data_1B0F
# 
_entry.id   1B0F 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1B0F         
RCSB  RCSB000049   
WWPDB D_1000000049 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1B0F 
_pdbx_database_status.recvd_initial_deposition_date   1998-11-09 
_pdbx_database_status.deposit_site                    BNL 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Schreuder, H.A.' 1 
'Metz, W.A.'      2 
'Peet, N.P.'      3 
'Pelton, J.T.'    4 
'Tardif, C.'      5 
# 
_citation.id                        primary 
_citation.title                     
;Inhibition of human neutrophil elastase. 4. Design, synthesis, X-ray crystallographic analysis, and structure-activity relationships for a series of P2-modified, orally active peptidyl pentafluoroethyl ketones.
;
_citation.journal_abbrev            J.Med.Chem. 
_citation.journal_volume            41 
_citation.page_first                2461 
_citation.page_last                 2480 
_citation.year                      1998 
_citation.journal_id_ASTM           JMCMAR 
_citation.country                   US 
_citation.journal_id_ISSN           0022-2623 
_citation.journal_id_CSD            0151 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   9651152 
_citation.pdbx_database_id_DOI      10.1021/jm970812e 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Cregge, R.J.'    1  ? 
primary 'Durham, S.L.'    2  ? 
primary 'Farr, R.A.'      3  ? 
primary 'Gallion, S.L.'   4  ? 
primary 'Hare, C.M.'      5  ? 
primary 'Hoffman, R.V.'   6  ? 
primary 'Janusz, M.J.'    7  ? 
primary 'Kim, H.O.'       8  ? 
primary 'Koehl, J.R.'     9  ? 
primary 'Mehdi, S.'       10 ? 
primary 'Metz, W.A.'      11 ? 
primary 'Peet, N.P.'      12 ? 
primary 'Pelton, J.T.'    13 ? 
primary 'Schreuder, H.A.' 14 ? 
primary 'Sunder, S.'      15 ? 
primary 'Tardif, C.'      16 ? 
# 
_cell.entry_id           1B0F 
_cell.length_a           75.800 
_cell.length_b           75.800 
_cell.length_c           108.500 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1B0F 
_symmetry.space_group_name_H-M             'P 43 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                95 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     nat 'PROTEIN (ELASTASE)' 23233.850 1  3.4.21.37 ? ? ? 
2 branched    man 
'2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[alpha-L-fucopyranose-(1-6)]2-acetamido-2-deoxy-beta-D-glucopyranose' 570.542   2  
?         ? ? ? 
3 non-polymer syn 
;1-{3-METHYL-2-[4-(MORPHOLINE-4-CARBONYL)-BENZOYLAMINO]-BUTYRYL}-PYRROLIDINE-2-CARBOXYLIC ACID (3,3,4,4,4-PENTAFLUORO-1-ISOPROPYL-2-OXO-BUTYL)-AMIDE
;
632.619   1  ?         ? ? ? 
4 water       nat water 18.015    34 ?         ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        HNE 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;IVGGRRARPHAWPFMVSLQLAGGHFCGATLIAPNFVMSAAHCVANVNVRAVRVVLGAHNLSRREPTRQVFAVQRIFEDGY
DPVNLLNDIVILQLNGSATINANVQVAQLPAQGRRLGNGVQCLAMGWGLLGRNRGIASVLQELNVTVVTSLCRRSNVCTL
VRGRQAGVCFGDSGSPLVCNGLIHGIASFVRGGCASGLYPDAFAPVAQFVNWIDSIIQ
;
_entity_poly.pdbx_seq_one_letter_code_can   
;IVGGRRARPHAWPFMVSLQLAGGHFCGATLIAPNFVMSAAHCVANVNVRAVRVVLGAHNLSRREPTRQVFAVQRIFEDGY
DPVNLLNDIVILQLNGSATINANVQVAQLPAQGRRLGNGVQCLAMGWGLLGRNRGIASVLQELNVTVVTSLCRRSNVCTL
VRGRQAGVCFGDSGSPLVCNGLIHGIASFVRGGCASGLYPDAFAPVAQFVNWIDSIIQ
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ILE n 
1 2   VAL n 
1 3   GLY n 
1 4   GLY n 
1 5   ARG n 
1 6   ARG n 
1 7   ALA n 
1 8   ARG n 
1 9   PRO n 
1 10  HIS n 
1 11  ALA n 
1 12  TRP n 
1 13  PRO n 
1 14  PHE n 
1 15  MET n 
1 16  VAL n 
1 17  SER n 
1 18  LEU n 
1 19  GLN n 
1 20  LEU n 
1 21  ALA n 
1 22  GLY n 
1 23  GLY n 
1 24  HIS n 
1 25  PHE n 
1 26  CYS n 
1 27  GLY n 
1 28  ALA n 
1 29  THR n 
1 30  LEU n 
1 31  ILE n 
1 32  ALA n 
1 33  PRO n 
1 34  ASN n 
1 35  PHE n 
1 36  VAL n 
1 37  MET n 
1 38  SER n 
1 39  ALA n 
1 40  ALA n 
1 41  HIS n 
1 42  CYS n 
1 43  VAL n 
1 44  ALA n 
1 45  ASN n 
1 46  VAL n 
1 47  ASN n 
1 48  VAL n 
1 49  ARG n 
1 50  ALA n 
1 51  VAL n 
1 52  ARG n 
1 53  VAL n 
1 54  VAL n 
1 55  LEU n 
1 56  GLY n 
1 57  ALA n 
1 58  HIS n 
1 59  ASN n 
1 60  LEU n 
1 61  SER n 
1 62  ARG n 
1 63  ARG n 
1 64  GLU n 
1 65  PRO n 
1 66  THR n 
1 67  ARG n 
1 68  GLN n 
1 69  VAL n 
1 70  PHE n 
1 71  ALA n 
1 72  VAL n 
1 73  GLN n 
1 74  ARG n 
1 75  ILE n 
1 76  PHE n 
1 77  GLU n 
1 78  ASP n 
1 79  GLY n 
1 80  TYR n 
1 81  ASP n 
1 82  PRO n 
1 83  VAL n 
1 84  ASN n 
1 85  LEU n 
1 86  LEU n 
1 87  ASN n 
1 88  ASP n 
1 89  ILE n 
1 90  VAL n 
1 91  ILE n 
1 92  LEU n 
1 93  GLN n 
1 94  LEU n 
1 95  ASN n 
1 96  GLY n 
1 97  SER n 
1 98  ALA n 
1 99  THR n 
1 100 ILE n 
1 101 ASN n 
1 102 ALA n 
1 103 ASN n 
1 104 VAL n 
1 105 GLN n 
1 106 VAL n 
1 107 ALA n 
1 108 GLN n 
1 109 LEU n 
1 110 PRO n 
1 111 ALA n 
1 112 GLN n 
1 113 GLY n 
1 114 ARG n 
1 115 ARG n 
1 116 LEU n 
1 117 GLY n 
1 118 ASN n 
1 119 GLY n 
1 120 VAL n 
1 121 GLN n 
1 122 CYS n 
1 123 LEU n 
1 124 ALA n 
1 125 MET n 
1 126 GLY n 
1 127 TRP n 
1 128 GLY n 
1 129 LEU n 
1 130 LEU n 
1 131 GLY n 
1 132 ARG n 
1 133 ASN n 
1 134 ARG n 
1 135 GLY n 
1 136 ILE n 
1 137 ALA n 
1 138 SER n 
1 139 VAL n 
1 140 LEU n 
1 141 GLN n 
1 142 GLU n 
1 143 LEU n 
1 144 ASN n 
1 145 VAL n 
1 146 THR n 
1 147 VAL n 
1 148 VAL n 
1 149 THR n 
1 150 SER n 
1 151 LEU n 
1 152 CYS n 
1 153 ARG n 
1 154 ARG n 
1 155 SER n 
1 156 ASN n 
1 157 VAL n 
1 158 CYS n 
1 159 THR n 
1 160 LEU n 
1 161 VAL n 
1 162 ARG n 
1 163 GLY n 
1 164 ARG n 
1 165 GLN n 
1 166 ALA n 
1 167 GLY n 
1 168 VAL n 
1 169 CYS n 
1 170 PHE n 
1 171 GLY n 
1 172 ASP n 
1 173 SER n 
1 174 GLY n 
1 175 SER n 
1 176 PRO n 
1 177 LEU n 
1 178 VAL n 
1 179 CYS n 
1 180 ASN n 
1 181 GLY n 
1 182 LEU n 
1 183 ILE n 
1 184 HIS n 
1 185 GLY n 
1 186 ILE n 
1 187 ALA n 
1 188 SER n 
1 189 PHE n 
1 190 VAL n 
1 191 ARG n 
1 192 GLY n 
1 193 GLY n 
1 194 CYS n 
1 195 ALA n 
1 196 SER n 
1 197 GLY n 
1 198 LEU n 
1 199 TYR n 
1 200 PRO n 
1 201 ASP n 
1 202 ALA n 
1 203 PHE n 
1 204 ALA n 
1 205 PRO n 
1 206 VAL n 
1 207 ALA n 
1 208 GLN n 
1 209 PHE n 
1 210 VAL n 
1 211 ASN n 
1 212 TRP n 
1 213 ILE n 
1 214 ASP n 
1 215 SER n 
1 216 ILE n 
1 217 ILE n 
1 218 GLN n 
# 
_entity_src_nat.entity_id                  1 
_entity_src_nat.pdbx_src_id                1 
_entity_src_nat.pdbx_alt_source_flag       sample 
_entity_src_nat.pdbx_beg_seq_num           ? 
_entity_src_nat.pdbx_end_seq_num           ? 
_entity_src_nat.common_name                human 
_entity_src_nat.pdbx_organism_scientific   'Homo sapiens' 
_entity_src_nat.pdbx_ncbi_taxonomy_id      9606 
_entity_src_nat.genus                      Homo 
_entity_src_nat.species                    ? 
_entity_src_nat.strain                     ? 
_entity_src_nat.tissue                     ? 
_entity_src_nat.tissue_fraction            ? 
_entity_src_nat.pdbx_secretion             ? 
_entity_src_nat.pdbx_fragment              ? 
_entity_src_nat.pdbx_variant               ? 
_entity_src_nat.pdbx_cell_line             ? 
_entity_src_nat.pdbx_atcc                  ? 
_entity_src_nat.pdbx_cellular_location     ? 
_entity_src_nat.pdbx_organ                 ? 
_entity_src_nat.pdbx_organelle             ? 
_entity_src_nat.pdbx_cell                  NEUTROPHIL 
_entity_src_nat.pdbx_plasmid_name          ? 
_entity_src_nat.pdbx_plasmid_details       ? 
_entity_src_nat.details                    ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ELNE_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P08246 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1B0F 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 218 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P08246 
_struct_ref_seq.db_align_beg                  30 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  247 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       16 
_struct_ref_seq.pdbx_auth_seq_align_end       243 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'           y ALANINE ?             'C3 H7 N O2'       89.093  
ARG 'L-peptide linking'           y ARGININE ?             'C6 H15 N4 O2 1'   175.209 
ASN 'L-peptide linking'           y ASPARAGINE ?             'C4 H8 N2 O3'      132.118 
ASP 'L-peptide linking'           y 'ASPARTIC ACID' ?             'C4 H7 N O4'       133.103 
CYS 'L-peptide linking'           y CYSTEINE ?             'C3 H7 N O2 S'     121.158 
FUC 'L-saccharide, alpha linking' . alpha-L-fucopyranose ?             'C6 H12 O5'        164.156 
GLN 'L-peptide linking'           y GLUTAMINE ?             'C5 H10 N2 O3'     146.144 
GLU 'L-peptide linking'           y 'GLUTAMIC ACID' ?             'C5 H9 N O4'       147.129 
GLY 'peptide linking'             y GLYCINE ?             'C2 H5 N O2'       75.067  
HIS 'L-peptide linking'           y HISTIDINE ?             'C6 H10 N3 O2 1'   156.162 
HOH non-polymer                   . WATER ?             'H2 O'             18.015  
ILE 'L-peptide linking'           y ISOLEUCINE ?             'C6 H13 N O2'      131.173 
LEU 'L-peptide linking'           y LEUCINE ?             'C6 H13 N O2'      131.173 
MET 'L-peptide linking'           y METHIONINE ?             'C5 H11 N O2 S'    149.211 
NAG 'D-saccharide, beta linking'  . 2-acetamido-2-deoxy-beta-D-glucopyranose ?             'C8 H15 N O6'      221.208 
PHE 'L-peptide linking'           y PHENYLALANINE ?             'C9 H11 N O2'      165.189 
PRO 'L-peptide linking'           y PROLINE ?             'C5 H9 N O2'       115.130 
SEI non-polymer                   . 
;1-{3-METHYL-2-[4-(MORPHOLINE-4-CARBONYL)-BENZOYLAMINO]-BUTYRYL}-PYRROLIDINE-2-CARBOXYLIC ACID (3,3,4,4,4-PENTAFLUORO-1-ISOPROPYL-2-OXO-BUTYL)-AMIDE
;
'MDL 101,146' 'C29 H37 F5 N4 O6' 632.619 
SER 'L-peptide linking'           y SERINE ?             'C3 H7 N O3'       105.093 
THR 'L-peptide linking'           y THREONINE ?             'C4 H9 N O3'       119.119 
TRP 'L-peptide linking'           y TRYPTOPHAN ?             'C11 H12 N2 O2'    204.225 
TYR 'L-peptide linking'           y TYROSINE ?             'C9 H11 N O3'      181.189 
VAL 'L-peptide linking'           y VALINE ?             'C5 H11 N O2'      117.146 
# 
_exptl.entry_id          1B0F 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.20 
_exptl_crystal.density_percent_sol   63.31 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.00 
_exptl_crystal_grow.pdbx_details    'pH 5.00' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           287.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'AREA DETECTOR' 
_diffrn_detector.type                   SIEMENS 
_diffrn_detector.pdbx_collection_date   1993-10-19 
_diffrn_detector.details                COLLIMATOR 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    GRAPHITE 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        SIEMENS 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1B0F 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             20.000 
_reflns.d_resolution_high            3.000 
_reflns.number_obs                   6729 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.1 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.099 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              7.200 
_reflns.R_free_details               ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             3.00 
_reflns_shell.d_res_low              3.10 
_reflns_shell.percent_possible_all   95.9 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.371 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        5.20 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 1B0F 
_refine.ls_number_reflns_obs                     5799 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          2.000 
_refine.pdbx_data_cutoff_high_absF               100000.000 
_refine.pdbx_data_cutoff_low_absF                0.1000 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             8.00 
_refine.ls_d_res_high                            3.00 
_refine.ls_percent_reflns_obs                    91.2 
_refine.ls_R_factor_obs                          0.16 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.16 
_refine.ls_R_factor_R_free                       ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               21.00 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 1HNE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1B0F 
_refine_analyze.Luzzati_coordinate_error_obs    0.25 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1630 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         120 
_refine_hist.number_atoms_solvent             34 
_refine_hist.number_atoms_total               1784 
_refine_hist.d_res_high                       3.00 
_refine_hist.d_res_low                        8.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d                0.012 ?     ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_na             ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_prot           ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d               ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_na            ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_prot          ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg             1.80  ?     ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_na          ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_prot        ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d      26.40 ?     ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_na   ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_prot ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d      1.43  ?     ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_na   ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_prot ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
x_mcbond_it             2.84  1.500 ? ? 'X-RAY DIFFRACTION' ? 
x_mcangle_it            4.46  2.000 ? ? 'X-RAY DIFFRACTION' ? 
x_scbond_it             8.45  3.000 ? ? 'X-RAY DIFFRACTION' ? 
x_scangle_it            13.50 5.000 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   8 
_refine_ls_shell.d_res_high                       3.00 
_refine_ls_shell.d_res_low                        3.13 
_refine_ls_shell.number_reflns_R_work             576 
_refine_ls_shell.R_factor_R_work                  0.206 
_refine_ls_shell.percent_reflns_obs               75.20 
_refine_ls_shell.R_factor_R_free                  ? 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PARHCSDX.PRO   TOPHCSDX.PRO 'X-RAY DIFFRACTION' 
2 INHIBITOR.PAR  103139.TOP   'X-RAY DIFFRACTION' 
3 WAT.PAR        WAT.TOP      'X-RAY DIFFRACTION' 
4 PARAM3_MOD.CHO TOPH3.CHO    'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1B0F 
_struct.title                     'CRYSTAL STRUCTURE OF HUMAN NEUTROPHIL ELASTASE WITH MDL 101, 146' 
_struct.pdbx_descriptor           'PROTEIN (ELASTASE) (3.4.21.37)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1B0F 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            'SERINE PROTEASE, FLUOROETHYL KETONES, HYDROLASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
D N N 3 ? 
E N N 4 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ALA A 40  ? VAL A 43  ? ALA A 56  VAL A 59  1 ? 4  
HELX_P HELX_P2 2 VAL A 48  B ALA A 50  ? VAL A 62  ALA A 64  5 ? 3  
HELX_P HELX_P3 3 VAL A 206 ? ILE A 216 ? VAL A 231 ILE A 241 5 ? 11 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1 disulf ?    ? A CYS 26  SG  ? ? ? 1_555 A CYS 42  SG  ? ? A CYS 42  A CYS 58  1_555 ? ? ? ? ? ? ? 2.024 ? ?               
disulf2 disulf ?    ? A CYS 122 SG  ? ? ? 1_555 A CYS 179 SG  ? ? A CYS 136 A CYS 201 1_555 ? ? ? ? ? ? ? 2.035 ? ?               
disulf3 disulf ?    ? A CYS 152 SG  ? ? ? 1_555 A CYS 158 SG  ? ? A CYS 168 A CYS 182 1_555 ? ? ? ? ? ? ? 2.022 ? ?               
disulf4 disulf ?    ? A CYS 169 SG  ? ? ? 1_555 A CYS 194 SG  ? ? A CYS 191 A CYS 220 1_555 ? ? ? ? ? ? ? 2.021 ? ?               
covale1 covale one  ? A ASN 95  ND2 ? ? ? 1_555 B NAG .   C1  ? ? A ASN 109 B NAG 1   1_555 ? ? ? ? ? ? ? 1.449 ? N-Glycosylation 
covale2 covale one  ? A ASN 144 ND2 ? ? ? 1_555 C NAG .   C1  ? ? A ASN 159 C NAG 1   1_555 ? ? ? ? ? ? ? 1.447 ? N-Glycosylation 
covale3 covale none ? A SER 173 OG  ? ? ? 1_555 D SEI .   C71 ? ? A SER 195 A SEI 300 1_555 ? ? ? ? ? ? ? 1.488 ? ?               
covale4 covale both ? B NAG .   O4  ? ? ? 1_555 B NAG .   C1  ? ? B NAG 1   B NAG 2   1_555 ? ? ? ? ? ? ? 1.391 ? ?               
covale5 covale both ? B NAG .   O6  ? ? ? 1_555 B FUC .   C1  ? ? B NAG 1   B FUC 3   1_555 ? ? ? ? ? ? ? 1.397 ? ?               
covale6 covale both ? C NAG .   O4  ? ? ? 1_555 C NAG .   C1  ? ? C NAG 1   C NAG 2   1_555 ? ? ? ? ? ? ? 1.387 ? ?               
covale7 covale both ? C NAG .   O6  ? ? ? 1_555 C FUC .   C1  ? ? C NAG 1   C FUC 3   1_555 ? ? ? ? ? ? ? 1.398 ? ?               
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 7 ? 
