data_1AYU
# 
_entry.id   1AYU 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.290 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1AYU         
WWPDB D_1000171421 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1AYU 
_pdbx_database_status.recvd_initial_deposition_date   1997-11-10 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    BNL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Zhao, B.'           1 
'Smith, W.W.'        2 
'Janson, C.A.'       3 
'Abdel-Meguid, S.S.' 4 
# 
_citation.id                        primary 
_citation.title                     'Design of potent and selective human cathepsin K inhibitors that span the active site.' 
_citation.journal_abbrev            Proc.Natl.Acad.Sci.USA 
_citation.journal_volume            94 
_citation.page_first                14249 
_citation.page_last                 14254 
_citation.year                      1997 
_citation.journal_id_ASTM           PNASA6 
_citation.country                   US 
_citation.journal_id_ISSN           0027-8424 
_citation.journal_id_CSD            0040 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   9405598 
_citation.pdbx_database_id_DOI      10.1073/pnas.94.26.14249 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Thompson, S.K.'      1  
primary 'Halbert, S.M.'       2  
primary 'Bossard, M.J.'       3  
primary 'Tomaszek, T.A.'      4  
primary 'Levy, M.A.'          5  
primary 'Zhao, B.'            6  
primary 'Smith, W.W.'         7  
primary 'Abdel-Meguid, S.S.'  8  
primary 'Janson, C.A.'        9  
primary 
;D'Alessio, K.J.
;
10 
primary 'McQueney, M.S.'      11 
primary 'Amegadzie, B.Y.'     12 
primary 'Hanning, C.R.'       13 
primary 'DesJarlais, R.L.'    14 
primary 'Briand, J.'          15 
primary 'Sarkar, S.K.'        16 
primary 'Huddleston, M.J.'    17 
primary 'Ijames, C.F.'        18 
primary 'Carr, S.A.'          19 
primary 'Garnes, K.T.'        20 
primary 'Shu, A.'             21 
primary 'Heys, J.R.'          22 
primary 'Bradbeer, J.'        23 
primary 'Zembryki, D.'        24 
primary 'Lee-Rykaczewski, L.' 25 
primary 'James, I.E.'         26 
primary 'Lark, M.W.'          27 
primary 'Drake, F.H.'         28 
primary 'Gowen, M.'           29 
primary 'Gleason, J.G.'       30 
primary 'Veber, D.F.'         31 
# 
_cell.entry_id           1AYU 
_cell.length_a           38.330 
_cell.length_b           51.300 
_cell.length_c           103.860 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         1AYU 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'CATHEPSIN K'                                           23523.480 1  3.4.22.38 ? ? 
'INHIBITOR COVALENTLY BOUND TO ACTIVE SITE CYS 25' 
2 non-polymer syn '1,5-BIS(N-BENZYLOXYCARBONYL-L-LEUCINYL)CARBOHYDRAZIDE' 584.664   1  ?         ? ? ? 
3 water       nat water                                                   18.015    66 ?         ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;APDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRG
IDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNL
NHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM
;
_entity_poly.pdbx_seq_one_letter_code_can   
;APDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRG
IDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNL
NHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ALA n 
1 2   PRO n 
1 3   ASP n 
1 4   SER n 
1 5   VAL n 
1 6   ASP n 
1 7   TYR n 
1 8   ARG n 
1 9   LYS n 
1 10  LYS n 
1 11  GLY n 
1 12  TYR n 
1 13  VAL n 
1 14  THR n 
1 15  PRO n 
1 16  VAL n 
1 17  LYS n 
1 18  ASN n 
1 19  GLN n 
1 20  GLY n 
1 21  GLN n 
1 22  CYS n 
1 23  GLY n 
1 24  SER n 
1 25  CYS n 
1 26  TRP n 
1 27  ALA n 
1 28  PHE n 
1 29  SER n 
1 30  SER n 
1 31  VAL n 
1 32  GLY n 
1 33  ALA n 
1 34  LEU n 
1 35  GLU n 
1 36  GLY n 
1 37  GLN n 
1 38  LEU n 
1 39  LYS n 
1 40  LYS n 
1 41  LYS n 
1 42  THR n 
1 43  GLY n 
1 44  LYS n 
1 45  LEU n 
1 46  LEU n 
1 47  ASN n 
1 48  LEU n 
1 49  SER n 
1 50  PRO n 
1 51  GLN n 
1 52  ASN n 
1 53  LEU n 
1 54  VAL n 
1 55  ASP n 
1 56  CYS n 
1 57  VAL n 
1 58  SER n 
1 59  GLU n 
1 60  ASN n 
1 61  ASP n 
1 62  GLY n 
1 63  CYS n 
1 64  GLY n 
1 65  GLY n 
1 66  GLY n 
1 67  TYR n 
1 68  MET n 
1 69  THR n 
1 70  ASN n 
1 71  ALA n 
1 72  PHE n 
1 73  GLN n 
1 74  TYR n 
1 75  VAL n 
1 76  GLN n 
1 77  LYS n 
1 78  ASN n 
1 79  ARG n 
1 80  GLY n 
1 81  ILE n 
1 82  ASP n 
1 83  SER n 
1 84  GLU n 
1 85  ASP n 
1 86  ALA n 
1 87  TYR n 
1 88  PRO n 
1 89  TYR n 
1 90  VAL n 
1 91  GLY n 
1 92  GLN n 
1 93  GLU n 
1 94  GLU n 
1 95  SER n 
1 96  CYS n 
1 97  MET n 
1 98  TYR n 
1 99  ASN n 
1 100 PRO n 
1 101 THR n 
1 102 GLY n 
1 103 LYS n 
1 104 ALA n 
1 105 ALA n 
1 106 LYS n 
1 107 CYS n 
1 108 ARG n 
1 109 GLY n 
1 110 TYR n 
1 111 ARG n 
1 112 GLU n 
1 113 ILE n 
1 114 PRO n 
1 115 GLU n 
1 116 GLY n 
1 117 ASN n 
1 118 GLU n 
1 119 LYS n 
1 120 ALA n 
1 121 LEU n 
1 122 LYS n 
1 123 ARG n 
1 124 ALA n 
1 125 VAL n 
1 126 ALA n 
1 127 ARG n 
1 128 VAL n 
1 129 GLY n 
1 130 PRO n 
1 131 VAL n 
1 132 SER n 
1 133 VAL n 
1 134 ALA n 
1 135 ILE n 
1 136 ASP n 
1 137 ALA n 
1 138 SER n 
1 139 LEU n 
1 140 THR n 
1 141 SER n 
1 142 PHE n 
1 143 GLN n 
1 144 PHE n 
1 145 TYR n 
1 146 SER n 
1 147 LYS n 
1 148 GLY n 
1 149 VAL n 
1 150 TYR n 
1 151 TYR n 
1 152 ASP n 
1 153 GLU n 
1 154 SER n 
1 155 CYS n 
1 156 ASN n 
1 157 SER n 
1 158 ASP n 
1 159 ASN n 
1 160 LEU n 
1 161 ASN n 
1 162 HIS n 
1 163 ALA n 
1 164 VAL n 
1 165 LEU n 
1 166 ALA n 
1 167 VAL n 
1 168 GLY n 
1 169 TYR n 
1 170 GLY n 
1 171 ILE n 
1 172 GLN n 
1 173 LYS n 
1 174 GLY n 
1 175 ASN n 
1 176 LYS n 
1 177 HIS n 
1 178 TRP n 
1 179 ILE n 
1 180 ILE n 
1 181 LYS n 
1 182 ASN n 
1 183 SER n 
1 184 TRP n 
1 185 GLY n 
1 186 GLU n 
1 187 ASN n 
1 188 TRP n 
1 189 GLY n 
1 190 ASN n 
1 191 LYS n 
1 192 GLY n 
1 193 TYR n 
1 194 ILE n 
1 195 LEU n 
1 196 MET n 
1 197 ALA n 
1 198 ARG n 
1 199 ASN n 
1 200 LYS n 
1 201 ASN n 
1 202 ASN n 
1 203 ALA n 
1 204 CYS n 
1 205 GLY n 
1 206 ILE n 
1 207 ALA n 
1 208 ASN n 
1 209 LEU n 
1 210 ALA n 
1 211 SER n 
1 212 PHE n 
1 213 PRO n 
1 214 LYS n 
1 215 MET n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            SF21 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 OSTEOCLAST 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               'fall armyworm' 
_entity_src_gen.pdbx_host_org_scientific_name      'Spodoptera frugiperda' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     7108 
_entity_src_gen.host_org_genus                     Spodoptera 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            SF21 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               BACULOVIRUS 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    CATK_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P43235 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   
;MWGLKVLLLPVVSFALYPEEILDTHWELWKKTHRKQYNNKVDEISRRLIWEKNLKYISIHNLEASLGVHTYELAMNHLGD
MTSEEVVQKMTGLKVPLSHSRSNDTLYIPEWEGRAPDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLL
NLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVA
RVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGI
ANLASFPKM
;
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1AYU 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 215 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P43235 
_struct_ref_seq.db_align_beg                  115 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  329 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       215 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                                 ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                                                ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                                              ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                         ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE                                                ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE                                               ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                         ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                                                 ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                                               ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                                                   ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                              ? 'C6 H13 N O2'    131.173 
INA non-polymer         . '1,5-BIS(N-BENZYLOXYCARBONYL-L-LEUCINYL)CARBOHYDRAZIDE' ? 'C29 H40 N6 O7'  584.664 
LEU 'L-peptide linking' y LEUCINE                                                 ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                                                  ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                                              ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE                                           ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                                                 ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                                                  ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                                               ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                              ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                                                ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                                                  ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1AYU 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.16 
_exptl_crystal.density_percent_sol   42.5 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.0 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    '30% MPD, 0.1M MES, 0.1M TRIS-HCL, PH7.0' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           293 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'AREA DETECTOR' 
_diffrn_detector.type                   SIEMENS 
_diffrn_detector.pdbx_collection_date   1996-02 
_diffrn_detector.details                COLLIMATOR 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'GRAPHITE(002)' 
_diffrn_radiation.pdbx_diffrn_protocol             ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        SIEMENS 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1AYU 
_reflns.observed_criterion_sigma_I   2 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             25. 
_reflns.d_resolution_high            2.2 
_reflns.number_obs                   9452 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         98 
_reflns.pdbx_Rmerge_I_obs            0.11 
_reflns.pdbx_Rsym_value              0.11 
_reflns.pdbx_netI_over_sigmaI        11 
_reflns.B_iso_Wilson_estimate        18.3 
_reflns.pdbx_redundancy              3.0 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.22 
_reflns_shell.d_res_low              2.44 
_reflns_shell.percent_possible_all   93 
_reflns_shell.Rmerge_I_obs           0.24 
_reflns_shell.pdbx_Rsym_value        0.24 
_reflns_shell.meanI_over_sigI_obs    4.0 
_reflns_shell.pdbx_redundancy        2.5 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 1AYU 
_refine.ls_number_reflns_obs                     8108 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          2 
_refine.pdbx_data_cutoff_high_absF               1000000 
_refine.pdbx_data_cutoff_low_absF                0.001 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             6 
_refine.ls_d_res_high                            2.2 
_refine.ls_percent_reflns_obs                    78.5 
_refine.ls_R_factor_obs                          0.208 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.208 
_refine.ls_R_factor_R_free                       0.318 
_refine.ls_R_factor_R_free_error                 0.011 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 10.4 
_refine.ls_number_reflns_R_free                  840 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               15.0 
_refine.aniso_B[1][1]                            0 
_refine.aniso_B[2][2]                            0 
_refine.aniso_B[3][3]                            0 
_refine.aniso_B[1][2]                            0 
_refine.aniso_B[1][3]                            0 
_refine.aniso_B[2][3]                            0 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      1ATK 
_refine.pdbx_method_to_determine_struct          MR 
_refine.pdbx_isotropic_thermal_model             OVERALL 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1AYU 
_refine_analyze.Luzzati_coordinate_error_obs    0.25 
_refine_analyze.Luzzati_sigma_a_obs             0.26 
_refine_analyze.Luzzati_d_res_low_obs           8 
_refine_analyze.Luzzati_coordinate_error_free   0.38 
_refine_analyze.Luzzati_sigma_a_free            0.25 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1649 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         42 
_refine_hist.number_atoms_solvent             66 
_refine_hist.number_atoms_total               1757 
_refine_hist.d_res_high                       2.2 
_refine_hist.d_res_low                        6 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d                0.009 ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg             1.4   ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d      23.9  ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d      1.17  ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   8 
_refine_ls_shell.d_res_high                       2.2 
_refine_ls_shell.d_res_low                        2.29 
_refine_ls_shell.number_reflns_R_work             717 
_refine_ls_shell.R_factor_R_work                  0.254 
_refine_ls_shell.percent_reflns_obs               63.1 
_refine_ls_shell.R_factor_R_free                  0.334 
_refine_ls_shell.R_factor_R_free_error            0.037 
_refine_ls_shell.percent_reflns_R_free            10.4 
_refine_ls_shell.number_reflns_R_free             83 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PARHCSDX.PRO TOPHCSDX.PRO 'X-RAY DIFFRACTION' 
2 PARAM19.SOL  ?            'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1AYU 
_struct.title                     
'CRYSTAL STRUCTURE OF CYSTEINE PROTEASE HUMAN CATHEPSIN K IN COMPLEX WITH A COVALENT SYMMETRIC BISCARBOHYDRAZIDE INHIBITOR' 
_struct.pdbx_descriptor           'CATHEPSIN K, 1,5-BIS(N-BENZYLOXYCARBONYL-L-LEUCINYL)CARBOHYDRAZIDE' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1AYU 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            'HYDROLASE, SULFHYDRYL PROTEINASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 CYS A 25  ? THR A 42  ? CYS A 25  THR A 42  1 ? 18 
HELX_P HELX_P2 2 PRO A 50  ? CYS A 56  ? PRO A 50  CYS A 56  1 ? 7  
HELX_P HELX_P3 3 GLY A 62  ? GLY A 64  ? GLY A 62  GLY A 64  5 ? 3  
HELX_P HELX_P4 4 MET A 68  ? LYS A 77  ? MET A 68  LYS A 77  1 ? 10 
HELX_P HELX_P5 5 PRO A 100 ? GLY A 102 ? PRO A 100 GLY A 102 5 ? 3  
HELX_P HELX_P6 6 GLU A 118 ? ARG A 127 ? GLU A 118 ARG A 127 1 ? 10 
HELX_P HELX_P7 7 THR A 140 ? GLN A 143 ? THR A 140 GLN A 143 1 ? 4  
HELX_P HELX_P8 8 ALA A 203 ? GLY A 205 ? ALA A 203 GLY A 205 5 ? 3  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 22  SG  ? ? ? 1_555 A CYS 63  SG ? ? A CYS 22  A CYS 63  1_555 ? ? ? ? ? ? ? 2.034 ? 
disulf2 disulf ? ? A CYS 56  SG  ? ? ? 1_555 A CYS 96  SG ? ? A CYS 56  A CYS 96  1_555 ? ? ? ? ? ? ? 2.030 ? 
disulf3 disulf ? ? A CYS 155 SG  ? ? ? 1_555 A CYS 204 SG ? ? A CYS 155 A CYS 204 1_555 ? ? ? ? ? ? ? 2.032 ? 
covale1 covale ? ? B INA .   C21 ? ? ? 1_555 A CYS 25  SG ? ? A INA 300 A CYS 25  1_555 ? ? ? ? ? ? ? 1.799 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 TYR A 110 ? GLU A 112 ? TYR A 110 GLU A 112 
A 2 SER A 211 ? PRO A 213 ? SER A 211 PRO A 213 
B 1 VAL A 131 ? ILE A 135 ? VAL A 131 ILE A 135 
B 2 HIS A 162 ? GLN A 172 ? HIS A 162 GLN A 172 
B 3 ASN A 175 ? LYS A 181 ? ASN A 175 LYS A 181 
B 4 TYR A 193 ? ALA A 197 ? TYR A 193 ALA A 197 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O ARG A 111 ? O ARG A 111 N PHE A 212 ? N PHE A 212 
B 1 2 O VAL A 131 ? O VAL A 131 N ALA A 166 ? N ALA A 166 
B 2 3 O LEU A 165 ? O LEU A 165 N LYS A 181 ? N LYS A 181 
B 3 4 O TRP A 178 ? O TRP A 178 N MET A 196 ? N MET A 196 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    25 
_struct_site.details              'BINDING SITE FOR RESIDUE INA A 300' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 25 SER A 4   ? SER A 4   . ? 1_655 ? 
2  AC1 25 ASN A 18  ? ASN A 18  . ? 1_555 ? 
3  AC1 25 GLN A 19  ? GLN A 19  . ? 1_555 ? 
4  AC1 25 GLY A 20  ? GLY A 20  . ? 1_555 ? 
5  AC1 25 GLN A 21  ? GLN A 21  . ? 1_555 ? 
6  AC1 25 CYS A 22  ? CYS A 22  . ? 1_555 ? 
7  AC1 25 GLY A 23  ? GLY A 23  . ? 1_555 ? 
8  AC1 25 SER A 24  ? SER A 24  . ? 1_555 ? 
9  AC1 25 CYS A 25  ? CYS A 25  . ? 1_555 ? 
10 AC1 25 TRP A 26  ? TRP A 26  . ? 1_555 ? 
11 AC1 25 GLU A 59  ? GLU A 59  . ? 1_555 ? 
12 AC1 25 ASP A 61  ? ASP A 61  . ? 1_555 ? 
13 AC1 25 GLY A 65  ? GLY A 65  . ? 1_555 ? 
14 AC1 25 GLY A 66  ? GLY A 66  . ? 1_555 ? 
15 AC1 25 TYR A 67  ? TYR A 67  . ? 1_555 ? 
16 AC1 25 MET A 68  ? MET A 68  . ? 1_555 ? 
17 AC1 25 PHE A 144 ? PHE A 144 . ? 4_546 ? 
18 AC1 25 TYR A 145 ? TYR A 145 . ? 4_546 ? 
19 AC1 25 SER A 146 ? SER A 146 . ? 4_546 ? 
20 AC1 25 LYS A 147 ? LYS A 147 . ? 4_546 ? 
21 AC1 25 ASN A 161 ? ASN A 161 . ? 1_555 ? 
22 AC1 25 HIS A 162 ? HIS A 162 . ? 1_555 ? 
23 AC1 25 ALA A 163 ? ALA A 163 . ? 1_555 ? 
24 AC1 25 ILE A 171 ? ILE A 171 . ? 1_655 ? 
25 AC1 25 TRP A 184 ? TRP A 184 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1AYU 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1AYU 
_atom_sites.fract_transf_matrix[1][1]   0.026089 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.019493 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009628 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ALA A 1 1   ? -46.029 -38.046 66.175 1.00 15.00 ? 1   ALA A N   1 
ATOM   2    C CA  . ALA A 1 1   ? -45.546 -36.977 65.241 1.00 15.00 ? 1   ALA A CA  1 
ATOM   3    C C   . ALA A 1 1   ? -46.717 -36.337 64.479 1.00 15.00 ? 1   ALA A C   1 
ATOM   4    O O   . ALA A 1 1   ? -47.322 -36.959 63.595 1.00 15.00 ? 1   ALA A O   1 
ATOM   5    C CB  . ALA A 1 1   ? -44.523 -37.543 64.257 1.00 15.00 ? 1   ALA A CB  1 
ATOM   6    N N   . PRO A 1 2   ? -47.085 -35.103 64.857 1.00 15.00 ? 2   PRO A N   1 
ATOM   7    C CA  . PRO A 1 2   ? -48.187 -34.392 64.201 1.00 15.00 ? 2   PRO A CA  1 
ATOM   8    C C   . PRO A 1 2   ? -47.853 -34.050 62.757 1.00 15.00 ? 2   PRO A C   1 
ATOM   9    O O   . PRO A 1 2   ? -46.734 -34.289 62.290 1.00 15.00 ? 2   PRO A O   1 
ATOM   10   C CB  . PRO A 1 2   ? -48.317 -33.125 65.043 1.00 15.00 ? 2   PRO A CB  1 
ATOM   11   C CG  . PRO A 1 2   ? -46.892 -32.887 65.497 1.00 15.00 ? 2   PRO A CG  1 
ATOM   12   C CD  . PRO A 1 2   ? -46.485 -34.275 65.921 1.00 15.00 ? 2   PRO A CD  1 
ATOM   13   N N   . ASP A 1 3   ? -48.842 -33.520 62.045 1.00 15.00 ? 3   ASP A N   1 
ATOM   14   C CA  . ASP A 1 3   ? -48.642 -33.121 60.662 1.00 15.00 ? 3   ASP A CA  1 
ATOM   15   C C   . ASP A 1 3   ? -48.056 -31.727 60.626 1.00 15.00 ? 3   ASP A C   1 
ATOM   16   O O   . ASP A 1 3   ? -47.451 -31.316 59.632 1.00 15.00 ? 3   ASP A O   1 
ATOM   17   C CB  . ASP A 1 3   ? -49.967 -33.126 59.908 1.00 15.00 ? 3   ASP A CB  1 
ATOM   18   C CG  . ASP A 1 3   ? -50.311 -34.494 59.370 1.00 15.00 ? 3   ASP A CG  1 
ATOM   19   O OD1 . ASP A 1 3   ? -50.252 -35.485 60.143 1.00 15.00 ? 3   ASP A OD1 1 
ATOM   20   O OD2 . ASP A 1 3   ? -50.612 -34.583 58.159 1.00 15.00 ? 3   ASP A OD2 1 
ATOM   21   N N   . SER A 1 4   ? -48.184 -31.033 61.752 1.00 15.00 ? 4   SER A N   1 
ATOM   22   C CA  . SER A 1 4   ? -47.717 -29.674 61.868 1.00 15.00 ? 4   SER A CA  1 
ATOM   23   C C   . SER A 1 4   ? -47.287 -29.409 63.286 1.00 15.00 ? 4   SER A C   1 
ATOM   24   O O   . SER A 1 4   ? -47.894 -29.914 64.233 1.00 15.00 ? 4   SER A O   1 
ATOM   25   C CB  . SER A 1 4   ? -48.862 -28.736 61.510 1.00 15.00 ? 4   SER A CB  1 
ATOM   26   O OG  . SER A 1 4   ? -48.478 -27.371 61.572 1.00 15.00 ? 4   SER A OG  1 
ATOM   27   N N   . VAL A 1 5   ? -46.205 -28.659 63.427 1.00 15.00 ? 5   VAL A N   1 
ATOM   28   C CA  . VAL A 1 5   ? -45.707 -28.288 64.734 1.00 15.00 ? 5   VAL A CA  1 
ATOM   29   C C   . VAL A 1 5   ? -44.810 -27.080 64.616 1.00 15.00 ? 5   VAL A C   1 
ATOM   30   O O   . VAL A 1 5   ? -44.036 -26.931 63.660 1.00 15.00 ? 5   VAL A O   1 
ATOM   31   C CB  . VAL A 1 5   ? -44.975 -29.437 65.472 1.00 15.00 ? 5   VAL A CB  1 
ATOM   32   C CG1 . VAL A 1 5   ? -43.591 -29.681 64.888 1.00 15.00 ? 5   VAL A CG1 1 
ATOM   33   C CG2 . VAL A 1 5   ? -44.881 -29.108 66.963 1.00 15.00 ? 5   VAL A CG2 1 
ATOM   34   N N   . ASP A 1 6   ? -44.959 -26.199 65.591 1.00 15.00 ? 6   ASP A N   1 
ATOM   35   C CA  . ASP A 1 6   ? -44.194 -24.978 65.660 1.00 15.00 ? 6   ASP A CA  1 
ATOM   36   C C   . ASP A 1 6   ? -43.718 -24.809 67.102 1.00 15.00 ? 6   ASP A C   1 
ATOM   37   O O   . ASP A 1 6   ? -44.499 -24.480 67.999 1.00 15.00 ? 6   ASP A O   1 
ATOM   38   C CB  . ASP A 1 6   ? -45.077 -23.806 65.221 1.00 15.00 ? 6   ASP A CB  1 
ATOM   39   C CG  . ASP A 1 6   ? -44.306 -22.525 65.057 1.00 15.00 ? 6   ASP A CG  1 
ATOM   40   O OD1 . ASP A 1 6   ? -43.134 -22.455 65.487 1.00 15.00 ? 6   ASP A OD1 1 
ATOM   41   O OD2 . ASP A 1 6   ? -44.879 -21.576 64.493 1.00 15.00 ? 6   ASP A OD2 1 
ATOM   42   N N   . TYR A 1 7   ? -42.425 -25.021 67.315 1.00 15.00 ? 7   TYR A N   1 
ATOM   43   C CA  . TYR A 1 7   ? -41.828 -24.898 68.640 1.00 15.00 ? 7   TYR A CA  1 
ATOM   44   C C   . TYR A 1 7   ? -41.802 -23.474 69.201 1.00 15.00 ? 7   TYR A C   1 
ATOM   45   O O   . TYR A 1 7   ? -41.664 -23.283 70.415 1.00 15.00 ? 7   TYR A O   1 
ATOM   46   C CB  . TYR A 1 7   ? -40.433 -25.534 68.660 1.00 15.00 ? 7   TYR A CB  1 
ATOM   47   C CG  . TYR A 1 7   ? -40.490 -27.045 68.760 1.00 15.00 ? 7   TYR A CG  1 
ATOM   48   C CD1 . TYR A 1 7   ? -40.754 -27.663 69.981 1.00 15.00 ? 7   TYR A CD1 1 
ATOM   49   C CD2 . TYR A 1 7   ? -40.345 -27.852 67.631 1.00 15.00 ? 7   TYR A CD2 1 
ATOM   50   C CE1 . TYR A 1 7   ? -40.877 -29.043 70.084 1.00 15.00 ? 7   TYR A CE1 1 
ATOM   51   C CE2 . TYR A 1 7   ? -40.470 -29.240 67.720 1.00 15.00 ? 7   TYR A CE2 1 
ATOM   52   C CZ  . TYR A 1 7   ? -40.740 -29.831 68.953 1.00 15.00 ? 7   TYR A CZ  1 
ATOM   53   O OH  . TYR A 1 7   ? -40.892 -31.199 69.064 1.00 15.00 ? 7   TYR A OH  1 
ATOM   54   N N   . ARG A 1 8   ? -41.926 -22.477 68.327 1.00 15.00 ? 8   ARG A N   1 
ATOM   55   C CA  . ARG A 1 8   ? -41.952 -21.081 68.771 1.00 15.00 ? 8   ARG A CA  1 
