  ? 5.220   12.033 -7.009  1.00 1.00 ? 7  PRO A HA   11 
ATOM   7704  H HB2  . PRO A 1 7  ? 5.673   11.490 -9.937  1.00 1.00 ? 7  PRO A HB2  11 
ATOM   7705  H HB3  . PRO A 1 7  ? 6.869   11.906 -8.678  1.00 1.00 ? 7  PRO A HB3  11 
ATOM   7706  H HG2  . PRO A 1 7  ? 6.628   9.331  -9.502  1.00 1.00 ? 7  PRO A HG2  11 
ATOM   7707  H HG3  . PRO A 1 7  ? 6.761   9.694  -7.756  1.00 1.00 ? 7  PRO A HG3  11 
ATOM   7708  H HD2  . PRO A 1 7  ? 4.244   9.115  -9.334  1.00 1.00 ? 7  PRO A HD2  11 
ATOM   7709  H HD3  . PRO A 1 7  ? 4.755   8.465  -7.753  1.00 1.00 ? 7  PRO A HD3  11 
ATOM   7710  N N    . SER A 1 8  ? 4.514   13.914 -8.973  1.00 1.00 ? 8  SER A N    11 
ATOM   7711  C CA   . SER A 1 8  ? 3.807   15.054 -9.535  1.00 1.00 ? 8  SER A CA   11 
ATOM   7712  C C    . SER A 1 8  ? 2.828   14.664 -10.658 1.00 1.00 ? 8  SER A C    11 
ATOM   7713  O O    . SER A 1 8  ? 2.993   13.636 -11.325 1.00 1.00 ? 8  SER A O    11 
ATOM   7714  C CB   . SER A 1 8  ? 4.846   16.068 -10.014 1.00 1.00 ? 8  SER A CB   11 
ATOM   7715  O OG   . SER A 1 8  ? 5.879   16.225 -9.052  1.00 1.00 ? 8  SER A OG   11 
ATOM   7716  H H    . SER A 1 8  ? 5.492   14.067 -8.772  1.00 1.00 ? 8  SER A H    11 
ATOM   7717  H HA   . SER A 1 8  ? 3.240   15.508 -8.720  1.00 1.00 ? 8  SER A HA   11 
ATOM   7718  H HB2  . SER A 1 8  ? 5.282   15.729 -10.957 1.00 1.00 ? 8  SER A HB2  11 
ATOM   7719  H HB3  . SER A 1 8  ? 4.349   17.022 -10.172 1.00 1.00 ? 8  SER A HB3  11 
ATOM   7720  H HG   . SER A 1 8  ? 6.392   17.009 -9.300  1.00 1.00 ? 8  SER A HG   11 
ATOM   7721  N N    . GLY A 1 9  ? 1.781   15.471 -10.852 1.00 1.00 ? 9  GLY A N    11 
ATOM   7722  C CA   . GLY A 1 9  ? 0.666   15.173 -11.744 1.00 1.00 ? 9  GLY A CA   11 
ATOM   7723  C C    . GLY A 1 9  ? -0.550  15.987 -11.318 1.00 1.00 ? 9  GLY A C    11 
ATOM   7724  O O    . GLY A 1 9  ? -1.111  16.731 -12.115 1.00 1.00 ? 9  GLY A O    11 
ATOM   7725  H H    . GLY A 1 9  ? 1.760   16.371 -10.380 1.00 1.00 ? 9  GLY A H    11 
ATOM   7726  H HA2  . GLY A 1 9  ? 0.941   15.424 -12.768 1.00 1.00 ? 9  GLY A HA2  11 
ATOM   7727  H HA3  . GLY A 1 9  ? 0.390   14.122 -11.692 1.00 1.00 ? 9  GLY A HA3  11 
ATOM   7728  N N    . THR A 1 10 ? -0.897  15.902 -10.030 1.00 1.00 ? 10 THR A N    11 
ATOM   7729  C CA   . THR A 1 10 ? -1.895  16.778 -9.434  1.00 1.00 ? 10 THR A CA   11 
ATOM   7730  C C    . THR A 1 10 ? -1.151  18.068 -9.095  1.00 1.00 ? 10 THR A C    11 
ATOM   7731  O O    . THR A 1 10 ? -1.585  19.163 -9.444  1.00 1.00 ? 10 THR A O    11 
ATOM   7732  C CB   . THR A 1 10 ? -2.468  16.127 -8.164  1.00 1.00 ? 10 THR A CB   11 
ATOM   7733  O OG1  . THR A 1 10 ? -2.533  14.719 -8.322  1.00 1.00 ? 10 THR A OG1  11 
ATOM   7734  C CG2  . THR A 1 10 ? -3.858  16.673 -7.836  1.00 1.00 ? 10 THR A CG2  11 
ATOM   7735  H H    . THR A 1 10 ? -0.454  15.220 -9.435  1.00 1.00 ? 10 THR A H    11 
ATOM   7736  H HA   . THR A 1 10 ? -2.699  16.976 -10.145 1.00 1.00 ? 10 THR A HA   11 
ATOM   7737  H HB   . THR A 1 10 ? -1.820  16.343 -7.311  1.00 1.00 ? 10 THR A HB   11 
ATOM   7738  H HG1  . THR A 1 10 ? -3.053  14.528 -9.108  1.00 1.00 ? 10 THR A HG1  11 
ATOM   7739  H HG21 . THR A 1 10 ? -3.804  17.755 -7.703  1.00 1.00 ? 10 THR A HG21 11 
ATOM   7740  H HG22 . THR A 1 10 ? -4.555  16.444 -8.642  1.00 1.00 ? 10 THR A HG22 11 
ATOM   7741  H HG23 . THR A 1 10 ? -4.223  16.227 -6.911  1.00 1.00 ? 10 THR A HG23 11 
ATOM   7742  N N    . TRP A 1 11 ? 0.009   17.918 -8.453  1.00 1.00 ? 11 TRP A N    11 
ATOM   7743  C CA   . TRP A 1 11 ? 0.941   19.009 -8.283  1.00 1.00 ? 11 TRP A CA   11 
ATOM   7744  C C    . TRP A 1 11 ? 1.665   19.209 -9.612  1.00 1.00 ? 11 TRP A C    11 
ATOM   7745  O O    . TRP A 1 11 ? 1.989   18.232 -10.297 1.00 1.00 ? 11 TRP A O    11 
ATOM   7746  C CB   . TRP A 1 11 ? 1.953   18.662 -7.198  1.00 1.00 ? 11 TRP A CB   11 
ATOM   7747  C CG   . TRP A 1 11 ? 2.977   19.732 -7.003  1.00 1.00 ? 11 TRP A CG   11 
ATOM   7748  C CD1  . TRP A 1 11 ? 4.075   19.931 -7.766  1.00 1.00 ? 11 TRP A CD1  11 
ATOM   7749  C CD2  . TRP A 1 11 ? 2.940   20.837 -6.063  1.00 1.00 ? 11 TRP A CD2  11 
ATOM   7750  N NE1  . TRP A 1 11 ? 4.669   21.123 -7.417  1.00 1.00 ? 11 TRP A NE1  11 
ATOM   7751  C CE2  . TRP A 1 11 ? 4.034   21.704 -6.338  1.00 1.00 ? 11 TRP A CE2  11 
ATOM   7752  C CE3  . TRP A 1 11 ? 2.077   21.196 -5.011  1.00 1.00 ? 11 TRP A CE3  11 
ATOM   7753  C CZ2  . TRP A 1 11 ? 4.268   22.869 -5.595  1.00 1.00 ? 11 TRP A CZ2  11 
ATOM   7754  C CZ3  . TRP A 1 11 ? 2.303   22.359 -4.254  1.00 1.00 ? 11 TRP A CZ3  11 
ATOM   7755  C CH2  . TRP A 1 11 ? 3.402   23.185 -4.536  1.00 1.00 ? 11 TRP A CH2  11 
ATOM   7756  H H    . TRP A 1 11 ? 0.321   16.991 -8.213  1.00 1.00 ? 11 TRP A H    11 
ATOM   7757  H HA   . TRP A 1 11 ? 0.406   19.918 -7.999  1.00 1.00 ? 11 TRP A HA   11 
ATOM   7758  H HB2  . TRP A 1 11 ? 1.418   18.507 -6.260  1.00 1.00 ? 11 TRP A HB2  11 
ATOM   7759  H HB3  . TRP A 1 11 ? 2.445   17.732 -7.474  1.00 1.00 ? 11 TRP A HB3  11 
ATOM   7760  H HD1  . TRP A 1 11 ? 4.387   19.306 -8.588  1.00 1.00 ? 11 TRP A HD1  11 
ATOM   7761  H HE1  . TRP A 1 11 ? 5.457   21.551 -7.891  1.00 1.00 ? 11 TRP A HE1  11 
ATOM   7762  H HE3  . TRP A 1 11 ? 1.251   20.546 -4.771  1.00 1.00 ? 11 TRP A HE3  11 
ATOM   7763  H HZ2  . TRP A 1 11 ? 5.108   23.511 -5.822  1.00 1.00 ? 11 TRP A HZ2  11 
ATOM   7764  H HZ3  . TRP A 1 11 ? 1.633   22.614 -3.447  1.00 1.00 ? 11 TRP A HZ3  11 
ATOM   7765  H HH2  . TRP A 1 11 ? 3.575   24.062 -3.938  1.00 1.00 ? 11 TRP A HH2  11 
ATOM   7766  N N    . SER A 1 12 ? 1.999   20.457 -9.939  1.00 1.00 ? 12 SER A N    11 
ATOM   7767  C CA   . SER A 1 12 ? 2.483   20.809 -11.256 1.00 1.00 ? 12 SER A CA   11 
ATOM   7768  C C    . SER A 1 12 ? 3.999   20.667 -11.379 1.00 1.00 ? 12 SER A C    11 
ATOM   7769  O O    . SER A 1 12 ? 4.738   21.642 -11.463 1.00 1.00 ? 12 SER A O    11 
ATOM   7770  C CB   . SER A 1 12 ? 2.005   22.227 -11.588 1.00 1.00 ? 12 SER A CB   11 
ATOM   7771  O OG   . SER A 1 12 ? 0.661   22.385 -11.170 1.00 1.00 ? 12 SER A OG   11 
ATOM   7772  H H    . SER A 1 12 ? 1.701   21.220 -9.348  1.00 1.00 ? 12 SER A H    11 
ATOM   7773  H HA   . SER A 1 12 ? 2.039   20.097 -11.946 1.00 1.00 ? 12 SER A HA   11 
ATOM   7774  H HB2  . SER A 1 12 ? 2.616   22.960 -11.054 1.00 1.00 ? 12 SER A HB2  11 
ATOM   7775  H HB3  . SER A 1 12 ? 2.101   22.410 -12.658 1.00 1.00 ? 12 SER A HB3  11 
ATOM   7776  H HG   . SER A 1 12 ? 0.119   21.701 -11.572 1.00 1.00 ? 12 SER A HG   11 
ATOM   7777  N N    . GLY A 1 13 ? 4.443   19.414 -11.451 1.00 1.00 ? 13 GLY A N    11 
ATOM   7778  C CA   . GLY A 1 13 ? 5.818   19.076 -11.785 1.00 1.00 ? 13 GLY A CA   11 
ATOM   7779  C C    . GLY A 1 13 ? 6.782   19.438 -10.659 1.00 1.00 ? 13 GLY A C    11 
ATOM   7780  O O    . GLY A 1 13 ? 6.886   18.696 -9.682  1.00 1.00 ? 13 GLY A O    11 
ATOM   7781  H H    . GLY A 1 13 ? 3.754   18.678 -11.343 1.00 1.00 ? 13 GLY A H    11 
ATOM   7782  H HA2  . GLY A 1 13 ? 5.882   18.004 -11.970 1.00 1.00 ? 13 GLY A HA2  11 
ATOM   7783  H HA3  . GLY A 1 13 ? 6.106   19.592 -12.703 1.00 1.00 ? 13 GLY A HA3  11 
ATOM   7784  N N    . VAL A 1 14 ? 7.509   20.548 -10.807 1.00 1.00 ? 14 VAL A N    11 
ATOM   7785  C CA   . VAL A 1 14 ? 8.539   20.943 -9.857  1.00 1.00 ? 14 VAL A CA   11 
ATOM   7786  C C    . VAL A 1 14 ? 7.861   21.509 -8.614  1.00 1.00 ? 14 VAL A C    11 
ATOM   7787  O O    . VAL A 1 14 ? 6.899   22.265 -8.727  1.00 1.00 ? 14 VAL A O    11 
ATOM   7788  C CB   . VAL A 1 14 ? 9.516   21.951 -10.485 1.00 1.00 ? 14 VAL A CB   11 
ATOM   7789  C CG1  . VAL A 1 14 ? 10.683  22.247 -9.533  1.00 1.00 ? 14 VAL A CG1  11 
ATOM   7790  C CG2  . VAL A 1 14 ? 10.092  21.413 -11.802 1.00 1.00 ? 14 VAL A CG2  11 
ATOM   7791  H H    . VAL A 1 14 ? 7.273   21.183 -11.557 1.00 1.00 ? 14 VAL A H    11 
ATOM   7792  H HA   . VAL A 1 14 ? 9.103   20.053 -9.587  1.00 1.00 ? 14 VAL A HA   11 
ATOM   7793  H HB   . VAL A 1 14 ? 8.988   22.885 -10.680 1.00 1.00 ? 14 VAL A HB   11 
ATOM   7794  H HG11 . VAL A 1 14 ? 11.216  21.325 -9.300  1.00 1.00 ? 14 VAL A HG11 11 
ATOM   7795  H HG12 . VAL A 1 14 ? 11.375  22.944 -10.005 1.00 1.00 ? 14 VAL A HG12 11 
ATOM   7796  H HG13 . VAL A 1 14 ? 10.322  22.699 -8.609  1.00 1.00 ? 14 VAL A HG13 11 
ATOM   7797  H HG21 . VAL A 1 14 ? 10.569  20.447 -11.630 1.00 1.00 ? 14 VAL A HG21 11 
ATOM   7798  H HG22 . VAL A 1 14 ? 9.306   21.296 -12.546 1.00 1.00 ? 14 VAL A HG22 11 
ATOM   7799  H HG23 . VAL A 1 14 ? 10.833  22.111 -12.192 1.00 1.00 ? 14 VAL A HG23 11 
ATOM   7800  N N    . CYS A 1 15 ? 8.331   21.118 -7.427  1.00 1.00 ? 15 CYS A N    11 
ATOM   7801  C CA   . CYS A 1 15 ? 7.717   21.502 -6.160  1.00 1.00 ? 15 CYS A CA   11 
ATOM   7802  C C    . CYS A 1 15 ? 8.555   22.504 -5.386  1.00 1.00 ? 15 CYS A C    11 
ATOM   7803  O O    . CYS A 1 15 ? 8.046   23.551 -4.994  1.00 1.00 ? 15 CYS A O    11 
ATOM   7804  C CB   . CYS A 1 15 ? 7.355   20.261 -5.341  1.00 1.00 ? 15 CYS A CB   11 
ATOM   7805  S SG   . CYS A 1 15 ? 8.640   19.040 -5.028  1.00 1.00 ? 15 CYS A SG   11 
ATOM   7806  H H    . CYS A 1 15 ? 9.094   20.457 -7.412  1.00 1.00 ? 15 CYS A H    11 
ATOM   7807  H HA   . CYS A 1 15 ? 6.788   22.024 -6.349  1.00 1.00 ? 15 CYS A HA   11 
ATOM   7808  H HB2  . CYS A 1 15 ? 6.930   20.547 -4.386  1.00 1.00 ? 15 CYS A HB2  11 
ATOM   7809  H HB3  . CYS A 1 15 ? 6.590   19.741 -5.906  1.00 1.00 ? 15 CYS A HB3  11 
ATOM   7810  N N    . GLY A 1 16 ? 9.820   22.186 -5.121  1.00 1.00 ? 16 GLY A N    11 
ATOM   7811  C CA   . GLY A 1 16 ? 10.673  22.953 -4.222  1.00 1.00 ? 16 GLY A CA   11 
ATOM   7812  C C    . GLY A 1 16 ? 10.251  22.827 -2.750  1.00 1.00 ? 16 GLY A C    11 
ATOM   7813  O O    . GLY A 1 16 ? 11.038  22.400 -1.909  1.00 1.00 ? 16 GLY A O    11 
ATOM   7814  H H    . GLY A 1 16 ? 10.172  21.334 -5.515  1.00 1.00 ? 16 GLY A H    11 
ATOM   7815  H HA2  . GLY A 1 16 ? 11.700  22.610 -4.323  1.00 1.00 ? 16 GLY A HA2  11 
ATOM   7816  H HA3  . GLY A 1 16 ? 10.643  24.007 -4.505  1.00 1.00 ? 16 GLY A HA3  11 
ATOM   7817  N N    . ASN A 1 17 ? 9.010   23.211 -2.445  1.00 1.00 ? 17 ASN A N    11 
ATOM   7818  C CA   . ASN A 1 17 ? 8.486   23.383 -1.093  1.00 1.00 ? 17 ASN A CA   11 
ATOM   7819  C C    . ASN A 1 17 ? 7.687   22.166 -0.610  1.00 1.00 ? 17 ASN A C    11 
ATOM   7820  O O    . ASN A 1 17 ? 6.614   21.850 -1.131  1.00 1.00 ? 17 ASN A O    11 
ATOM   7821  C CB   . ASN A 1 17 ? 7.643   24.661 -1.024  1.00 1.00 ? 17 ASN A CB   11 
ATOM   7822  C CG   . ASN A 1 17 ? 7.232   24.969 0.416   1.00 1.00 ? 17 ASN A CG   11 
ATOM   7823  O OD1  . ASN A 1 17 ? 6.561   24.173 1.065   1.00 1.00 ? 17 ASN A OD1  11 
ATOM   7824  N ND2  . ASN A 1 17 ? 7.646   26.115 0.946   1.00 1.00 ? 17 ASN A ND2  11 
ATOM   7825  H H    . ASN A 1 17 ? 8.423   23.440 -3.234  1.00 1.00 ? 17 ASN A H    11 
ATOM   7826  H HA   . ASN A 1 17 ? 9.330   23.541 -0.419  1.00 1.00 ? 17 ASN A HA   11 
ATOM   7827  H HB2  . ASN A 1 17 ? 8.228   25.491 -1.422  1.00 1.00 ? 17 ASN A HB2  11 
ATOM   7828  H HB3  . ASN A 1 17 ? 6.750   24.548 -1.638  1.00 1.00 ? 17 ASN A HB3  11 
ATOM   7829  H HD21 . ASN A 1 17 ? 8.197   26.766 0.408   1.00 1.00 ? 17 ASN A HD21 11 
ATOM   7830  H HD22 . ASN A 1 17 ? 7.389   26.325 1.898   1.00 1.00 ? 17 ASN A HD22 11 
ATOM   7831  N N    . ASN A 1 18 ? 8.210   21.509 0.428   1.00 1.00 ? 18 ASN A N    11 
ATOM   7832  C CA   . ASN A 1 18 ? 7.641   20.318 1.035   1.00 1.00 ? 18 ASN A CA   11 
ATOM   7833  C C    . ASN A 1 18 ? 6.219   20.514 1.533   1.00 1.00 ? 18 ASN A C    11 
ATOM   7834  O O    . ASN A 1 18 ? 5.294   19.831 1.094   1.00 1.00 ? 18 ASN A O    11 
ATOM   7835  C CB   . ASN A 1 18 ? 8.565   19.846 2.158   1.00 1.00 ? 18 ASN A CB   11 
ATOM   7836  C CG   . ASN A 1 18 ? 8.166   18.448 2.589   1.00 1.00 ? 18 ASN A CG   11 
ATOM   7837  O OD1  . ASN A 1 18 ? 7.356   18.273 3.495   1.00 1.00 ? 18 ASN A OD1  11 
ATOM   7838  N ND2  . ASN A 1 18 ? 8.678   17.428 1.915   1.00 1.00 ? 18 ASN A ND2  11 
ATOM   7839  H H    . ASN A 1 18 ? 9.105   21.814 0.780   1.00 1.00 ? 18 ASN A H    11 
ATOM   7840  H HA   . ASN A 1 18 ? 7.569   19.551 0.282   1.00 1.00 ? 18 ASN A HA   11 
ATOM   7841  H HB2  . ASN A 1 18 ? 9.592   19.843 1.803   1.00 1.00 ? 18 ASN A HB2  11 
ATOM   7842  H HB3  . ASN A 1 18 ? 8.514   20.518 3.015   1.00 1.00 ? 18 ASN A HB3  11 
ATOM   7843  H HD21 . ASN A 1 18 ? 9.380   17.521 1.180   1.00 1.00 ? 18 ASN A HD21 11 
ATOM   7844  H HD22 . ASN A 1 18 ? 8.360   16.517 2.215   1.00 1.00 ? 18 ASN A HD22 11 
ATOM   7845  N N    . ASN A 1 19 ? 6.077   21.431 2.483   1.00 1.00 ? 19 ASN A N    11 
ATOM   7846  C CA   . ASN A 1 19 ? 4.808   21.802 3.095   1.00 1.00 ? 19 ASN A CA   11 
ATOM   7847  C C    . ASN A 1 19 ? 3.746   22.079 2.031   1.00 1.00 ? 19 ASN A C    11 
ATOM   7848  O O    . ASN A 1 19 ? 2.605   21.646 2.187   1.00 1.00 ? 19 ASN A O    11 
ATOM   7849  C CB   . ASN A 1 19 ? 4.986   23.018 4.013   1.00 1.00 ? 19 ASN A CB   11 
ATOM   7850  C CG   . ASN A 1 19 ? 3.857   23.197 5.036   1.00 1.00 ? 19 ASN A CG   11 
ATOM   7851  O OD1  . ASN A 1 19 ? 4.120   23.613 6.158   1.00 1.00 ? 19 ASN A OD1  11 
ATOM   7852  N ND2  . ASN A 1 19 ? 2.603   22.886 4.709   1.00 1.00 ? 19 ASN A ND2  11 
ATOM   7853  H H    . ASN A 1 19 ? 6.937   21.849 2.795   1.00 1.00 ? 19 ASN A H    11 
ATOM   7854  H HA   . ASN A 1 19 ? 4.478   20.964 3.709   1.00 1.00 ? 19 ASN A HA   11 
ATOM   7855  H HB2  . ASN A 1 19 ? 5.912   22.897 4.576   1.00 1.00 ? 19 ASN A HB2  11 
ATOM   7856  H HB3  . ASN A 1 19 ? 5.070   23.928 3.415   1.00 1.00 ? 19 ASN A HB3  11 
ATOM   7857  H HD21 . ASN A 1 19 ? 2.349   22.511 3.802   1.00 1.00 ? 19 ASN A HD21 11 
ATOM   7858  H HD22 . ASN A 1 19 ? 1.893   23.034 5.410   1.00 1.00 ? 19 ASN A HD22 11 
ATOM   7859  N N    . ALA A 1 20 ? 4.096   22.821 0.979   1.00 1.00 ? 20 ALA A N    11 
ATOM   7860  C CA   . ALA A 1 20 ? 3.157   23.155 -0.079  1.00 1.00 ? 20 ALA A CA   11 
ATOM   7861  C C    . ALA A 1 20 ? 2.694   21.885 -0.786  1.00 1.00 ? 20 ALA A C    11 
ATOM   7862  O O    . ALA A 1 20 ? 1.493   21.631 -0.848  1.00 1.00 ? 20 ALA A O    11 
ATOM   7863  C CB   . ALA A 1 20 ? 3.767   24.148 -1.066  1.00 1.00 ? 20 ALA A CB   11 
ATOM   7864  H H    . ALA A 1 20 ? 5.047   23.171 0.921   1.00 1.00 ? 20 ALA A H    11 
ATOM   7865  H HA   . ALA A 1 20 ? 2.288   23.635 0.375   1.00 1.00 ? 20 ALA A HA   11 
ATOM   7866  H HB1  . ALA A 1 20 ? 4.149   25.019 -0.536  1.00 1.00 ? 20 ALA A HB1  11 
ATOM   7867  H HB2  . ALA A 1 20 ? 4.573   23.677 -1.629  1.00 1.00 ? 20 ALA A HB2  11 
ATOM   7868  H HB3  . ALA A 1 20 ? 2.989   24.473 -1.757  1.00 1.00 ? 20 ALA A HB3  11 
ATOM   7869  N N    . CYS A 1 21 ? 3.639   21.083 -1.296  1.00 1.00 ? 21 CYS A N    11 
ATOM   7870  C CA   . CYS A 1 21 ? 3.316   19.821 -1.964  1.00 1.00 ? 21 CYS A CA   11 
ATOM   7871  C C    . CYS A 1 21 ? 2.407   18.960 -1.088  1.00 1.00 ? 21 CYS A C    11 
ATOM   7872  O O    . CYS A 1 21 ? 1.325   18.550 -1.508  1.00 1.00 ? 21 CYS A O    11 
ATOM   7873  C CB   . CYS A 1 21 ? 4.591   19.055 -2.328  1.00 1.00 ? 21 CYS A CB   11 
ATOM   7874  S SG   . CYS A 1 21 ? 4.337   17.287 -2.641  1.00 1.00 ? 21 CYS A SG   11 
ATOM   7875  H H    . CYS A 1 21 ? 4.615   21.349 -1.194  1.00 1.00 ? 21 CYS A H    11 
ATOM   7876  H HA   . CYS A 1 21 ? 2.781   20.046 -2.879  1.00 1.00 ? 21 CYS A HA   11 
ATOM   7877  H HB2  . CYS A 1 21 ? 5.052   19.507 -3.204  1.00 1.00 ? 21 CYS A HB2  11 
ATOM   7878  H HB3  . CYS A 1 21 ? 5.290   19.118 -1.495  1.00 1.00 ? 21 CYS A HB3  11 
ATOM   7879  N N    . LYS A 1 22 ? 2.857   18.721 0.145   1.00 1.00 ? 22 LYS A N    11 
ATOM   7880  C CA   . LYS A 1 22 ? 2.148   17.969 1.164   1.00 1.00 ? 22 LYS A CA   11 
ATOM   7881  C C    . LYS A 1 22 ? 0.711   18.463 1.296   1.00 1.00 ? 22 LYS A C    11 
ATOM   7882  O O    . LYS A 1 22 ? -0.235  17.713 1.040   1.00 1.00 ? 22 LYS A O    11 
ATOM   7883  C CB   . LYS A 1 22 ? 2.932   18.143 2.475   1.00 1.00 ? 22 LYS A CB   11 
ATOM   7884  C CG   . LYS A 1 22 ? 2.302   17.457 3.695   1.00 1.00 ? 22 LYS A CG   11 
ATOM   7885  C CD   . LYS A 1 22 ? 3.084   17.716 5.000   1.00 1.00 ? 22 LYS A CD   11 
ATOM   7886  C CE   . LYS A 1 22 ? 4.612   17.878 4.873   1.00 1.00 ? 22 LYS A CE   11 
ATOM   7887  N NZ   . LYS A 1 22 ? 5.298   16.688 4.331   1.00 1.00 ? 22 LYS A NZ   11 
ATOM   7888  H H    . LYS A 1 22 ? 3.746   19.139 0.402   1.00 1.00 ? 22 LYS A H    11 
ATOM   7889  H HA   . LYS A 1 22 ? 2.116   16.920 0.862   1.00 1.00 ? 22 LYS A HA   11 
ATOM   7890  H HB2  . LYS A 1 22 ? 3.931   17.754 2.294   1.00 1.00 ? 22 LYS A HB2  11 
ATOM   7891  H HB3  . LYS A 1 22 ? 3.024   19.203 2.701   1.00 1.00 ? 22 LYS A HB3  11 
ATOM   7892  H HG2  . LYS A 1 22 ? 1.293   17.845 3.848   1.00 1.00 ? 22 LYS A HG2  11 
ATOM   7893  H HG3  . LYS A 1 22 ? 2.192   16.395 3.498   1.00 1.00 ? 22 LYS A HG3  11 
ATOM   7894  H HD2  . LYS A 1 22 ? 2.710   18.654 5.417   1.00 1.00 ? 22 LYS A HD2  11 
ATOM   7895  H HD3  . LYS A 1 22 ? 2.845   16.928 5.718   1.00 1.00 ? 22 LYS A HD3  11 
ATOM   7896  H HE2  . LYS A 1 22 ? 4.835   18.729 4.231   1.00 1.00 ? 22 LYS A HE2  11 
ATOM   7897  H HE3  . LYS A 1 22 ? 5.027   18.097 5.858   1.00 1.00 ? 22 LYS A HE3  11 
ATOM   7898  H HZ1  . LYS A 1 22 ? 4.857   16.368 3.480   1.00 1.00 ? 22 LYS A HZ1  11 
ATOM   7899  H HZ2  . LYS A 1 22 ? 6.257   16.923 4.086   1.00 1.00 ? 22 LYS A HZ2  11 
ATOM   7900  H HZ3  . LYS A 1 22 ? 5.299   15.923 4.986   1.00 1.00 ? 22 LYS A HZ3  11 
ATOM   7901  N N    . ASN A 1 23 ? 0.566   19.719 1.732   1.00 1.00 ? 23 ASN A N    11 
ATOM   7902  C CA   . ASN A 1 23 ? -0.736  20.304 1.988   1.00 1.00 ? 23 ASN A CA   11 
ATOM   7903  C C    . ASN A 1 23 ? -1.580  20.177 0.732   1.00 1.00 ? 23 ASN A C    11 
ATOM   7904  O O    . ASN A 1 23 ? -2.605  19.511 0.753   1.00 1.00 ? 23 ASN A O    11 
ATOM   7905  C CB   . ASN A 1 23 ? -0.620  21.779 2.405   1.00 1.00 ? 23 ASN A CB   11 
ATOM   7906  C CG   . ASN A 1 23 ? -1.950  22.528 2.246   1.00 1.00 ? 23 ASN A CG   11 
ATOM   7907  O OD1  . ASN A 1 23 ? -2.982  22.132 2.780   1.00 1.00 ? 23 ASN A OD1  11 
ATOM   7908  N ND2  . ASN A 1 23 ? -1.948  23.617 1.484   1.00 1.00 ? 23 ASN A ND2  11 
ATOM   7909  H H    . ASN A 1 23 ? 1.390   20.297 1.864   1.00 1.00 ? 23 ASN A H    11 
ATOM   7910  H HA   . ASN A 1 23 ? -1.193  19.728 2.796   1.00 1.00 ? 23 ASN A HA   11 
ATOM   7911  H HB2  . ASN A 1 23 ? -0.291  21.839 3.443   1.00 1.00 ? 23 ASN A HB2  11 
ATOM   7912  H HB3  . ASN A 1 23 ? 0.125   22.266 1.777   1.00 1.00 ? 23 ASN A HB3  11 
ATOM   7913  H HD21 . ASN A 1 23 ? -1.100  23.935 1.040   1.00 1.00 ? 23 ASN A HD21 11 
ATOM   7914  H HD22 . ASN A 1 23 ? -2.811  24.124 1.356   1.00 1.00 ? 23 ASN A HD22 11 
ATOM   7915  N N    . GLN A 1 24 ? -1.141  20.801 -0.362  1.00 1.00 ? 24 GLN A N    11 
ATOM   7916  C CA   . GLN A 1 24 ? -1.917  20.861 -1.586  1.00 1.00 ? 24 GLN A CA   11 
ATOM   7917  C C    . GLN A 1 24 ? -2.365  19.465 -2.001  1.00 1.00 ? 24 GLN A C    11 
ATOM   7918  O O    . GLN A 1 24 ? -3.540  19.291 -2.309  1.00 1.00 ? 24 GLN A O    11 
ATOM   7919  C CB   . GLN A 1 24 ? -1.136  21.617 -2.668  1.00 1.00 ? 24 GLN A CB   11 
ATOM   7920  C CG   . GLN A 1 24 ? -2.033  21.958 -3.863  1.00 1.00 ? 24 GLN A CG   11 
ATOM   7921  C CD   . GLN A 1 24 ? -1.437  23.053 -4.741  1.00 1.00 ? 24 GLN A CD   11 
ATOM   7922  O OE1  . GLN A 1 24 ? -1.773  24.223 -4.597  1.00 1.00 ? 24 GLN A OE1  11 
ATOM   7923  N NE2  . GLN A 1 24 ? -0.556  22.689 -5.665  1.00 1.00 ? 24 GLN A NE2  11 
ATOM   7924  H H    . GLN A 1 24 ? -0.221  21.232 -0.356  1.00 1.00 ? 24 GLN A H    11 
ATOM   7925  H HA   . GLN A 1 24 ? -2.835  21.412 -1.373  1.00 1.00 ? 24 GLN A HA   11 
ATOM   7926  H HB2  . GLN A 1 24 ? -0.777  22.553 -2.238  1.00 1.00 ? 24 GLN A HB2  11 
ATOM   7927  H HB3  . GLN A 1 24 ? -0.280  21.026 -2.993  1.00 1.00 ? 24 GLN A HB3  11 
ATOM   7928  H HG2  . GLN A 1 24 ? -2.214  21.061 -4.455  1.00 1.00 ? 24 GLN A HG2  11 
ATOM   7929  H HG3  . GLN A 1 24 ? -2.985  22.339 -3.498  1.00 1.00 ? 24 GLN A HG3  11 
ATOM   7930  H HE21 . GLN A 1 24 ? -0.263  21.729 -5.739  1.00 1.00 ? 24 GLN A HE21 11 
ATOM   7931  H HE22 . GLN A 1 24 ? -0.151  23.404 -6.250  1.00 1.00 ? 24 GLN A HE22 11 
ATOM   7932  N N    . CYS A 1 25 ? -1.487  18.458 -1.936  1.00 1.00 ? 25 CYS A N    11 
ATOM   7933  C CA   . CYS A 1 25 ? -1.921  17.098 -2.212  1.00 1.00 ? 25 CYS A CA   11 
ATOM   7934  C C    . CYS A 1 25 ? -3.085  16.674 -1.315  1.00 1.00 ? 25 CYS A C    11 
ATOM   7935  O O    . CYS A 1 25 ? -4.183  16.428 -1.812  1.00 1.00 ? 25 CYS A O    11 
ATOM   7936  C CB   . CYS A 1 25 ? -0.802  16.073 -2.061  1.00 1.00 ? 25 CYS A CB   11 
ATOM   7937  S SG   . CYS A 1 25 ? -1.457  14.476 -2.579  1.00 1.00 ? 25 CYS A SG   11 
ATOM   7938  H H    . CYS A 1 25 ? -0.527  18.626 -1.647  1.00 1.00 ? 25 CYS A H    11 
ATOM   7939  H HA   . CYS A 1 25 ? -2.257  17.064 -3.250  1.00 1.00 ? 25 CYS A HA   11 
ATOM   7940  H HB2  . CYS A 1 25 ? 0.065   16.318 -2.660  1.00 1.00 ? 25 CYS A HB2  11 
ATOM   7941  H HB3  . CYS A 1 25 ? -0.483  15.999 -1.022  1.00 1.00 ? 25 CYS A HB3  11 
ATOM   7942  N N    . ILE A 1 26 ? -2.851  16.563 -0.001  1.00 1.00 ? 26 ILE A N    11 
ATOM   7943  C CA   . ILE A 1 26 ? -3.836  15.957 0.902   1.00 1.00 ? 26 ILE A CA   11 
ATOM   7944  C C    . ILE A 1 26 ? -5.068  16.856 1.096   1.00 1.00 ? 26 ILE A C    11 
ATOM   7945  O O    . ILE A 1 26 ? -6.112  16.417 1.590   1.00 1.00 ? 26 ILE A O    11 
ATOM   7946  C CB   . ILE A 1 26 ? -3.175  15.544 2.232   1.00 1.00 ? 26 ILE A CB   11 
ATOM   7947  C CG1  . ILE A 1 26 ? -2.882  16.747 3.142   1.00 1.00 ? 26 ILE A CG1  11 
ATOM   7948  C CG2  . ILE A 1 26 ? -1.903  14.728 1.956   1.00 1.00 ? 26 ILE A CG2  11 
ATOM   7949  C CD1  . ILE A 1 26 ? -2.141  16.364 4.427   1.00 1.00 ? 26 ILE A CD1  11 
ATOM   7950  H H    . ILE A 1 26 ? -1.962  16.886 0.374   1.00 1.00 ? 26 ILE A H    11 
ATOM   7951  H HA   . ILE A 1 26 ? -4.192  15.037 0.432   1.00 1.00 ? 26 ILE A HA   11 
ATOM   7952  H HB   . ILE A 1 26 ? -3.876  14.897 2.759   1.00 1.00 ? 26 ILE A HB   11 
ATOM   7953  H HG12 . ILE A 1 26 ? -2.287  17.481 2.603   1.00 1.00 ? 26 ILE A HG12 11 
ATOM   7954  H HG13 . ILE A 1 26 ? -3.828  17.202 3.436   1.00 1.00 ? 26 ILE A HG13 11 
ATOM   7955  H HG21 . ILE A 1 26 ? -2.110  13.959 1.215   1.00 1.00 ? 26 ILE A HG21 11 
ATOM   7956  H HG22 . ILE A 1 26 ? -1.099  15.365 1.590   1.00 1.00 ? 26 ILE A HG22 11 
ATOM   7957  H HG23 . ILE A 1 26 ? -1.571  14.242 2.869   1.00 1.00 ? 26 ILE A HG23 11 
ATOM   7958  H HD11 . ILE A 1 26 ? -2.669  15.556 4.935   1.00 1.00 ? 26 ILE A HD11 11 
ATOM   7959  H HD12 . ILE A 1 26 ? -1.122  16.052 4.203   1.00 1.00 ? 26 ILE A HD12 11 
ATOM   7960  H HD13 . ILE A 1 26 ? -2.100  17.232 5.087   1.00 1.00 ? 26 ILE A HD13 11 
ATOM   7961  N N    . ASN A 1 27 ? -4.942  18.126 0.710   1.00 1.00 ? 27 ASN A N    11 
ATOM   7962  C CA   . ASN A 1 27 ? -5.987  19.128 0.767   1.00 1.00 ? 27 ASN A CA   11 
ATOM   7963  C C    . ASN A 1 27 ? -6.881  18.982 -0.464  1.00 1.00 ? 27 ASN A C    11 
ATOM   7964  O O    . ASN A 1 27 ? -8.078  18.737 -0.314  1.00 1.00 ? 27 ASN A O    11 
ATOM   7965  C CB   . ASN A 1 27 ? -5.314  20.497 0.886   1.00 1.00 ? 27 ASN A CB   11 
ATOM   7966  C CG   . ASN A 1 27 ? -6.254  21.640 1.228   1.00 1.00 ? 27 ASN A CG   11 
ATOM   7967  O OD1  . ASN A 1 27 ? -7.396  21.680 0.786   1.00 1.00 ? 27 ASN A OD1  11 
ATOM   7968  N ND2  . ASN A 1 27 ? -5.762  22.584 2.027   1.00 1.00 ? 27 ASN A ND2  11 
ATOM   7969  H H    . ASN A 1 27 ? -4.032  18.436 0.380   1.00 1.00 ? 27 ASN A H    11 
ATOM   7970  H HA   . ASN A 1 27 ? -6.587  18.972 1.666   1.00 1.00 ? 27 ASN A HA   11 
ATOM   7971  H HB2  . ASN A 1 27 ? -4.607  20.417 1.710   1.00 1.00 ? 27 ASN A HB2  11 
ATOM   7972  H HB3  . ASN A 1 27 ? -4.777  20.742 -0.031  1.00 1.00 ? 27 ASN A HB3  11 
ATOM   7973  H HD21 . ASN A 1 27 ? -4.813  22.492 2.389   1.00 1.00 ? 27 ASN A HD21 11 
ATOM   7974  H HD22 . ASN A 1 27 ? -6.351  23.358 2.290   1.00 1.00 ? 27 ASN A HD22 11 
ATOM   7975  N N    . LEU A 1 28 ? -6.306  19.046 -1.671  1.00 1.00 ? 28 LEU A N    11 
ATOM   7976  C CA   . LEU A 1 28 ? -7.058  18.896 -2.914  1.00 1.00 ? 28 LEU A CA   11 
ATOM   7977  C C    . LEU A 1 28 ? -7.519  17.447 -3.091  1.00 1.00 ? 28 LEU A C    11 
ATOM   7978  O O    . LEU A 1 28 ? -8.720  17.182 -3.065  1.00 1.00 ? 28 LEU A O    11 
ATOM   7979  C CB   . LEU A 1 28 ? -6.228  19.373 -4.116  1.00 1.00 ? 28 LEU A CB   11 
ATOM   7980  C CG   . LEU A 1 28 ? -6.321  20.886 -4.372  1.00 1.00 ? 28 LEU A CG   11 
ATOM   7981  C CD1  . LEU A 1 28 ? -5.935  21.729 -3.151  1.00 1.00 ? 28 LEU A CD1  11 
ATOM   7982  C CD2  . LEU A 1 28 ? -5.415  21.229 -5.561  1.00 1.00 ? 28 LEU A CD2  11 
ATOM   7983  H H    . LEU A 1 28 ? -5.301  19.168 -1.743  1.00 1.00 ? 28 LEU A H    11 
ATOM   7984  H HA   . LEU A 1 28 ? -7.956  19.514 -2.861  1.00 1.00 ? 28 LEU A HA   11 
ATOM   7985  H HB2  . LEU A 1 28 ? -5.188  19.075 -4.002  1.00 1.00 ? 28 LEU A HB2  11 
ATOM   7986  H HB3  . LEU A 1 28 ? -6.607  18.883 -5.009  1.00 1.00 ? 28 LEU A HB3  11 
ATOM   7987  H HG   . LEU A 1 28 ? -7.348  21.136 -4.645  1.00 1.00 ? 28 LEU A HG   11 
ATOM   7988  H HD11 . LEU A 1 28 ? -4.967  21.416 -2.768  1.00 1.00 ? 28 LEU A HD11 11 
ATOM   7989  H HD12 . LEU A 1 28 ? -5.887  22.782 -3.430  1.00 1.00 ? 28 LEU A HD12 11 
ATOM   7990  H HD13 . LEU A 1 28 ? -6.683  21.620 -2.366  1.00 1.00 ? 28 LEU A HD13 11 
ATOM   7991  H HD21 . LEU A 1 28 ? -5.738  20.674 -6.444  1.00 1.00 ? 28 LEU A HD21 11 
ATOM   7992  H HD22 . LEU A 1 28 ? -5.468  22.295 -5.780  1.00 1.00 ? 28 LEU A HD22 11 
ATOM   7993  H HD23 . LEU A 1 28 ? -4.385  20.959 -5.337  1.00 1.00 ? 28 LEU A HD23 11 
ATOM   7994  N N    . GLU A 1 29 ? -6.586  16.498 -3.234  1.00 1.00 ? 29 GLU A N    11 
ATOM   7995  C CA   . GLU A 1 29 ? -6.938  15.080 -3.258  1.00 1.00 ? 29 GLU A CA   11 
ATOM   7996  C C    . GLU A 1 29 ? -6.914  14.585 -1.811  1.00 1.00 ? 29 GLU A C    11 
ATOM   7997  O O    . GLU A 1 29 ? -6.799  15.400 -0.901  1.00 1.00 ? 29 GLU A O    11 
ATOM   7998  C CB   . GLU A 1 29 ? -6.080  14.292 -4.265  1.00 1.00 ? 29 GLU A CB   11 
ATOM   7999  C CG   . GLU A 1 29 ? -4.561  14.411 -4.095  1.00 1.00 ? 29 GLU A CG   11 
ATOM   8000  C CD   . GLU A 1 29 ? -3.813  13.720 -5.231  1.00 1.00 ? 29 GLU A CD   11 
ATOM   8001  O OE1  . GLU A 1 29 ? -4.257  12.681 -5.709  1.00 1.00 ? 29 GLU A OE1  11 
ATOM   8002  O OE2  . GLU A 1 29 ? -2.681  14.340 -5.659  1.00 1.00 ? 29 GLU A OE2  11 
ATOM   8003  H H    . GLU A 1 29 ? -5.622  16.733 -3.009  1.00 1.00 ? 29 GLU A H    11 
ATOM   8004  H HA   . GLU A 1 29 ? -7.967  14.961 -3.605  1.00 1.00 ? 29 GLU A HA   11 
ATOM   8005  H HB2  . GLU A 1 29 ? -6.362  13.240 -4.231  1.00 1.00 ? 29 GLU A HB2  11 
ATOM   8006  H HB3  . GLU A 1 29 ? -6.328  14.666 -5.261  1.00 1.00 ? 29 GLU A HB3  11 
ATOM   8007  H HG2  . GLU A 1 29 ? -4.276  15.460 -4.111  1.00 1.00 ? 29 GLU A HG2  11 
ATOM   8008  H HG3  . GLU A 1 29 ? -4.254  13.960 -3.153  1.00 1.00 ? 29 GLU A HG3  11 
ATOM   8009  H HE2  . GLU A 1 29 ? -2.499  14.124 -6.582  1.00 1.00 ? 29 GLU A HE2  11 
ATOM   8010  N N    . LYS A 1 30 ? -7.126  13.293 -1.557  1.00 1.00 ? 30 LYS A N    11 
ATOM   8011  C CA   . LYS A 1 30 ? -7.361  12.775 -0.204  1.00 1.00 ? 30 LYS A CA   11 
ATOM   8012  C C    . LYS A 1 30 ? -6.281  11.818 0.304   1.00 1.00 ? 30 LYS A C    11 
ATOM   8013  O O    . LYS A 1 30 ? -6.506  11.124 1.295   1.00 1.00 ? 30 LYS A O    11 
ATOM   8014  C CB   . LYS A 1 30 ? -8.799  12.246 -0.091  1.00 1.00 ? 30 LYS A CB   11 
ATOM   8015  C CG   . LYS A 1 30 ? -9.798  13.420 -0.087  1.00 1.00 ? 30 LYS A CG   11 
ATOM   8016  C CD   . LYS A 1 30 ? -9.826  14.163 1.266   1.00 1.00 ? 30 LYS A CD   11 
ATOM   8017  C CE   . LYS A 1 30 ? -9.952  15.691 1.124   1.00 1.00 ? 30 LYS A CE   11 
ATOM   8018  N NZ   . LYS A 1 30 ? -8.697  16.337 0.680   1.00 1.00 ? 30 LYS A NZ   11 
ATOM   8019  H H    . LYS A 1 30 ? -7.242  12.657 -2.333  1.00 1.00 ? 30 LYS A H    11 
ATOM   8020  H HA   . LYS A 1 30 ? -7.274  13.593 0.508   1.00 1.00 ? 30 LYS A HA   11 
ATOM   8021  H HB2  . LYS A 1 30 ? -9.005  11.587 -0.935  1.00 1.00 ? 30 LYS A HB2  11 
ATOM   8022  H HB3  . LYS A 1 30 ? -8.934  11.677 0.829   1.00 1.00 ? 30 LYS A HB3  11 
ATOM   8023  H HG2  . LYS A 1 30 ? -9.570  14.099 -0.908  1.00 1.00 ? 30 LYS A HG2  11 
ATOM   8024  H HG3  . LYS A 1 30 ? -10.796 13.016 -0.274  1.00 1.00 ? 30 LYS A HG3  11 
ATOM   8025  H HD2  . LYS A 1 30 ? -10.698 13.802 1.817   1.00 1.00 ? 30 LYS A HD2  11 
ATOM   8026  H HD3  . LYS A 1 30 ? -8.954  13.929 1.877   1.00 1.00 ? 30 LYS A HD3  11 
ATOM   8027  H HE2  . LYS A 1 30 ? -10.751 15.925 0.418   1.00 1.00 ? 30 LYS A HE2  11 
ATOM   8028  H HE3  . LYS A 1 30 ? -10.221 16.112 2.095   1.00 1.00 ? 30 LYS A HE3  11 
ATOM   8029  H HZ1  . LYS A 1 30 ? -8.363  15.962 -0.199  1.00 1.00 ? 30 LYS A HZ1  11 
ATOM   8030  H HZ2  . LYS A 1 30 ? -8.826  17.333 0.525   1.00 1.00 ? 30 LYS A HZ2  11 
ATOM   8031  H HZ3  . LYS A 1 30 ? -7.923  16.228 1.329   1.00 1.00 ? 30 LYS A HZ3  11 
ATOM   8032  N N    . ALA A 1 31 ? -5.137  11.760 -0.383  1.00 1.00 ? 31 ALA A N    11 
ATOM   8033  C CA   . ALA A 1 31 ? -3.915  11.085 0.054   1.00 1.00 ? 31 ALA A CA   11 
ATOM   8034  C C    . ALA A 1 31 ? -3.602  11.307 1.545   1.00 1.00 ? 31 ALA A C    11 
ATOM   8035  O O    . ALA A 1 31 ? -4.096  12.258 2.151   1.00 1.00 ? 31 ALA A O    11 
ATOM   8036  C CB   . ALA A 1 31 ? -2.775  11.661 -0.779  1.00 1.00 ? 31 ALA A CB   11 
ATOM   8037  H H    . ALA A 1 31 ? -5.057  12.362 -1.188  1.00 1.00 ? 31 ALA A H    11 
ATOM   8038  H HA   . ALA A 1 31 ? -4.004  10.017 -0.147  1.00 1.00 ? 31 ALA A HA   11 
ATOM   8039  H HB1  . ALA A 1 31 ? -2.741  12.738 -0.618  1.00 1.00 ? 31 ALA A HB1  11 
ATOM   8040  H HB2  . ALA A 1 31 ? -1.825  11.225 -0.476  1.00 1.00 ? 31 ALA A HB2  11 
ATOM   8041  H HB3  . ALA A 1 31 ? -2.931  11.475 -1.840  1.00 1.00 ? 31 ALA A HB3  11 
ATOM   8042  N N    . ARG A 1 32 ? -2.784  10.433 2.148   1.00 1.00 ? 32 ARG A N    11 
ATOM   8043  C CA   . ARG A 1 32 ? -2.442  10.512 3.571   1.00 1.00 ? 32 ARG A CA   11 
ATOM   8044  C C    . ARG A 1 32 ? -1.218  11.392 3.800   1.00 1.00 ? 32 ARG A C    11 
ATOM   8045  O O    . ARG A 1 32 ? -1.302  12.372 4.533   1.00 1.00 ? 32 ARG A O    11 
ATOM   8046  C CB   . ARG A 1 32 ? -2.191  9.116  4.173   1.00 1.00 ? 32 ARG A CB   11 
ATOM   8047  C CG   . ARG A 1 32 ? -3.372  8.136  4.150   1.00 1.00 ? 32 ARG A CG   11 
ATOM   8048  C CD   . ARG A 1 32 ? -4.421  8.354  5.257   1.00 1.00 ? 32 ARG A CD   11 
ATOM   8049  N NE   . ARG A 1 32 ? -5.083  9.665  5.179   1.00 1.00 ? 32 ARG A NE   11 
ATOM   8050  C CZ   . ARG A 1 32 ? -5.792  10.101 4.127   1.00 1.00 ? 32 ARG A CZ   11 
ATOM   8051  N NH1  . ARG A 1 32 ? -6.187  9.246  3.182   1.00 1.00 ? 32 ARG A NH1  11 
ATOM   8052  N NH2  . ARG A 1 32 ? -6.070  11.398 3.990   1.00 1.00 ? 32 ARG A NH2  11 
ATOM   8053  H H    . ARG A 1 32 ? -2.309  9.746  1.568   1.00 1.00 ? 32 ARG A H    11 
ATOM   8054  H HA   . ARG A 1 32 ? -3.241  11.014 4.113   1.00 1.00 ? 32 ARG A HA   11 
ATOM   8055  H HB2  . ARG A 1 32 ? -1.379  8.653  3.610   1.00 1.00 ? 32 ARG A HB2  11 
ATOM   8056  H HB3  . ARG A 1 32 ? -1.862  9.230  5.207   1.00 1.00 ? 32 ARG A HB3  11 
ATOM   8057  H HG2  . ARG A 1 32 ? -3.820  8.152  3.160   1.00 1.00 ? 32 ARG A HG2  11 
ATOM   8058  H HG3  . ARG A 1 32 ? -2.957  7.138  4.309   1.00 1.00 ? 32 ARG A HG3  11 
ATOM   8059  H HD2  . ARG A 1 32 ? -5.169  7.559  5.219   1.00 1.00 ? 32 ARG A HD2  11 
ATOM   8060  H HD3  . ARG A 1 32 ? -3.923  8.279  6.226   1.00 1.00 ? 32 ARG A HD3  11 
ATOM   8061  H HE   . ARG A 1 32 ? -4.874  10.314 5.926   1.00 1.00 ? 32 ARG A HE   11 
ATOM   8062  H HH11 . ARG A 1 32 ? -6.022  8.258  3.284   1.00 1.00 ? 32 ARG A HH11 11 
ATOM   8063  H HH12 . ARG A 1 32 ? -6.589  9.618  2.325   1.00 1.00 ? 32 ARG A HH12 11 
ATOM   8064  H HH21 . ARG A 1 32 ? -5.733  12.085 4.646   1.00 1.00 ? 32 ARG A HH21 11 
ATOM   8065  H HH22 . ARG A 1 32 ? -6.344  11.708 3.059   1.00 1.00 ? 32 ARG A HH22 11 
ATOM   8066  N N    . HIS A 1 33 ? -0.071  10.995 3.246   1.00 1.00 ? 33 HIS A N    11 
ATOM   8067  C CA   . HIS A 1 33 ? 1.157   11.776 3.335   1.00 1.00 ? 33 HIS A CA   11 
ATOM   8068  C C    . HIS A 1 33 ? 1.412   12.426 1.987   1.00 1.00 ? 33 HIS A C    11 
ATOM   8069  O O    . HIS A 1 33 ? 0.914   11.962 0.963   1.00 1.00 ? 33 HIS A O    11 
ATOM   8070  C CB   . HIS A 1 33 ? 2.367   10.901 3.702   1.00 1.00 ? 33 HIS A CB   11 
ATOM   8071  C CG   . HIS A 1 33 ? 2.325   10.257 5.058   1.00 1.00 ? 33 HIS A CG   11 
ATOM   8072  N ND1  . HIS A 1 33 ? 1.242   9.526  5.515   1.00 1.00 ? 33 HIS A ND1  11 
ATOM   8073  C CD2  . HIS A 1 33 ? 3.279   10.152 6.040   1.00 1.00 ? 33 HIS A CD2  11 
ATOM   8074  C CE1  . HIS A 1 33 ? 1.565   9.047  6.727   1.00 1.00 ? 33 HIS A CE1  11 
ATOM   8075  N NE2  . HIS A 1 33 ? 2.798   9.394  7.105   1.00 1.00 ? 33 HIS A NE2  11 
ATOM   8076  H H    . HIS A 1 33 ? -0.100  10.259 2.554   1.00 1.00 ? 33 HIS A H    11 
ATOM   8077  H HA   . HIS A 1 33 ? 1.069   12.566 4.083   1.00 1.00 ? 33 HIS A HA   11 
ATOM   8078  H HB2  . HIS A 1 33 ? 2.504   10.112 2.970   1.00 1.00 ? 33 HIS A HB2  11 
ATOM   8079  H HB3  . HIS A 1 33 ? 3.261   11.527 3.675   1.00 1.00 ? 33 HIS A HB3  11 
ATOM   8080  H HD1  . HIS A 1 33 ? 0.374   9.379  5.026   1.00 1.00 ? 33 HIS A HD1  11 
ATOM   8081  H HD2  . HIS A 1 33 ? 4.271   10.581 5.962   1.00 1.00 ? 33 HIS A HD2  11 
ATOM   8082  H HE1  . HIS A 1 33 ? 0.894   8.435  7.315   1.00 1.00 ? 33 HIS A HE1  11 
ATOM   8083  N N    . GLY A 1 34 ? 2.245   13.459 1.992   1.00 1.00 ? 34 GLY A N    11 
ATOM   8084  C CA   . GLY A 1 34 ? 2.787   14.058 0.797   1.00 1.00 ? 34 GLY A CA   11 
ATOM   8085  C C    . GLY A 1 34 ? 4.003   14.860 1.211   1.00 1.00 ? 34 GLY A C    11 
ATOM   8086  O O    . GLY A 1 34 ? 4.128   15.200 2.389   1.00 1.00 ? 34 GLY A O    11 
ATOM   8087  H H    . GLY A 1 34 ? 2.640   13.792 2.862   1.00 1.00 ? 34 GLY A H    11 
ATOM   8088  H HA2  . GLY A 1 34 ? 3.150   13.259 0.167   1.00 1.00 ? 34 GLY A HA2  11 
ATOM   8089  H HA3  . GLY A 1 34 ? 2.050   14.659 0.269   1.00 1.00 ? 34 GLY A HA3  11 
ATOM   8090  N N    . SER A 1 35 ? 4.931   15.089 0.288   1.00 1.00 ? 35 SER A N    11 
ATOM   8091  C CA   . SER A 1 35 ? 6.224   15.675 0.580   1.00 1.00 ? 35 SER A CA   11 
ATOM   8092  C C    . SER A 1 35 ? 6.927   15.959 -0.746  1.00 1.00 ? 35 SER A C    11 
ATOM   8093  O O    . SER A 1 35 ? 6.950   15.125 -1.649  1.00 1.00 ? 35 SER A O    11 
ATOM   8094  C CB   . SER A 1 35 ? 7.050   14.713 1.460   1.00 1.00 ? 35 SER A CB   11 
ATOM   8095  O OG   . SER A 1 35 ? 7.164   15.210 2.785   1.00 1.00 ? 35 SER A OG   11 
ATOM   8096  H H    . SER A 1 35 ? 4.789   14.728 -0.653  1.00 1.00 ? 35 SER A H    11 
ATOM   8097  H HA   . SER A 1 35 ? 6.073   16.626 1.105   1.00 1.00 ? 35 SER A HA   11 
ATOM   8098  H HB2  . SER A 1 35 ? 6.587   13.722 1.484   1.00 1.00 ? 35 SER A HB2  11 
ATOM   8099  H HB3  . SER A 1 35 ? 8.051   14.589 1.043   1.00 1.00 ? 35 SER A HB3  11 
ATOM   8100  H HG   . SER A 1 35 ? 7.610   14.539 3.316   1.00 1.00 ? 35 SER A HG   11 
ATOM   8101  N N    . CYS A 1 36 ? 7.508   17.150 -0.846  1.00 1.00 ? 36 CYS A N    11 
ATOM   8102  C CA   . CYS A 1 36 ? 8.396   17.511 -1.933  1.00 1.00 ? 36 CYS A CA   11 
ATOM   8103  C C    . CYS A 1 36 ? 9.721   16.806 -1.682  1.00 1.00 ? 36 CYS A C    11 
ATOM   8104  O O    . CYS A 1 36 ? 10.294  16.967 -0.602  1.00 1.00 ? 36 CYS A O    11 
ATOM   8105  C CB   . CYS A 1 36 ? 8.612   19.022 -1.972  1.00 1.00 ? 36 CYS A CB   11 
ATOM   8106  S SG   . CYS A 1 36 ? 9.655   19.596 -3.306  1.00 1.00 ? 36 CYS A SG   11 
ATOM   8107  H H    . CYS A 1 36 ? 7.486   17.733 -0.029  1.00 1.00 ? 36 CYS A H    11 
ATOM   8108  H HA   . CYS A 1 36 ? 7.958   17.192 -2.876  1.00 1.00 ? 36 CYS A HA   11 
ATOM   8109  H HB2  . CYS A 1 36 ? 7.653   19.532 -2.055  1.00 1.00 ? 36 CYS A HB2  11 
ATOM   8110  H HB3  . CYS A 1 36 ? 9.140   19.333 -1.075  1.00 1.00 ? 36 CYS A HB3  11 
ATOM   8111  N N    . ASN A 1 37 ? 10.157  15.999 -2.647  1.00 1.00 ? 37 ASN A N    11 
ATOM   8112  C CA   . ASN A 1 37 ? 11.410  15.261 -2.647  1.00 1.00 ? 37 ASN A CA   11 
ATOM   8113  C C    . ASN A 1 37 ? 12.389  15.939 -3.607  1.00 1.00 ? 37 ASN A C    11 
ATOM   8114  O O    . ASN A 1 37 ? 11.949  16.610 -4.543  1.00 1.00 ? 37 ASN A O    11 
ATOM   8115  C CB   . ASN A 1 37 ? 11.121  13.832 -3.121  1.00 1.00 ? 37 ASN A CB   11 
ATOM   8116  C CG   . ASN A 1 37 ? 12.400  13.101 -3.488  1.00 1.00 ? 37 ASN A CG   11 
ATOM   8117  O OD1  . ASN A 1 37 ? 12.678  12.896 -4.665  1.00 1.00 ? 37 ASN A OD1  11 
ATOM   8118  N ND2  . ASN A 1 37 ? 13.228  12.785 -2.496  1.00 1.00 ? 37 ASN A ND2  11 
ATOM   8119  H H    . ASN A 1 37 ? 9.599   15.935 -3.492  1.00 1.00 ? 37 ASN A H    11 
ATOM   8120  H HA   . ASN A 1 37 ? 11.842  15.232 -1.646  1.00 1.00 ? 37 ASN A HA   11 
ATOM   8121  H HB2  . ASN A 1 37 ? 10.575  13.283 -2.354  1.00 1.00 ? 37 ASN A HB2  11 
ATOM   8122  H HB3  . ASN A 1 37 ? 10.516  13.885 -4.027  1.00 1.00 ? 37 ASN A HB3  11 
ATOM   8123  H HD21 . ASN A 1 37 ? 12.966  12.953 -1.536  1.00 1.00 ? 37 ASN A HD21 11 
ATOM   8124  H HD22 . ASN A 1 37 ? 14.098  12.325 -2.717  1.00 1.00 ? 37 ASN A HD22 11 
ATOM   8125  N N    . TYR A 1 38 ? 13.699  15.738 -3.398  1.00 1.00 ? 38 TYR A N    11 
ATOM   8126  C CA   . TYR A 1 38 ? 14.742  16.246 -4.275  1.00 1.00 ? 38 TYR A CA   11 
ATOM   8127  C C    . TYR A 1 38 ? 15.671  15.171 -4.852  1.00 1.00 ? 38 TYR A C    11 
ATOM   8128  O O    . TYR A 1 38 ? 16.889  15.329 -4.847  1.00 1.00 ? 38 TYR A O    11 
ATOM   8129  C CB   . TYR A 1 38 ? 15.510  17.380 -3.578  1.00 1.00 ? 38 TYR A CB   11 
ATOM   8130  C CG   . TYR A 1 38 ? 16.435  18.155 -4.506  1.00 1.00 ? 38 TYR A CG   11 
ATOM   8131  C CD1  . TYR A 1 38 ? 15.930  18.652 -5.722  1.00 1.00 ? 38 TYR A CD1  11 
ATOM   8132  C CD2  . TYR A 1 38 ? 17.827  18.157 -4.290  1.00 1.00 ? 38 TYR A CD2  11 
ATOM   8133  C CE1  . TYR A 1 38 ? 16.799  19.090 -6.729  1.00 1.00 ? 38 TYR A CE1  11 
ATOM   8134  C CE2  . TYR A 1 38 ? 18.700  18.572 -5.312  1.00 1.00 ? 38 TYR A CE2  11 
ATOM   8135  C CZ   . TYR A 1 38 ? 18.185  18.981 -6.554  1.00 1.00 ? 38 TYR A CZ   11 
ATOM   8136  O OH   . TYR A 1 38 ? 19.022  19.246 -7.595  1.00 1.00 ? 38 TYR A OH   11 
ATOM   8137  H H    . TYR A 1 38 ? 13.996  15.204 -2.596  1.00 1.00 ? 38 TYR A H    11 
ATOM   8138  H HA   . TYR A 1 38 ? 14.254  16.656 -5.154  1.00 1.00 ? 38 TYR A HA   11 
ATOM   8139  H HB2  . TYR A 1 38 ? 14.780  18.064 -3.149  1.00 1.00 ? 38 TYR A HB2  11 
ATOM   8140  H HB3  . TYR A 1 38 ? 16.086  16.954 -2.756  1.00 1.00 ? 38 TYR A HB3  11 
ATOM   8141  H HD1  . TYR A 1 38 ? 14.873  18.658 -5.911  1.00 1.00 ? 38 TYR A HD1  11 
ATOM   8142  H HD2  . TYR A 1 38 ? 18.235  17.776 -3.364  1.00 1.00 ? 38 TYR A HD2  11 
ATOM   8143  H HE1  . TYR A 1 38 ? 16.394  19.490 -7.644  1.00 1.00 ? 38 TYR A HE1  11 
ATOM   8144  H HE2  . TYR A 1 38 ? 19.769  18.528 -5.162  1.00 1.00 ? 38 TYR A HE2  11 
ATOM   8145  H HH   . TYR A 1 38 ? 18.547  19.240 -8.437  1.00 1.00 ? 38 TYR A HH   11 
ATOM   8146  N N    . VAL A 1 39 ? 15.128  14.067 -5.371  1.00 1.00 ? 39 VAL A N    11 
ATOM   8147  C CA   . VAL A 1 39 ? 15.957  13.181 -6.184  1.00 1.00 ? 39 VAL A CA   11 
ATOM   8148  C C    . VAL A 1 39 ? 16.263  14.002 -7.444  1.00 1.00 ? 39 VAL A C    11 
ATOM   8149  O O    . VAL A 1 39 ? 15.407  14.769 -7.889  1.00 1.00 ? 39 VAL A O    11 
ATOM   8150  C CB   . VAL A 1 39 ? 15.223  11.865 -6.502  1.00 1.00 ? 39 VAL A CB   11 
ATOM   8151  C CG1  . VAL A 1 39 ? 15.879  11.090 -7.653  1.00 1.00 ? 39 VAL A CG1  11 
ATOM   8152  C CG2  . VAL A 1 39 ? 15.226  10.956 -5.267  1.00 1.00 ? 39 VAL A CG2  11 
ATOM   8153  H H    . VAL A 1 39 ? 14.130  13.902 -5.319  1.00 1.00 ? 39 VAL A H    11 
ATOM   8154  H HA   . VAL A 1 39 ? 16.890  12.951 -5.664  1.00 1.00 ? 39 VAL A HA   11 
ATOM   8155  H HB   . VAL A 1 39 ? 14.192  12.084 -6.786  1.00 1.00 ? 39 VAL A HB   11 
ATOM   8156  H HG11 . VAL A 1 39 ? 16.936  10.924 -7.442  1.00 1.00 ? 39 VAL A HG11 11 
ATOM   8157  H HG12 . VAL A 1 39 ? 15.389  10.123 -7.771  1.00 1.00 ? 39 VAL A HG12 11 
ATOM   8158  H HG13 . VAL A 1 39 ? 15.781  11.633 -8.592  1.00 1.00 ? 39 VAL A HG13 11 
ATOM   8159  H HG21 . VAL A 1 39 ? 14.829  11.484 -4.406  1.00 1.00 ? 39 VAL A HG21 11 
ATOM   8160  H HG22 . VAL A 1 39 ? 14.610  10.075 -5.455  1.00 1.00 ? 39 VAL A HG22 11 
ATOM   8161  H HG23 . VAL A 1 39 ? 16.243  10.636 -5.041  1.00 1.00 ? 39 VAL A HG23 11 
ATOM   8162  N N    . PHE A 1 40 ? 17.464  13.876 -8.011  1.00 1.00 ? 40 PHE A N    11 
ATOM   8163  C CA   . PHE A 1 40 ? 17.907  14.680 -9.148  1.00 1.00 ? 40 PHE A CA   11 
ATOM   8164  C C    . PHE A 1 40 ? 16.932  14.577 -10.342 1.00 1.00 ? 40 PHE A C    11 
ATOM   8165  O O    . PHE A 1 40 ? 16.122  13.650 -10.409 1.00 1.00 ? 40 PHE A O    11 
ATOM   8166  C CB   . PHE A 1 40 ? 19.329  14.233 -9.535  1.00 1.00 ? 40 PHE A CB   11 
ATOM   8167  C CG   . PHE A 1 40 ? 19.391  12.883 -10.225 1.00 1.00 ? 40 PHE A CG   11 
ATOM   8168  C CD1  . PHE A 1 40 ? 19.485  11.699 -9.469  1.00 1.00 ? 40 PHE A CD1  11 
ATOM   8169  C CD2  . PHE A 1 40 ? 19.304  12.810 -11.628 1.00 1.00 ? 40 PHE A CD2  11 
ATOM   8170  C CE1  . PHE A 1 40 ? 19.455  10.449 -10.112 1.00 1.00 ? 40 PHE A CE1  11 
ATOM   8171  C CE2  . PHE A 1 40 ? 19.274  11.561 -12.270 1.00 1.00 ? 40 PHE A CE2  11 
ATOM   8172  C CZ   . PHE A 1 40 ? 19.343  10.380 -11.511 1.00 1.00 ? 40 PHE A CZ   11 
ATOM   8173  H H    . PHE A 1 40 ? 18.114  13.219 -7.611  1.00 1.00 ? 40 PHE A H    11 
ATOM   8174  H HA   . PHE A 1 40 ? 17.949  15.714 -8.802  1.00 1.00 ? 40 PHE A HA   11 
ATOM   8175  H HB2  . PHE A 1 40 ? 19.780  14.964 -10.202 1.00 1.00 ? 40 PHE A HB2  11 
ATOM   8176  H HB3  . PHE A 1 40 ? 19.953  14.211 -8.641  1.00 1.00 ? 40 PHE A HB3  11 
ATOM   8177  H HD1  . PHE A 1 40 ? 19.595  11.736 -8.395  1.00 1.00 ? 40 PHE A HD1  11 
ATOM   8178  H HD2  . PHE A 1 40 ? 19.259  13.709 -12.226 1.00 1.00 ? 40 PHE A HD2  11 
ATOM   8179  H HE1  . PHE A 1 40 ? 19.525  9.541  -9.531  1.00 1.00 ? 40 PHE A HE1  11 
ATOM   8180  H HE2  . PHE A 1 40 ? 19.204  11.506 -13.347 1.00 1.00 ? 40 PHE A HE2  11 
ATOM   8181  H HZ   . PHE A 1 40 ? 19.321  9.419  -12.005 1.00 1.00 ? 40 PHE A HZ   11 
ATOM   8182  N N    . PRO A 1 41 ? 16.957  15.513 -11.305 1.00 1.00 ? 41 PRO A N    11 
ATOM   8183  C CA   . PRO A 1 41 ? 17.672  16.780 -11.287 1.00 1.00 ? 41 PRO A CA   11 
ATOM   8184  C C    . PRO A 1 41 ? 16.875  17.839 -10.514 1.00 1.00 ? 41 PRO A C    11 
ATOM   8185  O O    . PRO A 1 41 ? 17.461  18.618 -9.767  1.00 1.00 ? 41 PRO A O    11 
ATOM   8186  C CB   . PRO A 1 41 ? 17.835  17.153 -12.761 1.00 1.00 ? 41 PRO A CB   11 
ATOM   8187  C CG   . PRO A 1 41 ? 16.591  16.564 -13.428 1.00 1.00 ? 41 PRO A CG   11 
ATOM   8188  C CD   . PRO A 1 41 ? 16.300  15.315 -12.591 1.00 1.00 ? 41 PRO A CD   11 
ATOM   8189  H HA   . PRO A 1 41 ? 18.663  16.703 -10.843 1.00 1.00 ? 41 PRO A HA   11 
ATOM   8190  H HB2  . PRO A 1 41 ? 17.926  18.229 -12.919 1.00 1.00 ? 41 PRO A HB2  11 
ATOM   8191  H HB3  . PRO A 1 41 ? 18.716  16.641 -13.155 1.00 1.00 ? 41 PRO A HB3  11 
ATOM   8192  H HG2  . PRO A 1 41 ? 15.762  17.270 -13.356 1.00 1.00 ? 41 PRO A HG2  11 
ATOM   8193  H HG3  . PRO A 1 41 ? 16.769  16.320 -14.476 1.00 1.00 ? 41 PRO A HG3  11 
ATOM   8194  H HD2  . PRO A 1 41 ? 15.226  15.166 -12.480 1.00 1.00 ? 41 PRO A HD2  11 
ATOM   8195  H HD3  . PRO A 1 41 ? 16.738  14.442 -13.080 1.00 1.00 ? 41 PRO A HD3  11 
ATOM   8196  N N    . ALA A 1 42 ? 15.550  17.863 -10.705 1.00 1.00 ? 42 ALA A N    11 
ATOM   8197  C CA   . ALA A 1 42 ? 14.632  18.842 -10.134 1.00 1.00 ? 42 ALA A CA   11 
ATOM   8198  C C    . ALA A 1 42 ? 13.717  18.194 -9.090  1.00 1.00 ? 42 ALA A C    11 
ATOM   8199  O O    . ALA A 1 42 ? 13.533  16.973 -9.089  1.00 1.00 ? 42 ALA A O    11 
ATOM   8200  C CB   . ALA A 1 42 ? 13.803  19.464 -11.261 1.00 1.00 ? 42 ALA A CB   11 
