data_1AYV
# 
_entry.id   1AYV 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.290 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1AYV         
WWPDB D_1000171422 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1AYV 
_pdbx_database_status.recvd_initial_deposition_date   1997-11-10 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    BNL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Zhao, B.'           1 
'Smith, W.W.'        2 
'Janson, C.A.'       3 
'Abdel-Meguid, S.S.' 4 
# 
_citation.id                        primary 
_citation.title                     'Design of potent and selective human cathepsin K inhibitors that span the active site.' 
_citation.journal_abbrev            Proc.Natl.Acad.Sci.USA 
_citation.journal_volume            94 
_citation.page_first                14249 
_citation.page_last                 14254 
_citation.year                      1997 
_citation.journal_id_ASTM           PNASA6 
_citation.country                   US 
_citation.journal_id_ISSN           0027-8424 
_citation.journal_id_CSD            0040 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   9405598 
_citation.pdbx_database_id_DOI      10.1073/pnas.94.26.14249 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Thompson, S.K.'      1  
primary 'Halbert, S.M.'       2  
primary 'Bossard, M.J.'       3  
primary 'Tomaszek, T.A.'      4  
primary 'Levy, M.A.'          5  
primary 'Zhao, B.'            6  
primary 'Smith, W.W.'         7  
primary 'Abdel-Meguid, S.S.'  8  
primary 'Janson, C.A.'        9  
primary 
;D'Alessio, K.J.
;
10 
primary 'McQueney, M.S.'      11 
primary 'Amegadzie, B.Y.'     12 
primary 'Hanning, C.R.'       13 
primary 'DesJarlais, R.L.'    14 
primary 'Briand, J.'          15 
primary 'Sarkar, S.K.'        16 
primary 'Huddleston, M.J.'    17 
primary 'Ijames, C.F.'        18 
primary 'Carr, S.A.'          19 
primary 'Garnes, K.T.'        20 
primary 'Shu, A.'             21 
primary 'Heys, J.R.'          22 
primary 'Bradbeer, J.'        23 
primary 'Zembryki, D.'        24 
primary 'Lee-Rykaczewski, L.' 25 
primary 'James, I.E.'         26 
primary 'Lark, M.W.'          27 
primary 'Drake, F.H.'         28 
primary 'Gowen, M.'           29 
primary 'Gleason, J.G.'       30 
primary 'Veber, D.F.'         31 
# 
_cell.entry_id           1AYV 
_cell.length_a           38.310 
_cell.length_b           51.270 
_cell.length_c           103.870 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1AYV 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'CATHEPSIN K' 23523.480 1  3.4.22.38 ? ? 'INHIBITOR COVALENTLY BOUND TO ACTIVE SITE CYS 25' 
2 non-polymer syn 
"N-[2-[1-(N-BENZYLOXYCARBONYLAMINO)-3-METHYLBUTYL]THIAZOL-4-YLCARBONYL]-N'-(BENZYLOXYCARBONYL-L-LEUCINYL)HYDRAZIDE" 609.736   1  ? 
? ? ?                                                  
3 water       nat water 18.015    67 ?         ? ? ?                                                  
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;APDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRG
IDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNL
NHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM
;
_entity_poly.pdbx_seq_one_letter_code_can   
;APDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRG
IDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNL
NHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ALA n 
1 2   PRO n 
1 3   ASP n 
1 4   SER n 
1 5   VAL n 
1 6   ASP n 
1 7   TYR n 
1 8   ARG n 
1 9   LYS n 
1 10  LYS n 
1 11  GLY n 
1 12  TYR n 
1 13  VAL n 
1 14  THR n 
1 15  PRO n 
1 16  VAL n 
1 17  LYS n 
1 18  ASN n 
1 19  GLN n 
1 20  GLY n 
1 21  GLN n 
1 22  CYS n 
1 23  GLY n 
1 24  SER n 
1 25  CYS n 
1 26  TRP n 
1 27  ALA n 
1 28  PHE n 
1 29  SER n 
1 30  SER n 
1 31  VAL n 
1 32  GLY n 
1 33  ALA n 
1 34  LEU n 
1 35  GLU n 
1 36  GLY n 
1 37  GLN n 
1 38  LEU n 
1 39  LYS n 
1 40  LYS n 
1 41  LYS n 
1 42  THR n 
1 43  GLY n 
1 44  LYS n 
1 45  LEU n 
1 46  LEU n 
1 47  ASN n 
1 48  LEU n 
1 49  SER n 
1 50  PRO n 
1 51  GLN n 
1 52  ASN n 
1 53  LEU n 
1 54  VAL n 
1 55  ASP n 
1 56  CYS n 
1 57  VAL n 
1 58  SER n 
1 59  GLU n 
1 60  ASN n 
1 61  ASP n 
1 62  GLY n 
1 63  CYS n 
1 64  GLY n 
1 65  GLY n 
1 66  GLY n 
1 67  TYR n 
1 68  MET n 
1 69  THR n 
1 70  ASN n 
1 71  ALA n 
1 72  PHE n 
1 73  GLN n 
1 74  TYR n 
1 75  VAL n 
1 76  GLN n 
1 77  LYS n 
1 78  ASN n 
1 79  ARG n 
1 80  GLY n 
1 81  ILE n 
1 82  ASP n 
1 83  SER n 
1 84  GLU n 
1 85  ASP n 
1 86  ALA n 
1 87  TYR n 
1 88  PRO n 
1 89  TYR n 
1 90  VAL n 
1 91  GLY n 
1 92  GLN n 
1 93  GLU n 
1 94  GLU n 
1 95  SER n 
1 96  CYS n 
1 97  MET n 
1 98  TYR n 
1 99  ASN n 
1 100 PRO n 
1 101 THR n 
1 102 GLY n 
1 103 LYS n 
1 104 ALA n 
1 105 ALA n 
1 106 LYS n 
1 107 CYS n 
1 108 ARG n 
1 109 GLY n 
1 110 TYR n 
1 111 ARG n 
1 112 GLU n 
1 113 ILE n 
1 114 PRO n 
1 115 GLU n 
1 116 GLY n 
1 117 ASN n 
1 118 GLU n 
1 119 LYS n 
1 120 ALA n 
1 121 LEU n 
1 122 LYS n 
1 123 ARG n 
1 124 ALA n 
1 125 VAL n 
1 126 ALA n 
1 127 ARG n 
1 128 VAL n 
1 129 GLY n 
1 130 PRO n 
1 131 VAL n 
1 132 SER n 
1 133 VAL n 
1 134 ALA n 
1 135 ILE n 
1 136 ASP n 
1 137 ALA n 
1 138 SER n 
1 139 LEU n 
1 140 THR n 
1 141 SER n 
1 142 PHE n 
1 143 GLN n 
1 144 PHE n 
1 145 TYR n 
1 146 SER n 
1 147 LYS n 
1 148 GLY n 
1 149 VAL n 
1 150 TYR n 
1 151 TYR n 
1 152 ASP n 
1 153 GLU n 
1 154 SER n 
1 155 CYS n 
1 156 ASN n 
1 157 SER n 
1 158 ASP n 
1 159 ASN n 
1 160 LEU n 
1 161 ASN n 
1 162 HIS n 
1 163 ALA n 
1 164 VAL n 
1 165 LEU n 
1 166 ALA n 
1 167 VAL n 
1 168 GLY n 
1 169 TYR n 
1 170 GLY n 
1 171 ILE n 
1 172 GLN n 
1 173 LYS n 
1 174 GLY n 
1 175 ASN n 
1 176 LYS n 
1 177 HIS n 
1 178 TRP n 
1 179 ILE n 
1 180 ILE n 
1 181 LYS n 
1 182 ASN n 
1 183 SER n 
1 184 TRP n 
1 185 GLY n 
1 186 GLU n 
1 187 ASN n 
1 188 TRP n 
1 189 GLY n 
1 190 ASN n 
1 191 LYS n 
1 192 GLY n 
1 193 TYR n 
1 194 ILE n 
1 195 LEU n 
1 196 MET n 
1 197 ALA n 
1 198 ARG n 
1 199 ASN n 
1 200 LYS n 
1 201 ASN n 
1 202 ASN n 
1 203 ALA n 
1 204 CYS n 
1 205 GLY n 
1 206 ILE n 
1 207 ALA n 
1 208 ASN n 
1 209 LEU n 
1 210 ALA n 
1 211 SER n 
1 212 PHE n 
1 213 PRO n 
1 214 LYS n 
1 215 MET n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            SF21 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 OSTEOCLAST 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               'fall armyworm' 
_entity_src_gen.pdbx_host_org_scientific_name      'Spodoptera frugiperda' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     7108 
_entity_src_gen.host_org_genus                     Spodoptera 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            SF21 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               BACULOVIRUS 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    CATK_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P43235 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   
;MWGLKVLLLPVVSFALYPEEILDTHWELWKKTHRKQYNNKVDEISRRLIWEKNLKYISIHNLEASLGVHTYELAMNHLGD
MTSEEVVQKMTGLKVPLSHSRSNDTLYIPEWEGRAPDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLL
NLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVA
RVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGI
ANLASFPKM
;
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1AYV 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 215 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P43235 
_struct_ref_seq.db_align_beg                  115 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  329 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       215 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S'    121.158 
GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2'     131.173 
IN6 non-polymer         . 
"N-[2-[1-(N-BENZYLOXYCARBONYLAMINO)-3-METHYLBUTYL]THIAZOL-4-YLCARBONYL]-N'-(BENZYLOXYCARBONYL-L-LEUCINYL)HYDRAZIDE" ? 
'C31 H39 N5 O6 S' 609.736 
LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          1AYV 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.15 
_exptl_crystal.density_percent_sol   42.4 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.0 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    '30% MPD, 0.1M MES, 0.1M TRIS-HCL, PH7.0' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           293 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'AREA DETECTOR' 
_diffrn_detector.type                   SIEMENS 
_diffrn_detector.pdbx_collection_date   1996-01 
_diffrn_detector.details                COLLIMATOR 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'GRAPHITE(002)' 
_diffrn_radiation.pdbx_diffrn_protocol             ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        SIEMENS 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1AYV 
_reflns.observed_criterion_sigma_I   2 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             25. 
_reflns.d_resolution_high            2.3 
_reflns.number_obs                   9131 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         95 
_reflns.pdbx_Rmerge_I_obs            0.12 
_reflns.pdbx_Rsym_value              0.12 
_reflns.pdbx_netI_over_sigmaI        9.4 
_reflns.B_iso_Wilson_estimate        18.3 
_reflns.pdbx_redundancy              3.0 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.30 
_reflns_shell.d_res_low              2.44 
_reflns_shell.percent_possible_all   87 
_reflns_shell.Rmerge_I_obs           0.31 
_reflns_shell.pdbx_Rsym_value        0.31 
_reflns_shell.meanI_over_sigI_obs    2.2 
_reflns_shell.pdbx_redundancy        2.2 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 1AYV 
_refine.ls_number_reflns_obs                     7567 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          2 
_refine.pdbx_data_cutoff_high_absF               1000000 
_refine.pdbx_data_cutoff_low_absF                0.001 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             8 
_refine.ls_d_res_high                            2.3 
_refine.ls_percent_reflns_obs                    81.1 
_refine.ls_R_factor_obs                          0.209 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.209 
_refine.ls_R_factor_R_free                       0.312 
_refine.ls_R_factor_R_free_error                 0.011 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 10.5 
_refine.ls_number_reflns_R_free                  793 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               15.0 
_refine.aniso_B[1][1]                            0 
_refine.aniso_B[2][2]                            0 
_refine.aniso_B[3][3]                            0 
_refine.aniso_B[1][2]                            0 
_refine.aniso_B[1][3]                            0 
_refine.aniso_B[2][3]                            0 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      1ATK 
_refine.pdbx_method_to_determine_struct          MR 
_refine.pdbx_isotropic_thermal_model             OVERALL 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1AYV 
_refine_analyze.Luzzati_coordinate_error_obs    0.25 
_refine_analyze.Luzzati_sigma_a_obs             0.25 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.36 
_refine_analyze.Luzzati_sigma_a_free            0.30 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1649 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         43 
_refine_hist.number_atoms_solvent             67 
_refine_hist.number_atoms_total               1759 
_refine_hist.d_res_high                       2.3 
_refine_hist.d_res_low                        8 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d                0.010 ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg             1.5   ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d      24.0  ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d      1.17  ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   8 
_refine_ls_shell.d_res_high                       2.3 
_refine_ls_shell.d_res_low                        2.4 
_refine_ls_shell.number_reflns_R_work             592 
_refine_ls_shell.R_factor_R_work                  0.222 
_refine_ls_shell.percent_reflns_obs               58.4 
_refine_ls_shell.R_factor_R_free                  0.339 
_refine_ls_shell.R_factor_R_free_error            0.039 
_refine_ls_shell.percent_reflns_R_free            11.5 
_refine_ls_shell.number_reflns_R_free             77 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PARHCSDX.PRO TOPHCSDX.PRO 'X-RAY DIFFRACTION' 
2 PARAM19.SOL  ?            'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1AYV 
_struct.title                     
'CRYSTAL STRUCTURE OF CYSTEINE PROTEASE HUMAN CATHEPSIN K IN COMPLEX WITH A COVALENT THIAZOLHYDRAZIDE INHIBITOR' 
_struct.pdbx_descriptor           
;CATHEPSIN K, N-[2-[1-(N-BENZYLOXYCARBONYLAMINO)-3-METHYLBUTYL]THIAZOL-4-YLCARBONYL]-N'-(BENZYLOXYCARBONYL-L-LEUCINYL)HYDRAZIDE
;
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1AYV 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            'HYDROLASE, SULFHYDRYL PROTEINASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  TYR A 7   ? LYS A 10  ? TYR A 7   LYS A 10  1 ? 4  
HELX_P HELX_P2  2  CYS A 25  ? THR A 42  ? CYS A 25  THR A 42  1 ? 18 
HELX_P HELX_P3  3  PRO A 50  ? CYS A 56  ? PRO A 50  CYS A 56  1 ? 7  
HELX_P HELX_P4  4  GLY A 62  ? GLY A 64  ? GLY A 62  GLY A 64  5 ? 3  
HELX_P HELX_P5  5  MET A 68  ? LYS A 77  ? MET A 68  LYS A 77  1 ? 10 
HELX_P HELX_P6  6  ASP A 85  ? TYR A 87  ? ASP A 85  TYR A 87  5 ? 3  
HELX_P HELX_P7  7  PRO A 100 ? GLY A 102 ? PRO A 100 GLY A 102 5 ? 3  
HELX_P HELX_P8  8  GLU A 118 ? ARG A 127 ? GLU A 118 ARG A 127 1 ? 10 
HELX_P HELX_P9  9  THR A 140 ? GLN A 143 ? THR A 140 GLN A 143 1 ? 4  
HELX_P HELX_P10 10 ALA A 203 ? GLY A 205 ? ALA A 203 GLY A 205 5 ? 3  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 22  SG  ? ? ? 1_555 A CYS 63  SG ? ? A CYS 22  A CYS 63  1_555 ? ? ? ? ? ? ? 2.039 ? 
disulf2 disulf ? ? A CYS 56  SG  ? ? ? 1_555 A CYS 96  SG ? ? A CYS 56  A CYS 96  1_555 ? ? ? ? ? ? ? 2.031 ? 
disulf3 disulf ? ? A CYS 155 SG  ? ? ? 1_555 A CYS 204 SG ? ? A CYS 155 A CYS 204 1_555 ? ? ? ? ? ? ? 2.039 ? 
covale1 covale ? ? B IN6 .   C21 ? ? ? 1_555 A CYS 25  SG ? ? A IN6 300 A CYS 25  1_555 ? ? ? ? ? ? ? 1.806 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 TYR A 110 ? GLU A 112 ? TYR A 110 GLU A 112 
A 2 SER A 211 ? PRO A 213 ? SER A 211 PRO A 213 
B 1 VAL A 131 ? ILE A 135 ? VAL A 131 ILE A 135 
B 2 HIS A 162 ? ILE A 171 ? HIS A 162 ILE A 171 
B 3 LYS A 176 ? LYS A 181 ? LYS A 176 LYS A 181 
B 4 TYR A 193 ? ALA A 197 ? TYR A 193 ALA A 197 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O ARG A 111 ? O ARG A 111 N PHE A 212 ? N PHE A 212 
B 1 2 O VAL A 131 ? O VAL A 131 N ALA A 166 ? N ALA A 166 
B 2 3 O LEU A 165 ? O LEU A 165 N LYS A 181 ? N LYS A 181 
B 3 4 O TRP A 178 ? O TRP A 178 N MET A 196 ? N MET A 196 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    24 
_struct_site.details              'BINDING SITE FOR RESIDUE IN6 A 300' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 24 GLN A 19  ? GLN A 19  . ? 1_555 ? 
2  AC1 24 GLY A 20  ? GLY A 20  . ? 1_555 ? 
3  AC1 24 GLN A 21  ? GLN A 21  . ? 1_555 ? 
4  AC1 24 GLY A 23  ? GLY A 23  . ? 1_555 ? 
5  AC1 24 SER A 24  ? SER A 24  . ? 1_555 ? 
6  AC1 24 CYS A 25  ? CYS A 25  . ? 1_555 ? 
7  AC1 24 TRP A 26  ? TRP A 26  . ? 1_555 ? 
8  AC1 24 ASP A 61  ? ASP A 61  . ? 1_555 ? 
9  AC1 24 GLY A 64  ? GLY A 64  . ? 1_555 ? 
10 AC1 24 GLY A 65  ? GLY A 65  . ? 1_555 ? 
11 AC1 24 GLY A 66  ? GLY A 66  . ? 1_555 ? 
12 AC1 24 TYR A 67  ? TYR A 67  . ? 1_555 ? 
13 AC1 24 SER A 141 ? SER A 141 . ? 4_546 ? 
14 AC1 24 PHE A 144 ? PHE A 144 . ? 4_546 ? 
15 AC1 24 TYR A 145 ? TYR A 145 . ? 4_546 ? 
16 AC1 24 SER A 146 ? SER A 146 . ? 4_546 ? 
17 AC1 24 LYS A 147 ? LYS A 147 . ? 4_546 ? 
18 AC1 24 ASN A 161 ? ASN A 161 . ? 1_555 ? 
19 AC1 24 HIS A 162 ? HIS A 162 . ? 1_555 ? 
20 AC1 24 ALA A 163 ? ALA A 163 . ? 1_555 ? 
21 AC1 24 ILE A 171 ? ILE A 171 . ? 1_655 ? 
22 AC1 24 GLN A 172 ? GLN A 172 . ? 1_655 ? 
23 AC1 24 LYS A 173 ? LYS A 173 . ? 1_655 ? 
24 AC1 24 TRP A 184 ? TRP A 184 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1AYV 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1AYV 
_atom_sites.fract_transf_matrix[1][1]   0.026103 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.019505 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009627 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N     . ALA A 1 1   ? -46.074 -38.962 63.892 1.00 15.00 ? 1   ALA A N     1 
ATOM   2    C CA    . ALA A 1 1   ? -45.703 -37.587 64.357 1.00 15.00 ? 1   ALA A CA    1 
ATOM   3    C C     . ALA A 1 1   ? -46.758 -36.623 63.830 1.00 15.00 ? 1   ALA A C     1 
ATOM   4    O O     . ALA A 1 1   ? -47.464 -36.941 62.860 1.00 15.00 ? 1   ALA A O     1 
ATOM   5    C CB    . ALA A 1 1   ? -44.325 -37.196 63.832 1.00 15.00 ? 1   ALA A CB    1 
ATOM   6    N N     . PRO A 1 2   ? -46.938 -35.474 64.508 1.00 15.00 ? 2   PRO A N     1 
ATOM   7    C CA    . PRO A 1 2   ? -47.929 -34.488 64.069 1.00 15.00 ? 2   PRO A CA    1 
ATOM   8    C C     . PRO A 1 2   ? -47.634 -34.145 62.625 1.00 15.00 ? 2   PRO A C     1 
ATOM   9    O O     . PRO A 1 2   ? -46.501 -34.304 62.163 1.00 15.00 ? 2   PRO A O     1 
ATOM   10   C CB    . PRO A 1 2   ? -47.633 -33.281 64.968 1.00 15.00 ? 2   PRO A CB    1 
ATOM   11   C CG    . PRO A 1 2   ? -47.148 -33.903 66.232 1.00 15.00 ? 2   PRO A CG    1 
ATOM   12   C CD    . PRO A 1 2   ? -46.250 -35.022 65.736 1.00 15.00 ? 2   PRO A CD    1 
ATOM   13   N N     . ASP A 1 3   ? -48.650 -33.742 61.884 1.00 15.00 ? 3   ASP A N     1 
ATOM   14   C CA    . ASP A 1 3   ? -48.387 -33.357 60.517 1.00 15.00 ? 3   ASP A CA    1 
ATOM   15   C C     . ASP A 1 3   ? -47.921 -31.916 60.507 1.00 15.00 ? 3   ASP A C     1 
ATOM   16   O O     . ASP A 1 3   ? -47.438 -31.421 59.491 1.00 15.00 ? 3   ASP A O     1 
ATOM   17   C CB    . ASP A 1 3   ? -49.604 -33.605 59.628 1.00 15.00 ? 3   ASP A CB    1 
ATOM   18   C CG    . ASP A 1 3   ? -49.784 -35.099 59.293 1.00 15.00 ? 3   ASP A CG    1 
ATOM   19   O OD1   . ASP A 1 3   ? -49.045 -35.952 59.862 1.00 15.00 ? 3   ASP A OD1   1 
ATOM   20   O OD2   . ASP A 1 3   ? -50.652 -35.420 58.451 1.00 15.00 ? 3   ASP A OD2   1 
ATOM   21   N N     . SER A 1 4   ? -47.937 -31.303 61.690 1.00 15.00 ? 4   SER A N     1 
ATOM   22   C CA    . SER A 1 4   ? -47.549 -29.912 61.870 1.00 15.00 ? 4   SER A CA    1 
ATOM   23   C C     . SER A 1 4   ? -47.127 -29.610 63.292 1.00 15.00 ? 4   SER A C     1 
ATOM   24   O O     . SER A 1 4   ? -47.792 -30.026 64.236 1.00 15.00 ? 4   SER A O     1 
ATOM   25   C CB    . SER A 1 4   ? -48.698 -28.985 61.486 1.00 15.00 ? 4   SER A CB    1 
ATOM   26   O OG    . SER A 1 4   ? -48.419 -27.645 61.851 1.00 15.00 ? 4   SER A OG    1 
ATOM   27   N N     . VAL A 1 5   ? -46.043 -28.862 63.451 1.00 15.00 ? 5   VAL A N     1 
ATOM   28   C CA    . VAL A 1 5   ? -45.601 -28.472 64.777 1.00 15.00 ? 5   VAL A CA    1 
ATOM   29   C C     . VAL A 1 5   ? -44.776 -27.197 64.705 1.00 15.00 ? 5   VAL A C     1 
ATOM   30   O O     . VAL A 1 5   ? -43.998 -26.980 63.773 1.00 15.00 ? 5   VAL A O     1 
ATOM   31   C CB    . VAL A 1 5   ? -44.861 -29.605 65.527 1.00 15.00 ? 5   VAL A CB    1 
ATOM   32   C CG1   . VAL A 1 5   ? -43.458 -29.813 64.972 1.00 15.00 ? 5   VAL A CG1   1 
ATOM   33   C CG2   . VAL A 1 5   ? -44.832 -29.307 67.024 1.00 15.00 ? 5   VAL A CG2   1 
ATOM   34   N N     . ASP A 1 6   ? -44.976 -26.340 65.694 1.00 15.00 ? 6   ASP A N     1 
ATOM   35   C CA    . ASP A 1 6   ? -44.294 -25.066 65.761 1.00 15.00 ? 6   ASP A CA    1 
ATOM   36   C C     . ASP A 1 6   ? -43.717 -24.867 67.161 1.00 15.00 ? 6   ASP A C     1 
ATOM   37   O O     . ASP A 1 6   ? -44.440 -24.512 68.100 1.00 15.00 ? 6   ASP A O     1 
ATOM   38   C CB    . ASP A 1 6   ? -45.267 -23.940 65.386 1.00 15.00 ? 6   ASP A CB    1 
ATOM   39   C CG    . ASP A 1 6   ? -44.568 -22.649 64.999 1.00 15.00 ? 6   ASP A CG    1 
ATOM   40   O OD1   . ASP A 1 6   ? -43.383 -22.472 65.348 1.00 15.00 ? 6   ASP A OD1   1 
ATOM   41   O OD2   . ASP A 1 6   ? -45.209 -21.807 64.332 1.00 15.00 ? 6   ASP A OD2   1 
ATOM   42   N N     . TYR A 1 7   ? -42.408 -25.067 67.293 1.00 15.00 ? 7   TYR A N     1 
ATOM   43   C CA    . TYR A 1 7   ? -41.750 -24.900 68.581 1.00 15.00 ? 7   TYR A CA    1 
ATOM   44   C C     . TYR A 1 7   ? -41.747 -23.464 69.083 1.00 15.00 ? 7   TYR A C     1 
ATOM   45   O O     . TYR A 1 7   ? -41.621 -23.224 70.287 1.00 15.00 ? 7   TYR A O     1 
ATOM   46   C CB    . TYR A 1 7   ? -40.350 -25.507 68.572 1.00 15.00 ? 7   TYR A CB    1 
ATOM   47   C CG    . TYR A 1 7   ? -40.392 -27.004 68.751 1.00 15.00 ? 7   TYR A CG    1 
ATOM   48   C CD1   . TYR A 1 7   ? -40.490 -27.565 70.022 1.00 15.00 ? 7   TYR A CD1   1 
ATOM   49   C CD2   . TYR A 1 7   ? -40.380 -27.866 67.648 1.00 15.00 ? 7   TYR A CD2   1 
ATOM   50   C CE1   . TYR A 1 7   ? -40.578 -28.944 70.196 1.00 15.00 ? 7   TYR A CE1   1 
ATOM   51   C CE2   . TYR A 1 7   ? -40.472 -29.247 67.813 1.00 15.00 ? 7   TYR A CE2   1 
ATOM   52   C CZ    . TYR A 1 7   ? -40.571 -29.774 69.089 1.00 15.00 ? 7   TYR A CZ    1 
ATOM   53   O OH    . TYR A 1 7   ? -40.676 -31.126 69.283 1.00 15.00 ? 7   TYR A OH    1 
ATOM   54   N N     . ARG A 1 8   ? -41.914 -22.512 68.167 1.00 15.00 ? 8   ARG A N     1 
ATOM   55   C CA    . ARG A 1 8   ? -41.978 -21.102 68.547 1.00 15.00 ? 8   ARG A CA    1 
ATOM   56   C C     . ARG A 1 8   ? -43.217 -20.923 69.420 1.00 15.00 ? 8   ARG A C     1 
ATOM   57   O O     . ARG A 1 8   ? -43.169 -20.220 70.429 1.00 15.00 ? 8   ARG A O     1 
ATOM   58   C CB    . ARG A 1 8   ? -42.050 -20.193 67.334 1.00 15.00 ? 8   ARG A CB    1 
ATOM   59   C CG    . ARG A 1 8   ? -40.915 -20.364 66.382 1.00 15.00 ? 8   ARG A CG    1 
ATOM   60   C CD    . ARG A 1 8   ? -41.085 -19.449 65.195 1.00 15.00 ? 8   ARG A CD    1 
ATOM   61   N NE    . ARG A 1 8   ? -42.197 -19.812 64.322 1.00 15.00 ? 8   ARG A NE    1 
ATOM   62   C CZ    . ARG A 1 8   ? -42.556 -19.121 63.245 1.00 15.00 ? 8   ARG A CZ    1 
ATOM   63   N NH1   . ARG A 1 8   ? -41.888 -18.033 62.893 1.00 15.00 ? 8   ARG A NH1   1 
ATOM   64   N NH2   . ARG A 1 8   ? -43.630 -19.478 62.556 1.00 15.00 ? 8   ARG A NH2   1 
ATOM   65   N N     . LYS A 1 9   ? -44.310 -21.595 69.044 1.00 15.00 ? 9   LYS A N     1 
ATOM   66   C CA    . LYS A 1 9   ? -45.553 -21.526 69.815 1.00 15.00 ? 9   LYS A CA    1 
ATOM   67   C C     . LYS A 1 9   ? -45.442 -22.319 71.126 1.00 15.00 ? 9   LYS A C     1 
ATOM   68   O O     . LYS A 1 9   ? -46.267 -22.167 72.023 1.00 15.00 ? 9   LYS A O     1 
ATOM   69   C CB    . LYS A 1 9   ? -46.766 -21.978 68.991 1.00 15.00 ? 9   LYS A CB    1 
ATOM   70   C CG    . LYS A 1 9   ? -47.203 -21.003 67.884 1.00 15.00 ? 9   LYS A CG    1 
ATOM   71   C CD    . LYS A 1 9   ? -48.520 -21.461 67.220 1.00 15.00 ? 9   LYS A CD    1 
ATOM   72   C CE    . LYS A 1 9   ? -48.987 -20.546 66.076 1.00 15.00 ? 9   LYS A CE    1 
ATOM   73   N NZ    . LYS A 1 9   ? -49.375 -19.149 66.486 1.00 15.00 ? 9   LYS A NZ    1 
ATOM   74   N N     . LYS A 1 10  ? -44.414 -23.157 71.228 1.00 15.00 ? 10  LYS A N     1 
ATOM   75   C CA    . LYS A 1 10  ? -44.169 -23.944 72.434 1.00 15.00 ? 10  LYS A CA    1 
ATOM   76   C C     . LYS A 1 10  ? -43.253 -23.202 73.402 1.00 15.00 ? 10  LYS A C     1 
ATOM   77   O O     . LYS A 1 10  ? -43.063 -23.646 74.535 1.00 15.00 ? 10  LYS A O     1 
ATOM   78   C CB    . LYS A 1 10  ? -43.580 -25.318 72.113 1.00 15.00 ? 10  LYS A CB    1 
ATOM   79   C CG    . LYS A 1 10  ? -44.576 -26.335 71.567 1.00 15.00 ? 10  LYS A CG    1 
