data_1B07
# 
_entry.id   1B07 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1B07         
RCSB  RCSB008105   
WWPDB D_1000008105 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1B07 
_pdbx_database_status.recvd_initial_deposition_date   1998-11-17 
_pdbx_database_status.deposit_site                    BNL 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Nguyen, J.T.'     1 
'Turck, C.W.'      2 
'Cohen, F.E.'      3 
'Zuckermann, R.N.' 4 
'Lim, W.A.'        5 
# 
_citation.id                        primary 
_citation.title                     
'Exploiting the basis of proline recognition by SH3 and WW domains: design of N-substituted inhibitors.' 
_citation.journal_abbrev            Science 
_citation.journal_volume            282 
_citation.page_first                2088 
_citation.page_last                 2092 
_citation.year                      1998 
_citation.journal_id_ASTM           SCIEAS 
_citation.country                   US 
_citation.journal_id_ISSN           0036-8075 
_citation.journal_id_CSD            0038 
_citation.book_publisher            'American Association for the Advancement of Science Washington, D.C.' 
_citation.pdbx_database_id_PubMed   9851931 
_citation.pdbx_database_id_DOI      10.1126/science.282.5396.2088 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Nguyen, J.T.'     1 
primary 'Turck, C.W.'      2 
primary 'Cohen, F.E.'      3 
primary 'Zuckermann, R.N.' 4 
primary 'Lim, W.A.'        5 
# 
_citation_editor.citation_id   primary 
_citation_editor.name          'Bloom, F.E.' 
_citation_editor.ordinal       1 
# 
_cell.entry_id           1B07 
_cell.length_a           36.800 
_cell.length_b           36.800 
_cell.length_c           52.600 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1B07 
_symmetry.space_group_name_H-M             'P 43' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                78 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'PROTEIN (PROTO-ONCOGENE CRK (CRK))' 7787.548 1  ? ? 'SH3 DOMAIN' ? 
2 polymer     man 'PROTEIN (SH3 PEPTOID INHIBITOR)'    1425.657 1  ? ? ?            ? 
3 non-polymer syn PHENYLETHANE                         106.165  1  ? ? ?            ? 
4 water       nat water                                18.015   46 ? ? ?            ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'P38, ADAPTER MOLECULE CRK' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no GSAEYVRALFDFNGNDEEDLPFKKGDILRIRDKPEEQWWNAEDSEGKRGMIPVPYVEKYHHHHHH 
GSAEYVRALFDFNGNDEEDLPFKKGDILRIRDKPEEQWWNAEDSEGKRGMIPVPYVEKYHHHHHH A ? 
2 'polypeptide(L)' no no YEVPGPVPPRRR                                                      YEVPGPVPPRRR C ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  GLY n 
1 2  SER n 
1 3  ALA n 
1 4  GLU n 
1 5  TYR n 
1 6  VAL n 
1 7  ARG n 
1 8  ALA n 
1 9  LEU n 
1 10 PHE n 
1 11 ASP n 
1 12 PHE n 
1 13 ASN n 
1 14 GLY n 
1 15 ASN n 
1 16 ASP n 
1 17 GLU n 
1 18 GLU n 
1 19 ASP n 
1 20 LEU n 
1 21 PRO n 
1 22 PHE n 
1 23 LYS n 
1 24 LYS n 
1 25 GLY n 
1 26 ASP n 
1 27 ILE n 
1 28 LEU n 
1 29 ARG n 
1 30 ILE n 
1 31 ARG n 
1 32 ASP n 
1 33 LYS n 
1 34 PRO n 
1 35 GLU n 
1 36 GLU n 
1 37 GLN n 
1 38 TRP n 
1 39 TRP n 
1 40 ASN n 
1 41 ALA n 
1 42 GLU n 
1 43 ASP n 
1 44 SER n 
1 45 GLU n 
1 46 GLY n 
1 47 LYS n 
1 48 ARG n 
1 49 GLY n 
1 50 MET n 
1 51 ILE n 
1 52 PRO n 
1 53 VAL n 
1 54 PRO n 
1 55 TYR n 
1 56 VAL n 
1 57 GLU n 
1 58 LYS n 
1 59 TYR n 
1 60 HIS n 
1 61 HIS n 
1 62 HIS n 
1 63 HIS n 
1 64 HIS n 
1 65 HIS n 
2 1  TYR n 
2 2  GLU n 
2 3  VAL n 
2 4  PRO n 
2 5  GLY n 
2 6  PRO n 
2 7  VAL n 
2 8  PRO n 
2 9  PRO n 
2 10 ARG n 
2 11 ARG n 
2 12 ARG n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               'house mouse' 
_entity_src_gen.gene_src_genus                     Mus 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Mus musculus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     10090 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               TG1 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
_struct_ref.pdbx_seq_one_letter_code 
1 UNP CRK_MOUSE Q64010 1 134 ? ? 
2 PDB 1B07      1B07   2 ?   ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1B07 A 3 ? 59 ? Q64010 134 ? 190 ? 134 190 
2 2 1B07 C 1 ? 12 ? 1B07   1   ? 12  ? 1   12  
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
PYJ non-polymer         . PHENYLETHANE    ? 'C8 H10'         106.165 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1B07 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      1.93 
_exptl_crystal.density_percent_sol   36.31 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.00 
_exptl_crystal_grow.pdbx_details    '29% PEG4000, 0.2 M AMMONIUM ACETATE, PH 6.0, pH 6.00' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           123.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   1998-04-15 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.08 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SSRL BEAMLINE BL7-1' 
_diffrn_source.pdbx_synchrotron_site       SSRL 
_diffrn_source.pdbx_synchrotron_beamline   BL7-1 
_diffrn_source.pdbx_wavelength             1.08 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1B07 
_reflns.observed_criterion_sigma_I   0.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             30.000 
_reflns.d_resolution_high            2.500 
_reflns.number_obs                   15685 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         92.0 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.062 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              8.000 
_reflns.R_free_details               ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.50 
_reflns_shell.d_res_low              2.54 
_reflns_shell.percent_possible_all   81.8 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.075 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        8.00 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 1B07 
_refine.ls_number_reflns_obs                     2277 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_data_cutoff_high_absF               10000000.000 
_refine.pdbx_data_cutoff_low_absF                0.0010 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             30.0 
_refine.ls_d_res_high                            2.50 
_refine.ls_percent_reflns_obs                    92.0 
_refine.ls_R_factor_obs                          0.242 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.242 
_refine.ls_R_factor_R_free                       0.354 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 10.100 
_refine.ls_number_reflns_R_free                  229 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      1CKB 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        561 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         8 
_refine_hist.number_atoms_solvent             46 
_refine_hist.number_atoms_total               615 
_refine_hist.d_res_high                       2.50 
_refine_hist.d_res_low                        30.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d                0.006 ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg             1.14  ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   8 
_refine_ls_shell.d_res_high                       2.50 
_refine_ls_shell.d_res_low                        2.61 
_refine_ls_shell.number_reflns_R_work             276 
_refine_ls_shell.R_factor_R_work                  0.317 
_refine_ls_shell.percent_reflns_obs               ? 
_refine_ls_shell.R_factor_R_free                  0.484 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            9.80 
_refine_ls_shell.number_reflns_R_free             30 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  1B07 
_struct.title                     'CRK SH3 DOMAIN COMPLEXED WITH PEPTOID INHIBITOR' 
_struct.pdbx_descriptor           'PROTEIN (PROTO-ONCOGENE CRK (CRK))' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1B07 
_struct_keywords.pdbx_keywords   'SH3 DOMAIN' 
_struct_keywords.text            
'SH3 DOMAIN, INHIBITORS, PEPTOIDS, PROTEIN-PROTEIN RECOGNITION, PROLINE-RICH MOTIFS, SIGNAL TRANSDUCTION' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 4 ? 
# 
_struct_biol.id   1 
# 
_struct_conf.conf_type_id            HELX_P 
_struct_conf.id                      HELX_P1 
_struct_conf.pdbx_PDB_helix_id       1 
_struct_conf.beg_label_comp_id       VAL 
_struct_conf.beg_label_asym_id       A 
_struct_conf.beg_label_seq_id        53 
_struct_conf.pdbx_beg_PDB_ins_code   ? 
_struct_conf.end_label_comp_id       TYR 
_struct_conf.end_label_asym_id       A 
_struct_conf.end_label_seq_id        55 
_struct_conf.pdbx_end_PDB_ins_code   ? 
_struct_conf.beg_auth_comp_id        VAL 
_struct_conf.beg_auth_asym_id        A 
_struct_conf.beg_auth_seq_id         184 
_struct_conf.end_auth_comp_id        TYR 
_struct_conf.end_auth_asym_id        A 
_struct_conf.end_auth_seq_id         186 
_struct_conf.pdbx_PDB_helix_class    5 
_struct_conf.details                 ? 
_struct_conf.pdbx_PDB_helix_length   3 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_conn.id                            covale1 
_struct_conn.conn_type_id                  covale 
_struct_conn.pdbx_leaving_atom_flag        ? 
_struct_conn.pdbx_PDB_id                   ? 
_struct_conn.ptnr1_label_asym_id           C 
_struct_conn.ptnr1_label_comp_id           PYJ 
_struct_conn.ptnr1_label_seq_id            . 
_struct_conn.ptnr1_label_atom_id           CB 
_struct_conn.pdbx_ptnr1_label_alt_id       ? 
_struct_conn.pdbx_ptnr1_PDB_ins_code       ? 
_struct_conn.pdbx_ptnr1_standard_comp_id   ? 
_struct_conn.ptnr1_symmetry                1_555 
_struct_conn.ptnr2_label_asym_id           B 
_struct_conn.ptnr2_label_comp_id           GLY 
_struct_conn.ptnr2_label_seq_id            5 
_struct_conn.ptnr2_label_atom_id           N 
_struct_conn.pdbx_ptnr2_label_alt_id       ? 
_struct_conn.pdbx_ptnr2_PDB_ins_code       ? 
_struct_conn.ptnr1_auth_asym_id            C 
_struct_conn.ptnr1_auth_comp_id            PYJ 
_struct_conn.ptnr1_auth_seq_id             1005 
_struct_conn.ptnr2_auth_asym_id            C 
_struct_conn.ptnr2_auth_comp_id            GLY 
_struct_conn.ptnr2_auth_seq_id             5 
_struct_conn.ptnr2_symmetry                1_555 
_struct_conn.pdbx_ptnr3_label_atom_id      ? 
_struct_conn.pdbx_ptnr3_label_seq_id       ? 
_struct_conn.pdbx_ptnr3_label_comp_id      ? 
_struct_conn.pdbx_ptnr3_label_asym_id      ? 
_struct_conn.pdbx_ptnr3_label_alt_id       ? 
_struct_conn.pdbx_ptnr3_PDB_ins_code       ? 
_struct_conn.details                       ? 
_struct_conn.pdbx_dist_value               1.470 
_struct_conn.pdbx_value_order              ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   5 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 VAL A 56 ? LYS A 58 ? VAL A 187 LYS A 189 
A 2 TYR A 5  ? ALA A 8  ? TYR A 136 ALA A 139 
A 3 ILE A 27 ? ASP A 32 ? ILE A 158 ASP A 163 
A 4 TRP A 38 ? GLU A 42 ? TRP A 169 GLU A 173 
A 5 ARG A 48 ? PRO A 52 ? ARG A 179 PRO A 183 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O GLU A 57 ? O GLU A 188 N ARG A 7  ? N ARG A 138 
A 2 3 O VAL A 6  ? O VAL A 137 N LEU A 28 ? N LEU A 159 
A 3 4 O ARG A 29 ? O ARG A 160 N GLU A 42 ? N GLU A 173 
A 4 5 O TRP A 39 ? O TRP A 170 N ILE A 51 ? N ILE A 182 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    7 
_struct_site.details              'BINDING SITE FOR RESIDUE PYJ C 1005' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 7 ILE A 27 ? ILE A 158 . ? 4_565 ? 