ATOM   8201  H H    . ALA A 1 42 ? 15.147  17.165 -11.308 1.00 1.00 ? 42 ALA A H    11 
ATOM   8202  H HA   . ALA A 1 42 ? 15.194  19.646 -9.659  1.00 1.00 ? 42 ALA A HA   11 
ATOM   8203  H HB1  . ALA A 1 42 ? 14.466  19.923 -11.997 1.00 1.00 ? 42 ALA A HB1  11 
ATOM   8204  H HB2  . ALA A 1 42 ? 13.199  18.698 -11.749 1.00 1.00 ? 42 ALA A HB2  11 
ATOM   8205  H HB3  . ALA A 1 42 ? 13.143  20.233 -10.857 1.00 1.00 ? 42 ALA A HB3  11 
ATOM   8206  N N    . HIS A 1 43 ? 13.124  19.036 -8.235  1.00 1.00 ? 43 HIS A N    11 
ATOM   8207  C CA   . HIS A 1 43 ? 12.253  18.643 -7.134  1.00 1.00 ? 43 HIS A CA   11 
ATOM   8208  C C    . HIS A 1 43 ? 10.978  17.971 -7.657  1.00 1.00 ? 43 HIS A C    11 
ATOM   8209  O O    . HIS A 1 43 ? 10.555  18.260 -8.773  1.00 1.00 ? 43 HIS A O    11 
ATOM   8210  C CB   . HIS A 1 43 ? 11.896  19.894 -6.317  1.00 1.00 ? 43 HIS A CB   11 
ATOM   8211  C CG   . HIS A 1 43 ? 13.052  20.565 -5.628  1.00 1.00 ? 43 HIS A CG   11 
ATOM   8212  N ND1  . HIS A 1 43 ? 13.344  20.344 -4.289  1.00 1.00 ? 43 HIS A ND1  11 
ATOM   8213  C CD2  . HIS A 1 43 ? 13.973  21.494 -6.053  1.00 1.00 ? 43 HIS A CD2  11 
ATOM   8214  C CE1  . HIS A 1 43 ? 14.397  21.118 -3.978  1.00 1.00 ? 43 HIS A CE1  11 
ATOM   8215  N NE2  . HIS A 1 43 ? 14.826  21.843 -5.013  1.00 1.00 ? 43 HIS A NE2  11 
ATOM   8216  H H    . HIS A 1 43 ? 13.300  20.021 -8.354  1.00 1.00 ? 43 HIS A H    11 
ATOM   8217  H HA   . HIS A 1 43 ? 12.786  17.934 -6.504  1.00 1.00 ? 43 HIS A HA   11 
ATOM   8218  H HB2  . HIS A 1 43 ? 11.400  20.625 -6.956  1.00 1.00 ? 43 HIS A HB2  11 
ATOM   8219  H HB3  . HIS A 1 43 ? 11.206  19.619 -5.529  1.00 1.00 ? 43 HIS A HB3  11 
ATOM   8220  H HD1  . HIS A 1 43 ? 12.858  19.721 -3.660  1.00 1.00 ? 43 HIS A HD1  11 
ATOM   8221  H HD2  . HIS A 1 43 ? 14.018  21.906 -7.050  1.00 1.00 ? 43 HIS A HD2  11 
ATOM   8222  H HE1  . HIS A 1 43 ? 14.847  21.152 -2.996  1.00 1.00 ? 43 HIS A HE1  11 
ATOM   8223  N N    . LYS A 1 44 ? 10.381  17.063 -6.872  1.00 1.00 ? 44 LYS A N    11 
ATOM   8224  C CA   . LYS A 1 44 ? 9.222   16.270 -7.283  1.00 1.00 ? 44 LYS A CA   11 
ATOM   8225  C C    . LYS A 1 44 ? 8.225   16.143 -6.135  1.00 1.00 ? 44 LYS A C    11 
ATOM   8226  O O    . LYS A 1 44 ? 8.630   15.840 -5.014  1.00 1.00 ? 44 LYS A O    11 
ATOM   8227  C CB   . LYS A 1 44 ? 9.680   14.862 -7.696  1.00 1.00 ? 44 LYS A CB   11 
ATOM   8228  C CG   . LYS A 1 44 ? 10.828  14.871 -8.710  1.00 1.00 ? 44 LYS A CG   11 
ATOM   8229  C CD   . LYS A 1 44 ? 11.324  13.439 -8.943  1.00 1.00 ? 44 LYS A CD   11 
ATOM   8230  C CE   . LYS A 1 44 ? 12.439  13.391 -10.000 1.00 1.00 ? 44 LYS A CE   11 
ATOM   8231  N NZ   . LYS A 1 44 ? 13.570  14.293 -9.689  1.00 1.00 ? 44 LYS A NZ   11 
ATOM   8232  H H    . LYS A 1 44 ? 10.776  16.875 -5.954  1.00 1.00 ? 44 LYS A H    11 
ATOM   8233  H HA   . LYS A 1 44 ? 8.707   16.780 -8.100  1.00 1.00 ? 44 LYS A HA   11 
ATOM   8234  H HB2  . LYS A 1 44 ? 10.021  14.338 -6.802  1.00 1.00 ? 44 LYS A HB2  11 
ATOM   8235  H HB3  . LYS A 1 44 ? 8.827   14.321 -8.112  1.00 1.00 ? 44 LYS A HB3  11 
ATOM   8236  H HG2  . LYS A 1 44 ? 10.486  15.329 -9.640  1.00 1.00 ? 44 LYS A HG2  11 
ATOM   8237  H HG3  . LYS A 1 44 ? 11.651  15.450 -8.300  1.00 1.00 ? 44 LYS A HG3  11 
ATOM   8238  H HD2  . LYS A 1 44 ? 11.684  13.026 -7.996  1.00 1.00 ? 44 LYS A HD2  11 
ATOM   8239  H HD3  . LYS A 1 44 ? 10.487  12.820 -9.275  1.00 1.00 ? 44 LYS A HD3  11 
ATOM   8240  H HE2  . LYS A 1 44 ? 12.814  12.368 -10.060 1.00 1.00 ? 44 LYS A HE2  11 
ATOM   8241  H HE3  . LYS A 1 44 ? 12.028  13.662 -10.974 1.00 1.00 ? 44 LYS A HE3  11 
ATOM   8242  H HZ1  . LYS A 1 44 ? 13.932  14.152 -8.753  1.00 1.00 ? 44 LYS A HZ1  11 
ATOM   8243  H HZ2  . LYS A 1 44 ? 14.357  14.109 -10.302 1.00 1.00 ? 44 LYS A HZ2  11 
ATOM   8244  H HZ3  . LYS A 1 44 ? 13.326  15.277 -9.739  1.00 1.00 ? 44 LYS A HZ3  11 
ATOM   8245  N N    . CYS A 1 45 ? 6.939   16.390 -6.398  1.00 1.00 ? 45 CYS A N    11 
ATOM   8246  C CA   . CYS A 1 45 ? 5.914   16.336 -5.368  1.00 1.00 ? 45 CYS A CA   11 
ATOM   8247  C C    . CYS A 1 45 ? 5.467   14.892 -5.198  1.00 1.00 ? 45 CYS A C    11 
ATOM   8248  O O    . CYS A 1 45 ? 4.731   14.381 -6.037  1.00 1.00 ? 45 CYS A O    11 
ATOM   8249  C CB   . CYS A 1 45 ? 4.715   17.218 -5.733  1.00 1.00 ? 45 CYS A CB   11 
ATOM   8250  S SG   . CYS A 1 45 ? 3.387   17.156 -4.495  1.00 1.00 ? 45 CYS A SG   11 
ATOM   8251  H H    . CYS A 1 45 ? 6.633   16.518 -7.357  1.00 1.00 ? 45 CYS A H    11 
ATOM   8252  H HA   . CYS A 1 45 ? 6.335   16.707 -4.436  1.00 1.00 ? 45 CYS A HA   11 
ATOM   8253  H HB2  . CYS A 1 45 ? 5.025   18.252 -5.842  1.00 1.00 ? 45 CYS A HB2  11 
ATOM   8254  H HB3  . CYS A 1 45 ? 4.311   16.900 -6.698  1.00 1.00 ? 45 CYS A HB3  11 
ATOM   8255  N N    . ILE A 1 46 ? 5.936   14.215 -4.150  1.00 1.00 ? 46 ILE A N    11 
ATOM   8256  C CA   . ILE A 1 46 ? 5.559   12.834 -3.895  1.00 1.00 ? 46 ILE A CA   11 
ATOM   8257  C C    . ILE A 1 46 ? 4.336   12.856 -2.990  1.00 1.00 ? 46 ILE A C    11 
ATOM   8258  O O    . ILE A 1 46 ? 4.334   13.583 -1.996  1.00 1.00 ? 46 ILE A O    11 
ATOM   8259  C CB   . ILE A 1 46 ? 6.723   12.065 -3.249  1.00 1.00 ? 46 ILE A CB   11 
ATOM   8260  C CG1  . ILE A 1 46 ? 8.067   12.297 -3.960  1.00 1.00 ? 46 ILE A CG1  11 
ATOM   8261  C CG2  . ILE A 1 46 ? 6.392   10.569 -3.197  1.00 1.00 ? 46 ILE A CG2  11 
ATOM   8262  C CD1  . ILE A 1 46 ? 8.068   11.968 -5.458  1.00 1.00 ? 46 ILE A CD1  11 
ATOM   8263  H H    . ILE A 1 46 ? 6.483   14.688 -3.436  1.00 1.00 ? 46 ILE A H    11 
ATOM   8264  H HA   . ILE A 1 46 ? 5.301   12.333 -4.824  1.00 1.00 ? 46 ILE A HA   11 
ATOM   8265  H HB   . ILE A 1 46 ? 6.845   12.413 -2.221  1.00 1.00 ? 46 ILE A HB   11 
ATOM   8266  H HG12 . ILE A 1 46 ? 8.344   13.343 -3.838  1.00 1.00 ? 46 ILE A HG12 11 
ATOM   8267  H HG13 . ILE A 1 46 ? 8.830   11.690 -3.472  1.00 1.00 ? 46 ILE A HG13 11 
ATOM   8268  H HG21 . ILE A 1 46 ? 6.173   10.190 -4.194  1.00 1.00 ? 46 ILE A HG21 11 
ATOM   8269  H HG22 . ILE A 1 46 ? 7.242   10.026 -2.785  1.00 1.00 ? 46 ILE A HG22 11 
ATOM   8270  H HG23 . ILE A 1 46 ? 5.524   10.398 -2.561  1.00 1.00 ? 46 ILE A HG23 11 
ATOM   8271  H HD11 . ILE A 1 46 ? 7.794   10.927 -5.625  1.00 1.00 ? 46 ILE A HD11 11 
ATOM   8272  H HD12 . ILE A 1 46 ? 7.379   12.619 -5.993  1.00 1.00 ? 46 ILE A HD12 11 
ATOM   8273  H HD13 . ILE A 1 46 ? 9.072   12.129 -5.852  1.00 1.00 ? 46 ILE A HD13 11 
ATOM   8274  N N    . CYS A 1 47 ? 3.303   12.078 -3.318  1.00 1.00 ? 47 CYS A N    11 
ATOM   8275  C CA   . CYS A 1 47 ? 2.131   11.943 -2.467  1.00 1.00 ? 47 CYS A CA   11 
ATOM   8276  C C    . CYS A 1 47 ? 1.778   10.475 -2.272  1.00 1.00 ? 47 CYS A C    11 
ATOM   8277  O O    . CYS A 1 47 ? 2.063   9.685  -3.165  1.00 1.00 ? 47 CYS A O    11 
ATOM   8278  C CB   . CYS A 1 47 ? 0.998   12.784 -3.023  1.00 1.00 ? 47 CYS A CB   11 
ATOM   8279  S SG   . CYS A 1 47 ? -0.176  13.119 -1.719  1.00 1.00 ? 47 CYS A SG   11 
ATOM   8280  H H    . CYS A 1 47 ? 3.304   11.560 -4.194  1.00 1.00 ? 47 CYS A H    11 
ATOM   8281  H HA   . CYS A 1 47 ? 2.357   12.323 -1.481  1.00 1.00 ? 47 CYS A HA   11 
ATOM   8282  H HB2  . CYS A 1 47 ? 1.382   13.744 -3.367  1.00 1.00 ? 47 CYS A HB2  11 
ATOM   8283  H HB3  . CYS A 1 47 ? 0.504   12.275 -3.851  1.00 1.00 ? 47 CYS A HB3  11 
ATOM   8284  N N    . TYR A 1 48 ? 1.215   10.097 -1.116  1.00 1.00 ? 48 TYR A N    11 
ATOM   8285  C CA   . TYR A 1 48 ? 1.052   8.708  -0.687  1.00 1.00 ? 48 TYR A CA   11 
ATOM   8286  C C    . TYR A 1 48 ? -0.394  8.320  -0.364  1.00 1.00 ? 48 TYR A C    11 
ATOM   8287  O O    . TYR A 1 48 ? -1.072  9.025  0.388   1.00 1.00 ? 48 TYR A O    11 
ATOM   8288  C CB   . TYR A 1 48 ? 1.882   8.501  0.578   1.00 1.00 ? 48 TYR A CB   11 
ATOM   8289  C CG   . TYR A 1 48 ? 3.379   8.653  0.411   1.00 1.00 ? 48 TYR A CG   11 
ATOM   8290  C CD1  . TYR A 1 48 ? 3.978   9.928  0.417   1.00 1.00 ? 48 TYR A CD1  11 
ATOM   8291  C CD2  . TYR A 1 48 ? 4.178   7.506  0.267   1.00 1.00 ? 48 TYR A CD2  11 
ATOM   8292  C CE1  . TYR A 1 48 ? 5.360   10.056 0.200   1.00 1.00 ? 48 TYR A CE1  11 
ATOM   8293  C CE2  . TYR A 1 48 ? 5.558   7.636  0.052   1.00 1.00 ? 48 TYR A CE2  11 
ATOM   8294  C CZ   . TYR A 1 48 ? 6.137   8.912  -0.041  1.00 1.00 ? 48 TYR A CZ   11 
ATOM   8295  O OH   . TYR A 1 48 ? 7.442   9.031  -0.404  1.00 1.00 ? 48 TYR A OH   11 
ATOM   8296  H H    . TYR A 1 48 ? 0.967   10.811 -0.438  1.00 1.00 ? 48 TYR A H    11 
ATOM   8297  H HA   . TYR A 1 48 ? 1.436   8.032  -1.448  1.00 1.00 ? 48 TYR A HA   11 
ATOM   8298  H HB2  . TYR A 1 48 ? 1.516   9.190  1.333   1.00 1.00 ? 48 TYR A HB2  11 
ATOM   8299  H HB3  . TYR A 1 48 ? 1.692   7.495  0.934   1.00 1.00 ? 48 TYR A HB3  11 
ATOM   8300  H HD1  . TYR A 1 48 ? 3.377   10.812 0.564   1.00 1.00 ? 48 TYR A HD1  11 
ATOM   8301  H HD2  . TYR A 1 48 ? 3.735   6.521  0.287   1.00 1.00 ? 48 TYR A HD2  11 
ATOM   8302  H HE1  . TYR A 1 48 ? 5.815   11.034 0.165   1.00 1.00 ? 48 TYR A HE1  11 
ATOM   8303  H HE2  . TYR A 1 48 ? 6.164   6.752  -0.082  1.00 1.00 ? 48 TYR A HE2  11 
ATOM   8304  H HH   . TYR A 1 48 ? 7.703   8.285  -0.962  1.00 1.00 ? 48 TYR A HH   11 
ATOM   8305  N N    . PHE A 1 49 ? -0.825  7.150  -0.851  1.00 1.00 ? 49 PHE A N    11 
ATOM   8306  C CA   . PHE A 1 49 ? -2.169  6.623  -0.707  1.00 1.00 ? 49 PHE A CA   11 
ATOM   8307  C C    . PHE A 1 49 ? -2.099  5.202  -0.123  1.00 1.00 ? 49 PHE A C    11 
ATOM   8308  O O    . PHE A 1 49 ? -1.150  4.466  -0.409  1.00 1.00 ? 49 PHE A O    11 
ATOM   8309  C CB   . PHE A 1 49 ? -2.860  6.584  -2.075  1.00 1.00 ? 49 PHE A CB   11 
ATOM   8310  C CG   . PHE A 1 49 ? -2.664  7.807  -2.957  1.00 1.00 ? 49 PHE A CG   11 
ATOM   8311  C CD1  . PHE A 1 49 ? -1.410  8.049  -3.546  1.00 1.00 ? 49 PHE A CD1  11 
ATOM   8312  C CD2  . PHE A 1 49 ? -3.714  8.723  -3.170  1.00 1.00 ? 49 PHE A CD2  11 
ATOM   8313  C CE1  . PHE A 1 49 ? -1.152  9.278  -4.162  1.00 1.00 ? 49 PHE A CE1  11 
ATOM   8314  C CE2  . PHE A 1 49 ? -3.495  9.876  -3.946  1.00 1.00 ? 49 PHE A CE2  11 
ATOM   8315  C CZ   . PHE A 1 49 ? -2.204  10.171 -4.418  1.00 1.00 ? 49 PHE A CZ   11 
ATOM   8316  H H    . PHE A 1 49 ? -0.216  6.595  -1.440  1.00 1.00 ? 49 PHE A H    11 
ATOM   8317  H HA   . PHE A 1 49 ? -2.732  7.294  -0.061  1.00 1.00 ? 49 PHE A HA   11 
ATOM   8318  H HB2  . PHE A 1 49 ? -2.529  5.694  -2.601  1.00 1.00 ? 49 PHE A HB2  11 
ATOM   8319  H HB3  . PHE A 1 49 ? -3.917  6.443  -1.904  1.00 1.00 ? 49 PHE A HB3  11 
ATOM   8320  H HD1  . PHE A 1 49 ? -0.616  7.320  -3.478  1.00 1.00 ? 49 PHE A HD1  11 
ATOM   8321  H HD2  . PHE A 1 49 ? -4.697  8.537  -2.761  1.00 1.00 ? 49 PHE A HD2  11 
ATOM   8322  H HE1  . PHE A 1 49 ? -0.140  9.524  -4.427  1.00 1.00 ? 49 PHE A HE1  11 
ATOM   8323  H HE2  . PHE A 1 49 ? -4.314  10.546 -4.166  1.00 1.00 ? 49 PHE A HE2  11 
ATOM   8324  H HZ   . PHE A 1 49 ? -2.015  11.067 -4.991  1.00 1.00 ? 49 PHE A HZ   11 
ATOM   8325  N N    . PRO A 1 50 ? -3.092  4.802  0.685   1.00 1.00 ? 50 PRO A N    11 
ATOM   8326  C CA   . PRO A 1 50 ? -3.141  3.527  1.382   1.00 1.00 ? 50 PRO A CA   11 
ATOM   8327  C C    . PRO A 1 50 ? -3.532  2.401  0.428   1.00 1.00 ? 50 PRO A C    11 
ATOM   8328  O O    . PRO A 1 50 ? -4.658  1.907  0.428   1.00 1.00 ? 50 PRO A O    11 
ATOM   8329  C CB   . PRO A 1 50 ? -4.171  3.727  2.490   1.00 1.00 ? 50 PRO A CB   11 
ATOM   8330  C CG   . PRO A 1 50 ? -5.155  4.716  1.863   1.00 1.00 ? 50 PRO A CG   11 
ATOM   8331  C CD   . PRO A 1 50 ? -4.228  5.618  1.046   1.00 1.00 ? 50 PRO A CD   11 
ATOM   8332  H HA   . PRO A 1 50 ? -2.178  3.286  1.836   1.00 1.00 ? 50 PRO A HA   11 
ATOM   8333  H HB2  . PRO A 1 50 ? -4.639  2.790  2.794   1.00 1.00 ? 50 PRO A HB2  11 
ATOM   8334  H HB3  . PRO A 1 50 ? -3.669  4.192  3.338   1.00 1.00 ? 50 PRO A HB3  11 
ATOM   8335  H HG2  . PRO A 1 50 ? -5.835  4.185  1.195   1.00 1.00 ? 50 PRO A HG2  11 
ATOM   8336  H HG3  . PRO A 1 50 ? -5.722  5.268  2.613   1.00 1.00 ? 50 PRO A HG3  11 
ATOM   8337  H HD2  . PRO A 1 50 ? -4.713  5.998  0.144   1.00 1.00 ? 50 PRO A HD2  11 
ATOM   8338  H HD3  . PRO A 1 50 ? -3.869  6.426  1.683   1.00 1.00 ? 50 PRO A HD3  11 
ATOM   8339  N N    . CYS A 1 51 ? -2.573  1.970  -0.380  1.00 1.00 ? 51 CYS A N    11 
ATOM   8340  C CA   . CYS A 1 51 ? -2.733  0.872  -1.328  1.00 1.00 ? 51 CYS A CA   11 
ATOM   8341  C C    . CYS A 1 51 ? -2.904  -0.468 -0.601  1.00 1.00 ? 51 CYS A C    11 
ATOM   8342  O O    . CYS A 1 51 ? -1.988  -1.292 -0.588  1.00 1.00 ? 51 CYS A O    11 
ATOM   8343  C CB   . CYS A 1 51 ? -1.558  0.883  -2.309  1.00 1.00 ? 51 CYS A CB   11 
ATOM   8344  S SG   . CYS A 1 51 ? 0.080   0.632  -1.589  1.00 1.00 ? 51 CYS A SG   11 
ATOM   8345  O OXT  . CYS A 1 51 ? -4.104  -0.671 0.009   1.00 0.00 ? 51 CYS A OXT  11 
ATOM   8346  H H    . CYS A 1 51 ? -1.699  2.481  -0.338  1.00 1.00 ? 51 CYS A H    11 
ATOM   8347  H HA   . CYS A 1 51 ? -3.637  1.050  -1.914  1.00 1.00 ? 51 CYS A HA   11 
ATOM   8348  H HB2  . CYS A 1 51 ? -1.688  0.147  -3.097  1.00 1.00 ? 51 CYS A HB2  11 
ATOM   8349  H HB3  . CYS A 1 51 ? -1.567  1.859  -2.790  1.00 1.00 ? 51 CYS A HB3  11 
HETATM 8350  N N    . PCA A 1 1  ? -3.807  3.904  5.599   1.00 1.00 ? 1  PCA A N    12 
HETATM 8351  C CA   . PCA A 1 1  ? -3.433  2.502  5.522   1.00 1.00 ? 1  PCA A CA   12 
HETATM 8352  C CB   . PCA A 1 1  ? -4.590  1.834  4.758   1.00 1.00 ? 1  PCA A CB   12 
HETATM 8353  C CG   . PCA A 1 1  ? -5.761  2.803  4.985   1.00 1.00 ? 1  PCA A CG   12 
HETATM 8354  C CD   . PCA A 1 1  ? -5.079  4.120  5.298   1.00 1.00 ? 1  PCA A CD   12 
HETATM 8355  O OE   . PCA A 1 1  ? -5.631  5.221  5.225   1.00 1.00 ? 1  PCA A OE   12 
HETATM 8356  C C    . PCA A 1 1  ? -2.067  2.329  4.852   1.00 1.00 ? 1  PCA A C    12 
HETATM 8357  O O    . PCA A 1 1  ? -1.383  3.321  4.608   1.00 1.00 ? 1  PCA A O    12 
HETATM 8358  H H    . PCA A 1 1  ? -3.111  4.623  5.736   1.00 0.00 ? 1  PCA A H    12 
HETATM 8359  H HA   . PCA A 1 1  ? -3.389  2.102  6.538   1.00 1.00 ? 1  PCA A HA   12 
HETATM 8360  H HB2  . PCA A 1 1  ? -4.357  1.799  3.692   1.00 1.00 ? 1  PCA A HB2  12 
HETATM 8361  H HB3  . PCA A 1 1  ? -4.808  0.831  5.126   1.00 1.00 ? 1  PCA A HB3  12 
HETATM 8362  H HG2  . PCA A 1 1  ? -6.400  2.878  4.105   1.00 1.00 ? 1  PCA A HG2  12 
HETATM 8363  H HG3  . PCA A 1 1  ? -6.345  2.495  5.853   1.00 1.00 ? 1  PCA A HG3  12 
ATOM   8364  N N    . LYS A 1 2  ? -1.676  1.081  4.564   1.00 1.00 ? 2  LYS A N    12 
ATOM   8365  C CA   . LYS A 1 2  ? -0.409  0.752  3.913   1.00 1.00 ? 2  LYS A CA   12 
ATOM   8366  C C    . LYS A 1 2  ? -0.232  1.604  2.653   1.00 1.00 ? 2  LYS A C    12 
ATOM   8367  O O    . LYS A 1 2  ? -1.042  1.523  1.735   1.00 1.00 ? 2  LYS A O    12 
ATOM   8368  C CB   . LYS A 1 2  ? -0.382  -0.743 3.555   1.00 1.00 ? 2  LYS A CB   12 
ATOM   8369  C CG   . LYS A 1 2  ? 0.913   -1.155 2.825   1.00 1.00 ? 2  LYS A CG   12 
ATOM   8370  C CD   . LYS A 1 2  ? 0.616   -2.080 1.633   1.00 1.00 ? 2  LYS A CD   12 
ATOM   8371  C CE   . LYS A 1 2  ? 1.723   -2.041 0.567   1.00 1.00 ? 2  LYS A CE   12 
ATOM   8372  N NZ   . LYS A 1 2  ? 1.718   -0.776 -0.204  1.00 1.00 ? 2  LYS A NZ   12 
ATOM   8373  H H    . LYS A 1 2  ? -2.300  0.321  4.784   1.00 1.00 ? 2  LYS A H    12 
ATOM   8374  H HA   . LYS A 1 2  ? 0.402   0.956  4.614   1.00 1.00 ? 2  LYS A HA   12 
ATOM   8375  H HB2  . LYS A 1 2  ? -0.478  -1.337 4.467   1.00 1.00 ? 2  LYS A HB2  12 
ATOM   8376  H HB3  . LYS A 1 2  ? -1.253  -0.946 2.932   1.00 1.00 ? 2  LYS A HB3  12 
ATOM   8377  H HG2  . LYS A 1 2  ? 1.456   -0.280 2.474   1.00 1.00 ? 2  LYS A HG2  12 
ATOM   8378  H HG3  . LYS A 1 2  ? 1.570   -1.672 3.530   1.00 1.00 ? 2  LYS A HG3  12 
ATOM   8379  H HD2  . LYS A 1 2  ? 0.509   -3.101 2.008   1.00 1.00 ? 2  LYS A HD2  12 
ATOM   8380  H HD3  . LYS A 1 2  ? -0.326  -1.805 1.155   1.00 1.00 ? 2  LYS A HD3  12 
ATOM   8381  H HE2  . LYS A 1 2  ? 2.699   -2.196 1.031   1.00 1.00 ? 2  LYS A HE2  12 
ATOM   8382  H HE3  . LYS A 1 2  ? 1.542   -2.860 -0.133  1.00 1.00 ? 2  LYS A HE3  12 
ATOM   8383  H HZ1  . LYS A 1 2  ? 0.784   -0.572 -0.545  1.00 1.00 ? 2  LYS A HZ1  12 
ATOM   8384  H HZ2  . LYS A 1 2  ? 2.002   0.024  0.353   1.00 1.00 ? 2  LYS A HZ2  12 
ATOM   8385  H HZ3  . LYS A 1 2  ? 2.344   -0.830 -0.993  1.00 1.00 ? 2  LYS A HZ3  12 
ATOM   8386  N N    . LEU A 1 3  ? 0.837   2.399  2.599   1.00 1.00 ? 3  LEU A N    12 
ATOM   8387  C CA   . LEU A 1 3  ? 1.018   3.406  1.566   1.00 1.00 ? 3  LEU A CA   12 
ATOM   8388  C C    . LEU A 1 3  ? 1.689   2.866  0.300   1.00 1.00 ? 3  LEU A C    12 
ATOM   8389  O O    . LEU A 1 3  ? 2.314   1.801  0.309   1.00 1.00 ? 3  LEU A O    12 
ATOM   8390  C CB   . LEU A 1 3  ? 1.858   4.561  2.124   1.00 1.00 ? 3  LEU A CB   12 
ATOM   8391  C CG   . LEU A 1 3  ? 1.203   5.310  3.296   1.00 1.00 ? 3  LEU A CG   12 
ATOM   8392  C CD1  . LEU A 1 3  ? 2.243   6.214  3.973   1.00 1.00 ? 3  LEU A CD1  12 
ATOM   8393  C CD2  . LEU A 1 3  ? 0.018   6.156  2.833   1.00 1.00 ? 3  LEU A CD2  12 
ATOM   8394  H H    . LEU A 1 3  ? 1.469   2.417  3.386   1.00 1.00 ? 3  LEU A H    12 
ATOM   8395  H HA   . LEU A 1 3  ? 0.046   3.797  1.304   1.00 1.00 ? 3  LEU A HA   12 
ATOM   8396  H HB2  . LEU A 1 3  ? 2.807   4.143  2.451   1.00 1.00 ? 3  LEU A HB2  12 
ATOM   8397  H HB3  . LEU A 1 3  ? 2.063   5.275  1.326   1.00 1.00 ? 3  LEU A HB3  12 
ATOM   8398  H HG   . LEU A 1 3  ? 0.830   4.603  4.035   1.00 1.00 ? 3  LEU A HG   12 
ATOM   8399  H HD11 . LEU A 1 3  ? 3.071   5.611  4.348   1.00 1.00 ? 3  LEU A HD11 12 
ATOM   8400  H HD12 . LEU A 1 3  ? 2.634   6.945  3.268   1.00 1.00 ? 3  LEU A HD12 12 
ATOM   8401  H HD13 . LEU A 1 3  ? 1.789   6.741  4.812   1.00 1.00 ? 3  LEU A HD13 12 
ATOM   8402  H HD21 . LEU A 1 3  ? 0.336   6.885  2.089   1.00 1.00 ? 3  LEU A HD21 12 
ATOM   8403  H HD22 . LEU A 1 3  ? -0.767  5.528  2.419   1.00 1.00 ? 3  LEU A HD22 12 
ATOM   8404  H HD23 . LEU A 1 3  ? -0.385  6.674  3.698   1.00 1.00 ? 3  LEU A HD23 12 
ATOM   8405  N N    . CYS A 1 4  ? 1.556   3.642  -0.778  1.00 1.00 ? 4  CYS A N    12 
ATOM   8406  C CA   . CYS A 1 4  ? 2.262   3.552  -2.050  1.00 1.00 ? 4  CYS A CA   12 
ATOM   8407  C C    . CYS A 1 4  ? 2.554   5.004  -2.426  1.00 1.00 ? 4  CYS A C    12 
ATOM   8408  O O    . CYS A 1 4  ? 1.704   5.870  -2.199  1.00 1.00 ? 4  CYS A O    12 
ATOM   8409  C CB   . CYS A 1 4  ? 1.417   2.923  -3.162  1.00 1.00 ? 4  CYS A CB   12 
ATOM   8410  S SG   . CYS A 1 4  ? 0.980   1.183  -2.962  1.00 1.00 ? 4  CYS A SG   12 
ATOM   8411  H H    . CYS A 1 4  ? 0.903   4.420  -0.711  1.00 1.00 ? 4  CYS A H    12 
ATOM   8412  H HA   . CYS A 1 4  ? 3.191   2.994  -1.927  1.00 1.00 ? 4  CYS A HA   12 
ATOM   8413  H HB2  . CYS A 1 4  ? 0.501   3.502  -3.275  1.00 1.00 ? 4  CYS A HB2  12 
ATOM   8414  H HB3  . CYS A 1 4  ? 1.966   3.000  -4.100  1.00 1.00 ? 4  CYS A HB3  12 
ATOM   8415  N N    . GLU A 1 5  ? 3.746   5.279  -2.959  1.00 1.00 ? 5  GLU A N    12 
ATOM   8416  C CA   . GLU A 1 5  ? 4.136   6.626  -3.347  1.00 1.00 ? 5  GLU A CA   12 
ATOM   8417  C C    . GLU A 1 5  ? 3.626   6.955  -4.752  1.00 1.00 ? 5  GLU A C    12 
ATOM   8418  O O    . GLU A 1 5  ? 3.524   6.073  -5.604  1.00 1.00 ? 5  GLU A O    12 
ATOM   8419  C CB   . GLU A 1 5  ? 5.656   6.804  -3.219  1.00 1.00 ? 5  GLU A CB   12 
ATOM   8420  C CG   . GLU A 1 5  ? 6.475   5.912  -4.163  1.00 1.00 ? 5  GLU A CG   12 
ATOM   8421  C CD   . GLU A 1 5  ? 7.968   6.124  -3.947  1.00 1.00 ? 5  GLU A CD   12 
ATOM   8422  O OE1  . GLU A 1 5  ? 8.646   5.223  -3.464  1.00 1.00 ? 5  GLU A OE1  12 
ATOM   8423  O OE2  . GLU A 1 5  ? 8.459   7.341  -4.307  1.00 1.00 ? 5  GLU A OE2  12 
ATOM   8424  H H    . GLU A 1 5  ? 4.380   4.525  -3.167  1.00 1.00 ? 5  GLU A H    12 
ATOM   8425  H HA   . GLU A 1 5  ? 3.688   7.331  -2.647  1.00 1.00 ? 5  GLU A HA   12 
ATOM   8426  H HB2  . GLU A 1 5  ? 5.898   7.848  -3.422  1.00 1.00 ? 5  GLU A HB2  12 
ATOM   8427  H HB3  . GLU A 1 5  ? 5.948   6.581  -2.193  1.00 1.00 ? 5  GLU A HB3  12 
ATOM   8428  H HG2  . GLU A 1 5  ? 6.249   4.861  -3.983  1.00 1.00 ? 5  GLU A HG2  12 
ATOM   8429  H HG3  . GLU A 1 5  ? 6.243   6.148  -5.201  1.00 1.00 ? 5  GLU A HG3  12 
ATOM   8430  H HE2  . GLU A 1 5  ? 9.398   7.387  -4.120  1.00 1.00 ? 5  GLU A HE2  12 
ATOM   8431  N N    . ARG A 1 6  ? 3.329   8.232  -4.988  1.00 1.00 ? 6  ARG A N    12 
ATOM   8432  C CA   . ARG A 1 6  ? 2.981   8.813  -6.269  1.00 1.00 ? 6  ARG A CA   12 
ATOM   8433  C C    . ARG A 1 6  ? 3.772   10.123 -6.383  1.00 1.00 ? 6  ARG A C    12 
ATOM   8434  O O    . ARG A 1 6  ? 3.702   10.934 -5.460  1.00 1.00 ? 6  ARG A O    12 
ATOM   8435  C CB   . ARG A 1 6  ? 1.469   9.101  -6.299  1.00 1.00 ? 6  ARG A CB   12 
ATOM   8436  C CG   . ARG A 1 6  ? 1.004   9.735  -7.617  1.00 1.00 ? 6  ARG A CG   12 
ATOM   8437  C CD   . ARG A 1 6  ? 0.906   8.744  -8.784  1.00 1.00 ? 6  ARG A CD   12 
ATOM   8438  N NE   . ARG A 1 6  ? 0.628   9.480  -10.025 1.00 1.00 ? 6  ARG A NE   12 
ATOM   8439  C CZ   . ARG A 1 6  ? 0.287   8.973  -11.217 1.00 1.00 ? 6  ARG A CZ   12 
ATOM   8440  N NH1  . ARG A 1 6  ? 0.164   7.652  -11.380 1.00 1.00 ? 6  ARG A NH1  12 
ATOM   8441  N NH2  . ARG A 1 6  ? 0.079   9.819  -12.231 1.00 1.00 ? 6  ARG A NH2  12 
ATOM   8442  H H    . ARG A 1 6  ? 3.409   8.891  -4.221  1.00 1.00 ? 6  ARG A H    12 
ATOM   8443  H HA   . ARG A 1 6  ? 3.234   8.113  -7.061  1.00 1.00 ? 6  ARG A HA   12 
ATOM   8444  H HB2  . ARG A 1 6  ? 0.900   8.189  -6.117  1.00 1.00 ? 6  ARG A HB2  12 
ATOM   8445  H HB3  . ARG A 1 6  ? 1.240   9.803  -5.493  1.00 1.00 ? 6  ARG A HB3  12 
ATOM   8446  H HG2  . ARG A 1 6  ? 0.010   10.150 -7.459  1.00 1.00 ? 6  ARG A HG2  12 
ATOM   8447  H HG3  . ARG A 1 6  ? 1.663   10.562 -7.882  1.00 1.00 ? 6  ARG A HG3  12 
ATOM   8448  H HD2  . ARG A 1 6  ? 1.841   8.195  -8.893  1.00 1.00 ? 6  ARG A HD2  12 
ATOM   8449  H HD3  . ARG A 1 6  ? 0.102   8.038  -8.567  1.00 1.00 ? 6  ARG A HD3  12 
ATOM   8450  H HE   . ARG A 1 6  ? 0.723   10.489 -9.981  1.00 1.00 ? 6  ARG A HE   12 
ATOM   8451  H HH11 . ARG A 1 6  ? 0.343   7.041  -10.598 1.00 1.00 ? 6  ARG A HH11 12 
ATOM   8452  H HH12 . ARG A 1 6  ? -0.093  7.249  -12.268 1.00 1.00 ? 6  ARG A HH12 12 
ATOM   8453  H HH21 . ARG A 1 6  ? 0.211   10.816 -12.055 1.00 1.00 ? 6  ARG A HH21 12 
ATOM   8454  H HH22 . ARG A 1 6  ? -0.193  9.512  -13.153 1.00 1.00 ? 6  ARG A HH22 12 
ATOM   8455  N N    . PRO A 1 7  ? 4.517   10.355 -7.476  1.00 1.00 ? 7  PRO A N    12 
ATOM   8456  C CA   . PRO A 1 7  ? 5.104   11.653 -7.745  1.00 1.00 ? 7  PRO A CA   12 
ATOM   8457  C C    . PRO A 1 7  ? 4.008   12.568 -8.308  1.00 1.00 ? 7  PRO A C    12 
ATOM   8458  O O    . PRO A 1 7  ? 3.259   13.190 -7.557  1.00 1.00 ? 7  PRO A O    12 
ATOM   8459  C CB   . PRO A 1 7  ? 6.265   11.373 -8.706  1.00 1.00 ? 7  PRO A CB   12 
ATOM   8460  C CG   . PRO A 1 7  ? 5.851   10.098 -9.450  1.00 1.00 ? 7  PRO A CG   12 
ATOM   8461  C CD   . PRO A 1 7  ? 4.917   9.375  -8.475  1.00 1.00 ? 7  PRO A CD   12 
ATOM   8462  H HA   . PRO A 1 7  ? 5.498   12.106 -6.836  1.00 1.00 ? 7  PRO A HA   12 
ATOM   8463  H HB2  . PRO A 1 7  ? 6.488   12.207 -9.374  1.00 1.00 ? 7  PRO A HB2  12 
ATOM   8464  H HB3  . PRO A 1 7  ? 7.152   11.147 -8.111  1.00 1.00 ? 7  PRO A HB3  12 
ATOM   8465  H HG2  . PRO A 1 7  ? 5.308   10.342 -10.364 1.00 1.00 ? 7  PRO A HG2  12 
ATOM   8466  H HG3  . PRO A 1 7  ? 6.718   9.487  -9.703  1.00 1.00 ? 7  PRO A HG3  12 
ATOM   8467  H HD2  . PRO A 1 7  ? 4.060   8.980  -9.019  1.00 1.00 ? 7  PRO A HD2  12 
ATOM   8468  H HD3  . PRO A 1 7  ? 5.460   8.562  -7.986  1.00 1.00 ? 7  PRO A HD3  12 
ATOM   8469  N N    . SER A 1 8  ? 3.857   12.617 -9.634  1.00 1.00 ? 8  SER A N    12 
ATOM   8470  C CA   . SER A 1 8  ? 2.855   13.430 -10.291 1.00 1.00 ? 8  SER A CA   12 
ATOM   8471  C C    . SER A 1 8  ? 1.470   12.816 -10.081 1.00 1.00 ? 8  SER A C    12 
ATOM   8472  O O    . SER A 1 8  ? 0.981   12.062 -10.929 1.00 1.00 ? 8  SER A O    12 
ATOM   8473  C CB   . SER A 1 8  ? 3.227   13.480 -11.776 1.00 1.00 ? 8  SER A CB   12 
ATOM   8474  O OG   . SER A 1 8  ? 3.545   12.168 -12.208 1.00 1.00 ? 8  SER A OG   12 
ATOM   8475  H H    . SER A 1 8  ? 4.450   12.081 -10.250 1.00 1.00 ? 8  SER A H    12 
ATOM   8476  H HA   . SER A 1 8  ? 2.864   14.445 -9.888  1.00 1.00 ? 8  SER A HA   12 
ATOM   8477  H HB2  . SER A 1 8  ? 2.397   13.883 -12.360 1.00 1.00 ? 8  SER A HB2  12 
ATOM   8478  H HB3  . SER A 1 8  ? 4.102   14.115 -11.913 1.00 1.00 ? 8  SER A HB3  12 
ATOM   8479  H HG   . SER A 1 8  ? 2.741   11.642 -12.135 1.00 1.00 ? 8  SER A HG   12 
ATOM   8480  N N    . GLY A 1 9  ? 0.854   13.115 -8.937  1.00 1.00 ? 9  GLY A N    12 
ATOM   8481  C CA   . GLY A 1 9  ? -0.541  12.819 -8.649  1.00 1.00 ? 9  GLY A CA   12 
ATOM   8482  C C    . GLY A 1 9  ? -1.328  14.059 -9.043  1.00 1.00 ? 9  GLY A C    12 
ATOM   8483  O O    . GLY A 1 9  ? -1.786  14.174 -10.175 1.00 1.00 ? 9  GLY A O    12 
ATOM   8484  H H    . GLY A 1 9  ? 1.411   13.600 -8.239  1.00 1.00 ? 9  GLY A H    12 
ATOM   8485  H HA2  . GLY A 1 9  ? -0.896  11.958 -9.216  1.00 1.00 ? 9  GLY A HA2  12 
ATOM   8486  H HA3  . GLY A 1 9  ? -0.658  12.619 -7.584  1.00 1.00 ? 9  GLY A HA3  12 
ATOM   8487  N N    . THR A 1 10 ? -1.426  15.009 -8.114  1.00 1.00 ? 10 THR A N    12 
ATOM   8488  C CA   . THR A 1 10 ? -1.927  16.345 -8.379  1.00 1.00 ? 10 THR A CA   12 
ATOM   8489  C C    . THR A 1 10 ? -0.735  17.141 -8.906  1.00 1.00 ? 10 THR A C    12 
ATOM   8490  O O    . THR A 1 10 ? -0.660  17.471 -10.092 1.00 1.00 ? 10 THR A O    12 
ATOM   8491  C CB   . THR A 1 10 ? -2.438  16.961 -7.065  1.00 1.00 ? 10 THR A CB   12 
ATOM   8492  O OG1  . THR A 1 10 ? -1.621  16.526 -5.989  1.00 1.00 ? 10 THR A OG1  12 
ATOM   8493  C CG2  . THR A 1 10 ? -3.897  16.596 -6.788  1.00 1.00 ? 10 THR A CG2  12 
ATOM   8494  H H    . THR A 1 10 ? -1.088  14.829 -7.178  1.00 1.00 ? 10 THR A H    12 
ATOM   8495  H HA   . THR A 1 10 ? -2.721  16.339 -9.129  1.00 1.00 ? 10 THR A HA   12 
ATOM   8496  H HB   . THR A 1 10 ? -2.384  18.050 -7.131  1.00 1.00 ? 10 THR A HB   12 
ATOM   8497  H HG1  . THR A 1 10 ? -1.927  15.658 -5.692  1.00 1.00 ? 10 THR A HG1  12 
ATOM   8498  H HG21 . THR A 1 10 ? -4.039  15.519 -6.843  1.00 1.00 ? 10 THR A HG21 12 
ATOM   8499  H HG22 . THR A 1 10 ? -4.180  16.955 -5.798  1.00 1.00 ? 10 THR A HG22 12 
ATOM   8500  H HG23 . THR A 1 10 ? -4.535  17.074 -7.531  1.00 1.00 ? 10 THR A HG23 12 
ATOM   8501  N N    . TRP A 1 11 ? 0.204   17.421 -7.998  1.00 1.00 ? 11 TRP A N    12 
ATOM   8502  C CA   . TRP A 1 11 ? 1.357   18.281 -8.215  1.00 1.00 ? 11 TRP A CA   12 
ATOM   8503  C C    . TRP A 1 11 ? 2.328   17.670 -9.231  1.00 1.00 ? 11 TRP A C    12 
ATOM   8504  O O    . TRP A 1 11 ? 3.394   17.157 -8.895  1.00 1.00 ? 11 TRP A O    12 
ATOM   8505  C CB   . TRP A 1 11 ? 2.020   18.587 -6.868  1.00 1.00 ? 11 TRP A CB   12 
ATOM   8506  C CG   . TRP A 1 11 ? 2.903   19.797 -6.849  1.00 1.00 ? 11 TRP A CG   12 
ATOM   8507  C CD1  . TRP A 1 11 ? 3.957   20.030 -7.664  1.00 1.00 ? 11 TRP A CD1  12 
ATOM   8508  C CD2  . TRP A 1 11 ? 2.822   20.962 -5.975  1.00 1.00 ? 11 TRP A CD2  12 
ATOM   8509  N NE1  . TRP A 1 11 ? 4.499   21.262 -7.387  1.00 1.00 ? 11 TRP A NE1  12 
ATOM   8510  C CE2  . TRP A 1 11 ? 3.856   21.871 -6.336  1.00 1.00 ? 11 TRP A CE2  12 
ATOM   8511  C CE3  . TRP A 1 11 ? 1.984   21.345 -4.908  1.00 1.00 ? 11 TRP A CE3  12 
ATOM   8512  C CZ2  . TRP A 1 11 ? 4.059   23.087 -5.674  1.00 1.00 ? 11 TRP A CZ2  12 
ATOM   8513  C CZ3  . TRP A 1 11 ? 2.245   22.513 -4.171  1.00 1.00 ? 11 TRP A CZ3  12 
ATOM   8514  C CH2  . TRP A 1 11 ? 3.274   23.385 -4.554  1.00 1.00 ? 11 TRP A CH2  12 
ATOM   8515  H H    . TRP A 1 11 ? 0.019   17.096 -7.054  1.00 1.00 ? 11 TRP A H    12 
ATOM   8516  H HA   . TRP A 1 11 ? 0.990   19.229 -8.615  1.00 1.00 ? 11 TRP A HA   12 
ATOM   8517  H HB2  . TRP A 1 11 ? 1.232   18.762 -6.134  1.00 1.00 ? 11 TRP A HB2  12 
ATOM   8518  H HB3  . TRP A 1 11 ? 2.584   17.715 -6.538  1.00 1.00 ? 11 TRP A HB3  12 
ATOM   8519  H HD1  . TRP A 1 11 ? 4.327   19.377 -8.435  1.00 1.00 ? 11 TRP A HD1  12 
ATOM   8520  H HE1  . TRP A 1 11 ? 5.286   21.682 -7.864  1.00 1.00 ? 11 TRP A HE1  12 
ATOM   8521  H HE3  . TRP A 1 11 ? 1.164   20.710 -4.612  1.00 1.00 ? 11 TRP A HE3  12 
ATOM   8522  H HZ2  . TRP A 1 11 ? 4.844   23.759 -5.988  1.00 1.00 ? 11 TRP A HZ2  12 
ATOM   8523  H HZ3  . TRP A 1 11 ? 1.666   22.728 -3.290  1.00 1.00 ? 11 TRP A HZ3  12 
ATOM   8524  H HH2  . TRP A 1 11 ? 3.478   24.265 -3.974  1.00 1.00 ? 11 TRP A HH2  12 
ATOM   8525  N N    . SER A 1 12 ? 1.961   17.758 -10.503 1.00 1.00 ? 12 SER A N    12 
ATOM   8526  C CA   . SER A 1 12 ? 2.711   17.197 -11.607 1.00 1.00 ? 12 SER A CA   12 
ATOM   8527  C C    . SER A 1 12 ? 3.715   18.226 -12.121 1.00 1.00 ? 12 SER A C    12 
ATOM   8528  O O    . SER A 1 12 ? 3.601   18.694 -13.251 1.00 1.00 ? 12 SER A O    12 
ATOM   8529  C CB   . SER A 1 12 ? 1.706   16.753 -12.674 1.00 1.00 ? 12 SER A CB   12 
ATOM   8530  O OG   . SER A 1 12 ? 0.759   15.881 -12.076 1.00 1.00 ? 12 SER A OG   12 
ATOM   8531  H H    . SER A 1 12 ? 1.030   18.115 -10.686 1.00 1.00 ? 12 SER A H    12 
ATOM   8532  H HA   . SER A 1 12 ? 3.265   16.318 -11.278 1.00 1.00 ? 12 SER A HA   12 
ATOM   8533  H HB2  . SER A 1 12 ? 1.194   17.621 -13.093 1.00 1.00 ? 12 SER A HB2  12 
ATOM   8534  H HB3  . SER A 1 12 ? 2.233   16.241 -13.482 1.00 1.00 ? 12 SER A HB3  12 
ATOM   8535  H HG   . SER A 1 12 ? 0.200   16.380 -11.462 1.00 1.00 ? 12 SER A HG   12 
ATOM   8536  N N    . GLY A 1 13 ? 4.693   18.590 -11.285 1.00 1.00 ? 13 GLY A N    12 
ATOM   8537  C CA   . GLY A 1 13 ? 5.683   19.597 -11.638 1.00 1.00 ? 13 GLY A CA   12 
ATOM   8538  C C    . GLY A 1 13 ? 6.732   19.758 -10.540 1.00 1.00 ? 13 GLY A C    12 
ATOM   8539  O O    . GLY A 1 13 ? 6.749   18.994 -9.574  1.00 1.00 ? 13 GLY A O    12 
ATOM   8540  H H    . GLY A 1 13 ? 4.755   18.166 -10.364 1.00 1.00 ? 13 GLY A H    12 
ATOM   8541  H HA2  . GLY A 1 13 ? 6.184   19.306 -12.562 1.00 1.00 ? 13 GLY A HA2  12 
ATOM   8542  H HA3  . GLY A 1 13 ? 5.177   20.552 -11.790 1.00 1.00 ? 13 GLY A HA3  12 
ATOM   8543  N N    . VAL A 1 14 ? 7.606   20.758 -10.700 1.00 1.00 ? 14 VAL A N    12 
ATOM   8544  C CA   . VAL A 1 14 ? 8.651   21.087 -9.735  1.00 1.00 ? 14 VAL A CA   12 
ATOM   8545  C C    . VAL A 1 14 ? 7.991   21.374 -8.383  1.00 1.00 ? 14 VAL A C    12 
ATOM   8546  O O    . VAL A 1 14 ? 6.961   22.040 -8.342  1.00 1.00 ? 14 VAL A O    12 
ATOM   8547  C CB   . VAL A 1 14 ? 9.480   22.282 -10.242 1.00 1.00 ? 14 VAL A CB   12 
ATOM   8548  C CG1  . VAL A 1 14 ? 10.593  22.677 -9.260  1.00 1.00 ? 14 VAL A CG1  12 
ATOM   8549  C CG2  . VAL A 1 14 ? 10.129  21.965 -11.598 1.00 1.00 ? 14 VAL A CG2  12 
ATOM   8550  H H    . VAL A 1 14 ? 7.501   21.364 -11.499 1.00 1.00 ? 14 VAL A H    12 
ATOM   8551  H HA   . VAL A 1 14 ? 9.294   20.213 -9.658  1.00 1.00 ? 14 VAL A HA   12 
ATOM   8552  H HB   . VAL A 1 14 ? 8.818   23.141 -10.361 1.00 1.00 ? 14 VAL A HB   12 
ATOM   8553  H HG11 . VAL A 1 14 ? 11.274  21.841 -9.107  1.00 1.00 ? 14 VAL A HG11 12 
ATOM   8554  H HG12 . VAL A 1 14 ? 11.155  23.517 -9.664  1.00 1.00 ? 14 VAL A HG12 12 
ATOM   8555  H HG13 . VAL A 1 14 ? 10.172  22.980 -8.302  1.00 1.00 ? 14 VAL A HG13 12 
ATOM   8556  H HG21 . VAL A 1 14 ? 10.763  21.082 -11.509 1.00 1.00 ? 14 VAL A HG21 12 
ATOM   8557  H HG22 . VAL A 1 14 ? 9.372   21.784 -12.359 1.00 1.00 ? 14 VAL A HG22 12 
ATOM   8558  H HG23 . VAL A 1 14 ? 10.740  22.809 -11.920 1.00 1.00 ? 14 VAL A HG23 12 
ATOM   8559  N N    . CYS A 1 15 ? 8.584   20.922 -7.273  1.00 1.00 ? 15 CYS A N    12 
ATOM   8560  C CA   . CYS A 1 15 ? 7.904   20.935 -5.977  1.00 1.00 ? 15 CYS A CA   12 
ATOM   8561  C C    . CYS A 1 15 ? 7.775   22.332 -5.384  1.00 1.00 ? 15 CYS A C    12 
ATOM   8562  O O    . CYS A 1 15 ? 6.811   22.595 -4.673  1.00 1.00 ? 15 CYS A O    12 
ATOM   8563  C CB   . CYS A 1 15 ? 8.618   20.038 -4.952  1.00 1.00 ? 15 CYS A CB   12 
ATOM   8564  S SG   . CYS A 1 15 ? 9.669   20.902 -3.754  1.00 1.00 ? 15 CYS A SG   12 
ATOM   8565  H H    . CYS A 1 15 ? 9.454   20.414 -7.386  1.00 1.00 ? 15 CYS A H    12 
ATOM   8566  H HA   . CYS A 1 15 ? 6.901   20.530 -6.121  1.00 1.00 ? 15 CYS A HA   12 
ATOM   8567  H HB2  . CYS A 1 15 ? 7.865   19.510 -4.370  1.00 1.00 ? 15 CYS A HB2  12 
ATOM   8568  H HB3  . CYS A 1 15 ? 9.232   19.306 -5.462  1.00 1.00 ? 15 CYS A HB3  12 
ATOM   8569  N N    . GLY A 1 16 ? 8.778   23.194 -5.566  1.00 1.00 ? 16 GLY A N    12 
ATOM   8570  C CA   . GLY A 1 16 ? 8.817   24.506 -4.930  1.00 1.00 ? 16 GLY A CA   12 
ATOM   8571  C C    . GLY A 1 16 ? 9.078   24.460 -3.414  1.00 1.00 ? 16 GLY A C    12 
ATOM   8572  O O    . GLY A 1 16 ? 9.901   25.225 -2.919  1.00 1.00 ? 16 GLY A O    12 
ATOM   8573  H H    . GLY A 1 16 ? 9.563   22.907 -6.129  1.00 1.00 ? 16 GLY A H    12 
ATOM   8574  H HA2  . GLY A 1 16 ? 9.606   25.091 -5.402  1.00 1.00 ? 16 GLY A HA2  12 
ATOM   8575  H HA3  . GLY A 1 16 ? 7.869   25.017 -5.101  1.00 1.00 ? 16 GLY A HA3  12 
ATOM   8576  N N    . ASN A 1 17 ? 8.384   23.594 -2.665  1.00 1.00 ? 17 ASN A N    12 
ATOM   8577  C CA   . ASN A 1 17 ? 8.372   23.597 -1.205  1.00 1.00 ? 17 ASN A CA   12 
ATOM   8578  C C    . ASN A 1 17 ? 7.614   22.387 -0.633  1.00 1.00 ? 17 ASN A C    12 
ATOM   8579  O O    . ASN A 1 17 ? 6.510   22.073 -1.079  1.00 1.00 ? 17 ASN A O    12 
ATOM   8580  C CB   . ASN A 1 17 ? 7.710   24.889 -0.706  1.00 1.00 ? 17 ASN A CB   12 
ATOM   8581  C CG   . ASN A 1 17 ? 7.517   24.855 0.804   1.00 1.00 ? 17 ASN A CG   12 
ATOM   8582  O OD1  . ASN A 1 17 ? 6.436   24.538 1.285   1.00 1.00 ? 17 ASN A OD1  12 
ATOM   8583  N ND2  . ASN A 1 17 ? 8.569   25.140 1.564   1.00 1.00 ? 17 ASN A ND2  12 
ATOM   8584  H H    . ASN A 1 17 ? 7.815   22.907 -3.147  1.00 1.00 ? 17 ASN A H    12 
ATOM   8585  H HA   . ASN A 1 17 ? 9.404   23.571 -0.851  1.00 1.00 ? 17 ASN A HA   12 
ATOM   8586  H HB2  . ASN A 1 17 ? 8.311   25.760 -0.970  1.00 1.00 ? 17 ASN A HB2  12 
ATOM   8587  H HB3  . ASN A 1 17 ? 6.730   24.991 -1.175  1.00 1.00 ? 17 ASN A HB3  12 
ATOM   8588  H HD21 . ASN A 1 17 ? 9.440   25.426 1.140   1.00 1.00 ? 17 ASN A HD21 12 
ATOM   8589  H HD22 . ASN A 1 17 ? 8.458   25.158 2.566   1.00 1.00 ? 17 ASN A HD22 12 
ATOM   8590  N N    . ASN A 1 18 ? 8.193   21.744 0.393   1.00 1.00 ? 18 ASN A N    12 
ATOM   8591  C CA   . ASN A 1 18 ? 7.622   20.610 1.109   1.00 1.00 ? 18 ASN A CA   12 
ATOM   8592  C C    . ASN A 1 18 ? 6.192   20.856 1.566   1.00 1.00 ? 18 ASN A C    12 
ATOM   8593  O O    . ASN A 1 18 ? 5.283   20.116 1.208   1.00 1.00 ? 18 ASN A O    12 
ATOM   8594  C CB   . ASN A 1 18 ? 8.489   20.302 2.335   1.00 1.00 ? 18 ASN A CB   12 
ATOM   8595  C CG   . ASN A 1 18 ? 8.028   19.005 2.985   1.00 1.00 ? 18 ASN A CG   12 
ATOM   8596  O OD1  . ASN A 1 18 ? 7.019   18.954 3.684   1.00 1.00 ? 18 ASN A OD1  12 
ATOM   8597  N ND2  . ASN A 1 18 ? 8.735   17.915 2.729   1.00 1.00 ? 18 ASN A ND2  12 
ATOM   8598  H H    . ASN A 1 18 ? 9.107   22.034 0.701   1.00 1.00 ? 18 ASN A H    12 
ATOM   8599  H HA   . ASN A 1 18 ? 7.616   19.748 0.446   1.00 1.00 ? 18 ASN A HA   12 
ATOM   8600  H HB2  . ASN A 1 18 ? 9.527   20.222 2.024   1.00 1.00 ? 18 ASN A HB2  12 
ATOM   8601  H HB3  . ASN A 1 18 ? 8.435   21.103 3.070   1.00 1.00 ? 18 ASN A HB3  12 
ATOM   8602  H HD21 . ASN A 1 18 ? 9.626   17.947 2.250   1.00 1.00 ? 18 ASN A HD21 12 
ATOM   8603  H HD22 . ASN A 1 18 ? 8.375   17.052 3.116   1.00 1.00 ? 18 ASN A HD22 12 
ATOM   8604  N N    . ASN A 1 19 ? 6.025   21.861 2.422   1.00 1.00 ? 19 ASN A N    12 
ATOM   8605  C CA   . ASN A 1 19 ? 4.748   22.181 3.045   1.00 1.00 ? 19 ASN A CA   12 
ATOM   8606  C C    . ASN A 1 19 ? 3.655   22.410 2.003   1.00 1.00 ? 19 ASN A C    12 
ATOM   8607  O O    . ASN A 1 19 ? 2.562   21.867 2.132   1.00 1.00 ? 19 ASN A O    12 
ATOM   8608  C CB   . ASN A 1 19 ? 4.870   23.377 3.991   1.00 1.00 ? 19 ASN A CB   12 
ATOM   8609  C CG   . ASN A 1 19 ? 3.522   23.653 4.650   1.00 1.00 ? 19 ASN A CG   12 
ATOM   8610  O OD1  . ASN A 1 19 ? 3.102   22.914 5.533   1.00 1.00 ? 19 ASN A OD1  12 
ATOM   8611  N ND2  . ASN A 1 19 ? 2.825   24.701 4.220   1.00 1.00 ? 19 ASN A ND2  12 
ATOM   8612  H H    . ASN A 1 19 ? 6.860   22.362 2.683   1.00 1.00 ? 19 ASN A H    12 
ATOM   8613  H HA   . ASN A 1 19 ? 4.448   21.327 3.649   1.00 1.00 ? 19 ASN A HA   12 
ATOM   8614  H HB2  . ASN A 1 19 ? 5.598   23.147 4.771   1.00 1.00 ? 19 ASN A HB2  12 
ATOM   8615  H HB3  . ASN A 1 19 ? 5.204   24.263 3.453   1.00 1.00 ? 19 ASN A HB3  12 
ATOM   8616  H HD21 . ASN A 1 19 ? 3.184   25.302 3.494   1.00 1.00 ? 19 ASN A HD21 12 
ATOM   8617  H HD22 . ASN A 1 19 ? 1.931   24.887 4.649   1.00 1.00 ? 19 ASN A HD22 12 
ATOM   8618  N N    . ALA A 1 20 ? 3.945   23.201 0.968   1.00 1.00 ? 20 ALA A N    12 
ATOM   8619  C CA   . ALA A 1 20 ? 2.990   23.426 -0.106  1.00 1.00 ? 20 ALA A CA   12 
ATOM   8620  C C    . ALA A 1 20 ? 2.626   22.101 -0.778  1.00 1.00 ? 20 ALA A C    12 
ATOM   8621  O O    . ALA A 1 20 ? 1.445   21.763 -0.855  1.00 1.00 ? 20 ALA A O    12 
ATOM   8622  C CB   . ALA A 1 20 ? 3.537   24.436 -1.116  1.00 1.00 ? 20 ALA A CB   12 
ATOM   8623  H H    . ALA A 1 20 ? 4.863   23.631 0.922   1.00 1.00 ? 20 ALA A H    12 
ATOM   8624  H HA   . ALA A 1 20 ? 2.084   23.854 0.327   1.00 1.00 ? 20 ALA A HA   12 
ATOM   8625  H HB1  . ALA A 1 20 ? 3.827   25.354 -0.606  1.00 1.00 ? 20 ALA A HB1  12 
ATOM   8626  H HB2  . ALA A 1 20 ? 4.399   24.023 -1.642  1.00 1.00 ? 20 ALA A HB2  12 
ATOM   8627  H HB3  . ALA A 1 20 ? 2.752   24.669 -1.835  1.00 1.00 ? 20 ALA A HB3  12 
ATOM   8628  N N    . CYS A 1 21 ? 3.638   21.355 -1.241  1.00 1.00 ? 21 CYS A N    12 
ATOM   8629  C CA   . CYS A 1 21 ? 3.458   20.050 -1.879  1.00 1.00 ? 21 CYS A CA   12 
ATOM   8630  C C    . CYS A 1 21 ? 2.544   19.151 -1.041  1.00 1.00 ? 21 CYS A C    12 
ATOM   8631  O O    . CYS A 1 21 ? 1.503   18.685 -1.507  1.00 1.00 ? 21 CYS A O    12 
ATOM   8632  C CB   . CYS A 1 21 ? 4.829   19.397 -2.107  1.00 1.00 ? 21 CYS A CB   12 
ATOM   8633  S SG   . CYS A 1 21 ? 4.844   17.589 -2.237  1.00 1.00 ? 21 CYS A SG   12 
ATOM   8634  H H    . CYS A 1 21 ? 4.588   21.703 -1.135  1.00 1.00 ? 21 CYS A H    12 
ATOM   8635  H HA   . CYS A 1 21 ? 2.992   20.213 -2.847  1.00 1.00 ? 21 CYS A HA   12 
ATOM   8636  H HB2  . CYS A 1 21 ? 5.285   19.820 -3.002  1.00 1.00 ? 21 CYS A HB2  12 
ATOM   8637  H HB3  . CYS A 1 21 ? 5.477   19.623 -1.264  1.00 1.00 ? 21 CYS A HB3  12 
ATOM   8638  N N    . LYS A 1 22 ? 2.936   18.955 0.220   1.00 1.00 ? 22 LYS A N    12 
ATOM   8639  C CA   . LYS A 1 22 ? 2.204   18.212 1.229   1.00 1.00 ? 22 LYS A CA   12 
ATOM   8640  C C    . LYS A 1 22 ? 0.753   18.664 1.272   1.00 1.00 ? 22 LYS A C    12 
ATOM   8641  O O    . LYS A 1 22 ? -0.153  17.864 1.026   1.00 1.00 ? 22 LYS A O    12 
ATOM   8642  C CB   . LYS A 1 22 ? 2.888   18.447 2.585   1.00 1.00 ? 22 LYS A CB   12 
ATOM   8643  C CG   . LYS A 1 22 ? 2.182   17.760 3.766   1.00 1.00 ? 22 LYS A CG   12 
ATOM   8644  C CD   . LYS A 1 22 ? 2.746   18.166 5.142   1.00 1.00 ? 22 LYS A CD   12 
ATOM   8645  C CE   . LYS A 1 22 ? 4.255   18.456 5.193   1.00 1.00 ? 22 LYS A CE   12 
ATOM   8646  N NZ   . LYS A 1 22 ? 5.088   17.323 4.754   1.00 1.00 ? 22 LYS A NZ   12 
ATOM   8647  H H    . LYS A 1 22 ? 3.791   19.413 0.507   1.00 1.00 ? 22 LYS A H    12 
ATOM   8648  H HA   . LYS A 1 22 ? 2.224   17.153 0.971   1.00 1.00 ? 22 LYS A HA   12 
ATOM   8649  H HB2  . LYS A 1 22 ? 3.914   18.099 2.494   1.00 1.00 ? 22 LYS A HB2  12 
ATOM   8650  H HB3  . LYS A 1 22 ? 2.919   19.514 2.793   1.00 1.00 ? 22 LYS A HB3  12 
ATOM   8651  H HG2  . LYS A 1 22 ? 1.127   18.042 3.778   1.00 1.00 ? 22 LYS A HG2  12 
ATOM   8652  H HG3  . LYS A 1 22 ? 2.206   16.684 3.623   1.00 1.00 ? 22 LYS A HG3  12 
ATOM   8653  H HD2  . LYS A 1 22 ? 2.244   19.090 5.441   1.00 1.00 ? 22 LYS A HD2  12 
ATOM   8654  H HD3  . LYS A 1 22 ? 2.479   17.403 5.876   1.00 1.00 ? 22 LYS A HD3  12 
ATOM   8655  H HE2  . LYS A 1 22 ? 4.475   19.306 4.551   1.00 1.00 ? 22 LYS A HE2  12 
ATOM   8656  H HE3  . LYS A 1 22 ? 4.536   18.734 6.211   1.00 1.00 ? 22 LYS A HE3  12 
ATOM   8657  H HZ1  . LYS A 1 22 ? 4.714   16.914 3.907   1.00 1.00 ? 22 LYS A HZ1  12 
ATOM   8658  H HZ2  . LYS A 1 22 ? 6.020   17.669 4.538   1.00 1.00 ? 22 LYS A HZ2  12 
ATOM   8659  H HZ3  . LYS A 1 22 ? 5.144   16.609 5.465   1.00 1.00 ? 22 LYS A HZ3  12 
ATOM   8660  N N    . ASN A 1 23 ? 0.551   19.931 1.645   1.00 1.00 ? 23 ASN A N    12 
ATOM   8661  C CA   . ASN A 1 23 ? -0.772  20.483 1.860   1.00 1.00 ? 23 ASN A CA   12 
ATOM   8662  C C    . ASN A 1 23 ? -1.607  20.223 0.621   1.00 1.00 ? 23 ASN A C    12 
ATOM   8663  O O    . ASN A 1 23 ? -2.589  19.494 0.694   1.00 1.00 ? 23 ASN A O    12 
ATOM   8664  C CB   . ASN A 1 23 ? -0.702  21.988 2.163   1.00 1.00 ? 23 ASN A CB   12 
ATOM   8665  C CG   . ASN A 1 23 ? -2.048  22.697 1.960   1.00 1.00 ? 23 ASN A CG   12 
ATOM   8666  O OD1  . ASN A 1 23 ? -3.108  22.203 2.338   1.00 1.00 ? 23 ASN A OD1  12 
ATOM   8667  N ND2  . ASN A 1 23 ? -2.027  23.869 1.331   1.00 1.00 ? 23 ASN A ND2  12 
ATOM   8668  H H    . ASN A 1 23 ? 1.352   20.539 1.784   1.00 1.00 ? 23 ASN A H    12 
ATOM   8669  H HA   . ASN A 1 23 ? -1.204  19.946 2.708   1.00 1.00 ? 23 ASN A HA   12 
ATOM   8670  H HB2  . ASN A 1 23 ? -0.366  22.137 3.189   1.00 1.00 ? 23 ASN A HB2  12 
ATOM   8671  H HB3  . ASN A 1 23 ? 0.027   22.444 1.493   1.00 1.00 ? 23 ASN A HB3  12 
ATOM   8672  H HD21 . ASN A 1 23 ? -1.155  24.270 1.020   1.00 1.00 ? 23 ASN A HD21 12 
ATOM   8673  H HD22 . ASN A 1 23 ? -2.898  24.356 1.181   1.00 1.00 ? 23 ASN A HD22 12 
ATOM   8674  N N    . GLN A 1 24 ? -1.203  20.789 -0.517  1.00 1.00 ? 24 GLN A N    12 
ATOM   8675  C CA   . GLN A 1 24 ? -1.988  20.677 -1.732  1.00 1.00 ? 24 GLN A CA   12 
ATOM   8676  C C    . GLN A 1 24 ? -2.324  19.222 -2.029  1.00 1.00 ? 24 GLN A C    12 
ATOM   8677  O O    . GLN A 1 24 ? -3.482  18.934 -2.320  1.00 1.00 ? 24 GLN A O    12 
ATOM   8678  C CB   . GLN A 1 24 ? -1.293  21.351 -2.915  1.00 1.00 ? 24 GLN A CB   12 
ATOM   8679  C CG   . GLN A 1 24 ? -1.291  22.877 -2.740  1.00 1.00 ? 24 GLN A CG   12 
ATOM   8680  C CD   . GLN A 1 24 ? -0.746  23.663 -3.931  1.00 1.00 ? 24 GLN A CD   12 
ATOM   8681  O OE1  . GLN A 1 24 ? -0.294  24.790 -3.765  1.00 1.00 ? 24 GLN A OE1  12 
ATOM   8682  N NE2  . GLN A 1 24 ? -0.766  23.099 -5.135  1.00 1.00 ? 24 GLN A NE2  12 
ATOM   8683  H H    . GLN A 1 24 ? -0.307  21.268 -0.550  1.00 1.00 ? 24 GLN A H    12 
ATOM   8684  H HA   . GLN A 1 24 ? -2.943  21.175 -1.557  1.00 1.00 ? 24 GLN A HA   12 
ATOM   8685  H HB2  . GLN A 1 24 ? -0.274  20.976 -2.988  1.00 1.00 ? 24 GLN A HB2  12 
ATOM   8686  H HB3  . GLN A 1 24 ? -1.850  21.082 -3.813  1.00 1.00 ? 24 GLN A HB3  12 
ATOM   8687  H HG2  . GLN A 1 24 ? -2.313  23.212 -2.574  1.00 1.00 ? 24 GLN A HG2  12 
ATOM   8688  H HG3  . GLN A 1 24 ? -0.687  23.129 -1.870  1.00 1.00 ? 24 GLN A HG3  12 
ATOM   8689  H HE21 . GLN A 1 24 ? -1.082  22.151 -5.257  1.00 1.00 ? 24 GLN A HE21 12 
ATOM   8690  H HE22 . GLN A 1 24 ? -0.381  23.619 -5.908  1.00 1.00 ? 24 GLN A HE22 12 
ATOM   8691  N N    . CYS A 1 25 ? -1.364  18.299 -1.908  1.00 1.00 ? 25 CYS A N    12 
ATOM   8692  C CA   . CYS A 1 25 ? -1.695  16.901 -2.130  1.00 1.00 ? 25 CYS A CA   12 
ATOM   8693  C C    . CYS A 1 25 ? -2.829  16.427 -1.220  1.00 1.00 ? 25 CYS A C    12 
ATOM   8694  O O    . CYS A 1 25 ? -3.889  16.047 -1.711  1.00 1.00 ? 25 CYS A O    12 
ATOM   8695  C CB   . CYS A 1 25 ? -0.504  15.974 -1.938  1.00 1.00 ? 25 CYS A CB   12 
ATOM   8696  S SG   . CYS A 1 25 ? -1.043  14.309 -2.371  1.00 1.00 ? 25 CYS A SG   12 
ATOM   8697  H H    . CYS A 1 25 ? -0.416  18.558 -1.646  1.00 1.00 ? 25 CYS A H    12 
ATOM   8698  H HA   . CYS A 1 25 ? -2.022  16.801 -3.166  1.00 1.00 ? 25 CYS A HA   12 