ATOM   80   C CD    . LYS A 1 10  ? -43.932 -27.721 71.475 1.00 15.00 ? 10  LYS A CD    1 
ATOM   81   C CE    . LYS A 1 10  ? -44.971 -28.811 71.254 1.00 15.00 ? 10  LYS A CE    1 
ATOM   82   N NZ    . LYS A 1 10  ? -45.934 -28.851 72.395 1.00 15.00 ? 10  LYS A NZ    1 
ATOM   83   N N     . GLY A 1 11  ? -42.669 -22.092 72.947 1.00 15.00 ? 11  GLY A N     1 
ATOM   84   C CA    . GLY A 1 11  ? -41.776 -21.316 73.789 1.00 15.00 ? 11  GLY A CA    1 
ATOM   85   C C     . GLY A 1 11  ? -40.382 -21.910 73.874 1.00 15.00 ? 11  GLY A C     1 
ATOM   86   O O     . GLY A 1 11  ? -39.642 -21.666 74.833 1.00 15.00 ? 11  GLY A O     1 
ATOM   87   N N     . TYR A 1 12  ? -40.013 -22.663 72.844 1.00 15.00 ? 12  TYR A N     1 
ATOM   88   C CA    . TYR A 1 12  ? -38.708 -23.313 72.770 1.00 15.00 ? 12  TYR A CA    1 
ATOM   89   C C     . TYR A 1 12  ? -37.640 -22.484 72.080 1.00 15.00 ? 12  TYR A C     1 
ATOM   90   O O     . TYR A 1 12  ? -36.462 -22.812 72.158 1.00 15.00 ? 12  TYR A O     1 
ATOM   91   C CB    . TYR A 1 12  ? -38.805 -24.646 72.045 1.00 15.00 ? 12  TYR A CB    1 
ATOM   92   C CG    . TYR A 1 12  ? -39.272 -25.801 72.868 1.00 15.00 ? 12  TYR A CG    1 
ATOM   93   C CD1   . TYR A 1 12  ? -40.411 -25.713 73.662 1.00 15.00 ? 12  TYR A CD1   1 
ATOM   94   C CD2   . TYR A 1 12  ? -38.572 -26.998 72.846 1.00 15.00 ? 12  TYR A CD2   1 
ATOM   95   C CE1   . TYR A 1 12  ? -40.840 -26.794 74.422 1.00 15.00 ? 12  TYR A CE1   1 
ATOM   96   C CE2   . TYR A 1 12  ? -38.988 -28.088 73.594 1.00 15.00 ? 12  TYR A CE2   1 
ATOM   97   C CZ    . TYR A 1 12  ? -40.121 -27.981 74.384 1.00 15.00 ? 12  TYR A CZ    1 
ATOM   98   O OH    . TYR A 1 12  ? -40.504 -29.065 75.141 1.00 15.00 ? 12  TYR A OH    1 
ATOM   99   N N     . VAL A 1 13  ? -38.059 -21.444 71.366 1.00 15.00 ? 13  VAL A N     1 
ATOM   100  C CA    . VAL A 1 13  ? -37.140 -20.622 70.585 1.00 15.00 ? 13  VAL A CA    1 
ATOM   101  C C     . VAL A 1 13  ? -36.894 -19.225 71.137 1.00 15.00 ? 13  VAL A C     1 
ATOM   102  O O     . VAL A 1 13  ? -37.836 -18.498 71.452 1.00 15.00 ? 13  VAL A O     1 
ATOM   103  C CB    . VAL A 1 13  ? -37.662 -20.500 69.127 1.00 15.00 ? 13  VAL A CB    1 
ATOM   104  C CG1   . VAL A 1 13  ? -36.664 -19.770 68.249 1.00 15.00 ? 13  VAL A CG1   1 
ATOM   105  C CG2   . VAL A 1 13  ? -37.955 -21.874 68.561 1.00 15.00 ? 13  VAL A CG2   1 
ATOM   106  N N     . THR A 1 14  ? -35.629 -18.837 71.228 1.00 15.00 ? 14  THR A N     1 
ATOM   107  C CA    . THR A 1 14  ? -35.312 -17.511 71.720 1.00 15.00 ? 14  THR A CA    1 
ATOM   108  C C     . THR A 1 14  ? -35.440 -16.500 70.557 1.00 15.00 ? 14  THR A C     1 
ATOM   109  O O     . THR A 1 14  ? -35.635 -16.888 69.404 1.00 15.00 ? 14  THR A O     1 
ATOM   110  C CB    . THR A 1 14  ? -33.914 -17.473 72.355 1.00 15.00 ? 14  THR A CB    1 
ATOM   111  O OG1   . THR A 1 14  ? -32.934 -17.765 71.365 1.00 15.00 ? 14  THR A OG1   1 
ATOM   112  C CG2   . THR A 1 14  ? -33.803 -18.488 73.467 1.00 15.00 ? 14  THR A CG2   1 
ATOM   113  N N     . PRO A 1 15  ? -35.412 -15.188 70.856 1.00 15.00 ? 15  PRO A N     1 
ATOM   114  C CA    . PRO A 1 15  ? -35.533 -14.184 69.789 1.00 15.00 ? 15  PRO A CA    1 
ATOM   115  C C     . PRO A 1 15  ? -34.523 -14.365 68.662 1.00 15.00 ? 15  PRO A C     1 
ATOM   116  O O     . PRO A 1 15  ? -33.502 -15.041 68.819 1.00 15.00 ? 15  PRO A O     1 
ATOM   117  C CB    . PRO A 1 15  ? -35.286 -12.872 70.532 1.00 15.00 ? 15  PRO A CB    1 
ATOM   118  C CG    . PRO A 1 15  ? -35.872 -13.150 71.886 1.00 15.00 ? 15  PRO A CG    1 
ATOM   119  C CD    . PRO A 1 15  ? -35.341 -14.539 72.178 1.00 15.00 ? 15  PRO A CD    1 
ATOM   120  N N     . VAL A 1 16  ? -34.820 -13.760 67.520 1.00 15.00 ? 16  VAL A N     1 
ATOM   121  C CA    . VAL A 1 16  ? -33.930 -13.834 66.368 1.00 15.00 ? 16  VAL A CA    1 
ATOM   122  C C     . VAL A 1 16  ? -32.680 -13.011 66.645 1.00 15.00 ? 16  VAL A C     1 
ATOM   123  O O     . VAL A 1 16  ? -32.763 -11.878 67.112 1.00 15.00 ? 16  VAL A O     1 
ATOM   124  C CB    . VAL A 1 16  ? -34.621 -13.314 65.090 1.00 15.00 ? 16  VAL A CB    1 
ATOM   125  C CG1   . VAL A 1 16  ? -33.607 -13.108 63.982 1.00 15.00 ? 16  VAL A CG1   1 
ATOM   126  C CG2   . VAL A 1 16  ? -35.679 -14.306 64.651 1.00 15.00 ? 16  VAL A CG2   1 
ATOM   127  N N     . LYS A 1 17  ? -31.525 -13.612 66.385 1.00 15.00 ? 17  LYS A N     1 
ATOM   128  C CA    . LYS A 1 17  ? -30.238 -12.959 66.583 1.00 15.00 ? 17  LYS A CA    1 
ATOM   129  C C     . LYS A 1 17  ? -29.671 -12.530 65.227 1.00 15.00 ? 17  LYS A C     1 
ATOM   130  O O     . LYS A 1 17  ? -30.205 -12.881 64.170 1.00 15.00 ? 17  LYS A O     1 
ATOM   131  C CB    . LYS A 1 17  ? -29.250 -13.887 67.303 1.00 15.00 ? 17  LYS A CB    1 
ATOM   132  C CG    . LYS A 1 17  ? -29.807 -14.638 68.504 1.00 15.00 ? 17  LYS A CG    1 
ATOM   133  C CD    . LYS A 1 17  ? -30.238 -13.705 69.609 1.00 15.00 ? 17  LYS A CD    1 
ATOM   134  C CE    . LYS A 1 17  ? -30.582 -14.456 70.883 1.00 15.00 ? 17  LYS A CE    1 
ATOM   135  N NZ    . LYS A 1 17  ? -31.749 -15.342 70.734 1.00 15.00 ? 17  LYS A NZ    1 
ATOM   136  N N     . ASN A 1 18  ? -28.574 -11.787 65.270 1.00 15.00 ? 18  ASN A N     1 
ATOM   137  C CA    . ASN A 1 18  ? -27.902 -11.324 64.065 1.00 15.00 ? 18  ASN A CA    1 
ATOM   138  C C     . ASN A 1 18  ? -26.407 -11.581 64.187 1.00 15.00 ? 18  ASN A C     1 
ATOM   139  O O     . ASN A 1 18  ? -25.738 -11.034 65.075 1.00 15.00 ? 18  ASN A O     1 
ATOM   140  C CB    . ASN A 1 18  ? -28.173 -9.844  63.801 1.00 15.00 ? 18  ASN A CB    1 
ATOM   141  C CG    . ASN A 1 18  ? -27.658 -9.388  62.448 1.00 15.00 ? 18  ASN A CG    1 
ATOM   142  O OD1   . ASN A 1 18  ? -26.793 -10.022 61.847 1.00 15.00 ? 18  ASN A OD1   1 
ATOM   143  N ND2   . ASN A 1 18  ? -28.204 -8.295  61.955 1.00 15.00 ? 18  ASN A ND2   1 
ATOM   144  N N     . GLN A 1 19  ? -25.887 -12.417 63.297 1.00 15.00 ? 19  GLN A N     1 
ATOM   145  C CA    . GLN A 1 19  ? -24.476 -12.750 63.307 1.00 15.00 ? 19  GLN A CA    1 
ATOM   146  C C     . GLN A 1 19  ? -23.586 -11.600 62.858 1.00 15.00 ? 19  GLN A C     1 
ATOM   147  O O     . GLN A 1 19  ? -22.433 -11.514 63.269 1.00 15.00 ? 19  GLN A O     1 
ATOM   148  C CB    . GLN A 1 19  ? -24.199 -14.015 62.484 1.00 15.00 ? 19  GLN A CB    1 
ATOM   149  C CG    . GLN A 1 19  ? -24.560 -13.939 60.998 1.00 15.00 ? 19  GLN A CG    1 
ATOM   150  C CD    . GLN A 1 19  ? -24.277 -15.244 60.268 1.00 15.00 ? 19  GLN A CD    1 
ATOM   151  O OE1   . GLN A 1 19  ? -25.139 -15.792 59.596 1.00 15.00 ? 19  GLN A OE1   1 
ATOM   152  N NE2   . GLN A 1 19  ? -23.063 -15.743 60.402 1.00 15.00 ? 19  GLN A NE2   1 
ATOM   153  N N     . GLY A 1 20  ? -24.119 -10.706 62.034 1.00 15.00 ? 20  GLY A N     1 
ATOM   154  C CA    . GLY A 1 20  ? -23.325 -9.593  61.546 1.00 15.00 ? 20  GLY A CA    1 
ATOM   155  C C     . GLY A 1 20  ? -22.334 -10.052 60.488 1.00 15.00 ? 20  GLY A C     1 
ATOM   156  O O     . GLY A 1 20  ? -22.590 -11.028 59.777 1.00 15.00 ? 20  GLY A O     1 
ATOM   157  N N     . GLN A 1 21  ? -21.190 -9.382  60.396 1.00 15.00 ? 21  GLN A N     1 
ATOM   158  C CA    . GLN A 1 21  ? -20.185 -9.731  59.394 1.00 15.00 ? 21  GLN A CA    1 
ATOM   159  C C     . GLN A 1 21  ? -19.148 -10.706 59.946 1.00 15.00 ? 21  GLN A C     1 
ATOM   160  O O     . GLN A 1 21  ? -17.956 -10.405 60.017 1.00 15.00 ? 21  GLN A O     1 
ATOM   161  C CB    . GLN A 1 21  ? -19.514 -8.481  58.813 1.00 15.00 ? 21  GLN A CB    1 
ATOM   162  C CG    . GLN A 1 21  ? -20.420 -7.635  57.926 1.00 15.00 ? 21  GLN A CG    1 
ATOM   163  C CD    . GLN A 1 21  ? -20.793 -8.331  56.622 1.00 15.00 ? 21  GLN A CD    1 
ATOM   164  O OE1   . GLN A 1 21  ? -20.019 -9.117  56.074 1.00 15.00 ? 21  GLN A OE1   1 
ATOM   165  N NE2   . GLN A 1 21  ? -21.974 -8.022  56.106 1.00 15.00 ? 21  GLN A NE2   1 
ATOM   166  N N     . CYS A 1 22  ? -19.625 -11.880 60.341 1.00 15.00 ? 22  CYS A N     1 
ATOM   167  C CA    . CYS A 1 22  ? -18.793 -12.940 60.890 1.00 15.00 ? 22  CYS A CA    1 
ATOM   168  C C     . CYS A 1 22  ? -19.488 -14.244 60.533 1.00 15.00 ? 22  CYS A C     1 
ATOM   169  O O     . CYS A 1 22  ? -20.711 -14.344 60.624 1.00 15.00 ? 22  CYS A O     1 
ATOM   170  C CB    . CYS A 1 22  ? -18.613 -12.777 62.411 1.00 15.00 ? 22  CYS A CB    1 
ATOM   171  S SG    . CYS A 1 22  ? -18.028 -14.242 63.331 1.00 15.00 ? 22  CYS A SG    1 
ATOM   172  N N     . GLY A 1 23  ? -18.728 -15.193 60.004 1.00 15.00 ? 23  GLY A N     1 
ATOM   173  C CA    . GLY A 1 23  ? -19.290 -16.483 59.660 1.00 15.00 ? 23  GLY A CA    1 
ATOM   174  C C     . GLY A 1 23  ? -19.534 -17.349 60.891 1.00 15.00 ? 23  GLY A C     1 
ATOM   175  O O     . GLY A 1 23  ? -19.040 -18.478 60.978 1.00 15.00 ? 23  GLY A O     1 
ATOM   176  N N     . SER A 1 24  ? -20.358 -16.858 61.811 1.00 15.00 ? 24  SER A N     1 
ATOM   177  C CA    . SER A 1 24  ? -20.667 -17.597 63.028 1.00 15.00 ? 24  SER A CA    1 
ATOM   178  C C     . SER A 1 24  ? -22.008 -18.355 62.960 1.00 15.00 ? 24  SER A C     1 
ATOM   179  O O     . SER A 1 24  ? -22.577 -18.726 63.993 1.00 15.00 ? 24  SER A O     1 
ATOM   180  C CB    . SER A 1 24  ? -20.615 -16.660 64.224 1.00 15.00 ? 24  SER A CB    1 
ATOM   181  O OG    . SER A 1 24  ? -21.353 -15.487 63.953 1.00 15.00 ? 24  SER A OG    1 
ATOM   182  N N     . CYS A 1 25  ? -22.501 -18.581 61.742 1.00 15.00 ? 25  CYS A N     1 
ATOM   183  C CA    . CYS A 1 25  ? -23.764 -19.279 61.516 1.00 15.00 ? 25  CYS A CA    1 
ATOM   184  C C     . CYS A 1 25  ? -23.857 -20.578 62.316 1.00 15.00 ? 25  CYS A C     1 
ATOM   185  O O     . CYS A 1 25  ? -24.835 -20.820 63.015 1.00 15.00 ? 25  CYS A O     1 
ATOM   186  C CB    . CYS A 1 25  ? -23.983 -19.512 60.014 1.00 15.00 ? 25  CYS A CB    1 
ATOM   187  S SG    . CYS A 1 25  ? -22.572 -20.305 59.152 1.00 15.00 ? 25  CYS A SG    1 
ATOM   188  N N     . TRP A 1 26  ? -22.803 -21.382 62.246 1.00 15.00 ? 26  TRP A N     1 
ATOM   189  C CA    . TRP A 1 26  ? -22.727 -22.648 62.968 1.00 15.00 ? 26  TRP A CA    1 
ATOM   190  C C     . TRP A 1 26  ? -22.950 -22.495 64.488 1.00 15.00 ? 26  TRP A C     1 
ATOM   191  O O     . TRP A 1 26  ? -23.651 -23.298 65.102 1.00 15.00 ? 26  TRP A O     1 
ATOM   192  C CB    . TRP A 1 26  ? -21.388 -23.331 62.673 1.00 15.00 ? 26  TRP A CB    1 
ATOM   193  C CG    . TRP A 1 26  ? -20.189 -22.456 62.980 1.00 15.00 ? 26  TRP A CG    1 
ATOM   194  C CD1   . TRP A 1 26  ? -19.670 -21.482 62.187 1.00 15.00 ? 26  TRP A CD1   1 
ATOM   195  C CD2   . TRP A 1 26  ? -19.406 -22.452 64.186 1.00 15.00 ? 26  TRP A CD2   1 
ATOM   196  N NE1   . TRP A 1 26  ? -18.624 -20.863 62.821 1.00 15.00 ? 26  TRP A NE1   1 
ATOM   197  C CE2   . TRP A 1 26  ? -18.439 -21.438 64.051 1.00 15.00 ? 26  TRP A CE2   1 
ATOM   198  C CE3   . TRP A 1 26  ? -19.433 -23.206 65.371 1.00 15.00 ? 26  TRP A CE3   1 
ATOM   199  C CZ2   . TRP A 1 26  ? -17.498 -21.154 65.059 1.00 15.00 ? 26  TRP A CZ2   1 
ATOM   200  C CZ3   . TRP A 1 26  ? -18.500 -22.924 66.372 1.00 15.00 ? 26  TRP A CZ3   1 
ATOM   201  C CH2   . TRP A 1 26  ? -17.547 -21.908 66.207 1.00 15.00 ? 26  TRP A CH2   1 
ATOM   202  N N     . ALA A 1 27  ? -22.349 -21.461 65.080 1.00 15.00 ? 27  ALA A N     1 
ATOM   203  C CA    . ALA A 1 27  ? -22.455 -21.182 66.511 1.00 15.00 ? 27  ALA A CA    1 
ATOM   204  C C     . ALA A 1 27  ? -23.904 -20.896 66.883 1.00 15.00 ? 27  ALA A C     1 
ATOM   205  O O     . ALA A 1 27  ? -24.457 -21.564 67.743 1.00 15.00 ? 27  ALA A O     1 
ATOM   206  C CB    . ALA A 1 27  ? -21.557 -20.016 66.886 1.00 15.00 ? 27  ALA A CB    1 
ATOM   207  N N     . PHE A 1 28  ? -24.526 -19.940 66.192 1.00 15.00 ? 28  PHE A N     1 
ATOM   208  C CA    . PHE A 1 28  ? -25.931 -19.577 66.410 1.00 15.00 ? 28  PHE A CA    1 
ATOM   209  C C     . PHE A 1 28  ? -26.870 -20.780 66.234 1.00 15.00 ? 28  PHE A C     1 
ATOM   210  O O     . PHE A 1 28  ? -27.846 -20.923 66.960 1.00 15.00 ? 28  PHE A O     1 
ATOM   211  C CB    . PHE A 1 28  ? -26.362 -18.436 65.481 1.00 15.00 ? 28  PHE A CB    1 
ATOM   212  C CG    . PHE A 1 28  ? -25.830 -17.088 65.877 1.00 15.00 ? 28  PHE A CG    1 
ATOM   213  C CD1   . PHE A 1 28  ? -26.482 -16.323 66.837 1.00 15.00 ? 28  PHE A CD1   1 
ATOM   214  C CD2   . PHE A 1 28  ? -24.661 -16.595 65.316 1.00 15.00 ? 28  PHE A CD2   1 
ATOM   215  C CE1   . PHE A 1 28  ? -25.967 -15.090 67.237 1.00 15.00 ? 28  PHE A CE1   1 
ATOM   216  C CE2   . PHE A 1 28  ? -24.145 -15.370 65.708 1.00 15.00 ? 28  PHE A CE2   1 
ATOM   217  C CZ    . PHE A 1 28  ? -24.795 -14.617 66.668 1.00 15.00 ? 28  PHE A CZ    1 
ATOM   218  N N     . SER A 1 29  ? -26.564 -21.636 65.264 1.00 15.00 ? 29  SER A N     1 
ATOM   219  C CA    . SER A 1 29  ? -27.351 -22.831 64.988 1.00 15.00 ? 29  SER A CA    1 
ATOM   220  C C     . SER A 1 29  ? -27.215 -23.841 66.127 1.00 15.00 ? 29  SER A C     1 
ATOM   221  O O     . SER A 1 29  ? -28.193 -24.490 66.499 1.00 15.00 ? 29  SER A O     1 
ATOM   222  C CB    . SER A 1 29  ? -26.948 -23.452 63.643 1.00 15.00 ? 29  SER A CB    1 
ATOM   223  O OG    . SER A 1 29  ? -27.679 -24.634 63.364 1.00 15.00 ? 29  SER A OG    1 
ATOM   224  N N     . SER A 1 30  ? -26.007 -23.956 66.685 1.00 15.00 ? 30  SER A N     1 
ATOM   225  C CA    . SER A 1 30  ? -25.733 -24.884 67.794 1.00 15.00 ? 30  SER A CA    1 
ATOM   226  C C     . SER A 1 30  ? -26.371 -24.390 69.086 1.00 15.00 ? 30  SER A C     1 
ATOM   227  O O     . SER A 1 30  ? -26.951 -25.160 69.850 1.00 15.00 ? 30  SER A O     1 
ATOM   228  C CB    . SER A 1 30  ? -24.225 -25.100 67.995 1.00 15.00 ? 30  SER A CB    1 
ATOM   229  O OG    . SER A 1 30  ? -23.604 -25.574 66.817 1.00 15.00 ? 30  SER A OG    1 
ATOM   230  N N     . VAL A 1 31  ? -26.234 -23.093 69.328 1.00 15.00 ? 31  VAL A N     1 
ATOM   231  C CA    . VAL A 1 31  ? -26.795 -22.450 70.506 1.00 15.00 ? 31  VAL A CA    1 
ATOM   232  C C     . VAL A 1 31  ? -28.309 -22.630 70.484 1.00 15.00 ? 31  VAL A C     1 
ATOM   233  O O     . VAL A 1 31  ? -28.914 -22.923 71.513 1.00 15.00 ? 31  VAL A O     1 
ATOM   234  C CB    . VAL A 1 31  ? -26.393 -20.952 70.549 1.00 15.00 ? 31  VAL A CB    1 
ATOM   235  C CG1   . VAL A 1 31  ? -27.418 -20.121 71.240 1.00 15.00 ? 31  VAL A CG1   1 
ATOM   236  C CG2   . VAL A 1 31  ? -25.071 -20.809 71.262 1.00 15.00 ? 31  VAL A CG2   1 
ATOM   237  N N     . GLY A 1 32  ? -28.891 -22.515 69.291 1.00 15.00 ? 32  GLY A N     1 
ATOM   238  C CA    . GLY A 1 32  ? -30.321 -22.681 69.115 1.00 15.00 ? 32  GLY A CA    1 
ATOM   239  C C     . GLY A 1 32  ? -30.779 -24.090 69.447 1.00 15.00 ? 32  GLY A C     1 
ATOM   240  O O     . GLY A 1 32  ? -31.860 -24.279 69.994 1.00 15.00 ? 32  GLY A O     1 
ATOM   241  N N     . ALA A 1 33  ? -29.967 -25.081 69.093 1.00 15.00 ? 33  ALA A N     1 
ATOM   242  C CA    . ALA A 1 33  ? -30.286 -26.473 69.379 1.00 15.00 ? 33  ALA A CA    1 
ATOM   243  C C     . ALA A 1 33  ? -30.191 -26.696 70.891 1.00 15.00 ? 33  ALA A C     1 
ATOM   244  O O     . ALA A 1 33  ? -31.077 -27.297 71.503 1.00 15.00 ? 33  ALA A O     1 
ATOM   245  C CB    . ALA A 1 33  ? -29.333 -27.392 68.647 1.00 15.00 ? 33  ALA A CB    1 
ATOM   246  N N     . LEU A 1 34  ? -29.129 -26.180 71.495 1.00 15.00 ? 34  LEU A N     1 
ATOM   247  C CA    . LEU A 1 34  ? -28.926 -26.319 72.930 1.00 15.00 ? 34  LEU A CA    1 
ATOM   248  C C     . LEU A 1 34  ? -30.066 -25.650 73.687 1.00 15.00 ? 34  LEU A C     1 
ATOM   249  O O     . LEU A 1 34  ? -30.593 -26.213 74.642 1.00 15.00 ? 34  LEU A O     1 
ATOM   250  C CB    . LEU A 1 34  ? -27.577 -25.745 73.349 1.00 15.00 ? 34  LEU A CB    1 
ATOM   251  C CG    . LEU A 1 34  ? -26.311 -26.496 72.947 1.00 15.00 ? 34  LEU A CG    1 
ATOM   252  C CD1   . LEU A 1 34  ? -25.076 -25.640 73.209 1.00 15.00 ? 34  LEU A CD1   1 
ATOM   253  C CD2   . LEU A 1 34  ? -26.236 -27.791 73.730 1.00 15.00 ? 34  LEU A CD2   1 
ATOM   254  N N     . GLU A 1 35  ? -30.466 -24.470 73.219 1.00 15.00 ? 35  GLU A N     1 
ATOM   255  C CA    . GLU A 1 35  ? -31.548 -23.701 73.823 1.00 15.00 ? 35  GLU A CA    1 
ATOM   256  C C     . GLU A 1 35  ? -32.858 -24.467 73.955 1.00 15.00 ? 35  GLU A C     1 
ATOM   257  O O     . GLU A 1 35  ? -33.515 -24.391 74.996 1.00 15.00 ? 35  GLU A O     1 
ATOM   258  C CB    . GLU A 1 35  ? -31.770 -22.388 73.082 1.00 15.00 ? 35  GLU A CB    1 
ATOM   259  C CG    . GLU A 1 35  ? -30.838 -21.282 73.540 1.00 15.00 ? 35  GLU A CG    1 
ATOM   260  C CD    . GLU A 1 35  ? -30.756 -20.129 72.545 1.00 15.00 ? 35  GLU A CD    1 
ATOM   261  O OE1   . GLU A 1 35  ? -31.506 -20.136 71.540 1.00 15.00 ? 35  GLU A OE1   1 
ATOM   262  O OE2   . GLU A 1 35  ? -29.927 -19.219 72.759 1.00 15.00 ? 35  GLU A OE2   1 
ATOM   263  N N     . GLY A 1 36  ? -33.211 -25.210 72.904 1.00 15.00 ? 36  GLY A N     1 
ATOM   264  C CA    . GLY A 1 36  ? -34.425 -26.001 72.898 1.00 15.00 ? 36  GLY A CA    1 
ATOM   265  C C     . GLY A 1 36  ? -34.351 -27.130 73.911 1.00 15.00 ? 36  GLY A C     1 
ATOM   266  O O     . GLY A 1 36  ? -35.291 -27.367 74.664 1.00 15.00 ? 36  GLY A O     1 
ATOM   267  N N     . GLN A 1 37  ? -33.219 -27.820 73.951 1.00 15.00 ? 37  GLN A N     1 
ATOM   268  C CA    . GLN A 1 37  ? -33.036 -28.916 74.899 1.00 15.00 ? 37  GLN A CA    1 
ATOM   269  C C     . GLN A 1 37  ? -33.048 -28.411 76.347 1.00 15.00 ? 37  GLN A C     1 
ATOM   270  O O     . GLN A 1 37  ? -33.635 -29.044 77.230 1.00 15.00 ? 37  GLN A O     1 
ATOM   271  C CB    . GLN A 1 37  ? -31.770 -29.710 74.565 1.00 15.00 ? 37  GLN A CB    1 
ATOM   272  C CG    . GLN A 1 37  ? -31.840 -30.384 73.195 1.00 15.00 ? 37  GLN A CG    1 
ATOM   273  C CD    . GLN A 1 37  ? -33.167 -31.113 72.971 1.00 15.00 ? 37  GLN A CD    1 
ATOM   274  O OE1   . GLN A 1 37  ? -33.600 -31.900 73.811 1.00 15.00 ? 37  GLN A OE1   1 
ATOM   275  N NE2   . GLN A 1 37  ? -33.823 -30.833 71.849 1.00 15.00 ? 37  GLN A NE2   1 
ATOM   276  N N     . LEU A 1 38  ? -32.455 -27.239 76.572 1.00 15.00 ? 38  LEU A N     1 
ATOM   277  C CA    . LEU A 1 38  ? -32.424 -26.625 77.901 1.00 15.00 ? 38  LEU A CA    1 
ATOM   278  C C     . LEU A 1 38  ? -33.855 -26.349 78.349 1.00 15.00 ? 38  LEU A C     1 
ATOM   279  O O     . LEU A 1 38  ? -34.217 -26.598 79.504 1.00 15.00 ? 38  LEU A O     1 
ATOM   280  C CB    . LEU A 1 38  ? -31.605 -25.342 77.895 1.00 15.00 ? 38  LEU A CB    1 
ATOM   281  C CG    . LEU A 1 38  ? -31.496 -24.543 79.197 1.00 15.00 ? 38  LEU A CG    1 
ATOM   282  C CD1   . LEU A 1 38  ? -30.941 -25.415 80.343 1.00 15.00 ? 38  LEU A CD1   1 
ATOM   283  C CD2   . LEU A 1 38  ? -30.602 -23.340 78.949 1.00 15.00 ? 38  LEU A CD2   1 
ATOM   284  N N     . LYS A 1 39  ? -34.664 -25.845 77.419 1.00 15.00 ? 39  LYS A N     1 
ATOM   285  C CA    . LYS A 1 39  ? -36.065 -25.556 77.684 1.00 15.00 ? 39  LYS A CA    1 
ATOM   286  C C     . LYS A 1 39  ? -36.831 -26.834 78.036 1.00 15.00 ? 39  LYS A C     1 
ATOM   287  O O     . LYS A 1 39  ? -37.545 -26.889 79.044 1.00 15.00 ? 39  LYS A O     1 
ATOM   288  C CB    . LYS A 1 39  ? -36.708 -24.847 76.494 1.00 15.00 ? 39  LYS A CB    1 
ATOM   289  C CG    . LYS A 1 39  ? -38.208 -24.623 76.624 1.00 15.00 ? 39  LYS A CG    1 
ATOM   290  C CD    . LYS A 1 39  ? -38.523 -23.638 77.740 1.00 15.00 ? 39  LYS A CD    1 
ATOM   291  C CE    . LYS A 1 39  ? -40.029 -23.469 77.924 1.00 15.00 ? 39  LYS A CE    1 
ATOM   292  N NZ    . LYS A 1 39  ? -40.355 -22.387 78.906 1.00 15.00 ? 39  LYS A NZ    1 
ATOM   293  N N     . LYS A 1 40  ? -36.648 -27.871 77.227 1.00 15.00 ? 40  LYS A N     1 
ATOM   294  C CA    . LYS A 1 40  ? -37.328 -29.140 77.443 1.00 15.00 ? 40  LYS A CA    1 
ATOM   295  C C     . LYS A 1 40  ? -37.008 -29.805 78.783 1.00 15.00 ? 40  LYS A C     1 
ATOM   296  O O     . LYS A 1 40  ? -37.918 -30.195 79.517 1.00 15.00 ? 40  LYS A O     1 
ATOM   297  C CB    . LYS A 1 40  ? -37.065 -30.092 76.283 1.00 15.00 ? 40  LYS A CB    1 
ATOM   298  C CG    . LYS A 1 40  ? -37.541 -31.502 76.529 1.00 15.00 ? 40  LYS A CG    1 
ATOM   299  C CD    . LYS A 1 40  ? -37.533 -32.321 75.258 1.00 15.00 ? 40  LYS A CD    1 
ATOM   300  C CE    . LYS A 1 40  ? -38.472 -31.719 74.218 1.00 15.00 ? 40  LYS A CE    1 
ATOM   301  N NZ    . LYS A 1 40  ? -38.747 -32.660 73.092 1.00 15.00 ? 40  LYS A NZ    1 
ATOM   302  N N     . LYS A 1 41  ? -35.725 -29.902 79.114 1.00 15.00 ? 41  LYS A N     1 
ATOM   303  C CA    . LYS A 1 41  ? -35.290 -30.524 80.362 1.00 15.00 ? 41  LYS A CA    1 
ATOM   304  C C     . LYS A 1 41  ? -35.469 -29.727 81.677 1.00 15.00 ? 41  LYS A C     1 
ATOM   305  O O     . LYS A 1 41  ? -35.739 -30.323 82.734 1.00 15.00 ? 41  LYS A O     1 
ATOM   306  C CB    . LYS A 1 41  ? -33.842 -31.020 80.224 1.00 15.00 ? 41  LYS A CB    1 
ATOM   307  C CG    . LYS A 1 41  ? -33.701 -32.501 79.871 1.00 15.00 ? 41  LYS A CG    1 
ATOM   308  C CD    . LYS A 1 41  ? -34.486 -32.904 78.619 1.00 15.00 ? 41  LYS A CD    1 
ATOM   309  C CE    . LYS A 1 41  ? -33.578 -33.118 77.405 1.00 15.00 ? 41  LYS A CE    1 
ATOM   310  N NZ    . LYS A 1 41  ? -33.063 -31.849 76.830 1.00 15.00 ? 41  LYS A NZ    1 
ATOM   311  N N     . THR A 1 42  ? -35.276 -28.404 81.633 1.00 15.00 ? 42  THR A N     1 
ATOM   312  C CA    . THR A 1 42  ? -35.405 -27.568 82.832 1.00 15.00 ? 42  THR A CA    1 
ATOM   313  C C     . THR A 1 42  ? -36.637 -26.665 82.818 1.00 15.00 ? 42  THR A C     1 
ATOM   314  O O     . THR A 1 42  ? -37.068 -26.162 83.864 1.00 15.00 ? 42  THR A O     1 
ATOM   315  C CB    . THR A 1 42  ? -34.168 -26.654 83.037 1.00 15.00 ? 42  THR A CB    1 
ATOM   316  O OG1   . THR A 1 42  ? -34.203 -25.567 82.102 1.00 15.00 ? 42  THR A OG1   1 
ATOM   317  C CG2   . THR A 1 42  ? -32.870 -27.433 82.845 1.00 15.00 ? 42  THR A CG2   1 
ATOM   318  N N     . GLY A 1 43  ? -37.174 -26.415 81.628 1.00 15.00 ? 43  GLY A N     1 
ATOM   319  C CA    . GLY A 1 43  ? -38.334 -25.553 81.520 1.00 15.00 ? 43  GLY A CA    1 
ATOM   320  C C     . GLY A 1 43  ? -37.929 -24.096 81.406 1.00 15.00 ? 43  GLY A C     1 
ATOM   321  O O     . GLY A 1 43  ? -38.785 -23.229 81.257 1.00 15.00 ? 43  GLY A O     1 
ATOM   322  N N     . LYS A 1 44  ? -36.632 -23.820 81.525 1.00 15.00 ? 44  LYS A N     1 
ATOM   323  C CA    . LYS A 1 44  ? -36.110 -22.462 81.409 1.00 15.00 ? 44  LYS A CA    1 
ATOM   324  C C     . LYS A 1 44  ? -35.715 -22.168 79.962 1.00 15.00 ? 44  LYS A C     1 
ATOM   325  O O     . LYS A 1 44  ? -35.240 -23.050 79.253 1.00 15.00 ? 44  LYS A O     1 
ATOM   326  C CB    . LYS A 1 44  ? -34.914 -22.237 82.328 1.00 15.00 ? 44  LYS A CB    1 
ATOM   327  C CG    . LYS A 1 44  ? -35.254 -22.150 83.791 1.00 15.00 ? 44  LYS A CG    1 
ATOM   328  C CD    . LYS A 1 44  ? -34.061 -21.630 84.590 1.00 15.00 ? 44  LYS A CD    1 
ATOM   329  C CE    . LYS A 1 44  ? -33.686 -20.185 84.170 1.00 15.00 ? 44  LYS A CE    1 
ATOM   330  N NZ    . LYS A 1 44  ? -32.771 -19.504 85.160 1.00 15.00 ? 44  LYS A NZ    1 
ATOM   331  N N     . LEU A 1 45  ? -35.909 -20.926 79.536 1.00 15.00 ? 45  LEU A N     1 
ATOM   332  C CA    . LEU A 1 45  ? -35.565 -20.516 78.186 1.00 15.00 ? 45  LEU A CA    1 
ATOM   333  C C     . LEU A 1 45  ? -34.714 -19.259 78.245 1.00 15.00 ? 45  LEU A C     1 
ATOM   334  O O     . LEU A 1 45  ? -35.218 -18.173 78.528 1.00 15.00 ? 45  LEU A O     1 
ATOM   335  C CB    . LEU A 1 45  ? -36.801 -20.277 77.311 1.00 15.00 ? 45  LEU A CB    1 
ATOM   336  C CG    . LEU A 1 45  ? -36.486 -19.858 75.866 1.00 15.00 ? 45  LEU A CG    1 
ATOM   337  C CD1   . LEU A 1 45  ? -36.010 -21.065 75.082 1.00 15.00 ? 45  LEU A CD1   1 
ATOM   338  C CD2   . LEU A 1 45  ? -37.694 -19.229 75.170 1.00 15.00 ? 45  LEU A CD2   1 
ATOM   339  N N     . LEU A 1 46  ? -33.415 -19.423 78.018 1.00 15.00 ? 46  LEU A N     1 