2 AC1 7 ARG A 29 ? ARG A 160 . ? 4_565 ? 
3 AC1 7 GLU A 42 ? GLU A 173 . ? 4_565 ? 
4 AC1 7 ASP A 43 ? ASP A 174 . ? 4_565 ? 
5 AC1 7 SER A 44 ? SER A 175 . ? 4_565 ? 
6 AC1 7 PRO B 4  ? PRO C 4   . ? 1_555 ? 
7 AC1 7 GLY B 5  ? GLY C 5   . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1B07 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1B07 
_atom_sites.fract_transf_matrix[1][1]   0.027174 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.027174 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.019011 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1   N N   . SER A 1 2  ? 10.628  11.317 -14.304 1.00 37.59  ? 133  SER A N   1 
ATOM   2   C CA  . SER A 1 2  ? 11.127  12.681 -13.950 1.00 37.28  ? 133  SER A CA  1 
ATOM   3   C C   . SER A 1 2  ? 10.087  13.504 -13.186 1.00 35.02  ? 133  SER A C   1 
ATOM   4   O O   . SER A 1 2  ? 9.683   14.587 -13.622 1.00 35.23  ? 133  SER A O   1 
ATOM   5   C CB  . SER A 1 2  ? 11.587  13.430 -15.212 1.00 39.16  ? 133  SER A CB  1 
ATOM   6   O OG  . SER A 1 2  ? 10.549  13.529 -16.175 1.00 42.85  ? 133  SER A OG  1 
ATOM   7   N N   . ALA A 1 3  ? 9.664   12.986 -12.037 1.00 31.53  ? 134  ALA A N   1 
ATOM   8   C CA  . ALA A 1 3  ? 8.680   13.667 -11.207 1.00 28.38  ? 134  ALA A CA  1 
ATOM   9   C C   . ALA A 1 3  ? 9.365   14.676 -10.283 1.00 26.35  ? 134  ALA A C   1 
ATOM   10  O O   . ALA A 1 3  ? 10.541  14.532 -9.961  1.00 24.68  ? 134  ALA A O   1 
ATOM   11  C CB  . ALA A 1 3  ? 7.886   12.652 -10.398 1.00 30.01  ? 134  ALA A CB  1 
ATOM   12  N N   . GLU A 1 4  ? 8.622   15.701 -9.876  1.00 23.73  ? 135  GLU A N   1 
ATOM   13  C CA  . GLU A 1 4  ? 9.138   16.747 -8.999  1.00 20.97  ? 135  GLU A CA  1 
ATOM   14  C C   . GLU A 1 4  ? 8.653   16.545 -7.565  1.00 19.80  ? 135  GLU A C   1 
ATOM   15  O O   . GLU A 1 4  ? 7.450   16.564 -7.302  1.00 19.60  ? 135  GLU A O   1 
ATOM   16  C CB  . GLU A 1 4  ? 8.691   18.121 -9.517  1.00 20.89  ? 135  GLU A CB  1 
ATOM   17  C CG  . GLU A 1 4  ? 9.201   19.300 -8.698  1.00 22.30  ? 135  GLU A CG  1 
ATOM   18  C CD  . GLU A 1 4  ? 8.874   20.652 -9.313  1.00 23.64  ? 135  GLU A CD  1 
ATOM   19  O OE1 . GLU A 1 4  ? 8.360   20.705 -10.450 1.00 26.07  ? 135  GLU A OE1 1 
ATOM   20  O OE2 . GLU A 1 4  ? 9.138   21.673 -8.652  1.00 24.02  ? 135  GLU A OE2 1 
ATOM   21  N N   . TYR A 1 5  ? 9.592   16.364 -6.640  1.00 18.33  ? 136  TYR A N   1 
ATOM   22  C CA  . TYR A 1 5  ? 9.247   16.157 -5.234  1.00 17.40  ? 136  TYR A CA  1 
ATOM   23  C C   . TYR A 1 5  ? 9.751   17.267 -4.314  1.00 16.94  ? 136  TYR A C   1 
ATOM   24  O O   . TYR A 1 5  ? 10.610  18.070 -4.683  1.00 16.67  ? 136  TYR A O   1 
ATOM   25  C CB  . TYR A 1 5  ? 9.800   14.816 -4.729  1.00 17.89  ? 136  TYR A CB  1 
ATOM   26  C CG  . TYR A 1 5  ? 9.310   13.602 -5.485  1.00 16.80  ? 136  TYR A CG  1 
ATOM   27  C CD1 . TYR A 1 5  ? 8.085   13.015 -5.179  1.00 14.35  ? 136  TYR A CD1 1 
ATOM   28  C CD2 . TYR A 1 5  ? 10.070  13.047 -6.515  1.00 16.29  ? 136  TYR A CD2 1 
ATOM   29  C CE1 . TYR A 1 5  ? 7.622   11.904 -5.885  1.00 13.95  ? 136  TYR A CE1 1 
ATOM   30  C CE2 . TYR A 1 5  ? 9.619   11.936 -7.224  1.00 17.04  ? 136  TYR A CE2 1 
ATOM   31  C CZ  . TYR A 1 5  ? 8.393   11.371 -6.906  1.00 14.40  ? 136  TYR A CZ  1 
ATOM   32  O OH  . TYR A 1 5  ? 7.935   10.291 -7.621  1.00 12.08  ? 136  TYR A OH  1 
ATOM   33  N N   . VAL A 1 6  ? 9.178   17.308 -3.117  1.00 16.34  ? 137  VAL A N   1 
ATOM   34  C CA  . VAL A 1 6  ? 9.556   18.264 -2.081  1.00 17.11  ? 137  VAL A CA  1 
ATOM   35  C C   . VAL A 1 6  ? 9.548   17.520 -0.752  1.00 17.95  ? 137  VAL A C   1 
ATOM   36  O O   . VAL A 1 6  ? 8.864   16.503 -0.602  1.00 17.19  ? 137  VAL A O   1 
ATOM   37  C CB  . VAL A 1 6  ? 8.578   19.477 -1.977  1.00 18.27  ? 137  VAL A CB  1 
ATOM   38  C CG1 . VAL A 1 6  ? 8.635   20.327 -3.229  1.00 15.87  ? 137  VAL A CG1 1 
ATOM   39  C CG2 . VAL A 1 6  ? 7.150   19.000 -1.705  1.00 17.53  ? 137  VAL A CG2 1 
ATOM   40  N N   . ARG A 1 7  ? 10.360  17.986 0.188   1.00 17.34  ? 138  ARG A N   1 
ATOM   41  C CA  . ARG A 1 7  ? 10.410  17.375 1.509   1.00 18.24  ? 138  ARG A CA  1 
ATOM   42  C C   . ARG A 1 7  ? 9.845   18.388 2.494   1.00 16.72  ? 138  ARG A C   1 
ATOM   43  O O   . ARG A 1 7  ? 10.258  19.552 2.503   1.00 15.22  ? 138  ARG A O   1 
ATOM   44  C CB  . ARG A 1 7  ? 11.848  17.009 1.898   1.00 19.15  ? 138  ARG A CB  1 
ATOM   45  C CG  . ARG A 1 7  ? 11.989  16.575 3.350   1.00 23.49  ? 138  ARG A CG  1 
ATOM   46  C CD  . ARG A 1 7  ? 13.437  16.551 3.811   1.00 26.97  ? 138  ARG A CD  1 
ATOM   47  N NE  . ARG A 1 7  ? 14.138  15.336 3.409   1.00 30.30  ? 138  ARG A NE  1 
ATOM   48  C CZ  . ARG A 1 7  ? 14.823  15.192 2.281   1.00 32.16  ? 138  ARG A CZ  1 
ATOM   49  N NH1 . ARG A 1 7  ? 14.909  16.192 1.414   1.00 33.99  ? 138  ARG A NH1 1 
ATOM   50  N NH2 . ARG A 1 7  ? 15.438  14.044 2.028   1.00 35.31  ? 138  ARG A NH2 1 
ATOM   51  N N   . ALA A 1 8  ? 8.880   17.948 3.296   1.00 14.93  ? 139  ALA A N   1 
ATOM   52  C CA  . ALA A 1 8  ? 8.248   18.806 4.291   1.00 15.20  ? 139  ALA A CA  1 
ATOM   53  C C   . ALA A 1 8  ? 9.227   19.193 5.402   1.00 16.01  ? 139  ALA A C   1 
ATOM   54  O O   . ALA A 1 8  ? 9.855   18.330 6.018   1.00 16.83  ? 139  ALA A O   1 
ATOM   55  C CB  . ALA A 1 8  ? 7.032   18.105 4.879   1.00 14.20  ? 139  ALA A CB  1 
ATOM   56  N N   . LEU A 1 9  ? 9.373   20.494 5.636   1.00 15.12  ? 140  LEU A N   1 
ATOM   57  C CA  . LEU A 1 9  ? 10.275  20.988 6.676   1.00 14.93  ? 140  LEU A CA  1 
ATOM   58  C C   . LEU A 1 9  ? 9.541   21.125 8.003   1.00 16.07  ? 140  LEU A C   1 
ATOM   59  O O   . LEU A 1 9  ? 10.127  20.924 9.065   1.00 16.27  ? 140  LEU A O   1 
ATOM   60  C CB  . LEU A 1 9  ? 10.884  22.339 6.275   1.00 13.63  ? 140  LEU A CB  1 
ATOM   61  C CG  . LEU A 1 9  ? 11.735  22.365 5.002   1.00 13.62  ? 140  LEU A CG  1 
ATOM   62  C CD1 . LEU A 1 9  ? 12.077  23.789 4.633   1.00 10.46  ? 140  LEU A CD1 1 
ATOM   63  C CD2 . LEU A 1 9  ? 12.990  21.534 5.192   1.00 14.25  ? 140  LEU A CD2 1 
ATOM   64  N N   . PHE A 1 10 ? 8.258   21.478 7.934   1.00 16.36  ? 141  PHE A N   1 
ATOM   65  C CA  . PHE A 1 10 ? 7.433   21.650 9.126   1.00 17.63  ? 141  PHE A CA  1 
ATOM   66  C C   . PHE A 1 10 ? 6.155   20.832 8.997   1.00 19.10  ? 141  PHE A C   1 
ATOM   67  O O   . PHE A 1 10 ? 5.745   20.464 7.892   1.00 18.87  ? 141  PHE A O   1 
ATOM   68  C CB  . PHE A 1 10 ? 7.029   23.122 9.313   1.00 17.34  ? 141  PHE A CB  1 
ATOM   69  C CG  . PHE A 1 10 ? 8.172   24.099 9.242   1.00 15.64  ? 141  PHE A CG  1 
ATOM   70  C CD1 . PHE A 1 10 ? 9.066   24.228 10.299  1.00 17.40  ? 141  PHE A CD1 1 
ATOM   71  C CD2 . PHE A 1 10 ? 8.341   24.907 8.122   1.00 15.41  ? 141  PHE A CD2 1 
ATOM   72  C CE1 . PHE A 1 10 ? 10.112  25.151 10.240  1.00 14.66  ? 141  PHE A CE1 1 
ATOM   73  C CE2 . PHE A 1 10 ? 9.382   25.831 8.053   1.00 14.54  ? 141  PHE A CE2 1 
ATOM   74  C CZ  . PHE A 1 10 ? 10.267  25.952 9.113   1.00 14.82  ? 141  PHE A CZ  1 
ATOM   75  N N   . ASP A 1 11 ? 5.523   20.561 10.135  1.00 20.62  ? 142  ASP A N   1 
ATOM   76  C CA  . ASP A 1 11 ? 4.265   19.822 10.160  1.00 23.25  ? 142  ASP A CA  1 
ATOM   77  C C   . ASP A 1 11 ? 3.157   20.790 9.740   1.00 23.55  ? 142  ASP A C   1 
ATOM   78  O O   . ASP A 1 11 ? 3.106   21.927 10.210  1.00 24.32  ? 142  ASP A O   1 
ATOM   79  C CB  . ASP A 1 11 ? 3.969   19.296 11.573  1.00 24.00  ? 142  ASP A CB  1 
ATOM   80  C CG  . ASP A 1 11 ? 5.100   18.455 12.139  1.00 26.44  ? 142  ASP A CG  1 
ATOM   81  O OD1 . ASP A 1 11 ? 5.361   17.359 11.599  1.00 25.49  ? 142  ASP A OD1 1 
ATOM   82  O OD2 . ASP A 1 11 ? 5.730   18.889 13.127  1.00 29.65  ? 142  ASP A OD2 1 
ATOM   83  N N   . PHE A 1 12 ? 2.304   20.352 8.822   1.00 24.34  ? 143  PHE A N   1 
ATOM   84  C CA  . PHE A 1 12 ? 1.195   21.173 8.355   1.00 24.98  ? 143  PHE A CA  1 
ATOM   85  C C   . PHE A 1 12 ? -0.097  20.386 8.539   1.00 26.73  ? 143  PHE A C   1 
ATOM   86  O O   . PHE A 1 12 ? -0.344  19.394 7.854   1.00 26.73  ? 143  PHE A O   1 
ATOM   87  C CB  . PHE A 1 12 ? 1.393   21.559 6.888   1.00 23.43  ? 143  PHE A CB  1 
ATOM   88  C CG  . PHE A 1 12 ? 0.306   22.438 6.330   1.00 24.32  ? 143  PHE A CG  1 
ATOM   89  C CD1 . PHE A 1 12 ? 0.077   23.713 6.852   1.00 25.53  ? 143  PHE A CD1 1 
ATOM   90  C CD2 . PHE A 1 12 ? -0.481  21.999 5.268   1.00 23.20  ? 143  PHE A CD2 1 
ATOM   91  C CE1 . PHE A 1 12 ? -0.920  24.536 6.324   1.00 21.47  ? 143  PHE A CE1 1 
ATOM   92  C CE2 . PHE A 1 12 ? -1.477  22.813 4.734   1.00 23.92  ? 143  PHE A CE2 1 