ATOM   8699  H HB2  . CYS A 1 25 ? 0.330   16.266 -2.565  1.00 1.00 ? 25 CYS A HB2  12 
ATOM   8700  H HB3  . CYS A 1 25 ? -0.171  15.978 -0.901  1.00 1.00 ? 25 CYS A HB3  12 
ATOM   8701  N N    . ILE A 1 26 ? -2.607  16.427 0.098   1.00 1.00 ? 26 ILE A N    12 
ATOM   8702  C CA   . ILE A 1 26 ? -3.538  15.794 1.033   1.00 1.00 ? 26 ILE A CA   12 
ATOM   8703  C C    . ILE A 1 26 ? -4.835  16.608 1.176   1.00 1.00 ? 26 ILE A C    12 
ATOM   8704  O O    . ILE A 1 26 ? -5.860  16.109 1.655   1.00 1.00 ? 26 ILE A O    12 
ATOM   8705  C CB   . ILE A 1 26 ? -2.838  15.522 2.382   1.00 1.00 ? 26 ILE A CB   12 
ATOM   8706  C CG1  . ILE A 1 26 ? -2.655  16.798 3.222   1.00 1.00 ? 26 ILE A CG1  12 
ATOM   8707  C CG2  . ILE A 1 26 ? -1.490  14.820 2.155   1.00 1.00 ? 26 ILE A CG2  12 
ATOM   8708  C CD1  . ILE A 1 26 ? -1.835  16.560 4.496   1.00 1.00 ? 26 ILE A CD1  12 
ATOM   8709  H H    . ILE A 1 26 ? -1.759  16.865 0.456   1.00 1.00 ? 26 ILE A H    12 
ATOM   8710  H HA   . ILE A 1 26 ? -3.821  14.823 0.620   1.00 1.00 ? 26 ILE A HA   12 
ATOM   8711  H HB   . ILE A 1 26 ? -3.474  14.840 2.951   1.00 1.00 ? 26 ILE A HB   12 
ATOM   8712  H HG12 . ILE A 1 26 ? -2.162  17.567 2.630   1.00 1.00 ? 26 ILE A HG12 12 
ATOM   8713  H HG13 . ILE A 1 26 ? -3.637  17.163 3.524   1.00 1.00 ? 26 ILE A HG13 12 
ATOM   8714  H HG21 . ILE A 1 26 ? -1.619  13.959 1.506   1.00 1.00 ? 26 ILE A HG21 12 
ATOM   8715  H HG22 . ILE A 1 26 ? -0.762  15.495 1.709   1.00 1.00 ? 26 ILE A HG22 12 
ATOM   8716  H HG23 . ILE A 1 26 ? -1.091  14.465 3.100   1.00 1.00 ? 26 ILE A HG23 12 
ATOM   8717  H HD11 . ILE A 1 26 ? -2.238  15.708 5.047   1.00 1.00 ? 26 ILE A HD11 12 
ATOM   8718  H HD12 . ILE A 1 26 ? -0.790  16.371 4.250   1.00 1.00 ? 26 ILE A HD12 12 
ATOM   8719  H HD13 . ILE A 1 26 ? -1.883  17.446 5.127   1.00 1.00 ? 26 ILE A HD13 12 
ATOM   8720  N N    . ASN A 1 27 ? -4.794  17.865 0.729   1.00 1.00 ? 27 ASN A N    12 
ATOM   8721  C CA   . ASN A 1 27 ? -5.918  18.781 0.727   1.00 1.00 ? 27 ASN A CA   12 
ATOM   8722  C C    . ASN A 1 27 ? -6.784  18.498 -0.499  1.00 1.00 ? 27 ASN A C    12 
ATOM   8723  O O    . ASN A 1 27 ? -7.948  18.129 -0.344  1.00 1.00 ? 27 ASN A O    12 
ATOM   8724  C CB   . ASN A 1 27 ? -5.357  20.204 0.774   1.00 1.00 ? 27 ASN A CB   12 
ATOM   8725  C CG   . ASN A 1 27 ? -6.385  21.295 1.015   1.00 1.00 ? 27 ASN A CG   12 
ATOM   8726  O OD1  . ASN A 1 27 ? -7.545  21.178 0.637   1.00 1.00 ? 27 ASN A OD1  12 
ATOM   8727  N ND2  . ASN A 1 27 ? -5.945  22.375 1.654   1.00 1.00 ? 27 ASN A ND2  12 
ATOM   8728  H H    . ASN A 1 27 ? -3.905  18.234 0.397   1.00 1.00 ? 27 ASN A H    12 
ATOM   8729  H HA   . ASN A 1 27 ? -6.512  18.625 1.629   1.00 1.00 ? 27 ASN A HA   12 
ATOM   8730  H HB2  . ASN A 1 27 ? -4.671  20.233 1.621   1.00 1.00 ? 27 ASN A HB2  12 
ATOM   8731  H HB3  . ASN A 1 27 ? -4.816  20.434 -0.144  1.00 1.00 ? 27 ASN A HB3  12 
ATOM   8732  H HD21 . ASN A 1 27 ? -4.975  22.410 1.967   1.00 1.00 ? 27 ASN A HD21 12 
ATOM   8733  H HD22 . ASN A 1 27 ? -6.587  23.127 1.849   1.00 1.00 ? 27 ASN A HD22 12 
ATOM   8734  N N    . LEU A 1 28 ? -6.215  18.586 -1.707  1.00 1.00 ? 28 LEU A N    12 
ATOM   8735  C CA   . LEU A 1 28 ? -6.945  18.342 -2.943  1.00 1.00 ? 28 LEU A CA   12 
ATOM   8736  C C    . LEU A 1 28 ? -7.278  16.853 -3.079  1.00 1.00 ? 28 LEU A C    12 
ATOM   8737  O O    . LEU A 1 28 ? -8.455  16.498 -3.084  1.00 1.00 ? 28 LEU A O    12 
ATOM   8738  C CB   . LEU A 1 28 ? -6.163  18.856 -4.162  1.00 1.00 ? 28 LEU A CB   12 
ATOM   8739  C CG   . LEU A 1 28 ? -6.328  20.364 -4.424  1.00 1.00 ? 28 LEU A CG   12 
ATOM   8740  C CD1  . LEU A 1 28 ? -5.905  21.248 -3.244  1.00 1.00 ? 28 LEU A CD1  12 
ATOM   8741  C CD2  . LEU A 1 28 ? -5.501  20.744 -5.656  1.00 1.00 ? 28 LEU A CD2  12 
ATOM   8742  H H    . LEU A 1 28 ? -5.226  18.803 -1.786  1.00 1.00 ? 28 LEU A H    12 
ATOM   8743  H HA   . LEU A 1 28 ? -7.893  18.882 -2.905  1.00 1.00 ? 28 LEU A HA   12 
ATOM   8744  H HB2  . LEU A 1 28 ? -5.110  18.596 -4.075  1.00 1.00 ? 28 LEU A HB2  12 
ATOM   8745  H HB3  . LEU A 1 28 ? -6.551  18.341 -5.040  1.00 1.00 ? 28 LEU A HB3  12 
ATOM   8746  H HG   . LEU A 1 28 ? -7.378  20.566 -4.641  1.00 1.00 ? 28 LEU A HG   12 
ATOM   8747  H HD11 . LEU A 1 28 ? -4.878  21.031 -2.964  1.00 1.00 ? 28 LEU A HD11 12 
ATOM   8748  H HD12 . LEU A 1 28 ? -5.978  22.297 -3.531  1.00 1.00 ? 28 LEU A HD12 12 
ATOM   8749  H HD13 . LEU A 1 28 ? -6.562  21.086 -2.390  1.00 1.00 ? 28 LEU A HD13 12 
ATOM   8750  H HD21 . LEU A 1 28 ? -5.816  20.149 -6.514  1.00 1.00 ? 28 LEU A HD21 12 
ATOM   8751  H HD22 . LEU A 1 28 ? -5.648  21.799 -5.890  1.00 1.00 ? 28 LEU A HD22 12 
ATOM   8752  H HD23 . LEU A 1 28 ? -4.442  20.566 -5.466  1.00 1.00 ? 28 LEU A HD23 12 
ATOM   8753  N N    . GLU A 1 29 ? -6.270  15.974 -3.161  1.00 1.00 ? 29 GLU A N    12 
ATOM   8754  C CA   . GLU A 1 29 ? -6.528  14.536 -3.177  1.00 1.00 ? 29 GLU A CA   12 
ATOM   8755  C C    . GLU A 1 29 ? -6.542  14.044 -1.728  1.00 1.00 ? 29 GLU A C    12 
ATOM   8756  O O    . GLU A 1 29 ? -6.379  14.834 -0.803  1.00 1.00 ? 29 GLU A O    12 
ATOM   8757  C CB   . GLU A 1 29 ? -5.622  13.783 -4.172  1.00 1.00 ? 29 GLU A CB   12 
ATOM   8758  C CG   . GLU A 1 29 ? -4.098  13.884 -4.007  1.00 1.00 ? 29 GLU A CG   12 
ATOM   8759  C CD   . GLU A 1 29 ? -3.367  13.330 -5.226  1.00 1.00 ? 29 GLU A CD   12 
ATOM   8760  O OE1  . GLU A 1 29 ? -2.327  13.866 -5.610  1.00 1.00 ? 29 GLU A OE1  12 
ATOM   8761  O OE2  . GLU A 1 29 ? -3.947  12.262 -5.838  1.00 1.00 ? 29 GLU A OE2  12 
ATOM   8762  H H    . GLU A 1 29 ? -5.330  16.279 -2.917  1.00 1.00 ? 29 GLU A H    12 
ATOM   8763  H HA   . GLU A 1 29 ? -7.537  14.359 -3.554  1.00 1.00 ? 29 GLU A HA   12 
ATOM   8764  H HB2  . GLU A 1 29 ? -5.901  12.729 -4.163  1.00 1.00 ? 29 GLU A HB2  12 
ATOM   8765  H HB3  . GLU A 1 29 ? -5.865  14.176 -5.160  1.00 1.00 ? 29 GLU A HB3  12 
ATOM   8766  H HG2  . GLU A 1 29 ? -3.807  14.926 -3.894  1.00 1.00 ? 29 GLU A HG2  12 
ATOM   8767  H HG3  . GLU A 1 29 ? -3.763  13.304 -3.147  1.00 1.00 ? 29 GLU A HG3  12 
ATOM   8768  H HE2  . GLU A 1 29 ? -3.459  11.989 -6.616  1.00 1.00 ? 29 GLU A HE2  12 
ATOM   8769  N N    . LYS A 1 30 ? -6.858  12.770 -1.502  1.00 1.00 ? 30 LYS A N    12 
ATOM   8770  C CA   . LYS A 1 30 ? -7.158  12.205 -0.183  1.00 1.00 ? 30 LYS A CA   12 
ATOM   8771  C C    . LYS A 1 30 ? -6.053  11.333 0.414   1.00 1.00 ? 30 LYS A C    12 
ATOM   8772  O O    . LYS A 1 30 ? -6.337  10.481 1.254   1.00 1.00 ? 30 LYS A O    12 
ATOM   8773  C CB   . LYS A 1 30 ? -8.579  11.629 -0.159  1.00 1.00 ? 30 LYS A CB   12 
ATOM   8774  C CG   . LYS A 1 30 ? -9.592  12.793 -0.168  1.00 1.00 ? 30 LYS A CG   12 
ATOM   8775  C CD   . LYS A 1 30 ? -9.663  13.537 1.187   1.00 1.00 ? 30 LYS A CD   12 
ATOM   8776  C CE   . LYS A 1 30 ? -9.701  15.073 1.061   1.00 1.00 ? 30 LYS A CE   12 
ATOM   8777  N NZ   . LYS A 1 30 ? -8.396  15.685 0.715   1.00 1.00 ? 30 LYS A NZ   12 
ATOM   8778  H H    . LYS A 1 30 ? -6.992  12.167 -2.299  1.00 1.00 ? 30 LYS A H    12 
ATOM   8779  H HA   . LYS A 1 30 ? -7.163  13.028 0.527   1.00 1.00 ? 30 LYS A HA   12 
ATOM   8780  H HB2  . LYS A 1 30 ? -8.729  10.990 -1.031  1.00 1.00 ? 30 LYS A HB2  12 
ATOM   8781  H HB3  . LYS A 1 30 ? -8.746  11.034 0.740   1.00 1.00 ? 30 LYS A HB3  12 
ATOM   8782  H HG2  . LYS A 1 30 ? -9.355  13.479 -0.981  1.00 1.00 ? 30 LYS A HG2  12 
ATOM   8783  H HG3  . LYS A 1 30 ? -10.579 12.376 -0.379  1.00 1.00 ? 30 LYS A HG3  12 
ATOM   8784  H HD2  . LYS A 1 30 ? -10.593 13.226 1.671   1.00 1.00 ? 30 LYS A HD2  12 
ATOM   8785  H HD3  . LYS A 1 30 ? -8.858  13.242 1.861   1.00 1.00 ? 30 LYS A HD3  12 
ATOM   8786  H HE2  . LYS A 1 30 ? -10.437 15.352 0.305   1.00 1.00 ? 30 LYS A HE2  12 
ATOM   8787  H HE3  . LYS A 1 30 ? -10.022 15.495 2.016   1.00 1.00 ? 30 LYS A HE3  12 
ATOM   8788  H HZ1  . LYS A 1 30 ? -7.996  15.294 -0.127  1.00 1.00 ? 30 LYS A HZ1  12 
ATOM   8789  H HZ2  . LYS A 1 30 ? -8.511  16.677 0.529   1.00 1.00 ? 30 LYS A HZ2  12 
ATOM   8790  H HZ3  . LYS A 1 30 ? -7.674  15.600 1.426   1.00 1.00 ? 30 LYS A HZ3  12 
ATOM   8791  N N    . ALA A 1 31 ? -4.843  11.451 -0.138  1.00 1.00 ? 31 ALA A N    12 
ATOM   8792  C CA   . ALA A 1 31 ? -3.578  10.914 0.364   1.00 1.00 ? 31 ALA A CA   12 
ATOM   8793  C C    . ALA A 1 31 ? -3.390  10.998 1.897   1.00 1.00 ? 31 ALA A C    12 
ATOM   8794  O O    . ALA A 1 31 ? -4.253  11.480 2.629   1.00 1.00 ? 31 ALA A O    12 
ATOM   8795  C CB   . ALA A 1 31 ? -2.486  11.738 -0.322  1.00 1.00 ? 31 ALA A CB   12 
ATOM   8796  H H    . ALA A 1 31 ? -4.766  12.133 -0.875  1.00 1.00 ? 31 ALA A H    12 
ATOM   8797  H HA   . ALA A 1 31 ? -3.494  9.872  0.055   1.00 1.00 ? 31 ALA A HA   12 
ATOM   8798  H HB1  . ALA A 1 31 ? -2.609  11.696 -1.401  1.00 1.00 ? 31 ALA A HB1  12 
ATOM   8799  H HB2  . ALA A 1 31 ? -2.581  12.782 -0.029  1.00 1.00 ? 31 ALA A HB2  12 
ATOM   8800  H HB3  . ALA A 1 31 ? -1.495  11.379 -0.048  1.00 1.00 ? 31 ALA A HB3  12 
ATOM   8801  N N    . ARG A 1 32 ? -2.243  10.526 2.409   1.00 1.00 ? 32 ARG A N    12 
ATOM   8802  C CA   . ARG A 1 32 ? -1.899  10.654 3.829   1.00 1.00 ? 32 ARG A CA   12 
ATOM   8803  C C    . ARG A 1 32 ? -0.724  11.600 4.029   1.00 1.00 ? 32 ARG A C    12 
ATOM   8804  O O    . ARG A 1 32 ? -0.858  12.612 4.710   1.00 1.00 ? 32 ARG A O    12 
ATOM   8805  C CB   . ARG A 1 32 ? -1.559  9.290  4.445   1.00 1.00 ? 32 ARG A CB   12 
ATOM   8806  C CG   . ARG A 1 32 ? -2.737  8.317  4.448   1.00 1.00 ? 32 ARG A CG   12 
ATOM   8807  C CD   . ARG A 1 32 ? -3.797  8.674  5.497   1.00 1.00 ? 32 ARG A CD   12 
ATOM   8808  N NE   . ARG A 1 32 ? -5.029  7.925  5.232   1.00 1.00 ? 32 ARG A NE   12 
ATOM   8809  C CZ   . ARG A 1 32 ? -5.927  8.236  4.288   1.00 1.00 ? 32 ARG A CZ   12 
ATOM   8810  N NH1  . ARG A 1 32 ? -5.836  9.389  3.616   1.00 1.00 ? 32 ARG A NH1  12 
ATOM   8811  N NH2  . ARG A 1 32 ? -6.889  7.354  4.009   1.00 1.00 ? 32 ARG A NH2  12 
ATOM   8812  H H    . ARG A 1 32 ? -1.560  10.112 1.777   1.00 1.00 ? 32 ARG A H    12 
ATOM   8813  H HA   . ARG A 1 32 ? -2.718  11.100 4.390   1.00 1.00 ? 32 ARG A HA   12 
ATOM   8814  H HB2  . ARG A 1 32 ? -0.746  8.850  3.870   1.00 1.00 ? 32 ARG A HB2  12 
ATOM   8815  H HB3  . ARG A 1 32 ? -1.224  9.429  5.475   1.00 1.00 ? 32 ARG A HB3  12 
ATOM   8816  H HG2  . ARG A 1 32 ? -3.168  8.293  3.449   1.00 1.00 ? 32 ARG A HG2  12 
ATOM   8817  H HG3  . ARG A 1 32 ? -2.364  7.319  4.683   1.00 1.00 ? 32 ARG A HG3  12 
ATOM   8818  H HD2  . ARG A 1 32 ? -3.421  8.396  6.484   1.00 1.00 ? 32 ARG A HD2  12 
ATOM   8819  H HD3  . ARG A 1 32 ? -4.010  9.742  5.525   1.00 1.00 ? 32 ARG A HD3  12 
ATOM   8820  H HE   . ARG A 1 32 ? -5.120  7.012  5.672   1.00 1.00 ? 32 ARG A HE   12 
ATOM   8821  H HH11 . ARG A 1 32 ? -5.083  10.052 3.768   1.00 1.00 ? 32 ARG A HH11 12 
ATOM   8822  H HH12 . ARG A 1 32 ? -6.420  9.604  2.813   1.00 1.00 ? 32 ARG A HH12 12 
ATOM   8823  H HH21 . ARG A 1 32 ? -6.835  6.440  4.456   1.00 1.00 ? 32 ARG A HH21 12 
ATOM   8824  H HH22 . ARG A 1 32 ? -7.612  7.541  3.330   1.00 1.00 ? 32 ARG A HH22 12 
ATOM   8825  N N    . HIS A 1 33 ? 0.443   11.226 3.505   1.00 1.00 ? 33 HIS A N    12 
ATOM   8826  C CA   . HIS A 1 33 ? 1.648   12.033 3.605   1.00 1.00 ? 33 HIS A CA   12 
ATOM   8827  C C    . HIS A 1 33 ? 1.920   12.667 2.253   1.00 1.00 ? 33 HIS A C    12 
ATOM   8828  O O    . HIS A 1 33 ? 1.516   12.134 1.222   1.00 1.00 ? 33 HIS A O    12 
ATOM   8829  C CB   . HIS A 1 33 ? 2.854   11.170 3.999   1.00 1.00 ? 33 HIS A CB   12 
ATOM   8830  C CG   . HIS A 1 33 ? 2.809   10.611 5.392   1.00 1.00 ? 33 HIS A CG   12 
ATOM   8831  N ND1  . HIS A 1 33 ? 1.759   9.839  5.859   1.00 1.00 ? 33 HIS A ND1  12 
ATOM   8832  C CD2  . HIS A 1 33 ? 3.720   10.648 6.420   1.00 1.00 ? 33 HIS A CD2  12 
ATOM   8833  C CE1  . HIS A 1 33 ? 2.052   9.479  7.118   1.00 1.00 ? 33 HIS A CE1  12 
ATOM   8834  N NE2  . HIS A 1 33 ? 3.239   9.942  7.520   1.00 1.00 ? 33 HIS A NE2  12 
ATOM   8835  H H    . HIS A 1 33 ? 0.462   10.446 2.864   1.00 1.00 ? 33 HIS A H    12 
ATOM   8836  H HA   . HIS A 1 33 ? 1.525   12.837 4.336   1.00 1.00 ? 33 HIS A HA   12 
ATOM   8837  H HB2  . HIS A 1 33 ? 2.953   10.335 3.309   1.00 1.00 ? 33 HIS A HB2  12 
ATOM   8838  H HB3  . HIS A 1 33 ? 3.758   11.775 3.921   1.00 1.00 ? 33 HIS A HB3  12 
ATOM   8839  H HD1  . HIS A 1 33 ? 0.928   9.594  5.346   1.00 1.00 ? 33 HIS A HD1  12 
ATOM   8840  H HD2  . HIS A 1 33 ? 4.680   11.146 6.357   1.00 1.00 ? 33 HIS A HD2  12 
ATOM   8841  H HE1  . HIS A 1 33 ? 1.395   8.872  7.723   1.00 1.00 ? 33 HIS A HE1  12 
ATOM   8842  N N    . GLY A 1 34 ? 2.669   13.766 2.274   1.00 1.00 ? 34 GLY A N    12 
ATOM   8843  C CA   . GLY A 1 34 ? 3.225   14.380 1.094   1.00 1.00 ? 34 GLY A CA   12 
ATOM   8844  C C    . GLY A 1 34 ? 4.421   15.200 1.536   1.00 1.00 ? 34 GLY A C    12 
ATOM   8845  O O    . GLY A 1 34 ? 4.487   15.608 2.702   1.00 1.00 ? 34 GLY A O    12 
ATOM   8846  H H    . GLY A 1 34 ? 2.986   14.141 3.157   1.00 1.00 ? 34 GLY A H    12 
ATOM   8847  H HA2  . GLY A 1 34 ? 3.614   13.595 0.460   1.00 1.00 ? 34 GLY A HA2  12 
ATOM   8848  H HA3  . GLY A 1 34 ? 2.485   14.972 0.558   1.00 1.00 ? 34 GLY A HA3  12 
ATOM   8849  N N    . SER A 1 35 ? 5.406   15.354 0.656   1.00 1.00 ? 35 SER A N    12 
ATOM   8850  C CA   . SER A 1 35 ? 6.664   16.010 0.950   1.00 1.00 ? 35 SER A CA   12 
ATOM   8851  C C    . SER A 1 35 ? 7.441   16.186 -0.343  1.00 1.00 ? 35 SER A C    12 
ATOM   8852  O O    . SER A 1 35 ? 7.291   15.423 -1.293  1.00 1.00 ? 35 SER A O    12 
ATOM   8853  C CB   . SER A 1 35 ? 7.482   15.191 1.961   1.00 1.00 ? 35 SER A CB   12 
ATOM   8854  O OG   . SER A 1 35 ? 7.108   15.579 3.269   1.00 1.00 ? 35 SER A OG   12 
ATOM   8855  H H    . SER A 1 35 ? 5.304   14.962 -0.282  1.00 1.00 ? 35 SER A H    12 
ATOM   8856  H HA   . SER A 1 35 ? 6.456   17.006 1.354   1.00 1.00 ? 35 SER A HA   12 
ATOM   8857  H HB2  . SER A 1 35 ? 7.303   14.121 1.820   1.00 1.00 ? 35 SER A HB2  12 
ATOM   8858  H HB3  . SER A 1 35 ? 8.550   15.366 1.827   1.00 1.00 ? 35 SER A HB3  12 
ATOM   8859  H HG   . SER A 1 35 ? 6.192   15.292 3.375   1.00 1.00 ? 35 SER A HG   12 
ATOM   8860  N N    . CYS A 1 36 ? 8.280   17.213 -0.360  1.00 1.00 ? 36 CYS A N    12 
ATOM   8861  C CA   . CYS A 1 36 ? 9.146   17.506 -1.478  1.00 1.00 ? 36 CYS A CA   12 
ATOM   8862  C C    . CYS A 1 36 ? 10.417  16.672 -1.373  1.00 1.00 ? 36 CYS A C    12 
ATOM   8863  O O    . CYS A 1 36 ? 11.040  16.652 -0.314  1.00 1.00 ? 36 CYS A O    12 
ATOM   8864  C CB   . CYS A 1 36 ? 9.492   18.984 -1.454  1.00 1.00 ? 36 CYS A CB   12 
ATOM   8865  S SG   . CYS A 1 36 ? 10.665  19.395 -2.740  1.00 1.00 ? 36 CYS A SG   12 
ATOM   8866  H H    . CYS A 1 36 ? 8.385   17.760 0.479   1.00 1.00 ? 36 CYS A H    12 
ATOM   8867  H HA   . CYS A 1 36 ? 8.637   17.291 -2.418  1.00 1.00 ? 36 CYS A HA   12 
ATOM   8868  H HB2  . CYS A 1 36 ? 8.586   19.566 -1.619  1.00 1.00 ? 36 CYS A HB2  12 
ATOM   8869  H HB3  . CYS A 1 36 ? 9.934   19.258 -0.496  1.00 1.00 ? 36 CYS A HB3  12 
ATOM   8870  N N    . ASN A 1 37 ? 10.799  16.004 -2.462  1.00 1.00 ? 37 ASN A N    12 
ATOM   8871  C CA   . ASN A 1 37 ? 12.067  15.301 -2.599  1.00 1.00 ? 37 ASN A CA   12 
ATOM   8872  C C    . ASN A 1 37 ? 12.957  16.089 -3.558  1.00 1.00 ? 37 ASN A C    12 
ATOM   8873  O O    . ASN A 1 37 ? 12.441  16.813 -4.410  1.00 1.00 ? 37 ASN A O    12 
ATOM   8874  C CB   . ASN A 1 37 ? 11.790  13.900 -3.158  1.00 1.00 ? 37 ASN A CB   12 
ATOM   8875  C CG   . ASN A 1 37 ? 13.063  13.194 -3.607  1.00 1.00 ? 37 ASN A CG   12 
ATOM   8876  O OD1  . ASN A 1 37 ? 13.195  12.821 -4.766  1.00 1.00 ? 37 ASN A OD1  12 
ATOM   8877  N ND2  . ASN A 1 37 ? 14.027  13.038 -2.701  1.00 1.00 ? 37 ASN A ND2  12 
ATOM   8878  H H    . ASN A 1 37 ? 10.246  16.104 -3.309  1.00 1.00 ? 37 ASN A H    12 
ATOM   8879  H HA   . ASN A 1 37 ? 12.568  15.212 -1.634  1.00 1.00 ? 37 ASN A HA   12 
ATOM   8880  H HB2  . ASN A 1 37 ? 11.285  13.297 -2.403  1.00 1.00 ? 37 ASN A HB2  12 
ATOM   8881  H HB3  . ASN A 1 37 ? 11.143  13.994 -4.029  1.00 1.00 ? 37 ASN A HB3  12 
ATOM   8882  H HD21 . ASN A 1 37 ? 13.877  13.300 -1.739  1.00 1.00 ? 37 ASN A HD21 12 
ATOM   8883  H HD22 . ASN A 1 37 ? 14.874  12.570 -2.985  1.00 1.00 ? 37 ASN A HD22 12 
ATOM   8884  N N    . TYR A 1 38 ? 14.284  15.961 -3.428  1.00 1.00 ? 38 TYR A N    12 
ATOM   8885  C CA   . TYR A 1 38 ? 15.190  16.484 -4.438  1.00 1.00 ? 38 TYR A CA   12 
ATOM   8886  C C    . TYR A 1 38 ? 15.311  15.461 -5.570  1.00 1.00 ? 38 TYR A C    12 
ATOM   8887  O O    . TYR A 1 38 ? 14.347  15.275 -6.308  1.00 1.00 ? 38 TYR A O    12 
ATOM   8888  C CB   . TYR A 1 38 ? 16.535  16.956 -3.856  1.00 1.00 ? 38 TYR A CB   12 
ATOM   8889  C CG   . TYR A 1 38 ? 17.474  17.514 -4.922  1.00 1.00 ? 38 TYR A CG   12 
ATOM   8890  C CD1  . TYR A 1 38 ? 16.994  18.474 -5.835  1.00 1.00 ? 38 TYR A CD1  12 
ATOM   8891  C CD2  . TYR A 1 38 ? 18.703  16.874 -5.185  1.00 1.00 ? 38 TYR A CD2  12 
ATOM   8892  C CE1  . TYR A 1 38 ? 17.663  18.696 -7.050  1.00 1.00 ? 38 TYR A CE1  12 
ATOM   8893  C CE2  . TYR A 1 38 ? 19.358  17.080 -6.412  1.00 1.00 ? 38 TYR A CE2  12 
ATOM   8894  C CZ   . TYR A 1 38 ? 18.815  17.959 -7.363  1.00 1.00 ? 38 TYR A CZ   12 
ATOM   8895  O OH   . TYR A 1 38 ? 19.400  18.083 -8.588  1.00 1.00 ? 38 TYR A OH   12 
ATOM   8896  H H    . TYR A 1 38 ? 14.652  15.332 -2.729  1.00 1.00 ? 38 TYR A H    12 
ATOM   8897  H HA   . TYR A 1 38 ? 14.726  17.363 -4.866  1.00 1.00 ? 38 TYR A HA   12 
ATOM   8898  H HB2  . TYR A 1 38 ? 16.341  17.746 -3.130  1.00 1.00 ? 38 TYR A HB2  12 
ATOM   8899  H HB3  . TYR A 1 38 ? 17.013  16.133 -3.324  1.00 1.00 ? 38 TYR A HB3  12 
ATOM   8900  H HD1  . TYR A 1 38 ? 16.084  19.015 -5.636  1.00 1.00 ? 38 TYR A HD1  12 
ATOM   8901  H HD2  . TYR A 1 38 ? 19.115  16.169 -4.477  1.00 1.00 ? 38 TYR A HD2  12 
ATOM   8902  H HE1  . TYR A 1 38 ? 17.282  19.425 -7.746  1.00 1.00 ? 38 TYR A HE1  12 
ATOM   8903  H HE2  . TYR A 1 38 ? 20.273  16.550 -6.633  1.00 1.00 ? 38 TYR A HE2  12 
ATOM   8904  H HH   . TYR A 1 38 ? 18.872  18.602 -9.208  1.00 1.00 ? 38 TYR A HH   12 
ATOM   8905  N N    . VAL A 1 39 ? 16.467  14.799 -5.708  1.00 1.00 ? 39 VAL A N    12 
ATOM   8906  C CA   . VAL A 1 39 ? 16.840  13.967 -6.850  1.00 1.00 ? 39 VAL A CA   12 
ATOM   8907  C C    . VAL A 1 39 ? 16.882  14.830 -8.124  1.00 1.00 ? 39 VAL A C    12 
ATOM   8908  O O    . VAL A 1 39 ? 16.170  15.824 -8.250  1.00 1.00 ? 39 VAL A O    12 
ATOM   8909  C CB   . VAL A 1 39 ? 15.942  12.714 -6.961  1.00 1.00 ? 39 VAL A CB   12 
ATOM   8910  C CG1  . VAL A 1 39 ? 16.291  11.844 -8.177  1.00 1.00 ? 39 VAL A CG1  12 
ATOM   8911  C CG2  . VAL A 1 39 ? 16.097  11.850 -5.703  1.00 1.00 ? 39 VAL A CG2  12 
ATOM   8912  H H    . VAL A 1 39 ? 17.190  14.980 -5.032  1.00 1.00 ? 39 VAL A H    12 
ATOM   8913  H HA   . VAL A 1 39 ? 17.858  13.626 -6.665  1.00 1.00 ? 39 VAL A HA   12 
ATOM   8914  H HB   . VAL A 1 39 ? 14.895  12.999 -7.057  1.00 1.00 ? 39 VAL A HB   12 
ATOM   8915  H HG11 . VAL A 1 39 ? 17.349  11.583 -8.163  1.00 1.00 ? 39 VAL A HG11 12 
ATOM   8916  H HG12 . VAL A 1 39 ? 15.701  10.927 -8.150  1.00 1.00 ? 39 VAL A HG12 12 
ATOM   8917  H HG13 . VAL A 1 39 ? 16.055  12.365 -9.103  1.00 1.00 ? 39 VAL A HG13 12 
ATOM   8918  H HG21 . VAL A 1 39 ? 15.868  12.429 -4.812  1.00 1.00 ? 39 VAL A HG21 12 
ATOM   8919  H HG22 . VAL A 1 39 ? 15.412  11.003 -5.751  1.00 1.00 ? 39 VAL A HG22 12 
ATOM   8920  H HG23 . VAL A 1 39 ? 17.120  11.478 -5.628  1.00 1.00 ? 39 VAL A HG23 12 
ATOM   8921  N N    . PHE A 1 40 ? 17.726  14.466 -9.089  1.00 1.00 ? 40 PHE A N    12 
ATOM   8922  C CA   . PHE A 1 40 ? 17.818  15.210 -10.340 1.00 1.00 ? 40 PHE A CA   12 
ATOM   8923  C C    . PHE A 1 40 ? 16.445  15.261 -11.040 1.00 1.00 ? 40 PHE A C    12 
ATOM   8924  O O    . PHE A 1 40 ? 15.569  14.439 -10.751 1.00 1.00 ? 40 PHE A O    12 
ATOM   8925  C CB   . PHE A 1 40 ? 18.896  14.574 -11.234 1.00 1.00 ? 40 PHE A CB   12 
ATOM   8926  C CG   . PHE A 1 40 ? 18.459  13.297 -11.925 1.00 1.00 ? 40 PHE A CG   12 
ATOM   8927  C CD1  . PHE A 1 40 ? 18.572  12.056 -11.271 1.00 1.00 ? 40 PHE A CD1  12 
ATOM   8928  C CD2  . PHE A 1 40 ? 17.866  13.363 -13.202 1.00 1.00 ? 40 PHE A CD2  12 
ATOM   8929  C CE1  . PHE A 1 40 ? 18.061  10.894 -11.874 1.00 1.00 ? 40 PHE A CE1  12 
ATOM   8930  C CE2  . PHE A 1 40 ? 17.358  12.200 -13.804 1.00 1.00 ? 40 PHE A CE2  12 
ATOM   8931  C CZ   . PHE A 1 40 ? 17.448  10.968 -13.136 1.00 1.00 ? 40 PHE A CZ   12 
ATOM   8932  H H    . PHE A 1 40 ? 18.274  13.628 -8.980  1.00 1.00 ? 40 PHE A H    12 
ATOM   8933  H HA   . PHE A 1 40 ? 18.143  16.217 -10.078 1.00 1.00 ? 40 PHE A HA   12 
ATOM   8934  H HB2  . PHE A 1 40 ? 19.188  15.286 -12.005 1.00 1.00 ? 40 PHE A HB2  12 
ATOM   8935  H HB3  . PHE A 1 40 ? 19.792  14.381 -10.641 1.00 1.00 ? 40 PHE A HB3  12 
ATOM   8936  H HD1  . PHE A 1 40 ? 19.056  11.982 -10.309 1.00 1.00 ? 40 PHE A HD1  12 
ATOM   8937  H HD2  . PHE A 1 40 ? 17.791  14.304 -13.727 1.00 1.00 ? 40 PHE A HD2  12 
ATOM   8938  H HE1  . PHE A 1 40 ? 18.144  9.942  -11.369 1.00 1.00 ? 40 PHE A HE1  12 
ATOM   8939  H HE2  . PHE A 1 40 ? 16.899  12.253 -14.782 1.00 1.00 ? 40 PHE A HE2  12 
ATOM   8940  H HZ   . PHE A 1 40 ? 17.056  10.072 -13.600 1.00 1.00 ? 40 PHE A HZ   12 
ATOM   8941  N N    . PRO A 1 41 ? 16.189  16.234 -11.925 1.00 1.00 ? 41 PRO A N    12 
ATOM   8942  C CA   . PRO A 1 41 ? 17.000  17.414 -12.164 1.00 1.00 ? 41 PRO A CA   12 
ATOM   8943  C C    . PRO A 1 41 ? 16.733  18.447 -11.062 1.00 1.00 ? 41 PRO A C    12 
ATOM   8944  O O    . PRO A 1 41 ? 17.670  19.020 -10.510 1.00 1.00 ? 41 PRO A O    12 
ATOM   8945  C CB   . PRO A 1 41 ? 16.565  17.906 -13.546 1.00 1.00 ? 41 PRO A CB   12 
ATOM   8946  C CG   . PRO A 1 41 ? 15.098  17.484 -13.650 1.00 1.00 ? 41 PRO A CG   12 
ATOM   8947  C CD   . PRO A 1 41 ? 15.039  16.200 -12.817 1.00 1.00 ? 41 PRO A CD   12 
ATOM   8948  H HA   . PRO A 1 41 ? 18.066  17.194 -12.198 1.00 1.00 ? 41 PRO A HA   12 
ATOM   8949  H HB2  . PRO A 1 41 ? 16.703  18.981 -13.675 1.00 1.00 ? 41 PRO A HB2  12 
ATOM   8950  H HB3  . PRO A 1 41 ? 17.137  17.363 -14.301 1.00 1.00 ? 41 PRO A HB3  12 
ATOM   8951  H HG2  . PRO A 1 41 ? 14.458  18.251 -13.214 1.00 1.00 ? 41 PRO A HG2  12 
ATOM   8952  H HG3  . PRO A 1 41 ? 14.801  17.310 -14.685 1.00 1.00 ? 41 PRO A HG3  12 
ATOM   8953  H HD2  . PRO A 1 41 ? 14.100  16.143 -12.264 1.00 1.00 ? 41 PRO A HD2  12 
ATOM   8954  H HD3  . PRO A 1 41 ? 15.127  15.334 -13.474 1.00 1.00 ? 41 PRO A HD3  12 
ATOM   8955  N N    . ALA A 1 42 ? 15.455  18.662 -10.734 1.00 1.00 ? 42 ALA A N    12 
ATOM   8956  C CA   . ALA A 1 42 ? 14.977  19.683 -9.814  1.00 1.00 ? 42 ALA A CA   12 
ATOM   8957  C C    . ALA A 1 42 ? 14.092  19.040 -8.746  1.00 1.00 ? 42 ALA A C    12 
ATOM   8958  O O    . ALA A 1 42 ? 13.761  17.855 -8.835  1.00 1.00 ? 42 ALA A O    12 
ATOM   8959  C CB   . ALA A 1 42 ? 14.198  20.739 -10.607 1.00 1.00 ? 42 ALA A CB   12 
ATOM   8960  H H    . ALA A 1 42 ? 14.749  18.054 -11.122 1.00 1.00 ? 42 ALA A H    12 
ATOM   8961  H HA   . ALA A 1 42 ? 15.813  20.182 -9.324  1.00 1.00 ? 42 ALA A HA   12 
ATOM   8962  H HB1  . ALA A 1 42 ? 14.841  21.165 -11.378 1.00 1.00 ? 42 ALA A HB1  12 
ATOM   8963  H HB2  . ALA A 1 42 ? 13.327  20.283 -11.080 1.00 1.00 ? 42 ALA A HB2  12 
ATOM   8964  H HB3  . ALA A 1 42 ? 13.867  21.540 -9.947  1.00 1.00 ? 42 ALA A HB3  12 
ATOM   8965  N N    . HIS A 1 43 ? 13.675  19.834 -7.758  1.00 1.00 ? 43 HIS A N    12 
ATOM   8966  C CA   . HIS A 1 43 ? 12.857  19.357 -6.656  1.00 1.00 ? 43 HIS A CA   12 
ATOM   8967  C C    . HIS A 1 43 ? 11.505  18.879 -7.175  1.00 1.00 ? 43 HIS A C    12 
ATOM   8968  O O    . HIS A 1 43 ? 10.919  19.529 -8.035  1.00 1.00 ? 43 HIS A O    12 
ATOM   8969  C CB   . HIS A 1 43 ? 12.663  20.483 -5.638  1.00 1.00 ? 43 HIS A CB   12 
ATOM   8970  C CG   . HIS A 1 43 ? 13.907  20.789 -4.850  1.00 1.00 ? 43 HIS A CG   12 
ATOM   8971  N ND1  . HIS A 1 43 ? 14.209  20.134 -3.665  1.00 1.00 ? 43 HIS A ND1  12 
ATOM   8972  C CD2  . HIS A 1 43 ? 14.952  21.656 -5.064  1.00 1.00 ? 43 HIS A CD2  12 
ATOM   8973  C CE1  . HIS A 1 43 ? 15.383  20.621 -3.229  1.00 1.00 ? 43 HIS A CE1  12 
ATOM   8974  N NE2  . HIS A 1 43 ? 15.892  21.544 -4.046  1.00 1.00 ? 43 HIS A NE2  12 
ATOM   8975  H H    . HIS A 1 43 ? 13.942  20.806 -7.767  1.00 1.00 ? 43 HIS A H    12 
ATOM   8976  H HA   . HIS A 1 43 ? 13.367  18.521 -6.180  1.00 1.00 ? 43 HIS A HA   12 
ATOM   8977  H HB2  . HIS A 1 43 ? 12.271  21.388 -6.107  1.00 1.00 ? 43 HIS A HB2  12 
ATOM   8978  H HB3  . HIS A 1 43 ? 11.910  20.152 -4.938  1.00 1.00 ? 43 HIS A HB3  12 
ATOM   8979  H HD1  . HIS A 1 43 ? 13.651  19.425 -3.210  1.00 1.00 ? 43 HIS A HD1  12 
ATOM   8980  H HD2  . HIS A 1 43 ? 15.040  22.317 -5.915  1.00 1.00 ? 43 HIS A HD2  12 
ATOM   8981  H HE1  . HIS A 1 43 ? 15.868  20.292 -2.322  1.00 1.00 ? 43 HIS A HE1  12 
ATOM   8982  N N    . LYS A 1 44 ? 11.005  17.755 -6.657  1.00 1.00 ? 44 LYS A N    12 
ATOM   8983  C CA   . LYS A 1 44 ? 9.805   17.085 -7.140  1.00 1.00 ? 44 LYS A CA   12 
ATOM   8984  C C    . LYS A 1 44 ? 8.912   16.717 -5.953  1.00 1.00 ? 44 LYS A C    12 
ATOM   8985  O O    . LYS A 1 44 ? 9.398   16.239 -4.928  1.00 1.00 ? 44 LYS A O    12 
ATOM   8986  C CB   . LYS A 1 44 ? 10.211  15.871 -7.993  1.00 1.00 ? 44 LYS A CB   12 
ATOM   8987  C CG   . LYS A 1 44 ? 11.116  14.887 -7.235  1.00 1.00 ? 44 LYS A CG   12 
ATOM   8988  C CD   . LYS A 1 44 ? 11.674  13.768 -8.126  1.00 1.00 ? 44 LYS A CD   12 
ATOM   8989  C CE   . LYS A 1 44 ? 12.544  14.231 -9.305  1.00 1.00 ? 44 LYS A CE   12 
ATOM   8990  N NZ   . LYS A 1 44 ? 13.614  15.163 -8.903  1.00 1.00 ? 44 LYS A NZ   12 
ATOM   8991  H H    . LYS A 1 44 ? 11.484  17.328 -5.868  1.00 1.00 ? 44 LYS A H    12 
ATOM   8992  H HA   . LYS A 1 44 ? 9.240   17.758 -7.787  1.00 1.00 ? 44 LYS A HA   12 
ATOM   8993  H HB2  . LYS A 1 44 ? 9.313   15.353 -8.332  1.00 1.00 ? 44 LYS A HB2  12 
ATOM   8994  H HB3  . LYS A 1 44 ? 10.739  16.254 -8.866  1.00 1.00 ? 44 LYS A HB3  12 
ATOM   8995  H HG2  . LYS A 1 44 ? 11.941  15.410 -6.760  1.00 1.00 ? 44 LYS A HG2  12 
ATOM   8996  H HG3  . LYS A 1 44 ? 10.531  14.419 -6.441  1.00 1.00 ? 44 LYS A HG3  12 
ATOM   8997  H HD2  . LYS A 1 44 ? 12.275  13.113 -7.490  1.00 1.00 ? 44 LYS A HD2  12 
ATOM   8998  H HD3  . LYS A 1 44 ? 10.843  13.182 -8.521  1.00 1.00 ? 44 LYS A HD3  12 
ATOM   8999  H HE2  . LYS A 1 44 ? 13.013  13.346 -9.740  1.00 1.00 ? 44 LYS A HE2  12 
ATOM   9000  H HE3  . LYS A 1 44 ? 11.930  14.695 -10.078 1.00 1.00 ? 44 LYS A HE3  12 
ATOM   9001  H HZ1  . LYS A 1 44 ? 14.031  14.910 -8.015  1.00 1.00 ? 44 LYS A HZ1  12 
ATOM   9002  H HZ2  . LYS A 1 44 ? 14.368  15.160 -9.580  1.00 1.00 ? 44 LYS A HZ2  12 
ATOM   9003  H HZ3  . LYS A 1 44 ? 13.291  16.119 -8.799  1.00 1.00 ? 44 LYS A HZ3  12 
ATOM   9004  N N    . CYS A 1 45 ? 7.611   16.995 -6.071  1.00 1.00 ? 45 CYS A N    12 
ATOM   9005  C CA   . CYS A 1 45 ? 6.640   16.699 -5.025  1.00 1.00 ? 45 CYS A CA   12 
ATOM   9006  C C    . CYS A 1 45 ? 6.347   15.200 -5.015  1.00 1.00 ? 45 CYS A C    12 
ATOM   9007  O O    . CYS A 1 45 ? 6.027   14.639 -6.062  1.00 1.00 ? 45 CYS A O    12 
ATOM   9008  C CB   . CYS A 1 45 ? 5.358   17.499 -5.270  1.00 1.00 ? 45 CYS A CB   12 
ATOM   9009  S SG   . CYS A 1 45 ? 4.021   17.159 -4.098  1.00 1.00 ? 45 CYS A SG   12 
ATOM   9010  H H    . CYS A 1 45 ? 7.262   17.358 -6.946  1.00 1.00 ? 45 CYS A H    12 
ATOM   9011  H HA   . CYS A 1 45 ? 7.049   16.999 -4.062  1.00 1.00 ? 45 CYS A HA   12 
ATOM   9012  H HB2  . CYS A 1 45 ? 5.581   18.563 -5.224  1.00 1.00 ? 45 CYS A HB2  12 
ATOM   9013  H HB3  . CYS A 1 45 ? 4.981   17.267 -6.267  1.00 1.00 ? 45 CYS A HB3  12 
ATOM   9014  N N    . ILE A 1 46 ? 6.486   14.549 -3.857  1.00 1.00 ? 46 ILE A N    12 
ATOM   9015  C CA   . ILE A 1 46 ? 6.097   13.161 -3.651  1.00 1.00 ? 46 ILE A CA   12 
ATOM   9016  C C    . ILE A 1 46 ? 4.889   13.168 -2.723  1.00 1.00 ? 46 ILE A C    12 
ATOM   9017  O O    . ILE A 1 46 ? 4.838   13.957 -1.775  1.00 1.00 ? 46 ILE A O    12 
ATOM   9018  C CB   . ILE A 1 46 ? 7.255   12.353 -3.033  1.00 1.00 ? 46 ILE A CB   12 
ATOM   9019  C CG1  . ILE A 1 46 ? 8.549   12.428 -3.865  1.00 1.00 ? 46 ILE A CG1  12 
ATOM   9020  C CG2  . ILE A 1 46 ? 6.839   10.890 -2.797  1.00 1.00 ? 46 ILE A CG2  12 
ATOM   9021  C CD1  . ILE A 1 46 ? 8.423   11.900 -5.297  1.00 1.00 ? 46 ILE A CD1  12 
ATOM   9022  H H    . ILE A 1 46 ? 6.741   15.062 -3.018  1.00 1.00 ? 46 ILE A H    12 
ATOM   9023  H HA   . ILE A 1 46 ? 5.804   12.697 -4.592  1.00 1.00 ? 46 ILE A HA   12 
ATOM   9024  H HB   . ILE A 1 46 ? 7.485   12.781 -2.057  1.00 1.00 ? 46 ILE A HB   12 
ATOM   9025  H HG12 . ILE A 1 46 ? 8.885   13.464 -3.911  1.00 1.00 ? 46 ILE A HG12 12 
ATOM   9026  H HG13 . ILE A 1 46 ? 9.321   11.851 -3.355  1.00 1.00 ? 46 ILE A HG13 12 
ATOM   9027  H HG21 . ILE A 1 46 ? 6.458   10.442 -3.714  1.00 1.00 ? 46 ILE A HG21 12 
ATOM   9028  H HG22 . ILE A 1 46 ? 7.692   10.311 -2.442  1.00 1.00 ? 46 ILE A HG22 12 
ATOM   9029  H HG23 . ILE A 1 46 ? 6.059   10.836 -2.038  1.00 1.00 ? 46 ILE A HG23 12 
ATOM   9030  H HD11 . ILE A 1 46 ? 8.084   10.865 -5.300  1.00 1.00 ? 46 ILE A HD11 12 
ATOM   9031  H HD12 . ILE A 1 46 ? 7.730   12.514 -5.869  1.00 1.00 ? 46 ILE A HD12 12 
ATOM   9032  H HD13 . ILE A 1 46 ? 9.401   11.948 -5.778  1.00 1.00 ? 46 ILE A HD13 12 
ATOM   9033  N N    . CYS A 1 47 ? 3.926   12.282 -2.977  1.00 1.00 ? 47 CYS A N    12 
ATOM   9034  C CA   . CYS A 1 47 ? 2.774   12.101 -2.115  1.00 1.00 ? 47 CYS A CA   12 
ATOM   9035  C C    . CYS A 1 47 ? 2.473   10.618 -1.948  1.00 1.00 ? 47 CYS A C    12 
ATOM   9036  O O    . CYS A 1 47 ? 2.863   9.828  -2.799  1.00 1.00 ? 47 CYS A O    12 
ATOM   9037  C CB   . CYS A 1 47 ? 1.603   12.904 -2.658  1.00 1.00 ? 47 CYS A CB   12 
ATOM   9038  S SG   . CYS A 1 47 ? 0.315   13.087 -1.425  1.00 1.00 ? 47 CYS A SG   12 
ATOM   9039  H H    . CYS A 1 47 ? 3.990   11.667 -3.785  1.00 1.00 ? 47 CYS A H    12 
ATOM   9040  H HA   . CYS A 1 47 ? 3.002   12.471 -1.126  1.00 1.00 ? 47 CYS A HA   12 
ATOM   9041  H HB2  . CYS A 1 47 ? 1.940   13.906 -2.919  1.00 1.00 ? 47 CYS A HB2  12 
ATOM   9042  H HB3  . CYS A 1 47 ? 1.199   12.425 -3.549  1.00 1.00 ? 47 CYS A HB3  12 
ATOM   9043  N N    . TYR A 1 48 ? 1.863   10.224 -0.828  1.00 1.00 ? 48 TYR A N    12 
ATOM   9044  C CA   . TYR A 1 48 ? 1.718   8.826  -0.446  1.00 1.00 ? 48 TYR A CA   12 
ATOM   9045  C C    . TYR A 1 48 ? 0.247   8.502  -0.198  1.00 1.00 ? 48 TYR A C    12 
ATOM   9046  O O    . TYR A 1 48 ? -0.386  9.125  0.663   1.00 1.00 ? 48 TYR A O    12 
ATOM   9047  C CB   . TYR A 1 48 ? 2.558   8.553  0.802   1.00 1.00 ? 48 TYR A CB   12 
ATOM   9048  C CG   . TYR A 1 48 ? 4.038   8.856  0.655   1.00 1.00 ? 48 TYR A CG   12 
ATOM   9049  C CD1  . TYR A 1 48 ? 4.519   10.165 0.853   1.00 1.00 ? 48 TYR A CD1  12 
ATOM   9050  C CD2  . TYR A 1 48 ? 4.942   7.823  0.344   1.00 1.00 ? 48 TYR A CD2  12 
ATOM   9051  C CE1  . TYR A 1 48 ? 5.892   10.439 0.755   1.00 1.00 ? 48 TYR A CE1  12 
ATOM   9052  C CE2  . TYR A 1 48 ? 6.318   8.097  0.253   1.00 1.00 ? 48 TYR A CE2  12 
ATOM   9053  C CZ   . TYR A 1 48 ? 6.792   9.403  0.456   1.00 1.00 ? 48 TYR A CZ   12 
ATOM   9054  O OH   . TYR A 1 48 ? 8.127   9.658  0.351   1.00 1.00 ? 48 TYR A OH   12 
ATOM   9055  H H    . TYR A 1 48 ? 1.571   10.921 -0.151  1.00 1.00 ? 48 TYR A H    12 
ATOM   9056  H HA   . TYR A 1 48 ? 2.088   8.172  -1.231  1.00 1.00 ? 48 TYR A HA   12 
ATOM   9057  H HB2  . TYR A 1 48 ? 2.151   9.129  1.630   1.00 1.00 ? 48 TYR A HB2  12 
ATOM   9058  H HB3  . TYR A 1 48 ? 2.447   7.499  1.044   1.00 1.00 ? 48 TYR A HB3  12 
ATOM   9059  H HD1  . TYR A 1 48 ? 3.836   10.968 1.074   1.00 1.00 ? 48 TYR A HD1  12 
ATOM   9060  H HD2  . TYR A 1 48 ? 4.585   6.817  0.184   1.00 1.00 ? 48 TYR A HD2  12 
ATOM   9061  H HE1  . TYR A 1 48 ? 6.247   11.449 0.900   1.00 1.00 ? 48 TYR A HE1  12 
ATOM   9062  H HE2  . TYR A 1 48 ? 7.014   7.302  0.030   1.00 1.00 ? 48 TYR A HE2  12 
ATOM   9063  H HH   . TYR A 1 48 ? 8.351   10.577 0.505   1.00 1.00 ? 48 TYR A HH   12 
ATOM   9064  N N    . PHE A 1 49 ? -0.296  7.542  -0.956  1.00 1.00 ? 49 PHE A N    12 
ATOM   9065  C CA   . PHE A 1 49 ? -1.690  7.138  -0.889  1.00 1.00 ? 49 PHE A CA   12 
ATOM   9066  C C    . PHE A 1 49 ? -1.763  5.722  -0.316  1.00 1.00 ? 49 PHE A C    12 
ATOM   9067  O O    . PHE A 1 49 ? -0.868  4.926  -0.592  1.00 1.00 ? 49 PHE A O    12 
ATOM   9068  C CB   . PHE A 1 49 ? -2.317  7.114  -2.291  1.00 1.00 ? 49 PHE A CB   12 
ATOM   9069  C CG   . PHE A 1 49 ? -1.989  8.238  -3.259  1.00 1.00 ? 49 PHE A CG   12 
ATOM   9070  C CD1  . PHE A 1 49 ? -1.652  9.520  -2.790  1.00 1.00 ? 49 PHE A CD1  12 
ATOM   9071  C CD2  . PHE A 1 49 ? -2.140  8.028  -4.643  1.00 1.00 ? 49 PHE A CD2  12 
ATOM   9072  C CE1  . PHE A 1 49 ? -1.402  10.562 -3.694  1.00 1.00 ? 49 PHE A CE1  12 
ATOM   9073  C CE2  . PHE A 1 49 ? -1.930  9.084  -5.547  1.00 1.00 ? 49 PHE A CE2  12 
ATOM   9074  C CZ   . PHE A 1 49 ? -1.544  10.348 -5.069  1.00 1.00 ? 49 PHE A CZ   12 
ATOM   9075  H H    . PHE A 1 49 ? 0.280   7.029  -1.616  1.00 1.00 ? 49 PHE A H    12 
ATOM   9076  H HA   . PHE A 1 49 ? -2.237  7.843  -0.266  1.00 1.00 ? 49 PHE A HA   12 
ATOM   9077  H HB2  . PHE A 1 49 ? -2.057  6.163  -2.748  1.00 1.00 ? 49 PHE A HB2  12 
ATOM   9078  H HB3  . PHE A 1 49 ? -3.392  7.103  -2.170  1.00 1.00 ? 49 PHE A HB3  12 
ATOM   9079  H HD1  . PHE A 1 49 ? -1.572  9.708  -1.737  1.00 1.00 ? 49 PHE A HD1  12 
ATOM   9080  H HD2  . PHE A 1 49 ? -2.436  7.057  -5.018  1.00 1.00 ? 49 PHE A HD2  12 
ATOM   9081  H HE1  . PHE A 1 49 ? -1.109  11.534 -3.333  1.00 1.00 ? 49 PHE A HE1  12 
ATOM   9082  H HE2  . PHE A 1 49 ? -2.063  8.917  -6.606  1.00 1.00 ? 49 PHE A HE2  12 
ATOM   9083  H HZ   . PHE A 1 49 ? -1.346  11.167 -5.740  1.00 1.00 ? 49 PHE A HZ   12 
ATOM   9084  N N    . PRO A 1 50 ? -2.824  5.376  0.425   1.00 1.00 ? 50 PRO A N    12 
ATOM   9085  C CA   . PRO A 1 50 ? -3.090  4.012  0.843   1.00 1.00 ? 50 PRO A CA   12 
ATOM   9086  C C    . PRO A 1 50 ? -3.327  3.151  -0.401  1.00 1.00 ? 50 PRO A C    12 
ATOM   9087  O O    . PRO A 1 50 ? -4.119  3.525  -1.264  1.00 1.00 ? 50 PRO A O    12 
ATOM   9088  C CB   . PRO A 1 50 ? -4.328  4.098  1.737   1.00 1.00 ? 50 PRO A CB   12 
ATOM   9089  C CG   . PRO A 1 50 ? -5.065  5.328  1.210   1.00 1.00 ? 50 PRO A CG   12 
ATOM   9090  C CD   . PRO A 1 50 ? -3.927  6.248  0.772   1.00 1.00 ? 50 PRO A CD   12 
ATOM   9091  H HA   . PRO A 1 50 ? -2.257  3.632  1.428   1.00 1.00 ? 50 PRO A HA   12 
ATOM   9092  H HB2  . PRO A 1 50 ? -4.941  3.197  1.696   1.00 1.00 ? 50 PRO A HB2  12 
ATOM   9093  H HB3  . PRO A 1 50 ? -4.000  4.291  2.757   1.00 1.00 ? 50 PRO A HB3  12 
ATOM   9094  H HG2  . PRO A 1 50 ? -5.661  5.046  0.340   1.00 1.00 ? 50 PRO A HG2  12 
ATOM   9095  H HG3  . PRO A 1 50 ? -5.703  5.785  1.966   1.00 1.00 ? 50 PRO A HG3  12 
ATOM   9096  H HD2  . PRO A 1 50 ? -4.234  6.842  -0.091  1.00 1.00 ? 50 PRO A HD2  12 
ATOM   9097  H HD3  . PRO A 1 50 ? -3.606  6.879  1.602   1.00 1.00 ? 50 PRO A HD3  12 
ATOM   9098  N N    . CYS A 1 51 ? -2.616  2.029  -0.526  1.00 1.00 ? 51 CYS A N    12 
ATOM   9099  C CA   . CYS A 1 51 ? -2.612  1.223  -1.740  1.00 1.00 ? 51 CYS A CA   12 
ATOM   9100  C C    . CYS A 1 51 ? -1.907  -0.111 -1.482  1.00 1.00 ? 51 CYS A C    12 
ATOM   9101  O O    . CYS A 1 51 ? -0.927  -0.149 -0.737  1.00 1.00 ? 51 CYS A O    12 
ATOM   9102  C CB   . CYS A 1 51 ? -1.930  2.015  -2.863  1.00 1.00 ? 51 CYS A CB   12 
ATOM   9103  S SG   . CYS A 1 51 ? -0.842  1.081  -3.964  1.00 1.00 ? 51 CYS A SG   12 
ATOM   9104  O OXT  . CYS A 1 51 ? -2.424  -1.201 -2.114  1.00 0.00 ? 51 CYS A OXT  12 
ATOM   9105  H H    . CYS A 1 51 ? -1.945  1.779  0.196   1.00 1.00 ? 51 CYS A H    12 
ATOM   9106  H HA   . CYS A 1 51 ? -3.643  1.015  -2.031  1.00 1.00 ? 51 CYS A HA   12 
ATOM   9107  H HB2  . CYS A 1 51 ? -2.681  2.512  -3.473  1.00 1.00 ? 51 CYS A HB2  12 
ATOM   9108  H HB3  . CYS A 1 51 ? -1.325  2.794  -2.407  1.00 1.00 ? 51 CYS A HB3  12 
HETATM 9109  N N    . PCA A 1 1  ? -3.436  1.188  5.886   1.00 1.00 ? 1  PCA A N    13 
HETATM 9110  C CA   . PCA A 1 1  ? -2.794  0.270  4.966   1.00 1.00 ? 1  PCA A CA   13 
HETATM 9111  C CB   . PCA A 1 1  ? -3.803  0.069  3.818   1.00 1.00 ? 1  PCA A CB   13 
HETATM 9112  C CG   . PCA A 1 1  ? -5.126  0.589  4.398   1.00 1.00 ? 1  PCA A CG   13 
HETATM 9113  C CD   . PCA A 1 1  ? -4.688  1.455  5.558   1.00 1.00 ? 1  PCA A CD   13 
HETATM 9114  O OE   . PCA A 1 1  ? -5.370  2.347  6.064   1.00 1.00 ? 1  PCA A OE   13 
HETATM 9115  C C    . PCA A 1 1  ? -1.472  0.868  4.486   1.00 1.00 ? 1  PCA A C    13 
HETATM 9116  O O    . PCA A 1 1  ? -1.314  2.089  4.475   1.00 1.00 ? 1  PCA A O    13 
HETATM 9117  H H    . PCA A 1 1  ? -2.909  1.672  6.596   1.00 0.00 ? 1  PCA A H    13 
HETATM 9118  H HA   . PCA A 1 1  ? -2.624  -0.674 5.486   1.00 1.00 ? 1  PCA A HA   13 
HETATM 9119  H HB2  . PCA A 1 1  ? -3.517  0.683  2.963   1.00 1.00 ? 1  PCA A HB2  13 
HETATM 9120  H HB3  . PCA A 1 1  ? -3.873  -0.976 3.514   1.00 1.00 ? 1  PCA A HB3  13 
HETATM 9121  H HG2  . PCA A 1 1  ? -5.699  1.153  3.662   1.00 1.00 ? 1  PCA A HG2  13 
HETATM 9122  H HG3  . PCA A 1 1  ? -5.720  -0.241 4.784   1.00 1.00 ? 1  PCA A HG3  13 
ATOM   9123  N N    . LYS A 1 2  ? -0.523  0.007  4.112   1.00 1.00 ? 2  LYS A N    13 
ATOM   9124  C CA   . LYS A 1 2  ? 0.811   0.425  3.702   1.00 1.00 ? 2  LYS A CA   13 
ATOM   9125  C C    . LYS A 1 2  ? 0.752   1.439  2.552   1.00 1.00 ? 2  LYS A C    13 
ATOM   9126  O O    . LYS A 1 2  ? 0.034   1.229  1.571   1.00 1.00 ? 2  LYS A O    13 
ATOM   9127  C CB   . LYS A 1 2  ? 1.653   -0.804 3.327   1.00 1.00 ? 2  LYS A CB   13 
ATOM   9128  C CG   . LYS A 1 2  ? 0.962   -1.738 2.313   1.00 1.00 ? 2  LYS A CG   13 
ATOM   9129  C CD   . LYS A 1 2  ? 1.924   -2.331 1.268   1.00 1.00 ? 2  LYS A CD   13 
ATOM   9130  C CE   . LYS A 1 2  ? 2.653   -1.288 0.402   1.00 1.00 ? 2  LYS A CE   13 
ATOM   9131  N NZ   . LYS A 1 2  ? 1.750   -0.239 -0.110  1.00 1.00 ? 2  LYS A NZ   13 
ATOM   9132  H H    . LYS A 1 2  ? -0.721  -0.980 4.154   1.00 1.00 ? 2  LYS A H    13 
ATOM   9133  H HA   . LYS A 1 2  ? 1.286   0.905  4.560   1.00 1.00 ? 2  LYS A HA   13 
ATOM   9134  H HB2  . LYS A 1 2  ? 2.608   -0.443 2.953   1.00 1.00 ? 2  LYS A HB2  13 
ATOM   9135  H HB3  . LYS A 1 2  ? 1.858   -1.378 4.232   1.00 1.00 ? 2  LYS A HB3  13 
ATOM   9136  H HG2  . LYS A 1 2  ? 0.524   -2.569 2.870   1.00 1.00 ? 2  LYS A HG2  13 
ATOM   9137  H HG3  . LYS A 1 2  ? 0.135   -1.242 1.804   1.00 1.00 ? 2  LYS A HG3  13 
ATOM   9138  H HD2  . LYS A 1 2  ? 2.670   -2.944 1.779   1.00 1.00 ? 2  LYS A HD2  13 
ATOM   9139  H HD3  . LYS A 1 2  ? 1.347   -2.991 0.615   1.00 1.00 ? 2  LYS A HD3  13 
ATOM   9140  H HE2  . LYS A 1 2  ? 3.444   -0.811 0.980   1.00 1.00 ? 2  LYS A HE2  13 
ATOM   9141  H HE3  . LYS A 1 2  ? 3.126   -1.794 -0.442  1.00 1.00 ? 2  LYS A HE3  13 
ATOM   9142  H HZ1  . LYS A 1 2  ? 1.192   0.168  0.628   1.00 1.00 ? 2  LYS A HZ1  13 
ATOM   9143  H HZ2  . LYS A 1 2  ? 2.282   0.530  -0.505  1.00 1.00 ? 2  LYS A HZ2  13 
ATOM   9144  H HZ3  . LYS A 1 2  ? 1.068   -0.584 -0.776  1.00 1.00 ? 2  LYS A HZ3  13 
ATOM   9145  N N    . LEU A 1 3  ? 1.543   2.506  2.628   1.00 1.00 ? 3  LEU A N    13 
ATOM   9146  C CA   . LEU A 1 3  ? 1.519   3.564  1.627   1.00 1.00 ? 3  LEU A CA   13 
ATOM   9147  C C    . LEU A 1 3  ? 2.091   3.108  0.276   1.00 1.00 ? 3  LEU A C    13 
ATOM   9148  O O    . LEU A 1 3  ? 2.853   2.143  0.195   1.00 1.00 ? 3  LEU A O    13 
ATOM   9149  C CB   . LEU A 1 3  ? 2.282   4.791  2.140   1.00 1.00 ? 3  LEU A CB   13 
ATOM   9150  C CG   . LEU A 1 3  ? 1.674   5.430  3.404   1.00 1.00 ? 3  LEU A CG   13 
ATOM   9151  C CD1  . LEU A 1 3  ? 2.703   6.360  4.058   1.00 1.00 ? 3  LEU A CD1  13 
ATOM   9152  C CD2  . LEU A 1 3  ? 0.397   6.219  3.092   1.00 1.00 ? 3  LEU A CD2  13 
ATOM   9153  H H    . LEU A 1 3  ? 2.144   2.622  3.430   1.00 1.00 ? 3  LEU A H    13 
ATOM   9154  H HA   . LEU A 1 3  ? 0.487   3.854  1.486   1.00 1.00 ? 3  LEU A HA   13 
ATOM   9155  H HB2  . LEU A 1 3  ? 3.298   4.468  2.345   1.00 1.00 ? 3  LEU A HB2  13 
ATOM   9156  H HB3  . LEU A 1 3  ? 2.321   5.540  1.350   1.00 1.00 ? 3  LEU A HB3  13 
ATOM   9157  H HG   . LEU A 1 3  ? 1.414   4.658  4.128   1.00 1.00 ? 3  LEU A HG   13 
ATOM   9158  H HD11 . LEU A 1 3  ? 3.596   5.795  4.327   1.00 1.00 ? 3  LEU A HD11 13 
ATOM   9159  H HD12 . LEU A 1 3  ? 2.988   7.160  3.376   1.00 1.00 ? 3  LEU A HD12 13 
ATOM   9160  H HD13 . LEU A 1 3  ? 2.285   6.802  4.962   1.00 1.00 ? 3  LEU A HD13 13 
ATOM   9161  H HD21 . LEU A 1 3  ? 0.590   6.971  2.329   1.00 1.00 ? 3  LEU A HD21 13 
ATOM   9162  H HD22 . LEU A 1 3  ? -0.384  5.545  2.746   1.00 1.00 ? 3  LEU A HD22 13 
ATOM   9163  H HD23 . LEU A 1 3  ? 0.049   6.716  3.997   1.00 1.00 ? 3  LEU A HD23 13 
ATOM   9164  N N    . CYS A 1 4  ? 1.701   3.806  -0.789  1.00 1.00 ? 4  CYS A N    13 
ATOM   9165  C CA   . CYS A 1 4  ? 2.242   3.747  -2.140  1.00 1.00 ? 4  CYS A CA   13 
ATOM   9166  C C    . CYS A 1 4  ? 2.387   5.200  -2.575  1.00 1.00 ? 4  CYS A C    13 
ATOM   9167  O O    . CYS A 1 4  ? 1.578   6.038  -2.168  1.00 1.00 ? 4  CYS A O    13 
ATOM   9168  C CB   . CYS A 1 4  ? 1.302   3.046  -3.128  1.00 1.00 ? 4  CYS A CB   13 
ATOM   9169  S SG   . CYS A 1 4  ? 1.018   1.281  -2.879  1.00 1.00 ? 4  CYS A SG   13 
ATOM   9170  H H    . CYS A 1 4  ? 1.007   4.531  -0.637  1.00 1.00 ? 4  CYS A H    13 
ATOM   9171  H HA   . CYS A 1 4  ? 3.216   3.252  -2.141  1.00 1.00 ? 4  CYS A HA   13 
ATOM   9172  H HB2  . CYS A 1 4  ? 0.342   3.560  -3.123  1.00 1.00 ? 4  CYS A HB2  13 
ATOM   9173  H HB3  . CYS A 1 4  ? 1.717   3.150  -4.131  1.00 1.00 ? 4  CYS A HB3  13 
ATOM   9174  N N    . GLU A 1 5  ? 3.421   5.497  -3.358  1.00 1.00 ? 5  GLU A N    13 
ATOM   9175  C CA   . GLU A 1 5  ? 3.789   6.847  -3.738  1.00 1.00 ? 5  GLU A CA   13 
ATOM   9176  C C    . GLU A 1 5  ? 3.248   7.204  -5.125  1.00 1.00 ? 5  GLU A C    13 
ATOM   9177  O O    . GLU A 1 5  ? 3.161   6.341  -5.995  1.00 1.00 ? 5  GLU A O    13 
ATOM   9178  C CB   . GLU A 1 5  ? 5.321   6.978  -3.751  1.00 1.00 ? 5  GLU A CB   13 
ATOM   9179  C CG   . GLU A 1 5  ? 5.970   6.776  -2.373  1.00 1.00 ? 5  GLU A CG   13 
ATOM   9180  C CD   . GLU A 1 5  ? 6.010   5.327  -1.885  1.00 1.00 ? 5  GLU A CD   13 
ATOM   9181  O OE1  . GLU A 1 5  ? 5.783   4.402  -2.663  1.00 1.00 ? 5  GLU A OE1  13 
ATOM   9182  O OE2  . GLU A 1 5  ? 6.290   5.156  -0.566  1.00 1.00 ? 5  GLU A OE2  13 
ATOM   9183  H H    . GLU A 1 5  ? 4.085   4.766  -3.591  1.00 1.00 ? 5  GLU A H    13 
ATOM   9184  H HA   . GLU A 1 5  ? 3.397   7.536  -2.997  1.00 1.00 ? 5  GLU A HA   13 
ATOM   9185  H HB2  . GLU A 1 5  ? 5.753   6.284  -4.475  1.00 1.00 ? 5  GLU A HB2  13 
ATOM   9186  H HB3  . GLU A 1 5  ? 5.561   7.992  -4.077  1.00 1.00 ? 5  GLU A HB3  13 
ATOM   9187  H HG2  . GLU A 1 5  ? 6.999   7.132  -2.421  1.00 1.00 ? 5  GLU A HG2  13 
ATOM   9188  H HG3  . GLU A 1 5  ? 5.430   7.383  -1.651  1.00 1.00 ? 5  GLU A HG3  13 
ATOM   9189  H HE2  . GLU A 1 5  ? 6.331   4.222  -0.350  1.00 1.00 ? 5  GLU A HE2  13 
ATOM   9190  N N    . ARG A 1 6  ? 2.923   8.484  -5.335  1.00 1.00 ? 6  ARG A N    13 
ATOM   9191  C CA   . ARG A 1 6  ? 2.635   9.068  -6.638  1.00 1.00 ? 6  ARG A CA   13 
ATOM   9192  C C    . ARG A 1 6  ? 3.488   10.339 -6.699  1.00 1.00 ? 6  ARG A C    13 
ATOM   9193  O O    . ARG A 1 6  ? 3.447   11.114 -5.742  1.00 1.00 ? 6  ARG A O    13 
ATOM   9194  C CB   . ARG A 1 6  ? 1.136   9.370  -6.832  1.00 1.00 ? 6  ARG A CB   13 
ATOM   9195  C CG   . ARG A 1 6  ? 0.798   9.582  -8.313  1.00 1.00 ? 6  ARG A CG   13 