ATOM   340  C CA    . LEU A 1 46  ? -32.496 -18.293 78.005 1.00 15.00 ? 46  LEU A CA    1 
ATOM   341  C C     . LEU A 1 46  ? -31.537 -18.341 76.803 1.00 15.00 ? 46  LEU A C     1 
ATOM   342  O O     . LEU A 1 46  ? -31.413 -19.372 76.139 1.00 15.00 ? 46  LEU A O     1 
ATOM   343  C CB    . LEU A 1 46  ? -31.754 -18.142 79.350 1.00 15.00 ? 46  LEU A CB    1 
ATOM   344  C CG    . LEU A 1 46  ? -31.052 -19.266 80.114 1.00 15.00 ? 46  LEU A CG    1 
ATOM   345  C CD1   . LEU A 1 46  ? -32.042 -20.117 80.860 1.00 15.00 ? 46  LEU A CD1   1 
ATOM   346  C CD2   . LEU A 1 46  ? -30.230 -20.092 79.166 1.00 15.00 ? 46  LEU A CD2   1 
ATOM   347  N N     . ASN A 1 47  ? -30.929 -17.203 76.483 1.00 15.00 ? 47  ASN A N     1 
ATOM   348  C CA    . ASN A 1 47  ? -30.001 -17.116 75.364 1.00 15.00 ? 47  ASN A CA    1 
ATOM   349  C C     . ASN A 1 47  ? -28.643 -17.642 75.753 1.00 15.00 ? 47  ASN A C     1 
ATOM   350  O O     . ASN A 1 47  ? -28.096 -17.244 76.780 1.00 15.00 ? 47  ASN A O     1 
ATOM   351  C CB    . ASN A 1 47  ? -29.883 -15.692 74.841 1.00 15.00 ? 47  ASN A CB    1 
ATOM   352  C CG    . ASN A 1 47  ? -31.206 -15.119 74.456 1.00 15.00 ? 47  ASN A CG    1 
ATOM   353  O OD1   . ASN A 1 47  ? -31.905 -15.657 73.602 1.00 15.00 ? 47  ASN A OD1   1 
ATOM   354  N ND2   . ASN A 1 47  ? -31.587 -14.039 75.109 1.00 15.00 ? 47  ASN A ND2   1 
ATOM   355  N N     . LEU A 1 48  ? -28.119 -18.557 74.944 1.00 15.00 ? 48  LEU A N     1 
ATOM   356  C CA    . LEU A 1 48  ? -26.815 -19.150 75.183 1.00 15.00 ? 48  LEU A CA    1 
ATOM   357  C C     . LEU A 1 48  ? -25.734 -18.357 74.468 1.00 15.00 ? 48  LEU A C     1 
ATOM   358  O O     . LEU A 1 48  ? -26.043 -17.441 73.708 1.00 15.00 ? 48  LEU A O     1 
ATOM   359  C CB    . LEU A 1 48  ? -26.799 -20.629 74.804 1.00 15.00 ? 48  LEU A CB    1 
ATOM   360  C CG    . LEU A 1 48  ? -27.729 -21.453 75.706 1.00 15.00 ? 48  LEU A CG    1 
ATOM   361  C CD1   . LEU A 1 48  ? -27.553 -22.930 75.440 1.00 15.00 ? 48  LEU A CD1   1 
ATOM   362  C CD2   . LEU A 1 48  ? -27.444 -21.153 77.168 1.00 15.00 ? 48  LEU A CD2   1 
ATOM   363  N N     . SER A 1 49  ? -24.475 -18.723 74.693 1.00 15.00 ? 49  SER A N     1 
ATOM   364  C CA    . SER A 1 49  ? -23.359 -18.000 74.117 1.00 15.00 ? 49  SER A CA    1 
ATOM   365  C C     . SER A 1 49  ? -22.725 -18.498 72.825 1.00 15.00 ? 49  SER A C     1 
ATOM   366  O O     . SER A 1 49  ? -21.928 -19.433 72.840 1.00 15.00 ? 49  SER A O     1 
ATOM   367  C CB    . SER A 1 49  ? -22.274 -17.782 75.179 1.00 15.00 ? 49  SER A CB    1 
ATOM   368  O OG    . SER A 1 49  ? -21.186 -17.012 74.685 1.00 15.00 ? 49  SER A OG    1 
ATOM   369  N N     . PRO A 1 50  ? -23.071 -17.871 71.681 1.00 15.00 ? 50  PRO A N     1 
ATOM   370  C CA    . PRO A 1 50  ? -22.467 -18.295 70.415 1.00 15.00 ? 50  PRO A CA    1 
ATOM   371  C C     . PRO A 1 50  ? -20.996 -17.832 70.390 1.00 15.00 ? 50  PRO A C     1 
ATOM   372  O O     . PRO A 1 50  ? -20.149 -18.479 69.770 1.00 15.00 ? 50  PRO A O     1 
ATOM   373  C CB    . PRO A 1 50  ? -23.328 -17.578 69.363 1.00 15.00 ? 50  PRO A CB    1 
ATOM   374  C CG    . PRO A 1 50  ? -23.809 -16.352 70.072 1.00 15.00 ? 50  PRO A CG    1 
ATOM   375  C CD    . PRO A 1 50  ? -24.144 -16.882 71.445 1.00 15.00 ? 50  PRO A CD    1 
ATOM   376  N N     . GLN A 1 51  ? -20.702 -16.734 71.097 1.00 15.00 ? 51  GLN A N     1 
ATOM   377  C CA    . GLN A 1 51  ? -19.343 -16.184 71.187 1.00 15.00 ? 51  GLN A CA    1 
ATOM   378  C C     . GLN A 1 51  ? -18.423 -17.164 71.948 1.00 15.00 ? 51  GLN A C     1 
ATOM   379  O O     . GLN A 1 51  ? -17.251 -17.334 71.595 1.00 15.00 ? 51  GLN A O     1 
ATOM   380  C CB    . GLN A 1 51  ? -19.352 -14.782 71.816 1.00 15.00 ? 51  GLN A CB    1 
ATOM   381  C CG    . GLN A 1 51  ? -18.057 -13.960 71.658 1.00 15.00 ? 51  GLN A CG    1 
ATOM   382  C CD    . GLN A 1 51  ? -17.756 -13.495 70.218 1.00 15.00 ? 51  GLN A CD    1 
ATOM   383  O OE1   . GLN A 1 51  ? -18.596 -12.889 69.543 1.00 15.00 ? 51  GLN A OE1   1 
ATOM   384  N NE2   . GLN A 1 51  ? -16.536 -13.739 69.771 1.00 15.00 ? 51  GLN A NE2   1 
ATOM   385  N N     . ASN A 1 52  ? -18.981 -17.855 72.938 1.00 15.00 ? 52  ASN A N     1 
ATOM   386  C CA    . ASN A 1 52  ? -18.232 -18.852 73.701 1.00 15.00 ? 52  ASN A CA    1 
ATOM   387  C C     . ASN A 1 52  ? -17.679 -19.864 72.698 1.00 15.00 ? 52  ASN A C     1 
ATOM   388  O O     . ASN A 1 52  ? -16.495 -20.209 72.726 1.00 15.00 ? 52  ASN A O     1 
ATOM   389  C CB    . ASN A 1 52  ? -19.143 -19.540 74.726 1.00 15.00 ? 52  ASN A CB    1 
ATOM   390  C CG    . ASN A 1 52  ? -18.400 -20.503 75.656 1.00 15.00 ? 52  ASN A CG    1 
ATOM   391  O OD1   . ASN A 1 52  ? -18.992 -21.016 76.608 1.00 15.00 ? 52  ASN A OD1   1 
ATOM   392  N ND2   . ASN A 1 52  ? -17.112 -20.731 75.410 1.00 15.00 ? 52  ASN A ND2   1 
ATOM   393  N N     . LEU A 1 53  ? -18.545 -20.278 71.777 1.00 15.00 ? 53  LEU A N     1 
ATOM   394  C CA    . LEU A 1 53  ? -18.189 -21.239 70.744 1.00 15.00 ? 53  LEU A CA    1 
ATOM   395  C C     . LEU A 1 53  ? -17.214 -20.663 69.719 1.00 15.00 ? 53  LEU A C     1 
ATOM   396  O O     . LEU A 1 53  ? -16.194 -21.290 69.423 1.00 15.00 ? 53  LEU A O     1 
ATOM   397  C CB    . LEU A 1 53  ? -19.437 -21.791 70.055 1.00 15.00 ? 53  LEU A CB    1 
ATOM   398  C CG    . LEU A 1 53  ? -20.115 -23.016 70.674 1.00 15.00 ? 53  LEU A CG    1 
ATOM   399  C CD1   . LEU A 1 53  ? -20.053 -22.961 72.194 1.00 15.00 ? 53  LEU A CD1   1 
ATOM   400  C CD2   . LEU A 1 53  ? -21.551 -23.114 70.166 1.00 15.00 ? 53  LEU A CD2   1 
ATOM   401  N N     . VAL A 1 54  ? -17.514 -19.464 69.213 1.00 15.00 ? 54  VAL A N     1 
ATOM   402  C CA    . VAL A 1 54  ? -16.653 -18.819 68.218 1.00 15.00 ? 54  VAL A CA    1 
ATOM   403  C C     . VAL A 1 54  ? -15.191 -18.749 68.683 1.00 15.00 ? 54  VAL A C     1 
ATOM   404  O O     . VAL A 1 54  ? -14.284 -19.128 67.941 1.00 15.00 ? 54  VAL A O     1 
ATOM   405  C CB    . VAL A 1 54  ? -17.161 -17.394 67.848 1.00 15.00 ? 54  VAL A CB    1 
ATOM   406  C CG1   . VAL A 1 54  ? -16.219 -16.728 66.853 1.00 15.00 ? 54  VAL A CG1   1 
ATOM   407  C CG2   . VAL A 1 54  ? -18.561 -17.471 67.248 1.00 15.00 ? 54  VAL A CG2   1 
ATOM   408  N N     . ASP A 1 55  ? -14.987 -18.326 69.931 1.00 15.00 ? 55  ASP A N     1 
ATOM   409  C CA    . ASP A 1 55  ? -13.648 -18.180 70.524 1.00 15.00 ? 55  ASP A CA    1 
ATOM   410  C C     . ASP A 1 55  ? -12.985 -19.444 71.085 1.00 15.00 ? 55  ASP A C     1 
ATOM   411  O O     . ASP A 1 55  ? -11.752 -19.528 71.147 1.00 15.00 ? 55  ASP A O     1 
ATOM   412  C CB    . ASP A 1 55  ? -13.640 -17.116 71.643 1.00 15.00 ? 55  ASP A CB    1 
ATOM   413  C CG    . ASP A 1 55  ? -14.106 -15.730 71.179 1.00 15.00 ? 55  ASP A CG    1 
ATOM   414  O OD1   . ASP A 1 55  ? -14.115 -15.430 69.963 1.00 15.00 ? 55  ASP A OD1   1 
ATOM   415  O OD2   . ASP A 1 55  ? -14.463 -14.930 72.063 1.00 15.00 ? 55  ASP A OD2   1 
ATOM   416  N N     . CYS A 1 56  ? -13.789 -20.431 71.467 1.00 15.00 ? 56  CYS A N     1 
ATOM   417  C CA    . CYS A 1 56  ? -13.256 -21.625 72.119 1.00 15.00 ? 56  CYS A CA    1 
ATOM   418  C C     . CYS A 1 56  ? -13.133 -22.971 71.410 1.00 15.00 ? 56  CYS A C     1 
ATOM   419  O O     . CYS A 1 56  ? -12.362 -23.819 71.858 1.00 15.00 ? 56  CYS A O     1 
ATOM   420  C CB    . CYS A 1 56  ? -13.975 -21.806 73.455 1.00 15.00 ? 56  CYS A CB    1 
ATOM   421  S SG    . CYS A 1 56  ? -13.915 -20.341 74.553 1.00 15.00 ? 56  CYS A SG    1 
ATOM   422  N N     . VAL A 1 57  ? -13.921 -23.204 70.362 1.00 15.00 ? 57  VAL A N     1 
ATOM   423  C CA    . VAL A 1 57  ? -13.854 -24.476 69.638 1.00 15.00 ? 57  VAL A CA    1 
ATOM   424  C C     . VAL A 1 57  ? -12.670 -24.449 68.678 1.00 15.00 ? 57  VAL A C     1 
ATOM   425  O O     . VAL A 1 57  ? -12.727 -23.816 67.623 1.00 15.00 ? 57  VAL A O     1 
ATOM   426  C CB    . VAL A 1 57  ? -15.129 -24.768 68.825 1.00 15.00 ? 57  VAL A CB    1 
ATOM   427  C CG1   . VAL A 1 57  ? -15.083 -26.199 68.301 1.00 15.00 ? 57  VAL A CG1   1 
ATOM   428  C CG2   . VAL A 1 57  ? -16.371 -24.515 69.655 1.00 15.00 ? 57  VAL A CG2   1 
ATOM   429  N N     . SER A 1 58  ? -11.602 -25.147 69.041 1.00 15.00 ? 58  SER A N     1 
ATOM   430  C CA    . SER A 1 58  ? -10.402 -25.176 68.218 1.00 15.00 ? 58  SER A CA    1 
ATOM   431  C C     . SER A 1 58  ? -10.536 -25.933 66.906 1.00 15.00 ? 58  SER A C     1 
ATOM   432  O O     . SER A 1 58  ? -9.715  -25.751 66.018 1.00 15.00 ? 58  SER A O     1 
ATOM   433  C CB    . SER A 1 58  ? -9.192  -25.665 69.017 1.00 15.00 ? 58  SER A CB    1 
ATOM   434  O OG    . SER A 1 58  ? -9.556  -26.663 69.948 1.00 15.00 ? 58  SER A OG    1 
ATOM   435  N N     . GLU A 1 59  ? -11.559 -26.781 66.793 1.00 15.00 ? 59  GLU A N     1 
ATOM   436  C CA    . GLU A 1 59  ? -11.786 -27.551 65.571 1.00 15.00 ? 59  GLU A CA    1 
ATOM   437  C C     . GLU A 1 59  ? -12.514 -26.736 64.503 1.00 15.00 ? 59  GLU A C     1 
ATOM   438  O O     . GLU A 1 59  ? -12.452 -27.061 63.321 1.00 15.00 ? 59  GLU A O     1 
ATOM   439  C CB    . GLU A 1 59  ? -12.528 -28.865 65.843 1.00 15.00 ? 59  GLU A CB    1 
ATOM   440  C CG    . GLU A 1 59  ? -11.719 -29.945 66.560 1.00 15.00 ? 59  GLU A CG    1 
ATOM   441  C CD    . GLU A 1 59  ? -11.467 -29.630 68.025 1.00 15.00 ? 59  GLU A CD    1 
ATOM   442  O OE1   . GLU A 1 59  ? -12.444 -29.478 68.794 1.00 15.00 ? 59  GLU A OE1   1 
ATOM   443  O OE2   . GLU A 1 59  ? -10.284 -29.537 68.415 1.00 15.00 ? 59  GLU A OE2   1 
ATOM   444  N N     . ASN A 1 60  ? -13.218 -25.689 64.921 1.00 15.00 ? 60  ASN A N     1 
ATOM   445  C CA    . ASN A 1 60  ? -13.914 -24.833 63.975 1.00 15.00 ? 60  ASN A CA    1 
ATOM   446  C C     . ASN A 1 60  ? -13.031 -23.630 63.718 1.00 15.00 ? 60  ASN A C     1 
ATOM   447  O O     . ASN A 1 60  ? -12.009 -23.456 64.392 1.00 15.00 ? 60  ASN A O     1 
ATOM   448  C CB    . ASN A 1 60  ? -15.288 -24.447 64.488 1.00 15.00 ? 60  ASN A CB    1 
ATOM   449  C CG    . ASN A 1 60  ? -16.247 -25.623 64.510 1.00 15.00 ? 60  ASN A CG    1 
ATOM   450  O OD1   . ASN A 1 60  ? -17.166 -25.659 65.320 1.00 15.00 ? 60  ASN A OD1   1 
ATOM   451  N ND2   . ASN A 1 60  ? -16.037 -26.594 63.618 1.00 15.00 ? 60  ASN A ND2   1 
ATOM   452  N N     . ASP A 1 61  ? -13.391 -22.808 62.738 1.00 15.00 ? 61  ASP A N     1 
ATOM   453  C CA    . ASP A 1 61  ? -12.562 -21.658 62.393 1.00 15.00 ? 61  ASP A CA    1 
ATOM   454  C C     . ASP A 1 61  ? -13.116 -20.301 62.863 1.00 15.00 ? 61  ASP A C     1 
ATOM   455  O O     . ASP A 1 61  ? -12.754 -19.256 62.320 1.00 15.00 ? 61  ASP A O     1 
ATOM   456  C CB    . ASP A 1 61  ? -12.273 -21.641 60.876 1.00 15.00 ? 61  ASP A CB    1 
ATOM   457  C CG    . ASP A 1 61  ? -11.955 -23.048 60.301 1.00 15.00 ? 61  ASP A CG    1 
ATOM   458  O OD1   . ASP A 1 61  ? -10.781 -23.499 60.365 1.00 15.00 ? 61  ASP A OD1   1 
ATOM   459  O OD2   . ASP A 1 61  ? -12.886 -23.697 59.758 1.00 15.00 ? 61  ASP A OD2   1 
ATOM   460  N N     . GLY A 1 62  ? -13.972 -20.307 63.880 1.00 15.00 ? 62  GLY A N     1 
ATOM   461  C CA    . GLY A 1 62  ? -14.544 -19.061 64.360 1.00 15.00 ? 62  GLY A CA    1 
ATOM   462  C C     . GLY A 1 62  ? -15.404 -18.386 63.301 1.00 15.00 ? 62  GLY A C     1 
ATOM   463  O O     . GLY A 1 62  ? -16.412 -18.948 62.842 1.00 15.00 ? 62  GLY A O     1 
ATOM   464  N N     . CYS A 1 63  ? -14.996 -17.183 62.897 1.00 15.00 ? 63  CYS A N     1 
ATOM   465  C CA    . CYS A 1 63  ? -15.708 -16.427 61.881 1.00 15.00 ? 63  CYS A CA    1 
ATOM   466  C C     . CYS A 1 63  ? -15.437 -16.965 60.474 1.00 15.00 ? 63  CYS A C     1 
ATOM   467  O O     . CYS A 1 63  ? -16.000 -16.473 59.493 1.00 15.00 ? 63  CYS A O     1 
ATOM   468  C CB    . CYS A 1 63  ? -15.386 -14.937 61.969 1.00 15.00 ? 63  CYS A CB    1 
ATOM   469  S SG    . CYS A 1 63  ? -16.001 -14.056 63.452 1.00 15.00 ? 63  CYS A SG    1 
ATOM   470  N N     . GLY A 1 64  ? -14.571 -17.967 60.375 1.00 15.00 ? 64  GLY A N     1 
ATOM   471  C CA    . GLY A 1 64  ? -14.274 -18.565 59.085 1.00 15.00 ? 64  GLY A CA    1 
ATOM   472  C C     . GLY A 1 64  ? -15.010 -19.879 58.838 1.00 15.00 ? 64  GLY A C     1 
ATOM   473  O O     . GLY A 1 64  ? -14.587 -20.685 58.008 1.00 15.00 ? 64  GLY A O     1 
ATOM   474  N N     . GLY A 1 65  ? -16.087 -20.116 59.585 1.00 15.00 ? 65  GLY A N     1 
ATOM   475  C CA    . GLY A 1 65  ? -16.857 -21.335 59.420 1.00 15.00 ? 65  GLY A CA    1 
ATOM   476  C C     . GLY A 1 65  ? -16.662 -22.394 60.491 1.00 15.00 ? 65  GLY A C     1 
ATOM   477  O O     . GLY A 1 65  ? -15.768 -22.302 61.339 1.00 15.00 ? 65  GLY A O     1 
ATOM   478  N N     . GLY A 1 66  ? -17.524 -23.404 60.459 1.00 15.00 ? 66  GLY A N     1 
ATOM   479  C CA    . GLY A 1 66  ? -17.442 -24.486 61.417 1.00 15.00 ? 66  GLY A CA    1 
ATOM   480  C C     . GLY A 1 66  ? -18.612 -25.441 61.317 1.00 15.00 ? 66  GLY A C     1 
ATOM   481  O O     . GLY A 1 66  ? -19.493 -25.272 60.484 1.00 15.00 ? 66  GLY A O     1 
ATOM   482  N N     . TYR A 1 67  ? -18.621 -26.444 62.184 1.00 15.00 ? 67  TYR A N     1 
ATOM   483  C CA    . TYR A 1 67  ? -19.678 -27.444 62.211 1.00 15.00 ? 67  TYR A CA    1 
ATOM   484  C C     . TYR A 1 67  ? -20.355 -27.477 63.564 1.00 15.00 ? 67  TYR A C     1 
ATOM   485  O O     . TYR A 1 67  ? -19.710 -27.305 64.586 1.00 15.00 ? 67  TYR A O     1 
ATOM   486  C CB    . TYR A 1 67  ? -19.140 -28.833 61.865 1.00 15.00 ? 67  TYR A CB    1 
ATOM   487  C CG    . TYR A 1 67  ? -18.685 -28.949 60.436 1.00 15.00 ? 67  TYR A CG    1 
ATOM   488  C CD1   . TYR A 1 67  ? -19.576 -29.325 59.439 1.00 15.00 ? 67  TYR A CD1   1 
ATOM   489  C CD2   . TYR A 1 67  ? -17.372 -28.639 60.073 1.00 15.00 ? 67  TYR A CD2   1 
ATOM   490  C CE1   . TYR A 1 67  ? -19.183 -29.385 58.113 1.00 15.00 ? 67  TYR A CE1   1 
ATOM   491  C CE2   . TYR A 1 67  ? -16.963 -28.697 58.746 1.00 15.00 ? 67  TYR A CE2   1 
ATOM   492  C CZ    . TYR A 1 67  ? -17.875 -29.069 57.766 1.00 15.00 ? 67  TYR A CZ    1 
ATOM   493  O OH    . TYR A 1 67  ? -17.496 -29.102 56.445 1.00 15.00 ? 67  TYR A OH    1 
ATOM   494  N N     . MET A 1 68  ? -21.648 -27.766 63.559 1.00 15.00 ? 68  MET A N     1 
ATOM   495  C CA    . MET A 1 68  ? -22.438 -27.849 64.779 1.00 15.00 ? 68  MET A CA    1 
ATOM   496  C C     . MET A 1 68  ? -21.909 -28.979 65.676 1.00 15.00 ? 68  MET A C     1 
ATOM   497  O O     . MET A 1 68  ? -21.675 -28.775 66.867 1.00 15.00 ? 68  MET A O     1 
ATOM   498  C CB    . MET A 1 68  ? -23.932 -28.031 64.445 1.00 15.00 ? 68  MET A CB    1 
ATOM   499  C CG    . MET A 1 68  ? -24.583 -26.862 63.656 1.00 15.00 ? 68  MET A CG    1 
ATOM   500  S SD    . MET A 1 68  ? -24.013 -26.582 61.932 1.00 15.00 ? 68  MET A SD    1 
ATOM   501  C CE    . MET A 1 68  ? -25.228 -27.499 61.007 1.00 15.00 ? 68  MET A CE    1 
ATOM   502  N N     . THR A 1 69  ? -21.681 -30.155 65.082 1.00 15.00 ? 69  THR A N     1 
ATOM   503  C CA    . THR A 1 69  ? -21.166 -31.323 65.813 1.00 15.00 ? 69  THR A CA    1 
ATOM   504  C C     . THR A 1 69  ? -19.907 -31.011 66.635 1.00 15.00 ? 69  THR A C     1 
ATOM   505  O O     . THR A 1 69  ? -19.795 -31.457 67.779 1.00 15.00 ? 69  THR A O     1 
ATOM   506  C CB    . THR A 1 69  ? -20.890 -32.540 64.872 1.00 15.00 ? 69  THR A CB    1 
ATOM   507  O OG1   . THR A 1 69  ? -20.068 -32.137 63.764 1.00 15.00 ? 69  THR A OG1   1 
ATOM   508  C CG2   . THR A 1 69  ? -22.205 -33.118 64.351 1.00 15.00 ? 69  THR A CG2   1 
ATOM   509  N N     . ASN A 1 70  ? -18.970 -30.254 66.057 1.00 15.00 ? 70  ASN A N     1 
ATOM   510  C CA    . ASN A 1 70  ? -17.740 -29.867 66.770 1.00 15.00 ? 70  ASN A CA    1 
ATOM   511  C C     . ASN A 1 70  ? -18.109 -29.012 67.979 1.00 15.00 ? 70  ASN A C     1 
ATOM   512  O O     . ASN A 1 70  ? -17.568 -29.192 69.077 1.00 15.00 ? 70  ASN A O     1 
ATOM   513  C CB    . ASN A 1 70  ? -16.759 -29.075 65.889 1.00 15.00 ? 70  ASN A CB    1 
ATOM   514  C CG    . ASN A 1 70  ? -16.173 -29.892 64.754 1.00 15.00 ? 70  ASN A CG    1 
ATOM   515  O OD1   . ASN A 1 70  ? -15.656 -29.337 63.792 1.00 15.00 ? 70  ASN A OD1   1 
ATOM   516  N ND2   . ASN A 1 70  ? -16.252 -31.199 64.856 1.00 15.00 ? 70  ASN A ND2   1 
ATOM   517  N N     . ALA A 1 71  ? -19.021 -28.068 67.743 1.00 15.00 ? 71  ALA A N     1 
ATOM   518  C CA    . ALA A 1 71  ? -19.505 -27.155 68.773 1.00 15.00 ? 71  ALA A CA    1 
ATOM   519  C C     . ALA A 1 71  ? -20.202 -27.924 69.908 1.00 15.00 ? 71  ALA A C     1 
ATOM   520  O O     . ALA A 1 71  ? -20.028 -27.590 71.081 1.00 15.00 ? 71  ALA A O     1 
ATOM   521  C CB    . ALA A 1 71  ? -20.438 -26.106 68.156 1.00 15.00 ? 71  ALA A CB    1 
ATOM   522  N N     . PHE A 1 72  ? -20.945 -28.973 69.558 1.00 15.00 ? 72  PHE A N     1 
ATOM   523  C CA    . PHE A 1 72  ? -21.632 -29.817 70.539 1.00 15.00 ? 72  PHE A CA    1 
ATOM   524  C C     . PHE A 1 72  ? -20.636 -30.630 71.361 1.00 15.00 ? 72  PHE A C     1 
ATOM   525  O O     . PHE A 1 72  ? -20.690 -30.658 72.588 1.00 15.00 ? 72  PHE A O     1 
ATOM   526  C CB    . PHE A 1 72  ? -22.646 -30.745 69.862 1.00 15.00 ? 72  PHE A CB    1 
ATOM   527  C CG    . PHE A 1 72  ? -23.801 -30.024 69.252 1.00 15.00 ? 72  PHE A CG    1 
ATOM   528  C CD1   . PHE A 1 72  ? -24.324 -28.883 69.856 1.00 15.00 ? 72  PHE A CD1   1 
ATOM   529  C CD2   . PHE A 1 72  ? -24.374 -30.479 68.078 1.00 15.00 ? 72  PHE A CD2   1 
ATOM   530  C CE1   . PHE A 1 72  ? -25.403 -28.211 69.304 1.00 15.00 ? 72  PHE A CE1   1 
ATOM   531  C CE2   . PHE A 1 72  ? -25.462 -29.807 67.513 1.00 15.00 ? 72  PHE A CE2   1 
ATOM   532  C CZ    . PHE A 1 72  ? -25.974 -28.674 68.129 1.00 15.00 ? 72  PHE A CZ    1 
ATOM   533  N N     . GLN A 1 73  ? -19.709 -31.273 70.669 1.00 15.00 ? 73  GLN A N     1 
ATOM   534  C CA    . GLN A 1 73  ? -18.699 -32.079 71.328 1.00 15.00 ? 73  GLN A CA    1 
ATOM   535  C C     . GLN A 1 73  ? -17.870 -31.209 72.247 1.00 15.00 ? 73  GLN A C     1 
ATOM   536  O O     . GLN A 1 73  ? -17.488 -31.642 73.332 1.00 15.00 ? 73  GLN A O     1 
ATOM   537  C CB    . GLN A 1 73  ? -17.828 -32.793 70.310 1.00 15.00 ? 73  GLN A CB    1 
ATOM   538  C CG    . GLN A 1 73  ? -16.900 -33.824 70.915 1.00 15.00 ? 73  GLN A CG    1 
ATOM   539  C CD    . GLN A 1 73  ? -16.283 -34.728 69.868 1.00 15.00 ? 73  GLN A CD    1 
ATOM   540  O OE1   . GLN A 1 73  ? -16.829 -34.919 68.776 1.00 15.00 ? 73  GLN A OE1   1 
ATOM   541  N NE2   . GLN A 1 73  ? -15.140 -35.298 70.198 1.00 15.00 ? 73  GLN A NE2   1 
ATOM   542  N N     . TYR A 1 74  ? -17.599 -29.979 71.817 1.00 15.00 ? 74  TYR A N     1 
ATOM   543  C CA    . TYR A 1 74  ? -16.829 -29.032 72.624 1.00 15.00 ? 74  TYR A CA    1 
ATOM   544  C C     . TYR A 1 74  ? -17.552 -28.794 73.945 1.00 15.00 ? 74  TYR A C     1 
ATOM   545  O O     . TYR A 1 74  ? -16.921 -28.755 75.000 1.00 15.00 ? 74  TYR A O     1 
ATOM   546  C CB    . TYR A 1 74  ? -16.605 -27.693 71.889 1.00 15.00 ? 74  TYR A CB    1 
ATOM   547  C CG    . TYR A 1 74  ? -16.386 -26.512 72.825 1.00 15.00 ? 74  TYR A CG    1 
ATOM   548  C CD1   . TYR A 1 74  ? -15.178 -26.347 73.506 1.00 15.00 ? 74  TYR A CD1   1 
ATOM   549  C CD2   . TYR A 1 74  ? -17.427 -25.633 73.121 1.00 15.00 ? 74  TYR A CD2   1 
ATOM   550  C CE1   . TYR A 1 74  ? -15.022 -25.350 74.469 1.00 15.00 ? 74  TYR A CE1   1 
ATOM   551  C CE2   . TYR A 1 74  ? -17.279 -24.637 74.078 1.00 15.00 ? 74  TYR A CE2   1 
ATOM   552  C CZ    . TYR A 1 74  ? -16.083 -24.504 74.753 1.00 15.00 ? 74  TYR A CZ    1 
ATOM   553  O OH    . TYR A 1 74  ? -15.964 -23.571 75.755 1.00 15.00 ? 74  TYR A OH    1 
ATOM   554  N N     . VAL A 1 75  ? -18.871 -28.623 73.865 1.00 15.00 ? 75  VAL A N     1 
ATOM   555  C CA    . VAL A 1 75  ? -19.703 -28.359 75.036 1.00 15.00 ? 75  VAL A CA    1 
ATOM   556  C C     . VAL A 1 75  ? -19.771 -29.545 75.979 1.00 15.00 ? 75  VAL A C     1 
ATOM   557  O O     . VAL A 1 75  ? -19.906 -29.382 77.190 1.00 15.00 ? 75  VAL A O     1 
ATOM   558  C CB    . VAL A 1 75  ? -21.110 -27.880 74.626 1.00 15.00 ? 75  VAL A CB    1 
ATOM   559  C CG1   . VAL A 1 75  ? -21.965 -27.657 75.850 1.00 15.00 ? 75  VAL A CG1   1 
ATOM   560  C CG2   . VAL A 1 75  ? -20.996 -26.567 73.827 1.00 15.00 ? 75  VAL A CG2   1 
ATOM   561  N N     . GLN A 1 76  ? -19.661 -30.739 75.422 1.00 15.00 ? 76  GLN A N     1 
ATOM   562  C CA    . GLN A 1 76  ? -19.658 -31.952 76.224 1.00 15.00 ? 76  GLN A CA    1 
ATOM   563  C C     . GLN A 1 76  ? -18.338 -32.003 77.002 1.00 15.00 ? 76  GLN A C     1 
ATOM   564  O O     . GLN A 1 76  ? -18.342 -32.085 78.225 1.00 15.00 ? 76  GLN A O     1 
ATOM   565  C CB    . GLN A 1 76  ? -19.835 -33.206 75.359 1.00 15.00 ? 76  GLN A CB    1 
ATOM   566  C CG    . GLN A 1 76  ? -19.805 -34.507 76.135 1.00 15.00 ? 76  GLN A CG    1 
ATOM   567  C CD    . GLN A 1 76  ? -19.782 -35.746 75.249 1.00 15.00 ? 76  GLN A CD    1 
ATOM   568  O OE1   . GLN A 1 76  ? -19.345 -35.701 74.095 1.00 15.00 ? 76  GLN A OE1   1 
ATOM   569  N NE2   . GLN A 1 76  ? -20.239 -36.864 75.793 1.00 15.00 ? 76  GLN A NE2   1 
ATOM   570  N N     . LYS A 1 77  ? -17.218 -31.899 76.289 1.00 15.00 ? 77  LYS A N     1 
ATOM   571  C CA    . LYS A 1 77  ? -15.891 -31.951 76.905 1.00 15.00 ? 77  LYS A CA    1 
ATOM   572  C C     . LYS A 1 77  ? -15.627 -30.800 77.868 1.00 15.00 ? 77  LYS A C     1 
ATOM   573  O O     . LYS A 1 77  ? -14.988 -30.979 78.907 1.00 15.00 ? 77  LYS A O     1 
ATOM   574  C CB    . LYS A 1 77  ? -14.788 -32.014 75.846 1.00 15.00 ? 77  LYS A CB    1 
ATOM   575  C CG    . LYS A 1 77  ? -14.768 -33.287 75.007 1.00 15.00 ? 77  LYS A CG    1 
ATOM   576  C CD    . LYS A 1 77  ? -13.805 -33.139 73.839 1.00 15.00 ? 77  LYS A CD    1 
ATOM   577  C CE    . LYS A 1 77  ? -13.620 -34.436 73.095 1.00 15.00 ? 77  LYS A CE    1 
ATOM   578  N NZ    . LYS A 1 77  ? -12.546 -34.326 72.064 1.00 15.00 ? 77  LYS A NZ    1 
ATOM   579  N N     . ASN A 1 78  ? -16.090 -29.614 77.497 1.00 15.00 ? 78  ASN A N     1 
ATOM   580  C CA    . ASN A 1 78  ? -15.912 -28.431 78.318 1.00 15.00 ? 78  ASN A CA    1 
ATOM   581  C C     . ASN A 1 78  ? -16.834 -28.518 79.520 1.00 15.00 ? 78  ASN A C     1 
ATOM   582  O O     . ASN A 1 78  ? -16.644 -27.807 80.492 1.00 15.00 ? 78  ASN A O     1 
ATOM   583  C CB    . ASN A 1 78  ? -16.179 -27.163 77.511 1.00 15.00 ? 78  ASN A CB    1 
ATOM   584  C CG    . ASN A 1 78  ? -15.952 -25.886 78.315 1.00 15.00 ? 78  ASN A CG    1 
ATOM   585  O OD1   . ASN A 1 78  ? -14.898 -25.691 78.920 1.00 15.00 ? 78  ASN A OD1   1 
ATOM   586  N ND2   . ASN A 1 78  ? -16.926 -24.987 78.278 1.00 15.00 ? 78  ASN A ND2   1 
ATOM   587  N N     . ARG A 1 79  ? -17.814 -29.417 79.436 1.00 15.00 ? 79  ARG A N     1 
ATOM   588  C CA    . ARG A 1 79  ? -18.822 -29.640 80.469 1.00 15.00 ? 79  ARG A CA    1 
ATOM   589  C C     . ARG A 1 79  ? -19.766 -28.450 80.653 1.00 15.00 ? 79  ARG A C     1 
ATOM   590  O O     . ARG A 1 79  ? -20.427 -28.317 81.689 1.00 15.00 ? 79  ARG A O     1 
ATOM   591  C CB    . ARG A 1 79  ? -18.191 -30.057 81.813 1.00 15.00 ? 79  ARG A CB    1 
ATOM   592  C CG    . ARG A 1 79  ? -17.692 -31.482 81.848 1.00 15.00 ? 79  ARG A CG    1 
ATOM   593  C CD    . ARG A 1 79  ? -16.752 -31.696 83.000 1.00 15.00 ? 79  ARG A CD    1 
ATOM   594  N NE    . ARG A 1 79  ? -16.072 -32.981 82.878 1.00 15.00 ? 79  ARG A NE    1 
ATOM   595  C CZ    . ARG A 1 79  ? -14.788 -33.135 82.555 1.00 15.00 ? 79  ARG A CZ    1 
ATOM   596  N NH1   . ARG A 1 79  ? -14.017 -32.078 82.327 1.00 15.00 ? 79  ARG A NH1   1 
ATOM   597  N NH2   . ARG A 1 79  ? -14.283 -34.357 82.414 1.00 15.00 ? 79  ARG A NH2   1 
ATOM   598  N N     . GLY A 1 80  ? -19.835 -27.580 79.655 1.00 15.00 ? 80  GLY A N     1 