ATOM   93  C CZ  . PHE A 1 12 ? -1.696  24.086 5.263   1.00 23.14  ? 143  PHE A CZ  1 
ATOM   94  N N   . ASN A 1 13 ? -0.900  20.826 9.499   1.00 28.99  ? 144  ASN A N   1 
ATOM   95  C CA  . ASN A 1 13 ? -2.165  20.178 9.809   1.00 32.66  ? 144  ASN A CA  1 
ATOM   96  C C   . ASN A 1 13 ? -3.226  20.439 8.741   1.00 34.14  ? 144  ASN A C   1 
ATOM   97  O O   . ASN A 1 13 ? -4.144  19.637 8.566   1.00 34.45  ? 144  ASN A O   1 
ATOM   98  C CB  . ASN A 1 13 ? -2.667  20.645 11.180  1.00 35.03  ? 144  ASN A CB  1 
ATOM   99  C CG  . ASN A 1 13 ? -1.642  20.426 12.290  1.00 36.24  ? 144  ASN A CG  1 
ATOM   100 O OD1 . ASN A 1 13 ? -0.988  19.385 12.353  1.00 38.24  ? 144  ASN A OD1 1 
ATOM   101 N ND2 . ASN A 1 13 ? -1.502  21.414 13.171  1.00 35.97  ? 144  ASN A ND2 1 
ATOM   102 N N   . GLY A 1 14 ? -3.083  21.543 8.012   1.00 35.24  ? 145  GLY A N   1 
ATOM   103 C CA  . GLY A 1 14 ? -4.051  21.876 6.981   1.00 37.09  ? 145  GLY A CA  1 
ATOM   104 C C   . GLY A 1 14 ? -5.121  22.809 7.514   1.00 39.30  ? 145  GLY A C   1 
ATOM   105 O O   . GLY A 1 14 ? -5.852  22.469 8.446   1.00 38.78  ? 145  GLY A O   1 
ATOM   106 N N   . ASN A 1 15 ? -5.207  23.994 6.919   1.00 41.44  ? 146  ASN A N   1 
ATOM   107 C CA  . ASN A 1 15 ? -6.178  25.008 7.325   1.00 42.43  ? 146  ASN A CA  1 
ATOM   108 C C   . ASN A 1 15 ? -7.516  24.878 6.594   1.00 43.69  ? 146  ASN A C   1 
ATOM   109 O O   . ASN A 1 15 ? -8.581  25.003 7.202   1.00 44.30  ? 146  ASN A O   1 
ATOM   110 C CB  . ASN A 1 15 ? -5.605  26.412 7.083   1.00 43.04  ? 146  ASN A CB  1 
ATOM   111 C CG  . ASN A 1 15 ? -4.303  26.663 7.835   1.00 42.59  ? 146  ASN A CG  1 
ATOM   112 O OD1 . ASN A 1 15 ? -3.771  25.775 8.506   1.00 39.60  ? 146  ASN A OD1 1 
ATOM   113 N ND2 . ASN A 1 15 ? -3.783  27.880 7.716   1.00 41.41  ? 146  ASN A ND2 1 
ATOM   114 N N   . ASP A 1 16 ? -7.450  24.639 5.287   1.00 44.43  ? 147  ASP A N   1 
ATOM   115 C CA  . ASP A 1 16 ? -8.638  24.506 4.448   1.00 44.56  ? 147  ASP A CA  1 
ATOM   116 C C   . ASP A 1 16 ? -8.917  23.052 4.060   1.00 43.51  ? 147  ASP A C   1 
ATOM   117 O O   . ASP A 1 16 ? -8.047  22.188 4.183   1.00 42.58  ? 147  ASP A O   1 
ATOM   118 C CB  . ASP A 1 16 ? -8.465  25.361 3.190   1.00 46.86  ? 147  ASP A CB  1 
ATOM   119 C CG  . ASP A 1 16 ? -9.727  25.449 2.362   1.00 48.97  ? 147  ASP A CG  1 
ATOM   120 O OD1 . ASP A 1 16 ? -10.648 26.191 2.764   1.00 51.13  ? 147  ASP A OD1 1 
ATOM   121 O OD2 . ASP A 1 16 ? -9.794  24.778 1.312   1.00 51.36  ? 147  ASP A OD2 1 
ATOM   122 N N   . GLU A 1 17 ? -10.136 22.798 3.584   1.00 43.04  ? 148  GLU A N   1 
ATOM   123 C CA  . GLU A 1 17 ? -10.561 21.461 3.164   1.00 42.67  ? 148  GLU A CA  1 
ATOM   124 C C   . GLU A 1 17 ? -9.772  20.973 1.955   1.00 40.68  ? 148  GLU A C   1 
ATOM   125 O O   . GLU A 1 17 ? -9.596  19.771 1.767   1.00 41.10  ? 148  GLU A O   1 
ATOM   126 C CB  . GLU A 1 17 ? -12.052 21.461 2.815   1.00 45.48  ? 148  GLU A CB  1 
ATOM   127 C CG  . GLU A 1 17 ? -12.978 21.875 3.955   1.00 49.52  ? 148  GLU A CG  1 
ATOM   128 C CD  . GLU A 1 17 ? -13.087 20.828 5.049   1.00 50.55  ? 148  GLU A CD  1 
ATOM   129 O OE1 . GLU A 1 17 ? -12.272 20.866 6.001   1.00 52.95  ? 148  GLU A OE1 1 
ATOM   130 O OE2 . GLU A 1 17 ? -13.997 19.974 4.961   1.00 51.62  ? 148  GLU A OE2 1 
ATOM   131 N N   . GLU A 1 18 ? -9.317  21.916 1.132   1.00 38.60  ? 149  GLU A N   1 
ATOM   132 C CA  . GLU A 1 18 ? -8.545  21.604 -0.068  1.00 35.98  ? 149  GLU A CA  1 
ATOM   133 C C   . GLU A 1 18 ? -7.048  21.424 0.216   1.00 32.85  ? 149  GLU A C   1 
ATOM   134 O O   . GLU A 1 18 ? -6.301  20.941 -0.638  1.00 32.56  ? 149  GLU A O   1 
ATOM   135 C CB  . GLU A 1 18 ? -8.754  22.695 -1.126  1.00 37.82  ? 149  GLU A CB  1 
ATOM   136 C CG  . GLU A 1 18 ? -10.207 22.891 -1.566  1.00 40.95  ? 149  GLU A CG  1 
ATOM   137 C CD  . GLU A 1 18 ? -10.727 21.771 -2.452  1.00 43.02  ? 149  GLU A CD  1 
ATOM   138 O OE1 . GLU A 1 18 ? -10.953 20.649 -1.947  1.00 43.99  ? 149  GLU A OE1 1 
ATOM   139 O OE2 . GLU A 1 18 ? -10.923 22.018 -3.661  1.00 44.09  ? 149  GLU A OE2 1 
ATOM   140 N N   . ASP A 1 19 ? -6.620  21.812 1.414   1.00 28.16  ? 150  ASP A N   1 
ATOM   141 C CA  . ASP A 1 19 ? -5.224  21.693 1.816   1.00 25.20  ? 150  ASP A CA  1 
ATOM   142 C C   . ASP A 1 19 ? -4.808  20.244 2.016   1.00 24.66  ? 150  ASP A C   1 
ATOM   143 O O   . ASP A 1 19 ? -5.623  19.400 2.391   1.00 23.87  ? 150  ASP A O   1 
ATOM   144 C CB  . ASP A 1 19 ? -4.976  22.447 3.127   1.00 24.22  ? 150  ASP A CB  1 
ATOM   145 C CG  . ASP A 1 19 ? -5.056  23.956 2.974   1.00 22.50  ? 150  ASP A CG  1 
ATOM   146 O OD1 . ASP A 1 19 ? -5.211  24.453 1.838   1.00 21.53  ? 150  ASP A OD1 1 
ATOM   147 O OD2 . ASP A 1 19 ? -4.950  24.649 4.008   1.00 19.90  ? 150  ASP A OD2 1 
ATOM   148 N N   . LEU A 1 20 ? -3.537  19.960 1.753   1.00 22.67  ? 151  LEU A N   1 
ATOM   149 C CA  . LEU A 1 20 ? -2.999  18.623 1.946   1.00 21.53  ? 151  LEU A CA  1 
ATOM   150 C C   . LEU A 1 20 ? -2.157  18.632 3.217   1.00 21.96  ? 151  LEU A C   1 
ATOM   151 O O   . LEU A 1 20 ? -1.095  19.256 3.264   1.00 22.22  ? 151  LEU A O   1 
ATOM   152 C CB  . LEU A 1 20 ? -2.130  18.193 0.760   1.00 21.59  ? 151  LEU A CB  1 
ATOM   153 C CG  . LEU A 1 20 ? -1.386  16.859 0.913   1.00 23.80  ? 151  LEU A CG  1 
ATOM   154 C CD1 . LEU A 1 20 ? -2.374  15.708 1.097   1.00 21.86  ? 151  LEU A CD1 1 
ATOM   155 C CD2 . LEU A 1 20 ? -0.506  16.619 -0.297  1.00 22.28  ? 151  LEU A CD2 1 
ATOM   156 N N   . PRO A 1 21 ? -2.655  17.999 4.290   1.00 22.43  ? 152  PRO A N   1 
ATOM   157 C CA  . PRO A 1 21 ? -1.895  17.962 5.543   1.00 22.99  ? 152  PRO A CA  1 
ATOM   158 C C   . PRO A 1 21 ? -0.691  17.032 5.423   1.00 22.73  ? 152  PRO A C   1 
ATOM   159 O O   . PRO A 1 21 ? -0.719  16.052 4.675   1.00 23.33  ? 152  PRO A O   1 
ATOM   160 C CB  . PRO A 1 21 ? -2.920  17.438 6.544   1.00 23.66  ? 152  PRO A CB  1 
ATOM   161 C CG  . PRO A 1 21 ? -3.787  16.555 5.702   1.00 24.36  ? 152  PRO A CG  1 
ATOM   162 C CD  . PRO A 1 21 ? -3.976  17.369 4.455   1.00 22.69  ? 152  PRO A CD  1 
ATOM   163 N N   . PHE A 1 22 ? 0.373   17.356 6.146   1.00 20.52  ? 153  PHE A N   1 
ATOM   164 C CA  . PHE A 1 22 ? 1.585   16.546 6.111   1.00 19.25  ? 153  PHE A CA  1 
ATOM   165 C C   . PHE A 1 22 ? 2.442   16.755 7.353   1.00 18.90  ? 153  PHE A C   1 
ATOM   166 O O   . PHE A 1 22 ? 2.187   17.653 8.166   1.00 17.08  ? 153  PHE A O   1 
ATOM   167 C CB  . PHE A 1 22 ? 2.399   16.848 4.840   1.00 16.27  ? 153  PHE A CB  1 
ATOM   168 C CG  . PHE A 1 22 ? 2.740   18.306 4.663   1.00 15.48  ? 153  PHE A CG  1 
ATOM   169 C CD1 . PHE A 1 22 ? 3.822   18.871 5.335   1.00 15.14  ? 153  PHE A CD1 1 
ATOM   170 C CD2 . PHE A 1 22 ? 1.982   19.110 3.822   1.00 13.22  ? 153  PHE A CD2 1 
ATOM   171 C CE1 . PHE A 1 22 ? 4.143   20.214 5.170   1.00 16.40  ? 153  PHE A CE1 1 
ATOM   172 C CE2 . PHE A 1 22 ? 2.292   20.454 3.649   1.00 14.11  ? 153  PHE A CE2 1 
ATOM   173 C CZ  . PHE A 1 22 ? 3.375   21.011 4.323   1.00 15.56  ? 153  PHE A CZ  1 
ATOM   174 N N   . LYS A 1 23 ? 3.460   15.912 7.489   1.00 19.53  ? 154  LYS A N   1 
ATOM   175 C CA  . LYS A 1 23 ? 4.368   15.977 8.621   1.00 20.10  ? 154  LYS A CA  1 
ATOM   176 C C   . LYS A 1 23 ? 5.807   16.219 8.191   1.00 18.87  ? 154  LYS A C   1 
ATOM   177 O O   . LYS A 1 23 ? 6.206   15.888 7.074   1.00 17.92  ? 154  LYS A O   1 
ATOM   178 C CB  . LYS A 1 23 ? 4.287   14.690 9.446   1.00 18.66  ? 154  LYS A CB  1 
ATOM   179 C CG  . LYS A 1 23 ? 2.939   14.464 10.108  1.00 21.04  ? 154  LYS A CG  1 
ATOM   180 C CD  . LYS A 1 23 ? 2.629   15.560 11.114  1.00 20.87  ? 154  LYS A CD  1 
ATOM   181 C CE  . LYS A 1 23 ? 1.190   15.490 11.566  1.00 21.60  ? 154  LYS A CE  1 
ATOM   182 N NZ  . LYS A 1 23 ? 0.855   16.605 12.481  1.00 22.36  ? 154  LYS A NZ  1 
ATOM   183 N N   . LYS A 1 24 ? 6.570   16.806 9.107   1.00 20.28  ? 155  LYS A N   1 
ATOM   184 C CA  . LYS A 1 24 ? 7.980   17.118 8.916   1.00 20.39  ? 155  LYS A CA  1 
ATOM   185 C C   . LYS A 1 24 ? 8.727   15.888 8.381   1.00 21.63  ? 155  LYS A C   1 
ATOM   186 O O   . LYS A 1 24 ? 8.682   14.809 8.982   1.00 22.81  ? 155  LYS A O   1 
ATOM   187 C CB  . LYS A 1 24 ? 8.555   17.560 10.263  1.00 19.18  ? 155  LYS A CB  1 
ATOM   188 C CG  . LYS A 1 24 ? 10.000  17.986 10.268  1.00 17.98  ? 155  LYS A CG  1 
ATOM   189 C CD  . LYS A 1 24 ? 10.405  18.360 11.679  1.00 18.66  ? 155  LYS A CD  1 
ATOM   190 C CE  . LYS A 1 24 ? 11.903  18.500 11.814  1.00 19.39  ? 155  LYS A CE  1 
ATOM   191 N NZ  . LYS A 1 24 ? 12.302  18.855 13.202  1.00 20.41  ? 155  LYS A NZ  1 