ATOM   9196  C CD   . ARG A 1 6  ? -0.705  9.532  -8.633  1.00 1.00 ? 6  ARG A CD   13 
ATOM   9197  N NE   . ARG A 1 6  ? -1.322  10.870 -8.687  1.00 1.00 ? 6  ARG A NE   13 
ATOM   9198  C CZ   . ARG A 1 6  ? -2.416  11.290 -8.034  1.00 1.00 ? 6  ARG A CZ   13 
ATOM   9199  N NH1  . ARG A 1 6  ? -2.981  10.569 -7.064  1.00 1.00 ? 6  ARG A NH1  13 
ATOM   9200  N NH2  . ARG A 1 6  ? -2.950  12.469 -8.345  1.00 1.00 ? 6  ARG A NH2  13 
ATOM   9201  H H    . ARG A 1 6  ? 3.003   9.132  -4.554  1.00 1.00 ? 6  ARG A H    13 
ATOM   9202  H HA   . ARG A 1 6  ? 2.939   8.352  -7.399  1.00 1.00 ? 6  ARG A HA   13 
ATOM   9203  H HB2  . ARG A 1 6  ? 0.562   8.523  -6.454  1.00 1.00 ? 6  ARG A HB2  13 
ATOM   9204  H HB3  . ARG A 1 6  ? 0.863   10.280 -6.299  1.00 1.00 ? 6  ARG A HB3  13 
ATOM   9205  H HG2  . ARG A 1 6  ? 1.222   10.531 -8.648  1.00 1.00 ? 6  ARG A HG2  13 
ATOM   9206  H HG3  . ARG A 1 6  ? 1.258   8.767  -8.868  1.00 1.00 ? 6  ARG A HG3  13 
ATOM   9207  H HD2  . ARG A 1 6  ? -0.810  9.115  -9.637  1.00 1.00 ? 6  ARG A HD2  13 
ATOM   9208  H HD3  . ARG A 1 6  ? -1.209  8.843  -7.955  1.00 1.00 ? 6  ARG A HD3  13 
ATOM   9209  H HE   . ARG A 1 6  ? -0.969  11.508 -9.397  1.00 1.00 ? 6  ARG A HE   13 
ATOM   9210  H HH11 . ARG A 1 6  ? -2.582  9.697  -6.751  1.00 1.00 ? 6  ARG A HH11 13 
ATOM   9211  H HH12 . ARG A 1 6  ? -3.732  10.996 -6.528  1.00 1.00 ? 6  ARG A HH12 13 
ATOM   9212  H HH21 . ARG A 1 6  ? -2.459  13.070 -9.006  1.00 1.00 ? 6  ARG A HH21 13 
ATOM   9213  H HH22 . ARG A 1 6  ? -3.707  12.841 -7.781  1.00 1.00 ? 6  ARG A HH22 13 
ATOM   9214  N N    . PRO A 1 7  ? 4.303   10.534 -7.747  1.00 1.00 ? 7  PRO A N    13 
ATOM   9215  C CA   . PRO A 1 7  ? 5.139   11.715 -7.891  1.00 1.00 ? 7  PRO A CA   13 
ATOM   9216  C C    . PRO A 1 7  ? 4.286   12.843 -8.493  1.00 1.00 ? 7  PRO A C    13 
ATOM   9217  O O    . PRO A 1 7  ? 3.083   12.914 -8.242  1.00 1.00 ? 7  PRO A O    13 
ATOM   9218  C CB   . PRO A 1 7  ? 6.289   11.229 -8.786  1.00 1.00 ? 7  PRO A CB   13 
ATOM   9219  C CG   . PRO A 1 7  ? 5.577   10.279 -9.747  1.00 1.00 ? 7  PRO A CG   13 
ATOM   9220  C CD   . PRO A 1 7  ? 4.554   9.599  -8.835  1.00 1.00 ? 7  PRO A CD   13 
ATOM   9221  H HA   . PRO A 1 7  ? 5.543   12.042 -6.934  1.00 1.00 ? 7  PRO A HA   13 
ATOM   9222  H HB2  . PRO A 1 7  ? 6.854   12.006 -9.298  1.00 1.00 ? 7  PRO A HB2  13 
ATOM   9223  H HB3  . PRO A 1 7  ? 6.979   10.645 -8.173  1.00 1.00 ? 7  PRO A HB3  13 
ATOM   9224  H HG2  . PRO A 1 7  ? 5.063   10.853 -10.520 1.00 1.00 ? 7  PRO A HG2  13 
ATOM   9225  H HG3  . PRO A 1 7  ? 6.261   9.563  -10.206 1.00 1.00 ? 7  PRO A HG3  13 
ATOM   9226  H HD2  . PRO A 1 7  ? 3.647   9.372  -9.396  1.00 1.00 ? 7  PRO A HD2  13 
ATOM   9227  H HD3  . PRO A 1 7  ? 4.989   8.682  -8.434  1.00 1.00 ? 7  PRO A HD3  13 
ATOM   9228  N N    . SER A 1 8  ? 4.877   13.671 -9.359  1.00 1.00 ? 8  SER A N    13 
ATOM   9229  C CA   . SER A 1 8  ? 4.319   14.810 -10.074 1.00 1.00 ? 8  SER A CA   13 
ATOM   9230  C C    . SER A 1 8  ? 2.947   14.633 -10.746 1.00 1.00 ? 8  SER A C    13 
ATOM   9231  O O    . SER A 1 8  ? 2.444   15.590 -11.329 1.00 1.00 ? 8  SER A O    13 
ATOM   9232  C CB   . SER A 1 8  ? 5.362   15.268 -11.098 1.00 1.00 ? 8  SER A CB   13 
ATOM   9233  O OG   . SER A 1 8  ? 6.668   15.033 -10.590 1.00 1.00 ? 8  SER A OG   13 
ATOM   9234  H H    . SER A 1 8  ? 5.875   13.603 -9.507  1.00 1.00 ? 8  SER A H    13 
ATOM   9235  H HA   . SER A 1 8  ? 4.211   15.608 -9.338  1.00 1.00 ? 8  SER A HA   13 
ATOM   9236  H HB2  . SER A 1 8  ? 5.237   14.707 -12.026 1.00 1.00 ? 8  SER A HB2  13 
ATOM   9237  H HB3  . SER A 1 8  ? 5.218   16.330 -11.305 1.00 1.00 ? 8  SER A HB3  13 
ATOM   9238  H HG   . SER A 1 8  ? 7.303   15.456 -11.174 1.00 1.00 ? 8  SER A HG   13 
ATOM   9239  N N    . GLY A 1 9  ? 2.322   13.452 -10.728 1.00 1.00 ? 9  GLY A N    13 
ATOM   9240  C CA   . GLY A 1 9  ? 1.000   13.214 -11.300 1.00 1.00 ? 9  GLY A CA   13 
ATOM   9241  C C    . GLY A 1 9  ? -0.134  13.859 -10.497 1.00 1.00 ? 9  GLY A C    13 
ATOM   9242  O O    . GLY A 1 9  ? -1.159  13.219 -10.261 1.00 1.00 ? 9  GLY A O    13 
ATOM   9243  H H    . GLY A 1 9  ? 2.703   12.741 -10.119 1.00 1.00 ? 9  GLY A H    13 
ATOM   9244  H HA2  . GLY A 1 9  ? 0.969   13.586 -12.325 1.00 1.00 ? 9  GLY A HA2  13 
ATOM   9245  H HA3  . GLY A 1 9  ? 0.818   12.140 -11.315 1.00 1.00 ? 9  GLY A HA3  13 
ATOM   9246  N N    . THR A 1 10 ? 0.079   15.085 -10.017 1.00 1.00 ? 10 THR A N    13 
ATOM   9247  C CA   . THR A 1 10 ? -0.899  15.989 -9.435  1.00 1.00 ? 10 THR A CA   13 
ATOM   9248  C C    . THR A 1 10 ? -0.305  17.388 -9.611  1.00 1.00 ? 10 THR A C    13 
ATOM   9249  O O    . THR A 1 10 ? -0.805  18.212 -10.371 1.00 1.00 ? 10 THR A O    13 
ATOM   9250  C CB   . THR A 1 10 ? -1.218  15.676 -7.958  1.00 1.00 ? 10 THR A CB   13 
ATOM   9251  O OG1  . THR A 1 10 ? -0.973  14.320 -7.632  1.00 1.00 ? 10 THR A OG1  13 
ATOM   9252  C CG2  . THR A 1 10 ? -2.686  16.010 -7.694  1.00 1.00 ? 10 THR A CG2  13 
ATOM   9253  H H    . THR A 1 10 ? 0.934   15.528 -10.324 1.00 1.00 ? 10 THR A H    13 
ATOM   9254  H HA   . THR A 1 10 ? -1.811  15.919 -10.032 1.00 1.00 ? 10 THR A HA   13 
ATOM   9255  H HB   . THR A 1 10 ? -0.620  16.298 -7.289  1.00 1.00 ? 10 THR A HB   13 
ATOM   9256  H HG1  . THR A 1 10 ? -0.046  14.134 -7.820  1.00 1.00 ? 10 THR A HG1  13 
ATOM   9257  H HG21 . THR A 1 10 ? -2.888  17.030 -8.018  1.00 1.00 ? 10 THR A HG21 13 
ATOM   9258  H HG22 . THR A 1 10 ? -3.332  15.326 -8.245  1.00 1.00 ? 10 THR A HG22 13 
ATOM   9259  H HG23 . THR A 1 10 ? -2.899  15.940 -6.629  1.00 1.00 ? 10 THR A HG23 13 
ATOM   9260  N N    . TRP A 1 11 ? 0.831   17.612 -8.944  1.00 1.00 ? 11 TRP A N    13 
ATOM   9261  C CA   . TRP A 1 11 ? 1.646   18.800 -9.112  1.00 1.00 ? 11 TRP A CA   13 
ATOM   9262  C C    . TRP A 1 11 ? 2.562   18.559 -10.310 1.00 1.00 ? 11 TRP A C    13 
ATOM   9263  O O    . TRP A 1 11 ? 3.734   18.215 -10.158 1.00 1.00 ? 11 TRP A O    13 
ATOM   9264  C CB   . TRP A 1 11 ? 2.420   19.065 -7.814  1.00 1.00 ? 11 TRP A CB   13 
ATOM   9265  C CG   . TRP A 1 11 ? 3.043   20.421 -7.676  1.00 1.00 ? 11 TRP A CG   13 
ATOM   9266  C CD1  . TRP A 1 11 ? 3.853   21.027 -8.574  1.00 1.00 ? 11 TRP A CD1  13 
ATOM   9267  C CD2  . TRP A 1 11 ? 2.939   21.349 -6.557  1.00 1.00 ? 11 TRP A CD2  13 
ATOM   9268  N NE1  . TRP A 1 11 ? 4.237   22.263 -8.104  1.00 1.00 ? 11 TRP A NE1  13 
ATOM   9269  C CE2  . TRP A 1 11 ? 3.693   22.518 -6.865  1.00 1.00 ? 11 TRP A CE2  13 
ATOM   9270  C CE3  . TRP A 1 11 ? 2.298   21.312 -5.299  1.00 1.00 ? 11 TRP A CE3  13 
ATOM   9271  C CZ2  . TRP A 1 11 ? 3.802   23.595 -5.977  1.00 1.00 ? 11 TRP A CZ2  13 
ATOM   9272  C CZ3  . TRP A 1 11 ? 2.373   22.401 -4.416  1.00 1.00 ? 11 TRP A CZ3  13 
ATOM   9273  C CH2  . TRP A 1 11 ? 3.150   23.521 -4.738  1.00 1.00 ? 11 TRP A CH2  13 
ATOM   9274  H H    . TRP A 1 11 ? 1.216   16.874 -8.375  1.00 1.00 ? 11 TRP A H    13 
ATOM   9275  H HA   . TRP A 1 11 ? 1.007   19.664 -9.306  1.00 1.00 ? 11 TRP A HA   13 
ATOM   9276  H HB2  . TRP A 1 11 ? 1.723   18.950 -6.983  1.00 1.00 ? 11 TRP A HB2  13 
ATOM   9277  H HB3  . TRP A 1 11 ? 3.198   18.314 -7.696  1.00 1.00 ? 11 TRP A HB3  13 
ATOM   9278  H HD1  . TRP A 1 11 ? 4.178   20.618 -9.517  1.00 1.00 ? 11 TRP A HD1  13 
ATOM   9279  H HE1  . TRP A 1 11 ? 4.916   22.874 -8.554  1.00 1.00 ? 11 TRP A HE1  13 
ATOM   9280  H HE3  . TRP A 1 11 ? 1.731   20.441 -5.006  1.00 1.00 ? 11 TRP A HE3  13 
ATOM   9281  H HZ2  . TRP A 1 11 ? 4.406   24.456 -6.228  1.00 1.00 ? 11 TRP A HZ2  13 
ATOM   9282  H HZ3  . TRP A 1 11 ? 1.845   22.372 -3.476  1.00 1.00 ? 11 TRP A HZ3  13 
ATOM   9283  H HH2  . TRP A 1 11 ? 3.259   24.307 -4.015  1.00 1.00 ? 11 TRP A HH2  13 
ATOM   9284  N N    . SER A 1 12 ? 2.038   18.748 -11.519 1.00 1.00 ? 12 SER A N    13 
ATOM   9285  C CA   . SER A 1 12 ? 2.765   18.395 -12.727 1.00 1.00 ? 12 SER A CA   13 
ATOM   9286  C C    . SER A 1 12 ? 3.629   19.575 -13.160 1.00 1.00 ? 12 SER A C    13 
ATOM   9287  O O    . SER A 1 12 ? 3.413   20.184 -14.205 1.00 1.00 ? 12 SER A O    13 
ATOM   9288  C CB   . SER A 1 12 ? 1.763   17.954 -13.797 1.00 1.00 ? 12 SER A CB   13 
ATOM   9289  O OG   . SER A 1 12 ? 0.936   16.945 -13.244 1.00 1.00 ? 12 SER A OG   13 
ATOM   9290  H H    . SER A 1 12 ? 1.046   18.941 -11.591 1.00 1.00 ? 12 SER A H    13 
ATOM   9291  H HA   . SER A 1 12 ? 3.433   17.555 -12.537 1.00 1.00 ? 12 SER A HA   13 
ATOM   9292  H HB2  . SER A 1 12 ? 1.149   18.798 -14.115 1.00 1.00 ? 12 SER A HB2  13 
ATOM   9293  H HB3  . SER A 1 12 ? 2.303   17.567 -14.662 1.00 1.00 ? 12 SER A HB3  13 
ATOM   9294  H HG   . SER A 1 12 ? 1.476   16.393 -12.662 1.00 1.00 ? 12 SER A HG   13 
ATOM   9295  N N    . GLY A 1 13 ? 4.626   19.872 -12.326 1.00 1.00 ? 13 GLY A N    13 
ATOM   9296  C CA   . GLY A 1 13 ? 5.606   20.925 -12.515 1.00 1.00 ? 13 GLY A CA   13 
ATOM   9297  C C    . GLY A 1 13 ? 6.627   20.819 -11.385 1.00 1.00 ? 13 GLY A C    13 
ATOM   9298  O O    . GLY A 1 13 ? 6.577   19.871 -10.600 1.00 1.00 ? 13 GLY A O    13 
ATOM   9299  H H    . GLY A 1 13 ? 4.732   19.314 -11.479 1.00 1.00 ? 13 GLY A H    13 
ATOM   9300  H HA2  . GLY A 1 13 ? 6.106   20.802 -13.476 1.00 1.00 ? 13 GLY A HA2  13 
ATOM   9301  H HA3  . GLY A 1 13 ? 5.111   21.897 -12.477 1.00 1.00 ? 13 GLY A HA3  13 
ATOM   9302  N N    . VAL A 1 14 ? 7.544   21.784 -11.284 1.00 1.00 ? 14 VAL A N    13 
ATOM   9303  C CA   . VAL A 1 14 ? 8.486   21.833 -10.173 1.00 1.00 ? 14 VAL A CA   13 
ATOM   9304  C C    . VAL A 1 14 ? 7.686   22.051 -8.883  1.00 1.00 ? 14 VAL A C    13 
ATOM   9305  O O    . VAL A 1 14 ? 6.774   22.876 -8.857  1.00 1.00 ? 14 VAL A O    13 
ATOM   9306  C CB   . VAL A 1 14 ? 9.536   22.935 -10.400 1.00 1.00 ? 14 VAL A CB   13 
ATOM   9307  C CG1  . VAL A 1 14 ? 10.623  22.884 -9.317  1.00 1.00 ? 14 VAL A CG1  13 
ATOM   9308  C CG2  . VAL A 1 14 ? 10.211  22.788 -11.773 1.00 1.00 ? 14 VAL A CG2  13 
ATOM   9309  H H    . VAL A 1 14 ? 7.514   22.562 -11.924 1.00 1.00 ? 14 VAL A H    13 
ATOM   9310  H HA   . VAL A 1 14 ? 9.000   20.871 -10.123 1.00 1.00 ? 14 VAL A HA   13 
ATOM   9311  H HB   . VAL A 1 14 ? 9.049   23.910 -10.358 1.00 1.00 ? 14 VAL A HB   13 
ATOM   9312  H HG11 . VAL A 1 14 ? 11.100  21.903 -9.308  1.00 1.00 ? 14 VAL A HG11 13 
ATOM   9313  H HG12 . VAL A 1 14 ? 11.379  23.644 -9.517  1.00 1.00 ? 14 VAL A HG12 13 
ATOM   9314  H HG13 . VAL A 1 14 ? 10.193  23.082 -8.338  1.00 1.00 ? 14 VAL A HG13 13 
ATOM   9315  H HG21 . VAL A 1 14 ? 10.634  21.789 -11.876 1.00 1.00 ? 14 VAL A HG21 13 
ATOM   9316  H HG22 . VAL A 1 14 ? 9.495   22.956 -12.576 1.00 1.00 ? 14 VAL A HG22 13 
ATOM   9317  H HG23 . VAL A 1 14 ? 11.009  23.524 -11.872 1.00 1.00 ? 14 VAL A HG23 13 
ATOM   9318  N N    . CYS A 1 15 ? 8.017   21.315 -7.820  1.00 1.00 ? 15 CYS A N    13 
ATOM   9319  C CA   . CYS A 1 15 ? 7.200   21.265 -6.609  1.00 1.00 ? 15 CYS A CA   13 
ATOM   9320  C C    . CYS A 1 15 ? 7.303   22.532 -5.763  1.00 1.00 ? 15 CYS A C    13 
ATOM   9321  O O    . CYS A 1 15 ? 6.466   22.756 -4.894  1.00 1.00 ? 15 CYS A O    13 
ATOM   9322  C CB   . CYS A 1 15 ? 7.610   20.082 -5.740  1.00 1.00 ? 15 CYS A CB   13 
ATOM   9323  S SG   . CYS A 1 15 ? 8.977   20.446 -4.621  1.00 1.00 ? 15 CYS A SG   13 
ATOM   9324  H H    . CYS A 1 15 ? 8.787   20.659 -7.911  1.00 1.00 ? 15 CYS A H    13 
ATOM   9325  H HA   . CYS A 1 15 ? 6.165   21.099 -6.894  1.00 1.00 ? 15 CYS A HA   13 
ATOM   9326  H HB2  . CYS A 1 15 ? 6.764   19.804 -5.114  1.00 1.00 ? 15 CYS A HB2  13 
ATOM   9327  H HB3  . CYS A 1 15 ? 7.870   19.233 -6.364  1.00 1.00 ? 15 CYS A HB3  13 
ATOM   9328  N N    . GLY A 1 16 ? 8.370   23.312 -5.936  1.00 1.00 ? 16 GLY A N    13 
ATOM   9329  C CA   . GLY A 1 16 ? 8.595   24.532 -5.178  1.00 1.00 ? 16 GLY A CA   13 
ATOM   9330  C C    . GLY A 1 16 ? 9.061   24.272 -3.742  1.00 1.00 ? 16 GLY A C    13 
ATOM   9331  O O    . GLY A 1 16 ? 10.052  24.859 -3.313  1.00 1.00 ? 16 GLY A O    13 
ATOM   9332  H H    . GLY A 1 16 ? 9.052   23.044 -6.628  1.00 1.00 ? 16 GLY A H    13 
ATOM   9333  H HA2  . GLY A 1 16 ? 9.354   25.121 -5.694  1.00 1.00 ? 16 GLY A HA2  13 
ATOM   9334  H HA3  . GLY A 1 16 ? 7.675   25.117 -5.148  1.00 1.00 ? 16 GLY A HA3  13 
ATOM   9335  N N    . ASN A 1 17 ? 8.358   23.426 -2.981  1.00 1.00 ? 17 ASN A N    13 
ATOM   9336  C CA   . ASN A 1 17 ? 8.582   23.287 -1.547  1.00 1.00 ? 17 ASN A CA   13 
ATOM   9337  C C    . ASN A 1 17 ? 7.854   22.070 -0.965  1.00 1.00 ? 17 ASN A C    13 
ATOM   9338  O O    . ASN A 1 17 ? 6.712   21.788 -1.328  1.00 1.00 ? 17 ASN A O    13 
ATOM   9339  C CB   . ASN A 1 17 ? 8.098   24.564 -0.845  1.00 1.00 ? 17 ASN A CB   13 
ATOM   9340  C CG   . ASN A 1 17 ? 8.102   24.398 0.667   1.00 1.00 ? 17 ASN A CG   13 
ATOM   9341  O OD1  . ASN A 1 17 ? 7.070   24.101 1.260   1.00 1.00 ? 17 ASN A OD1  13 
ATOM   9342  N ND2  . ASN A 1 17 ? 9.262   24.540 1.301   1.00 1.00 ? 17 ASN A ND2  13 
ATOM   9343  H H    . ASN A 1 17 ? 7.599   22.902 -3.405  1.00 1.00 ? 17 ASN A H    13 
ATOM   9344  H HA   . ASN A 1 17 ? 9.652   23.172 -1.369  1.00 1.00 ? 17 ASN A HA   13 
ATOM   9345  H HB2  . ASN A 1 17 ? 8.726   25.413 -1.116  1.00 1.00 ? 17 ASN A HB2  13 
ATOM   9346  H HB3  . ASN A 1 17 ? 7.076   24.777 -1.161  1.00 1.00 ? 17 ASN A HB3  13 
ATOM   9347  H HD21 . ASN A 1 17 ? 10.090  24.811 0.790   1.00 1.00 ? 17 ASN A HD21 13 
ATOM   9348  H HD22 . ASN A 1 17 ? 9.283   24.467 2.307   1.00 1.00 ? 17 ASN A HD22 13 
ATOM   9349  N N    . ASN A 1 18 ? 8.512   21.387 -0.016  1.00 1.00 ? 18 ASN A N    13 
ATOM   9350  C CA   . ASN A 1 18 ? 7.993   20.257 0.739   1.00 1.00 ? 18 ASN A CA   13 
ATOM   9351  C C    . ASN A 1 18 ? 6.581   20.484 1.255   1.00 1.00 ? 18 ASN A C    13 
ATOM   9352  O O    . ASN A 1 18 ? 5.668   19.722 0.950   1.00 1.00 ? 18 ASN A O    13 
ATOM   9353  C CB   . ASN A 1 18 ? 8.907   19.975 1.931   1.00 1.00 ? 18 ASN A CB   13 
ATOM   9354  C CG   . ASN A 1 18 ? 8.430   18.710 2.629   1.00 1.00 ? 18 ASN A CG   13 
ATOM   9355  O OD1  . ASN A 1 18 ? 7.632   18.764 3.564   1.00 1.00 ? 18 ASN A OD1  13 
ATOM   9356  N ND2  . ASN A 1 18 ? 8.850   17.555 2.135   1.00 1.00 ? 18 ASN A ND2  13 
ATOM   9357  H H    . ASN A 1 18 ? 9.455   21.661 0.212   1.00 1.00 ? 18 ASN A H    13 
ATOM   9358  H HA   . ASN A 1 18 ? 7.990   19.376 0.108   1.00 1.00 ? 18 ASN A HA   13 
ATOM   9359  H HB2  . ASN A 1 18 ? 9.926   19.858 1.582   1.00 1.00 ? 18 ASN A HB2  13 
ATOM   9360  H HB3  . ASN A 1 18 ? 8.900   20.802 2.642   1.00 1.00 ? 18 ASN A HB3  13 
ATOM   9361  H HD21 . ASN A 1 18 ? 9.488   17.527 1.340   1.00 1.00 ? 18 ASN A HD21 13 
ATOM   9362  H HD22 . ASN A 1 18 ? 8.516   16.701 2.560   1.00 1.00 ? 18 ASN A HD22 13 
ATOM   9363  N N    . ASN A 1 19 ? 6.449   21.497 2.104   1.00 1.00 ? 19 ASN A N    13 
ATOM   9364  C CA   . ASN A 1 19 ? 5.219   21.808 2.816   1.00 1.00 ? 19 ASN A CA   13 
ATOM   9365  C C    . ASN A 1 19 ? 4.109   22.233 1.856   1.00 1.00 ? 19 ASN A C    13 
ATOM   9366  O O    . ASN A 1 19 ? 2.959   21.840 2.033   1.00 1.00 ? 19 ASN A O    13 
ATOM   9367  C CB   . ASN A 1 19 ? 5.450   22.874 3.889   1.00 1.00 ? 19 ASN A CB   13 
ATOM   9368  C CG   . ASN A 1 19 ? 4.168   23.077 4.691   1.00 1.00 ? 19 ASN A CG   13 
ATOM   9369  O OD1  . ASN A 1 19 ? 3.745   22.183 5.416   1.00 1.00 ? 19 ASN A OD1  13 
ATOM   9370  N ND2  . ASN A 1 19 ? 3.531   24.236 4.560   1.00 1.00 ? 19 ASN A ND2  13 
ATOM   9371  H H    . ASN A 1 19 ? 7.278   22.046 2.269   1.00 1.00 ? 19 ASN A H    13 
ATOM   9372  H HA   . ASN A 1 19 ? 4.909   20.903 3.335   1.00 1.00 ? 19 ASN A HA   13 
ATOM   9373  H HB2  . ASN A 1 19 ? 6.235   22.539 4.568   1.00 1.00 ? 19 ASN A HB2  13 
ATOM   9374  H HB3  . ASN A 1 19 ? 5.759   23.815 3.433   1.00 1.00 ? 19 ASN A HB3  13 
ATOM   9375  H HD21 . ASN A 1 19 ? 3.889   24.963 3.960   1.00 1.00 ? 19 ASN A HD21 13 
ATOM   9376  H HD22 . ASN A 1 19 ? 2.680   24.373 5.085   1.00 1.00 ? 19 ASN A HD22 13 
ATOM   9377  N N    . ALA A 1 20 ? 4.439   23.025 0.831   1.00 1.00 ? 20 ALA A N    13 
ATOM   9378  C CA   . ALA A 1 20 ? 3.457   23.377 -0.187  1.00 1.00 ? 20 ALA A CA   13 
ATOM   9379  C C    . ALA A 1 20 ? 2.923   22.110 -0.850  1.00 1.00 ? 20 ALA A C    13 
ATOM   9380  O O    . ALA A 1 20 ? 1.714   21.880 -0.858  1.00 1.00 ? 20 ALA A O    13 
ATOM   9381  C CB   . ALA A 1 20 ? 4.041   24.328 -1.232  1.00 1.00 ? 20 ALA A CB   13 
ATOM   9382  H H    . ALA A 1 20 ? 5.397   23.355 0.753   1.00 1.00 ? 20 ALA A H    13 
ATOM   9383  H HA   . ALA A 1 20 ? 2.628   23.891 0.304   1.00 1.00 ? 20 ALA A HA   13 
ATOM   9384  H HB1  . ALA A 1 20 ? 4.502   25.187 -0.749  1.00 1.00 ? 20 ALA A HB1  13 
ATOM   9385  H HB2  . ALA A 1 20 ? 4.770   23.817 -1.862  1.00 1.00 ? 20 ALA A HB2  13 
ATOM   9386  H HB3  . ALA A 1 20 ? 3.218   24.682 -1.855  1.00 1.00 ? 20 ALA A HB3  13 
ATOM   9387  N N    . CYS A 1 21 ? 3.832   21.280 -1.378  1.00 1.00 ? 21 CYS A N    13 
ATOM   9388  C CA   . CYS A 1 21 ? 3.481   20.000 -1.985  1.00 1.00 ? 21 CYS A CA   13 
ATOM   9389  C C    . CYS A 1 21 ? 2.612   19.174 -1.038  1.00 1.00 ? 21 CYS A C    13 
ATOM   9390  O O    . CYS A 1 21 ? 1.553   18.688 -1.427  1.00 1.00 ? 21 CYS A O    13 
ATOM   9391  C CB   . CYS A 1 21 ? 4.748   19.223 -2.358  1.00 1.00 ? 21 CYS A CB   13 
ATOM   9392  S SG   . CYS A 1 21 ? 4.576   17.418 -2.433  1.00 1.00 ? 21 CYS A SG   13 
ATOM   9393  H H    . CYS A 1 21 ? 4.816   21.537 -1.332  1.00 1.00 ? 21 CYS A H    13 
ATOM   9394  H HA   . CYS A 1 21 ? 2.917   20.210 -2.893  1.00 1.00 ? 21 CYS A HA   13 
ATOM   9395  H HB2  . CYS A 1 21 ? 5.119   19.588 -3.316  1.00 1.00 ? 21 CYS A HB2  13 
ATOM   9396  H HB3  . CYS A 1 21 ? 5.510   19.410 -1.604  1.00 1.00 ? 21 CYS A HB3  13 
ATOM   9397  N N    . LYS A 1 22 ? 3.066   19.038 0.210   1.00 1.00 ? 22 LYS A N    13 
ATOM   9398  C CA   . LYS A 1 22 ? 2.387   18.313 1.269   1.00 1.00 ? 22 LYS A CA   13 
ATOM   9399  C C    . LYS A 1 22 ? 0.944   18.775 1.397   1.00 1.00 ? 22 LYS A C    13 
ATOM   9400  O O    . LYS A 1 22 ? 0.024   17.993 1.158   1.00 1.00 ? 22 LYS A O    13 
ATOM   9401  C CB   . LYS A 1 22 ? 3.177   18.515 2.573   1.00 1.00 ? 22 LYS A CB   13 
ATOM   9402  C CG   . LYS A 1 22 ? 2.559   17.893 3.835   1.00 1.00 ? 22 LYS A CG   13 
ATOM   9403  C CD   . LYS A 1 22 ? 3.433   18.111 5.090   1.00 1.00 ? 22 LYS A CD   13 
ATOM   9404  C CE   . LYS A 1 22 ? 4.582   17.106 5.303   1.00 1.00 ? 22 LYS A CE   13 
ATOM   9405  N NZ   . LYS A 1 22 ? 5.592   17.132 4.226   1.00 1.00 ? 22 LYS A NZ   13 
ATOM   9406  H H    . LYS A 1 22 ? 3.954   19.472 0.431   1.00 1.00 ? 22 LYS A H    13 
ATOM   9407  H HA   . LYS A 1 22 ? 2.370   17.264 0.990   1.00 1.00 ? 22 LYS A HA   13 
ATOM   9408  H HB2  . LYS A 1 22 ? 4.179   18.149 2.389   1.00 1.00 ? 22 LYS A HB2  13 
ATOM   9409  H HB3  . LYS A 1 22 ? 3.253   19.576 2.770   1.00 1.00 ? 22 LYS A HB3  13 
ATOM   9410  H HG2  . LYS A 1 22 ? 1.613   18.406 4.022   1.00 1.00 ? 22 LYS A HG2  13 
ATOM   9411  H HG3  . LYS A 1 22 ? 2.322   16.841 3.687   1.00 1.00 ? 22 LYS A HG3  13 
ATOM   9412  H HD2  . LYS A 1 22 ? 3.816   19.135 5.096   1.00 1.00 ? 22 LYS A HD2  13 
ATOM   9413  H HD3  . LYS A 1 22 ? 2.774   18.016 5.956   1.00 1.00 ? 22 LYS A HD3  13 
ATOM   9414  H HE2  . LYS A 1 22 ? 5.076   17.331 6.251   1.00 1.00 ? 22 LYS A HE2  13 
ATOM   9415  H HE3  . LYS A 1 22 ? 4.164   16.099 5.364   1.00 1.00 ? 22 LYS A HE3  13 
ATOM   9416  H HZ1  . LYS A 1 22 ? 6.050   18.032 4.123   1.00 1.00 ? 22 LYS A HZ1  13 
ATOM   9417  H HZ2  . LYS A 1 22 ? 6.321   16.432 4.332   1.00 1.00 ? 22 LYS A HZ2  13 
ATOM   9418  H HZ3  . LYS A 1 22 ? 5.136   16.879 3.361   1.00 1.00 ? 22 LYS A HZ3  13 
ATOM   9419  N N    . ASN A 1 23 ? 0.764   20.040 1.789   1.00 1.00 ? 23 ASN A N    13 
ATOM   9420  C CA   . ASN A 1 23 ? -0.552  20.625 1.973   1.00 1.00 ? 23 ASN A CA   13 
ATOM   9421  C C    . ASN A 1 23 ? -1.366  20.382 0.715   1.00 1.00 ? 23 ASN A C    13 
ATOM   9422  O O    . ASN A 1 23 ? -2.367  19.678 0.766   1.00 1.00 ? 23 ASN A O    13 
ATOM   9423  C CB   . ASN A 1 23 ? -0.437  22.127 2.278   1.00 1.00 ? 23 ASN A CB   13 
ATOM   9424  C CG   . ASN A 1 23 ? -1.767  22.885 2.166   1.00 1.00 ? 23 ASN A CG   13 
ATOM   9425  O OD1  . ASN A 1 23 ? -2.855  22.336 2.329   1.00 1.00 ? 23 ASN A OD1  13 
ATOM   9426  N ND2  . ASN A 1 23 ? -1.694  24.180 1.873   1.00 1.00 ? 23 ASN A ND2  13 
ATOM   9427  H H    . ASN A 1 23 ? 1.579   20.636 1.909   1.00 1.00 ? 23 ASN A H    13 
ATOM   9428  H HA   . ASN A 1 23 ? -1.034  20.110 2.805   1.00 1.00 ? 23 ASN A HA   13 
ATOM   9429  H HB2  . ASN A 1 23 ? -0.037  22.258 3.283   1.00 1.00 ? 23 ASN A HB2  13 
ATOM   9430  H HB3  . ASN A 1 23 ? 0.265   22.571 1.570   1.00 1.00 ? 23 ASN A HB3  13 
ATOM   9431  H HD21 . ASN A 1 23 ? -0.800  24.626 1.741   1.00 1.00 ? 23 ASN A HD21 13 
ATOM   9432  H HD22 . ASN A 1 23 ? -2.550  24.708 1.791   1.00 1.00 ? 23 ASN A HD22 13 
ATOM   9433  N N    . GLN A 1 24 ? -0.918  20.925 -0.416  1.00 1.00 ? 24 GLN A N    13 
ATOM   9434  C CA   . GLN A 1 24 ? -1.683  20.874 -1.647  1.00 1.00 ? 24 GLN A CA   13 
ATOM   9435  C C    . GLN A 1 24 ? -2.123  19.446 -1.951  1.00 1.00 ? 24 GLN A C    13 
ATOM   9436  O O    . GLN A 1 24 ? -3.308  19.217 -2.178  1.00 1.00 ? 24 GLN A O    13 
ATOM   9437  C CB   . GLN A 1 24 ? -0.878  21.520 -2.781  1.00 1.00 ? 24 GLN A CB   13 
ATOM   9438  C CG   . GLN A 1 24 ? -1.722  21.776 -4.038  1.00 1.00 ? 24 GLN A CG   13 
ATOM   9439  C CD   . GLN A 1 24 ? -1.556  20.696 -5.101  1.00 1.00 ? 24 GLN A CD   13 
ATOM   9440  O OE1  . GLN A 1 24 ? -2.289  19.714 -5.137  1.00 1.00 ? 24 GLN A OE1  13 
ATOM   9441  N NE2  . GLN A 1 24 ? -0.588  20.887 -5.989  1.00 1.00 ? 24 GLN A NE2  13 
ATOM   9442  H H    . GLN A 1 24 ? -0.014  21.390 -0.427  1.00 1.00 ? 24 GLN A H    13 
ATOM   9443  H HA   . GLN A 1 24 ? -2.593  21.448 -1.467  1.00 1.00 ? 24 GLN A HA   13 
ATOM   9444  H HB2  . GLN A 1 24 ? -0.528  22.489 -2.425  1.00 1.00 ? 24 GLN A HB2  13 
ATOM   9445  H HB3  . GLN A 1 24 ? -0.009  20.905 -3.022  1.00 1.00 ? 24 GLN A HB3  13 
ATOM   9446  H HG2  . GLN A 1 24 ? -2.775  21.863 -3.777  1.00 1.00 ? 24 GLN A HG2  13 
ATOM   9447  H HG3  . GLN A 1 24 ? -1.400  22.722 -4.474  1.00 1.00 ? 24 GLN A HG3  13 
ATOM   9448  H HE21 . GLN A 1 24 ? 0.037   21.677 -5.882  1.00 1.00 ? 24 GLN A HE21 13 
ATOM   9449  H HE22 . GLN A 1 24 ? -0.461  20.214 -6.728  1.00 1.00 ? 24 GLN A HE22 13 
ATOM   9450  N N    . CYS A 1 25 ? -1.207  18.479 -1.882  1.00 1.00 ? 25 CYS A N    13 
ATOM   9451  C CA   . CYS A 1 25 ? -1.572  17.097 -2.126  1.00 1.00 ? 25 CYS A CA   13 
ATOM   9452  C C    . CYS A 1 25 ? -2.695  16.633 -1.201  1.00 1.00 ? 25 CYS A C    13 
ATOM   9453  O O    . CYS A 1 25 ? -3.767  16.265 -1.679  1.00 1.00 ? 25 CYS A O    13 
ATOM   9454  C CB   . CYS A 1 25 ? -0.391  16.145 -1.976  1.00 1.00 ? 25 CYS A CB   13 
ATOM   9455  S SG   . CYS A 1 25 ? -0.944  14.517 -2.516  1.00 1.00 ? 25 CYS A SG   13 
ATOM   9456  H H    . CYS A 1 25 ? -0.249  18.702 -1.635  1.00 1.00 ? 25 CYS A H    13 
ATOM   9457  H HA   . CYS A 1 25 ? -1.924  17.030 -3.158  1.00 1.00 ? 25 CYS A HA   13 
ATOM   9458  H HB2  . CYS A 1 25 ? 0.459   16.464 -2.570  1.00 1.00 ? 25 CYS A HB2  13 
ATOM   9459  H HB3  . CYS A 1 25 ? -0.076  16.084 -0.935  1.00 1.00 ? 25 CYS A HB3  13 
ATOM   9460  N N    . ILE A 1 26 ? -2.449  16.635 0.117   1.00 1.00 ? 26 ILE A N    13 
ATOM   9461  C CA   . ILE A 1 26 ? -3.376  16.022 1.069   1.00 1.00 ? 26 ILE A CA   13 
ATOM   9462  C C    . ILE A 1 26 ? -4.646  16.862 1.233   1.00 1.00 ? 26 ILE A C    13 
ATOM   9463  O O    . ILE A 1 26 ? -5.655  16.391 1.764   1.00 1.00 ? 26 ILE A O    13 
ATOM   9464  C CB   . ILE A 1 26 ? -2.684  15.729 2.415   1.00 1.00 ? 26 ILE A CB   13 
ATOM   9465  C CG1  . ILE A 1 26 ? -2.484  16.996 3.263   1.00 1.00 ? 26 ILE A CG1  13 
ATOM   9466  C CG2  . ILE A 1 26 ? -1.364  14.985 2.175   1.00 1.00 ? 26 ILE A CG2  13 
ATOM   9467  C CD1  . ILE A 1 26 ? -1.667  16.749 4.534   1.00 1.00 ? 26 ILE A CD1  13 
ATOM   9468  H H    . ILE A 1 26 ? -1.598  17.073 0.468   1.00 1.00 ? 26 ILE A H    13 
ATOM   9469  H HA   . ILE A 1 26 ? -3.686  15.058 0.659   1.00 1.00 ? 26 ILE A HA   13 
ATOM   9470  H HB   . ILE A 1 26 ? -3.338  15.064 2.980   1.00 1.00 ? 26 ILE A HB   13 
ATOM   9471  H HG12 . ILE A 1 26 ? -1.991  17.763 2.673   1.00 1.00 ? 26 ILE A HG12 13 
ATOM   9472  H HG13 . ILE A 1 26 ? -3.463  17.366 3.572   1.00 1.00 ? 26 ILE A HG13 13 
ATOM   9473  H HG21 . ILE A 1 26 ? -1.521  14.181 1.460   1.00 1.00 ? 26 ILE A HG21 13 
ATOM   9474  H HG22 . ILE A 1 26 ? -0.604  15.660 1.787   1.00 1.00 ? 26 ILE A HG22 13 
ATOM   9475  H HG23 . ILE A 1 26 ? -1.012  14.556 3.110   1.00 1.00 ? 26 ILE A HG23 13 
ATOM   9476  H HD11 . ILE A 1 26 ? -2.098  15.921 5.099   1.00 1.00 ? 26 ILE A HD11 13 
ATOM   9477  H HD12 . ILE A 1 26 ? -0.631  16.521 4.283   1.00 1.00 ? 26 ILE A HD12 13 
ATOM   9478  H HD13 . ILE A 1 26 ? -1.685  17.647 5.151   1.00 1.00 ? 26 ILE A HD13 13 
ATOM   9479  N N    . ASN A 1 27 ? -4.609  18.115 0.778   1.00 1.00 ? 27 ASN A N    13 
ATOM   9480  C CA   . ASN A 1 27 ? -5.748  19.009 0.770   1.00 1.00 ? 27 ASN A CA   13 
ATOM   9481  C C    . ASN A 1 27 ? -6.617  18.665 -0.434  1.00 1.00 ? 27 ASN A C    13 
ATOM   9482  O O    . ASN A 1 27 ? -7.765  18.240 -0.277  1.00 1.00 ? 27 ASN A O    13 
ATOM   9483  C CB   . ASN A 1 27 ? -5.202  20.438 0.722   1.00 1.00 ? 27 ASN A CB   13 
ATOM   9484  C CG   . ASN A 1 27 ? -6.214  21.519 1.055   1.00 1.00 ? 27 ASN A CG   13 
ATOM   9485  O OD1  . ASN A 1 27 ? -7.391  21.412 0.732   1.00 1.00 ? 27 ASN A OD1  13 
ATOM   9486  N ND2  . ASN A 1 27 ? -5.742  22.572 1.717   1.00 1.00 ? 27 ASN A ND2  13 
ATOM   9487  H H    . ASN A 1 27 ? -3.731  18.485 0.414   1.00 1.00 ? 27 ASN A H    13 
ATOM   9488  H HA   . ASN A 1 27 ? -6.322  18.886 1.691   1.00 1.00 ? 27 ASN A HA   13 
ATOM   9489  H HB2  . ASN A 1 27 ? -4.441  20.488 1.492   1.00 1.00 ? 27 ASN A HB2  13 
ATOM   9490  H HB3  . ASN A 1 27 ? -4.740  20.660 -0.239  1.00 1.00 ? 27 ASN A HB3  13 
ATOM   9491  H HD21 . ASN A 1 27 ? -4.757  22.593 1.984   1.00 1.00 ? 27 ASN A HD21 13 
ATOM   9492  H HD22 . ASN A 1 27 ? -6.372  23.317 1.971   1.00 1.00 ? 27 ASN A HD22 13 
ATOM   9493  N N    . LEU A 1 28 ? -6.033  18.796 -1.628  1.00 1.00 ? 28 LEU A N    13 
ATOM   9494  C CA   . LEU A 1 28 ? -6.723  18.710 -2.903  1.00 1.00 ? 28 LEU A CA   13 
ATOM   9495  C C    . LEU A 1 28 ? -7.178  17.276 -3.163  1.00 1.00 ? 28 LEU A C    13 
ATOM   9496  O O    . LEU A 1 28 ? -8.365  17.039 -3.379  1.00 1.00 ? 28 LEU A O    13 
ATOM   9497  C CB   . LEU A 1 28 ? -5.802  19.242 -4.015  1.00 1.00 ? 28 LEU A CB   13 
ATOM   9498  C CG   . LEU A 1 28 ? -6.571  19.965 -5.124  1.00 1.00 ? 28 LEU A CG   13 
ATOM   9499  C CD1  . LEU A 1 28 ? -6.946  21.375 -4.642  1.00 1.00 ? 28 LEU A CD1  13 
ATOM   9500  C CD2  . LEU A 1 28 ? -5.682  20.064 -6.370  1.00 1.00 ? 28 LEU A CD2  13 
ATOM   9501  H H    . LEU A 1 28 ? -5.044  19.026 -1.658  1.00 1.00 ? 28 LEU A H    13 
ATOM   9502  H HA   . LEU A 1 28 ? -7.613  19.334 -2.830  1.00 1.00 ? 28 LEU A HA   13 
ATOM   9503  H HB2  . LEU A 1 28 ? -5.107  19.974 -3.606  1.00 1.00 ? 28 LEU A HB2  13 
ATOM   9504  H HB3  . LEU A 1 28 ? -5.216  18.421 -4.431  1.00 1.00 ? 28 LEU A HB3  13 
ATOM   9505  H HG   . LEU A 1 28 ? -7.472  19.405 -5.380  1.00 1.00 ? 28 LEU A HG   13 
ATOM   9506  H HD11 . LEU A 1 28 ? -6.044  21.939 -4.394  1.00 1.00 ? 28 LEU A HD11 13 
ATOM   9507  H HD12 . LEU A 1 28 ? -7.490  21.903 -5.423  1.00 1.00 ? 28 LEU A HD12 13 
ATOM   9508  H HD13 . LEU A 1 28 ? -7.574  21.329 -3.751  1.00 1.00 ? 28 LEU A HD13 13 
ATOM   9509  H HD21 . LEU A 1 28 ? -4.763  20.603 -6.133  1.00 1.00 ? 28 LEU A HD21 13 
ATOM   9510  H HD22 . LEU A 1 28 ? -5.422  19.065 -6.722  1.00 1.00 ? 28 LEU A HD22 13 
ATOM   9511  H HD23 . LEU A 1 28 ? -6.210  20.590 -7.165  1.00 1.00 ? 28 LEU A HD23 13 
ATOM   9512  N N    . GLU A 1 29 ? -6.246  16.316 -3.129  1.00 1.00 ? 29 GLU A N    13 
ATOM   9513  C CA   . GLU A 1 29 ? -6.595  14.902 -3.126  1.00 1.00 ? 29 GLU A CA   13 
ATOM   9514  C C    . GLU A 1 29 ? -6.518  14.447 -1.672  1.00 1.00 ? 29 GLU A C    13 
ATOM   9515  O O    . GLU A 1 29 ? -6.267  15.257 -0.785  1.00 1.00 ? 29 GLU A O    13 
ATOM   9516  C CB   . GLU A 1 29 ? -5.755  14.098 -4.133  1.00 1.00 ? 29 GLU A CB   13 
ATOM   9517  C CG   . GLU A 1 29 ? -4.234  14.220 -3.983  1.00 1.00 ? 29 GLU A CG   13 
ATOM   9518  C CD   . GLU A 1 29 ? -3.491  13.569 -5.145  1.00 1.00 ? 29 GLU A CD   13 
ATOM   9519  O OE1  . GLU A 1 29 ? -4.087  12.821 -5.926  1.00 1.00 ? 29 GLU A OE1  13 
ATOM   9520  O OE2  . GLU A 1 29 ? -2.172  13.874 -5.241  1.00 1.00 ? 29 GLU A OE2  13 
ATOM   9521  H H    . GLU A 1 29 ? -5.324  16.554 -2.769  1.00 1.00 ? 29 GLU A H    13 
ATOM   9522  H HA   . GLU A 1 29 ? -7.633  14.767 -3.435  1.00 1.00 ? 29 GLU A HA   13 
ATOM   9523  H HB2  . GLU A 1 29 ? -6.035  13.046 -4.079  1.00 1.00 ? 29 GLU A HB2  13 
ATOM   9524  H HB3  . GLU A 1 29 ? -6.023  14.463 -5.128  1.00 1.00 ? 29 GLU A HB3  13 
ATOM   9525  H HG2  . GLU A 1 29 ? -3.956  15.272 -3.983  1.00 1.00 ? 29 GLU A HG2  13 
ATOM   9526  H HG3  . GLU A 1 29 ? -3.904  13.758 -3.053  1.00 1.00 ? 29 GLU A HG3  13 
ATOM   9527  H HE2  . GLU A 1 29 ? -1.822  13.801 -6.136  1.00 1.00 ? 29 GLU A HE2  13 
ATOM   9528  N N    . LYS A 1 30 ? -6.840  13.188 -1.378  1.00 1.00 ? 30 LYS A N    13 
ATOM   9529  C CA   . LYS A 1 30 ? -7.022  12.703 -0.008  1.00 1.00 ? 30 LYS A CA   13 
ATOM   9530  C C    . LYS A 1 30 ? -5.871  11.806 0.459   1.00 1.00 ? 30 LYS A C    13 
ATOM   9531  O O    . LYS A 1 30 ? -6.019  11.066 1.431   1.00 1.00 ? 30 LYS A O    13 
ATOM   9532  C CB   . LYS A 1 30 ? -8.440  12.149 0.176   1.00 1.00 ? 30 LYS A CB   13 
ATOM   9533  C CG   . LYS A 1 30 ? -9.521  13.220 -0.108  1.00 1.00 ? 30 LYS A CG   13 
ATOM   9534  C CD   . LYS A 1 30 ? -9.973  14.089 1.087   1.00 1.00 ? 30 LYS A CD   13 
ATOM   9535  C CE   . LYS A 1 30 ? -8.920  14.933 1.834   1.00 1.00 ? 30 LYS A CE   13 
ATOM   9536  N NZ   . LYS A 1 30 ? -8.193  15.906 0.987   1.00 1.00 ? 30 LYS A NZ   13 
ATOM   9537  H H    . LYS A 1 30 ? -7.063  12.555 -2.131  1.00 1.00 ? 30 LYS A H    13 
ATOM   9538  H HA   . LYS A 1 30 ? -6.937  13.536 0.681   1.00 1.00 ? 30 LYS A HA   13 
ATOM   9539  H HB2  . LYS A 1 30 ? -8.570  11.320 -0.522  1.00 1.00 ? 30 LYS A HB2  13 
ATOM   9540  H HB3  . LYS A 1 30 ? -8.570  11.766 1.189   1.00 1.00 ? 30 LYS A HB3  13 
ATOM   9541  H HG2  . LYS A 1 30 ? -9.240  13.858 -0.945  1.00 1.00 ? 30 LYS A HG2  13 
ATOM   9542  H HG3  . LYS A 1 30 ? -10.411 12.674 -0.428  1.00 1.00 ? 30 LYS A HG3  13 
ATOM   9543  H HD2  . LYS A 1 30 ? -10.760 14.759 0.730   1.00 1.00 ? 30 LYS A HD2  13 
ATOM   9544  H HD3  . LYS A 1 30 ? -10.431 13.422 1.821   1.00 1.00 ? 30 LYS A HD3  13 
ATOM   9545  H HE2  . LYS A 1 30 ? -9.426  15.489 2.626   1.00 1.00 ? 30 LYS A HE2  13 
ATOM   9546  H HE3  . LYS A 1 30 ? -8.205  14.267 2.317   1.00 1.00 ? 30 LYS A HE3  13 
ATOM   9547  H HZ1  . LYS A 1 30 ? -7.734  15.454 0.210   1.00 1.00 ? 30 LYS A HZ1  13 
ATOM   9548  H HZ2  . LYS A 1 30 ? -8.738  16.677 0.617   1.00 1.00 ? 30 LYS A HZ2  13 
ATOM   9549  H HZ3  . LYS A 1 30 ? -7.427  16.314 1.514   1.00 1.00 ? 30 LYS A HZ3  13 
ATOM   9550  N N    . ALA A 1 31 ? -4.760  11.818 -0.286  1.00 1.00 ? 31 ALA A N    13 
ATOM   9551  C CA   . ALA A 1 31 ? -3.495  11.216 0.119   1.00 1.00 ? 31 ALA A CA   13 
ATOM   9552  C C    . ALA A 1 31 ? -3.192  11.510 1.593   1.00 1.00 ? 31 ALA A C    13 
ATOM   9553  O O    . ALA A 1 31 ? -3.592  12.551 2.112   1.00 1.00 ? 31 ALA A O    13 
ATOM   9554  C CB   . ALA A 1 31 ? -2.383  11.829 -0.725  1.00 1.00 ? 31 ALA A CB   13 
ATOM   9555  H H    . ALA A 1 31 ? -4.733  12.454 -1.066  1.00 1.00 ? 31 ALA A H    13 
ATOM   9556  H HA   . ALA A 1 31 ? -3.540  10.140 -0.052  1.00 1.00 ? 31 ALA A HA   13 
ATOM   9557  H HB1  . ALA A 1 31 ? -2.621  11.777 -1.783  1.00 1.00 ? 31 ALA A HB1  13 
ATOM   9558  H HB2  . ALA A 1 31 ? -2.269  12.879 -0.450  1.00 1.00 ? 31 ALA A HB2  13 
ATOM   9559  H HB3  . ALA A 1 31 ? -1.449  11.301 -0.540  1.00 1.00 ? 31 ALA A HB3  13 
ATOM   9560  N N    . ARG A 1 32 ? -2.471  10.612 2.266   1.00 1.00 ? 32 ARG A N    13 
ATOM   9561  C CA   . ARG A 1 32 ? -2.248  10.735 3.700   1.00 1.00 ? 32 ARG A CA   13 
ATOM   9562  C C    . ARG A 1 32 ? -1.036  11.602 3.996   1.00 1.00 ? 32 ARG A C    13 
ATOM   9563  O O    . ARG A 1 32 ? -1.113  12.486 4.846   1.00 1.00 ? 32 ARG A O    13 
ATOM   9564  C CB   . ARG A 1 32 ? -2.096  9.355  4.350   1.00 1.00 ? 32 ARG A CB   13 
ATOM   9565  C CG   . ARG A 1 32 ? -3.470  8.704  4.515   1.00 1.00 ? 32 ARG A CG   13 
ATOM   9566  C CD   . ARG A 1 32 ? -3.360  7.321  5.166   1.00 1.00 ? 32 ARG A CD   13 
ATOM   9567  N NE   . ARG A 1 32 ? -4.689  6.702  5.285   1.00 1.00 ? 32 ARG A NE   13 
ATOM   9568  C CZ   . ARG A 1 32 ? -4.917  5.446  5.700   1.00 1.00 ? 32 ARG A CZ   13 
ATOM   9569  N NH1  . ARG A 1 32 ? -3.905  4.682  6.115   1.00 1.00 ? 32 ARG A NH1  13 
ATOM   9570  N NH2  . ARG A 1 32 ? -6.152  4.937  5.689   1.00 1.00 ? 32 ARG A NH2  13 
ATOM   9571  H H    . ARG A 1 32 ? -1.995  9.878  1.749   1.00 1.00 ? 32 ARG A H    13 
ATOM   9572  H HA   . ARG A 1 32 ? -3.099  11.243 4.160   1.00 1.00 ? 32 ARG A HA   13 
ATOM   9573  H HB2  . ARG A 1 32 ? -1.439  8.727  3.745   1.00 1.00 ? 32 ARG A HB2  13 
ATOM   9574  H HB3  . ARG A 1 32 ? -1.655  9.474  5.340   1.00 1.00 ? 32 ARG A HB3  13 
ATOM   9575  H HG2  . ARG A 1 32 ? -4.081  9.346  5.153   1.00 1.00 ? 32 ARG A HG2  13 
ATOM   9576  H HG3  . ARG A 1 32 ? -3.943  8.621  3.537   1.00 1.00 ? 32 ARG A HG3  13 
ATOM   9577  H HD2  . ARG A 1 32 ? -2.709  6.695  4.554   1.00 1.00 ? 32 ARG A HD2  13 
ATOM   9578  H HD3  . ARG A 1 32 ? -2.919  7.436  6.159   1.00 1.00 ? 32 ARG A HD3  13 
ATOM   9579  H HE   . ARG A 1 32 ? -5.475  7.276  5.010   1.00 1.00 ? 32 ARG A HE   13 
ATOM   9580  H HH11 . ARG A 1 32 ? -2.960  5.034  6.141   1.00 1.00 ? 32 ARG A HH11 13 
ATOM   9581  H HH12 . ARG A 1 32 ? -4.104  3.727  6.392   1.00 1.00 ? 32 ARG A HH12 13 
ATOM   9582  H HH21 . ARG A 1 32 ? -6.956  5.479  5.408   1.00 1.00 ? 32 ARG A HH21 13 
ATOM   9583  H HH22 . ARG A 1 32 ? -6.274  3.955  5.934   1.00 1.00 ? 32 ARG A HH22 13 
ATOM   9584  N N    . HIS A 1 33 ? 0.125   11.268 3.430   1.00 1.00 ? 33 HIS A N    13 
ATOM   9585  C CA   . HIS A 1 33 ? 1.288   12.144 3.511   1.00 1.00 ? 33 HIS A CA   13 
ATOM   9586  C C    . HIS A 1 33 ? 1.553   12.763 2.151   1.00 1.00 ? 33 HIS A C    13 
ATOM   9587  O O    . HIS A 1 33 ? 1.155   12.210 1.128   1.00 1.00 ? 33 HIS A O    13 
ATOM   9588  C CB   . HIS A 1 33 ? 2.515   11.419 4.071   1.00 1.00 ? 33 HIS A CB   13 
ATOM   9589  C CG   . HIS A 1 33 ? 2.263   10.692 5.365   1.00 1.00 ? 33 HIS A CG   13 
ATOM   9590  N ND1  . HIS A 1 33 ? 1.123   10.876 6.135   1.00 1.00 ? 33 HIS A ND1  13 
ATOM   9591  C CD2  . HIS A 1 33 ? 2.999   9.741  6.027   1.00 1.00 ? 33 HIS A CD2  13 
ATOM   9592  C CE1  . HIS A 1 33 ? 1.162   9.971  7.125   1.00 1.00 ? 33 HIS A CE1  13 
ATOM   9593  N NE2  . HIS A 1 33 ? 2.289   9.255  7.123   1.00 1.00 ? 33 HIS A NE2  13 
ATOM   9594  H H    . HIS A 1 33 ? 0.115   10.572 2.693   1.00 1.00 ? 33 HIS A H    13 
ATOM   9595  H HA   . HIS A 1 33 ? 1.094   12.976 4.190   1.00 1.00 ? 33 HIS A HA   13 
ATOM   9596  H HB2  . HIS A 1 33 ? 2.878   10.694 3.346   1.00 1.00 ? 33 HIS A HB2  13 
ATOM   9597  H HB3  . HIS A 1 33 ? 3.310   12.147 4.240   1.00 1.00 ? 33 HIS A HB3  13 
ATOM   9598  H HD1  . HIS A 1 33 ? 0.370   11.531 5.949   1.00 1.00 ? 33 HIS A HD1  13 
ATOM   9599  H HD2  . HIS A 1 33 ? 3.963   9.388  5.688   1.00 1.00 ? 33 HIS A HD2  13 
ATOM   9600  H HE1  . HIS A 1 33 ? 0.353   9.832  7.830   1.00 1.00 ? 33 HIS A HE1  13 
ATOM   9601  N N    . GLY A 1 34 ? 2.288   13.869 2.147   1.00 1.00 ? 34 GLY A N    13 
ATOM   9602  C CA   . GLY A 1 34 ? 2.842   14.476 0.958   1.00 1.00 ? 34 GLY A CA   13 
ATOM   9603  C C    . GLY A 1 34 ? 4.119   15.157 1.408   1.00 1.00 ? 34 GLY A C    13 
ATOM   9604  O O    . GLY A 1 34 ? 4.180   15.611 2.550   1.00 1.00 ? 34 GLY A O    13 
ATOM   9605  H H    . GLY A 1 34 ? 2.609   14.262 3.021   1.00 1.00 ? 34 GLY A H    13 
ATOM   9606  H HA2  . GLY A 1 34 ? 3.120   13.703 0.260   1.00 1.00 ? 34 GLY A HA2  13 
ATOM   9607  H HA3  . GLY A 1 34 ? 2.140   15.162 0.489   1.00 1.00 ? 34 GLY A HA3  13 
ATOM   9608  N N    . SER A 1 35 ? 5.172   15.144 0.598   1.00 1.00 ? 35 SER A N    13 
ATOM   9609  C CA   . SER A 1 35 ? 6.480   15.608 1.027   1.00 1.00 ? 35 SER A CA   13 
ATOM   9610  C C    . SER A 1 35 ? 7.386   15.651 -0.202  1.00 1.00 ? 35 SER A C    13 
ATOM   9611  O O    . SER A 1 35 ? 7.944   14.633 -0.602  1.00 1.00 ? 35 SER A O    13 
ATOM   9612  C CB   . SER A 1 35 ? 7.039   14.682 2.140   1.00 1.00 ? 35 SER A CB   13 
ATOM   9613  O OG   . SER A 1 35 ? 7.401   15.418 3.302   1.00 1.00 ? 35 SER A OG   13 
ATOM   9614  H H    . SER A 1 35 ? 5.091   14.701 -0.318  1.00 1.00 ? 35 SER A H    13 
ATOM   9615  H HA   . SER A 1 35 ? 6.380   16.629 1.412   1.00 1.00 ? 35 SER A HA   13 
ATOM   9616  H HB2  . SER A 1 35 ? 6.303   13.927 2.432   1.00 1.00 ? 35 SER A HB2  13 
ATOM   9617  H HB3  . SER A 1 35 ? 7.913   14.131 1.785   1.00 1.00 ? 35 SER A HB3  13 
ATOM   9618  H HG   . SER A 1 35 ? 7.904   14.825 3.876   1.00 1.00 ? 35 SER A HG   13 
ATOM   9619  N N    . CYS A 1 36 ? 7.559   16.834 -0.793  1.00 1.00 ? 36 CYS A N    13 
ATOM   9620  C CA   . CYS A 1 36 ? 8.470   16.972 -1.920  1.00 1.00 ? 36 CYS A CA   13 
ATOM   9621  C C    . CYS A 1 36 ? 9.904   16.897 -1.411  1.00 1.00 ? 36 CYS A C    13 
ATOM   9622  O O    . CYS A 1 36 ? 10.201  17.390 -0.321  1.00 1.00 ? 36 CYS A O    13 
ATOM   9623  C CB   . CYS A 1 36 ? 8.269   18.304 -2.633  1.00 1.00 ? 36 CYS A CB   13 
ATOM   9624  S SG   . CYS A 1 36 ? 9.485   18.575 -3.926  1.00 1.00 ? 36 CYS A SG   13 
ATOM   9625  H H    . CYS A 1 36 ? 7.070   17.642 -0.444  1.00 1.00 ? 36 CYS A H    13 
ATOM   9626  H HA   . CYS A 1 36 ? 8.292   16.169 -2.637  1.00 1.00 ? 36 CYS A HA   13 
ATOM   9627  H HB2  . CYS A 1 36 ? 7.279   18.361 -3.075  1.00 1.00 ? 36 CYS A HB2  13 
ATOM   9628  H HB3  . CYS A 1 36 ? 8.387   19.135 -1.946  1.00 1.00 ? 36 CYS A HB3  13 
ATOM   9629  N N    . ASN A 1 37 ? 10.775  16.263 -2.196  1.00 1.00 ? 37 ASN A N    13 
ATOM   9630  C CA   . ASN A 1 37 ? 12.188  16.102 -1.902  1.00 1.00 ? 37 ASN A CA   13 
ATOM   9631  C C    . ASN A 1 37 ? 12.976  16.356 -3.188  1.00 1.00 ? 37 ASN A C    13 
ATOM   9632  O O    . ASN A 1 37 ? 12.401  16.338 -4.280  1.00 1.00 ? 37 ASN A O    13 
ATOM   9633  C CB   . ASN A 1 37 ? 12.430  14.682 -1.364  1.00 1.00 ? 37 ASN A CB   13 
ATOM   9634  C CG   . ASN A 1 37 ? 13.924  14.411 -1.214  1.00 1.00 ? 37 ASN A CG   13 
ATOM   9635  O OD1  . ASN A 1 37 ? 14.630  15.190 -0.584  1.00 1.00 ? 37 ASN A OD1  13 
ATOM   9636  N ND2  . ASN A 1 37 ? 14.443  13.386 -1.881  1.00 1.00 ? 37 ASN A ND2  13 
ATOM   9637  H H    . ASN A 1 37 ? 10.474  15.943 -3.108  1.00 1.00 ? 37 ASN A H    13 
ATOM   9638  H HA   . ASN A 1 37 ? 12.508  16.830 -1.154  1.00 1.00 ? 37 ASN A HA   13 
ATOM   9639  H HB2  . ASN A 1 37 ? 11.948  14.575 -0.392  1.00 1.00 ? 37 ASN A HB2  13 
ATOM   9640  H HB3  . ASN A 1 37 ? 11.983  13.957 -2.044  1.00 1.00 ? 37 ASN A HB3  13 
ATOM   9641  H HD21 . ASN A 1 37 ? 13.861  12.780 -2.436  1.00 1.00 ? 37 ASN A HD21 13 
ATOM   9642  H HD22 . ASN A 1 37 ? 15.444  13.252 -1.846  1.00 1.00 ? 37 ASN A HD22 13 
ATOM   9643  N N    . TYR A 1 38 ? 14.293  16.551 -3.065  1.00 1.00 ? 38 TYR A N    13 
ATOM   9644  C CA   . TYR A 1 38 ? 15.220  16.612 -4.184  1.00 1.00 ? 38 TYR A CA   13 
ATOM   9645  C C    . TYR A 1 38 ? 15.409  15.224 -4.811  1.00 1.00 ? 38 TYR A C    13 
ATOM   9646  O O    . TYR A 1 38 ? 16.517  14.695 -4.886  1.00 1.00 ? 38 TYR A O    13 
ATOM   9647  C CB   . TYR A 1 38 ? 16.541  17.240 -3.711  1.00 1.00 ? 38 TYR A CB   13 
ATOM   9648  C CG   . TYR A 1 38 ? 17.603  17.407 -4.787  1.00 1.00 ? 38 TYR A CG   13 
ATOM   9649  C CD1  . TYR A 1 38 ? 17.348  18.193 -5.926  1.00 1.00 ? 38 TYR A CD1  13 
ATOM   9650  C CD2  . TYR A 1 38 ? 18.837  16.737 -4.667  1.00 1.00 ? 38 TYR A CD2  13 
ATOM   9651  C CE1  . TYR A 1 38 ? 18.320  18.308 -6.935  1.00 1.00 ? 38 TYR A CE1  13 
ATOM   9652  C CE2  . TYR A 1 38 ? 19.802  16.843 -5.682  1.00 1.00 ? 38 TYR A CE2  13 
ATOM   9653  C CZ   . TYR A 1 38 ? 19.540  17.626 -6.819  1.00 1.00 ? 38 TYR A CZ   13 
ATOM   9654  O OH   . TYR A 1 38 ? 20.468  17.721 -7.814  1.00 1.00 ? 38 TYR A OH   13 
ATOM   9655  H H    . TYR A 1 38 ? 14.694  16.518 -2.134  1.00 1.00 ? 38 TYR A H    13 
ATOM   9656  H HA   . TYR A 1 38 ? 14.788  17.253 -4.950  1.00 1.00 ? 38 TYR A HA   13 
ATOM   9657  H HB2  . TYR A 1 38 ? 16.332  18.226 -3.296  1.00 1.00 ? 38 TYR A HB2  13 
ATOM   9658  H HB3  . TYR A 1 38 ? 16.941  16.624 -2.905  1.00 1.00 ? 38 TYR A HB3  13 
ATOM   9659  H HD1  . TYR A 1 38 ? 16.405  18.706 -6.037  1.00 1.00 ? 38 TYR A HD1  13 
ATOM   9660  H HD2  . TYR A 1 38 ? 19.040  16.121 -3.803  1.00 1.00 ? 38 TYR A HD2  13 
ATOM   9661  H HE1  . TYR A 1 38 ? 18.124  18.915 -7.806  1.00 1.00 ? 38 TYR A HE1  13 
ATOM   9662  H HE2  . TYR A 1 38 ? 20.739  16.316 -5.581  1.00 1.00 ? 38 TYR A HE2  13 
ATOM   9663  H HH   . TYR A 1 38 ? 21.306  17.314 -7.582  1.00 1.00 ? 38 TYR A HH   13 
ATOM   9664  N N    . VAL A 1 39 ? 14.319  14.620 -5.283  1.00 1.00 ? 39 VAL A N    13 
ATOM   9665  C CA   . VAL A 1 39 ? 14.407  13.427 -6.103  1.00 1.00 ? 39 VAL A CA   13 
ATOM   9666  C C    . VAL A 1 39 ? 14.809  13.948 -7.477  1.00 1.00 ? 39 VAL A C    13 
ATOM   9667  O O    . VAL A 1 39 ? 13.978  14.532 -8.168  1.00 1.00 ? 39 VAL A O    13 
ATOM   9668  C CB   . VAL A 1 39 ? 13.072  12.667 -6.130  1.00 1.00 ? 39 VAL A CB   13 
ATOM   9669  C CG1  . VAL A 1 39 ? 13.181  11.431 -7.034  1.00 1.00 ? 39 VAL A CG1  13 
ATOM   9670  C CG2  . VAL A 1 39 ? 12.685  12.221 -4.718  1.00 1.00 ? 39 VAL A CG2  13 
ATOM   9671  H H    . VAL A 1 39 ? 13.432  15.107 -5.220  1.00 1.00 ? 39 VAL A H    13 
ATOM   9672  H HA   . VAL A 1 39 ? 15.173  12.753 -5.713  1.00 1.00 ? 39 VAL A HA   13 
ATOM   9673  H HB   . VAL A 1 39 ? 12.286  13.317 -6.508  1.00 1.00 ? 39 VAL A HB   13 
ATOM   9674  H HG11 . VAL A 1 39 ? 13.961  10.766 -6.664  1.00 1.00 ? 39 VAL A HG11 13 
ATOM   9675  H HG12 . VAL A 1 39 ? 12.232  10.895 -7.041  1.00 1.00 ? 39 VAL A HG12 13 
ATOM   9676  H HG13 . VAL A 1 39 ? 13.421  11.720 -8.058  1.00 1.00 ? 39 VAL A HG13 13 
ATOM   9677  H HG21 . VAL A 1 39 ? 13.494  11.640 -4.275  1.00 1.00 ? 39 VAL A HG21 13 
ATOM   9678  H HG22 . VAL A 1 39 ? 12.482  13.096 -4.105  1.00 1.00 ? 39 VAL A HG22 13 
ATOM   9679  H HG23 . VAL A 1 39 ? 11.786  11.607 -4.755  1.00 1.00 ? 39 VAL A HG23 13 
ATOM   9680  N N    . PHE A 1 40 ? 16.089  13.805 -7.822  1.00 1.00 ? 40 PHE A N    13 
ATOM   9681  C CA   . PHE A 1 40 ? 16.724  14.388 -9.000  1.00 1.00 ? 40 PHE A CA   13 
ATOM   9682  C C    . PHE A 1 40 ? 15.853  14.310 -10.273 1.00 1.00 ? 40 PHE A C    13 
ATOM   9683  O O    . PHE A 1 40 ? 15.038  13.396 -10.419 1.00 1.00 ? 40 PHE A O    13 
ATOM   9684  C CB   . PHE A 1 40 ? 18.075  13.679 -9.193  1.00 1.00 ? 40 PHE A CB   13 
ATOM   9685  C CG   . PHE A 1 40 ? 18.875  14.037 -10.431 1.00 1.00 ? 40 PHE A CG   13 
ATOM   9686  C CD1  . PHE A 1 40 ? 18.676  13.327 -11.631 1.00 1.00 ? 40 PHE A CD1  13 
ATOM   9687  C CD2  . PHE A 1 40 ? 19.864  15.038 -10.368 1.00 1.00 ? 40 PHE A CD2  13 
ATOM   9688  C CE1  . PHE A 1 40 ? 19.438  13.642 -12.770 1.00 1.00 ? 40 PHE A CE1  13 
ATOM   9689  C CE2  . PHE A 1 40 ? 20.611  15.364 -11.513 1.00 1.00 ? 40 PHE A CE2  13 
ATOM   9690  C CZ   . PHE A 1 40 ? 20.396  14.669 -12.715 1.00 1.00 ? 40 PHE A CZ   13 
ATOM   9691  H H    . PHE A 1 40 ? 16.694  13.394 -7.125  1.00 1.00 ? 40 PHE A H    13 
ATOM   9692  H HA   . PHE A 1 40 ? 16.912  15.425 -8.733  1.00 1.00 ? 40 PHE A HA   13 
ATOM   9693  H HB2  . PHE A 1 40 ? 18.692  13.906 -8.324  1.00 1.00 ? 40 PHE A HB2  13 