ATOM   599  C CA    . GLY A 1 80  ? -20.720 -26.446 79.774 1.00 15.00 ? 80  GLY A CA    1 
ATOM   600  C C     . GLY A 1 80  ? -20.504 -25.383 78.728 1.00 15.00 ? 80  GLY A C     1 
ATOM   601  O O     . GLY A 1 80  ? -19.604 -25.492 77.895 1.00 15.00 ? 80  GLY A O     1 
ATOM   602  N N     . ILE A 1 81  ? -21.382 -24.387 78.751 1.00 15.00 ? 81  ILE A N     1 
ATOM   603  C CA    . ILE A 1 81  ? -21.340 -23.244 77.853 1.00 15.00 ? 81  ILE A CA    1 
ATOM   604  C C     . ILE A 1 81  ? -21.980 -22.089 78.601 1.00 15.00 ? 81  ILE A C     1 
ATOM   605  O O     . ILE A 1 81  ? -22.997 -22.258 79.291 1.00 15.00 ? 81  ILE A O     1 
ATOM   606  C CB    . ILE A 1 81  ? -22.123 -23.471 76.524 1.00 15.00 ? 81  ILE A CB    1 
ATOM   607  C CG1   . ILE A 1 81  ? -22.151 -22.165 75.710 1.00 15.00 ? 81  ILE A CG1   1 
ATOM   608  C CG2   . ILE A 1 81  ? -23.540 -23.998 76.804 1.00 15.00 ? 81  ILE A CG2   1 
ATOM   609  C CD1   . ILE A 1 81  ? -22.812 -22.279 74.361 1.00 15.00 ? 81  ILE A CD1   1 
ATOM   610  N N     . ASP A 1 82  ? -21.372 -20.921 78.481 1.00 15.00 ? 82  ASP A N     1 
ATOM   611  C CA    . ASP A 1 82  ? -21.880 -19.749 79.150 1.00 15.00 ? 82  ASP A CA    1 
ATOM   612  C C     . ASP A 1 82  ? -23.168 -19.212 78.573 1.00 15.00 ? 82  ASP A C     1 
ATOM   613  O O     . ASP A 1 82  ? -23.557 -19.544 77.446 1.00 15.00 ? 82  ASP A O     1 
ATOM   614  C CB    . ASP A 1 82  ? -20.827 -18.658 79.193 1.00 15.00 ? 82  ASP A CB    1 
ATOM   615  C CG    . ASP A 1 82  ? -19.685 -19.002 80.104 1.00 15.00 ? 82  ASP A CG    1 
ATOM   616  O OD1   . ASP A 1 82  ? -19.909 -19.764 81.071 1.00 15.00 ? 82  ASP A OD1   1 
ATOM   617  O OD2   . ASP A 1 82  ? -18.566 -18.516 79.851 1.00 15.00 ? 82  ASP A OD2   1 
ATOM   618  N N     . SER A 1 83  ? -23.851 -18.423 79.391 1.00 15.00 ? 83  SER A N     1 
ATOM   619  C CA    . SER A 1 83  ? -25.091 -17.773 78.996 1.00 15.00 ? 83  SER A CA    1 
ATOM   620  C C     . SER A 1 83  ? -24.696 -16.557 78.159 1.00 15.00 ? 83  SER A C     1 
ATOM   621  O O     . SER A 1 83  ? -23.581 -16.038 78.301 1.00 15.00 ? 83  SER A O     1 
ATOM   622  C CB    . SER A 1 83  ? -25.892 -17.337 80.219 1.00 15.00 ? 83  SER A CB    1 
ATOM   623  O OG    . SER A 1 83  ? -25.290 -16.216 80.856 1.00 15.00 ? 83  SER A OG    1 
ATOM   624  N N     . GLU A 1 84  ? -25.593 -16.097 77.299 1.00 15.00 ? 84  GLU A N     1 
ATOM   625  C CA    . GLU A 1 84  ? -25.301 -14.929 76.486 1.00 15.00 ? 84  GLU A CA    1 
ATOM   626  C C     . GLU A 1 84  ? -24.744 -13.807 77.373 1.00 15.00 ? 84  GLU A C     1 
ATOM   627  O O     . GLU A 1 84  ? -23.718 -13.203 77.056 1.00 15.00 ? 84  GLU A O     1 
ATOM   628  C CB    . GLU A 1 84  ? -26.545 -14.462 75.728 1.00 15.00 ? 84  GLU A CB    1 
ATOM   629  C CG    . GLU A 1 84  ? -26.403 -13.119 75.037 1.00 15.00 ? 84  GLU A CG    1 
ATOM   630  C CD    . GLU A 1 84  ? -25.371 -13.118 73.917 1.00 15.00 ? 84  GLU A CD    1 
ATOM   631  O OE1   . GLU A 1 84  ? -25.203 -14.151 73.229 1.00 15.00 ? 84  GLU A OE1   1 
ATOM   632  O OE2   . GLU A 1 84  ? -24.729 -12.072 73.716 1.00 15.00 ? 84  GLU A OE2   1 
ATOM   633  N N     . ASP A 1 85  ? -25.371 -13.595 78.527 1.00 15.00 ? 85  ASP A N     1 
ATOM   634  C CA    . ASP A 1 85  ? -24.941 -12.535 79.441 1.00 15.00 ? 85  ASP A CA    1 
ATOM   635  C C     . ASP A 1 85  ? -23.489 -12.601 79.869 1.00 15.00 ? 85  ASP A C     1 
ATOM   636  O O     . ASP A 1 85  ? -22.782 -11.591 79.791 1.00 15.00 ? 85  ASP A O     1 
ATOM   637  C CB    . ASP A 1 85  ? -25.852 -12.444 80.663 1.00 15.00 ? 85  ASP A CB    1 
ATOM   638  C CG    . ASP A 1 85  ? -27.219 -11.879 80.324 1.00 15.00 ? 85  ASP A CG    1 
ATOM   639  O OD1   . ASP A 1 85  ? -27.332 -11.063 79.374 1.00 15.00 ? 85  ASP A OD1   1 
ATOM   640  O OD2   . ASP A 1 85  ? -28.186 -12.267 81.009 1.00 15.00 ? 85  ASP A OD2   1 
ATOM   641  N N     . ALA A 1 86  ? -23.047 -13.790 80.283 1.00 15.00 ? 86  ALA A N     1 
ATOM   642  C CA    . ALA A 1 86  ? -21.670 -13.998 80.733 1.00 15.00 ? 86  ALA A CA    1 
ATOM   643  C C     . ALA A 1 86  ? -20.611 -14.064 79.621 1.00 15.00 ? 86  ALA A C     1 
ATOM   644  O O     . ALA A 1 86  ? -19.418 -14.179 79.918 1.00 15.00 ? 86  ALA A O     1 
ATOM   645  C CB    . ALA A 1 86  ? -21.591 -15.244 81.588 1.00 15.00 ? 86  ALA A CB    1 
ATOM   646  N N     . TYR A 1 87  ? -21.036 -13.982 78.362 1.00 15.00 ? 87  TYR A N     1 
ATOM   647  C CA    . TYR A 1 87  ? -20.127 -14.044 77.221 1.00 15.00 ? 87  TYR A CA    1 
ATOM   648  C C     . TYR A 1 87  ? -20.875 -13.456 76.005 1.00 15.00 ? 87  TYR A C     1 
ATOM   649  O O     . TYR A 1 87  ? -21.138 -14.152 75.017 1.00 15.00 ? 87  TYR A O     1 
ATOM   650  C CB    . TYR A 1 87  ? -19.687 -15.499 76.990 1.00 15.00 ? 87  TYR A CB    1 
ATOM   651  C CG    . TYR A 1 87  ? -18.299 -15.714 76.411 1.00 15.00 ? 87  TYR A CG    1 
ATOM   652  C CD1   . TYR A 1 87  ? -17.791 -14.888 75.412 1.00 15.00 ? 87  TYR A CD1   1 
ATOM   653  C CD2   . TYR A 1 87  ? -17.511 -16.780 76.840 1.00 15.00 ? 87  TYR A CD2   1 
ATOM   654  C CE1   . TYR A 1 87  ? -16.537 -15.117 74.856 1.00 15.00 ? 87  TYR A CE1   1 
ATOM   655  C CE2   . TYR A 1 87  ? -16.257 -17.019 76.288 1.00 15.00 ? 87  TYR A CE2   1 
ATOM   656  C CZ    . TYR A 1 87  ? -15.778 -16.182 75.297 1.00 15.00 ? 87  TYR A CZ    1 
ATOM   657  O OH    . TYR A 1 87  ? -14.542 -16.418 74.760 1.00 15.00 ? 87  TYR A OH    1 
ATOM   658  N N     . PRO A 1 88  ? -21.174 -12.138 76.048 1.00 15.00 ? 88  PRO A N     1 
ATOM   659  C CA    . PRO A 1 88  ? -21.897 -11.449 74.974 1.00 15.00 ? 88  PRO A CA    1 
ATOM   660  C C     . PRO A 1 88  ? -21.302 -11.573 73.581 1.00 15.00 ? 88  PRO A C     1 
ATOM   661  O O     . PRO A 1 88  ? -20.109 -11.801 73.423 1.00 15.00 ? 88  PRO A O     1 
ATOM   662  C CB    . PRO A 1 88  ? -21.936 -9.993  75.464 1.00 15.00 ? 88  PRO A CB    1 
ATOM   663  C CG    . PRO A 1 88  ? -20.718 -9.870  76.272 1.00 15.00 ? 88  PRO A CG    1 
ATOM   664  C CD    . PRO A 1 88  ? -20.721 -11.162 77.055 1.00 15.00 ? 88  PRO A CD    1 
ATOM   665  N N     . TYR A 1 89  ? -22.151 -11.390 72.576 1.00 15.00 ? 89  TYR A N     1 
ATOM   666  C CA    . TYR A 1 89  ? -21.738 -11.478 71.179 1.00 15.00 ? 89  TYR A CA    1 
ATOM   667  C C     . TYR A 1 89  ? -21.038 -10.207 70.712 1.00 15.00 ? 89  TYR A C     1 
ATOM   668  O O     . TYR A 1 89  ? -21.541 -9.109  70.940 1.00 15.00 ? 89  TYR A O     1 
ATOM   669  C CB    . TYR A 1 89  ? -22.931 -11.776 70.271 1.00 15.00 ? 89  TYR A CB    1 
ATOM   670  C CG    . TYR A 1 89  ? -22.534 -12.080 68.844 1.00 15.00 ? 89  TYR A CG    1 
ATOM   671  C CD1   . TYR A 1 89  ? -21.819 -13.234 68.541 1.00 15.00 ? 89  TYR A CD1   1 
ATOM   672  C CD2   . TYR A 1 89  ? -22.826 -11.196 67.806 1.00 15.00 ? 89  TYR A CD2   1 
ATOM   673  C CE1   . TYR A 1 89  ? -21.397 -13.504 67.250 1.00 15.00 ? 89  TYR A CE1   1 
ATOM   674  C CE2   . TYR A 1 89  ? -22.404 -11.463 66.497 1.00 15.00 ? 89  TYR A CE2   1 
ATOM   675  C CZ    . TYR A 1 89  ? -21.689 -12.618 66.236 1.00 15.00 ? 89  TYR A CZ    1 
ATOM   676  O OH    . TYR A 1 89  ? -21.227 -12.896 64.978 1.00 15.00 ? 89  TYR A OH    1 
ATOM   677  N N     . VAL A 1 90  ? -19.879 -10.357 70.076 1.00 15.00 ? 90  VAL A N     1 
ATOM   678  C CA    . VAL A 1 90  ? -19.151 -9.205  69.545 1.00 15.00 ? 90  VAL A CA    1 
ATOM   679  C C     . VAL A 1 90  ? -18.917 -9.313  68.050 1.00 15.00 ? 90  VAL A C     1 
ATOM   680  O O     . VAL A 1 90  ? -18.598 -8.317  67.398 1.00 15.00 ? 90  VAL A O     1 
ATOM   681  C CB    . VAL A 1 90  ? -17.810 -8.935  70.265 1.00 15.00 ? 90  VAL A CB    1 
ATOM   682  C CG1   . VAL A 1 90  ? -18.056 -8.151  71.547 1.00 15.00 ? 90  VAL A CG1   1 
ATOM   683  C CG2   . VAL A 1 90  ? -17.080 -10.234 70.560 1.00 15.00 ? 90  VAL A CG2   1 
ATOM   684  N N     . GLY A 1 91  ? -19.082 -10.513 67.496 1.00 15.00 ? 91  GLY A N     1 
ATOM   685  C CA    . GLY A 1 91  ? -18.901 -10.684 66.063 1.00 15.00 ? 91  GLY A CA    1 
ATOM   686  C C     . GLY A 1 91  ? -17.465 -10.672 65.561 1.00 15.00 ? 91  GLY A C     1 
ATOM   687  O O     . GLY A 1 91  ? -17.191 -10.280 64.422 1.00 15.00 ? 91  GLY A O     1 
ATOM   688  N N     . GLN A 1 92  ? -16.542 -11.097 66.411 1.00 15.00 ? 92  GLN A N     1 
ATOM   689  C CA    . GLN A 1 92  ? -15.141 -11.172 66.043 1.00 15.00 ? 92  GLN A CA    1 
ATOM   690  C C     . GLN A 1 92  ? -14.449 -12.216 66.918 1.00 15.00 ? 92  GLN A C     1 
ATOM   691  O O     . GLN A 1 92  ? -14.823 -12.417 68.068 1.00 15.00 ? 92  GLN A O     1 
ATOM   692  C CB    . GLN A 1 92  ? -14.464 -9.796  66.113 1.00 15.00 ? 92  GLN A CB    1 
ATOM   693  C CG    . GLN A 1 92  ? -14.409 -9.158  67.492 1.00 15.00 ? 92  GLN A CG    1 
ATOM   694  C CD    . GLN A 1 92  ? -14.157 -7.647  67.449 1.00 15.00 ? 92  GLN A CD    1 
ATOM   695  O OE1   . GLN A 1 92  ? -14.601 -6.909  68.335 1.00 15.00 ? 92  GLN A OE1   1 
ATOM   696  N NE2   . GLN A 1 92  ? -13.461 -7.183  66.421 1.00 15.00 ? 92  GLN A NE2   1 
ATOM   697  N N     . GLU A 1 93  ? -13.514 -12.941 66.317 1.00 15.00 ? 93  GLU A N     1 
ATOM   698  C CA    . GLU A 1 93  ? -12.753 -13.985 66.989 1.00 15.00 ? 93  GLU A CA    1 
ATOM   699  C C     . GLU A 1 93  ? -11.831 -13.341 68.027 1.00 15.00 ? 93  GLU A C     1 
ATOM   700  O O     . GLU A 1 93  ? -11.213 -12.302 67.753 1.00 15.00 ? 93  GLU A O     1 
ATOM   701  C CB    . GLU A 1 93  ? -11.920 -14.800 65.985 1.00 15.00 ? 93  GLU A CB    1 
ATOM   702  C CG    . GLU A 1 93  ? -12.600 -15.097 64.637 1.00 15.00 ? 93  GLU A CG    1 
ATOM   703  C CD    . GLU A 1 93  ? -11.660 -15.738 63.602 1.00 15.00 ? 93  GLU A CD    1 
ATOM   704  O OE1   . GLU A 1 93  ? -10.421 -15.600 63.722 1.00 15.00 ? 93  GLU A OE1   1 
ATOM   705  O OE2   . GLU A 1 93  ? -12.168 -16.370 62.648 1.00 15.00 ? 93  GLU A OE2   1 
ATOM   706  N N     . GLU A 1 94  ? -11.732 -13.967 69.199 1.00 15.00 ? 94  GLU A N     1 
ATOM   707  C CA    . GLU A 1 94  ? -10.880 -13.495 70.299 1.00 15.00 ? 94  GLU A CA    1 
ATOM   708  C C     . GLU A 1 94  ? -10.473 -14.701 71.147 1.00 15.00 ? 94  GLU A C     1 
ATOM   709  O O     . GLU A 1 94  ? -10.919 -15.817 70.890 1.00 15.00 ? 94  GLU A O     1 
ATOM   710  C CB    . GLU A 1 94  ? -11.578 -12.418 71.148 1.00 15.00 ? 94  GLU A CB    1 
ATOM   711  C CG    . GLU A 1 94  ? -11.715 -11.071 70.440 1.00 15.00 ? 94  GLU A CG    1 
ATOM   712  C CD    . GLU A 1 94  ? -12.525 -10.042 71.210 1.00 15.00 ? 94  GLU A CD    1 
ATOM   713  O OE1   . GLU A 1 94  ? -13.429 -10.419 71.978 1.00 15.00 ? 94  GLU A OE1   1 
ATOM   714  O OE2   . GLU A 1 94  ? -12.258 -8.838  71.020 1.00 15.00 ? 94  GLU A OE2   1 
ATOM   715  N N     . SER A 1 95  ? -9.613  -14.486 72.134 1.00 15.00 ? 95  SER A N     1 
ATOM   716  C CA    . SER A 1 95  ? -9.168  -15.583 72.987 1.00 15.00 ? 95  SER A CA    1 
ATOM   717  C C     . SER A 1 95  ? -10.289 -16.205 73.831 1.00 15.00 ? 95  SER A C     1 
ATOM   718  O O     . SER A 1 95  ? -11.160 -15.502 74.360 1.00 15.00 ? 95  SER A O     1 
ATOM   719  C CB    . SER A 1 95  ? -7.983  -15.164 73.870 1.00 15.00 ? 95  SER A CB    1 
ATOM   720  O OG    . SER A 1 95  ? -8.292  -14.055 74.703 1.00 15.00 ? 95  SER A OG    1 
ATOM   721  N N     . CYS A 1 96  ? -10.269 -17.528 73.934 1.00 15.00 ? 96  CYS A N     1 
ATOM   722  C CA    . CYS A 1 96  ? -11.262 -18.231 74.721 1.00 15.00 ? 96  CYS A CA    1 
ATOM   723  C C     . CYS A 1 96  ? -11.284 -17.619 76.129 1.00 15.00 ? 96  CYS A C     1 
ATOM   724  O O     . CYS A 1 96  ? -10.263 -17.581 76.826 1.00 15.00 ? 96  CYS A O     1 
ATOM   725  C CB    . CYS A 1 96  ? -10.972 -19.731 74.747 1.00 15.00 ? 96  CYS A CB    1 
ATOM   726  S SG    . CYS A 1 96  ? -12.233 -20.694 75.635 1.00 15.00 ? 96  CYS A SG    1 
ATOM   727  N N     . MET A 1 97  ? -12.443 -17.084 76.503 1.00 15.00 ? 97  MET A N     1 
ATOM   728  C CA    . MET A 1 97  ? -12.637 -16.439 77.796 1.00 15.00 ? 97  MET A CA    1 
ATOM   729  C C     . MET A 1 97  ? -13.836 -17.047 78.533 1.00 15.00 ? 97  MET A C     1 
ATOM   730  O O     . MET A 1 97  ? -14.640 -16.338 79.143 1.00 15.00 ? 97  MET A O     1 
ATOM   731  C CB    . MET A 1 97  ? -12.798 -14.929 77.611 1.00 15.00 ? 97  MET A CB    1 
ATOM   732  C CG    . MET A 1 97  ? -12.598 -14.113 78.870 1.00 15.00 ? 97  MET A CG    1 
ATOM   733  S SD    . MET A 1 97  ? -10.917 -14.279 79.503 1.00 15.00 ? 97  MET A SD    1 
ATOM   734  C CE    . MET A 1 97  ? -10.061 -13.180 78.416 1.00 15.00 ? 97  MET A CE    1 
ATOM   735  N N     . TYR A 1 98  ? -13.962 -18.371 78.443 1.00 15.00 ? 98  TYR A N     1 
ATOM   736  C CA    . TYR A 1 98  ? -15.045 -19.091 79.097 1.00 15.00 ? 98  TYR A CA    1 
ATOM   737  C C     . TYR A 1 98  ? -15.011 -18.911 80.610 1.00 15.00 ? 98  TYR A C     1 
ATOM   738  O O     . TYR A 1 98  ? -13.999 -19.175 81.259 1.00 15.00 ? 98  TYR A O     1 
ATOM   739  C CB    . TYR A 1 98  ? -15.030 -20.574 78.727 1.00 15.00 ? 98  TYR A CB    1 
ATOM   740  C CG    . TYR A 1 98  ? -15.990 -21.404 79.548 1.00 15.00 ? 98  TYR A CG    1 
ATOM   741  C CD1   . TYR A 1 98  ? -17.364 -21.358 79.313 1.00 15.00 ? 98  TYR A CD1   1 
ATOM   742  C CD2   . TYR A 1 98  ? -15.525 -22.209 80.586 1.00 15.00 ? 98  TYR A CD2   1 
ATOM   743  C CE1   . TYR A 1 98  ? -18.255 -22.088 80.094 1.00 15.00 ? 98  TYR A CE1   1 
ATOM   744  C CE2   . TYR A 1 98  ? -16.407 -22.949 81.378 1.00 15.00 ? 98  TYR A CE2   1 
ATOM   745  C CZ    . TYR A 1 98  ? -17.769 -22.880 81.129 1.00 15.00 ? 98  TYR A CZ    1 
ATOM   746  O OH    . TYR A 1 98  ? -18.636 -23.571 81.933 1.00 15.00 ? 98  TYR A OH    1 
ATOM   747  N N     . ASN A 1 99  ? -16.124 -18.444 81.158 1.00 15.00 ? 99  ASN A N     1 
ATOM   748  C CA    . ASN A 1 99  ? -16.244 -18.230 82.584 1.00 15.00 ? 99  ASN A CA    1 
ATOM   749  C C     . ASN A 1 99  ? -17.143 -19.313 83.152 1.00 15.00 ? 99  ASN A C     1 
ATOM   750  O O     . ASN A 1 99  ? -18.331 -19.369 82.852 1.00 15.00 ? 99  ASN A O     1 
ATOM   751  C CB    . ASN A 1 99  ? -16.800 -16.842 82.894 1.00 15.00 ? 99  ASN A CB    1 
ATOM   752  C CG    . ASN A 1 99  ? -16.728 -16.501 84.381 1.00 15.00 ? 99  ASN A CG    1 
ATOM   753  O OD1   . ASN A 1 99  ? -16.906 -17.365 85.243 1.00 15.00 ? 99  ASN A OD1   1 
ATOM   754  N ND2   . ASN A 1 99  ? -16.441 -15.248 84.684 1.00 15.00 ? 99  ASN A ND2   1 
ATOM   755  N N     . PRO A 1 100 ? -16.585 -20.190 83.994 1.00 15.00 ? 100 PRO A N     1 
ATOM   756  C CA    . PRO A 1 100 ? -17.335 -21.289 84.617 1.00 15.00 ? 100 PRO A CA    1 
ATOM   757  C C     . PRO A 1 100 ? -18.515 -20.815 85.476 1.00 15.00 ? 100 PRO A C     1 
ATOM   758  O O     . PRO A 1 100 ? -19.527 -21.507 85.578 1.00 15.00 ? 100 PRO A O     1 
ATOM   759  C CB    . PRO A 1 100 ? -16.268 -21.983 85.465 1.00 15.00 ? 100 PRO A CB    1 
ATOM   760  C CG    . PRO A 1 100 ? -14.998 -21.700 84.699 1.00 15.00 ? 100 PRO A CG    1 
ATOM   761  C CD    . PRO A 1 100 ? -15.163 -20.250 84.368 1.00 15.00 ? 100 PRO A CD    1 
ATOM   762  N N     . THR A 1 101 ? -18.373 -19.639 86.086 1.00 15.00 ? 101 THR A N     1 
ATOM   763  C CA    . THR A 1 101 ? -19.416 -19.049 86.928 1.00 15.00 ? 101 THR A CA    1 
ATOM   764  C C     . THR A 1 101 ? -20.676 -18.730 86.117 1.00 15.00 ? 101 THR A C     1 
ATOM   765  O O     . THR A 1 101 ? -21.768 -18.688 86.676 1.00 15.00 ? 101 THR A O     1 
ATOM   766  C CB    . THR A 1 101 ? -18.924 -17.727 87.613 1.00 15.00 ? 101 THR A CB    1 
ATOM   767  O OG1   . THR A 1 101 ? -17.732 -17.974 88.375 1.00 15.00 ? 101 THR A OG1   1 
ATOM   768  C CG2   . THR A 1 101 ? -19.993 -17.154 88.544 1.00 15.00 ? 101 THR A CG2   1 
ATOM   769  N N     . GLY A 1 102 ? -20.525 -18.509 84.808 1.00 15.00 ? 102 GLY A N     1 
ATOM   770  C CA    . GLY A 1 102 ? -21.672 -18.176 83.973 1.00 15.00 ? 102 GLY A CA    1 
ATOM   771  C C     . GLY A 1 102 ? -22.357 -19.327 83.249 1.00 15.00 ? 102 GLY A C     1 
ATOM   772  O O     . GLY A 1 102 ? -23.336 -19.117 82.534 1.00 15.00 ? 102 GLY A O     1 
ATOM   773  N N     . LYS A 1 103 ? -21.873 -20.543 83.471 1.00 15.00 ? 103 LYS A N     1 
ATOM   774  C CA    . LYS A 1 103 ? -22.406 -21.740 82.833 1.00 15.00 ? 103 LYS A CA    1 
ATOM   775  C C     . LYS A 1 103 ? -23.914 -21.864 82.952 1.00 15.00 ? 103 LYS A C     1 
ATOM   776  O O     . LYS A 1 103 ? -24.444 -21.969 84.048 1.00 15.00 ? 103 LYS A O     1 
ATOM   777  C CB    . LYS A 1 103 ? -21.729 -22.982 83.397 1.00 15.00 ? 103 LYS A CB    1 
ATOM   778  C CG    . LYS A 1 103 ? -21.932 -24.238 82.589 1.00 15.00 ? 103 LYS A CG    1 
ATOM   779  C CD    . LYS A 1 103 ? -21.933 -25.435 83.516 1.00 15.00 ? 103 LYS A CD    1 
ATOM   780  C CE    . LYS A 1 103 ? -20.797 -25.359 84.516 1.00 15.00 ? 103 LYS A CE    1 
ATOM   781  N NZ    . LYS A 1 103 ? -21.178 -26.014 85.800 1.00 15.00 ? 103 LYS A NZ    1 
ATOM   782  N N     . ALA A 1 104 ? -24.598 -21.916 81.817 1.00 15.00 ? 104 ALA A N     1 
ATOM   783  C CA    . ALA A 1 104 ? -26.055 -22.017 81.810 1.00 15.00 ? 104 ALA A CA    1 
ATOM   784  C C     . ALA A 1 104 ? -26.589 -23.377 81.351 1.00 15.00 ? 104 ALA A C     1 
ATOM   785  O O     . ALA A 1 104 ? -27.769 -23.673 81.531 1.00 15.00 ? 104 ALA A O     1 
ATOM   786  C CB    . ALA A 1 104 ? -26.652 -20.898 80.968 1.00 15.00 ? 104 ALA A CB    1 
ATOM   787  N N     . ALA A 1 105 ? -25.722 -24.201 80.773 1.00 15.00 ? 105 ALA A N     1 
ATOM   788  C CA    . ALA A 1 105 ? -26.109 -25.529 80.291 1.00 15.00 ? 105 ALA A CA    1 
ATOM   789  C C     . ALA A 1 105 ? -24.880 -26.335 79.907 1.00 15.00 ? 105 ALA A C     1 
ATOM   790  O O     . ALA A 1 105 ? -23.752 -25.828 79.942 1.00 15.00 ? 105 ALA A O     1 
ATOM   791  C CB    . ALA A 1 105 ? -27.030 -25.407 79.072 1.00 15.00 ? 105 ALA A CB    1 
ATOM   792  N N     . LYS A 1 106 ? -25.123 -27.599 79.572 1.00 15.00 ? 106 LYS A N     1 
ATOM   793  C CA    . LYS A 1 106 ? -24.102 -28.538 79.110 1.00 15.00 ? 106 LYS A CA    1 
ATOM   794  C C     . LYS A 1 106 ? -24.832 -29.572 78.269 1.00 15.00 ? 106 LYS A C     1 
ATOM   795  O O     . LYS A 1 106 ? -26.054 -29.542 78.185 1.00 15.00 ? 106 LYS A O     1 
ATOM   796  C CB    . LYS A 1 106 ? -23.331 -29.206 80.262 1.00 15.00 ? 106 LYS A CB    1 
ATOM   797  C CG    . LYS A 1 106 ? -24.143 -30.159 81.137 1.00 15.00 ? 106 LYS A CG    1 
ATOM   798  C CD    . LYS A 1 106 ? -23.573 -31.589 81.107 1.00 15.00 ? 106 LYS A CD    1 
ATOM   799  C CE    . LYS A 1 106 ? -24.325 -32.537 82.063 1.00 15.00 ? 106 LYS A CE    1 
ATOM   800  N NZ    . LYS A 1 106 ? -25.778 -32.679 81.697 1.00 15.00 ? 106 LYS A NZ    1 
ATOM   801  N N     . CYS A 1 107 ? -24.088 -30.439 77.597 1.00 15.00 ? 107 CYS A N     1 
ATOM   802  C CA    . CYS A 1 107 ? -24.703 -31.484 76.793 1.00 15.00 ? 107 CYS A CA    1 
ATOM   803  C C     . CYS A 1 107 ? -23.838 -32.718 76.877 1.00 15.00 ? 107 CYS A C     1 
ATOM   804  O O     . CYS A 1 107 ? -22.656 -32.636 77.189 1.00 15.00 ? 107 CYS A O     1 
ATOM   805  C CB    . CYS A 1 107 ? -24.945 -31.045 75.337 1.00 15.00 ? 107 CYS A CB    1 
ATOM   806  S SG    . CYS A 1 107 ? -23.543 -31.082 74.188 1.00 15.00 ? 107 CYS A SG    1 
ATOM   807  N N     . ARG A 1 108 ? -24.449 -33.871 76.678 1.00 15.00 ? 108 ARG A N     1 
ATOM   808  C CA    . ARG A 1 108 ? -23.730 -35.128 76.743 1.00 15.00 ? 108 ARG A CA    1 
ATOM   809  C C     . ARG A 1 108 ? -23.584 -35.820 75.395 1.00 15.00 ? 108 ARG A C     1 
ATOM   810  O O     . ARG A 1 108 ? -23.918 -36.992 75.239 1.00 15.00 ? 108 ARG A O     1 
ATOM   811  C CB    . ARG A 1 108 ? -24.365 -36.042 77.782 1.00 15.00 ? 108 ARG A CB    1 
ATOM   812  C CG    . ARG A 1 108 ? -24.137 -35.569 79.206 1.00 15.00 ? 108 ARG A CG    1 
ATOM   813  C CD    . ARG A 1 108 ? -24.539 -36.641 80.188 1.00 15.00 ? 108 ARG A CD    1 
ATOM   814  N NE    . ARG A 1 108 ? -25.965 -36.933 80.098 1.00 15.00 ? 108 ARG A NE    1 
ATOM   815  C CZ    . ARG A 1 108 ? -26.542 -38.011 80.607 1.00 15.00 ? 108 ARG A CZ    1 
ATOM   816  N NH1   . ARG A 1 108 ? -25.811 -38.913 81.240 1.00 15.00 ? 108 ARG A NH1   1 
ATOM   817  N NH2   . ARG A 1 108 ? -27.851 -38.177 80.500 1.00 15.00 ? 108 ARG A NH2   1 
ATOM   818  N N     . GLY A 1 109 ? -23.090 -35.079 74.414 1.00 15.00 ? 109 GLY A N     1 
ATOM   819  C CA    . GLY A 1 109 ? -22.896 -35.659 73.102 1.00 15.00 ? 109 GLY A CA    1 
ATOM   820  C C     . GLY A 1 109 ? -23.960 -35.211 72.134 1.00 15.00 ? 109 GLY A C     1 
ATOM   821  O O     . GLY A 1 109 ? -24.800 -34.380 72.485 1.00 15.00 ? 109 GLY A O     1 
ATOM   822  N N     . TYR A 1 110 ? -23.945 -35.793 70.938 1.00 15.00 ? 110 TYR A N     1 
ATOM   823  C CA    . TYR A 1 110 ? -24.896 -35.455 69.882 1.00 15.00 ? 110 TYR A CA    1 
ATOM   824  C C     . TYR A 1 110 ? -25.280 -36.658 69.020 1.00 15.00 ? 110 TYR A C     1 
ATOM   825  O O     . TYR A 1 110 ? -24.664 -37.723 69.086 1.00 15.00 ? 110 TYR A O     1 
ATOM   826  C CB    . TYR A 1 110 ? -24.352 -34.333 68.982 1.00 15.00 ? 110 TYR A CB    1 
ATOM   827  C CG    . TYR A 1 110 ? -23.082 -34.717 68.263 1.00 15.00 ? 110 TYR A CG    1 
ATOM   828  C CD1   . TYR A 1 110 ? -23.128 -35.369 67.039 1.00 15.00 ? 110 TYR A CD1   1 
ATOM   829  C CD2   . TYR A 1 110 ? -21.841 -34.517 68.855 1.00 15.00 ? 110 TYR A CD2   1 
ATOM   830  C CE1   . TYR A 1 110 ? -21.981 -35.822 66.428 1.00 15.00 ? 110 TYR A CE1   1 
ATOM   831  C CE2   . TYR A 1 110 ? -20.686 -34.960 68.257 1.00 15.00 ? 110 TYR A CE2   1 
ATOM   832  C CZ    . TYR A 1 110 ? -20.760 -35.618 67.045 1.00 15.00 ? 110 TYR A CZ    1 
ATOM   833  O OH    . TYR A 1 110 ? -19.615 -36.092 66.447 1.00 15.00 ? 110 TYR A OH    1 
ATOM   834  N N     . ARG A 1 111 ? -26.283 -36.450 68.182 1.00 15.00 ? 111 ARG A N     1 
ATOM   835  C CA    . ARG A 1 111 ? -26.766 -37.467 67.265 1.00 15.00 ? 111 ARG A CA    1 
ATOM   836  C C     . ARG A 1 111 ? -26.955 -36.778 65.917 1.00 15.00 ? 111 ARG A C     1 
ATOM   837  O O     . ARG A 1 111 ? -27.325 -35.596 65.853 1.00 15.00 ? 111 ARG A O     1 
ATOM   838  C CB    . ARG A 1 111 ? -28.064 -38.104 67.781 1.00 15.00 ? 111 ARG A CB    1 
ATOM   839  C CG    . ARG A 1 111 ? -28.999 -38.709 66.720 1.00 15.00 ? 111 ARG A CG    1 
ATOM   840  C CD    . ARG A 1 111 ? -28.587 -40.096 66.190 1.00 15.00 ? 111 ARG A CD    1 
ATOM   841  N NE    . ARG A 1 111 ? -29.558 -40.591 65.201 1.00 15.00 ? 111 ARG A NE    1 
ATOM   842  C CZ    . ARG A 1 111 ? -29.241 -41.121 64.015 1.00 15.00 ? 111 ARG A CZ    1 
ATOM   843  N NH1   . ARG A 1 111 ? -27.966 -41.250 63.647 1.00 15.00 ? 111 ARG A NH1   1 
ATOM   844  N NH2   . ARG A 1 111 ? -30.204 -41.447 63.154 1.00 15.00 ? 111 ARG A NH2   1 
ATOM   845  N N     . GLU A 1 112 ? -26.600 -37.491 64.857 1.00 15.00 ? 112 GLU A N     1 
ATOM   846  C CA    . GLU A 1 112 ? -26.727 -36.984 63.500 1.00 15.00 ? 112 GLU A CA    1 
ATOM   847  C C     . GLU A 1 112 ? -27.946 -37.636 62.841 1.00 15.00 ? 112 GLU A C     1 
ATOM   848  O O     . GLU A 1 112 ? -28.325 -38.736 63.205 1.00 15.00 ? 112 GLU A O     1 
ATOM   849  C CB    . GLU A 1 112 ? -25.444 -37.250 62.708 1.00 15.00 ? 112 GLU A CB    1 
ATOM   850  C CG    . GLU A 1 112 ? -24.233 -36.540 63.288 1.00 15.00 ? 112 GLU A CG    1 
ATOM   851  C CD    . GLU A 1 112 ? -22.944 -36.813 62.524 1.00 15.00 ? 112 GLU A CD    1 
ATOM   852  O OE1   . GLU A 1 112 ? -22.295 -37.835 62.820 1.00 15.00 ? 112 GLU A OE1   1 
ATOM   853  O OE2   . GLU A 1 112 ? -22.554 -35.998 61.658 1.00 15.00 ? 112 GLU A OE2   1 
ATOM   854  N N     . ILE A 1 113 ? -28.600 -36.938 61.926 1.00 15.00 ? 113 ILE A N     1 
ATOM   855  C CA    . ILE A 1 113 ? -29.752 -37.508 61.245 1.00 15.00 ? 113 ILE A CA    1 
ATOM   856  C C     . ILE A 1 113 ? -29.227 -38.171 59.969 1.00 15.00 ? 113 ILE A C     1 
ATOM   857  O O     . ILE A 1 113 ? -28.244 -37.702 59.394 1.00 15.00 ? 113 ILE A O     1 
ATOM   858  C CB    . ILE A 1 113 ? -30.793 -36.400 60.898 1.00 15.00 ? 113 ILE A CB    1 