ATOM   192 N N   . GLY A 1 25 ? 9.350   16.041 7.215   1.00 20.77  ? 156  GLY A N   1 
ATOM   193 C CA  . GLY A 1 25 ? 10.088  14.943 6.614   1.00 19.65  ? 156  GLY A CA  1 
ATOM   194 C C   . GLY A 1 25 ? 9.360   14.217 5.497   1.00 18.70  ? 156  GLY A C   1 
ATOM   195 O O   . GLY A 1 25 ? 9.974   13.434 4.769   1.00 18.95  ? 156  GLY A O   1 
ATOM   196 N N   . ASP A 1 26 ? 8.060   14.462 5.358   1.00 17.33  ? 157  ASP A N   1 
ATOM   197 C CA  . ASP A 1 26 ? 7.263   13.821 4.308   1.00 18.48  ? 157  ASP A CA  1 
ATOM   198 C C   . ASP A 1 26 ? 7.691   14.230 2.899   1.00 17.01  ? 157  ASP A C   1 
ATOM   199 O O   . ASP A 1 26 ? 8.080   15.372 2.664   1.00 17.32  ? 157  ASP A O   1 
ATOM   200 C CB  . ASP A 1 26 ? 5.767   14.138 4.481   1.00 18.58  ? 157  ASP A CB  1 
ATOM   201 C CG  . ASP A 1 26 ? 5.094   13.306 5.580   1.00 19.89  ? 157  ASP A CG  1 
ATOM   202 O OD1 . ASP A 1 26 ? 5.758   12.472 6.233   1.00 19.15  ? 157  ASP A OD1 1 
ATOM   203 O OD2 . ASP A 1 26 ? 3.877   13.493 5.792   1.00 18.06  ? 157  ASP A OD2 1 
ATOM   204 N N   . ILE A 1 27 ? 7.648   13.275 1.974   1.00 16.95  ? 158  ILE A N   1 
ATOM   205 C CA  . ILE A 1 27 ? 7.985   13.535 0.575   1.00 17.21  ? 158  ILE A CA  1 
ATOM   206 C C   . ILE A 1 27 ? 6.658   13.713 -0.165  1.00 16.76  ? 158  ILE A C   1 
ATOM   207 O O   . ILE A 1 27 ? 5.754   12.887 -0.043  1.00 17.04  ? 158  ILE A O   1 
ATOM   208 C CB  . ILE A 1 27 ? 8.798   12.367 -0.058  1.00 17.40  ? 158  ILE A CB  1 
ATOM   209 C CG1 . ILE A 1 27 ? 10.140  12.202 0.662   1.00 16.90  ? 158  ILE A CG1 1 
ATOM   210 C CG2 . ILE A 1 27 ? 9.024   12.607 -1.547  1.00 17.29  ? 158  ILE A CG2 1 
ATOM   211 C CD1 . ILE A 1 27 ? 11.029  13.421 0.604   1.00 17.65  ? 158  ILE A CD1 1 
ATOM   212 N N   . LEU A 1 28 ? 6.526   14.818 -0.887  1.00 15.30  ? 159  LEU A N   1 
ATOM   213 C CA  . LEU A 1 28 ? 5.304   15.106 -1.625  1.00 15.39  ? 159  LEU A CA  1 
ATOM   214 C C   . LEU A 1 28 ? 5.638   15.349 -3.086  1.00 14.75  ? 159  LEU A C   1 
ATOM   215 O O   . LEU A 1 28 ? 6.660   15.948 -3.399  1.00 13.05  ? 159  LEU A O   1 
ATOM   216 C CB  . LEU A 1 28 ? 4.631   16.347 -1.036  1.00 15.48  ? 159  LEU A CB  1 
ATOM   217 C CG  . LEU A 1 28 ? 4.435   16.345 0.484   1.00 16.92  ? 159  LEU A CG  1 
ATOM   218 C CD1 . LEU A 1 28 ? 4.095   17.746 0.979   1.00 17.34  ? 159  LEU A CD1 1 
ATOM   219 C CD2 . LEU A 1 28 ? 3.352   15.347 0.875   1.00 17.06  ? 159  LEU A CD2 1 
ATOM   220 N N   . ARG A 1 29 ? 4.793   14.863 -3.985  1.00 14.50  ? 160  ARG A N   1 
ATOM   221 C CA  . ARG A 1 29 ? 5.034   15.066 -5.404  1.00 15.23  ? 160  ARG A CA  1 
ATOM   222 C C   . ARG A 1 29 ? 4.261   16.284 -5.875  1.00 15.88  ? 160  ARG A C   1 
ATOM   223 O O   . ARG A 1 29 ? 3.073   16.418 -5.588  1.00 14.76  ? 160  ARG A O   1 
ATOM   224 C CB  . ARG A 1 29 ? 4.629   13.838 -6.215  1.00 16.38  ? 160  ARG A CB  1 
ATOM   225 C CG  . ARG A 1 29 ? 5.118   13.888 -7.654  1.00 21.01  ? 160  ARG A CG  1 
ATOM   226 C CD  . ARG A 1 29 ? 4.799   12.608 -8.402  1.00 26.10  ? 160  ARG A CD  1 
ATOM   227 N NE  . ARG A 1 29 ? 3.372   12.459 -8.668  1.00 30.19  ? 160  ARG A NE  1 
ATOM   228 C CZ  . ARG A 1 29 ? 2.746   12.969 -9.727  1.00 33.96  ? 160  ARG A CZ  1 
ATOM   229 N NH1 . ARG A 1 29 ? 3.419   13.672 -10.632 1.00 34.14  ? 160  ARG A NH1 1 
ATOM   230 N NH2 . ARG A 1 29 ? 1.446   12.763 -9.892  1.00 35.20  ? 160  ARG A NH2 1 
ATOM   231 N N   . ILE A 1 30 ? 4.945   17.178 -6.582  1.00 15.31  ? 161  ILE A N   1 
ATOM   232 C CA  . ILE A 1 30 ? 4.326   18.398 -7.092  1.00 16.23  ? 161  ILE A CA  1 
ATOM   233 C C   . ILE A 1 30 ? 3.553   18.150 -8.388  1.00 17.43  ? 161  ILE A C   1 
ATOM   234 O O   . ILE A 1 30 ? 4.115   17.669 -9.371  1.00 18.09  ? 161  ILE A O   1 
ATOM   235 C CB  . ILE A 1 30 ? 5.381   19.514 -7.304  1.00 14.74  ? 161  ILE A CB  1 
ATOM   236 C CG1 . ILE A 1 30 ? 6.157   19.761 -6.004  1.00 11.82  ? 161  ILE A CG1 1 
ATOM   237 C CG2 . ILE A 1 30 ? 4.709   20.799 -7.781  1.00 13.48  ? 161  ILE A CG2 1 
ATOM   238 C CD1 . ILE A 1 30 ? 5.288   20.098 -4.807  1.00 11.00  ? 161  ILE A CD1 1 
ATOM   239 N N   . ARG A 1 31 ? 2.265   18.493 -8.379  1.00 18.04  ? 162  ARG A N   1 
ATOM   240 C CA  . ARG A 1 31 ? 1.395   18.300 -9.542  1.00 18.53  ? 162  ARG A CA  1 
ATOM   241 C C   . ARG A 1 31 ? 1.042   19.590 -10.265 1.00 19.23  ? 162  ARG A C   1 
ATOM   242 O O   . ARG A 1 31 ? 0.951   19.612 -11.491 1.00 19.38  ? 162  ARG A O   1 
ATOM   243 C CB  . ARG A 1 31 ? 0.089   17.620 -9.126  1.00 20.01  ? 162  ARG A CB  1 
ATOM   244 C CG  . ARG A 1 31 ? 0.249   16.262 -8.473  1.00 22.60  ? 162  ARG A CG  1 
ATOM   245 C CD  . ARG A 1 31 ? -1.108  15.685 -8.086  1.00 27.10  ? 162  ARG A CD  1 
ATOM   246 N NE  . ARG A 1 31 ? -1.952  15.398 -9.247  1.00 29.45  ? 162  ARG A NE  1 
ATOM   247 C CZ  . ARG A 1 31 ? -2.996  16.133 -9.621  1.00 30.71  ? 162  ARG A CZ  1 
ATOM   248 N NH1 . ARG A 1 31 ? -3.337  17.210 -8.927  1.00 30.95  ? 162  ARG A NH1 1 
ATOM   249 N NH2 . ARG A 1 31 ? -3.702  15.790 -10.690 1.00 30.24  ? 162  ARG A NH2 1 
ATOM   250 N N   . ASP A 1 32 ? 0.842   20.660 -9.498  1.00 19.23  ? 163  ASP A N   1 
ATOM   251 C CA  . ASP A 1 32 ? 0.452   21.949 -10.056 1.00 20.67  ? 163  ASP A CA  1 
ATOM   252 C C   . ASP A 1 32 ? 1.073   23.107 -9.281  1.00 18.92  ? 163  ASP A C   1 
ATOM   253 O O   . ASP A 1 32 ? 1.393   22.970 -8.098  1.00 17.57  ? 163  ASP A O   1 
ATOM   254 C CB  . ASP A 1 32 ? -1.076  22.068 -9.981  1.00 23.24  ? 163  ASP A CB  1 
ATOM   255 C CG  . ASP A 1 32 ? -1.672  22.811 -11.151 1.00 27.04  ? 163  ASP A CG  1 
ATOM   256 O OD1 . ASP A 1 32 ? -1.463  24.036 -11.271 1.00 30.02  ? 163  ASP A OD1 1 
ATOM   257 O OD2 . ASP A 1 32 ? -2.386  22.162 -11.941 1.00 29.27  ? 163  ASP A OD2 1 
ATOM   258 N N   . LYS A 1 33 ? 1.220   24.247 -9.956  1.00 17.35  ? 164  LYS A N   1 
ATOM   259 C CA  . LYS A 1 33 ? 1.768   25.463 -9.357  1.00 18.10  ? 164  LYS A CA  1 
ATOM   260 C C   . LYS A 1 33 ? 0.904   26.665 -9.756  1.00 18.41  ? 164  LYS A C   1 
ATOM   261 O O   . LYS A 1 33 ? 1.314   27.497 -10.565 1.00 16.20  ? 164  LYS A O   1 
ATOM   262 C CB  . LYS A 1 33 ? 3.216   25.678 -9.803  1.00 17.87  ? 164  LYS A CB  1 
ATOM   263 C CG  . LYS A 1 33 ? 4.158   24.592 -9.324  1.00 17.88  ? 164  LYS A CG  1 
ATOM   264 C CD  . LYS A 1 33 ? 5.598   24.874 -9.698  1.00 19.15  ? 164  LYS A CD  1 
ATOM   265 C CE  . LYS A 1 33 ? 6.510   23.777 -9.167  1.00 17.63  ? 164  LYS A CE  1 
ATOM   266 N NZ  . LYS A 1 33 ? 7.938   24.030 -9.492  1.00 18.15  ? 164  LYS A NZ  1 
ATOM   267 N N   . PRO A 1 34 ? -0.318  26.759 -9.195  1.00 20.27  ? 165  PRO A N   1 
ATOM   268 C CA  . PRO A 1 34 ? -1.250  27.853 -9.491  1.00 20.85  ? 165  PRO A CA  1 
ATOM   269 C C   . PRO A 1 34 ? -0.838  29.190 -8.875  1.00 21.54  ? 165  PRO A C   1 
ATOM   270 O O   . PRO A 1 34 ? -1.303  30.247 -9.299  1.00 22.59  ? 165  PRO A O   1 
ATOM   271 C CB  . PRO A 1 34 ? -2.563  27.339 -8.905  1.00 20.61  ? 165  PRO A CB  1 
ATOM   272 C CG  . PRO A 1 34 ? -2.114  26.582 -7.718  1.00 22.32  ? 165  PRO A CG  1 
ATOM   273 C CD  . PRO A 1 34 ? -0.923  25.811 -8.239  1.00 20.77  ? 165  PRO A CD  1 
ATOM   274 N N   . GLU A 1 35 ? 0.046   29.125 -7.885  1.00 20.95  ? 166  GLU A N   1 
ATOM   275 C CA  . GLU A 1 35 ? 0.548   30.299 -7.183  1.00 20.66  ? 166  GLU A CA  1 
ATOM   276 C C   . GLU A 1 35 ? 2.021   30.120 -6.885  1.00 19.00  ? 166  GLU A C   1 
ATOM   277 O O   . GLU A 1 35 ? 2.536   29.009 -6.919  1.00 17.59  ? 166  GLU A O   1 
ATOM   278 C CB  . GLU A 1 35 ? -0.174  30.480 -5.850  1.00 23.06  ? 166  GLU A CB  1 
ATOM   279 C CG  . GLU A 1 35 ? -1.487  31.206 -5.915  1.00 26.30  ? 166  GLU A CG  1 
ATOM   280 C CD  . GLU A 1 35 ? -2.075  31.420 -4.536  1.00 26.70  ? 166  GLU A CD  1 
ATOM   281 O OE1 . GLU A 1 35 ? -1.364  31.956 -3.659  1.00 28.30  ? 166  GLU A OE1 1 
ATOM   282 O OE2 . GLU A 1 35 ? -3.248  31.050 -4.326  1.00 28.71  ? 166  GLU A OE2 1 
ATOM   283 N N   . GLU A 1 36 ? 2.677   31.219 -6.533  1.00 19.71  ? 167  GLU A N   1 
ATOM   284 C CA  . GLU A 1 36 ? 4.095   31.211 -6.205  1.00 20.18  ? 167  GLU A CA  1 
ATOM   285 C C   . GLU A 1 36 ? 4.327   30.532 -4.856  1.00 19.49  ? 167  GLU A C   1 
ATOM   286 O O   . GLU A 1 36 ? 5.290   29.787 -4.693  1.00 19.00  ? 167  GLU A O   1 
ATOM   287 C CB  . GLU A 1 36 ? 4.624   32.650 -6.149  1.00 22.32  ? 167  GLU A CB  1 
ATOM   288 C CG  . GLU A 1 36 ? 4.047   33.458 -4.988  1.00 26.52  ? 167  GLU A CG  1 
ATOM   289 C CD  . GLU A 1 36 ? 4.187   34.958 -5.140  1.00 28.73  ? 167  GLU A CD  1 