ATOM   9694  H HB3  . PHE A 1 40 ? 17.900  12.603 -9.213  1.00 1.00 ? 40 PHE A HB3  13 
ATOM   9695  H HD1  . PHE A 1 40 ? 17.947  12.532 -11.684 1.00 1.00 ? 40 PHE A HD1  13 
ATOM   9696  H HD2  . PHE A 1 40 ? 20.040  15.580 -9.450  1.00 1.00 ? 40 PHE A HD2  13 
ATOM   9697  H HE1  . PHE A 1 40 ? 19.289  13.092 -13.688 1.00 1.00 ? 40 PHE A HE1  13 
ATOM   9698  H HE2  . PHE A 1 40 ? 21.356  16.147 -11.467 1.00 1.00 ? 40 PHE A HE2  13 
ATOM   9699  H HZ   . PHE A 1 40 ? 20.978  14.913 -13.592 1.00 1.00 ? 40 PHE A HZ   13 
ATOM   9700  N N    . PRO A 1 41 ? 15.979  15.261 -11.216 1.00 1.00 ? 41 PRO A N    13 
ATOM   9701  C CA   . PRO A 1 41 ? 16.717  16.504 -11.081 1.00 1.00 ? 41 PRO A CA   13 
ATOM   9702  C C    . PRO A 1 41 ? 15.856  17.517 -10.325 1.00 1.00 ? 41 PRO A C    13 
ATOM   9703  O O    . PRO A 1 41 ? 16.180  17.902 -9.206  1.00 1.00 ? 41 PRO A O    13 
ATOM   9704  C CB   . PRO A 1 41 ? 17.053  16.970 -12.507 1.00 1.00 ? 41 PRO A CB   13 
ATOM   9705  C CG   . PRO A 1 41 ? 16.498  15.884 -13.436 1.00 1.00 ? 41 PRO A CG   13 
ATOM   9706  C CD   . PRO A 1 41 ? 15.501  15.108 -12.577 1.00 1.00 ? 41 PRO A CD   13 
ATOM   9707  H HA   . PRO A 1 41 ? 17.640  16.347 -10.528 1.00 1.00 ? 41 PRO A HA   13 
ATOM   9708  H HB2  . PRO A 1 41 ? 16.595  17.932 -12.741 1.00 1.00 ? 41 PRO A HB2  13 
ATOM   9709  H HB3  . PRO A 1 41 ? 18.133  17.055 -12.636 1.00 1.00 ? 41 PRO A HB3  13 
ATOM   9710  H HG2  . PRO A 1 41 ? 16.033  16.303 -14.329 1.00 1.00 ? 41 PRO A HG2  13 
ATOM   9711  H HG3  . PRO A 1 41 ? 17.312  15.218 -13.725 1.00 1.00 ? 41 PRO A HG3  13 
ATOM   9712  H HD2  . PRO A 1 41 ? 14.509  15.546 -12.677 1.00 1.00 ? 41 PRO A HD2  13 
ATOM   9713  H HD3  . PRO A 1 41 ? 15.476  14.062 -12.889 1.00 1.00 ? 41 PRO A HD3  13 
ATOM   9714  N N    . ALA A 1 42 ? 14.742  17.941 -10.927 1.00 1.00 ? 42 ALA A N    13 
ATOM   9715  C CA   . ALA A 1 42 ? 13.889  18.963 -10.341 1.00 1.00 ? 42 ALA A CA   13 
ATOM   9716  C C    . ALA A 1 42 ? 13.211  18.437 -9.077  1.00 1.00 ? 42 ALA A C    13 
ATOM   9717  O O    . ALA A 1 42 ? 12.845  17.261 -9.017  1.00 1.00 ? 42 ALA A O    13 
ATOM   9718  C CB   . ALA A 1 42 ? 12.842  19.410 -11.363 1.00 1.00 ? 42 ALA A CB   13 
ATOM   9719  H H    . ALA A 1 42 ? 14.506  17.579 -11.837 1.00 1.00 ? 42 ALA A H    13 
ATOM   9720  H HA   . ALA A 1 42 ? 14.509  19.824 -10.087 1.00 1.00 ? 42 ALA A HA   13 
ATOM   9721  H HB1  . ALA A 1 42 ? 13.334  19.809 -12.250 1.00 1.00 ? 42 ALA A HB1  13 
ATOM   9722  H HB2  . ALA A 1 42 ? 12.210  18.567 -11.647 1.00 1.00 ? 42 ALA A HB2  13 
ATOM   9723  H HB3  . ALA A 1 42 ? 12.218  20.188 -10.923 1.00 1.00 ? 42 ALA A HB3  13 
ATOM   9724  N N    . HIS A 1 43 ? 12.982  19.329 -8.110  1.00 1.00 ? 43 HIS A N    13 
ATOM   9725  C CA   . HIS A 1 43 ? 12.233  19.017 -6.904  1.00 1.00 ? 43 HIS A CA   13 
ATOM   9726  C C    . HIS A 1 43 ? 10.808  18.677 -7.338  1.00 1.00 ? 43 HIS A C    13 
ATOM   9727  O O    . HIS A 1 43 ? 10.167  19.468 -8.032  1.00 1.00 ? 43 HIS A O    13 
ATOM   9728  C CB   . HIS A 1 43 ? 12.243  20.225 -5.960  1.00 1.00 ? 43 HIS A CB   13 
ATOM   9729  C CG   . HIS A 1 43 ? 13.612  20.578 -5.438  1.00 1.00 ? 43 HIS A CG   13 
ATOM   9730  N ND1  . HIS A 1 43 ? 14.437  21.516 -6.041  1.00 1.00 ? 43 HIS A ND1  13 
ATOM   9731  C CD2  . HIS A 1 43 ? 14.308  20.137 -4.339  1.00 1.00 ? 43 HIS A CD2  13 
ATOM   9732  C CE1  . HIS A 1 43 ? 15.568  21.576 -5.317  1.00 1.00 ? 43 HIS A CE1  13 
ATOM   9733  N NE2  . HIS A 1 43 ? 15.550  20.759 -4.264  1.00 1.00 ? 43 HIS A NE2  13 
ATOM   9734  H H    . HIS A 1 43 ? 13.276  20.281 -8.250  1.00 1.00 ? 43 HIS A H    13 
ATOM   9735  H HA   . HIS A 1 43 ? 12.693  18.165 -6.401  1.00 1.00 ? 43 HIS A HA   13 
ATOM   9736  H HB2  . HIS A 1 43 ? 11.799  21.077 -6.471  1.00 1.00 ? 43 HIS A HB2  13 
ATOM   9737  H HB3  . HIS A 1 43 ? 11.626  20.013 -5.089  1.00 1.00 ? 43 HIS A HB3  13 
ATOM   9738  H HD1  . HIS A 1 43 ? 14.232  22.066 -6.861  1.00 1.00 ? 43 HIS A HD1  13 
ATOM   9739  H HD2  . HIS A 1 43 ? 13.941  19.408 -3.631  1.00 1.00 ? 43 HIS A HD2  13 
ATOM   9740  H HE1  . HIS A 1 43 ? 16.398  22.225 -5.556  1.00 1.00 ? 43 HIS A HE1  13 
ATOM   9741  N N    . LYS A 1 44 ? 10.348  17.480 -6.975  1.00 1.00 ? 44 LYS A N    13 
ATOM   9742  C CA   . LYS A 1 44 ? 9.115   16.888 -7.473  1.00 1.00 ? 44 LYS A CA   13 
ATOM   9743  C C    . LYS A 1 44 ? 8.275   16.360 -6.311  1.00 1.00 ? 44 LYS A C    13 
ATOM   9744  O O    . LYS A 1 44 ? 8.806   15.789 -5.356  1.00 1.00 ? 44 LYS A O    13 
ATOM   9745  C CB   . LYS A 1 44 ? 9.435   15.821 -8.529  1.00 1.00 ? 44 LYS A CB   13 
ATOM   9746  C CG   . LYS A 1 44 ? 10.472  14.784 -8.073  1.00 1.00 ? 44 LYS A CG   13 
ATOM   9747  C CD   . LYS A 1 44 ? 10.689  13.687 -9.130  1.00 1.00 ? 44 LYS A CD   13 
ATOM   9748  C CE   . LYS A 1 44 ? 11.265  14.178 -10.467 1.00 1.00 ? 44 LYS A CE   13 
ATOM   9749  N NZ   . LYS A 1 44 ? 12.579  14.833 -10.311 1.00 1.00 ? 44 LYS A NZ   13 
ATOM   9750  H H    . LYS A 1 44 ? 10.889  16.951 -6.305  1.00 1.00 ? 44 LYS A H    13 
ATOM   9751  H HA   . LYS A 1 44 ? 8.525   17.651 -7.983  1.00 1.00 ? 44 LYS A HA   13 
ATOM   9752  H HB2  . LYS A 1 44 ? 8.511   15.310 -8.796  1.00 1.00 ? 44 LYS A HB2  13 
ATOM   9753  H HB3  . LYS A 1 44 ? 9.813   16.342 -9.410  1.00 1.00 ? 44 LYS A HB3  13 
ATOM   9754  H HG2  . LYS A 1 44 ? 11.418  15.270 -7.835  1.00 1.00 ? 44 LYS A HG2  13 
ATOM   9755  H HG3  . LYS A 1 44 ? 10.104  14.308 -7.163  1.00 1.00 ? 44 LYS A HG3  13 
ATOM   9756  H HD2  . LYS A 1 44 ? 11.363  12.936 -8.718  1.00 1.00 ? 44 LYS A HD2  13 
ATOM   9757  H HD3  . LYS A 1 44 ? 9.732   13.203 -9.329  1.00 1.00 ? 44 LYS A HD3  13 
ATOM   9758  H HE2  . LYS A 1 44 ? 11.387  13.316 -11.126 1.00 1.00 ? 44 LYS A HE2  13 
ATOM   9759  H HE3  . LYS A 1 44 ? 10.568  14.868 -10.945 1.00 1.00 ? 44 LYS A HE3  13 
ATOM   9760  H HZ1  . LYS A 1 44 ? 13.263  14.212 -9.878  1.00 1.00 ? 44 LYS A HZ1  13 
ATOM   9761  H HZ2  . LYS A 1 44 ? 12.945  15.131 -11.199 1.00 1.00 ? 44 LYS A HZ2  13 
ATOM   9762  H HZ3  . LYS A 1 44 ? 12.522  15.636 -9.692  1.00 1.00 ? 44 LYS A HZ3  13 
ATOM   9763  N N    . CYS A 1 45 ? 6.963   16.600 -6.379  1.00 1.00 ? 45 CYS A N    13 
ATOM   9764  C CA   . CYS A 1 45 ? 6.044   16.366 -5.278  1.00 1.00 ? 45 CYS A CA   13 
ATOM   9765  C C    . CYS A 1 45 ? 5.764   14.878 -5.106  1.00 1.00 ? 45 CYS A C    13 
ATOM   9766  O O    . CYS A 1 45 ? 4.921   14.320 -5.804  1.00 1.00 ? 45 CYS A O    13 
ATOM   9767  C CB   . CYS A 1 45 ? 4.750   17.153 -5.510  1.00 1.00 ? 45 CYS A CB   13 
ATOM   9768  S SG   . CYS A 1 45 ? 3.520   17.021 -4.185  1.00 1.00 ? 45 CYS A SG   13 
ATOM   9769  H H    . CYS A 1 45 ? 6.592   17.025 -7.217  1.00 1.00 ? 45 CYS A H    13 
ATOM   9770  H HA   . CYS A 1 45 ? 6.507   16.739 -4.370  1.00 1.00 ? 45 CYS A HA   13 
ATOM   9771  H HB2  . CYS A 1 45 ? 4.986   18.208 -5.637  1.00 1.00 ? 45 CYS A HB2  13 
ATOM   9772  H HB3  . CYS A 1 45 ? 4.281   16.790 -6.423  1.00 1.00 ? 45 CYS A HB3  13 
ATOM   9773  N N    . ILE A 1 46 ? 6.468   14.236 -4.171  1.00 1.00 ? 46 ILE A N    13 
ATOM   9774  C CA   . ILE A 1 46 ? 6.180   12.866 -3.782  1.00 1.00 ? 46 ILE A CA   13 
ATOM   9775  C C    . ILE A 1 46 ? 4.987   12.919 -2.833  1.00 1.00 ? 46 ILE A C    13 
ATOM   9776  O O    . ILE A 1 46 ? 5.035   13.631 -1.824  1.00 1.00 ? 46 ILE A O    13 
ATOM   9777  C CB   . ILE A 1 46 ? 7.399   12.213 -3.100  1.00 1.00 ? 46 ILE A CB   13 
ATOM   9778  C CG1  . ILE A 1 46 ? 8.718   12.427 -3.869  1.00 1.00 ? 46 ILE A CG1  13 
ATOM   9779  C CG2  . ILE A 1 46 ? 7.127   10.719 -2.851  1.00 1.00 ? 46 ILE A CG2  13 
ATOM   9780  C CD1  . ILE A 1 46 ? 8.685   11.924 -5.317  1.00 1.00 ? 46 ILE A CD1  13 
ATOM   9781  H H    . ILE A 1 46 ? 7.172   14.738 -3.655  1.00 1.00 ? 46 ILE A H    13 
ATOM   9782  H HA   . ILE A 1 46 ? 5.922   12.278 -4.663  1.00 1.00 ? 46 ILE A HA   13 
ATOM   9783  H HB   . ILE A 1 46 ? 7.534   12.673 -2.123  1.00 1.00 ? 46 ILE A HB   13 
ATOM   9784  H HG12 . ILE A 1 46 ? 8.959   13.490 -3.882  1.00 1.00 ? 46 ILE A HG12 13 
ATOM   9785  H HG13 . ILE A 1 46 ? 9.526   11.926 -3.332  1.00 1.00 ? 46 ILE A HG13 13 
ATOM   9786  H HG21 . ILE A 1 46 ? 6.917   10.201 -3.786  1.00 1.00 ? 46 ILE A HG21 13 
ATOM   9787  H HG22 . ILE A 1 46 ? 7.990   10.259 -2.371  1.00 1.00 ? 46 ILE A HG22 13 
ATOM   9788  H HG23 . ILE A 1 46 ? 6.266   10.598 -2.192  1.00 1.00 ? 46 ILE A HG23 13 
ATOM   9789  H HD11 . ILE A 1 46 ? 8.488   10.852 -5.345  1.00 1.00 ? 46 ILE A HD11 13 
ATOM   9790  H HD12 . ILE A 1 46 ? 7.921   12.451 -5.887  1.00 1.00 ? 46 ILE A HD12 13 
ATOM   9791  H HD13 . ILE A 1 46 ? 9.651   12.112 -5.782  1.00 1.00 ? 46 ILE A HD13 13 
ATOM   9792  N N    . CYS A 1 47 ? 3.918   12.190 -3.161  1.00 1.00 ? 47 CYS A N    13 
ATOM   9793  C CA   . CYS A 1 47 ? 2.743   12.088 -2.314  1.00 1.00 ? 47 CYS A CA   13 
ATOM   9794  C C    . CYS A 1 47 ? 2.406   10.629 -2.035  1.00 1.00 ? 47 CYS A C    13 
ATOM   9795  O O    . CYS A 1 47 ? 2.702   9.782  -2.873  1.00 1.00 ? 47 CYS A O    13 
ATOM   9796  C CB   . CYS A 1 47 ? 1.597   12.895 -2.900  1.00 1.00 ? 47 CYS A CB   13 
ATOM   9797  S SG   . CYS A 1 47 ? 0.364   13.195 -1.636  1.00 1.00 ? 47 CYS A SG   13 
ATOM   9798  H H    . CYS A 1 47 ? 3.903   11.671 -4.035  1.00 1.00 ? 47 CYS A H    13 
ATOM   9799  H HA   . CYS A 1 47 ? 2.979   12.511 -1.351  1.00 1.00 ? 47 CYS A HA   13 
ATOM   9800  H HB2  . CYS A 1 47 ? 1.965   13.865 -3.233  1.00 1.00 ? 47 CYS A HB2  13 
ATOM   9801  H HB3  . CYS A 1 47 ? 1.148   12.372 -3.743  1.00 1.00 ? 47 CYS A HB3  13 
ATOM   9802  N N    . TYR A 1 48 ? 1.847   10.331 -0.854  1.00 1.00 ? 48 TYR A N    13 
ATOM   9803  C CA   . TYR A 1 48 ? 1.693   8.982  -0.325  1.00 1.00 ? 48 TYR A CA   13 
ATOM   9804  C C    . TYR A 1 48 ? 0.234   8.656  0.018   1.00 1.00 ? 48 TYR A C    13 
ATOM   9805  O O    . TYR A 1 48 ? -0.394  9.357  0.818   1.00 1.00 ? 48 TYR A O    13 
ATOM   9806  C CB   . TYR A 1 48 ? 2.551   8.853  0.941   1.00 1.00 ? 48 TYR A CB   13 
ATOM   9807  C CG   . TYR A 1 48 ? 4.016   9.244  0.817   1.00 1.00 ? 48 TYR A CG   13 
ATOM   9808  C CD1  . TYR A 1 48 ? 4.393   10.600 0.773   1.00 1.00 ? 48 TYR A CD1  13 
ATOM   9809  C CD2  . TYR A 1 48 ? 5.014   8.252  0.846   1.00 1.00 ? 48 TYR A CD2  13 
ATOM   9810  C CE1  . TYR A 1 48 ? 5.746   10.959 0.665   1.00 1.00 ? 48 TYR A CE1  13 
ATOM   9811  C CE2  . TYR A 1 48 ? 6.371   8.611  0.765   1.00 1.00 ? 48 TYR A CE2  13 
ATOM   9812  C CZ   . TYR A 1 48 ? 6.735   9.965  0.665   1.00 1.00 ? 48 TYR A CZ   13 
ATOM   9813  O OH   . TYR A 1 48 ? 8.048   10.321 0.573   1.00 1.00 ? 48 TYR A OH   13 
ATOM   9814  H H    . TYR A 1 48 ? 1.567   11.085 -0.237  1.00 1.00 ? 48 TYR A H    13 
ATOM   9815  H HA   . TYR A 1 48 ? 2.067   8.257  -1.046  1.00 1.00 ? 48 TYR A HA   13 
ATOM   9816  H HB2  . TYR A 1 48 ? 2.096   9.460  1.721   1.00 1.00 ? 48 TYR A HB2  13 
ATOM   9817  H HB3  . TYR A 1 48 ? 2.494   7.816  1.259   1.00 1.00 ? 48 TYR A HB3  13 
ATOM   9818  H HD1  . TYR A 1 48 ? 3.647   11.376 0.817   1.00 1.00 ? 48 TYR A HD1  13 
ATOM   9819  H HD2  . TYR A 1 48 ? 4.745   7.208  0.924   1.00 1.00 ? 48 TYR A HD2  13 
ATOM   9820  H HE1  . TYR A 1 48 ? 6.027   11.998 0.572   1.00 1.00 ? 48 TYR A HE1  13 
ATOM   9821  H HE2  . TYR A 1 48 ? 7.126   7.839  0.777   1.00 1.00 ? 48 TYR A HE2  13 
ATOM   9822  H HH   . TYR A 1 48 ? 8.645   9.572  0.580   1.00 1.00 ? 48 TYR A HH   13 
ATOM   9823  N N    . PHE A 1 49 ? -0.282  7.555  -0.539  1.00 1.00 ? 49 PHE A N    13 
ATOM   9824  C CA   . PHE A 1 49 ? -1.652  7.094  -0.397  1.00 1.00 ? 49 PHE A CA   13 
ATOM   9825  C C    . PHE A 1 49 ? -1.612  5.649  0.113   1.00 1.00 ? 49 PHE A C    13 
ATOM   9826  O O    . PHE A 1 49 ? -0.729  4.907  -0.305  1.00 1.00 ? 49 PHE A O    13 
ATOM   9827  C CB   . PHE A 1 49 ? -2.350  7.106  -1.765  1.00 1.00 ? 49 PHE A CB   13 
ATOM   9828  C CG   . PHE A 1 49 ? -2.060  8.283  -2.686  1.00 1.00 ? 49 PHE A CG   13 
ATOM   9829  C CD1  . PHE A 1 49 ? -0.786  8.432  -3.261  1.00 1.00 ? 49 PHE A CD1  13 
ATOM   9830  C CD2  . PHE A 1 49 ? -3.075  9.200  -3.021  1.00 1.00 ? 49 PHE A CD2  13 
ATOM   9831  C CE1  . PHE A 1 49 ? -0.468  9.594  -3.972  1.00 1.00 ? 49 PHE A CE1  13 
ATOM   9832  C CE2  . PHE A 1 49 ? -2.795  10.277 -3.882  1.00 1.00 ? 49 PHE A CE2  13 
ATOM   9833  C CZ   . PHE A 1 49 ? -1.481  10.493 -4.339  1.00 1.00 ? 49 PHE A CZ   13 
ATOM   9834  H H    . PHE A 1 49 ? 0.290   6.990  -1.157  1.00 1.00 ? 49 PHE A H    13 
ATOM   9835  H HA   . PHE A 1 49 ? -2.185  7.752  0.289   1.00 1.00 ? 49 PHE A HA   13 
ATOM   9836  H HB2  . PHE A 1 49 ? -2.101  6.184  -2.285  1.00 1.00 ? 49 PHE A HB2  13 
ATOM   9837  H HB3  . PHE A 1 49 ? -3.413  7.056  -1.577  1.00 1.00 ? 49 PHE A HB3  13 
ATOM   9838  H HD1  . PHE A 1 49 ? -0.021  7.683  -3.128  1.00 1.00 ? 49 PHE A HD1  13 
ATOM   9839  H HD2  . PHE A 1 49 ? -4.073  9.082  -2.624  1.00 1.00 ? 49 PHE A HD2  13 
ATOM   9840  H HE1  . PHE A 1 49 ? 0.561   9.782  -4.230  1.00 1.00 ? 49 PHE A HE1  13 
ATOM   9841  H HE2  . PHE A 1 49 ? -3.588  10.962 -4.133  1.00 1.00 ? 49 PHE A HE2  13 
ATOM   9842  H HZ   . PHE A 1 49 ? -1.231  11.328 -4.981  1.00 1.00 ? 49 PHE A HZ   13 
ATOM   9843  N N    . PRO A 1 50 ? -2.548  5.219  0.968   1.00 1.00 ? 50 PRO A N    13 
ATOM   9844  C CA   . PRO A 1 50 ? -2.662  3.834  1.402   1.00 1.00 ? 50 PRO A CA   13 
ATOM   9845  C C    . PRO A 1 50 ? -3.015  2.965  0.193   1.00 1.00 ? 50 PRO A C    13 
ATOM   9846  O O    . PRO A 1 50 ? -3.940  3.307  -0.542  1.00 1.00 ? 50 PRO A O    13 
ATOM   9847  C CB   . PRO A 1 50 ? -3.787  3.844  2.442   1.00 1.00 ? 50 PRO A CB   13 
ATOM   9848  C CG   . PRO A 1 50 ? -4.678  5.003  1.990   1.00 1.00 ? 50 PRO A CG   13 
ATOM   9849  C CD   . PRO A 1 50 ? -3.681  6.003  1.407   1.00 1.00 ? 50 PRO A CD   13 
ATOM   9850  H HA   . PRO A 1 50 ? -1.740  3.485  1.866   1.00 1.00 ? 50 PRO A HA   13 
ATOM   9851  H HB2  . PRO A 1 50 ? -4.332  2.900  2.477   1.00 1.00 ? 50 PRO A HB2  13 
ATOM   9852  H HB3  . PRO A 1 50 ? -3.360  4.067  3.419   1.00 1.00 ? 50 PRO A HB3  13 
ATOM   9853  H HG2  . PRO A 1 50 ? -5.345  4.656  1.199   1.00 1.00 ? 50 PRO A HG2  13 
ATOM   9854  H HG3  . PRO A 1 50 ? -5.266  5.427  2.802   1.00 1.00 ? 50 PRO A HG3  13 
ATOM   9855  H HD2  . PRO A 1 50 ? -4.120  6.533  0.557   1.00 1.00 ? 50 PRO A HD2  13 
ATOM   9856  H HD3  . PRO A 1 50 ? -3.342  6.698  2.176   1.00 1.00 ? 50 PRO A HD3  13 
ATOM   9857  N N    . CYS A 1 51 ? -2.280  1.874  -0.057  1.00 1.00 ? 51 CYS A N    13 
ATOM   9858  C CA   . CYS A 1 51 ? -2.485  1.109  -1.286  1.00 1.00 ? 51 CYS A CA   13 
ATOM   9859  C C    . CYS A 1 51 ? -1.886  -0.295 -1.206  1.00 1.00 ? 51 CYS A C    13 
ATOM   9860  O O    . CYS A 1 51 ? -0.780  -0.471 -0.695  1.00 1.00 ? 51 CYS A O    13 
ATOM   9861  C CB   . CYS A 1 51 ? -1.933  1.908  -2.475  1.00 1.00 ? 51 CYS A CB   13 
ATOM   9862  S SG   . CYS A 1 51 ? -0.894  1.020  -3.660  1.00 1.00 ? 51 CYS A SG   13 
ATOM   9863  O OXT  . CYS A 1 51 ? -2.650  -1.297 -1.720  1.00 0.00 ? 51 CYS A OXT  13 
ATOM   9864  H H    . CYS A 1 51 ? -1.481  1.642  0.529   1.00 1.00 ? 51 CYS A H    13 
ATOM   9865  H HA   . CYS A 1 51 ? -3.558  0.975  -1.442  1.00 1.00 ? 51 CYS A HA   13 
ATOM   9866  H HB2  . CYS A 1 51 ? -2.762  2.342  -3.031  1.00 1.00 ? 51 CYS A HB2  13 
ATOM   9867  H HB3  . CYS A 1 51 ? -1.345  2.738  -2.090  1.00 1.00 ? 51 CYS A HB3  13 
HETATM 9868  N N    . PCA A 1 1  ? 0.028   4.408  6.409   1.00 1.00 ? 1  PCA A N    14 
HETATM 9869  C CA   . PCA A 1 1  ? -0.172  2.976  6.273   1.00 1.00 ? 1  PCA A CA   14 
HETATM 9870  C CB   . PCA A 1 1  ? -1.625  2.837  5.774   1.00 1.00 ? 1  PCA A CB   14 
HETATM 9871  C CG   . PCA A 1 1  ? -2.274  4.161  6.205   1.00 1.00 ? 1  PCA A CG   14 
HETATM 9872  C CD   . PCA A 1 1  ? -1.096  5.104  6.328   1.00 1.00 ? 1  PCA A CD   14 
HETATM 9873  O OE   . PCA A 1 1  ? -1.192  6.327  6.301   1.00 1.00 ? 1  PCA A OE   14 
HETATM 9874  C C    . PCA A 1 1  ? 0.858   2.398  5.302   1.00 1.00 ? 1  PCA A C    14 
HETATM 9875  O O    . PCA A 1 1  ? 1.884   3.030  5.049   1.00 1.00 ? 1  PCA A O    14 
HETATM 9876  H H    . PCA A 1 1  ? 0.952   4.817  6.390   1.00 0.00 ? 1  PCA A H    14 
HETATM 9877  H HA   . PCA A 1 1  ? -0.064  2.507  7.253   1.00 1.00 ? 1  PCA A HA   14 
HETATM 9878  H HB2  . PCA A 1 1  ? -1.645  2.788  4.684   1.00 1.00 ? 1  PCA A HB2  14 
HETATM 9879  H HB3  . PCA A 1 1  ? -2.132  1.971  6.201   1.00 1.00 ? 1  PCA A HB3  14 
HETATM 9880  H HG2  . PCA A 1 1  ? -2.999  4.515  5.472   1.00 1.00 ? 1  PCA A HG2  14 
HETATM 9881  H HG3  . PCA A 1 1  ? -2.742  4.053  7.184   1.00 1.00 ? 1  PCA A HG3  14 
ATOM   9882  N N    . LYS A 1 2  ? 0.575   1.231  4.713   1.00 1.00 ? 2  LYS A N    14 
ATOM   9883  C CA   . LYS A 1 2  ? 1.376   0.707  3.613   1.00 1.00 ? 2  LYS A CA   14 
ATOM   9884  C C    . LYS A 1 2  ? 1.065   1.540  2.365   1.00 1.00 ? 2  LYS A C    14 
ATOM   9885  O O    . LYS A 1 2  ? 0.358   1.080  1.466   1.00 1.00 ? 2  LYS A O    14 
ATOM   9886  C CB   . LYS A 1 2  ? 1.077   -0.786 3.394   1.00 1.00 ? 2  LYS A CB   14 
ATOM   9887  C CG   . LYS A 1 2  ? 2.101   -1.406 2.424   1.00 1.00 ? 2  LYS A CG   14 
ATOM   9888  C CD   . LYS A 1 2  ? 1.569   -2.648 1.692   1.00 1.00 ? 2  LYS A CD   14 
ATOM   9889  C CE   . LYS A 1 2  ? 0.920   -2.314 0.337   1.00 1.00 ? 2  LYS A CE   14 
ATOM   9890  N NZ   . LYS A 1 2  ? -0.253  -1.429 0.462   1.00 1.00 ? 2  LYS A NZ   14 
ATOM   9891  H H    . LYS A 1 2  ? -0.278  0.754  4.958   1.00 1.00 ? 2  LYS A H    14 
ATOM   9892  H HA   . LYS A 1 2  ? 2.435   0.806  3.859   1.00 1.00 ? 2  LYS A HA   14 
ATOM   9893  H HB2  . LYS A 1 2  ? 1.155   -1.311 4.348   1.00 1.00 ? 2  LYS A HB2  14 
ATOM   9894  H HB3  . LYS A 1 2  ? 0.057   -0.904 3.034   1.00 1.00 ? 2  LYS A HB3  14 
ATOM   9895  H HG2  . LYS A 1 2  ? 2.449   -0.680 1.688   1.00 1.00 ? 2  LYS A HG2  14 
ATOM   9896  H HG3  . LYS A 1 2  ? 2.970   -1.698 3.019   1.00 1.00 ? 2  LYS A HG3  14 
ATOM   9897  H HD2  . LYS A 1 2  ? 2.420   -3.302 1.485   1.00 1.00 ? 2  LYS A HD2  14 
ATOM   9898  H HD3  . LYS A 1 2  ? 0.882   -3.202 2.336   1.00 1.00 ? 2  LYS A HD3  14 
ATOM   9899  H HE2  . LYS A 1 2  ? 1.658   -1.826 -0.305  1.00 1.00 ? 2  LYS A HE2  14 
ATOM   9900  H HE3  . LYS A 1 2  ? 0.609   -3.243 -0.143  1.00 1.00 ? 2  LYS A HE3  14 
ATOM   9901  H HZ1  . LYS A 1 2  ? -0.961  -1.833 1.052   1.00 1.00 ? 2  LYS A HZ1  14 
ATOM   9902  H HZ2  . LYS A 1 2  ? 0.020   -0.532 0.844   1.00 1.00 ? 2  LYS A HZ2  14 
ATOM   9903  H HZ3  . LYS A 1 2  ? -0.682  -1.240 -0.441  1.00 1.00 ? 2  LYS A HZ3  14 
ATOM   9904  N N    . LEU A 1 3  ? 1.552   2.777  2.341   1.00 1.00 ? 3  LEU A N    14 
ATOM   9905  C CA   . LEU A 1 3  ? 1.268   3.737  1.288   1.00 1.00 ? 3  LEU A CA   14 
ATOM   9906  C C    . LEU A 1 3  ? 2.018   3.372  0.004   1.00 1.00 ? 3  LEU A C    14 
ATOM   9907  O O    . LEU A 1 3  ? 2.955   2.576  0.034   1.00 1.00 ? 3  LEU A O    14 
ATOM   9908  C CB   . LEU A 1 3  ? 1.665   5.139  1.757   1.00 1.00 ? 3  LEU A CB   14 
ATOM   9909  C CG   . LEU A 1 3  ? 0.929   5.592  3.033   1.00 1.00 ? 3  LEU A CG   14 
ATOM   9910  C CD1  . LEU A 1 3  ? 1.900   6.290  3.993   1.00 1.00 ? 3  LEU A CD1  14 
ATOM   9911  C CD2  . LEU A 1 3  ? -0.226  6.533  2.713   1.00 1.00 ? 3  LEU A CD2  14 
ATOM   9912  H H    . LEU A 1 3  ? 2.084   3.080  3.149   1.00 1.00 ? 3  LEU A H    14 
ATOM   9913  H HA   . LEU A 1 3  ? 0.200   3.733  1.097   1.00 1.00 ? 3  LEU A HA   14 
ATOM   9914  H HB2  . LEU A 1 3  ? 2.738   5.119  1.939   1.00 1.00 ? 3  LEU A HB2  14 
ATOM   9915  H HB3  . LEU A 1 3  ? 1.467   5.843  0.950   1.00 1.00 ? 3  LEU A HB3  14 
ATOM   9916  H HG   . LEU A 1 3  ? 0.482   4.739  3.540   1.00 1.00 ? 3  LEU A HG   14 
ATOM   9917  H HD11 . LEU A 1 3  ? 2.358   7.153  3.510   1.00 1.00 ? 3  LEU A HD11 14 
ATOM   9918  H HD12 . LEU A 1 3  ? 1.365   6.627  4.881   1.00 1.00 ? 3  LEU A HD12 14 
ATOM   9919  H HD13 . LEU A 1 3  ? 2.685   5.598  4.297   1.00 1.00 ? 3  LEU A HD13 14 
ATOM   9920  H HD21 . LEU A 1 3  ? -0.876  6.077  1.975   1.00 1.00 ? 3  LEU A HD21 14 
ATOM   9921  H HD22 . LEU A 1 3  ? -0.799  6.704  3.621   1.00 1.00 ? 3  LEU A HD22 14 
ATOM   9922  H HD23 . LEU A 1 3  ? 0.150   7.482  2.337   1.00 1.00 ? 3  LEU A HD23 14 
ATOM   9923  N N    . CYS A 1 4  ? 1.622   3.982  -1.116  1.00 1.00 ? 4  CYS A N    14 
ATOM   9924  C CA   . CYS A 1 4  ? 2.339   3.929  -2.385  1.00 1.00 ? 4  CYS A CA   14 
ATOM   9925  C C    . CYS A 1 4  ? 2.578   5.364  -2.838  1.00 1.00 ? 4  CYS A C    14 
ATOM   9926  O O    . CYS A 1 4  ? 1.733   6.233  -2.612  1.00 1.00 ? 4  CYS A O    14 
ATOM   9927  C CB   . CYS A 1 4  ? 1.568   3.151  -3.458  1.00 1.00 ? 4  CYS A CB   14 
ATOM   9928  S SG   . CYS A 1 4  ? 1.456   1.363  -3.224  1.00 1.00 ? 4  CYS A SG   14 
ATOM   9929  H H    . CYS A 1 4  ? 0.823   4.606  -1.066  1.00 1.00 ? 4  CYS A H    14 
ATOM   9930  H HA   . CYS A 1 4  ? 3.306   3.441  -2.249  1.00 1.00 ? 4  CYS A HA   14 
ATOM   9931  H HB2  . CYS A 1 4  ? 0.550   3.530  -3.543  1.00 1.00 ? 4  CYS A HB2  14 
ATOM   9932  H HB3  . CYS A 1 4  ? 2.067   3.302  -4.415  1.00 1.00 ? 4  CYS A HB3  14 
ATOM   9933  N N    . GLU A 1 5  ? 3.742   5.600  -3.445  1.00 1.00 ? 5  GLU A N    14 
ATOM   9934  C CA   . GLU A 1 5  ? 4.219   6.914  -3.838  1.00 1.00 ? 5  GLU A CA   14 
ATOM   9935  C C    . GLU A 1 5  ? 3.723   7.264  -5.242  1.00 1.00 ? 5  GLU A C    14 
ATOM   9936  O O    . GLU A 1 5  ? 4.180   6.668  -6.214  1.00 1.00 ? 5  GLU A O    14 
ATOM   9937  C CB   . GLU A 1 5  ? 5.755   6.909  -3.803  1.00 1.00 ? 5  GLU A CB   14 
ATOM   9938  C CG   . GLU A 1 5  ? 6.271   6.778  -2.365  1.00 1.00 ? 5  GLU A CG   14 
ATOM   9939  C CD   . GLU A 1 5  ? 7.792   6.853  -2.280  1.00 1.00 ? 5  GLU A CD   14 
ATOM   9940  O OE1  . GLU A 1 5  ? 8.321   7.634  -1.492  1.00 1.00 ? 5  GLU A OE1  14 
ATOM   9941  O OE2  . GLU A 1 5  ? 8.482   6.022  -3.107  1.00 1.00 ? 5  GLU A OE2  14 
ATOM   9942  H H    . GLU A 1 5  ? 4.355   4.821  -3.625  1.00 1.00 ? 5  GLU A H    14 
ATOM   9943  H HA   . GLU A 1 5  ? 3.865   7.664  -3.131  1.00 1.00 ? 5  GLU A HA   14 
ATOM   9944  H HB2  . GLU A 1 5  ? 6.137   6.087  -4.413  1.00 1.00 ? 5  GLU A HB2  14 
ATOM   9945  H HB3  . GLU A 1 5  ? 6.125   7.842  -4.227  1.00 1.00 ? 5  GLU A HB3  14 
ATOM   9946  H HG2  . GLU A 1 5  ? 5.847   7.593  -1.783  1.00 1.00 ? 5  GLU A HG2  14 
ATOM   9947  H HG3  . GLU A 1 5  ? 5.950   5.830  -1.932  1.00 1.00 ? 5  GLU A HG3  14 
ATOM   9948  H HE2  . GLU A 1 5  ? 9.427   6.129  -2.985  1.00 1.00 ? 5  GLU A HE2  14 
ATOM   9949  N N    . ARG A 1 6  ? 2.816   8.237  -5.349  1.00 1.00 ? 6  ARG A N    14 
ATOM   9950  C CA   . ARG A 1 6  ? 2.416   8.838  -6.610  1.00 1.00 ? 6  ARG A CA   14 
ATOM   9951  C C    . ARG A 1 6  ? 3.183   10.156 -6.764  1.00 1.00 ? 6  ARG A C    14 
ATOM   9952  O O    . ARG A 1 6  ? 3.020   11.041 -5.922  1.00 1.00 ? 6  ARG A O    14 
ATOM   9953  C CB   . ARG A 1 6  ? 0.901   9.119  -6.619  1.00 1.00 ? 6  ARG A CB   14 
ATOM   9954  C CG   . ARG A 1 6  ? 0.421   9.695  -7.962  1.00 1.00 ? 6  ARG A CG   14 
ATOM   9955  C CD   . ARG A 1 6  ? 0.443   8.686  -9.119  1.00 1.00 ? 6  ARG A CD   14 
ATOM   9956  N NE   . ARG A 1 6  ? 0.141   9.373  -10.381 1.00 1.00 ? 6  ARG A NE   14 
ATOM   9957  C CZ   . ARG A 1 6  ? 0.320   8.894  -11.619 1.00 1.00 ? 6  ARG A CZ   14 
ATOM   9958  N NH1  . ARG A 1 6  ? 0.586   7.597  -11.806 1.00 1.00 ? 6  ARG A NH1  14 
ATOM   9959  N NH2  . ARG A 1 6  ? 0.236   9.734  -12.651 1.00 1.00 ? 6  ARG A NH2  14 
ATOM   9960  H H    . ARG A 1 6  ? 2.496   8.692  -4.502  1.00 1.00 ? 6  ARG A H    14 
ATOM   9961  H HA   . ARG A 1 6  ? 2.633   8.151  -7.422  1.00 1.00 ? 6  ARG A HA   14 
ATOM   9962  H HB2  . ARG A 1 6  ? 0.328   8.219  -6.394  1.00 1.00 ? 6  ARG A HB2  14 
ATOM   9963  H HB3  . ARG A 1 6  ? 0.680   9.854  -5.841  1.00 1.00 ? 6  ARG A HB3  14 
ATOM   9964  H HG2  . ARG A 1 6  ? -0.605  10.040 -7.841  1.00 1.00 ? 6  ARG A HG2  14 
ATOM   9965  H HG3  . ARG A 1 6  ? 1.027   10.565 -8.219  1.00 1.00 ? 6  ARG A HG3  14 
ATOM   9966  H HD2  . ARG A 1 6  ? 1.428   8.230  -9.204  1.00 1.00 ? 6  ARG A HD2  14 
ATOM   9967  H HD3  . ARG A 1 6  ? -0.299  7.909  -8.925  1.00 1.00 ? 6  ARG A HD3  14 
ATOM   9968  H HE   . ARG A 1 6  ? -0.123  10.351 -10.313 1.00 1.00 ? 6  ARG A HE   14 
ATOM   9969  H HH11 . ARG A 1 6  ? 0.624   6.982  -11.006 1.00 1.00 ? 6  ARG A HH11 14 
ATOM   9970  H HH12 . ARG A 1 6  ? 0.731   7.212  -12.728 1.00 1.00 ? 6  ARG A HH12 14 
ATOM   9971  H HH21 . ARG A 1 6  ? 0.149   10.729 -12.435 1.00 1.00 ? 6  ARG A HH21 14 
ATOM   9972  H HH22 . ARG A 1 6  ? 0.355   9.446  -13.609 1.00 1.00 ? 6  ARG A HH22 14 
ATOM   9973  N N    . PRO A 1 7  ? 4.012   10.318 -7.809  1.00 1.00 ? 7  PRO A N    14 
ATOM   9974  C CA   . PRO A 1 7  ? 4.583   11.610 -8.145  1.00 1.00 ? 7  PRO A CA   14 
ATOM   9975  C C    . PRO A 1 7  ? 3.478   12.480 -8.758  1.00 1.00 ? 7  PRO A C    14 
ATOM   9976  O O    . PRO A 1 7  ? 2.910   13.347 -8.098  1.00 1.00 ? 7  PRO A O    14 
ATOM   9977  C CB   . PRO A 1 7  ? 5.758   11.336 -9.103  1.00 1.00 ? 7  PRO A CB   14 
ATOM   9978  C CG   . PRO A 1 7  ? 5.957   9.819  -9.044  1.00 1.00 ? 7  PRO A CG   14 
ATOM   9979  C CD   . PRO A 1 7  ? 4.591   9.274  -8.634  1.00 1.00 ? 7  PRO A CD   14 
ATOM   9980  H HA   . PRO A 1 7  ? 4.963   12.094 -7.244  1.00 1.00 ? 7  PRO A HA   14 
ATOM   9981  H HB2  . PRO A 1 7  ? 5.541   11.626 -10.131 1.00 1.00 ? 7  PRO A HB2  14 
ATOM   9982  H HB3  . PRO A 1 7  ? 6.657   11.860 -8.777  1.00 1.00 ? 7  PRO A HB3  14 
ATOM   9983  H HG2  . PRO A 1 7  ? 6.298   9.407  -9.996  1.00 1.00 ? 7  PRO A HG2  14 
ATOM   9984  H HG3  . PRO A 1 7  ? 6.680   9.587  -8.261  1.00 1.00 ? 7  PRO A HG3  14 
ATOM   9985  H HD2  . PRO A 1 7  ? 3.961   9.111  -9.508  1.00 1.00 ? 7  PRO A HD2  14 
ATOM   9986  H HD3  . PRO A 1 7  ? 4.737   8.340  -8.094  1.00 1.00 ? 7  PRO A HD3  14 
ATOM   9987  N N    . SER A 1 8  ? 3.122   12.236 -10.024 1.00 1.00 ? 8  SER A N    14 
ATOM   9988  C CA   . SER A 1 8  ? 2.189   13.089 -10.729 1.00 1.00 ? 8  SER A CA   14 
ATOM   9989  C C    . SER A 1 8  ? 0.761   12.704 -10.362 1.00 1.00 ? 8  SER A C    14 
ATOM   9990  O O    . SER A 1 8  ? 0.084   11.991 -11.106 1.00 1.00 ? 8  SER A O    14 
ATOM   9991  C CB   . SER A 1 8  ? 2.467   12.931 -12.229 1.00 1.00 ? 8  SER A CB   14 
ATOM   9992  O OG   . SER A 1 8  ? 2.757   11.571 -12.528 1.00 1.00 ? 8  SER A OG   14 
ATOM   9993  H H    . SER A 1 8  ? 3.531   11.487 -10.568 1.00 1.00 ? 8  SER A H    14 
ATOM   9994  H HA   . SER A 1 8  ? 2.342   14.134 -10.459 1.00 1.00 ? 8  SER A HA   14 
ATOM   9995  H HB2  . SER A 1 8  ? 1.612   13.289 -12.808 1.00 1.00 ? 8  SER A HB2  14 
ATOM   9996  H HB3  . SER A 1 8  ? 3.337   13.536 -12.484 1.00 1.00 ? 8  SER A HB3  14 
ATOM   9997  H HG   . SER A 1 8  ? 3.062   11.516 -13.438 1.00 1.00 ? 8  SER A HG   14 
ATOM   9998  N N    . GLY A 1 9  ? 0.298   13.208 -9.221  1.00 1.00 ? 9  GLY A N    14 
ATOM   9999  C CA   . GLY A 1 9  ? -1.095  13.143 -8.815  1.00 1.00 ? 9  GLY A CA   14 
ATOM   10000 C C    . GLY A 1 9  ? -1.712  14.460 -9.257  1.00 1.00 ? 9  GLY A C    14 
ATOM   10001 O O    . GLY A 1 9  ? -2.077  14.621 -10.417 1.00 1.00 ? 9  GLY A O    14 
ATOM   10002 H H    . GLY A 1 9  ? 0.970   13.690 -8.628  1.00 1.00 ? 9  GLY A H    14 
ATOM   10003 H HA2  . GLY A 1 9  ? -1.618  12.311 -9.288  1.00 1.00 ? 9  GLY A HA2  14 
ATOM   10004 H HA3  . GLY A 1 9  ? -1.153  13.027 -7.734  1.00 1.00 ? 9  GLY A HA3  14 
ATOM   10005 N N    . THR A 1 10 ? -1.758  15.427 -8.342  1.00 1.00 ? 10 THR A N    14 
ATOM   10006 C CA   . THR A 1 10 ? -2.096  16.801 -8.652  1.00 1.00 ? 10 THR A CA   14 
ATOM   10007 C C    . THR A 1 10 ? -0.803  17.476 -9.113  1.00 1.00 ? 10 THR A C    14 
ATOM   10008 O O    . THR A 1 10 ? -0.621  17.760 -10.297 1.00 1.00 ? 10 THR A O    14 
ATOM   10009 C CB   . THR A 1 10 ? -2.683  17.466 -7.395  1.00 1.00 ? 10 THR A CB   14 
ATOM   10010 O OG1  . THR A 1 10 ? -1.927  17.113 -6.243  1.00 1.00 ? 10 THR A OG1  14 
ATOM   10011 C CG2  . THR A 1 10 ? -4.135  17.032 -7.177  1.00 1.00 ? 10 THR A CG2  14 
ATOM   10012 H H    . THR A 1 10 ? -1.487  15.230 -7.388  1.00 1.00 ? 10 THR A H    14 
ATOM   10013 H HA   . THR A 1 10 ? -2.827  16.854 -9.461  1.00 1.00 ? 10 THR A HA   14 
ATOM   10014 H HB   . THR A 1 10 ? -2.667  18.549 -7.526  1.00 1.00 ? 10 THR A HB   14 
ATOM   10015 H HG1  . THR A 1 10 ? -2.060  17.823 -5.594  1.00 1.00 ? 10 THR A HG1  14 
ATOM   10016 H HG21 . THR A 1 10 ? -4.210  15.947 -7.127  1.00 1.00 ? 10 THR A HG21 14 
ATOM   10017 H HG22 . THR A 1 10 ? -4.513  17.462 -6.248  1.00 1.00 ? 10 THR A HG22 14 
ATOM   10018 H HG23 . THR A 1 10 ? -4.751  17.388 -8.004  1.00 1.00 ? 10 THR A HG23 14 
ATOM   10019 N N    . TRP A 1 11 ? 0.107   17.700 -8.159  1.00 1.00 ? 11 TRP A N    14 
ATOM   10020 C CA   . TRP A 1 11 ? 1.352   18.437 -8.343  1.00 1.00 ? 11 TRP A CA   14 
ATOM   10021 C C    . TRP A 1 11 ? 2.335   17.689 -9.251  1.00 1.00 ? 11 TRP A C    14 
ATOM   10022 O O    . TRP A 1 11 ? 3.365   17.177 -8.816  1.00 1.00 ? 11 TRP A O    14 
ATOM   10023 C CB   . TRP A 1 11 ? 1.962   18.753 -6.974  1.00 1.00 ? 11 TRP A CB   14 
ATOM   10024 C CG   . TRP A 1 11 ? 2.926   19.904 -6.930  1.00 1.00 ? 11 TRP A CG   14 
ATOM   10025 C CD1  . TRP A 1 11 ? 3.971   20.128 -7.759  1.00 1.00 ? 11 TRP A CD1  14 
ATOM   10026 C CD2  . TRP A 1 11 ? 2.925   21.020 -5.998  1.00 1.00 ? 11 TRP A CD2  14 
ATOM   10027 N NE1  . TRP A 1 11 ? 4.602   21.304 -7.418  1.00 1.00 ? 11 TRP A NE1  14 
ATOM   10028 C CE2  . TRP A 1 11 ? 4.012   21.884 -6.315  1.00 1.00 ? 11 TRP A CE2  14 
ATOM   10029 C CE3  . TRP A 1 11 ? 2.116   21.379 -4.904  1.00 1.00 ? 11 TRP A CE3  14 
ATOM   10030 C CZ2  . TRP A 1 11 ? 4.296   23.034 -5.561  1.00 1.00 ? 11 TRP A CZ2  14 
ATOM   10031 C CZ3  . TRP A 1 11 ? 2.380   22.533 -4.150  1.00 1.00 ? 11 TRP A CZ3  14 
ATOM   10032 C CH2  . TRP A 1 11 ? 3.486   23.340 -4.458  1.00 1.00 ? 11 TRP A CH2  14 
ATOM   10033 H H    . TRP A 1 11 ? -0.146  17.399 -7.224  1.00 1.00 ? 11 TRP A H    14 
ATOM   10034 H HA   . TRP A 1 11 ? 1.104   19.389 -8.816  1.00 1.00 ? 11 TRP A HA   14 
ATOM   10035 H HB2  . TRP A 1 11 ? 1.148   19.002 -6.293  1.00 1.00 ? 11 TRP A HB2  14 
ATOM   10036 H HB3  . TRP A 1 11 ? 2.440   17.860 -6.575  1.00 1.00 ? 11 TRP A HB3  14 
ATOM   10037 H HD1  . TRP A 1 11 ? 4.279   19.501 -8.579  1.00 1.00 ? 11 TRP A HD1  14 
ATOM   10038 H HE1  . TRP A 1 11 ? 5.410   21.693 -7.898  1.00 1.00 ? 11 TRP A HE1  14 
ATOM   10039 H HE3  . TRP A 1 11 ? 1.318   20.722 -4.602  1.00 1.00 ? 11 TRP A HE3  14 
ATOM   10040 H HZ2  . TRP A 1 11 ? 5.133   23.668 -5.811  1.00 1.00 ? 11 TRP A HZ2  14 
ATOM   10041 H HZ3  . TRP A 1 11 ? 1.751   22.768 -3.307  1.00 1.00 ? 11 TRP A HZ3  14 
ATOM   10042 H HH2  . TRP A 1 11 ? 3.718   24.183 -3.833  1.00 1.00 ? 11 TRP A HH2  14 
ATOM   10043 N N    . SER A 1 12 ? 2.049   17.685 -10.546 1.00 1.00 ? 12 SER A N    14 
ATOM   10044 C CA   . SER A 1 12 ? 2.824   16.954 -11.529 1.00 1.00 ? 12 SER A CA   14 
ATOM   10045 C C    . SER A 1 12 ? 3.954   17.842 -12.044 1.00 1.00 ? 12 SER A C    14 
ATOM   10046 O O    . SER A 1 12 ? 3.985   18.192 -13.221 1.00 1.00 ? 12 SER A O    14 
ATOM   10047 C CB   . SER A 1 12 ? 1.869   16.504 -12.640 1.00 1.00 ? 12 SER A CB   14 
ATOM   10048 O OG   . SER A 1 12 ? 0.810   15.754 -12.068 1.00 1.00 ? 12 SER A OG   14 
ATOM   10049 H H    . SER A 1 12 ? 1.157   18.080 -10.824 1.00 1.00 ? 12 SER A H    14 
ATOM   10050 H HA   . SER A 1 12 ? 3.272   16.068 -11.082 1.00 1.00 ? 12 SER A HA   14 
ATOM   10051 H HB2  . SER A 1 12 ? 1.464   17.375 -13.161 1.00 1.00 ? 12 SER A HB2  14 
ATOM   10052 H HB3  . SER A 1 12 ? 2.415   15.896 -13.362 1.00 1.00 ? 12 SER A HB3  14 
ATOM   10053 H HG   . SER A 1 12 ? 0.243   16.341 -11.547 1.00 1.00 ? 12 SER A HG   14 
ATOM   10054 N N    . GLY A 1 13 ? 4.885   18.207 -11.156 1.00 1.00 ? 13 GLY A N    14 
ATOM   10055 C CA   . GLY A 1 13 ? 5.995   19.076 -11.510 1.00 1.00 ? 13 GLY A CA   14 
ATOM   10056 C C    . GLY A 1 13 ? 6.933   19.323 -10.330 1.00 1.00 ? 13 GLY A C    14 
ATOM   10057 O O    . GLY A 1 13 ? 6.785   18.723 -9.264  1.00 1.00 ? 13 GLY A O    14 
ATOM   10058 H H    . GLY A 1 13 ? 4.814   17.884 -10.195 1.00 1.00 ? 13 GLY A H    14 
ATOM   10059 H HA2  . GLY A 1 13 ? 6.566   18.620 -12.319 1.00 1.00 ? 13 GLY A HA2  14 
ATOM   10060 H HA3  . GLY A 1 13 ? 5.599   20.033 -11.852 1.00 1.00 ? 13 GLY A HA3  14 
ATOM   10061 N N    . VAL A 1 14 ? 7.903   20.219 -10.540 1.00 1.00 ? 14 VAL A N    14 
ATOM   10062 C CA   . VAL A 1 14 ? 8.828   20.673 -9.509  1.00 1.00 ? 14 VAL A CA   14 
ATOM   10063 C C    . VAL A 1 14 ? 8.025   21.405 -8.429  1.00 1.00 ? 14 VAL A C    14 
ATOM   10064 O O    . VAL A 1 14 ? 6.991   22.003 -8.730  1.00 1.00 ? 14 VAL A O    14 
ATOM   10065 C CB   . VAL A 1 14 ? 9.900   21.593 -10.130 1.00 1.00 ? 14 VAL A CB   14 
ATOM   10066 C CG1  . VAL A 1 14 ? 10.993  22.002 -9.133  1.00 1.00 ? 14 VAL A CG1  14 
ATOM   10067 C CG2  . VAL A 1 14 ? 10.587  20.927 -11.331 1.00 1.00 ? 14 VAL A CG2  14 
ATOM   10068 H H    . VAL A 1 14 ? 7.924   20.697 -11.427 1.00 1.00 ? 14 VAL A H    14 
ATOM   10069 H HA   . VAL A 1 14 ? 9.311   19.793 -9.085  1.00 1.00 ? 14 VAL A HA   14 
ATOM   10070 H HB   . VAL A 1 14 ? 9.409   22.509 -10.457 1.00 1.00 ? 14 VAL A HB   14 
ATOM   10071 H HG11 . VAL A 1 14 ? 10.569  22.519 -8.274  1.00 1.00 ? 14 VAL A HG11 14 
ATOM   10072 H HG12 . VAL A 1 14 ? 11.539  21.122 -8.797  1.00 1.00 ? 14 VAL A HG12 14 
ATOM   10073 H HG13 . VAL A 1 14 ? 11.694  22.680 -9.620  1.00 1.00 ? 14 VAL A HG13 14 
ATOM   10074 H HG21 . VAL A 1 14 ? 11.022  19.974 -11.026 1.00 1.00 ? 14 VAL A HG21 14 
ATOM   10075 H HG22 . VAL A 1 14 ? 9.881   20.754 -12.142 1.00 1.00 ? 14 VAL A HG22 14 
ATOM   10076 H HG23 . VAL A 1 14 ? 11.379  21.574 -11.709 1.00 1.00 ? 14 VAL A HG23 14 
ATOM   10077 N N    . CYS A 1 15 ? 8.481   21.348 -7.177  1.00 1.00 ? 15 CYS A N    14 
ATOM   10078 C CA   . CYS A 1 15 ? 7.790   21.936 -6.038  1.00 1.00 ? 15 CYS A CA   14 
ATOM   10079 C C    . CYS A 1 15 ? 8.699   22.761 -5.134  1.00 1.00 ? 15 CYS A C    14 
ATOM   10080 O O    . CYS A 1 15 ? 8.350   23.885 -4.780  1.00 1.00 ? 15 CYS A O    14 
ATOM   10081 C CB   . CYS A 1 15 ? 7.123   20.847 -5.200  1.00 1.00 ? 15 CYS A CB   14 
ATOM   10082 S SG   . CYS A 1 15 ? 8.182   19.555 -4.579  1.00 1.00 ? 15 CYS A SG   14 
ATOM   10083 H H    . CYS A 1 15 ? 9.320   20.806 -7.008  1.00 1.00 ? 15 CYS A H    14 
ATOM   10084 H HA   . CYS A 1 15 ? 7.015   22.612 -6.391  1.00 1.00 ? 15 CYS A HA   14 
ATOM   10085 H HB2  . CYS A 1 15 ? 6.599   21.317 -4.369  1.00 1.00 ? 15 CYS A HB2  14 
ATOM   10086 H HB3  . CYS A 1 15 ? 6.411   20.276 -5.755  1.00 1.00 ? 15 CYS A HB3  14 
ATOM   10087 N N    . GLY A 1 16 ? 9.828   22.199 -4.700  1.00 1.00 ? 16 GLY A N    14 
ATOM   10088 C CA   . GLY A 1 16 ? 10.660  22.786 -3.655  1.00 1.00 ? 16 GLY A CA   14 
ATOM   10089 C C    . GLY A 1 16 ? 9.977   22.720 -2.282  1.00 1.00 ? 16 GLY A C    14 
ATOM   10090 O O    . GLY A 1 16 ? 10.443  22.042 -1.365  1.00 1.00 ? 16 GLY A O    14 
ATOM   10091 H H    . GLY A 1 16 ? 10.070  21.296 -5.082  1.00 1.00 ? 16 GLY A H    14 
ATOM   10092 H HA2  . GLY A 1 16 ? 11.607  22.258 -3.586  1.00 1.00 ? 16 GLY A HA2  14 
ATOM   10093 H HA3  . GLY A 1 16 ? 10.874  23.828 -3.898  1.00 1.00 ? 16 GLY A HA3  14 
ATOM   10094 N N    . ASN A 1 17 ? 8.878   23.456 -2.126  1.00 1.00 ? 17 ASN A N    14 
ATOM   10095 C CA   . ASN A 1 17 ? 8.226   23.682 -0.843  1.00 1.00 ? 17 ASN A CA   14 
ATOM   10096 C C    . ASN A 1 17 ? 7.443   22.449 -0.381  1.00 1.00 ? 17 ASN A C    14 
ATOM   10097 O O    . ASN A 1 17 ? 6.243   22.325 -0.623  1.00 1.00 ? 17 ASN A O    14 
ATOM   10098 C CB   . ASN A 1 17 ? 7.350   24.941 -0.893  1.00 1.00 ? 17 ASN A CB   14 
ATOM   10099 C CG   . ASN A 1 17 ? 6.912   25.338 0.514   1.00 1.00 ? 17 ASN A CG   14 
ATOM   10100 O OD1  . ASN A 1 17 ? 5.840   24.966 0.981   1.00 1.00 ? 17 ASN A OD1  14 
ATOM   10101 N ND2  . ASN A 1 17 ? 7.750   26.083 1.228   1.00 1.00 ? 17 ASN A ND2  14 
ATOM   10102 H H    . ASN A 1 17 ? 8.525   23.913 -2.957  1.00 1.00 ? 17 ASN A H    14 
ATOM   10103 H HA   . ASN A 1 17 ? 9.009   23.883 -0.110  1.00 1.00 ? 17 ASN A HA   14 
ATOM   10104 H HB2  . ASN A 1 17 ? 7.922   25.762 -1.328  1.00 1.00 ? 17 ASN A HB2  14 
ATOM   10105 H HB3  . ASN A 1 17 ? 6.478   24.766 -1.522  1.00 1.00 ? 17 ASN A HB3  14 
ATOM   10106 H HD21 . ASN A 1 17 ? 8.624   26.396 0.831   1.00 1.00 ? 17 ASN A HD21 14 
ATOM   10107 H HD22 . ASN A 1 17 ? 7.479   26.374 2.155   1.00 1.00 ? 17 ASN A HD22 14 
ATOM   10108 N N    . ASN A 1 18 ? 8.150   21.553 0.313   1.00 1.00 ? 18 ASN A N    14 
ATOM   10109 C CA   . ASN A 1 18 ? 7.643   20.343 0.964   1.00 1.00 ? 18 ASN A CA   14 
ATOM   10110 C C    . ASN A 1 18 ? 6.238   20.524 1.539   1.00 1.00 ? 18 ASN A C    14 
ATOM   10111 O O    . ASN A 1 18 ? 5.314   19.786 1.215   1.00 1.00 ? 18 ASN A O    14 
ATOM   10112 C CB   . ASN A 1 18 ? 8.628   19.942 2.071   1.00 1.00 ? 18 ASN A CB   14 
ATOM   10113 C CG   . ASN A 1 18 ? 8.389   18.507 2.517   1.00 1.00 ? 18 ASN A CG   14 
ATOM   10114 O OD1  . ASN A 1 18 ? 7.416   18.204 3.206   1.00 1.00 ? 18 ASN A OD1  14 
ATOM   10115 N ND2  . ASN A 1 18 ? 9.261   17.606 2.084   1.00 1.00 ? 18 ASN A ND2  14 
ATOM   10116 H H    . ASN A 1 18 ? 9.156   21.693 0.290   1.00 1.00 ? 18 ASN A H    14 
ATOM   10117 H HA   . ASN A 1 18 ? 7.590   19.548 0.227   1.00 1.00 ? 18 ASN A HA   14 
ATOM   10118 H HB2  . ASN A 1 18 ? 9.645   20.033 1.691   1.00 1.00 ? 18 ASN A HB2  14 
ATOM   10119 H HB3  . ASN A 1 18 ? 8.539   20.602 2.934   1.00 1.00 ? 18 ASN A HB3  14 
ATOM   10120 H HD21 . ASN A 1 18 ? 10.086  17.881 1.570   1.00 1.00 ? 18 ASN A HD21 14 
ATOM   10121 H HD22 . ASN A 1 18 ? 9.108   16.619 2.284   1.00 1.00 ? 18 ASN A HD22 14 
ATOM   10122 N N    . ASN A 1 19 ? 6.118   21.526 2.402   1.00 1.00 ? 19 ASN A N    14 
ATOM   10123 C CA   . ASN A 1 19 ? 4.894   22.008 3.033   1.00 1.00 ? 19 ASN A CA   14 
ATOM   10124 C C    . ASN A 1 19 ? 3.756   22.190 2.024   1.00 1.00 ? 19 ASN A C    14 
ATOM   10125 O O    . ASN A 1 19 ? 2.661   21.672 2.229   1.00 1.00 ? 19 ASN A O    14 
ATOM   10126 C CB   . ASN A 1 19 ? 5.205   23.310 3.790   1.00 1.00 ? 19 ASN A CB   14 
ATOM   10127 C CG   . ASN A 1 19 ? 3.981   24.213 3.939   1.00 1.00 ? 19 ASN A CG   14 
ATOM   10128 O OD1  . ASN A 1 19 ? 3.193   24.053 4.864   1.00 1.00 ? 19 ASN A OD1  14 
ATOM   10129 N ND2  . ASN A 1 19 ? 3.815   25.163 3.023   1.00 1.00 ? 19 ASN A ND2  14 
ATOM   10130 H H    . ASN A 1 19 ? 6.981   22.005 2.580   1.00 1.00 ? 19 ASN A H    14 
ATOM   10131 H HA   . ASN A 1 19 ? 4.561   21.274 3.766   1.00 1.00 ? 19 ASN A HA   14 
ATOM   10132 H HB2  . ASN A 1 19 ? 5.584   23.060 4.781   1.00 1.00 ? 19 ASN A HB2  14 
ATOM   10133 H HB3  . ASN A 1 19 ? 5.982   23.870 3.271   1.00 1.00 ? 19 ASN A HB3  14 
ATOM   10134 H HD21 . ASN A 1 19 ? 4.468   25.241 2.246   1.00 1.00 ? 19 ASN A HD21 14 
ATOM   10135 H HD22 . ASN A 1 19 ? 3.017   25.774 3.096   1.00 1.00 ? 19 ASN A HD22 14 
ATOM   10136 N N    . ALA A 1 20 ? 3.995   22.944 0.953   1.00 1.00 ? 20 ALA A N    14 
ATOM   10137 C CA   . ALA A 1 20 ? 2.954   23.245 -0.018  1.00 1.00 ? 20 ALA A CA   14 
ATOM   10138 C C    . ALA A 1 20 ? 2.569   21.970 -0.751  1.00 1.00 ? 20 ALA A C    14 
ATOM   10139 O O    . ALA A 1 20 ? 1.385   21.662 -0.856  1.00 1.00 ? 20 ALA A O    14 
ATOM   10140 C CB   . ALA A 1 20 ? 3.404   24.323 -1.003  1.00 1.00 ? 20 ALA A CB   14 
ATOM   10141 H H    . ALA A 1 20 ? 4.931   23.311 0.802   1.00 1.00 ? 20 ALA A H    14 
ATOM   10142 H HA   . ALA A 1 20 ? 2.078   23.624 0.512   1.00 1.00 ? 20 ALA A HA   14 
ATOM   10143 H HB1  . ALA A 1 20 ? 3.646   25.242 -0.474  1.00 1.00 ? 20 ALA A HB1  14 
ATOM   10144 H HB2  . ALA A 1 20 ? 4.271   23.978 -1.563  1.00 1.00 ? 20 ALA A HB2  14 
ATOM   10145 H HB3  . ALA A 1 20 ? 2.588   24.529 -1.699  1.00 1.00 ? 20 ALA A HB3  14 
ATOM   10146 N N    . CYS A 1 21 ? 3.571   21.230 -1.239  1.00 1.00 ? 21 CYS A N    14 
ATOM   10147 C CA   . CYS A 1 21 ? 3.354   19.948 -1.906  1.00 1.00 ? 21 CYS A CA   14 
ATOM   10148 C C    . CYS A 1 21 ? 2.453   19.058 -1.056  1.00 1.00 ? 21 CYS A C    14 
ATOM   10149 O O    . CYS A 1 21 ? 1.400   18.606 -1.503  1.00 1.00 ? 21 CYS A O    14 
ATOM   10150 C CB   . CYS A 1 21 ? 4.690   19.253 -2.175  1.00 1.00 ? 21 CYS A CB   14 
ATOM   10151 S SG   . CYS A 1 21 ? 4.645   17.442 -2.277  1.00 1.00 ? 21 CYS A SG   14 
ATOM   10152 H H    . CYS A 1 21 ? 4.523   21.557 -1.088  1.00 1.00 ? 21 CYS A H    14 
ATOM   10153 H HA   . CYS A 1 21 ? 2.861   20.143 -2.852  1.00 1.00 ? 21 CYS A HA   14 
ATOM   10154 H HB2  . CYS A 1 21 ? 5.106   19.645 -3.100  1.00 1.00 ? 21 CYS A HB2  14 
ATOM   10155 H HB3  . CYS A 1 21 ? 5.369   19.480 -1.356  1.00 1.00 ? 21 CYS A HB3  14 
ATOM   10156 N N    . LYS A 1 22 ? 2.878   18.853 0.190   1.00 1.00 ? 22 LYS A N    14 
ATOM   10157 C CA   . LYS A 1 22 ? 2.170   18.098 1.199   1.00 1.00 ? 22 LYS A CA   14 
ATOM   10158 C C    . LYS A 1 22 ? 0.731   18.578 1.298   1.00 1.00 ? 22 LYS A C    14 
ATOM   10159 O O    . LYS A 1 22 ? -0.192  17.815 1.014   1.00 1.00 ? 22 LYS A O    14 
ATOM   10160 C CB   . LYS A 1 22 ? 2.923   18.270 2.526   1.00 1.00 ? 22 LYS A CB   14 
ATOM   10161 C CG   . LYS A 1 22 ? 2.284   17.554 3.721   1.00 1.00 ? 22 LYS A CG   14 
ATOM   10162 C CD   . LYS A 1 22 ? 2.995   17.870 5.054   1.00 1.00 ? 22 LYS A CD   14 
ATOM   10163 C CE   . LYS A 1 22 ? 4.511   18.140 4.980   1.00 1.00 ? 22 LYS A CE   14 
ATOM   10164 N NZ   . LYS A 1 22 ? 5.291   17.002 4.460   1.00 1.00 ? 22 LYS A NZ   14 
ATOM   10165 H H    . LYS A 1 22 ? 3.752   19.289 0.460   1.00 1.00 ? 22 LYS A H    14 
ATOM   10166 H HA   . LYS A 1 22 ? 2.155   17.054 0.895   1.00 1.00 ? 22 LYS A HA   14 
ATOM   10167 H HB2  . LYS A 1 22 ? 3.932   17.903 2.361   1.00 1.00 ? 22 LYS A HB2  14 
ATOM   10168 H HB3  . LYS A 1 22 ? 2.988   19.326 2.771   1.00 1.00 ? 22 LYS A HB3  14 
ATOM   10169 H HG2  . LYS A 1 22 ? 1.248   17.880 3.829   1.00 1.00 ? 22 LYS A HG2  14 
ATOM   10170 H HG3  . LYS A 1 22 ? 2.250   16.487 3.521   1.00 1.00 ? 22 LYS A HG3  14 
ATOM   10171 H HD2  . LYS A 1 22 ? 2.540   18.782 5.449   1.00 1.00 ? 22 LYS A HD2  14 
ATOM   10172 H HD3  . LYS A 1 22 ? 2.783   17.071 5.768   1.00 1.00 ? 22 LYS A HD3  14 
ATOM   10173 H HE2  . LYS A 1 22 ? 4.697   19.006 4.344   1.00 1.00 ? 22 LYS A HE2  14 
ATOM   10174 H HE3  . LYS A 1 22 ? 4.874   18.385 5.979   1.00 1.00 ? 22 LYS A HE3  14 
ATOM   10175 H HZ1  . LYS A 1 22 ? 4.887   16.657 3.598   1.00 1.00 ? 22 LYS A HZ1  14 
ATOM   10176 H HZ2  . LYS A 1 22 ? 6.234   17.312 4.241   1.00 1.00 ? 22 LYS A HZ2  14 
ATOM   10177 H HZ3  . LYS A 1 22 ? 5.328   16.243 5.123   1.00 1.00 ? 22 LYS A HZ3  14 
ATOM   10178 N N    . ASN A 1 23 ? 0.559   19.829 1.734   1.00 1.00 ? 23 ASN A N    14 
ATOM   10179 C CA   . ASN A 1 23 ? -0.747  20.394 2.010   1.00 1.00 ? 23 ASN A CA   14 
ATOM   10180 C C    . ASN A 1 23 ? -1.621  20.222 0.778   1.00 1.00 ? 23 ASN A C    14 
ATOM   10181 O O    . ASN A 1 23 ? -2.605  19.493 0.823   1.00 1.00 ? 23 ASN A O    14 
ATOM   10182 C CB   . ASN A 1 23 ? -0.606  21.872 2.410   1.00 1.00 ? 23 ASN A CB   14 
ATOM   10183 C CG   . ASN A 1 23 ? -1.929  22.618 2.632   1.00 1.00 ? 23 ASN A CG   14 
ATOM   10184 O OD1  . ASN A 1 23 ? -3.017  22.179 2.264   1.00 1.00 ? 23 ASN A OD1  14 
ATOM   10185 N ND2  . ASN A 1 23 ? -1.839  23.795 3.244   1.00 1.00 ? 23 ASN A ND2  14 
ATOM   10186 H H    . ASN A 1 23 ? 1.376   20.411 1.891   1.00 1.00 ? 23 ASN A H    14 
ATOM   10187 H HA   . ASN A 1 23 ? -1.159  19.819 2.842   1.00 1.00 ? 23 ASN A HA   14 
ATOM   10188 H HB2  . ASN A 1 23 ? -0.024  21.917 3.332   1.00 1.00 ? 23 ASN A HB2  14 
ATOM   10189 H HB3  . ASN A 1 23 ? -0.052  22.403 1.635   1.00 1.00 ? 23 ASN A HB3  14 
ATOM   10190 H HD21 . ASN A 1 23 ? -0.941  24.151 3.535   1.00 1.00 ? 23 ASN A HD21 14 
ATOM   10191 H HD22 . ASN A 1 23 ? -2.683  24.321 3.412   1.00 1.00 ? 23 ASN A HD22 14 