B ? 7 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
A 5 6 ? anti-parallel 
A 6 7 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
B 5 6 ? anti-parallel 
B 6 7 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLN A 68  ? ALA A 71  ? GLN A 81  ALA A 84  
A 2 VAL A 51  ? LEU A 55  ? VAL A 65  LEU A 68  
A 3 MET A 15  ? LEU A 20  ? MET A 30  LEU A 35  
A 4 GLY A 23  ? ALA A 32  ? GLY A 39  ALA A 48  
A 5 PHE A 35  ? SER A 38  ? PHE A 51  SER A 54  
A 6 VAL A 90  ? LEU A 94  ? VAL A 104 LEU A 108 
A 7 VAL A 72  ? GLU A 77  ? VAL A 85  GLU A 90  
B 1 GLN A 141 ? THR A 146 ? GLN A 156 THR A 162 
B 2 GLN A 121 ? GLY A 126 ? GLN A 135 GLY A 140 
B 3 PRO A 176 ? CYS A 179 ? PRO A 198 CYS A 201 
B 4 LEU A 182 ? PHE A 189 ? LEU A 208 PHE A 215 
B 5 ASP A 201 ? ALA A 204 ? ASP A 226 ALA A 229 
B 6 ASN A 156 ? LEU A 160 ? ASN A 180 LEU A 184 
B 7 THR A 146 ? VAL A 148 ? THR A 162 VAL A 164 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O GLN A 68  ? O GLN A 81  N LEU A 55  ? N LEU A 68  
A 2 3 O ARG A 52  A O ARG A 65  N GLN A 19  ? N GLN A 34  
A 3 4 O VAL A 16  ? O VAL A 31  N ALA A 28  ? N ALA A 44  
A 4 5 O THR A 29  ? O THR A 45  N MET A 37  ? N MET A 53  
A 5 6 O VAL A 36  ? O VAL A 52  N LEU A 92  ? N LEU A 106 
A 6 7 O ILE A 91  ? O ILE A 105 N PHE A 76  ? N PHE A 89  
B 1 2 O GLN A 141 ? O GLN A 156 N GLY A 126 ? N GLY A 140 
B 2 3 O LEU A 123 ? O LEU A 137 N VAL A 178 ? N VAL A 200 
B 3 4 O LEU A 177 ? O LEU A 199 N GLY A 185 ? N GLY A 211 
B 4 5 O ILE A 186 ? O ILE A 212 N ALA A 204 ? N ALA A 229 
B 5 6 O ASP A 201 ? O ASP A 226 N THR A 159 ? N THR A 183 
B 6 7 O CYS A 158 ? O CYS A 182 N VAL A 148 ? N VAL A 164 
# 
_database_PDB_matrix.entry_id          1B0F 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1B0F 
_atom_sites.fract_transf_matrix[1][1]   0.013193 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.013193 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009216 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
F 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ILE A 1 1   ? 65.469 59.647 44.018 1.00 13.40  ? 16  ILE A N   1 
ATOM   2    C CA  . ILE A 1 1   ? 65.547 58.434 43.151 1.00 11.96  ? 16  ILE A CA  1 
ATOM   3    C C   . ILE A 1 1   ? 66.724 58.586 42.218 1.00 11.05  ? 16  ILE A C   1 
ATOM   4    O O   . ILE A 1 1   ? 66.818 59.573 41.486 1.00 13.74  ? 16  ILE A O   1 
ATOM   5    C CB  . ILE A 1 1   ? 64.258 58.254 42.314 1.00 11.83  ? 16  ILE A CB  1 
ATOM   6    C CG1 . ILE A 1 1   ? 63.138 57.677 43.179 1.00 11.55  ? 16  ILE A CG1 1 
ATOM   7    C CG2 . ILE A 1 1   ? 64.507 57.339 41.115 1.00 16.05  ? 16  ILE A CG2 1 
ATOM   8    C CD1 . ILE A 1 1   ? 63.296 56.195 43.482 1.00 20.28  ? 16  ILE A CD1 1 
ATOM   9    N N   . VAL A 1 2   ? 67.621 57.611 42.243 1.00 10.37  ? 17  VAL A N   1 
ATOM   10   C CA  . VAL A 1 2   ? 68.796 57.643 41.381 1.00 13.50  ? 17  VAL A CA  1 
ATOM   11   C C   . VAL A 1 2   ? 68.573 56.771 40.157 1.00 15.47  ? 17  VAL A C   1 
ATOM   12   O O   . VAL A 1 2   ? 68.206 55.607 40.275 1.00 16.71  ? 17  VAL A O   1 
ATOM   13   C CB  . VAL A 1 2   ? 70.082 57.201 42.130 1.00 9.78   ? 17  VAL A CB  1 
ATOM   14   C CG1 . VAL A 1 2   ? 71.232 57.097 41.182 1.00 2.00   ? 17  VAL A CG1 1 
ATOM   15   C CG2 . VAL A 1 2   ? 70.433 58.226 43.188 1.00 17.14  ? 17  VAL A CG2 1 
ATOM   16   N N   . GLY A 1 3   ? 68.707 57.372 38.982 1.00 15.01  ? 18  GLY A N   1 
ATOM   17   C CA  . GLY A 1 3   ? 68.548 56.630 37.753 1.00 15.13  ? 18  GLY A CA  1 
ATOM   18   C C   . GLY A 1 3   ? 67.133 56.412 37.286 1.00 21.26  ? 18  GLY A C   1 
ATOM   19   O O   . GLY A 1 3   ? 66.873 55.424 36.605 1.00 27.64  ? 18  GLY A O   1 
ATOM   20   N N   . GLY A 1 4   ? 66.218 57.321 37.610 1.00 22.32  ? 19  GLY A N   1 
ATOM   21   C CA  . GLY A 1 4   ? 64.841 57.148 37.162 1.00 24.27  ? 19  GLY A CA  1 
ATOM   22   C C   . GLY A 1 4   ? 64.418 58.182 36.128 1.00 23.47  ? 19  GLY A C   1 
ATOM   23   O O   . GLY A 1 4   ? 65.219 58.585 35.295 1.00 23.41  ? 19  GLY A O   1 
ATOM   24   N N   . ARG A 1 5   ? 63.158 58.609 36.179 1.00 24.56  ? 20  ARG A N   1 
ATOM   25   C CA  . ARG A 1 5   ? 62.632 59.616 35.263 1.00 26.30  ? 20  ARG A CA  1 
ATOM   26   C C   . ARG A 1 5   ? 61.471 60.372 35.922 1.00 28.87  ? 20  ARG A C   1 
ATOM   27   O O   . ARG A 1 5   ? 60.914 59.924 36.927 1.00 30.29  ? 20  ARG A O   1 
ATOM   28   C CB  . ARG A 1 5   ? 62.169 58.975 33.953 1.00 24.67  ? 20  ARG A CB  1 
ATOM   29   C CG  . ARG A 1 5   ? 60.943 58.125 34.106 1.00 30.73  ? 20  ARG A CG  1 
ATOM   30   C CD  . ARG A 1 5   ? 60.623 57.329 32.866 1.00 22.43  ? 20  ARG A CD  1 
ATOM   31   N NE  . ARG A 1 5   ? 59.558 56.386 33.178 1.00 32.82  ? 20  ARG A NE  1 
ATOM   32   C CZ  . ARG A 1 5   ? 59.739 55.245 33.843 1.00 36.40  ? 20  ARG A CZ  1 
ATOM   33   N NH1 . ARG A 1 5   ? 60.950 54.894 34.261 1.00 30.48  ? 20  ARG A NH1 1 
ATOM   34   N NH2 . ARG A 1 5   ? 58.698 54.468 34.124 1.00 43.42  ? 20  ARG A NH2 1 
ATOM   35   N N   . ARG A 1 6   ? 61.127 61.522 35.353 1.00 29.04  ? 21  ARG A N   1 
ATOM   36   C CA  . ARG A 1 6   ? 60.058 62.366 35.867 1.00 28.84  ? 21  ARG A CA  1 
ATOM   37   C C   . ARG A 1 6   ? 58.707 61.701 35.677 1.00 29.41  ? 21  ARG A C   1 
ATOM   38   O O   . ARG A 1 6   ? 58.375 61.231 34.590 1.00 31.29  ? 21  ARG A O   1 
ATOM   39   C CB  . ARG A 1 6   ? 60.099 63.718 35.162 1.00 24.39  ? 21  ARG A CB  1 
ATOM   40   C CG  . ARG A 1 6   ? 61.435 64.415 35.348 1.00 42.31  ? 21  ARG A CG  1 
ATOM   41   C CD  . ARG A 1 6   ? 61.791 65.304 34.176 1.00 66.92  ? 21  ARG A CD  1 
ATOM   42   N NE  . ARG A 1 6   ? 60.956 66.502 34.099 1.00 87.73  ? 21  ARG A NE  1 
ATOM   43   C CZ  . ARG A 1 6   ? 61.429 67.746 34.122 1.00 100.79 ? 21  ARG A CZ  1 
ATOM   44   N NH1 . ARG A 1 6   ? 62.735 67.965 34.225 1.00 107.99 ? 21  ARG A NH1 1 
ATOM   45   N NH2 . ARG A 1 6   ? 60.597 68.776 34.028 1.00 107.96 ? 21  ARG A NH2 1 
ATOM   46   N N   . ALA A 1 7   ? 57.952 61.595 36.757 1.00 27.66  ? 22  ALA A N   1 
ATOM   47   C CA  . ALA A 1 7   ? 56.650 60.981 36.665 1.00 26.73  ? 22  ALA A CA  1 
ATOM   48   C C   . ALA A 1 7   ? 55.751 62.005 36.020 1.00 25.49  ? 22  ALA A C   1 
ATOM   49   O O   . ALA A 1 7   ? 55.933 63.201 36.215 1.00 25.65  ? 22  ALA A O   1 
ATOM   50   C CB  . ALA A 1 7   ? 56.130 60.615 38.039 1.00 25.92  ? 22  ALA A CB  1 
ATOM   51   N N   . ARG A 1 8   ? 54.810 61.531 35.214 1.00 26.99  ? 23  ARG A N   1 
ATOM   52   C CA  . ARG A 1 8   ? 53.857 62.403 34.548 1.00 25.01  ? 23  ARG A CA  1 
ATOM   53   C C   . ARG A 1 8   ? 53.099 63.122 35.652 1.00 21.31  ? 23  ARG A C   1 
ATOM   54   O O   . ARG A 1 8   ? 52.828 62.552 36.713 1.00 22.76  ? 23  ARG A O   1 
ATOM   55   C CB  . ARG A 1 8   ? 52.918 61.564 33.684 1.00 37.81  ? 23  ARG A CB  1 
ATOM   56   C CG  . ARG A 1 8   ? 51.826 62.338 32.970 1.00 63.49  ? 23  ARG A CG  1 
ATOM   57   C CD  . ARG A 1 8   ? 51.050 61.435 32.012 1.00 88.27  ? 23  ARG A CD  1 
ATOM   58   N NE  . ARG A 1 8   ? 50.561 60.214 32.661 1.00 105.61 ? 23  ARG A NE  1 
ATOM   59   C CZ  . ARG A 1 8   ? 49.500 60.157 33.465 1.00 114.00 ? 23  ARG A CZ  1 
ATOM   60   N NH1 . ARG A 1 8   ? 48.798 61.255 33.732 1.00 121.74 ? 23  ARG A NH1 1 
ATOM   61   N NH2 . ARG A 1 8   ? 49.139 58.997 34.003 1.00 113.07 ? 23  ARG A NH2 1 
ATOM   62   N N   . PRO A 1 9   ? 52.816 64.404 35.456 1.00 19.82  ? 24  PRO A N   1 
ATOM   63   C CA  . PRO A 1 9   ? 52.098 65.186 36.456 1.00 23.11  ? 24  PRO A CA  1 
ATOM   64   C C   . PRO A 1 9   ? 50.834 64.536 37.000 1.00 25.85  ? 24  PRO A C   1 
ATOM   65   O O   . PRO A 1 9   ? 49.851 64.318 36.271 1.00 29.34  ? 24  PRO A O   1 
ATOM   66   C CB  . PRO A 1 9   ? 51.793 66.479 35.714 1.00 20.68  ? 24  PRO A CB  1 
ATOM   67   C CG  . PRO A 1 9   ? 52.992 66.650 34.884 1.00 22.00  ? 24  PRO A CG  1 
ATOM   68   C CD  . PRO A 1 9   ? 53.188 65.252 34.318 1.00 24.41  ? 24  PRO A CD  1 
ATOM   69   N N   . HIS A 1 10  ? 50.891 64.210 38.289 1.00 23.14  ? 25  HIS A N   1 
ATOM   70   C CA  . HIS A 1 10  ? 49.772 63.617 38.995 1.00 19.82  ? 25  HIS A CA  1 
ATOM   71   C C   . HIS A 1 10  ? 49.419 62.217 38.503 1.00 21.13  ? 25  HIS A C   1 
ATOM   72   O O   . HIS A 1 10  ? 48.255 61.817 38.457 1.00 25.95  ? 25  HIS A O   1 
ATOM   73   C CB  . HIS A 1 10  ? 48.587 64.579 38.947 1.00 12.17  ? 25  HIS A CB  1 
ATOM   74   C CG  . HIS A 1 10  ? 48.925 65.951 39.445 1.00 14.65  ? 25  HIS A CG  1 
ATOM   75   N ND1 . HIS A 1 10  ? 49.148 66.225 40.779 1.00 26.33  ? 25  HIS A ND1 1 
ATOM   76   C CD2 . HIS A 1 10  ? 49.133 67.113 38.785 1.00 9.95   ? 25  HIS A CD2 1 
ATOM   77   C CE1 . HIS A 1 10  ? 49.481 67.497 40.916 1.00 17.93  ? 25  HIS A CE1 1 
ATOM   78   N NE2 . HIS A 1 10  ? 49.479 68.059 39.721 1.00 10.81  ? 25  HIS A NE2 1 
ATOM   79   N N   . ALA A 1 11  ? 50.459 61.467 38.174 1.00 19.17  ? 26  ALA A N   1 
ATOM   80   C CA  . ALA A 1 11  ? 50.322 60.099 37.723 1.00 18.84  ? 26  ALA A CA  1 
ATOM   81   C C   . ALA A 1 11  ? 50.005 59.171 38.914 1.00 21.21  ? 26  ALA A C   1 
ATOM   82   O O   . ALA A 1 11  ? 49.362 58.120 38.760 1.00 22.31  ? 26  ALA A O   1 
ATOM   83   C CB  . ALA A 1 11  ? 51.608 59.681 37.079 1.00 17.96  ? 26  ALA A CB  1 
ATOM   84   N N   . TRP A 1 12  ? 50.477 59.566 40.096 1.00 19.69  ? 27  TRP A N   1 
ATOM   85   C CA  . TRP A 1 12  ? 50.292 58.799 41.329 1.00 19.69  ? 27  TRP A CA  1 
ATOM   86   C C   . TRP A 1 12  ? 49.728 59.759 42.377 1.00 19.66  ? 27  TRP A C   1 
ATOM   87   O O   . TRP A 1 12  ? 50.483 60.287 43.198 1.00 23.16  ? 27  TRP A O   1 
ATOM   88   C CB  . TRP A 1 12  ? 51.652 58.271 41.785 1.00 18.60  ? 27  TRP A CB  1 
ATOM   89   C CG  . TRP A 1 12  ? 52.408 57.626 40.668 1.00 21.97  ? 27  TRP A CG  1 
ATOM   90   C CD1 . TRP A 1 12  ? 53.572 58.056 40.111 1.00 22.87  ? 27  TRP A CD1 1 
ATOM   91   C CD2 . TRP A 1 12  ? 52.026 56.451 39.937 1.00 19.87  ? 27  TRP A CD2 1 
ATOM   92   N NE1 . TRP A 1 12  ? 53.938 57.226 39.076 1.00 16.24  ? 27  TRP A NE1 1 
ATOM   93   C CE2 . TRP A 1 12  ? 53.004 56.234 38.951 1.00 10.60  ? 27  TRP A CE2 1 
ATOM   94   C CE3 . TRP A 1 12  ? 50.948 55.560 40.022 1.00 21.65  ? 27  TRP A CE3 1 
ATOM   95   C CZ2 . TRP A 1 12  ? 52.944 55.167 38.063 1.00 5.51   ? 27  TRP A CZ2 1 
ATOM   96   C CZ3 . TRP A 1 12  ? 50.894 54.495 39.137 1.00 18.51  ? 27  TRP A CZ3 1 
ATOM   97   C CH2 . TRP A 1 12  ? 51.888 54.311 38.169 1.00 2.00   ? 27  TRP A CH2 1 
ATOM   98   N N   . PRO A 1 13  ? 48.384 59.895 42.445 1.00 14.21  ? 28  PRO A N   1 
ATOM   99   C CA  . PRO A 1 13  ? 47.700 60.794 43.378 1.00 10.55  ? 28  PRO A CA  1 
ATOM   100  C C   . PRO A 1 13  ? 47.778 60.479 44.852 1.00 7.63   ? 28  PRO A C   1 
ATOM   101  O O   . PRO A 1 13  ? 47.326 61.277 45.666 1.00 10.20  ? 28  PRO A O   1 
ATOM   102  C CB  . PRO A 1 13  ? 46.246 60.764 42.895 1.00 7.09   ? 28  PRO A CB  1 
ATOM   103  C CG  . PRO A 1 13  ? 46.271 60.002 41.642 1.00 2.03   ? 28  PRO A CG  1 
ATOM   104  C CD  . PRO A 1 13  ? 47.387 59.039 41.798 1.00 5.88   ? 28  PRO A CD  1 
ATOM   105  N N   . PHE A 1 14  ? 48.293 59.305 45.185 1.00 4.70   ? 29  PHE A N   1 
ATOM   106  C CA  . PHE A 1 14  ? 48.429 58.893 46.570 1.00 4.35   ? 29  PHE A CA  1 
ATOM   107  C C   . PHE A 1 14  ? 49.797 59.289 47.117 1.00 5.67   ? 29  PHE A C   1 
ATOM   108  O O   . PHE A 1 14  ? 50.060 59.159 48.310 1.00 10.97  ? 29  PHE A O   1 
ATOM   109  C CB  . PHE A 1 14  ? 48.222 57.383 46.690 1.00 2.00   ? 29  PHE A CB  1 
ATOM   110  C CG  . PHE A 1 14  ? 49.064 56.591 45.750 1.00 6.05   ? 29  PHE A CG  1 
ATOM   111  C CD1 . PHE A 1 14  ? 50.446 56.508 45.928 1.00 3.13   ? 29  PHE A CD1 1 
ATOM   112  C CD2 . PHE A 1 14  ? 48.495 55.980 44.638 1.00 7.14   ? 29  PHE A CD2 1 
ATOM   113  C CE1 . PHE A 1 14  ? 51.253 55.828 45.007 1.00 12.12  ? 29  PHE A CE1 1 
ATOM   114  C CE2 . PHE A 1 14  ? 49.297 55.294 43.706 1.00 2.25   ? 29  PHE A CE2 1 
ATOM   115  C CZ  . PHE A 1 14  ? 50.677 55.219 43.890 1.00 4.99   ? 29  PHE A CZ  1 
ATOM   116  N N   . MET A 1 15  ? 50.687 59.729 46.237 1.00 5.74   ? 30  MET A N   1 
ATOM   117  C CA  . MET A 1 15  ? 52.030 60.130 46.648 1.00 5.57   ? 30  MET A CA  1 
ATOM   118  C C   . MET A 1 15  ? 51.942 61.369 47.533 1.00 5.77   ? 30  MET A C   1 
ATOM   119  O O   . MET A 1 15  ? 51.278 62.335 47.168 1.00 9.95   ? 30  MET A O   1 
ATOM   120  C CB  . MET A 1 15  ? 52.884 60.410 45.418 1.00 5.66   ? 30  MET A CB  1 
ATOM   121  C CG  . MET A 1 15  ? 54.311 60.736 45.727 1.00 5.91   ? 30  MET A CG  1 
ATOM   122  S SD  . MET A 1 15  ? 55.067 59.435 46.656 1.00 13.00  ? 30  MET A SD  1 
ATOM   123  C CE  . MET A 1 15  ? 56.414 60.306 47.481 1.00 2.00   ? 30  MET A CE  1 
ATOM   124  N N   . VAL A 1 16  ? 52.631 61.338 48.674 1.00 5.56   ? 31  VAL A N   1 
ATOM   125  C CA  . VAL A 1 16  ? 52.617 62.430 49.654 1.00 2.00   ? 31  VAL A CA  1 
ATOM   126  C C   . VAL A 1 16  ? 54.020 62.891 50.003 1.00 2.00   ? 31  VAL A C   1 
ATOM   127  O O   . VAL A 1 16  ? 54.913 62.069 50.145 1.00 2.53   ? 31  VAL A O   1 
ATOM   128  C CB  . VAL A 1 16  ? 51.992 61.946 50.973 1.00 2.49   ? 31  VAL A CB  1 
ATOM   129  C CG1 . VAL A 1 16  ? 51.988 63.057 52.008 1.00 3.67   ? 31  VAL A CG1 1 
ATOM   130  C CG2 . VAL A 1 16  ? 50.597 61.401 50.734 1.00 2.00   ? 31  VAL A CG2 1 
ATOM   131  N N   . SER A 1 17  ? 54.206 64.194 50.187 1.00 2.00   ? 32  SER A N   1 
ATOM   132  C CA  . SER A 1 17  ? 55.501 64.741 50.566 1.00 2.00   ? 32  SER A CA  1 
ATOM   133  C C   . SER A 1 17  ? 55.434 65.299 52.006 1.00 8.08   ? 32  SER A C   1 
ATOM   134  O O   . SER A 1 17  ? 54.650 66.212 52.284 1.00 11.17  ? 32  SER A O   1 
ATOM   135  C CB  . SER A 1 17  ? 55.888 65.853 49.592 1.00 2.42   ? 32  SER A CB  1 