ATOM   56   C C   . ARG A 1 8   ? -43.199 -20.926 69.638 1.00 15.00 ? 8   ARG A C   1 
ATOM   57   O O   . ARG A 1 8   ? -43.179 -20.255 70.676 1.00 15.00 ? 8   ARG A O   1 
ATOM   58   C CB  . ARG A 1 8   ? -42.059 -20.123 67.575 1.00 15.00 ? 8   ARG A CB  1 
ATOM   59   C CG  . ARG A 1 8   ? -40.924 -20.208 66.568 1.00 15.00 ? 8   ARG A CG  1 
ATOM   60   C CD  . ARG A 1 8   ? -41.188 -19.305 65.377 1.00 15.00 ? 8   ARG A CD  1 
ATOM   61   N NE  . ARG A 1 8   ? -42.235 -19.836 64.507 1.00 15.00 ? 8   ARG A NE  1 
ATOM   62   C CZ  . ARG A 1 8   ? -42.659 -19.259 63.383 1.00 15.00 ? 8   ARG A CZ  1 
ATOM   63   N NH1 . ARG A 1 8   ? -42.134 -18.113 62.972 1.00 15.00 ? 8   ARG A NH1 1 
ATOM   64   N NH2 . ARG A 1 8   ? -43.614 -19.836 62.661 1.00 15.00 ? 8   ARG A NH2 1 
ATOM   65   N N   . LYS A 1 9   ? -44.276 -21.583 69.213 1.00 15.00 ? 9   LYS A N   1 
ATOM   66   C CA  . LYS A 1 9   ? -45.542 -21.528 69.925 1.00 15.00 ? 9   LYS A CA  1 
ATOM   67   C C   . LYS A 1 9   ? -45.455 -22.218 71.272 1.00 15.00 ? 9   LYS A C   1 
ATOM   68   O O   . LYS A 1 9   ? -46.193 -21.875 72.189 1.00 15.00 ? 9   LYS A O   1 
ATOM   69   C CB  . LYS A 1 9   ? -46.657 -22.135 69.082 1.00 15.00 ? 9   LYS A CB  1 
ATOM   70   C CG  . LYS A 1 9   ? -47.109 -21.261 67.921 1.00 15.00 ? 9   LYS A CG  1 
ATOM   71   C CD  . LYS A 1 9   ? -47.977 -22.074 66.955 1.00 15.00 ? 9   LYS A CD  1 
ATOM   72   C CE  . LYS A 1 9   ? -48.738 -21.201 65.978 1.00 15.00 ? 9   LYS A CE  1 
ATOM   73   N NZ  . LYS A 1 9   ? -49.837 -20.486 66.669 1.00 15.00 ? 9   LYS A NZ  1 
ATOM   74   N N   . LYS A 1 10  ? -44.527 -23.165 71.389 1.00 15.00 ? 10  LYS A N   1 
ATOM   75   C CA  . LYS A 1 10  ? -44.304 -23.910 72.625 1.00 15.00 ? 10  LYS A CA  1 
ATOM   76   C C   . LYS A 1 10  ? -43.282 -23.222 73.532 1.00 15.00 ? 10  LYS A C   1 
ATOM   77   O O   . LYS A 1 10  ? -42.941 -23.735 74.597 1.00 15.00 ? 10  LYS A O   1 
ATOM   78   C CB  . LYS A 1 10  ? -43.823 -25.327 72.303 1.00 15.00 ? 10  LYS A CB  1 
ATOM   79   C CG  . LYS A 1 10  ? -44.901 -26.253 71.751 1.00 15.00 ? 10  LYS A CG  1 
ATOM   80   C CD  . LYS A 1 10  ? -44.351 -27.645 71.469 1.00 15.00 ? 10  LYS A CD  1 
ATOM   81   C CE  . LYS A 1 10  ? -45.485 -28.634 71.197 1.00 15.00 ? 10  LYS A CE  1 
ATOM   82   N NZ  . LYS A 1 10  ? -44.987 -30.006 70.874 1.00 15.00 ? 10  LYS A NZ  1 
ATOM   83   N N   . GLY A 1 11  ? -42.753 -22.087 73.086 1.00 15.00 ? 11  GLY A N   1 
ATOM   84   C CA  . GLY A 1 11  ? -41.775 -21.370 73.884 1.00 15.00 ? 11  GLY A CA  1 
ATOM   85   C C   . GLY A 1 11  ? -40.407 -22.038 73.969 1.00 15.00 ? 11  GLY A C   1 
ATOM   86   O O   . GLY A 1 11  ? -39.708 -21.911 74.975 1.00 15.00 ? 11  GLY A O   1 
ATOM   87   N N   . TYR A 1 12  ? -40.018 -22.747 72.919 1.00 15.00 ? 12  TYR A N   1 
ATOM   88   C CA  . TYR A 1 12  ? -38.725 -23.412 72.894 1.00 15.00 ? 12  TYR A CA  1 
ATOM   89   C C   . TYR A 1 12  ? -37.730 -22.624 72.042 1.00 15.00 ? 12  TYR A C   1 
ATOM   90   O O   . TYR A 1 12  ? -36.649 -23.137 71.725 1.00 15.00 ? 12  TYR A O   1 
ATOM   91   C CB  . TYR A 1 12  ? -38.858 -24.809 72.289 1.00 15.00 ? 12  TYR A CB  1 
ATOM   92   C CG  . TYR A 1 12  ? -39.465 -25.865 73.180 1.00 15.00 ? 12  TYR A CG  1 
ATOM   93   C CD1 . TYR A 1 12  ? -40.559 -25.587 73.990 1.00 15.00 ? 12  TYR A CD1 1 
ATOM   94   C CD2 . TYR A 1 12  ? -38.941 -27.152 73.206 1.00 15.00 ? 12  TYR A CD2 1 
ATOM   95   C CE1 . TYR A 1 12  ? -41.120 -26.563 74.805 1.00 15.00 ? 12  TYR A CE1 1 
ATOM   96   C CE2 . TYR A 1 12  ? -39.488 -28.137 74.017 1.00 15.00 ? 12  TYR A CE2 1 
ATOM   97   C CZ  . TYR A 1 12  ? -40.577 -27.837 74.817 1.00 15.00 ? 12  TYR A CZ  1 
ATOM   98   O OH  . TYR A 1 12  ? -41.104 -28.809 75.643 1.00 15.00 ? 12  TYR A OH  1 
ATOM   99   N N   . VAL A 1 13  ? -38.079 -21.394 71.664 1.00 15.00 ? 13  VAL A N   1 
ATOM   100  C CA  . VAL A 1 13  ? -37.207 -20.589 70.799 1.00 15.00 ? 13  VAL A CA  1 
ATOM   101  C C   . VAL A 1 13  ? -36.933 -19.169 71.295 1.00 15.00 ? 13  VAL A C   1 
ATOM   102  O O   . VAL A 1 13  ? -37.864 -18.421 71.609 1.00 15.00 ? 13  VAL A O   1 
ATOM   103  C CB  . VAL A 1 13  ? -37.821 -20.457 69.400 1.00 15.00 ? 13  VAL A CB  1 
ATOM   104  C CG1 . VAL A 1 13  ? -36.748 -20.071 68.380 1.00 15.00 ? 13  VAL A CG1 1 
ATOM   105  C CG2 . VAL A 1 13  ? -38.522 -21.730 69.024 1.00 15.00 ? 13  VAL A CG2 1 
ATOM   106  N N   . THR A 1 14  ? -35.661 -18.789 71.337 1.00 15.00 ? 14  THR A N   1 
ATOM   107  C CA  . THR A 1 14  ? -35.293 -17.453 71.783 1.00 15.00 ? 14  THR A CA  1 
ATOM   108  C C   . THR A 1 14  ? -35.456 -16.516 70.595 1.00 15.00 ? 14  THR A C   1 
ATOM   109  O O   . THR A 1 14  ? -35.550 -16.964 69.460 1.00 15.00 ? 14  THR A O   1 
ATOM   110  C CB  . THR A 1 14  ? -33.836 -17.397 72.319 1.00 15.00 ? 14  THR A CB  1 
ATOM   111  O OG1 . THR A 1 14  ? -32.915 -17.762 71.279 1.00 15.00 ? 14  THR A OG1 1 
ATOM   112  C CG2 . THR A 1 14  ? -33.668 -18.328 73.518 1.00 15.00 ? 14  THR A CG2 1 
ATOM   113  N N   . PRO A 1 15  ? -35.494 -15.201 70.838 1.00 15.00 ? 15  PRO A N   1 
ATOM   114  C CA  . PRO A 1 15  ? -35.653 -14.267 69.725 1.00 15.00 ? 15  PRO A CA  1 
ATOM   115  C C   . PRO A 1 15  ? -34.541 -14.353 68.692 1.00 15.00 ? 15  PRO A C   1 
ATOM   116  O O   . PRO A 1 15  ? -33.455 -14.889 68.954 1.00 15.00 ? 15  PRO A O   1 
ATOM   117  C CB  . PRO A 1 15  ? -35.708 -12.903 70.423 1.00 15.00 ? 15  PRO A CB  1 
ATOM   118  C CG  . PRO A 1 15  ? -34.928 -13.121 71.675 1.00 15.00 ? 15  PRO A CG  1 
ATOM   119  C CD  . PRO A 1 15  ? -35.389 -14.479 72.117 1.00 15.00 ? 15  PRO A CD  1 
ATOM   120  N N   . VAL A 1 16  ? -34.852 -13.848 67.499 1.00 15.00 ? 16  VAL A N   1 
ATOM   121  C CA  . VAL A 1 16  ? -33.935 -13.838 66.374 1.00 15.00 ? 16  VAL A CA  1 
ATOM   122  C C   . VAL A 1 16  ? -32.711 -12.944 66.610 1.00 15.00 ? 16  VAL A C   1 
ATOM   123  O O   . VAL A 1 16  ? -32.837 -11.785 67.036 1.00 15.00 ? 16  VAL A O   1 
ATOM   124  C CB  . VAL A 1 16  ? -34.677 -13.409 65.075 1.00 15.00 ? 16  VAL A CB  1 
ATOM   125  C CG1 . VAL A 1 16  ? -33.717 -13.354 63.895 1.00 15.00 ? 16  VAL A CG1 1 
ATOM   126  C CG2 . VAL A 1 16  ? -35.818 -14.389 64.779 1.00 15.00 ? 16  VAL A CG2 1 
ATOM   127  N N   . LYS A 1 17  ? -31.536 -13.503 66.328 1.00 15.00 ? 17  LYS A N   1 
ATOM   128  C CA  . LYS A 1 17  ? -30.265 -12.805 66.476 1.00 15.00 ? 17  LYS A CA  1 
ATOM   129  C C   . LYS A 1 17  ? -29.704 -12.426 65.089 1.00 15.00 ? 17  LYS A C   1 
ATOM   130  O O   . LYS A 1 17  ? -30.248 -12.811 64.045 1.00 15.00 ? 17  LYS A O   1 
ATOM   131  C CB  . LYS A 1 17  ? -29.261 -13.698 67.215 1.00 15.00 ? 17  LYS A CB  1 
ATOM   132  C CG  . LYS A 1 17  ? -29.847 -14.447 68.414 1.00 15.00 ? 17  LYS A CG  1 
ATOM   133  C CD  . LYS A 1 17  ? -30.146 -13.519 69.564 1.00 15.00 ? 17  LYS A CD  1 
ATOM   134  C CE  . LYS A 1 17  ? -31.100 -14.142 70.585 1.00 15.00 ? 17  LYS A CE  1 
ATOM   135  N NZ  . LYS A 1 17  ? -30.734 -15.524 70.943 1.00 15.00 ? 17  LYS A NZ  1 
ATOM   136  N N   . ASN A 1 18  ? -28.586 -11.708 65.100 1.00 15.00 ? 18  ASN A N   1 
ATOM   137  C CA  . ASN A 1 18  ? -27.929 -11.239 63.893 1.00 15.00 ? 18  ASN A CA  1 
ATOM   138  C C   . ASN A 1 18  ? -26.410 -11.467 63.989 1.00 15.00 ? 18  ASN A C   1 
ATOM   139  O O   . ASN A 1 18  ? -25.701 -10.745 64.684 1.00 15.00 ? 18  ASN A O   1 
ATOM   140  C CB  . ASN A 1 18  ? -28.251 -9.749  63.693 1.00 15.00 ? 18  ASN A CB  1 
ATOM   141  C CG  . ASN A 1 18  ? -27.738 -9.207  62.374 1.00 15.00 ? 18  ASN A CG  1 
ATOM   142  O OD1 . ASN A 1 18  ? -27.337 -9.953  61.487 1.00 15.00 ? 18  ASN A OD1 1 
ATOM   143  N ND2 . ASN A 1 18  ? -27.747 -7.897  62.241 1.00 15.00 ? 18  ASN A ND2 1 
ATOM   144  N N   . GLN A 1 19  ? -25.920 -12.468 63.272 1.00 15.00 ? 19  GLN A N   1 
ATOM   145  C CA  . GLN A 1 19  ? -24.501 -12.807 63.268 1.00 15.00 ? 19  GLN A CA  1 
ATOM   146  C C   . GLN A 1 19  ? -23.588 -11.654 62.843 1.00 15.00 ? 19  GLN A C   1 
ATOM   147  O O   . GLN A 1 19  ? -22.448 -11.561 63.304 1.00 15.00 ? 19  GLN A O   1 
ATOM   148  C CB  . GLN A 1 19  ? -24.229 -14.048 62.389 1.00 15.00 ? 19  GLN A CB  1 
ATOM   149  C CG  . GLN A 1 19  ? -24.591 -13.906 60.910 1.00 15.00 ? 19  GLN A CG  1 
ATOM   150  C CD  . GLN A 1 19  ? -24.310 -15.166 60.100 1.00 15.00 ? 19  GLN A CD  1 
ATOM   151  O OE1 . GLN A 1 19  ? -25.150 -16.060 59.999 1.00 15.00 ? 19  GLN A OE1 1 
ATOM   152  N NE2 . GLN A 1 19  ? -23.130 -15.232 59.504 1.00 15.00 ? 19  GLN A NE2 1 
ATOM   153  N N   . GLY A 1 20  ? -24.091 -10.765 61.993 1.00 15.00 ? 20  GLY A N   1 
ATOM   154  C CA  . GLY A 1 20  ? -23.284 -9.646  61.535 1.00 15.00 ? 20  GLY A CA  1 
ATOM   155  C C   . GLY A 1 20  ? -22.310 -10.074 60.454 1.00 15.00 ? 20  GLY A C   1 
ATOM   156  O O   . GLY A 1 20  ? -22.594 -10.984 59.669 1.00 15.00 ? 20  GLY A O   1 
ATOM   157  N N   . GLN A 1 21  ? -21.153 -9.428  60.414 1.00 15.00 ? 21  GLN A N   1 
ATOM   158  C CA  . GLN A 1 21  ? -20.135 -9.752  59.411 1.00 15.00 ? 21  GLN A CA  1 
ATOM   159  C C   . GLN A 1 21  ? -19.151 -10.777 59.975 1.00 15.00 ? 21  GLN A C   1 
ATOM   160  O O   . GLN A 1 21  ? -17.953 -10.509 60.128 1.00 15.00 ? 21  GLN A O   1 
ATOM   161  C CB  . GLN A 1 21  ? -19.404 -8.484  58.963 1.00 15.00 ? 21  GLN A CB  1 
ATOM   162  C CG  . GLN A 1 21  ? -20.223 -7.590  58.057 1.00 15.00 ? 21  GLN A CG  1 
ATOM   163  C CD  . GLN A 1 21  ? -20.483 -8.227  56.688 1.00 15.00 ? 21  GLN A CD  1 
ATOM   164  O OE1 . GLN A 1 21  ? -19.881 -9.255  56.332 1.00 15.00 ? 21  GLN A OE1 1 
ATOM   165  N NE2 . GLN A 1 21  ? -21.366 -7.604  55.902 1.00 15.00 ? 21  GLN A NE2 1 
ATOM   166  N N   . CYS A 1 22  ? -19.682 -11.949 60.299 1.00 15.00 ? 22  CYS A N   1 
ATOM   167  C CA  . CYS A 1 22  ? -18.897 -13.035 60.864 1.00 15.00 ? 22  CYS A CA  1 
ATOM   168  C C   . CYS A 1 22  ? -19.595 -14.320 60.464 1.00 15.00 ? 22  CYS A C   1 
ATOM   169  O O   . CYS A 1 22  ? -20.821 -14.397 60.498 1.00 15.00 ? 22  CYS A O   1 
ATOM   170  C CB  . CYS A 1 22  ? -18.830 -12.901 62.402 1.00 15.00 ? 22  CYS A CB  1 
ATOM   171  S SG  . CYS A 1 22  ? -18.130 -14.318 63.330 1.00 15.00 ? 22  CYS A SG  1 
ATOM   172  N N   . GLY A 1 23  ? -18.812 -15.300 60.026 1.00 15.00 ? 23  GLY A N   1 
ATOM   173  C CA  . GLY A 1 23  ? -19.359 -16.583 59.627 1.00 15.00 ? 23  GLY A CA  1 
ATOM   174  C C   . GLY A 1 23  ? -19.615 -17.478 60.829 1.00 15.00 ? 23  GLY A C   1 
ATOM   175  O O   . GLY A 1 23  ? -19.226 -18.648 60.844 1.00 15.00 ? 23  GLY A O   1 
ATOM   176  N N   . SER A 1 24  ? -20.323 -16.940 61.816 1.00 15.00 ? 24  SER A N   1 
ATOM   177  C CA  . SER A 1 24  ? -20.634 -17.670 63.032 1.00 15.00 ? 24  SER A CA  1 
ATOM   178  C C   . SER A 1 24  ? -22.001 -18.344 62.979 1.00 15.00 ? 24  SER A C   1 
ATOM   179  O O   . SER A 1 24  ? -22.515 -18.781 64.012 1.00 15.00 ? 24  SER A O   1 
ATOM   180  C CB  . SER A 1 24  ? -20.579 -16.715 64.224 1.00 15.00 ? 24  SER A CB  1 
ATOM   181  O OG  . SER A 1 24  ? -21.384 -15.576 63.998 1.00 15.00 ? 24  SER A OG  1 
ATOM   182  N N   . CYS A 1 25  ? -22.586 -18.455 61.788 1.00 15.00 ? 25  CYS A N   1 
ATOM   183  C CA  . CYS A 1 25  ? -23.901 -19.078 61.648 1.00 15.00 ? 25  CYS A CA  1 
ATOM   184  C C   . CYS A 1 25  ? -23.947 -20.468 62.291 1.00 15.00 ? 25  CYS A C   1 
ATOM   185  O O   . CYS A 1 25  ? -24.953 -20.848 62.890 1.00 15.00 ? 25  CYS A O   1 
ATOM   186  C CB  . CYS A 1 25  ? -24.313 -19.151 60.172 1.00 15.00 ? 25  CYS A CB  1 
ATOM   187  S SG  . CYS A 1 25  ? -23.118 -20.004 59.058 1.00 15.00 ? 25  CYS A SG  1 
ATOM   188  N N   . TRP A 1 26  ? -22.830 -21.190 62.213 1.00 15.00 ? 26  TRP A N   1 
ATOM   189  C CA  . TRP A 1 26  ? -22.700 -22.526 62.787 1.00 15.00 ? 26  TRP A CA  1 
ATOM   190  C C   . TRP A 1 26  ? -22.868 -22.471 64.305 1.00 15.00 ? 26  TRP A C   1 
ATOM   191  O O   . TRP A 1 26  ? -23.457 -23.365 64.909 1.00 15.00 ? 26  TRP A O   1 
ATOM   192  C CB  . TRP A 1 26  ? -21.332 -23.133 62.415 1.00 15.00 ? 26  TRP A CB  1 
ATOM   193  C CG  . TRP A 1 26  ? -20.123 -22.324 62.881 1.00 15.00 ? 26  TRP A CG  1 
ATOM   194  C CD1 . TRP A 1 26  ? -19.500 -21.312 62.201 1.00 15.00 ? 26  TRP A CD1 1 
ATOM   195  C CD2 . TRP A 1 26  ? -19.432 -22.442 64.142 1.00 15.00 ? 26  TRP A CD2 1 
ATOM   196  N NE1 . TRP A 1 26  ? -18.476 -20.789 62.961 1.00 15.00 ? 26  TRP A NE1 1 
ATOM   197  C CE2 . TRP A 1 26  ? -18.416 -21.457 64.155 1.00 15.00 ? 26  TRP A CE2 1 
ATOM   198  C CE3 . TRP A 1 26  ? -19.581 -23.272 65.261 1.00 15.00 ? 26  TRP A CE3 1 
ATOM   199  C CZ2 . TRP A 1 26  ? -17.560 -21.285 65.245 1.00 15.00 ? 26  TRP A CZ2 1 
ATOM   200  C CZ3 . TRP A 1 26  ? -18.728 -23.099 66.340 1.00 15.00 ? 26  TRP A CZ3 1 
ATOM   201  C CH2 . TRP A 1 26  ? -17.734 -22.111 66.326 1.00 15.00 ? 26  TRP A CH2 1 
ATOM   202  N N   . ALA A 1 27  ? -22.373 -21.391 64.901 1.00 15.00 ? 27  ALA A N   1 
ATOM   203  C CA  . ALA A 1 27  ? -22.432 -21.170 66.342 1.00 15.00 ? 27  ALA A CA  1 
ATOM   204  C C   . ALA A 1 27  ? -23.866 -20.899 66.768 1.00 15.00 ? 27  ALA A C   1 
ATOM   205  O O   . ALA A 1 27  ? -24.335 -21.424 67.779 1.00 15.00 ? 27  ALA A O   1 
ATOM   206  C CB  . ALA A 1 27  ? -21.534 -19.996 66.722 1.00 15.00 ? 27  ALA A CB  1 
ATOM   207  N N   . PHE A 1 28  ? -24.546 -20.060 65.988 1.00 15.00 ? 28  PHE A N   1 
ATOM   208  C CA  . PHE A 1 28  ? -25.944 -19.711 66.228 1.00 15.00 ? 28  PHE A CA  1 
ATOM   209  C C   . PHE A 1 28  ? -26.861 -20.932 66.074 1.00 15.00 ? 28  PHE A C   1 
ATOM   210  O O   . PHE A 1 28  ? -27.825 -21.096 66.821 1.00 15.00 ? 28  PHE A O   1 
ATOM   211  C CB  . PHE A 1 28  ? -26.376 -18.581 65.293 1.00 15.00 ? 28  PHE A CB  1 
ATOM   212  C CG  . PHE A 1 28  ? -25.848 -17.234 65.698 1.00 15.00 ? 28  PHE A CG  1 
ATOM   213  C CD1 . PHE A 1 28  ? -24.586 -16.814 65.297 1.00 15.00 ? 28  PHE A CD1 1 
ATOM   214  C CD2 . PHE A 1 28  ? -26.602 -16.391 66.516 1.00 15.00 ? 28  PHE A CD2 1 
ATOM   215  C CE1 . PHE A 1 28  ? -24.078 -15.575 65.705 1.00 15.00 ? 28  PHE A CE1 1 
ATOM   216  C CE2 . PHE A 1 28  ? -26.094 -15.147 66.926 1.00 15.00 ? 28  PHE A CE2 1 
ATOM   217  C CZ  . PHE A 1 28  ? -24.834 -14.745 66.519 1.00 15.00 ? 28  PHE A CZ  1 
ATOM   218  N N   . SER A 1 29  ? -26.540 -21.806 65.132 1.00 15.00 ? 29  SER A N   1 
ATOM   219  C CA  . SER A 1 29  ? -27.327 -23.011 64.927 1.00 15.00 ? 29  SER A CA  1 
ATOM   220  C C   . SER A 1 29  ? -27.190 -23.930 66.156 1.00 15.00 ? 29  SER A C   1 
ATOM   221  O O   . SER A 1 29  ? -28.191 -24.390 66.713 1.00 15.00 ? 29  SER A O   1 
ATOM   222  C CB  . SER A 1 29  ? -26.853 -23.727 63.663 1.00 15.00 ? 29  SER A CB  1 
ATOM   223  O OG  . SER A 1 29  ? -27.550 -24.933 63.467 1.00 15.00 ? 29  SER A OG  1 
ATOM   224  N N   . SER A 1 30  ? -25.946 -24.155 66.590 1.00 15.00 ? 30  SER A N   1 
ATOM   225  C CA  . SER A 1 30  ? -25.630 -25.004 67.747 1.00 15.00 ? 30  SER A CA  1 
ATOM   226  C C   . SER A 1 30  ? -26.356 -24.507 68.983 1.00 15.00 ? 30  SER A C   1 
ATOM   227  O O   . SER A 1 30  ? -27.017 -25.258 69.689 1.00 15.00 ? 30  SER A O   1 
ATOM   228  C CB  . SER A 1 30  ? -24.124 -24.966 68.042 1.00 15.00 ? 30  SER A CB  1 
ATOM   229  O OG  . SER A 1 30  ? -23.344 -25.284 66.909 1.00 15.00 ? 30  SER A OG  1 
ATOM   230  N N   . VAL A 1 31  ? -26.156 -23.229 69.257 1.00 15.00 ? 31  VAL A N   1 
ATOM   231  C CA  . VAL A 1 31  ? -26.757 -22.545 70.386 1.00 15.00 ? 31  VAL A CA  1 
ATOM   232  C C   . VAL A 1 31  ? -28.279 -22.698 70.370 1.00 15.00 ? 31  VAL A C   1 
ATOM   233  O O   . VAL A 1 31  ? -28.871 -23.113 71.367 1.00 15.00 ? 31  VAL A O   1 
ATOM   234  C CB  . VAL A 1 31  ? -26.308 -21.066 70.383 1.00 15.00 ? 31  VAL A CB  1 
ATOM   235  C CG1 . VAL A 1 31  ? -27.422 -20.130 70.840 1.00 15.00 ? 31  VAL A CG1 1 
ATOM   236  C CG2 . VAL A 1 31  ? -25.084 -20.924 71.258 1.00 15.00 ? 31  VAL A CG2 1 
ATOM   237  N N   . GLY A 1 32  ? -28.887 -22.438 69.215 1.00 15.00 ? 32  GLY A N   1 
ATOM   238  C CA  . GLY A 1 32  ? -30.325 -22.562 69.081 1.00 15.00 ? 32  GLY A CA  1 
ATOM   239  C C   . GLY A 1 32  ? -30.787 -23.956 69.448 1.00 15.00 ? 32  GLY A C   1 
ATOM   240  O O   . GLY A 1 32  ? -31.798 -24.124 70.135 1.00 15.00 ? 32  GLY A O   1 
ATOM   241  N N   . ALA A 1 33  ? -30.030 -24.957 69.007 1.00 15.00 ? 33  ALA A N   1 
ATOM   242  C CA  . ALA A 1 33  ? -30.352 -26.346 69.296 1.00 15.00 ? 33  ALA A CA  1 
ATOM   243  C C   . ALA A 1 33  ? -30.236 -26.639 70.796 1.00 15.00 ? 33  ALA A C   1 
ATOM   244  O O   . ALA A 1 33  ? -31.109 -27.287 71.383 1.00 15.00 ? 33  ALA A O   1 
ATOM   245  C CB  . ALA A 1 33  ? -29.440 -27.286 68.483 1.00 15.00 ? 33  ALA A CB  1 
ATOM   246  N N   . LEU A 1 34  ? -29.171 -26.147 71.418 1.00 15.00 ? 34  LEU A N   1 
ATOM   247  C CA  . LEU A 1 34  ? -28.965 -26.370 72.844 1.00 15.00 ? 34  LEU A CA  1 
ATOM   248  C C   . LEU A 1 34  ? -30.092 -25.734 73.656 1.00 15.00 ? 34  LEU A C   1 
ATOM   249  O O   . LEU A 1 34  ? -30.618 -26.337 74.594 1.00 15.00 ? 34  LEU A O   1 
ATOM   250  C CB  . LEU A 1 34  ? -27.606 -25.820 73.280 1.00 15.00 ? 34  LEU A CB  1 
ATOM   251  C CG  . LEU A 1 34  ? -26.392 -26.656 72.866 1.00 15.00 ? 34  LEU A CG  1 
ATOM   252  C CD1 . LEU A 1 34  ? -25.117 -25.824 72.889 1.00 15.00 ? 34  LEU A CD1 1 
ATOM   253  C CD2 . LEU A 1 34  ? -26.271 -27.869 73.779 1.00 15.00 ? 34  LEU A CD2 1 
ATOM   254  N N   . GLU A 1 35  ? -30.483 -24.531 73.248 1.00 15.00 ? 35  GLU A N   1 
ATOM   255  C CA  . GLU A 1 35  ? -31.546 -23.784 73.900 1.00 15.00 ? 35  GLU A CA  1 
ATOM   256  C C   . GLU A 1 35  ? -32.886 -24.518 73.874 1.00 15.00 ? 35  GLU A C   1 
ATOM   257  O O   . GLU A 1 35  ? -33.662 -24.408 74.812 1.00 15.00 ? 35  GLU A O   1 
ATOM   258  C CB  . GLU A 1 35  ? -31.695 -22.412 73.250 1.00 15.00 ? 35  GLU A CB  1 
ATOM   259  C CG  . GLU A 1 35  ? -30.487 -21.526 73.409 1.00 15.00 ? 35  GLU A CG  1 
ATOM   260  C CD  . GLU A 1 35  ? -30.585 -20.249 72.604 1.00 15.00 ? 35  GLU A CD  1 
ATOM   261  O OE1 . GLU A 1 35  ? -31.422 -20.166 71.669 1.00 15.00 ? 35  GLU A OE1 1 
ATOM   262  O OE2 . GLU A 1 35  ? -29.808 -19.321 72.904 1.00 15.00 ? 35  GLU A OE2 1 
ATOM   263  N N   . GLY A 1 36  ? -33.161 -25.247 72.794 1.00 15.00 ? 36  GLY A N   1 
ATOM   264  C CA  . GLY A 1 36  ? -34.412 -25.973 72.717 1.00 15.00 ? 36  GLY A CA  1 
ATOM   265  C C   . GLY A 1 36  ? -34.416 -27.055 73.778 1.00 15.00 ? 36  GLY A C   1 
ATOM   266  O O   . GLY A 1 36  ? -35.316 -27.126 74.614 1.00 15.00 ? 36  GLY A O   1 
ATOM   267  N N   . GLN A 1 37  ? -33.355 -27.855 73.773 1.00 15.00 ? 37  GLN A N   1 
ATOM   268  C CA  . GLN A 1 37  ? -33.184 -28.954 74.711 1.00 15.00 ? 37  GLN A CA  1 
ATOM   269  C C   . GLN A 1 37  ? -33.100 -28.483 76.165 1.00 15.00 ? 37  GLN A C   1 
ATOM   270  O O   . GLN A 1 37  ? -33.697 -29.086 77.059 1.00 15.00 ? 37  GLN A O   1 
ATOM   271  C CB  . GLN A 1 37  ? -31.949 -29.771 74.324 1.00 15.00 ? 37  GLN A CB  1 
ATOM   272  C CG  . GLN A 1 37  ? -32.008 -30.342 72.905 1.00 15.00 ? 37  GLN A CG  1 
ATOM   273  C CD  . GLN A 1 37  ? -33.219 -31.247 72.686 1.00 15.00 ? 37  GLN A CD  1 
ATOM   274  O OE1 . GLN A 1 37  ? -33.309 -32.348 73.259 1.00 15.00 ? 37  GLN A OE1 1 
ATOM   275  N NE2 . GLN A 1 37  ? -34.165 -30.783 71.871 1.00 15.00 ? 37  GLN A NE2 1 
ATOM   276  N N   . LEU A 1 38  ? -32.385 -27.393 76.402 1.00 15.00 ? 38  LEU A N   1 
ATOM   277  C CA  . LEU A 1 38  ? -32.269 -26.871 77.750 1.00 15.00 ? 38  LEU A CA  1 
ATOM   278  C C   . LEU A 1 38  ? -33.650 -26.507 78.259 1.00 15.00 ? 38  LEU A C   1 
ATOM   279  O O   . LEU A 1 38  ? -33.967 -26.731 79.431 1.00 15.00 ? 38  LEU A O   1 
ATOM   280  C CB  . LEU A 1 38  ? -31.393 -25.628 77.786 1.00 15.00 ? 38  LEU A CB  1 
ATOM   281  C CG  . LEU A 1 38  ? -31.339 -25.006 79.182 1.00 15.00 ? 38  LEU A CG  1 
ATOM   282  C CD1 . LEU A 1 38  ? -30.490 -25.866 80.108 1.00 15.00 ? 38  LEU A CD1 1 
ATOM   283  C CD2 . LEU A 1 38  ? -30.788 -23.607 79.082 1.00 15.00 ? 38  LEU A CD2 1 
ATOM   284  N N   . LYS A 1 39  ? -34.447 -25.904 77.383 1.00 15.00 ? 39  LYS A N   1 
ATOM   285  C CA  . LYS A 1 39  ? -35.806 -25.509 77.716 1.00 15.00 ? 39  LYS A CA  1 
ATOM   286  C C   . LYS A 1 39  ? -36.614 -26.777 77.996 1.00 15.00 ? 39  LYS A C   1 
ATOM   287  O O   . LYS A 1 39  ? -37.276 -26.894 79.037 1.00 15.00 ? 39  LYS A O   1 
ATOM   288  C CB  . LYS A 1 39  ? -36.418 -24.719 76.552 1.00 15.00 ? 39  LYS A CB  1 
ATOM   289  C CG  . LYS A 1 39  ? -37.628 -23.876 76.908 1.00 15.00 ? 39  LYS A CG  1 
ATOM   290  C CD  . LYS A 1 39  ? -38.882 -24.711 77.077 1.00 15.00 ? 39  LYS A CD  1 
ATOM   291  C CE  . LYS A 1 39  ? -39.793 -24.138 78.152 1.00 15.00 ? 39  LYS A CE  1 
ATOM   292  N NZ  . LYS A 1 39  ? -39.993 -22.662 78.008 1.00 15.00 ? 39  LYS A NZ  1 
ATOM   293  N N   . LYS A 1 40  ? -36.478 -27.755 77.109 1.00 15.00 ? 40  LYS A N   1 
ATOM   294  C CA  . LYS A 1 40  ? -37.192 -29.011 77.234 1.00 15.00 ? 40  LYS A CA  1 
ATOM   295  C C   . LYS A 1 40  ? -36.821 -29.758 78.508 1.00 15.00 ? 40  LYS A C   1 
ATOM   296  O O   . LYS A 1 40  ? -37.691 -30.359 79.157 1.00 15.00 ? 40  LYS A O   1 
ATOM   297  C CB  . LYS A 1 40  ? -36.931 -29.897 76.011 1.00 15.00 ? 40  LYS A CB  1 
ATOM   298  C CG  . LYS A 1 40  ? -37.836 -31.126 75.907 1.00 15.00 ? 40  LYS A CG  1 
ATOM   299  C CD  . LYS A 1 40  ? -37.594 -31.869 74.603 1.00 15.00 ? 40  LYS A CD  1 
ATOM   300  C CE  . LYS A 1 40  ? -37.063 -33.281 74.850 1.00 15.00 ? 40  LYS A CE  1 
ATOM   301  N NZ  . LYS A 1 40  ? -36.363 -33.872 73.656 1.00 15.00 ? 40  LYS A NZ  1 
ATOM   302  N N   . LYS A 1 41  ? -35.555 -29.657 78.917 1.00 15.00 ? 41  LYS A N   1 
ATOM   303  C CA  . LYS A 1 41  ? -35.082 -30.369 80.104 1.00 15.00 ? 41  LYS A CA  1 
ATOM   304  C C   . LYS A 1 41  ? -35.320 -29.680 81.446 1.00 15.00 ? 41  LYS A C   1 
ATOM   305  O O   . LYS A 1 41  ? -35.760 -30.317 82.400 1.00 15.00 ? 41  LYS A O   1 
ATOM   306  C CB  . LYS A 1 41  ? -33.596 -30.713 79.954 1.00 15.00 ? 41  LYS A CB  1 
ATOM   307  C CG  . LYS A 1 41  ? -33.118 -31.741 80.954 1.00 15.00 ? 41  LYS A CG  1 
ATOM   308  C CD  . LYS A 1 41  ? -31.656 -32.096 80.758 1.00 15.00 ? 41  LYS A CD  1 
ATOM   309  C CE  . LYS A 1 41  ? -31.185 -33.022 81.867 1.00 15.00 ? 41  LYS A CE  1 
ATOM   310  N NZ  . LYS A 1 41  ? -31.860 -34.350 81.797 1.00 15.00 ? 41  LYS A NZ  1 
ATOM   311  N N   . THR A 1 42  ? -35.037 -28.383 81.513 1.00 15.00 ? 42  THR A N   1 
ATOM   312  C CA  . THR A 1 42  ? -35.187 -27.621 82.754 1.00 15.00 ? 42  THR A CA  1 
ATOM   313  C C   . THR A 1 42  ? -36.456 -26.778 82.862 1.00 15.00 ? 42  THR A C   1 
ATOM   314  O O   . THR A 1 42  ? -36.864 -26.408 83.960 1.00 15.00 ? 42  THR A O   1 
ATOM   315  C CB  . THR A 1 42  ? -34.001 -26.661 82.950 1.00 15.00 ? 42  THR A CB  1 
ATOM   316  O OG1 . THR A 1 42  ? -34.100 -25.576 82.010 1.00 15.00 ? 42  THR A OG1 1 
ATOM   317  C CG2 . THR A 1 42  ? -32.679 -27.395 82.713 1.00 15.00 ? 42  THR A CG2 1 
ATOM   318  N N   . GLY A 1 43  ? -37.041 -26.422 81.728 1.00 15.00 ? 43  GLY A N   1 