ATOM   859  C CG1   . ILE A 1 113 ? -31.466 -35.887 62.175 1.00 15.00 ? 113 ILE A CG1   1 
ATOM   860  C CG2   . ILE A 1 113 ? -31.818 -36.897 59.887 1.00 15.00 ? 113 ILE A CG2   1 
ATOM   861  C CD1   . ILE A 1 113 ? -32.108 -36.976 63.003 1.00 15.00 ? 113 ILE A CD1   1 
ATOM   862  N N     . PRO A 1 114 ? -29.812 -39.316 59.557 1.00 15.00 ? 114 PRO A N     1 
ATOM   863  C CA    . PRO A 1 114 ? -29.342 -39.974 58.337 1.00 15.00 ? 114 PRO A CA    1 
ATOM   864  C C     . PRO A 1 114 ? -29.303 -38.936 57.221 1.00 15.00 ? 114 PRO A C     1 
ATOM   865  O O     . PRO A 1 114 ? -30.291 -38.230 56.974 1.00 15.00 ? 114 PRO A O     1 
ATOM   866  C CB    . PRO A 1 114 ? -30.429 -41.013 58.077 1.00 15.00 ? 114 PRO A CB    1 
ATOM   867  C CG    . PRO A 1 114 ? -30.838 -41.400 59.419 1.00 15.00 ? 114 PRO A CG    1 
ATOM   868  C CD    . PRO A 1 114 ? -30.914 -40.083 60.161 1.00 15.00 ? 114 PRO A CD    1 
ATOM   869  N N     . GLU A 1 115 ? -28.143 -38.814 56.589 1.00 15.00 ? 115 GLU A N     1 
ATOM   870  C CA    . GLU A 1 115 ? -27.952 -37.851 55.517 1.00 15.00 ? 115 GLU A CA    1 
ATOM   871  C C     . GLU A 1 115 ? -28.938 -38.053 54.377 1.00 15.00 ? 115 GLU A C     1 
ATOM   872  O O     . GLU A 1 115 ? -29.142 -39.172 53.911 1.00 15.00 ? 115 GLU A O     1 
ATOM   873  C CB    . GLU A 1 115 ? -26.515 -37.885 55.003 1.00 15.00 ? 115 GLU A CB    1 
ATOM   874  C CG    . GLU A 1 115 ? -26.243 -36.837 53.950 1.00 15.00 ? 115 GLU A CG    1 
ATOM   875  C CD    . GLU A 1 115 ? -24.869 -36.967 53.336 1.00 15.00 ? 115 GLU A CD    1 
ATOM   876  O OE1   . GLU A 1 115 ? -24.725 -37.741 52.347 1.00 15.00 ? 115 GLU A OE1   1 
ATOM   877  O OE2   . GLU A 1 115 ? -23.943 -36.286 53.844 1.00 15.00 ? 115 GLU A OE2   1 
ATOM   878  N N     . GLY A 1 116 ? -29.552 -36.960 53.946 1.00 15.00 ? 116 GLY A N     1 
ATOM   879  C CA    . GLY A 1 116 ? -30.514 -37.016 52.857 1.00 15.00 ? 116 GLY A CA    1 
ATOM   880  C C     . GLY A 1 116 ? -31.928 -37.428 53.234 1.00 15.00 ? 116 GLY A C     1 
ATOM   881  O O     . GLY A 1 116 ? -32.849 -37.229 52.435 1.00 15.00 ? 116 GLY A O     1 
ATOM   882  N N     . ASN A 1 117 ? -32.118 -37.916 54.460 1.00 15.00 ? 117 ASN A N     1 
ATOM   883  C CA    . ASN A 1 117 ? -33.431 -38.372 54.927 1.00 15.00 ? 117 ASN A CA    1 
ATOM   884  C C     . ASN A 1 117 ? -34.299 -37.297 55.603 1.00 15.00 ? 117 ASN A C     1 
ATOM   885  O O     . ASN A 1 117 ? -34.124 -37.002 56.789 1.00 15.00 ? 117 ASN A O     1 
ATOM   886  C CB    . ASN A 1 117 ? -33.270 -39.595 55.852 1.00 15.00 ? 117 ASN A CB    1 
ATOM   887  C CG    . ASN A 1 117 ? -34.529 -40.477 55.923 1.00 15.00 ? 117 ASN A CG    1 
ATOM   888  O OD1   . ASN A 1 117 ? -35.652 -40.022 55.698 1.00 15.00 ? 117 ASN A OD1   1 
ATOM   889  N ND2   . ASN A 1 117 ? -34.335 -41.744 56.267 1.00 15.00 ? 117 ASN A ND2   1 
ATOM   890  N N     . GLU A 1 118 ? -35.256 -36.746 54.856 1.00 15.00 ? 118 GLU A N     1 
ATOM   891  C CA    . GLU A 1 118 ? -36.180 -35.730 55.383 1.00 15.00 ? 118 GLU A CA    1 
ATOM   892  C C     . GLU A 1 118 ? -37.186 -36.366 56.351 1.00 15.00 ? 118 GLU A C     1 
ATOM   893  O O     . GLU A 1 118 ? -37.567 -35.762 57.355 1.00 15.00 ? 118 GLU A O     1 
ATOM   894  C CB    . GLU A 1 118 ? -36.914 -34.979 54.262 1.00 15.00 ? 118 GLU A CB    1 
ATOM   895  C CG    . GLU A 1 118 ? -36.010 -34.113 53.374 1.00 15.00 ? 118 GLU A CG    1 
ATOM   896  C CD    . GLU A 1 118 ? -36.781 -33.088 52.549 1.00 15.00 ? 118 GLU A CD    1 
ATOM   897  O OE1   . GLU A 1 118 ? -37.303 -32.114 53.125 1.00 15.00 ? 118 GLU A OE1   1 
ATOM   898  O OE2   . GLU A 1 118 ? -36.864 -33.255 51.317 1.00 15.00 ? 118 GLU A OE2   1 
ATOM   899  N N     . LYS A 1 119 ? -37.592 -37.599 56.060 1.00 15.00 ? 119 LYS A N     1 
ATOM   900  C CA    . LYS A 1 119 ? -38.531 -38.315 56.919 1.00 15.00 ? 119 LYS A CA    1 
ATOM   901  C C     . LYS A 1 119 ? -37.888 -38.452 58.300 1.00 15.00 ? 119 LYS A C     1 
ATOM   902  O O     . LYS A 1 119 ? -38.535 -38.235 59.329 1.00 15.00 ? 119 LYS A O     1 
ATOM   903  C CB    . LYS A 1 119 ? -38.887 -39.684 56.329 1.00 15.00 ? 119 LYS A CB    1 
ATOM   904  C CG    . LYS A 1 119 ? -40.096 -40.360 56.965 1.00 15.00 ? 119 LYS A CG    1 
ATOM   905  C CD    . LYS A 1 119 ? -40.369 -41.751 56.351 1.00 15.00 ? 119 LYS A CD    1 
ATOM   906  C CE    . LYS A 1 119 ? -39.706 -42.887 57.156 1.00 15.00 ? 119 LYS A CE    1 
ATOM   907  N NZ    . LYS A 1 119 ? -39.802 -44.227 56.471 1.00 15.00 ? 119 LYS A NZ    1 
ATOM   908  N N     . ALA A 1 120 ? -36.594 -38.764 58.305 1.00 15.00 ? 120 ALA A N     1 
ATOM   909  C CA    . ALA A 1 120 ? -35.846 -38.913 59.541 1.00 15.00 ? 120 ALA A CA    1 
ATOM   910  C C     . ALA A 1 120 ? -35.783 -37.577 60.261 1.00 15.00 ? 120 ALA A C     1 
ATOM   911  O O     . ALA A 1 120 ? -35.886 -37.519 61.492 1.00 15.00 ? 120 ALA A O     1 
ATOM   912  C CB    . ALA A 1 120 ? -34.444 -39.410 59.253 1.00 15.00 ? 120 ALA A CB    1 
ATOM   913  N N     . LEU A 1 121 ? -35.608 -36.509 59.485 1.00 15.00 ? 121 LEU A N     1 
ATOM   914  C CA    . LEU A 1 121 ? -35.523 -35.155 60.023 1.00 15.00 ? 121 LEU A CA    1 
ATOM   915  C C     . LEU A 1 121 ? -36.830 -34.681 60.676 1.00 15.00 ? 121 LEU A C     1 
ATOM   916  O O     . LEU A 1 121 ? -36.792 -34.049 61.740 1.00 15.00 ? 121 LEU A O     1 
ATOM   917  C CB    . LEU A 1 121 ? -35.023 -34.181 58.943 1.00 15.00 ? 121 LEU A CB    1 
ATOM   918  C CG    . LEU A 1 121 ? -34.844 -32.683 59.230 1.00 15.00 ? 121 LEU A CG    1 
ATOM   919  C CD1   . LEU A 1 121 ? -33.984 -32.434 60.459 1.00 15.00 ? 121 LEU A CD1   1 
ATOM   920  C CD2   . LEU A 1 121 ? -34.251 -32.018 57.994 1.00 15.00 ? 121 LEU A CD2   1 
ATOM   921  N N     . LYS A 1 122 ? -37.971 -35.027 60.075 1.00 15.00 ? 122 LYS A N     1 
ATOM   922  C CA    . LYS A 1 122 ? -39.292 -34.651 60.600 1.00 15.00 ? 122 LYS A CA    1 
ATOM   923  C C     . LYS A 1 122 ? -39.574 -35.327 61.925 1.00 15.00 ? 122 LYS A C     1 
ATOM   924  O O     . LYS A 1 122 ? -40.033 -34.695 62.879 1.00 15.00 ? 122 LYS A O     1 
ATOM   925  C CB    . LYS A 1 122 ? -40.420 -34.988 59.627 1.00 15.00 ? 122 LYS A CB    1 
ATOM   926  C CG    . LYS A 1 122 ? -41.821 -34.898 60.257 1.00 15.00 ? 122 LYS A CG    1 
ATOM   927  C CD    . LYS A 1 122 ? -42.889 -35.492 59.338 1.00 15.00 ? 122 LYS A CD    1 
ATOM   928  C CE    . LYS A 1 122 ? -44.279 -35.441 59.971 1.00 15.00 ? 122 LYS A CE    1 
ATOM   929  N NZ    . LYS A 1 122 ? -45.358 -35.910 59.031 1.00 15.00 ? 122 LYS A NZ    1 
ATOM   930  N N     . ARG A 1 123 ? -39.332 -36.629 61.961 1.00 15.00 ? 123 ARG A N     1 
ATOM   931  C CA    . ARG A 1 123 ? -39.547 -37.397 63.166 1.00 15.00 ? 123 ARG A CA    1 
ATOM   932  C C     . ARG A 1 123 ? -38.722 -36.818 64.328 1.00 15.00 ? 123 ARG A C     1 
ATOM   933  O O     . ARG A 1 123 ? -39.213 -36.722 65.460 1.00 15.00 ? 123 ARG A O     1 
ATOM   934  C CB    . ARG A 1 123 ? -39.256 -38.879 62.913 1.00 15.00 ? 123 ARG A CB    1 
ATOM   935  C CG    . ARG A 1 123 ? -40.255 -39.533 61.949 1.00 15.00 ? 123 ARG A CG    1 
ATOM   936  C CD    . ARG A 1 123 ? -40.036 -41.042 61.791 1.00 15.00 ? 123 ARG A CD    1 
ATOM   937  N NE    . ARG A 1 123 ? -38.709 -41.346 61.247 1.00 15.00 ? 123 ARG A NE    1 
ATOM   938  C CZ    . ARG A 1 123 ? -37.764 -42.033 61.893 1.00 15.00 ? 123 ARG A CZ    1 
ATOM   939  N NH1   . ARG A 1 123 ? -37.991 -42.509 63.116 1.00 15.00 ? 123 ARG A NH1   1 
ATOM   940  N NH2   . ARG A 1 123 ? -36.569 -42.203 61.334 1.00 15.00 ? 123 ARG A NH2   1 
ATOM   941  N N     . ALA A 1 124 ? -37.498 -36.380 64.036 1.00 15.00 ? 124 ALA A N     1 
ATOM   942  C CA    . ALA A 1 124 ? -36.624 -35.792 65.051 1.00 15.00 ? 124 ALA A CA    1 
ATOM   943  C C     . ALA A 1 124 ? -37.175 -34.464 65.577 1.00 15.00 ? 124 ALA A C     1 
ATOM   944  O O     . ALA A 1 124 ? -37.172 -34.214 66.789 1.00 15.00 ? 124 ALA A O     1 
ATOM   945  C CB    . ALA A 1 124 ? -35.213 -35.603 64.499 1.00 15.00 ? 124 ALA A CB    1 
ATOM   946  N N     . VAL A 1 125 ? -37.638 -33.608 64.676 1.00 15.00 ? 125 VAL A N     1 
ATOM   947  C CA    . VAL A 1 125 ? -38.196 -32.328 65.091 1.00 15.00 ? 125 VAL A CA    1 
ATOM   948  C C     . VAL A 1 125 ? -39.413 -32.572 65.992 1.00 15.00 ? 125 VAL A C     1 
ATOM   949  O O     . VAL A 1 125 ? -39.528 -31.989 67.066 1.00 15.00 ? 125 VAL A O     1 
ATOM   950  C CB    . VAL A 1 125 ? -38.570 -31.441 63.867 1.00 15.00 ? 125 VAL A CB    1 
ATOM   951  C CG1   . VAL A 1 125 ? -39.390 -30.229 64.307 1.00 15.00 ? 125 VAL A CG1   1 
ATOM   952  C CG2   . VAL A 1 125 ? -37.302 -30.972 63.149 1.00 15.00 ? 125 VAL A CG2   1 
ATOM   953  N N     . ALA A 1 126 ? -40.273 -33.492 65.578 1.00 15.00 ? 126 ALA A N     1 
ATOM   954  C CA    . ALA A 1 126 ? -41.463 -33.830 66.343 1.00 15.00 ? 126 ALA A CA    1 
ATOM   955  C C     . ALA A 1 126 ? -41.150 -34.290 67.771 1.00 15.00 ? 126 ALA A C     1 
ATOM   956  O O     . ALA A 1 126 ? -41.694 -33.742 68.728 1.00 15.00 ? 126 ALA A O     1 
ATOM   957  C CB    . ALA A 1 126 ? -42.269 -34.900 65.616 1.00 15.00 ? 126 ALA A CB    1 
ATOM   958  N N     . ARG A 1 127 ? -40.259 -35.264 67.929 1.00 15.00 ? 127 ARG A N     1 
ATOM   959  C CA    . ARG A 1 127 ? -39.955 -35.758 69.269 1.00 15.00 ? 127 ARG A CA    1 
ATOM   960  C C     . ARG A 1 127 ? -38.724 -35.259 70.012 1.00 15.00 ? 127 ARG A C     1 
ATOM   961  O O     . ARG A 1 127 ? -38.503 -35.646 71.147 1.00 15.00 ? 127 ARG A O     1 
ATOM   962  C CB    . ARG A 1 127 ? -39.991 -37.284 69.298 1.00 15.00 ? 127 ARG A CB    1 
ATOM   963  C CG    . ARG A 1 127 ? -38.951 -37.979 68.455 1.00 15.00 ? 127 ARG A CG    1 
ATOM   964  C CD    . ARG A 1 127 ? -39.081 -39.482 68.629 1.00 15.00 ? 127 ARG A CD    1 
ATOM   965  N NE    . ARG A 1 127 ? -40.432 -39.945 68.298 1.00 15.00 ? 127 ARG A NE    1 
ATOM   966  C CZ    . ARG A 1 127 ? -41.253 -40.575 69.141 1.00 15.00 ? 127 ARG A CZ    1 
ATOM   967  N NH1   . ARG A 1 127 ? -40.878 -40.834 70.395 1.00 15.00 ? 127 ARG A NH1   1 
ATOM   968  N NH2   . ARG A 1 127 ? -42.465 -40.944 68.729 1.00 15.00 ? 127 ARG A NH2   1 
ATOM   969  N N     . VAL A 1 128 ? -37.913 -34.421 69.396 1.00 15.00 ? 128 VAL A N     1 
ATOM   970  C CA    . VAL A 1 128 ? -36.723 -33.936 70.073 1.00 15.00 ? 128 VAL A CA    1 
ATOM   971  C C     . VAL A 1 128 ? -36.781 -32.431 70.319 1.00 15.00 ? 128 VAL A C     1 
ATOM   972  O O     . VAL A 1 128 ? -36.544 -31.961 71.430 1.00 15.00 ? 128 VAL A O     1 
ATOM   973  C CB    . VAL A 1 128 ? -35.456 -34.310 69.266 1.00 15.00 ? 128 VAL A CB    1 
ATOM   974  C CG1   . VAL A 1 128 ? -34.253 -33.522 69.743 1.00 15.00 ? 128 VAL A CG1   1 
ATOM   975  C CG2   . VAL A 1 128 ? -35.178 -35.794 69.415 1.00 15.00 ? 128 VAL A CG2   1 
ATOM   976  N N     . GLY A 1 129 ? -37.116 -31.681 69.279 1.00 15.00 ? 129 GLY A N     1 
ATOM   977  C CA    . GLY A 1 129 ? -37.179 -30.239 69.392 1.00 15.00 ? 129 GLY A CA    1 
ATOM   978  C C     . GLY A 1 129 ? -36.407 -29.694 68.215 1.00 15.00 ? 129 GLY A C     1 
ATOM   979  O O     . GLY A 1 129 ? -36.101 -30.458 67.301 1.00 15.00 ? 129 GLY A O     1 
ATOM   980  N N     . PRO A 1 130 ? -36.086 -28.390 68.195 1.00 15.00 ? 130 PRO A N     1 
ATOM   981  C CA    . PRO A 1 130 ? -35.336 -27.748 67.110 1.00 15.00 ? 130 PRO A CA    1 
ATOM   982  C C     . PRO A 1 130 ? -34.063 -28.521 66.735 1.00 15.00 ? 130 PRO A C     1 
ATOM   983  O O     . PRO A 1 130 ? -33.354 -29.045 67.610 1.00 15.00 ? 130 PRO A O     1 
ATOM   984  C CB    . PRO A 1 130 ? -35.009 -26.378 67.698 1.00 15.00 ? 130 PRO A CB    1 
ATOM   985  C CG    . PRO A 1 130 ? -36.231 -26.078 68.513 1.00 15.00 ? 130 PRO A CG    1 
ATOM   986  C CD    . PRO A 1 130 ? -36.462 -27.403 69.224 1.00 15.00 ? 130 PRO A CD    1 
ATOM   987  N N     . VAL A 1 131 ? -33.778 -28.583 65.435 1.00 15.00 ? 131 VAL A N     1 
ATOM   988  C CA    . VAL A 1 131 ? -32.607 -29.296 64.922 1.00 15.00 ? 131 VAL A CA    1 
ATOM   989  C C     . VAL A 1 131 ? -31.714 -28.417 64.024 1.00 15.00 ? 131 VAL A C     1 
ATOM   990  O O     . VAL A 1 131 ? -32.211 -27.714 63.139 1.00 15.00 ? 131 VAL A O     1 
ATOM   991  C CB    . VAL A 1 131 ? -33.053 -30.573 64.146 1.00 15.00 ? 131 VAL A CB    1 
ATOM   992  C CG1   . VAL A 1 131 ? -31.851 -31.309 63.567 1.00 15.00 ? 131 VAL A CG1   1 
ATOM   993  C CG2   . VAL A 1 131 ? -33.841 -31.500 65.066 1.00 15.00 ? 131 VAL A CG2   1 
ATOM   994  N N     . SER A 1 132 ? -30.407 -28.444 64.287 1.00 15.00 ? 132 SER A N     1 
ATOM   995  C CA    . SER A 1 132 ? -29.399 -27.689 63.528 1.00 15.00 ? 132 SER A CA    1 
ATOM   996  C C     . SER A 1 132 ? -29.190 -28.306 62.134 1.00 15.00 ? 132 SER A C     1 
ATOM   997  O O     . SER A 1 132 ? -28.822 -29.484 62.019 1.00 15.00 ? 132 SER A O     1 
ATOM   998  C CB    . SER A 1 132 ? -28.067 -27.654 64.275 1.00 15.00 ? 132 SER A CB    1 
ATOM   999  O OG    . SER A 1 132 ? -28.216 -27.174 65.593 1.00 15.00 ? 132 SER A OG    1 
ATOM   1000 N N     . VAL A 1 133 ? -29.400 -27.516 61.083 1.00 15.00 ? 133 VAL A N     1 
ATOM   1001 C CA    . VAL A 1 133 ? -29.233 -28.016 59.725 1.00 15.00 ? 133 VAL A CA    1 
ATOM   1002 C C     . VAL A 1 133 ? -28.349 -27.103 58.894 1.00 15.00 ? 133 VAL A C     1 
ATOM   1003 O O     . VAL A 1 133 ? -28.219 -25.923 59.195 1.00 15.00 ? 133 VAL A O     1 
ATOM   1004 C CB    . VAL A 1 133 ? -30.602 -28.184 58.992 1.00 15.00 ? 133 VAL A CB    1 
ATOM   1005 C CG1   . VAL A 1 133 ? -31.532 -29.064 59.799 1.00 15.00 ? 133 VAL A CG1   1 
ATOM   1006 C CG2   . VAL A 1 133 ? -31.242 -26.837 58.703 1.00 15.00 ? 133 VAL A CG2   1 
ATOM   1007 N N     . ALA A 1 134 ? -27.742 -27.656 57.851 1.00 15.00 ? 134 ALA A N     1 
ATOM   1008 C CA    . ALA A 1 134 ? -26.881 -26.896 56.949 1.00 15.00 ? 134 ALA A CA    1 
ATOM   1009 C C     . ALA A 1 134 ? -27.593 -26.859 55.593 1.00 15.00 ? 134 ALA A C     1 
ATOM   1010 O O     . ALA A 1 134 ? -28.146 -27.867 55.145 1.00 15.00 ? 134 ALA A O     1 
ATOM   1011 C CB    . ALA A 1 134 ? -25.502 -27.561 56.826 1.00 15.00 ? 134 ALA A CB    1 
ATOM   1012 N N     . ILE A 1 135 ? -27.607 -25.690 54.961 1.00 15.00 ? 135 ILE A N     1 
ATOM   1013 C CA    . ILE A 1 135 ? -28.283 -25.518 53.682 1.00 15.00 ? 135 ILE A CA    1 
ATOM   1014 C C     . ILE A 1 135 ? -27.451 -24.694 52.709 1.00 15.00 ? 135 ILE A C     1 
ATOM   1015 O O     . ILE A 1 135 ? -26.359 -24.216 53.039 1.00 15.00 ? 135 ILE A O     1 
ATOM   1016 C CB    . ILE A 1 135 ? -29.635 -24.753 53.856 1.00 15.00 ? 135 ILE A CB    1 
ATOM   1017 C CG1   . ILE A 1 135 ? -29.371 -23.340 54.389 1.00 15.00 ? 135 ILE A CG1   1 
ATOM   1018 C CG2   . ILE A 1 135 ? -30.593 -25.514 54.767 1.00 15.00 ? 135 ILE A CG2   1 
ATOM   1019 C CD1   . ILE A 1 135 ? -30.612 -22.474 54.501 1.00 15.00 ? 135 ILE A CD1   1 
ATOM   1020 N N     . ASP A 1 136 ? -27.977 -24.563 51.494 1.00 15.00 ? 136 ASP A N     1 
ATOM   1021 C CA    . ASP A 1 136 ? -27.372 -23.746 50.453 1.00 15.00 ? 136 ASP A CA    1 
ATOM   1022 C C     . ASP A 1 136 ? -28.207 -22.465 50.500 1.00 15.00 ? 136 ASP A C     1 
ATOM   1023 O O     . ASP A 1 136 ? -29.406 -22.483 50.217 1.00 15.00 ? 136 ASP A O     1 
ATOM   1024 C CB    . ASP A 1 136 ? -27.453 -24.422 49.074 1.00 15.00 ? 136 ASP A CB    1 
ATOM   1025 C CG    . ASP A 1 136 ? -26.860 -23.566 47.944 1.00 15.00 ? 136 ASP A CG    1 
ATOM   1026 O OD1   . ASP A 1 136 ? -26.348 -22.455 48.191 1.00 15.00 ? 136 ASP A OD1   1 
ATOM   1027 O OD2   . ASP A 1 136 ? -26.906 -24.017 46.787 1.00 15.00 ? 136 ASP A OD2   1 
ATOM   1028 N N     . ALA A 1 137 ? -27.577 -21.376 50.923 1.00 15.00 ? 137 ALA A N     1 
ATOM   1029 C CA    . ALA A 1 137 ? -28.233 -20.083 51.038 1.00 15.00 ? 137 ALA A CA    1 
ATOM   1030 C C     . ALA A 1 137 ? -27.454 -19.041 50.250 1.00 15.00 ? 137 ALA A C     1 
ATOM   1031 O O     . ALA A 1 137 ? -27.309 -17.906 50.691 1.00 15.00 ? 137 ALA A O     1 
ATOM   1032 C CB    . ALA A 1 137 ? -28.295 -19.679 52.486 1.00 15.00 ? 137 ALA A CB    1 
ATOM   1033 N N     . SER A 1 138 ? -26.973 -19.437 49.077 1.00 15.00 ? 138 SER A N     1 
ATOM   1034 C CA    . SER A 1 138 ? -26.176 -18.559 48.224 1.00 15.00 ? 138 SER A CA    1 
ATOM   1035 C C     . SER A 1 138 ? -26.987 -17.809 47.161 1.00 15.00 ? 138 SER A C     1 
ATOM   1036 O O     . SER A 1 138 ? -26.484 -16.880 46.515 1.00 15.00 ? 138 SER A O     1 
ATOM   1037 C CB    . SER A 1 138 ? -25.045 -19.358 47.563 1.00 15.00 ? 138 SER A CB    1 
ATOM   1038 O OG    . SER A 1 138 ? -25.571 -20.329 46.672 1.00 15.00 ? 138 SER A OG    1 
ATOM   1039 N N     . LEU A 1 139 ? -28.228 -18.243 46.971 1.00 15.00 ? 139 LEU A N     1 
ATOM   1040 C CA    . LEU A 1 139 ? -29.112 -17.676 45.969 1.00 15.00 ? 139 LEU A CA    1 
ATOM   1041 C C     . LEU A 1 139 ? -29.759 -16.353 46.314 1.00 15.00 ? 139 LEU A C     1 
ATOM   1042 O O     . LEU A 1 139 ? -30.199 -16.126 47.437 1.00 15.00 ? 139 LEU A O     1 
ATOM   1043 C CB    . LEU A 1 139 ? -30.166 -18.699 45.550 1.00 15.00 ? 139 LEU A CB    1 
ATOM   1044 C CG    . LEU A 1 139 ? -29.681 -19.888 44.708 1.00 15.00 ? 139 LEU A CG    1 
ATOM   1045 C CD1   . LEU A 1 139 ? -28.411 -20.511 45.273 1.00 15.00 ? 139 LEU A CD1   1 
ATOM   1046 C CD2   . LEU A 1 139 ? -30.782 -20.927 44.650 1.00 15.00 ? 139 LEU A CD2   1 
ATOM   1047 N N     . THR A 1 140 ? -29.817 -15.483 45.314 1.00 15.00 ? 140 THR A N     1 
ATOM   1048 C CA    . THR A 1 140 ? -30.414 -14.154 45.440 1.00 15.00 ? 140 THR A CA    1 
ATOM   1049 C C     . THR A 1 140 ? -31.873 -14.266 45.914 1.00 15.00 ? 140 THR A C     1 
ATOM   1050 O O     . THR A 1 140 ? -32.360 -13.415 46.659 1.00 15.00 ? 140 THR A O     1 
ATOM   1051 C CB    . THR A 1 140 ? -30.312 -13.398 44.072 1.00 15.00 ? 140 THR A CB    1 
ATOM   1052 O OG1   . THR A 1 140 ? -28.940 -13.061 43.813 1.00 15.00 ? 140 THR A OG1   1 
ATOM   1053 C CG2   . THR A 1 140 ? -31.172 -12.143 44.058 1.00 15.00 ? 140 THR A CG2   1 
ATOM   1054 N N     . SER A 1 141 ? -32.546 -15.336 45.497 1.00 15.00 ? 141 SER A N     1 
ATOM   1055 C CA    . SER A 1 141 ? -33.926 -15.577 45.893 1.00 15.00 ? 141 SER A CA    1 
ATOM   1056 C C     . SER A 1 141 ? -33.996 -15.696 47.415 1.00 15.00 ? 141 SER A C     1 
ATOM   1057 O O     . SER A 1 141 ? -34.834 -15.069 48.066 1.00 15.00 ? 141 SER A O     1 
ATOM   1058 C CB    . SER A 1 141 ? -34.473 -16.839 45.226 1.00 15.00 ? 141 SER A CB    1 
ATOM   1059 O OG    . SER A 1 141 ? -33.611 -17.943 45.441 1.00 15.00 ? 141 SER A OG    1 
ATOM   1060 N N     . PHE A 1 142 ? -33.067 -16.471 47.968 1.00 15.00 ? 142 PHE A N     1 
ATOM   1061 C CA    . PHE A 1 142 ? -32.993 -16.704 49.403 1.00 15.00 ? 142 PHE A CA    1 
ATOM   1062 C C     . PHE A 1 142 ? -32.726 -15.416 50.158 1.00 15.00 ? 142 PHE A C     1 
ATOM   1063 O O     . PHE A 1 142 ? -33.464 -15.070 51.075 1.00 15.00 ? 142 PHE A O     1 
ATOM   1064 C CB    . PHE A 1 142 ? -31.937 -17.761 49.732 1.00 15.00 ? 142 PHE A CB    1 
ATOM   1065 C CG    . PHE A 1 142 ? -31.904 -18.153 51.174 1.00 15.00 ? 142 PHE A CG    1 
ATOM   1066 C CD1   . PHE A 1 142 ? -32.767 -19.121 51.657 1.00 15.00 ? 142 PHE A CD1   1 
ATOM   1067 C CD2   . PHE A 1 142 ? -31.018 -17.546 52.052 1.00 15.00 ? 142 PHE A CD2   1 
ATOM   1068 C CE1   . PHE A 1 142 ? -32.749 -19.481 52.997 1.00 15.00 ? 142 PHE A CE1   1 
ATOM   1069 C CE2   . PHE A 1 142 ? -30.995 -17.900 53.390 1.00 15.00 ? 142 PHE A CE2   1 
ATOM   1070 C CZ    . PHE A 1 142 ? -31.865 -18.872 53.863 1.00 15.00 ? 142 PHE A CZ    1 
ATOM   1071 N N     . GLN A 1 143 ? -31.671 -14.709 49.761 1.00 15.00 ? 143 GLN A N     1 
ATOM   1072 C CA    . GLN A 1 143 ? -31.305 -13.453 50.398 1.00 15.00 ? 143 GLN A CA    1 
ATOM   1073 C C     . GLN A 1 143 ? -32.501 -12.506 50.431 1.00 15.00 ? 143 GLN A C     1 
ATOM   1074 O O     . GLN A 1 143 ? -32.763 -11.848 51.439 1.00 15.00 ? 143 GLN A O     1 
ATOM   1075 C CB    . GLN A 1 143 ? -30.100 -12.814 49.700 1.00 15.00 ? 143 GLN A CB    1 
ATOM   1076 C CG    . GLN A 1 143 ? -29.691 -11.449 50.278 1.00 15.00 ? 143 GLN A CG    1 
ATOM   1077 C CD    . GLN A 1 143 ? -28.337 -10.915 49.769 1.00 15.00 ? 143 GLN A CD    1 
ATOM   1078 O OE1   . GLN A 1 143 ? -27.728 -10.036 50.401 1.00 15.00 ? 143 GLN A OE1   1 
ATOM   1079 N NE2   . GLN A 1 143 ? -27.853 -11.455 48.644 1.00 15.00 ? 143 GLN A NE2   1 
ATOM   1080 N N     . PHE A 1 144 ? -33.280 -12.511 49.357 1.00 15.00 ? 144 PHE A N     1 
ATOM   1081 C CA    . PHE A 1 144 ? -34.427 -11.621 49.264 1.00 15.00 ? 144 PHE A CA    1 
ATOM   1082 C C     . PHE A 1 144 ? -35.791 -12.232 49.609 1.00 15.00 ? 144 PHE A C     1 
ATOM   1083 O O     . PHE A 1 144 ? -36.831 -11.618 49.350 1.00 15.00 ? 144 PHE A O     1 
ATOM   1084 C CB    . PHE A 1 144 ? -34.433 -10.901 47.894 1.00 15.00 ? 144 PHE A CB    1 
ATOM   1085 C CG    . PHE A 1 144 ? -33.214 -10.011 47.659 1.00 15.00 ? 144 PHE A CG    1 
ATOM   1086 C CD1   . PHE A 1 144 ? -32.960 -8.917  48.483 1.00 15.00 ? 144 PHE A CD1   1 
ATOM   1087 C CD2   . PHE A 1 144 ? -32.313 -10.286 46.633 1.00 15.00 ? 144 PHE A CD2   1 
ATOM   1088 C CE1   . PHE A 1 144 ? -31.832 -8.117  48.297 1.00 15.00 ? 144 PHE A CE1   1 
ATOM   1089 C CE2   . PHE A 1 144 ? -31.174 -9.485  46.438 1.00 15.00 ? 144 PHE A CE2   1 
ATOM   1090 C CZ    . PHE A 1 144 ? -30.938 -8.401  47.274 1.00 15.00 ? 144 PHE A CZ    1 
ATOM   1091 N N     . TYR A 1 145 ? -35.785 -13.406 50.244 1.00 15.00 ? 145 TYR A N     1 
ATOM   1092 C CA    . TYR A 1 145 ? -37.028 -14.079 50.639 1.00 15.00 ? 145 TYR A CA    1 
ATOM   1093 C C     . TYR A 1 145 ? -37.897 -13.176 51.515 1.00 15.00 ? 145 TYR A C     1 
ATOM   1094 O O     . TYR A 1 145 ? -37.385 -12.428 52.358 1.00 15.00 ? 145 TYR A O     1 
ATOM   1095 C CB    . TYR A 1 145 ? -36.756 -15.421 51.346 1.00 15.00 ? 145 TYR A CB    1 
ATOM   1096 C CG    . TYR A 1 145 ? -37.964 -16.002 52.078 1.00 15.00 ? 145 TYR A CG    1 
ATOM   1097 C CD1   . TYR A 1 145 ? -38.260 -15.619 53.385 1.00 15.00 ? 145 TYR A CD1   1 
ATOM   1098 C CD2   . TYR A 1 145 ? -38.817 -16.923 51.457 1.00 15.00 ? 145 TYR A CD2   1 
ATOM   1099 C CE1   . TYR A 1 145 ? -39.368 -16.129 54.055 1.00 15.00 ? 145 TYR A CE1   1 
ATOM   1100 C CE2   . TYR A 1 145 ? -39.931 -17.447 52.126 1.00 15.00 ? 145 TYR A CE2   1 
ATOM   1101 C CZ    . TYR A 1 145 ? -40.200 -17.043 53.426 1.00 15.00 ? 145 TYR A CZ    1 
ATOM   1102 O OH    . TYR A 1 145 ? -41.287 -17.540 54.119 1.00 15.00 ? 145 TYR A OH    1 
ATOM   1103 N N     . SER A 1 146 ? -39.211 -13.311 51.375 1.00 15.00 ? 146 SER A N     1 
ATOM   1104 C CA    . SER A 1 146 ? -40.128 -12.490 52.152 1.00 15.00 ? 146 SER A CA    1 
ATOM   1105 C C     . SER A 1 146 ? -41.456 -13.147 52.514 1.00 15.00 ? 146 SER A C     1 
ATOM   1106 O O     . SER A 1 146 ? -41.954 -12.960 53.622 1.00 15.00 ? 146 SER A O     1 
ATOM   1107 C CB    . SER A 1 146 ? -40.374 -11.150 51.447 1.00 15.00 ? 146 SER A CB    1 
ATOM   1108 O OG    . SER A 1 146 ? -40.913 -11.352 50.147 1.00 15.00 ? 146 SER A OG    1 
ATOM   1109 N N     . LYS A 1 147 ? -42.008 -13.923 51.581 1.00 15.00 ? 147 LYS A N     1 
ATOM   1110 C CA    . LYS A 1 147 ? -43.302 -14.590 51.755 1.00 15.00 ? 147 LYS A CA    1 
ATOM   1111 C C     . LYS A 1 147 ? -43.368 -16.026 51.200 1.00 15.00 ? 147 LYS A C     1 
ATOM   1112 O O     . LYS A 1 147 ? -42.630 -16.394 50.275 1.00 15.00 ? 147 LYS A O     1 
ATOM   1113 C CB    . LYS A 1 147 ? -44.424 -13.759 51.100 1.00 15.00 ? 147 LYS A CB    1 
ATOM   1114 C CG    . LYS A 1 147 ? -44.602 -12.344 51.619 1.00 15.00 ? 147 LYS A CG    1 
ATOM   1115 C CD    . LYS A 1 147 ? -45.054 -12.336 53.084 1.00 15.00 ? 147 LYS A CD    1 
ATOM   1116 C CE    . LYS A 1 147 ? -45.367 -10.922 53.581 1.00 15.00 ? 147 LYS A CE    1 
ATOM   1117 N NZ    . LYS A 1 147 ? -46.003 -10.904 54.930 1.00 15.00 ? 147 LYS A NZ    1 