ATOM   136  O OG  . SER A 1 17  ? 57.137 66.425 49.919 1.00 5.30   ? 32  SER A OG  1 
ATOM   137  N N   . LEU A 1 18  ? 56.190 64.691 52.927 1.00 9.97   ? 33  LEU A N   1 
ATOM   138  C CA  . LEU A 1 18  ? 56.272 65.122 54.340 1.00 9.14   ? 33  LEU A CA  1 
ATOM   139  C C   . LEU A 1 18  ? 57.309 66.231 54.401 1.00 9.29   ? 33  LEU A C   1 
ATOM   140  O O   . LEU A 1 18  ? 58.440 66.032 53.945 1.00 9.38   ? 33  LEU A O   1 
ATOM   141  C CB  . LEU A 1 18  ? 56.760 63.988 55.237 1.00 2.63   ? 33  LEU A CB  1 
ATOM   142  C CG  . LEU A 1 18  ? 55.829 62.828 55.530 1.00 8.00   ? 33  LEU A CG  1 
ATOM   143  C CD1 . LEU A 1 18  ? 56.429 62.044 56.668 1.00 8.95   ? 33  LEU A CD1 1 
ATOM   144  C CD2 . LEU A 1 18  ? 54.436 63.335 55.902 1.00 9.06   ? 33  LEU A CD2 1 
ATOM   145  N N   . GLN A 1 19  ? 56.979 67.351 55.033 1.00 7.74   ? 34  GLN A N   1 
ATOM   146  C CA  . GLN A 1 19  ? 57.909 68.469 55.068 1.00 11.03  ? 34  GLN A CA  1 
ATOM   147  C C   . GLN A 1 19  ? 58.086 69.144 56.404 1.00 15.18  ? 34  GLN A C   1 
ATOM   148  O O   . GLN A 1 19  ? 57.150 69.263 57.185 1.00 24.08  ? 34  GLN A O   1 
ATOM   149  C CB  . GLN A 1 19  ? 57.460 69.529 54.071 1.00 3.55   ? 34  GLN A CB  1 
ATOM   150  C CG  . GLN A 1 19  ? 56.994 68.981 52.745 1.00 9.22   ? 34  GLN A CG  1 
ATOM   151  C CD  . GLN A 1 19  ? 56.744 70.057 51.711 1.00 15.78  ? 34  GLN A CD  1 
ATOM   152  O OE1 . GLN A 1 19  ? 56.617 69.764 50.527 1.00 24.24  ? 34  GLN A OE1 1 
ATOM   153  N NE2 . GLN A 1 19  ? 56.663 71.308 52.150 1.00 17.34  ? 34  GLN A NE2 1 
ATOM   154  N N   . LEU A 1 20  ? 59.283 69.641 56.648 1.00 17.51  ? 35  LEU A N   1 
ATOM   155  C CA  . LEU A 1 20  ? 59.549 70.341 57.886 1.00 22.60  ? 35  LEU A CA  1 
ATOM   156  C C   . LEU A 1 20  ? 60.079 71.677 57.467 1.00 27.33  ? 35  LEU A C   1 
ATOM   157  O O   . LEU A 1 20  ? 61.030 71.741 56.676 1.00 28.46  ? 35  LEU A O   1 
ATOM   158  C CB  . LEU A 1 20  ? 60.611 69.620 58.698 1.00 22.64  ? 35  LEU A CB  1 
ATOM   159  C CG  . LEU A 1 20  ? 60.173 69.243 60.103 1.00 25.04  ? 35  LEU A CG  1 
ATOM   160  C CD1 . LEU A 1 20  ? 61.378 68.733 60.841 1.00 38.92  ? 35  LEU A CD1 1 
ATOM   161  C CD2 . LEU A 1 20  ? 59.574 70.432 60.822 1.00 35.22  ? 35  LEU A CD2 1 
ATOM   162  N N   . ALA A 1 21  ? 59.448 72.738 57.965 1.00 31.84  ? 36  ALA A N   1 
ATOM   163  C CA  . ALA A 1 21  ? 59.842 74.117 57.645 1.00 34.87  ? 36  ALA A CA  1 
ATOM   164  C C   . ALA A 1 21  ? 60.114 74.321 56.133 1.00 33.66  ? 36  ALA A C   1 
ATOM   165  O O   . ALA A 1 21  ? 61.245 74.584 55.706 1.00 35.22  ? 36  ALA A O   1 
ATOM   166  C CB  . ALA A 1 21  ? 61.068 74.524 58.501 1.00 31.27  ? 36  ALA A CB  1 
ATOM   167  N N   . GLY A 1 22  ? 59.085 74.121 55.317 1.00 31.82  ? 38  GLY A N   1 
ATOM   168  C CA  . GLY A 1 22  ? 59.250 74.289 53.879 1.00 32.79  ? 38  GLY A CA  1 
ATOM   169  C C   . GLY A 1 22  ? 60.048 73.230 53.120 1.00 32.13  ? 38  GLY A C   1 
ATOM   170  O O   . GLY A 1 22  ? 59.920 73.148 51.894 1.00 32.94  ? 38  GLY A O   1 
ATOM   171  N N   . GLY A 1 23  ? 60.838 72.406 53.816 1.00 29.14  ? 39  GLY A N   1 
ATOM   172  C CA  . GLY A 1 23  ? 61.619 71.384 53.131 1.00 22.86  ? 39  GLY A CA  1 
ATOM   173  C C   . GLY A 1 23  ? 61.220 69.913 53.251 1.00 17.71  ? 39  GLY A C   1 
ATOM   174  O O   . GLY A 1 23  ? 61.159 69.366 54.349 1.00 19.49  ? 39  GLY A O   1 
ATOM   175  N N   . HIS A 1 24  ? 60.969 69.271 52.110 1.00 12.35  ? 40  HIS A N   1 
ATOM   176  C CA  . HIS A 1 24  ? 60.618 67.846 52.044 1.00 2.90   ? 40  HIS A CA  1 
ATOM   177  C C   . HIS A 1 24  ? 61.689 67.008 52.726 1.00 2.00   ? 40  HIS A C   1 
ATOM   178  O O   . HIS A 1 24  ? 62.861 67.188 52.459 1.00 3.50   ? 40  HIS A O   1 
ATOM   179  C CB  . HIS A 1 24  ? 60.502 67.426 50.570 1.00 2.00   ? 40  HIS A CB  1 
ATOM   180  C CG  . HIS A 1 24  ? 60.606 65.946 50.330 1.00 2.00   ? 40  HIS A CG  1 
ATOM   181  N ND1 . HIS A 1 24  ? 59.527 65.179 49.946 1.00 3.98   ? 40  HIS A ND1 1 
ATOM   182  C CD2 . HIS A 1 24  ? 61.661 65.103 50.395 1.00 4.97   ? 40  HIS A CD2 1 
ATOM   183  C CE1 . HIS A 1 24  ? 59.914 63.924 49.797 1.00 2.00   ? 40  HIS A CE1 1 
ATOM   184  N NE2 . HIS A 1 24  ? 61.205 63.847 50.060 1.00 2.00   ? 40  HIS A NE2 1 
ATOM   185  N N   . PHE A 1 25  ? 61.291 66.077 53.581 1.00 2.15   ? 41  PHE A N   1 
ATOM   186  C CA  . PHE A 1 25  ? 62.259 65.210 54.252 1.00 3.25   ? 41  PHE A CA  1 
ATOM   187  C C   . PHE A 1 25  ? 61.938 63.722 54.134 1.00 3.79   ? 41  PHE A C   1 
ATOM   188  O O   . PHE A 1 25  ? 62.806 62.888 54.361 1.00 5.84   ? 41  PHE A O   1 
ATOM   189  C CB  . PHE A 1 25  ? 62.434 65.590 55.722 1.00 2.00   ? 41  PHE A CB  1 
ATOM   190  C CG  . PHE A 1 25  ? 61.235 65.314 56.570 1.00 2.10   ? 41  PHE A CG  1 
ATOM   191  C CD1 . PHE A 1 25  ? 60.208 66.254 56.673 1.00 7.21   ? 41  PHE A CD1 1 
ATOM   192  C CD2 . PHE A 1 25  ? 61.138 64.125 57.288 1.00 2.62   ? 41  PHE A CD2 1 
ATOM   193  C CE1 . PHE A 1 25  ? 59.109 66.018 57.481 1.00 8.33   ? 41  PHE A CE1 1 
ATOM   194  C CE2 . PHE A 1 25  ? 60.048 63.877 58.098 1.00 7.78   ? 41  PHE A CE2 1 
ATOM   195  C CZ  . PHE A 1 25  ? 59.025 64.829 58.198 1.00 15.88  ? 41  PHE A CZ  1 
ATOM   196  N N   . CYS A 1 26  ? 60.699 63.394 53.775 1.00 4.65   ? 42  CYS A N   1 
ATOM   197  C CA  . CYS A 1 26  ? 60.284 62.001 53.603 1.00 4.90   ? 42  CYS A CA  1 
ATOM   198  C C   . CYS A 1 26  ? 59.043 61.853 52.709 1.00 8.25   ? 42  CYS A C   1 
ATOM   199  O O   . CYS A 1 26  ? 58.294 62.812 52.491 1.00 11.61  ? 42  CYS A O   1 
ATOM   200  C CB  . CYS A 1 26  ? 60.010 61.358 54.956 1.00 2.39   ? 42  CYS A CB  1 
ATOM   201  S SG  . CYS A 1 26  ? 61.397 60.434 55.644 1.00 2.87   ? 42  CYS A SG  1 
ATOM   202  N N   . GLY A 1 27  ? 58.867 60.665 52.143 1.00 7.60   ? 43  GLY A N   1 
ATOM   203  C CA  . GLY A 1 27  ? 57.711 60.402 51.310 1.00 4.99   ? 43  GLY A CA  1 
ATOM   204  C C   . GLY A 1 27  ? 56.675 59.630 52.113 1.00 6.28   ? 43  GLY A C   1 
ATOM   205  O O   . GLY A 1 27  ? 57.002 59.029 53.139 1.00 6.71   ? 43  GLY A O   1 
ATOM   206  N N   . ALA A 1 28  ? 55.426 59.640 51.653 1.00 7.34   ? 44  ALA A N   1 
ATOM   207  C CA  . ALA A 1 28  ? 54.344 58.945 52.344 1.00 6.70   ? 44  ALA A CA  1 
ATOM   208  C C   . ALA A 1 28  ? 53.261 58.616 51.339 1.00 6.14   ? 44  ALA A C   1 
ATOM   209  O O   . ALA A 1 28  ? 53.242 59.157 50.235 1.00 6.07   ? 44  ALA A O   1 
ATOM   210  C CB  . ALA A 1 28  ? 53.788 59.810 53.449 1.00 2.00   ? 44  ALA A CB  1 
ATOM   211  N N   . THR A 1 29  ? 52.371 57.715 51.703 1.00 2.00   ? 45  THR A N   1 
ATOM   212  C CA  . THR A 1 29  ? 51.315 57.332 50.801 1.00 2.00   ? 45  THR A CA  1 
ATOM   213  C C   . THR A 1 29  ? 49.988 57.616 51.463 1.00 2.58   ? 45  THR A C   1 
ATOM   214  O O   . THR A 1 29  ? 49.827 57.323 52.637 1.00 6.02   ? 45  THR A O   1 
ATOM   215  C CB  . THR A 1 29  ? 51.387 55.833 50.535 1.00 2.00   ? 45  THR A CB  1 
ATOM   216  O OG1 . THR A 1 29  ? 52.713 55.479 50.145 1.00 4.74   ? 45  THR A OG1 1 
ATOM   217  C CG2 . THR A 1 29  ? 50.440 55.455 49.447 1.00 3.46   ? 45  THR A CG2 1 
ATOM   218  N N   . LEU A 1 30  ? 49.039 58.194 50.735 1.00 2.25   ? 46  LEU A N   1 
ATOM   219  C CA  . LEU A 1 30  ? 47.717 58.466 51.298 1.00 2.00   ? 46  LEU A CA  1 
ATOM   220  C C   . LEU A 1 30  ? 46.954 57.139 51.282 1.00 3.90   ? 46  LEU A C   1 
ATOM   221  O O   . LEU A 1 30  ? 46.861 56.482 50.238 1.00 6.58   ? 46  LEU A O   1 
ATOM   222  C CB  . LEU A 1 30  ? 46.987 59.510 50.463 1.00 2.00   ? 46  LEU A CB  1 
ATOM   223  C CG  . LEU A 1 30  ? 45.656 60.003 51.023 1.00 2.00   ? 46  LEU A CG  1 
ATOM   224  C CD1 . LEU A 1 30  ? 45.874 60.750 52.315 1.00 2.00   ? 46  LEU A CD1 1 
ATOM   225  C CD2 . LEU A 1 30  ? 44.986 60.898 49.999 1.00 2.00   ? 46  LEU A CD2 1 
ATOM   226  N N   . ILE A 1 31  ? 46.445 56.712 52.431 1.00 2.00   ? 47  ILE A N   1 
ATOM   227  C CA  . ILE A 1 31  ? 45.728 55.451 52.487 1.00 2.00   ? 47  ILE A CA  1 
ATOM   228  C C   . ILE A 1 31  ? 44.295 55.556 52.942 1.00 2.00   ? 47  ILE A C   1 
ATOM   229  O O   . ILE A 1 31  ? 43.606 54.558 53.051 1.00 3.27   ? 47  ILE A O   1 
ATOM   230  C CB  . ILE A 1 31  ? 46.439 54.419 53.356 1.00 2.00   ? 47  ILE A CB  1 
ATOM   231  C CG1 . ILE A 1 31  ? 46.785 55.019 54.716 1.00 7.89   ? 47  ILE A CG1 1 
ATOM   232  C CG2 . ILE A 1 31  ? 47.631 53.854 52.628 1.00 2.00   ? 47  ILE A CG2 1 
ATOM   233  C CD1 . ILE A 1 31  ? 47.382 54.009 55.675 1.00 9.21   ? 47  ILE A CD1 1 
ATOM   234  N N   . ALA A 1 32  ? 43.846 56.766 53.206 1.00 3.44   ? 48  ALA A N   1 
ATOM   235  C CA  . ALA A 1 32  ? 42.471 57.019 53.623 1.00 3.87   ? 48  ALA A CA  1 
ATOM   236  C C   . ALA A 1 32  ? 42.388 58.518 53.543 1.00 8.83   ? 48  ALA A C   1 
ATOM   237  O O   . ALA A 1 32  ? 43.415 59.197 53.635 1.00 10.66  ? 48  ALA A O   1 
ATOM   238  C CB  . ALA A 1 32  ? 42.243 56.573 55.025 1.00 2.00   ? 48  ALA A CB  1 
ATOM   239  N N   . PRO A 1 33  ? 41.179 59.075 53.373 1.00 9.84   ? 49  PRO A N   1 
ATOM   240  C CA  . PRO A 1 33  ? 41.141 60.537 53.293 1.00 8.26   ? 49  PRO A CA  1 
ATOM   241  C C   . PRO A 1 33  ? 41.866 61.245 54.446 1.00 7.57   ? 49  PRO A C   1 
ATOM   242  O O   . PRO A 1 33  ? 42.353 62.370 54.289 1.00 7.12   ? 49  PRO A O   1 
ATOM   243  C CB  . PRO A 1 33  ? 39.644 60.830 53.253 1.00 5.87   ? 49  PRO A CB  1 
ATOM   244  C CG  . PRO A 1 33  ? 39.124 59.650 52.474 1.00 4.72   ? 49  PRO A CG  1 
ATOM   245  C CD  . PRO A 1 33  ? 39.846 58.499 53.118 1.00 2.00   ? 49  PRO A CD  1 
ATOM   246  N N   . ASN A 1 34  ? 42.024 60.553 55.568 1.00 7.02   ? 50  ASN A N   1 
ATOM   247  C CA  . ASN A 1 34  ? 42.670 61.150 56.721 1.00 5.72   ? 50  ASN A CA  1 
ATOM   248  C C   . ASN A 1 34  ? 43.787 60.314 57.303 1.00 5.22   ? 50  ASN A C   1 
ATOM   249  O O   . ASN A 1 34  ? 44.109 60.426 58.478 1.00 10.58  ? 50  ASN A O   1 
ATOM   250  C CB  . ASN A 1 34  ? 41.626 61.473 57.794 1.00 6.61   ? 50  ASN A CB  1 
ATOM   251  C CG  . ASN A 1 34  ? 40.843 60.250 58.256 1.00 10.63  ? 50  ASN A CG  1 
ATOM   252  O OD1 . ASN A 1 34  ? 40.774 59.216 57.569 1.00 17.30  ? 50  ASN A OD1 1 
ATOM   253  N ND2 . ASN A 1 34  ? 40.231 60.369 59.425 1.00 17.52  ? 50  ASN A ND2 1 
ATOM   254  N N   . PHE A 1 35  ? 44.409 59.487 56.487 1.00 6.05   ? 51  PHE A N   1 
ATOM   255  C CA  . PHE A 1 35  ? 45.494 58.670 56.995 1.00 5.90   ? 51  PHE A CA  1 
ATOM   256  C C   . PHE A 1 35  ? 46.571 58.519 55.965 1.00 4.59   ? 51  PHE A C   1 
ATOM   257  O O   . PHE A 1 35  ? 46.307 58.172 54.820 1.00 3.98   ? 51  PHE A O   1 
ATOM   258  C CB  . PHE A 1 35  ? 45.010 57.290 57.392 1.00 11.22  ? 51  PHE A CB  1 
ATOM   259  C CG  . PHE A 1 35  ? 44.340 57.233 58.722 1.00 4.89   ? 51  PHE A CG  1 
ATOM   260  C CD1 . PHE A 1 35  ? 45.081 56.987 59.866 1.00 11.08  ? 51  PHE A CD1 1 
ATOM   261  C CD2 . PHE A 1 35  ? 42.956 57.333 58.823 1.00 7.10   ? 51  PHE A CD2 1 
ATOM   262  C CE1 . PHE A 1 35  ? 44.452 56.832 61.107 1.00 17.45  ? 51  PHE A CE1 1 
ATOM   263  C CE2 . PHE A 1 35  ? 42.316 57.181 60.050 1.00 14.47  ? 51  PHE A CE2 1 
ATOM   264  C CZ  . PHE A 1 35  ? 43.067 56.928 61.197 1.00 11.40  ? 51  PHE A CZ  1 
ATOM   265  N N   . VAL A 1 36  ? 47.797 58.704 56.421 1.00 5.28   ? 52  VAL A N   1 
ATOM   266  C CA  . VAL A 1 36  ? 48.979 58.605 55.599 1.00 2.60   ? 52  VAL A CA  1 
ATOM   267  C C   . VAL A 1 36  ? 49.865 57.553 56.215 1.00 2.00   ? 52  VAL A C   1 
ATOM   268  O O   . VAL A 1 36  ? 49.928 57.414 57.431 1.00 6.02   ? 52  VAL A O   1 
ATOM   269  C CB  . VAL A 1 36  ? 49.706 59.924 55.589 1.00 2.00   ? 52  VAL A CB  1 
ATOM   270  C CG1 . VAL A 1 36  ? 51.066 59.747 55.081 1.00 7.45   ? 52  VAL A CG1 1 
ATOM   271  C CG2 . VAL A 1 36  ? 48.953 60.915 54.738 1.00 2.00   ? 52  VAL A CG2 1 
ATOM   272  N N   . MET A 1 37  ? 50.572 56.836 55.369 1.00 2.00   ? 53  MET A N   1 
ATOM   273  C CA  . MET A 1 37  ? 51.449 55.775 55.805 1.00 2.00   ? 53  MET A CA  1 
ATOM   274  C C   . MET A 1 37  ? 52.845 56.181 55.381 1.00 2.00   ? 53  MET A C   1 
ATOM   275  O O   . MET A 1 37  ? 53.036 56.690 54.281 1.00 4.69   ? 53  MET A O   1 
ATOM   276  C CB  . MET A 1 37  ? 51.014 54.502 55.094 1.00 2.00   ? 53  MET A CB  1 
ATOM   277  C CG  . MET A 1 37  ? 51.656 53.245 55.555 1.00 6.42   ? 53  MET A CG  1 
ATOM   278  S SD  . MET A 1 37  ? 51.181 51.915 54.473 1.00 9.77   ? 53  MET A SD  1 
ATOM   279  C CE  . MET A 1 37  ? 51.678 52.509 52.916 1.00 11.08  ? 53  MET A CE  1 
ATOM   280  N N   . SER A 1 38  ? 53.815 55.989 56.260 1.00 2.00   ? 54  SER A N   1 
ATOM   281  C CA  . SER A 1 38  ? 55.194 56.351 55.959 1.00 3.94   ? 54  SER A CA  1 
ATOM   282  C C   . SER A 1 38  ? 56.167 55.443 56.720 1.00 5.11   ? 54  SER A C   1 
ATOM   283  O O   . SER A 1 38  ? 55.767 54.417 57.282 1.00 9.64   ? 54  SER A O   1 
ATOM   284  C CB  . SER A 1 38  ? 55.426 57.825 56.313 1.00 10.81  ? 54  SER A CB  1 
ATOM   285  O OG  . SER A 1 38  ? 56.740 58.259 56.002 1.00 19.94  ? 54  SER A OG  1 
ATOM   286  N N   . ALA A 1 39  ? 57.450 55.775 56.690 1.00 4.02   ? 55  ALA A N   1 
ATOM   287  C CA  . ALA A 1 39  ? 58.445 54.983 57.396 1.00 6.92   ? 55  ALA A CA  1 
ATOM   288  C C   . ALA A 1 39  ? 58.620 55.508 58.837 1.00 7.38   ? 55  ALA A C   1 
ATOM   289  O O   . ALA A 1 39  ? 58.796 56.705 59.064 1.00 8.02   ? 55  ALA A O   1 
ATOM   290  C CB  . ALA A 1 39  ? 59.769 55.009 56.636 1.00 2.00   ? 55  ALA A CB  1 
ATOM   291  N N   . ALA A 1 40  ? 58.584 54.602 59.807 1.00 8.96   ? 56  ALA A N   1 
ATOM   292  C CA  . ALA A 1 40  ? 58.727 54.965 61.217 1.00 8.32   ? 56  ALA A CA  1 
ATOM   293  C C   . ALA A 1 40  ? 59.940 55.839 61.521 1.00 5.72   ? 56  ALA A C   1 