ATOM   290 O OE1 . GLU A 1 36 ? 4.030   35.456 -6.271  1.00 29.30  ? 167  GLU A OE1 1 
ATOM   291 O OE2 . GLU A 1 36 ? 4.426   35.642 -4.120  1.00 27.31  ? 167  GLU A OE2 1 
ATOM   292 N N   . GLN A 1 37 ? 3.418   30.763 -3.906  1.00 17.74  ? 168  GLN A N   1 
ATOM   293 C CA  . GLN A 1 37 ? 3.553   30.209 -2.560  1.00 15.64  ? 168  GLN A CA  1 
ATOM   294 C C   . GLN A 1 37 ? 2.583   29.078 -2.189  1.00 13.97  ? 168  GLN A C   1 
ATOM   295 O O   . GLN A 1 37 ? 2.620   28.572 -1.064  1.00 13.21  ? 168  GLN A O   1 
ATOM   296 C CB  . GLN A 1 37 ? 3.472   31.334 -1.525  1.00 17.42  ? 168  GLN A CB  1 
ATOM   297 C CG  . GLN A 1 37 ? 4.389   32.537 -1.792  1.00 20.97  ? 168  GLN A CG  1 
ATOM   298 C CD  . GLN A 1 37 ? 5.873   32.217 -1.685  1.00 21.83  ? 168  GLN A CD  1 
ATOM   299 O OE1 . GLN A 1 37 ? 6.317   31.557 -0.744  1.00 24.16  ? 168  GLN A OE1 1 
ATOM   300 N NE2 . GLN A 1 37 ? 6.653   32.706 -2.643  1.00 23.55  ? 168  GLN A NE2 1 
ATOM   301 N N   . TRP A 1 38 ? 1.726   28.683 -3.126  1.00 12.86  ? 169  TRP A N   1 
ATOM   302 C CA  . TRP A 1 38 ? 0.776   27.598 -2.891  1.00 13.33  ? 169  TRP A CA  1 
ATOM   303 C C   . TRP A 1 38 ? 0.763   26.647 -4.083  1.00 12.76  ? 169  TRP A C   1 
ATOM   304 O O   . TRP A 1 38 ? 0.375   27.020 -5.188  1.00 13.37  ? 169  TRP A O   1 
ATOM   305 C CB  . TRP A 1 38 ? -0.638  28.138 -2.609  1.00 14.80  ? 169  TRP A CB  1 
ATOM   306 C CG  . TRP A 1 38 ? -0.800  28.732 -1.226  1.00 14.15  ? 169  TRP A CG  1 
ATOM   307 C CD1 . TRP A 1 38 ? -0.622  30.041 -0.868  1.00 12.03  ? 169  TRP A CD1 1 
ATOM   308 C CD2 . TRP A 1 38 ? -1.106  28.025 -0.013  1.00 12.39  ? 169  TRP A CD2 1 
ATOM   309 N NE1 . TRP A 1 38 ? -0.784  30.189 0.486   1.00 11.32  ? 169  TRP A NE1 1 
ATOM   310 C CE2 . TRP A 1 38 ? -1.083  28.971 1.037   1.00 11.94  ? 169  TRP A CE2 1 
ATOM   311 C CE3 . TRP A 1 38 ? -1.391  26.684 0.288   1.00 11.48  ? 169  TRP A CE3 1 
ATOM   312 C CZ2 . TRP A 1 38 ? -1.329  28.620 2.372   1.00 14.37  ? 169  TRP A CZ2 1 
ATOM   313 C CZ3 . TRP A 1 38 ? -1.636  26.332 1.616   1.00 11.69  ? 169  TRP A CZ3 1 
ATOM   314 C CH2 . TRP A 1 38 ? -1.603  27.298 2.641   1.00 14.75  ? 169  TRP A CH2 1 
ATOM   315 N N   . TRP A 1 39 ? 1.234   25.425 -3.855  1.00 14.28  ? 170  TRP A N   1 
ATOM   316 C CA  . TRP A 1 39 ? 1.292   24.406 -4.898  1.00 13.55  ? 170  TRP A CA  1 
ATOM   317 C C   . TRP A 1 39 ? 0.360   23.230 -4.604  1.00 15.00  ? 170  TRP A C   1 
ATOM   318 O O   . TRP A 1 39 ? 0.018   22.961 -3.450  1.00 16.94  ? 170  TRP A O   1 
ATOM   319 C CB  . TRP A 1 39 ? 2.728   23.881 -5.058  1.00 14.58  ? 170  TRP A CB  1 
ATOM   320 C CG  . TRP A 1 39 ? 3.730   24.897 -5.550  1.00 15.15  ? 170  TRP A CG  1 
ATOM   321 C CD1 . TRP A 1 39 ? 3.464   26.129 -6.076  1.00 16.60  ? 170  TRP A CD1 1 
ATOM   322 C CD2 . TRP A 1 39 ? 5.162   24.762 -5.559  1.00 15.71  ? 170  TRP A CD2 1 
ATOM   323 N NE1 . TRP A 1 39 ? 4.637   26.769 -6.412  1.00 15.92  ? 170  TRP A NE1 1 
ATOM   324 C CE2 . TRP A 1 39 ? 5.692   25.953 -6.105  1.00 16.23  ? 170  TRP A CE2 1 
ATOM   325 C CE3 . TRP A 1 39 ? 6.044   23.749 -5.157  1.00 17.04  ? 170  TRP A CE3 1 
ATOM   326 C CZ2 . TRP A 1 39 ? 7.070   26.162 -6.259  1.00 17.34  ? 170  TRP A CZ2 1 
ATOM   327 C CZ3 . TRP A 1 39 ? 7.416   23.956 -5.311  1.00 16.88  ? 170  TRP A CZ3 1 
ATOM   328 C CH2 . TRP A 1 39 ? 7.913   25.156 -5.858  1.00 17.20  ? 170  TRP A CH2 1 
ATOM   329 N N   . ASN A 1 40 ? -0.084  22.564 -5.663  1.00 15.03  ? 171  ASN A N   1 
ATOM   330 C CA  . ASN A 1 40 ? -0.948  21.398 -5.529  1.00 16.71  ? 171  ASN A CA  1 
ATOM   331 C C   . ASN A 1 40 ? -0.028  20.174 -5.523  1.00 16.14  ? 171  ASN A C   1 
ATOM   332 O O   . ASN A 1 40 ? 0.693   19.913 -6.490  1.00 16.81  ? 171  ASN A O   1 
ATOM   333 C CB  . ASN A 1 40 ? -1.938  21.326 -6.694  1.00 17.11  ? 171  ASN A CB  1 
ATOM   334 C CG  . ASN A 1 40 ? -2.907  20.170 -6.563  1.00 20.10  ? 171  ASN A CG  1 
ATOM   335 O OD1 . ASN A 1 40 ? -2.811  19.181 -7.291  1.00 23.53  ? 171  ASN A OD1 1 
ATOM   336 N ND2 . ASN A 1 40 ? -3.841  20.282 -5.622  1.00 22.64  ? 171  ASN A ND2 1 
ATOM   337 N N   . ALA A 1 41 ? -0.029  19.448 -4.413  1.00 16.90  ? 172  ALA A N   1 
ATOM   338 C CA  . ALA A 1 41 ? 0.828   18.281 -4.281  1.00 18.06  ? 172  ALA A CA  1 
ATOM   339 C C   . ALA A 1 41 ? 0.049   17.000 -4.007  1.00 19.82  ? 172  ALA A C   1 
ATOM   340 O O   . ALA A 1 41 ? -1.172  17.020 -3.844  1.00 19.52  ? 172  ALA A O   1 
ATOM   341 C CB  . ALA A 1 41 ? 1.869   18.521 -3.189  1.00 15.55  ? 172  ALA A CB  1 
ATOM   342 N N   . GLU A 1 42 ? 0.782   15.891 -3.963  1.00 19.78  ? 173  GLU A N   1 
ATOM   343 C CA  . GLU A 1 42 ? 0.228   14.567 -3.717  1.00 21.33  ? 173  GLU A CA  1 
ATOM   344 C C   . GLU A 1 42 ? 1.183   13.825 -2.792  1.00 20.58  ? 173  GLU A C   1 
ATOM   345 O O   . GLU A 1 42 ? 2.387   13.809 -3.031  1.00 19.77  ? 173  GLU A O   1 
ATOM   346 C CB  . GLU A 1 42 ? 0.097   13.811 -5.046  1.00 24.13  ? 173  GLU A CB  1 
ATOM   347 C CG  . GLU A 1 42 ? -0.378  12.368 -4.931  1.00 28.54  ? 173  GLU A CG  1 
ATOM   348 C CD  . GLU A 1 42 ? -0.468  11.672 -6.279  1.00 32.85  ? 173  GLU A CD  1 
ATOM   349 O OE1 . GLU A 1 42 ? 0.507   11.742 -7.057  1.00 34.84  ? 173  GLU A OE1 1 
ATOM   350 O OE2 . GLU A 1 42 ? -1.514  11.052 -6.565  1.00 34.62  ? 173  GLU A OE2 1 
ATOM   351 N N   . ASP A 1 43 ? 0.657   13.242 -1.718  1.00 19.16  ? 174  ASP A N   1 
ATOM   352 C CA  . ASP A 1 43 ? 1.504   12.499 -0.793  1.00 18.43  ? 174  ASP A CA  1 
ATOM   353 C C   . ASP A 1 43 ? 1.770   11.079 -1.268  1.00 19.26  ? 174  ASP A C   1 
ATOM   354 O O   . ASP A 1 43 ? 1.334   10.680 -2.353  1.00 18.16  ? 174  ASP A O   1 
ATOM   355 C CB  . ASP A 1 43 ? 0.947   12.512 0.642   1.00 17.06  ? 174  ASP A CB  1 
ATOM   356 C CG  . ASP A 1 43 ? -0.419  11.840 0.776   1.00 19.73  ? 174  ASP A CG  1 
ATOM   357 O OD1 . ASP A 1 43 ? -0.779  10.955 -0.030  1.00 19.23  ? 174  ASP A OD1 1 
ATOM   358 O OD2 . ASP A 1 43 ? -1.137  12.196 1.727   1.00 19.09  ? 174  ASP A OD2 1 
ATOM   359 N N   . SER A 1 44 ? 2.467   10.326 -0.423  1.00 22.05  ? 175  SER A N   1 
ATOM   360 C CA  . SER A 1 44 ? 2.848   8.943  -0.688  1.00 24.48  ? 175  SER A CA  1 
ATOM   361 C C   . SER A 1 44 ? 1.664   8.004  -0.900  1.00 25.78  ? 175  SER A C   1 
ATOM   362 O O   . SER A 1 44 ? 1.754   7.048  -1.671  1.00 27.41  ? 175  SER A O   1 
ATOM   363 C CB  . SER A 1 44 ? 3.712   8.425  0.464   1.00 23.31  ? 175  SER A CB  1 
ATOM   364 O OG  . SER A 1 44 ? 4.339   7.207  0.122   1.00 25.82  ? 175  SER A OG  1 
ATOM   365 N N   . GLU A 1 45 ? 0.557   8.293  -0.219  1.00 26.06  ? 176  GLU A N   1 
ATOM   366 C CA  . GLU A 1 45 ? -0.657  7.481  -0.299  1.00 25.60  ? 176  GLU A CA  1 
ATOM   367 C C   . GLU A 1 45 ? -1.620  7.903  -1.406  1.00 25.60  ? 176  GLU A C   1 
ATOM   368 O O   . GLU A 1 45 ? -2.717  7.353  -1.517  1.00 27.19  ? 176  GLU A O   1 
ATOM   369 C CB  . GLU A 1 45 ? -1.386  7.516  1.040   1.00 23.98  ? 176  GLU A CB  1 
ATOM   370 C CG  . GLU A 1 45 ? -0.596  6.927  2.183   1.00 27.20  ? 176  GLU A CG  1 
ATOM   371 C CD  . GLU A 1 45 ? -1.190  7.279  3.528   1.00 29.90  ? 176  GLU A CD  1 
ATOM   372 O OE1 . GLU A 1 45 ? -2.421  7.134  3.702   1.00 34.58  ? 176  GLU A OE1 1 
ATOM   373 O OE2 . GLU A 1 45 ? -0.423  7.712  4.415   1.00 32.08  ? 176  GLU A OE2 1 
ATOM   374 N N   . GLY A 1 46 ? -1.231  8.898  -2.198  1.00 25.50  ? 177  GLY A N   1 
ATOM   375 C CA  . GLY A 1 46 ? -2.083  9.343  -3.287  1.00 25.36  ? 177  GLY A CA  1 
ATOM   376 C C   . GLY A 1 46 ? -3.104  10.428 -2.984  1.00 24.59  ? 177  GLY A C   1 
ATOM   377 O O   . GLY A 1 46 ? -3.912  10.765 -3.852  1.00 25.12  ? 177  GLY A O   1 
ATOM   378 N N   . LYS A 1 47 ? -3.097  10.958 -1.763  1.00 25.39  ? 178  LYS A N   1 
ATOM   379 C CA  . LYS A 1 47 ? -4.027  12.029 -1.398  1.00 24.97  ? 178  LYS A CA  1 
ATOM   380 C C   . LYS A 1 47 ? -3.502  13.355 -1.941  1.00 24.84  ? 178  LYS A C   1 
ATOM   381 O O   . LYS A 1 47 ? -2.328  13.679 -1.770  1.00 23.54  ? 178  LYS A O   1 
ATOM   382 C CB  . LYS A 1 47 ? -4.195  12.112 0.119   1.00 24.88  ? 178  LYS A CB  1 
ATOM   383 C CG  . LYS A 1 47 ? -4.845  10.886 0.732   1.00 26.83  ? 178  LYS A CG  1 
ATOM   384 C CD  . LYS A 1 47 ? -3.941  10.264 1.776   1.00 30.19  ? 178  LYS A CD  1 
ATOM   385 C CE  . LYS A 1 47 ? -3.737  11.201 2.953   1.00 31.58  ? 178  LYS A CE  1 
ATOM   386 N NZ  . LYS A 1 47 ? -2.670  10.711 3.867   1.00 36.30  ? 178  LYS A NZ  1 
ATOM   387 N N   . ARG A 1 48 ? -4.372  14.105 -2.610  1.00 23.84  ? 179  ARG A N   1 
ATOM   388 C CA  . ARG A 1 48 ? -3.991  15.384 -3.199  1.00 23.80  ? 179  ARG A CA  1 