ATOM   10192 N N    . GLN A 1 24 ? -1.231  20.850 -0.334  1.00 1.00 ? 24 GLN A N    14 
ATOM   10193 C CA   . GLN A 1 24 ? -1.994  20.820 -1.567  1.00 1.00 ? 24 GLN A CA   14 
ATOM   10194 C C    . GLN A 1 24 ? -2.375  19.391 -1.923  1.00 1.00 ? 24 GLN A C    14 
ATOM   10195 O O    . GLN A 1 24 ? -3.551  19.130 -2.166  1.00 1.00 ? 24 GLN A O    14 
ATOM   10196 C CB   . GLN A 1 24 ? -1.211  21.531 -2.679  1.00 1.00 ? 24 GLN A CB   14 
ATOM   10197 C CG   . GLN A 1 24 ? -2.034  21.700 -3.965  1.00 1.00 ? 24 GLN A CG   14 
ATOM   10198 C CD   . GLN A 1 24 ? -1.738  20.624 -5.008  1.00 1.00 ? 24 GLN A CD   14 
ATOM   10199 O OE1  . GLN A 1 24 ? -2.301  19.532 -4.986  1.00 1.00 ? 24 GLN A OE1  14 
ATOM   10200 N NE2  . GLN A 1 24 ? -0.846  20.928 -5.943  1.00 1.00 ? 24 GLN A NE2  14 
ATOM   10201 H H    . GLN A 1 24 ? -0.333  21.323 -0.340  1.00 1.00 ? 24 GLN A H    14 
ATOM   10202 H HA   . GLN A 1 24 ? -2.926  21.358 -1.389  1.00 1.00 ? 24 GLN A HA   14 
ATOM   10203 H HB2  . GLN A 1 24 ? -0.954  22.528 -2.317  1.00 1.00 ? 24 GLN A HB2  14 
ATOM   10204 H HB3  . GLN A 1 24 ? -0.287  20.993 -2.888  1.00 1.00 ? 24 GLN A HB3  14 
ATOM   10205 H HG2  . GLN A 1 24 ? -3.096  21.699 -3.731  1.00 1.00 ? 24 GLN A HG2  14 
ATOM   10206 H HG3  . GLN A 1 24 ? -1.796  22.672 -4.399  1.00 1.00 ? 24 GLN A HG3  14 
ATOM   10207 H HE21 . GLN A 1 24 ? -0.359  21.811 -5.893  1.00 1.00 ? 24 GLN A HE21 14 
ATOM   10208 H HE22 . GLN A 1 24 ? -0.622  20.255 -6.659  1.00 1.00 ? 24 GLN A HE22 14 
ATOM   10209 N N    . CYS A 1 25 ? -1.418  18.458 -1.899  1.00 1.00 ? 25 CYS A N    14 
ATOM   10210 C CA   . CYS A 1 25 ? -1.742  17.079 -2.207  1.00 1.00 ? 25 CYS A CA   14 
ATOM   10211 C C    . CYS A 1 25 ? -2.846  16.538 -1.298  1.00 1.00 ? 25 CYS A C    14 
ATOM   10212 O O    . CYS A 1 25 ? -3.907  16.166 -1.793  1.00 1.00 ? 25 CYS A O    14 
ATOM   10213 C CB   . CYS A 1 25 ? -0.534  16.155 -2.125  1.00 1.00 ? 25 CYS A CB   14 
ATOM   10214 S SG   . CYS A 1 25 ? -1.064  14.534 -2.705  1.00 1.00 ? 25 CYS A SG   14 
ATOM   10215 H H    . CYS A 1 25 ? -0.461  18.698 -1.653  1.00 1.00 ? 25 CYS A H    14 
ATOM   10216 H HA   . CYS A 1 25 ? -2.104  17.053 -3.236  1.00 1.00 ? 25 CYS A HA   14 
ATOM   10217 H HB2  . CYS A 1 25 ? 0.289   16.517 -2.733  1.00 1.00 ? 25 CYS A HB2  14 
ATOM   10218 H HB3  . CYS A 1 25 ? -0.188  16.065 -1.095  1.00 1.00 ? 25 CYS A HB3  14 
ATOM   10219 N N    . ILE A 1 26 ? -2.604  16.486 0.018   1.00 1.00 ? 26 ILE A N    14 
ATOM   10220 C CA   . ILE A 1 26 ? -3.529  15.840 0.952   1.00 1.00 ? 26 ILE A CA   14 
ATOM   10221 C C    . ILE A 1 26 ? -4.830  16.635 1.110   1.00 1.00 ? 26 ILE A C    14 
ATOM   10222 O O    . ILE A 1 26 ? -5.829  16.123 1.627   1.00 1.00 ? 26 ILE A O    14 
ATOM   10223 C CB   . ILE A 1 26 ? -2.848  15.579 2.312   1.00 1.00 ? 26 ILE A CB   14 
ATOM   10224 C CG1  . ILE A 1 26 ? -2.664  16.866 3.137   1.00 1.00 ? 26 ILE A CG1  14 
ATOM   10225 C CG2  . ILE A 1 26 ? -1.521  14.833 2.109   1.00 1.00 ? 26 ILE A CG2  14 
ATOM   10226 C CD1  . ILE A 1 26 ? -1.939  16.628 4.465   1.00 1.00 ? 26 ILE A CD1  14 
ATOM   10227 H H    . ILE A 1 26 ? -1.752  16.912 0.379   1.00 1.00 ? 26 ILE A H    14 
ATOM   10228 H HA   . ILE A 1 26 ? -3.799  14.867 0.536   1.00 1.00 ? 26 ILE A HA   14 
ATOM   10229 H HB   . ILE A 1 26 ? -3.507  14.925 2.884   1.00 1.00 ? 26 ILE A HB   14 
ATOM   10230 H HG12 . ILE A 1 26 ? -2.108  17.602 2.566   1.00 1.00 ? 26 ILE A HG12 14 
ATOM   10231 H HG13 . ILE A 1 26 ? -3.642  17.286 3.375   1.00 1.00 ? 26 ILE A HG13 14 
ATOM   10232 H HG21 . ILE A 1 26 ? -1.668  13.988 1.438   1.00 1.00 ? 26 ILE A HG21 14 
ATOM   10233 H HG22 . ILE A 1 26 ? -0.762  15.486 1.686   1.00 1.00 ? 26 ILE A HG22 14 
ATOM   10234 H HG23 . ILE A 1 26 ? -1.161  14.454 3.062   1.00 1.00 ? 26 ILE A HG23 14 
ATOM   10235 H HD11 . ILE A 1 26 ? -2.432  15.830 5.021   1.00 1.00 ? 26 ILE A HD11 14 
ATOM   10236 H HD12 . ILE A 1 26 ? -0.897  16.361 4.289   1.00 1.00 ? 26 ILE A HD12 14 
ATOM   10237 H HD13 . ILE A 1 26 ? -1.967  17.543 5.056   1.00 1.00 ? 26 ILE A HD13 14 
ATOM   10238 N N    . ASN A 1 27 ? -4.823  17.895 0.676   1.00 1.00 ? 27 ASN A N    14 
ATOM   10239 C CA   . ASN A 1 27 ? -5.957  18.796 0.724   1.00 1.00 ? 27 ASN A CA   14 
ATOM   10240 C C    . ASN A 1 27 ? -6.844  18.534 -0.493  1.00 1.00 ? 27 ASN A C    14 
ATOM   10241 O O    . ASN A 1 27 ? -7.987  18.096 -0.335  1.00 1.00 ? 27 ASN A O    14 
ATOM   10242 C CB   . ASN A 1 27 ? -5.390  20.217 0.798   1.00 1.00 ? 27 ASN A CB   14 
ATOM   10243 C CG   . ASN A 1 27 ? -6.404  21.320 1.035   1.00 1.00 ? 27 ASN A CG   14 
ATOM   10244 O OD1  . ASN A 1 27 ? -7.586  21.183 0.739   1.00 1.00 ? 27 ASN A OD1  14 
ATOM   10245 N ND2  . ASN A 1 27 ? -5.922  22.433 1.583   1.00 1.00 ? 27 ASN A ND2  14 
ATOM   10246 H H    . ASN A 1 27 ? -3.945  18.288 0.340   1.00 1.00 ? 27 ASN A H    14 
ATOM   10247 H HA   . ASN A 1 27 ? -6.533  18.615 1.634   1.00 1.00 ? 27 ASN A HA   14 
ATOM   10248 H HB2  . ASN A 1 27 ? -4.723  20.233 1.659   1.00 1.00 ? 27 ASN A HB2  14 
ATOM   10249 H HB3  . ASN A 1 27 ? -4.829  20.454 -0.104  1.00 1.00 ? 27 ASN A HB3  14 
ATOM   10250 H HD21 . ASN A 1 27 ? -4.932  22.478 1.825   1.00 1.00 ? 27 ASN A HD21 14 
ATOM   10251 H HD22 . ASN A 1 27 ? -6.545  23.204 1.764   1.00 1.00 ? 27 ASN A HD22 14 
ATOM   10252 N N    . LEU A 1 28 ? -6.300  18.724 -1.699  1.00 1.00 ? 28 LEU A N    14 
ATOM   10253 C CA   . LEU A 1 28 ? -7.028  18.559 -2.951  1.00 1.00 ? 28 LEU A CA   14 
ATOM   10254 C C    . LEU A 1 28 ? -7.342  17.084 -3.205  1.00 1.00 ? 28 LEU A C    14 
ATOM   10255 O O    . LEU A 1 28 ? -8.515  16.720 -3.276  1.00 1.00 ? 28 LEU A O    14 
ATOM   10256 C CB   . LEU A 1 28 ? -6.256  19.197 -4.118  1.00 1.00 ? 28 LEU A CB   14 
ATOM   10257 C CG   . LEU A 1 28 ? -6.537  20.702 -4.269  1.00 1.00 ? 28 LEU A CG   14 
ATOM   10258 C CD1  . LEU A 1 28 ? -6.155  21.507 -3.021  1.00 1.00 ? 28 LEU A CD1  14 
ATOM   10259 C CD2  . LEU A 1 28 ? -5.778  21.231 -5.490  1.00 1.00 ? 28 LEU A CD2  14 
ATOM   10260 H H    . LEU A 1 28 ? -5.321  18.984 -1.759  1.00 1.00 ? 28 LEU A H    14 
ATOM   10261 H HA   . LEU A 1 28 ? -7.987  19.074 -2.863  1.00 1.00 ? 28 LEU A HA   14 
ATOM   10262 H HB2  . LEU A 1 28 ? -5.185  19.023 -4.014  1.00 1.00 ? 28 LEU A HB2  14 
ATOM   10263 H HB3  . LEU A 1 28 ? -6.577  18.720 -5.043  1.00 1.00 ? 28 LEU A HB3  14 
ATOM   10264 H HG   . LEU A 1 28 ? -7.603  20.846 -4.453  1.00 1.00 ? 28 LEU A HG   14 
ATOM   10265 H HD11 . LEU A 1 28 ? -5.135  21.277 -2.719  1.00 1.00 ? 28 LEU A HD11 14 
ATOM   10266 H HD12 . LEU A 1 28 ? -6.234  22.574 -3.230  1.00 1.00 ? 28 LEU A HD12 14 
ATOM   10267 H HD13 . LEU A 1 28 ? -6.833  21.273 -2.201  1.00 1.00 ? 28 LEU A HD13 14 
ATOM   10268 H HD21 . LEU A 1 28 ? -6.107  20.705 -6.386  1.00 1.00 ? 28 LEU A HD21 14 
ATOM   10269 H HD22 . LEU A 1 28 ? -5.975  22.296 -5.619  1.00 1.00 ? 28 LEU A HD22 14 
ATOM   10270 H HD23 . LEU A 1 28 ? -4.707  21.078 -5.364  1.00 1.00 ? 28 LEU A HD23 14 
ATOM   10271 N N    . GLU A 1 29 ? -6.323  16.221 -3.309  1.00 1.00 ? 29 GLU A N    14 
ATOM   10272 C CA   . GLU A 1 29 ? -6.558  14.779 -3.329  1.00 1.00 ? 29 GLU A CA   14 
ATOM   10273 C C    . GLU A 1 29 ? -6.528  14.309 -1.871  1.00 1.00 ? 29 GLU A C    14 
ATOM   10274 O O    . GLU A 1 29 ? -6.357  15.127 -0.973  1.00 1.00 ? 29 GLU A O    14 
ATOM   10275 C CB   . GLU A 1 29 ? -5.638  14.055 -4.335  1.00 1.00 ? 29 GLU A CB   14 
ATOM   10276 C CG   . GLU A 1 29 ? -4.129  14.320 -4.232  1.00 1.00 ? 29 GLU A CG   14 
ATOM   10277 C CD   . GLU A 1 29 ? -3.366  13.837 -5.461  1.00 1.00 ? 29 GLU A CD   14 
ATOM   10278 O OE1  . GLU A 1 29 ? -3.817  12.912 -6.129  1.00 1.00 ? 29 GLU A OE1  14 
ATOM   10279 O OE2  . GLU A 1 29 ? -2.197  14.477 -5.745  1.00 1.00 ? 29 GLU A OE2  14 
ATOM   10280 H H    . GLU A 1 29 ? -5.400  16.527 -3.010  1.00 1.00 ? 29 GLU A H    14 
ATOM   10281 H HA   . GLU A 1 29 ? -7.569  14.573 -3.686  1.00 1.00 ? 29 GLU A HA   14 
ATOM   10282 H HB2  . GLU A 1 29 ? -5.811  12.980 -4.277  1.00 1.00 ? 29 GLU A HB2  14 
ATOM   10283 H HB3  . GLU A 1 29 ? -5.953  14.383 -5.327  1.00 1.00 ? 29 GLU A HB3  14 
ATOM   10284 H HG2  . GLU A 1 29 ? -3.948  15.388 -4.131  1.00 1.00 ? 29 GLU A HG2  14 
ATOM   10285 H HG3  . GLU A 1 29 ? -3.724  13.777 -3.379  1.00 1.00 ? 29 GLU A HG3  14 
ATOM   10286 H HE2  . GLU A 1 29 ? -2.185  15.404 -5.475  1.00 1.00 ? 29 GLU A HE2  14 
ATOM   10287 N N    . LYS A 1 30 ? -6.825  13.041 -1.580  1.00 1.00 ? 30 LYS A N    14 
ATOM   10288 C CA   . LYS A 1 30 ? -7.050  12.576 -0.203  1.00 1.00 ? 30 LYS A CA   14 
ATOM   10289 C C    . LYS A 1 30 ? -5.899  11.725 0.346   1.00 1.00 ? 30 LYS A C    14 
ATOM   10290 O O    . LYS A 1 30 ? -6.027  11.090 1.397   1.00 1.00 ? 30 LYS A O    14 
ATOM   10291 C CB   . LYS A 1 30 ? -8.454  11.972 -0.076  1.00 1.00 ? 30 LYS A CB   14 
ATOM   10292 C CG   . LYS A 1 30 ? -9.559  12.994 -0.436  1.00 1.00 ? 30 LYS A CG   14 
ATOM   10293 C CD   . LYS A 1 30 ? -10.110 13.862 0.717   1.00 1.00 ? 30 LYS A CD   14 
ATOM   10294 C CE   . LYS A 1 30 ? -9.120  14.726 1.523   1.00 1.00 ? 30 LYS A CE   14 
ATOM   10295 N NZ   . LYS A 1 30 ? -8.361  15.707 0.716   1.00 1.00 ? 30 LYS A NZ   14 
ATOM   10296 H H    . LYS A 1 30 ? -6.991  12.392 -2.335  1.00 1.00 ? 30 LYS A H    14 
ATOM   10297 H HA   . LYS A 1 30 ? -7.028  13.423 0.472   1.00 1.00 ? 30 LYS A HA   14 
ATOM   10298 H HB2  . LYS A 1 30 ? -8.518  11.125 -0.761  1.00 1.00 ? 30 LYS A HB2  14 
ATOM   10299 H HB3  . LYS A 1 30 ? -8.619  11.604 0.939   1.00 1.00 ? 30 LYS A HB3  14 
ATOM   10300 H HG2  . LYS A 1 30 ? -9.259  13.630 -1.268  1.00 1.00 ? 30 LYS A HG2  14 
ATOM   10301 H HG3  . LYS A 1 30 ? -10.408 12.408 -0.795  1.00 1.00 ? 30 LYS A HG3  14 
ATOM   10302 H HD2  . LYS A 1 30 ? -10.882 14.516 0.302   1.00 1.00 ? 30 LYS A HD2  14 
ATOM   10303 H HD3  . LYS A 1 30 ? -10.605 13.192 1.423   1.00 1.00 ? 30 LYS A HD3  14 
ATOM   10304 H HE2  . LYS A 1 30 ? -9.681  15.277 2.282   1.00 1.00 ? 30 LYS A HE2  14 
ATOM   10305 H HE3  . LYS A 1 30 ? -8.424  14.072 2.048   1.00 1.00 ? 30 LYS A HE3  14 
ATOM   10306 H HZ1  . LYS A 1 30 ? -7.902  15.273 -0.073  1.00 1.00 ? 30 LYS A HZ1  14 
ATOM   10307 H HZ2  . LYS A 1 30 ? -8.889  16.499 0.361   1.00 1.00 ? 30 LYS A HZ2  14 
ATOM   10308 H HZ3  . LYS A 1 30 ? -7.597  16.093 1.261   1.00 1.00 ? 30 LYS A HZ3  14 
ATOM   10309 N N    . ALA A 1 31 ? -4.767  11.736 -0.363  1.00 1.00 ? 31 ALA A N    14 
ATOM   10310 C CA   . ALA A 1 31 ? -3.488  11.194 0.073   1.00 1.00 ? 31 ALA A CA   14 
ATOM   10311 C C    . ALA A 1 31 ? -3.198  11.487 1.548   1.00 1.00 ? 31 ALA A C    14 
ATOM   10312 O O    . ALA A 1 31 ? -3.775  12.411 2.124   1.00 1.00 ? 31 ALA A O    14 
ATOM   10313 C CB   . ALA A 1 31 ? -2.409  11.859 -0.766  1.00 1.00 ? 31 ALA A CB   14 
ATOM   10314 H H    . ALA A 1 31 ? -4.758  12.287 -1.207  1.00 1.00 ? 31 ALA A H    14 
ATOM   10315 H HA   . ALA A 1 31 ? -3.482  10.117 -0.102  1.00 1.00 ? 31 ALA A HA   14 
ATOM   10316 H HB1  . ALA A 1 31 ? -2.626  11.730 -1.824  1.00 1.00 ? 31 ALA A HB1  14 
ATOM   10317 H HB2  . ALA A 1 31 ? -2.388  12.926 -0.545  1.00 1.00 ? 31 ALA A HB2  14 
ATOM   10318 H HB3  . ALA A 1 31 ? -1.443  11.420 -0.521  1.00 1.00 ? 31 ALA A HB3  14 
ATOM   10319 N N    . ARG A 1 32 ? -2.326  10.695 2.175   1.00 1.00 ? 32 ARG A N    14 
ATOM   10320 C CA   . ARG A 1 32 ? -2.090  10.793 3.611   1.00 1.00 ? 32 ARG A CA   14 
ATOM   10321 C C    . ARG A 1 32 ? -0.847  11.623 3.914   1.00 1.00 ? 32 ARG A C    14 
ATOM   10322 O O    . ARG A 1 32 ? -0.915  12.529 4.739   1.00 1.00 ? 32 ARG A O    14 
ATOM   10323 C CB   . ARG A 1 32 ? -2.017  9.402  4.249   1.00 1.00 ? 32 ARG A CB   14 
ATOM   10324 C CG   . ARG A 1 32 ? -3.234  8.505  3.961   1.00 1.00 ? 32 ARG A CG   14 
ATOM   10325 C CD   . ARG A 1 32 ? -4.551  8.960  4.615   1.00 1.00 ? 32 ARG A CD   14 
ATOM   10326 N NE   . ARG A 1 32 ? -5.137  10.146 3.958   1.00 1.00 ? 32 ARG A NE   14 
ATOM   10327 C CZ   . ARG A 1 32 ? -5.661  11.210 4.587   1.00 1.00 ? 32 ARG A CZ   14 
ATOM   10328 N NH1  . ARG A 1 32 ? -6.011  11.134 5.876   1.00 1.00 ? 32 ARG A NH1  14 
ATOM   10329 N NH2  . ARG A 1 32 ? -5.814  12.354 3.917   1.00 1.00 ? 32 ARG A NH2  14 
ATOM   10330 H H    . ARG A 1 32 ? -1.798  10.013 1.633   1.00 1.00 ? 32 ARG A H    14 
ATOM   10331 H HA   . ARG A 1 32 ? -2.907  11.319 4.099   1.00 1.00 ? 32 ARG A HA   14 
ATOM   10332 H HB2  . ARG A 1 32 ? -1.123  8.910  3.870   1.00 1.00 ? 32 ARG A HB2  14 
ATOM   10333 H HB3  . ARG A 1 32 ? -1.902  9.509  5.329   1.00 1.00 ? 32 ARG A HB3  14 
ATOM   10334 H HG2  . ARG A 1 32 ? -3.369  8.401  2.889   1.00 1.00 ? 32 ARG A HG2  14 
ATOM   10335 H HG3  . ARG A 1 32 ? -2.998  7.518  4.364   1.00 1.00 ? 32 ARG A HG3  14 
ATOM   10336 H HD2  . ARG A 1 32 ? -5.270  8.143  4.539   1.00 1.00 ? 32 ARG A HD2  14 
ATOM   10337 H HD3  . ARG A 1 32 ? -4.338  9.135  5.670   1.00 1.00 ? 32 ARG A HD3  14 
ATOM   10338 H HE   . ARG A 1 32 ? -5.101  10.196 2.942   1.00 1.00 ? 32 ARG A HE   14 
ATOM   10339 H HH11 . ARG A 1 32 ? -5.938  10.251 6.357   1.00 1.00 ? 32 ARG A HH11 14 
ATOM   10340 H HH12 . ARG A 1 32 ? -6.381  11.930 6.373   1.00 1.00 ? 32 ARG A HH12 14 
ATOM   10341 H HH21 . ARG A 1 32 ? -5.412  12.395 2.977   1.00 1.00 ? 32 ARG A HH21 14 
ATOM   10342 H HH22 . ARG A 1 32 ? -6.159  13.198 4.342   1.00 1.00 ? 32 ARG A HH22 14 
ATOM   10343 N N    . HIS A 1 33 ? 0.306   11.274 3.337   1.00 1.00 ? 33 HIS A N    14 
ATOM   10344 C CA   . HIS A 1 33 ? 1.497   12.121 3.393   1.00 1.00 ? 33 HIS A CA   14 
ATOM   10345 C C    . HIS A 1 33 ? 1.752   12.753 2.027   1.00 1.00 ? 33 HIS A C    14 
ATOM   10346 O O    . HIS A 1 33 ? 1.229   12.285 1.017   1.00 1.00 ? 33 HIS A O    14 
ATOM   10347 C CB   . HIS A 1 33 ? 2.737   11.348 3.865   1.00 1.00 ? 33 HIS A CB   14 
ATOM   10348 C CG   . HIS A 1 33 ? 2.545   10.397 5.016   1.00 1.00 ? 33 HIS A CG   14 
ATOM   10349 N ND1  . HIS A 1 33 ? 1.446   10.409 5.863   1.00 1.00 ? 33 HIS A ND1  14 
ATOM   10350 C CD2  . HIS A 1 33 ? 3.334   9.365  5.459   1.00 1.00 ? 33 HIS A CD2  14 
ATOM   10351 C CE1  . HIS A 1 33 ? 1.569   9.356  6.687   1.00 1.00 ? 33 HIS A CE1  14 
ATOM   10352 N NE2  . HIS A 1 33 ? 2.711   8.689  6.504   1.00 1.00 ? 33 HIS A NE2  14 
ATOM   10353 H H    . HIS A 1 33 ? 0.287   10.549 2.633   1.00 1.00 ? 33 HIS A H    14 
ATOM   10354 H HA   . HIS A 1 33 ? 1.346   12.934 4.105   1.00 1.00 ? 33 HIS A HA   14 
ATOM   10355 H HB2  . HIS A 1 33 ? 3.124   10.758 3.040   1.00 1.00 ? 33 HIS A HB2  14 
ATOM   10356 H HB3  . HIS A 1 33 ? 3.510   12.065 4.144   1.00 1.00 ? 33 HIS A HB3  14 
ATOM   10357 H HD1  . HIS A 1 33 ? 0.677   11.064 5.836   1.00 1.00 ? 33 HIS A HD1  14 
ATOM   10358 H HD2  . HIS A 1 33 ? 4.285   9.105  5.013   1.00 1.00 ? 33 HIS A HD2  14 
ATOM   10359 H HE1  . HIS A 1 33 ? 0.822   9.082  7.420   1.00 1.00 ? 33 HIS A HE1  14 
ATOM   10360 N N    . GLY A 1 34 ? 2.630   13.755 1.997   1.00 1.00 ? 34 GLY A N    14 
ATOM   10361 C CA   . GLY A 1 34 ? 3.179   14.331 0.784   1.00 1.00 ? 34 GLY A CA   14 
ATOM   10362 C C    . GLY A 1 34 ? 4.458   15.061 1.165   1.00 1.00 ? 34 GLY A C    14 
ATOM   10363 O O    . GLY A 1 34 ? 4.591   15.469 2.322   1.00 1.00 ? 34 GLY A O    14 
ATOM   10364 H H    . GLY A 1 34 ? 3.053   14.077 2.857   1.00 1.00 ? 34 GLY A H    14 
ATOM   10365 H HA2  . GLY A 1 34 ? 3.465   13.522 0.127   1.00 1.00 ? 34 GLY A HA2  14 
ATOM   10366 H HA3  . GLY A 1 34 ? 2.460   14.977 0.283   1.00 1.00 ? 34 GLY A HA3  14 
ATOM   10367 N N    . SER A 1 35 ? 5.431   15.147 0.256   1.00 1.00 ? 35 SER A N    14 
ATOM   10368 C CA   . SER A 1 35 ? 6.768   15.621 0.578   1.00 1.00 ? 35 SER A CA   14 
ATOM   10369 C C    . SER A 1 35 ? 7.521   15.913 -0.724  1.00 1.00 ? 35 SER A C    14 
ATOM   10370 O O    . SER A 1 35 ? 7.446   15.146 -1.686  1.00 1.00 ? 35 SER A O    14 
ATOM   10371 C CB   . SER A 1 35 ? 7.470   14.509 1.385   1.00 1.00 ? 35 SER A CB   14 
ATOM   10372 O OG   . SER A 1 35 ? 8.732   14.920 1.874   1.00 1.00 ? 35 SER A OG   14 
ATOM   10373 H H    . SER A 1 35 ? 5.292   14.737 -0.668  1.00 1.00 ? 35 SER A H    14 
ATOM   10374 H HA   . SER A 1 35 ? 6.696   16.554 1.163   1.00 1.00 ? 35 SER A HA   14 
ATOM   10375 H HB2  . SER A 1 35 ? 6.862   14.209 2.241   1.00 1.00 ? 35 SER A HB2  14 
ATOM   10376 H HB3  . SER A 1 35 ? 7.600   13.631 0.746   1.00 1.00 ? 35 SER A HB3  14 
ATOM   10377 H HG   . SER A 1 35 ? 9.189   14.150 2.231   1.00 1.00 ? 35 SER A HG   14 
ATOM   10378 N N    . CYS A 1 36 ? 8.254   17.026 -0.757  1.00 1.00 ? 36 CYS A N    14 
ATOM   10379 C CA   . CYS A 1 36 ? 9.082   17.403 -1.892  1.00 1.00 ? 36 CYS A CA   14 
ATOM   10380 C C    . CYS A 1 36 ? 10.399  16.646 -1.824  1.00 1.00 ? 36 CYS A C    14 
ATOM   10381 O O    . CYS A 1 36 ? 11.419  17.199 -1.411  1.00 1.00 ? 36 CYS A O    14 
ATOM   10382 C CB   . CYS A 1 36 ? 9.307   18.917 -1.951  1.00 1.00 ? 36 CYS A CB   14 
ATOM   10383 S SG   . CYS A 1 36 ? 7.929   19.847 -2.574  1.00 1.00 ? 36 CYS A SG   14 
ATOM   10384 H H    . CYS A 1 36 ? 8.323   17.572 0.086   1.00 1.00 ? 36 CYS A H    14 
ATOM   10385 H HA   . CYS A 1 36 ? 8.578   17.127 -2.815  1.00 1.00 ? 36 CYS A HA   14 
ATOM   10386 H HB2  . CYS A 1 36 ? 9.497   19.353 -0.995  1.00 1.00 ? 36 CYS A HB2  14 
ATOM   10387 H HB3  . CYS A 1 36 ? 10.153  19.133 -2.598  1.00 1.00 ? 36 CYS A HB3  14 
ATOM   10388 N N    . ASN A 1 37 ? 10.376  15.381 -2.242  1.00 1.00 ? 37 ASN A N    14 
ATOM   10389 C CA   . ASN A 1 37 ? 11.585  14.593 -2.442  1.00 1.00 ? 37 ASN A CA   14 
ATOM   10390 C C    . ASN A 1 37 ? 12.556  15.351 -3.349  1.00 1.00 ? 37 ASN A C    14 
ATOM   10391 O O    . ASN A 1 37 ? 12.116  16.107 -4.215  1.00 1.00 ? 37 ASN A O    14 
ATOM   10392 C CB   . ASN A 1 37 ? 11.212  13.256 -3.092  1.00 1.00 ? 37 ASN A CB   14 
ATOM   10393 C CG   . ASN A 1 37 ? 12.433  12.504 -3.608  1.00 1.00 ? 37 ASN A CG   14 
ATOM   10394 O OD1  . ASN A 1 37 ? 12.549  12.241 -4.800  1.00 1.00 ? 37 ASN A OD1  14 
ATOM   10395 N ND2  . ASN A 1 37 ? 13.374  12.185 -2.723  1.00 1.00 ? 37 ASN A ND2  14 
ATOM   10396 H H    . ASN A 1 37 ? 9.491   15.026 -2.586  1.00 1.00 ? 37 ASN A H    14 
ATOM   10397 H HA   . ASN A 1 37 ? 12.054  14.413 -1.474  1.00 1.00 ? 37 ASN A HA   14 
ATOM   10398 H HB2  . ASN A 1 37 ? 10.667  12.636 -2.380  1.00 1.00 ? 37 ASN A HB2  14 
ATOM   10399 H HB3  . ASN A 1 37 ? 10.577  13.470 -3.950  1.00 1.00 ? 37 ASN A HB3  14 
ATOM   10400 H HD21 . ASN A 1 37 ? 13.240  12.361 -1.739  1.00 1.00 ? 37 ASN A HD21 14 
ATOM   10401 H HD22 . ASN A 1 37 ? 14.190  11.693 -3.054  1.00 1.00 ? 37 ASN A HD22 14 
ATOM   10402 N N    . TYR A 1 38 ? 13.865  15.144 -3.160  1.00 1.00 ? 38 TYR A N    14 
ATOM   10403 C CA   . TYR A 1 38 ? 14.860  15.671 -4.079  1.00 1.00 ? 38 TYR A CA   14 
ATOM   10404 C C    . TYR A 1 38 ? 14.925  14.793 -5.335  1.00 1.00 ? 38 TYR A C    14 
ATOM   10405 O O    . TYR A 1 38 ? 13.973  14.779 -6.111  1.00 1.00 ? 38 TYR A O    14 
ATOM   10406 C CB   . TYR A 1 38 ? 16.218  15.903 -3.388  1.00 1.00 ? 38 TYR A CB   14 
ATOM   10407 C CG   . TYR A 1 38 ? 17.270  16.496 -4.318  1.00 1.00 ? 38 TYR A CG   14 
ATOM   10408 C CD1  . TYR A 1 38 ? 16.954  17.639 -5.077  1.00 1.00 ? 38 TYR A CD1  14 
ATOM   10409 C CD2  . TYR A 1 38 ? 18.431  15.762 -4.633  1.00 1.00 ? 38 TYR A CD2  14 
ATOM   10410 C CE1  . TYR A 1 38 ? 17.706  17.959 -6.219  1.00 1.00 ? 38 TYR A CE1  14 
ATOM   10411 C CE2  . TYR A 1 38 ? 19.158  16.060 -5.799  1.00 1.00 ? 38 TYR A CE2  14 
ATOM   10412 C CZ   . TYR A 1 38 ? 18.762  17.128 -6.621  1.00 1.00 ? 38 TYR A CZ   14 
ATOM   10413 O OH   . TYR A 1 38 ? 19.394  17.345 -7.808  1.00 1.00 ? 38 TYR A OH   14 
ATOM   10414 H H    . TYR A 1 38 ? 14.154  14.477 -2.463  1.00 1.00 ? 38 TYR A H    14 
ATOM   10415 H HA   . TYR A 1 38 ? 14.510  16.646 -4.400  1.00 1.00 ? 38 TYR A HA   14 
ATOM   10416 H HB2  . TYR A 1 38 ? 16.074  16.600 -2.562  1.00 1.00 ? 38 TYR A HB2  14 
ATOM   10417 H HB3  . TYR A 1 38 ? 16.576  14.963 -2.964  1.00 1.00 ? 38 TYR A HB3  14 
ATOM   10418 H HD1  . TYR A 1 38 ? 16.105  18.252 -4.816  1.00 1.00 ? 38 TYR A HD1  14 
ATOM   10419 H HD2  . TYR A 1 38 ? 18.726  14.918 -4.026  1.00 1.00 ? 38 TYR A HD2  14 
ATOM   10420 H HE1  . TYR A 1 38 ? 17.463  18.839 -6.793  1.00 1.00 ? 38 TYR A HE1  14 
ATOM   10421 H HE2  . TYR A 1 38 ? 20.009  15.457 -6.077  1.00 1.00 ? 38 TYR A HE2  14 
ATOM   10422 H HH   . TYR A 1 38 ? 18.931  17.993 -8.357  1.00 1.00 ? 38 TYR A HH   14 
ATOM   10423 N N    . VAL A 1 39 ? 16.031  14.068 -5.541  1.00 1.00 ? 39 VAL A N    14 
ATOM   10424 C CA   . VAL A 1 39 ? 16.373  13.361 -6.771  1.00 1.00 ? 39 VAL A CA   14 
ATOM   10425 C C    . VAL A 1 39 ? 16.515  14.364 -7.932  1.00 1.00 ? 39 VAL A C    14 
ATOM   10426 O O    . VAL A 1 39 ? 15.869  15.411 -7.959  1.00 1.00 ? 39 VAL A O    14 
ATOM   10427 C CB   . VAL A 1 39 ? 15.390  12.202 -7.052  1.00 1.00 ? 39 VAL A CB   14 
ATOM   10428 C CG1  . VAL A 1 39 ? 15.724  11.453 -8.350  1.00 1.00 ? 39 VAL A CG1  14 
ATOM   10429 C CG2  . VAL A 1 39 ? 15.432  11.191 -5.899  1.00 1.00 ? 39 VAL A CG2  14 
ATOM   10430 H H    . VAL A 1 39 ? 16.742  14.095 -4.830  1.00 1.00 ? 39 VAL A H    14 
ATOM   10431 H HA   . VAL A 1 39 ? 17.359  12.922 -6.610  1.00 1.00 ? 39 VAL A HA   14 
ATOM   10432 H HB   . VAL A 1 39 ? 14.371  12.576 -7.145  1.00 1.00 ? 39 VAL A HB   14 
ATOM   10433 H HG11 . VAL A 1 39 ? 16.761  11.116 -8.335  1.00 1.00 ? 39 VAL A HG11 14 
ATOM   10434 H HG12 . VAL A 1 39 ? 15.072  10.585 -8.448  1.00 1.00 ? 39 VAL A HG12 14 
ATOM   10435 H HG13 . VAL A 1 39 ? 15.561  12.094 -9.215  1.00 1.00 ? 39 VAL A HG13 14 
ATOM   10436 H HG21 . VAL A 1 39 ? 15.189  11.676 -4.956  1.00 1.00 ? 39 VAL A HG21 14 
ATOM   10437 H HG22 . VAL A 1 39 ? 14.705  10.398 -6.075  1.00 1.00 ? 39 VAL A HG22 14 
ATOM   10438 H HG23 . VAL A 1 39 ? 16.427  10.750 -5.823  1.00 1.00 ? 39 VAL A HG23 14 
ATOM   10439 N N    . PHE A 1 40 ? 17.365  14.056 -8.910  1.00 1.00 ? 40 PHE A N    14 
ATOM   10440 C CA   . PHE A 1 40 ? 17.544  14.903 -10.085 1.00 1.00 ? 40 PHE A CA   14 
ATOM   10441 C C    . PHE A 1 40 ? 16.189  15.210 -10.753 1.00 1.00 ? 40 PHE A C    14 
ATOM   10442 O O    . PHE A 1 40 ? 15.256  14.408 -10.648 1.00 1.00 ? 40 PHE A O    14 
ATOM   10443 C CB   . PHE A 1 40 ? 18.511  14.203 -11.054 1.00 1.00 ? 40 PHE A CB   14 
ATOM   10444 C CG   . PHE A 1 40 ? 18.687  14.832 -12.424 1.00 1.00 ? 40 PHE A CG   14 
ATOM   10445 C CD1  . PHE A 1 40 ? 17.785  14.527 -13.463 1.00 1.00 ? 40 PHE A CD1  14 
ATOM   10446 C CD2  . PHE A 1 40 ? 19.770  15.696 -12.673 1.00 1.00 ? 40 PHE A CD2  14 
ATOM   10447 C CE1  . PHE A 1 40 ? 17.934  15.127 -14.725 1.00 1.00 ? 40 PHE A CE1  14 
ATOM   10448 C CE2  . PHE A 1 40 ? 19.919  16.293 -13.937 1.00 1.00 ? 40 PHE A CE2  14 
ATOM   10449 C CZ   . PHE A 1 40 ? 18.999  16.013 -14.961 1.00 1.00 ? 40 PHE A CZ   14 
ATOM   10450 H H    . PHE A 1 40 ? 17.877  13.188 -8.856  1.00 1.00 ? 40 PHE A H    14 
ATOM   10451 H HA   . PHE A 1 40 ? 18.011  15.820 -9.727  1.00 1.00 ? 40 PHE A HA   14 
ATOM   10452 H HB2  . PHE A 1 40 ? 19.487  14.169 -10.574 1.00 1.00 ? 40 PHE A HB2  14 
ATOM   10453 H HB3  . PHE A 1 40 ? 18.166  13.181 -11.210 1.00 1.00 ? 40 PHE A HB3  14 
ATOM   10454 H HD1  . PHE A 1 40 ? 16.973  13.832 -13.300 1.00 1.00 ? 40 PHE A HD1  14 
ATOM   10455 H HD2  . PHE A 1 40 ? 20.486  15.920 -11.894 1.00 1.00 ? 40 PHE A HD2  14 
ATOM   10456 H HE1  . PHE A 1 40 ? 17.238  14.897 -15.519 1.00 1.00 ? 40 PHE A HE1  14 
ATOM   10457 H HE2  . PHE A 1 40 ? 20.746  16.965 -14.123 1.00 1.00 ? 40 PHE A HE2  14 
ATOM   10458 H HZ   . PHE A 1 40 ? 19.117  16.469 -15.935 1.00 1.00 ? 40 PHE A HZ   14 
ATOM   10459 N N    . PRO A 1 41 ? 16.024  16.366 -11.411 1.00 1.00 ? 41 PRO A N    14 
ATOM   10460 C CA   . PRO A 1 41 ? 16.943  17.488 -11.396 1.00 1.00 ? 41 PRO A CA   14 
ATOM   10461 C C    . PRO A 1 41 ? 16.726  18.319 -10.127 1.00 1.00 ? 41 PRO A C    14 
ATOM   10462 O O    . PRO A 1 41 ? 17.689  18.708 -9.468  1.00 1.00 ? 41 PRO A O    14 
ATOM   10463 C CB   . PRO A 1 41 ? 16.613  18.282 -12.663 1.00 1.00 ? 41 PRO A CB   14 
ATOM   10464 C CG   . PRO A 1 41 ? 15.124  18.014 -12.894 1.00 1.00 ? 41 PRO A CG   14 
ATOM   10465 C CD   . PRO A 1 41 ? 14.915  16.609 -12.322 1.00 1.00 ? 41 PRO A CD   14 
ATOM   10466 H HA   . PRO A 1 41 ? 17.982  17.162 -11.437 1.00 1.00 ? 41 PRO A HA   14 
ATOM   10467 H HB2  . PRO A 1 41 ? 16.837  19.345 -12.562 1.00 1.00 ? 41 PRO A HB2  14 
ATOM   10468 H HB3  . PRO A 1 41 ? 17.180  17.864 -13.496 1.00 1.00 ? 41 PRO A HB3  14 
ATOM   10469 H HG2  . PRO A 1 41 ? 14.527  18.741 -12.342 1.00 1.00 ? 41 PRO A HG2  14 
ATOM   10470 H HG3  . PRO A 1 41 ? 14.867  18.064 -13.953 1.00 1.00 ? 41 PRO A HG3  14 
ATOM   10471 H HD2  . PRO A 1 41 ? 13.952  16.535 -11.814 1.00 1.00 ? 41 PRO A HD2  14 
ATOM   10472 H HD3  . PRO A 1 41 ? 14.957  15.878 -13.131 1.00 1.00 ? 41 PRO A HD3  14 
ATOM   10473 N N    . ALA A 1 42 ? 15.458  18.583 -9.793  1.00 1.00 ? 42 ALA A N    14 
ATOM   10474 C CA   . ALA A 1 42 ? 15.031  19.476 -8.727  1.00 1.00 ? 42 ALA A CA   14 
ATOM   10475 C C    . ALA A 1 42 ? 13.968  18.794 -7.863  1.00 1.00 ? 42 ALA A C    14 
ATOM   10476 O O    . ALA A 1 42 ? 13.498  17.699 -8.187  1.00 1.00 ? 42 ALA A O    14 
ATOM   10477 C CB   . ALA A 1 42 ? 14.493  20.765 -9.356  1.00 1.00 ? 42 ALA A CB   14 
ATOM   10478 H H    . ALA A 1 42 ? 14.723  18.145 -10.326 1.00 1.00 ? 42 ALA A H    14 
ATOM   10479 H HA   . ALA A 1 42 ? 15.873  19.741 -8.091  1.00 1.00 ? 42 ALA A HA   14 
ATOM   10480 H HB1  . ALA A 1 42 ? 15.274  21.230 -9.960  1.00 1.00 ? 42 ALA A HB1  14 
ATOM   10481 H HB2  . ALA A 1 42 ? 13.639  20.540 -9.995  1.00 1.00 ? 42 ALA A HB2  14 
ATOM   10482 H HB3  . ALA A 1 42 ? 14.187  21.468 -8.581  1.00 1.00 ? 42 ALA A HB3  14 
ATOM   10483 N N    . HIS A 1 43 ? 13.575  19.462 -6.775  1.00 1.00 ? 43 HIS A N    14 
ATOM   10484 C CA   . HIS A 1 43 ? 12.636  18.934 -5.797  1.00 1.00 ? 43 HIS A CA   14 
ATOM   10485 C C    . HIS A 1 43 ? 11.267  18.713 -6.426  1.00 1.00 ? 43 HIS A C    14 
ATOM   10486 O O    . HIS A 1 43 ? 10.691  19.628 -7.007  1.00 1.00 ? 43 HIS A O    14 
ATOM   10487 C CB   . HIS A 1 43 ? 12.507  19.904 -4.626  1.00 1.00 ? 43 HIS A CB   14 
ATOM   10488 C CG   . HIS A 1 43 ? 13.574  19.718 -3.581  1.00 1.00 ? 43 HIS A CG   14 
ATOM   10489 N ND1  . HIS A 1 43 ? 13.438  18.825 -2.528  1.00 1.00 ? 43 HIS A ND1  14 
ATOM   10490 C CD2  . HIS A 1 43 ? 14.814  20.288 -3.417  1.00 1.00 ? 43 HIS A CD2  14 
ATOM   10491 C CE1  . HIS A 1 43 ? 14.567  18.889 -1.804  1.00 1.00 ? 43 HIS A CE1  14 
ATOM   10492 N NE2  . HIS A 1 43 ? 15.453  19.753 -2.303  1.00 1.00 ? 43 HIS A NE2  14 
ATOM   10493 H H    . HIS A 1 43 ? 13.979  20.368 -6.598  1.00 1.00 ? 43 HIS A H    14 
ATOM   10494 H HA   . HIS A 1 43 ? 13.024  17.991 -5.429  1.00 1.00 ? 43 HIS A HA   14 
ATOM   10495 H HB2  . HIS A 1 43 ? 12.553  20.904 -5.040  1.00 1.00 ? 43 HIS A HB2  14 
ATOM   10496 H HB3  . HIS A 1 43 ? 11.534  19.794 -4.150  1.00 1.00 ? 43 HIS A HB3  14 
ATOM   10497 H HD1  . HIS A 1 43 ? 12.642  18.232 -2.322  1.00 1.00 ? 43 HIS A HD1  14 
ATOM   10498 H HD2  . HIS A 1 43 ? 15.245  21.026 -4.078  1.00 1.00 ? 43 HIS A HD2  14 
ATOM   10499 H HE1  . HIS A 1 43 ? 14.743  18.295 -0.919  1.00 1.00 ? 43 HIS A HE1  14 
ATOM   10500 N N    . LYS A 1 44 ? 10.757  17.495 -6.278  1.00 1.00 ? 44 LYS A N    14 
ATOM   10501 C CA   . LYS A 1 44 ? 9.575   16.975 -6.949  1.00 1.00 ? 44 LYS A CA   14 
ATOM   10502 C C    . LYS A 1 44 ? 8.588   16.471 -5.899  1.00 1.00 ? 44 LYS A C    14 
ATOM   10503 O O    . LYS A 1 44 ? 8.993   15.854 -4.914  1.00 1.00 ? 44 LYS A O    14 
ATOM   10504 C CB   . LYS A 1 44 ? 9.995   15.871 -7.934  1.00 1.00 ? 44 LYS A CB   14 
ATOM   10505 C CG   . LYS A 1 44 ? 10.743  14.717 -7.246  1.00 1.00 ? 44 LYS A CG   14 
ATOM   10506 C CD   . LYS A 1 44 ? 11.274  13.665 -8.228  1.00 1.00 ? 44 LYS A CD   14 
ATOM   10507 C CE   . LYS A 1 44 ? 12.243  14.204 -9.293  1.00 1.00 ? 44 LYS A CE   14 
ATOM   10508 N NZ   . LYS A 1 44 ? 13.313  15.046 -8.726  1.00 1.00 ? 44 LYS A NZ   14 
ATOM   10509 H H    . LYS A 1 44 ? 11.230  16.895 -5.611  1.00 1.00 ? 44 LYS A H    14 
ATOM   10510 H HA   . LYS A 1 44 ? 9.095   17.769 -7.523  1.00 1.00 ? 44 LYS A HA   14 
ATOM   10511 H HB2  . LYS A 1 44 ? 9.106   15.479 -8.430  1.00 1.00 ? 44 LYS A HB2  14 
ATOM   10512 H HB3  . LYS A 1 44 ? 10.636  16.333 -8.684  1.00 1.00 ? 44 LYS A HB3  14 
ATOM   10513 H HG2  . LYS A 1 44 ? 11.570  15.098 -6.649  1.00 1.00 ? 44 LYS A HG2  14 
ATOM   10514 H HG3  . LYS A 1 44 ? 10.063  14.209 -6.562  1.00 1.00 ? 44 LYS A HG3  14 
ATOM   10515 H HD2  . LYS A 1 44 ? 11.786  12.898 -7.641  1.00 1.00 ? 44 LYS A HD2  14 
ATOM   10516 H HD3  . LYS A 1 44 ? 10.430  13.191 -8.731  1.00 1.00 ? 44 LYS A HD3  14 
ATOM   10517 H HE2  . LYS A 1 44 ? 12.706  13.348 -9.788  1.00 1.00 ? 44 LYS A HE2  14 
ATOM   10518 H HE3  . LYS A 1 44 ? 11.699  14.774 -10.048 1.00 1.00 ? 44 LYS A HE3  14 
ATOM   10519 H HZ1  . LYS A 1 44 ? 13.674  14.673 -7.856  1.00 1.00 ? 44 LYS A HZ1  14 
ATOM   10520 H HZ2  . LYS A 1 44 ? 14.104  15.094 -9.359  1.00 1.00 ? 44 LYS A HZ2  14 
ATOM   10521 H HZ3  . LYS A 1 44 ? 13.012  15.994 -8.520  1.00 1.00 ? 44 LYS A HZ3  14 
ATOM   10522 N N    . CYS A 1 45 ? 7.301   16.767 -6.086  1.00 1.00 ? 45 CYS A N    14 
ATOM   10523 C CA   . CYS A 1 45 ? 6.291   16.444 -5.093  1.00 1.00 ? 45 CYS A CA   14 
ATOM   10524 C C    . CYS A 1 45 ? 5.960   14.957 -5.159  1.00 1.00 ? 45 CYS A C    14 
ATOM   10525 O O    . CYS A 1 45 ? 5.315   14.516 -6.105  1.00 1.00 ? 45 CYS A O    14 
ATOM   10526 C CB   . CYS A 1 45 ? 5.039   17.291 -5.317  1.00 1.00 ? 45 CYS A CB   14 
ATOM   10527 S SG   . CYS A 1 45 ? 3.733   17.010 -4.097  1.00 1.00 ? 45 CYS A SG   14 
ATOM   10528 H H    . CYS A 1 45 ? 7.013   17.252 -6.926  1.00 1.00 ? 45 CYS A H    14 
ATOM   10529 H HA   . CYS A 1 45 ? 6.680   16.684 -4.104  1.00 1.00 ? 45 CYS A HA   14 
ATOM   10530 H HB2  . CYS A 1 45 ? 5.303   18.344 -5.271  1.00 1.00 ? 45 CYS A HB2  14 
ATOM   10531 H HB3  . CYS A 1 45 ? 4.634   17.078 -6.306  1.00 1.00 ? 45 CYS A HB3  14 
ATOM   10532 N N    . ILE A 1 46 ? 6.420   14.178 -4.178  1.00 1.00 ? 46 ILE A N    14 
ATOM   10533 C CA   . ILE A 1 46 ? 5.991   12.798 -4.015  1.00 1.00 ? 46 ILE A CA   14 
ATOM   10534 C C    . ILE A 1 46 ? 4.829   12.832 -3.036  1.00 1.00 ? 46 ILE A C    14 
ATOM   10535 O O    . ILE A 1 46 ? 4.927   13.487 -1.993  1.00 1.00 ? 46 ILE A O    14 
ATOM   10536 C CB   . ILE A 1 46 ? 7.138   11.917 -3.493  1.00 1.00 ? 46 ILE A CB   14 
ATOM   10537 C CG1  . ILE A 1 46 ? 8.291   11.817 -4.509  1.00 1.00 ? 46 ILE A CG1  14 
ATOM   10538 C CG2  . ILE A 1 46 ? 6.620   10.521 -3.112  1.00 1.00 ? 46 ILE A CG2  14 
ATOM   10539 C CD1  . ILE A 1 46 ? 7.967   11.034 -5.785  1.00 1.00 ? 46 ILE A CD1  14 
ATOM   10540 H H    . ILE A 1 46 ? 6.911   14.603 -3.396  1.00 1.00 ? 46 ILE A H    14 
ATOM   10541 H HA   . ILE A 1 46 ? 5.634   12.387 -4.959  1.00 1.00 ? 46 ILE A HA   14 
ATOM   10542 H HB   . ILE A 1 46 ? 7.539   12.377 -2.587  1.00 1.00 ? 46 ILE A HB   14 
ATOM   10543 H HG12 . ILE A 1 46 ? 8.596   12.821 -4.799  1.00 1.00 ? 46 ILE A HG12 14 
ATOM   10544 H HG13 . ILE A 1 46 ? 9.137   11.328 -4.023  1.00 1.00 ? 46 ILE A HG13 14 
ATOM   10545 H HG21 . ILE A 1 46 ? 6.035   10.103 -3.931  1.00 1.00 ? 46 ILE A HG21 14 
ATOM   10546 H HG22 . ILE A 1 46 ? 7.456   9.863  -2.880  1.00 1.00 ? 46 ILE A HG22 14 
ATOM   10547 H HG23 . ILE A 1 46 ? 5.979   10.577 -2.233  1.00 1.00 ? 46 ILE A HG23 14 
ATOM   10548 H HD11 . ILE A 1 46 ? 7.702   10.004 -5.550  1.00 1.00 ? 46 ILE A HD11 14 
ATOM   10549 H HD12 . ILE A 1 46 ? 7.153   11.507 -6.329  1.00 1.00 ? 46 ILE A HD12 14 
ATOM   10550 H HD13 . ILE A 1 46 ? 8.850   11.024 -6.425  1.00 1.00 ? 46 ILE A HD13 14 
ATOM   10551 N N    . CYS A 1 47 ? 3.736   12.141 -3.364  1.00 1.00 ? 47 CYS A N    14 
ATOM   10552 C CA   . CYS A 1 47 ? 2.577   12.068 -2.498  1.00 1.00 ? 47 CYS A CA   14 
ATOM   10553 C C    . CYS A 1 47 ? 2.214   10.616 -2.209  1.00 1.00 ? 47 CYS A C    14 
ATOM   10554 O O    . CYS A 1 47 ? 2.364   9.763  -3.076  1.00 1.00 ? 47 CYS A O    14 
ATOM   10555 C CB   . CYS A 1 47 ? 1.449   12.892 -3.086  1.00 1.00 ? 47 CYS A CB   14 
ATOM   10556 S SG   . CYS A 1 47 ? 0.233   13.209 -1.814  1.00 1.00 ? 47 CYS A SG   14 
ATOM   10557 H H    . CYS A 1 47 ? 3.677   11.649 -4.253  1.00 1.00 ? 47 CYS A H    14 
ATOM   10558 H HA   . CYS A 1 47 ? 2.811   12.513 -1.542  1.00 1.00 ? 47 CYS A HA   14 
ATOM   10559 H HB2  . CYS A 1 47 ? 1.833   13.857 -3.420  1.00 1.00 ? 47 CYS A HB2  14 
ATOM   10560 H HB3  . CYS A 1 47 ? 0.996   12.376 -3.933  1.00 1.00 ? 47 CYS A HB3  14 
ATOM   10561 N N    . TYR A 1 48 ? 1.798   10.320 -0.974  1.00 1.00 ? 48 TYR A N    14 
ATOM   10562 C CA   . TYR A 1 48 ? 1.652   8.963  -0.468  1.00 1.00 ? 48 TYR A CA   14 
ATOM   10563 C C    . TYR A 1 48 ? 0.176   8.589  -0.336  1.00 1.00 ? 48 TYR A C    14 
ATOM   10564 O O    . TYR A 1 48 ? -0.531  9.162  0.501   1.00 1.00 ? 48 TYR A O    14 
ATOM   10565 C CB   . TYR A 1 48 ? 2.376   8.878  0.881   1.00 1.00 ? 48 TYR A CB   14 
ATOM   10566 C CG   . TYR A 1 48 ? 3.874   9.120  0.816   1.00 1.00 ? 48 TYR A CG   14 
ATOM   10567 C CD1  . TYR A 1 48 ? 4.381   10.424 0.654   1.00 1.00 ? 48 TYR A CD1  14 
ATOM   10568 C CD2  . TYR A 1 48 ? 4.770   8.037  0.907   1.00 1.00 ? 48 TYR A CD2  14 
ATOM   10569 C CE1  . TYR A 1 48 ? 5.759   10.637 0.501   1.00 1.00 ? 48 TYR A CE1  14 
ATOM   10570 C CE2  . TYR A 1 48 ? 6.151   8.253  0.769   1.00 1.00 ? 48 TYR A CE2  14 
ATOM   10571 C CZ   . TYR A 1 48 ? 6.638   9.542  0.497   1.00 1.00 ? 48 TYR A CZ   14 
ATOM   10572 O OH   . TYR A 1 48 ? 7.953   9.735  0.203   1.00 1.00 ? 48 TYR A OH   14 
ATOM   10573 H H    . TYR A 1 48 ? 1.620   11.076 -0.321  1.00 1.00 ? 48 TYR A H    14 
ATOM   10574 H HA   . TYR A 1 48 ? 2.145   8.254  -1.134  1.00 1.00 ? 48 TYR A HA   14 
ATOM   10575 H HB2  . TYR A 1 48 ? 1.923   9.592  1.565   1.00 1.00 ? 48 TYR A HB2  14 
ATOM   10576 H HB3  . TYR A 1 48 ? 2.212   7.887  1.294   1.00 1.00 ? 48 TYR A HB3  14 
ATOM   10577 H HD1  . TYR A 1 48 ? 3.713   11.268 0.623   1.00 1.00 ? 48 TYR A HD1  14 
ATOM   10578 H HD2  . TYR A 1 48 ? 4.401   7.034  1.065   1.00 1.00 ? 48 TYR A HD2  14 
ATOM   10579 H HE1  . TYR A 1 48 ? 6.136   11.631 0.319   1.00 1.00 ? 48 TYR A HE1  14 
ATOM   10580 H HE2  . TYR A 1 48 ? 6.832   7.416  0.831   1.00 1.00 ? 48 TYR A HE2  14 
ATOM   10581 H HH   . TYR A 1 48 ? 8.331   8.952  -0.219  1.00 1.00 ? 48 TYR A HH   14 
ATOM   10582 N N    . PHE A 1 49 ? -0.300  7.647  -1.163  1.00 1.00 ? 49 PHE A N    14 
ATOM   10583 C CA   . PHE A 1 49 ? -1.694  7.222  -1.174  1.00 1.00 ? 49 PHE A CA   14 
ATOM   10584 C C    . PHE A 1 49 ? -1.816  5.856  -0.486  1.00 1.00 ? 49 PHE A C    14 
ATOM   10585 O O    . PHE A 1 49 ? -0.926  5.018  -0.634  1.00 1.00 ? 49 PHE A O    14 
ATOM   10586 C CB   . PHE A 1 49 ? -2.238  7.096  -2.602  1.00 1.00 ? 49 PHE A CB   14 
ATOM   10587 C CG   . PHE A 1 49 ? -2.042  8.237  -3.586  1.00 1.00 ? 49 PHE A CG   14 
ATOM   10588 C CD1  . PHE A 1 49 ? -1.633  9.518  -3.169  1.00 1.00 ? 49 PHE A CD1  14 
ATOM   10589 C CD2  . PHE A 1 49 ? -2.450  8.047  -4.921  1.00 1.00 ? 49 PHE A CD2  14 
ATOM   10590 C CE1  . PHE A 1 49 ? -1.571  10.577 -4.085  1.00 1.00 ? 49 PHE A CE1  14 
ATOM   10591 C CE2  . PHE A 1 49 ? -2.438  9.122  -5.826  1.00 1.00 ? 49 PHE A CE2  14 
ATOM   10592 C CZ   . PHE A 1 49 ? -1.981  10.383 -5.410  1.00 1.00 ? 49 PHE A CZ   14 
ATOM   10593 H H    . PHE A 1 49 ? 0.321   7.186  -1.822  1.00 1.00 ? 49 PHE A H    14 
ATOM   10594 H HA   . PHE A 1 49 ? -2.289  7.978  -0.668  1.00 1.00 ? 49 PHE A HA   14 
ATOM   10595 H HB2  . PHE A 1 49 ? -1.854  6.172  -3.017  1.00 1.00 ? 49 PHE A HB2  14 
ATOM   10596 H HB3  . PHE A 1 49 ? -3.308  6.954  -2.525  1.00 1.00 ? 49 PHE A HB3  14 
ATOM   10597 H HD1  . PHE A 1 49 ? -1.380  9.719  -2.145  1.00 1.00 ? 49 PHE A HD1  14 
ATOM   10598 H HD2  . PHE A 1 49 ? -2.803  7.080  -5.250  1.00 1.00 ? 49 PHE A HD2  14 
ATOM   10599 H HE1  . PHE A 1 49 ? -1.229  11.550 -3.770  1.00 1.00 ? 49 PHE A HE1  14 
ATOM   10600 H HE2  . PHE A 1 49 ? -2.783  8.979  -6.840  1.00 1.00 ? 49 PHE A HE2  14 
ATOM   10601 H HZ   . PHE A 1 49 ? -1.934  11.210 -6.097  1.00 1.00 ? 49 PHE A HZ   14 
ATOM   10602 N N    . PRO A 1 50 ? -2.915  5.606  0.237   1.00 1.00 ? 50 PRO A N    14 
ATOM   10603 C CA   . PRO A 1 50 ? -3.161  4.385  0.988   1.00 1.00 ? 50 PRO A CA   14 
ATOM   10604 C C    . PRO A 1 50 ? -3.557  3.253  0.042   1.00 1.00 ? 50 PRO A C    14 
ATOM   10605 O O    . PRO A 1 50 ? -4.713  2.842  -0.039  1.00 1.00 ? 50 PRO A O    14 
ATOM   10606 C CB   . PRO A 1 50 ? -4.283  4.748  1.957   1.00 1.00 ? 50 PRO A CB   14 
ATOM   10607 C CG   . PRO A 1 50 ? -5.099  5.772  1.164   1.00 1.00 ? 50 PRO A CG   14 
ATOM   10608 C CD   . PRO A 1 50 ? -4.018  6.527  0.389   1.00 1.00 ? 50 PRO A CD   14 
ATOM   10609 H HA   . PRO A 1 50 ? -2.280  4.087  1.557   1.00 1.00 ? 50 PRO A HA   14 
ATOM   10610 H HB2  . PRO A 1 50 ? -4.862  3.877  2.261   1.00 1.00 ? 50 PRO A HB2  14 
ATOM   10611 H HB3  . PRO A 1 50 ? -3.832  5.228  2.824   1.00 1.00 ? 50 PRO A HB3  14 
ATOM   10612 H HG2  . PRO A 1 50 ? -5.759  5.255  0.466   1.00 1.00 ? 50 PRO A HG2  14 
ATOM   10613 H HG3  . PRO A 1 50 ? -5.682  6.429  1.812   1.00 1.00 ? 50 PRO A HG3  14 
ATOM   10614 H HD2  . PRO A 1 50 ? -4.360  6.847  -0.598  1.00 1.00 ? 50 PRO A HD2  14 
ATOM   10615 H HD3  . PRO A 1 50 ? -3.675  7.372  0.982   1.00 1.00 ? 50 PRO A HD3  14 
ATOM   10616 N N    . CYS A 1 51 ? -2.571  2.739  -0.682  1.00 1.00 ? 51 CYS A N    14 
ATOM   10617 C CA   . CYS A 1 51 ? -2.738  1.691  -1.682  1.00 1.00 ? 51 CYS A CA   14 
ATOM   10618 C C    . CYS A 1 51 ? -3.091  0.347  -1.034  1.00 1.00 ? 51 CYS A C    14 
ATOM   10619 O O    . CYS A 1 51 ? -2.267  -0.567 -1.008  1.00 1.00 ? 51 CYS A O    14 
ATOM   10620 C CB   . CYS A 1 51 ? -1.477  1.630  -2.550  1.00 1.00 ? 51 CYS A CB   14 
ATOM   10621 S SG   . CYS A 1 51 ? 0.061   1.206  -1.697  1.00 1.00 ? 51 CYS A SG   14 
ATOM   10622 O OXT  . CYS A 1 51 ? -4.342  0.243  -0.507  1.00 0.00 ? 51 CYS A OXT  14 
ATOM   10623 H H    . CYS A 1 51 ? -1.670  3.191  -0.568  1.00 1.00 ? 51 CYS A H    14 
ATOM   10624 H HA   . CYS A 1 51 ? -3.563  1.970  -2.340  1.00 1.00 ? 51 CYS A HA   14 
ATOM   10625 H HB2  . CYS A 1 51 ? -1.597  0.932  -3.373  1.00 1.00 ? 51 CYS A HB2  14 
ATOM   10626 H HB3  . CYS A 1 51 ? -1.353  2.616  -2.990  1.00 1.00 ? 51 CYS A HB3  14 
HETATM 10627 N N    . PCA A 1 1  ? 0.690   -3.346 1.634   1.00 1.00 ? 1  PCA A N    15 
HETATM 10628 C CA   . PCA A 1 1  ? 0.928   -2.855 2.980   1.00 1.00 ? 1  PCA A CA   15 
HETATM 10629 C CB   . PCA A 1 1  ? 1.680   -3.996 3.689   1.00 1.00 ? 1  PCA A CB   15 
HETATM 10630 C CG   . PCA A 1 1  ? 1.324   -5.231 2.848   1.00 1.00 ? 1  PCA A CG   15 
HETATM 10631 C CD   . PCA A 1 1  ? 0.903   -4.648 1.515   1.00 1.00 ? 1  PCA A CD   15 
HETATM 10632 O OE   . PCA A 1 1  ? 0.805   -5.297 0.480   1.00 1.00 ? 1  PCA A OE   15 
HETATM 10633 C C    . PCA A 1 1  ? 1.719   -1.548 2.954   1.00 1.00 ? 1  PCA A C    15 
HETATM 10634 O O    . PCA A 1 1  ? 1.400   -0.605 3.673   1.00 1.00 ? 1  PCA A O    15 
HETATM 10635 H H    . PCA A 1 1  ? 0.406   -2.749 0.870   1.00 0.00 ? 1  PCA A H    15 
HETATM 10636 H HA   . PCA A 1 1  ? -0.033  -2.692 3.469   1.00 1.00 ? 1  PCA A HA   15 
HETATM 10637 H HB2  . PCA A 1 1  ? 2.757   -3.830 3.634   1.00 1.00 ? 1  PCA A HB2  15 
HETATM 10638 H HB3  . PCA A 1 1  ? 1.374   -4.102 4.731   1.00 1.00 ? 1  PCA A HB3  15 
HETATM 10639 H HG2  . PCA A 1 1  ? 2.173   -5.905 2.740   1.00 1.00 ? 1  PCA A HG2  15 
HETATM 10640 H HG3  . PCA A 1 1  ? 0.475   -5.756 3.286   1.00 1.00 ? 1  PCA A HG3  15 
ATOM   10641 N N    . LYS A 1 2  ? 2.740   -1.490 2.096   1.00 1.00 ? 2  LYS A N    15 
ATOM   10642 C CA   . LYS A 1 2  ? 3.473   -0.260 1.847   1.00 1.00 ? 2  LYS A CA   15 
ATOM   10643 C C    . LYS A 1 2  ? 2.520   0.764  1.226   1.00 1.00 ? 2  LYS A C    15 
ATOM   10644 O O    . LYS A 1 2  ? 1.706   0.416  0.371   1.00 1.00 ? 2  LYS A O    15 
ATOM   10645 C CB   . LYS A 1 2  ? 4.652   -0.542 0.902   1.00 1.00 ? 2  LYS A CB   15 
ATOM   10646 C CG   . LYS A 1 2  ? 5.621   0.650  0.807   1.00 1.00 ? 2  LYS A CG   15 
ATOM   10647 C CD   . LYS A 1 2  ? 6.741   0.443  -0.226  1.00 1.00 ? 2  LYS A CD   15 
ATOM   10648 C CE   . LYS A 1 2  ? 6.260   0.233  -1.672  1.00 1.00 ? 2  LYS A CE   15 
ATOM   10649 N NZ   . LYS A 1 2  ? 5.376   1.314  -2.158  1.00 1.00 ? 2  LYS A NZ   15 
ATOM   10650 H H    . LYS A 1 2  ? 2.912   -2.290 1.508   1.00 1.00 ? 2  LYS A H    15 
ATOM   10651 H HA   . LYS A 1 2  ? 3.857   0.110  2.801   1.00 1.00 ? 2  LYS A HA   15 
ATOM   10652 H HB2  . LYS A 1 2  ? 5.208   -1.406 1.270   1.00 1.00 ? 2  LYS A HB2  15 
ATOM   10653 H HB3  . LYS A 1 2  ? 4.243   -0.782 -0.079  1.00 1.00 ? 2  LYS A HB3  15 
ATOM   10654 H HG2  . LYS A 1 2  ? 5.090   1.572  0.580   1.00 1.00 ? 2  LYS A HG2  15 
ATOM   10655 H HG3  . LYS A 1 2  ? 6.088   0.780  1.786   1.00 1.00 ? 2  LYS A HG3  15 
ATOM   10656 H HD2  . LYS A 1 2  ? 7.403   1.312  -0.192  1.00 1.00 ? 2  LYS A HD2  15 
ATOM   10657 H HD3  . LYS A 1 2  ? 7.330   -0.429 0.071   1.00 1.00 ? 2  LYS A HD3  15 
ATOM   10658 H HE2  . LYS A 1 2  ? 7.136   0.179  -2.323  1.00 1.00 ? 2  LYS A HE2  15 
ATOM   10659 H HE3  . LYS A 1 2  ? 5.736   -0.722 -1.749  1.00 1.00 ? 2  LYS A HE3  15 
ATOM   10660 H HZ1  . LYS A 1 2  ? 4.558   1.422  -1.567  1.00 1.00 ? 2  LYS A HZ1  15 
ATOM   10661 H HZ2  . LYS A 1 2  ? 5.840   2.217  -2.167  1.00 1.00 ? 2  LYS A HZ2  15 
ATOM   10662 H HZ3  . LYS A 1 2  ? 5.062   1.119  -3.096  1.00 1.00 ? 2  LYS A HZ3  15 
ATOM   10663 N N    . LEU A 1 3  ? 2.658   2.035  1.613   1.00 1.00 ? 3  LEU A N    15 
ATOM   10664 C CA   . LEU A 1 3  ? 1.977   3.135  0.943   1.00 1.00 ? 3  LEU A CA   15 
ATOM   10665 C C    . LEU A 1 3  ? 2.321   3.098  -0.546  1.00 1.00 ? 3  LEU A C    15 
ATOM   10666 O O    . LEU A 1 3  ? 3.399   2.634  -0.925  1.00 1.00 ? 3  LEU A O    15 
ATOM   10667 C CB   . LEU A 1 3  ? 2.452   4.468  1.521   1.00 1.00 ? 3  LEU A CB   15 
ATOM   10668 C CG   . LEU A 1 3  ? 2.128   4.633  3.014   1.00 1.00 ? 3  LEU A CG   15 
ATOM   10669 C CD1  . LEU A 1 3  ? 3.252   5.414  3.700   1.00 1.00 ? 3  LEU A CD1  15 
ATOM   10670 C CD2  . LEU A 1 3  ? 0.793   5.364  3.180   1.00 1.00 ? 3  LEU A CD2  15 
ATOM   10671 H H    . LEU A 1 3  ? 3.321   2.254  2.340   1.00 1.00 ? 3  LEU A H    15 
ATOM   10672 H HA   . LEU A 1 3  ? 0.902   3.043  1.084   1.00 1.00 ? 3  LEU A HA   15 
ATOM   10673 H HB2  . LEU A 1 3  ? 3.525   4.500  1.363   1.00 1.00 ? 3  LEU A HB2  15 
ATOM   10674 H HB3  . LEU A 1 3  ? 2.013   5.295  0.959   1.00 1.00 ? 3  LEU A HB3  15 
ATOM   10675 H HG   . LEU A 1 3  ? 2.052   3.662  3.504   1.00 1.00 ? 3  LEU A HG   15 
ATOM   10676 H HD11 . LEU A 1 3  ? 3.382   6.381  3.219   1.00 1.00 ? 3  LEU A HD11 15 
ATOM   10677 H HD12 . LEU A 1 3  ? 3.013   5.567  4.753   1.00 1.00 ? 3  LEU A HD12 15 
ATOM   10678 H HD13 . LEU A 1 3  ? 4.188   4.859  3.630   1.00 1.00 ? 3  LEU A HD13 15 
ATOM   10679 H HD21 . LEU A 1 3  ? 0.009   4.826  2.648   1.00 1.00 ? 3  LEU A HD21 15 
ATOM   10680 H HD22 . LEU A 1 3  ? 0.533   5.413  4.237   1.00 1.00 ? 3  LEU A HD22 15 
ATOM   10681 H HD23 . LEU A 1 3  ? 0.872   6.376  2.785   1.00 1.00 ? 3  LEU A HD23 15 
ATOM   10682 N N    . CYS A 1 4  ? 1.441   3.631  -1.390  1.00 1.00 ? 4  CYS A N    15 
ATOM   10683 C CA   . CYS A 1 4  ? 1.749   3.846  -2.795  1.00 1.00 ? 4  CYS A CA   15 
ATOM   10684 C C    . CYS A 1 4  ? 2.145   5.308  -2.931  1.00 1.00 ? 4  CYS A C    15 
ATOM   10685 O O    . CYS A 1 4  ? 1.295   6.195  -2.863  1.00 1.00 ? 4  CYS A O    15 
ATOM   10686 C CB   . CYS A 1 4  ? 0.571   3.442  -3.683  1.00 1.00 ? 4  CYS A CB   15 
ATOM   10687 S SG   . CYS A 1 4  ? 0.640   1.702  -4.186  1.00 1.00 ? 4  CYS A SG   15 
ATOM   10688 H H    . CYS A 1 4  ? 0.613   4.080  -1.007  1.00 1.00 ? 4  CYS A H    15 