ATOM   294  O O   . ALA A 1 40  ? 59.879 56.701 62.381 1.00 9.61   ? 56  ALA A O   1 
ATOM   295  C CB  . ALA A 1 40  ? 58.748 53.709 62.090 1.00 4.04   ? 56  ALA A CB  1 
ATOM   296  N N   . HIS A 1 41  ? 61.027 55.663 60.784 1.00 7.48   ? 57  HIS A N   1 
ATOM   297  C CA  . HIS A 1 41  ? 62.232 56.452 61.039 1.00 4.64   ? 57  HIS A CA  1 
ATOM   298  C C   . HIS A 1 41  ? 62.127 57.873 60.529 1.00 4.97   ? 57  HIS A C   1 
ATOM   299  O O   . HIS A 1 41  ? 63.020 58.669 60.767 1.00 10.45  ? 57  HIS A O   1 
ATOM   300  C CB  . HIS A 1 41  ? 63.502 55.764 60.485 1.00 2.00   ? 57  HIS A CB  1 
ATOM   301  C CG  . HIS A 1 41  ? 63.648 55.839 58.998 1.00 2.00   ? 57  HIS A CG  1 
ATOM   302  N ND1 . HIS A 1 41  ? 63.306 54.800 58.163 1.00 5.44   ? 57  HIS A ND1 1 
ATOM   303  C CD2 . HIS A 1 41  ? 64.120 56.821 58.194 1.00 2.00   ? 57  HIS A CD2 1 
ATOM   304  C CE1 . HIS A 1 41  ? 63.559 55.134 56.909 1.00 2.00   ? 57  HIS A CE1 1 
ATOM   305  N NE2 . HIS A 1 41  ? 64.053 56.357 56.902 1.00 2.17   ? 57  HIS A NE2 1 
ATOM   306  N N   . CYS A 1 42  ? 61.061 58.193 59.809 1.00 4.06   ? 58  CYS A N   1 
ATOM   307  C CA  . CYS A 1 42  ? 60.904 59.546 59.308 1.00 4.75   ? 58  CYS A CA  1 
ATOM   308  C C   . CYS A 1 42  ? 60.453 60.460 60.416 1.00 6.64   ? 58  CYS A C   1 
ATOM   309  O O   . CYS A 1 42  ? 60.968 61.556 60.550 1.00 16.51  ? 58  CYS A O   1 
ATOM   310  C CB  . CYS A 1 42  ? 59.912 59.613 58.153 1.00 3.47   ? 58  CYS A CB  1 
ATOM   311  S SG  . CYS A 1 42  ? 60.556 58.873 56.620 1.00 3.02   ? 58  CYS A SG  1 
ATOM   312  N N   . VAL A 1 43  ? 59.490 60.025 61.211 1.00 4.11   ? 59  VAL A N   1 
ATOM   313  C CA  . VAL A 1 43  ? 59.016 60.861 62.296 1.00 8.30   ? 59  VAL A CA  1 
ATOM   314  C C   . VAL A 1 43  ? 59.804 60.615 63.584 1.00 9.02   ? 59  VAL A C   1 
ATOM   315  O O   . VAL A 1 43  ? 59.628 61.322 64.568 1.00 7.15   ? 59  VAL A O   1 
ATOM   316  C CB  . VAL A 1 43  ? 57.523 60.656 62.523 1.00 11.27  ? 59  VAL A CB  1 
ATOM   317  C CG1 . VAL A 1 43  ? 56.765 61.083 61.283 1.00 15.79  ? 59  VAL A CG1 1 
ATOM   318  C CG2 . VAL A 1 43  ? 57.235 59.200 62.819 1.00 16.96  ? 59  VAL A CG2 1 
ATOM   319  N N   . ALA A 1 44  ? 60.709 59.644 63.536 1.00 10.97  ? 60  ALA A N   1 
ATOM   320  C CA  . ALA A 1 44  ? 61.548 59.277 64.666 1.00 15.16  ? 60  ALA A CA  1 
ATOM   321  C C   . ALA A 1 44  ? 62.070 60.477 65.458 1.00 22.39  ? 60  ALA A C   1 
ATOM   322  O O   . ALA A 1 44  ? 61.506 60.805 66.504 1.00 30.67  ? 60  ALA A O   1 
ATOM   323  C CB  . ALA A 1 44  ? 62.690 58.391 64.204 1.00 14.57  ? 60  ALA A CB  1 
ATOM   324  N N   . ASN A 1 45  ? 63.129 61.142 65.005 1.00 21.83  ? 61  ASN A N   1 
ATOM   325  C CA  . ASN A 1 45  ? 63.606 62.292 65.776 1.00 27.10  ? 61  ASN A CA  1 
ATOM   326  C C   . ASN A 1 45  ? 63.335 63.529 64.936 1.00 27.59  ? 61  ASN A C   1 
ATOM   327  O O   . ASN A 1 45  ? 64.202 64.043 64.224 1.00 31.05  ? 61  ASN A O   1 
ATOM   328  C CB  . ASN A 1 45  ? 65.086 62.165 66.137 1.00 43.41  ? 61  ASN A CB  1 
ATOM   329  C CG  . ASN A 1 45  ? 65.490 63.076 67.293 1.00 54.81  ? 61  ASN A CG  1 
ATOM   330  O OD1 . ASN A 1 45  ? 65.222 62.779 68.450 1.00 60.71  ? 61  ASN A OD1 1 
ATOM   331  N ND2 . ASN A 1 45  ? 66.150 64.183 66.978 1.00 62.08  ? 61  ASN A ND2 1 
ATOM   332  N N   . VAL A 1 46  ? 62.103 64.001 65.041 1.00 23.58  ? 62  VAL A N   1 
ATOM   333  C CA  . VAL A 1 46  ? 61.641 65.129 64.283 1.00 14.94  ? 62  VAL A CA  1 
ATOM   334  C C   . VAL A 1 46  ? 60.507 65.726 65.094 1.00 14.90  ? 62  VAL A C   1 
ATOM   335  O O   . VAL A 1 46  ? 59.803 65.006 65.795 1.00 18.76  ? 62  VAL A O   1 
ATOM   336  C CB  . VAL A 1 46  ? 61.134 64.602 62.935 1.00 10.95  ? 62  VAL A CB  1 
ATOM   337  C CG1 . VAL A 1 46  ? 59.649 64.873 62.747 1.00 5.55   ? 62  VAL A CG1 1 
ATOM   338  C CG2 . VAL A 1 46  ? 61.987 65.140 61.806 1.00 7.50   ? 62  VAL A CG2 1 
ATOM   339  N N   . ASN A 1 47  A 60.333 67.037 65.042 1.00 14.78  ? 62  ASN A N   1 
ATOM   340  C CA  . ASN A 1 47  A 59.244 67.644 65.799 1.00 16.29  ? 62  ASN A CA  1 
ATOM   341  C C   . ASN A 1 47  A 57.942 67.420 65.031 1.00 16.85  ? 62  ASN A C   1 
ATOM   342  O O   . ASN A 1 47  A 57.595 68.184 64.124 1.00 19.46  ? 62  ASN A O   1 
ATOM   343  C CB  . ASN A 1 47  A 59.504 69.136 66.027 1.00 18.18  ? 62  ASN A CB  1 
ATOM   344  C CG  . ASN A 1 47  A 58.336 69.838 66.700 1.00 22.39  ? 62  ASN A CG  1 
ATOM   345  O OD1 . ASN A 1 47  A 58.086 71.017 66.449 1.00 35.12  ? 62  ASN A OD1 1 
ATOM   346  N ND2 . ASN A 1 47  A 57.611 69.119 67.555 1.00 28.40  ? 62  ASN A ND2 1 
ATOM   347  N N   . VAL A 1 48  B 57.210 66.378 65.404 1.00 14.08  ? 62  VAL A N   1 
ATOM   348  C CA  . VAL A 1 48  B 55.971 66.053 64.711 1.00 11.81  ? 62  VAL A CA  1 
ATOM   349  C C   . VAL A 1 48  B 54.930 67.172 64.683 1.00 11.92  ? 62  VAL A C   1 
ATOM   350  O O   . VAL A 1 48  B 54.198 67.307 63.715 1.00 16.30  ? 62  VAL A O   1 
ATOM   351  C CB  . VAL A 1 48  B 55.364 64.744 65.232 1.00 6.06   ? 62  VAL A CB  1 
ATOM   352  C CG1 . VAL A 1 48  B 54.216 64.325 64.355 1.00 10.98  ? 62  VAL A CG1 1 
ATOM   353  C CG2 . VAL A 1 48  B 56.404 63.649 65.228 1.00 2.00   ? 62  VAL A CG2 1 
ATOM   354  N N   . ARG A 1 49  ? 54.918 68.026 65.695 1.00 12.79  ? 63  ARG A N   1 
ATOM   355  C CA  . ARG A 1 49  ? 53.960 69.130 65.736 1.00 17.05  ? 63  ARG A CA  1 
ATOM   356  C C   . ARG A 1 49  ? 54.204 70.128 64.613 1.00 17.32  ? 63  ARG A C   1 
ATOM   357  O O   . ARG A 1 49  ? 53.316 70.908 64.298 1.00 19.59  ? 63  ARG A O   1 
ATOM   358  C CB  . ARG A 1 49  ? 54.029 69.865 67.082 1.00 20.16  ? 63  ARG A CB  1 
ATOM   359  C CG  . ARG A 1 49  ? 53.904 68.941 68.282 1.00 52.94  ? 63  ARG A CG  1 
ATOM   360  C CD  . ARG A 1 49  ? 54.276 69.610 69.611 1.00 75.05  ? 63  ARG A CD  1 
ATOM   361  N NE  . ARG A 1 49  ? 54.818 68.633 70.566 1.00 91.80  ? 63  ARG A NE  1 
ATOM   362  C CZ  . ARG A 1 49  ? 54.412 68.481 71.828 1.00 96.18  ? 63  ARG A CZ  1 
ATOM   363  N NH1 . ARG A 1 49  ? 53.440 69.239 72.325 1.00 96.65  ? 63  ARG A NH1 1 
ATOM   364  N NH2 . ARG A 1 49  ? 54.992 67.568 72.602 1.00 97.70  ? 63  ARG A NH2 1 
ATOM   365  N N   . ALA A 1 50  ? 55.388 70.076 63.997 1.00 17.18  ? 64  ALA A N   1 
ATOM   366  C CA  . ALA A 1 50  ? 55.764 70.996 62.921 1.00 17.61  ? 64  ALA A CA  1 
ATOM   367  C C   . ALA A 1 50  ? 55.821 70.363 61.537 1.00 21.11  ? 64  ALA A C   1 
ATOM   368  O O   . ALA A 1 50  ? 56.118 71.037 60.543 1.00 21.69  ? 64  ALA A O   1 
ATOM   369  C CB  . ALA A 1 50  ? 57.098 71.613 63.233 1.00 16.59  ? 64  ALA A CB  1 
ATOM   370  N N   . VAL A 1 51  ? 55.602 69.056 61.476 1.00 22.32  ? 65  VAL A N   1 
ATOM   371  C CA  . VAL A 1 51  ? 55.644 68.342 60.209 1.00 18.93  ? 65  VAL A CA  1 
ATOM   372  C C   . VAL A 1 51  ? 54.343 68.647 59.486 1.00 18.55  ? 65  VAL A C   1 
ATOM   373  O O   . VAL A 1 51  ? 53.266 68.629 60.101 1.00 18.60  ? 65  VAL A O   1 
ATOM   374  C CB  . VAL A 1 51  ? 55.762 66.799 60.436 1.00 17.65  ? 65  VAL A CB  1 
ATOM   375  C CG1 . VAL A 1 51  ? 55.912 66.067 59.127 1.00 6.93   ? 65  VAL A CG1 1 
ATOM   376  C CG2 . VAL A 1 51  ? 56.931 66.483 61.331 1.00 17.01  ? 65  VAL A CG2 1 
ATOM   377  N N   . ARG A 1 52  A 54.455 68.990 58.206 1.00 16.57  ? 65  ARG A N   1 
ATOM   378  C CA  . ARG A 1 52  A 53.297 69.273 57.365 1.00 15.51  ? 65  ARG A CA  1 
ATOM   379  C C   . ARG A 1 52  A 53.232 68.197 56.286 1.00 14.63  ? 65  ARG A C   1 
ATOM   380  O O   . ARG A 1 52  A 54.243 67.874 55.649 1.00 13.73  ? 65  ARG A O   1 
ATOM   381  C CB  . ARG A 1 52  A 53.411 70.646 56.709 1.00 16.44  ? 65  ARG A CB  1 
ATOM   382  C CG  . ARG A 1 52  A 53.551 71.780 57.672 1.00 30.48  ? 65  ARG A CG  1 
ATOM   383  C CD  . ARG A 1 52  A 53.616 73.077 56.917 1.00 55.10  ? 65  ARG A CD  1 
ATOM   384  N NE  . ARG A 1 52  A 53.866 74.208 57.802 1.00 70.68  ? 65  ARG A NE  1 
ATOM   385  C CZ  . ARG A 1 52  A 53.062 75.263 57.920 1.00 76.04  ? 65  ARG A CZ  1 
ATOM   386  N NH1 . ARG A 1 52  A 51.945 75.340 57.204 1.00 74.07  ? 65  ARG A NH1 1 
ATOM   387  N NH2 . ARG A 1 52  A 53.382 76.246 58.756 1.00 83.67  ? 65  ARG A NH2 1 
ATOM   388  N N   . VAL A 1 53  ? 52.042 67.638 56.099 1.00 13.30  ? 66  VAL A N   1 
ATOM   389  C CA  . VAL A 1 53  ? 51.797 66.583 55.121 1.00 12.09  ? 66  VAL A CA  1 
ATOM   390  C C   . VAL A 1 53  ? 51.242 67.161 53.822 1.00 13.13  ? 66  VAL A C   1 
ATOM   391  O O   . VAL A 1 53  ? 50.047 67.461 53.758 1.00 15.79  ? 66  VAL A O   1 
ATOM   392  C CB  . VAL A 1 53  ? 50.784 65.586 55.702 1.00 2.90   ? 66  VAL A CB  1 
ATOM   393  C CG1 . VAL A 1 53  ? 50.480 64.485 54.728 1.00 7.15   ? 66  VAL A CG1 1 
ATOM   394  C CG2 . VAL A 1 53  ? 51.335 65.011 56.985 1.00 15.74  ? 66  VAL A CG2 1 
ATOM   395  N N   . VAL A 1 54  ? 52.088 67.324 52.799 1.00 9.93   ? 67  VAL A N   1 
ATOM   396  C CA  . VAL A 1 54  ? 51.618 67.879 51.523 1.00 8.76   ? 67  VAL A CA  1 
ATOM   397  C C   . VAL A 1 54  ? 51.122 66.840 50.537 1.00 6.18   ? 67  VAL A C   1 
ATOM   398  O O   . VAL A 1 54  ? 51.866 65.961 50.119 1.00 8.21   ? 67  VAL A O   1 
ATOM   399  C CB  . VAL A 1 54  ? 52.675 68.755 50.809 1.00 9.60   ? 67  VAL A CB  1 
ATOM   400  C CG1 . VAL A 1 54  ? 52.090 69.340 49.531 1.00 2.00   ? 67  VAL A CG1 1 
ATOM   401  C CG2 . VAL A 1 54  ? 53.115 69.888 51.716 1.00 14.10  ? 67  VAL A CG2 1 
ATOM   402  N N   . LEU A 1 55  ? 49.863 66.976 50.152 1.00 6.11   ? 68  LEU A N   1 
ATOM   403  C CA  . LEU A 1 55  ? 49.227 66.081 49.199 1.00 7.74   ? 68  LEU A CA  1 
ATOM   404  C C   . LEU A 1 55  ? 49.023 66.854 47.908 1.00 13.05  ? 68  LEU A C   1 
ATOM   405  O O   . LEU A 1 55  ? 48.931 68.094 47.926 1.00 14.40  ? 68  LEU A O   1 
ATOM   406  C CB  . LEU A 1 55  ? 47.845 65.695 49.694 1.00 6.52   ? 68  LEU A CB  1 
ATOM   407  C CG  . LEU A 1 55  ? 47.678 65.034 51.048 1.00 6.23   ? 68  LEU A CG  1 
ATOM   408  C CD1 . LEU A 1 55  ? 46.238 65.149 51.435 1.00 2.11   ? 68  LEU A CD1 1 
ATOM   409  C CD2 . LEU A 1 55  ? 48.097 63.585 50.969 1.00 7.98   ? 68  LEU A CD2 1 
ATOM   410  N N   . GLY A 1 56  ? 48.898 66.128 46.799 1.00 11.88  ? 69  GLY A N   1 
ATOM   411  C CA  . GLY A 1 56  ? 48.654 66.779 45.519 1.00 12.61  ? 69  GLY A CA  1 
ATOM   412  C C   . GLY A 1 56  ? 49.795 67.584 44.918 1.00 12.53  ? 69  GLY A C   1 
ATOM   413  O O   . GLY A 1 56  ? 49.569 68.513 44.136 1.00 13.40  ? 69  GLY A O   1 
ATOM   414  N N   . ALA A 1 57  ? 51.024 67.198 45.234 1.00 12.34  ? 70  ALA A N   1 
ATOM   415  C CA  . ALA A 1 57  ? 52.192 67.886 44.719 1.00 9.42   ? 70  ALA A CA  1 
ATOM   416  C C   . ALA A 1 57  ? 52.814 67.117 43.569 1.00 11.91  ? 70  ALA A C   1 
ATOM   417  O O   . ALA A 1 57  ? 52.487 65.942 43.320 1.00 12.85  ? 70  ALA A O   1 
ATOM   418  C CB  . ALA A 1 57  ? 53.201 68.062 45.816 1.00 6.49   ? 70  ALA A CB  1 
ATOM   419  N N   . HIS A 1 58  ? 53.668 67.806 42.825 1.00 12.22  ? 71  HIS A N   1 
ATOM   420  C CA  . HIS A 1 58  ? 54.377 67.182 41.725 1.00 16.12  ? 71  HIS A CA  1 
ATOM   421  C C   . HIS A 1 58  ? 55.751 67.789 41.601 1.00 14.70  ? 71  HIS A C   1 
ATOM   422  O O   . HIS A 1 58  ? 56.745 67.062 41.498 1.00 13.66  ? 71  HIS A O   1 
ATOM   423  C CB  . HIS A 1 58  ? 53.655 67.338 40.397 1.00 26.04  ? 71  HIS A CB  1 
ATOM   424  C CG  . HIS A 1 58  ? 54.382 66.690 39.263 1.00 41.42  ? 71  HIS A CG  1 
ATOM   425  N ND1 . HIS A 1 58  ? 54.598 65.330 39.208 1.00 52.01  ? 71  HIS A ND1 1 
ATOM   426  C CD2 . HIS A 1 58  ? 54.995 67.213 38.172 1.00 37.91  ? 71  HIS A CD2 1 
ATOM   427  C CE1 . HIS A 1 58  ? 55.312 65.041 38.134 1.00 51.43  ? 71  HIS A CE1 1 
ATOM   428  N NE2 . HIS A 1 58  ? 55.565 66.168 37.489 1.00 45.77  ? 71  HIS A NE2 1 
ATOM   429  N N   . ASN A 1 59  ? 55.779 69.118 41.533 1.00 12.69  ? 72  ASN A N   1 
ATOM   430  C CA  . ASN A 1 59  ? 57.017 69.876 41.434 1.00 12.78  ? 72  ASN A CA  1 
ATOM   431  C C   . ASN A 1 59  ? 57.107 70.719 42.693 1.00 14.35  ? 72  ASN A C   1 
ATOM   432  O O   . ASN A 1 59  ? 56.469 71.763 42.804 1.00 12.73  ? 72  ASN A O   1 
ATOM   433  C CB  . ASN A 1 59  ? 56.997 70.774 40.206 1.00 15.50  ? 72  ASN A CB  1 
ATOM   434  C CG  . ASN A 1 59  ? 58.314 71.484 39.983 1.00 17.63  ? 72  ASN A CG  1 
ATOM   435  O OD1 . ASN A 1 59  ? 59.096 71.668 40.910 1.00 15.85  ? 72  ASN A OD1 1 
ATOM   436  N ND2 . ASN A 1 59  ? 58.563 71.890 38.744 1.00 21.87  ? 72  ASN A ND2 1 
ATOM   437  N N   . LEU A 1 60  ? 57.907 70.257 43.640 1.00 17.39  ? 73  LEU A N   1 
ATOM   438  C CA  . LEU A 1 60  ? 58.045 70.935 44.912 1.00 21.43  ? 73  LEU A CA  1 
ATOM   439  C C   . LEU A 1 60  ? 58.585 72.345 44.887 1.00 24.93  ? 73  LEU A C   1 
ATOM   440  O O   . LEU A 1 60  ? 58.388 73.083 45.844 1.00 28.12  ? 73  LEU A O   1 
ATOM   441  C CB  . LEU A 1 60  ? 58.865 70.097 45.891 1.00 15.23  ? 73  LEU A CB  1 
ATOM   442  C CG  . LEU A 1 60  ? 58.391 68.674 46.160 1.00 13.71  ? 73  LEU A CG  1 
ATOM   443  C CD1 . LEU A 1 60  ? 59.290 68.075 47.208 1.00 17.67  ? 73  LEU A CD1 1 
ATOM   444  C CD2 . LEU A 1 60  ? 56.942 68.645 46.622 1.00 19.94  ? 73  LEU A CD2 1 
ATOM   445  N N   . SER A 1 61  ? 59.271 72.744 43.826 1.00 29.77  ? 74  SER A N   1 
ATOM   446  C CA  . SER A 1 61  ? 59.802 74.104 43.823 1.00 36.89  ? 74  SER A CA  1 
ATOM   447  C C   . SER A 1 61  ? 58.771 75.174 43.476 1.00 38.84  ? 74  SER A C   1 
ATOM   448  O O   . SER A 1 61  ? 58.953 76.349 43.813 1.00 40.52  ? 74  SER A O   1 
ATOM   449  C CB  . SER A 1 61  ? 61.028 74.227 42.915 1.00 35.02  ? 74  SER A CB  1 
ATOM   450  O OG  . SER A 1 61  ? 60.732 73.793 41.603 1.00 42.44  ? 74  SER A OG  1 
ATOM   451  N N   . ARG A 1 62  ? 57.686 74.780 42.815 1.00 39.40  ? 75  ARG A N   1 