ATOM   389 C C   . ARG A 1 48 ? -4.484  16.587 -2.404  1.00 22.60  ? 179  ARG A C   1 
ATOM   390 O O   . ARG A 1 48 ? -5.418  16.474 -1.610  1.00 23.06  ? 179  ARG A O   1 
ATOM   391 C CB  . ARG A 1 48 ? -4.490  15.463 -4.646  1.00 26.03  ? 179  ARG A CB  1 
ATOM   392 C CG  . ARG A 1 48 ? -3.946  14.357 -5.535  1.00 29.76  ? 179  ARG A CG  1 
ATOM   393 C CD  . ARG A 1 48 ? -4.596  14.368 -6.903  1.00 32.21  ? 179  ARG A CD  1 
ATOM   394 N NE  . ARG A 1 48 ? -4.238  13.187 -7.688  1.00 33.87  ? 179  ARG A NE  1 
ATOM   395 C CZ  . ARG A 1 48 ? -4.825  12.842 -8.830  1.00 33.35  ? 179  ARG A CZ  1 
ATOM   396 N NH1 . ARG A 1 48 ? -5.801  13.588 -9.328  1.00 36.03  ? 179  ARG A NH1 1 
ATOM   397 N NH2 . ARG A 1 48 ? -4.438  11.751 -9.477  1.00 33.64  ? 179  ARG A NH2 1 
ATOM   398 N N   . GLY A 1 49 ? -3.837  17.732 -2.610  1.00 20.97  ? 180  GLY A N   1 
ATOM   399 C CA  . GLY A 1 49 ? -4.225  18.945 -1.909  1.00 19.12  ? 180  GLY A CA  1 
ATOM   400 C C   . GLY A 1 49 ? -3.199  20.059 -2.009  1.00 19.53  ? 180  GLY A C   1 
ATOM   401 O O   . GLY A 1 49 ? -2.082  19.850 -2.482  1.00 19.47  ? 180  GLY A O   1 
ATOM   402 N N   . MET A 1 50 ? -3.573  21.244 -1.539  1.00 18.05  ? 181  MET A N   1 
ATOM   403 C CA  . MET A 1 50 ? -2.690  22.405 -1.579  1.00 17.65  ? 181  MET A CA  1 
ATOM   404 C C   . MET A 1 50 ? -1.693  22.442 -0.419  1.00 15.39  ? 181  MET A C   1 
ATOM   405 O O   . MET A 1 50 ? -2.017  22.039 0.700   1.00 14.53  ? 181  MET A O   1 
ATOM   406 C CB  . MET A 1 50 ? -3.518  23.697 -1.578  1.00 19.88  ? 181  MET A CB  1 
ATOM   407 C CG  . MET A 1 50 ? -4.544  23.790 -2.697  1.00 21.05  ? 181  MET A CG  1 
ATOM   408 S SD  . MET A 1 50 ? -3.816  23.646 -4.338  1.00 24.90  ? 181  MET A SD  1 
ATOM   409 C CE  . MET A 1 50 ? -3.043  25.245 -4.502  1.00 24.54  ? 181  MET A CE  1 
ATOM   410 N N   . ILE A 1 51 ? -0.488  22.947 -0.692  1.00 14.68  ? 182  ILE A N   1 
ATOM   411 C CA  . ILE A 1 51 ? 0.559   23.059 0.329   1.00 12.85  ? 182  ILE A CA  1 
ATOM   412 C C   . ILE A 1 51 ? 1.283   24.413 0.280   1.00 10.49  ? 182  ILE A C   1 
ATOM   413 O O   . ILE A 1 51 ? 1.406   25.028 -0.781  1.00 9.20   ? 182  ILE A O   1 
ATOM   414 C CB  . ILE A 1 51 ? 1.636   21.934 0.205   1.00 11.85  ? 182  ILE A CB  1 
ATOM   415 C CG1 . ILE A 1 51 ? 2.329   21.992 -1.161  1.00 11.74  ? 182  ILE A CG1 1 
ATOM   416 C CG2 . ILE A 1 51 ? 1.012   20.558 0.457   1.00 11.98  ? 182  ILE A CG2 1 
ATOM   417 C CD1 . ILE A 1 51 ? 3.584   21.136 -1.255  1.00 10.49  ? 182  ILE A CD1 1 
ATOM   418 N N   . PRO A 1 52 ? 1.714   24.921 1.446   1.00 11.48  ? 183  PRO A N   1 
ATOM   419 C CA  . PRO A 1 52 ? 2.425   26.203 1.487   1.00 11.71  ? 183  PRO A CA  1 
ATOM   420 C C   . PRO A 1 52 ? 3.909   25.954 1.193   1.00 11.05  ? 183  PRO A C   1 
ATOM   421 O O   . PRO A 1 52 ? 4.585   25.212 1.916   1.00 9.71   ? 183  PRO A O   1 
ATOM   422 C CB  . PRO A 1 52 ? 2.184   26.675 2.918   1.00 12.23  ? 183  PRO A CB  1 
ATOM   423 C CG  . PRO A 1 52 ? 2.170   25.394 3.691   1.00 14.37  ? 183  PRO A CG  1 
ATOM   424 C CD  . PRO A 1 52 ? 1.379   24.455 2.804   1.00 11.80  ? 183  PRO A CD  1 
ATOM   425 N N   . VAL A 1 53 ? 4.392   26.559 0.111   1.00 10.46  ? 184  VAL A N   1 
ATOM   426 C CA  . VAL A 1 53 ? 5.780   26.409 -0.335  1.00 12.35  ? 184  VAL A CA  1 
ATOM   427 C C   . VAL A 1 53 ? 6.863   26.645 0.733   1.00 12.46  ? 184  VAL A C   1 
ATOM   428 O O   . VAL A 1 53 ? 7.835   25.892 0.798   1.00 13.63  ? 184  VAL A O   1 
ATOM   429 C CB  . VAL A 1 53 ? 6.057   27.273 -1.599  1.00 12.70  ? 184  VAL A CB  1 
ATOM   430 C CG1 . VAL A 1 53 ? 7.522   27.146 -2.050  1.00 12.44  ? 184  VAL A CG1 1 
ATOM   431 C CG2 . VAL A 1 53 ? 5.125   26.853 -2.725  1.00 10.37  ? 184  VAL A CG2 1 
ATOM   432 N N   . PRO A 1 54 ? 6.723   27.696 1.568   1.00 13.09  ? 185  PRO A N   1 
ATOM   433 C CA  . PRO A 1 54 ? 7.730   27.959 2.608   1.00 14.53  ? 185  PRO A CA  1 
ATOM   434 C C   . PRO A 1 54 ? 7.875   26.840 3.648   1.00 12.89  ? 185  PRO A C   1 
ATOM   435 O O   . PRO A 1 54 ? 8.811   26.843 4.446   1.00 13.64  ? 185  PRO A O   1 
ATOM   436 C CB  . PRO A 1 54 ? 7.225   29.253 3.245   1.00 14.02  ? 185  PRO A CB  1 
ATOM   437 C CG  . PRO A 1 54 ? 6.580   29.945 2.108   1.00 15.34  ? 185  PRO A CG  1 
ATOM   438 C CD  . PRO A 1 54 ? 5.790   28.832 1.466   1.00 13.12  ? 185  PRO A CD  1 
ATOM   439 N N   . TYR A 1 55 ? 6.946   25.888 3.636   1.00 14.19  ? 186  TYR A N   1 
ATOM   440 C CA  . TYR A 1 55 ? 6.976   24.764 4.572   1.00 14.35  ? 186  TYR A CA  1 
ATOM   441 C C   . TYR A 1 55 ? 7.713   23.545 4.022   1.00 12.72  ? 186  TYR A C   1 
ATOM   442 O O   . TYR A 1 55 ? 7.904   22.562 4.733   1.00 11.87  ? 186  TYR A O   1 
ATOM   443 C CB  . TYR A 1 55 ? 5.551   24.355 4.975   1.00 15.33  ? 186  TYR A CB  1 
ATOM   444 C CG  . TYR A 1 55 ? 4.958   25.188 6.087   1.00 14.85  ? 186  TYR A CG  1 
ATOM   445 C CD1 . TYR A 1 55 ? 5.013   26.582 6.052   1.00 14.41  ? 186  TYR A CD1 1 
ATOM   446 C CD2 . TYR A 1 55 ? 4.360   24.580 7.187   1.00 13.24  ? 186  TYR A CD2 1 
ATOM   447 C CE1 . TYR A 1 55 ? 4.484   27.348 7.090   1.00 17.75  ? 186  TYR A CE1 1 
ATOM   448 C CE2 . TYR A 1 55 ? 3.829   25.333 8.226   1.00 16.90  ? 186  TYR A CE2 1 
ATOM   449 C CZ  . TYR A 1 55 ? 3.895   26.717 8.173   1.00 16.89  ? 186  TYR A CZ  1 
ATOM   450 O OH  . TYR A 1 55 ? 3.369   27.463 9.201   1.00 20.76  ? 186  TYR A OH  1 
ATOM   451 N N   . VAL A 1 56 ? 8.091   23.596 2.748   1.00 12.93  ? 187  VAL A N   1 
ATOM   452 C CA  . VAL A 1 56 ? 8.799   22.484 2.116   1.00 12.78  ? 187  VAL A CA  1 
ATOM   453 C C   . VAL A 1 56 ? 10.067  22.961 1.407   1.00 13.93  ? 187  VAL A C   1 
ATOM   454 O O   . VAL A 1 56 ? 10.262  24.156 1.186   1.00 15.34  ? 187  VAL A O   1 
ATOM   455 C CB  . VAL A 1 56 ? 7.897   21.738 1.076   1.00 11.81  ? 187  VAL A CB  1 
ATOM   456 C CG1 . VAL A 1 56 ? 6.583   21.324 1.711   1.00 11.32  ? 187  VAL A CG1 1 
ATOM   457 C CG2 . VAL A 1 56 ? 7.655   22.606 -0.157  1.00 9.80   ? 187  VAL A CG2 1 
ATOM   458 N N   . GLU A 1 57 ? 10.940  22.017 1.081   1.00 15.51  ? 188  GLU A N   1 
ATOM   459 C CA  . GLU A 1 57 ? 12.169  22.328 0.367   1.00 16.21  ? 188  GLU A CA  1 
ATOM   460 C C   . GLU A 1 57 ? 12.194  21.459 -0.884  1.00 17.92  ? 188  GLU A C   1 
ATOM   461 O O   . GLU A 1 57 ? 11.619  20.364 -0.898  1.00 16.89  ? 188  GLU A O   1 
ATOM   462 C CB  . GLU A 1 57 ? 13.405  22.060 1.239   1.00 18.03  ? 188  GLU A CB  1 
ATOM   463 C CG  . GLU A 1 57 ? 13.692  20.582 1.543   1.00 19.55  ? 188  GLU A CG  1 
ATOM   464 C CD  . GLU A 1 57 ? 14.926  20.381 2.414   1.00 20.07  ? 188  GLU A CD  1 
ATOM   465 O OE1 . GLU A 1 57 ? 15.813  21.261 2.427   1.00 21.57  ? 188  GLU A OE1 1 
ATOM   466 O OE2 . GLU A 1 57 ? 15.010  19.342 3.097   1.00 21.61  ? 188  GLU A OE2 1 
ATOM   467 N N   . LYS A 1 58 ? 12.807  21.976 -1.945  1.00 18.00  ? 189  LYS A N   1 
ATOM   468 C CA  . LYS A 1 58 ? 12.923  21.262 -3.212  1.00 20.41  ? 189  LYS A CA  1 
ATOM   469 C C   . LYS A 1 58 ? 13.701  19.972 -2.956  1.00 21.05  ? 189  LYS A C   1 
ATOM   470 O O   . LYS A 1 58 ? 14.870  20.020 -2.567  1.00 21.69  ? 189  LYS A O   1 
ATOM   471 C CB  . LYS A 1 58 ? 13.690  22.126 -4.216  1.00 22.73  ? 189  LYS A CB  1 
ATOM   472 C CG  . LYS A 1 58 ? 13.069  22.212 -5.594  1.00 23.46  ? 189  LYS A CG  1 
ATOM   473 C CD  . LYS A 1 58 ? 12.354  23.540 -5.812  1.00 24.23  ? 189  LYS A CD  1 
ATOM   474 C CE  . LYS A 1 58 ? 11.883  23.651 -7.256  1.00 25.77  ? 189  LYS A CE  1 
ATOM   475 N NZ  . LYS A 1 58 ? 11.281  24.971 -7.578  1.00 27.13  ? 189  LYS A NZ  1 
ATOM   476 N N   . TYR A 1 59 ? 13.052  18.825 -3.132  1.00 21.43  ? 190  TYR A N   1 
ATOM   477 C CA  . TYR A 1 59 ? 13.726  17.553 -2.902  1.00 22.94  ? 190  TYR A CA  1 
ATOM   478 C C   . TYR A 1 59 ? 14.800  17.313 -3.948  1.00 24.37  ? 190  TYR A C   1 
ATOM   479 O O   . TYR A 1 59 ? 14.522  17.303 -5.150  1.00 23.41  ? 190  TYR A O   1 
ATOM   480 C CB  . TYR A 1 59 ? 12.739  16.393 -2.901  1.00 21.75  ? 190  TYR A CB  1 
ATOM   481 C CG  . TYR A 1 59 ? 13.378  15.066 -2.587  1.00 19.58  ? 190  TYR A CG  1 
ATOM   482 C CD1 . TYR A 1 59 ? 13.986  14.841 -1.353  1.00 19.19  ? 190  TYR A CD1 1 
ATOM   483 C CD2 . TYR A 1 59 ? 13.385  14.037 -3.524  1.00 19.97  ? 190  TYR A CD2 1 
ATOM   484 C CE1 . TYR A 1 59 ? 14.581  13.629 -1.056  1.00 17.32  ? 190  TYR A CE1 1 
ATOM   485 C CE2 . TYR A 1 59 ? 13.979  12.819 -3.238  1.00 19.79  ? 190  TYR A CE2 1 
ATOM   486 C CZ  . TYR A 1 59 ? 14.575  12.623 -2.001  1.00 18.45  ? 190  TYR A CZ  1 
ATOM   487 O OH  . TYR A 1 59 ? 15.160  11.417 -1.710  1.00 18.87  ? 190  TYR A OH  1 