ATOM   319  C CA  . GLY A 1 43  ? -38.238 -25.604 81.746 1.00 15.00 ? 43  GLY A CA  1 
ATOM   320  C C   . GLY A 1 43  ? -37.951 -24.119 81.592 1.00 15.00 ? 43  GLY A C   1 
ATOM   321  O O   . GLY A 1 43  ? -38.883 -23.309 81.623 1.00 15.00 ? 43  GLY A O   1 
ATOM   322  N N   . LYS A 1 44  ? -36.675 -23.751 81.482 1.00 15.00 ? 44  LYS A N   1 
ATOM   323  C CA  . LYS A 1 44  ? -36.278 -22.350 81.307 1.00 15.00 ? 44  LYS A CA  1 
ATOM   324  C C   . LYS A 1 44  ? -35.821 -22.065 79.874 1.00 15.00 ? 44  LYS A C   1 
ATOM   325  O O   . LYS A 1 44  ? -35.325 -22.949 79.190 1.00 15.00 ? 44  LYS A O   1 
ATOM   326  C CB  . LYS A 1 44  ? -35.136 -21.965 82.261 1.00 15.00 ? 44  LYS A CB  1 
ATOM   327  C CG  . LYS A 1 44  ? -35.580 -21.638 83.671 1.00 15.00 ? 44  LYS A CG  1 
ATOM   328  C CD  . LYS A 1 44  ? -35.802 -22.896 84.472 1.00 15.00 ? 44  LYS A CD  1 
ATOM   329  C CE  . LYS A 1 44  ? -34.479 -23.493 84.909 1.00 15.00 ? 44  LYS A CE  1 
ATOM   330  N NZ  . LYS A 1 44  ? -33.812 -22.586 85.898 1.00 15.00 ? 44  LYS A NZ  1 
ATOM   331  N N   . LEU A 1 45  ? -35.968 -20.819 79.443 1.00 15.00 ? 45  LEU A N   1 
ATOM   332  C CA  . LEU A 1 45  ? -35.564 -20.401 78.110 1.00 15.00 ? 45  LEU A CA  1 
ATOM   333  C C   . LEU A 1 45  ? -34.650 -19.184 78.262 1.00 15.00 ? 45  LEU A C   1 
ATOM   334  O O   . LEU A 1 45  ? -35.089 -18.109 78.687 1.00 15.00 ? 45  LEU A O   1 
ATOM   335  C CB  . LEU A 1 45  ? -36.789 -20.005 77.262 1.00 15.00 ? 45  LEU A CB  1 
ATOM   336  C CG  . LEU A 1 45  ? -36.543 -19.613 75.796 1.00 15.00 ? 45  LEU A CG  1 
ATOM   337  C CD1 . LEU A 1 45  ? -36.316 -20.875 74.977 1.00 15.00 ? 45  LEU A CD1 1 
ATOM   338  C CD2 . LEU A 1 45  ? -37.711 -18.813 75.219 1.00 15.00 ? 45  LEU A CD2 1 
ATOM   339  N N   . LEU A 1 46  ? -33.364 -19.383 77.998 1.00 15.00 ? 46  LEU A N   1 
ATOM   340  C CA  . LEU A 1 46  ? -32.405 -18.297 78.059 1.00 15.00 ? 46  LEU A CA  1 
ATOM   341  C C   . LEU A 1 46  ? -31.463 -18.376 76.861 1.00 15.00 ? 46  LEU A C   1 
ATOM   342  O O   . LEU A 1 46  ? -31.394 -19.398 76.169 1.00 15.00 ? 46  LEU A O   1 
ATOM   343  C CB  . LEU A 1 46  ? -31.636 -18.246 79.402 1.00 15.00 ? 46  LEU A CB  1 
ATOM   344  C CG  . LEU A 1 46  ? -30.798 -19.341 80.076 1.00 15.00 ? 46  LEU A CG  1 
ATOM   345  C CD1 . LEU A 1 46  ? -31.608 -20.014 81.152 1.00 15.00 ? 46  LEU A CD1 1 
ATOM   346  C CD2 . LEU A 1 46  ? -30.273 -20.346 79.086 1.00 15.00 ? 46  LEU A CD2 1 
ATOM   347  N N   . ASN A 1 47  ? -30.789 -17.268 76.589 1.00 15.00 ? 47  ASN A N   1 
ATOM   348  C CA  . ASN A 1 47  ? -29.864 -17.180 75.472 1.00 15.00 ? 47  ASN A CA  1 
ATOM   349  C C   . ASN A 1 47  ? -28.507 -17.751 75.814 1.00 15.00 ? 47  ASN A C   1 
ATOM   350  O O   . ASN A 1 47  ? -27.905 -17.366 76.809 1.00 15.00 ? 47  ASN A O   1 
ATOM   351  C CB  . ASN A 1 47  ? -29.738 -15.730 75.042 1.00 15.00 ? 47  ASN A CB  1 
ATOM   352  C CG  . ASN A 1 47  ? -31.070 -15.144 74.662 1.00 15.00 ? 47  ASN A CG  1 
ATOM   353  O OD1 . ASN A 1 47  ? -31.738 -15.640 73.752 1.00 15.00 ? 47  ASN A OD1 1 
ATOM   354  N ND2 . ASN A 1 47  ? -31.502 -14.127 75.394 1.00 15.00 ? 47  ASN A ND2 1 
ATOM   355  N N   . LEU A 1 48  ? -28.069 -18.738 75.048 1.00 15.00 ? 48  LEU A N   1 
ATOM   356  C CA  . LEU A 1 48  ? -26.771 -19.342 75.267 1.00 15.00 ? 48  LEU A CA  1 
ATOM   357  C C   . LEU A 1 48  ? -25.774 -18.569 74.417 1.00 15.00 ? 48  LEU A C   1 
ATOM   358  O O   . LEU A 1 48  ? -26.166 -17.882 73.472 1.00 15.00 ? 48  LEU A O   1 
ATOM   359  C CB  . LEU A 1 48  ? -26.811 -20.835 74.946 1.00 15.00 ? 48  LEU A CB  1 
ATOM   360  C CG  . LEU A 1 48  ? -27.742 -21.602 75.900 1.00 15.00 ? 48  LEU A CG  1 
ATOM   361  C CD1 . LEU A 1 48  ? -27.670 -23.089 75.665 1.00 15.00 ? 48  LEU A CD1 1 
ATOM   362  C CD2 . LEU A 1 48  ? -27.373 -21.299 77.328 1.00 15.00 ? 48  LEU A CD2 1 
ATOM   363  N N   . SER A 1 49  ? -24.497 -18.670 74.764 1.00 15.00 ? 49  SER A N   1 
ATOM   364  C CA  . SER A 1 49  ? -23.448 -17.919 74.087 1.00 15.00 ? 49  SER A CA  1 
ATOM   365  C C   . SER A 1 49  ? -22.826 -18.441 72.803 1.00 15.00 ? 49  SER A C   1 
ATOM   366  O O   . SER A 1 49  ? -22.077 -19.404 72.821 1.00 15.00 ? 49  SER A O   1 
ATOM   367  C CB  . SER A 1 49  ? -22.320 -17.617 75.079 1.00 15.00 ? 49  SER A CB  1 
ATOM   368  O OG  . SER A 1 49  ? -21.283 -16.866 74.476 1.00 15.00 ? 49  SER A OG  1 
ATOM   369  N N   . PRO A 1 50  ? -23.100 -17.780 71.669 1.00 15.00 ? 50  PRO A N   1 
ATOM   370  C CA  . PRO A 1 50  ? -22.502 -18.234 70.407 1.00 15.00 ? 50  PRO A CA  1 
ATOM   371  C C   . PRO A 1 50  ? -21.006 -17.847 70.418 1.00 15.00 ? 50  PRO A C   1 
ATOM   372  O O   . PRO A 1 50  ? -20.155 -18.576 69.916 1.00 15.00 ? 50  PRO A O   1 
ATOM   373  C CB  . PRO A 1 50  ? -23.273 -17.429 69.352 1.00 15.00 ? 50  PRO A CB  1 
ATOM   374  C CG  . PRO A 1 50  ? -24.582 -17.103 70.037 1.00 15.00 ? 50  PRO A CG  1 
ATOM   375  C CD  . PRO A 1 50  ? -24.127 -16.754 71.422 1.00 15.00 ? 50  PRO A CD  1 
ATOM   376  N N   . GLN A 1 51  ? -20.704 -16.702 71.026 1.00 15.00 ? 51  GLN A N   1 
ATOM   377  C CA  . GLN A 1 51  ? -19.339 -16.200 71.121 1.00 15.00 ? 51  GLN A CA  1 
ATOM   378  C C   . GLN A 1 51  ? -18.449 -17.206 71.856 1.00 15.00 ? 51  GLN A C   1 
ATOM   379  O O   . GLN A 1 51  ? -17.281 -17.391 71.498 1.00 15.00 ? 51  GLN A O   1 
ATOM   380  C CB  . GLN A 1 51  ? -19.325 -14.844 71.826 1.00 15.00 ? 51  GLN A CB  1 
ATOM   381  C CG  . GLN A 1 51  ? -18.004 -14.102 71.729 1.00 15.00 ? 51  GLN A CG  1 
ATOM   382  C CD  . GLN A 1 51  ? -17.722 -13.588 70.336 1.00 15.00 ? 51  GLN A CD  1 
ATOM   383  O OE1 . GLN A 1 51  ? -18.548 -12.904 69.733 1.00 15.00 ? 51  GLN A OE1 1 
ATOM   384  N NE2 . GLN A 1 51  ? -16.552 -13.905 69.818 1.00 15.00 ? 51  GLN A NE2 1 
ATOM   385  N N   . ASN A 1 52  ? -19.011 -17.868 72.868 1.00 15.00 ? 52  ASN A N   1 
ATOM   386  C CA  . ASN A 1 52  ? -18.282 -18.877 73.624 1.00 15.00 ? 52  ASN A CA  1 
ATOM   387  C C   . ASN A 1 52  ? -17.738 -19.880 72.593 1.00 15.00 ? 52  ASN A C   1 
ATOM   388  O O   . ASN A 1 52  ? -16.551 -20.220 72.597 1.00 15.00 ? 52  ASN A O   1 
ATOM   389  C CB  . ASN A 1 52  ? -19.242 -19.571 74.601 1.00 15.00 ? 52  ASN A CB  1 
ATOM   390  C CG  . ASN A 1 52  ? -18.537 -20.474 75.633 1.00 15.00 ? 52  ASN A CG  1 
ATOM   391  O OD1 . ASN A 1 52  ? -19.186 -20.950 76.570 1.00 15.00 ? 52  ASN A OD1 1 
ATOM   392  N ND2 . ASN A 1 52  ? -17.241 -20.701 75.482 1.00 15.00 ? 52  ASN A ND2 1 
ATOM   393  N N   . LEU A 1 53  ? -18.603 -20.309 71.680 1.00 15.00 ? 53  LEU A N   1 
ATOM   394  C CA  . LEU A 1 53  ? -18.224 -21.259 70.644 1.00 15.00 ? 53  LEU A CA  1 
ATOM   395  C C   . LEU A 1 53  ? -17.183 -20.690 69.677 1.00 15.00 ? 53  LEU A C   1 
ATOM   396  O O   . LEU A 1 53  ? -16.168 -21.329 69.398 1.00 15.00 ? 53  LEU A O   1 
ATOM   397  C CB  . LEU A 1 53  ? -19.469 -21.695 69.863 1.00 15.00 ? 53  LEU A CB  1 
ATOM   398  C CG  . LEU A 1 53  ? -20.370 -22.807 70.416 1.00 15.00 ? 53  LEU A CG  1 
ATOM   399  C CD1 . LEU A 1 53  ? -20.054 -23.129 71.869 1.00 15.00 ? 53  LEU A CD1 1 
ATOM   400  C CD2 . LEU A 1 53  ? -21.832 -22.410 70.225 1.00 15.00 ? 53  LEU A CD2 1 
ATOM   401  N N   . VAL A 1 54  ? -17.443 -19.482 69.184 1.00 15.00 ? 54  VAL A N   1 
ATOM   402  C CA  . VAL A 1 54  ? -16.551 -18.817 68.233 1.00 15.00 ? 54  VAL A CA  1 
ATOM   403  C C   . VAL A 1 54  ? -15.100 -18.790 68.715 1.00 15.00 ? 54  VAL A C   1 
ATOM   404  O O   . VAL A 1 54  ? -14.190 -19.174 67.981 1.00 15.00 ? 54  VAL A O   1 
ATOM   405  C CB  . VAL A 1 54  ? -17.033 -17.363 67.915 1.00 15.00 ? 54  VAL A CB  1 
ATOM   406  C CG1 . VAL A 1 54  ? -15.964 -16.582 67.189 1.00 15.00 ? 54  VAL A CG1 1 
ATOM   407  C CG2 . VAL A 1 54  ? -18.283 -17.399 67.048 1.00 15.00 ? 54  VAL A CG2 1 
ATOM   408  N N   . ASP A 1 55  ? -14.899 -18.369 69.956 1.00 15.00 ? 55  ASP A N   1 
ATOM   409  C CA  . ASP A 1 55  ? -13.559 -18.258 70.514 1.00 15.00 ? 55  ASP A CA  1 
ATOM   410  C C   . ASP A 1 55  ? -12.933 -19.546 71.036 1.00 15.00 ? 55  ASP A C   1 
ATOM   411  O O   . ASP A 1 55  ? -11.723 -19.702 70.995 1.00 15.00 ? 55  ASP A O   1 
ATOM   412  C CB  . ASP A 1 55  ? -13.560 -17.250 71.672 1.00 15.00 ? 55  ASP A CB  1 
ATOM   413  C CG  . ASP A 1 55  ? -14.041 -15.867 71.267 1.00 15.00 ? 55  ASP A CG  1 
ATOM   414  O OD1 . ASP A 1 55  ? -14.019 -15.537 70.062 1.00 15.00 ? 55  ASP A OD1 1 
ATOM   415  O OD2 . ASP A 1 55  ? -14.427 -15.103 72.180 1.00 15.00 ? 55  ASP A OD2 1 
ATOM   416  N N   . CYS A 1 56  ? -13.759 -20.471 71.502 1.00 15.00 ? 56  CYS A N   1 
ATOM   417  C CA  . CYS A 1 56  ? -13.264 -21.690 72.137 1.00 15.00 ? 56  CYS A CA  1 
ATOM   418  C C   . CYS A 1 56  ? -13.176 -23.015 71.374 1.00 15.00 ? 56  CYS A C   1 
ATOM   419  O O   . CYS A 1 56  ? -12.339 -23.861 71.715 1.00 15.00 ? 56  CYS A O   1 
ATOM   420  C CB  . CYS A 1 56  ? -14.027 -21.895 73.454 1.00 15.00 ? 56  CYS A CB  1 
ATOM   421  S SG  . CYS A 1 56  ? -14.047 -20.411 74.534 1.00 15.00 ? 56  CYS A SG  1 
ATOM   422  N N   . VAL A 1 57  ? -14.032 -23.219 70.373 1.00 15.00 ? 57  VAL A N   1 
ATOM   423  C CA  . VAL A 1 57  ? -13.998 -24.472 69.618 1.00 15.00 ? 57  VAL A CA  1 
ATOM   424  C C   . VAL A 1 57  ? -12.802 -24.450 68.662 1.00 15.00 ? 57  VAL A C   1 
ATOM   425  O O   . VAL A 1 57  ? -12.852 -23.832 67.597 1.00 15.00 ? 57  VAL A O   1 
ATOM   426  C CB  . VAL A 1 57  ? -15.337 -24.756 68.865 1.00 15.00 ? 57  VAL A CB  1 
ATOM   427  C CG1 . VAL A 1 57  ? -15.376 -26.205 68.375 1.00 15.00 ? 57  VAL A CG1 1 
ATOM   428  C CG2 . VAL A 1 57  ? -16.518 -24.509 69.771 1.00 15.00 ? 57  VAL A CG2 1 
ATOM   429  N N   . SER A 1 58  ? -11.717 -25.099 69.084 1.00 15.00 ? 58  SER A N   1 
ATOM   430  C CA  . SER A 1 58  ? -10.477 -25.162 68.322 1.00 15.00 ? 58  SER A CA  1 
ATOM   431  C C   . SER A 1 58  ? -10.529 -25.970 67.030 1.00 15.00 ? 58  SER A C   1 
ATOM   432  O O   . SER A 1 58  ? -9.671  -25.811 66.170 1.00 15.00 ? 58  SER A O   1 
ATOM   433  C CB  . SER A 1 58  ? -9.339  -25.678 69.211 1.00 15.00 ? 58  SER A CB  1 
ATOM   434  O OG  . SER A 1 58  ? -9.698  -26.907 69.823 1.00 15.00 ? 58  SER A OG  1 
ATOM   435  N N   . GLU A 1 59  ? -11.486 -26.880 66.915 1.00 15.00 ? 59  GLU A N   1 
ATOM   436  C CA  . GLU A 1 59  ? -11.616 -27.675 65.700 1.00 15.00 ? 59  GLU A CA  1 
ATOM   437  C C   . GLU A 1 59  ? -12.374 -26.893 64.618 1.00 15.00 ? 59  GLU A C   1 
ATOM   438  O O   . GLU A 1 59  ? -12.484 -27.341 63.488 1.00 15.00 ? 59  GLU A O   1 
ATOM   439  C CB  . GLU A 1 59  ? -12.326 -29.002 65.989 1.00 15.00 ? 59  GLU A CB  1 
ATOM   440  C CG  . GLU A 1 59  ? -11.573 -29.963 66.922 1.00 15.00 ? 59  GLU A CG  1 
ATOM   441  C CD  . GLU A 1 59  ? -11.662 -29.594 68.400 1.00 15.00 ? 59  GLU A CD  1 
ATOM   442  O OE1 . GLU A 1 59  ? -12.688 -29.028 68.852 1.00 15.00 ? 59  GLU A OE1 1 
ATOM   443  O OE2 . GLU A 1 59  ? -10.689 -29.882 69.122 1.00 15.00 ? 59  GLU A OE2 1 
ATOM   444  N N   . ASN A 1 60  ? -12.913 -25.734 64.985 1.00 15.00 ? 60  ASN A N   1 
ATOM   445  C CA  . ASN A 1 60  ? -13.652 -24.873 64.061 1.00 15.00 ? 60  ASN A CA  1 
ATOM   446  C C   . ASN A 1 60  ? -12.813 -23.653 63.731 1.00 15.00 ? 60  ASN A C   1 
ATOM   447  O O   . ASN A 1 60  ? -11.763 -23.436 64.346 1.00 15.00 ? 60  ASN A O   1 
ATOM   448  C CB  . ASN A 1 60  ? -14.993 -24.443 64.660 1.00 15.00 ? 60  ASN A CB  1 
ATOM   449  C CG  . ASN A 1 60  ? -16.077 -25.506 64.508 1.00 15.00 ? 60  ASN A CG  1 
ATOM   450  O OD1 . ASN A 1 60  ? -17.164 -25.380 65.075 1.00 15.00 ? 60  ASN A OD1 1 
ATOM   451  N ND2 . ASN A 1 60  ? -15.794 -26.552 63.740 1.00 15.00 ? 60  ASN A ND2 1 
ATOM   452  N N   . ASP A 1 61  ? -13.277 -22.849 62.780 1.00 15.00 ? 61  ASP A N   1 
ATOM   453  C CA  . ASP A 1 61  ? -12.526 -21.667 62.375 1.00 15.00 ? 61  ASP A CA  1 
ATOM   454  C C   . ASP A 1 61  ? -13.126 -20.312 62.739 1.00 15.00 ? 61  ASP A C   1 
ATOM   455  O O   . ASP A 1 61  ? -12.892 -19.321 62.044 1.00 15.00 ? 61  ASP A O   1 
ATOM   456  C CB  . ASP A 1 61  ? -12.221 -21.743 60.879 1.00 15.00 ? 61  ASP A CB  1 
ATOM   457  C CG  . ASP A 1 61  ? -11.536 -23.043 60.497 1.00 15.00 ? 61  ASP A CG  1 
ATOM   458  O OD1 . ASP A 1 61  ? -10.535 -23.409 61.156 1.00 15.00 ? 61  ASP A OD1 1 
ATOM   459  O OD2 . ASP A 1 61  ? -12.015 -23.718 59.565 1.00 15.00 ? 61  ASP A OD2 1 
ATOM   460  N N   . GLY A 1 62  ? -13.883 -20.272 63.833 1.00 15.00 ? 62  GLY A N   1 
ATOM   461  C CA  . GLY A 1 62  ? -14.481 -19.032 64.300 1.00 15.00 ? 62  GLY A CA  1 
ATOM   462  C C   . GLY A 1 62  ? -15.344 -18.295 63.300 1.00 15.00 ? 62  GLY A C   1 
ATOM   463  O O   . GLY A 1 62  ? -16.370 -18.810 62.867 1.00 15.00 ? 62  GLY A O   1 
ATOM   464  N N   . CYS A 1 63  ? -14.955 -17.069 62.960 1.00 15.00 ? 63  CYS A N   1 
ATOM   465  C CA  . CYS A 1 63  ? -15.705 -16.282 61.988 1.00 15.00 ? 63  CYS A CA  1 
ATOM   466  C C   . CYS A 1 63  ? -15.488 -16.790 60.562 1.00 15.00 ? 63  CYS A C   1 
ATOM   467  O O   . CYS A 1 63  ? -16.189 -16.394 59.632 1.00 15.00 ? 63  CYS A O   1 
ATOM   468  C CB  . CYS A 1 63  ? -15.367 -14.792 62.100 1.00 15.00 ? 63  CYS A CB  1 
ATOM   469  S SG  . CYS A 1 63  ? -16.140 -13.944 63.526 1.00 15.00 ? 63  CYS A SG  1 
ATOM   470  N N   . GLY A 1 64  ? -14.547 -17.713 60.408 1.00 15.00 ? 64  GLY A N   1 
ATOM   471  C CA  . GLY A 1 64  ? -14.272 -18.270 59.100 1.00 15.00 ? 64  GLY A CA  1 
ATOM   472  C C   . GLY A 1 64  ? -15.105 -19.502 58.794 1.00 15.00 ? 64  GLY A C   1 
ATOM   473  O O   . GLY A 1 64  ? -14.952 -20.104 57.728 1.00 15.00 ? 64  GLY A O   1 
ATOM   474  N N   . GLY A 1 65  ? -15.943 -19.920 59.740 1.00 15.00 ? 65  GLY A N   1 
ATOM   475  C CA  . GLY A 1 65  ? -16.779 -21.082 59.518 1.00 15.00 ? 65  GLY A CA  1 
ATOM   476  C C   . GLY A 1 65  ? -16.535 -22.205 60.505 1.00 15.00 ? 65  GLY A C   1 
ATOM   477  O O   . GLY A 1 65  ? -15.543 -22.200 61.240 1.00 15.00 ? 65  GLY A O   1 
ATOM   478  N N   . GLY A 1 66  ? -17.437 -23.183 60.515 1.00 15.00 ? 66  GLY A N   1 
ATOM   479  C CA  . GLY A 1 66  ? -17.292 -24.313 61.412 1.00 15.00 ? 66  GLY A CA  1 
ATOM   480  C C   . GLY A 1 66  ? -18.409 -25.323 61.265 1.00 15.00 ? 66  GLY A C   1 
ATOM   481  O O   . GLY A 1 66  ? -19.246 -25.186 60.365 1.00 15.00 ? 66  GLY A O   1 
ATOM   482  N N   . TYR A 1 67  ? -18.405 -26.337 62.132 1.00 15.00 ? 67  TYR A N   1 
ATOM   483  C CA  . TYR A 1 67  ? -19.418 -27.393 62.148 1.00 15.00 ? 67  TYR A CA  1 
ATOM   484  C C   . TYR A 1 67  ? -20.121 -27.464 63.509 1.00 15.00 ? 67  TYR A C   1 
ATOM   485  O O   . TYR A 1 67  ? -19.482 -27.309 64.541 1.00 15.00 ? 67  TYR A O   1 
ATOM   486  C CB  . TYR A 1 67  ? -18.776 -28.740 61.832 1.00 15.00 ? 67  TYR A CB  1 
ATOM   487  C CG  . TYR A 1 67  ? -18.295 -28.839 60.414 1.00 15.00 ? 67  TYR A CG  1 
ATOM   488  C CD1 . TYR A 1 67  ? -17.151 -28.163 59.999 1.00 15.00 ? 67  TYR A CD1 1 
ATOM   489  C CD2 . TYR A 1 67  ? -19.020 -29.555 59.470 1.00 15.00 ? 67  TYR A CD2 1 
ATOM   490  C CE1 . TYR A 1 67  ? -16.742 -28.187 58.673 1.00 15.00 ? 67  TYR A CE1 1 
ATOM   491  C CE2 . TYR A 1 67  ? -18.619 -29.589 58.127 1.00 15.00 ? 67  TYR A CE2 1 
ATOM   492  C CZ  . TYR A 1 67  ? -17.483 -28.898 57.739 1.00 15.00 ? 67  TYR A CZ  1 
ATOM   493  O OH  . TYR A 1 67  ? -17.117 -28.879 56.417 1.00 15.00 ? 67  TYR A OH  1 
ATOM   494  N N   . MET A 1 68  ? -21.426 -27.734 63.502 1.00 15.00 ? 68  MET A N   1 
ATOM   495  C CA  . MET A 1 68  ? -22.219 -27.811 64.731 1.00 15.00 ? 68  MET A CA  1 
ATOM   496  C C   . MET A 1 68  ? -21.845 -29.016 65.611 1.00 15.00 ? 68  MET A C   1 
ATOM   497  O O   . MET A 1 68  ? -21.886 -28.945 66.836 1.00 15.00 ? 68  MET A O   1 
ATOM   498  C CB  . MET A 1 68  ? -23.721 -27.830 64.408 1.00 15.00 ? 68  MET A CB  1 
ATOM   499  C CG  . MET A 1 68  ? -24.256 -26.597 63.634 1.00 15.00 ? 68  MET A CG  1 
ATOM   500  S SD  . MET A 1 68  ? -24.046 -26.616 61.791 1.00 15.00 ? 68  MET A SD  1 
ATOM   501  C CE  . MET A 1 68  ? -25.418 -27.658 61.307 1.00 15.00 ? 68  MET A CE  1 
ATOM   502  N N   . THR A 1 69  ? -21.482 -30.124 64.978 1.00 15.00 ? 69  THR A N   1 
ATOM   503  C CA  . THR A 1 69  ? -21.079 -31.333 65.701 1.00 15.00 ? 69  THR A CA  1 
ATOM   504  C C   . THR A 1 69  ? -19.823 -31.046 66.532 1.00 15.00 ? 69  THR A C   1 
ATOM   505  O O   . THR A 1 69  ? -19.672 -31.545 67.658 1.00 15.00 ? 69  THR A O   1 
ATOM   506  C CB  . THR A 1 69  ? -20.805 -32.507 64.726 1.00 15.00 ? 69  THR A CB  1 
ATOM   507  O OG1 . THR A 1 69  ? -20.083 -32.018 63.583 1.00 15.00 ? 69  THR A OG1 1 
ATOM   508  C CG2 . THR A 1 69  ? -22.120 -33.148 64.274 1.00 15.00 ? 69  THR A CG2 1 
ATOM   509  N N   . ASN A 1 70  ? -18.940 -30.210 65.987 1.00 15.00 ? 70  ASN A N   1 
ATOM   510  C CA  . ASN A 1 70  ? -17.716 -29.846 66.695 1.00 15.00 ? 70  ASN A CA  1 
ATOM   511  C C   . ASN A 1 70  ? -18.081 -29.017 67.907 1.00 15.00 ? 70  ASN A C   1 
ATOM   512  O O   . ASN A 1 70  ? -17.569 -29.252 69.003 1.00 15.00 ? 70  ASN A O   1 
ATOM   513  C CB  . ASN A 1 70  ? -16.759 -29.068 65.790 1.00 15.00 ? 70  ASN A CB  1 
ATOM   514  C CG  . ASN A 1 70  ? -15.887 -29.974 64.950 1.00 15.00 ? 70  ASN A CG  1 
ATOM   515  O OD1 . ASN A 1 70  ? -15.354 -29.556 63.931 1.00 15.00 ? 70  ASN A OD1 1 
ATOM   516  N ND2 . ASN A 1 70  ? -15.717 -31.214 65.388 1.00 15.00 ? 70  ASN A ND2 1 
ATOM   517  N N   . ALA A 1 71  ? -19.018 -28.093 67.707 1.00 15.00 ? 71  ALA A N   1 
ATOM   518  C CA  . ALA A 1 71  ? -19.500 -27.218 68.771 1.00 15.00 ? 71  ALA A CA  1 
ATOM   519  C C   . ALA A 1 71  ? -20.135 -28.023 69.903 1.00 15.00 ? 71  ALA A C   1 
ATOM   520  O O   . ALA A 1 71  ? -19.877 -27.759 71.074 1.00 15.00 ? 71  ALA A O   1 
ATOM   521  C CB  . ALA A 1 71  ? -20.488 -26.197 68.214 1.00 15.00 ? 71  ALA A CB  1 
ATOM   522  N N   . PHE A 1 72  ? -20.904 -29.047 69.552 1.00 15.00 ? 72  PHE A N   1 
ATOM   523  C CA  . PHE A 1 72  ? -21.556 -29.889 70.551 1.00 15.00 ? 72  PHE A CA  1 
ATOM   524  C C   . PHE A 1 72  ? -20.533 -30.676 71.371 1.00 15.00 ? 72  PHE A C   1 
ATOM   525  O O   . PHE A 1 72  ? -20.659 -30.764 72.600 1.00 15.00 ? 72  PHE A O   1 
ATOM   526  C CB  . PHE A 1 72  ? -22.550 -30.855 69.887 1.00 15.00 ? 72  PHE A CB  1 
ATOM   527  C CG  . PHE A 1 72  ? -23.718 -30.175 69.242 1.00 15.00 ? 72  PHE A CG  1 
ATOM   528  C CD1 . PHE A 1 72  ? -24.301 -29.054 69.824 1.00 15.00 ? 72  PHE A CD1 1 
ATOM   529  C CD2 . PHE A 1 72  ? -24.233 -30.646 68.044 1.00 15.00 ? 72  PHE A CD2 1 
ATOM   530  C CE1 . PHE A 1 72  ? -25.383 -28.408 69.212 1.00 15.00 ? 72  PHE A CE1 1 
ATOM   531  C CE2 . PHE A 1 72  ? -25.313 -30.009 67.423 1.00 15.00 ? 72  PHE A CE2 1 
ATOM   532  C CZ  . PHE A 1 72  ? -25.889 -28.888 68.007 1.00 15.00 ? 72  PHE A CZ  1 
ATOM   533  N N   . GLN A 1 73  ? -19.548 -31.267 70.685 1.00 15.00 ? 73  GLN A N   1 
ATOM   534  C CA  . GLN A 1 73  ? -18.505 -32.045 71.345 1.00 15.00 ? 73  GLN A CA  1 
ATOM   535  C C   . GLN A 1 73  ? -17.747 -31.158 72.303 1.00 15.00 ? 73  GLN A C   1 
ATOM   536  O O   . GLN A 1 73  ? -17.354 -31.608 73.376 1.00 15.00 ? 73  GLN A O   1 
ATOM   537  C CB  . GLN A 1 73  ? -17.518 -32.659 70.344 1.00 15.00 ? 73  GLN A CB  1 
ATOM   538  C CG  . GLN A 1 73  ? -18.089 -33.797 69.513 1.00 15.00 ? 73  GLN A CG  1 
ATOM   539  C CD  . GLN A 1 73  ? -17.029 -34.630 68.791 1.00 15.00 ? 73  GLN A CD  1 
ATOM   540  O OE1 . GLN A 1 73  ? -17.199 -35.007 67.617 1.00 15.00 ? 73  GLN A OE1 1 
ATOM   541  N NE2 . GLN A 1 73  ? -15.946 -34.943 69.492 1.00 15.00 ? 73  GLN A NE2 1 
ATOM   542  N N   . TYR A 1 74  ? -17.554 -29.894 71.917 1.00 15.00 ? 74  TYR A N   1 
ATOM   543  C CA  . TYR A 1 74  ? -16.845 -28.938 72.752 1.00 15.00 ? 74  TYR A CA  1 
ATOM   544  C C   . TYR A 1 74  ? -17.581 -28.807 74.064 1.00 15.00 ? 74  TYR A C   1 
ATOM   545  O O   . TYR A 1 74  ? -17.023 -29.093 75.122 1.00 15.00 ? 74  TYR A O   1 
ATOM   546  C CB  . TYR A 1 74  ? -16.754 -27.569 72.077 1.00 15.00 ? 74  TYR A CB  1 
ATOM   547  C CG  . TYR A 1 74  ? -16.457 -26.430 73.035 1.00 15.00 ? 74  TYR A CG  1 
ATOM   548  C CD1 . TYR A 1 74  ? -15.180 -26.261 73.585 1.00 15.00 ? 74  TYR A CD1 1 
ATOM   549  C CD2 . TYR A 1 74  ? -17.461 -25.544 73.420 1.00 15.00 ? 74  TYR A CD2 1 
ATOM   550  C CE1 . TYR A 1 74  ? -14.912 -25.232 74.505 1.00 15.00 ? 74  TYR A CE1 1 
ATOM   551  C CE2 . TYR A 1 74  ? -17.207 -24.509 74.337 1.00 15.00 ? 74  TYR A CE2 1 
ATOM   552  C CZ  . TYR A 1 74  ? -15.931 -24.362 74.875 1.00 15.00 ? 74  TYR A CZ  1 
ATOM   553  O OH  . TYR A 1 74  ? -15.688 -23.360 75.783 1.00 15.00 ? 74  TYR A OH  1 
ATOM   554  N N   . VAL A 1 75  ? -18.840 -28.390 73.987 1.00 15.00 ? 75  VAL A N   1 
ATOM   555  C CA  . VAL A 1 75  ? -19.670 -28.207 75.167 1.00 15.00 ? 75  VAL A CA  1 
ATOM   556  C C   . VAL A 1 75  ? -19.605 -29.427 76.093 1.00 15.00 ? 75  VAL A C   1 
ATOM   557  O O   . VAL A 1 75  ? -19.547 -29.273 77.308 1.00 15.00 ? 75  VAL A O   1 
ATOM   558  C CB  . VAL A 1 75  ? -21.137 -27.888 74.773 1.00 15.00 ? 75  VAL A CB  1 
ATOM   559  C CG1 . VAL A 1 75  ? -22.005 -27.770 76.014 1.00 15.00 ? 75  VAL A CG1 1 
ATOM   560  C CG2 . VAL A 1 75  ? -21.196 -26.586 73.962 1.00 15.00 ? 75  VAL A CG2 1 
ATOM   561  N N   . GLN A 1 76  ? -19.558 -30.625 75.514 1.00 15.00 ? 76  GLN A N   1 
ATOM   562  C CA  . GLN A 1 76  ? -19.480 -31.851 76.293 1.00 15.00 ? 76  GLN A CA  1 
ATOM   563  C C   . GLN A 1 76  ? -18.152 -31.964 77.028 1.00 15.00 ? 76  GLN A C   1 
ATOM   564  O O   . GLN A 1 76  ? -18.138 -32.205 78.232 1.00 15.00 ? 76  GLN A O   1 
ATOM   565  C CB  . GLN A 1 76  ? -19.681 -33.087 75.415 1.00 15.00 ? 76  GLN A CB  1 
ATOM   566  C CG  . GLN A 1 76  ? -19.527 -34.387 76.192 1.00 15.00 ? 76  GLN A CG  1 
ATOM   567  C CD  . GLN A 1 76  ? -19.728 -35.632 75.353 1.00 15.00 ? 76  GLN A CD  1 
ATOM   568  O OE1 . GLN A 1 76  ? -19.395 -35.662 74.172 1.00 15.00 ? 76  GLN A OE1 1 
ATOM   569  N NE2 . GLN A 1 76  ? -20.274 -36.674 75.966 1.00 15.00 ? 76  GLN A NE2 1 
ATOM   570  N N   . LYS A 1 77  ? -17.045 -31.809 76.299 1.00 15.00 ? 77  LYS A N   1 
ATOM   571  C CA  . LYS A 1 77  ? -15.697 -31.897 76.874 1.00 15.00 ? 77  LYS A CA  1 
ATOM   572  C C   . LYS A 1 77  ? -15.513 -30.799 77.926 1.00 15.00 ? 77  LYS A C   1 
ATOM   573  O O   . LYS A 1 77  ? -15.067 -31.055 79.041 1.00 15.00 ? 77  LYS A O   1 
ATOM   574  C CB  . LYS A 1 77  ? -14.631 -31.710 75.793 1.00 15.00 ? 77  LYS A CB  1 
ATOM   575  C CG  . LYS A 1 77  ? -14.731 -32.634 74.605 1.00 15.00 ? 77  LYS A CG  1 
ATOM   576  C CD  . LYS A 1 77  ? -14.441 -34.067 74.973 1.00 15.00 ? 77  LYS A CD  1 
ATOM   577  C CE  . LYS A 1 77  ? -14.490 -34.962 73.727 1.00 15.00 ? 77  LYS A CE  1 
ATOM   578  N NZ  . LYS A 1 77  ? -13.559 -34.519 72.634 1.00 15.00 ? 77  LYS A NZ  1 
ATOM   579  N N   . ASN A 1 78  ? -15.874 -29.578 77.549 1.00 15.00 ? 78  ASN A N   1 
ATOM   580  C CA  . ASN A 1 78  ? -15.776 -28.421 78.419 1.00 15.00 ? 78  ASN A CA  1 
ATOM   581  C C   . ASN A 1 78  ? -16.756 -28.555 79.605 1.00 15.00 ? 78  ASN A C   1 