ATOM   452  C CA  . ARG A 1 62  ? 56.678 75.761 42.445 1.00 41.51  ? 75  ARG A CA  1 
ATOM   453  C C   . ARG A 1 62  ? 55.455 75.768 43.353 1.00 42.79  ? 75  ARG A C   1 
ATOM   454  O O   . ARG A 1 62  ? 55.210 74.799 44.070 1.00 45.18  ? 75  ARG A O   1 
ATOM   455  C CB  . ARG A 1 62  ? 56.277 75.615 40.964 1.00 36.88  ? 75  ARG A CB  1 
ATOM   456  C CG  . ARG A 1 62  ? 55.892 74.232 40.495 1.00 49.21  ? 75  ARG A CG  1 
ATOM   457  C CD  . ARG A 1 62  ? 55.310 74.295 39.072 1.00 68.17  ? 75  ARG A CD  1 
ATOM   458  N NE  . ARG A 1 62  ? 54.949 72.979 38.521 1.00 81.73  ? 75  ARG A NE  1 
ATOM   459  C CZ  . ARG A 1 62  ? 53.701 72.519 38.374 1.00 80.51  ? 75  ARG A CZ  1 
ATOM   460  N NH1 . ARG A 1 62  ? 52.653 73.251 38.741 1.00 78.51  ? 75  ARG A NH1 1 
ATOM   461  N NH2 . ARG A 1 62  ? 53.497 71.327 37.819 1.00 76.38  ? 75  ARG A NH2 1 
ATOM   462  N N   . ARG A 1 63  ? 54.760 76.907 43.408 1.00 43.74  ? 76  ARG A N   1 
ATOM   463  C CA  . ARG A 1 63  ? 53.539 77.013 44.203 1.00 45.13  ? 76  ARG A CA  1 
ATOM   464  C C   . ARG A 1 63  ? 52.459 76.303 43.380 1.00 42.36  ? 76  ARG A C   1 
ATOM   465  O O   . ARG A 1 63  ? 52.179 76.663 42.232 1.00 42.45  ? 76  ARG A O   1 
ATOM   466  C CB  . ARG A 1 63  ? 53.132 78.477 44.455 1.00 52.29  ? 76  ARG A CB  1 
ATOM   467  C CG  . ARG A 1 63  ? 52.448 79.167 43.271 1.00 70.61  ? 76  ARG A CG  1 
ATOM   468  C CD  . ARG A 1 63  ? 51.648 80.403 43.675 1.00 92.21  ? 76  ARG A CD  1 
ATOM   469  N NE  . ARG A 1 63  ? 50.542 80.108 44.589 1.00 106.22 ? 76  ARG A NE  1 
ATOM   470  C CZ  . ARG A 1 63  ? 49.455 79.402 44.274 1.00 112.72 ? 76  ARG A CZ  1 
ATOM   471  N NH1 . ARG A 1 63  ? 49.299 78.893 43.055 1.00 111.28 ? 76  ARG A NH1 1 
ATOM   472  N NH2 . ARG A 1 63  ? 48.500 79.232 45.181 1.00 115.54 ? 76  ARG A NH2 1 
ATOM   473  N N   . GLU A 1 64  ? 51.902 75.244 43.933 1.00 38.69  ? 77  GLU A N   1 
ATOM   474  C CA  . GLU A 1 64  ? 50.895 74.525 43.209 1.00 35.88  ? 77  GLU A CA  1 
ATOM   475  C C   . GLU A 1 64  ? 49.622 74.610 43.991 1.00 41.05  ? 77  GLU A C   1 
ATOM   476  O O   . GLU A 1 64  ? 49.633 74.541 45.216 1.00 44.00  ? 77  GLU A O   1 
ATOM   477  C CB  . GLU A 1 64  ? 51.327 73.091 43.024 1.00 28.59  ? 77  GLU A CB  1 
ATOM   478  C CG  . GLU A 1 64  ? 52.670 72.992 42.347 1.00 22.49  ? 77  GLU A CG  1 
ATOM   479  C CD  . GLU A 1 64  ? 53.212 71.596 42.367 1.00 27.29  ? 77  GLU A CD  1 
ATOM   480  O OE1 . GLU A 1 64  ? 53.511 71.098 43.469 1.00 34.00  ? 77  GLU A OE1 1 
ATOM   481  O OE2 . GLU A 1 64  ? 53.335 70.988 41.287 1.00 27.04  ? 77  GLU A OE2 1 
ATOM   482  N N   . PRO A 1 65  ? 48.520 74.911 43.296 1.00 43.84  ? 78  PRO A N   1 
ATOM   483  C CA  . PRO A 1 65  ? 47.161 75.042 43.836 1.00 45.05  ? 78  PRO A CA  1 
ATOM   484  C C   . PRO A 1 65  ? 46.457 73.683 43.968 1.00 42.95  ? 78  PRO A C   1 
ATOM   485  O O   . PRO A 1 65  ? 45.349 73.591 44.488 1.00 44.55  ? 78  PRO A O   1 
ATOM   486  C CB  . PRO A 1 65  ? 46.489 75.928 42.795 1.00 47.80  ? 78  PRO A CB  1 
ATOM   487  C CG  . PRO A 1 65  ? 47.134 75.479 41.535 1.00 49.64  ? 78  PRO A CG  1 
ATOM   488  C CD  . PRO A 1 65  ? 48.584 75.421 41.918 1.00 45.84  ? 78  PRO A CD  1 
ATOM   489  N N   . THR A 1 66  ? 47.103 72.653 43.437 1.00 40.57  ? 79  THR A N   1 
ATOM   490  C CA  . THR A 1 66  ? 46.630 71.275 43.474 1.00 39.27  ? 79  THR A CA  1 
ATOM   491  C C   . THR A 1 66  ? 46.813 70.711 44.892 1.00 36.89  ? 79  THR A C   1 
ATOM   492  O O   . THR A 1 66  ? 46.121 69.760 45.316 1.00 36.91  ? 79  THR A O   1 
ATOM   493  C CB  . THR A 1 66  ? 47.529 70.414 42.586 1.00 43.21  ? 79  THR A CB  1 
ATOM   494  O OG1 . THR A 1 66  ? 47.529 70.907 41.246 1.00 56.33  ? 79  THR A OG1 1 
ATOM   495  C CG2 . THR A 1 66  ? 47.084 69.022 42.602 1.00 47.29  ? 79  THR A CG2 1 
ATOM   496  N N   . ARG A 1 67  ? 47.808 71.279 45.572 1.00 30.79  ? 80  ARG A N   1 
ATOM   497  C CA  . ARG A 1 67  ? 48.207 70.888 46.906 1.00 21.89  ? 80  ARG A CA  1 
ATOM   498  C C   . ARG A 1 67  ? 47.205 71.104 47.997 1.00 17.87  ? 80  ARG A C   1 
ATOM   499  O O   . ARG A 1 67  ? 46.546 72.136 48.078 1.00 18.28  ? 80  ARG A O   1 
ATOM   500  C CB  . ARG A 1 67  ? 49.480 71.619 47.313 1.00 19.89  ? 80  ARG A CB  1 
ATOM   501  C CG  . ARG A 1 67  ? 50.709 71.257 46.513 1.00 31.17  ? 80  ARG A CG  1 
ATOM   502  C CD  . ARG A 1 67  ? 51.907 72.013 47.063 1.00 42.27  ? 80  ARG A CD  1 
ATOM   503  N NE  . ARG A 1 67  ? 53.064 71.922 46.183 1.00 44.45  ? 80  ARG A NE  1 
ATOM   504  C CZ  . ARG A 1 67  ? 54.303 72.235 46.543 1.00 50.12  ? 80  ARG A CZ  1 
ATOM   505  N NH1 . ARG A 1 67  ? 54.555 72.654 47.775 1.00 57.14  ? 80  ARG A NH1 1 
ATOM   506  N NH2 . ARG A 1 67  ? 55.288 72.152 45.661 1.00 53.55  ? 80  ARG A NH2 1 
ATOM   507  N N   . GLN A 1 68  ? 47.151 70.125 48.878 1.00 15.95  ? 81  GLN A N   1 
ATOM   508  C CA  . GLN A 1 68  ? 46.310 70.177 50.047 1.00 14.11  ? 81  GLN A CA  1 
ATOM   509  C C   . GLN A 1 68  ? 47.324 69.896 51.148 1.00 13.40  ? 81  GLN A C   1 
ATOM   510  O O   . GLN A 1 68  ? 48.145 68.991 51.005 1.00 14.04  ? 81  GLN A O   1 
ATOM   511  C CB  . GLN A 1 68  ? 45.251 69.081 49.997 1.00 14.40  ? 81  GLN A CB  1 
ATOM   512  C CG  . GLN A 1 68  ? 44.233 69.272 48.903 1.00 10.57  ? 81  GLN A CG  1 
ATOM   513  C CD  . GLN A 1 68  ? 43.140 68.234 48.952 1.00 6.85   ? 81  GLN A CD  1 
ATOM   514  O OE1 . GLN A 1 68  ? 42.619 67.912 50.019 1.00 2.23   ? 81  GLN A OE1 1 
ATOM   515  N NE2 . GLN A 1 68  ? 42.790 67.698 47.796 1.00 6.23   ? 81  GLN A NE2 1 
ATOM   516  N N   . VAL A 1 69  ? 47.336 70.719 52.189 1.00 12.57  ? 82  VAL A N   1 
ATOM   517  C CA  . VAL A 1 69  ? 48.280 70.535 53.289 1.00 12.82  ? 82  VAL A CA  1 
ATOM   518  C C   . VAL A 1 69  ? 47.598 70.236 54.616 1.00 13.83  ? 82  VAL A C   1 
ATOM   519  O O   . VAL A 1 69  ? 46.763 71.024 55.081 1.00 17.90  ? 82  VAL A O   1 
ATOM   520  C CB  . VAL A 1 69  ? 49.145 71.781 53.505 1.00 6.63   ? 82  VAL A CB  1 
ATOM   521  C CG1 . VAL A 1 69  ? 50.171 71.516 54.579 1.00 9.98   ? 82  VAL A CG1 1 
ATOM   522  C CG2 . VAL A 1 69  ? 49.821 72.174 52.222 1.00 5.67   ? 82  VAL A CG2 1 
ATOM   523  N N   . PHE A 1 70  ? 47.997 69.132 55.243 1.00 10.22  ? 83  PHE A N   1 
ATOM   524  C CA  . PHE A 1 70  ? 47.451 68.733 56.532 1.00 5.05   ? 83  PHE A CA  1 
ATOM   525  C C   . PHE A 1 70  ? 48.571 68.611 57.562 1.00 6.35   ? 83  PHE A C   1 
ATOM   526  O O   . PHE A 1 70  ? 49.753 68.622 57.211 1.00 7.99   ? 83  PHE A O   1 
ATOM   527  C CB  . PHE A 1 70  ? 46.755 67.389 56.403 1.00 2.00   ? 83  PHE A CB  1 
ATOM   528  C CG  . PHE A 1 70  ? 45.575 67.411 55.522 1.00 7.73   ? 83  PHE A CG  1 
ATOM   529  C CD1 . PHE A 1 70  ? 44.357 67.865 55.998 1.00 11.28  ? 83  PHE A CD1 1 
ATOM   530  C CD2 . PHE A 1 70  ? 45.670 66.988 54.203 1.00 18.53  ? 83  PHE A CD2 1 
ATOM   531  C CE1 . PHE A 1 70  ? 43.244 67.892 55.173 1.00 7.07   ? 83  PHE A CE1 1 
ATOM   532  C CE2 . PHE A 1 70  ? 44.560 67.014 53.368 1.00 15.19  ? 83  PHE A CE2 1 
ATOM   533  C CZ  . PHE A 1 70  ? 43.347 67.469 53.853 1.00 9.22   ? 83  PHE A CZ  1 
ATOM   534  N N   . ALA A 1 71  ? 48.196 68.487 58.830 1.00 6.35   ? 84  ALA A N   1 
ATOM   535  C CA  . ALA A 1 71  ? 49.157 68.323 59.911 1.00 6.80   ? 84  ALA A CA  1 
ATOM   536  C C   . ALA A 1 71  ? 48.911 66.950 60.496 1.00 9.58   ? 84  ALA A C   1 
ATOM   537  O O   . ALA A 1 71  ? 47.840 66.379 60.290 1.00 12.85  ? 84  ALA A O   1 
ATOM   538  C CB  . ALA A 1 71  ? 48.945 69.359 60.955 1.00 2.31   ? 84  ALA A CB  1 
ATOM   539  N N   . VAL A 1 72  ? 49.908 66.410 61.192 1.00 11.15  ? 85  VAL A N   1 
ATOM   540  C CA  . VAL A 1 72  ? 49.796 65.098 61.818 1.00 8.43   ? 85  VAL A CA  1 
ATOM   541  C C   . VAL A 1 72  ? 48.976 65.279 63.088 1.00 10.71  ? 85  VAL A C   1 
ATOM   542  O O   . VAL A 1 72  ? 49.046 66.316 63.733 1.00 14.55  ? 85  VAL A O   1 
ATOM   543  C CB  . VAL A 1 72  ? 51.194 64.511 62.128 1.00 2.54   ? 85  VAL A CB  1 
ATOM   544  C CG1 . VAL A 1 72  ? 51.094 63.278 63.057 1.00 2.00   ? 85  VAL A CG1 1 
ATOM   545  C CG2 . VAL A 1 72  ? 51.868 64.118 60.823 1.00 2.00   ? 85  VAL A CG2 1 
ATOM   546  N N   . GLN A 1 73  ? 48.176 64.283 63.435 1.00 11.30  ? 86  GLN A N   1 
ATOM   547  C CA  . GLN A 1 73  ? 47.335 64.374 64.613 1.00 8.09   ? 86  GLN A CA  1 
ATOM   548  C C   . GLN A 1 73  ? 47.523 63.211 65.561 1.00 9.34   ? 86  GLN A C   1 
ATOM   549  O O   . GLN A 1 73  ? 47.362 63.363 66.768 1.00 9.38   ? 86  GLN A O   1 
ATOM   550  C CB  . GLN A 1 73  ? 45.881 64.467 64.188 1.00 6.56   ? 86  GLN A CB  1 
ATOM   551  C CG  . GLN A 1 73  ? 44.919 64.262 65.303 1.00 16.33  ? 86  GLN A CG  1 
ATOM   552  C CD  . GLN A 1 73  ? 43.638 64.983 65.072 1.00 24.39  ? 86  GLN A CD  1 
ATOM   553  O OE1 . GLN A 1 73  ? 42.667 64.409 64.589 1.00 35.44  ? 86  GLN A OE1 1 
ATOM   554  N NE2 . GLN A 1 73  ? 43.624 66.270 65.402 1.00 40.35  ? 86  GLN A NE2 1 
ATOM   555  N N   . ARG A 1 74  ? 47.791 62.033 65.010 1.00 11.09  ? 87  ARG A N   1 
ATOM   556  C CA  . ARG A 1 74  ? 48.010 60.846 65.825 1.00 8.80   ? 87  ARG A CA  1 
ATOM   557  C C   . ARG A 1 74  ? 49.029 59.975 65.159 1.00 9.91   ? 87  ARG A C   1 
ATOM   558  O O   . ARG A 1 74  ? 49.046 59.869 63.936 1.00 14.29  ? 87  ARG A O   1 
ATOM   559  C CB  . ARG A 1 74  ? 46.736 60.047 66.000 1.00 2.00   ? 87  ARG A CB  1 
ATOM   560  C CG  . ARG A 1 74  ? 45.768 60.668 66.920 1.00 2.00   ? 87  ARG A CG  1 
ATOM   561  C CD  . ARG A 1 74  ? 44.691 59.702 67.222 1.00 11.93  ? 87  ARG A CD  1 
ATOM   562  N NE  . ARG A 1 74  ? 43.718 60.326 68.090 1.00 40.36  ? 87  ARG A NE  1 
ATOM   563  C CZ  . ARG A 1 74  ? 42.852 59.659 68.837 1.00 63.40  ? 87  ARG A CZ  1 
ATOM   564  N NH1 . ARG A 1 74  ? 42.841 58.331 68.824 1.00 71.10  ? 87  ARG A NH1 1 
ATOM   565  N NH2 . ARG A 1 74  ? 41.991 60.328 69.592 1.00 77.49  ? 87  ARG A NH2 1 
ATOM   566  N N   . ILE A 1 75  ? 49.860 59.344 65.977 1.00 10.13  ? 88  ILE A N   1 
ATOM   567  C CA  . ILE A 1 75  ? 50.919 58.458 65.525 1.00 5.46   ? 88  ILE A CA  1 
ATOM   568  C C   . ILE A 1 75  ? 50.621 57.042 65.996 1.00 4.50   ? 88  ILE A C   1 
ATOM   569  O O   . ILE A 1 75  ? 50.231 56.843 67.141 1.00 7.18   ? 88  ILE A O   1 
ATOM   570  C CB  . ILE A 1 75  ? 52.250 58.914 66.134 1.00 2.00   ? 88  ILE A CB  1 
ATOM   571  C CG1 . ILE A 1 75  ? 52.647 60.261 65.541 1.00 3.18   ? 88  ILE A CG1 1 
ATOM   572  C CG2 . ILE A 1 75  ? 53.335 57.869 65.940 1.00 2.39   ? 88  ILE A CG2 1 
ATOM   573  C CD1 . ILE A 1 75  ? 53.134 61.269 66.582 1.00 9.47   ? 88  ILE A CD1 1 
ATOM   574  N N   . PHE A 1 76  ? 50.742 56.073 65.097 1.00 3.24   ? 89  PHE A N   1 
ATOM   575  C CA  . PHE A 1 76  ? 50.531 54.662 65.427 1.00 2.42   ? 89  PHE A CA  1 
ATOM   576  C C   . PHE A 1 76  ? 51.774 53.901 64.944 1.00 4.08   ? 89  PHE A C   1 
ATOM   577  O O   . PHE A 1 76  ? 52.197 54.070 63.815 1.00 8.48   ? 89  PHE A O   1 
ATOM   578  C CB  . PHE A 1 76  ? 49.296 54.096 64.711 1.00 2.00   ? 89  PHE A CB  1 
ATOM   579  C CG  . PHE A 1 76  ? 48.005 54.806 65.033 1.00 7.95   ? 89  PHE A CG  1 
ATOM   580  C CD1 . PHE A 1 76  ? 47.671 56.004 64.403 1.00 14.60  ? 89  PHE A CD1 1 
ATOM   581  C CD2 . PHE A 1 76  ? 47.112 54.270 65.956 1.00 7.59   ? 89  PHE A CD2 1 
ATOM   582  C CE1 . PHE A 1 76  ? 46.470 56.653 64.690 1.00 4.67   ? 89  PHE A CE1 1 
ATOM   583  C CE2 . PHE A 1 76  ? 45.910 54.917 66.247 1.00 2.00   ? 89  PHE A CE2 1 
ATOM   584  C CZ  . PHE A 1 76  ? 45.592 56.106 65.615 1.00 2.00   ? 89  PHE A CZ  1 
ATOM   585  N N   . GLU A 1 77  ? 52.400 53.121 65.808 1.00 6.78   ? 90  GLU A N   1 
ATOM   586  C CA  . GLU A 1 77  ? 53.572 52.342 65.418 1.00 5.90   ? 90  GLU A CA  1 
ATOM   587  C C   . GLU A 1 77  ? 53.405 50.973 66.024 1.00 6.66   ? 90  GLU A C   1 
ATOM   588  O O   . GLU A 1 77  ? 52.792 50.825 67.095 1.00 4.52   ? 90  GLU A O   1 
ATOM   589  C CB  . GLU A 1 77  ? 54.862 52.971 65.903 1.00 5.14   ? 90  GLU A CB  1 
ATOM   590  C CG  . GLU A 1 77  ? 55.253 54.214 65.151 1.00 8.80   ? 90  GLU A CG  1 
ATOM   591  C CD  . GLU A 1 77  ? 56.619 54.724 65.564 1.00 19.15  ? 90  GLU A CD  1 
ATOM   592  O OE1 . GLU A 1 77  ? 57.275 54.086 66.410 1.00 18.17  ? 90  GLU A OE1 1 
ATOM   593  O OE2 . GLU A 1 77  ? 57.045 55.772 65.044 1.00 28.63  ? 90  GLU A OE2 1 
ATOM   594  N N   . ASP A 1 78  ? 53.988 49.986 65.360 1.00 6.14   ? 91  ASP A N   1 
ATOM   595  C CA  . ASP A 1 78  ? 53.849 48.601 65.764 1.00 9.03   ? 91  ASP A CA  1 
ATOM   596  C C   . ASP A 1 78  ? 55.153 47.804 65.823 1.00 7.48   ? 91  ASP A C   1 
ATOM   597  O O   . ASP A 1 78  ? 55.466 47.025 64.923 1.00 7.21   ? 91  ASP A O   1 
ATOM   598  C CB  . ASP A 1 78  ? 52.853 47.934 64.807 1.00 21.44  ? 91  ASP A CB  1 
ATOM   599  C CG  . ASP A 1 78  ? 52.474 46.534 65.232 1.00 37.13  ? 91  ASP A CG  1 
ATOM   600  O OD1 . ASP A 1 78  ? 51.967 46.361 66.369 1.00 37.50  ? 91  ASP A OD1 1 
ATOM   601  O OD2 . ASP A 1 78  ? 52.678 45.613 64.409 1.00 50.40  ? 91  ASP A OD2 1 
ATOM   602  N N   . GLY A 1 79  ? 55.896 47.994 66.906 1.00 6.67   ? 92  GLY A N   1 
ATOM   603  C CA  . GLY A 1 79  ? 57.136 47.276 67.096 1.00 3.96   ? 92  GLY A CA  1 
ATOM   604  C C   . GLY A 1 79  ? 58.297 47.749 66.258 1.00 2.00   ? 92  GLY A C   1 
ATOM   605  O O   . GLY A 1 79  ? 59.130 46.948 65.838 1.00 2.00   ? 92  GLY A O   1 
ATOM   606  N N   . TYR A 1 80  ? 58.387 49.050 66.045 1.00 2.00   ? 94  TYR A N   1 
ATOM   607  C CA  . TYR A 1 80  ? 59.473 49.574 65.242 1.00 5.81   ? 94  TYR A CA  1 
ATOM   608  C C   . TYR A 1 80  ? 60.765 49.345 66.003 1.00 7.54   ? 94  TYR A C   1 
ATOM   609  O O   . TYR A 1 80  ? 60.878 49.735 67.165 1.00 10.52  ? 94  TYR A O   1 