ATOM   10689 H HA   . CYS A 1 4  ? 2.594   3.235  -3.119  1.00 1.00 ? 4  CYS A HA   15 
ATOM   10690 H HB2  . CYS A 1 4  ? -0.349  3.626  -3.136  1.00 1.00 ? 4  CYS A HB2  15 
ATOM   10691 H HB3  . CYS A 1 4  ? 0.570   4.037  -4.596  1.00 1.00 ? 4  CYS A HB3  15 
ATOM   10692 N N    . GLU A 1 5  ? 3.449   5.549  -3.057  1.00 1.00 ? 5  GLU A N    15 
ATOM   10693 C CA   . GLU A 1 5  ? 4.018   6.870  -3.211  1.00 1.00 ? 5  GLU A CA   15 
ATOM   10694 C C    . GLU A 1 5  ? 3.674   7.378  -4.611  1.00 1.00 ? 5  GLU A C    15 
ATOM   10695 O O    . GLU A 1 5  ? 4.268   6.925  -5.587  1.00 1.00 ? 5  GLU A O    15 
ATOM   10696 C CB   . GLU A 1 5  ? 5.537   6.800  -2.983  1.00 1.00 ? 5  GLU A CB   15 
ATOM   10697 C CG   . GLU A 1 5  ? 5.905   6.284  -1.581  1.00 1.00 ? 5  GLU A CG   15 
ATOM   10698 C CD   . GLU A 1 5  ? 5.944   4.762  -1.428  1.00 1.00 ? 5  GLU A CD   15 
ATOM   10699 O OE1  . GLU A 1 5  ? 5.659   4.024  -2.375  1.00 1.00 ? 5  GLU A OE1  15 
ATOM   10700 O OE2  . GLU A 1 5  ? 6.296   4.295  -0.200  1.00 1.00 ? 5  GLU A OE2  15 
ATOM   10701 H H    . GLU A 1 5  ? 4.095   4.769  -3.090  1.00 1.00 ? 5  GLU A H    15 
ATOM   10702 H HA   . GLU A 1 5  ? 3.590   7.538  -2.463  1.00 1.00 ? 5  GLU A HA   15 
ATOM   10703 H HB2  . GLU A 1 5  ? 6.017   6.189  -3.751  1.00 1.00 ? 5  GLU A HB2  15 
ATOM   10704 H HB3  . GLU A 1 5  ? 5.921   7.817  -3.080  1.00 1.00 ? 5  GLU A HB3  15 
ATOM   10705 H HG2  . GLU A 1 5  ? 6.898   6.663  -1.335  1.00 1.00 ? 5  GLU A HG2  15 
ATOM   10706 H HG3  . GLU A 1 5  ? 5.189   6.685  -0.865  1.00 1.00 ? 5  GLU A HG3  15 
ATOM   10707 H HE2  . GLU A 1 5  ? 6.517   5.001  0.411   1.00 1.00 ? 5  GLU A HE2  15 
ATOM   10708 N N    . ARG A 1 6  ? 2.704   8.286  -4.726  1.00 1.00 ? 6  ARG A N    15 
ATOM   10709 C CA   . ARG A 1 6  ? 2.361   8.875  -6.010  1.00 1.00 ? 6  ARG A CA   15 
ATOM   10710 C C    . ARG A 1 6  ? 3.377   9.972  -6.318  1.00 1.00 ? 6  ARG A C    15 
ATOM   10711 O O    . ARG A 1 6  ? 3.696   10.763 -5.425  1.00 1.00 ? 6  ARG A O    15 
ATOM   10712 C CB   . ARG A 1 6  ? 0.946   9.479  -6.008  1.00 1.00 ? 6  ARG A CB   15 
ATOM   10713 C CG   . ARG A 1 6  ? -0.154  8.459  -6.326  1.00 1.00 ? 6  ARG A CG   15 
ATOM   10714 C CD   . ARG A 1 6  ? -0.244  7.389  -5.241  1.00 1.00 ? 6  ARG A CD   15 
ATOM   10715 N NE   . ARG A 1 6  ? -1.518  6.658  -5.315  1.00 1.00 ? 6  ARG A NE   15 
ATOM   10716 C CZ   . ARG A 1 6  ? -2.097  6.071  -4.256  1.00 1.00 ? 6  ARG A CZ   15 
ATOM   10717 N NH1  . ARG A 1 6  ? -1.437  5.986  -3.103  1.00 1.00 ? 6  ARG A NH1  15 
ATOM   10718 N NH2  . ARG A 1 6  ? -3.325  5.556  -4.342  1.00 1.00 ? 6  ARG A NH2  15 
ATOM   10719 H H    . ARG A 1 6  ? 2.346   8.720  -3.881  1.00 1.00 ? 6  ARG A H    15 
ATOM   10720 H HA   . ARG A 1 6  ? 2.390   8.088  -6.764  1.00 1.00 ? 6  ARG A HA   15 
ATOM   10721 H HB2  . ARG A 1 6  ? 0.747   9.969  -5.056  1.00 1.00 ? 6  ARG A HB2  15 
ATOM   10722 H HB3  . ARG A 1 6  ? 0.883   10.243 -6.785  1.00 1.00 ? 6  ARG A HB3  15 
ATOM   10723 H HG2  . ARG A 1 6  ? -1.100  9.000  -6.379  1.00 1.00 ? 6  ARG A HG2  15 
ATOM   10724 H HG3  . ARG A 1 6  ? 0.033   7.996  -7.296  1.00 1.00 ? 6  ARG A HG3  15 
ATOM   10725 H HD2  . ARG A 1 6  ? 0.588   6.691  -5.347  1.00 1.00 ? 6  ARG A HD2  15 
ATOM   10726 H HD3  . ARG A 1 6  ? -0.162  7.901  -4.280  1.00 1.00 ? 6  ARG A HD3  15 
ATOM   10727 H HE   . ARG A 1 6  ? -2.007  6.682  -6.198  1.00 1.00 ? 6  ARG A HE   15 
ATOM   10728 H HH11 . ARG A 1 6  ? -0.479  6.314  -3.021  1.00 1.00 ? 6  ARG A HH11 15 
ATOM   10729 H HH12 . ARG A 1 6  ? -1.866  5.562  -2.286  1.00 1.00 ? 6  ARG A HH12 15 
ATOM   10730 H HH21 . ARG A 1 6  ? -3.853  5.552  -5.200  1.00 1.00 ? 6  ARG A HH21 15 
ATOM   10731 H HH22 . ARG A 1 6  ? -3.720  5.055  -3.543  1.00 1.00 ? 6  ARG A HH22 15 
ATOM   10732 N N    . PRO A 1 7  ? 3.880   10.038 -7.562  1.00 1.00 ? 7  PRO A N    15 
ATOM   10733 C CA   . PRO A 1 7  ? 4.659   11.170 -8.018  1.00 1.00 ? 7  PRO A CA   15 
ATOM   10734 C C    . PRO A 1 7  ? 3.691   12.337 -8.235  1.00 1.00 ? 7  PRO A C    15 
ATOM   10735 O O    . PRO A 1 7  ? 2.492   12.229 -7.963  1.00 1.00 ? 7  PRO A O    15 
ATOM   10736 C CB   . PRO A 1 7  ? 5.310   10.698 -9.322  1.00 1.00 ? 7  PRO A CB   15 
ATOM   10737 C CG   . PRO A 1 7  ? 4.250   9.762  -9.902  1.00 1.00 ? 7  PRO A CG   15 
ATOM   10738 C CD   . PRO A 1 7  ? 3.640   9.111  -8.659  1.00 1.00 ? 7  PRO A CD   15 
ATOM   10739 H HA   . PRO A 1 7  ? 5.415   11.450 -7.287  1.00 1.00 ? 7  PRO A HA   15 
ATOM   10740 H HB2  . PRO A 1 7  ? 5.562   11.512 -10.002 1.00 1.00 ? 7  PRO A HB2  15 
ATOM   10741 H HB3  . PRO A 1 7  ? 6.204   10.121 -9.084  1.00 1.00 ? 7  PRO A HB3  15 
ATOM   10742 H HG2  . PRO A 1 7  ? 3.488   10.353 -10.415 1.00 1.00 ? 7  PRO A HG2  15 
ATOM   10743 H HG3  . PRO A 1 7  ? 4.676   9.029  -10.587 1.00 1.00 ? 7  PRO A HG3  15 
ATOM   10744 H HD2  . PRO A 1 7  ? 2.575   8.943  -8.827  1.00 1.00 ? 7  PRO A HD2  15 
ATOM   10745 H HD3  . PRO A 1 7  ? 4.147   8.167  -8.450  1.00 1.00 ? 7  PRO A HD3  15 
ATOM   10746 N N    . SER A 1 8  ? 4.194   13.466 -8.732  1.00 1.00 ? 8  SER A N    15 
ATOM   10747 C CA   . SER A 1 8  ? 3.397   14.673 -8.801  1.00 1.00 ? 8  SER A CA   15 
ATOM   10748 C C    . SER A 1 8  ? 2.382   14.595 -9.952  1.00 1.00 ? 8  SER A C    15 
ATOM   10749 O O    . SER A 1 8  ? 2.578   15.165 -11.025 1.00 1.00 ? 8  SER A O    15 
ATOM   10750 C CB   . SER A 1 8  ? 4.375   15.844 -8.926  1.00 1.00 ? 8  SER A CB   15 
ATOM   10751 O OG   . SER A 1 8  ? 5.522   15.573 -8.139  1.00 1.00 ? 8  SER A OG   15 
ATOM   10752 H H    . SER A 1 8  ? 5.184   13.564 -8.906  1.00 1.00 ? 8  SER A H    15 
ATOM   10753 H HA   . SER A 1 8  ? 2.859   14.799 -7.859  1.00 1.00 ? 8  SER A HA   15 
ATOM   10754 H HB2  . SER A 1 8  ? 4.678   16.007 -9.962  1.00 1.00 ? 8  SER A HB2  15 
ATOM   10755 H HB3  . SER A 1 8  ? 3.876   16.731 -8.546  1.00 1.00 ? 8  SER A HB3  15 
ATOM   10756 H HG   . SER A 1 8  ? 5.205   15.185 -7.312  1.00 1.00 ? 8  SER A HG   15 
ATOM   10757 N N    . GLY A 1 9  ? 1.257   13.932 -9.682  1.00 1.00 ? 9  GLY A N    15 
ATOM   10758 C CA   . GLY A 1 9  ? 0.177   13.712 -10.636 1.00 1.00 ? 9  GLY A CA   15 
ATOM   10759 C C    . GLY A 1 9  ? -0.710  14.945 -10.771 1.00 1.00 ? 9  GLY A C    15 
ATOM   10760 O O    . GLY A 1 9  ? -1.270  15.198 -11.833 1.00 1.00 ? 9  GLY A O    15 
ATOM   10761 H H    . GLY A 1 9  ? 1.258   13.393 -8.821  1.00 1.00 ? 9  GLY A H    15 
ATOM   10762 H HA2  . GLY A 1 9  ? 0.590   13.453 -11.612 1.00 1.00 ? 9  GLY A HA2  15 
ATOM   10763 H HA3  . GLY A 1 9  ? -0.435  12.881 -10.286 1.00 1.00 ? 9  GLY A HA3  15 
ATOM   10764 N N    . THR A 1 10 ? -0.847  15.709 -9.685  1.00 1.00 ? 10 THR A N    15 
ATOM   10765 C CA   . THR A 1 10 ? -1.529  16.986 -9.676  1.00 1.00 ? 10 THR A CA   15 
ATOM   10766 C C    . THR A 1 10 ? -0.518  18.043 -10.122 1.00 1.00 ? 10 THR A C    15 
ATOM   10767 O O    . THR A 1 10 ? -0.606  18.627 -11.201 1.00 1.00 ? 10 THR A O    15 
ATOM   10768 C CB   . THR A 1 10 ? -1.993  17.246 -8.233  1.00 1.00 ? 10 THR A CB   15 
ATOM   10769 O OG1  . THR A 1 10 ? -0.937  16.931 -7.339  1.00 1.00 ? 10 THR A OG1  15 
ATOM   10770 C CG2  . THR A 1 10 ? -3.188  16.379 -7.834  1.00 1.00 ? 10 THR A CG2  15 
ATOM   10771 H H    . THR A 1 10 ? -0.392  15.453 -8.821  1.00 1.00 ? 10 THR A H    15 
ATOM   10772 H HA   . THR A 1 10 ? -2.386  16.989 -10.352 1.00 1.00 ? 10 THR A HA   15 
ATOM   10773 H HB   . THR A 1 10 ? -2.271  18.297 -8.130  1.00 1.00 ? 10 THR A HB   15 
ATOM   10774 H HG1  . THR A 1 10 ? -1.167  17.335 -6.490  1.00 1.00 ? 10 THR A HG1  15 
ATOM   10775 H HG21 . THR A 1 10 ? -2.930  15.323 -7.907  1.00 1.00 ? 10 THR A HG21 15 
ATOM   10776 H HG22 . THR A 1 10 ? -3.468  16.605 -6.804  1.00 1.00 ? 10 THR A HG22 15 
ATOM   10777 H HG23 . THR A 1 10 ? -4.035  16.593 -8.485  1.00 1.00 ? 10 THR A HG23 15 
ATOM   10778 N N    . TRP A 1 11 ? 0.470   18.273 -9.260  1.00 1.00 ? 11 TRP A N    15 
ATOM   10779 C CA   . TRP A 1 11 ? 1.511   19.265 -9.439  1.00 1.00 ? 11 TRP A CA   15 
ATOM   10780 C C    . TRP A 1 11 ? 2.543   18.742 -10.437 1.00 1.00 ? 11 TRP A C    15 
ATOM   10781 O O    . TRP A 1 11 ? 3.685   18.475 -10.074 1.00 1.00 ? 11 TRP A O    15 
ATOM   10782 C CB   . TRP A 1 11 ? 2.114   19.568 -8.060  1.00 1.00 ? 11 TRP A CB   15 
ATOM   10783 C CG   . TRP A 1 11 ? 2.948   20.807 -7.912  1.00 1.00 ? 11 TRP A CG   15 
ATOM   10784 C CD1  . TRP A 1 11 ? 3.857   21.300 -8.786  1.00 1.00 ? 11 TRP A CD1  15 
ATOM   10785 C CD2  . TRP A 1 11 ? 2.980   21.706 -6.768  1.00 1.00 ? 11 TRP A CD2  15 
ATOM   10786 N NE1  . TRP A 1 11 ? 4.440   22.436 -8.268  1.00 1.00 ? 11 TRP A NE1  15 
ATOM   10787 C CE2  . TRP A 1 11 ? 3.924   22.740 -7.026  1.00 1.00 ? 11 TRP A CE2  15 
ATOM   10788 C CE3  . TRP A 1 11 ? 2.319   21.731 -5.523  1.00 1.00 ? 11 TRP A CE3  15 
ATOM   10789 C CZ2  . TRP A 1 11 ? 4.197   23.748 -6.092  1.00 1.00 ? 11 TRP A CZ2  15 
ATOM   10790 C CZ3  . TRP A 1 11 ? 2.577   22.742 -4.584  1.00 1.00 ? 11 TRP A CZ3  15 
ATOM   10791 C CH2  . TRP A 1 11 ? 3.541   23.724 -4.852  1.00 1.00 ? 11 TRP A CH2  15 
ATOM   10792 H H    . TRP A 1 11 ? 0.427   17.757 -8.388  1.00 1.00 ? 11 TRP A H    15 
ATOM   10793 H HA   . TRP A 1 11 ? 1.068   20.183 -9.829  1.00 1.00 ? 11 TRP A HA   15 
ATOM   10794 H HB2  . TRP A 1 11 ? 1.280   19.685 -7.367  1.00 1.00 ? 11 TRP A HB2  15 
ATOM   10795 H HB3  . TRP A 1 11 ? 2.699   18.715 -7.716  1.00 1.00 ? 11 TRP A HB3  15 
ATOM   10796 H HD1  . TRP A 1 11 ? 4.123   20.877 -9.739  1.00 1.00 ? 11 TRP A HD1  15 
ATOM   10797 H HE1  . TRP A 1 11 ? 5.218   22.942 -8.687  1.00 1.00 ? 11 TRP A HE1  15 
ATOM   10798 H HE3  . TRP A 1 11 ? 1.617   20.951 -5.289  1.00 1.00 ? 11 TRP A HE3  15 
ATOM   10799 H HZ2  . TRP A 1 11 ? 4.933   24.509 -6.309  1.00 1.00 ? 11 TRP A HZ2  15 
ATOM   10800 H HZ3  . TRP A 1 11 ? 2.042   22.755 -3.647  1.00 1.00 ? 11 TRP A HZ3  15 
ATOM   10801 H HH2  . TRP A 1 11 ? 3.793   24.440 -4.093  1.00 1.00 ? 11 TRP A HH2  15 
ATOM   10802 N N    . SER A 1 12 ? 2.190   18.646 -11.717 1.00 1.00 ? 12 SER A N    15 
ATOM   10803 C CA   . SER A 1 12 ? 3.088   18.046 -12.693 1.00 1.00 ? 12 SER A CA   15 
ATOM   10804 C C    . SER A 1 12 ? 4.025   19.131 -13.222 1.00 1.00 ? 12 SER A C    15 
ATOM   10805 O O    . SER A 1 12 ? 3.968   19.533 -14.381 1.00 1.00 ? 12 SER A O    15 
ATOM   10806 C CB   . SER A 1 12 ? 2.266   17.377 -13.794 1.00 1.00 ? 12 SER A CB   15 
ATOM   10807 O OG   . SER A 1 12 ? 1.372   16.458 -13.198 1.00 1.00 ? 12 SER A OG   15 
ATOM   10808 H H    . SER A 1 12 ? 1.211   18.782 -11.957 1.00 1.00 ? 12 SER A H    15 
ATOM   10809 H HA   . SER A 1 12 ? 3.695   17.265 -12.231 1.00 1.00 ? 12 SER A HA   15 
ATOM   10810 H HB2  . SER A 1 12 ? 1.702   18.126 -14.354 1.00 1.00 ? 12 SER A HB2  15 
ATOM   10811 H HB3  . SER A 1 12 ? 2.935   16.855 -14.480 1.00 1.00 ? 12 SER A HB3  15 
ATOM   10812 H HG   . SER A 1 12 ? 1.834   15.965 -12.505 1.00 1.00 ? 12 SER A HG   15 
ATOM   10813 N N    . GLY A 1 13 ? 4.896   19.586 -12.319 1.00 1.00 ? 13 GLY A N    15 
ATOM   10814 C CA   . GLY A 1 13 ? 5.918   20.596 -12.501 1.00 1.00 ? 13 GLY A CA   15 
ATOM   10815 C C    . GLY A 1 13 ? 6.808   20.555 -11.259 1.00 1.00 ? 13 GLY A C    15 
ATOM   10816 O O    . GLY A 1 13 ? 6.590   19.726 -10.376 1.00 1.00 ? 13 GLY A O    15 
ATOM   10817 H H    . GLY A 1 13 ? 4.866   19.173 -11.387 1.00 1.00 ? 13 GLY A H    15 
ATOM   10818 H HA2  . GLY A 1 13 ? 6.510   20.377 -13.390 1.00 1.00 ? 13 GLY A HA2  15 
ATOM   10819 H HA3  . GLY A 1 13 ? 5.453   21.577 -12.596 1.00 1.00 ? 13 GLY A HA3  15 
ATOM   10820 N N    . VAL A 1 14 ? 7.809   21.432 -11.175 1.00 1.00 ? 14 VAL A N    15 
ATOM   10821 C CA   . VAL A 1 14 ? 8.701   21.462 -10.023 1.00 1.00 ? 14 VAL A CA   15 
ATOM   10822 C C    . VAL A 1 14 ? 7.905   21.881 -8.782  1.00 1.00 ? 14 VAL A C    15 
ATOM   10823 O O    . VAL A 1 14 ? 7.106   22.816 -8.843  1.00 1.00 ? 14 VAL A O    15 
ATOM   10824 C CB   . VAL A 1 14 ? 9.889   22.402 -10.290 1.00 1.00 ? 14 VAL A CB   15 
ATOM   10825 C CG1  . VAL A 1 14 ? 10.893  22.364 -9.132  1.00 1.00 ? 14 VAL A CG1  15 
ATOM   10826 C CG2  . VAL A 1 14 ? 10.616  22.019 -11.588 1.00 1.00 ? 14 VAL A CG2  15 
ATOM   10827 H H    . VAL A 1 14 ? 7.925   22.126 -11.897 1.00 1.00 ? 14 VAL A H    15 
ATOM   10828 H HA   . VAL A 1 14 ? 9.092   20.454 -9.875  1.00 1.00 ? 14 VAL A HA   15 
ATOM   10829 H HB   . VAL A 1 14 ? 9.516   23.422 -10.383 1.00 1.00 ? 14 VAL A HB   15 
ATOM   10830 H HG11 . VAL A 1 14 ? 11.188  21.336 -8.927  1.00 1.00 ? 14 VAL A HG11 15 
ATOM   10831 H HG12 . VAL A 1 14 ? 11.779  22.947 -9.386  1.00 1.00 ? 14 VAL A HG12 15 
ATOM   10832 H HG13 . VAL A 1 14 ? 10.450  22.798 -8.238  1.00 1.00 ? 14 VAL A HG13 15 
ATOM   10833 H HG21 . VAL A 1 14 ? 10.918  20.972 -11.549 1.00 1.00 ? 14 VAL A HG21 15 
ATOM   10834 H HG22 . VAL A 1 14 ? 9.972   22.171 -12.452 1.00 1.00 ? 14 VAL A HG22 15 
ATOM   10835 H HG23 . VAL A 1 14 ? 11.503  22.641 -11.713 1.00 1.00 ? 14 VAL A HG23 15 
ATOM   10836 N N    . CYS A 1 15 ? 8.119   21.191 -7.657  1.00 1.00 ? 15 CYS A N    15 
ATOM   10837 C CA   . CYS A 1 15 ? 7.345   21.419 -6.437  1.00 1.00 ? 15 CYS A CA   15 
ATOM   10838 C C    . CYS A 1 15 ? 7.753   22.709 -5.733  1.00 1.00 ? 15 CYS A C    15 
ATOM   10839 O O    . CYS A 1 15 ? 6.954   23.324 -5.031  1.00 1.00 ? 15 CYS A O    15 
ATOM   10840 C CB   . CYS A 1 15 ? 7.503   20.253 -5.458  1.00 1.00 ? 15 CYS A CB   15 
ATOM   10841 S SG   . CYS A 1 15 ? 8.778   20.499 -4.201  1.00 1.00 ? 15 CYS A SG   15 
ATOM   10842 H H    . CYS A 1 15 ? 8.776   20.418 -7.691  1.00 1.00 ? 15 CYS A H    15 
ATOM   10843 H HA   . CYS A 1 15 ? 6.293   21.469 -6.702  1.00 1.00 ? 15 CYS A HA   15 
ATOM   10844 H HB2  . CYS A 1 15 ? 6.572   20.154 -4.907  1.00 1.00 ? 15 CYS A HB2  15 
ATOM   10845 H HB3  . CYS A 1 15 ? 7.694   19.328 -5.998  1.00 1.00 ? 15 CYS A HB3  15 
ATOM   10846 N N    . GLY A 1 16 ? 9.035   23.067 -5.824  1.00 1.00 ? 16 GLY A N    15 
ATOM   10847 C CA   . GLY A 1 16 ? 9.612   24.137 -5.036  1.00 1.00 ? 16 GLY A CA   15 
ATOM   10848 C C    . GLY A 1 16 ? 9.751   23.745 -3.561  1.00 1.00 ? 16 GLY A C    15 
ATOM   10849 O O    . GLY A 1 16 ? 10.873  23.558 -3.089  1.00 1.00 ? 16 GLY A O    15 
ATOM   10850 H H    . GLY A 1 16 ? 9.650   22.486 -6.371  1.00 1.00 ? 16 GLY A H    15 
ATOM   10851 H HA2  . GLY A 1 16 ? 10.600  24.367 -5.437  1.00 1.00 ? 16 GLY A HA2  15 
ATOM   10852 H HA3  . GLY A 1 16 ? 8.995   25.033 -5.116  1.00 1.00 ? 16 GLY A HA3  15 
ATOM   10853 N N    . ASN A 1 17 ? 8.628   23.591 -2.846  1.00 1.00 ? 17 ASN A N    15 
ATOM   10854 C CA   . ASN A 1 17 ? 8.580   23.461 -1.390  1.00 1.00 ? 17 ASN A CA   15 
ATOM   10855 C C    . ASN A 1 17 ? 7.723   22.292 -0.871  1.00 1.00 ? 17 ASN A C    15 
ATOM   10856 O O    . ASN A 1 17 ? 6.599   22.066 -1.322  1.00 1.00 ? 17 ASN A O    15 
ATOM   10857 C CB   . ASN A 1 17 ? 8.052   24.779 -0.815  1.00 1.00 ? 17 ASN A CB   15 
ATOM   10858 C CG   . ASN A 1 17 ? 7.877   24.692 0.695   1.00 1.00 ? 17 ASN A CG   15 
ATOM   10859 O OD1  . ASN A 1 17 ? 6.780   24.439 1.178   1.00 1.00 ? 17 ASN A OD1  15 
ATOM   10860 N ND2  . ASN A 1 17 ? 8.957   24.855 1.453   1.00 1.00 ? 17 ASN A ND2  15 
ATOM   10861 H H    . ASN A 1 17 ? 7.754   23.586 -3.363  1.00 1.00 ? 17 ASN A H    15 
ATOM   10862 H HA   . ASN A 1 17 ? 9.593   23.326 -1.010  1.00 1.00 ? 17 ASN A HA   15 
ATOM   10863 H HB2  . ASN A 1 17 ? 8.737   25.592 -1.060  1.00 1.00 ? 17 ASN A HB2  15 
ATOM   10864 H HB3  . ASN A 1 17 ? 7.081   24.999 -1.261  1.00 1.00 ? 17 ASN A HB3  15 
ATOM   10865 H HD21 . ASN A 1 17 ? 9.847   25.086 1.034   1.00 1.00 ? 17 ASN A HD21 15 
ATOM   10866 H HD22 . ASN A 1 17 ? 8.855   24.835 2.455   1.00 1.00 ? 17 ASN A HD22 15 
ATOM   10867 N N    . ASN A 1 18 ? 8.255   21.604 0.150   1.00 1.00 ? 18 ASN A N    15 
ATOM   10868 C CA   . ASN A 1 18 ? 7.633   20.505 0.874   1.00 1.00 ? 18 ASN A CA   15 
ATOM   10869 C C    . ASN A 1 18 ? 6.241   20.833 1.393   1.00 1.00 ? 18 ASN A C    15 
ATOM   10870 O O    . ASN A 1 18 ? 5.275   20.169 1.039   1.00 1.00 ? 18 ASN A O    15 
ATOM   10871 C CB   . ASN A 1 18 ? 8.542   20.094 2.035   1.00 1.00 ? 18 ASN A CB   15 
ATOM   10872 C CG   . ASN A 1 18 ? 8.052   18.790 2.642   1.00 1.00 ? 18 ASN A CG   15 
ATOM   10873 O OD1  . ASN A 1 18 ? 7.227   18.782 3.554   1.00 1.00 ? 18 ASN A OD1  15 
ATOM   10874 N ND2  . ASN A 1 18 ? 8.513   17.662 2.124   1.00 1.00 ? 18 ASN A ND2  15 
ATOM   10875 H H    . ASN A 1 18 ? 9.186   21.850 0.451   1.00 1.00 ? 18 ASN A H    15 
ATOM   10876 H HA   . ASN A 1 18 ? 7.525   19.656 0.213   1.00 1.00 ? 18 ASN A HA   15 
ATOM   10877 H HB2  . ASN A 1 18 ? 9.556   19.973 1.670   1.00 1.00 ? 18 ASN A HB2  15 
ATOM   10878 H HB3  . ASN A 1 18 ? 8.564   20.863 2.808   1.00 1.00 ? 18 ASN A HB3  15 
ATOM   10879 H HD21 . ASN A 1 18 ? 9.181   17.618 1.351   1.00 1.00 ? 18 ASN A HD21 15 
ATOM   10880 H HD22 . ASN A 1 18 ? 8.171   16.814 2.553   1.00 1.00 ? 18 ASN A HD22 15 
ATOM   10881 N N    . ASN A 1 19 ? 6.161   21.820 2.278   1.00 1.00 ? 19 ASN A N    15 
ATOM   10882 C CA   . ASN A 1 19 ? 4.922   22.263 2.914   1.00 1.00 ? 19 ASN A CA   15 
ATOM   10883 C C    . ASN A 1 19 ? 3.842   22.593 1.882   1.00 1.00 ? 19 ASN A C    15 
ATOM   10884 O O    . ASN A 1 19 ? 2.682   22.222 2.070   1.00 1.00 ? 19 ASN A O    15 
ATOM   10885 C CB   . ASN A 1 19 ? 5.171   23.457 3.846   1.00 1.00 ? 19 ASN A CB   15 
ATOM   10886 C CG   . ASN A 1 19 ? 4.100   23.613 4.931   1.00 1.00 ? 19 ASN A CG   15 
ATOM   10887 O OD1  . ASN A 1 19 ? 4.426   23.951 6.062   1.00 1.00 ? 19 ASN A OD1  15 
ATOM   10888 N ND2  . ASN A 1 19 ? 2.824   23.360 4.642   1.00 1.00 ? 19 ASN A ND2  15 
ATOM   10889 H H    . ASN A 1 19 ? 7.044   22.224 2.541   1.00 1.00 ? 19 ASN A H    15 
ATOM   10890 H HA   . ASN A 1 19 ? 4.562   21.447 3.532   1.00 1.00 ? 19 ASN A HA   15 
ATOM   10891 H HB2  . ASN A 1 19 ? 6.127   23.314 4.352   1.00 1.00 ? 19 ASN A HB2  15 
ATOM   10892 H HB3  . ASN A 1 19 ? 5.225   24.381 3.270   1.00 1.00 ? 19 ASN A HB3  15 
ATOM   10893 H HD21 . ASN A 1 19 ? 2.522   23.048 3.725   1.00 1.00 ? 19 ASN A HD21 15 
ATOM   10894 H HD22 . ASN A 1 19 ? 2.150   23.486 5.381   1.00 1.00 ? 19 ASN A HD22 15 
ATOM   10895 N N    . ALA A 1 20 ? 4.203   23.309 0.817   1.00 1.00 ? 20 ALA A N    15 
ATOM   10896 C CA   . ALA A 1 20 ? 3.253   23.637 -0.234  1.00 1.00 ? 20 ALA A CA   15 
ATOM   10897 C C    . ALA A 1 20 ? 2.745   22.356 -0.889  1.00 1.00 ? 20 ALA A C    15 
ATOM   10898 O O    . ALA A 1 20 ? 1.538   22.124 -0.936  1.00 1.00 ? 20 ALA A O    15 
ATOM   10899 C CB   . ALA A 1 20 ? 3.890   24.551 -1.277  1.00 1.00 ? 20 ALA A CB   15 
ATOM   10900 H H    . ALA A 1 20 ? 5.162   23.634 0.747   1.00 1.00 ? 20 ALA A H    15 
ATOM   10901 H HA   . ALA A 1 20 ? 2.406   24.165 0.211   1.00 1.00 ? 20 ALA A HA   15 
ATOM   10902 H HB1  . ALA A 1 20 ? 4.290   25.442 -0.798  1.00 1.00 ? 20 ALA A HB1  15 
ATOM   10903 H HB2  . ALA A 1 20 ? 4.687   24.027 -1.807  1.00 1.00 ? 20 ALA A HB2  15 
ATOM   10904 H HB3  . ALA A 1 20 ? 3.115   24.842 -1.987  1.00 1.00 ? 20 ALA A HB3  15 
ATOM   10905 N N    . CYS A 1 21 ? 3.671   21.524 -1.378  1.00 1.00 ? 21 CYS A N    15 
ATOM   10906 C CA   . CYS A 1 21 ? 3.339   20.247 -2.001  1.00 1.00 ? 21 CYS A CA   15 
ATOM   10907 C C    . CYS A 1 21 ? 2.398   19.434 -1.114  1.00 1.00 ? 21 CYS A C    15 
ATOM   10908 O O    . CYS A 1 21 ? 1.352   18.977 -1.568  1.00 1.00 ? 21 CYS A O    15 
ATOM   10909 C CB   . CYS A 1 21 ? 4.613   19.440 -2.251  1.00 1.00 ? 21 CYS A CB   15 
ATOM   10910 S SG   . CYS A 1 21 ? 4.348   17.652 -2.391  1.00 1.00 ? 21 CYS A SG   15 
ATOM   10911 H H    . CYS A 1 21 ? 4.653   21.781 -1.302  1.00 1.00 ? 21 CYS A H    15 
ATOM   10912 H HA   . CYS A 1 21 ? 2.860   20.456 -2.958  1.00 1.00 ? 21 CYS A HA   15 
ATOM   10913 H HB2  . CYS A 1 21 ? 5.089   19.807 -3.157  1.00 1.00 ? 21 CYS A HB2  15 
ATOM   10914 H HB3  . CYS A 1 21 ? 5.298   19.581 -1.419  1.00 1.00 ? 21 CYS A HB3  15 
ATOM   10915 N N    . LYS A 1 22 ? 2.800   19.265 0.148   1.00 1.00 ? 22 LYS A N    15 
ATOM   10916 C CA   . LYS A 1 22 ? 2.088   18.573 1.207   1.00 1.00 ? 22 LYS A CA   15 
ATOM   10917 C C    . LYS A 1 22 ? 0.651   19.067 1.271   1.00 1.00 ? 22 LYS A C    15 
ATOM   10918 O O    . LYS A 1 22 ? -0.283  18.287 1.066   1.00 1.00 ? 22 LYS A O    15 
ATOM   10919 C CB   . LYS A 1 22 ? 2.853   18.824 2.519   1.00 1.00 ? 22 LYS A CB   15 
ATOM   10920 C CG   . LYS A 1 22 ? 2.164   18.326 3.798   1.00 1.00 ? 22 LYS A CG   15 
ATOM   10921 C CD   . LYS A 1 22 ? 2.949   18.679 5.080   1.00 1.00 ? 22 LYS A CD   15 
ATOM   10922 C CE   . LYS A 1 22 ? 4.487   18.682 4.978   1.00 1.00 ? 22 LYS A CE   15 
ATOM   10923 N NZ   . LYS A 1 22 ? 5.065   17.381 4.593   1.00 1.00 ? 22 LYS A NZ   15 
ATOM   10924 H H    . LYS A 1 22 ? 3.679   19.698 0.394   1.00 1.00 ? 22 LYS A H    15 
ATOM   10925 H HA   . LYS A 1 22 ? 2.079   17.508 0.991   1.00 1.00 ? 22 LYS A HA   15 
ATOM   10926 H HB2  . LYS A 1 22 ? 3.825   18.350 2.405   1.00 1.00 ? 22 LYS A HB2  15 
ATOM   10927 H HB3  . LYS A 1 22 ? 3.011   19.890 2.640   1.00 1.00 ? 22 LYS A HB3  15 
ATOM   10928 H HG2  . LYS A 1 22 ? 1.184   18.800 3.889   1.00 1.00 ? 22 LYS A HG2  15 
ATOM   10929 H HG3  . LYS A 1 22 ? 1.977   17.258 3.727   1.00 1.00 ? 22 LYS A HG3  15 
ATOM   10930 H HD2  . LYS A 1 22 ? 2.659   19.694 5.363   1.00 1.00 ? 22 LYS A HD2  15 
ATOM   10931 H HD3  . LYS A 1 22 ? 2.626   18.018 5.887   1.00 1.00 ? 22 LYS A HD3  15 
ATOM   10932 H HE2  . LYS A 1 22 ? 4.800   19.415 4.239   1.00 1.00 ? 22 LYS A HE2  15 
ATOM   10933 H HE3  . LYS A 1 22 ? 4.912   18.984 5.937   1.00 1.00 ? 22 LYS A HE3  15 
ATOM   10934 H HZ1  . LYS A 1 22 ? 4.570   16.991 3.803   1.00 1.00 ? 22 LYS A HZ1  15 
ATOM   10935 H HZ2  . LYS A 1 22 ? 6.036   17.490 4.296   1.00 1.00 ? 22 LYS A HZ2  15 
ATOM   10936 H HZ3  . LYS A 1 22 ? 5.023   16.713 5.346   1.00 1.00 ? 22 LYS A HZ3  15 
ATOM   10937 N N    . ASN A 1 23 ? 0.499   20.363 1.572   1.00 1.00 ? 23 ASN A N    15 
ATOM   10938 C CA   . ASN A 1 23 ? -0.803  20.995 1.688   1.00 1.00 ? 23 ASN A CA   15 
ATOM   10939 C C    . ASN A 1 23 ? -1.603  20.670 0.435   1.00 1.00 ? 23 ASN A C    15 
ATOM   10940 O O    . ASN A 1 23 ? -2.616  19.987 0.516   1.00 1.00 ? 23 ASN A O    15 
ATOM   10941 C CB   . ASN A 1 23 ? -0.640  22.511 1.889   1.00 1.00 ? 23 ASN A CB   15 
ATOM   10942 C CG   . ASN A 1 23 ? -1.963  23.284 1.980   1.00 1.00 ? 23 ASN A CG   15 
ATOM   10943 O OD1  . ASN A 1 23 ? -2.956  22.976 1.324   1.00 1.00 ? 23 ASN A OD1  15 
ATOM   10944 N ND2  . ASN A 1 23 ? -1.985  24.333 2.795   1.00 1.00 ? 23 ASN A ND2  15 
ATOM   10945 H H    . ASN A 1 23 ? 1.326   20.944 1.677   1.00 1.00 ? 23 ASN A H    15 
ATOM   10946 H HA   . ASN A 1 23 ? -1.295  20.554 2.556   1.00 1.00 ? 23 ASN A HA   15 
ATOM   10947 H HB2  . ASN A 1 23 ? -0.078  22.665 2.810   1.00 1.00 ? 23 ASN A HB2  15 
ATOM   10948 H HB3  . ASN A 1 23 ? -0.063  22.934 1.067   1.00 1.00 ? 23 ASN A HB3  15 
ATOM   10949 H HD21 . ASN A 1 23 ? -1.157  24.601 3.307   1.00 1.00 ? 23 ASN A HD21 15 
ATOM   10950 H HD22 . ASN A 1 23 ? -2.836  24.867 2.876   1.00 1.00 ? 23 ASN A HD22 15 
ATOM   10951 N N    . GLN A 1 24 ? -1.099  21.098 -0.725  1.00 1.00 ? 24 GLN A N    15 
ATOM   10952 C CA   . GLN A 1 24 ? -1.730  20.863 -2.010  1.00 1.00 ? 24 GLN A CA   15 
ATOM   10953 C C    . GLN A 1 24 ? -2.207  19.418 -2.141  1.00 1.00 ? 24 GLN A C    15 
ATOM   10954 O O    . GLN A 1 24 ? -3.369  19.206 -2.470  1.00 1.00 ? 24 GLN A O    15 
ATOM   10955 C CB   . GLN A 1 24 ? -0.778  21.321 -3.127  1.00 1.00 ? 24 GLN A CB   15 
ATOM   10956 C CG   . GLN A 1 24 ? -1.206  20.908 -4.545  1.00 1.00 ? 24 GLN A CG   15 
ATOM   10957 C CD   . GLN A 1 24 ? -0.935  19.440 -4.885  1.00 1.00 ? 24 GLN A CD   15 
ATOM   10958 O OE1  . GLN A 1 24 ? -1.742  18.789 -5.539  1.00 1.00 ? 24 GLN A OE1  15 
ATOM   10959 N NE2  . GLN A 1 24 ? 0.190   18.885 -4.443  1.00 1.00 ? 24 GLN A NE2  15 
ATOM   10960 H H    . GLN A 1 24 ? -0.202  21.574 -0.717  1.00 1.00 ? 24 GLN A H    15 
ATOM   10961 H HA   . GLN A 1 24 ? -2.632  21.477 -2.056  1.00 1.00 ? 24 GLN A HA   15 
ATOM   10962 H HB2  . GLN A 1 24 ? -0.756  22.412 -3.097  1.00 1.00 ? 24 GLN A HB2  15 
ATOM   10963 H HB3  . GLN A 1 24 ? 0.232   20.979 -2.921  1.00 1.00 ? 24 GLN A HB3  15 
ATOM   10964 H HG2  . GLN A 1 24 ? -2.268  21.118 -4.670  1.00 1.00 ? 24 GLN A HG2  15 
ATOM   10965 H HG3  . GLN A 1 24 ? -0.662  21.518 -5.264  1.00 1.00 ? 24 GLN A HG3  15 
ATOM   10966 H HE21 . GLN A 1 24 ? 0.801   19.393 -3.819  1.00 1.00 ? 24 GLN A HE21 15 
ATOM   10967 H HE22 . GLN A 1 24 ? 0.377   17.916 -4.650  1.00 1.00 ? 24 GLN A HE22 15 
ATOM   10968 N N    . CYS A 1 25 ? -1.358  18.424 -1.876  1.00 1.00 ? 25 CYS A N    15 
ATOM   10969 C CA   . CYS A 1 25 ? -1.760  17.039 -2.065  1.00 1.00 ? 25 CYS A CA   15 
ATOM   10970 C C    . CYS A 1 25 ? -2.961  16.706 -1.192  1.00 1.00 ? 25 CYS A C    15 
ATOM   10971 O O    . CYS A 1 25 ? -3.991  16.276 -1.706  1.00 1.00 ? 25 CYS A O    15 
ATOM   10972 C CB   . CYS A 1 25 ? -0.631  16.052 -1.778  1.00 1.00 ? 25 CYS A CB   15 
ATOM   10973 S SG   . CYS A 1 25 ? -1.193  14.368 -2.121  1.00 1.00 ? 25 CYS A SG   15 
ATOM   10974 H H    . CYS A 1 25 ? -0.414  18.637 -1.576  1.00 1.00 ? 25 CYS A H    15 
ATOM   10975 H HA   . CYS A 1 25 ? -2.048  16.912 -3.111  1.00 1.00 ? 25 CYS A HA   15 
ATOM   10976 H HB2  . CYS A 1 25 ? 0.223   16.272 -2.410  1.00 1.00 ? 25 CYS A HB2  15 
ATOM   10977 H HB3  . CYS A 1 25 ? -0.327  16.116 -0.733  1.00 1.00 ? 25 CYS A HB3  15 
ATOM   10978 N N    . ILE A 1 26 ? -2.834  16.913 0.124   1.00 1.00 ? 26 ILE A N    15 
ATOM   10979 C CA   . ILE A 1 26 ? -3.875  16.487 1.059   1.00 1.00 ? 26 ILE A CA   15 
ATOM   10980 C C    . ILE A 1 26 ? -5.111  17.399 0.990   1.00 1.00 ? 26 ILE A C    15 
ATOM   10981 O O    . ILE A 1 26 ? -6.196  17.045 1.468   1.00 1.00 ? 26 ILE A O    15 
ATOM   10982 C CB   . ILE A 1 26 ? -3.291  16.367 2.480   1.00 1.00 ? 26 ILE A CB   15 
ATOM   10983 C CG1  . ILE A 1 26 ? -3.042  17.736 3.138   1.00 1.00 ? 26 ILE A CG1  15 
ATOM   10984 C CG2  . ILE A 1 26 ? -2.000  15.534 2.432   1.00 1.00 ? 26 ILE A CG2  15 
ATOM   10985 C CD1  . ILE A 1 26 ? -2.394  17.617 4.521   1.00 1.00 ? 26 ILE A CD1  15 
ATOM   10986 H H    . ILE A 1 26 ? -1.999  17.376 0.478   1.00 1.00 ? 26 ILE A H    15 
ATOM   10987 H HA   . ILE A 1 26 ? -4.203  15.487 0.768   1.00 1.00 ? 26 ILE A HA   15 
ATOM   10988 H HB   . ILE A 1 26 ? -4.017  15.830 3.092   1.00 1.00 ? 26 ILE A HB   15 
ATOM   10989 H HG12 . ILE A 1 26 ? -2.397  18.341 2.507   1.00 1.00 ? 26 ILE A HG12 15 
ATOM   10990 H HG13 . ILE A 1 26 ? -3.993  18.253 3.263   1.00 1.00 ? 26 ILE A HG13 15 
ATOM   10991 H HG21 . ILE A 1 26 ? -2.156  14.635 1.839   1.00 1.00 ? 26 ILE A HG21 15 
ATOM   10992 H HG22 . ILE A 1 26 ? -1.182  16.104 1.999   1.00 1.00 ? 26 ILE A HG22 15 
ATOM   10993 H HG23 . ILE A 1 26 ? -1.717  15.241 3.438   1.00 1.00 ? 26 ILE A HG23 15 
ATOM   10994 H HD11 . ILE A 1 26 ? -2.963  16.926 5.144   1.00 1.00 ? 26 ILE A HD11 15 
ATOM   10995 H HD12 . ILE A 1 26 ? -1.366  17.264 4.433   1.00 1.00 ? 26 ILE A HD12 15 
ATOM   10996 H HD13 . ILE A 1 26 ? -2.381  18.598 4.997   1.00 1.00 ? 26 ILE A HD13 15 
ATOM   10997 N N    . ASN A 1 27 ? -4.950  18.576 0.380   1.00 1.00 ? 27 ASN A N    15 
ATOM   10998 C CA   . ASN A 1 27 ? -5.988  19.575 0.195   1.00 1.00 ? 27 ASN A CA   15 
ATOM   10999 C C    . ASN A 1 27 ? -6.803  19.221 -1.047  1.00 1.00 ? 27 ASN A C    15 
ATOM   11000 O O    . ASN A 1 27 ? -8.007  18.990 -0.942  1.00 1.00 ? 27 ASN A O    15 
ATOM   11001 C CB   . ASN A 1 27 ? -5.301  20.940 0.110   1.00 1.00 ? 27 ASN A CB   15 
ATOM   11002 C CG   . ASN A 1 27 ? -6.229  22.140 0.045   1.00 1.00 ? 27 ASN A CG   15 
ATOM   11003 O OD1  . ASN A 1 27 ? -7.400  22.031 -0.300  1.00 1.00 ? 27 ASN A OD1  15 
ATOM   11004 N ND2  . ASN A 1 27 ? -5.687  23.305 0.386   1.00 1.00 ? 27 ASN A ND2  15 
ATOM   11005 H H    . ASN A 1 27 ? -4.013  18.832 0.070   1.00 1.00 ? 27 ASN A H    15 
ATOM   11006 H HA   . ASN A 1 27 ? -6.647  19.582 1.064   1.00 1.00 ? 27 ASN A HA   15 
ATOM   11007 H HB2  . ASN A 1 27 ? -4.716  21.048 1.023   1.00 1.00 ? 27 ASN A HB2  15 
ATOM   11008 H HB3  . ASN A 1 27 ? -4.637  20.976 -0.754  1.00 1.00 ? 27 ASN A HB3  15 
ATOM   11009 H HD21 . ASN A 1 27 ? -4.712  23.329 0.683   1.00 1.00 ? 27 ASN A HD21 15 
ATOM   11010 H HD22 . ASN A 1 27 ? -6.252  24.139 0.359   1.00 1.00 ? 27 ASN A HD22 15 
ATOM   11011 N N    . LEU A 1 28 ? -6.144  19.095 -2.202  1.00 1.00 ? 28 LEU A N    15 
ATOM   11012 C CA   . LEU A 1 28 ? -6.783  18.748 -3.464  1.00 1.00 ? 28 LEU A CA   15 
ATOM   11013 C C    . LEU A 1 28 ? -7.253  17.293 -3.432  1.00 1.00 ? 28 LEU A C    15 
ATOM   11014 O O    . LEU A 1 28 ? -8.457  17.042 -3.425  1.00 1.00 ? 28 LEU A O    15 
ATOM   11015 C CB   . LEU A 1 28 ? -5.832  19.017 -4.647  1.00 1.00 ? 28 LEU A CB   15 
ATOM   11016 C CG   . LEU A 1 28 ? -5.900  20.467 -5.156  1.00 1.00 ? 28 LEU A CG   15 
ATOM   11017 C CD1  . LEU A 1 28 ? -5.479  21.494 -4.098  1.00 1.00 ? 28 LEU A CD1  15 
ATOM   11018 C CD2  . LEU A 1 28 ? -5.010  20.604 -6.396  1.00 1.00 ? 28 LEU A CD2  15 
ATOM   11019 H H    . LEU A 1 28 ? -5.140  19.226 -2.204  1.00 1.00 ? 28 LEU A H    15 
ATOM   11020 H HA   . LEU A 1 28 ? -7.671  19.370 -3.594  1.00 1.00 ? 28 LEU A HA   15 
ATOM   11021 H HB2  . LEU A 1 28 ? -4.804  18.758 -4.386  1.00 1.00 ? 28 LEU A HB2  15 
ATOM   11022 H HB3  . LEU A 1 28 ? -6.126  18.376 -5.476  1.00 1.00 ? 28 LEU A HB3  15 
ATOM   11023 H HG   . LEU A 1 28 ? -6.926  20.688 -5.457  1.00 1.00 ? 28 LEU A HG   15 
ATOM   11024 H HD11 . LEU A 1 28 ? -4.489  21.254 -3.716  1.00 1.00 ? 28 LEU A HD11 15 
ATOM   11025 H HD12 . LEU A 1 28 ? -5.456  22.490 -4.542  1.00 1.00 ? 28 LEU A HD12 15 
ATOM   11026 H HD13 . LEU A 1 28 ? -6.192  21.507 -3.276  1.00 1.00 ? 28 LEU A HD13 15 
ATOM   11027 H HD21 . LEU A 1 28 ? -5.354  19.924 -7.176  1.00 1.00 ? 28 LEU A HD21 15 
ATOM   11028 H HD22 . LEU A 1 28 ? -5.056  21.625 -6.777  1.00 1.00 ? 28 LEU A HD22 15 
ATOM   11029 H HD23 . LEU A 1 28 ? -3.978  20.362 -6.146  1.00 1.00 ? 28 LEU A HD23 15 
ATOM   11030 N N    . GLU A 1 29 ? -6.328  16.328 -3.370  1.00 1.00 ? 29 GLU A N    15 
ATOM   11031 C CA   . GLU A 1 29 ? -6.701  14.927 -3.200  1.00 1.00 ? 29 GLU A CA   15 
ATOM   11032 C C    . GLU A 1 29 ? -6.764  14.654 -1.696  1.00 1.00 ? 29 GLU A C    15 
ATOM   11033 O O    . GLU A 1 29 ? -6.640  15.586 -0.906  1.00 1.00 ? 29 GLU A O    15 
ATOM   11034 C CB   . GLU A 1 29 ? -5.803  13.994 -4.039  1.00 1.00 ? 29 GLU A CB   15 
ATOM   11035 C CG   . GLU A 1 29 ? -4.286  14.163 -3.875  1.00 1.00 ? 29 GLU A CG   15 
ATOM   11036 C CD   . GLU A 1 29 ? -3.505  13.399 -4.938  1.00 1.00 ? 29 GLU A CD   15 
ATOM   11037 O OE1  . GLU A 1 29 ? -3.940  12.335 -5.367  1.00 1.00 ? 29 GLU A OE1  15 
ATOM   11038 O OE2  . GLU A 1 29 ? -2.345  13.972 -5.354  1.00 1.00 ? 29 GLU A OE2  15 
ATOM   11039 H H    . GLU A 1 29 ? -5.375  16.584 -3.128  1.00 1.00 ? 29 GLU A H    15 
ATOM   11040 H HA   . GLU A 1 29 ? -7.712  14.764 -3.579  1.00 1.00 ? 29 GLU A HA   15 
ATOM   11041 H HB2  . GLU A 1 29 ? -6.068  12.955 -3.841  1.00 1.00 ? 29 GLU A HB2  15 
ATOM   11042 H HB3  . GLU A 1 29 ? -6.036  14.197 -5.086  1.00 1.00 ? 29 GLU A HB3  15 
ATOM   11043 H HG2  . GLU A 1 29 ? -4.015  15.213 -3.974  1.00 1.00 ? 29 GLU A HG2  15 
ATOM   11044 H HG3  . GLU A 1 29 ? -3.971  13.786 -2.904  1.00 1.00 ? 29 GLU A HG3  15 
ATOM   11045 H HE2  . GLU A 1 29 ? -1.934  13.453 -6.048  1.00 1.00 ? 29 GLU A HE2  15 
ATOM   11046 N N    . LYS A 1 30 ? -7.086  13.433 -1.266  1.00 1.00 ? 30 LYS A N    15 
ATOM   11047 C CA   . LYS A 1 30 ? -7.386  13.136 0.140   1.00 1.00 ? 30 LYS A CA   15 
ATOM   11048 C C    . LYS A 1 30 ? -6.308  12.289 0.815   1.00 1.00 ? 30 LYS A C    15 
ATOM   11049 O O    . LYS A 1 30 ? -6.507  11.789 1.927   1.00 1.00 ? 30 LYS A O    15 
ATOM   11050 C CB   . LYS A 1 30 ? -8.816  12.596 0.271   1.00 1.00 ? 30 LYS A CB   15 
ATOM   11051 C CG   . LYS A 1 30 ? -9.829  13.728 0.017   1.00 1.00 ? 30 LYS A CG   15 
ATOM   11052 C CD   . LYS A 1 30 ? -9.927  14.712 1.203   1.00 1.00 ? 30 LYS A CD   15 
ATOM   11053 C CE   . LYS A 1 30 ? -9.988  16.191 0.776   1.00 1.00 ? 30 LYS A CE   15 
ATOM   11054 N NZ   . LYS A 1 30 ? -8.685  16.730 0.329   1.00 1.00 ? 30 LYS A NZ   15 
ATOM   11055 H H    . LYS A 1 30 ? -7.219  12.697 -1.945  1.00 1.00 ? 30 LYS A H    15 
ATOM   11056 H HA   . LYS A 1 30 ? -7.346  14.055 0.720   1.00 1.00 ? 30 LYS A HA   15 
ATOM   11057 H HB2  . LYS A 1 30 ? -8.965  11.795 -0.453  1.00 1.00 ? 30 LYS A HB2  15 
ATOM   11058 H HB3  . LYS A 1 30 ? -8.984  12.193 1.271   1.00 1.00 ? 30 LYS A HB3  15 
ATOM   11059 H HG2  . LYS A 1 30 ? -9.575  14.248 -0.908  1.00 1.00 ? 30 LYS A HG2  15 
ATOM   11060 H HG3  . LYS A 1 30 ? -10.811 13.275 -0.130  1.00 1.00 ? 30 LYS A HG3  15 
ATOM   11061 H HD2  . LYS A 1 30 ? -10.852 14.481 1.738   1.00 1.00 ? 30 LYS A HD2  15 
ATOM   11062 H HD3  . LYS A 1 30 ? -9.115  14.570 1.917   1.00 1.00 ? 30 LYS A HD3  15 
ATOM   11063 H HE2  . LYS A 1 30 ? -10.721 16.306 -0.026  1.00 1.00 ? 30 LYS A HE2  15 
ATOM   11064 H HE3  . LYS A 1 30 ? -10.322 16.788 1.627   1.00 1.00 ? 30 LYS A HE3  15 
ATOM   11065 H HZ1  . LYS A 1 30 ? -8.283  16.196 -0.431  1.00 1.00 ? 30 LYS A HZ1  15 
ATOM   11066 H HZ2  . LYS A 1 30 ? -8.787  17.678 -0.018  1.00 1.00 ? 30 LYS A HZ2  15 
ATOM   11067 H HZ3  . LYS A 1 30 ? -7.971  16.750 1.052   1.00 1.00 ? 30 LYS A HZ3  15 
ATOM   11068 N N    . ALA A 1 31 ? -5.153  12.150 0.157   1.00 1.00 ? 31 ALA A N    15 
ATOM   11069 C CA   . ALA A 1 31 ? -3.952  11.572 0.740   1.00 1.00 ? 31 ALA A CA   15 
ATOM   11070 C C    . ALA A 1 31 ? -3.719  12.077 2.166   1.00 1.00 ? 31 ALA A C    15 
ATOM   11071 O O    . ALA A 1 31 ? -4.200  13.148 2.543   1.00 1.00 ? 31 ALA A O    15 
ATOM   11072 C CB   . ALA A 1 31 ? -2.757  11.956 -0.123  1.00 1.00 ? 31 ALA A CB   15 
ATOM   11073 H H    . ALA A 1 31 ? -5.061  12.603 -0.739  1.00 1.00 ? 31 ALA A H    15 
ATOM   11074 H HA   . ALA A 1 31 ? -4.073  10.489 0.747   1.00 1.00 ? 31 ALA A HA   15 
ATOM   11075 H HB1  . ALA A 1 31 ? -2.912  11.630 -1.151  1.00 1.00 ? 31 ALA A HB1  15 
ATOM   11076 H HB2  . ALA A 1 31 ? -2.649  13.039 -0.099  1.00 1.00 ? 31 ALA A HB2  15 
ATOM   11077 H HB3  . ALA A 1 31 ? -1.849  11.502 0.277   1.00 1.00 ? 31 ALA A HB3  15 
ATOM   11078 N N    . ARG A 1 32 ? -3.020  11.284 2.977   1.00 1.00 ? 32 ARG A N    15 
ATOM   11079 C CA   . ARG A 1 32 ? -2.852  11.574 4.391   1.00 1.00 ? 32 ARG A CA   15 
ATOM   11080 C C    . ARG A 1 32 ? -1.595  12.405 4.621   1.00 1.00 ? 32 ARG A C    15 
ATOM   11081 O O    . ARG A 1 32 ? -1.696  13.494 5.179   1.00 1.00 ? 32 ARG A O    15 
ATOM   11082 C CB   . ARG A 1 32 ? -2.905  10.274 5.204   1.00 1.00 ? 32 ARG A CB   15 
ATOM   11083 C CG   . ARG A 1 32 ? -4.206  9.472  4.991   1.00 1.00 ? 32 ARG A CG   15 
ATOM   11084 C CD   . ARG A 1 32 ? -5.486  10.153 5.513   1.00 1.00 ? 32 ARG A CD   15 
ATOM   11085 N NE   . ARG A 1 32 ? -5.942  11.266 4.653   1.00 1.00 ? 32 ARG A NE   15 
ATOM   11086 C CZ   . ARG A 1 32 ? -6.356  12.470 5.077   1.00 1.00 ? 32 ARG A CZ   15 
ATOM   11087 N NH1  . ARG A 1 32 ? -6.779  12.638 6.335   1.00 1.00 ? 32 ARG A NH1  15 
ATOM   11088 N NH2  . ARG A 1 32 ? -6.322  13.505 4.234   1.00 1.00 ? 32 ARG A NH2  15 
ATOM   11089 H H    . ARG A 1 32 ? -2.609  10.440 2.609   1.00 1.00 ? 32 ARG A H    15 
ATOM   11090 H HA   . ARG A 1 32 ? -3.658  12.208 4.747   1.00 1.00 ? 32 ARG A HA   15 
ATOM   11091 H HB2  . ARG A 1 32 ? -2.064  9.642  4.914   1.00 1.00 ? 32 ARG A HB2  15 
ATOM   11092 H HB3  . ARG A 1 32 ? -2.801  10.515 6.263   1.00 1.00 ? 32 ARG A HB3  15 
ATOM   11093 H HG2  . ARG A 1 32 ? -4.324  9.209  3.939   1.00 1.00 ? 32 ARG A HG2  15 
ATOM   11094 H HG3  . ARG A 1 32 ? -4.085  8.538  5.546   1.00 1.00 ? 32 ARG A HG3  15 
ATOM   11095 H HD2  . ARG A 1 32 ? -6.283  9.406  5.541   1.00 1.00 ? 32 ARG A HD2  15 
ATOM   11096 H HD3  . ARG A 1 32 ? -5.288  10.480 6.535   1.00 1.00 ? 32 ARG A HD3  15 
ATOM   11097 H HE   . ARG A 1 32 ? -5.869  11.144 3.645   1.00 1.00 ? 32 ARG A HE   15 
ATOM   11098 H HH11 . ARG A 1 32 ? -6.845  11.837 6.945   1.00 1.00 ? 32 ARG A HH11 15 
ATOM   11099 H HH12 . ARG A 1 32 ? -7.066  13.540 6.683   1.00 1.00 ? 32 ARG A HH12 15 
ATOM   11100 H HH21 . ARG A 1 32 ? -5.846  13.365 3.339   1.00 1.00 ? 32 ARG A HH21 15 
ATOM   11101 H HH22 . ARG A 1 32 ? -6.589  14.438 4.503   1.00 1.00 ? 32 ARG A HH22 15 
ATOM   11102 N N    . HIS A 1 33 ? -0.416  11.892 4.249   1.00 1.00 ? 33 HIS A N    15 
ATOM   11103 C CA   . HIS A 1 33 ? 0.807   12.686 4.215   1.00 1.00 ? 33 HIS A CA   15 
ATOM   11104 C C    . HIS A 1 33 ? 1.229   12.966 2.769   1.00 1.00 ? 33 HIS A C    15 
ATOM   11105 O O    . HIS A 1 33 ? 1.135   12.103 1.896   1.00 1.00 ? 33 HIS A O    15 
ATOM   11106 C CB   . HIS A 1 33 ? 1.915   12.094 5.101   1.00 1.00 ? 33 HIS A CB   15 
ATOM   11107 C CG   . HIS A 1 33 ? 2.177   10.614 4.987   1.00 1.00 ? 33 HIS A CG   15 
ATOM   11108 N ND1  . HIS A 1 33 ? 1.203   9.661  5.237   1.00 1.00 ? 33 HIS A ND1  15 
ATOM   11109 C CD2  . HIS A 1 33 ? 3.337   9.899  4.800   1.00 1.00 ? 33 HIS A CD2  15 
ATOM   11110 C CE1  . HIS A 1 33 ? 1.775   8.454  5.113   1.00 1.00 ? 33 HIS A CE1  15 
ATOM   11111 N NE2  . HIS A 1 33 ? 3.082   8.531  4.854   1.00 1.00 ? 33 HIS A NE2  15 
ATOM   11112 H H    . HIS A 1 33 ? -0.405  11.039 3.704   1.00 1.00 ? 33 HIS A H    15 
ATOM   11113 H HA   . HIS A 1 33 ? 0.603   13.667 4.649   1.00 1.00 ? 33 HIS A HA   15 
ATOM   11114 H HB2  . HIS A 1 33 ? 2.844   12.629 4.904   1.00 1.00 ? 33 HIS A HB2  15 
ATOM   11115 H HB3  . HIS A 1 33 ? 1.641   12.281 6.140   1.00 1.00 ? 33 HIS A HB3  15 
ATOM   11116 H HD1  . HIS A 1 33 ? 0.241   9.841  5.477   1.00 1.00 ? 33 HIS A HD1  15 
ATOM   11117 H HD2  . HIS A 1 33 ? 4.310   10.336 4.629   1.00 1.00 ? 33 HIS A HD2  15 
ATOM   11118 H HE1  . HIS A 1 33 ? 1.237   7.529  5.246   1.00 1.00 ? 33 HIS A HE1  15 
ATOM   11119 N N    . GLY A 1 34 ? 1.722   14.180 2.530   1.00 1.00 ? 34 GLY A N    15 
ATOM   11120 C CA   . GLY A 1 34 ? 2.374   14.588 1.301   1.00 1.00 ? 34 GLY A CA   15 
ATOM   11121 C C    . GLY A 1 34 ? 3.660   15.287 1.712   1.00 1.00 ? 34 GLY A C    15 
ATOM   11122 O O    . GLY A 1 34 ? 3.739   15.777 2.839   1.00 1.00 ? 34 GLY A O    15 
ATOM   11123 H H    . GLY A 1 34 ? 1.827   14.822 3.305   1.00 1.00 ? 34 GLY A H    15 
ATOM   11124 H HA2  . GLY A 1 34 ? 2.623   13.721 0.704   1.00 1.00 ? 34 GLY A HA2  15 
ATOM   11125 H HA3  . GLY A 1 34 ? 1.727   15.255 0.731   1.00 1.00 ? 34 GLY A HA3  15 
ATOM   11126 N N    . SER A 1 35 ? 4.693   15.290 0.869   1.00 1.00 ? 35 SER A N    15 
ATOM   11127 C CA   . SER A 1 35 ? 6.004   15.795 1.257   1.00 1.00 ? 35 SER A CA   15 
ATOM   11128 C C    . SER A 1 35 ? 6.903   15.724 0.028   1.00 1.00 ? 35 SER A C    15 
ATOM   11129 O O    . SER A 1 35 ? 7.304   14.635 -0.387  1.00 1.00 ? 35 SER A O    15 
ATOM   11130 C CB   . SER A 1 35 ? 6.604   14.964 2.418   1.00 1.00 ? 35 SER A CB   15 
ATOM   11131 O OG   . SER A 1 35 ? 6.962   15.790 3.513   1.00 1.00 ? 35 SER A OG   15 
ATOM   11132 H H    . SER A 1 35 ? 4.608   14.857 -0.050  1.00 1.00 ? 35 SER A H    15 
ATOM   11133 H HA   . SER A 1 35 ? 5.905   16.845 1.568   1.00 1.00 ? 35 SER A HA   15 
ATOM   11134 H HB2  . SER A 1 35 ? 5.901   14.209 2.773   1.00 1.00 ? 35 SER A HB2  15 
ATOM   11135 H HB3  . SER A 1 35 ? 7.499   14.434 2.082   1.00 1.00 ? 35 SER A HB3  15 
ATOM   11136 H HG   . SER A 1 35 ? 7.442   15.247 4.152   1.00 1.00 ? 35 SER A HG   15 
ATOM   11137 N N    . CYS A 1 36 ? 7.252   16.886 -0.519  1.00 1.00 ? 36 CYS A N    15 
ATOM   11138 C CA   . CYS A 1 36 ? 8.088   16.938 -1.701  1.00 1.00 ? 36 CYS A CA   15 
ATOM   11139 C C    . CYS A 1 36 ? 9.512   16.570 -1.324  1.00 1.00 ? 36 CYS A C    15 
ATOM   11140 O O    . CYS A 1 36 ? 9.977   16.923 -0.237  1.00 1.00 ? 36 CYS A O    15 
ATOM   11141 C CB   . CYS A 1 36 ? 8.089   18.339 -2.298  1.00 1.00 ? 36 CYS A CB   15 
ATOM   11142 S SG   . CYS A 1 36 ? 9.274   18.591 -3.617  1.00 1.00 ? 36 CYS A SG   15 
ATOM   11143 H H    . CYS A 1 36 ? 6.913   17.744 -0.117  1.00 1.00 ? 36 CYS A H    15 
ATOM   11144 H HA   . CYS A 1 36 ? 7.697   16.229 -2.425  1.00 1.00 ? 36 CYS A HA   15 
ATOM   11145 H HB2  . CYS A 1 36 ? 7.104   18.597 -2.671  1.00 1.00 ? 36 CYS A HB2  15 
ATOM   11146 H HB3  . CYS A 1 36 ? 8.392   19.058 -1.549  1.00 1.00 ? 36 CYS A HB3  15 
ATOM   11147 N N    . ASN A 1 37 ? 10.159  15.834 -2.226  1.00 1.00 ? 37 ASN A N    15 
ATOM   11148 C CA   . ASN A 1 37 ? 11.491  15.284 -2.069  1.00 1.00 ? 37 ASN A CA   15 
ATOM   11149 C C    . ASN A 1 37 ? 12.377  15.865 -3.163  1.00 1.00 ? 37 ASN A C    15 
ATOM   11150 O O    . ASN A 1 37 ? 11.885  16.168 -4.253  1.00 1.00 ? 37 ASN A O    15 
ATOM   11151 C CB   . ASN A 1 37 ? 11.396  13.762 -2.202  1.00 1.00 ? 37 ASN A CB   15 
ATOM   11152 C CG   . ASN A 1 37 ? 12.731  13.066 -1.978  1.00 1.00 ? 37 ASN A CG   15 
ATOM   11153 O OD1  . ASN A 1 37 ? 13.046  12.666 -0.864  1.00 1.00 ? 37 ASN A OD1  15 
ATOM   11154 N ND2  . ASN A 1 37 ? 13.539  12.905 -3.020  1.00 1.00 ? 37 ASN A ND2  15 
ATOM   11155 H H    . ASN A 1 37 ? 9.709   15.686 -3.128  1.00 1.00 ? 37 ASN A H    15 
ATOM   11156 H HA   . ASN A 1 37 ? 11.898  15.534 -1.087  1.00 1.00 ? 37 ASN A HA   15 
ATOM   11157 H HB2  . ASN A 1 37 ? 10.693  13.392 -1.454  1.00 1.00 ? 37 ASN A HB2  15 
ATOM   11158 H HB3  . ASN A 1 37 ? 11.021  13.506 -3.194  1.00 1.00 ? 37 ASN A HB3  15 
ATOM   11159 H HD21 . ASN A 1 37 ? 13.334  13.297 -3.936  1.00 1.00 ? 37 ASN A HD21 15 
ATOM   11160 H HD22 . ASN A 1 37 ? 14.389  12.387 -2.868  1.00 1.00 ? 37 ASN A HD22 15 
ATOM   11161 N N    . TYR A 1 38 ? 13.678  15.996 -2.887  1.00 1.00 ? 38 TYR A N    15 
ATOM   11162 C CA   . TYR A 1 38 ? 14.646  16.336 -3.918  1.00 1.00 ? 38 TYR A CA   15 
ATOM   11163 C C    . TYR A 1 38 ? 14.988  15.082 -4.731  1.00 1.00 ? 38 TYR A C    15 
ATOM   11164 O O    . TYR A 1 38 ? 14.079  14.468 -5.293  1.00 1.00 ? 38 TYR A O    15 
ATOM   11165 C CB   . TYR A 1 38 ? 15.856  17.118 -3.370  1.00 1.00 ? 38 TYR A CB   15 
ATOM   11166 C CG   . TYR A 1 38 ? 16.777  17.636 -4.471  1.00 1.00 ? 38 TYR A CG   15 
ATOM   11167 C CD1  . TYR A 1 38 ? 16.215  18.315 -5.569  1.00 1.00 ? 38 TYR A CD1  15 
ATOM   11168 C CD2  . TYR A 1 38 ? 18.111  17.187 -4.555  1.00 1.00 ? 38 TYR A CD2  15 
ATOM   11169 C CE1  . TYR A 1 38 ? 16.902  18.377 -6.792  1.00 1.00 ? 38 TYR A CE1  15 
ATOM   11170 C CE2  . TYR A 1 38 ? 18.792  17.233 -5.785  1.00 1.00 ? 38 TYR A CE2  15 
ATOM   11171 C CZ   . TYR A 1 38 ? 18.163  17.775 -6.919  1.00 1.00 ? 38 TYR A CZ   15 
ATOM   11172 O OH   . TYR A 1 38 ? 18.771  17.705 -8.136  1.00 1.00 ? 38 TYR A OH   15 
ATOM   11173 H H    . TYR A 1 38 ? 14.012  15.690 -1.985  1.00 1.00 ? 38 TYR A H    15 
ATOM   11174 H HA   . TYR A 1 38 ? 14.142  17.006 -4.612  1.00 1.00 ? 38 TYR A HA   15 
ATOM   11175 H HB2  . TYR A 1 38 ? 15.485  17.983 -2.819  1.00 1.00 ? 38 TYR A HB2  15 
ATOM   11176 H HB3  . TYR A 1 38 ? 16.411  16.491 -2.670  1.00 1.00 ? 38 TYR A HB3  15 
ATOM   11177 H HD1  . TYR A 1 38 ? 15.226  18.736 -5.497  1.00 1.00 ? 38 TYR A HD1  15 
ATOM   11178 H HD2  . TYR A 1 38 ? 18.587  16.726 -3.702  1.00 1.00 ? 38 TYR A HD2  15 
ATOM   11179 H HE1  . TYR A 1 38 ? 16.450  18.868 -7.638  1.00 1.00 ? 38 TYR A HE1  15 
ATOM   11180 H HE2  . TYR A 1 38 ? 19.789  16.826 -5.868  1.00 1.00 ? 38 TYR A HE2  15 
ATOM   11181 H HH   . TYR A 1 38 ? 18.190  17.982 -8.859  1.00 1.00 ? 38 TYR A HH   15 
ATOM   11182 N N    . VAL A 1 39 ? 16.269  14.705 -4.820  1.00 1.00 ? 39 VAL A N    15 
ATOM   11183 C CA   . VAL A 1 39 ? 16.800  13.700 -5.738  1.00 1.00 ? 39 VAL A CA   15 
ATOM   11184 C C    . VAL A 1 39 ? 16.662  14.260 -7.162  1.00 1.00 ? 39 VAL A C    15 
ATOM   11185 O O    . VAL A 1 39 ? 15.823  15.126 -7.418  1.00 1.00 ? 39 VAL A O    15 
ATOM   11186 C CB   . VAL A 1 39 ? 16.161  12.308 -5.518  1.00 1.00 ? 39 VAL A CB   15 