ATOM   1118 N N     . GLY A 1 148 ? -44.294 -16.810 51.747 1.00 15.00 ? 148 GLY A N     1 
ATOM   1119 C CA    . GLY A 1 148 ? -44.517 -18.165 51.277 1.00 15.00 ? 148 GLY A CA    1 
ATOM   1120 C C     . GLY A 1 148 ? -43.456 -19.221 51.495 1.00 15.00 ? 148 GLY A C     1 
ATOM   1121 O O     . GLY A 1 148 ? -42.465 -18.993 52.178 1.00 15.00 ? 148 GLY A O     1 
ATOM   1122 N N     . VAL A 1 149 ? -43.704 -20.409 50.947 1.00 15.00 ? 149 VAL A N     1 
ATOM   1123 C CA    . VAL A 1 149 ? -42.784 -21.532 51.067 1.00 15.00 ? 149 VAL A CA    1 
ATOM   1124 C C     . VAL A 1 149 ? -41.688 -21.413 50.013 1.00 15.00 ? 149 VAL A C     1 
ATOM   1125 O O     . VAL A 1 149 ? -41.941 -21.545 48.821 1.00 15.00 ? 149 VAL A O     1 
ATOM   1126 C CB    . VAL A 1 149 ? -43.534 -22.900 50.949 1.00 15.00 ? 149 VAL A CB    1 
ATOM   1127 C CG1   . VAL A 1 149 ? -42.550 -24.070 50.900 1.00 15.00 ? 149 VAL A CG1   1 
ATOM   1128 C CG2   . VAL A 1 149 ? -44.473 -23.078 52.138 1.00 15.00 ? 149 VAL A CG2   1 
ATOM   1129 N N     . TYR A 1 150 ? -40.487 -21.081 50.475 1.00 15.00 ? 150 TYR A N     1 
ATOM   1130 C CA    . TYR A 1 150 ? -39.314 -20.922 49.627 1.00 15.00 ? 150 TYR A CA    1 
ATOM   1131 C C     . TYR A 1 150 ? -38.892 -22.182 48.889 1.00 15.00 ? 150 TYR A C     1 
ATOM   1132 O O     . TYR A 1 150 ? -38.880 -23.282 49.449 1.00 15.00 ? 150 TYR A O     1 
ATOM   1133 C CB    . TYR A 1 150 ? -38.117 -20.362 50.420 1.00 15.00 ? 150 TYR A CB    1 
ATOM   1134 C CG    . TYR A 1 150 ? -36.838 -20.287 49.603 1.00 15.00 ? 150 TYR A CG    1 
ATOM   1135 C CD1   . TYR A 1 150 ? -36.667 -19.303 48.629 1.00 15.00 ? 150 TYR A CD1   1 
ATOM   1136 C CD2   . TYR A 1 150 ? -35.842 -21.249 49.742 1.00 15.00 ? 150 TYR A CD2   1 
ATOM   1137 C CE1   . TYR A 1 150 ? -35.539 -19.285 47.807 1.00 15.00 ? 150 TYR A CE1   1 
ATOM   1138 C CE2   . TYR A 1 150 ? -34.708 -21.242 48.921 1.00 15.00 ? 150 TYR A CE2   1 
ATOM   1139 C CZ    . TYR A 1 150 ? -34.567 -20.261 47.956 1.00 15.00 ? 150 TYR A CZ    1 
ATOM   1140 O OH    . TYR A 1 150 ? -33.477 -20.270 47.124 1.00 15.00 ? 150 TYR A OH    1 
ATOM   1141 N N     . TYR A 1 151 ? -38.466 -21.975 47.647 1.00 15.00 ? 151 TYR A N     1 
ATOM   1142 C CA    . TYR A 1 151 ? -37.983 -23.029 46.771 1.00 15.00 ? 151 TYR A CA    1 
ATOM   1143 C C     . TYR A 1 151 ? -37.351 -22.387 45.546 1.00 15.00 ? 151 TYR A C     1 
ATOM   1144 O O     . TYR A 1 151 ? -37.803 -21.333 45.074 1.00 15.00 ? 151 TYR A O     1 
ATOM   1145 C CB    . TYR A 1 151 ? -39.095 -23.992 46.354 1.00 15.00 ? 151 TYR A CB    1 
ATOM   1146 C CG    . TYR A 1 151 ? -38.621 -25.089 45.421 1.00 15.00 ? 151 TYR A CG    1 
ATOM   1147 C CD1   . TYR A 1 151 ? -37.921 -26.198 45.911 1.00 15.00 ? 151 TYR A CD1   1 
ATOM   1148 C CD2   . TYR A 1 151 ? -38.892 -25.035 44.053 1.00 15.00 ? 151 TYR A CD2   1 
ATOM   1149 C CE1   . TYR A 1 151 ? -37.514 -27.235 45.064 1.00 15.00 ? 151 TYR A CE1   1 
ATOM   1150 C CE2   . TYR A 1 151 ? -38.487 -26.065 43.190 1.00 15.00 ? 151 TYR A CE2   1 
ATOM   1151 C CZ    . TYR A 1 151 ? -37.803 -27.164 43.704 1.00 15.00 ? 151 TYR A CZ    1 
ATOM   1152 O OH    . TYR A 1 151 ? -37.463 -28.215 42.871 1.00 15.00 ? 151 TYR A OH    1 
ATOM   1153 N N     . ASP A 1 152 ? -36.297 -23.018 45.046 1.00 15.00 ? 152 ASP A N     1 
ATOM   1154 C CA    . ASP A 1 152 ? -35.595 -22.540 43.864 1.00 15.00 ? 152 ASP A CA    1 
ATOM   1155 C C     . ASP A 1 152 ? -34.831 -23.704 43.254 1.00 15.00 ? 152 ASP A C     1 
ATOM   1156 O O     . ASP A 1 152 ? -33.944 -24.268 43.889 1.00 15.00 ? 152 ASP A O     1 
ATOM   1157 C CB    . ASP A 1 152 ? -34.657 -21.384 44.201 1.00 15.00 ? 152 ASP A CB    1 
ATOM   1158 C CG    . ASP A 1 152 ? -34.129 -20.682 42.965 1.00 15.00 ? 152 ASP A CG    1 
ATOM   1159 O OD1   . ASP A 1 152 ? -34.322 -21.200 41.841 1.00 15.00 ? 152 ASP A OD1   1 
ATOM   1160 O OD2   . ASP A 1 152 ? -33.524 -19.598 43.120 1.00 15.00 ? 152 ASP A OD2   1 
ATOM   1161 N N     . GLU A 1 153 ? -35.153 -24.037 42.010 1.00 15.00 ? 153 GLU A N     1 
ATOM   1162 C CA    . GLU A 1 153 ? -34.496 -25.154 41.340 1.00 15.00 ? 153 GLU A CA    1 
ATOM   1163 C C     . GLU A 1 153 ? -32.982 -25.018 41.174 1.00 15.00 ? 153 GLU A C     1 
ATOM   1164 O O     . GLU A 1 153 ? -32.298 -26.006 40.923 1.00 15.00 ? 153 GLU A O     1 
ATOM   1165 C CB    . GLU A 1 153 ? -35.155 -25.452 39.996 1.00 15.00 ? 153 GLU A CB    1 
ATOM   1166 C CG    . GLU A 1 153 ? -34.951 -24.378 38.957 1.00 15.00 ? 153 GLU A CG    1 
ATOM   1167 C CD    . GLU A 1 153 ? -35.388 -24.808 37.563 1.00 15.00 ? 153 GLU A CD    1 
ATOM   1168 O OE1   . GLU A 1 153 ? -35.723 -26.005 37.367 1.00 15.00 ? 153 GLU A OE1   1 
ATOM   1169 O OE2   . GLU A 1 153 ? -35.404 -23.936 36.661 1.00 15.00 ? 153 GLU A OE2   1 
ATOM   1170 N N     . SER A 1 154 ? -32.460 -23.805 41.323 1.00 15.00 ? 154 SER A N     1 
ATOM   1171 C CA    . SER A 1 154 ? -31.022 -23.563 41.182 1.00 15.00 ? 154 SER A CA    1 
ATOM   1172 C C     . SER A 1 154 ? -30.225 -23.821 42.458 1.00 15.00 ? 154 SER A C     1 
ATOM   1173 O O     . SER A 1 154 ? -28.991 -23.762 42.455 1.00 15.00 ? 154 SER A O     1 
ATOM   1174 C CB    . SER A 1 154 ? -30.767 -22.149 40.657 1.00 15.00 ? 154 SER A CB    1 
ATOM   1175 O OG    . SER A 1 154 ? -31.561 -21.911 39.501 1.00 15.00 ? 154 SER A OG    1 
ATOM   1176 N N     . CYS A 1 155 ? -30.942 -24.129 43.534 1.00 15.00 ? 155 CYS A N     1 
ATOM   1177 C CA    . CYS A 1 155 ? -30.354 -24.388 44.845 1.00 15.00 ? 155 CYS A CA    1 
ATOM   1178 C C     . CYS A 1 155 ? -29.601 -25.713 44.923 1.00 15.00 ? 155 CYS A C     1 
ATOM   1179 O O     . CYS A 1 155 ? -30.204 -26.778 44.851 1.00 15.00 ? 155 CYS A O     1 
ATOM   1180 C CB    . CYS A 1 155 ? -31.433 -24.323 45.913 1.00 15.00 ? 155 CYS A CB    1 
ATOM   1181 S SG    . CYS A 1 155 ? -30.842 -23.761 47.526 1.00 15.00 ? 155 CYS A SG    1 
ATOM   1182 N N     . ASN A 1 156 ? -28.289 -25.644 45.113 1.00 15.00 ? 156 ASN A N     1 
ATOM   1183 C CA    . ASN A 1 156 ? -27.461 -26.841 45.199 1.00 15.00 ? 156 ASN A CA    1 
ATOM   1184 C C     . ASN A 1 156 ? -27.333 -27.506 46.575 1.00 15.00 ? 156 ASN A C     1 
ATOM   1185 O O     . ASN A 1 156 ? -26.740 -26.948 47.505 1.00 15.00 ? 156 ASN A O     1 
ATOM   1186 C CB    . ASN A 1 156 ? -26.079 -26.581 44.610 1.00 15.00 ? 156 ASN A CB    1 
ATOM   1187 C CG    . ASN A 1 156 ? -25.256 -27.852 44.476 1.00 15.00 ? 156 ASN A CG    1 
ATOM   1188 O OD1   . ASN A 1 156 ? -25.775 -28.967 44.564 1.00 15.00 ? 156 ASN A OD1   1 
ATOM   1189 N ND2   . ASN A 1 156 ? -23.962 -27.688 44.261 1.00 15.00 ? 156 ASN A ND2   1 
ATOM   1190 N N     . SER A 1 157 ? -27.778 -28.758 46.649 1.00 15.00 ? 157 SER A N     1 
ATOM   1191 C CA    . SER A 1 157 ? -27.731 -29.532 47.882 1.00 15.00 ? 157 SER A CA    1 
ATOM   1192 C C     . SER A 1 157 ? -26.328 -29.971 48.291 1.00 15.00 ? 157 SER A C     1 
ATOM   1193 O O     . SER A 1 157 ? -26.156 -30.577 49.355 1.00 15.00 ? 157 SER A O     1 
ATOM   1194 C CB    . SER A 1 157 ? -28.660 -30.742 47.801 1.00 15.00 ? 157 SER A CB    1 
ATOM   1195 O OG    . SER A 1 157 ? -28.217 -31.645 46.805 1.00 15.00 ? 157 SER A OG    1 
ATOM   1196 N N     . ASP A 1 158 ? -25.343 -29.713 47.431 1.00 15.00 ? 158 ASP A N     1 
ATOM   1197 C CA    . ASP A 1 158 ? -23.952 -30.071 47.712 1.00 15.00 ? 158 ASP A CA    1 
ATOM   1198 C C     . ASP A 1 158 ? -23.093 -28.836 47.967 1.00 15.00 ? 158 ASP A C     1 
ATOM   1199 O O     . ASP A 1 158 ? -21.861 -28.896 47.960 1.00 15.00 ? 158 ASP A O     1 
ATOM   1200 C CB    . ASP A 1 158 ? -23.352 -30.922 46.591 1.00 15.00 ? 158 ASP A CB    1 
ATOM   1201 C CG    . ASP A 1 158 ? -24.024 -32.272 46.468 1.00 15.00 ? 158 ASP A CG    1 
ATOM   1202 O OD1   . ASP A 1 158 ? -24.014 -33.041 47.466 1.00 15.00 ? 158 ASP A OD1   1 
ATOM   1203 O OD2   . ASP A 1 158 ? -24.576 -32.548 45.375 1.00 15.00 ? 158 ASP A OD2   1 
ATOM   1204 N N     . ASN A 1 159 ? -23.758 -27.704 48.144 1.00 15.00 ? 159 ASN A N     1 
ATOM   1205 C CA    . ASN A 1 159 ? -23.082 -26.453 48.423 1.00 15.00 ? 159 ASN A CA    1 
ATOM   1206 C C     . ASN A 1 159 ? -23.691 -25.986 49.734 1.00 15.00 ? 159 ASN A C     1 
ATOM   1207 O O     . ASN A 1 159 ? -24.502 -25.059 49.753 1.00 15.00 ? 159 ASN A O     1 
ATOM   1208 C CB    . ASN A 1 159 ? -23.317 -25.445 47.299 1.00 15.00 ? 159 ASN A CB    1 
ATOM   1209 C CG    . ASN A 1 159 ? -22.570 -24.135 47.508 1.00 15.00 ? 159 ASN A CG    1 
ATOM   1210 O OD1   . ASN A 1 159 ? -21.741 -24.001 48.406 1.00 15.00 ? 159 ASN A OD1   1 
ATOM   1211 N ND2   . ASN A 1 159 ? -22.860 -23.163 46.666 1.00 15.00 ? 159 ASN A ND2   1 
ATOM   1212 N N     . LEU A 1 160 ? -23.386 -26.710 50.810 1.00 15.00 ? 160 LEU A N     1 
ATOM   1213 C CA    . LEU A 1 160 ? -23.891 -26.377 52.148 1.00 15.00 ? 160 LEU A CA    1 
ATOM   1214 C C     . LEU A 1 160 ? -23.011 -25.246 52.697 1.00 15.00 ? 160 LEU A C     1 
ATOM   1215 O O     . LEU A 1 160 ? -21.919 -25.481 53.215 1.00 15.00 ? 160 LEU A O     1 
ATOM   1216 C CB    . LEU A 1 160 ? -23.899 -27.616 53.063 1.00 15.00 ? 160 LEU A CB    1 
ATOM   1217 C CG    . LEU A 1 160 ? -24.566 -28.916 52.576 1.00 15.00 ? 160 LEU A CG    1 
ATOM   1218 C CD1   . LEU A 1 160 ? -24.382 -30.007 53.599 1.00 15.00 ? 160 LEU A CD1   1 
ATOM   1219 C CD2   . LEU A 1 160 ? -26.041 -28.716 52.329 1.00 15.00 ? 160 LEU A CD2   1 
ATOM   1220 N N     . ASN A 1 161 ? -23.515 -24.022 52.601 1.00 15.00 ? 161 ASN A N     1 
ATOM   1221 C CA    . ASN A 1 161 ? -22.764 -22.834 53.003 1.00 15.00 ? 161 ASN A CA    1 
ATOM   1222 C C     . ASN A 1 161 ? -23.264 -22.012 54.196 1.00 15.00 ? 161 ASN A C     1 
ATOM   1223 O O     . ASN A 1 161 ? -22.549 -21.121 54.686 1.00 15.00 ? 161 ASN A O     1 
ATOM   1224 C CB    . ASN A 1 161 ? -22.568 -21.920 51.790 1.00 15.00 ? 161 ASN A CB    1 
ATOM   1225 C CG    . ASN A 1 161 ? -23.877 -21.634 51.049 1.00 15.00 ? 161 ASN A CG    1 
ATOM   1226 O OD1   . ASN A 1 161 ? -24.759 -20.947 51.553 1.00 15.00 ? 161 ASN A OD1   1 
ATOM   1227 N ND2   . ASN A 1 161 ? -24.003 -22.175 49.856 1.00 15.00 ? 161 ASN A ND2   1 
ATOM   1228 N N     . HIS A 1 162 ? -24.465 -22.316 54.679 1.00 15.00 ? 162 HIS A N     1 
ATOM   1229 C CA    . HIS A 1 162 ? -25.048 -21.573 55.793 1.00 15.00 ? 162 HIS A CA    1 
ATOM   1230 C C     . HIS A 1 162 ? -25.781 -22.497 56.777 1.00 15.00 ? 162 HIS A C     1 
ATOM   1231 O O     . HIS A 1 162 ? -26.693 -23.220 56.388 1.00 15.00 ? 162 HIS A O     1 
ATOM   1232 C CB    . HIS A 1 162 ? -25.960 -20.486 55.226 1.00 15.00 ? 162 HIS A CB    1 
ATOM   1233 C CG    . HIS A 1 162 ? -26.587 -19.595 56.253 1.00 15.00 ? 162 HIS A CG    1 
ATOM   1234 N ND1   . HIS A 1 162 ? -25.859 -18.914 57.206 1.00 15.00 ? 162 HIS A ND1   1 
ATOM   1235 C CD2   . HIS A 1 162 ? -27.873 -19.206 56.420 1.00 15.00 ? 162 HIS A CD2   1 
ATOM   1236 C CE1   . HIS A 1 162 ? -26.665 -18.140 57.905 1.00 15.00 ? 162 HIS A CE1   1 
ATOM   1237 N NE2   . HIS A 1 162 ? -27.892 -18.299 57.450 1.00 15.00 ? 162 HIS A NE2   1 
ATOM   1238 N N     . ALA A 1 163 ? -25.315 -22.549 58.020 1.00 15.00 ? 163 ALA A N     1 
ATOM   1239 C CA    . ALA A 1 163 ? -25.963 -23.374 59.048 1.00 15.00 ? 163 ALA A CA    1 
ATOM   1240 C C     . ALA A 1 163 ? -27.129 -22.568 59.620 1.00 15.00 ? 163 ALA A C     1 
ATOM   1241 O O     . ALA A 1 163 ? -26.961 -21.419 60.035 1.00 15.00 ? 163 ALA A O     1 
ATOM   1242 C CB    . ALA A 1 163 ? -24.981 -23.743 60.147 1.00 15.00 ? 163 ALA A CB    1 
ATOM   1243 N N     . VAL A 1 164 ? -28.290 -23.198 59.708 1.00 15.00 ? 164 VAL A N     1 
ATOM   1244 C CA    . VAL A 1 164 ? -29.503 -22.538 60.164 1.00 15.00 ? 164 VAL A CA    1 
ATOM   1245 C C     . VAL A 1 164 ? -30.199 -23.449 61.207 1.00 15.00 ? 164 VAL A C     1 
ATOM   1246 O O     . VAL A 1 164 ? -29.648 -24.485 61.568 1.00 15.00 ? 164 VAL A O     1 
ATOM   1247 C CB    . VAL A 1 164 ? -30.350 -22.259 58.884 1.00 15.00 ? 164 VAL A CB    1 
ATOM   1248 C CG1   . VAL A 1 164 ? -31.363 -23.347 58.631 1.00 15.00 ? 164 VAL A CG1   1 
ATOM   1249 C CG2   . VAL A 1 164 ? -30.917 -20.886 58.892 1.00 15.00 ? 164 VAL A CG2   1 
ATOM   1250 N N     . LEU A 1 165 ? -31.354 -23.057 61.743 1.00 15.00 ? 165 LEU A N     1 
ATOM   1251 C CA    . LEU A 1 165 ? -32.051 -23.899 62.724 1.00 15.00 ? 165 LEU A CA    1 
ATOM   1252 C C     . LEU A 1 165 ? -33.482 -24.250 62.308 1.00 15.00 ? 165 LEU A C     1 
ATOM   1253 O O     . LEU A 1 165 ? -34.260 -23.365 61.973 1.00 15.00 ? 165 LEU A O     1 
ATOM   1254 C CB    . LEU A 1 165 ? -32.052 -23.252 64.112 1.00 15.00 ? 165 LEU A CB    1 
ATOM   1255 C CG    . LEU A 1 165 ? -32.782 -23.962 65.262 1.00 15.00 ? 165 LEU A CG    1 
ATOM   1256 C CD1   . LEU A 1 165 ? -32.011 -25.177 65.724 1.00 15.00 ? 165 LEU A CD1   1 
ATOM   1257 C CD2   . LEU A 1 165 ? -32.973 -22.992 66.415 1.00 15.00 ? 165 LEU A CD2   1 
ATOM   1258 N N     . ALA A 1 166 ? -33.829 -25.535 62.364 1.00 15.00 ? 166 ALA A N     1 
ATOM   1259 C CA    . ALA A 1 166 ? -35.166 -26.003 61.999 1.00 15.00 ? 166 ALA A CA    1 
ATOM   1260 C C     . ALA A 1 166 ? -36.087 -26.065 63.226 1.00 15.00 ? 166 ALA A C     1 
ATOM   1261 O O     . ALA A 1 166 ? -36.077 -27.045 63.974 1.00 15.00 ? 166 ALA A O     1 
ATOM   1262 C CB    . ALA A 1 166 ? -35.078 -27.366 61.330 1.00 15.00 ? 166 ALA A CB    1 
ATOM   1263 N N     . VAL A 1 167 ? -36.919 -25.040 63.392 1.00 15.00 ? 167 VAL A N     1 
ATOM   1264 C CA    . VAL A 1 167 ? -37.819 -24.945 64.538 1.00 15.00 ? 167 VAL A CA    1 
ATOM   1265 C C     . VAL A 1 167 ? -39.227 -25.527 64.348 1.00 15.00 ? 167 VAL A C     1 
ATOM   1266 O O     . VAL A 1 167 ? -40.116 -25.324 65.178 1.00 15.00 ? 167 VAL A O     1 
ATOM   1267 C CB    . VAL A 1 167 ? -37.903 -23.482 65.054 1.00 15.00 ? 167 VAL A CB    1 
ATOM   1268 C CG1   . VAL A 1 167 ? -36.520 -22.984 65.429 1.00 15.00 ? 167 VAL A CG1   1 
ATOM   1269 C CG2   . VAL A 1 167 ? -38.520 -22.571 63.999 1.00 15.00 ? 167 VAL A CG2   1 
ATOM   1270 N N     . GLY A 1 168 ? -39.431 -26.271 63.271 1.00 15.00 ? 168 GLY A N     1 
ATOM   1271 C CA    . GLY A 1 168 ? -40.729 -26.861 63.042 1.00 15.00 ? 168 GLY A CA    1 
ATOM   1272 C C     . GLY A 1 168 ? -40.943 -27.304 61.612 1.00 15.00 ? 168 GLY A C     1 
ATOM   1273 O O     . GLY A 1 168 ? -39.999 -27.421 60.819 1.00 15.00 ? 168 GLY A O     1 
ATOM   1274 N N     . TYR A 1 169 ? -42.207 -27.550 61.294 1.00 15.00 ? 169 TYR A N     1 
ATOM   1275 C CA    . TYR A 1 169 ? -42.629 -28.002 59.978 1.00 15.00 ? 169 TYR A CA    1 
ATOM   1276 C C     . TYR A 1 169 ? -44.142 -27.910 59.906 1.00 15.00 ? 169 TYR A C     1 
ATOM   1277 O O     . TYR A 1 169 ? -44.832 -27.984 60.918 1.00 15.00 ? 169 TYR A O     1 
ATOM   1278 C CB    . TYR A 1 169 ? -42.140 -29.438 59.668 1.00 15.00 ? 169 TYR A CB    1 
ATOM   1279 C CG    . TYR A 1 169 ? -42.652 -30.539 60.593 1.00 15.00 ? 169 TYR A CG    1 
ATOM   1280 C CD1   . TYR A 1 169 ? -43.916 -31.116 60.412 1.00 15.00 ? 169 TYR A CD1   1 
ATOM   1281 C CD2   . TYR A 1 169 ? -41.864 -31.024 61.634 1.00 15.00 ? 169 TYR A CD2   1 
ATOM   1282 C CE1   . TYR A 1 169 ? -44.374 -32.151 61.247 1.00 15.00 ? 169 TYR A CE1   1 
ATOM   1283 C CE2   . TYR A 1 169 ? -42.313 -32.057 62.473 1.00 15.00 ? 169 TYR A CE2   1 
ATOM   1284 C CZ    . TYR A 1 169 ? -43.567 -32.612 62.275 1.00 15.00 ? 169 TYR A CZ    1 
ATOM   1285 O OH    . TYR A 1 169 ? -44.001 -33.613 63.109 1.00 15.00 ? 169 TYR A OH    1 
ATOM   1286 N N     . GLY A 1 170 ? -44.654 -27.781 58.697 1.00 15.00 ? 170 GLY A N     1 
ATOM   1287 C CA    . GLY A 1 170 ? -46.081 -27.683 58.513 1.00 15.00 ? 170 GLY A CA    1 
ATOM   1288 C C     . GLY A 1 170 ? -46.383 -27.730 57.038 1.00 15.00 ? 170 GLY A C     1 
ATOM   1289 O O     . GLY A 1 170 ? -45.568 -28.171 56.236 1.00 15.00 ? 170 GLY A O     1 
ATOM   1290 N N     . ILE A 1 171 ? -47.524 -27.170 56.677 1.00 15.00 ? 171 ILE A N     1 
ATOM   1291 C CA    . ILE A 1 171 ? -47.970 -27.141 55.300 1.00 15.00 ? 171 ILE A CA    1 
ATOM   1292 C C     . ILE A 1 171 ? -48.711 -25.829 55.056 1.00 15.00 ? 171 ILE A C     1 
ATOM   1293 O O     . ILE A 1 171 ? -49.506 -25.404 55.885 1.00 15.00 ? 171 ILE A O     1 
ATOM   1294 C CB    . ILE A 1 171 ? -48.866 -28.382 55.008 1.00 15.00 ? 171 ILE A CB    1 
ATOM   1295 C CG1   . ILE A 1 171 ? -49.577 -28.245 53.672 1.00 15.00 ? 171 ILE A CG1   1 
ATOM   1296 C CG2   . ILE A 1 171 ? -49.848 -28.626 56.152 1.00 15.00 ? 171 ILE A CG2   1 
ATOM   1297 C CD1   . ILE A 1 171 ? -50.272 -29.514 53.257 1.00 15.00 ? 171 ILE A CD1   1 
ATOM   1298 N N     . GLN A 1 172 ? -48.346 -25.127 53.989 1.00 15.00 ? 172 GLN A N     1 
ATOM   1299 C CA    . GLN A 1 172 ? -48.991 -23.866 53.647 1.00 15.00 ? 172 GLN A CA    1 
ATOM   1300 C C     . GLN A 1 172 ? -49.601 -23.998 52.252 1.00 15.00 ? 172 GLN A C     1 
ATOM   1301 O O     . GLN A 1 172 ? -48.882 -24.131 51.262 1.00 15.00 ? 172 GLN A O     1 
ATOM   1302 C CB    . GLN A 1 172 ? -48.012 -22.705 53.723 1.00 15.00 ? 172 GLN A CB    1 
ATOM   1303 C CG    . GLN A 1 172 ? -48.668 -21.358 53.616 1.00 15.00 ? 172 GLN A CG    1 
ATOM   1304 C CD    . GLN A 1 172 ? -47.706 -20.227 53.894 1.00 15.00 ? 172 GLN A CD    1 
ATOM   1305 O OE1   . GLN A 1 172 ? -47.354 -19.966 55.048 1.00 15.00 ? 172 GLN A OE1   1 
ATOM   1306 N NE2   . GLN A 1 172 ? -47.265 -19.549 52.838 1.00 15.00 ? 172 GLN A NE2   1 
ATOM   1307 N N     . LYS A 1 173 ? -50.930 -23.993 52.197 1.00 15.00 ? 173 LYS A N     1 
ATOM   1308 C CA    . LYS A 1 173 ? -51.681 -24.153 50.967 1.00 15.00 ? 173 LYS A CA    1 
ATOM   1309 C C     . LYS A 1 173 ? -51.150 -25.344 50.200 1.00 15.00 ? 173 LYS A C     1 
ATOM   1310 O O     . LYS A 1 173 ? -50.544 -25.193 49.139 1.00 15.00 ? 173 LYS A O     1 
ATOM   1311 C CB    . LYS A 1 173 ? -51.663 -22.885 50.101 1.00 15.00 ? 173 LYS A CB    1 
ATOM   1312 C CG    . LYS A 1 173 ? -52.377 -23.034 48.718 1.00 15.00 ? 173 LYS A CG    1 
ATOM   1313 C CD    . LYS A 1 173 ? -53.923 -23.146 48.791 1.00 15.00 ? 173 LYS A CD    1 
ATOM   1314 C CE    . LYS A 1 173 ? -54.455 -24.436 49.469 1.00 15.00 ? 173 LYS A CE    1 
ATOM   1315 N NZ    . LYS A 1 173 ? -54.103 -25.730 48.788 1.00 15.00 ? 173 LYS A NZ    1 
ATOM   1316 N N     . GLY A 1 174 ? -51.311 -26.530 50.773 1.00 15.00 ? 174 GLY A N     1 
ATOM   1317 C CA    . GLY A 1 174 ? -50.839 -27.728 50.102 1.00 15.00 ? 174 GLY A CA    1 
ATOM   1318 C C     . GLY A 1 174 ? -49.362 -27.736 49.756 1.00 15.00 ? 174 GLY A C     1 
ATOM   1319 O O     . GLY A 1 174 ? -48.950 -28.416 48.816 1.00 15.00 ? 174 GLY A O     1 
ATOM   1320 N N     . ASN A 1 175 ? -48.568 -26.970 50.504 1.00 15.00 ? 175 ASN A N     1 
ATOM   1321 C CA    . ASN A 1 175 ? -47.121 -26.899 50.300 1.00 15.00 ? 175 ASN A CA    1 
ATOM   1322 C C     . ASN A 1 175 ? -46.398 -27.184 51.611 1.00 15.00 ? 175 ASN A C     1 
ATOM   1323 O O     . ASN A 1 175 ? -46.327 -26.310 52.492 1.00 15.00 ? 175 ASN A O     1 
ATOM   1324 C CB    . ASN A 1 175 ? -46.692 -25.537 49.743 1.00 15.00 ? 175 ASN A CB    1 
ATOM   1325 C CG    . ASN A 1 175 ? -46.880 -25.431 48.236 1.00 15.00 ? 175 ASN A CG    1 
ATOM   1326 O OD1   . ASN A 1 175 ? -45.906 -25.391 47.484 1.00 15.00 ? 175 ASN A OD1   1 
ATOM   1327 N ND2   . ASN A 1 175 ? -48.129 -25.379 47.790 1.00 15.00 ? 175 ASN A ND2   1 
ATOM   1328 N N     . LYS A 1 176 ? -45.909 -28.414 51.764 1.00 15.00 ? 176 LYS A N     1 
ATOM   1329 C CA    . LYS A 1 176 ? -45.182 -28.820 52.966 1.00 15.00 ? 176 LYS A CA    1 
ATOM   1330 C C     . LYS A 1 176 ? -43.903 -27.999 53.082 1.00 15.00 ? 176 LYS A C     1 
ATOM   1331 O O     . LYS A 1 176 ? -43.340 -27.576 52.067 1.00 15.00 ? 176 LYS A O     1 
ATOM   1332 C CB    . LYS A 1 176 ? -44.884 -30.317 52.949 1.00 15.00 ? 176 LYS A CB    1 
ATOM   1333 C CG    . LYS A 1 176 ? -46.141 -31.175 52.925 1.00 15.00 ? 176 LYS A CG    1 
ATOM   1334 C CD    . LYS A 1 176 ? -45.827 -32.638 52.629 1.00 15.00 ? 176 LYS A CD    1 
ATOM   1335 C CE    . LYS A 1 176 ? -47.075 -33.512 52.736 1.00 15.00 ? 176 LYS A CE    1 
ATOM   1336 N NZ    . LYS A 1 176 ? -47.618 -33.571 54.128 1.00 15.00 ? 176 LYS A NZ    1 
ATOM   1337 N N     . HIS A 1 177 ? -43.425 -27.795 54.305 1.00 15.00 ? 177 HIS A N     1 
ATOM   1338 C CA    . HIS A 1 177 ? -42.233 -26.991 54.516 1.00 15.00 ? 177 HIS A CA    1 
ATOM   1339 C C     . HIS A 1 177 ? -41.621 -27.241 55.884 1.00 15.00 ? 177 HIS A C     1 
ATOM   1340 O O     . HIS A 1 177 ? -42.209 -27.921 56.714 1.00 15.00 ? 177 HIS A O     1 
ATOM   1341 C CB    . HIS A 1 177 ? -42.580 -25.513 54.383 1.00 15.00 ? 177 HIS A CB    1 
ATOM   1342 C CG    . HIS A 1 177 ? -43.534 -25.043 55.433 1.00 15.00 ? 177 HIS A CG    1 
ATOM   1343 N ND1   . HIS A 1 177 ? -44.870 -24.828 55.181 1.00 15.00 ? 177 HIS A ND1   1 
ATOM   1344 C CD2   . HIS A 1 177 ? -43.364 -24.827 56.759 1.00 15.00 ? 177 HIS A CD2   1 
ATOM   1345 C CE1   . HIS A 1 177 ? -45.484 -24.505 56.306 1.00 15.00 ? 177 HIS A CE1   1 
ATOM   1346 N NE2   . HIS A 1 177 ? -44.591 -24.500 57.279 1.00 15.00 ? 177 HIS A NE2   1 
ATOM   1347 N N     . TRP A 1 178 ? -40.490 -26.580 56.123 1.00 15.00 ? 178 TRP A N     1 
ATOM   1348 C CA    . TRP A 1 178 ? -39.741 -26.603 57.384 1.00 15.00 ? 178 TRP A CA    1 
ATOM   1349 C C     . TRP A 1 178 ? -39.762 -25.152 57.891 1.00 15.00 ? 178 TRP A C     1 
ATOM   1350 O O     . TRP A 1 178 ? -39.629 -24.211 57.097 1.00 15.00 ? 178 TRP A O     1 
ATOM   1351 C CB    . TRP A 1 178 ? -38.281 -27.019 57.177 1.00 15.00 ? 178 TRP A CB    1 
ATOM   1352 C CG    . TRP A 1 178 ? -38.077 -28.361 56.616 1.00 15.00 ? 178 TRP A CG    1 
ATOM   1353 C CD1   . TRP A 1 178 ? -37.823 -28.671 55.319 1.00 15.00 ? 178 TRP A CD1   1 
ATOM   1354 C CD2   . TRP A 1 178 ? -38.097 -29.595 57.335 1.00 15.00 ? 178 TRP A CD2   1 
ATOM   1355 N NE1   . TRP A 1 178 ? -37.682 -30.024 55.179 1.00 15.00 ? 178 TRP A NE1   1 
ATOM   1356 C CE2   . TRP A 1 178 ? -37.842 -30.620 56.405 1.00 15.00 ? 178 TRP A CE2   1 
ATOM   1357 C CE3   . TRP A 1 178 ? -38.303 -29.936 58.681 1.00 15.00 ? 178 TRP A CE3   1 
ATOM   1358 C CZ2   . TRP A 1 178 ? -37.788 -31.976 56.773 1.00 15.00 ? 178 TRP A CZ2   1 
ATOM   1359 C CZ3   . TRP A 1 178 ? -38.250 -31.280 59.049 1.00 15.00 ? 178 TRP A CZ3   1 
ATOM   1360 C CH2   . TRP A 1 178 ? -37.994 -32.281 58.094 1.00 15.00 ? 178 TRP A CH2   1 
ATOM   1361 N N     . ILE A 1 179 ? -39.959 -24.953 59.182 1.00 15.00 ? 179 ILE A N     1 
ATOM   1362 C CA    . ILE A 1 179 ? -39.956 -23.600 59.717 1.00 15.00 ? 179 ILE A CA    1 
ATOM   1363 C C     . ILE A 1 179 ? -38.501 -23.368 60.103 1.00 15.00 ? 179 ILE A C     1 
ATOM   1364 O O     . ILE A 1 179 ? -37.970 -24.029 60.997 1.00 15.00 ? 179 ILE A O     1 
ATOM   1365 C CB    . ILE A 1 179 ? -40.920 -23.460 60.921 1.00 15.00 ? 179 ILE A CB    1 
ATOM   1366 C CG1   . ILE A 1 179 ? -42.326 -23.907 60.504 1.00 15.00 ? 179 ILE A CG1   1 
ATOM   1367 C CG2   . ILE A 1 179 ? -40.996 -22.014 61.385 1.00 15.00 ? 179 ILE A CG2   1 
ATOM   1368 C CD1   . ILE A 1 179 ? -43.312 -23.940 61.644 1.00 15.00 ? 179 ILE A CD1   1 
ATOM   1369 N N     . ILE A 1 180 ? -37.845 -22.483 59.361 1.00 15.00 ? 180 ILE A N     1 
ATOM   1370 C CA    . ILE A 1 180 ? -36.431 -22.178 59.555 1.00 15.00 ? 180 ILE A CA    1 
ATOM   1371 C C     . ILE A 1 180 ? -36.141 -20.837 60.222 1.00 15.00 ? 180 ILE A C     1 
ATOM   1372 O O     . ILE A 1 180 ? -36.626 -19.795 59.787 1.00 15.00 ? 180 ILE A O     1 
ATOM   1373 C CB    . ILE A 1 180 ? -35.674 -22.222 58.193 1.00 15.00 ? 180 ILE A CB    1 
ATOM   1374 C CG1   . ILE A 1 180 ? -35.734 -23.627 57.584 1.00 15.00 ? 180 ILE A CG1   1 
ATOM   1375 C CG2   . ILE A 1 180 ? -34.249 -21.743 58.348 1.00 15.00 ? 180 ILE A CG2   1 
ATOM   1376 C CD1   . ILE A 1 180 ? -35.191 -24.732 58.475 1.00 15.00 ? 180 ILE A CD1   1 
ATOM   1377 N N     . LYS A 1 181 ? -35.329 -20.878 61.274 1.00 15.00 ? 181 LYS A N     1 