ATOM   610  C CB  . TYR A 1 80  ? 59.269 51.062 64.943 1.00 2.00   ? 94  TYR A CB  1 
ATOM   611  C CG  . TYR A 1 80  ? 60.490 51.748 64.407 1.00 2.00   ? 94  TYR A CG  1 
ATOM   612  C CD1 . TYR A 1 80  ? 61.319 51.131 63.478 1.00 4.04   ? 94  TYR A CD1 1 
ATOM   613  C CD2 . TYR A 1 80  ? 60.834 53.012 64.846 1.00 5.55   ? 94  TYR A CD2 1 
ATOM   614  C CE1 . TYR A 1 80  ? 62.468 51.770 63.004 1.00 7.38   ? 94  TYR A CE1 1 
ATOM   615  C CE2 . TYR A 1 80  ? 61.975 53.656 64.380 1.00 2.00   ? 94  TYR A CE2 1 
ATOM   616  C CZ  . TYR A 1 80  ? 62.782 53.035 63.466 1.00 5.53   ? 94  TYR A CZ  1 
ATOM   617  O OH  . TYR A 1 80  ? 63.907 53.689 63.030 1.00 16.27  ? 94  TYR A OH  1 
ATOM   618  N N   . ASP A 1 81  ? 61.696 48.646 65.364 1.00 6.88   ? 95  ASP A N   1 
ATOM   619  C CA  . ASP A 1 81  ? 62.998 48.340 65.942 1.00 9.41   ? 95  ASP A CA  1 
ATOM   620  C C   . ASP A 1 81  ? 63.968 49.324 65.299 1.00 13.41  ? 95  ASP A C   1 
ATOM   621  O O   . ASP A 1 81  ? 64.357 49.146 64.124 1.00 16.08  ? 95  ASP A O   1 
ATOM   622  C CB  . ASP A 1 81  ? 63.383 46.894 65.591 1.00 8.74   ? 95  ASP A CB  1 
ATOM   623  C CG  . ASP A 1 81  ? 64.675 46.438 66.260 1.00 14.46  ? 95  ASP A CG  1 
ATOM   624  O OD1 . ASP A 1 81  ? 65.608 47.264 66.392 1.00 3.23   ? 95  ASP A OD1 1 
ATOM   625  O OD2 . ASP A 1 81  ? 64.763 45.242 66.638 1.00 9.03   ? 95  ASP A OD2 1 
ATOM   626  N N   . PRO A 1 82  ? 64.378 50.372 66.046 1.00 10.94  ? 98  PRO A N   1 
ATOM   627  C CA  . PRO A 1 82  ? 65.302 51.409 65.568 1.00 9.68   ? 98  PRO A CA  1 
ATOM   628  C C   . PRO A 1 82  ? 66.715 50.945 65.224 1.00 8.49   ? 98  PRO A C   1 
ATOM   629  O O   . PRO A 1 82  ? 67.330 51.467 64.299 1.00 2.00   ? 98  PRO A O   1 
ATOM   630  C CB  . PRO A 1 82  ? 65.305 52.417 66.719 1.00 2.89   ? 98  PRO A CB  1 
ATOM   631  C CG  . PRO A 1 82  ? 65.092 51.579 67.887 1.00 6.57   ? 98  PRO A CG  1 
ATOM   632  C CD  . PRO A 1 82  ? 63.978 50.662 67.429 1.00 6.97   ? 98  PRO A CD  1 
ATOM   633  N N   . VAL A 1 83  ? 67.217 49.955 65.950 1.00 10.31  ? 99  VAL A N   1 
ATOM   634  C CA  . VAL A 1 83  ? 68.566 49.474 65.697 1.00 11.44  ? 99  VAL A CA  1 
ATOM   635  C C   . VAL A 1 83  ? 68.696 48.495 64.533 1.00 10.55  ? 99  VAL A C   1 
ATOM   636  O O   . VAL A 1 83  ? 69.659 48.584 63.791 1.00 13.46  ? 99  VAL A O   1 
ATOM   637  C CB  . VAL A 1 83  ? 69.227 48.911 66.990 1.00 13.24  ? 99  VAL A CB  1 
ATOM   638  C CG1 . VAL A 1 83  ? 68.512 47.666 67.468 1.00 14.96  ? 99  VAL A CG1 1 
ATOM   639  C CG2 . VAL A 1 83  ? 70.705 48.622 66.750 1.00 22.29  ? 99  VAL A CG2 1 
ATOM   640  N N   . ASN A 1 84  A 67.726 47.589 64.369 1.00 10.07  ? 99  ASN A N   1 
ATOM   641  C CA  . ASN A 1 84  A 67.732 46.595 63.279 1.00 8.87   ? 99  ASN A CA  1 
ATOM   642  C C   . ASN A 1 84  A 66.848 46.972 62.100 1.00 11.79  ? 99  ASN A C   1 
ATOM   643  O O   . ASN A 1 84  A 66.641 46.156 61.214 1.00 15.60  ? 99  ASN A O   1 
ATOM   644  C CB  . ASN A 1 84  A 67.219 45.247 63.761 1.00 6.29   ? 99  ASN A CB  1 
ATOM   645  C CG  . ASN A 1 84  A 68.037 44.679 64.865 1.00 19.46  ? 99  ASN A CG  1 
ATOM   646  O OD1 . ASN A 1 84  A 69.104 44.094 64.635 1.00 19.44  ? 99  ASN A OD1 1 
ATOM   647  N ND2 . ASN A 1 84  A 67.547 44.827 66.090 1.00 21.32  ? 99  ASN A ND2 1 
ATOM   648  N N   . LEU A 1 85  B 66.221 48.143 62.161 1.00 11.74  ? 99  LEU A N   1 
ATOM   649  C CA  . LEU A 1 85  B 65.338 48.615 61.099 1.00 8.75   ? 99  LEU A CA  1 
ATOM   650  C C   . LEU A 1 85  B 64.229 47.623 60.711 1.00 8.78   ? 99  LEU A C   1 
ATOM   651  O O   . LEU A 1 85  B 64.009 47.321 59.536 1.00 5.86   ? 99  LEU A O   1 
ATOM   652  C CB  . LEU A 1 85  B 66.149 49.083 59.880 1.00 2.00   ? 99  LEU A CB  1 
ATOM   653  C CG  . LEU A 1 85  B 66.823 50.457 60.016 1.00 2.00   ? 99  LEU A CG  1 
ATOM   654  C CD1 . LEU A 1 85  B 67.679 50.774 58.803 1.00 4.13   ? 99  LEU A CD1 1 
ATOM   655  C CD2 . LEU A 1 85  B 65.760 51.528 60.187 1.00 10.97  ? 99  LEU A CD2 1 
ATOM   656  N N   . LEU A 1 86  ? 63.493 47.167 61.718 1.00 8.32   ? 100 LEU A N   1 
ATOM   657  C CA  . LEU A 1 86  ? 62.388 46.241 61.496 1.00 6.88   ? 100 LEU A CA  1 
ATOM   658  C C   . LEU A 1 86  ? 61.084 46.961 61.816 1.00 6.56   ? 100 LEU A C   1 
ATOM   659  O O   . LEU A 1 86  ? 61.071 47.862 62.643 1.00 10.09  ? 100 LEU A O   1 
ATOM   660  C CB  . LEU A 1 86  ? 62.518 45.034 62.414 1.00 2.44   ? 100 LEU A CB  1 
ATOM   661  C CG  . LEU A 1 86  ? 63.712 44.105 62.248 1.00 3.22   ? 100 LEU A CG  1 
ATOM   662  C CD1 . LEU A 1 86  ? 63.777 43.283 63.505 1.00 2.00   ? 100 LEU A CD1 1 
ATOM   663  C CD2 . LEU A 1 86  ? 63.581 43.219 60.998 1.00 2.00   ? 100 LEU A CD2 1 
ATOM   664  N N   . ASN A 1 87  ? 60.003 46.571 61.145 1.00 7.76   ? 101 ASN A N   1 
ATOM   665  C CA  . ASN A 1 87  ? 58.671 47.148 61.350 1.00 4.51   ? 101 ASN A CA  1 
ATOM   666  C C   . ASN A 1 87  ? 58.713 48.658 61.198 1.00 5.85   ? 101 ASN A C   1 
ATOM   667  O O   . ASN A 1 87  ? 58.094 49.408 61.954 1.00 8.15   ? 101 ASN A O   1 
ATOM   668  C CB  . ASN A 1 87  ? 58.145 46.762 62.723 1.00 2.00   ? 101 ASN A CB  1 
ATOM   669  C CG  . ASN A 1 87  ? 57.956 45.265 62.880 1.00 9.09   ? 101 ASN A CG  1 
ATOM   670  O OD1 . ASN A 1 87  ? 57.472 44.799 63.910 1.00 34.79  ? 101 ASN A OD1 1 
ATOM   671  N ND2 . ASN A 1 87  ? 58.321 44.501 61.860 1.00 12.83  ? 101 ASN A ND2 1 
ATOM   672  N N   . ASP A 1 88  ? 59.430 49.084 60.172 1.00 4.59   ? 102 ASP A N   1 
ATOM   673  C CA  . ASP A 1 88  ? 59.646 50.484 59.867 1.00 2.24   ? 102 ASP A CA  1 
ATOM   674  C C   . ASP A 1 88  ? 58.428 51.067 59.175 1.00 3.64   ? 102 ASP A C   1 
ATOM   675  O O   . ASP A 1 88  ? 58.495 51.462 58.012 1.00 7.01   ? 102 ASP A O   1 
ATOM   676  C CB  . ASP A 1 88  ? 60.873 50.565 58.958 1.00 3.65   ? 102 ASP A CB  1 
ATOM   677  C CG  . ASP A 1 88  ? 61.467 51.938 58.884 1.00 6.46   ? 102 ASP A CG  1 
ATOM   678  O OD1 . ASP A 1 88  ? 60.857 52.884 59.412 1.00 7.71   ? 102 ASP A OD1 1 
ATOM   679  O OD2 . ASP A 1 88  ? 62.560 52.060 58.294 1.00 4.94   ? 102 ASP A OD2 1 
ATOM   680  N N   . ILE A 1 89  ? 57.326 51.170 59.900 1.00 4.05   ? 103 ILE A N   1 
ATOM   681  C CA  . ILE A 1 89  ? 56.097 51.704 59.330 1.00 6.42   ? 103 ILE A CA  1 
ATOM   682  C C   . ILE A 1 89  ? 55.401 52.539 60.401 1.00 7.93   ? 103 ILE A C   1 
ATOM   683  O O   . ILE A 1 89  ? 55.481 52.214 61.581 1.00 10.76  ? 103 ILE A O   1 
ATOM   684  C CB  . ILE A 1 89  ? 55.190 50.543 58.847 1.00 9.21   ? 103 ILE A CB  1 
ATOM   685  C CG1 . ILE A 1 89  ? 53.970 51.069 58.118 1.00 4.01   ? 103 ILE A CG1 1 
ATOM   686  C CG2 . ILE A 1 89  ? 54.740 49.686 60.017 1.00 17.17  ? 103 ILE A CG2 1 
ATOM   687  C CD1 . ILE A 1 89  ? 53.178 49.976 57.493 1.00 2.00   ? 103 ILE A CD1 1 
ATOM   688  N N   . VAL A 1 90  ? 54.786 53.644 60.004 1.00 6.02   ? 104 VAL A N   1 
ATOM   689  C CA  . VAL A 1 90  ? 54.100 54.526 60.945 1.00 6.06   ? 104 VAL A CA  1 
ATOM   690  C C   . VAL A 1 90  ? 52.827 54.999 60.285 1.00 7.60   ? 104 VAL A C   1 
ATOM   691  O O   . VAL A 1 90  ? 52.826 55.287 59.086 1.00 12.69  ? 104 VAL A O   1 
ATOM   692  C CB  . VAL A 1 90  ? 54.970 55.786 61.318 1.00 3.01   ? 104 VAL A CB  1 
ATOM   693  C CG1 . VAL A 1 90  ? 55.214 56.655 60.106 1.00 5.51   ? 104 VAL A CG1 1 
ATOM   694  C CG2 . VAL A 1 90  ? 54.282 56.626 62.379 1.00 3.87   ? 104 VAL A CG2 1 
ATOM   695  N N   . ILE A 1 91  ? 51.718 54.970 61.012 1.00 6.21   ? 105 ILE A N   1 
ATOM   696  C CA  . ILE A 1 91  ? 50.482 55.470 60.437 1.00 7.12   ? 105 ILE A CA  1 
ATOM   697  C C   . ILE A 1 91  ? 50.246 56.815 61.097 1.00 8.44   ? 105 ILE A C   1 
ATOM   698  O O   . ILE A 1 91  ? 50.316 56.937 62.329 1.00 5.19   ? 105 ILE A O   1 
ATOM   699  C CB  . ILE A 1 91  ? 49.300 54.522 60.636 1.00 5.40   ? 105 ILE A CB  1 
ATOM   700  C CG1 . ILE A 1 91  ? 49.480 53.300 59.745 1.00 5.03   ? 105 ILE A CG1 1 
ATOM   701  C CG2 . ILE A 1 91  ? 47.996 55.220 60.269 1.00 2.00   ? 105 ILE A CG2 1 
ATOM   702  C CD1 . ILE A 1 91  ? 48.342 52.323 59.841 1.00 24.61  ? 105 ILE A CD1 1 
ATOM   703  N N   . LEU A 1 92  ? 50.100 57.837 60.262 1.00 6.98   ? 106 LEU A N   1 
ATOM   704  C CA  . LEU A 1 92  ? 49.896 59.196 60.731 1.00 6.29   ? 106 LEU A CA  1 
ATOM   705  C C   . LEU A 1 92  ? 48.487 59.635 60.415 1.00 6.58   ? 106 LEU A C   1 
ATOM   706  O O   . LEU A 1 92  ? 48.097 59.652 59.242 1.00 5.96   ? 106 LEU A O   1 
ATOM   707  C CB  . LEU A 1 92  ? 50.869 60.142 60.033 1.00 5.82   ? 106 LEU A CB  1 
ATOM   708  C CG  . LEU A 1 92  ? 52.355 59.915 60.280 1.00 6.81   ? 106 LEU A CG  1 
ATOM   709  C CD1 . LEU A 1 92  ? 53.180 60.745 59.324 1.00 11.85  ? 106 LEU A CD1 1 
ATOM   710  C CD2 . LEU A 1 92  ? 52.681 60.277 61.703 1.00 18.78  ? 106 LEU A CD2 1 
ATOM   711  N N   . GLN A 1 93  ? 47.700 59.941 61.443 1.00 4.32   ? 107 GLN A N   1 
ATOM   712  C CA  . GLN A 1 93  ? 46.357 60.402 61.175 1.00 4.86   ? 107 GLN A CA  1 
ATOM   713  C C   . GLN A 1 93  ? 46.411 61.900 60.987 1.00 8.73   ? 107 GLN A C   1 
ATOM   714  O O   . GLN A 1 93  ? 47.031 62.604 61.785 1.00 12.00  ? 107 GLN A O   1 
ATOM   715  C CB  . GLN A 1 93  ? 45.396 60.090 62.301 1.00 2.33   ? 107 GLN A CB  1 
ATOM   716  C CG  . GLN A 1 93  ? 44.018 60.638 61.975 1.00 13.13  ? 107 GLN A CG  1 
ATOM   717  C CD  . GLN A 1 93  ? 43.004 60.412 63.050 1.00 8.95   ? 107 GLN A CD  1 
ATOM   718  O OE1 . GLN A 1 93  ? 43.013 59.379 63.709 1.00 2.00   ? 107 GLN A OE1 1 
ATOM   719  N NE2 . GLN A 1 93  ? 42.097 61.370 63.219 1.00 15.69  ? 107 GLN A NE2 1 
ATOM   720  N N   . LEU A 1 94  ? 45.756 62.383 59.938 1.00 6.93   ? 108 LEU A N   1 
ATOM   721  C CA  . LEU A 1 94  ? 45.729 63.809 59.652 1.00 5.73   ? 108 LEU A CA  1 
ATOM   722  C C   . LEU A 1 94  ? 44.689 64.538 60.494 1.00 5.18   ? 108 LEU A C   1 
ATOM   723  O O   . LEU A 1 94  ? 43.715 63.941 60.993 1.00 2.00   ? 108 LEU A O   1 
ATOM   724  C CB  . LEU A 1 94  ? 45.461 64.057 58.174 1.00 2.21   ? 108 LEU A CB  1 
ATOM   725  C CG  . LEU A 1 94  ? 46.409 63.280 57.270 1.00 6.77   ? 108 LEU A CG  1 
ATOM   726  C CD1 . LEU A 1 94  ? 46.194 63.646 55.791 1.00 15.57  ? 108 LEU A CD1 1 
ATOM   727  C CD2 . LEU A 1 94  ? 47.822 63.594 57.724 1.00 2.00   ? 108 LEU A CD2 1 
ATOM   728  N N   . ASN A 1 95  ? 44.882 65.847 60.587 1.00 6.45   ? 109 ASN A N   1 
ATOM   729  C CA  . ASN A 1 95  ? 44.012 66.730 61.341 1.00 7.21   ? 109 ASN A CA  1 
ATOM   730  C C   . ASN A 1 95  ? 42.719 67.093 60.582 1.00 8.29   ? 109 ASN A C   1 
ATOM   731  O O   . ASN A 1 95  ? 41.875 67.833 61.090 1.00 7.42   ? 109 ASN A O   1 
ATOM   732  C CB  . ASN A 1 95  ? 44.793 68.001 61.669 1.00 3.81   ? 109 ASN A CB  1 
ATOM   733  C CG  . ASN A 1 95  ? 44.962 68.890 60.485 1.00 2.09   ? 109 ASN A CG  1 
ATOM   734  O OD1 . ASN A 1 95  ? 45.053 68.411 59.355 1.00 3.09   ? 109 ASN A OD1 1 
ATOM   735  N ND2 . ASN A 1 95  ? 44.982 70.196 60.736 1.00 8.40   ? 109 ASN A ND2 1 
ATOM   736  N N   . GLY A 1 96  ? 42.600 66.596 59.356 1.00 8.31   ? 110 GLY A N   1 
ATOM   737  C CA  . GLY A 1 96  ? 41.435 66.833 58.525 1.00 8.47   ? 110 GLY A CA  1 
ATOM   738  C C   . GLY A 1 96  ? 41.375 65.712 57.495 1.00 12.53  ? 110 GLY A C   1 
ATOM   739  O O   . GLY A 1 96  ? 42.055 64.699 57.655 1.00 11.73  ? 110 GLY A O   1 
ATOM   740  N N   . SER A 1 97  ? 40.592 65.879 56.435 1.00 11.63  ? 111 SER A N   1 
ATOM   741  C CA  . SER A 1 97  ? 40.487 64.845 55.424 1.00 9.56   ? 111 SER A CA  1 
ATOM   742  C C   . SER A 1 97  ? 40.690 65.430 54.040 1.00 15.12  ? 111 SER A C   1 
ATOM   743  O O   . SER A 1 97  ? 40.172 66.509 53.724 1.00 18.71  ? 111 SER A O   1 
ATOM   744  C CB  . SER A 1 97  ? 39.127 64.158 55.512 1.00 2.72   ? 111 SER A CB  1 
ATOM   745  O OG  . SER A 1 97  ? 38.958 63.566 56.781 1.00 8.63   ? 111 SER A OG  1 
ATOM   746  N N   . ALA A 1 98  ? 41.495 64.745 53.236 1.00 13.45  ? 112 ALA A N   1 
ATOM   747  C CA  . ALA A 1 98  ? 41.781 65.196 51.893 1.00 13.14  ? 112 ALA A CA  1 
ATOM   748  C C   . ALA A 1 98  ? 40.501 65.208 51.108 1.00 14.56  ? 112 ALA A C   1 
ATOM   749  O O   . ALA A 1 98  ? 39.636 64.358 51.326 1.00 17.23  ? 112 ALA A O   1 
ATOM   750  C CB  . ALA A 1 98  ? 42.767 64.268 51.223 1.00 9.22   ? 112 ALA A CB  1 
ATOM   751  N N   . THR A 1 99  ? 40.345 66.216 50.260 1.00 15.69  ? 113 THR A N   1 
ATOM   752  C CA  . THR A 1 99  ? 39.186 66.301 49.395 1.00 16.76  ? 113 THR A CA  1 
ATOM   753  C C   . THR A 1 99  ? 39.649 65.412 48.245 1.00 17.03  ? 113 THR A C   1 
ATOM   754  O O   . THR A 1 99  ? 40.601 65.761 47.550 1.00 19.03  ? 113 THR A O   1 
ATOM   755  C CB  . THR A 1 99  ? 38.973 67.736 48.875 1.00 13.10  ? 113 THR A CB  1 
ATOM   756  O OG1 . THR A 1 99  ? 39.123 68.673 49.946 1.00 34.31  ? 113 THR A OG1 1 
ATOM   757  C CG2 . THR A 1 99  ? 37.595 67.888 48.335 1.00 16.03  ? 113 THR A CG2 1 
ATOM   758  N N   . ILE A 1 100 ? 39.075 64.224 48.104 1.00 15.73  ? 114 ILE A N   1 
ATOM   759  C CA  . ILE A 1 100 ? 39.511 63.343 47.023 1.00 18.72  ? 114 ILE A CA  1 
ATOM   760  C C   . ILE A 1 100 ? 39.215 63.906 45.637 1.00 20.84  ? 114 ILE A C   1 
ATOM   761  O O   . ILE A 1 100 ? 38.091 64.306 45.369 1.00 29.39  ? 114 ILE A O   1 
ATOM   762  C CB  . ILE A 1 100 ? 38.863 61.962 47.124 1.00 12.24  ? 114 ILE A CB  1 
ATOM   763  C CG1 . ILE A 1 100 ? 39.292 61.293 48.422 1.00 2.00   ? 114 ILE A CG1 1 
ATOM   764  C CG2 . ILE A 1 100 ? 39.227 61.118 45.898 1.00 9.78   ? 114 ILE A CG2 1 
ATOM   765  C CD1 . ILE A 1 100 ? 40.760 61.480 48.741 1.00 14.39  ? 114 ILE A CD1 1 
ATOM   766  N N   . ASN A 1 101 ? 40.211 63.937 44.759 1.00 20.20  ? 115 ASN A N   1 
ATOM   767  C CA  . ASN A 1 101 ? 40.011 64.439 43.401 1.00 18.92  ? 115 ASN A CA  1 