ATOM   488 N N   . HIS A 1 60 ? 16.027  17.117 -3.472  1.00 26.77  ? 191  HIS A N   1 
ATOM   489 C CA  . HIS A 1 60 ? 17.178  16.887 -4.335  1.00 29.16  ? 191  HIS A CA  1 
ATOM   490 C C   . HIS A 1 60 ? 17.422  18.093 -5.255  1.00 29.05  ? 191  HIS A C   1 
ATOM   491 O O   . HIS A 1 60 ? 17.679  17.896 -6.465  1.00 30.49  ? 191  HIS A O   1 
ATOM   492 C CB  . HIS A 1 60 ? 16.987  15.596 -5.145  1.00 31.38  ? 191  HIS A CB  1 
ATOM   493 C CG  . HIS A 1 60 ? 18.008  14.540 -4.852  1.00 35.49  ? 191  HIS A CG  1 
ATOM   494 N ND1 . HIS A 1 60 ? 18.125  13.389 -5.603  1.00 35.98  ? 191  HIS A ND1 1 
ATOM   495 C CD2 . HIS A 1 60 ? 18.971  14.468 -3.902  1.00 36.16  ? 191  HIS A CD2 1 
ATOM   496 C CE1 . HIS A 1 60 ? 19.115  12.657 -5.131  1.00 35.69  ? 191  HIS A CE1 1 
ATOM   497 N NE2 . HIS A 1 60 ? 19.646  13.286 -4.099  1.00 36.23  ? 191  HIS A NE2 1 
ATOM   498 N N   . GLU B 2 2  ? 3.885   28.856 17.888  1.00 39.21  ? 2    GLU C N   1 
ATOM   499 C CA  . GLU B 2 2  ? 4.093   28.745 16.415  1.00 37.68  ? 2    GLU C CA  1 
ATOM   500 C C   . GLU B 2 2  ? 5.578   28.706 16.053  1.00 35.51  ? 2    GLU C C   1 
ATOM   501 O O   . GLU B 2 2  ? 6.200   29.747 15.827  1.00 35.88  ? 2    GLU C O   1 
ATOM   502 C CB  . GLU B 2 2  ? 3.406   29.910 15.701  1.00 37.59  ? 2    GLU C CB  1 
ATOM   503 N N   . VAL B 2 3  ? 6.139   27.500 16.000  1.00 34.17  ? 3    VAL C N   1 
ATOM   504 C CA  . VAL B 2 3  ? 7.545   27.315 15.650  1.00 30.31  ? 3    VAL C CA  1 
ATOM   505 C C   . VAL B 2 3  ? 7.790   27.794 14.222  1.00 28.57  ? 3    VAL C C   1 
ATOM   506 O O   . VAL B 2 3  ? 8.694   28.589 13.989  1.00 28.19  ? 3    VAL C O   1 
ATOM   507 C CB  . VAL B 2 3  ? 7.957   25.858 15.819  1.00 29.87  ? 3    VAL C CB  1 
ATOM   508 N N   . PRO B 2 4  ? 6.977   27.327 13.250  1.00 26.83  ? 4    PRO C N   1 
ATOM   509 C CA  . PRO B 2 4  ? 7.162   27.765 11.863  1.00 25.56  ? 4    PRO C CA  1 
ATOM   510 C C   . PRO B 2 4  ? 6.552   29.160 11.725  1.00 24.11  ? 4    PRO C C   1 
ATOM   511 O O   . PRO B 2 4  ? 5.693   29.547 12.523  1.00 23.81  ? 4    PRO C O   1 
ATOM   512 C CB  . PRO B 2 4  ? 6.326   26.756 11.061  1.00 24.63  ? 4    PRO C CB  1 
ATOM   513 C CG  . PRO B 2 4  ? 6.112   25.612 12.004  1.00 25.51  ? 4    PRO C CG  1 
ATOM   514 C CD  . PRO B 2 4  ? 5.931   26.293 13.314  1.00 26.68  ? 4    PRO C CD  1 
ATOM   515 N N   . GLY B 2 5  ? 6.985   29.927 10.712  1.00 21.82  ? 5    GLY C N   1 
ATOM   516 C CA  . GLY B 2 5  ? 6.316   31.174 10.379  1.00 21.86  ? 5    GLY C CA  1 
ATOM   517 C C   . GLY B 2 5  ? 4.908   30.917 9.866   1.00 21.82  ? 5    GLY C C   1 
ATOM   518 N N   . PRO B 2 6  ? 4.068   31.957 9.763   1.00 21.83  ? 6    PRO C N   1 
ATOM   519 C CA  . PRO B 2 6  ? 2.688   31.823 9.280   1.00 22.20  ? 6    PRO C CA  1 
ATOM   520 C C   . PRO B 2 6  ? 2.671   31.388 7.819   1.00 21.74  ? 6    PRO C C   1 
ATOM   521 O O   . PRO B 2 6  ? 3.616   31.667 7.079   1.00 20.01  ? 6    PRO C O   1 
ATOM   522 C CB  . PRO B 2 6  ? 2.144   33.247 9.410   1.00 22.47  ? 6    PRO C CB  1 
ATOM   523 C CG  . PRO B 2 6  ? 2.978   33.850 10.484  1.00 22.83  ? 6    PRO C CG  1 
ATOM   524 C CD  . PRO B 2 6  ? 4.347   33.346 10.158  1.00 22.83  ? 6    PRO C CD  1 
ATOM   525 N N   . VAL B 2 7  ? 1.616   30.691 7.404   1.00 21.60  ? 7    VAL C N   1 
ATOM   526 C CA  . VAL B 2 7  ? 1.510   30.267 6.006   1.00 22.70  ? 7    VAL C CA  1 
ATOM   527 C C   . VAL B 2 7  ? 1.364   31.518 5.127   1.00 22.75  ? 7    VAL C C   1 
ATOM   528 O O   . VAL B 2 7  ? 0.862   32.544 5.582   1.00 23.07  ? 7    VAL C O   1 
ATOM   529 C CB  . VAL B 2 7  ? 0.330   29.276 5.775   1.00 23.89  ? 7    VAL C CB  1 
ATOM   530 C CG1 . VAL B 2 7  ? 0.669   27.917 6.364   1.00 24.36  ? 7    VAL C CG1 1 
ATOM   531 C CG2 . VAL B 2 7  ? -0.954  29.807 6.395   1.00 25.63  ? 7    VAL C CG2 1 
ATOM   532 N N   . PRO B 2 8  ? 1.855   31.467 3.876   1.00 23.08  ? 8    PRO C N   1 
ATOM   533 C CA  . PRO B 2 8  ? 1.759   32.626 2.979   1.00 21.41  ? 8    PRO C CA  1 
ATOM   534 C C   . PRO B 2 8  ? 0.331   32.960 2.553   1.00 20.20  ? 8    PRO C C   1 
ATOM   535 O O   . PRO B 2 8  ? -0.556  32.105 2.599   1.00 18.67  ? 8    PRO C O   1 
ATOM   536 C CB  . PRO B 2 8  ? 2.613   32.199 1.786   1.00 20.50  ? 8    PRO C CB  1 
ATOM   537 C CG  . PRO B 2 8  ? 2.405   30.720 1.746   1.00 20.86  ? 8    PRO C CG  1 
ATOM   538 C CD  . PRO B 2 8  ? 2.528   30.341 3.201   1.00 22.61  ? 8    PRO C CD  1 
ATOM   539 N N   . PRO B 2 9  ? 0.087   34.225 2.165   1.00 20.15  ? 9    PRO C N   1 
ATOM   540 C CA  . PRO B 2 9  ? -1.232  34.683 1.727   1.00 20.04  ? 9    PRO C CA  1 
ATOM   541 C C   . PRO B 2 9  ? -1.686  33.893 0.510   1.00 19.01  ? 9    PRO C C   1 
ATOM   542 O O   . PRO B 2 9  ? -0.885  33.607 -0.381  1.00 19.33  ? 9    PRO C O   1 
ATOM   543 C CB  . PRO B 2 9  ? -0.975  36.144 1.354   1.00 19.61  ? 9    PRO C CB  1 
ATOM   544 C CG  . PRO B 2 9  ? 0.111   36.544 2.294   1.00 20.41  ? 9    PRO C CG  1 
ATOM   545 C CD  . PRO B 2 9  ? 1.035   35.354 2.220   1.00 20.98  ? 9    PRO C CD  1 
ATOM   546 N N   . ARG B 2 10 ? -2.958  33.512 0.490   1.00 19.20  ? 10   ARG C N   1 
ATOM   547 C CA  . ARG B 2 10 ? -3.507  32.764 -0.630  1.00 22.21  ? 10   ARG C CA  1 
ATOM   548 C C   . ARG B 2 10 ? -3.976  33.747 -1.698  1.00 25.56  ? 10   ARG C C   1 
ATOM   549 O O   . ARG B 2 10 ? -4.725  34.680 -1.405  1.00 26.83  ? 10   ARG C O   1 
ATOM   550 C CB  . ARG B 2 10 ? -4.656  31.879 -0.156  1.00 21.38  ? 10   ARG C CB  1 
ATOM   551 C CG  . ARG B 2 10 ? -4.220  30.767 0.788   1.00 21.01  ? 10   ARG C CG  1 
ATOM   552 C CD  . ARG B 2 10 ? -5.419  30.090 1.420   1.00 22.71  ? 10   ARG C CD  1 
ATOM   553 N NE  . ARG B 2 10 ? -5.098  28.808 2.045   1.00 26.13  ? 10   ARG C NE  1 
ATOM   554 C CZ  . ARG B 2 10 ? -4.863  28.635 3.341   1.00 28.35  ? 10   ARG C CZ  1 
ATOM   555 N NH1 . ARG B 2 10 ? -4.898  29.667 4.176   1.00 32.20  ? 10   ARG C NH1 1 
ATOM   556 N NH2 . ARG B 2 10 ? -4.647  27.416 3.813   1.00 28.06  ? 10   ARG C NH2 1 
ATOM   557 N N   . ARG B 2 11 ? -3.477  33.556 -2.918  1.00 28.51  ? 11   ARG C N   1 
ATOM   558 C CA  . ARG B 2 11 ? -3.795  34.401 -4.070  1.00 33.31  ? 11   ARG C CA  1 
ATOM   559 C C   . ARG B 2 11 ? -3.388  35.856 -3.829  1.00 35.94  ? 11   ARG C C   1 
ATOM   560 O O   . ARG B 2 11 ? -2.180  36.074 -3.602  1.00 38.61  ? 11   ARG C O   1 
ATOM   561 C CB  . ARG B 2 11 ? -5.285  34.289 -4.436  1.00 33.84  ? 11   ARG C CB  1 
HETATM 562 C CB  . PYJ C 3 .  ? 7.897   29.750 9.573   1.00 18.54  ? 1005 PYJ C CB  1 
HETATM 563 C CX  . PYJ C 3 .  ? 7.580   29.245 8.154   1.00 16.82  ? 1005 PYJ C CX  1 
HETATM 564 C CG  . PYJ C 3 .  ? 9.130   30.594 9.737   1.00 21.75  ? 1005 PYJ C CG  1 
HETATM 565 C CD1 . PYJ C 3 .  ? 9.259   31.569 8.749   1.00 23.25  ? 1005 PYJ C CD1 1 
HETATM 566 C CD2 . PYJ C 3 .  ? 10.077  30.484 10.756  1.00 23.21  ? 1005 PYJ C CD2 1 
HETATM 567 C CE1 . PYJ C 3 .  ? 10.314  32.484 8.708   1.00 22.13  ? 1005 PYJ C CE1 1 
HETATM 568 C CE2 . PYJ C 3 .  ? 11.140  31.373 10.750  1.00 23.82  ? 1005 PYJ C CE2 1 
HETATM 569 C CZ  . PYJ C 3 .  ? 11.234  32.336 9.750   1.00 22.85  ? 1005 PYJ C CZ  1 
HETATM 570 O O   . HOH D 4 .  ? 1.296   32.735 -3.749  1.00 16.83  ? 21   HOH A O   1 
HETATM 571 O O   . HOH D 4 .  ? 1.790   33.921 -7.562  1.00 27.51  ? 22   HOH A O   1 
HETATM 572 O O   . HOH D 4 .  ? -7.141  19.404 5.620   1.00 28.98  ? 23   HOH A O   1 
HETATM 573 O O   . HOH D 4 .  ? 1.970   9.998  3.485   1.00 31.13  ? 24   HOH A O   1 
HETATM 574 O O   . HOH D 4 .  ? 3.342   29.476 -10.780 1.00 24.43  ? 25   HOH A O   1 
HETATM 575 O O   . HOH D 4 .  ? -7.324  28.687 8.205   1.00 30.05  ? 29   HOH A O   1 
HETATM 576 O O   . HOH D 4 .  ? 0.667   13.818 3.544   1.00 23.42  ? 30   HOH A O   1 
HETATM 577 O O   . HOH D 4 .  ? 9.725   29.239 0.138   1.00 31.10  ? 31   HOH A O   1 
HETATM 578 O O   . HOH D 4 .  ? -6.412  14.959 0.801   1.00 80.56  ? 32   HOH A O   1 
HETATM 579 O O   . HOH D 4 .  ? 5.741   15.827 -10.814 1.00 28.41  ? 33   HOH A O   1 
HETATM 580 O O   . HOH D 4 .  ? -6.768  12.457 -4.429  1.00 37.56  ? 35   HOH A O   1 
HETATM 581 O O   . HOH D 4 .  ? 11.306  14.294 12.069  1.00 58.63  ? 36   HOH A O   1 
HETATM 582 O O   . HOH D 4 .  ? 12.431  16.117 -6.794  1.00 21.46  ? 37   HOH A O   1 
HETATM 583 O O   . HOH D 4 .  ? 6.779   21.935 13.009  1.00 39.43  ? 38   HOH A O   1 
HETATM 584 O O   . HOH D 4 .  ? 15.843  23.938 3.430   1.00 26.75  ? 40   HOH A O   1 
HETATM 585 O O   . HOH D 4 .  ? 4.159   11.483 1.717   1.00 27.33  ? 41   HOH A O   1 
HETATM 586 O O   . HOH D 4 .  ? 9.046   23.024 16.921  1.00 31.24  ? 42   HOH A O   1 