ATOM   582  O O   . ASN A 1 78  ? -16.663 -27.823 80.594 1.00 15.00 ? 78  ASN A O   1 
ATOM   583  C CB  . ASN A 1 78  ? -16.110 -27.173 77.610 1.00 15.00 ? 78  ASN A CB  1 
ATOM   584  C CG  . ASN A 1 78  ? -15.750 -25.899 78.330 1.00 15.00 ? 78  ASN A CG  1 
ATOM   585  O OD1 . ASN A 1 78  ? -14.650 -25.773 78.857 1.00 15.00 ? 78  ASN A OD1 1 
ATOM   586  N ND2 . ASN A 1 78  ? -16.657 -24.933 78.328 1.00 15.00 ? 78  ASN A ND2 1 
ATOM   587  N N   . ARG A 1 79  ? -17.699 -29.484 79.467 1.00 15.00 ? 79  ARG A N   1 
ATOM   588  C CA  . ARG A 1 79  ? -18.728 -29.758 80.460 1.00 15.00 ? 79  ARG A CA  1 
ATOM   589  C C   . ARG A 1 79  ? -19.659 -28.580 80.713 1.00 15.00 ? 79  ARG A C   1 
ATOM   590  O O   . ARG A 1 79  ? -20.265 -28.490 81.784 1.00 15.00 ? 79  ARG A O   1 
ATOM   591  C CB  . ARG A 1 79  ? -18.111 -30.220 81.774 1.00 15.00 ? 79  ARG A CB  1 
ATOM   592  C CG  . ARG A 1 79  ? -17.416 -31.559 81.703 1.00 15.00 ? 79  ARG A CG  1 
ATOM   593  C CD  . ARG A 1 79  ? -16.950 -31.925 83.078 1.00 15.00 ? 79  ARG A CD  1 
ATOM   594  N NE  . ARG A 1 79  ? -16.169 -33.153 83.115 1.00 15.00 ? 79  ARG A NE  1 
ATOM   595  C CZ  . ARG A 1 79  ? -14.858 -33.222 82.888 1.00 15.00 ? 79  ARG A CZ  1 
ATOM   596  N NH1 . ARG A 1 79  ? -14.171 -32.132 82.577 1.00 15.00 ? 79  ARG A NH1 1 
ATOM   597  N NH2 . ARG A 1 79  ? -14.215 -34.369 83.071 1.00 15.00 ? 79  ARG A NH2 1 
ATOM   598  N N   . GLY A 1 80  ? -19.793 -27.702 79.723 1.00 15.00 ? 80  GLY A N   1 
ATOM   599  C CA  . GLY A 1 80  ? -20.654 -26.545 79.869 1.00 15.00 ? 80  GLY A CA  1 
ATOM   600  C C   . GLY A 1 80  ? -20.479 -25.476 78.811 1.00 15.00 ? 80  GLY A C   1 
ATOM   601  O O   . GLY A 1 80  ? -19.542 -25.520 78.008 1.00 15.00 ? 80  GLY A O   1 
ATOM   602  N N   . ILE A 1 81  ? -21.411 -24.532 78.795 1.00 15.00 ? 81  ILE A N   1 
ATOM   603  C CA  . ILE A 1 81  ? -21.396 -23.401 77.875 1.00 15.00 ? 81  ILE A CA  1 
ATOM   604  C C   . ILE A 1 81  ? -21.986 -22.201 78.623 1.00 15.00 ? 81  ILE A C   1 
ATOM   605  O O   . ILE A 1 81  ? -22.907 -22.352 79.426 1.00 15.00 ? 81  ILE A O   1 
ATOM   606  C CB  . ILE A 1 81  ? -22.234 -23.675 76.577 1.00 15.00 ? 81  ILE A CB  1 
ATOM   607  C CG1 . ILE A 1 81  ? -22.194 -22.456 75.641 1.00 15.00 ? 81  ILE A CG1 1 
ATOM   608  C CG2 . ILE A 1 81  ? -23.675 -24.045 76.928 1.00 15.00 ? 81  ILE A CG2 1 
ATOM   609  C CD1 . ILE A 1 81  ? -22.887 -22.662 74.312 1.00 15.00 ? 81  ILE A CD1 1 
ATOM   610  N N   . ASP A 1 82  ? -21.439 -21.020 78.372 1.00 15.00 ? 82  ASP A N   1 
ATOM   611  C CA  . ASP A 1 82  ? -21.914 -19.808 79.013 1.00 15.00 ? 82  ASP A CA  1 
ATOM   612  C C   . ASP A 1 82  ? -23.215 -19.254 78.450 1.00 15.00 ? 82  ASP A C   1 
ATOM   613  O O   . ASP A 1 82  ? -23.630 -19.583 77.326 1.00 15.00 ? 82  ASP A O   1 
ATOM   614  C CB  . ASP A 1 82  ? -20.846 -18.715 78.940 1.00 15.00 ? 82  ASP A CB  1 
ATOM   615  C CG  . ASP A 1 82  ? -19.734 -18.921 79.950 1.00 15.00 ? 82  ASP A CG  1 
ATOM   616  O OD1 . ASP A 1 82  ? -19.929 -19.686 80.912 1.00 15.00 ? 82  ASP A OD1 1 
ATOM   617  O OD2 . ASP A 1 82  ? -18.665 -18.324 79.779 1.00 15.00 ? 82  ASP A OD2 1 
ATOM   618  N N   . SER A 1 83  ? -23.865 -18.425 79.260 1.00 15.00 ? 83  SER A N   1 
ATOM   619  C CA  . SER A 1 83  ? -25.090 -17.776 78.852 1.00 15.00 ? 83  SER A CA  1 
ATOM   620  C C   . SER A 1 83  ? -24.651 -16.549 78.063 1.00 15.00 ? 83  SER A C   1 
ATOM   621  O O   . SER A 1 83  ? -23.505 -16.103 78.174 1.00 15.00 ? 83  SER A O   1 
ATOM   622  C CB  . SER A 1 83  ? -25.917 -17.357 80.075 1.00 15.00 ? 83  SER A CB  1 
ATOM   623  O OG  . SER A 1 83  ? -25.250 -16.375 80.858 1.00 15.00 ? 83  SER A OG  1 
ATOM   624  N N   . GLU A 1 84  ? -25.558 -16.011 77.262 1.00 15.00 ? 84  GLU A N   1 
ATOM   625  C CA  . GLU A 1 84  ? -25.273 -14.831 76.475 1.00 15.00 ? 84  GLU A CA  1 
ATOM   626  C C   . GLU A 1 84  ? -24.770 -13.704 77.377 1.00 15.00 ? 84  GLU A C   1 
ATOM   627  O O   . GLU A 1 84  ? -23.767 -13.087 77.061 1.00 15.00 ? 84  GLU A O   1 
ATOM   628  C CB  . GLU A 1 84  ? -26.527 -14.400 75.700 1.00 15.00 ? 84  GLU A CB  1 
ATOM   629  C CG  . GLU A 1 84  ? -26.385 -13.095 74.931 1.00 15.00 ? 84  GLU A CG  1 
ATOM   630  C CD  . GLU A 1 84  ? -25.295 -13.124 73.852 1.00 15.00 ? 84  GLU A CD  1 
ATOM   631  O OE1 . GLU A 1 84  ? -24.979 -14.217 73.330 1.00 15.00 ? 84  GLU A OE1 1 
ATOM   632  O OE2 . GLU A 1 84  ? -24.761 -12.045 73.520 1.00 15.00 ? 84  GLU A OE2 1 
ATOM   633  N N   . ASP A 1 85  ? -25.436 -13.471 78.514 1.00 15.00 ? 85  ASP A N   1 
ATOM   634  C CA  . ASP A 1 85  ? -25.054 -12.408 79.459 1.00 15.00 ? 85  ASP A CA  1 
ATOM   635  C C   . ASP A 1 85  ? -23.619 -12.539 79.978 1.00 15.00 ? 85  ASP A C   1 
ATOM   636  O O   . ASP A 1 85  ? -22.890 -11.550 80.074 1.00 15.00 ? 85  ASP A O   1 
ATOM   637  C CB  . ASP A 1 85  ? -26.027 -12.350 80.654 1.00 15.00 ? 85  ASP A CB  1 
ATOM   638  C CG  . ASP A 1 85  ? -27.204 -11.393 80.420 1.00 15.00 ? 85  ASP A CG  1 
ATOM   639  O OD1 . ASP A 1 85  ? -27.863 -11.497 79.367 1.00 15.00 ? 85  ASP A OD1 1 
ATOM   640  O OD2 . ASP A 1 85  ? -27.466 -10.527 81.289 1.00 15.00 ? 85  ASP A OD2 1 
ATOM   641  N N   . ALA A 1 86  ? -23.229 -13.774 80.273 1.00 15.00 ? 86  ALA A N   1 
ATOM   642  C CA  . ALA A 1 86  ? -21.906 -14.090 80.780 1.00 15.00 ? 86  ALA A CA  1 
ATOM   643  C C   . ALA A 1 86  ? -20.793 -14.089 79.708 1.00 15.00 ? 86  ALA A C   1 
ATOM   644  O O   . ALA A 1 86  ? -19.612 -14.215 80.042 1.00 15.00 ? 86  ALA A O   1 
ATOM   645  C CB  . ALA A 1 86  ? -21.948 -15.447 81.494 1.00 15.00 ? 86  ALA A CB  1 
ATOM   646  N N   . TYR A 1 87  ? -21.164 -13.977 78.437 1.00 15.00 ? 87  TYR A N   1 
ATOM   647  C CA  . TYR A 1 87  ? -20.181 -13.990 77.356 1.00 15.00 ? 87  TYR A CA  1 
ATOM   648  C C   . TYR A 1 87  ? -20.897 -13.420 76.139 1.00 15.00 ? 87  TYR A C   1 
ATOM   649  O O   . TYR A 1 87  ? -21.253 -14.151 75.220 1.00 15.00 ? 87  TYR A O   1 
ATOM   650  C CB  . TYR A 1 87  ? -19.754 -15.441 77.091 1.00 15.00 ? 87  TYR A CB  1 
ATOM   651  C CG  . TYR A 1 87  ? -18.360 -15.669 76.519 1.00 15.00 ? 87  TYR A CG  1 
ATOM   652  C CD1 . TYR A 1 87  ? -17.818 -14.834 75.542 1.00 15.00 ? 87  TYR A CD1 1 
ATOM   653  C CD2 . TYR A 1 87  ? -17.602 -16.764 76.936 1.00 15.00 ? 87  TYR A CD2 1 
ATOM   654  C CE1 . TYR A 1 87  ? -16.551 -15.091 74.992 1.00 15.00 ? 87  TYR A CE1 1 
ATOM   655  C CE2 . TYR A 1 87  ? -16.344 -17.030 76.398 1.00 15.00 ? 87  TYR A CE2 1 
ATOM   656  C CZ  . TYR A 1 87  ? -15.821 -16.194 75.425 1.00 15.00 ? 87  TYR A CZ  1 
ATOM   657  O OH  . TYR A 1 87  ? -14.592 -16.487 74.881 1.00 15.00 ? 87  TYR A OH  1 
ATOM   658  N N   . PRO A 1 88  ? -21.086 -12.093 76.107 1.00 15.00 ? 88  PRO A N   1 
ATOM   659  C CA  . PRO A 1 88  ? -21.771 -11.424 75.000 1.00 15.00 ? 88  PRO A CA  1 
ATOM   660  C C   . PRO A 1 88  ? -21.134 -11.582 73.617 1.00 15.00 ? 88  PRO A C   1 
ATOM   661  O O   . PRO A 1 88  ? -19.918 -11.774 73.466 1.00 15.00 ? 88  PRO A O   1 
ATOM   662  C CB  . PRO A 1 88  ? -21.834 -9.967  75.470 1.00 15.00 ? 88  PRO A CB  1 
ATOM   663  C CG  . PRO A 1 88  ? -20.617 -9.822  76.277 1.00 15.00 ? 88  PRO A CG  1 
ATOM   664  C CD  . PRO A 1 88  ? -20.582 -11.102 77.076 1.00 15.00 ? 88  PRO A CD  1 
ATOM   665  N N   . TYR A 1 89  ? -21.980 -11.449 72.605 1.00 15.00 ? 89  TYR A N   1 
ATOM   666  C CA  . TYR A 1 89  ? -21.564 -11.585 71.223 1.00 15.00 ? 89  TYR A CA  1 
ATOM   667  C C   . TYR A 1 89  ? -20.910 -10.307 70.721 1.00 15.00 ? 89  TYR A C   1 
ATOM   668  O O   . TYR A 1 89  ? -21.451 -9.215  70.887 1.00 15.00 ? 89  TYR A O   1 
ATOM   669  C CB  . TYR A 1 89  ? -22.773 -11.926 70.347 1.00 15.00 ? 89  TYR A CB  1 
ATOM   670  C CG  . TYR A 1 89  ? -22.407 -12.263 68.917 1.00 15.00 ? 89  TYR A CG  1 
ATOM   671  C CD1 . TYR A 1 89  ? -21.667 -13.411 68.620 1.00 15.00 ? 89  TYR A CD1 1 
ATOM   672  C CD2 . TYR A 1 89  ? -22.777 -11.425 67.866 1.00 15.00 ? 89  TYR A CD2 1 
ATOM   673  C CE1 . TYR A 1 89  ? -21.301 -13.714 67.319 1.00 15.00 ? 89  TYR A CE1 1 
ATOM   674  C CE2 . TYR A 1 89  ? -22.415 -11.723 66.562 1.00 15.00 ? 89  TYR A CE2 1 
ATOM   675  C CZ  . TYR A 1 89  ? -21.676 -12.870 66.295 1.00 15.00 ? 89  TYR A CZ  1 
ATOM   676  O OH  . TYR A 1 89  ? -21.294 -13.154 65.010 1.00 15.00 ? 89  TYR A OH  1 
ATOM   677  N N   . VAL A 1 90  ? -19.734 -10.451 70.125 1.00 15.00 ? 90  VAL A N   1 
ATOM   678  C CA  . VAL A 1 90  ? -19.007 -9.314  69.576 1.00 15.00 ? 90  VAL A CA  1 
ATOM   679  C C   . VAL A 1 90  ? -18.875 -9.445  68.058 1.00 15.00 ? 90  VAL A C   1 
ATOM   680  O O   . VAL A 1 90  ? -18.503 -8.498  67.378 1.00 15.00 ? 90  VAL A O   1 
ATOM   681  C CB  . VAL A 1 90  ? -17.591 -9.142  70.228 1.00 15.00 ? 90  VAL A CB  1 
ATOM   682  C CG1 . VAL A 1 90  ? -17.712 -8.964  71.730 1.00 15.00 ? 90  VAL A CG1 1 
ATOM   683  C CG2 . VAL A 1 90  ? -16.688 -10.313 69.886 1.00 15.00 ? 90  VAL A CG2 1 
ATOM   684  N N   . GLY A 1 91  ? -19.171 -10.626 67.528 1.00 15.00 ? 91  GLY A N   1 
ATOM   685  C CA  . GLY A 1 91  ? -19.078 -10.822 66.092 1.00 15.00 ? 91  GLY A CA  1 
ATOM   686  C C   . GLY A 1 91  ? -17.668 -10.737 65.546 1.00 15.00 ? 91  GLY A C   1 
ATOM   687  O O   . GLY A 1 91  ? -17.444 -10.334 64.398 1.00 15.00 ? 91  GLY A O   1 
ATOM   688  N N   . GLN A 1 92  ? -16.714 -11.136 66.373 1.00 15.00 ? 92  GLN A N   1 
ATOM   689  C CA  . GLN A 1 92  ? -15.314 -11.115 65.995 1.00 15.00 ? 92  GLN A CA  1 
ATOM   690  C C   . GLN A 1 92  ? -14.596 -12.192 66.822 1.00 15.00 ? 92  GLN A C   1 
ATOM   691  O O   . GLN A 1 92  ? -15.024 -12.501 67.936 1.00 15.00 ? 92  GLN A O   1 
ATOM   692  C CB  . GLN A 1 92  ? -14.730 -9.719  66.262 1.00 15.00 ? 92  GLN A CB  1 
ATOM   693  C CG  . GLN A 1 92  ? -13.351 -9.495  65.647 1.00 15.00 ? 92  GLN A CG  1 
ATOM   694  C CD  . GLN A 1 92  ? -12.714 -8.193  66.078 1.00 15.00 ? 92  GLN A CD  1 
ATOM   695  O OE1 . GLN A 1 92  ? -12.197 -7.440  65.243 1.00 15.00 ? 92  GLN A OE1 1 
ATOM   696  N NE2 . GLN A 1 92  ? -12.729 -7.919  67.386 1.00 15.00 ? 92  GLN A NE2 1 
ATOM   697  N N   . GLU A 1 93  ? -13.539 -12.779 66.264 1.00 15.00 ? 93  GLU A N   1 
ATOM   698  C CA  . GLU A 1 93  ? -12.768 -13.825 66.938 1.00 15.00 ? 93  GLU A CA  1 
ATOM   699  C C   . GLU A 1 93  ? -11.921 -13.197 68.038 1.00 15.00 ? 93  GLU A C   1 
ATOM   700  O O   . GLU A 1 93  ? -11.312 -12.142 67.836 1.00 15.00 ? 93  GLU A O   1 
ATOM   701  C CB  . GLU A 1 93  ? -11.864 -14.556 65.943 1.00 15.00 ? 93  GLU A CB  1 
ATOM   702  C CG  . GLU A 1 93  ? -12.591 -15.026 64.683 1.00 15.00 ? 93  GLU A CG  1 
ATOM   703  C CD  . GLU A 1 93  ? -11.655 -15.501 63.566 1.00 15.00 ? 93  GLU A CD  1 
ATOM   704  O OE1 . GLU A 1 93  ? -10.574 -14.882 63.361 1.00 15.00 ? 93  GLU A OE1 1 
ATOM   705  O OE2 . GLU A 1 93  ? -12.021 -16.489 62.882 1.00 15.00 ? 93  GLU A OE2 1 
ATOM   706  N N   . GLU A 1 94  ? -11.904 -13.844 69.203 1.00 15.00 ? 94  GLU A N   1 
ATOM   707  C CA  . GLU A 1 94  ? -11.152 -13.379 70.361 1.00 15.00 ? 94  GLU A CA  1 
ATOM   708  C C   . GLU A 1 94  ? -10.698 -14.626 71.111 1.00 15.00 ? 94  GLU A C   1 
ATOM   709  O O   . GLU A 1 94  ? -11.126 -15.736 70.772 1.00 15.00 ? 94  GLU A O   1 
ATOM   710  C CB  . GLU A 1 94  ? -12.028 -12.490 71.250 1.00 15.00 ? 94  GLU A CB  1 
ATOM   711  C CG  . GLU A 1 94  ? -12.705 -11.362 70.478 1.00 15.00 ? 94  GLU A CG  1 
ATOM   712  C CD  . GLU A 1 94  ? -13.299 -10.281 71.347 1.00 15.00 ? 94  GLU A CD  1 
ATOM   713  O OE1 . GLU A 1 94  ? -13.810 -10.602 72.431 1.00 15.00 ? 94  GLU A OE1 1 
ATOM   714  O OE2 . GLU A 1 94  ? -13.268 -9.101  70.936 1.00 15.00 ? 94  GLU A OE2 1 
ATOM   715  N N   . SER A 1 95  ? -9.820  -14.460 72.096 1.00 15.00 ? 95  SER A N   1 
ATOM   716  C CA  . SER A 1 95  ? -9.320  -15.600 72.861 1.00 15.00 ? 95  SER A CA  1 
ATOM   717  C C   . SER A 1 95  ? -10.396 -16.215 73.742 1.00 15.00 ? 95  SER A C   1 
ATOM   718  O O   . SER A 1 95  ? -11.264 -15.506 74.258 1.00 15.00 ? 95  SER A O   1 
ATOM   719  C CB  . SER A 1 95  ? -8.129  -15.190 73.729 1.00 15.00 ? 95  SER A CB  1 
ATOM   720  O OG  . SER A 1 95  ? -8.457  -14.108 74.580 1.00 15.00 ? 95  SER A OG  1 
ATOM   721  N N   . CYS A 1 96  ? -10.313 -17.524 73.953 1.00 15.00 ? 96  CYS A N   1 
ATOM   722  C CA  . CYS A 1 96  ? -11.303 -18.202 74.777 1.00 15.00 ? 96  CYS A CA  1 
ATOM   723  C C   . CYS A 1 96  ? -11.281 -17.677 76.211 1.00 15.00 ? 96  CYS A C   1 
ATOM   724  O O   . CYS A 1 96  ? -10.253 -17.711 76.891 1.00 15.00 ? 96  CYS A O   1 
ATOM   725  C CB  . CYS A 1 96  ? -11.101 -19.719 74.739 1.00 15.00 ? 96  CYS A CB  1 
ATOM   726  S SG  . CYS A 1 96  ? -12.370 -20.663 75.649 1.00 15.00 ? 96  CYS A SG  1 
ATOM   727  N N   . MET A 1 97  ? -12.429 -17.179 76.656 1.00 15.00 ? 97  MET A N   1 
ATOM   728  C CA  . MET A 1 97  ? -12.571 -16.626 77.993 1.00 15.00 ? 97  MET A CA  1 
ATOM   729  C C   . MET A 1 97  ? -13.830 -17.227 78.620 1.00 15.00 ? 97  MET A C   1 
ATOM   730  O O   . MET A 1 97  ? -14.713 -16.500 79.078 1.00 15.00 ? 97  MET A O   1 
ATOM   731  C CB  . MET A 1 97  ? -12.713 -15.100 77.897 1.00 15.00 ? 97  MET A CB  1 
ATOM   732  C CG  . MET A 1 97  ? -12.324 -14.332 79.152 1.00 15.00 ? 97  MET A CG  1 
ATOM   733  S SD  . MET A 1 97  ? -10.527 -14.178 79.357 1.00 15.00 ? 97  MET A SD  1 
ATOM   734  C CE  . MET A 1 97  ? -10.230 -15.437 80.611 1.00 15.00 ? 97  MET A CE  1 
ATOM   735  N N   . TYR A 1 98  ? -13.951 -18.551 78.569 1.00 15.00 ? 98  TYR A N   1 
ATOM   736  C CA  . TYR A 1 98  ? -15.112 -19.235 79.140 1.00 15.00 ? 98  TYR A CA  1 
ATOM   737  C C   . TYR A 1 98  ? -15.164 -19.000 80.655 1.00 15.00 ? 98  TYR A C   1 
ATOM   738  O O   . TYR A 1 98  ? -14.216 -19.327 81.364 1.00 15.00 ? 98  TYR A O   1 
ATOM   739  C CB  . TYR A 1 98  ? -15.040 -20.741 78.855 1.00 15.00 ? 98  TYR A CB  1 
ATOM   740  C CG  . TYR A 1 98  ? -16.038 -21.572 79.650 1.00 15.00 ? 98  TYR A CG  1 
ATOM   741  C CD1 . TYR A 1 98  ? -17.411 -21.441 79.440 1.00 15.00 ? 98  TYR A CD1 1 
ATOM   742  C CD2 . TYR A 1 98  ? -15.604 -22.516 80.590 1.00 15.00 ? 98  TYR A CD2 1 
ATOM   743  C CE1 . TYR A 1 98  ? -18.322 -22.229 80.136 1.00 15.00 ? 98  TYR A CE1 1 
ATOM   744  C CE2 . TYR A 1 98  ? -16.512 -23.307 81.292 1.00 15.00 ? 98  TYR A CE2 1 
ATOM   745  C CZ  . TYR A 1 98  ? -17.869 -23.159 81.055 1.00 15.00 ? 98  TYR A CZ  1 
ATOM   746  O OH  . TYR A 1 98  ? -18.778 -23.952 81.706 1.00 15.00 ? 98  TYR A OH  1 
ATOM   747  N N   . ASN A 1 99  ? -16.233 -18.374 81.132 1.00 15.00 ? 99  ASN A N   1 
ATOM   748  C CA  . ASN A 1 99  ? -16.393 -18.120 82.557 1.00 15.00 ? 99  ASN A CA  1 
ATOM   749  C C   . ASN A 1 99  ? -17.184 -19.268 83.159 1.00 15.00 ? 99  ASN A C   1 
ATOM   750  O O   . ASN A 1 99  ? -18.384 -19.394 82.933 1.00 15.00 ? 99  ASN A O   1 
ATOM   751  C CB  . ASN A 1 99  ? -17.133 -16.809 82.807 1.00 15.00 ? 99  ASN A CB  1 
ATOM   752  C CG  . ASN A 1 99  ? -17.364 -16.539 84.298 1.00 15.00 ? 99  ASN A CG  1 
ATOM   753  O OD1 . ASN A 1 99  ? -17.385 -17.461 85.121 1.00 15.00 ? 99  ASN A OD1 1 
ATOM   754  N ND2 . ASN A 1 99  ? -17.537 -15.271 84.651 1.00 15.00 ? 99  ASN A ND2 1 
ATOM   755  N N   . PRO A 1 100 ? -16.526 -20.094 83.979 1.00 15.00 ? 100 PRO A N   1 
ATOM   756  C CA  . PRO A 1 100 ? -17.168 -21.242 84.625 1.00 15.00 ? 100 PRO A CA  1 
ATOM   757  C C   . PRO A 1 100 ? -18.427 -20.858 85.403 1.00 15.00 ? 100 PRO A C   1 
ATOM   758  O O   . PRO A 1 100 ? -19.409 -21.594 85.398 1.00 15.00 ? 100 PRO A O   1 
ATOM   759  C CB  . PRO A 1 100 ? -16.082 -21.754 85.574 1.00 15.00 ? 100 PRO A CB  1 
ATOM   760  C CG  . PRO A 1 100 ? -14.802 -21.333 84.891 1.00 15.00 ? 100 PRO A CG  1 
ATOM   761  C CD  . PRO A 1 100 ? -15.128 -19.947 84.421 1.00 15.00 ? 100 PRO A CD  1 
ATOM   762  N N   . THR A 1 101 ? -18.405 -19.693 86.044 1.00 15.00 ? 101 THR A N   1 
ATOM   763  C CA  . THR A 1 101 ? -19.539 -19.239 86.844 1.00 15.00 ? 101 THR A CA  1 
ATOM   764  C C   . THR A 1 101 ? -20.732 -18.682 86.076 1.00 15.00 ? 101 THR A C   1 
ATOM   765  O O   . THR A 1 101 ? -21.786 -18.434 86.664 1.00 15.00 ? 101 THR A O   1 
ATOM   766  C CB  . THR A 1 101 ? -19.092 -18.256 87.950 1.00 15.00 ? 101 THR A CB  1 
ATOM   767  O OG1 . THR A 1 101 ? -18.600 -17.044 87.367 1.00 15.00 ? 101 THR A OG1 1 
ATOM   768  C CG2 . THR A 1 101 ? -17.986 -18.898 88.790 1.00 15.00 ? 101 THR A CG2 1 
ATOM   769  N N   . GLY A 1 102 ? -20.573 -18.479 84.771 1.00 15.00 ? 102 GLY A N   1 
ATOM   770  C CA  . GLY A 1 102 ? -21.677 -17.985 83.968 1.00 15.00 ? 102 GLY A CA  1 
ATOM   771  C C   . GLY A 1 102 ? -22.305 -19.139 83.210 1.00 15.00 ? 102 GLY A C   1 
ATOM   772  O O   . GLY A 1 102 ? -23.133 -18.940 82.323 1.00 15.00 ? 102 GLY A O   1 
ATOM   773  N N   . LYS A 1 103 ? -21.878 -20.354 83.540 1.00 15.00 ? 103 LYS A N   1 
ATOM   774  C CA  . LYS A 1 103 ? -22.365 -21.572 82.900 1.00 15.00 ? 103 LYS A CA  1 
ATOM   775  C C   . LYS A 1 103 ? -23.888 -21.667 82.947 1.00 15.00 ? 103 LYS A C   1 
ATOM   776  O O   . LYS A 1 103 ? -24.498 -21.537 84.002 1.00 15.00 ? 103 LYS A O   1 
ATOM   777  C CB  . LYS A 1 103 ? -21.729 -22.789 83.575 1.00 15.00 ? 103 LYS A CB  1 
ATOM   778  C CG  . LYS A 1 103 ? -22.111 -24.134 82.983 1.00 15.00 ? 103 LYS A CG  1 
ATOM   779  C CD  . LYS A 1 103 ? -21.504 -25.255 83.805 1.00 15.00 ? 103 LYS A CD  1 
ATOM   780  C CE  . LYS A 1 103 ? -21.819 -25.074 85.285 1.00 15.00 ? 103 LYS A CE  1 
ATOM   781  N NZ  . LYS A 1 103 ? -21.218 -26.157 86.104 1.00 15.00 ? 103 LYS A NZ  1 
ATOM   782  N N   . ALA A 1 104 ? -24.499 -21.889 81.794 1.00 15.00 ? 104 ALA A N   1 
ATOM   783  C CA  . ALA A 1 104 ? -25.946 -21.970 81.722 1.00 15.00 ? 104 ALA A CA  1 
ATOM   784  C C   . ALA A 1 104 ? -26.445 -23.348 81.316 1.00 15.00 ? 104 ALA A C   1 
ATOM   785  O O   . ALA A 1 104 ? -27.631 -23.646 81.464 1.00 15.00 ? 104 ALA A O   1 
ATOM   786  C CB  . ALA A 1 104 ? -26.484 -20.901 80.771 1.00 15.00 ? 104 ALA A CB  1 
ATOM   787  N N   . ALA A 1 105 ? -25.550 -24.177 80.784 1.00 15.00 ? 105 ALA A N   1 
ATOM   788  C CA  . ALA A 1 105 ? -25.913 -25.528 80.362 1.00 15.00 ? 105 ALA A CA  1 
ATOM   789  C C   . ALA A 1 105 ? -24.697 -26.295 79.861 1.00 15.00 ? 105 ALA A C   1 
ATOM   790  O O   . ALA A 1 105 ? -23.556 -25.838 80.003 1.00 15.00 ? 105 ALA A O   1 
ATOM   791  C CB  . ALA A 1 105 ? -26.985 -25.481 79.274 1.00 15.00 ? 105 ALA A CB  1 
ATOM   792  N N   . LYS A 1 106 ? -24.955 -27.484 79.334 1.00 15.00 ? 106 LYS A N   1 
ATOM   793  C CA  . LYS A 1 106 ? -23.932 -28.364 78.783 1.00 15.00 ? 106 LYS A CA  1 
ATOM   794  C C   . LYS A 1 106 ? -24.704 -29.405 77.986 1.00 15.00 ? 106 LYS A C   1 
ATOM   795  O O   . LYS A 1 106 ? -25.895 -29.225 77.728 1.00 15.00 ? 106 LYS A O   1 
ATOM   796  C CB  . LYS A 1 106 ? -23.123 -29.053 79.902 1.00 15.00 ? 106 LYS A CB  1 
ATOM   797  C CG  . LYS A 1 106 ? -23.870 -30.116 80.696 1.00 15.00 ? 106 LYS A CG  1 
ATOM   798  C CD  . LYS A 1 106 ? -22.925 -30.928 81.556 1.00 15.00 ? 106 LYS A CD  1 
ATOM   799  C CE  . LYS A 1 106 ? -23.655 -31.736 82.652 1.00 15.00 ? 106 LYS A CE  1 
ATOM   800  N NZ  . LYS A 1 106 ? -24.383 -32.971 82.212 1.00 15.00 ? 106 LYS A NZ  1 
ATOM   801  N N   . CYS A 1 107 ? -24.027 -30.467 77.570 1.00 15.00 ? 107 CYS A N   1 
ATOM   802  C CA  . CYS A 1 107 ? -24.668 -31.554 76.850 1.00 15.00 ? 107 CYS A CA  1 
ATOM   803  C C   . CYS A 1 107 ? -23.772 -32.775 76.947 1.00 15.00 ? 107 CYS A C   1 
ATOM   804  O O   . CYS A 1 107 ? -22.601 -32.672 77.310 1.00 15.00 ? 107 CYS A O   1 
ATOM   805  C CB  . CYS A 1 107 ? -24.965 -31.179 75.390 1.00 15.00 ? 107 CYS A CB  1 
ATOM   806  S SG  . CYS A 1 107 ? -23.566 -31.176 74.257 1.00 15.00 ? 107 CYS A SG  1 
ATOM   807  N N   . ARG A 1 108 ? -24.349 -33.940 76.705 1.00 15.00 ? 108 ARG A N   1 
ATOM   808  C CA  . ARG A 1 108 ? -23.620 -35.189 76.775 1.00 15.00 ? 108 ARG A CA  1 
ATOM   809  C C   . ARG A 1 108 ? -23.518 -35.877 75.417 1.00 15.00 ? 108 ARG A C   1 
ATOM   810  O O   . ARG A 1 108 ? -23.754 -37.080 75.294 1.00 15.00 ? 108 ARG A O   1 
ATOM   811  C CB  . ARG A 1 108 ? -24.297 -36.096 77.796 1.00 15.00 ? 108 ARG A CB  1 
ATOM   812  C CG  . ARG A 1 108 ? -24.560 -35.388 79.128 1.00 15.00 ? 108 ARG A CG  1 
ATOM   813  C CD  . ARG A 1 108 ? -24.782 -36.374 80.245 1.00 15.00 ? 108 ARG A CD  1 
ATOM   814  N NE  . ARG A 1 108 ? -26.076 -37.035 80.165 1.00 15.00 ? 108 ARG A NE  1 
ATOM   815  C CZ  . ARG A 1 108 ? -26.311 -38.288 80.545 1.00 15.00 ? 108 ARG A CZ  1 
ATOM   816  N NH1 . ARG A 1 108 ? -25.338 -39.048 81.029 1.00 15.00 ? 108 ARG A NH1 1 
ATOM   817  N NH2 . ARG A 1 108 ? -27.546 -38.765 80.476 1.00 15.00 ? 108 ARG A NH2 1 
ATOM   818  N N   . GLY A 1 109 ? -23.147 -35.107 74.400 1.00 15.00 ? 109 GLY A N   1 
ATOM   819  C CA  . GLY A 1 109 ? -23.009 -35.657 73.066 1.00 15.00 ? 109 GLY A CA  1 
ATOM   820  C C   . GLY A 1 109 ? -23.963 -35.039 72.058 1.00 15.00 ? 109 GLY A C   1 
ATOM   821  O O   . GLY A 1 109 ? -24.534 -33.973 72.302 1.00 15.00 ? 109 GLY A O   1 
ATOM   822  N N   . TYR A 1 110 ? -24.116 -35.713 70.923 1.00 15.00 ? 110 TYR A N   1 
ATOM   823  C CA  . TYR A 1 110 ? -24.989 -35.261 69.851 1.00 15.00 ? 110 TYR A CA  1 
ATOM   824  C C   . TYR A 1 110 ? -25.408 -36.439 68.981 1.00 15.00 ? 110 TYR A C   1 
ATOM   825  O O   . TYR A 1 110 ? -24.810 -37.516 69.040 1.00 15.00 ? 110 TYR A O   1 
ATOM   826  C CB  . TYR A 1 110 ? -24.281 -34.213 68.987 1.00 15.00 ? 110 TYR A CB  1 
ATOM   827  C CG  . TYR A 1 110 ? -23.060 -34.725 68.242 1.00 15.00 ? 110 TYR A CG  1 
ATOM   828  C CD1 . TYR A 1 110 ? -23.194 -35.482 67.078 1.00 15.00 ? 110 TYR A CD1 1 
ATOM   829  C CD2 . TYR A 1 110 ? -21.772 -34.396 68.667 1.00 15.00 ? 110 TYR A CD2 1 
ATOM   830  C CE1 . TYR A 1 110 ? -22.084 -35.894 66.354 1.00 15.00 ? 110 TYR A CE1 1 
ATOM   831  C CE2 . TYR A 1 110 ? -20.648 -34.797 67.942 1.00 15.00 ? 110 TYR A CE2 1 
ATOM   832  C CZ  . TYR A 1 110 ? -20.808 -35.542 66.787 1.00 15.00 ? 110 TYR A CZ  1 
ATOM   833  O OH  . TYR A 1 110 ? -19.706 -35.905 66.034 1.00 15.00 ? 110 TYR A OH  1 
ATOM   834  N N   . ARG A 1 111 ? -26.389 -36.200 68.120 1.00 15.00 ? 111 ARG A N   1 
ATOM   835  C CA  . ARG A 1 111 ? -26.909 -37.226 67.232 1.00 15.00 ? 111 ARG A CA  1 
ATOM   836  C C   . ARG A 1 111 ? -27.133 -36.598 65.851 1.00 15.00 ? 111 ARG A C   1 
ATOM   837  O O   . ARG A 1 111 ? -27.702 -35.509 65.740 1.00 15.00 ? 111 ARG A O   1 
ATOM   838  C CB  . ARG A 1 111 ? -28.220 -37.780 67.826 1.00 15.00 ? 111 ARG A CB  1 
ATOM   839  C CG  . ARG A 1 111 ? -28.856 -38.967 67.106 1.00 15.00 ? 111 ARG A CG  1 
ATOM   840  C CD  . ARG A 1 111 ? -29.480 -38.539 65.780 1.00 15.00 ? 111 ARG A CD  1 
ATOM   841  N NE  . ARG A 1 111 ? -30.337 -39.561 65.172 1.00 15.00 ? 111 ARG A NE  1 
ATOM   842  C CZ  . ARG A 1 111 ? -31.138 -39.336 64.132 1.00 15.00 ? 111 ARG A CZ  1 
ATOM   843  N NH1 . ARG A 1 111 ? -31.186 -38.128 63.576 1.00 15.00 ? 111 ARG A NH1 1 
ATOM   844  N NH2 . ARG A 1 111 ? -31.924 -40.305 63.677 1.00 15.00 ? 111 ARG A NH2 1 