ATOM   768  C C   . ASN A 1 101 ? 40.952 63.771 42.400 1.00 21.48  ? 115 ASN A C   1 
ATOM   769  O O   . ASN A 1 101 ? 41.448 62.674 42.639 1.00 27.49  ? 115 ASN A O   1 
ATOM   770  C CB  . ASN A 1 101 ? 40.125 65.971 43.352 1.00 8.69   ? 115 ASN A CB  1 
ATOM   771  C CG  . ASN A 1 101 ? 41.492 66.469 43.741 1.00 17.38  ? 115 ASN A CG  1 
ATOM   772  O OD1 . ASN A 1 101 ? 42.496 65.833 43.434 1.00 22.70  ? 115 ASN A OD1 1 
ATOM   773  N ND2 . ASN A 1 101 ? 41.545 67.616 44.425 1.00 2.00   ? 115 ASN A ND2 1 
ATOM   774  N N   . ALA A 1 102 ? 41.176 64.409 41.263 1.00 22.17  ? 116 ALA A N   1 
ATOM   775  C CA  . ALA A 1 102 ? 42.056 63.845 40.252 1.00 20.33  ? 116 ALA A CA  1 
ATOM   776  C C   . ALA A 1 102 ? 43.506 63.835 40.690 1.00 22.08  ? 116 ALA A C   1 
ATOM   777  O O   . ALA A 1 102 ? 44.287 63.013 40.244 1.00 25.93  ? 116 ALA A O   1 
ATOM   778  C CB  . ALA A 1 102 ? 41.929 64.615 38.998 1.00 23.17  ? 116 ALA A CB  1 
ATOM   779  N N   . ASN A 1 103 ? 43.876 64.779 41.538 1.00 23.38  ? 117 ASN A N   1 
ATOM   780  C CA  . ASN A 1 103 ? 45.248 64.867 42.015 1.00 25.46  ? 117 ASN A CA  1 
ATOM   781  C C   . ASN A 1 103 ? 45.479 64.133 43.315 1.00 27.39  ? 117 ASN A C   1 
ATOM   782  O O   . ASN A 1 103 ? 46.592 63.695 43.600 1.00 31.26  ? 117 ASN A O   1 
ATOM   783  C CB  . ASN A 1 103 ? 45.618 66.311 42.265 1.00 21.98  ? 117 ASN A CB  1 
ATOM   784  C CG  . ASN A 1 103 ? 45.143 67.224 41.180 1.00 30.47  ? 117 ASN A CG  1 
ATOM   785  O OD1 . ASN A 1 103 ? 44.428 68.184 41.446 1.00 38.32  ? 117 ASN A OD1 1 
ATOM   786  N ND2 . ASN A 1 103 ? 45.550 66.948 39.945 1.00 41.97  ? 117 ASN A ND2 1 
ATOM   787  N N   . VAL A 1 104 ? 44.441 64.053 44.130 1.00 25.10  ? 118 VAL A N   1 
ATOM   788  C CA  . VAL A 1 104 ? 44.544 63.429 45.431 1.00 20.72  ? 118 VAL A CA  1 
ATOM   789  C C   . VAL A 1 104 ? 43.682 62.187 45.482 1.00 17.82  ? 118 VAL A C   1 
ATOM   790  O O   . VAL A 1 104 ? 42.462 62.276 45.635 1.00 16.55  ? 118 VAL A O   1 
ATOM   791  C CB  . VAL A 1 104 ? 44.113 64.450 46.505 1.00 17.50  ? 118 VAL A CB  1 
ATOM   792  C CG1 . VAL A 1 104 ? 44.171 63.855 47.886 1.00 19.73  ? 118 VAL A CG1 1 
ATOM   793  C CG2 . VAL A 1 104 ? 44.996 65.689 46.398 1.00 7.80   ? 118 VAL A CG2 1 
ATOM   794  N N   . GLN A 1 105 ? 44.316 61.030 45.338 1.00 14.44  ? 119 GLN A N   1 
ATOM   795  C CA  . GLN A 1 105 ? 43.592 59.763 45.365 1.00 14.42  ? 119 GLN A CA  1 
ATOM   796  C C   . GLN A 1 105 ? 44.133 58.831 46.431 1.00 12.27  ? 119 GLN A C   1 
ATOM   797  O O   . GLN A 1 105 ? 45.265 58.977 46.858 1.00 14.86  ? 119 GLN A O   1 
ATOM   798  C CB  . GLN A 1 105 ? 43.642 59.071 44.006 1.00 12.56  ? 119 GLN A CB  1 
ATOM   799  C CG  . GLN A 1 105 ? 42.847 59.770 42.926 1.00 33.53  ? 119 GLN A CG  1 
ATOM   800  C CD  . GLN A 1 105 ? 42.242 58.781 41.961 1.00 58.57  ? 119 GLN A CD  1 
ATOM   801  O OE1 . GLN A 1 105 ? 41.040 58.507 42.005 1.00 69.53  ? 119 GLN A OE1 1 
ATOM   802  N NE2 . GLN A 1 105 ? 43.080 58.191 41.117 1.00 66.83  ? 119 GLN A NE2 1 
ATOM   803  N N   . VAL A 1 106 ? 43.326 57.864 46.844 1.00 10.29  ? 120 VAL A N   1 
ATOM   804  C CA  . VAL A 1 106 ? 43.735 56.920 47.869 1.00 9.59   ? 120 VAL A CA  1 
ATOM   805  C C   . VAL A 1 106 ? 44.394 55.679 47.265 1.00 12.23  ? 120 VAL A C   1 
ATOM   806  O O   . VAL A 1 106 ? 43.951 55.166 46.238 1.00 12.71  ? 120 VAL A O   1 
ATOM   807  C CB  . VAL A 1 106 ? 42.533 56.540 48.749 1.00 6.41   ? 120 VAL A CB  1 
ATOM   808  C CG1 . VAL A 1 106 ? 42.852 55.369 49.626 1.00 9.40   ? 120 VAL A CG1 1 
ATOM   809  C CG2 . VAL A 1 106 ? 42.151 57.712 49.620 1.00 12.40  ? 120 VAL A CG2 1 
ATOM   810  N N   . ALA A 1 107 ? 45.475 55.226 47.893 1.00 13.98  ? 121 ALA A N   1 
ATOM   811  C CA  . ALA A 1 107 ? 46.224 54.058 47.436 1.00 16.82  ? 121 ALA A CA  1 
ATOM   812  C C   . ALA A 1 107 ? 45.577 52.776 47.920 1.00 17.44  ? 121 ALA A C   1 
ATOM   813  O O   . ALA A 1 107 ? 44.849 52.781 48.904 1.00 19.05  ? 121 ALA A O   1 
ATOM   814  C CB  . ALA A 1 107 ? 47.638 54.128 47.958 1.00 14.31  ? 121 ALA A CB  1 
ATOM   815  N N   . GLN A 1 108 ? 45.869 51.666 47.255 1.00 18.11  ? 122 GLN A N   1 
ATOM   816  C CA  . GLN A 1 108 ? 45.317 50.381 47.666 1.00 17.90  ? 122 GLN A CA  1 
ATOM   817  C C   . GLN A 1 108 ? 46.423 49.470 48.133 1.00 16.85  ? 122 GLN A C   1 
ATOM   818  O O   . GLN A 1 108 ? 47.506 49.457 47.555 1.00 25.06  ? 122 GLN A O   1 
ATOM   819  C CB  . GLN A 1 108 ? 44.552 49.727 46.538 1.00 25.55  ? 122 GLN A CB  1 
ATOM   820  C CG  . GLN A 1 108 ? 43.259 50.418 46.237 1.00 50.83  ? 122 GLN A CG  1 
ATOM   821  C CD  . GLN A 1 108 ? 42.339 49.516 45.487 1.00 69.28  ? 122 GLN A CD  1 
ATOM   822  O OE1 . GLN A 1 108 ? 42.494 49.313 44.282 1.00 78.35  ? 122 GLN A OE1 1 
ATOM   823  N NE2 . GLN A 1 108 ? 41.394 48.919 46.200 1.00 77.13  ? 122 GLN A NE2 1 
ATOM   824  N N   . LEU A 1 109 ? 46.142 48.673 49.151 1.00 13.01  ? 123 LEU A N   1 
ATOM   825  C CA  . LEU A 1 109 ? 47.150 47.789 49.712 1.00 11.65  ? 123 LEU A CA  1 
ATOM   826  C C   . LEU A 1 109 ? 46.892 46.314 49.374 1.00 10.92  ? 123 LEU A C   1 
ATOM   827  O O   . LEU A 1 109 ? 45.789 45.953 48.962 1.00 11.34  ? 123 LEU A O   1 
ATOM   828  C CB  . LEU A 1 109 ? 47.198 47.996 51.245 1.00 9.77   ? 123 LEU A CB  1 
ATOM   829  C CG  . LEU A 1 109 ? 46.830 49.369 51.846 1.00 2.00   ? 123 LEU A CG  1 
ATOM   830  C CD1 . LEU A 1 109 ? 47.064 49.363 53.351 1.00 4.51   ? 123 LEU A CD1 1 
ATOM   831  C CD2 . LEU A 1 109 ? 47.618 50.491 51.210 1.00 2.00   ? 123 LEU A CD2 1 
ATOM   832  N N   . PRO A 1 110 ? 47.931 45.458 49.457 1.00 10.98  ? 124 PRO A N   1 
ATOM   833  C CA  . PRO A 1 110 ? 47.746 44.036 49.163 1.00 12.51  ? 124 PRO A CA  1 
ATOM   834  C C   . PRO A 1 110 ? 47.037 43.387 50.344 1.00 11.93  ? 124 PRO A C   1 
ATOM   835  O O   . PRO A 1 110 ? 46.786 44.039 51.357 1.00 14.01  ? 124 PRO A O   1 
ATOM   836  C CB  . PRO A 1 110 ? 49.178 43.534 49.068 1.00 16.06  ? 124 PRO A CB  1 
ATOM   837  C CG  . PRO A 1 110 ? 49.866 44.345 50.094 1.00 12.02  ? 124 PRO A CG  1 
ATOM   838  C CD  . PRO A 1 110 ? 49.353 45.726 49.734 1.00 13.30  ? 124 PRO A CD  1 
ATOM   839  N N   . ALA A 1 111 ? 46.745 42.098 50.231 1.00 13.02  ? 125 ALA A N   1 
ATOM   840  C CA  . ALA A 1 111 ? 46.072 41.388 51.315 1.00 11.46  ? 125 ALA A CA  1 
ATOM   841  C C   . ALA A 1 111 ? 47.073 40.970 52.355 1.00 10.34  ? 125 ALA A C   1 
ATOM   842  O O   . ALA A 1 111 ? 48.215 40.682 52.031 1.00 11.21  ? 125 ALA A O   1 
ATOM   843  C CB  . ALA A 1 111 ? 45.357 40.183 50.794 1.00 14.50  ? 125 ALA A CB  1 
ATOM   844  N N   . GLN A 1 112 ? 46.630 40.895 53.598 1.00 11.64  ? 126 GLN A N   1 
ATOM   845  C CA  . GLN A 1 112 ? 47.505 40.508 54.683 1.00 13.98  ? 126 GLN A CA  1 
ATOM   846  C C   . GLN A 1 112 ? 48.317 39.267 54.330 1.00 17.65  ? 126 GLN A C   1 
ATOM   847  O O   . GLN A 1 112 ? 47.759 38.233 53.976 1.00 23.28  ? 126 GLN A O   1 
ATOM   848  C CB  . GLN A 1 112 ? 46.668 40.271 55.937 1.00 11.33  ? 126 GLN A CB  1 
ATOM   849  C CG  . GLN A 1 112 ? 47.413 39.657 57.106 1.00 21.71  ? 126 GLN A CG  1 
ATOM   850  C CD  . GLN A 1 112 ? 48.541 40.521 57.628 1.00 31.03  ? 126 GLN A CD  1 
ATOM   851  O OE1 . GLN A 1 112 ? 48.364 41.721 57.879 1.00 39.21  ? 126 GLN A OE1 1 
ATOM   852  N NE2 . GLN A 1 112 ? 49.713 39.914 57.799 1.00 35.71  ? 126 GLN A NE2 1 
ATOM   853  N N   . GLY A 1 113 ? 49.638 39.400 54.349 1.00 21.61  ? 127 GLY A N   1 
ATOM   854  C CA  . GLY A 1 113 ? 50.508 38.269 54.062 1.00 28.22  ? 127 GLY A CA  1 
ATOM   855  C C   . GLY A 1 113 ? 50.809 37.926 52.612 1.00 30.89  ? 127 GLY A C   1 
ATOM   856  O O   . GLY A 1 113 ? 51.378 36.867 52.331 1.00 34.71  ? 127 GLY A O   1 
ATOM   857  N N   . ARG A 1 114 ? 50.459 38.827 51.700 1.00 32.53  ? 128 ARG A N   1 
ATOM   858  C CA  . ARG A 1 114 ? 50.693 38.656 50.268 1.00 31.43  ? 128 ARG A CA  1 
ATOM   859  C C   . ARG A 1 114 ? 52.165 38.912 49.943 1.00 30.81  ? 128 ARG A C   1 
ATOM   860  O O   . ARG A 1 114 ? 52.579 40.059 49.768 1.00 31.55  ? 128 ARG A O   1 
ATOM   861  C CB  . ARG A 1 114 ? 49.793 39.633 49.514 1.00 36.11  ? 128 ARG A CB  1 
ATOM   862  C CG  . ARG A 1 114 ? 49.759 39.503 48.021 1.00 52.03  ? 128 ARG A CG  1 
ATOM   863  C CD  . ARG A 1 114 ? 48.708 40.465 47.477 1.00 72.93  ? 128 ARG A CD  1 
ATOM   864  N NE  . ARG A 1 114 ? 48.769 40.598 46.024 1.00 88.99  ? 128 ARG A NE  1 
ATOM   865  C CZ  . ARG A 1 114 ? 47.725 40.452 45.212 1.00 94.97  ? 128 ARG A CZ  1 
ATOM   866  N NH1 . ARG A 1 114 ? 46.524 40.166 45.707 1.00 95.98  ? 128 ARG A NH1 1 
ATOM   867  N NH2 . ARG A 1 114 ? 47.891 40.571 43.899 1.00 96.94  ? 128 ARG A NH2 1 
ATOM   868  N N   . ARG A 1 115 ? 52.944 37.829 49.918 1.00 34.03  ? 129 ARG A N   1 
ATOM   869  C CA  . ARG A 1 115 ? 54.396 37.809 49.639 1.00 33.68  ? 129 ARG A CA  1 
ATOM   870  C C   . ARG A 1 115 ? 54.712 37.997 48.135 1.00 32.23  ? 129 ARG A C   1 
ATOM   871  O O   . ARG A 1 115 ? 54.161 37.300 47.282 1.00 29.84  ? 129 ARG A O   1 
ATOM   872  C CB  . ARG A 1 115 ? 54.954 36.451 50.104 1.00 34.77  ? 129 ARG A CB  1 
ATOM   873  C CG  . ARG A 1 115 ? 56.428 36.390 50.510 1.00 58.69  ? 129 ARG A CG  1 
ATOM   874  C CD  . ARG A 1 115 ? 56.656 36.983 51.907 1.00 90.26  ? 129 ARG A CD  1 
ATOM   875  N NE  . ARG A 1 115 ? 57.735 36.322 52.652 1.00 104.44 ? 129 ARG A NE  1 
ATOM   876  C CZ  . ARG A 1 115 ? 58.023 36.559 53.934 1.00 112.14 ? 129 ARG A CZ  1 
ATOM   877  N NH1 . ARG A 1 115 ? 57.329 37.450 54.632 1.00 118.49 ? 129 ARG A NH1 1 
ATOM   878  N NH2 . ARG A 1 115 ? 58.972 35.861 54.542 1.00 114.81 ? 129 ARG A NH2 1 
ATOM   879  N N   . LEU A 1 116 ? 55.582 38.943 47.804 1.00 32.96  ? 130 LEU A N   1 
ATOM   880  C CA  . LEU A 1 116 ? 55.933 39.159 46.402 1.00 32.90  ? 130 LEU A CA  1 
ATOM   881  C C   . LEU A 1 116 ? 57.001 38.174 45.962 1.00 33.36  ? 130 LEU A C   1 
ATOM   882  O O   . LEU A 1 116 ? 57.901 37.828 46.735 1.00 36.46  ? 130 LEU A O   1 
ATOM   883  C CB  . LEU A 1 116 ? 56.435 40.577 46.171 1.00 32.04  ? 130 LEU A CB  1 
ATOM   884  C CG  . LEU A 1 116 ? 55.346 41.623 46.020 1.00 25.47  ? 130 LEU A CG  1 
ATOM   885  C CD1 . LEU A 1 116 ? 55.985 42.987 45.837 1.00 30.04  ? 130 LEU A CD1 1 
ATOM   886  C CD2 . LEU A 1 116 ? 54.490 41.263 44.824 1.00 14.18  ? 130 LEU A CD2 1 
ATOM   887  N N   . GLY A 1 117 ? 56.925 37.747 44.710 1.00 31.81  ? 131 GLY A N   1 
ATOM   888  C CA  . GLY A 1 117 ? 57.900 36.797 44.224 1.00 30.22  ? 131 GLY A CA  1 
ATOM   889  C C   . GLY A 1 117 ? 59.131 37.410 43.597 1.00 26.43  ? 131 GLY A C   1 
ATOM   890  O O   . GLY A 1 117 ? 59.096 38.529 43.090 1.00 28.74  ? 131 GLY A O   1 
ATOM   891  N N   . ASN A 1 118 ? 60.223 36.659 43.611 1.00 23.71  ? 132 ASN A N   1 
ATOM   892  C CA  . ASN A 1 118 ? 61.470 37.112 43.009 1.00 27.61  ? 132 ASN A CA  1 
ATOM   893  C C   . ASN A 1 118 ? 61.259 37.406 41.509 1.00 25.97  ? 132 ASN A C   1 
ATOM   894  O O   . ASN A 1 118 ? 60.743 36.570 40.762 1.00 29.97  ? 132 ASN A O   1 
ATOM   895  C CB  . ASN A 1 118 ? 62.549 36.036 43.191 1.00 30.38  ? 132 ASN A CB  1 
ATOM   896  C CG  . ASN A 1 118 ? 63.952 36.550 42.899 1.00 39.86  ? 132 ASN A CG  1 
ATOM   897  O OD1 . ASN A 1 118 ? 64.805 36.590 43.792 1.00 50.05  ? 132 ASN A OD1 1 
ATOM   898  N ND2 . ASN A 1 118 ? 64.207 36.928 41.646 1.00 43.11  ? 132 ASN A ND2 1 
ATOM   899  N N   . GLY A 1 119 ? 61.638 38.598 41.071 1.00 22.64  ? 133 GLY A N   1 
ATOM   900  C CA  . GLY A 1 119 ? 61.484 38.935 39.671 1.00 19.71  ? 133 GLY A CA  1 
ATOM   901  C C   . GLY A 1 119 ? 60.252 39.753 39.344 1.00 19.08  ? 133 GLY A C   1 
ATOM   902  O O   . GLY A 1 119 ? 60.101 40.189 38.209 1.00 20.57  ? 133 GLY A O   1 
ATOM   903  N N   . VAL A 1 120 ? 59.364 39.969 40.307 1.00 17.66  ? 134 VAL A N   1 
ATOM   904  C CA  . VAL A 1 120 ? 58.169 40.770 40.046 1.00 15.35  ? 134 VAL A CA  1 
ATOM   905  C C   . VAL A 1 120 ? 58.526 42.217 39.657 1.00 17.47  ? 134 VAL A C   1 
ATOM   906  O O   . VAL A 1 120 ? 59.427 42.824 40.239 1.00 18.81  ? 134 VAL A O   1 
ATOM   907  C CB  . VAL A 1 120 ? 57.242 40.795 41.265 1.00 3.27   ? 134 VAL A CB  1 
ATOM   908  C CG1 . VAL A 1 120 ? 56.042 41.704 40.990 1.00 10.97  ? 134 VAL A CG1 1 
ATOM   909  C CG2 . VAL A 1 120 ? 56.786 39.386 41.613 1.00 2.00   ? 134 VAL A CG2 1 
ATOM   910  N N   . GLN A 1 121 ? 57.830 42.762 38.663 1.00 19.34  ? 135 GLN A N   1 
ATOM   911  C CA  . GLN A 1 121 ? 58.099 44.119 38.217 1.00 21.89  ? 135 GLN A CA  1 
ATOM   912  C C   . GLN A 1 121 ? 57.313 45.116 39.053 1.00 22.84  ? 135 GLN A C   1 
ATOM   913  O O   . GLN A 1 121 ? 56.096 44.998 39.178 1.00 23.32  ? 135 GLN A O   1 
ATOM   914  C CB  . GLN A 1 121 ? 57.754 44.271 36.740 1.00 35.52  ? 135 GLN A CB  1 
ATOM   915  C CG  . GLN A 1 121 ? 58.505 43.305 35.801 1.00 69.91  ? 135 GLN A CG  1 
ATOM   916  C CD  . GLN A 1 121 ? 60.019 43.559 35.731 1.00 94.04  ? 135 GLN A CD  1 
ATOM   917  O OE1 . GLN A 1 121 ? 60.466 44.617 35.281 1.00 106.32 ? 135 GLN A OE1 1 
ATOM   918  N NE2 . GLN A 1 121 ? 60.810 42.572 36.157 1.00 100.18 ? 135 GLN A NE2 1 
ATOM   919  N N   . CYS A 1 122 ? 58.024 46.080 39.636 1.00 22.23  ? 136 CYS A N   1 
ATOM   920  C CA  . CYS A 1 122 ? 57.431 47.114 40.480 1.00 17.06  ? 136 CYS A CA  1 
ATOM   921  C C   . CYS A 1 122 ? 57.948 48.485 40.065 1.00 16.83  ? 136 CYS A C   1 
ATOM   922  O O   . CYS A 1 122 ? 58.920 48.586 39.319 1.00 20.27  ? 136 CYS A O   1 
ATOM   923  C CB  . CYS A 1 122 ? 57.799 46.878 41.928 1.00 6.06   ? 136 CYS A CB  1 
ATOM   924  S SG  . CYS A 1 122 ? 57.315 45.266 42.590 1.00 23.85  ? 136 CYS A SG  1 
ATOM   925  N N   . LEU A 1 123 ? 57.303 49.535 40.564 1.00 14.09  ? 137 LEU A N   1 