HETATM 587 O O   . HOH D 4 .  ? -10.437 20.128 -6.018  1.00 28.51  ? 43   HOH A O   1 
HETATM 588 O O   . HOH D 4 .  ? 4.924   27.307 -12.658 1.00 49.06  ? 44   HOH A O   1 
HETATM 589 O O   . HOH D 4 .  ? 3.516   11.108 7.754   1.00 29.05  ? 45   HOH A O   1 
HETATM 590 O O   . HOH D 4 .  ? -1.149  5.402  -4.344  1.00 45.72  ? 46   HOH A O   1 
HETATM 591 O O   . HOH D 4 .  ? 9.030   11.661 13.960  1.00 52.88  ? 47   HOH A O   1 
HETATM 592 O O   . HOH D 4 .  ? -1.493  14.545 8.506   1.00 38.57  ? 48   HOH A O   1 
HETATM 593 O O   . HOH D 4 .  ? 9.820   21.252 -5.885  1.00 26.06  ? 49   HOH A O   1 
HETATM 594 O O   . HOH D 4 .  ? 2.224   24.158 -12.940 1.00 32.04  ? 51   HOH A O   1 
HETATM 595 O O   . HOH D 4 .  ? -5.651  19.987 -8.661  1.00 41.51  ? 52   HOH A O   1 
HETATM 596 O O   . HOH D 4 .  ? -1.749  27.854 9.924   1.00 92.46  ? 54   HOH A O   1 
HETATM 597 O O   . HOH D 4 .  ? 15.749  12.749 5.734   1.00 37.84  ? 55   HOH A O   1 
HETATM 598 O O   . HOH D 4 .  ? 0.228   28.937 -12.921 1.00 53.19  ? 56   HOH A O   1 
HETATM 599 O O   . HOH D 4 .  ? 12.862  13.014 4.376   1.00 32.01  ? 59   HOH A O   1 
HETATM 600 O O   . HOH D 4 .  ? -9.601  26.327 -2.245  1.00 42.72  ? 61   HOH A O   1 
HETATM 601 O O   . HOH D 4 .  ? -0.198  32.815 -9.638  1.00 29.72  ? 62   HOH A O   1 
HETATM 602 O O   . HOH D 4 .  ? 7.986   11.749 8.087   1.00 100.00 ? 63   HOH A O   1 
HETATM 603 O O   . HOH D 4 .  ? -9.025  17.180 -2.907  1.00 49.47  ? 64   HOH A O   1 
HETATM 604 O O   . HOH D 4 .  ? -10.525 17.711 3.827   1.00 40.35  ? 65   HOH A O   1 
HETATM 605 O O   . HOH D 4 .  ? 2.165   18.434 14.217  1.00 27.20  ? 66   HOH A O   1 
HETATM 606 O O   . HOH E 4 .  ? -3.090  32.731 3.781   1.00 18.60  ? 26   HOH C O   1 
HETATM 607 O O   . HOH E 4 .  ? 3.773   36.711 -0.249  1.00 34.72  ? 27   HOH C O   1 
HETATM 608 O O   . HOH E 4 .  ? 0.157   37.347 -2.580  1.00 32.51  ? 28   HOH C O   1 
HETATM 609 O O   . HOH E 4 .  ? 9.994   24.075 14.113  1.00 87.86  ? 34   HOH C O   1 
HETATM 610 O O   . HOH E 4 .  ? 1.774   34.259 -0.908  1.00 22.47  ? 39   HOH C O   1 
HETATM 611 O O   . HOH E 4 .  ? -5.019  27.774 -1.534  1.00 31.44  ? 50   HOH C O   1 
HETATM 612 O O   . HOH E 4 .  ? 5.809   31.307 19.850  1.00 71.72  ? 53   HOH C O   1 
HETATM 613 O O   . HOH E 4 .  ? 5.069   30.113 5.334   1.00 62.03  ? 57   HOH C O   1 
HETATM 614 O O   . HOH E 4 .  ? 3.381   34.800 5.586   1.00 31.20  ? 58   HOH C O   1 
HETATM 615 O O   . HOH E 4 .  ? 3.655   38.081 3.226   1.00 46.38  ? 60   HOH C O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  GLY 1  132 ?   ?   ?   A . n 
A 1 2  SER 2  133 133 SER SER A . n 
A 1 3  ALA 3  134 134 ALA ALA A . n 
A 1 4  GLU 4  135 135 GLU GLU A . n 
A 1 5  TYR 5  136 136 TYR TYR A . n 
A 1 6  VAL 6  137 137 VAL VAL A . n 
A 1 7  ARG 7  138 138 ARG ARG A . n 
A 1 8  ALA 8  139 139 ALA ALA A . n 
A 1 9  LEU 9  140 140 LEU LEU A . n 
A 1 10 PHE 10 141 141 PHE PHE A . n 
A 1 11 ASP 11 142 142 ASP ASP A . n 
A 1 12 PHE 12 143 143 PHE PHE A . n 
A 1 13 ASN 13 144 144 ASN ASN A . n 
A 1 14 GLY 14 145 145 GLY GLY A . n 
A 1 15 ASN 15 146 146 ASN ASN A . n 
A 1 16 ASP 16 147 147 ASP ASP A . n 
A 1 17 GLU 17 148 148 GLU GLU A . n 
A 1 18 GLU 18 149 149 GLU GLU A . n 
A 1 19 ASP 19 150 150 ASP ASP A . n 
A 1 20 LEU 20 151 151 LEU LEU A . n 
A 1 21 PRO 21 152 152 PRO PRO A . n 
A 1 22 PHE 22 153 153 PHE PHE A . n 
A 1 23 LYS 23 154 154 LYS LYS A . n 
A 1 24 LYS 24 155 155 LYS LYS A . n 
A 1 25 GLY 25 156 156 GLY GLY A . n 
A 1 26 ASP 26 157 157 ASP ASP A . n 
A 1 27 ILE 27 158 158 ILE ILE A . n 
A 1 28 LEU 28 159 159 LEU LEU A . n 
A 1 29 ARG 29 160 160 ARG ARG A . n 
A 1 30 ILE 30 161 161 ILE ILE A . n 
A 1 31 ARG 31 162 162 ARG ARG A . n 
A 1 32 ASP 32 163 163 ASP ASP A . n 
A 1 33 LYS 33 164 164 LYS LYS A . n 
A 1 34 PRO 34 165 165 PRO PRO A . n 
A 1 35 GLU 35 166 166 GLU GLU A . n 
A 1 36 GLU 36 167 167 GLU GLU A . n 
A 1 37 GLN 37 168 168 GLN GLN A . n 
A 1 38 TRP 38 169 169 TRP TRP A . n 
A 1 39 TRP 39 170 170 TRP TRP A . n 
A 1 40 ASN 40 171 171 ASN ASN A . n 
A 1 41 ALA 41 172 172 ALA ALA A . n 
A 1 42 GLU 42 173 173 GLU GLU A . n 
A 1 43 ASP 43 174 174 ASP ASP A . n 
A 1 44 SER 44 175 175 SER SER A . n 
A 1 45 GLU 45 176 176 GLU GLU A . n 
A 1 46 GLY 46 177 177 GLY GLY A . n 
A 1 47 LYS 47 178 178 LYS LYS A . n 
A 1 48 ARG 48 179 179 ARG ARG A . n 
A 1 49 GLY 49 180 180 GLY GLY A . n 
A 1 50 MET 50 181 181 MET MET A . n 
A 1 51 ILE 51 182 182 ILE ILE A . n 
A 1 52 PRO 52 183 183 PRO PRO A . n 
A 1 53 VAL 53 184 184 VAL VAL A . n 
A 1 54 PRO 54 185 185 PRO PRO A . n 
A 1 55 TYR 55 186 186 TYR TYR A . n 
A 1 56 VAL 56 187 187 VAL VAL A . n 
A 1 57 GLU 57 188 188 GLU GLU A . n 
A 1 58 LYS 58 189 189 LYS LYS A . n 
A 1 59 TYR 59 190 190 TYR TYR A . n 
A 1 60 HIS 60 191 191 HIS HIS A . n 
A 1 61 HIS 61 192 ?   ?   ?   A . n 
A 1 62 HIS 62 193 ?   ?   ?   A . n 
A 1 63 HIS 63 194 ?   ?   ?   A . n 
A 1 64 HIS 64 195 ?   ?   ?   A . n 
A 1 65 HIS 65 196 ?   ?   ?   A . n 
B 2 1  TYR 1  1   ?   ?   ?   C . n 
B 2 2  GLU 2  2   2   GLU GLU C . n 
B 2 3  VAL 3  3   3   VAL VAL C . n 
B 2 4  PRO 4  4   4   PRO PRO C . n 
B 2 5  GLY 5  5   5   GLY GLY C . n 
B 2 6  PRO 6  6   6   PRO PRO C . n 
B 2 7  VAL 7  7   7   VAL VAL C . n 
B 2 8  PRO 8  8   8   PRO PRO C . n 
B 2 9  PRO 9  9   9   PRO PRO C . n 
B 2 10 ARG 10 10  10  ARG ARG C . n 
B 2 11 ARG 11 11  11  ARG ARG C . n 
B 2 12 ARG 12 12  ?   ?   ?   C . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 980  ? 
1 MORE         -8   ? 
1 'SSA (A^2)'  4710 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1999-01-06 
2 'Structure model' 1 1 2008-04-27 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2013-12-25 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Non-polymer description'   
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
AMoRE     phasing          .     ? 1 
X-PLOR    refinement       3.843 ? 2 
DENZO     'data reduction' .     ? 3 
SCALEPACK 'data scaling'   .     ? 4 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 C GLU 2  ? CG  ? B GLU 2  CG  
2  1 Y 1 C GLU 2  ? CD  ? B GLU 2  CD  
3  1 Y 1 C GLU 2  ? OE1 ? B GLU 2  OE1 
4  1 Y 1 C GLU 2  ? OE2 ? B GLU 2  OE2 
5  1 Y 1 C VAL 3  ? CG1 ? B VAL 3  CG1 
6  1 Y 1 C VAL 3  ? CG2 ? B VAL 3  CG2 
7  1 Y 1 C GLY 5  ? O   ? B GLY 5  O   
8  1 Y 1 C ARG 11 ? CG  ? B ARG 11 CG  
9  1 Y 1 C ARG 11 ? CD  ? B ARG 11 CD  
10 1 Y 1 C ARG 11 ? NE  ? B ARG 11 NE  
11 1 Y 1 C ARG 11 ? CZ  ? B ARG 11 CZ  
12 1 Y 1 C ARG 11 ? NH1 ? B ARG 11 NH1 
13 1 Y 1 C ARG 11 ? NH2 ? B ARG 11 NH2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A GLY 132 ? A GLY 1  
2 1 Y 1 A HIS 192 ? A HIS 61 
3 1 Y 1 A HIS 193 ? A HIS 62 
4 1 Y 1 A HIS 194 ? A HIS 63 
5 1 Y 1 A HIS 195 ? A HIS 64 
6 1 Y 1 A HIS 196 ? A HIS 65 
7 1 Y 1 C TYR 1   ? B TYR 1  
8 1 Y 1 C ARG 12  ? B ARG 12 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 PHENYLETHANE PYJ 
4 water        HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 PYJ 1  1005 1005 PYJ PYJ C . 
D 4 HOH 1  21   21   HOH HOH A . 
D 4 HOH 2  22   22   HOH HOH A . 
D 4 HOH 3  23   23   HOH HOH A . 
D 4 HOH 4  24   24   HOH HOH A . 
D 4 HOH 5  25   25   HOH HOH A . 
D 4 HOH 6  29   29   HOH HOH A . 
D 4 HOH 7  30   30   HOH HOH A . 
D 4 HOH 8  31   31   HOH HOH A . 
D 4 HOH 9  32   32   HOH HOH A . 
D 4 HOH 10 33   33   HOH HOH A . 
D 4 HOH 11 35   35   HOH HOH A . 
D 4 HOH 12 36   36   HOH HOH A . 
D 4 HOH 13 37   37   HOH HOH A . 
D 4 HOH 14 38   38   HOH HOH A . 
D 4 HOH 15 40   40   HOH HOH A . 
D 4 HOH 16 41   41   HOH HOH A . 
D 4 HOH 17 42   42   HOH HOH A . 
D 4 HOH 18 43   43   HOH HOH A . 
D 4 HOH 19 44   44   HOH HOH A . 
D 4 HOH 20 45   45   HOH HOH A . 
D 4 HOH 21 46   46   HOH HOH A . 
D 4 HOH 22 47   47   HOH HOH A . 
D 4 HOH 23 48   48   HOH HOH A . 
D 4 HOH 24 49   49   HOH HOH A . 
D 4 HOH 25 51   51   HOH HOH A . 
D 4 HOH 26 52   52   HOH HOH A . 
D 4 HOH 27 54   54   HOH HOH A . 
D 4 HOH 28 55   55   HOH HOH A . 
D 4 HOH 29 56   56   HOH HOH A . 
D 4 HOH 30 59   59   HOH HOH A . 
D 4 HOH 31 61   61   HOH HOH A . 
D 4 HOH 32 62   62   HOH HOH A . 
D 4 HOH 33 63   63   HOH HOH A . 
D 4 HOH 34 64   64   HOH HOH A . 
D 4 HOH 35 65   65   HOH HOH A . 
D 4 HOH 36 66   66   HOH HOH A . 
E 4 HOH 1  26   26   HOH HOH C . 
E 4 HOH 2  27   27   HOH HOH C . 
E 4 HOH 3  28   28   HOH HOH C . 
E 4 HOH 4  34   34   HOH HOH C . 
E 4 HOH 5  39   39   HOH HOH C . 
E 4 HOH 6  50   50   HOH HOH C . 
E 4 HOH 7  53   53   HOH HOH C . 
E 4 HOH 8  57   57   HOH HOH C . 
E 4 HOH 9  58   58   HOH HOH C . 
E 4 HOH 10 60   60   HOH HOH C . 
#