ATOM   845  N N   . GLU A 1 112 ? -26.673 -37.290 64.809 1.00 15.00 ? 112 GLU A N   1 
ATOM   846  C CA  . GLU A 1 112 ? -26.815 -36.820 63.434 1.00 15.00 ? 112 GLU A CA  1 
ATOM   847  C C   . GLU A 1 112 ? -27.991 -37.516 62.760 1.00 15.00 ? 112 GLU A C   1 
ATOM   848  O O   . GLU A 1 112 ? -28.306 -38.667 63.075 1.00 15.00 ? 112 GLU A O   1 
ATOM   849  C CB  . GLU A 1 112 ? -25.525 -37.088 62.645 1.00 15.00 ? 112 GLU A CB  1 
ATOM   850  C CG  . GLU A 1 112 ? -24.303 -36.392 63.225 1.00 15.00 ? 112 GLU A CG  1 
ATOM   851  C CD  . GLU A 1 112 ? -23.023 -36.619 62.424 1.00 15.00 ? 112 GLU A CD  1 
ATOM   852  O OE1 . GLU A 1 112 ? -22.422 -37.704 62.555 1.00 15.00 ? 112 GLU A OE1 1 
ATOM   853  O OE2 . GLU A 1 112 ? -22.597 -35.698 61.686 1.00 15.00 ? 112 GLU A OE2 1 
ATOM   854  N N   . ILE A 1 113 ? -28.655 -36.804 61.854 1.00 15.00 ? 113 ILE A N   1 
ATOM   855  C CA  . ILE A 1 113 ? -29.792 -37.347 61.111 1.00 15.00 ? 113 ILE A CA  1 
ATOM   856  C C   . ILE A 1 113 ? -29.262 -38.072 59.866 1.00 15.00 ? 113 ILE A C   1 
ATOM   857  O O   . ILE A 1 113 ? -28.260 -37.645 59.272 1.00 15.00 ? 113 ILE A O   1 
ATOM   858  C CB  . ILE A 1 113 ? -30.771 -36.213 60.692 1.00 15.00 ? 113 ILE A CB  1 
ATOM   859  C CG1 . ILE A 1 113 ? -31.621 -35.766 61.890 1.00 15.00 ? 113 ILE A CG1 1 
ATOM   860  C CG2 . ILE A 1 113 ? -31.674 -36.666 59.556 1.00 15.00 ? 113 ILE A CG2 1 
ATOM   861  C CD1 . ILE A 1 113 ? -30.838 -35.233 63.065 1.00 15.00 ? 113 ILE A CD1 1 
ATOM   862  N N   . PRO A 1 114 ? -29.882 -39.210 59.488 1.00 15.00 ? 114 PRO A N   1 
ATOM   863  C CA  . PRO A 1 114 ? -29.385 -39.904 58.295 1.00 15.00 ? 114 PRO A CA  1 
ATOM   864  C C   . PRO A 1 114 ? -29.359 -38.888 57.146 1.00 15.00 ? 114 PRO A C   1 
ATOM   865  O O   . PRO A 1 114 ? -30.365 -38.222 56.866 1.00 15.00 ? 114 PRO A O   1 
ATOM   866  C CB  . PRO A 1 114 ? -30.432 -41.002 58.080 1.00 15.00 ? 114 PRO A CB  1 
ATOM   867  C CG  . PRO A 1 114 ? -30.911 -41.303 59.464 1.00 15.00 ? 114 PRO A CG  1 
ATOM   868  C CD  . PRO A 1 114 ? -31.023 -39.928 60.088 1.00 15.00 ? 114 PRO A CD  1 
ATOM   869  N N   . GLU A 1 115 ? -28.178 -38.703 56.566 1.00 15.00 ? 115 GLU A N   1 
ATOM   870  C CA  . GLU A 1 115 ? -27.973 -37.749 55.487 1.00 15.00 ? 115 GLU A CA  1 
ATOM   871  C C   . GLU A 1 115 ? -28.986 -37.889 54.354 1.00 15.00 ? 115 GLU A C   1 
ATOM   872  O O   . GLU A 1 115 ? -29.143 -38.966 53.792 1.00 15.00 ? 115 GLU A O   1 
ATOM   873  C CB  . GLU A 1 115 ? -26.549 -37.893 54.961 1.00 15.00 ? 115 GLU A CB  1 
ATOM   874  C CG  . GLU A 1 115 ? -26.246 -37.138 53.693 1.00 15.00 ? 115 GLU A CG  1 
ATOM   875  C CD  . GLU A 1 115 ? -24.980 -37.656 53.036 1.00 15.00 ? 115 GLU A CD  1 
ATOM   876  O OE1 . GLU A 1 115 ? -23.886 -37.365 53.580 1.00 15.00 ? 115 GLU A OE1 1 
ATOM   877  O OE2 . GLU A 1 115 ? -25.079 -38.378 52.009 1.00 15.00 ? 115 GLU A OE2 1 
ATOM   878  N N   . GLY A 1 116 ? -29.658 -36.784 54.035 1.00 15.00 ? 116 GLY A N   1 
ATOM   879  C CA  . GLY A 1 116 ? -30.661 -36.761 52.978 1.00 15.00 ? 116 GLY A CA  1 
ATOM   880  C C   . GLY A 1 116 ? -32.046 -37.272 53.370 1.00 15.00 ? 116 GLY A C   1 
ATOM   881  O O   . GLY A 1 116 ? -33.001 -37.161 52.589 1.00 15.00 ? 116 GLY A O   1 
ATOM   882  N N   . ASN A 1 117 ? -32.172 -37.769 54.598 1.00 15.00 ? 117 ASN A N   1 
ATOM   883  C CA  . ASN A 1 117 ? -33.427 -38.318 55.090 1.00 15.00 ? 117 ASN A CA  1 
ATOM   884  C C   . ASN A 1 117 ? -34.361 -37.284 55.717 1.00 15.00 ? 117 ASN A C   1 
ATOM   885  O O   . ASN A 1 117 ? -34.341 -37.096 56.934 1.00 15.00 ? 117 ASN A O   1 
ATOM   886  C CB  . ASN A 1 117 ? -33.137 -39.425 56.109 1.00 15.00 ? 117 ASN A CB  1 
ATOM   887  C CG  . ASN A 1 117 ? -34.246 -40.465 56.178 1.00 15.00 ? 117 ASN A CG  1 
ATOM   888  O OD1 . ASN A 1 117 ? -35.395 -40.189 55.833 1.00 15.00 ? 117 ASN A OD1 1 
ATOM   889  N ND2 . ASN A 1 117 ? -33.907 -41.668 56.640 1.00 15.00 ? 117 ASN A ND2 1 
ATOM   890  N N   . GLU A 1 118 ? -35.193 -36.642 54.889 1.00 15.00 ? 118 GLU A N   1 
ATOM   891  C CA  . GLU A 1 118 ? -36.163 -35.639 55.359 1.00 15.00 ? 118 GLU A CA  1 
ATOM   892  C C   . GLU A 1 118 ? -37.213 -36.245 56.296 1.00 15.00 ? 118 GLU A C   1 
ATOM   893  O O   . GLU A 1 118 ? -37.724 -35.570 57.194 1.00 15.00 ? 118 GLU A O   1 
ATOM   894  C CB  . GLU A 1 118 ? -36.857 -34.939 54.192 1.00 15.00 ? 118 GLU A CB  1 
ATOM   895  C CG  . GLU A 1 118 ? -36.011 -33.880 53.496 1.00 15.00 ? 118 GLU A CG  1 
ATOM   896  C CD  . GLU A 1 118 ? -36.832 -32.977 52.600 1.00 15.00 ? 118 GLU A CD  1 
ATOM   897  O OE1 . GLU A 1 118 ? -37.369 -31.972 53.108 1.00 15.00 ? 118 GLU A OE1 1 
ATOM   898  O OE2 . GLU A 1 118 ? -36.943 -33.266 51.389 1.00 15.00 ? 118 GLU A OE2 1 
ATOM   899  N N   . LYS A 1 119 ? -37.526 -37.519 56.083 1.00 15.00 ? 119 LYS A N   1 
ATOM   900  C CA  . LYS A 1 119 ? -38.466 -38.234 56.930 1.00 15.00 ? 119 LYS A CA  1 
ATOM   901  C C   . LYS A 1 119 ? -37.912 -38.289 58.364 1.00 15.00 ? 119 LYS A C   1 
ATOM   902  O O   . LYS A 1 119 ? -38.581 -37.893 59.323 1.00 15.00 ? 119 LYS A O   1 
ATOM   903  C CB  . LYS A 1 119 ? -38.642 -39.663 56.411 1.00 15.00 ? 119 LYS A CB  1 
ATOM   904  C CG  . LYS A 1 119 ? -39.731 -39.829 55.383 1.00 15.00 ? 119 LYS A CG  1 
ATOM   905  C CD  . LYS A 1 119 ? -39.533 -41.099 54.578 1.00 15.00 ? 119 LYS A CD  1 
ATOM   906  C CE  . LYS A 1 119 ? -38.514 -40.882 53.457 1.00 15.00 ? 119 LYS A CE  1 
ATOM   907  N NZ  . LYS A 1 119 ? -38.969 -39.825 52.484 1.00 15.00 ? 119 LYS A NZ  1 
ATOM   908  N N   . ALA A 1 120 ? -36.699 -38.814 58.507 1.00 15.00 ? 120 ALA A N   1 
ATOM   909  C CA  . ALA A 1 120 ? -36.061 -38.925 59.807 1.00 15.00 ? 120 ALA A CA  1 
ATOM   910  C C   . ALA A 1 120 ? -35.909 -37.544 60.405 1.00 15.00 ? 120 ALA A C   1 
ATOM   911  O O   . ALA A 1 120 ? -36.064 -37.381 61.611 1.00 15.00 ? 120 ALA A O   1 
ATOM   912  C CB  . ALA A 1 120 ? -34.714 -39.601 59.682 1.00 15.00 ? 120 ALA A CB  1 
ATOM   913  N N   . LEU A 1 121 ? -35.631 -36.547 59.565 1.00 15.00 ? 121 LEU A N   1 
ATOM   914  C CA  . LEU A 1 121 ? -35.484 -35.170 60.046 1.00 15.00 ? 121 LEU A CA  1 
ATOM   915  C C   . LEU A 1 121 ? -36.782 -34.710 60.722 1.00 15.00 ? 121 LEU A C   1 
ATOM   916  O O   . LEU A 1 121 ? -36.752 -34.173 61.834 1.00 15.00 ? 121 LEU A O   1 
ATOM   917  C CB  . LEU A 1 121 ? -35.114 -34.213 58.904 1.00 15.00 ? 121 LEU A CB  1 
ATOM   918  C CG  . LEU A 1 121 ? -34.865 -32.753 59.330 1.00 15.00 ? 121 LEU A CG  1 
ATOM   919  C CD1 . LEU A 1 121 ? -33.739 -32.690 60.377 1.00 15.00 ? 121 LEU A CD1 1 
ATOM   920  C CD2 . LEU A 1 121 ? -34.533 -31.879 58.117 1.00 15.00 ? 121 LEU A CD2 1 
ATOM   921  N N   . LYS A 1 122 ? -37.909 -34.942 60.047 1.00 15.00 ? 122 LYS A N   1 
ATOM   922  C CA  . LYS A 1 122 ? -39.225 -34.585 60.565 1.00 15.00 ? 122 LYS A CA  1 
ATOM   923  C C   . LYS A 1 122 ? -39.444 -35.321 61.879 1.00 15.00 ? 122 LYS A C   1 
ATOM   924  O O   . LYS A 1 122 ? -39.881 -34.736 62.874 1.00 15.00 ? 122 LYS A O   1 
ATOM   925  C CB  . LYS A 1 122 ? -40.315 -35.016 59.577 1.00 15.00 ? 122 LYS A CB  1 
ATOM   926  C CG  . LYS A 1 122 ? -41.738 -34.910 60.119 1.00 15.00 ? 122 LYS A CG  1 
ATOM   927  C CD  . LYS A 1 122 ? -42.717 -35.572 59.169 1.00 15.00 ? 122 LYS A CD  1 
ATOM   928  C CE  . LYS A 1 122 ? -44.112 -35.672 59.764 1.00 15.00 ? 122 LYS A CE  1 
ATOM   929  N NZ  . LYS A 1 122 ? -45.100 -36.142 58.741 1.00 15.00 ? 122 LYS A NZ  1 
ATOM   930  N N   . ARG A 1 123 ? -39.140 -36.612 61.859 1.00 15.00 ? 123 ARG A N   1 
ATOM   931  C CA  . ARG A 1 123 ? -39.280 -37.458 63.030 1.00 15.00 ? 123 ARG A CA  1 
ATOM   932  C C   . ARG A 1 123 ? -38.460 -36.880 64.186 1.00 15.00 ? 123 ARG A C   1 
ATOM   933  O O   . ARG A 1 123 ? -38.927 -36.843 65.323 1.00 15.00 ? 123 ARG A O   1 
ATOM   934  C CB  . ARG A 1 123 ? -38.801 -38.871 62.696 1.00 15.00 ? 123 ARG A CB  1 
ATOM   935  C CG  . ARG A 1 123 ? -38.845 -39.869 63.861 1.00 15.00 ? 123 ARG A CG  1 
ATOM   936  C CD  . ARG A 1 123 ? -37.703 -40.885 63.768 1.00 15.00 ? 123 ARG A CD  1 
ATOM   937  N NE  . ARG A 1 123 ? -37.373 -41.200 62.378 1.00 15.00 ? 123 ARG A NE  1 
ATOM   938  C CZ  . ARG A 1 123 ? -36.783 -42.321 61.980 1.00 15.00 ? 123 ARG A CZ  1 
ATOM   939  N NH1 . ARG A 1 123 ? -36.449 -43.251 62.867 1.00 15.00 ? 123 ARG A NH1 1 
ATOM   940  N NH2 . ARG A 1 123 ? -36.535 -42.510 60.687 1.00 15.00 ? 123 ARG A NH2 1 
ATOM   941  N N   . ALA A 1 124 ? -37.247 -36.420 63.886 1.00 15.00 ? 124 ALA A N   1 
ATOM   942  C CA  . ALA A 1 124 ? -36.370 -35.838 64.903 1.00 15.00 ? 124 ALA A CA  1 
ATOM   943  C C   . ALA A 1 124 ? -36.949 -34.534 65.449 1.00 15.00 ? 124 ALA A C   1 
ATOM   944  O O   . ALA A 1 124 ? -37.020 -34.333 66.664 1.00 15.00 ? 124 ALA A O   1 
ATOM   945  C CB  . ALA A 1 124 ? -34.978 -35.613 64.346 1.00 15.00 ? 124 ALA A CB  1 
ATOM   946  N N   . VAL A 1 125 ? -37.412 -33.663 64.567 1.00 15.00 ? 125 VAL A N   1 
ATOM   947  C CA  . VAL A 1 125 ? -37.992 -32.410 65.030 1.00 15.00 ? 125 VAL A CA  1 
ATOM   948  C C   . VAL A 1 125 ? -39.228 -32.652 65.892 1.00 15.00 ? 125 VAL A C   1 
ATOM   949  O O   . VAL A 1 125 ? -39.456 -31.940 66.873 1.00 15.00 ? 125 VAL A O   1 
ATOM   950  C CB  . VAL A 1 125 ? -38.349 -31.479 63.867 1.00 15.00 ? 125 VAL A CB  1 
ATOM   951  C CG1 . VAL A 1 125 ? -38.983 -30.186 64.393 1.00 15.00 ? 125 VAL A CG1 1 
ATOM   952  C CG2 . VAL A 1 125 ? -37.090 -31.166 63.057 1.00 15.00 ? 125 VAL A CG2 1 
ATOM   953  N N   . ALA A 1 126 ? -40.005 -33.669 65.527 1.00 15.00 ? 126 ALA A N   1 
ATOM   954  C CA  . ALA A 1 126 ? -41.220 -34.027 66.251 1.00 15.00 ? 126 ALA A CA  1 
ATOM   955  C C   . ALA A 1 126 ? -40.893 -34.610 67.623 1.00 15.00 ? 126 ALA A C   1 
ATOM   956  O O   . ALA A 1 126 ? -41.399 -34.144 68.642 1.00 15.00 ? 126 ALA A O   1 
ATOM   957  C CB  . ALA A 1 126 ? -42.035 -35.023 65.439 1.00 15.00 ? 126 ALA A CB  1 
ATOM   958  N N   . ARG A 1 127 ? -40.034 -35.620 67.635 1.00 15.00 ? 127 ARG A N   1 
ATOM   959  C CA  . ARG A 1 127 ? -39.613 -36.292 68.858 1.00 15.00 ? 127 ARG A CA  1 
ATOM   960  C C   . ARG A 1 127 ? -38.746 -35.472 69.825 1.00 15.00 ? 127 ARG A C   1 
ATOM   961  O O   . ARG A 1 127 ? -39.053 -35.360 71.011 1.00 15.00 ? 127 ARG A O   1 
ATOM   962  C CB  . ARG A 1 127 ? -38.828 -37.544 68.479 1.00 15.00 ? 127 ARG A CB  1 
ATOM   963  C CG  . ARG A 1 127 ? -38.449 -38.443 69.642 1.00 15.00 ? 127 ARG A CG  1 
ATOM   964  C CD  . ARG A 1 127 ? -39.626 -39.276 70.133 1.00 15.00 ? 127 ARG A CD  1 
ATOM   965  N NE  . ARG A 1 127 ? -40.148 -40.180 69.103 1.00 15.00 ? 127 ARG A NE  1 
ATOM   966  C CZ  . ARG A 1 127 ? -41.183 -39.899 68.313 1.00 15.00 ? 127 ARG A CZ  1 
ATOM   967  N NH1 . ARG A 1 127 ? -41.811 -38.729 68.425 1.00 15.00 ? 127 ARG A NH1 1 
ATOM   968  N NH2 . ARG A 1 127 ? -41.590 -40.784 67.407 1.00 15.00 ? 127 ARG A NH2 1 
ATOM   969  N N   . VAL A 1 128 ? -37.640 -34.941 69.312 1.00 15.00 ? 128 VAL A N   1 
ATOM   970  C CA  . VAL A 1 128 ? -36.657 -34.213 70.114 1.00 15.00 ? 128 VAL A CA  1 
ATOM   971  C C   . VAL A 1 128 ? -36.823 -32.702 70.259 1.00 15.00 ? 128 VAL A C   1 
ATOM   972  O O   . VAL A 1 128 ? -36.731 -32.168 71.362 1.00 15.00 ? 128 VAL A O   1 
ATOM   973  C CB  . VAL A 1 128 ? -35.227 -34.536 69.588 1.00 15.00 ? 128 VAL A CB  1 
ATOM   974  C CG1 . VAL A 1 128 ? -34.166 -33.718 70.317 1.00 15.00 ? 128 VAL A CG1 1 
ATOM   975  C CG2 . VAL A 1 128 ? -34.946 -36.024 69.738 1.00 15.00 ? 128 VAL A CG2 1 
ATOM   976  N N   . GLY A 1 129 ? -37.002 -32.006 69.145 1.00 15.00 ? 129 GLY A N   1 
ATOM   977  C CA  . GLY A 1 129 ? -37.157 -30.561 69.197 1.00 15.00 ? 129 GLY A CA  1 
ATOM   978  C C   . GLY A 1 129 ? -36.362 -29.910 68.083 1.00 15.00 ? 129 GLY A C   1 
ATOM   979  O O   . GLY A 1 129 ? -35.890 -30.618 67.180 1.00 15.00 ? 129 GLY A O   1 
ATOM   980  N N   . PRO A 1 130 ? -36.194 -28.571 68.107 1.00 15.00 ? 130 PRO A N   1 
ATOM   981  C CA  . PRO A 1 130 ? -35.445 -27.828 67.086 1.00 15.00 ? 130 PRO A CA  1 
ATOM   982  C C   . PRO A 1 130 ? -34.135 -28.522 66.741 1.00 15.00 ? 130 PRO A C   1 
ATOM   983  O O   . PRO A 1 130 ? -33.373 -28.907 67.627 1.00 15.00 ? 130 PRO A O   1 
ATOM   984  C CB  . PRO A 1 130 ? -35.230 -26.472 67.743 1.00 15.00 ? 130 PRO A CB  1 
ATOM   985  C CG  . PRO A 1 130 ? -36.514 -26.299 68.519 1.00 15.00 ? 130 PRO A CG  1 
ATOM   986  C CD  . PRO A 1 130 ? -36.664 -27.662 69.170 1.00 15.00 ? 130 PRO A CD  1 
ATOM   987  N N   . VAL A 1 131 ? -33.904 -28.716 65.452 1.00 15.00 ? 131 VAL A N   1 
ATOM   988  C CA  . VAL A 1 131 ? -32.712 -29.402 64.973 1.00 15.00 ? 131 VAL A CA  1 
ATOM   989  C C   . VAL A 1 131 ? -31.822 -28.489 64.130 1.00 15.00 ? 131 VAL A C   1 
ATOM   990  O O   . VAL A 1 131 ? -32.320 -27.687 63.337 1.00 15.00 ? 131 VAL A O   1 
ATOM   991  C CB  . VAL A 1 131 ? -33.133 -30.651 64.151 1.00 15.00 ? 131 VAL A CB  1 
ATOM   992  C CG1 . VAL A 1 131 ? -31.927 -31.355 63.569 1.00 15.00 ? 131 VAL A CG1 1 
ATOM   993  C CG2 . VAL A 1 131 ? -33.916 -31.607 65.029 1.00 15.00 ? 131 VAL A CG2 1 
ATOM   994  N N   . SER A 1 132 ? -30.510 -28.594 64.316 1.00 15.00 ? 132 SER A N   1 
ATOM   995  C CA  . SER A 1 132 ? -29.559 -27.792 63.554 1.00 15.00 ? 132 SER A CA  1 
ATOM   996  C C   . SER A 1 132 ? -29.443 -28.368 62.136 1.00 15.00 ? 132 SER A C   1 
ATOM   997  O O   . SER A 1 132 ? -29.406 -29.588 61.957 1.00 15.00 ? 132 SER A O   1 
ATOM   998  C CB  . SER A 1 132 ? -28.177 -27.829 64.217 1.00 15.00 ? 132 SER A CB  1 
ATOM   999  O OG  . SER A 1 132 ? -28.205 -27.336 65.546 1.00 15.00 ? 132 SER A OG  1 
ATOM   1000 N N   . VAL A 1 133 ? -29.386 -27.498 61.134 1.00 15.00 ? 133 VAL A N   1 
ATOM   1001 C CA  . VAL A 1 133 ? -29.253 -27.941 59.752 1.00 15.00 ? 133 VAL A CA  1 
ATOM   1002 C C   . VAL A 1 133 ? -28.368 -27.000 58.938 1.00 15.00 ? 133 VAL A C   1 
ATOM   1003 O O   . VAL A 1 133 ? -28.116 -25.871 59.342 1.00 15.00 ? 133 VAL A O   1 
ATOM   1004 C CB  . VAL A 1 133 ? -30.631 -28.067 59.031 1.00 15.00 ? 133 VAL A CB  1 
ATOM   1005 C CG1 . VAL A 1 133 ? -31.400 -29.287 59.532 1.00 15.00 ? 133 VAL A CG1 1 
ATOM   1006 C CG2 . VAL A 1 133 ? -31.445 -26.797 59.196 1.00 15.00 ? 133 VAL A CG2 1 
ATOM   1007 N N   . ALA A 1 134 ? -27.859 -27.503 57.817 1.00 15.00 ? 134 ALA A N   1 
ATOM   1008 C CA  . ALA A 1 134 ? -27.027 -26.725 56.907 1.00 15.00 ? 134 ALA A CA  1 
ATOM   1009 C C   . ALA A 1 134 ? -27.754 -26.733 55.573 1.00 15.00 ? 134 ALA A C   1 
ATOM   1010 O O   . ALA A 1 134 ? -28.289 -27.759 55.139 1.00 15.00 ? 134 ALA A O   1 
ATOM   1011 C CB  . ALA A 1 134 ? -25.653 -27.344 56.762 1.00 15.00 ? 134 ALA A CB  1 
ATOM   1012 N N   . ILE A 1 135 ? -27.803 -25.576 54.935 1.00 15.00 ? 135 ILE A N   1 
ATOM   1013 C CA  . ILE A 1 135 ? -28.490 -25.448 53.659 1.00 15.00 ? 135 ILE A CA  1 
ATOM   1014 C C   . ILE A 1 135 ? -27.636 -24.615 52.731 1.00 15.00 ? 135 ILE A C   1 
ATOM   1015 O O   . ILE A 1 135 ? -26.591 -24.092 53.135 1.00 15.00 ? 135 ILE A O   1 
ATOM   1016 C CB  . ILE A 1 135 ? -29.816 -24.676 53.819 1.00 15.00 ? 135 ILE A CB  1 
ATOM   1017 C CG1 . ILE A 1 135 ? -29.518 -23.279 54.377 1.00 15.00 ? 135 ILE A CG1 1 
ATOM   1018 C CG2 . ILE A 1 135 ? -30.798 -25.448 54.697 1.00 15.00 ? 135 ILE A CG2 1 
ATOM   1019 C CD1 . ILE A 1 135 ? -30.720 -22.397 54.524 1.00 15.00 ? 135 ILE A CD1 1 
ATOM   1020 N N   . ASP A 1 136 ? -28.093 -24.493 51.490 1.00 15.00 ? 136 ASP A N   1 
ATOM   1021 C CA  . ASP A 1 136 ? -27.422 -23.663 50.510 1.00 15.00 ? 136 ASP A CA  1 
ATOM   1022 C C   . ASP A 1 136 ? -28.194 -22.355 50.538 1.00 15.00 ? 136 ASP A C   1 
ATOM   1023 O O   . ASP A 1 136 ? -29.343 -22.294 50.104 1.00 15.00 ? 136 ASP A O   1 
ATOM   1024 C CB  . ASP A 1 136 ? -27.495 -24.281 49.112 1.00 15.00 ? 136 ASP A CB  1 
ATOM   1025 C CG  . ASP A 1 136 ? -27.019 -23.323 48.019 1.00 15.00 ? 136 ASP A CG  1 
ATOM   1026 O OD1 . ASP A 1 136 ? -26.221 -22.401 48.294 1.00 15.00 ? 136 ASP A OD1 1 
ATOM   1027 O OD2 . ASP A 1 136 ? -27.462 -23.490 46.881 1.00 15.00 ? 136 ASP A OD2 1 
ATOM   1028 N N   . ALA A 1 137 ? -27.577 -21.330 51.106 1.00 15.00 ? 137 ALA A N   1 
ATOM   1029 C CA  . ALA A 1 137 ? -28.192 -20.019 51.209 1.00 15.00 ? 137 ALA A CA  1 
ATOM   1030 C C   . ALA A 1 137 ? -27.471 -19.037 50.305 1.00 15.00 ? 137 ALA A C   1 
ATOM   1031 O O   . ALA A 1 137 ? -27.421 -17.847 50.596 1.00 15.00 ? 137 ALA A O   1 
ATOM   1032 C CB  . ALA A 1 137 ? -28.140 -19.535 52.652 1.00 15.00 ? 137 ALA A CB  1 
ATOM   1033 N N   . SER A 1 138 ? -26.936 -19.526 49.195 1.00 15.00 ? 138 SER A N   1 
ATOM   1034 C CA  . SER A 1 138 ? -26.198 -18.656 48.297 1.00 15.00 ? 138 SER A CA  1 
ATOM   1035 C C   . SER A 1 138 ? -27.056 -17.911 47.286 1.00 15.00 ? 138 SER A C   1 
ATOM   1036 O O   . SER A 1 138 ? -26.758 -16.766 46.944 1.00 15.00 ? 138 SER A O   1 
ATOM   1037 C CB  . SER A 1 138 ? -25.117 -19.443 47.568 1.00 15.00 ? 138 SER A CB  1 
ATOM   1038 O OG  . SER A 1 138 ? -25.708 -20.453 46.784 1.00 15.00 ? 138 SER A OG  1 
ATOM   1039 N N   . LEU A 1 139 ? -28.122 -18.550 46.820 1.00 15.00 ? 139 LEU A N   1 
ATOM   1040 C CA  . LEU A 1 139 ? -28.992 -17.949 45.821 1.00 15.00 ? 139 LEU A CA  1 
ATOM   1041 C C   . LEU A 1 139 ? -29.562 -16.584 46.180 1.00 15.00 ? 139 LEU A C   1 
ATOM   1042 O O   . LEU A 1 139 ? -29.935 -16.323 47.328 1.00 15.00 ? 139 LEU A O   1 
ATOM   1043 C CB  . LEU A 1 139 ? -30.118 -18.908 45.460 1.00 15.00 ? 139 LEU A CB  1 
ATOM   1044 C CG  . LEU A 1 139 ? -29.760 -20.019 44.478 1.00 15.00 ? 139 LEU A CG  1 
ATOM   1045 C CD1 . LEU A 1 139 ? -29.299 -19.400 43.180 1.00 15.00 ? 139 LEU A CD1 1 
ATOM   1046 C CD2 . LEU A 1 139 ? -28.674 -20.893 45.035 1.00 15.00 ? 139 LEU A CD2 1 
ATOM   1047 N N   . THR A 1 140 ? -29.629 -15.705 45.187 1.00 15.00 ? 140 THR A N   1 
ATOM   1048 C CA  . THR A 1 140 ? -30.187 -14.367 45.382 1.00 15.00 ? 140 THR A CA  1 
ATOM   1049 C C   . THR A 1 140 ? -31.654 -14.430 45.862 1.00 15.00 ? 140 THR A C   1 
ATOM   1050 O O   . THR A 1 140 ? -32.094 -13.617 46.690 1.00 15.00 ? 140 THR A O   1 
ATOM   1051 C CB  . THR A 1 140 ? -30.060 -13.538 44.088 1.00 15.00 ? 140 THR A CB  1 
ATOM   1052 O OG1 . THR A 1 140 ? -28.671 -13.303 43.821 1.00 15.00 ? 140 THR A OG1 1 
ATOM   1053 C CG2 . THR A 1 140 ? -30.801 -12.201 44.204 1.00 15.00 ? 140 THR A CG2 1 
ATOM   1054 N N   . SER A 1 141 ? -32.376 -15.445 45.403 1.00 15.00 ? 141 SER A N   1 
ATOM   1055 C CA  . SER A 1 141 ? -33.768 -15.626 45.786 1.00 15.00 ? 141 SER A CA  1 
ATOM   1056 C C   . SER A 1 141 ? -33.890 -15.891 47.294 1.00 15.00 ? 141 SER A C   1 
ATOM   1057 O O   . SER A 1 141 ? -34.944 -15.629 47.901 1.00 15.00 ? 141 SER A O   1 
ATOM   1058 C CB  . SER A 1 141 ? -34.387 -16.771 44.990 1.00 15.00 ? 141 SER A CB  1 
ATOM   1059 O OG  . SER A 1 141 ? -33.780 -17.996 45.321 1.00 15.00 ? 141 SER A OG  1 
ATOM   1060 N N   . PHE A 1 142 ? -32.820 -16.430 47.887 1.00 15.00 ? 142 PHE A N   1 
ATOM   1061 C CA  . PHE A 1 142 ? -32.793 -16.705 49.325 1.00 15.00 ? 142 PHE A CA  1 
ATOM   1062 C C   . PHE A 1 142 ? -32.530 -15.405 50.081 1.00 15.00 ? 142 PHE A C   1 
ATOM   1063 O O   . PHE A 1 142 ? -33.217 -15.089 51.063 1.00 15.00 ? 142 PHE A O   1 
ATOM   1064 C CB  . PHE A 1 142 ? -31.707 -17.717 49.667 1.00 15.00 ? 142 PHE A CB  1 
ATOM   1065 C CG  . PHE A 1 142 ? -31.767 -18.202 51.078 1.00 15.00 ? 142 PHE A CG  1 
ATOM   1066 C CD1 . PHE A 1 142 ? -31.142 -17.494 52.099 1.00 15.00 ? 142 PHE A CD1 1 
ATOM   1067 C CD2 . PHE A 1 142 ? -32.447 -19.381 51.392 1.00 15.00 ? 142 PHE A CD2 1 
ATOM   1068 C CE1 . PHE A 1 142 ? -31.195 -17.953 53.414 1.00 15.00 ? 142 PHE A CE1 1 
ATOM   1069 C CE2 . PHE A 1 142 ? -32.506 -19.850 52.700 1.00 15.00 ? 142 PHE A CE2 1 
ATOM   1070 C CZ  . PHE A 1 142 ? -31.880 -19.138 53.715 1.00 15.00 ? 142 PHE A CZ  1 
ATOM   1071 N N   . GLN A 1 143 ? -31.547 -14.644 49.604 1.00 15.00 ? 143 GLN A N   1 
ATOM   1072 C CA  . GLN A 1 143 ? -31.191 -13.379 50.224 1.00 15.00 ? 143 GLN A CA  1 
ATOM   1073 C C   . GLN A 1 143 ? -32.384 -12.429 50.332 1.00 15.00 ? 143 GLN A C   1 
ATOM   1074 O O   . GLN A 1 143 ? -32.573 -11.754 51.355 1.00 15.00 ? 143 GLN A O   1 
ATOM   1075 C CB  . GLN A 1 143 ? -30.065 -12.716 49.439 1.00 15.00 ? 143 GLN A CB  1 
ATOM   1076 C CG  . GLN A 1 143 ? -29.684 -11.316 49.940 1.00 15.00 ? 143 GLN A CG  1 
ATOM   1077 C CD  . GLN A 1 143 ? -28.358 -10.808 49.370 1.00 15.00 ? 143 GLN A CD  1 
ATOM   1078 O OE1 . GLN A 1 143 ? -28.050 -9.624  49.467 1.00 15.00 ? 143 GLN A OE1 1 
ATOM   1079 N NE2 . GLN A 1 143 ? -27.558 -11.710 48.797 1.00 15.00 ? 143 GLN A NE2 1 
ATOM   1080 N N   . PHE A 1 144 ? -33.215 -12.402 49.299 1.00 15.00 ? 144 PHE A N   1 
ATOM   1081 C CA  . PHE A 1 144 ? -34.362 -11.503 49.306 1.00 15.00 ? 144 PHE A CA  1 
ATOM   1082 C C   . PHE A 1 144 ? -35.725 -12.125 49.641 1.00 15.00 ? 144 PHE A C   1 
ATOM   1083 O O   . PHE A 1 144 ? -36.769 -11.518 49.379 1.00 15.00 ? 144 PHE A O   1 
ATOM   1084 C CB  . PHE A 1 144 ? -34.415 -10.730 47.985 1.00 15.00 ? 144 PHE A CB  1 
ATOM   1085 C CG  . PHE A 1 144 ? -33.217 -9.846  47.749 1.00 15.00 ? 144 PHE A CG  1 
ATOM   1086 C CD1 . PHE A 1 144 ? -33.135 -8.590  48.347 1.00 15.00 ? 144 PHE A CD1 1 
ATOM   1087 C CD2 . PHE A 1 144 ? -32.169 -10.271 46.943 1.00 15.00 ? 144 PHE A CD2 1 
ATOM   1088 C CE1 . PHE A 1 144 ? -32.020 -7.768  48.146 1.00 15.00 ? 144 PHE A CE1 1 
ATOM   1089 C CE2 . PHE A 1 144 ? -31.053 -9.463  46.735 1.00 15.00 ? 144 PHE A CE2 1 
ATOM   1090 C CZ  . PHE A 1 144 ? -30.976 -8.210  47.339 1.00 15.00 ? 144 PHE A CZ  1 
ATOM   1091 N N   . TYR A 1 145 ? -35.720 -13.303 50.262 1.00 15.00 ? 145 TYR A N   1 
ATOM   1092 C CA  . TYR A 1 145 ? -36.968 -13.979 50.633 1.00 15.00 ? 145 TYR A CA  1 
ATOM   1093 C C   . TYR A 1 145 ? -37.809 -13.161 51.618 1.00 15.00 ? 145 TYR A C   1 
ATOM   1094 O O   . TYR A 1 145 ? -37.268 -12.490 52.502 1.00 15.00 ? 145 TYR A O   1 
ATOM   1095 C CB  . TYR A 1 145 ? -36.681 -15.352 51.258 1.00 15.00 ? 145 TYR A CB  1 
ATOM   1096 C CG  . TYR A 1 145 ? -37.889 -15.982 51.942 1.00 15.00 ? 145 TYR A CG  1 
ATOM   1097 C CD1 . TYR A 1 145 ? -38.210 -15.665 53.261 1.00 15.00 ? 145 TYR A CD1 1 
ATOM   1098 C CD2 . TYR A 1 145 ? -38.715 -16.885 51.263 1.00 15.00 ? 145 TYR A CD2 1 
ATOM   1099 C CE1 . TYR A 1 145 ? -39.325 -16.224 53.896 1.00 15.00 ? 145 TYR A CE1 1 
ATOM   1100 C CE2 . TYR A 1 145 ? -39.833 -17.455 51.888 1.00 15.00 ? 145 TYR A CE2 1 
ATOM   1101 C CZ  . TYR A 1 145 ? -40.129 -17.118 53.207 1.00 15.00 ? 145 TYR A CZ  1 
ATOM   1102 O OH  . TYR A 1 145 ? -41.208 -17.680 53.847 1.00 15.00 ? 145 TYR A OH  1 
ATOM   1103 N N   . SER A 1 146 ? -39.132 -13.258 51.497 1.00 15.00 ? 146 SER A N   1 
ATOM   1104 C CA  . SER A 1 146 ? -40.031 -12.552 52.412 1.00 15.00 ? 146 SER A CA  1 
ATOM   1105 C C   . SER A 1 146 ? -41.314 -13.304 52.735 1.00 15.00 ? 146 SER A C   1 
ATOM   1106 O O   . SER A 1 146 ? -41.744 -13.308 53.882 1.00 15.00 ? 146 SER A O   1 