ATOM   11187 C CG1  . VAL A 1 39 ? 16.607  11.272 -6.558  1.00 1.00 ? 39 VAL A CG1  15 
ATOM   11188 C CG2  . VAL A 1 39 ? 16.541  11.785 -4.126  1.00 1.00 ? 39 VAL A CG2  15 
ATOM   11189 H H    . VAL A 1 39 ? 16.947  15.221 -4.285  1.00 1.00 ? 39 VAL A H    15 
ATOM   11190 H HA   . VAL A 1 39 ? 17.867  13.611 -5.533  1.00 1.00 ? 39 VAL A HA   15 
ATOM   11191 H HB   . VAL A 1 39 ? 15.077  12.352 -5.585  1.00 1.00 ? 39 VAL A HB   15 
ATOM   11192 H HG11 . VAL A 1 39 ? 17.695  11.215 -6.593  1.00 1.00 ? 39 VAL A HG11 15 
ATOM   11193 H HG12 . VAL A 1 39 ? 16.209  10.294 -6.289  1.00 1.00 ? 39 VAL A HG12 15 
ATOM   11194 H HG13 . VAL A 1 39 ? 16.219  11.531 -7.544  1.00 1.00 ? 39 VAL A HG13 15 
ATOM   11195 H HG21 . VAL A 1 39 ? 16.309  12.523 -3.359  1.00 1.00 ? 39 VAL A HG21 15 
ATOM   11196 H HG22 . VAL A 1 39 ? 15.988  10.870 -3.913  1.00 1.00 ? 39 VAL A HG22 15 
ATOM   11197 H HG23 . VAL A 1 39 ? 17.609  11.572 -4.087  1.00 1.00 ? 39 VAL A HG23 15 
ATOM   11198 N N    . PHE A 1 40 ? 17.496  13.812 -8.099  1.00 1.00 ? 40 PHE A N    15 
ATOM   11199 C CA   . PHE A 1 40 ? 17.465  14.330 -9.461  1.00 1.00 ? 40 PHE A CA   15 
ATOM   11200 C C    . PHE A 1 40 ? 16.069  14.137 -10.092 1.00 1.00 ? 40 PHE A C    15 
ATOM   11201 O O    . PHE A 1 40 ? 15.291  13.295 -9.632  1.00 1.00 ? 40 PHE A O    15 
ATOM   11202 C CB   . PHE A 1 40 ? 18.569  13.653 -10.292 1.00 1.00 ? 40 PHE A CB   15 
ATOM   11203 C CG   . PHE A 1 40 ? 18.237  12.242 -10.736 1.00 1.00 ? 40 PHE A CG   15 
ATOM   11204 C CD1  . PHE A 1 40 ? 18.498  11.147 -9.891  1.00 1.00 ? 40 PHE A CD1  15 
ATOM   11205 C CD2  . PHE A 1 40 ? 17.600  12.032 -11.976 1.00 1.00 ? 40 PHE A CD2  15 
ATOM   11206 C CE1  . PHE A 1 40 ? 18.090  9.856  -10.267 1.00 1.00 ? 40 PHE A CE1  15 
ATOM   11207 C CE2  . PHE A 1 40 ? 17.195  10.740 -12.350 1.00 1.00 ? 40 PHE A CE2  15 
ATOM   11208 C CZ   . PHE A 1 40 ? 17.433  9.654  -11.493 1.00 1.00 ? 40 PHE A CZ   15 
ATOM   11209 H H    . PHE A 1 40 ? 18.155  13.085 -7.870  1.00 1.00 ? 40 PHE A H    15 
ATOM   11210 H HA   . PHE A 1 40 ? 17.699  15.393 -9.388  1.00 1.00 ? 40 PHE A HA   15 
ATOM   11211 H HB2  . PHE A 1 40 ? 18.760  14.246 -11.186 1.00 1.00 ? 40 PHE A HB2  15 
ATOM   11212 H HB3  . PHE A 1 40 ? 19.500  13.647 -9.724  1.00 1.00 ? 40 PHE A HB3  15 
ATOM   11213 H HD1  . PHE A 1 40 ? 19.017  11.285 -8.955  1.00 1.00 ? 40 PHE A HD1  15 
ATOM   11214 H HD2  . PHE A 1 40 ? 17.413  12.857 -12.647 1.00 1.00 ? 40 PHE A HD2  15 
ATOM   11215 H HE1  . PHE A 1 40 ? 18.287  9.015  -9.616  1.00 1.00 ? 40 PHE A HE1  15 
ATOM   11216 H HE2  . PHE A 1 40 ? 16.703  10.580 -13.300 1.00 1.00 ? 40 PHE A HE2  15 
ATOM   11217 H HZ   . PHE A 1 40 ? 17.121  8.660  -11.782 1.00 1.00 ? 40 PHE A HZ   15 
ATOM   11218 N N    . PRO A 1 41 ? 15.690  14.921 -11.111 1.00 1.00 ? 41 PRO A N    15 
ATOM   11219 C CA   . PRO A 1 41 ? 16.374  16.111 -11.579 1.00 1.00 ? 41 PRO A CA   15 
ATOM   11220 C C    . PRO A 1 41 ? 16.027  17.289 -10.658 1.00 1.00 ? 41 PRO A C    15 
ATOM   11221 O O    . PRO A 1 41 ? 16.922  17.968 -10.160 1.00 1.00 ? 41 PRO A O    15 
ATOM   11222 C CB   . PRO A 1 41 ? 15.874  16.308 -13.012 1.00 1.00 ? 41 PRO A CB   15 
ATOM   11223 C CG   . PRO A 1 41 ? 14.466  15.708 -13.015 1.00 1.00 ? 41 PRO A CG   15 
ATOM   11224 C CD   . PRO A 1 41 ? 14.530  14.621 -11.939 1.00 1.00 ? 41 PRO A CD   15 
ATOM   11225 H HA   . PRO A 1 41 ? 17.456  15.993 -11.610 1.00 1.00 ? 41 PRO A HA   15 
ATOM   11226 H HB2  . PRO A 1 41 ? 15.887  17.353 -13.325 1.00 1.00 ? 41 PRO A HB2  15 
ATOM   11227 H HB3  . PRO A 1 41 ? 16.502  15.713 -13.678 1.00 1.00 ? 41 PRO A HB3  15 
ATOM   11228 H HG2  . PRO A 1 41 ? 13.733  16.470 -12.747 1.00 1.00 ? 41 PRO A HG2  15 
ATOM   11229 H HG3  . PRO A 1 41 ? 14.210  15.293 -13.992 1.00 1.00 ? 41 PRO A HG3  15 
ATOM   11230 H HD2  . PRO A 1 41 ? 13.612  14.603 -11.351 1.00 1.00 ? 41 PRO A HD2  15 
ATOM   11231 H HD3  . PRO A 1 41 ? 14.677  13.647 -12.411 1.00 1.00 ? 41 PRO A HD3  15 
ATOM   11232 N N    . ALA A 1 42 ? 14.728  17.509 -10.426 1.00 1.00 ? 42 ALA A N    15 
ATOM   11233 C CA   . ALA A 1 42 ? 14.180  18.653 -9.712  1.00 1.00 ? 42 ALA A CA   15 
ATOM   11234 C C    . ALA A 1 42 ? 13.343  18.202 -8.509  1.00 1.00 ? 42 ALA A C    15 
ATOM   11235 O O    . ALA A 1 42 ? 13.145  17.003 -8.286  1.00 1.00 ? 42 ALA A O    15 
ATOM   11236 C CB   . ALA A 1 42 ? 13.342  19.480 -10.692 1.00 1.00 ? 42 ALA A CB   15 
ATOM   11237 H H    . ALA A 1 42 ? 14.062  16.851 -10.797 1.00 1.00 ? 42 ALA A H    15 
ATOM   11238 H HA   . ALA A 1 42 ? 14.985  19.294 -9.351  1.00 1.00 ? 42 ALA A HA   15 
ATOM   11239 H HB1  . ALA A 1 42 ? 13.946  19.738 -11.563 1.00 1.00 ? 42 ALA A HB1  15 
ATOM   11240 H HB2  . ALA A 1 42 ? 12.473  18.907 -11.016 1.00 1.00 ? 42 ALA A HB2  15 
ATOM   11241 H HB3  . ALA A 1 42 ? 13.010  20.402 -10.218 1.00 1.00 ? 42 ALA A HB3  15 
ATOM   11242 N N    . HIS A 1 43 ? 12.844  19.179 -7.746  1.00 1.00 ? 43 HIS A N    15 
ATOM   11243 C CA   . HIS A 1 43 ? 12.041  18.967 -6.550  1.00 1.00 ? 43 HIS A CA   15 
ATOM   11244 C C    . HIS A 1 43 ? 10.705  18.327 -6.960  1.00 1.00 ? 43 HIS A C    15 
ATOM   11245 O O    . HIS A 1 43 ? 9.922   18.957 -7.673  1.00 1.00 ? 43 HIS A O    15 
ATOM   11246 C CB   . HIS A 1 43 ? 11.796  20.304 -5.828  1.00 1.00 ? 43 HIS A CB   15 
ATOM   11247 C CG   . HIS A 1 43 ? 12.984  21.178 -5.485  1.00 1.00 ? 43 HIS A CG   15 
ATOM   11248 N ND1  . HIS A 1 43 ? 12.898  22.156 -4.499  1.00 1.00 ? 43 HIS A ND1  15 
ATOM   11249 C CD2  . HIS A 1 43 ? 14.262  21.296 -5.985  1.00 1.00 ? 43 HIS A CD2  15 
ATOM   11250 C CE1  . HIS A 1 43 ? 14.090  22.771 -4.433  1.00 1.00 ? 43 HIS A CE1  15 
ATOM   11251 N NE2  . HIS A 1 43 ? 14.965  22.291 -5.317  1.00 1.00 ? 43 HIS A NE2  15 
ATOM   11252 H H    . HIS A 1 43 ? 13.008  20.132 -8.028  1.00 1.00 ? 43 HIS A H    15 
ATOM   11253 H HA   . HIS A 1 43 ? 12.584  18.305 -5.874  1.00 1.00 ? 43 HIS A HA   15 
ATOM   11254 H HB2  . HIS A 1 43 ? 11.102  20.889 -6.424  1.00 1.00 ? 43 HIS A HB2  15 
ATOM   11255 H HB3  . HIS A 1 43 ? 11.324  20.084 -4.876  1.00 1.00 ? 43 HIS A HB3  15 
ATOM   11256 H HD1  . HIS A 1 43 ? 12.093  22.393 -3.927  1.00 1.00 ? 43 HIS A HD1  15 
ATOM   11257 H HD2  . HIS A 1 43 ? 14.682  20.713 -6.789  1.00 1.00 ? 43 HIS A HD2  15 
ATOM   11258 H HE1  . HIS A 1 43 ? 14.311  23.576 -3.748  1.00 1.00 ? 43 HIS A HE1  15 
ATOM   11259 N N    . LYS A 1 44 ? 10.455  17.087 -6.529  1.00 1.00 ? 44 LYS A N    15 
ATOM   11260 C CA   . LYS A 1 44 ? 9.288   16.290 -6.904  1.00 1.00 ? 44 LYS A CA   15 
ATOM   11261 C C    . LYS A 1 44 ? 8.277   16.273 -5.764  1.00 1.00 ? 44 LYS A C    15 
ATOM   11262 O O    . LYS A 1 44 ? 8.602   15.812 -4.665  1.00 1.00 ? 44 LYS A O    15 
ATOM   11263 C CB   . LYS A 1 44 ? 9.709   14.844 -7.165  1.00 1.00 ? 44 LYS A CB   15 
ATOM   11264 C CG   . LYS A 1 44 ? 10.436  14.666 -8.500  1.00 1.00 ? 44 LYS A CG   15 
ATOM   11265 C CD   . LYS A 1 44 ? 11.161  13.310 -8.538  1.00 1.00 ? 44 LYS A CD   15 
ATOM   11266 C CE   . LYS A 1 44 ? 12.381  13.243 -7.605  1.00 1.00 ? 44 LYS A CE   15 
ATOM   11267 N NZ   . LYS A 1 44 ? 13.375  14.295 -7.893  1.00 1.00 ? 44 LYS A NZ   15 
ATOM   11268 H H    . LYS A 1 44 ? 11.084  16.703 -5.831  1.00 1.00 ? 44 LYS A H    15 
ATOM   11269 H HA   . LYS A 1 44 ? 8.817   16.687 -7.806  1.00 1.00 ? 44 LYS A HA   15 
ATOM   11270 H HB2  . LYS A 1 44 ? 10.323  14.525 -6.325  1.00 1.00 ? 44 LYS A HB2  15 
ATOM   11271 H HB3  . LYS A 1 44 ? 8.820   14.213 -7.190  1.00 1.00 ? 44 LYS A HB3  15 
ATOM   11272 H HG2  . LYS A 1 44 ? 9.685   14.686 -9.292  1.00 1.00 ? 44 LYS A HG2  15 
ATOM   11273 H HG3  . LYS A 1 44 ? 11.114  15.497 -8.680  1.00 1.00 ? 44 LYS A HG3  15 
ATOM   11274 H HD2  . LYS A 1 44 ? 10.455  12.527 -8.243  1.00 1.00 ? 44 LYS A HD2  15 
ATOM   11275 H HD3  . LYS A 1 44 ? 11.477  13.101 -9.560  1.00 1.00 ? 44 LYS A HD3  15 
ATOM   11276 H HE2  . LYS A 1 44 ? 12.071  13.328 -6.564  1.00 1.00 ? 44 LYS A HE2  15 
ATOM   11277 H HE3  . LYS A 1 44 ? 12.866  12.272 -7.719  1.00 1.00 ? 44 LYS A HE3  15 
ATOM   11278 H HZ1  . LYS A 1 44 ? 12.980  15.222 -7.992  1.00 1.00 ? 44 LYS A HZ1  15 
ATOM   11279 H HZ2  . LYS A 1 44 ? 14.041  14.373 -7.128  1.00 1.00 ? 44 LYS A HZ2  15 
ATOM   11280 H HZ3  . LYS A 1 44 ? 13.918  14.063 -8.716  1.00 1.00 ? 44 LYS A HZ3  15 
ATOM   11281 N N    . CYS A 1 45 ? 7.040   16.699 -6.034  1.00 1.00 ? 45 CYS A N    15 
ATOM   11282 C CA   . CYS A 1 45 ? 5.969   16.596 -5.059  1.00 1.00 ? 45 CYS A CA   15 
ATOM   11283 C C    . CYS A 1 45 ? 5.533   15.139 -4.957  1.00 1.00 ? 45 CYS A C    15 
ATOM   11284 O O    . CYS A 1 45 ? 4.595   14.723 -5.636  1.00 1.00 ? 45 CYS A O    15 
ATOM   11285 C CB   . CYS A 1 45 ? 4.792   17.512 -5.414  1.00 1.00 ? 45 CYS A CB   15 
ATOM   11286 S SG   . CYS A 1 45 ? 3.420   17.423 -4.235  1.00 1.00 ? 45 CYS A SG   15 
ATOM   11287 H H    . CYS A 1 45 ? 6.788   16.920 -6.991  1.00 1.00 ? 45 CYS A H    15 
ATOM   11288 H HA   . CYS A 1 45 ? 6.358   16.916 -4.099  1.00 1.00 ? 45 CYS A HA   15 
ATOM   11289 H HB2  . CYS A 1 45 ? 5.131   18.544 -5.447  1.00 1.00 ? 45 CYS A HB2  15 
ATOM   11290 H HB3  . CYS A 1 45 ? 4.398   17.256 -6.392  1.00 1.00 ? 45 CYS A HB3  15 
ATOM   11291 N N    . ILE A 1 46 ? 6.252   14.351 -4.160  1.00 1.00 ? 46 ILE A N    15 
ATOM   11292 C CA   . ILE A 1 46 ? 5.859   12.987 -3.855  1.00 1.00 ? 46 ILE A CA   15 
ATOM   11293 C C    . ILE A 1 46 ? 4.770   13.056 -2.779  1.00 1.00 ? 46 ILE A C    15 
ATOM   11294 O O    . ILE A 1 46 ? 4.849   13.874 -1.854  1.00 1.00 ? 46 ILE A O    15 
ATOM   11295 C CB   . ILE A 1 46 ? 7.074   12.158 -3.390  1.00 1.00 ? 46 ILE A CB   15 
ATOM   11296 C CG1  . ILE A 1 46 ? 8.260   12.173 -4.375  1.00 1.00 ? 46 ILE A CG1  15 
ATOM   11297 C CG2  . ILE A 1 46 ? 6.658   10.705 -3.104  1.00 1.00 ? 46 ILE A CG2  15 
ATOM   11298 C CD1  . ILE A 1 46 ? 7.882   11.787 -5.808  1.00 1.00 ? 46 ILE A CD1  15 
ATOM   11299 H H    . ILE A 1 46 ? 7.087   14.730 -3.734  1.00 1.00 ? 46 ILE A H    15 
ATOM   11300 H HA   . ILE A 1 46 ? 5.444   12.523 -4.750  1.00 1.00 ? 46 ILE A HA   15 
ATOM   11301 H HB   . ILE A 1 46 ? 7.435   12.592 -2.460  1.00 1.00 ? 46 ILE A HB   15 
ATOM   11302 H HG12 . ILE A 1 46 ? 8.728   13.159 -4.393  1.00 1.00 ? 46 ILE A HG12 15 
ATOM   11303 H HG13 . ILE A 1 46 ? 9.015   11.470 -4.019  1.00 1.00 ? 46 ILE A HG13 15 
ATOM   11304 H HG21 . ILE A 1 46 ? 6.204   10.254 -3.986  1.00 1.00 ? 46 ILE A HG21 15 
ATOM   11305 H HG22 . ILE A 1 46 ? 7.530   10.118 -2.813  1.00 1.00 ? 46 ILE A HG22 15 
ATOM   11306 H HG23 . ILE A 1 46 ? 5.937   10.665 -2.290  1.00 1.00 ? 46 ILE A HG23 15 
ATOM   11307 H HD11 . ILE A 1 46 ? 7.394   10.813 -5.829  1.00 1.00 ? 46 ILE A HD11 15 
ATOM   11308 H HD12 . ILE A 1 46 ? 7.221   12.539 -6.236  1.00 1.00 ? 46 ILE A HD12 15 
ATOM   11309 H HD13 . ILE A 1 46 ? 8.787   11.733 -6.412  1.00 1.00 ? 46 ILE A HD13 15 
ATOM   11310 N N    . CYS A 1 47 ? 3.741   12.214 -2.909  1.00 1.00 ? 47 CYS A N    15 
ATOM   11311 C CA   . CYS A 1 47 ? 2.657   12.145 -1.940  1.00 1.00 ? 47 CYS A CA   15 
ATOM   11312 C C    . CYS A 1 47 ? 2.400   10.689 -1.546  1.00 1.00 ? 47 CYS A C    15 
ATOM   11313 O O    . CYS A 1 47 ? 2.457   9.808  -2.402  1.00 1.00 ? 47 CYS A O    15 
ATOM   11314 C CB   . CYS A 1 47 ? 1.444   12.903 -2.466  1.00 1.00 ? 47 CYS A CB   15 
ATOM   11315 S SG   . CYS A 1 47 ? 0.184   13.119 -1.200  1.00 1.00 ? 47 CYS A SG   15 
ATOM   11316 H H    . CYS A 1 47 ? 3.713   11.579 -3.706  1.00 1.00 ? 47 CYS A H    15 
ATOM   11317 H HA   . CYS A 1 47 ? 2.981   12.644 -1.035  1.00 1.00 ? 47 CYS A HA   15 
ATOM   11318 H HB2  . CYS A 1 47 ? 1.749   13.900 -2.773  1.00 1.00 ? 47 CYS A HB2  15 
ATOM   11319 H HB3  . CYS A 1 47 ? 1.034   12.413 -3.344  1.00 1.00 ? 47 CYS A HB3  15 
ATOM   11320 N N    . TYR A 1 48 ? 2.152   10.427 -0.255  1.00 1.00 ? 48 TYR A N    15 
ATOM   11321 C CA   . TYR A 1 48 ? 2.167   9.088  0.329   1.00 1.00 ? 48 TYR A CA   15 
ATOM   11322 C C    . TYR A 1 48 ? 0.795   8.693  0.889   1.00 1.00 ? 48 TYR A C    15 
ATOM   11323 O O    . TYR A 1 48 ? 0.307   9.295  1.846   1.00 1.00 ? 48 TYR A O    15 
ATOM   11324 C CB   . TYR A 1 48 ? 3.229   9.071  1.443   1.00 1.00 ? 48 TYR A CB   15 
ATOM   11325 C CG   . TYR A 1 48 ? 4.531   9.805  1.145   1.00 1.00 ? 48 TYR A CG   15 
ATOM   11326 C CD1  . TYR A 1 48 ? 4.570   11.208 1.226   1.00 1.00 ? 48 TYR A CD1  15 
ATOM   11327 C CD2  . TYR A 1 48 ? 5.702   9.105  0.797   1.00 1.00 ? 48 TYR A CD2  15 
ATOM   11328 C CE1  . TYR A 1 48 ? 5.695   11.908 0.772   1.00 1.00 ? 48 TYR A CE1  15 
ATOM   11329 C CE2  . TYR A 1 48 ? 6.858   9.812  0.408   1.00 1.00 ? 48 TYR A CE2  15 
ATOM   11330 C CZ   . TYR A 1 48 ? 6.844   11.216 0.367   1.00 1.00 ? 48 TYR A CZ   15 
ATOM   11331 O OH   . TYR A 1 48 ? 7.933   11.913 -0.063  1.00 1.00 ? 48 TYR A OH   15 
ATOM   11332 H H    . TYR A 1 48 ? 1.969   11.189 0.394   1.00 1.00 ? 48 TYR A H    15 
ATOM   11333 H HA   . TYR A 1 48 ? 2.474   8.356  -0.418  1.00 1.00 ? 48 TYR A HA   15 
ATOM   11334 H HB2  . TYR A 1 48 ? 2.790   9.558  2.308   1.00 1.00 ? 48 TYR A HB2  15 
ATOM   11335 H HB3  . TYR A 1 48 ? 3.441   8.037  1.708   1.00 1.00 ? 48 TYR A HB3  15 
ATOM   11336 H HD1  . TYR A 1 48 ? 3.717   11.755 1.595   1.00 1.00 ? 48 TYR A HD1  15 
ATOM   11337 H HD2  . TYR A 1 48 ? 5.726   8.029  0.849   1.00 1.00 ? 48 TYR A HD2  15 
ATOM   11338 H HE1  . TYR A 1 48 ? 5.670   12.978 0.717   1.00 1.00 ? 48 TYR A HE1  15 
ATOM   11339 H HE2  . TYR A 1 48 ? 7.755   9.276  0.132   1.00 1.00 ? 48 TYR A HE2  15 
ATOM   11340 H HH   . TYR A 1 48 ? 7.752   12.854 -0.198  1.00 1.00 ? 48 TYR A HH   15 
ATOM   11341 N N    . PHE A 1 49 ? 0.141   7.697  0.279   1.00 1.00 ? 49 PHE A N    15 
ATOM   11342 C CA   . PHE A 1 49 ? -1.195  7.282  0.681   1.00 1.00 ? 49 PHE A CA   15 
ATOM   11343 C C    . PHE A 1 49 ? -1.437  5.828  0.280   1.00 1.00 ? 49 PHE A C    15 
ATOM   11344 O O    . PHE A 1 49 ? -0.696  5.303  -0.554  1.00 1.00 ? 49 PHE A O    15 
ATOM   11345 C CB   . PHE A 1 49 ? -2.257  8.249  0.123   1.00 1.00 ? 49 PHE A CB   15 
ATOM   11346 C CG   . PHE A 1 49 ? -2.148  8.687  -1.330  1.00 1.00 ? 49 PHE A CG   15 
ATOM   11347 C CD1  . PHE A 1 49 ? -1.134  9.589  -1.698  1.00 1.00 ? 49 PHE A CD1  15 
ATOM   11348 C CD2  . PHE A 1 49 ? -3.219  8.469  -2.224  1.00 1.00 ? 49 PHE A CD2  15 
ATOM   11349 C CE1  . PHE A 1 49 ? -1.137  10.193 -2.957  1.00 1.00 ? 49 PHE A CE1  15 
ATOM   11350 C CE2  . PHE A 1 49 ? -3.250  9.129  -3.470  1.00 1.00 ? 49 PHE A CE2  15 
ATOM   11351 C CZ   . PHE A 1 49 ? -2.204  9.996  -3.834  1.00 1.00 ? 49 PHE A CZ   15 
ATOM   11352 H H    . PHE A 1 49 ? 0.551   7.207  -0.508  1.00 1.00 ? 49 PHE A H    15 
ATOM   11353 H HA   . PHE A 1 49 ? -1.241  7.330  1.768   1.00 1.00 ? 49 PHE A HA   15 
ATOM   11354 H HB2  . PHE A 1 49 ? -3.243  7.821  0.283   1.00 1.00 ? 49 PHE A HB2  15 
ATOM   11355 H HB3  . PHE A 1 49 ? -2.194  9.151  0.729   1.00 1.00 ? 49 PHE A HB3  15 
ATOM   11356 H HD1  . PHE A 1 49 ? -0.393  9.919  -0.994  1.00 1.00 ? 49 PHE A HD1  15 
ATOM   11357 H HD2  . PHE A 1 49 ? -4.043  7.827  -1.946  1.00 1.00 ? 49 PHE A HD2  15 
ATOM   11358 H HE1  . PHE A 1 49 ? -0.345  10.860 -3.231  1.00 1.00 ? 49 PHE A HE1  15 
ATOM   11359 H HE2  . PHE A 1 49 ? -4.093  8.998  -4.134  1.00 1.00 ? 49 PHE A HE2  15 
ATOM   11360 H HZ   . PHE A 1 49 ? -2.202  10.561 -4.756  1.00 1.00 ? 49 PHE A HZ   15 
ATOM   11361 N N    . PRO A 1 50 ? -2.448  5.153  0.857   1.00 1.00 ? 50 PRO A N    15 
ATOM   11362 C CA   . PRO A 1 50 ? -2.801  3.791  0.483   1.00 1.00 ? 50 PRO A CA   15 
ATOM   11363 C C    . PRO A 1 50 ? -3.043  3.664  -1.023  1.00 1.00 ? 50 PRO A C    15 
ATOM   11364 O O    . PRO A 1 50 ? -3.362  4.647  -1.699  1.00 1.00 ? 50 PRO A O    15 
ATOM   11365 C CB   . PRO A 1 50 ? -4.057  3.449  1.290   1.00 1.00 ? 50 PRO A CB   15 
ATOM   11366 C CG   . PRO A 1 50 ? -3.920  4.339  2.524   1.00 1.00 ? 50 PRO A CG   15 
ATOM   11367 C CD   . PRO A 1 50 ? -3.313  5.611  1.936   1.00 1.00 ? 50 PRO A CD   15 
ATOM   11368 H HA   . PRO A 1 50 ? -1.985  3.134  0.788   1.00 1.00 ? 50 PRO A HA   15 
ATOM   11369 H HB2  . PRO A 1 50 ? -4.949  3.745  0.735   1.00 1.00 ? 50 PRO A HB2  15 
ATOM   11370 H HB3  . PRO A 1 50 ? -4.110  2.390  1.546   1.00 1.00 ? 50 PRO A HB3  15 
ATOM   11371 H HG2  . PRO A 1 50 ? -4.878  4.522  3.013   1.00 1.00 ? 50 PRO A HG2  15 
ATOM   11372 H HG3  . PRO A 1 50 ? -3.219  3.886  3.225   1.00 1.00 ? 50 PRO A HG3  15 
ATOM   11373 H HD2  . PRO A 1 50 ? -4.118  6.221  1.529   1.00 1.00 ? 50 PRO A HD2  15 
ATOM   11374 H HD3  . PRO A 1 50 ? -2.783  6.167  2.710   1.00 1.00 ? 50 PRO A HD3  15 
ATOM   11375 N N    . CYS A 1 51 ? -2.847  2.464  -1.570  1.00 1.00 ? 51 CYS A N    15 
ATOM   11376 C CA   . CYS A 1 51 ? -2.946  2.261  -3.009  1.00 1.00 ? 51 CYS A CA   15 
ATOM   11377 C C    . CYS A 1 51 ? -4.402  2.296  -3.463  1.00 1.00 ? 51 CYS A C    15 
ATOM   11378 O O    . CYS A 1 51 ? -4.809  3.273  -4.087  1.00 1.00 ? 51 CYS A O    15 
ATOM   11379 C CB   . CYS A 1 51 ? -2.210  0.992  -3.448  1.00 1.00 ? 51 CYS A CB   15 
ATOM   11380 S SG   . CYS A 1 51 ? -1.248  1.265  -4.953  1.00 1.00 ? 51 CYS A SG   15 
ATOM   11381 O OXT  . CYS A 1 51 ? -5.181  1.240  -3.104  1.00 0.00 ? 51 CYS A OXT  15 
ATOM   11382 H H    . CYS A 1 51 ? -2.569  1.690  -0.985  1.00 1.00 ? 51 CYS A H    15 
ATOM   11383 H HA   . CYS A 1 51 ? -2.448  3.097  -3.494  1.00 1.00 ? 51 CYS A HA   15 
ATOM   11384 H HB2  . CYS A 1 51 ? -1.506  0.677  -2.678  1.00 1.00 ? 51 CYS A HB2  15 
ATOM   11385 H HB3  . CYS A 1 51 ? -2.907  0.173  -3.623  1.00 1.00 ? 51 CYS A HB3  15 
HETATM 11386 N N    . PCA A 1 1  ? -1.214  -1.081 3.350   1.00 1.00 ? 1  PCA A N    16 
HETATM 11387 C CA   . PCA A 1 1  ? -1.064  -0.448 4.646   1.00 1.00 ? 1  PCA A CA   16 
HETATM 11388 C CB   . PCA A 1 1  ? -0.643  -1.587 5.594   1.00 1.00 ? 1  PCA A CB   16 
HETATM 11389 C CG   . PCA A 1 1  ? -0.115  -2.679 4.650   1.00 1.00 ? 1  PCA A CG   16 
HETATM 11390 C CD   . PCA A 1 1  ? -0.536  -2.213 3.270   1.00 1.00 ? 1  PCA A CD   16 
HETATM 11391 O OE   . PCA A 1 1  ? -0.163  -2.733 2.221   1.00 1.00 ? 1  PCA A OE   16 
HETATM 11392 C C    . PCA A 1 1  ? 0.011   0.626  4.470   1.00 1.00 ? 1  PCA A C    16 
HETATM 11393 O O    . PCA A 1 1  ? -0.297  1.814  4.399   1.00 1.00 ? 1  PCA A O    16 
HETATM 11394 H H    . PCA A 1 1  ? -1.588  -0.593 2.547   1.00 0.00 ? 1  PCA A H    16 
HETATM 11395 H HA   . PCA A 1 1  ? -2.001  -0.002 4.976   1.00 1.00 ? 1  PCA A HA   16 
HETATM 11396 H HB2  . PCA A 1 1  ? 0.095   -1.274 6.335   1.00 1.00 ? 1  PCA A HB2  16 
HETATM 11397 H HB3  . PCA A 1 1  ? -1.531  -1.962 6.105   1.00 1.00 ? 1  PCA A HB3  16 
HETATM 11398 H HG2  . PCA A 1 1  ? 0.968   -2.767 4.709   1.00 1.00 ? 1  PCA A HG2  16 
HETATM 11399 H HG3  . PCA A 1 1  ? -0.584  -3.636 4.880   1.00 1.00 ? 1  PCA A HG3  16 
ATOM   11400 N N    . LYS A 1 2  ? 1.265   0.181  4.322   1.00 1.00 ? 2  LYS A N    16 
ATOM   11401 C CA   . LYS A 1 2  ? 2.388   1.012  3.913   1.00 1.00 ? 2  LYS A CA   16 
ATOM   11402 C C    . LYS A 1 2  ? 1.990   1.812  2.673   1.00 1.00 ? 2  LYS A C    16 
ATOM   11403 O O    . LYS A 1 2  ? 1.295   1.287  1.795   1.00 1.00 ? 2  LYS A O    16 
ATOM   11404 C CB   . LYS A 1 2  ? 3.632   0.138  3.659   1.00 1.00 ? 2  LYS A CB   16 
ATOM   11405 C CG   . LYS A 1 2  ? 3.434   -0.998 2.635   1.00 1.00 ? 2  LYS A CG   16 
ATOM   11406 C CD   . LYS A 1 2  ? 3.676   -0.584 1.170   1.00 1.00 ? 2  LYS A CD   16 
ATOM   11407 C CE   . LYS A 1 2  ? 2.776   -1.343 0.178   1.00 1.00 ? 2  LYS A CE   16 
ATOM   11408 N NZ   . LYS A 1 2  ? 1.340   -1.169 0.480   1.00 1.00 ? 2  LYS A NZ   16 
ATOM   11409 H H    . LYS A 1 2  ? 1.437   -0.797 4.475   1.00 1.00 ? 2  LYS A H    16 
ATOM   11410 H HA   . LYS A 1 2  ? 2.611   1.703  4.727   1.00 1.00 ? 2  LYS A HA   16 
ATOM   11411 H HB2  . LYS A 1 2  ? 4.468   0.768  3.350   1.00 1.00 ? 2  LYS A HB2  16 
ATOM   11412 H HB3  . LYS A 1 2  ? 3.898   -0.320 4.612   1.00 1.00 ? 2  LYS A HB3  16 
ATOM   11413 H HG2  . LYS A 1 2  ? 4.159   -1.778 2.868   1.00 1.00 ? 2  LYS A HG2  16 
ATOM   11414 H HG3  . LYS A 1 2  ? 2.447   -1.429 2.768   1.00 1.00 ? 2  LYS A HG3  16 
ATOM   11415 H HD2  . LYS A 1 2  ? 3.535   0.487  1.028   1.00 1.00 ? 2  LYS A HD2  16 
ATOM   11416 H HD3  . LYS A 1 2  ? 4.721   -0.788 0.922   1.00 1.00 ? 2  LYS A HD3  16 
ATOM   11417 H HE2  . LYS A 1 2  ? 2.973   -0.946 -0.821  1.00 1.00 ? 2  LYS A HE2  16 
ATOM   11418 H HE3  . LYS A 1 2  ? 3.022   -2.406 0.179   1.00 1.00 ? 2  LYS A HE3  16 
ATOM   11419 H HZ1  . LYS A 1 2  ? 1.178   -0.247 0.869   1.00 1.00 ? 2  LYS A HZ1  16 
ATOM   11420 H HZ2  . LYS A 1 2  ? 0.748   -1.244 -0.344  1.00 1.00 ? 2  LYS A HZ2  16 
ATOM   11421 H HZ3  . LYS A 1 2  ? 1.002   -1.859 1.141   1.00 1.00 ? 2  LYS A HZ3  16 
ATOM   11422 N N    . LEU A 1 3  ? 2.412   3.074  2.611   1.00 1.00 ? 3  LEU A N    16 
ATOM   11423 C CA   . LEU A 1 3  ? 1.928   3.993  1.601   1.00 1.00 ? 3  LEU A CA   16 
ATOM   11424 C C    . LEU A 1 3  ? 2.729   3.870  0.306   1.00 1.00 ? 3  LEU A C    16 
ATOM   11425 O O    . LEU A 1 3  ? 3.909   3.519  0.343   1.00 1.00 ? 3  LEU A O    16 
ATOM   11426 C CB   . LEU A 1 3  ? 1.926   5.438  2.114   1.00 1.00 ? 3  LEU A CB   16 
ATOM   11427 C CG   . LEU A 1 3  ? 1.182   5.640  3.450   1.00 1.00 ? 3  LEU A CG   16 
ATOM   11428 C CD1  . LEU A 1 3  ? 2.154   5.684  4.637   1.00 1.00 ? 3  LEU A CD1  16 
ATOM   11429 C CD2  . LEU A 1 3  ? 0.388   6.953  3.436   1.00 1.00 ? 3  LEU A CD2  16 
ATOM   11430 H H    . LEU A 1 3  ? 3.038   3.424  3.319   1.00 1.00 ? 3  LEU A H    16 
ATOM   11431 H HA   . LEU A 1 3  ? 0.906   3.705  1.396   1.00 1.00 ? 3  LEU A HA   16 
ATOM   11432 H HB2  . LEU A 1 3  ? 2.956   5.769  2.209   1.00 1.00 ? 3  LEU A HB2  16 
ATOM   11433 H HB3  . LEU A 1 3  ? 1.447   6.039  1.342   1.00 1.00 ? 3  LEU A HB3  16 
ATOM   11434 H HG   . LEU A 1 3  ? 0.476   4.824  3.605   1.00 1.00 ? 3  LEU A HG   16 
ATOM   11435 H HD11 . LEU A 1 3  ? 2.869   6.497  4.507   1.00 1.00 ? 3  LEU A HD11 16 
ATOM   11436 H HD12 . LEU A 1 3  ? 1.595   5.851  5.558   1.00 1.00 ? 3  LEU A HD12 16 
ATOM   11437 H HD13 . LEU A 1 3  ? 2.698   4.746  4.733   1.00 1.00 ? 3  LEU A HD13 16 
ATOM   11438 H HD21 . LEU A 1 3  ? -0.292  6.975  2.586   1.00 1.00 ? 3  LEU A HD21 16 
ATOM   11439 H HD22 . LEU A 1 3  ? -0.196  7.035  4.352   1.00 1.00 ? 3  LEU A HD22 16 
ATOM   11440 H HD23 . LEU A 1 3  ? 1.066   7.805  3.377   1.00 1.00 ? 3  LEU A HD23 16 
ATOM   11441 N N    . CYS A 1 4  ? 2.091   4.179  -0.826  1.00 1.00 ? 4  CYS A N    16 
ATOM   11442 C CA   . CYS A 1 4  ? 2.702   4.183  -2.149  1.00 1.00 ? 4  CYS A CA   16 
ATOM   11443 C C    . CYS A 1 4  ? 3.033   5.624  -2.509  1.00 1.00 ? 4  CYS A C    16 
ATOM   11444 O O    . CYS A 1 4  ? 2.158   6.490  -2.482  1.00 1.00 ? 4  CYS A O    16 
ATOM   11445 C CB   . CYS A 1 4  ? 1.790   3.546  -3.205  1.00 1.00 ? 4  CYS A CB   16 
ATOM   11446 S SG   . CYS A 1 4  ? 1.814   1.746  -3.211  1.00 1.00 ? 4  CYS A SG   16 
ATOM   11447 H H    . CYS A 1 4  ? 1.127   4.484  -0.757  1.00 1.00 ? 4  CYS A H    16 
ATOM   11448 H HA   . CYS A 1 4  ? 3.624   3.597  -2.134  1.00 1.00 ? 4  CYS A HA   16 
ATOM   11449 H HB2  . CYS A 1 4  ? 0.749   3.842  -3.064  1.00 1.00 ? 4  CYS A HB2  16 
ATOM   11450 H HB3  . CYS A 1 4  ? 2.116   3.867  -4.195  1.00 1.00 ? 4  CYS A HB3  16 
ATOM   11451 N N    . GLU A 1 5  ? 4.312   5.865  -2.796  1.00 1.00 ? 5  GLU A N    16 
ATOM   11452 C CA   . GLU A 1 5  ? 4.906   7.168  -3.017  1.00 1.00 ? 5  GLU A CA   16 
ATOM   11453 C C    . GLU A 1 5  ? 4.663   7.585  -4.464  1.00 1.00 ? 5  GLU A C    16 
ATOM   11454 O O    . GLU A 1 5  ? 5.502   7.350  -5.327  1.00 1.00 ? 5  GLU A O    16 
ATOM   11455 C CB   . GLU A 1 5  ? 6.413   7.081  -2.714  1.00 1.00 ? 5  GLU A CB   16 
ATOM   11456 C CG   . GLU A 1 5  ? 6.700   6.825  -1.228  1.00 1.00 ? 5  GLU A CG   16 
ATOM   11457 C CD   . GLU A 1 5  ? 6.310   5.425  -0.755  1.00 1.00 ? 5  GLU A CD   16 
ATOM   11458 O OE1  . GLU A 1 5  ? 6.316   4.493  -1.556  1.00 1.00 ? 5  GLU A OE1  16 
ATOM   11459 O OE2  . GLU A 1 5  ? 5.909   5.317  0.539   1.00 1.00 ? 5  GLU A OE2  16 
ATOM   11460 H H    . GLU A 1 5  ? 4.959   5.083  -2.764  1.00 1.00 ? 5  GLU A H    16 
ATOM   11461 H HA   . GLU A 1 5  ? 4.451   7.904  -2.350  1.00 1.00 ? 5  GLU A HA   16 
ATOM   11462 H HB2  . GLU A 1 5  ? 6.877   6.302  -3.322  1.00 1.00 ? 5  GLU A HB2  16 
ATOM   11463 H HB3  . GLU A 1 5  ? 6.874   8.029  -2.990  1.00 1.00 ? 5  GLU A HB3  16 
ATOM   11464 H HG2  . GLU A 1 5  ? 7.766   6.962  -1.049  1.00 1.00 ? 5  GLU A HG2  16 
ATOM   11465 H HG3  . GLU A 1 5  ? 6.149   7.563  -0.652  1.00 1.00 ? 5  GLU A HG3  16 
ATOM   11466 H HE2  . GLU A 1 5  ? 5.431   4.485  0.652   1.00 1.00 ? 5  GLU A HE2  16 
ATOM   11467 N N    . ARG A 1 6  ? 3.516   8.206  -4.723  1.00 1.00 ? 6  ARG A N    16 
ATOM   11468 C CA   . ARG A 1 6  ? 3.175   8.756  -6.023  1.00 1.00 ? 6  ARG A CA   16 
ATOM   11469 C C    . ARG A 1 6  ? 4.167   9.870  -6.369  1.00 1.00 ? 6  ARG A C    16 
ATOM   11470 O O    . ARG A 1 6  ? 4.156   10.903 -5.689  1.00 1.00 ? 6  ARG A O    16 
ATOM   11471 C CB   . ARG A 1 6  ? 1.746   9.306  -5.981  1.00 1.00 ? 6  ARG A CB   16 
ATOM   11472 C CG   . ARG A 1 6  ? 1.324   9.977  -7.299  1.00 1.00 ? 6  ARG A CG   16 
ATOM   11473 C CD   . ARG A 1 6  ? 0.902   11.443 -7.111  1.00 1.00 ? 6  ARG A CD   16 
ATOM   11474 N NE   . ARG A 1 6  ? 2.036   12.366 -6.880  1.00 1.00 ? 6  ARG A NE   16 
ATOM   11475 C CZ   . ARG A 1 6  ? 1.920   13.707 -6.886  1.00 1.00 ? 6  ARG A CZ   16 
ATOM   11476 N NH1  . ARG A 1 6  ? 0.701   14.255 -6.890  1.00 1.00 ? 6  ARG A NH1  16 
ATOM   11477 N NH2  . ARG A 1 6  ? 3.005   14.485 -6.892  1.00 1.00 ? 6  ARG A NH2  16 
ATOM   11478 H H    . ARG A 1 6  ? 2.931   8.446  -3.926  1.00 1.00 ? 6  ARG A H    16 
ATOM   11479 H HA   . ARG A 1 6  ? 3.193   7.947  -6.751  1.00 1.00 ? 6  ARG A HA   16 
ATOM   11480 H HB2  . ARG A 1 6  ? 1.076   8.473  -5.771  1.00 1.00 ? 6  ARG A HB2  16 
ATOM   11481 H HB3  . ARG A 1 6  ? 1.655   10.023 -5.170  1.00 1.00 ? 6  ARG A HB3  16 
ATOM   11482 H HG2  . ARG A 1 6  ? 2.109   9.907  -8.051  1.00 1.00 ? 6  ARG A HG2  16 
ATOM   11483 H HG3  . ARG A 1 6  ? 0.467   9.426  -7.691  1.00 1.00 ? 6  ARG A HG3  16 
ATOM   11484 H HD2  . ARG A 1 6  ? 0.404   11.736 -8.034  1.00 1.00 ? 6  ARG A HD2  16 
ATOM   11485 H HD3  . ARG A 1 6  ? 0.175   11.510 -6.302  1.00 1.00 ? 6  ARG A HD3  16 
ATOM   11486 H HE   . ARG A 1 6  ? 2.970   11.974 -6.781  1.00 1.00 ? 6  ARG A HE   16 
ATOM   11487 H HH11 . ARG A 1 6  ? -0.122  13.678 -6.732  1.00 1.00 ? 6  ARG A HH11 16 
ATOM   11488 H HH12 . ARG A 1 6  ? 0.532   15.259 -6.919  1.00 1.00 ? 6  ARG A HH12 16 
ATOM   11489 H HH21 . ARG A 1 6  ? 3.936   14.059 -6.829  1.00 1.00 ? 6  ARG A HH21 16 
ATOM   11490 H HH22 . ARG A 1 6  ? 3.002   15.471 -7.133  1.00 1.00 ? 6  ARG A HH22 16 
ATOM   11491 N N    . PRO A 1 7  ? 4.986   9.712  -7.423  1.00 1.00 ? 7  PRO A N    16 
ATOM   11492 C CA   . PRO A 1 7  ? 5.966   10.709 -7.803  1.00 1.00 ? 7  PRO A CA   16 
ATOM   11493 C C    . PRO A 1 7  ? 5.256   11.868 -8.512  1.00 1.00 ? 7  PRO A C    16 
ATOM   11494 O O    . PRO A 1 7  ? 4.771   12.773 -7.841  1.00 1.00 ? 7  PRO A O    16 
ATOM   11495 C CB   . PRO A 1 7  ? 6.987   9.945  -8.655  1.00 1.00 ? 7  PRO A CB   16 
ATOM   11496 C CG   . PRO A 1 7  ? 6.171   8.830  -9.312  1.00 1.00 ? 7  PRO A CG   16 
ATOM   11497 C CD   . PRO A 1 7  ? 5.062   8.548  -8.299  1.00 1.00 ? 7  PRO A CD   16 
ATOM   11498 H HA   . PRO A 1 7  ? 6.449   11.104 -6.905  1.00 1.00 ? 7  PRO A HA   16 
ATOM   11499 H HB2  . PRO A 1 7  ? 7.515   10.560 -9.379  1.00 1.00 ? 7  PRO A HB2  16 
ATOM   11500 H HB3  . PRO A 1 7  ? 7.712   9.484  -7.982  1.00 1.00 ? 7  PRO A HB3  16 
ATOM   11501 H HG2  . PRO A 1 7  ? 5.730   9.164  -10.251 1.00 1.00 ? 7  PRO A HG2  16 
ATOM   11502 H HG3  . PRO A 1 7  ? 6.781   7.944  -9.497  1.00 1.00 ? 7  PRO A HG3  16 
ATOM   11503 H HD2  . PRO A 1 7  ? 4.119   8.382  -8.822  1.00 1.00 ? 7  PRO A HD2  16 
ATOM   11504 H HD3  . PRO A 1 7  ? 5.331   7.657  -7.732  1.00 1.00 ? 7  PRO A HD3  16 
ATOM   11505 N N    . SER A 1 8  ? 5.168   11.864 -9.846  1.00 1.00 ? 8  SER A N    16 
ATOM   11506 C CA   . SER A 1 8  ? 4.361   12.830 -10.589 1.00 1.00 ? 8  SER A CA   16 
ATOM   11507 C C    . SER A 1 8  ? 2.865   12.518 -10.426 1.00 1.00 ? 8  SER A C    16 
ATOM   11508 O O    . SER A 1 8  ? 2.500   11.413 -10.033 1.00 1.00 ? 8  SER A O    16 
ATOM   11509 C CB   . SER A 1 8  ? 4.760   12.803 -12.072 1.00 1.00 ? 8  SER A CB   16 
ATOM   11510 O OG   . SER A 1 8  ? 6.107   13.217 -12.285 1.00 1.00 ? 8  SER A OG   16 
ATOM   11511 H H    . SER A 1 8  ? 5.569   11.099 -10.363 1.00 1.00 ? 8  SER A H    16 
ATOM   11512 H HA   . SER A 1 8  ? 4.542   13.830 -10.196 1.00 1.00 ? 8  SER A HA   16 
ATOM   11513 H HB2  . SER A 1 8  ? 4.620   11.791 -12.458 1.00 1.00 ? 8  SER A HB2  16 
ATOM   11514 H HB3  . SER A 1 8  ? 4.091   13.461 -12.630 1.00 1.00 ? 8  SER A HB3  16 
ATOM   11515 H HG   . SER A 1 8  ? 6.268   13.142 -13.233 1.00 1.00 ? 8  SER A HG   16 
ATOM   11516 N N    . GLY A 1 9  ? 2.000   13.480 -10.757 1.00 1.00 ? 9  GLY A N    16 
ATOM   11517 C CA   . GLY A 1 9  ? 0.555   13.301 -10.828 1.00 1.00 ? 9  GLY A CA   16 
ATOM   11518 C C    . GLY A 1 9  ? -0.103  14.673 -10.908 1.00 1.00 ? 9  GLY A C    16 
ATOM   11519 O O    . GLY A 1 9  ? -0.378  15.162 -11.999 1.00 1.00 ? 9  GLY A O    16 
ATOM   11520 H H    . GLY A 1 9  ? 2.365   14.368 -11.091 1.00 1.00 ? 9  GLY A H    16 
ATOM   11521 H HA2  . GLY A 1 9  ? 0.311   12.731 -11.725 1.00 1.00 ? 9  GLY A HA2  16 
ATOM   11522 H HA3  . GLY A 1 9  ? 0.182   12.765 -9.959  1.00 1.00 ? 9  GLY A HA3  16 
ATOM   11523 N N    . THR A 1 10 ? -0.296  15.315 -9.753  1.00 1.00 ? 10 THR A N    16 
ATOM   11524 C CA   . THR A 1 10 ? -0.696  16.711 -9.690  1.00 1.00 ? 10 THR A CA   16 
ATOM   11525 C C    . THR A 1 10 ? 0.604   17.500 -9.816  1.00 1.00 ? 10 THR A C    16 
ATOM   11526 O O    . THR A 1 10 ? 1.146   17.684 -10.907 1.00 1.00 ? 10 THR A O    16 
ATOM   11527 C CB   . THR A 1 10 ? -1.413  17.020 -8.354  1.00 1.00 ? 10 THR A CB   16 
ATOM   11528 O OG1  . THR A 1 10 ? -0.710  16.470 -7.246  1.00 1.00 ? 10 THR A OG1  16 
ATOM   11529 C CG2  . THR A 1 10 ? -2.845  16.500 -8.319  1.00 1.00 ? 10 THR A CG2  16 
ATOM   11530 H H    . THR A 1 10 ? -0.065  14.856 -8.890  1.00 1.00 ? 10 THR A H    16 
ATOM   11531 H HA   . THR A 1 10 ? -1.351  16.974 -10.523 1.00 1.00 ? 10 THR A HA   16 
ATOM   11532 H HB   . THR A 1 10 ? -1.480  18.105 -8.238  1.00 1.00 ? 10 THR A HB   16 
ATOM   11533 H HG1  . THR A 1 10 ? -1.321  16.448 -6.494  1.00 1.00 ? 10 THR A HG1  16 
ATOM   11534 H HG21 . THR A 1 10 ? -3.399  16.913 -9.160  1.00 1.00 ? 10 THR A HG21 16 
ATOM   11535 H HG22 . THR A 1 10 ? -2.850  15.412 -8.359  1.00 1.00 ? 10 THR A HG22 16 
ATOM   11536 H HG23 . THR A 1 10 ? -3.321  16.836 -7.395  1.00 1.00 ? 10 THR A HG23 16 
ATOM   11537 N N    . TRP A 1 11 ? 1.154   17.894 -8.670  1.00 1.00 ? 11 TRP A N    16 
ATOM   11538 C CA   . TRP A 1 11 ? 2.420   18.576 -8.606  1.00 1.00 ? 11 TRP A CA   16 
ATOM   11539 C C    . TRP A 1 11 ? 3.505   17.598 -9.033  1.00 1.00 ? 11 TRP A C    16 
ATOM   11540 O O    . TRP A 1 11 ? 3.850   16.684 -8.282  1.00 1.00 ? 11 TRP A O    16 
ATOM   11541 C CB   . TRP A 1 11 ? 2.637   19.100 -7.195  1.00 1.00 ? 11 TRP A CB   16 
ATOM   11542 C CG   . TRP A 1 11 ? 3.636   20.202 -7.070  1.00 1.00 ? 11 TRP A CG   16 
ATOM   11543 C CD1  . TRP A 1 11 ? 4.667   20.487 -7.899  1.00 1.00 ? 11 TRP A CD1  16 
ATOM   11544 C CD2  . TRP A 1 11 ? 3.641   21.240 -6.063  1.00 1.00 ? 11 TRP A CD2  16 
ATOM   11545 N NE1  . TRP A 1 11 ? 5.269   21.660 -7.500  1.00 1.00 ? 11 TRP A NE1  16 
ATOM   11546 C CE2  . TRP A 1 11 ? 4.669   22.172 -6.368  1.00 1.00 ? 11 TRP A CE2  16 
ATOM   11547 C CE3  . TRP A 1 11 ? 2.854   21.487 -4.927  1.00 1.00 ? 11 TRP A CE3  16 
ATOM   11548 C CZ2  . TRP A 1 11 ? 4.902   23.303 -5.576  1.00 1.00 ? 11 TRP A CZ2  16 
ATOM   11549 C CZ3  . TRP A 1 11 ? 3.088   22.606 -4.116  1.00 1.00 ? 11 TRP A CZ3  16 
ATOM   11550 C CH2  . TRP A 1 11 ? 4.140   23.482 -4.411  1.00 1.00 ? 11 TRP A CH2  16 
ATOM   11551 H H    . TRP A 1 11 ? 0.694   17.634 -7.805  1.00 1.00 ? 11 TRP A H    16 
ATOM   11552 H HA   . TRP A 1 11 ? 2.379   19.432 -9.284  1.00 1.00 ? 11 TRP A HA   16 
ATOM   11553 H HB2  . TRP A 1 11 ? 1.689   19.520 -6.854  1.00 1.00 ? 11 TRP A HB2  16 
ATOM   11554 H HB3  . TRP A 1 11 ? 2.891   18.288 -6.517  1.00 1.00 ? 11 TRP A HB3  16 
ATOM   11555 H HD1  . TRP A 1 11 ? 4.959   19.928 -8.773  1.00 1.00 ? 11 TRP A HD1  16 
ATOM   11556 H HE1  . TRP A 1 11 ? 6.071   22.097 -7.945  1.00 1.00 ? 11 TRP A HE1  16 
ATOM   11557 H HE3  . TRP A 1 11 ? 2.065   20.796 -4.684  1.00 1.00 ? 11 TRP A HE3  16 
ATOM   11558 H HZ2  . TRP A 1 11 ? 5.685   24.001 -5.833  1.00 1.00 ? 11 TRP A HZ2  16 
ATOM   11559 H HZ3  . TRP A 1 11 ? 2.453   22.795 -3.268  1.00 1.00 ? 11 TRP A HZ3  16 
ATOM   11560 H HH2  . TRP A 1 11 ? 4.371   24.266 -3.716  1.00 1.00 ? 11 TRP A HH2  16 
ATOM   11561 N N    . SER A 1 12 ? 3.980   17.779 -10.263 1.00 1.00 ? 12 SER A N    16 
ATOM   11562 C CA   . SER A 1 12 ? 4.933   16.905 -10.922 1.00 1.00 ? 12 SER A CA   16 
ATOM   11563 C C    . SER A 1 12 ? 6.270   17.612 -11.168 1.00 1.00 ? 12 SER A C    16 
ATOM   11564 O O    . SER A 1 12 ? 7.304   16.947 -11.247 1.00 1.00 ? 12 SER A O    16 
ATOM   11565 C CB   . SER A 1 12 ? 4.294   16.417 -12.224 1.00 1.00 ? 12 SER A CB   16 
ATOM   11566 O OG   . SER A 1 12 ? 3.033   15.835 -11.931 1.00 1.00 ? 12 SER A OG   16 
ATOM   11567 H H    . SER A 1 12 ? 3.503   18.467 -10.828 1.00 1.00 ? 12 SER A H    16 
ATOM   11568 H HA   . SER A 1 12 ? 5.138   16.036 -10.298 1.00 1.00 ? 12 SER A HA   16 
ATOM   11569 H HB2  . SER A 1 12 ? 4.158   17.250 -12.918 1.00 1.00 ? 12 SER A HB2  16 
ATOM   11570 H HB3  . SER A 1 12 ? 4.951   15.684 -12.693 1.00 1.00 ? 12 SER A HB3  16 
ATOM   11571 H HG   . SER A 1 12 ? 2.396   16.541 -11.726 1.00 1.00 ? 12 SER A HG   16 
ATOM   11572 N N    . GLY A 1 13 ? 6.240   18.942 -11.307 1.00 1.00 ? 13 GLY A N    16 
ATOM   11573 C CA   . GLY A 1 13 ? 7.416   19.766 -11.541 1.00 1.00 ? 13 GLY A CA   16 
ATOM   11574 C C    . GLY A 1 13 ? 8.172   20.069 -10.248 1.00 1.00 ? 13 GLY A C    16 
ATOM   11575 O O    . GLY A 1 13 ? 8.035   19.351 -9.257  1.00 1.00 ? 13 GLY A O    16 
ATOM   11576 H H    . GLY A 1 13 ? 5.360   19.420 -11.210 1.00 1.00 ? 13 GLY A H    16 
ATOM   11577 H HA2  . GLY A 1 13 ? 8.087   19.268 -12.238 1.00 1.00 ? 13 GLY A HA2  16 
ATOM   11578 H HA3  . GLY A 1 13 ? 7.087   20.704 -11.991 1.00 1.00 ? 13 GLY A HA3  16 
ATOM   11579 N N    . VAL A 1 14 ? 8.965   21.146 -10.272 1.00 1.00 ? 14 VAL A N    16 
ATOM   11580 C CA   . VAL A 1 14 ? 9.743   21.608 -9.129  1.00 1.00 ? 14 VAL A CA   16 
ATOM   11581 C C    . VAL A 1 14 ? 8.811   21.832 -7.937  1.00 1.00 ? 14 VAL A C    16 
ATOM   11582 O O    . VAL A 1 14 ? 7.813   22.539 -8.053  1.00 1.00 ? 14 VAL A O    16 
ATOM   11583 C CB   . VAL A 1 14 ? 10.489  22.906 -9.471  1.00 1.00 ? 14 VAL A CB   16 
ATOM   11584 C CG1  . VAL A 1 14 ? 11.254  23.471 -8.265  1.00 1.00 ? 14 VAL A CG1  16 
ATOM   11585 C CG2  . VAL A 1 14 ? 11.472  22.700 -10.632 1.00 1.00 ? 14 VAL A CG2  16 
ATOM   11586 H H    . VAL A 1 14 ? 8.995   21.708 -11.108 1.00 1.00 ? 14 VAL A H    16 
ATOM   11587 H HA   . VAL A 1 14 ? 10.486  20.848 -8.902  1.00 1.00 ? 14 VAL A HA   16 
ATOM   11588 H HB   . VAL A 1 14 ? 9.739   23.639 -9.747  1.00 1.00 ? 14 VAL A HB   16 
ATOM   11589 H HG11 . VAL A 1 14 ? 11.924  22.718 -7.853  1.00 1.00 ? 14 VAL A HG11 16 
ATOM   11590 H HG12 . VAL A 1 14 ? 11.843  24.336 -8.575  1.00 1.00 ? 14 VAL A HG12 16 
ATOM   11591 H HG13 . VAL A 1 14 ? 10.561  23.797 -7.492  1.00 1.00 ? 14 VAL A HG13 16 
ATOM   11592 H HG21 . VAL A 1 14 ? 10.955  22.361 -11.527 1.00 1.00 ? 14 VAL A HG21 16 
ATOM   11593 H HG22 . VAL A 1 14 ? 11.969  23.643 -10.861 1.00 1.00 ? 14 VAL A HG22 16 
ATOM   11594 H HG23 . VAL A 1 14 ? 12.227  21.964 -10.351 1.00 1.00 ? 14 VAL A HG23 16 
ATOM   11595 N N    . CYS A 1 15 ? 9.143   21.228 -6.800  1.00 1.00 ? 15 CYS A N    16 
ATOM   11596 C CA   . CYS A 1 15 ? 8.311   21.238 -5.600  1.00 1.00 ? 15 CYS A CA   16 
ATOM   11597 C C    . CYS A 1 15 ? 8.390   22.572 -4.871  1.00 1.00 ? 15 CYS A C    16 
ATOM   11598 O O    . CYS A 1 15 ? 7.429   22.971 -4.225  1.00 1.00 ? 15 CYS A O    16 
ATOM   11599 C CB   . CYS A 1 15 ? 8.694   20.111 -4.637  1.00 1.00 ? 15 CYS A CB   16 
ATOM   11600 S SG   . CYS A 1 15 ? 9.941   20.547 -3.403  1.00 1.00 ? 15 CYS A SG   16 
ATOM   11601 H H    . CYS A 1 15 ? 9.985   20.670 -6.836  1.00 1.00 ? 15 CYS A H    16 
ATOM   11602 H HA   . CYS A 1 15 ? 7.280   21.060 -5.900  1.00 1.00 ? 15 CYS A HA   16 
ATOM   11603 H HB2  . CYS A 1 15 ? 7.804   19.810 -4.083  1.00 1.00 ? 15 CYS A HB2  16 
ATOM   11604 H HB3  . CYS A 1 15 ? 9.045   19.259 -5.205  1.00 1.00 ? 15 CYS A HB3  16 
ATOM   11605 N N    . GLY A 1 16 ? 9.561   23.215 -4.867  1.00 1.00 ? 16 GLY A N    16 
ATOM   11606 C CA   . GLY A 1 16 ? 9.790   24.460 -4.146  1.00 1.00 ? 16 GLY A CA   16 
ATOM   11607 C C    . GLY A 1 16 ? 9.798   24.326 -2.614  1.00 1.00 ? 16 GLY A C    16 
ATOM   11608 O O    . GLY A 1 16 ? 10.590  24.995 -1.955  1.00 1.00 ? 16 GLY A O    16 
ATOM   11609 H H    . GLY A 1 16 ? 10.330  22.810 -5.379  1.00 1.00 ? 16 GLY A H    16 
ATOM   11610 H HA2  . GLY A 1 16 ? 10.751  24.866 -4.463  1.00 1.00 ? 16 GLY A HA2  16 
ATOM   11611 H HA3  . GLY A 1 16 ? 9.015   25.176 -4.422  1.00 1.00 ? 16 GLY A HA3  16 
ATOM   11612 N N    . ASN A 1 17 ? 8.926   23.496 -2.026  1.00 1.00 ? 17 ASN A N    16 
ATOM   11613 C CA   . ASN A 1 17 ? 8.693   23.464 -0.587  1.00 1.00 ? 17 ASN A CA   16 
ATOM   11614 C C    . ASN A 1 17 ? 7.847   22.257 -0.160  1.00 1.00 ? 17 ASN A C    16 
ATOM   11615 O O    . ASN A 1 17 ? 6.771   22.009 -0.706  1.00 1.00 ? 17 ASN A O    16 
ATOM   11616 C CB   . ASN A 1 17 ? 7.982   24.756 -0.162  1.00 1.00 ? 17 ASN A CB   16 
ATOM   11617 C CG   . ASN A 1 17 ? 7.625   24.714 1.317   1.00 1.00 ? 17 ASN A CG   16 
ATOM   11618 O OD1  . ASN A 1 17 ? 6.492   24.416 1.677   1.00 1.00 ? 17 ASN A OD1  16 
ATOM   11619 N ND2  . ASN A 1 17 ? 8.595   24.970 2.190   1.00 1.00 ? 17 ASN A ND2  16 
ATOM   11620 H H    . ASN A 1 17 ? 8.350   22.910 -2.617  1.00 1.00 ? 17 ASN A H    16 
ATOM   11621 H HA   . ASN A 1 17 ? 9.660   23.419 -0.083  1.00 1.00 ? 17 ASN A HA   16 
ATOM   11622 H HB2  . ASN A 1 17 ? 8.613   25.625 -0.353  1.00 1.00 ? 17 ASN A HB2  16 
ATOM   11623 H HB3  . ASN A 1 17 ? 7.062   24.864 -0.738  1.00 1.00 ? 17 ASN A HB3  16 
ATOM   11624 H HD21 . ASN A 1 17 ? 9.512   25.242 1.865   1.00 1.00 ? 17 ASN A HD21 16 
ATOM   11625 H HD22 . ASN A 1 17 ? 8.375   24.982 3.174   1.00 1.00 ? 17 ASN A HD22 16 
ATOM   11626 N N    . ASN A 1 18 ? 8.323   21.541 0.867   1.00 1.00 ? 18 ASN A N    16 
ATOM   11627 C CA   . ASN A 1 18 ? 7.671   20.391 1.472   1.00 1.00 ? 18 ASN A CA   16 
ATOM   11628 C C    . ASN A 1 18 ? 6.209   20.643 1.823   1.00 1.00 ? 18 ASN A C    16 
ATOM   11629 O O    . ASN A 1 18 ? 5.332   19.878 1.445   1.00 1.00 ? 18 ASN A O    16 
ATOM   11630 C CB   . ASN A 1 18 ? 8.417   20.029 2.759   1.00 1.00 ? 18 ASN A CB   16 
ATOM   11631 C CG   . ASN A 1 18 ? 7.839   18.747 3.333   1.00 1.00 ? 18 ASN A CG   16 
ATOM   11632 O OD1  . ASN A 1 18 ? 6.833   18.762 4.038   1.00 1.00 ? 18 ASN A OD1  16 
ATOM   11633 N ND2  . ASN A 1 18 ? 8.431   17.611 2.991   1.00 1.00 ? 18 ASN A ND2  16 
ATOM   11634 H H    . ASN A 1 18 ? 9.218   21.788 1.257   1.00 1.00 ? 18 ASN A H    16 
ATOM   11635 H HA   . ASN A 1 18 ? 7.723   19.556 0.775   1.00 1.00 ? 18 ASN A HA   16 
ATOM   11636 H HB2  . ASN A 1 18 ? 9.473   19.916 2.544   1.00 1.00 ? 18 ASN A HB2  16 
ATOM   11637 H HB3  . ASN A 1 18 ? 8.320   20.822 3.503   1.00 1.00 ? 18 ASN A HB3  16 
ATOM   11638 H HD21 . ASN A 1 18 ? 9.318   17.592 2.507   1.00 1.00 ? 18 ASN A HD21 16 
ATOM   11639 H HD22 . ASN A 1 18 ? 7.995   16.758 3.313   1.00 1.00 ? 18 ASN A HD22 16 
ATOM   11640 N N    . ASN A 1 19 ? 5.978   21.667 2.634   1.00 1.00 ? 19 ASN A N    16 
ATOM   11641 C CA   . ASN A 1 19 ? 4.669   21.983 3.196   1.00 1.00 ? 19 ASN A CA   16 
ATOM   11642 C C    . ASN A 1 19 ? 3.638   22.328 2.116   1.00 1.00 ? 19 ASN A C    16 
ATOM   11643 O O    . ASN A 1 19 ? 2.521   21.814 2.144   1.00 1.00 ? 19 ASN A O    16 
ATOM   11644 C CB   . ASN A 1 19 ? 4.772   23.103 4.234   1.00 1.00 ? 19 ASN A CB   16 
ATOM   11645 C CG   . ASN A 1 19 ? 3.396   23.392 4.827   1.00 1.00 ? 19 ASN A CG   16 
ATOM   11646 O OD1  . ASN A 1 19 ? 2.895   22.619 5.636   1.00 1.00 ? 19 ASN A OD1  16 
ATOM   11647 N ND2  . ASN A 1 19 ? 2.768   24.492 4.423   1.00 1.00 ? 19 ASN A ND2  16 
ATOM   11648 H H    . ASN A 1 19 ? 6.806   22.145 2.949   1.00 1.00 ? 19 ASN A H    16 
ATOM   11649 H HA   . ASN A 1 19 ? 4.315   21.095 3.721   1.00 1.00 ? 19 ASN A HA   16 
ATOM   11650 H HB2  . ASN A 1 19 ? 5.438   22.787 5.038   1.00 1.00 ? 19 ASN A HB2  16 
ATOM   11651 H HB3  . ASN A 1 19 ? 5.175   24.009 3.784   1.00 1.00 ? 19 ASN A HB3  16 
ATOM   11652 H HD21 . ASN A 1 19 ? 3.193   25.119 3.757   1.00 1.00 ? 19 ASN A HD21 16 
ATOM   11653 H HD22 . ASN A 1 19 ? 1.859   24.691 4.813   1.00 1.00 ? 19 ASN A HD22 16 
ATOM   11654 N N    . ALA A 1 20 ? 3.992   23.186 1.155   1.00 1.00 ? 20 ALA A N    16 
ATOM   11655 C CA   . ALA A 1 20 ? 3.093   23.461 0.037   1.00 1.00 ? 20 ALA A CA   16 
ATOM   11656 C C    . ALA A 1 20 ? 2.770   22.155 -0.681  1.00 1.00 ? 20 ALA A C    16 
ATOM   11657 O O    . ALA A 1 20 ? 1.600   21.853 -0.917  1.00 1.00 ? 20 ALA A O    16 
ATOM   11658 C CB   . ALA A 1 20 ? 3.700   24.458 -0.949  1.00 1.00 ? 20 ALA A CB   16 
ATOM   11659 H H    . ALA A 1 20 ? 4.918   23.602 1.176   1.00 1.00 ? 20 ALA A H    16 
ATOM   11660 H HA   . ALA A 1 20 ? 2.166   23.885 0.429   1.00 1.00 ? 20 ALA A HA   16 
ATOM   11661 H HB1  . ALA A 1 20 ? 3.913   25.402 -0.452  1.00 1.00 ? 20 ALA A HB1  16 
ATOM   11662 H HB2  . ALA A 1 20 ? 4.611   24.050 -1.384  1.00 1.00 ? 20 ALA A HB2  16 
ATOM   11663 H HB3  . ALA A 1 20 ? 2.977   24.640 -1.748  1.00 1.00 ? 20 ALA A HB3  16 
ATOM   11664 N N    . CYS A 1 21 ? 3.812   21.380 -1.010  1.00 1.00 ? 21 CYS A N    16 
ATOM   11665 C CA   . CYS A 1 21 ? 3.635   20.084 -1.646  1.00 1.00 ? 21 CYS A CA   16 
ATOM   11666 C C    . CYS A 1 21 ? 2.639   19.229 -0.859  1.00 1.00 ? 21 CYS A C    16 
ATOM   11667 O O    . CYS A 1 21 ? 1.679   18.715 -1.424  1.00 1.00 ? 21 CYS A O    16 
ATOM   11668 C CB   . CYS A 1 21 ? 4.969   19.346 -1.783  1.00 1.00 ? 21 CYS A CB   16 
ATOM   11669 S SG   . CYS A 1 21 ? 4.792   17.548 -1.888  1.00 1.00 ? 21 CYS A SG   16 
ATOM   11670 H H    . CYS A 1 21 ? 4.758   21.697 -0.808  1.00 1.00 ? 21 CYS A H    16 
ATOM   11671 H HA   . CYS A 1 21 ? 3.246   20.274 -2.644  1.00 1.00 ? 21 CYS A HA   16 
ATOM   11672 H HB2  . CYS A 1 21 ? 5.490   19.709 -2.669  1.00 1.00 ? 21 CYS A HB2  16 
ATOM   11673 H HB3  . CYS A 1 21 ? 5.602   19.542 -0.925  1.00 1.00 ? 21 CYS A HB3  16 
ATOM   11674 N N    . LYS A 1 22 ? 2.878   19.090 0.445   1.00 1.00 ? 22 LYS A N    16 
ATOM   11675 C CA   . LYS A 1 22 ? 2.070   18.330 1.385   1.00 1.00 ? 22 LYS A CA   16 
ATOM   11676 C C    . LYS A 1 22 ? 0.609   18.733 1.270   1.00 1.00 ? 22 LYS A C    16 
ATOM   11677 O O    . LYS A 1 22 ? -0.260  17.890 1.033   1.00 1.00 ? 22 LYS A O    16 
ATOM   11678 C CB   . LYS A 1 22 ? 2.625   18.571 2.797   1.00 1.00 ? 22 LYS A CB   16 
ATOM   11679 C CG   . LYS A 1 22 ? 1.867   17.831 3.908   1.00 1.00 ? 22 LYS A CG   16 
ATOM   11680 C CD   . LYS A 1 22 ? 2.594   17.902 5.267   1.00 1.00 ? 22 LYS A CD   16 
ATOM   11681 C CE   . LYS A 1 22 ? 3.721   16.873 5.492   1.00 1.00 ? 22 LYS A CE   16 
ATOM   11682 N NZ   . LYS A 1 22 ? 4.856   17.029 4.559   1.00 1.00 ? 22 LYS A NZ   16 
ATOM   11683 H H    . LYS A 1 22 ? 3.691   19.564 0.810   1.00 1.00 ? 22 LYS A H    16 
ATOM   11684 H HA   . LYS A 1 22 ? 2.153   17.275