ATOM   1378 C CA    . LYS A 1 181 ? -34.926 -19.682 62.005 1.00 15.00 ? 181 LYS A CA    1 
ATOM   1379 C C     . LYS A 1 181 ? -33.548 -19.246 61.507 1.00 15.00 ? 181 LYS A C     1 
ATOM   1380 O O     . LYS A 1 181 ? -32.608 -20.033 61.535 1.00 15.00 ? 181 LYS A O     1 
ATOM   1381 C CB    . LYS A 1 181 ? -34.892 -19.938 63.508 1.00 15.00 ? 181 LYS A CB    1 
ATOM   1382 C CG    . LYS A 1 181 ? -34.355 -18.758 64.313 1.00 15.00 ? 181 LYS A CG    1 
ATOM   1383 C CD    . LYS A 1 181 ? -34.184 -19.107 65.773 1.00 15.00 ? 181 LYS A CD    1 
ATOM   1384 C CE    . LYS A 1 181 ? -33.683 -17.922 66.557 1.00 15.00 ? 181 LYS A CE    1 
ATOM   1385 N NZ    . LYS A 1 181 ? -33.512 -18.238 68.007 1.00 15.00 ? 181 LYS A NZ    1 
ATOM   1386 N N     . ASN A 1 182 ? -33.427 -17.999 61.067 1.00 15.00 ? 182 ASN A N     1 
ATOM   1387 C CA    . ASN A 1 182 ? -32.157 -17.488 60.565 1.00 15.00 ? 182 ASN A CA    1 
ATOM   1388 C C     . ASN A 1 182 ? -31.488 -16.533 61.558 1.00 15.00 ? 182 ASN A C     1 
ATOM   1389 O O     . ASN A 1 182 ? -32.115 -16.085 62.521 1.00 15.00 ? 182 ASN A O     1 
ATOM   1390 C CB    . ASN A 1 182 ? -32.348 -16.821 59.193 1.00 15.00 ? 182 ASN A CB    1 
ATOM   1391 C CG    . ASN A 1 182 ? -31.047 -16.689 58.411 1.00 15.00 ? 182 ASN A CG    1 
ATOM   1392 O OD1   . ASN A 1 182 ? -30.021 -17.260 58.779 1.00 15.00 ? 182 ASN A OD1   1 
ATOM   1393 N ND2   . ASN A 1 182 ? -31.094 -15.954 57.314 1.00 15.00 ? 182 ASN A ND2   1 
ATOM   1394 N N     . SER A 1 183 ? -30.198 -16.280 61.352 1.00 15.00 ? 183 SER A N     1 
ATOM   1395 C CA    . SER A 1 183 ? -29.439 -15.367 62.201 1.00 15.00 ? 183 SER A CA    1 
ATOM   1396 C C     . SER A 1 183 ? -28.934 -14.140 61.419 1.00 15.00 ? 183 SER A C     1 
ATOM   1397 O O     . SER A 1 183 ? -27.774 -13.734 61.543 1.00 15.00 ? 183 SER A O     1 
ATOM   1398 C CB    . SER A 1 183 ? -28.300 -16.093 62.930 1.00 15.00 ? 183 SER A CB    1 
ATOM   1399 O OG    . SER A 1 183 ? -27.531 -16.882 62.050 1.00 15.00 ? 183 SER A OG    1 
ATOM   1400 N N     . TRP A 1 184 ? -29.806 -13.596 60.572 1.00 15.00 ? 184 TRP A N     1 
ATOM   1401 C CA    . TRP A 1 184 ? -29.503 -12.407 59.783 1.00 15.00 ? 184 TRP A CA    1 
ATOM   1402 C C     . TRP A 1 184 ? -30.341 -11.225 60.268 1.00 15.00 ? 184 TRP A C     1 
ATOM   1403 O O     . TRP A 1 184 ? -30.586 -10.270 59.528 1.00 15.00 ? 184 TRP A O     1 
ATOM   1404 C CB    . TRP A 1 184 ? -29.712 -12.649 58.288 1.00 15.00 ? 184 TRP A CB    1 
ATOM   1405 C CG    . TRP A 1 184 ? -28.640 -13.474 57.672 1.00 15.00 ? 184 TRP A CG    1 
ATOM   1406 C CD1   . TRP A 1 184 ? -27.463 -13.864 58.251 1.00 15.00 ? 184 TRP A CD1   1 
ATOM   1407 C CD2   . TRP A 1 184 ? -28.663 -14.064 56.371 1.00 15.00 ? 184 TRP A CD2   1 
ATOM   1408 N NE1   . TRP A 1 184 ? -26.756 -14.671 57.388 1.00 15.00 ? 184 TRP A NE1   1 
ATOM   1409 C CE2   . TRP A 1 184 ? -27.472 -14.811 56.227 1.00 15.00 ? 184 TRP A CE2   1 
ATOM   1410 C CE3   . TRP A 1 184 ? -29.580 -14.038 55.311 1.00 15.00 ? 184 TRP A CE3   1 
ATOM   1411 C CZ2   . TRP A 1 184 ? -27.176 -15.534 55.064 1.00 15.00 ? 184 TRP A CZ2   1 
ATOM   1412 C CZ3   . TRP A 1 184 ? -29.285 -14.757 54.157 1.00 15.00 ? 184 TRP A CZ3   1 
ATOM   1413 C CH2   . TRP A 1 184 ? -28.091 -15.494 54.043 1.00 15.00 ? 184 TRP A CH2   1 
ATOM   1414 N N     . GLY A 1 185 ? -30.776 -11.306 61.520 1.00 15.00 ? 185 GLY A N     1 
ATOM   1415 C CA    . GLY A 1 185 ? -31.570 -10.251 62.097 1.00 15.00 ? 185 GLY A CA    1 
ATOM   1416 C C     . GLY A 1 185 ? -33.053 -10.445 61.901 1.00 15.00 ? 185 GLY A C     1 
ATOM   1417 O O     . GLY A 1 185 ? -33.496 -11.175 61.014 1.00 15.00 ? 185 GLY A O     1 
ATOM   1418 N N     . GLU A 1 186 ? -33.810 -9.757  62.747 1.00 15.00 ? 186 GLU A N     1 
ATOM   1419 C CA    . GLU A 1 186 ? -35.268 -9.783  62.745 1.00 15.00 ? 186 GLU A CA    1 
ATOM   1420 C C     . GLU A 1 186 ? -35.848 -9.106  61.496 1.00 15.00 ? 186 GLU A C     1 
ATOM   1421 O O     . GLU A 1 186 ? -36.994 -9.360  61.122 1.00 15.00 ? 186 GLU A O     1 
ATOM   1422 C CB    . GLU A 1 186 ? -35.814 -9.149  64.046 1.00 15.00 ? 186 GLU A CB    1 
ATOM   1423 C CG    . GLU A 1 186 ? -37.342 -9.124  64.179 1.00 15.00 ? 186 GLU A CG    1 
ATOM   1424 C CD    . GLU A 1 186 ? -37.840 -9.823  65.441 1.00 15.00 ? 186 GLU A CD    1 
ATOM   1425 O OE1   . GLU A 1 186 ? -37.528 -9.327  66.546 1.00 15.00 ? 186 GLU A OE1   1 
ATOM   1426 O OE2   . GLU A 1 186 ? -38.540 -10.866 65.329 1.00 15.00 ? 186 GLU A OE2   1 
ATOM   1427 N N     . ASN A 1 187 ? -35.052 -8.267  60.838 1.00 15.00 ? 187 ASN A N     1 
ATOM   1428 C CA    . ASN A 1 187 ? -35.518 -7.588  59.636 1.00 15.00 ? 187 ASN A CA    1 
ATOM   1429 C C     . ASN A 1 187 ? -35.234 -8.312  58.332 1.00 15.00 ? 187 ASN A C     1 
ATOM   1430 O O     . ASN A 1 187 ? -35.263 -7.717  57.265 1.00 15.00 ? 187 ASN A O     1 
ATOM   1431 C CB    . ASN A 1 187 ? -35.003 -6.162  59.565 1.00 15.00 ? 187 ASN A CB    1 
ATOM   1432 C CG    . ASN A 1 187 ? -36.015 -5.172  60.068 1.00 15.00 ? 187 ASN A CG    1 
ATOM   1433 O OD1   . ASN A 1 187 ? -35.905 -4.681  61.199 1.00 15.00 ? 187 ASN A OD1   1 
ATOM   1434 N ND2   . ASN A 1 187 ? -37.047 -4.900  59.252 1.00 15.00 ? 187 ASN A ND2   1 
ATOM   1435 N N     . TRP A 1 188 ? -34.937 -9.598  58.427 1.00 15.00 ? 188 TRP A N     1 
ATOM   1436 C CA    . TRP A 1 188 ? -34.677 -10.389 57.248 1.00 15.00 ? 188 TRP A CA    1 
ATOM   1437 C C     . TRP A 1 188 ? -35.816 -11.389 57.097 1.00 15.00 ? 188 TRP A C     1 
ATOM   1438 O O     . TRP A 1 188 ? -36.412 -11.807 58.092 1.00 15.00 ? 188 TRP A O     1 
ATOM   1439 C CB    . TRP A 1 188 ? -33.324 -11.098 57.332 1.00 15.00 ? 188 TRP A CB    1 
ATOM   1440 C CG    . TRP A 1 188 ? -33.115 -11.999 56.191 1.00 15.00 ? 188 TRP A CG    1 
ATOM   1441 C CD1   . TRP A 1 188 ? -32.638 -11.663 54.962 1.00 15.00 ? 188 TRP A CD1   1 
ATOM   1442 C CD2   . TRP A 1 188 ? -33.489 -13.378 56.116 1.00 15.00 ? 188 TRP A CD2   1 
ATOM   1443 N NE1   . TRP A 1 188 ? -32.707 -12.740 54.116 1.00 15.00 ? 188 TRP A NE1   1 
ATOM   1444 C CE2   . TRP A 1 188 ? -33.223 -13.810 54.799 1.00 15.00 ? 188 TRP A CE2   1 
ATOM   1445 C CE3   . TRP A 1 188 ? -34.036 -14.289 57.035 1.00 15.00 ? 188 TRP A CE3   1 
ATOM   1446 C CZ2   . TRP A 1 188 ? -33.485 -15.125 54.369 1.00 15.00 ? 188 TRP A CZ2   1 
ATOM   1447 C CZ3   . TRP A 1 188 ? -34.300 -15.600 56.605 1.00 15.00 ? 188 TRP A CZ3   1 
ATOM   1448 C CH2   . TRP A 1 188 ? -34.021 -15.999 55.285 1.00 15.00 ? 188 TRP A CH2   1 
ATOM   1449 N N     . GLY A 1 189 ? -36.112 -11.756 55.851 1.00 15.00 ? 189 GLY A N     1 
ATOM   1450 C CA    . GLY A 1 189 ? -37.164 -12.717 55.572 1.00 15.00 ? 189 GLY A CA    1 
ATOM   1451 C C     . GLY A 1 189 ? -38.431 -12.372 56.321 1.00 15.00 ? 189 GLY A C     1 
ATOM   1452 O O     . GLY A 1 189 ? -38.823 -11.201 56.395 1.00 15.00 ? 189 GLY A O     1 
ATOM   1453 N N     . ASN A 1 190 ? -39.078 -13.383 56.887 1.00 15.00 ? 190 ASN A N     1 
ATOM   1454 C CA    . ASN A 1 190 ? -40.301 -13.150 57.638 1.00 15.00 ? 190 ASN A CA    1 
ATOM   1455 C C     . ASN A 1 190 ? -40.017 -13.139 59.132 1.00 15.00 ? 190 ASN A C     1 
ATOM   1456 O O     . ASN A 1 190 ? -40.217 -14.149 59.804 1.00 15.00 ? 190 ASN A O     1 
ATOM   1457 C CB    . ASN A 1 190 ? -41.369 -14.187 57.300 1.00 15.00 ? 190 ASN A CB    1 
ATOM   1458 C CG    . ASN A 1 190 ? -42.778 -13.728 57.681 1.00 15.00 ? 190 ASN A CG    1 
ATOM   1459 O OD1   . ASN A 1 190 ? -43.758 -14.381 57.337 1.00 15.00 ? 190 ASN A OD1   1 
ATOM   1460 N ND2   . ASN A 1 190 ? -42.884 -12.593 58.369 1.00 15.00 ? 190 ASN A ND2   1 
ATOM   1461 N N     . LYS A 1 191 ? -39.565 -11.987 59.633 1.00 15.00 ? 191 LYS A N     1 
ATOM   1462 C CA    . LYS A 1 191 ? -39.225 -11.782 61.054 1.00 15.00 ? 191 LYS A CA    1 
ATOM   1463 C C     . LYS A 1 191 ? -37.978 -12.579 61.445 1.00 15.00 ? 191 LYS A C     1 
ATOM   1464 O O     . LYS A 1 191 ? -37.786 -12.951 62.613 1.00 15.00 ? 191 LYS A O     1 
ATOM   1465 C CB    . LYS A 1 191 ? -40.395 -12.114 61.994 1.00 15.00 ? 191 LYS A CB    1 
ATOM   1466 C CG    . LYS A 1 191 ? -41.620 -11.228 61.841 1.00 15.00 ? 191 LYS A CG    1 
ATOM   1467 C CD    . LYS A 1 191 ? -42.630 -11.524 62.945 1.00 15.00 ? 191 LYS A CD    1 
ATOM   1468 C CE    . LYS A 1 191 ? -43.990 -10.853 62.706 1.00 15.00 ? 191 LYS A CE    1 
ATOM   1469 N NZ    . LYS A 1 191 ? -44.939 -11.701 61.923 1.00 15.00 ? 191 LYS A NZ    1 
ATOM   1470 N N     . GLY A 1 192 ? -37.128 -12.819 60.452 1.00 15.00 ? 192 GLY A N     1 
ATOM   1471 C CA    . GLY A 1 192 ? -35.899 -13.563 60.662 1.00 15.00 ? 192 GLY A CA    1 
ATOM   1472 C C     . GLY A 1 192 ? -36.133 -15.036 60.397 1.00 15.00 ? 192 GLY A C     1 
ATOM   1473 O O     . GLY A 1 192 ? -35.287 -15.879 60.716 1.00 15.00 ? 192 GLY A O     1 
ATOM   1474 N N     . TYR A 1 193 ? -37.281 -15.336 59.798 1.00 15.00 ? 193 TYR A N     1 
ATOM   1475 C CA    . TYR A 1 193 ? -37.656 -16.702 59.490 1.00 15.00 ? 193 TYR A CA    1 
ATOM   1476 C C     . TYR A 1 193 ? -37.856 -16.934 58.007 1.00 15.00 ? 193 TYR A C     1 
ATOM   1477 O O     . TYR A 1 193 ? -37.919 -15.990 57.217 1.00 15.00 ? 193 TYR A O     1 
ATOM   1478 C CB    . TYR A 1 193 ? -38.911 -17.105 60.250 1.00 15.00 ? 193 TYR A CB    1 
ATOM   1479 C CG    . TYR A 1 193 ? -38.661 -17.455 61.683 1.00 15.00 ? 193 TYR A CG    1 
ATOM   1480 C CD1   . TYR A 1 193 ? -38.586 -16.461 62.660 1.00 15.00 ? 193 TYR A CD1   1 
ATOM   1481 C CD2   . TYR A 1 193 ? -38.477 -18.783 62.069 1.00 15.00 ? 193 TYR A CD2   1 
ATOM   1482 C CE1   . TYR A 1 193 ? -38.331 -16.781 63.982 1.00 15.00 ? 193 TYR A CE1   1 
ATOM   1483 C CE2   . TYR A 1 193 ? -38.219 -19.114 63.385 1.00 15.00 ? 193 TYR A CE2   1 
ATOM   1484 C CZ    . TYR A 1 193 ? -38.147 -18.108 64.337 1.00 15.00 ? 193 TYR A CZ    1 
ATOM   1485 O OH    . TYR A 1 193 ? -37.893 -18.431 65.643 1.00 15.00 ? 193 TYR A OH    1 
ATOM   1486 N N     . ILE A 1 194 ? -37.966 -18.202 57.646 1.00 15.00 ? 194 ILE A N     1 
ATOM   1487 C CA    . ILE A 1 194 ? -38.203 -18.604 56.276 1.00 15.00 ? 194 ILE A CA    1 
ATOM   1488 C C     . ILE A 1 194 ? -38.847 -19.998 56.280 1.00 15.00 ? 194 ILE A C     1 
ATOM   1489 O O     . ILE A 1 194 ? -38.539 -20.827 57.136 1.00 15.00 ? 194 ILE A O     1 
ATOM   1490 C CB    . ILE A 1 194 ? -36.885 -18.581 55.435 1.00 15.00 ? 194 ILE A CB    1 
ATOM   1491 C CG1   . ILE A 1 194 ? -37.155 -19.029 53.996 1.00 15.00 ? 194 ILE A CG1   1 
ATOM   1492 C CG2   . ILE A 1 194 ? -35.811 -19.441 56.076 1.00 15.00 ? 194 ILE A CG2   1 
ATOM   1493 C CD1   . ILE A 1 194 ? -36.052 -18.682 53.017 1.00 15.00 ? 194 ILE A CD1   1 
ATOM   1494 N N     . LEU A 1 195 ? -39.845 -20.195 55.425 1.00 15.00 ? 195 LEU A N     1 
ATOM   1495 C CA    . LEU A 1 195 ? -40.499 -21.491 55.304 1.00 15.00 ? 195 LEU A CA    1 
ATOM   1496 C C     . LEU A 1 195 ? -39.832 -22.088 54.086 1.00 15.00 ? 195 LEU A C     1 
ATOM   1497 O O     . LEU A 1 195 ? -39.846 -21.467 53.036 1.00 15.00 ? 195 LEU A O     1 
ATOM   1498 C CB    . LEU A 1 195 ? -41.999 -21.358 55.081 1.00 15.00 ? 195 LEU A CB    1 
ATOM   1499 C CG    . LEU A 1 195 ? -42.807 -20.657 56.165 1.00 15.00 ? 195 LEU A CG    1 
ATOM   1500 C CD1   . LEU A 1 195 ? -44.275 -20.649 55.772 1.00 15.00 ? 195 LEU A CD1   1 
ATOM   1501 C CD2   . LEU A 1 195 ? -42.604 -21.362 57.491 1.00 15.00 ? 195 LEU A CD2   1 
ATOM   1502 N N     . MET A 1 196 ? -39.170 -23.225 54.233 1.00 15.00 ? 196 MET A N     1 
ATOM   1503 C CA    . MET A 1 196 ? -38.493 -23.839 53.100 1.00 15.00 ? 196 MET A CA    1 
ATOM   1504 C C     . MET A 1 196 ? -39.170 -25.137 52.717 1.00 15.00 ? 196 MET A C     1 
ATOM   1505 O O     . MET A 1 196 ? -39.591 -25.894 53.593 1.00 15.00 ? 196 MET A O     1 
ATOM   1506 C CB    . MET A 1 196 ? -37.013 -24.076 53.392 1.00 15.00 ? 196 MET A CB    1 
ATOM   1507 C CG    . MET A 1 196 ? -36.149 -22.834 53.374 1.00 15.00 ? 196 MET A CG    1 
ATOM   1508 S SD    . MET A 1 196 ? -34.453 -23.194 53.932 1.00 15.00 ? 196 MET A SD    1 
ATOM   1509 C CE    . MET A 1 196 ? -33.630 -23.672 52.359 1.00 15.00 ? 196 MET A CE    1 
ATOM   1510 N N     . ALA A 1 197 ? -39.223 -25.410 51.414 1.00 15.00 ? 197 ALA A N     1 
ATOM   1511 C CA    . ALA A 1 197 ? -39.856 -26.620 50.867 1.00 15.00 ? 197 ALA A CA    1 
ATOM   1512 C C     . ALA A 1 197 ? -39.423 -27.928 51.526 1.00 15.00 ? 197 ALA A C     1 
ATOM   1513 O O     . ALA A 1 197 ? -38.228 -28.211 51.671 1.00 15.00 ? 197 ALA A O     1 
ATOM   1514 C CB    . ALA A 1 197 ? -39.638 -26.695 49.356 1.00 15.00 ? 197 ALA A CB    1 
ATOM   1515 N N     . ARG A 1 198 ? -40.412 -28.725 51.915 1.00 15.00 ? 198 ARG A N     1 
ATOM   1516 C CA    . ARG A 1 198 ? -40.176 -30.009 52.566 1.00 15.00 ? 198 ARG A CA    1 
ATOM   1517 C C     . ARG A 1 198 ? -40.741 -31.125 51.708 1.00 15.00 ? 198 ARG A C     1 
ATOM   1518 O O     . ARG A 1 198 ? -41.839 -31.004 51.161 1.00 15.00 ? 198 ARG A O     1 
ATOM   1519 C CB    . ARG A 1 198 ? -40.771 -30.030 53.976 1.00 15.00 ? 198 ARG A CB    1 
ATOM   1520 C CG    . ARG A 1 198 ? -40.779 -31.385 54.656 1.00 15.00 ? 198 ARG A CG    1 
ATOM   1521 C CD    . ARG A 1 198 ? -41.182 -31.276 56.121 1.00 15.00 ? 198 ARG A CD    1 
ATOM   1522 N NE    . ARG A 1 198 ? -42.524 -30.730 56.311 1.00 15.00 ? 198 ARG A NE    1 
ATOM   1523 C CZ    . ARG A 1 198 ? -43.626 -31.470 56.400 1.00 15.00 ? 198 ARG A CZ    1 
ATOM   1524 N NH1   . ARG A 1 198 ? -43.551 -32.796 56.310 1.00 15.00 ? 198 ARG A NH1   1 
ATOM   1525 N NH2   . ARG A 1 198 ? -44.801 -30.888 56.617 1.00 15.00 ? 198 ARG A NH2   1 
ATOM   1526 N N     . ASN A 1 199 ? -39.979 -32.209 51.611 1.00 15.00 ? 199 ASN A N     1 
ATOM   1527 C CA    . ASN A 1 199 ? -40.352 -33.372 50.814 1.00 15.00 ? 199 ASN A CA    1 
ATOM   1528 C C     . ASN A 1 199 ? -40.307 -33.036 49.324 1.00 15.00 ? 199 ASN A C     1 
ATOM   1529 O O     . ASN A 1 199 ? -41.178 -33.434 48.568 1.00 15.00 ? 199 ASN A O     1 
ATOM   1530 C CB    . ASN A 1 199 ? -41.724 -33.925 51.228 1.00 15.00 ? 199 ASN A CB    1 
ATOM   1531 C CG    . ASN A 1 199 ? -41.711 -34.549 52.610 1.00 15.00 ? 199 ASN A CG    1 
ATOM   1532 O OD1   . ASN A 1 199 ? -40.671 -34.601 53.263 1.00 15.00 ? 199 ASN A OD1   1 
ATOM   1533 N ND2   . ASN A 1 199 ? -42.868 -35.007 53.071 1.00 15.00 ? 199 ASN A ND2   1 
ATOM   1534 N N     . LYS A 1 200 ? -39.303 -32.267 48.924 1.00 15.00 ? 200 LYS A N     1 
ATOM   1535 C CA    . LYS A 1 200 ? -39.128 -31.883 47.537 1.00 15.00 ? 200 LYS A CA    1 
ATOM   1536 C C     . LYS A 1 200 ? -37.676 -32.171 47.162 1.00 15.00 ? 200 LYS A C     1 
ATOM   1537 O O     . LYS A 1 200 ? -36.886 -31.257 46.906 1.00 15.00 ? 200 LYS A O     1 
ATOM   1538 C CB    . LYS A 1 200 ? -39.462 -30.415 47.318 1.00 15.00 ? 200 LYS A CB    1 
ATOM   1539 C CG    . LYS A 1 200 ? -39.738 -30.065 45.865 1.00 15.00 ? 200 LYS A CG    1 
ATOM   1540 C CD    . LYS A 1 200 ? -41.237 -30.050 45.592 1.00 15.00 ? 200 LYS A CD    1 
ATOM   1541 C CE    . LYS A 1 200 ? -41.919 -28.931 46.404 1.00 15.00 ? 200 LYS A CE    1 
ATOM   1542 N NZ    . LYS A 1 200 ? -43.409 -28.843 46.208 1.00 15.00 ? 200 LYS A NZ    1 
ATOM   1543 N N     . ASN A 1 201 ? -37.339 -33.457 47.141 1.00 15.00 ? 201 ASN A N     1 
ATOM   1544 C CA    . ASN A 1 201 ? -36.000 -33.945 46.826 1.00 15.00 ? 201 ASN A CA    1 
ATOM   1545 C C     . ASN A 1 201 ? -34.839 -33.241 47.540 1.00 15.00 ? 201 ASN A C     1 
ATOM   1546 O O     . ASN A 1 201 ? -33.838 -32.883 46.920 1.00 15.00 ? 201 ASN A O     1 
ATOM   1547 C CB    . ASN A 1 201 ? -35.776 -34.022 45.311 1.00 15.00 ? 201 ASN A CB    1 
ATOM   1548 C CG    . ASN A 1 201 ? -36.185 -32.753 44.587 1.00 15.00 ? 201 ASN A CG    1 
ATOM   1549 O OD1   . ASN A 1 201 ? -37.203 -32.722 43.874 1.00 15.00 ? 201 ASN A OD1   1 
ATOM   1550 N ND2   . ASN A 1 201 ? -35.397 -31.695 44.761 1.00 15.00 ? 201 ASN A ND2   1 
ATOM   1551 N N     . ASN A 1 202 ? -34.977 -33.107 48.861 1.00 15.00 ? 202 ASN A N     1 
ATOM   1552 C CA    . ASN A 1 202 ? -33.973 -32.495 49.743 1.00 15.00 ? 202 ASN A CA    1 
ATOM   1553 C C     . ASN A 1 202 ? -33.565 -31.079 49.325 1.00 15.00 ? 202 ASN A C     1 
ATOM   1554 O O     . ASN A 1 202 ? -32.394 -30.818 49.019 1.00 15.00 ? 202 ASN A O     1 
ATOM   1555 C CB    . ASN A 1 202 ? -32.745 -33.420 49.886 1.00 15.00 ? 202 ASN A CB    1 
ATOM   1556 C CG    . ASN A 1 202 ? -31.905 -33.120 51.132 1.00 15.00 ? 202 ASN A CG    1 
ATOM   1557 O OD1   . ASN A 1 202 ? -32.360 -32.482 52.072 1.00 15.00 ? 202 ASN A OD1   1 
ATOM   1558 N ND2   . ASN A 1 202 ? -30.669 -33.597 51.134 1.00 15.00 ? 202 ASN A ND2   1 
ATOM   1559 N N     . ALA A 1 203 ? -34.512 -30.155 49.359 1.00 15.00 ? 203 ALA A N     1 
ATOM   1560 C CA    . ALA A 1 203 ? -34.336 -28.767 48.933 1.00 15.00 ? 203 ALA A CA    1 
ATOM   1561 C C     . ALA A 1 203 ? -33.145 -28.140 49.674 1.00 15.00 ? 203 ALA A C     1 
ATOM   1562 O O     . ALA A 1 203 ? -33.114 -27.979 50.890 1.00 15.00 ? 203 ALA A O     1 
ATOM   1563 C CB    . ALA A 1 203 ? -35.567 -27.931 49.272 1.00 15.00 ? 203 ALA A CB    1 
ATOM   1564 N N     . CYS A 1 204 ? -32.156 -27.738 48.861 1.00 15.00 ? 204 CYS A N     1 
ATOM   1565 C CA    . CYS A 1 204 ? -30.947 -27.059 49.312 1.00 15.00 ? 204 CYS A CA    1 
ATOM   1566 C C     . CYS A 1 204 ? -30.077 -27.849 50.285 1.00 15.00 ? 204 CYS A C     1 
ATOM   1567 O O     . CYS A 1 204 ? -29.253 -27.263 50.982 1.00 15.00 ? 204 CYS A O     1 
ATOM   1568 C CB    . CYS A 1 204 ? -31.274 -25.685 49.897 1.00 15.00 ? 204 CYS A CB    1 
ATOM   1569 S SG    . CYS A 1 204 ? -32.206 -24.523 48.836 1.00 15.00 ? 204 CYS A SG    1 
ATOM   1570 N N     . GLY A 1 205 ? -30.241 -29.168 50.316 1.00 15.00 ? 205 GLY A N     1 
ATOM   1571 C CA    . GLY A 1 205 ? -29.454 -29.993 51.221 1.00 15.00 ? 205 GLY A CA    1 
ATOM   1572 C C     . GLY A 1 205 ? -29.925 -29.888 52.661 1.00 15.00 ? 205 GLY A C     1 
ATOM   1573 O O     . GLY A 1 205 ? -29.143 -30.067 53.599 1.00 15.00 ? 205 GLY A O     1 
ATOM   1574 N N     . ILE A 1 206 ? -31.228 -29.677 52.829 1.00 15.00 ? 206 ILE A N     1 
ATOM   1575 C CA    . ILE A 1 206 ? -31.843 -29.525 54.147 1.00 15.00 ? 206 ILE A CA    1 
ATOM   1576 C C     . ILE A 1 206 ? -31.568 -30.691 55.113 1.00 15.00 ? 206 ILE A C     1 
ATOM   1577 O O     . ILE A 1 206 ? -31.386 -30.473 56.312 1.00 15.00 ? 206 ILE A O     1 
ATOM   1578 C CB    . ILE A 1 206 ? -33.386 -29.242 54.011 1.00 15.00 ? 206 ILE A CB    1 
ATOM   1579 C CG1   . ILE A 1 206 ? -33.999 -28.838 55.355 1.00 15.00 ? 206 ILE A CG1   1 
ATOM   1580 C CG2   . ILE A 1 206 ? -34.118 -30.439 53.421 1.00 15.00 ? 206 ILE A CG2   1 
ATOM   1581 C CD1   . ILE A 1 206 ? -33.664 -27.436 55.811 1.00 15.00 ? 206 ILE A CD1   1 
ATOM   1582 N N     . ALA A 1 207 ? -31.460 -31.912 54.586 1.00 15.00 ? 207 ALA A N     1 
ATOM   1583 C CA    . ALA A 1 207 ? -31.215 -33.090 55.422 1.00 15.00 ? 207 ALA A CA    1 
ATOM   1584 C C     . ALA A 1 207 ? -29.832 -33.729 55.240 1.00 15.00 ? 207 ALA A C     1 
ATOM   1585 O O     . ALA A 1 207 ? -29.581 -34.857 55.665 1.00 15.00 ? 207 ALA A O     1 
ATOM   1586 C CB    . ALA A 1 207 ? -32.317 -34.118 55.213 1.00 15.00 ? 207 ALA A CB    1 
ATOM   1587 N N     . ASN A 1 208 ? -28.916 -32.984 54.651 1.00 15.00 ? 208 ASN A N     1 
ATOM   1588 C CA    . ASN A 1 208 ? -27.576 -33.498 54.423 1.00 15.00 ? 208 ASN A CA    1 
ATOM   1589 C C     . ASN A 1 208 ? -26.682 -33.444 55.654 1.00 15.00 ? 208 ASN A C     1 
ATOM   1590 O O     . ASN A 1 208 ? -25.800 -34.294 55.815 1.00 15.00 ? 208 ASN A O     1 
ATOM   1591 C CB    . ASN A 1 208 ? -26.909 -32.786 53.249 1.00 15.00 ? 208 ASN A CB    1 
ATOM   1592 C CG    . ASN A 1 208 ? -27.228 -33.428 51.921 1.00 15.00 ? 208 ASN A CG    1 
ATOM   1593 O OD1   . ASN A 1 208 ? -27.611 -34.592 51.862 1.00 15.00 ? 208 ASN A OD1   1 
ATOM   1594 N ND2   . ASN A 1 208 ? -27.063 -32.672 50.841 1.00 15.00 ? 208 ASN A ND2   1 
ATOM   1595 N N     . LEU A 1 209 ? -26.910 -32.456 56.520 1.00 15.00 ? 209 LEU A N     1 
ATOM   1596 C CA    . LEU A 1 209 ? -26.089 -32.292 57.715 1.00 15.00 ? 209 LEU A CA    1 
ATOM   1597 C C     . LEU A 1 209 ? -26.857 -31.908 58.988 1.00 15.00 ? 209 LEU A C     1 
ATOM   1598 O O     . LEU A 1 209 ? -26.416 -31.038 59.744 1.00 15.00 ? 209 LEU A O     1 
ATOM   1599 C CB    . LEU A 1 209 ? -24.961 -31.295 57.439 1.00 15.00 ? 209 LEU A CB    1 
ATOM   1600 C CG    . LEU A 1 209 ? -23.701 -31.437 58.295 1.00 15.00 ? 209 LEU A CG    1 
ATOM   1601 C CD1   . LEU A 1 209 ? -22.812 -32.534 57.748 1.00 15.00 ? 209 LEU A CD1   1 
ATOM   1602 C CD2   . LEU A 1 209 ? -22.954 -30.120 58.325 1.00 15.00 ? 209 LEU A CD2   1 
ATOM   1603 N N     . ALA A 1 210 ? -27.987 -32.560 59.234 1.00 15.00 ? 210 ALA A N     1 
ATOM   1604 C CA    . ALA A 1 210 ? -28.782 -32.248 60.422 1.00 15.00 ? 210 ALA A CA    1 
ATOM   1605 C C     . ALA A 1 210 ? -28.239 -33.026 61.631 1.00 15.00 ? 210 ALA A C     1 
ATOM   1606 O O     . ALA A 1 210 ? -27.873 -34.195 61.511 1.00 15.00 ? 210 ALA A O     1 
ATOM   1607 C CB    . ALA A 1 210 ? -30.237 -32.669 60.233 1.00 15.00 ? 210 ALA A CB    1 
ATOM   1608 N N     . SER A 1 211 ? -28.167 -32.354 62.783 1.00 15.00 ? 211 SER A N     1 
ATOM   1609 C CA    . SER A 1 211 ? -27.711 -32.985 64.027 1.00 15.00 ? 211 SER A CA    1 
ATOM   1610 C C     . SER A 1 211 ? -28.325 -32.281 65.236 1.00 15.00 ? 211 SER A C     1 
ATOM   1611 O O     . SER A 1 211 ? -28.931 -31.204 65.111 1.00 15.00 ? 211 SER A O     1 
ATOM   1612 C CB    . SER A 1 211 ? -26.186 -33.012 64.147 1.00 15.00 ? 211 SER A CB    1 
ATOM   1613 O OG    . SER A 1 211 ? -25.651 -31.708 64.288 1.00 15.00 ? 211 SER A OG    1 
ATOM   1614 N N     . PHE A 1 212 ? -28.184 -32.889 66.407 1.00 15.00 ? 212 PHE A N     1 
ATOM   1615 C CA    . PHE A 1 212 ? -28.738 -32.304 67.615 1.00 15.00 ? 212 PHE A CA    1 
ATOM   1616 C C     . PHE A 1 212 ? -28.012 -32.782 68.872 1.00 15.00 ? 212 PHE A C     1 
ATOM   1617 O O     . PHE A 1 212 ? -27.552 -33.936 68.954 1.00 15.00 ? 212 PHE A O     1 
ATOM   1618 C CB    . PHE A 1 212 ? -30.252 -32.556 67.708 1.00 15.00 ? 212 PHE A CB    1 
ATOM   1619 C CG    . PHE A 1 212 ? -30.617 -34.002 67.789 1.00 15.00 ? 212 PHE A CG    1 
ATOM   1620 C CD1   . PHE A 1 212 ? -30.527 -34.689 68.995 1.00 15.00 ? 212 PHE A CD1   1 
ATOM   1621 C CD2   . PHE A 1 212 ? -31.038 -34.687 66.658 1.00 15.00 ? 212 PHE A CD2   1 
ATOM   1622 C CE1   . PHE A 1 212 ? -30.846 -36.039 69.071 1.00 15.00 ? 212 PHE A CE1   1 
ATOM   1623 C CE2   . PHE A 1 212 ? -31.359 -36.034 66.728 1.00 15.00 ? 212 PHE A CE2   1 
ATOM   1624 C CZ    . PHE A 1 212 ? -31.265 -36.709 67.935 1.00 15.00 ? 212 PHE A CZ    1 
ATOM   1625 N N     . PRO A 1 213 ? -27.924 -31.905 69.882 1.00 15.00 ? 213 PRO A N     1 
ATOM   1626 C CA    . PRO A 1 213 ? -27.252 -32.247 71.127 1.00 15.00 ? 213 PRO A CA    1 
ATOM   1627 C C     . PRO A 1 213 ? -28.127 -33.174 71.959 1.00 15.00 ? 213 PRO A C     1 
ATOM   1628 O O     . PRO A 1 213 ? -29.358 -33.230 71.786 1.00 15.00 ? 213 PRO A O     1 
ATOM   1629 C CB    . PRO A 1 213 ? -27.112 -30.893 71.800 1.00 15.00 ? 213 PRO A CB    1 
ATOM   1630 C CG    . PRO A 1 213 ? -28.436 -30.259 71.469 1.00 15.00 ? 213 PRO A CG    1 
ATOM   1631 C CD    . PRO A 1 213 ? -28.599 -30.597 69.994 1.00 15.00 ? 213 PRO A CD    1 
ATOM   1632 N N     . LYS A 1 214 ? -27.480 -33.936 72.824 1.00 15.00 ? 214 LYS A N     1 
ATOM   1633 C CA    . LYS A 1 214 ? -28.186 -34.824 73.718 1.00 15.00 ? 214 LYS A CA    1 
ATOM   1634 C C     . LYS A 1 214 ? -27.838 -34.257 75.073 1.00 15.00 ? 214 LYS A C     1 
ATOM   1635 O O     . LYS A 1 214 ? -26.756 -33.709 75.239 1.00 15.00 ? 214 LYS A O     1 
ATOM   1636 C CB    . LYS A 1 214 ? -27.709 -36.271 73.595 1.00 15.00 ? 214 LYS A CB    1 