ATOM   1107 C CB  . SER A 1 146 ? -40.326 -11.115 51.959 1.00 15.00 ? 146 SER A CB  1 
ATOM   1108 O OG  . SER A 1 146 ? -40.497 -11.029 50.566 1.00 15.00 ? 146 SER A OG  1 
ATOM   1109 N N   . LYS A 1 147 ? -41.888 -14.001 51.755 1.00 15.00 ? 147 LYS A N   1 
ATOM   1110 C CA  . LYS A 1 147 ? -43.130 -14.740 51.987 1.00 15.00 ? 147 LYS A CA  1 
ATOM   1111 C C   . LYS A 1 147 ? -43.296 -15.993 51.129 1.00 15.00 ? 147 LYS A C   1 
ATOM   1112 O O   . LYS A 1 147 ? -42.682 -16.131 50.071 1.00 15.00 ? 147 LYS A O   1 
ATOM   1113 C CB  . LYS A 1 147 ? -44.344 -13.804 51.821 1.00 15.00 ? 147 LYS A CB  1 
ATOM   1114 C CG  . LYS A 1 147 ? -44.602 -12.898 53.050 1.00 15.00 ? 147 LYS A CG  1 
ATOM   1115 C CD  . LYS A 1 147 ? -45.564 -11.752 52.751 1.00 15.00 ? 147 LYS A CD  1 
ATOM   1116 C CE  . LYS A 1 147 ? -45.635 -10.764 53.908 1.00 15.00 ? 147 LYS A CE  1 
ATOM   1117 N NZ  . LYS A 1 147 ? -46.249 -11.323 55.154 1.00 15.00 ? 147 LYS A NZ  1 
ATOM   1118 N N   . GLY A 1 148 ? -44.122 -16.917 51.605 1.00 15.00 ? 148 GLY A N   1 
ATOM   1119 C CA  . GLY A 1 148 ? -44.364 -18.141 50.868 1.00 15.00 ? 148 GLY A CA  1 
ATOM   1120 C C   . GLY A 1 148 ? -43.350 -19.220 51.178 1.00 15.00 ? 148 GLY A C   1 
ATOM   1121 O O   . GLY A 1 148 ? -42.394 -18.999 51.897 1.00 15.00 ? 148 GLY A O   1 
ATOM   1122 N N   . VAL A 1 149 ? -43.596 -20.418 50.674 1.00 15.00 ? 149 VAL A N   1 
ATOM   1123 C CA  . VAL A 1 149 ? -42.689 -21.527 50.897 1.00 15.00 ? 149 VAL A CA  1 
ATOM   1124 C C   . VAL A 1 149 ? -41.559 -21.340 49.877 1.00 15.00 ? 149 VAL A C   1 
ATOM   1125 O O   . VAL A 1 149 ? -41.808 -21.301 48.674 1.00 15.00 ? 149 VAL A O   1 
ATOM   1126 C CB  . VAL A 1 149 ? -43.429 -22.894 50.722 1.00 15.00 ? 149 VAL A CB  1 
ATOM   1127 C CG1 . VAL A 1 149 ? -42.462 -24.051 50.794 1.00 15.00 ? 149 VAL A CG1 1 
ATOM   1128 C CG2 . VAL A 1 149 ? -44.487 -23.052 51.795 1.00 15.00 ? 149 VAL A CG2 1 
ATOM   1129 N N   . TYR A 1 150 ? -40.344 -21.126 50.371 1.00 15.00 ? 150 TYR A N   1 
ATOM   1130 C CA  . TYR A 1 150 ? -39.194 -20.921 49.503 1.00 15.00 ? 150 TYR A CA  1 
ATOM   1131 C C   . TYR A 1 150 ? -38.799 -22.177 48.756 1.00 15.00 ? 150 TYR A C   1 
ATOM   1132 O O   . TYR A 1 150 ? -38.867 -23.286 49.295 1.00 15.00 ? 150 TYR A O   1 
ATOM   1133 C CB  . TYR A 1 150 ? -37.989 -20.417 50.295 1.00 15.00 ? 150 TYR A CB  1 
ATOM   1134 C CG  . TYR A 1 150 ? -36.724 -20.274 49.456 1.00 15.00 ? 150 TYR A CG  1 
ATOM   1135 C CD1 . TYR A 1 150 ? -36.479 -19.115 48.716 1.00 15.00 ? 150 TYR A CD1 1 
ATOM   1136 C CD2 . TYR A 1 150 ? -35.765 -21.300 49.412 1.00 15.00 ? 150 TYR A CD2 1 
ATOM   1137 C CE1 . TYR A 1 150 ? -35.312 -18.979 47.957 1.00 15.00 ? 150 TYR A CE1 1 
ATOM   1138 C CE2 . TYR A 1 150 ? -34.594 -21.174 48.651 1.00 15.00 ? 150 TYR A CE2 1 
ATOM   1139 C CZ  . TYR A 1 150 ? -34.374 -20.013 47.929 1.00 15.00 ? 150 TYR A CZ  1 
ATOM   1140 O OH  . TYR A 1 150 ? -33.224 -19.882 47.189 1.00 15.00 ? 150 TYR A OH  1 
ATOM   1141 N N   . TYR A 1 151 ? -38.312 -21.978 47.536 1.00 15.00 ? 151 TYR A N   1 
ATOM   1142 C CA  . TYR A 1 151 ? -37.870 -23.066 46.681 1.00 15.00 ? 151 TYR A CA  1 
ATOM   1143 C C   . TYR A 1 151 ? -37.237 -22.444 45.436 1.00 15.00 ? 151 TYR A C   1 
ATOM   1144 O O   . TYR A 1 151 ? -37.657 -21.367 44.998 1.00 15.00 ? 151 TYR A O   1 
ATOM   1145 C CB  . TYR A 1 151 ? -39.069 -23.953 46.314 1.00 15.00 ? 151 TYR A CB  1 
ATOM   1146 C CG  . TYR A 1 151 ? -38.801 -25.008 45.268 1.00 15.00 ? 151 TYR A CG  1 
ATOM   1147 C CD1 . TYR A 1 151 ? -38.364 -26.282 45.623 1.00 15.00 ? 151 TYR A CD1 1 
ATOM   1148 C CD2 . TYR A 1 151 ? -39.049 -24.749 43.920 1.00 15.00 ? 151 TYR A CD2 1 
ATOM   1149 C CE1 . TYR A 1 151 ? -38.189 -27.273 44.657 1.00 15.00 ? 151 TYR A CE1 1 
ATOM   1150 C CE2 . TYR A 1 151 ? -38.880 -25.727 42.956 1.00 15.00 ? 151 TYR A CE2 1 
ATOM   1151 C CZ  . TYR A 1 151 ? -38.457 -26.981 43.328 1.00 15.00 ? 151 TYR A CZ  1 
ATOM   1152 O OH  . TYR A 1 151 ? -38.342 -27.945 42.361 1.00 15.00 ? 151 TYR A OH  1 
ATOM   1153 N N   . ASP A 1 152 ? -36.220 -23.105 44.889 1.00 15.00 ? 152 ASP A N   1 
ATOM   1154 C CA  . ASP A 1 152 ? -35.525 -22.617 43.699 1.00 15.00 ? 152 ASP A CA  1 
ATOM   1155 C C   . ASP A 1 152 ? -34.750 -23.767 43.068 1.00 15.00 ? 152 ASP A C   1 
ATOM   1156 O O   . ASP A 1 152 ? -33.895 -24.378 43.726 1.00 15.00 ? 152 ASP A O   1 
ATOM   1157 C CB  . ASP A 1 152 ? -34.549 -21.500 44.080 1.00 15.00 ? 152 ASP A CB  1 
ATOM   1158 C CG  . ASP A 1 152 ? -33.967 -20.773 42.871 1.00 15.00 ? 152 ASP A CG  1 
ATOM   1159 O OD1 . ASP A 1 152 ? -33.748 -21.395 41.814 1.00 15.00 ? 152 ASP A OD1 1 
ATOM   1160 O OD2 . ASP A 1 152 ? -33.717 -19.556 42.988 1.00 15.00 ? 152 ASP A OD2 1 
ATOM   1161 N N   . GLU A 1 153 ? -35.012 -24.018 41.786 1.00 15.00 ? 153 GLU A N   1 
ATOM   1162 C CA  . GLU A 1 153 ? -34.354 -25.087 41.038 1.00 15.00 ? 153 GLU A CA  1 
ATOM   1163 C C   . GLU A 1 153 ? -32.843 -24.948 41.090 1.00 15.00 ? 153 GLU A C   1 
ATOM   1164 O O   . GLU A 1 153 ? -32.122 -25.931 40.987 1.00 15.00 ? 153 GLU A O   1 
ATOM   1165 C CB  . GLU A 1 153 ? -34.778 -25.064 39.560 1.00 15.00 ? 153 GLU A CB  1 
ATOM   1166 C CG  . GLU A 1 153 ? -36.221 -25.446 39.259 1.00 15.00 ? 153 GLU A CG  1 
ATOM   1167 C CD  . GLU A 1 153 ? -36.587 -25.210 37.783 1.00 15.00 ? 153 GLU A CD  1 
ATOM   1168 O OE1 . GLU A 1 153 ? -36.400 -26.135 36.957 1.00 15.00 ? 153 GLU A OE1 1 
ATOM   1169 O OE2 . GLU A 1 153 ? -37.048 -24.091 37.455 1.00 15.00 ? 153 GLU A OE2 1 
ATOM   1170 N N   . SER A 1 154 ? -32.375 -23.713 41.204 1.00 15.00 ? 154 SER A N   1 
ATOM   1171 C CA  . SER A 1 154 ? -30.948 -23.413 41.243 1.00 15.00 ? 154 SER A CA  1 
ATOM   1172 C C   . SER A 1 154 ? -30.249 -23.777 42.555 1.00 15.00 ? 154 SER A C   1 
ATOM   1173 O O   . SER A 1 154 ? -29.021 -23.752 42.635 1.00 15.00 ? 154 SER A O   1 
ATOM   1174 C CB  . SER A 1 154 ? -30.726 -21.929 40.923 1.00 15.00 ? 154 SER A CB  1 
ATOM   1175 O OG  . SER A 1 154 ? -31.332 -21.572 39.687 1.00 15.00 ? 154 SER A OG  1 
ATOM   1176 N N   . CYS A 1 155 ? -31.023 -24.110 43.580 1.00 15.00 ? 155 CYS A N   1 
ATOM   1177 C CA  . CYS A 1 155 ? -30.439 -24.465 44.868 1.00 15.00 ? 155 CYS A CA  1 
ATOM   1178 C C   . CYS A 1 155 ? -29.579 -25.722 44.760 1.00 15.00 ? 155 CYS A C   1 
ATOM   1179 O O   . CYS A 1 155 ? -29.981 -26.722 44.173 1.00 15.00 ? 155 CYS A O   1 
ATOM   1180 C CB  . CYS A 1 155 ? -31.532 -24.646 45.922 1.00 15.00 ? 155 CYS A CB  1 
ATOM   1181 S SG  . CYS A 1 155 ? -31.117 -23.808 47.485 1.00 15.00 ? 155 CYS A SG  1 
ATOM   1182 N N   . ASN A 1 156 ? -28.399 -25.673 45.351 1.00 15.00 ? 156 ASN A N   1 
ATOM   1183 C CA  . ASN A 1 156 ? -27.478 -26.797 45.294 1.00 15.00 ? 156 ASN A CA  1 
ATOM   1184 C C   . ASN A 1 156 ? -27.423 -27.578 46.606 1.00 15.00 ? 156 ASN A C   1 
ATOM   1185 O O   . ASN A 1 156 ? -26.986 -27.057 47.637 1.00 15.00 ? 156 ASN A O   1 
ATOM   1186 C CB  . ASN A 1 156 ? -26.089 -26.283 44.908 1.00 15.00 ? 156 ASN A CB  1 
ATOM   1187 C CG  . ASN A 1 156 ? -25.153 -27.393 44.454 1.00 15.00 ? 156 ASN A CG  1 
ATOM   1188 O OD1 . ASN A 1 156 ? -25.214 -28.536 44.936 1.00 15.00 ? 156 ASN A OD1 1 
ATOM   1189 N ND2 . ASN A 1 156 ? -24.262 -27.054 43.534 1.00 15.00 ? 156 ASN A ND2 1 
ATOM   1190 N N   . SER A 1 157 ? -27.805 -28.851 46.539 1.00 15.00 ? 157 SER A N   1 
ATOM   1191 C CA  . SER A 1 157 ? -27.817 -29.724 47.713 1.00 15.00 ? 157 SER A CA  1 
ATOM   1192 C C   . SER A 1 157 ? -26.428 -30.141 48.175 1.00 15.00 ? 157 SER A C   1 
ATOM   1193 O O   . SER A 1 157 ? -26.273 -30.764 49.232 1.00 15.00 ? 157 SER A O   1 
ATOM   1194 C CB  . SER A 1 157 ? -28.658 -30.978 47.452 1.00 15.00 ? 157 SER A CB  1 
ATOM   1195 O OG  . SER A 1 157 ? -28.065 -31.809 46.472 1.00 15.00 ? 157 SER A OG  1 
ATOM   1196 N N   . ASP A 1 158 ? -25.423 -29.820 47.370 1.00 15.00 ? 158 ASP A N   1 
ATOM   1197 C CA  . ASP A 1 158 ? -24.063 -30.185 47.694 1.00 15.00 ? 158 ASP A CA  1 
ATOM   1198 C C   . ASP A 1 158 ? -23.213 -29.013 48.136 1.00 15.00 ? 158 ASP A C   1 
ATOM   1199 O O   . ASP A 1 158 ? -22.189 -29.207 48.786 1.00 15.00 ? 158 ASP A O   1 
ATOM   1200 C CB  . ASP A 1 158 ? -23.442 -30.988 46.546 1.00 15.00 ? 158 ASP A CB  1 
ATOM   1201 C CG  . ASP A 1 158 ? -23.699 -32.489 46.690 1.00 15.00 ? 158 ASP A CG  1 
ATOM   1202 O OD1 . ASP A 1 158 ? -23.320 -33.051 47.747 1.00 15.00 ? 158 ASP A OD1 1 
ATOM   1203 O OD2 . ASP A 1 158 ? -24.297 -33.107 45.779 1.00 15.00 ? 158 ASP A OD2 1 
ATOM   1204 N N   . ASN A 1 159 ? -23.667 -27.796 47.851 1.00 15.00 ? 159 ASN A N   1 
ATOM   1205 C CA  . ASN A 1 159 ? -22.950 -26.597 48.282 1.00 15.00 ? 159 ASN A CA  1 
ATOM   1206 C C   . ASN A 1 159 ? -23.546 -26.104 49.613 1.00 15.00 ? 159 ASN A C   1 
ATOM   1207 O O   . ASN A 1 159 ? -24.200 -25.058 49.666 1.00 15.00 ? 159 ASN A O   1 
ATOM   1208 C CB  . ASN A 1 159 ? -23.042 -25.492 47.221 1.00 15.00 ? 159 ASN A CB  1 
ATOM   1209 C CG  . ASN A 1 159 ? -22.272 -24.231 47.609 1.00 15.00 ? 159 ASN A CG  1 
ATOM   1210 O OD1 . ASN A 1 159 ? -21.813 -24.085 48.740 1.00 15.00 ? 159 ASN A OD1 1 
ATOM   1211 N ND2 . ASN A 1 159 ? -22.135 -23.310 46.666 1.00 15.00 ? 159 ASN A ND2 1 
ATOM   1212 N N   . LEU A 1 160 ? -23.384 -26.885 50.676 1.00 15.00 ? 160 LEU A N   1 
ATOM   1213 C CA  . LEU A 1 160 ? -23.914 -26.468 51.976 1.00 15.00 ? 160 LEU A CA  1 
ATOM   1214 C C   . LEU A 1 160 ? -23.042 -25.295 52.410 1.00 15.00 ? 160 LEU A C   1 
ATOM   1215 O O   . LEU A 1 160 ? -21.822 -25.422 52.456 1.00 15.00 ? 160 LEU A O   1 
ATOM   1216 C CB  . LEU A 1 160 ? -23.828 -27.612 52.989 1.00 15.00 ? 160 LEU A CB  1 
ATOM   1217 C CG  . LEU A 1 160 ? -24.491 -28.939 52.618 1.00 15.00 ? 160 LEU A CG  1 
ATOM   1218 C CD1 . LEU A 1 160 ? -24.409 -29.893 53.808 1.00 15.00 ? 160 LEU A CD1 1 
ATOM   1219 C CD2 . LEU A 1 160 ? -25.944 -28.710 52.227 1.00 15.00 ? 160 LEU A CD2 1 
ATOM   1220 N N   . ASN A 1 161 ? -23.649 -24.149 52.696 1.00 15.00 ? 161 ASN A N   1 
ATOM   1221 C CA  . ASN A 1 161 ? -22.864 -22.978 53.073 1.00 15.00 ? 161 ASN A CA  1 
ATOM   1222 C C   . ASN A 1 161 ? -23.403 -22.100 54.200 1.00 15.00 ? 161 ASN A C   1 
ATOM   1223 O O   . ASN A 1 161 ? -22.803 -21.069 54.540 1.00 15.00 ? 161 ASN A O   1 
ATOM   1224 C CB  . ASN A 1 161 ? -22.588 -22.129 51.832 1.00 15.00 ? 161 ASN A CB  1 
ATOM   1225 C CG  . ASN A 1 161 ? -23.822 -21.920 50.982 1.00 15.00 ? 161 ASN A CG  1 
ATOM   1226 O OD1 . ASN A 1 161 ? -24.767 -21.241 51.380 1.00 15.00 ? 161 ASN A OD1 1 
ATOM   1227 N ND2 . ASN A 1 161 ? -23.827 -22.514 49.810 1.00 15.00 ? 161 ASN A ND2 1 
ATOM   1228 N N   . HIS A 1 162 ? -24.466 -22.550 54.850 1.00 15.00 ? 162 HIS A N   1 
ATOM   1229 C CA  . HIS A 1 162 ? -25.071 -21.779 55.924 1.00 15.00 ? 162 HIS A CA  1 
ATOM   1230 C C   . HIS A 1 162 ? -25.710 -22.756 56.911 1.00 15.00 ? 162 HIS A C   1 
ATOM   1231 O O   . HIS A 1 162 ? -26.374 -23.714 56.503 1.00 15.00 ? 162 HIS A O   1 
ATOM   1232 C CB  . HIS A 1 162 ? -26.122 -20.826 55.329 1.00 15.00 ? 162 HIS A CB  1 
ATOM   1233 C CG  . HIS A 1 162 ? -26.580 -19.747 56.265 1.00 15.00 ? 162 HIS A CG  1 
ATOM   1234 N ND1 . HIS A 1 162 ? -25.727 -19.083 57.121 1.00 15.00 ? 162 HIS A ND1 1 
ATOM   1235 C CD2 . HIS A 1 162 ? -27.808 -19.220 56.483 1.00 15.00 ? 162 HIS A CD2 1 
ATOM   1236 C CE1 . HIS A 1 162 ? -26.409 -18.201 57.831 1.00 15.00 ? 162 HIS A CE1 1 
ATOM   1237 N NE2 . HIS A 1 162 ? -27.676 -18.265 57.460 1.00 15.00 ? 162 HIS A NE2 1 
ATOM   1238 N N   . ALA A 1 163 ? -25.399 -22.584 58.193 1.00 15.00 ? 163 ALA A N   1 
ATOM   1239 C CA  . ALA A 1 163 ? -25.959 -23.433 59.243 1.00 15.00 ? 163 ALA A CA  1 
ATOM   1240 C C   . ALA A 1 163 ? -27.169 -22.647 59.741 1.00 15.00 ? 163 ALA A C   1 
ATOM   1241 O O   . ALA A 1 163 ? -27.098 -21.423 59.918 1.00 15.00 ? 163 ALA A O   1 
ATOM   1242 C CB  . ALA A 1 163 ? -24.953 -23.656 60.352 1.00 15.00 ? 163 ALA A CB  1 
ATOM   1243 N N   . VAL A 1 164 ? -28.272 -23.345 59.963 1.00 15.00 ? 164 VAL A N   1 
ATOM   1244 C CA  . VAL A 1 164 ? -29.510 -22.709 60.363 1.00 15.00 ? 164 VAL A CA  1 
ATOM   1245 C C   . VAL A 1 164 ? -30.298 -23.599 61.341 1.00 15.00 ? 164 VAL A C   1 
ATOM   1246 O O   . VAL A 1 164 ? -29.889 -24.728 61.616 1.00 15.00 ? 164 VAL A O   1 
ATOM   1247 C CB  . VAL A 1 164 ? -30.302 -22.378 59.082 1.00 15.00 ? 164 VAL A CB  1 
ATOM   1248 C CG1 . VAL A 1 164 ? -31.280 -23.480 58.748 1.00 15.00 ? 164 VAL A CG1 1 
ATOM   1249 C CG2 . VAL A 1 164 ? -30.899 -20.990 59.151 1.00 15.00 ? 164 VAL A CG2 1 
ATOM   1250 N N   . LEU A 1 165 ? -31.397 -23.092 61.893 1.00 15.00 ? 165 LEU A N   1 
ATOM   1251 C CA  . LEU A 1 165 ? -32.176 -23.865 62.864 1.00 15.00 ? 165 LEU A CA  1 
ATOM   1252 C C   . LEU A 1 165 ? -33.581 -24.267 62.404 1.00 15.00 ? 165 LEU A C   1 
ATOM   1253 O O   . LEU A 1 165 ? -34.394 -23.418 62.035 1.00 15.00 ? 165 LEU A O   1 
ATOM   1254 C CB  . LEU A 1 165 ? -32.266 -23.106 64.205 1.00 15.00 ? 165 LEU A CB  1 
ATOM   1255 C CG  . LEU A 1 165 ? -32.790 -23.868 65.438 1.00 15.00 ? 165 LEU A CG  1 
ATOM   1256 C CD1 . LEU A 1 165 ? -31.761 -24.895 65.900 1.00 15.00 ? 165 LEU A CD1 1 
ATOM   1257 C CD2 . LEU A 1 165 ? -33.125 -22.904 66.568 1.00 15.00 ? 165 LEU A CD2 1 
ATOM   1258 N N   . ALA A 1 166 ? -33.847 -25.567 62.426 1.00 15.00 ? 166 ALA A N   1 
ATOM   1259 C CA  . ALA A 1 166 ? -35.146 -26.105 62.052 1.00 15.00 ? 166 ALA A CA  1 
ATOM   1260 C C   . ALA A 1 166 ? -35.991 -26.111 63.328 1.00 15.00 ? 166 ALA A C   1 
ATOM   1261 O O   . ALA A 1 166 ? -35.764 -26.905 64.246 1.00 15.00 ? 166 ALA A O   1 
ATOM   1262 C CB  . ALA A 1 166 ? -35.000 -27.507 61.500 1.00 15.00 ? 166 ALA A CB  1 
ATOM   1263 N N   . VAL A 1 167 ? -36.944 -25.193 63.389 1.00 15.00 ? 167 VAL A N   1 
ATOM   1264 C CA  . VAL A 1 167 ? -37.803 -25.062 64.551 1.00 15.00 ? 167 VAL A CA  1 
ATOM   1265 C C   . VAL A 1 167 ? -39.235 -25.577 64.333 1.00 15.00 ? 167 VAL A C   1 
ATOM   1266 O O   . VAL A 1 167 ? -40.145 -25.313 65.137 1.00 15.00 ? 167 VAL A O   1 
ATOM   1267 C CB  . VAL A 1 167 ? -37.812 -23.596 65.032 1.00 15.00 ? 167 VAL A CB  1 
ATOM   1268 C CG1 . VAL A 1 167 ? -38.828 -22.750 64.239 1.00 15.00 ? 167 VAL A CG1 1 
ATOM   1269 C CG2 . VAL A 1 167 ? -38.062 -23.552 66.501 1.00 15.00 ? 167 VAL A CG2 1 
ATOM   1270 N N   . GLY A 1 168 ? -39.439 -26.306 63.245 1.00 15.00 ? 168 GLY A N   1 
ATOM   1271 C CA  . GLY A 1 168 ? -40.755 -26.840 62.966 1.00 15.00 ? 168 GLY A CA  1 
ATOM   1272 C C   . GLY A 1 168 ? -40.966 -27.247 61.527 1.00 15.00 ? 168 GLY A C   1 
ATOM   1273 O O   . GLY A 1 168 ? -40.018 -27.374 60.744 1.00 15.00 ? 168 GLY A O   1 
ATOM   1274 N N   . TYR A 1 169 ? -42.232 -27.479 61.199 1.00 15.00 ? 169 TYR A N   1 
ATOM   1275 C CA  . TYR A 1 169 ? -42.666 -27.888 59.871 1.00 15.00 ? 169 TYR A CA  1 
ATOM   1276 C C   . TYR A 1 169 ? -44.184 -27.799 59.840 1.00 15.00 ? 169 TYR A C   1 
ATOM   1277 O O   . TYR A 1 169 ? -44.840 -27.817 60.885 1.00 15.00 ? 169 TYR A O   1 
ATOM   1278 C CB  . TYR A 1 169 ? -42.212 -29.330 59.542 1.00 15.00 ? 169 TYR A CB  1 
ATOM   1279 C CG  . TYR A 1 169 ? -42.752 -30.415 60.459 1.00 15.00 ? 169 TYR A CG  1 
ATOM   1280 C CD1 . TYR A 1 169 ? -42.057 -30.787 61.611 1.00 15.00 ? 169 TYR A CD1 1 
ATOM   1281 C CD2 . TYR A 1 169 ? -43.944 -31.086 60.165 1.00 15.00 ? 169 TYR A CD2 1 
ATOM   1282 C CE1 . TYR A 1 169 ? -42.531 -31.801 62.446 1.00 15.00 ? 169 TYR A CE1 1 
ATOM   1283 C CE2 . TYR A 1 169 ? -44.427 -32.096 60.990 1.00 15.00 ? 169 TYR A CE2 1 
ATOM   1284 C CZ  . TYR A 1 169 ? -43.713 -32.451 62.128 1.00 15.00 ? 169 TYR A CZ  1 
ATOM   1285 O OH  . TYR A 1 169 ? -44.151 -33.471 62.938 1.00 15.00 ? 169 TYR A OH  1 
ATOM   1286 N N   . GLY A 1 170 ? -44.734 -27.726 58.638 1.00 15.00 ? 170 GLY A N   1 
ATOM   1287 C CA  . GLY A 1 170 ? -46.175 -27.633 58.478 1.00 15.00 ? 170 GLY A CA  1 
ATOM   1288 C C   . GLY A 1 170 ? -46.529 -27.635 57.010 1.00 15.00 ? 170 GLY A C   1 
ATOM   1289 O O   . GLY A 1 170 ? -45.725 -28.042 56.177 1.00 15.00 ? 170 GLY A O   1 
ATOM   1290 N N   . ILE A 1 171 ? -47.713 -27.142 56.685 1.00 15.00 ? 171 ILE A N   1 
ATOM   1291 C CA  . ILE A 1 171 ? -48.163 -27.090 55.302 1.00 15.00 ? 171 ILE A CA  1 
ATOM   1292 C C   . ILE A 1 171 ? -48.969 -25.815 55.091 1.00 15.00 ? 171 ILE A C   1 
ATOM   1293 O O   . ILE A 1 171 ? -49.842 -25.478 55.891 1.00 15.00 ? 171 ILE A O   1 
ATOM   1294 C CB  . ILE A 1 171 ? -48.945 -28.370 54.908 1.00 15.00 ? 171 ILE A CB  1 
ATOM   1295 C CG1 . ILE A 1 171 ? -49.523 -28.247 53.505 1.00 15.00 ? 171 ILE A CG1 1 
ATOM   1296 C CG2 . ILE A 1 171 ? -50.039 -28.688 55.912 1.00 15.00 ? 171 ILE A CG2 1 
ATOM   1297 C CD1 . ILE A 1 171 ? -50.203 -29.534 53.053 1.00 15.00 ? 171 ILE A CD1 1 
ATOM   1298 N N   . GLN A 1 172 ? -48.594 -25.074 54.050 1.00 15.00 ? 172 GLN A N   1 
ATOM   1299 C CA  . GLN A 1 172 ? -49.210 -23.802 53.716 1.00 15.00 ? 172 GLN A CA  1 
ATOM   1300 C C   . GLN A 1 172 ? -49.729 -23.813 52.289 1.00 15.00 ? 172 GLN A C   1 
ATOM   1301 O O   . GLN A 1 172 ? -48.958 -23.961 51.330 1.00 15.00 ? 172 GLN A O   1 
ATOM   1302 C CB  . GLN A 1 172 ? -48.190 -22.674 53.890 1.00 15.00 ? 172 GLN A CB  1 
ATOM   1303 C CG  . GLN A 1 172 ? -48.683 -21.317 53.453 1.00 15.00 ? 172 GLN A CG  1 
ATOM   1304 C CD  . GLN A 1 172 ? -47.730 -20.198 53.842 1.00 15.00 ? 172 GLN A CD  1 
ATOM   1305 O OE1 . GLN A 1 172 ? -47.845 -19.615 54.923 1.00 15.00 ? 172 GLN A OE1 1 
ATOM   1306 N NE2 . GLN A 1 172 ? -46.783 -19.892 52.962 1.00 15.00 ? 172 GLN A NE2 1 
ATOM   1307 N N   . LYS A 1 173 ? -51.041 -23.641 52.166 1.00 15.00 ? 173 LYS A N   1 
ATOM   1308 C CA  . LYS A 1 173 ? -51.730 -23.620 50.885 1.00 15.00 ? 173 LYS A CA  1 
ATOM   1309 C C   . LYS A 1 173 ? -51.390 -24.873 50.079 1.00 15.00 ? 173 LYS A C   1 
ATOM   1310 O O   . LYS A 1 173 ? -51.271 -24.825 48.865 1.00 15.00 ? 173 LYS A O   1 
ATOM   1311 C CB  . LYS A 1 173 ? -51.374 -22.351 50.094 1.00 15.00 ? 173 LYS A CB  1 
ATOM   1312 C CG  . LYS A 1 173 ? -51.476 -21.013 50.876 1.00 15.00 ? 173 LYS A CG  1 
ATOM   1313 C CD  . LYS A 1 173 ? -52.848 -20.775 51.553 1.00 15.00 ? 173 LYS A CD  1 
ATOM   1314 C CE  . LYS A 1 173 ? -54.017 -20.837 50.563 1.00 15.00 ? 173 LYS A CE  1 
ATOM   1315 N NZ  . LYS A 1 173 ? -53.893 -19.899 49.405 1.00 15.00 ? 173 LYS A NZ  1 
ATOM   1316 N N   . GLY A 1 174 ? -51.220 -25.992 50.772 1.00 15.00 ? 174 GLY A N   1 
ATOM   1317 C CA  . GLY A 1 174 ? -50.908 -27.239 50.099 1.00 15.00 ? 174 GLY A CA  1 
ATOM   1318 C C   . GLY A 1 174 ? -49.432 -27.583 50.059 1.00 15.00 ? 174 GLY A C   1 
ATOM   1319 O O   . GLY A 1 174 ? -49.067 -28.715 49.741 1.00 15.00 ? 174 GLY A O   1 
ATOM   1320 N N   . ASN A 1 175 ? -48.586 -26.650 50.477 1.00 15.00 ? 175 ASN A N   1 
ATOM   1321 C CA  . ASN A 1 175 ? -47.146 -26.873 50.440 1.00 15.00 ? 175 ASN A CA  1 
ATOM   1322 C C   . ASN A 1 175 ? -46.539 -27.228 51.787 1.00 15.00 ? 175 ASN A C   1 
ATOM   1323 O O   . ASN A 1 175 ? -46.629 -26.458 52.739 1.00 15.00 ? 175 ASN A O   1 
ATOM   1324 C CB  . ASN A 1 175 ? -46.443 -25.637 49.884 1.00 15.00 ? 175 ASN A CB  1 
ATOM   1325 C CG  . ASN A 1 175 ? -47.060 -25.145 48.594 1.00 15.00 ? 175 ASN A CG  1 
ATOM   1326 O OD1 . ASN A 1 175 ? -47.080 -25.857 47.579 1.00 15.00 ? 175 ASN A OD1 1 
ATOM   1327 N ND2 . ASN A 1 175 ? -47.565 -23.910 48.620 1.00 15.00 ? 175 ASN A ND2 1 
ATOM   1328 N N   . LYS A 1 176 ? -45.925 -28.400 51.867 1.00 15.00 ? 176 LYS A N   1 
ATOM   1329 C CA  . LYS A 1 176 ? -45.277 -28.838 53.092 1.00 15.00 ? 176 LYS A CA  1 
ATOM   1330 C C   . LYS A 1 176 ? -43.998 -28.030 53.205 1.00 15.00 ? 176 LYS A C   1 
ATOM   1331 O O   . LYS A 1 176 ? -43.367 -27.730 52.194 1.00 15.00 ? 176 LYS A O   1 
ATOM   1332 C CB  . LYS A 1 176 ? -44.977 -30.334 53.018 1.00 15.00 ? 176 LYS A CB  1 
ATOM   1333 C CG  . LYS A 1 176 ? -46.226 -31.183 52.841 1.00 15.00 ? 176 LYS A CG  1 
ATOM   1334 C CD  . LYS A 1 176 ? -45.949 -32.633 53.093 1.00 15.00 ? 176 LYS A CD  1 
ATOM   1335 C CE  . LYS A 1 176 ? -47.175 -33.475 52.820 1.00 15.00 ? 176 LYS A CE  1 
ATOM   1336 N NZ  . LYS A 1 176 ? -46.843 -34.933 52.776 1.00 15.00 ? 176 LYS A NZ  1 
ATOM   1337 N N   . HIS A 1 177 ? -43.592 -27.690 54.419 1.00 15.00 ? 177 HIS A N   1 
ATOM   1338 C CA  . HIS A 1 177 ? -42.394 -26.876 54.576 1.00 15.00 ? 177 HIS A CA  1 
ATOM   1339 C C   . HIS A 1 177 ? -41.677 -27.103 55.879 1.00 15.00 ? 177 HIS A C   1 
ATOM   1340 O O   . HIS A 1 177 ? -42.196 -27.759 56.778 1.00 15.00 ? 177 HIS A O   1 
ATOM   1341 C CB  . HIS A 1 177 ? -42.757 -25.395 54.505 1.00 15.00 ? 177 HIS A CB  1 
ATOM   1342 C CG  . HIS A 1 177 ? -43.615 -24.939 55.639 1.00 15.00 ? 177 HIS A CG  1 
ATOM   1343 N ND1 . HIS A 1 177 ? -44.964 -24.696 55.501 1.00 15.00 ? 177 HIS A ND1 1 
ATOM   1344 C CD2 . HIS A 1 177 ? -43.318 -24.684 56.937 1.00 15.00 ? 177 HIS A CD2 1 
ATOM   1345 C CE1 . HIS A 1 177 ? -45.461 -24.306 56.661 1.00 15.00 ? 177 HIS A CE1 1 
ATOM   1346 N NE2 . HIS A 1 177 ? -44.482 -24.293 57.548 1.00 15.00 ? 177 HIS A NE2 1 
ATOM   1347 N N   . TRP A 1 178 ? -40.524 -26.457 55.994 1.00 15.00 ? 178 TRP A N   1 
ATOM   1348 C CA  . TRP A 1 178 ? -39.688 -26.513 57.176 1.00 15.00 ? 178 TRP A CA  1 
ATOM   1349 C C   . TRP A 1 178 ? -39.730 -25.105 57.738 1.00 15.00 ? 178 TRP A C   1 
ATOM   1350 O O   . TRP A 1 178 ? -39.680 -24.136 56.973 1.00 15.00 ? 178 TRP A O   1 
ATOM   1351 C CB  . TRP A 1 178 ? -38.241 -26.838 56.791 1.00 15.00 ? 178 TRP A CB  1 
ATOM   1352 C CG  . TRP A 1 178 ? -38.006 -28.227 56.306 1.00 15.00 ? 178 TRP A CG  1 
ATOM   1353 C CD1 . TRP A 1 178 ? -37.555 -28.591 55.073 1.00 15.00 ? 178 TRP A CD1 1 
ATOM   1354 C CD2 . TRP A 1 178 ? -38.141 -29.446 57.063 1.00 15.00 ? 178 TRP A CD2 1 
ATOM   1355 N NE1 . TRP A 1 178 ? -37.381 -29.954 55.014 1.00 15.00 ? 178 TRP A NE1 1 
ATOM   1356 C CE2 . TRP A 1 178 ? -37.733 -30.505 56.218 1.00 15.00 ? 178 TRP A CE2 1 
ATOM   1357 C CE3 . TRP A 1 178 ? -38.558 -29.742 58.369 1.00 15.00 ? 178 TRP A CE3 1 
ATOM   1358 C CZ2 . TRP A 1 178 ? -37.732 -31.851 56.637 1.00 15.00 ? 178 TRP A CZ2 1 
ATOM   1359 C CZ3 . TRP A 1 178 ? -38.558 -31.078 58.789 1.00 15.00 ? 178 TRP A CZ3 1 
ATOM   1360 C CH2 . TRP A 1 178 ? -38.144 -32.117 57.918 1.00 15.00 ? 178 TRP A CH2 1 
ATOM   1361 N N   . ILE A 1 179 ? -39.901 -24.973 59.048 1.00 15.00 ? 179 ILE A N   1 
ATOM   1362 C CA  . ILE A 1 179 ? -39.914 -23.648 59.649 1.00 15.00 ? 179 ILE A CA  1 
ATOM   1363 C C   . ILE A 1 179 ? -38.465 -23.409 60.081 1.00 15.00 ? 179 ILE A C   1 
ATOM   1364 O O   . ILE A 1 179 ? -37.958 -24.055 60.998 1.00 15.00 ? 179 ILE A O   1 
ATOM   1365 C CB  . ILE A 1 179 ? -40.889 -23.547 60.841 1.00 15.00 ? 179 ILE A CB  1 
ATOM   1366 C CG1 . ILE A 1 179 ? -42.287 -24.022 60.429 1.00 15.00 ? 179 ILE A CG1 1 
ATOM   1367 C CG2 . ILE A 1 179 ? -40.950 -22.103 61.338 1.00 15.00 ? 179 ILE A CG2 1 
ATOM   1368 C CD1 . ILE A 1 179 ? -43.320 -23.946 61.553 1.00 15.00 ? 179 ILE A CD1 1 
ATOM   1369 N N   . ILE A 1 180 ? -37.793 -22.521 59.362 1.00 15.00 ? 180 ILE A N   1 
ATOM   1370 C CA  . ILE A 1 180 ? -36.395 -22.230 59.607 1.00 15.00 ? 180 ILE A CA  1 
ATOM   1371 C C   . ILE A 1 180 ? -36.127 -20.876 60.253 1.00 15.00 ? 180 ILE A C   1 
ATOM   1372 O O   . ILE A 1 180 ? -36.678 -19.850 59.845 1.00 15.00 ? 180 ILE A O   1 
ATOM   1373 C CB  . ILE A 1 180 ? -35.582 -22.340 58.287 1.00 15.00 ? 180 ILE A CB  1 
ATOM   1374 C CG1 . ILE A 1 180 ? -35.739 -23.736 57.684 1.00 15.00 ? 180 ILE A CG1 1 
ATOM   1375 C CG2 . ILE A 1 180 ? -34.137 -21.970 58.516 1.00 15.00 ? 180 ILE A CG2 1 
ATOM   1376 C CD1 . ILE A 1 180 ? -35.523 -24.882 58.660 1.00 15.00 ? 180 ILE A CD1 1 
ATOM   1377 N N   . LYS A 1 181 ? -35.244 -20.897 61.247 1.00 15.00 ? 181 LYS A N   1 
ATOM   1378 C CA  . LYS A 1 181 ? -34.839 -19.718 61.992 1.00 15.00 ? 181 LYS A CA  1 
ATOM   1379 C C   . LYS A 1 181 ? -33.461 -19.271 61.494 1.00 15.00 ? 181 LYS A C   1 
ATOM   1380 O O   . LYS A 1 181 ? -32.499 -20.028 61.564 1.00 15.00 ? 181 LYS A O   1 
ATOM   1381 C CB  . LYS A 1 181 ? -34.770 -20.057 63.482 1.00 15.00 ? 181 LYS A CB  1 
ATOM   1382 C CG  . LYS A 1 181 ? -34.664 -18.837 64.353 1.00 15.00 ? 181 LYS A CG  1 
ATOM   1383 C CD  . LYS A 1 181 ? -34.337 -19.172 65.793 1.00 15.00 ? 181 LYS A CD  1 
ATOM   1384 C CE  . LYS A 1 181 ? -34.163 -17.886 66.565 1.00 15.00 ? 181 LYS A CE  1 
ATOM   1385 N NZ  . LYS A 1 181 ? -33.686 -18.087 67.944 1.00 15.00 ? 181 LYS A NZ  1 
ATOM   1386 N N   . ASN A 1 182 ? -33.373 -18.051 60.980 1.00 15.00 ? 182 ASN A N   1 
ATOM   1387 C CA  . ASN A 1 182 ? -32.111 -17.524 60.473 1.00 15.00 ? 182 ASN A CA  1 
ATOM   1388 C C   . ASN A 1 182 ? -31.432 -16.624 61.514 1.00 15.00 ? 182 ASN A C   1 
ATOM   1389 O O   . ASN A 1 182 ? -32.001 -16.333 62.566 1.00 15.00 ? 182 ASN A O   1 
ATOM   1390 C CB  . ASN A 1 182 ? -32.334 -16.757 59.147 1.00 15.00 ? 182 ASN A CB  1 
ATOM   1391 C CG  . ASN A 1 182 ? -31.049 -16.644 58.286 1.00 15.00 ? 182 ASN A CG  1 
ATOM   1392 O OD1 . ASN A 1 182 ? -30.003 -17.214 58.605 1.00 15.00 ? 182 ASN A OD1 1 
ATOM   1393 N ND2 . ASN A 1 182 ? -31.146 -15.915 57.181 1.00 15.00 ? 182 ASN A ND2 1 
ATOM   1394 N N   . SER A 1 183 ? -30.185 -16.248 61.243 1.00 15.00 ? 183 SER A N   1 
ATOM   1395 C CA  . SER A 1 183 ? -29.434 -15.378 62.136 1.00 15.00 ? 183 SER A CA  1 
ATOM   1396 C C   . SER A 1 183 ? -28.964 -14.094 61.435 1.00 15.00 ? 183 SER A C   1 
ATOM   1397 O O   . SER A 1 183 ? -27.846 -13.631 61.662 1.00 15.00 ? 183 SER A O   1 
ATOM   1398 C CB  . SER A 1 183 ? -28.248 -16.129 62.752 1.00 15.00 ? 183 SER A CB  1 
ATOM   1399 O OG  . SER A 1 183 ? -27.476 -16.780 61.761 1.00 15.00 ? 183 SER A OG  1 
ATOM   1400 N N   . TRP A 1 184 ? -29.825 -13.518 60.591 1.00 15.00 ? 184 TRP A N   1 
ATOM   1401 C CA  . TRP A 1 184 ? -29.503 -12.277 59.883 1.00 15.00 ? 184 TRP A CA  1 
ATOM   1402 C C   . TRP A 1 184 ? -30.346 -11.105 60.400 1.00 15.00 ? 184 TRP A C   1 
ATOM   1403 O O   . TRP A 1 184 ? -30.506 -10.085 59.721 1.00 15.00 ? 184 TRP A O   1 
ATOM   1404 C CB  . TRP A 1 184 ? -29.686 -12.454 58.371 1.00 15.00 ? 184 TRP A CB  1 
ATOM   1405 C CG  . TRP A 1 184 ? -28.706 -13.438 57.763 1.00 15.00 ? 184 TRP A CG  1 
ATOM   1406 C CD1 . TRP A 1 184 ? -27.603 -13.976 58.366 1.00 15.00 ? 184 TRP A CD1 1 
ATOM   1407 C CD2 . TRP A 1 184 ? -28.737 -13.980 56.436 1.00 15.00 ? 184 TRP A CD2 1 
ATOM   1408 N NE1 . TRP A 1 184 ? -26.948 -14.808 57.498 1.00 15.00 ? 184 TRP A NE1 1 
ATOM   1409 C CE2 . TRP A 1 184 ? -27.620 -14.828 56.305 1.00 15.00 ? 184 TRP A CE2 1 
ATOM   1410 C CE3 . TRP A 1 184 ? -29.600 -13.826 55.342 1.00 15.00 ? 184 TRP A CE3 1 
ATOM   1411 C CZ2 . TRP A 1 184 ? -27.344 -15.525 55.126 1.00 15.00 ? 184 TRP A CZ2 1 
ATOM   1412 C CZ3 . TRP A 1 184 ? -29.327 -14.517 54.171 1.00 15.00 ? 184 TRP A CZ3 1 
ATOM   1413 C CH2 . TRP A 1 184 ? -28.209 -15.353 54.071 1.00 15.00 ? 184 TRP A CH2 1 
ATOM   1414 N N   . GLY A 1 185 ? -30.845 -11.250 61.628 1.00 15.00 ? 185 GLY A N   1 
ATOM   1415 C CA  . GLY A 1 185 ? -31.666 -10.224 62.242 1.00 15.00 ? 185 GLY A CA  1 
ATOM   1416 C C   . GLY A 1 185 ? -33.136 -10.426 61.938 1.00 15.00 ? 185 GLY A C   1 
ATOM   1417 O O   . GLY A 1 185 ? -33.487 -11.181 61.033 1.00 15.00 ? 185 GLY A O   1 
ATOM   1418 N N   . GLU A 1 186 ? -33.994 -9.728  62.682 1.00 15.00 ? 186 GLU A N   1 
ATOM   1419 C CA  . GLU A 1 186 ? -35.448 -9.830  62.502 1.00 15.00 ? 186 GLU A CA  1 
ATOM   1420 C C   . GLU A 1 186 ? -36.045 -9.155  61.268 1.00 15.00 ? 186 GLU A C   1 
ATOM   1421 O O   . GLU A 1 186 ? -37.100 -9.562  60.783 1.00 15.00 ? 186 GLU A O   1 
ATOM   1422 C CB  . GLU A 1 186 ? -36.173 -9.313  63.738 1.00 15.00 ? 186 GLU A CB  1 
ATOM   1423 C CG  . GLU A 1 186 ? -35.940 -10.144 64.975 1.00 15.00 ? 186 GLU A CG  1 
ATOM   1424 C CD  . GLU A 1 186 ? -37.154 -10.155 65.894 1.00 15.00 ? 186 GLU A CD  1 
ATOM   1425 O OE1 . GLU A 1 186 ? -38.257 -10.524 65.413 1.00 15.00 ? 186 GLU A OE1 1 
ATOM   1426 O OE2 . GLU A 1 186 ? -37.008 -9.811  67.094 1.00 15.00 ? 186 GLU A OE2 1 
ATOM   1427 N N   . ASN A 1 187 ? -35.383 -8.125  60.760 1.00 15.00 ? 187 ASN A N   1 
ATOM   1428 C CA  . ASN A 1 187 ? -35.889 -7.422  59.594 1.00 15.00 ? 187 ASN A CA  1 
ATOM   1429 C C   . ASN A 1 187 ? -35.605 -8.144  58.289 1.00 15.00 ? 187 ASN A C   1 
ATOM   1430 O O   . ASN A 1 187 ? -35.821 -7.570  57.219 1.00 15.00 ? 187 ASN A O   1 
ATOM   1431 C CB  . ASN A 1 187 ? -35.318 -6.003  59.519 1.00 15.00 ? 187 ASN A CB  1 
ATOM   1432 C CG  . ASN A 1 187 ? -35.951 -5.045  60.531 1.00 15.00 ? 187 ASN A CG  1 
ATOM   1433 O OD1 . ASN A 1 187 ? -35.822 -3.831  60.391 1.00 15.00 ? 187 ASN A OD1 1 
ATOM   1434 N ND2 . ASN A 1 187 ? -36.615 -5.580  61.561 1.00 15.00 ? 187 ASN A ND2 1 
ATOM   1435 N N   . TRP A 1 188 ? -35.115 -9.383  58.369 1.00 15.00 ? 188 TRP A N   1 
ATOM   1436 C CA  . TRP A 1 188 ? -34.814 -10.180 57.175 1.00 15.00 ? 188 TRP A CA  1 
ATOM   1437 C C   . TRP A 1 188 ? -35.882 -11.267 57.031 1.00 15.00 ? 188 TRP A C   1 
ATOM   1438 O O   . TRP A 1 188 ? -36.445 -11.714 58.036 1.00 15.00 ? 188 TRP A O   1 
ATOM   1439 C CB  . TRP A 1 188 ? -33.424 -10.835 57.282 1.00 15.00 ? 188 TRP A CB  1 
ATOM   1440 C CG  . TRP A 1 188 ? -33.156 -11.845 56.182 1.00 15.00 ? 188 TRP A CG  1 
ATOM   1441 C CD1 . TRP A 1 188 ? -32.602 -11.593 54.965 1.00 15.00 ? 188 TRP A CD1 1 
ATOM   1442 C CD2 . TRP A 1 188 ? -33.536 -13.235 56.168 1.00 15.00 ? 188 TRP A CD2 1 
ATOM   1443 N NE1 . TRP A 1 188 ? -32.625 -12.727 54.184 1.00 15.00 ? 188 TRP A NE1 1 
ATOM   1444 C CE2 . TRP A 1 188 ? -33.193 -13.748 54.893 1.00 15.00 ? 188 TRP A CE2 1 
ATOM   1445 C CE3 . TRP A 1 188 ? -34.142 -14.090 57.100 1.00 15.00 ? 188 TRP A CE3 1 
ATOM   1446 C CZ2 . TRP A 1 188 ? -33.438 -15.080 54.525 1.00 15.00 ? 188 TRP A CZ2 1 
ATOM   1447 C CZ3 . TRP A 1 188 ? -34.388 -15.417 56.736 1.00 15.00 ? 188 TRP A CZ3 1 
ATOM   1448 C CH2 . TRP A 1 188 ? -34.035 -15.896 55.457 1.00 15.00 ? 188 TRP A CH2 1 
ATOM   1449 N N   . GLY A 1 189 ? -36.142 -11.691 55.791 1.00 15.00 ? 189 GLY A N   1 
ATOM   1450 C CA  . GLY A 1 189 ? -37.133 -12.725 55.531 1.00 15.00 ? 189 GLY A CA  1 
ATOM   1451 C C   . GLY A 1 189 ? -38.452 -12.400 56.207 1.00 15.00 ? 189 GLY A C   1 
ATOM   1452 O O   . GLY A 1 189 ? -38.908 -11.264 56.152 1.00 15.00 ? 189 GLY A O   1 
ATOM   1453 N N   . ASN A 1 190 ? -39.069 -13.383 56.852 1.00 15.00 ? 190 ASN A N   1 
ATOM   1454 C CA  . ASN A 1 190 ? -40.326 -13.137 57.548 1.00 15.00 ? 190 ASN A CA  1 
ATOM   1455 C C   . ASN A 1 190 ? -40.028 -13.038 59.042 1.00 15.00 ? 190 ASN A C   1 
ATOM   1456 O O   . ASN A 1 190 ? -40.086 -14.045 59.760 1.00 15.00 ? 190 ASN A O   1 
ATOM   1457 C CB  . ASN A 1 190 ? -41.325 -14.266 57.288 1.00 15.00 ? 190 ASN A CB  1 
ATOM   1458 C CG  . ASN A 1 190 ? -42.742 -13.892 57.685 1.00 15.00 ? 190 ASN A CG  1 
ATOM   1459 O OD1 . ASN A 1 190 ? -42.979 -12.883 58.354 1.00 15.00 ? 190 ASN A OD1 1 
ATOM   1460 N ND2 . ASN A 1 190 ? -43.694 -14.700 57.261 1.00 15.00 ? 190 ASN A ND2 1 
ATOM   1461 N N   . LYS A 1 191 ? -39.684 -11.831 59.492 1.00 15.00 ? 191 LYS A N   1 
ATOM   1462 C CA  . LYS A 1 191 ? -39.342 -11.586 60.896 1.00 15.00 ? 191 LYS A CA  1 
ATOM   1463 C C   . LYS A 1 191 ? -38.182 -12.503 61.330 1.00 15.00 ? 191 LYS A C   1 
ATOM   1464 O O   . LYS A 1 191 ? -38.182 -13.069 62.438 1.00 15.00 ? 191 LYS A O   1 
ATOM   1465 C CB  . LYS A 1 191 ? -40.566 -11.787 61.811 1.00 15.00 ? 191 LYS A CB  1 
ATOM   1466 C CG  . LYS A 1 191 ? -41.665 -10.757 61.633 1.00 15.00 ? 191 LYS A CG  1 
ATOM   1467 C CD  . LYS A 1 191 ? -42.978 -11.226 62.266 1.00 15.00 ? 191 LYS A CD  1 
ATOM   1468 C CE  . LYS A 1 191 ? -43.687 -12.289 61.412 1.00 15.00 ? 191 LYS A CE  1 
ATOM   1469 N NZ  . LYS A 1 191 ? -42.878 -13.538 61.161 1.00 15.00 ? 191 LYS A NZ  1 
ATOM   1470 N N   . GLY A 1 192 ? -37.217 -12.668 60.428 1.00 15.00 ? 192 GLY A N   1 
ATOM   1471 C CA  . GLY A 1 192 ? -36.061 -13.506 60.707 1.00 15.00 ? 192 GLY A CA  1 
ATOM   1472 C C   . GLY A 1 192 ? -36.268 -14.987 60.448 1.00 15.00 ? 192 GLY A C   1 
ATOM   1473 O O   . GLY A 1 192 ? -35.410 -15.806 60.778 1.00 15.00 ? 192 GLY A O   1 
ATOM   1474 N N   . TYR A 1 193 ? -37.404 -15.344 59.869 1.00 15.00 ? 193 TYR A N   1 
ATOM   1475 C CA  . TYR A 1 193 ? -37.688 -16.736 59.575 1.00 15.00 ? 193 TYR A CA  1 
ATOM   1476 C C   . TYR A 1 193 ? -37.923 -16.950 58.097 1.00 15.00 ? 193 TYR A C   1 
ATOM   1477 O O   . TYR A 1 193 ? -38.216 -16.006 57.359 1.00 15.00 ? 193 TYR A O   1 
ATOM   1478 C CB  . TYR A 1 193 ? -38.927 -17.205 60.328 1.00 15.00 ? 193 TYR A CB  1 
ATOM   1479 C CG  . TYR A 1 193 ? -38.684 -17.492 61.779 1.00 15.00 ? 193 TYR A CG  1 
ATOM   1480 C CD1 . TYR A 1 193 ? -38.809 -16.482 62.740 1.00 15.00 ? 193 TYR A CD1 1 
ATOM   1481 C CD2 . TYR A 1 193 ? -38.307 -18.765 62.200 1.00 15.00 ? 193 TYR A CD2 1 
ATOM   1482 C CE1 . TYR A 1 193 ? -38.559 -16.735 64.087 1.00 15.00 ? 193 TYR A CE1 1 
ATOM   1483 C CE2 . TYR A 1 193 ? -38.056 -19.030 63.546 1.00 15.00 ? 193 TYR A CE2 1 
ATOM   1484 C CZ  . TYR A 1 193 ? -38.182 -18.010 64.480 1.00 15.00 ? 193 TYR A CZ  1 
ATOM   1485 O OH  . TYR A 1 193 ? -37.911 -18.263 65.811 1.00 15.00 ? 193 TYR A OH  1 
ATOM   1486 N N   . ILE A 1 194 ? -37.813 -18.207 57.684 1.00 15.00 ? 194 ILE A N   1 
ATOM   1487 C CA  . ILE A 1 194 ? -38.043 -18.598 56.306 1.00 15.00 ? 194 ILE A CA  1 
ATOM   1488 C C   . ILE A 1 194 ? -38.627 -20.003 56.295 1.00 15.00 ? 194 ILE A C   1 
ATOM   1489 O O   . ILE A 1 194 ? -38.160 -20.878 57.014 1.00 15.00 ? 194 ILE A O   1 
ATOM   1490 C CB  . ILE A 1 194 ? -36.732 -18.545 55.434 1.00 15.00 ? 194 ILE A CB  1 
ATOM   1491 C CG1 . ILE A 1 194 ? -37.005 -19.097 54.026 1.00 15.00 ? 194 ILE A CG1 1 
ATOM   1492 C CG2 . ILE A 1 194 ? -35.605 -19.332 56.085 1.00 15.00 ? 194 ILE A CG2 1 
ATOM   1493 C CD1 . ILE A 1 194 ? -35.852 -18.959 53.074 1.00 15.00 ? 194 ILE A CD1 1 
ATOM   1494 N N   . LEU A 1 195 ? -39.716 -20.180 55.553 1.00 15.00 ? 195 LEU A N   1 
ATOM   1495 C CA  . LEU A 1 195 ? -40.342 -21.490 55.424 1.00 15.00 ? 195 LEU A CA  1 
ATOM   1496 C C   . LEU A 1 195 ? -39.760 -22.051 54.130 1.00 15.00 ? 195 LEU A C   1 
ATOM   1497 O O   . LEU A 1 195 ? -39.933 -21.455 53.061 1.00 15.00 ? 195 LEU A O   1 
ATOM   1498 C CB  . LEU A 1 195 ? -41.865 -21.369 55.277 1.00 15.00 ? 195 LEU A CB  1 
ATOM   1499 C CG  . LEU A 1 195 ? -42.725 -20.470 56.175 1.00 15.00 ? 195 LEU A CG  1 
ATOM   1500 C CD1 . LEU A 1 195 ? -44.178 -20.597 55.734 1.00 15.00 ? 195 LEU A CD1 1 
ATOM   1501 C CD2 . LEU A 1 195 ? -42.575 -20.812 57.648 1.00 15.00 ? 195 LEU A CD2 1 
ATOM   1502 N N   . MET A 1 196 ? -39.026 -23.153 54.215 1.00 15.00 ? 196 MET A N   1 
ATOM   1503 C CA  . MET A 1 196 ? -38.429 -23.752 53.022 1.00 15.00 ? 196 MET A CA  1 
ATOM   1504 C C   . MET A 1 196 ? -39.161 -25.048 52.644 1.00 15.00 ? 196 MET A C   1 
ATOM   1505 O O   . MET A 1 196 ? -39.623 -25.771 53.522 1.00 15.00 ? 196 MET A O   1 
ATOM   1506 C CB  . MET A 1 196 ? -36.944 -24.019 53.264 1.00 15.00 ? 196 MET A CB  1 
ATOM   1507 C CG  . MET A 1 196 ? -36.138 -22.769 53.555 1.00 15.00 ? 196 MET A CG  1 
ATOM   1508 S SD  . MET A 1 196 ? -34.440 -23.128 54.064 1.00 15.00 ? 196 MET A SD  1 
ATOM   1509 C CE  . MET A 1 196 ? -33.700 -23.507 52.448 1.00 15.00 ? 196 MET A CE  1 
ATOM   1510 N N   . ALA A 1 197 ? -39.260 -25.335 51.348 1.00 15.00 ? 197 ALA A N   1 
ATOM   1511 C CA  . ALA A 1 197 ? -39.951 -26.528 50.863 1.00 15.00 ? 197 ALA A CA  1 
ATOM   1512 C C   . ALA A 1 197 ? -39.516 -27.840 51.522 1.00 15.00 ? 197 ALA A C   1 
ATOM   1513 O O   . ALA A 1 197 ? -38.323 -28.081 51.728 1.00 15.00 ? 197 ALA A O   1 
ATOM   1514 C CB  . ALA A 1 197 ? -39.822 -26.628 49.358 1.00 15.00 ? 197 ALA A CB  1 
ATOM   1515 N N   . ARG A 1 198 ? -40.499 -28.678 51.851 1.00 15.00 ? 198 ARG A N   1 
ATOM   1516 C CA  . ARG A 1 198 ? -40.273 -29.977 52.485 1.00 15.00 ? 198 ARG A CA  1 
ATOM   1517 C C   . ARG A 1 198 ? -40.726 -31.091 51.563 1.00 15.00 ? 198 ARG A C   1 
ATOM   1518 O O   . ARG A 1 198 ? -41.787 -30.995 50.958 1.00 15.00 ? 198 ARG A O   1 
ATOM   1519 C CB  . ARG A 1 198 ? -41.041 -30.070 53.807 1.00 15.00 ? 198 ARG A CB  1 
ATOM   1520 C CG  . ARG A 1 198 ? -41.065 -31.447 54.434 1.00 15.00 ? 198 ARG A CG  1 
ATOM   1521 C CD  . ARG A 1 198 ? -41.332 -31.376 55.935 1.00 15.00 ? 198 ARG A CD  1 
ATOM   1522 N NE  . ARG A 1 198 ? -42.614 -30.755 56.264 1.00 15.00 ? 198 ARG A NE  1 
ATOM   1523 C CZ  . ARG A 1 198 ? -43.753 -31.423 56.440 1.00 15.00 ? 198 ARG A CZ  1 
ATOM   1524 N NH1 . ARG A 1 198 ? -43.784 -32.745 56.324 1.00 15.00 ? 198 ARG A NH1 1 
ATOM   1525 N NH2 . ARG A 1 198 ? -44.873 -30.760 56.696 1.00 15.00 ? 198 ARG A NH2 1 
ATOM   1526 N N   . ASN A 1 199 ? -39.949 -32.171 51.525 1.00 15.00 ? 199 ASN A N   1 
ATOM   1527 C CA  . ASN A 1 199 ? -40.218 -33.334 50.681 1.00 15.00 ? 199 ASN A CA  1 
ATOM   1528 C C   . ASN A 1 199 ? -40.158 -32.941 49.212 1.00 15.00 ? 199 ASN A C   1 
ATOM   1529 O O   . ASN A 1 199 ? -40.837 -33.530 48.364 1.00 15.00 ? 199 ASN A O   1 
ATOM   1530 C CB  . ASN A 1 199 ? -41.580 -33.971 50.987 1.00 15.00 ? 199 ASN A CB  1 
ATOM   1531 C CG  . ASN A 1 199 ? -41.667 -34.518 52.391 1.00 15.00 ? 199 ASN A CG  1 
ATOM   1532 O OD1 . ASN A 1 199 ? -40.691 -34.503 53.138 1.00 15.00 ? 199 ASN A OD1 1 
ATOM   1533 N ND2 . ASN A 1 199 ? -42.846 -34.995 52.766 1.00 15.00 ? 199 ASN A ND2 1 
ATOM   1534 N N   . LYS A 1 200 ? -39.355 -31.929 48.913 1.00 15.00 ? 200 LYS A N   1 
ATOM   1535 C CA  . LYS A 1 200 ? -39.207 -31.489 47.547 1.00 15.00 ? 200 LYS A CA  1 
ATOM   1536 C C   . LYS A 1 200 ? -37.785 -31.846 47.166 1.00 15.00 ? 200 LYS A C   1 
ATOM   1537 O O   . LYS A 1 200 ? -36.944 -30.976 46.933 1.00 15.00 ? 200 LYS A O   1 
ATOM   1538 C CB  . LYS A 1 200 ? -39.467 -29.990 47.430 1.00 15.00 ? 200 LYS A CB  1 
ATOM   1539 C CG  . LYS A 1 200 ? -40.304 -29.635 46.222 1.00 15.00 ? 200 LYS A CG  1 
ATOM   1540 C CD  . LYS A 1 200 ? -41.121 -28.370 46.456 1.00 15.00 ? 200 LYS A CD  1 
ATOM   1541 C CE  . LYS A 1 200 ? -42.160 -28.184 45.357 1.00 15.00 ? 200 LYS A CE  1 
ATOM   1542 N NZ  . LYS A 1 200 ? -41.561 -28.023 43.989 1.00 15.00 ? 200 LYS A NZ  1 
ATOM   1543 N N   . ASN A 1 201 ? -37.513 -33.146 47.205 1.00 15.00 ? 201 ASN A N   1 
ATOM   1544 C CA  . ASN A 1 201 ? -36.210 -33.690 46.863 1.00 15.00 ? 201 ASN A CA  1 
ATOM   1545 C C   . ASN A 1 201 ? -35.028 -33.164 47.668 1.00 15.00 ? 201 ASN A C   1 
ATOM   1546 O O   . ASN A 1 201 ? -33.944 -32.958 47.112 1.00 15.00 ? 201 ASN A O   1 
ATOM   1547 C CB  . ASN A 1 201 ? -35.939 -33.508 45.373 1.00 15.00 ? 201 ASN A CB  1 
ATOM   1548 C CG  . ASN A 1 201 ? -36.894 -34.296 44.516 1.00 15.00 ? 201 ASN A CG  1 
ATOM   1549 O OD1 . ASN A 1 201 ? -37.201 -35.461 44.809 1.00 15.00 ? 201 ASN A OD1 1 
ATOM   1550 N ND2 . ASN A 1 201 ? -37.400 -33.663 43.467 1.00 15.00 ? 201 ASN A ND2 1 
ATOM   1551 N N   . ASN A 1 202 ? -35.230 -32.997 48.977 1.00 15.00 ? 202 ASN A N   1 
ATOM   1552 C CA  . ASN A 1 202 ? -34.184 -32.513 49.892 1.00 15.00 ? 202 ASN A CA  1 
ATOM   1553 C C   . ASN A 1 202 ? -33.662 -31.158 49.408 1.00 15.00 ? 202 ASN A C   1 
ATOM   1554 O O   . ASN A 1 202 ? -32.459 -30.954 49.274 1.00 15.00 ? 202 ASN A O   1 
ATOM   1555 C CB  . ASN A 1 202 ? -33.043 -33.539 49.988 1.00 15.00 ? 202 ASN A CB  1 
ATOM   1556 C CG  . ASN A 1 202 ? -32.049 -33.226 51.103 1.00 15.00 ? 202 ASN A CG  1 
ATOM   1557 O OD1 . ASN A 1 202 ? -32.410 -32.667 52.141 1.00 15.00 ? 202 ASN A OD1 1 
ATOM   1558 N ND2 . ASN A 1 202 ? -30.790 -33.594 50.891 1.00 15.00 ? 202 ASN A ND2 1 
ATOM   1559 N N   . ALA A 1 203 ? -34.570 -30.226 49.181 1.00 15.00 ? 203 ALA A N   1 
ATOM   1560 C CA  . ALA A 1 203 ? -34.308 -28.897 48.631 1.00 15.00 ? 203 ALA A CA  1 
ATOM   1561 C C   . ALA A 1 203 ? -33.196 -28.207 49.437 1.00 15.00 ? 203 ALA A C   1 
ATOM   1562 O O   . ALA A 1 203 ? -33.271 -28.012 50.636 1.00 15.00 ? 203 ALA A O   1 
ATOM   1563 C CB  . ALA A 1 203 ? -35.547 -28.011 48.724 1.00 15.00 ? 203 ALA A CB  1 
ATOM   1564 N N   . CYS A 1 204 ? -32.188 -27.724 48.677 1.00 15.00 ? 204 CYS A N   1 
ATOM   1565 C CA  . CYS A 1 204 ? -31.051 -26.981 49.215 1.00 15.00 ? 204 CYS A CA  1 
ATOM   1566 C C   . CYS A 1 204 ? -30.211 -27.754 50.222 1.00 15.00 ? 204 CYS A C   1 
ATOM   1567 O O   . CYS A 1 204 ? -29.444 -27.144 50.969 1.00 15.00 ? 204 CYS A O   1 
ATOM   1568 C CB  . CYS A 1 204 ? -31.507 -25.669 49.864 1.00 15.00 ? 204 CYS A CB  1 
ATOM   1569 S SG  . CYS A 1 204 ? -32.468 -24.527 48.822 1.00 15.00 ? 204 CYS A SG  1 
ATOM   1570 N N   . GLY A 1 205 ? -30.371 -29.074 50.265 1.00 15.00 ? 205 GLY A N   1 
ATOM   1571 C CA  . GLY A 1 205 ? -29.604 -29.894 51.195 1.00 15.00 ? 205 GLY A CA  1 
ATOM   1572 C C   . GLY A 1 205 ? -30.010 -29.846 52.663 1.00 15.00 ? 205 GLY A C   1 
ATOM   1573 O O   . GLY A 1 205 ? -29.231 -30.214 53.549 1.00 15.00 ? 205 GLY A O   1 
ATOM   1574 N N   . ILE A 1 206 ? -31.271 -29.495 52.904 1.00 15.00 ? 206 ILE A N   1 
ATOM   1575 C CA  . ILE A 1 206 ? -31.843 -29.375 54.253 1.00 15.00 ? 206 ILE A CA  1 
ATOM   1576 C C   . ILE A 1 206 ? -31.585 -30.568 55.190 1.00 15.00 ? 206 ILE A C   1 
ATOM   1577 O O   . ILE A 1 206 ? -31.419 -30.392 56.401 1.00 15.00 ? 206 ILE A O   1 
ATOM   1578 C CB  . ILE A 1 206 ? -33.375 -29.055 54.167 1.00 15.00 ? 206 ILE A CB  1 
ATOM   1579 C CG1 . ILE A 1 206 ? -33.941 -28.692 55.542 1.00 15.00 ? 206 ILE A CG1 1 
ATOM   1580 C CG2 . ILE A 1 206 ? -34.132 -30.206 53.530 1.00 15.00 ? 206 ILE A CG2 1 
ATOM   1581 C CD1 . ILE A 1 206 ? -33.539 -27.314 56.024 1.00 15.00 ? 206 ILE A CD1 1 
ATOM   1582 N N   . ALA A 1 207 ? -31.517 -31.775 54.644 1.00 15.00 ? 207 ALA A N   1 
ATOM   1583 C CA  . ALA A 1 207 ? -31.266 -32.945 55.488 1.00 15.00 ? 207 ALA A CA  1 
ATOM   1584 C C   . ALA A 1 207 ? -29.886 -33.577 55.258 1.00 15.00 ? 207 ALA A C   1 
ATOM   1585 O O   . ALA A 1 207 ? -29.620 -34.700 55.699 1.00 15.00 ? 207 ALA A O   1 
ATOM   1586 C CB  . ALA A 1 207 ? -32.378 -33.991 55.311 1.00 15.00 ? 207 ALA A CB  1 
ATOM   1587 N N   . ASN A 1 208 ? -28.990 -32.838 54.619 1.00 15.00 ? 208 ASN A N   1 
ATOM   1588 C CA  . ASN A 1 208 ? -27.660 -33.356 54.345 1.00 15.00 ? 208 ASN A CA  1 
ATOM   1589 C C   . ASN A 1 208 ? -26.673 -33.323 55.514 1.00 15.00 ? 208 ASN A C   1 
ATOM   1590 O O   . ASN A 1 208 ? -25.804 -34.185 55.610 1.00 15.00 ? 208 ASN A O   1 
ATOM   1591 C CB  . ASN A 1 208 ? -27.052 -32.651 53.132 1.00 15.00 ? 208 ASN A CB  1 
ATOM   1592 C CG  . ASN A 1 208 ? -27.493 -33.271 51.827 1.00 15.00 ? 208 ASN A CG  1 
ATOM   1593 O OD1 . ASN A 1 208 ? -27.922 -34.426 51.789 1.00 15.00 ? 208 ASN A OD1 1 
ATOM   1594 N ND2 . ASN A 1 208 ? -27.393 -32.510 50.749 1.00 15.00 ? 208 ASN A ND2 1 
ATOM   1595 N N   . LEU A 1 209 ? -26.820 -32.346 56.401 1.00 15.00 ? 209 LEU A N   1 
ATOM   1596 C CA  . LEU A 1 209 ? -25.920 -32.195 57.535 1.00 15.00 ? 209 LEU A CA  1 
ATOM   1597 C C   . LEU A 1 209 ? -26.691 -31.675 58.747 1.00 15.00 ? 209 LEU A C   1 
ATOM   1598 O O   . LEU A 1 209 ? -26.544 -30.520 59.145 1.00 15.00 ? 209 LEU A O   1 
ATOM   1599 C CB  . LEU A 1 209 ? -24.792 -31.224 57.163 1.00 15.00 ? 209 LEU A CB  1 
ATOM   1600 C CG  . LEU A 1 209 ? -23.530 -31.175 58.023 1.00 15.00 ? 209 LEU A CG  1 
ATOM   1601 C CD1 . LEU A 1 209 ? -22.720 -32.435 57.774 1.00 15.00 ? 209 LEU A CD1 1 
ATOM   1602 C CD2 . LEU A 1 209 ? -22.718 -29.927 57.681 1.00 15.00 ? 209 LEU A CD2 1 
ATOM   1603 N N   . ALA A 1 210 ? -27.500 -32.549 59.340 1.00 15.00 ? 210 ALA A N   1 
ATOM   1604 C CA  . ALA A 1 210 ? -28.317 -32.122 60.475 1.00 15.00 ? 210 ALA A CA  1 
ATOM   1605 C C   . ALA A 1 210 ? -27.942 -32.936 61.723 1.00 15.00 ? 210 ALA A C   1 
ATOM   1606 O O   . ALA A 1 210 ? -27.568 -34.095 61.635 1.00 15.00 ? 210 ALA A O   1 
ATOM   1607 C CB  . ALA A 1 210 ? -29.799 -32.369 60.206 1.00 15.00 ? 210 ALA A CB  1 
ATOM   1608 N N   . SER A 1 211 ? -28.101 -32.289 62.878 1.00 15.00 ? 211 SER A N   1 
ATOM   1609 C CA  . SER A 1 211 ? -27.797 -32.921 64.153 1.00 15.00 ? 211 SER A CA  1 
ATOM   1610 C C   . SER A 1 211 ? -28.461 -32.192 65.329 1.00 15.00 ? 211 SER A C   1 
ATOM   1611 O O   . SER A 1 211 ? -29.010 -31.093 65.172 1.00 15.00 ? 211 SER A O   1 
ATOM   1612 C CB  . SER A 1 211 ? -26.276 -32.966 64.369 1.00 15.00 ? 211 SER A CB  1 
ATOM   1613 O OG  . SER A 1 211 ? -25.707 -31.664 64.339 1.00 15.00 ? 211 SER A OG  1 
ATOM   1614 N N   . PHE A 1 212 ? -28.431 -32.827 66.496 1.00 15.00 ? 212 PHE A N   1 
ATOM   1615 C CA  . PHE A 1 212 ? -28.981 -32.236 67.709 1.00 15.00 ? 212 PHE A CA  1 
ATOM   1616 C C   . PHE A 1 212 ? -28.178 -32.662 68.956 1.00 15.00 ? 212 PHE A C   1 
ATOM   1617 O O   . PHE A 1 212 ? -27.649 -33.772 69.032 1.00 15.00 ? 212 PHE A O   1 
ATOM   1618 C CB  . PHE A 1 212 ? -30.464 -32.586 67.857 1.00 15.00 ? 212 PHE A CB  1 
ATOM   1619 C CG  . PHE A 1 212 ? -30.742 -34.061 67.929 1.00 15.00 ? 212 PHE A CG  1 
ATOM   1620 C CD1 . PHE A 1 212 ? -30.757 -34.722 69.156 1.00 15.00 ? 212 PHE A CD1 1 
ATOM   1621 C CD2 . PHE A 1 212 ? -31.032 -34.786 66.769 1.00 15.00 ? 212 PHE A CD2 1 
ATOM   1622 C CE1 . PHE A 1 212 ? -31.062 -36.080 69.223 1.00 15.00 ? 212 PHE A CE1 1 
ATOM   1623 C CE2 . PHE A 1 212 ? -31.336 -36.135 66.829 1.00 15.00 ? 212 PHE A CE2 1 
ATOM   1624 C CZ  . PHE A 1 212 ? -31.354 -36.787 68.051 1.00 15.00 ? 212 PHE A CZ  1 
ATOM   1625 N N   . PRO A 1 213 ? -28.027 -31.758 69.923 1.00 15.00 ? 213 PRO A N   1 
ATOM   1626 C CA  . PRO A 1 213 ? -27.276 -32.110 71.127 1.00 15.00 ? 213 PRO A CA  1 
ATOM   1627 C C   . PRO A 1 213 ? -28.101 -33.029 72.011 1.00 15.00 ? 213 PRO A C   1 
ATOM   1628 O O   . PRO A 1 213 ? -29.330 -33.003 71.953 1.00 15.00 ? 213 PRO A O   1 
ATOM   1629 C CB  . PRO A 1 213 ? -27.068 -30.757 71.790 1.00 15.00 ? 213 PRO A CB  1 
ATOM   1630 C CG  . PRO A 1 213 ? -28.333 -30.030 71.426 1.00 15.00 ? 213 PRO A CG  1 
ATOM   1631 C CD  . PRO A 1 213 ? -28.510 -30.368 69.981 1.00 15.00 ? 213 PRO A CD  1 
ATOM   1632 N N   . LYS A 1 214 ? -27.424 -33.861 72.797 1.00 15.00 ? 214 LYS A N   1 