ATOM   1637 C CG    . LYS A 1 214 ? -27.915 -36.898 72.227 1.00 15.00 ? 214 LYS A CG    1 
ATOM   1638 C CD    . LYS A 1 214 ? -27.276 -38.290 72.158 1.00 15.00 ? 214 LYS A CD    1 
ATOM   1639 C CE    . LYS A 1 214 ? -25.787 -38.268 72.503 1.00 15.00 ? 214 LYS A CE    1 
ATOM   1640 N NZ    . LYS A 1 214 ? -25.114 -39.563 72.183 1.00 15.00 ? 214 LYS A NZ    1 
ATOM   1641 N N     . MET A 1 215 ? -28.791 -34.266 75.993 1.00 15.00 ? 215 MET A N     1 
ATOM   1642 C CA    . MET A 1 215 ? -28.546 -33.776 77.342 1.00 15.00 ? 215 MET A CA    1 
ATOM   1643 C C     . MET A 1 215 ? -28.660 -34.931 78.345 1.00 15.00 ? 215 MET A C     1 
ATOM   1644 O O     . MET A 1 215 ? -27.810 -35.005 79.257 1.00 15.00 ? 215 MET A O     1 
ATOM   1645 C CB    . MET A 1 215 ? -29.466 -32.598 77.704 1.00 15.00 ? 215 MET A CB    1 
ATOM   1646 C CG    . MET A 1 215 ? -29.119 -31.300 76.958 1.00 15.00 ? 215 MET A CG    1 
ATOM   1647 S SD    . MET A 1 215 ? -29.588 -29.735 77.803 1.00 15.00 ? 215 MET A SD    1 
ATOM   1648 C CE    . MET A 1 215 ? -28.677 -28.542 76.806 1.00 15.00 ? 215 MET A CE    1 
ATOM   1649 O OXT   . MET A 1 215 ? -29.544 -35.797 78.162 1.00 15.00 ? 215 MET A OXT   1 
HETATM 1650 C C1    . IN6 B 2 .   ? -28.495 -9.523  55.701 1.00 15.00 ? 300 IN6 A C1    1 
HETATM 1651 C C2    . IN6 B 2 .   ? -28.629 -9.334  57.084 1.00 15.00 ? 300 IN6 A C2    1 
HETATM 1652 C C3    . IN6 B 2 .   ? -27.556 -9.627  57.939 1.00 15.00 ? 300 IN6 A C3    1 
HETATM 1653 C C4    . IN6 B 2 .   ? -26.351 -10.105 57.430 1.00 15.00 ? 300 IN6 A C4    1 
HETATM 1654 C C5    . IN6 B 2 .   ? -26.228 -10.288 56.052 1.00 15.00 ? 300 IN6 A C5    1 
HETATM 1655 C C6    . IN6 B 2 .   ? -27.290 -10.001 55.185 1.00 15.00 ? 300 IN6 A C6    1 
HETATM 1656 C C7    . IN6 B 2 .   ? -25.200 -10.405 58.348 1.00 15.00 ? 300 IN6 A C7    1 
HETATM 1657 O O8    . IN6 B 2 .   ? -24.727 -11.765 58.361 1.00 15.00 ? 300 IN6 A O8    1 
HETATM 1658 C C9    . IN6 B 2 .   ? -24.031 -12.420 57.297 1.00 15.00 ? 300 IN6 A C9    1 
HETATM 1659 O O10   . IN6 B 2 .   ? -24.330 -12.231 56.098 1.00 15.00 ? 300 IN6 A O10   1 
HETATM 1660 C C11   . IN6 B 2 .   ? -22.266 -14.013 56.705 1.00 15.00 ? 300 IN6 A C11   1 
HETATM 1661 C C12   . IN6 B 2 .   ? -20.775 -13.625 56.802 1.00 15.00 ? 300 IN6 A C12   1 
HETATM 1662 C C14   . IN6 B 2 .   ? -20.177 -12.602 55.816 1.00 15.00 ? 300 IN6 A C14   1 
HETATM 1663 C C15   . IN6 B 2 .   ? -19.006 -11.829 56.472 1.00 15.00 ? 300 IN6 A C15   1 
HETATM 1664 C C16   . IN6 B 2 .   ? -21.222 -11.635 55.226 1.00 15.00 ? 300 IN6 A C16   1 
HETATM 1665 C C17   . IN6 B 2 .   ? -22.498 -15.590 56.800 1.00 15.00 ? 300 IN6 A C17   1 
HETATM 1666 S S18   . IN6 B 2 .   ? -23.784 -16.315 55.923 1.00 15.00 ? 300 IN6 A S18   1 
HETATM 1667 N N19   . IN6 B 2 .   ? -21.796 -16.549 57.498 1.00 15.00 ? 300 IN6 A N19   1 
HETATM 1668 C C20   . IN6 B 2 .   ? -22.208 -17.872 57.393 1.00 15.00 ? 300 IN6 A C20   1 
HETATM 1669 N N24   . IN6 B 2 .   ? -23.054 -13.250 57.681 1.00 15.00 ? 300 IN6 A N24   1 
HETATM 1670 C C42   . IN6 B 2 .   ? -23.274 -17.877 56.551 1.00 15.00 ? 300 IN6 A C42   1 
HETATM 1671 C C21   . IN6 B 2 .   ? -21.576 -19.104 58.242 1.00 15.00 ? 300 IN6 A C21   1 
HETATM 1672 O O22   . IN6 B 2 .   ? -21.372 -18.386 59.169 1.00 15.00 ? 300 IN6 A O22   1 
HETATM 1673 C "C1'" . IN6 B 2 .   ? -13.785 -23.508 54.959 1.00 15.00 ? 300 IN6 A "C1'" 1 
HETATM 1674 C "C2'" . IN6 B 2 .   ? -14.232 -22.838 56.077 1.00 15.00 ? 300 IN6 A "C2'" 1 
HETATM 1675 C "C3'" . IN6 B 2 .   ? -14.833 -23.544 57.118 1.00 15.00 ? 300 IN6 A "C3'" 1 
HETATM 1676 C "C4'" . IN6 B 2 .   ? -14.998 -24.929 57.042 1.00 15.00 ? 300 IN6 A "C4'" 1 
HETATM 1677 C "C5'" . IN6 B 2 .   ? -14.535 -25.604 55.908 1.00 15.00 ? 300 IN6 A "C5'" 1 
HETATM 1678 C "C6'" . IN6 B 2 .   ? -13.935 -24.901 54.866 1.00 15.00 ? 300 IN6 A "C6'" 1 
HETATM 1679 C "C7'" . IN6 B 2 .   ? -15.723 -25.671 58.137 1.00 15.00 ? 300 IN6 A "C7'" 1 
HETATM 1680 O "O8'" . IN6 B 2 .   ? -17.102 -25.930 57.709 1.00 15.00 ? 300 IN6 A "O8'" 1 
HETATM 1681 C "C9'" . IN6 B 2 .   ? -17.910 -25.028 56.962 1.00 15.00 ? 300 IN6 A "C9'" 1 
HETATM 1682 O "OA'" . IN6 B 2 .   ? -17.690 -24.810 55.772 1.00 15.00 ? 300 IN6 A "OA'" 1 
HETATM 1683 C "CB'" . IN6 B 2 .   ? -19.822 -23.492 57.000 1.00 15.00 ? 300 IN6 A "CB'" 1 
HETATM 1684 C "CC'" . IN6 B 2 .   ? -21.217 -24.118 56.838 1.00 15.00 ? 300 IN6 A "CC'" 1 
HETATM 1685 C "CE'" . IN6 B 2 .   ? -21.919 -24.887 57.968 1.00 15.00 ? 300 IN6 A "CE'" 1 
HETATM 1686 C "CF'" . IN6 B 2 .   ? -21.435 -26.307 58.121 1.00 15.00 ? 300 IN6 A "CF'" 1 
HETATM 1687 C "CG'" . IN6 B 2 .   ? -21.865 -24.153 59.287 1.00 15.00 ? 300 IN6 A "CG'" 1 
HETATM 1688 C "CH'" . IN6 B 2 .   ? -19.867 -22.149 57.760 1.00 15.00 ? 300 IN6 A "CH'" 1 
HETATM 1689 O "OI'" . IN6 B 2 .   ? -19.604 -22.125 58.962 1.00 15.00 ? 300 IN6 A "OI'" 1 
HETATM 1690 N "NJ'" . IN6 B 2 .   ? -20.182 -20.996 57.082 1.00 15.00 ? 300 IN6 A "NJ'" 1 
HETATM 1691 N "NK'" . IN6 B 2 .   ? -20.198 -19.648 57.780 1.00 15.00 ? 300 IN6 A "NK'" 1 
HETATM 1692 N "NO'" . IN6 B 2 .   ? -18.904 -24.443 57.633 1.00 15.00 ? 300 IN6 A "NO'" 1 
HETATM 1693 O O     . HOH C 3 .   ? -40.323 -20.861 90.404 1.00 15.00 ? 301 HOH A O     1 
HETATM 1694 O O     . HOH C 3 .   ? -20.710 -32.430 79.674 1.00 15.00 ? 302 HOH A O     1 
HETATM 1695 O O     . HOH C 3 .   ? -31.327 -16.381 65.471 1.00 15.00 ? 303 HOH A O     1 
HETATM 1696 O O     . HOH C 3 .   ? -29.762 -17.627 70.422 1.00 15.00 ? 304 HOH A O     1 
HETATM 1697 O O     . HOH C 3 .   ? -7.134  -18.395 66.476 1.00 15.00 ? 305 HOH A O     1 
HETATM 1698 O O     . HOH C 3 .   ? -15.447 -12.549 73.007 1.00 15.00 ? 306 HOH A O     1 
HETATM 1699 O O     . HOH C 3 .   ? -34.688 -23.231 69.943 1.00 15.00 ? 307 HOH A O     1 
HETATM 1700 O O     . HOH C 3 .   ? -11.029 -30.641 72.739 1.00 15.00 ? 308 HOH A O     1 
HETATM 1701 O O     . HOH C 3 .   ? -30.921 -18.334 68.201 1.00 15.00 ? 309 HOH A O     1 
HETATM 1702 O O     . HOH C 3 .   ? -24.491 -30.793 61.593 1.00 15.00 ? 310 HOH A O     1 
HETATM 1703 O O     . HOH C 3 .   ? -15.062 -10.946 61.611 1.00 15.00 ? 311 HOH A O     1 
HETATM 1704 O O     . HOH C 3 .   ? -14.144 -21.835 66.382 1.00 15.00 ? 312 HOH A O     1 
HETATM 1705 O O     . HOH C 3 .   ? -45.456 -29.938 49.492 1.00 15.00 ? 313 HOH A O     1 
HETATM 1706 O O     . HOH C 3 .   ? -45.528 -34.977 55.748 1.00 15.00 ? 314 HOH A O     1 
HETATM 1707 O O     . HOH C 3 .   ? -37.467 -12.356 67.536 1.00 15.00 ? 315 HOH A O     1 
HETATM 1708 O O     . HOH C 3 .   ? -32.593 -13.973 60.213 1.00 15.00 ? 316 HOH A O     1 
HETATM 1709 O O     . HOH C 3 .   ? -23.453 -33.514 51.763 1.00 15.00 ? 317 HOH A O     1 
HETATM 1710 O O     . HOH C 3 .   ? -9.945  -25.407 63.342 1.00 15.00 ? 318 HOH A O     1 
HETATM 1711 O O     . HOH C 3 .   ? -57.825 -31.910 39.283 1.00 15.00 ? 319 HOH A O     1 
HETATM 1712 O O     . HOH C 3 .   ? -30.046 -20.104 63.450 1.00 15.00 ? 320 HOH A O     1 
HETATM 1713 O O     . HOH C 3 .   ? -22.110 -29.914 61.970 1.00 15.00 ? 321 HOH A O     1 
HETATM 1714 O O     . HOH C 3 .   ? -26.542 -11.159 68.266 1.00 15.00 ? 322 HOH A O     1 
HETATM 1715 O O     . HOH C 3 .   ? -28.192 -16.143 71.941 1.00 15.00 ? 323 HOH A O     1 
HETATM 1716 O O     . HOH C 3 .   ? -26.075 -26.033 83.657 1.00 15.00 ? 324 HOH A O     1 
HETATM 1717 O O     . HOH C 3 .   ? -35.837 -27.158 51.258 1.00 15.00 ? 325 HOH A O     1 
HETATM 1718 O O     . HOH C 3 .   ? -35.661 -24.801 49.570 1.00 15.00 ? 326 HOH A O     1 
HETATM 1719 O O     . HOH C 3 .   ? -46.960 -32.652 56.912 1.00 15.00 ? 327 HOH A O     1 
HETATM 1720 O O     . HOH C 3 .   ? -25.393 -9.003  77.824 1.00 15.00 ? 328 HOH A O     1 
HETATM 1721 O O     . HOH C 3 .   ? -41.607 -14.847 64.384 1.00 15.00 ? 329 HOH A O     1 
HETATM 1722 O O     . HOH C 3 .   ? -18.393 -3.012  63.149 1.00 15.00 ? 330 HOH A O     1 
HETATM 1723 O O     . HOH C 3 .   ? -33.492 -28.512 70.465 1.00 15.00 ? 331 HOH A O     1 
HETATM 1724 O O     . HOH C 3 .   ? -48.240 -19.584 79.274 1.00 15.00 ? 332 HOH A O     1 
HETATM 1725 O O     . HOH C 3 .   ? -17.158 -11.079 74.860 1.00 15.00 ? 333 HOH A O     1 
HETATM 1726 O O     . HOH C 3 .   ? -7.766  -18.993 72.853 1.00 15.00 ? 334 HOH A O     1 
HETATM 1727 O O     . HOH C 3 .   ? -12.496 -24.634 81.877 1.00 15.00 ? 335 HOH A O     1 
HETATM 1728 O O     . HOH C 3 .   ? -28.112 -35.312 58.105 1.00 15.00 ? 336 HOH A O     1 
HETATM 1729 O O     . HOH C 3 .   ? -35.244 -11.033 53.389 1.00 15.00 ? 337 HOH A O     1 
HETATM 1730 O O     . HOH C 3 .   ? -31.850 -28.951 46.177 1.00 15.00 ? 338 HOH A O     1 
HETATM 1731 O O     . HOH C 3 .   ? -35.109 -24.974 46.752 1.00 15.00 ? 339 HOH A O     1 
HETATM 1732 O O     . HOH C 3 .   ? -42.460 -38.442 54.366 1.00 15.00 ? 340 HOH A O     1 
HETATM 1733 O O     . HOH C 3 .   ? -37.822 -16.401 67.585 1.00 15.00 ? 341 HOH A O     1 
HETATM 1734 O O     . HOH C 3 .   ? -43.112 -16.231 66.452 1.00 15.00 ? 342 HOH A O     1 
HETATM 1735 O O     . HOH C 3 .   ? -36.788 -9.695  73.691 1.00 15.00 ? 343 HOH A O     1 
HETATM 1736 O O     . HOH C 3 .   ? -34.916 -15.404 75.946 1.00 15.00 ? 344 HOH A O     1 
HETATM 1737 O O     . HOH C 3 .   ? -32.030 -7.391  60.295 1.00 15.00 ? 345 HOH A O     1 
HETATM 1738 O O     . HOH C 3 .   ? -19.938 -8.074  62.812 1.00 15.00 ? 346 HOH A O     1 
HETATM 1739 O O     . HOH C 3 .   ? -33.787 -20.761 69.683 1.00 15.00 ? 347 HOH A O     1 
HETATM 1740 O O     . HOH C 3 .   ? -33.864 -45.025 74.422 1.00 15.00 ? 348 HOH A O     1 
HETATM 1741 O O     . HOH C 3 .   ? -11.975 -27.020 71.078 1.00 15.00 ? 349 HOH A O     1 
HETATM 1742 O O     . HOH C 3 .   ? -8.263  -25.332 61.282 1.00 15.00 ? 350 HOH A O     1 
HETATM 1743 O O     . HOH C 3 .   ? -19.533 -42.276 58.815 1.00 15.00 ? 351 HOH A O     1 
HETATM 1744 O O     . HOH C 3 .   ? -20.677 -32.752 61.189 1.00 15.00 ? 352 HOH A O     1 
HETATM 1745 O O     . HOH C 3 .   ? -24.870 -33.889 60.621 1.00 15.00 ? 353 HOH A O     1 
HETATM 1746 O O     . HOH C 3 .   ? -2.834  -32.790 71.846 1.00 15.00 ? 354 HOH A O     1 
HETATM 1747 O O     . HOH C 3 .   ? -14.432 -40.522 59.533 1.00 15.00 ? 355 HOH A O     1 
HETATM 1748 O O     . HOH C 3 .   ? -21.463 -37.413 78.349 1.00 15.00 ? 356 HOH A O     1 
HETATM 1749 O O     . HOH C 3 .   ? -19.792 -36.028 71.332 1.00 15.00 ? 357 HOH A O     1 
HETATM 1750 O O     . HOH C 3 .   ? -28.572 -35.404 88.702 1.00 15.00 ? 358 HOH A O     1 
HETATM 1751 O O     . HOH C 3 .   ? -13.042 -12.016 63.255 1.00 15.00 ? 359 HOH A O     1 
HETATM 1752 O O     . HOH C 3 .   ? -8.635  -11.886 72.804 1.00 15.00 ? 360 HOH A O     1 
HETATM 1753 O O     . HOH C 3 .   ? -28.584 -30.125 56.411 1.00 15.00 ? 361 HOH A O     1 
HETATM 1754 O O     . HOH C 3 .   ? -29.856 -20.692 48.272 1.00 15.00 ? 362 HOH A O     1 
HETATM 1755 O O     . HOH C 3 .   ? -26.770 -22.944 44.374 1.00 15.00 ? 363 HOH A O     1 
HETATM 1756 O O     . HOH C 3 .   ? -25.171 -36.240 49.676 1.00 15.00 ? 364 HOH A O     1 
HETATM 1757 O O     . HOH C 3 .   ? -19.398 -31.569 49.995 1.00 15.00 ? 365 HOH A O     1 
HETATM 1758 O O     . HOH C 3 .   ? -34.946 -29.419 45.519 1.00 15.00 ? 366 HOH A O     1 
HETATM 1759 O O     . HOH C 3 .   ? -37.688 -30.425 50.514 1.00 15.00 ? 367 HOH A O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ALA 1   1   1   ALA ALA A . n 
A 1 2   PRO 2   2   2   PRO PRO A . n 
A 1 3   ASP 3   3   3   ASP ASP A . n 
A 1 4   SER 4   4   4   SER SER A . n 
A 1 5   VAL 5   5   5   VAL VAL A . n 
A 1 6   ASP 6   6   6   ASP ASP A . n 
A 1 7   TYR 7   7   7   TYR TYR A . n 
A 1 8   ARG 8   8   8   ARG ARG A . n 
A 1 9   LYS 9   9   9   LYS LYS A . n 
A 1 10  LYS 10  10  10  LYS LYS A . n 
A 1 11  GLY 11  11  11  GLY GLY A . n 
A 1 12  TYR 12  12  12  TYR TYR A . n 
A 1 13  VAL 13  13  13  VAL VAL A . n 
A 1 14  THR 14  14  14  THR THR A . n 
A 1 15  PRO 15  15  15  PRO PRO A . n 
A 1 16  VAL 16  16  16  VAL VAL A . n 
A 1 17  LYS 17  17  17  LYS LYS A . n 
A 1 18  ASN 18  18  18  ASN ASN A . n 
A 1 19  GLN 19  19  19  GLN GLN A . n 
A 1 20  GLY 20  20  20  GLY GLY A . n 
A 1 21  GLN 21  21  21  GLN GLN A . n 
A 1 22  CYS 22  22  22  CYS CYS A . n 
A 1 23  GLY 23  23  23  GLY GLY A . n 
A 1 24  SER 24  24  24  SER SER A . n 
A 1 25  CYS 25  25  25  CYS CYS A . n 
A 1 26  TRP 26  26  26  TRP TRP A . n 
A 1 27  ALA 27  27  27  ALA ALA A . n 
A 1 28  PHE 28  28  28  PHE PHE A . n 
A 1 29  SER 29  29  29  SER SER A . n 
A 1 30  SER 30  30  30  SER SER A . n 
A 1 31  VAL 31  31  31  VAL VAL A . n 
A 1 32  GLY 32  32  32  GLY GLY A . n 
A 1 33  ALA 33  33  33  ALA ALA A . n 
A 1 34  LEU 34  34  34  LEU LEU A . n 
A 1 35  GLU 35  35  35  GLU GLU A . n 
A 1 36  GLY 36  36  36  GLY GLY A . n 
A 1 37  GLN 37  37  37  GLN GLN A . n 
A 1 38  LEU 38  38  38  LEU LEU A . n 
A 1 39  LYS 39  39  39  LYS LYS A . n 
A 1 40  LYS 40  40  40  LYS LYS A . n 
A 1 41  LYS 41  41  41  LYS LYS A . n 
A 1 42  THR 42  42  42  THR THR A . n 
A 1 43  GLY 43  43  43  GLY GLY A . n 
A 1 44  LYS 44  44  44  LYS LYS A . n 
A 1 45  LEU 45  45  45  LEU LEU A . n 
A 1 46  LEU 46  46  46  LEU LEU A . n 
A 1 47  ASN 47  47  47  ASN ASN A . n 
A 1 48  LEU 48  48  48  LEU LEU A . n 
A 1 49  SER 49  49  49  SER SER A . n 
A 1 50  PRO 50  50  50  PRO PRO A . n 
A 1 51  GLN 51  51  51  GLN GLN A . n 
A 1 52  ASN 52  52  52  ASN ASN A . n 
A 1 53  LEU 53  53  53  LEU LEU A . n 
A 1 54  VAL 54  54  54  VAL VAL A . n 
A 1 55  ASP 55  55  55  ASP ASP A . n 
A 1 56  CYS 56  56  56  CYS CYS A . n 
A 1 57  VAL 57  57  57  VAL VAL A . n 
A 1 58  SER 58  58  58  SER SER A . n 
A 1 59  GLU 59  59  59  GLU GLU A . n 
A 1 60  ASN 60  60  60  ASN ASN A . n 
A 1 61  ASP 61  61  61  ASP ASP A . n 
A 1 62  GLY 62  62  62  GLY GLY A . n 
A 1 63  CYS 63  63  63  CYS CYS A . n 
A 1 64  GLY 64  64  64  GLY GLY A . n 
A 1 65  GLY 65  65  65  GLY GLY A . n 
A 1 66  GLY 66  66  66  GLY GLY A . n 
A 1 67  TYR 67  67  67  TYR TYR A . n 
A 1 68  MET 68  68  68  MET MET A . n 
A 1 69  THR 69  69  69  THR THR A . n 
A 1 70  ASN 70  70  70  ASN ASN A . n 
A 1 71  ALA 71  71  71  ALA ALA A . n 
A 1 72  PHE 72  72  72  PHE PHE A . n 
A 1 73  GLN 73  73  73  GLN GLN A . n 
A 1 74  TYR 74  74  74  TYR TYR A . n 
A 1 75  VAL 75  75  75  VAL VAL A . n 
A 1 76  GLN 76  76  76  GLN GLN A . n 
A 1 77  LYS 77  77  77  LYS LYS A . n 
A 1 78  ASN 78  78  78  ASN ASN A . n 
A 1 79  ARG 79  79  79  ARG ARG A . n 
A 1 80  GLY 80  80  80  GLY GLY A . n 
A 1 81  ILE 81  81  81  ILE ILE A . n 
A 1 82  ASP 82  82  82  ASP ASP A . n 
A 1 83  SER 83  83  83  SER SER A . n 
A 1 84  GLU 84  84  84  GLU GLU A . n 
A 1 85  ASP 85  85  85  ASP ASP A . n 
A 1 86  ALA 86  86  86  ALA ALA A . n 
A 1 87  TYR 87  87  87  TYR TYR A . n 
A 1 88  PRO 88  88  88  PRO PRO A . n 
A 1 89  TYR 89  89  89  TYR TYR A . n 
A 1 90  VAL 90  90  90  VAL VAL A . n 
A 1 91  GLY 91  91  91  GLY GLY A . n 
A 1 92  GLN 92  92  92  GLN GLN A . n 
A 1 93  GLU 93  93  93  GLU GLU A . n 
A 1 94  GLU 94  94  94  GLU GLU A . n 
A 1 95  SER 95  95  95  SER SER A . n 
A 1 96  CYS 96  96  96  CYS CYS A . n 
A 1 97  MET 97  97  97  MET MET A . n 
A 1 98  TYR 98  98  98  TYR TYR A . n 
A 1 99  ASN 99  99  99  ASN ASN A . n 
A 1 100 PRO 100 100 100 PRO PRO A . n 
A 1 101 THR 101 101 101 THR THR A . n 
A 1 102 GLY 102 102 102 GLY GLY A . n 
A 1 103 LYS 103 103 103 LYS LYS A . n 
A 1 104 ALA 104 104 104 ALA ALA A . n 
A 1 105 ALA 105 105 105 ALA ALA A . n 
A 1 106 LYS 106 106 106 LYS LYS A . n 
A 1 107 CYS 107 107 107 CYS CYS A . n 
A 1 108 ARG 108 108 108 ARG ARG A . n 
A 1 109 GLY 109 109 109 GLY GLY A . n 
A 1 110 TYR 110 110 110 TYR TYR A . n 
A 1 111 ARG 111 111 111 ARG ARG A . n 
A 1 112 GLU 112 112 112 GLU GLU A . n 
A 1 113 ILE 113 113 113 ILE ILE A . n 
A 1 114 PRO 114 114 114 PRO PRO A . n 
A 1 115 GLU 115 115 115 GLU GLU A . n 
A 1 116 GLY 116 116 116 GLY GLY A . n 
A 1 117 ASN 117 117 117 ASN ASN A . n 
A 1 118 GLU 118 118 118 GLU GLU A . n 
A 1 119 LYS 119 119 119 LYS LYS A . n 
A 1 120 ALA 120 120 120 ALA ALA A . n 
A 1 121 LEU 121 121 121 LEU LEU A . n 
A 1 122 LYS 122 122 122 LYS LYS A . n 
A 1 123 ARG 123 123 123 ARG ARG A . n 
A 1 124 ALA 124 124 124 ALA ALA A . n 
A 1 125 VAL 125 125 125 VAL VAL A . n 
A 1 126 ALA 126 126 126 ALA ALA A . n 
A 1 127 ARG 127 127 127 ARG ARG A . n 
A 1 128 VAL 128 128 128 VAL VAL A . n 
A 1 129 GLY 129 129 129 GLY GLY A . n 
A 1 130 PRO 130 130 130 PRO PRO A . n 
A 1 131 VAL 131 131 131 VAL VAL A . n 
A 1 132 SER 132 132 132 SER SER A . n 
A 1 133 VAL 133 133 133 VAL VAL A . n 
A 1 134 ALA 134 134 134 ALA ALA A . n 
A 1 135 ILE 135 135 135 ILE ILE A . n 
A 1 136 ASP 136 136 136 ASP ASP A . n 
A 1 137 ALA 137 137 137 ALA ALA A . n 
A 1 138 SER 138 138 138 SER SER A . n 
A 1 139 LEU 139 139 139 LEU LEU A . n 
A 1 140 THR 140 140 140 THR THR A . n 
A 1 141 SER 141 141 141 SER SER A . n 
A 1 142 PHE 142 142 142 PHE PHE A . n 
A 1 143 GLN 143 143 143 GLN GLN A . n 
A 1 144 PHE 144 144 144 PHE PHE A . n 
A 1 145 TYR 145 145 145 TYR TYR A . n 
A 1 146 SER 146 146 146 SER SER A . n 
A 1 147 LYS 147 147 147 LYS LYS A . n 
A 1 148 GLY 148 148 148 GLY GLY A . n 
A 1 149 VAL 149 149 149 VAL VAL A . n 
A 1 150 TYR 150 150 150 TYR TYR A . n 
A 1 151 TYR 151 151 151 TYR TYR A . n 
A 1 152 ASP 152 152 152 ASP ASP A . n 
A 1 153 GLU 153 153 153 GLU GLU A . n 
A 1 154 SER 154 154 154 SER SER A . n 
A 1 155 CYS 155 155 155 CYS CYS A . n 
A 1 156 ASN 156 156 156 ASN ASN A . n 
A 1 157 SER 157 157 157 SER SER A . n 
A 1 158 ASP 158 158 158 ASP ASP A . n 
A 1 159 ASN 159 159 159 ASN ASN A . n 
A 1 160 LEU 160 160 160 LEU LEU A . n 
A 1 161 ASN 161 161 161 ASN ASN A . n 
A 1 162 HIS 162 162 162 HIS HIS A . n 
A 1 163 ALA 163 163 163 ALA ALA A . n 
A 1 164 VAL 164 164 164 VAL VAL A . n 
A 1 165 LEU 165 165 165 LEU LEU A . n 
A 1 166 ALA 166 166 166 ALA ALA A . n 
A 1 167 VAL 167 167 167 VAL VAL A . n 
A 1 168 GLY 168 168 168 GLY GLY A . n 
A 1 169 TYR 169 169 169 TYR TYR A . n 
A 1 170 GLY 170 170 170 GLY GLY A . n 
A 1 171 ILE 171 171 171 ILE ILE A . n 
A 1 172 GLN 172 172 172 GLN GLN A . n 
A 1 173 LYS 173 173 173 LYS LYS A . n 
A 1 174 GLY 174 174 174 GLY GLY A . n 
A 1 175 ASN 175 175 175 ASN ASN A . n 
A 1 176 LYS 176 176 176 LYS LYS A . n 
A 1 177 HIS 177 177 177 HIS HIS A . n 
A 1 178 TRP 178 178 178 TRP TRP A . n 
A 1 179 ILE 179 179 179 ILE ILE A . n 
A 1 180 ILE 180 180 180 ILE ILE A . n 
A 1 181 LYS 181 181 181 LYS LYS A . n 
A 1 182 ASN 182 182 182 ASN ASN A . n 
A 1 183 SER 183 183 183 SER SER A . n 
A 1 184 TRP 184 184 184 TRP TRP A . n 
A 1 185 GLY 185 185 185 GLY GLY A . n 
A 1 186 GLU 186 186 186 GLU GLU A . n 
A 1 187 ASN 187 187 187 ASN ASN A . n 
A 1 188 TRP 188 188 188 TRP TRP A . n 
A 1 189 GLY 189 189 189 GLY GLY A . n 
A 1 190 ASN 190 190 190 ASN ASN A . n 
A 1 191 LYS 191 191 191 LYS LYS A . n 
A 1 192 GLY 192 192 192 GLY GLY A . n 
A 1 193 TYR 193 193 193 TYR TYR A . n 
A 1 194 ILE 194 194 194 ILE ILE A . n 
A 1 195 LEU 195 195 195 LEU LEU A . n 
A 1 196 MET 196 196 196 MET MET A . n 
A 1 197 ALA 197 197 197 ALA ALA A . n 
A 1 198 ARG 198 198 198 ARG ARG A . n 
A 1 199 ASN 199 199 199 ASN ASN A . n 
A 1 200 LYS 200 200 200 LYS LYS A . n 
A 1 201 ASN 201 201 201 ASN ASN A . n 
A 1 202 ASN 202 202 202 ASN ASN A . n 
A 1 203 ALA 203 203 203 ALA ALA A . n 
A 1 204 CYS 204 204 204 CYS CYS A . n 
A 1 205 GLY 205 205 205 GLY GLY A . n 
A 1 206 ILE 206 206 206 ILE ILE A . n 
A 1 207 ALA 207 207 207 ALA ALA A . n 
A 1 208 ASN 208 208 208 ASN ASN A . n 
A 1 209 LEU 209 209 209 LEU LEU A . n 
A 1 210 ALA 210 210 210 ALA ALA A . n 
A 1 211 SER 211 211 211 SER SER A . n 
A 1 212 PHE 212 212 212 PHE PHE A . n 
A 1 213 PRO 213 213 213 PRO PRO A . n 
A 1 214 LYS 214 214 214 LYS LYS A . n 
A 1 215 MET 215 215 215 MET MET A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 IN6 1  300 300 IN6 IN6 A . 
C 3 HOH 1  301 301 HOH HOH A . 
C 3 HOH 2  302 302 HOH HOH A . 
C 3 HOH 3  303 303 HOH HOH A . 
C 3 HOH 4  304 304 HOH HOH A . 
C 3 HOH 5  305 305 HOH HOH A . 
C 3 HOH 6  306 306 HOH HOH A . 
C 3 HOH 7  307 307 HOH HOH A . 
C 3 HOH 8  308 308 HOH HOH A . 
C 3 HOH 9  309 309 HOH HOH A . 
C 3 HOH 10 310 310 HOH HOH A . 
C 3 HOH 11 311 311 HOH HOH A . 
C 3 HOH 12 312 312 HOH HOH A . 
C 3 HOH 13 313 313 HOH HOH A . 
C 3 HOH 14 314 314 HOH HOH A . 
C 3 HOH 15 315 315 HOH HOH A . 
C 3 HOH 16 316 316 HOH HOH A . 
C 3 HOH 17 317 317 HOH HOH A . 
C 3 HOH 18 318 318 HOH HOH A . 
C 3 HOH 19 319 319 HOH HOH A . 
C 3 HOH 20 320 320 HOH HOH A . 
C 3 HOH 21 321 321 HOH HOH A . 
C 3 HOH 22 322 322 HOH HOH A . 
C 3 HOH 23 323 323 HOH HOH A . 
C 3 HOH 24 324 324 HOH HOH A . 
C 3 HOH 25 325 325 HOH HOH A . 
C 3 HOH 26 326 326 HOH HOH A . 
C 3 HOH 27 327 327 HOH HOH A . 
C 3 HOH 28 328 328 HOH HOH A . 
C 3 HOH 29 329 329 HOH HOH A . 
C 3 HOH 30 330 330 HOH HOH A . 
C 3 HOH 31 331 331 HOH HOH A . 
C 3 HOH 32 332 332 HOH HOH A . 
C 3 HOH 33 333 333 HOH HOH A . 
C 3 HOH 34 334 334 HOH HOH A . 
C 3 HOH 35 335 335 HOH HOH A . 
C 3 HOH 36 336 336 HOH HOH A . 
C 3 HOH 37 337 337 HOH HOH A . 
C 3 HOH 38 338 338 HOH HOH A . 
C 3 HOH 39 339 339 HOH HOH A . 
C 3 HOH 40 340 340 HOH HOH A . 
C 3 HOH 41 341 341 HOH HOH A . 
C 3 HOH 42 342 342 HOH HOH A . 
C 3 HOH 43 343 343 HOH HOH A . 
C 3 HOH 44 344 344 HOH HOH A . 
C 3 HOH 45 345 345 HOH HOH A . 
C 3 HOH 46 346 346 HOH HOH A . 
C 3 HOH 47 347 347 HOH HOH A . 
C 3 HOH 48 348 348 HOH HOH A . 
C 3 HOH 49 349 349 HOH HOH A . 
C 3 HOH 50 350 350 HOH HOH A . 
C 3 HOH 51 351 351 HOH HOH A . 
C 3 HOH 52 352 352 HOH HOH A . 
C 3 HOH 53 353 353 HOH HOH A . 
C 3 HOH 54 354 354 HOH HOH A . 
C 3 HOH 55 355 355 HOH HOH A . 
C 3 HOH 56 356 356 HOH HOH A . 
C 3 HOH 57 357 357 HOH HOH A . 
C 3 HOH 58 358 358 HOH HOH A . 
C 3 HOH 59 359 359 HOH HOH A . 
C 3 HOH 60 360 360 HOH HOH A . 
C 3 HOH 61 361 361 HOH HOH A . 
C 3 HOH 62 362 362 HOH HOH A . 
C 3 HOH 63 363 363 HOH HOH A . 
C 3 HOH 64 364 364 HOH HOH A . 
C 3 HOH 65 365 365 HOH HOH A . 
C 3 HOH 66 366 366 HOH HOH A . 
C 3 HOH 67 367 367 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1998-11-25 
2 'Structure model' 1 1 2008-03-24 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2012-02-29 
5 'Structure model' 1 4 2018-03-07 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Database references'       
4 5 'Structure model' 'Data collection'           
5 5 'Structure model' Other                       
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 5 'Structure model' diffrn_source        
2 5 'Structure model' pdbx_database_status 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 5 'Structure model' '_diffrn_source.source'              
2 5 'Structure model' '_pdbx_database_status.process_site' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
XENGEN 'data collection' .   ? 1 
XENGEN 'data reduction'  .   ? 2 
X-PLOR 'model building'  3.1 ? 3 
X-PLOR refinement        3.1 ? 4 
XENGEN 'data scaling'    .   ? 5 
X-PLOR phasing           3.1 ? 6 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   CB 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   ALA 
_pdbx_validate_close_contact.auth_seq_id_1    203 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   O 
_pdbx_validate_close_contact.auth_asym_id_2   A 
_pdbx_validate_close_contact.auth_comp_id_2   HOH 
_pdbx_validate_close_contact.auth_seq_id_2    325 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.15 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 TYR A 87  ? ? -161.39 66.54  
2 1 ARG A 108 ? ? -110.73 51.82  
3 1 SER A 146 ? ? -148.25 -38.33 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 "N-[2-[1-(N-BENZYLOXYCARBONYLAMINO)-3-METHYLBUTYL]THIAZOL-4-YLCARBONYL]-N'-(BENZYLOXYCARBONYL-L-LEUCINYL)HYDRAZIDE" IN6 
3 water                                                                                                               HOH 
#