ATOM   1633 C CA  . LYS A 1 214 ? -28.078 -34.781 73.730 1.00 15.00 ? 214 LYS A CA  1 
ATOM   1634 C C   . LYS A 1 214 ? -27.602 -34.345 75.098 1.00 15.00 ? 214 LYS A C   1 
ATOM   1635 O O   . LYS A 1 214 ? -26.429 -34.001 75.258 1.00 15.00 ? 214 LYS A O   1 
ATOM   1636 C CB  . LYS A 1 214 ? -27.637 -36.231 73.495 1.00 15.00 ? 214 LYS A CB  1 
ATOM   1637 C CG  . LYS A 1 214 ? -27.921 -36.753 72.104 1.00 15.00 ? 214 LYS A CG  1 
ATOM   1638 C CD  . LYS A 1 214 ? -27.722 -38.258 72.003 1.00 15.00 ? 214 LYS A CD  1 
ATOM   1639 C CE  . LYS A 1 214 ? -26.289 -38.661 72.298 1.00 15.00 ? 214 LYS A CE  1 
ATOM   1640 N NZ  . LYS A 1 214 ? -26.004 -39.993 71.690 1.00 15.00 ? 214 LYS A NZ  1 
ATOM   1641 N N   . MET A 1 215 ? -28.505 -34.300 76.069 1.00 15.00 ? 215 MET A N   1 
ATOM   1642 C CA  . MET A 1 215 ? -28.121 -33.896 77.415 1.00 15.00 ? 215 MET A CA  1 
ATOM   1643 C C   . MET A 1 215 ? -28.259 -35.088 78.364 1.00 15.00 ? 215 MET A C   1 
ATOM   1644 O O   . MET A 1 215 ? -27.929 -34.955 79.553 1.00 15.00 ? 215 MET A O   1 
ATOM   1645 C CB  . MET A 1 215 ? -28.973 -32.715 77.887 1.00 15.00 ? 215 MET A CB  1 
ATOM   1646 C CG  . MET A 1 215 ? -28.965 -31.511 76.948 1.00 15.00 ? 215 MET A CG  1 
ATOM   1647 S SD  . MET A 1 215 ? -29.627 -30.019 77.755 1.00 15.00 ? 215 MET A SD  1 
ATOM   1648 C CE  . MET A 1 215 ? -28.683 -28.689 76.949 1.00 15.00 ? 215 MET A CE  1 
ATOM   1649 O OXT . MET A 1 215 ? -28.653 -36.171 77.890 1.00 15.00 ? 215 MET A OXT 1 
HETATM 1650 C C1  . INA B 2 .   ? -28.282 -9.310  55.936 1.00 15.00 ? 300 INA A C1  1 
HETATM 1651 C C2  . INA B 2 .   ? -28.070 -9.033  57.305 1.00 15.00 ? 300 INA A C2  1 
HETATM 1652 C C3  . INA B 2 .   ? -27.111 -9.775  58.032 1.00 15.00 ? 300 INA A C3  1 
HETATM 1653 C C4  . INA B 2 .   ? -26.368 -10.782 57.404 1.00 15.00 ? 300 INA A C4  1 
HETATM 1654 C C5  . INA B 2 .   ? -26.594 -11.048 56.046 1.00 15.00 ? 300 INA A C5  1 
HETATM 1655 C C6  . INA B 2 .   ? -27.542 -10.321 55.310 1.00 15.00 ? 300 INA A C6  1 
HETATM 1656 C C7  . INA B 2 .   ? -25.312 -11.537 58.158 1.00 15.00 ? 300 INA A C7  1 
HETATM 1657 O O8  . INA B 2 .   ? -24.191 -11.680 57.239 1.00 15.00 ? 300 INA A O8  1 
HETATM 1658 C C9  . INA B 2 .   ? -23.288 -12.790 57.200 1.00 15.00 ? 300 INA A C9  1 
HETATM 1659 O O10 . INA B 2 .   ? -22.497 -12.994 58.133 1.00 15.00 ? 300 INA A O10 1 
HETATM 1660 C C11 . INA B 2 .   ? -22.453 -14.708 55.877 1.00 15.00 ? 300 INA A C11 1 
HETATM 1661 C C12 . INA B 2 .   ? -21.047 -14.473 56.477 1.00 15.00 ? 300 INA A C12 1 
HETATM 1662 C C13 . INA B 2 .   ? -20.107 -13.384 55.921 1.00 15.00 ? 300 INA A C13 1 
HETATM 1663 C C14 . INA B 2 .   ? -19.146 -12.915 57.006 1.00 15.00 ? 300 INA A C14 1 
HETATM 1664 C C15 . INA B 2 .   ? -20.827 -12.173 55.229 1.00 15.00 ? 300 INA A C15 1 
HETATM 1665 C C16 . INA B 2 .   ? -23.003 -16.056 56.345 1.00 15.00 ? 300 INA A C16 1 
HETATM 1666 O O17 . INA B 2 .   ? -24.158 -16.147 56.754 1.00 15.00 ? 300 INA A O17 1 
HETATM 1667 N N18 . INA B 2 .   ? -22.192 -17.174 56.304 1.00 15.00 ? 300 INA A N18 1 
HETATM 1668 N N19 . INA B 2 .   ? -22.624 -18.534 56.742 1.00 15.00 ? 300 INA A N19 1 
HETATM 1669 N N20 . INA B 2 .   ? -23.336 -13.552 56.102 1.00 15.00 ? 300 INA A N20 1 
HETATM 1670 C C21 . INA B 2 .   ? -22.089 -18.852 58.136 1.00 15.00 ? 300 INA A C21 1 
HETATM 1671 O O22 . INA B 2 .   ? -22.102 -17.804 58.750 1.00 15.00 ? 300 INA A O22 1 
HETATM 1672 C C23 . INA B 2 .   ? -12.778 -27.305 59.765 1.00 15.00 ? 300 INA A C23 1 
HETATM 1673 C C24 . INA B 2 .   ? -13.750 -26.799 60.623 1.00 15.00 ? 300 INA A C24 1 
HETATM 1674 C C25 . INA B 2 .   ? -14.614 -25.791 60.172 1.00 15.00 ? 300 INA A C25 1 
HETATM 1675 C C26 . INA B 2 .   ? -14.516 -25.287 58.879 1.00 15.00 ? 300 INA A C26 1 
HETATM 1676 C C27 . INA B 2 .   ? -13.536 -25.805 58.031 1.00 15.00 ? 300 INA A C27 1 
HETATM 1677 C C28 . INA B 2 .   ? -12.667 -26.809 58.471 1.00 15.00 ? 300 INA A C28 1 
HETATM 1678 C C29 . INA B 2 .   ? -15.452 -24.211 58.400 1.00 15.00 ? 300 INA A C29 1 
HETATM 1679 O O30 . INA B 2 .   ? -16.523 -24.580 57.487 1.00 15.00 ? 300 INA A O30 1 
HETATM 1680 C C31 . INA B 2 .   ? -17.558 -23.663 57.052 1.00 15.00 ? 300 INA A C31 1 
HETATM 1681 O O32 . INA B 2 .   ? -17.320 -22.741 56.267 1.00 15.00 ? 300 INA A O32 1 
HETATM 1682 C C33 . INA B 2 .   ? -19.948 -23.086 57.184 1.00 15.00 ? 300 INA A C33 1 
HETATM 1683 C C34 . INA B 2 .   ? -21.231 -23.902 57.348 1.00 15.00 ? 300 INA A C34 1 
HETATM 1684 C C35 . INA B 2 .   ? -21.105 -25.252 58.035 1.00 15.00 ? 300 INA A C35 1 
HETATM 1685 C C36 . INA B 2 .   ? -22.315 -25.592 58.888 1.00 15.00 ? 300 INA A C36 1 
HETATM 1686 C C37 . INA B 2 .   ? -20.840 -26.311 56.988 1.00 15.00 ? 300 INA A C37 1 
HETATM 1687 C C38 . INA B 2 .   ? -20.066 -21.831 58.030 1.00 15.00 ? 300 INA A C38 1 
HETATM 1688 O O39 . INA B 2 .   ? -19.736 -21.858 59.216 1.00 15.00 ? 300 INA A O39 1 
HETATM 1689 N N40 . INA B 2 .   ? -20.558 -20.703 57.430 1.00 15.00 ? 300 INA A N40 1 
HETATM 1690 N N41 . INA B 2 .   ? -20.704 -19.436 58.209 1.00 15.00 ? 300 INA A N41 1 
HETATM 1691 N N42 . INA B 2 .   ? -18.779 -23.896 57.541 1.00 15.00 ? 300 INA A N42 1 
HETATM 1692 O O   . HOH C 3 .   ? -26.084 -16.545 83.967 1.00 15.00 ? 301 HOH A O   1 
HETATM 1693 O O   . HOH C 3 .   ? -20.532 -32.332 79.432 1.00 15.00 ? 302 HOH A O   1 
HETATM 1694 O O   . HOH C 3 .   ? -31.213 -16.222 65.486 1.00 15.00 ? 303 HOH A O   1 
HETATM 1695 O O   . HOH C 3 .   ? -30.953 -18.194 68.228 1.00 15.00 ? 304 HOH A O   1 
HETATM 1696 O O   . HOH C 3 .   ? -6.955  -10.588 69.845 1.00 15.00 ? 305 HOH A O   1 
HETATM 1697 O O   . HOH C 3 .   ? -15.235 -12.625 73.085 1.00 15.00 ? 306 HOH A O   1 
HETATM 1698 O O   . HOH C 3 .   ? -34.528 -23.510 69.956 1.00 15.00 ? 307 HOH A O   1 
HETATM 1699 O O   . HOH C 3 .   ? -13.781 -33.079 69.631 1.00 15.00 ? 308 HOH A O   1 
HETATM 1700 O O   . HOH C 3 .   ? -17.841 -17.710 57.566 1.00 15.00 ? 309 HOH A O   1 
HETATM 1701 O O   . HOH C 3 .   ? -24.918 -31.020 61.653 1.00 15.00 ? 310 HOH A O   1 
HETATM 1702 O O   . HOH C 3 .   ? -12.757 -8.209  61.816 1.00 15.00 ? 311 HOH A O   1 
HETATM 1703 O O   . HOH C 3 .   ? -14.160 -21.694 66.480 1.00 15.00 ? 312 HOH A O   1 
HETATM 1704 O O   . HOH C 3 .   ? -44.084 -26.874 48.479 1.00 15.00 ? 313 HOH A O   1 
HETATM 1705 O O   . HOH C 3 .   ? -44.492 -35.403 55.400 1.00 15.00 ? 314 HOH A O   1 
HETATM 1706 O O   . HOH C 3 .   ? -39.274 -16.797 68.537 1.00 15.00 ? 315 HOH A O   1 
HETATM 1707 O O   . HOH C 3 .   ? -24.123 -35.398 48.131 1.00 15.00 ? 316 HOH A O   1 
HETATM 1708 O O   . HOH C 3 .   ? -9.624  -25.464 63.419 1.00 15.00 ? 317 HOH A O   1 
HETATM 1709 O O   . HOH C 3 .   ? -46.023 -25.145 44.359 1.00 15.00 ? 318 HOH A O   1 
HETATM 1710 O O   . HOH C 3 .   ? -27.990 -19.443 61.959 1.00 15.00 ? 319 HOH A O   1 
HETATM 1711 O O   . HOH C 3 .   ? -22.101 -30.017 61.670 1.00 15.00 ? 320 HOH A O   1 
HETATM 1712 O O   . HOH C 3 .   ? -27.352 -15.732 71.931 1.00 15.00 ? 321 HOH A O   1 
HETATM 1713 O O   . HOH C 3 .   ? -29.186 -17.476 70.736 1.00 15.00 ? 322 HOH A O   1 
HETATM 1714 O O   . HOH C 3 .   ? -29.554 -22.691 83.517 1.00 15.00 ? 323 HOH A O   1 
HETATM 1715 O O   . HOH C 3 .   ? -35.733 -26.958 51.774 1.00 15.00 ? 324 HOH A O   1 
HETATM 1716 O O   . HOH C 3 .   ? -36.270 -24.645 49.308 1.00 15.00 ? 325 HOH A O   1 
HETATM 1717 O O   . HOH C 3 .   ? -46.675 -33.010 57.375 1.00 15.00 ? 326 HOH A O   1 
HETATM 1718 O O   . HOH C 3 .   ? -27.403 -10.901 68.663 1.00 15.00 ? 327 HOH A O   1 
HETATM 1719 O O   . HOH C 3 .   ? -42.006 -15.967 60.761 1.00 15.00 ? 328 HOH A O   1 
HETATM 1720 O O   . HOH C 3 .   ? -17.997 -3.176  62.851 1.00 15.00 ? 329 HOH A O   1 
HETATM 1721 O O   . HOH C 3 .   ? -33.492 -28.432 70.557 1.00 15.00 ? 330 HOH A O   1 
HETATM 1722 O O   . HOH C 3 .   ? -44.868 -25.332 75.865 1.00 15.00 ? 331 HOH A O   1 
HETATM 1723 O O   . HOH C 3 .   ? -17.324 -10.854 74.897 1.00 15.00 ? 332 HOH A O   1 
HETATM 1724 O O   . HOH C 3 .   ? -11.454 -17.841 66.509 1.00 15.00 ? 333 HOH A O   1 
HETATM 1725 O O   . HOH C 3 .   ? -11.557 -21.887 82.270 1.00 15.00 ? 334 HOH A O   1 
HETATM 1726 O O   . HOH C 3 .   ? -28.006 -35.206 58.236 1.00 15.00 ? 335 HOH A O   1 
HETATM 1727 O O   . HOH C 3 .   ? -35.051 -10.640 52.999 1.00 15.00 ? 336 HOH A O   1 
HETATM 1728 O O   . HOH C 3 .   ? -31.637 -28.631 46.098 1.00 15.00 ? 337 HOH A O   1 
HETATM 1729 O O   . HOH C 3 .   ? -35.044 -24.793 46.848 1.00 15.00 ? 338 HOH A O   1 
HETATM 1730 O O   . HOH C 3 .   ? -41.380 -35.108 55.807 1.00 15.00 ? 339 HOH A O   1 
HETATM 1731 O O   . HOH C 3 .   ? -40.435 -19.765 71.518 1.00 15.00 ? 340 HOH A O   1 
HETATM 1732 O O   . HOH C 3 .   ? -43.662 -16.338 65.705 1.00 15.00 ? 341 HOH A O   1 
HETATM 1733 O O   . HOH C 3 .   ? -39.000 -11.992 70.393 1.00 15.00 ? 342 HOH A O   1 
HETATM 1734 O O   . HOH C 3 .   ? -30.918 -9.067  66.513 1.00 15.00 ? 343 HOH A O   1 
HETATM 1735 O O   . HOH C 3 .   ? -32.507 -6.890  60.413 1.00 15.00 ? 344 HOH A O   1 
HETATM 1736 O O   . HOH C 3 .   ? -19.197 -8.288  62.912 1.00 15.00 ? 345 HOH A O   1 
HETATM 1737 O O   . HOH C 3 .   ? -33.667 -20.841 69.775 1.00 15.00 ? 346 HOH A O   1 
HETATM 1738 O O   . HOH C 3 .   ? -32.870 -44.916 73.867 1.00 15.00 ? 347 HOH A O   1 
HETATM 1739 O O   . HOH C 3 .   ? -13.196 -24.006 76.814 1.00 15.00 ? 348 HOH A O   1 
HETATM 1740 O O   . HOH C 3 .   ? -8.830  -25.261 60.255 1.00 15.00 ? 349 HOH A O   1 
HETATM 1741 O O   . HOH C 3 .   ? -17.234 -39.224 57.639 1.00 15.00 ? 350 HOH A O   1 
HETATM 1742 O O   . HOH C 3 .   ? -21.102 -32.622 61.093 1.00 15.00 ? 351 HOH A O   1 
HETATM 1743 O O   . HOH C 3 .   ? -24.500 -33.438 60.847 1.00 15.00 ? 352 HOH A O   1 
HETATM 1744 O O   . HOH C 3 .   ? -6.371  -28.132 76.249 1.00 15.00 ? 353 HOH A O   1 
HETATM 1745 O O   . HOH C 3 .   ? -10.203 -38.509 65.402 1.00 15.00 ? 354 HOH A O   1 
HETATM 1746 O O   . HOH C 3 .   ? -21.412 -37.756 78.267 1.00 15.00 ? 355 HOH A O   1 
HETATM 1747 O O   . HOH C 3 .   ? -22.559 -38.946 69.335 1.00 15.00 ? 356 HOH A O   1 
HETATM 1748 O O   . HOH C 3 .   ? -30.180 -25.128 93.773 1.00 15.00 ? 357 HOH A O   1 
HETATM 1749 O O   . HOH C 3 .   ? -12.079 -12.198 63.634 1.00 15.00 ? 358 HOH A O   1 
HETATM 1750 O O   . HOH C 3 .   ? -1.364  -9.622  67.961 1.00 15.00 ? 359 HOH A O   1 
HETATM 1751 O O   . HOH C 3 .   ? -28.392 -30.256 56.298 1.00 15.00 ? 360 HOH A O   1 
HETATM 1752 O O   . HOH C 3 .   ? -29.739 -20.186 48.424 1.00 15.00 ? 361 HOH A O   1 
HETATM 1753 O O   . HOH C 3 .   ? -26.116 -23.006 44.408 1.00 15.00 ? 362 HOH A O   1 
HETATM 1754 O O   . HOH C 3 .   ? -29.921 -34.207 47.418 1.00 15.00 ? 363 HOH A O   1 
HETATM 1755 O O   . HOH C 3 .   ? -26.239 -33.392 47.918 1.00 15.00 ? 364 HOH A O   1 
HETATM 1756 O O   . HOH C 3 .   ? -32.186 -28.288 42.417 1.00 15.00 ? 365 HOH A O   1 
HETATM 1757 O O   . HOH C 3 .   ? -37.495 -30.327 50.553 1.00 15.00 ? 366 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ALA 1   1   1   ALA ALA A . n 
A 1 2   PRO 2   2   2   PRO PRO A . n 
A 1 3   ASP 3   3   3   ASP ASP A . n 
A 1 4   SER 4   4   4   SER SER A . n 
A 1 5   VAL 5   5   5   VAL VAL A . n 
A 1 6   ASP 6   6   6   ASP ASP A . n 
A 1 7   TYR 7   7   7   TYR TYR A . n 
A 1 8   ARG 8   8   8   ARG ARG A . n 
A 1 9   LYS 9   9   9   LYS LYS A . n 
A 1 10  LYS 10  10  10  LYS LYS A . n 
A 1 11  GLY 11  11  11  GLY GLY A . n 
A 1 12  TYR 12  12  12  TYR TYR A . n 
A 1 13  VAL 13  13  13  VAL VAL A . n 
A 1 14  THR 14  14  14  THR THR A . n 
A 1 15  PRO 15  15  15  PRO PRO A . n 
A 1 16  VAL 16  16  16  VAL VAL A . n 
A 1 17  LYS 17  17  17  LYS LYS A . n 
A 1 18  ASN 18  18  18  ASN ASN A . n 
A 1 19  GLN 19  19  19  GLN GLN A . n 
A 1 20  GLY 20  20  20  GLY GLY A . n 
A 1 21  GLN 21  21  21  GLN GLN A . n 
A 1 22  CYS 22  22  22  CYS CYS A . n 
A 1 23  GLY 23  23  23  GLY GLY A . n 
A 1 24  SER 24  24  24  SER SER A . n 
A 1 25  CYS 25  25  25  CYS CYS A . n 
A 1 26  TRP 26  26  26  TRP TRP A . n 
A 1 27  ALA 27  27  27  ALA ALA A . n 
A 1 28  PHE 28  28  28  PHE PHE A . n 
A 1 29  SER 29  29  29  SER SER A . n 
A 1 30  SER 30  30  30  SER SER A . n 
A 1 31  VAL 31  31  31  VAL VAL A . n 
A 1 32  GLY 32  32  32  GLY GLY A . n 
A 1 33  ALA 33  33  33  ALA ALA A . n 
A 1 34  LEU 34  34  34  LEU LEU A . n 
A 1 35  GLU 35  35  35  GLU GLU A . n 
A 1 36  GLY 36  36  36  GLY GLY A . n 
A 1 37  GLN 37  37  37  GLN GLN A . n 
A 1 38  LEU 38  38  38  LEU LEU A . n 
A 1 39  LYS 39  39  39  LYS LYS A . n 
A 1 40  LYS 40  40  40  LYS LYS A . n 
A 1 41  LYS 41  41  41  LYS LYS A . n 
A 1 42  THR 42  42  42  THR THR A . n 
A 1 43  GLY 43  43  43  GLY GLY A . n 
A 1 44  LYS 44  44  44  LYS LYS A . n 
A 1 45  LEU 45  45  45  LEU LEU A . n 
A 1 46  LEU 46  46  46  LEU LEU A . n 
A 1 47  ASN 47  47  47  ASN ASN A . n 
A 1 48  LEU 48  48  48  LEU LEU A . n 
A 1 49  SER 49  49  49  SER SER A . n 
A 1 50  PRO 50  50  50  PRO PRO A . n 
A 1 51  GLN 51  51  51  GLN GLN A . n 
A 1 52  ASN 52  52  52  ASN ASN A . n 
A 1 53  LEU 53  53  53  LEU LEU A . n 
A 1 54  VAL 54  54  54  VAL VAL A . n 
A 1 55  ASP 55  55  55  ASP ASP A . n 
A 1 56  CYS 56  56  56  CYS CYS A . n 
A 1 57  VAL 57  57  57  VAL VAL A . n 
A 1 58  SER 58  58  58  SER SER A . n 
A 1 59  GLU 59  59  59  GLU GLU A . n 
A 1 60  ASN 60  60  60  ASN ASN A . n 
A 1 61  ASP 61  61  61  ASP ASP A . n 
A 1 62  GLY 62  62  62  GLY GLY A . n 
A 1 63  CYS 63  63  63  CYS CYS A . n 
A 1 64  GLY 64  64  64  GLY GLY A . n 
A 1 65  GLY 65  65  65  GLY GLY A . n 
A 1 66  GLY 66  66  66  GLY GLY A . n 
A 1 67  TYR 67  67  67  TYR TYR A . n 
A 1 68  MET 68  68  68  MET MET A . n 
A 1 69  THR 69  69  69  THR THR A . n 
A 1 70  ASN 70  70  70  ASN ASN A . n 
A 1 71  ALA 71  71  71  ALA ALA A . n 
A 1 72  PHE 72  72  72  PHE PHE A . n 
A 1 73  GLN 73  73  73  GLN GLN A . n 
A 1 74  TYR 74  74  74  TYR TYR A . n 
A 1 75  VAL 75  75  75  VAL VAL A . n 
A 1 76  GLN 76  76  76  GLN GLN A . n 
A 1 77  LYS 77  77  77  LYS LYS A . n 
A 1 78  ASN 78  78  78  ASN ASN A . n 
A 1 79  ARG 79  79  79  ARG ARG A . n 
A 1 80  GLY 80  80  80  GLY GLY A . n 
A 1 81  ILE 81  81  81  ILE ILE A . n 
A 1 82  ASP 82  82  82  ASP ASP A . n 
A 1 83  SER 83  83  83  SER SER A . n 
A 1 84  GLU 84  84  84  GLU GLU A . n 
A 1 85  ASP 85  85  85  ASP ASP A . n 
A 1 86  ALA 86  86  86  ALA ALA A . n 
A 1 87  TYR 87  87  87  TYR TYR A . n 
A 1 88  PRO 88  88  88  PRO PRO A . n 
A 1 89  TYR 89  89  89  TYR TYR A . n 
A 1 90  VAL 90  90  90  VAL VAL A . n 
A 1 91  GLY 91  91  91  GLY GLY A . n 
A 1 92  GLN 92  92  92  GLN GLN A . n 
A 1 93  GLU 93  93  93  GLU GLU A . n 
A 1 94  GLU 94  94  94  GLU GLU A . n 
A 1 95  SER 95  95  95  SER SER A . n 
A 1 96  CYS 96  96  96  CYS CYS A . n 
A 1 97  MET 97  97  97  MET MET A . n 
A 1 98  TYR 98  98  98  TYR TYR A . n 
A 1 99  ASN 99  99  99  ASN ASN A . n 
A 1 100 PRO 100 100 100 PRO PRO A . n 
A 1 101 THR 101 101 101 THR THR A . n 
A 1 102 GLY 102 102 102 GLY GLY A . n 
A 1 103 LYS 103 103 103 LYS LYS A . n 
A 1 104 ALA 104 104 104 ALA ALA A . n 
A 1 105 ALA 105 105 105 ALA ALA A . n 
A 1 106 LYS 106 106 106 LYS LYS A . n 
A 1 107 CYS 107 107 107 CYS CYS A . n 
A 1 108 ARG 108 108 108 ARG ARG A . n 
A 1 109 GLY 109 109 109 GLY GLY A . n 
A 1 110 TYR 110 110 110 TYR TYR A . n 
A 1 111 ARG 111 111 111 ARG ARG A . n 
A 1 112 GLU 112 112 112 GLU GLU A . n 
A 1 113 ILE 113 113 113 ILE ILE A . n 
A 1 114 PRO 114 114 114 PRO PRO A . n 
A 1 115 GLU 115 115 115 GLU GLU A . n 
A 1 116 GLY 116 116 116 GLY GLY A . n 
A 1 117 ASN 117 117 117 ASN ASN A . n 
A 1 118 GLU 118 118 118 GLU GLU A . n 
A 1 119 LYS 119 119 119 LYS LYS A . n 
A 1 120 ALA 120 120 120 ALA ALA A . n 
A 1 121 LEU 121 121 121 LEU LEU A . n 
A 1 122 LYS 122 122 122 LYS LYS A . n 
A 1 123 ARG 123 123 123 ARG ARG A . n 
A 1 124 ALA 124 124 124 ALA ALA A . n 
A 1 125 VAL 125 125 125 VAL VAL A . n 
A 1 126 ALA 126 126 126 ALA ALA A . n 
A 1 127 ARG 127 127 127 ARG ARG A . n 
A 1 128 VAL 128 128 128 VAL VAL A . n 
A 1 129 GLY 129 129 129 GLY GLY A . n 
A 1 130 PRO 130 130 130 PRO PRO A . n 
A 1 131 VAL 131 131 131 VAL VAL A . n 
A 1 132 SER 132 132 132 SER SER A . n 
A 1 133 VAL 133 133 133 VAL VAL A . n 
A 1 134 ALA 134 134 134 ALA ALA A . n 
A 1 135 ILE 135 135 135 ILE ILE A . n 
A 1 136 ASP 136 136 136 ASP ASP A . n 
A 1 137 ALA 137 137 137 ALA ALA A . n 
A 1 138 SER 138 138 138 SER SER A . n 
A 1 139 LEU 139 139 139 LEU LEU A . n 
A 1 140 THR 140 140 140 THR THR A . n 
A 1 141 SER 141 141 141 SER SER A . n 
A 1 142 PHE 142 142 142 PHE PHE A . n 
A 1 143 GLN 143 143 143 GLN GLN A . n 
A 1 144 PHE 144 144 144 PHE PHE A . n 
A 1 145 TYR 145 145 145 TYR TYR A . n 
A 1 146 SER 146 146 146 SER SER A . n 
A 1 147 LYS 147 147 147 LYS LYS A . n 
A 1 148 GLY 148 148 148 GLY GLY A . n 
A 1 149 VAL 149 149 149 VAL VAL A . n 
A 1 150 TYR 150 150 150 TYR TYR A . n 
A 1 151 TYR 151 151 151 TYR TYR A . n 
A 1 152 ASP 152 152 152 ASP ASP A . n 
A 1 153 GLU 153 153 153 GLU GLU A . n 
A 1 154 SER 154 154 154 SER SER A . n 
A 1 155 CYS 155 155 155 CYS CYS A . n 
A 1 156 ASN 156 156 156 ASN ASN A . n 
A 1 157 SER 157 157 157 SER SER A . n 
A 1 158 ASP 158 158 158 ASP ASP A . n 
A 1 159 ASN 159 159 159 ASN ASN A . n 
A 1 160 LEU 160 160 160 LEU LEU A . n 
A 1 161 ASN 161 161 161 ASN ASN A . n 
A 1 162 HIS 162 162 162 HIS HIS A . n 
A 1 163 ALA 163 163 163 ALA ALA A . n 
A 1 164 VAL 164 164 164 VAL VAL A . n 
A 1 165 LEU 165 165 165 LEU LEU A . n 
A 1 166 ALA 166 166 166 ALA ALA A . n 
A 1 167 VAL 167 167 167 VAL VAL A . n 
A 1 168 GLY 168 168 168 GLY GLY A . n 
A 1 169 TYR 169 169 169 TYR TYR A . n 
A 1 170 GLY 170 170 170 GLY GLY A . n 
A 1 171 ILE 171 171 171 ILE ILE A . n 
A 1 172 GLN 172 172 172 GLN GLN A . n 
A 1 173 LYS 173 173 173 LYS LYS A . n 
A 1 174 GLY 174 174 174 GLY GLY A . n 
A 1 175 ASN 175 175 175 ASN ASN A . n 
A 1 176 LYS 176 176 176 LYS LYS A . n 
A 1 177 HIS 177 177 177 HIS HIS A . n 
A 1 178 TRP 178 178 178 TRP TRP A . n 
A 1 179 ILE 179 179 179 ILE ILE A . n 
A 1 180 ILE 180 180 180 ILE ILE A . n 
A 1 181 LYS 181 181 181 LYS LYS A . n 
A 1 182 ASN 182 182 182 ASN ASN A . n 
A 1 183 SER 183 183 183 SER SER A . n 
A 1 184 TRP 184 184 184 TRP TRP A . n 
A 1 185 GLY 185 185 185 GLY GLY A . n 
A 1 186 GLU 186 186 186 GLU GLU A . n 
A 1 187 ASN 187 187 187 ASN ASN A . n 
A 1 188 TRP 188 188 188 TRP TRP A . n 
A 1 189 GLY 189 189 189 GLY GLY A . n 
A 1 190 ASN 190 190 190 ASN ASN A . n 
A 1 191 LYS 191 191 191 LYS LYS A . n 
A 1 192 GLY 192 192 192 GLY GLY A . n 
A 1 193 TYR 193 193 193 TYR TYR A . n 
A 1 194 ILE 194 194 194 ILE ILE A . n 
A 1 195 LEU 195 195 195 LEU LEU A . n 
A 1 196 MET 196 196 196 MET MET A . n 
A 1 197 ALA 197 197 197 ALA ALA A . n 
A 1 198 ARG 198 198 198 ARG ARG A . n 
A 1 199 ASN 199 199 199 ASN ASN A . n 
A 1 200 LYS 200 200 200 LYS LYS A . n 
A 1 201 ASN 201 201 201 ASN ASN A . n 
A 1 202 ASN 202 202 202 ASN ASN A . n 
A 1 203 ALA 203 203 203 ALA ALA A . n 
A 1 204 CYS 204 204 204 CYS CYS A . n 
A 1 205 GLY 205 205 205 GLY GLY A . n 
A 1 206 ILE 206 206 206 ILE ILE A . n 
A 1 207 ALA 207 207 207 ALA ALA A . n 
A 1 208 ASN 208 208 208 ASN ASN A . n 
A 1 209 LEU 209 209 209 LEU LEU A . n 
A 1 210 ALA 210 210 210 ALA ALA A . n 
A 1 211 SER 211 211 211 SER SER A . n 
A 1 212 PHE 212 212 212 PHE PHE A . n 
A 1 213 PRO 213 213 213 PRO PRO A . n 
A 1 214 LYS 214 214 214 LYS LYS A . n 
A 1 215 MET 215 215 215 MET MET A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 INA 1  300 300 INA INA A . 
C 3 HOH 1  301 301 HOH HOH A . 
C 3 HOH 2  302 302 HOH HOH A . 
C 3 HOH 3  303 303 HOH HOH A . 
C 3 HOH 4  304 304 HOH HOH A . 
C 3 HOH 5  305 305 HOH HOH A . 
C 3 HOH 6  306 306 HOH HOH A . 
C 3 HOH 7  307 307 HOH HOH A . 
C 3 HOH 8  308 308 HOH HOH A . 
C 3 HOH 9  309 309 HOH HOH A . 
C 3 HOH 10 310 310 HOH HOH A . 
C 3 HOH 11 311 311 HOH HOH A . 
C 3 HOH 12 312 312 HOH HOH A . 
C 3 HOH 13 313 313 HOH HOH A . 
C 3 HOH 14 314 314 HOH HOH A . 
C 3 HOH 15 315 315 HOH HOH A . 
C 3 HOH 16 316 316 HOH HOH A . 
C 3 HOH 17 317 317 HOH HOH A . 
C 3 HOH 18 318 318 HOH HOH A . 
C 3 HOH 19 319 319 HOH HOH A . 
C 3 HOH 20 320 320 HOH HOH A . 
C 3 HOH 21 321 321 HOH HOH A . 
C 3 HOH 22 322 322 HOH HOH A . 
C 3 HOH 23 323 323 HOH HOH A . 
C 3 HOH 24 324 324 HOH HOH A . 
C 3 HOH 25 325 325 HOH HOH A . 
C 3 HOH 26 326 326 HOH HOH A . 
C 3 HOH 27 327 327 HOH HOH A . 
C 3 HOH 28 328 328 HOH HOH A . 
C 3 HOH 29 329 329 HOH HOH A . 
C 3 HOH 30 330 330 HOH HOH A . 
C 3 HOH 31 331 331 HOH HOH A . 
C 3 HOH 32 332 332 HOH HOH A . 
C 3 HOH 33 333 333 HOH HOH A . 
C 3 HOH 34 334 334 HOH HOH A . 
C 3 HOH 35 335 335 HOH HOH A . 
C 3 HOH 36 336 336 HOH HOH A . 
C 3 HOH 37 337 337 HOH HOH A . 
C 3 HOH 38 338 338 HOH HOH A . 
C 3 HOH 39 339 339 HOH HOH A . 
C 3 HOH 40 340 340 HOH HOH A . 
C 3 HOH 41 341 341 HOH HOH A . 
C 3 HOH 42 342 342 HOH HOH A . 
C 3 HOH 43 343 343 HOH HOH A . 
C 3 HOH 44 344 344 HOH HOH A . 
C 3 HOH 45 345 345 HOH HOH A . 
C 3 HOH 46 346 346 HOH HOH A . 
C 3 HOH 47 347 347 HOH HOH A . 
C 3 HOH 48 348 348 HOH HOH A . 
C 3 HOH 49 349 349 HOH HOH A . 
C 3 HOH 50 350 350 HOH HOH A . 
C 3 HOH 51 351 351 HOH HOH A . 
C 3 HOH 52 352 352 HOH HOH A . 
C 3 HOH 53 353 353 HOH HOH A . 
C 3 HOH 54 354 354 HOH HOH A . 
C 3 HOH 55 355 355 HOH HOH A . 
C 3 HOH 56 356 356 HOH HOH A . 
C 3 HOH 57 357 357 HOH HOH A . 
C 3 HOH 58 358 358 HOH HOH A . 
C 3 HOH 59 359 359 HOH HOH A . 
C 3 HOH 60 360 360 HOH HOH A . 
C 3 HOH 61 361 361 HOH HOH A . 
C 3 HOH 62 362 362 HOH HOH A . 
C 3 HOH 63 363 363 HOH HOH A . 
C 3 HOH 64 364 364 HOH HOH A . 
C 3 HOH 65 365 365 HOH HOH A . 
C 3 HOH 66 366 366 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1998-11-25 
2 'Structure model' 1 1 2008-03-24 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2012-02-29 
5 'Structure model' 1 4 2018-03-07 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Database references'       
4 5 'Structure model' 'Data collection'           
5 5 'Structure model' Other                       
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 5 'Structure model' diffrn_source        
2 5 'Structure model' pdbx_database_status 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 5 'Structure model' '_diffrn_source.source'              
2 5 'Structure model' '_pdbx_database_status.process_site' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
XENGEN 'data collection' .   ? 1 
XENGEN 'data reduction'  .   ? 2 
X-PLOR 'model building'  3.1 ? 3 
X-PLOR refinement        3.1 ? 4 
XENGEN 'data scaling'    .   ? 5 
X-PLOR phasing           3.1 ? 6 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 TYR A 87  ? ? -162.92 75.82   
2 1 ALA A 105 ? ? -176.83 -173.60 
3 1 LYS A 106 ? ? -165.58 -168.50 
4 1 SER A 146 ? ? -145.28 -37.58  
5 1 TYR A 151 ? ? -173.82 146.63  
6 1 LYS A 200 ? ? -112.04 61.84   
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 '1,5-BIS(N-BENZYLOXYCARBONYL-L-LEUCINYL)CARBOHYDRAZIDE' INA 
3 water                                                   HOH 
#