ATOM   926  C CA  . LEU A 1 123 ? 57.668 50.908 40.254 1.00 9.96   ? 137 LEU A CA  1 
ATOM   927  C C   . LEU A 1 123 ? 57.842 51.638 41.567 1.00 9.30   ? 137 LEU A C   1 
ATOM   928  O O   . LEU A 1 123 ? 57.001 51.511 42.458 1.00 11.59  ? 137 LEU A O   1 
ATOM   929  C CB  . LEU A 1 123 ? 56.562 51.572 39.446 1.00 10.41  ? 137 LEU A CB  1 
ATOM   930  C CG  . LEU A 1 123 ? 56.847 52.967 38.904 1.00 8.18   ? 137 LEU A CG  1 
ATOM   931  C CD1 . LEU A 1 123 ? 57.843 52.908 37.780 1.00 2.00   ? 137 LEU A CD1 1 
ATOM   932  C CD2 . LEU A 1 123 ? 55.586 53.554 38.412 1.00 3.54   ? 137 LEU A CD2 1 
ATOM   933  N N   . ALA A 1 124 ? 58.972 52.332 41.702 1.00 9.07   ? 138 ALA A N   1 
ATOM   934  C CA  . ALA A 1 124 ? 59.331 53.088 42.907 1.00 7.87   ? 138 ALA A CA  1 
ATOM   935  C C   . ALA A 1 124 ? 59.277 54.546 42.527 1.00 9.80   ? 138 ALA A C   1 
ATOM   936  O O   . ALA A 1 124 ? 59.436 54.872 41.350 1.00 13.23  ? 138 ALA A O   1 
ATOM   937  C CB  . ALA A 1 124 ? 60.748 52.719 43.375 1.00 2.00   ? 138 ALA A CB  1 
ATOM   938  N N   . MET A 1 125 ? 59.066 55.421 43.508 1.00 9.36   ? 139 MET A N   1 
ATOM   939  C CA  . MET A 1 125 ? 58.978 56.855 43.254 1.00 4.97   ? 139 MET A CA  1 
ATOM   940  C C   . MET A 1 125 ? 59.362 57.600 44.514 1.00 5.05   ? 139 MET A C   1 
ATOM   941  O O   . MET A 1 125 ? 59.391 56.996 45.584 1.00 2.46   ? 139 MET A O   1 
ATOM   942  C CB  . MET A 1 125 ? 57.553 57.223 42.851 1.00 2.00   ? 139 MET A CB  1 
ATOM   943  C CG  . MET A 1 125 ? 56.526 56.827 43.878 1.00 8.05   ? 139 MET A CG  1 
ATOM   944  S SD  . MET A 1 125 ? 54.843 56.951 43.278 1.00 14.05  ? 139 MET A SD  1 
ATOM   945  C CE  . MET A 1 125 ? 54.710 55.438 42.415 1.00 10.62  ? 139 MET A CE  1 
ATOM   946  N N   . GLY A 1 126 ? 59.662 58.896 44.374 1.00 7.71   ? 140 GLY A N   1 
ATOM   947  C CA  . GLY A 1 126 ? 60.040 59.746 45.499 1.00 7.11   ? 140 GLY A CA  1 
ATOM   948  C C   . GLY A 1 126 ? 60.735 61.029 45.048 1.00 8.81   ? 140 GLY A C   1 
ATOM   949  O O   . GLY A 1 126 ? 61.052 61.183 43.871 1.00 11.09  ? 140 GLY A O   1 
ATOM   950  N N   . TRP A 1 127 ? 60.979 61.951 45.975 1.00 8.58   ? 141 TRP A N   1 
ATOM   951  C CA  . TRP A 1 127 ? 61.652 63.213 45.675 1.00 3.91   ? 141 TRP A CA  1 
ATOM   952  C C   . TRP A 1 127 ? 63.026 63.223 46.349 1.00 6.79   ? 141 TRP A C   1 
ATOM   953  O O   . TRP A 1 127 ? 63.517 64.266 46.740 1.00 9.62   ? 141 TRP A O   1 
ATOM   954  C CB  . TRP A 1 127 ? 60.863 64.377 46.270 1.00 2.00   ? 141 TRP A CB  1 
ATOM   955  C CG  . TRP A 1 127 ? 59.636 64.785 45.558 1.00 10.12  ? 141 TRP A CG  1 
ATOM   956  C CD1 . TRP A 1 127 ? 59.542 65.659 44.506 1.00 14.25  ? 141 TRP A CD1 1 
ATOM   957  C CD2 . TRP A 1 127 ? 58.294 64.438 45.905 1.00 11.74  ? 141 TRP A CD2 1 
ATOM   958  N NE1 . TRP A 1 127 ? 58.225 65.888 44.191 1.00 9.93   ? 141 TRP A NE1 1 
ATOM   959  C CE2 . TRP A 1 127 ? 57.437 65.152 45.036 1.00 14.82  ? 141 TRP A CE2 1 
ATOM   960  C CE3 . TRP A 1 127 ? 57.730 63.604 46.873 1.00 6.14   ? 141 TRP A CE3 1 
ATOM   961  C CZ2 . TRP A 1 127 ? 56.051 65.051 45.107 1.00 6.99   ? 141 TRP A CZ2 1 
ATOM   962  C CZ3 . TRP A 1 127 ? 56.360 63.505 46.941 1.00 3.42   ? 141 TRP A CZ3 1 
ATOM   963  C CH2 . TRP A 1 127 ? 55.534 64.226 46.065 1.00 5.61   ? 141 TRP A CH2 1 
ATOM   964  N N   . GLY A 1 128 ? 63.635 62.067 46.535 1.00 7.61   ? 142 GLY A N   1 
ATOM   965  C CA  . GLY A 1 128 ? 64.928 62.026 47.197 1.00 8.07   ? 142 GLY A CA  1 
ATOM   966  C C   . GLY A 1 128 ? 66.083 62.394 46.294 1.00 7.09   ? 142 GLY A C   1 
ATOM   967  O O   . GLY A 1 128 ? 65.858 62.767 45.147 1.00 9.36   ? 142 GLY A O   1 
ATOM   968  N N   . LEU A 1 129 ? 67.305 62.284 46.810 1.00 6.15   ? 143 LEU A N   1 
ATOM   969  C CA  . LEU A 1 129 ? 68.510 62.595 46.053 1.00 7.85   ? 143 LEU A CA  1 
ATOM   970  C C   . LEU A 1 129 ? 68.516 62.014 44.650 1.00 15.55  ? 143 LEU A C   1 
ATOM   971  O O   . LEU A 1 129 ? 68.197 60.829 44.430 1.00 13.65  ? 143 LEU A O   1 
ATOM   972  C CB  . LEU A 1 129 ? 69.763 62.108 46.778 1.00 3.20   ? 143 LEU A CB  1 
ATOM   973  C CG  . LEU A 1 129 ? 70.259 62.945 47.945 1.00 3.12   ? 143 LEU A CG  1 
ATOM   974  C CD1 . LEU A 1 129 ? 71.693 63.266 47.723 1.00 3.40   ? 143 LEU A CD1 1 
ATOM   975  C CD2 . LEU A 1 129 ? 69.455 64.220 48.073 1.00 6.93   ? 143 LEU A CD2 1 
ATOM   976  N N   . LEU A 1 130 ? 68.910 62.870 43.714 1.00 19.71  ? 144 LEU A N   1 
ATOM   977  C CA  . LEU A 1 130 ? 68.988 62.527 42.310 1.00 20.98  ? 144 LEU A CA  1 
ATOM   978  C C   . LEU A 1 130 ? 70.246 61.745 42.022 1.00 26.92  ? 144 LEU A C   1 
ATOM   979  O O   . LEU A 1 130 ? 70.362 61.086 40.996 1.00 33.76  ? 144 LEU A O   1 
ATOM   980  C CB  . LEU A 1 130 ? 68.966 63.799 41.481 1.00 13.71  ? 144 LEU A CB  1 
ATOM   981  C CG  . LEU A 1 130 ? 67.560 64.326 41.251 1.00 4.12   ? 144 LEU A CG  1 
ATOM   982  C CD1 . LEU A 1 130 ? 67.612 65.666 40.598 1.00 2.00   ? 144 LEU A CD1 1 
ATOM   983  C CD2 . LEU A 1 130 ? 66.824 63.335 40.372 1.00 6.31   ? 144 LEU A CD2 1 
ATOM   984  N N   . GLY A 1 131 ? 71.201 61.807 42.924 1.00 29.81  ? 145 GLY A N   1 
ATOM   985  C CA  . GLY A 1 131 ? 72.411 61.070 42.686 1.00 38.93  ? 145 GLY A CA  1 
ATOM   986  C C   . GLY A 1 131 ? 73.102 60.882 44.000 1.00 44.95  ? 145 GLY A C   1 
ATOM   987  O O   . GLY A 1 131 ? 72.868 61.648 44.930 1.00 44.42  ? 145 GLY A O   1 
ATOM   988  N N   . ARG A 1 132 ? 73.967 59.874 44.050 1.00 51.32  ? 147 ARG A N   1 
ATOM   989  C CA  . ARG A 1 132 ? 74.747 59.529 45.234 1.00 58.91  ? 147 ARG A CA  1 
ATOM   990  C C   . ARG A 1 132 ? 75.184 60.813 45.947 1.00 62.22  ? 147 ARG A C   1 
ATOM   991  O O   . ARG A 1 132 ? 75.254 60.870 47.180 1.00 61.89  ? 147 ARG A O   1 
ATOM   992  C CB  . ARG A 1 132 ? 75.971 58.690 44.828 1.00 68.64  ? 147 ARG A CB  1 
ATOM   993  C CG  . ARG A 1 132 ? 75.730 57.601 43.742 1.00 88.52  ? 147 ARG A CG  1 
ATOM   994  C CD  . ARG A 1 132 ? 75.783 58.168 42.301 1.00 106.38 ? 147 ARG A CD  1 
ATOM   995  N NE  . ARG A 1 132 ? 75.794 57.136 41.253 1.00 122.23 ? 147 ARG A NE  1 
ATOM   996  C CZ  . ARG A 1 132 ? 75.616 57.376 39.951 1.00 126.08 ? 147 ARG A CZ  1 
ATOM   997  N NH1 . ARG A 1 132 ? 75.405 58.616 39.520 1.00 130.22 ? 147 ARG A NH1 1 
ATOM   998  N NH2 . ARG A 1 132 ? 75.659 56.380 39.069 1.00 120.07 ? 147 ARG A NH2 1 
ATOM   999  N N   . ASN A 1 133 ? 75.439 61.846 45.145 1.00 65.69  ? 148 ASN A N   1 
ATOM   1000 C CA  . ASN A 1 133 ? 75.835 63.161 45.635 1.00 72.27  ? 148 ASN A CA  1 
ATOM   1001 C C   . ASN A 1 133 ? 74.866 64.238 45.147 1.00 73.13  ? 148 ASN A C   1 
ATOM   1002 O O   . ASN A 1 133 ? 74.587 65.200 45.863 1.00 74.31  ? 148 ASN A O   1 
ATOM   1003 C CB  . ASN A 1 133 ? 77.233 63.526 45.133 1.00 80.83  ? 148 ASN A CB  1 
ATOM   1004 C CG  . ASN A 1 133 ? 78.319 62.719 45.795 1.00 93.43  ? 148 ASN A CG  1 
ATOM   1005 O OD1 . ASN A 1 133 ? 78.834 61.763 45.216 1.00 103.22 ? 148 ASN A OD1 1 
ATOM   1006 N ND2 . ASN A 1 133 ? 78.693 63.111 47.010 1.00 102.39 ? 148 ASN A ND2 1 
ATOM   1007 N N   . ARG A 1 134 ? 74.383 64.074 43.914 1.00 73.80  ? 149 ARG A N   1 
ATOM   1008 C CA  . ARG A 1 134 ? 73.478 65.026 43.267 1.00 72.10  ? 149 ARG A CA  1 
ATOM   1009 C C   . ARG A 1 134 ? 72.158 65.325 43.972 1.00 67.76  ? 149 ARG A C   1 
ATOM   1010 O O   . ARG A 1 134 ? 71.371 64.423 44.267 1.00 69.85  ? 149 ARG A O   1 
ATOM   1011 C CB  . ARG A 1 134 ? 73.232 64.614 41.813 1.00 79.20  ? 149 ARG A CB  1 
ATOM   1012 C CG  . ARG A 1 134 ? 73.838 65.580 40.806 1.00 88.56  ? 149 ARG A CG  1 
ATOM   1013 C CD  . ARG A 1 134 ? 72.777 66.491 40.208 1.00 91.48  ? 149 ARG A CD  1 
ATOM   1014 N NE  . ARG A 1 134 ? 71.872 65.721 39.363 1.00 91.78  ? 149 ARG A NE  1 
ATOM   1015 C CZ  . ARG A 1 134 ? 70.881 66.239 38.648 1.00 94.27  ? 149 ARG A CZ  1 
ATOM   1016 N NH1 . ARG A 1 134 ? 70.649 67.547 38.666 1.00 98.57  ? 149 ARG A NH1 1 
ATOM   1017 N NH2 . ARG A 1 134 ? 70.123 65.442 37.910 1.00 95.48  ? 149 ARG A NH2 1 
ATOM   1018 N N   . GLY A 1 135 ? 71.914 66.624 44.138 1.00 62.58  ? 150 GLY A N   1 
ATOM   1019 C CA  . GLY A 1 135 ? 70.746 67.162 44.817 1.00 56.06  ? 150 GLY A CA  1 
ATOM   1020 C C   . GLY A 1 135 ? 69.375 66.516 44.795 1.00 51.46  ? 150 GLY A C   1 
ATOM   1021 O O   . GLY A 1 135 ? 69.038 65.685 43.947 1.00 51.89  ? 150 GLY A O   1 
ATOM   1022 N N   . ILE A 1 136 ? 68.561 66.963 45.740 1.00 44.83  ? 151 ILE A N   1 
ATOM   1023 C CA  . ILE A 1 136 ? 67.208 66.475 45.893 1.00 42.68  ? 151 ILE A CA  1 
ATOM   1024 C C   . ILE A 1 136 ? 66.341 66.833 44.683 1.00 40.41  ? 151 ILE A C   1 
ATOM   1025 O O   . ILE A 1 136 ? 66.457 67.920 44.105 1.00 39.76  ? 151 ILE A O   1 
ATOM   1026 C CB  . ILE A 1 136 ? 66.574 67.024 47.196 1.00 43.52  ? 151 ILE A CB  1 
ATOM   1027 C CG1 . ILE A 1 136 ? 65.170 66.460 47.385 1.00 45.02  ? 151 ILE A CG1 1 
ATOM   1028 C CG2 . ILE A 1 136 ? 66.539 68.545 47.173 1.00 51.73  ? 151 ILE A CG2 1 
ATOM   1029 C CD1 . ILE A 1 136 ? 64.535 66.811 48.702 1.00 48.94  ? 151 ILE A CD1 1 
ATOM   1030 N N   . ALA A 1 137 ? 65.506 65.886 44.278 1.00 36.87  ? 152 ALA A N   1 
ATOM   1031 C CA  . ALA A 1 137 ? 64.617 66.088 43.156 1.00 31.29  ? 152 ALA A CA  1 
ATOM   1032 C C   . ALA A 1 137 ? 63.611 67.172 43.516 1.00 29.00  ? 152 ALA A C   1 
ATOM   1033 O O   . ALA A 1 137 ? 63.359 67.432 44.686 1.00 27.49  ? 152 ALA A O   1 
ATOM   1034 C CB  . ALA A 1 137 ? 63.899 64.794 42.832 1.00 29.19  ? 152 ALA A CB  1 
ATOM   1035 N N   . SER A 1 138 ? 63.076 67.831 42.495 1.00 29.64  ? 153 SER A N   1 
ATOM   1036 C CA  . SER A 1 138 ? 62.074 68.878 42.665 1.00 27.21  ? 153 SER A CA  1 
ATOM   1037 C C   . SER A 1 138 ? 60.798 68.331 42.048 1.00 26.01  ? 153 SER A C   1 
ATOM   1038 O O   . SER A 1 138 ? 59.695 68.660 42.480 1.00 28.14  ? 153 SER A O   1 
ATOM   1039 C CB  . SER A 1 138 ? 62.490 70.129 41.906 1.00 27.54  ? 153 SER A CB  1 
ATOM   1040 O OG  . SER A 1 138 ? 63.789 69.955 41.363 1.00 46.14  ? 153 SER A OG  1 
ATOM   1041 N N   . VAL A 1 139 ? 60.962 67.515 41.013 1.00 21.10  ? 154 VAL A N   1 
ATOM   1042 C CA  . VAL A 1 139 ? 59.839 66.898 40.337 1.00 15.84  ? 154 VAL A CA  1 
ATOM   1043 C C   . VAL A 1 139 ? 59.866 65.411 40.596 1.00 15.11  ? 154 VAL A C   1 
ATOM   1044 O O   . VAL A 1 139 ? 60.883 64.753 40.388 1.00 15.55  ? 154 VAL A O   1 
ATOM   1045 C CB  . VAL A 1 139 ? 59.890 67.145 38.828 1.00 11.10  ? 154 VAL A CB  1 
ATOM   1046 C CG1 . VAL A 1 139 ? 59.058 66.122 38.098 1.00 8.71   ? 154 VAL A CG1 1 
ATOM   1047 C CG2 . VAL A 1 139 ? 59.362 68.516 38.525 1.00 17.16  ? 154 VAL A CG2 1 
ATOM   1048 N N   . LEU A 1 140 ? 58.737 64.886 41.050 1.00 14.72  ? 155 LEU A N   1 
ATOM   1049 C CA  . LEU A 1 140 ? 58.608 63.464 41.341 1.00 12.74  ? 155 LEU A CA  1 
ATOM   1050 C C   . LEU A 1 140 ? 59.212 62.552 40.256 1.00 12.17  ? 155 LEU A C   1 
ATOM   1051 O O   . LEU A 1 140 ? 58.863 62.657 39.072 1.00 15.16  ? 155 LEU A O   1 
ATOM   1052 C CB  . LEU A 1 140 ? 57.132 63.126 41.545 1.00 8.77   ? 155 LEU A CB  1 
ATOM   1053 C CG  . LEU A 1 140 ? 56.781 61.652 41.706 1.00 2.18   ? 155 LEU A CG  1 
ATOM   1054 C CD1 . LEU A 1 140 ? 57.340 61.123 43.018 1.00 13.10  ? 155 LEU A CD1 1 
ATOM   1055 C CD2 . LEU A 1 140 ? 55.284 61.522 41.685 1.00 11.01  ? 155 LEU A CD2 1 
ATOM   1056 N N   . GLN A 1 141 ? 60.110 61.668 40.677 1.00 7.08   ? 156 GLN A N   1 
ATOM   1057 C CA  . GLN A 1 141 ? 60.764 60.715 39.791 1.00 4.38   ? 156 GLN A CA  1 
ATOM   1058 C C   . GLN A 1 141 ? 60.133 59.360 40.008 1.00 4.90   ? 156 GLN A C   1 
ATOM   1059 O O   . GLN A 1 141 ? 59.495 59.126 41.021 1.00 9.79   ? 156 GLN A O   1 
ATOM   1060 C CB  . GLN A 1 141 ? 62.224 60.573 40.182 1.00 6.14   ? 156 GLN A CB  1 
ATOM   1061 C CG  . GLN A 1 141 ? 62.981 61.864 40.275 1.00 12.98  ? 156 GLN A CG  1 
ATOM   1062 C CD  . GLN A 1 141 ? 63.352 62.365 38.928 1.00 11.49  ? 156 GLN A CD  1 
ATOM   1063 O OE1 . GLN A 1 141 ? 62.832 63.376 38.471 1.00 13.62  ? 156 GLN A OE1 1 
ATOM   1064 N NE2 . GLN A 1 141 ? 64.236 61.641 38.252 1.00 14.31  ? 156 GLN A NE2 1 
ATOM   1065 N N   . GLU A 1 142 ? 60.319 58.455 39.064 1.00 5.50   ? 157 GLU A N   1 
ATOM   1066 C CA  . GLU A 1 142 ? 59.807 57.101 39.205 1.00 5.18   ? 157 GLU A CA  1 
ATOM   1067 C C   . GLU A 1 142 ? 60.906 56.203 38.668 1.00 5.69   ? 157 GLU A C   1 
ATOM   1068 O O   . GLU A 1 142 ? 61.815 56.676 37.978 1.00 2.00   ? 157 GLU A O   1 
ATOM   1069 C CB  . GLU A 1 142 ? 58.480 56.888 38.475 1.00 3.31   ? 157 GLU A CB  1 
ATOM   1070 C CG  . GLU A 1 142 ? 58.489 57.152 36.993 1.00 21.85  ? 157 GLU A CG  1 
ATOM   1071 C CD  . GLU A 1 142 ? 57.114 56.970 36.389 1.00 35.25  ? 157 GLU A CD  1 
ATOM   1072 O OE1 . GLU A 1 142 ? 56.146 57.488 36.988 1.00 41.19  ? 157 GLU A OE1 1 
ATOM   1073 O OE2 . GLU A 1 142 ? 56.993 56.310 35.331 1.00 33.48  ? 157 GLU A OE2 1 
ATOM   1074 N N   . LEU A 1 143 ? 60.833 54.916 38.977 1.00 3.90   ? 158 LEU A N   1 
ATOM   1075 C CA  . LEU A 1 143 ? 61.886 54.014 38.569 1.00 6.77   ? 158 LEU A CA  1 
ATOM   1076 C C   . LEU A 1 143 ? 61.385 52.603 38.521 1.00 7.09   ? 158 LEU A C   1 
ATOM   1077 O O   . LEU A 1 143 ? 60.759 52.152 39.461 1.00 11.53  ? 158 LEU A O   1 
ATOM   1078 C CB  . LEU A 1 143 ? 63.022 54.097 39.597 1.00 9.45   ? 158 LEU A CB  1 
ATOM   1079 C CG  . LEU A 1 143 ? 64.236 53.170 39.505 1.00 14.23  ? 158 LEU A CG  1 
ATOM   1080 C CD1 . LEU A 1 143 ? 65.231 53.750 38.521 1.00 17.53  ? 158 LEU A CD1 1 
ATOM   1081 C CD2 . LEU A 1 143 ? 64.894 53.040 40.857 1.00 7.01   ? 158 LEU A CD2 1 
ATOM   1082 N N   . ASN A 1 144 ? 61.644 51.913 37.419 1.00 9.04   ? 159 ASN A N   1 
ATOM   1083 C CA  . ASN A 1 144 ? 61.250 50.515 37.283 1.00 12.42  ? 159 ASN A CA  1 
ATOM   1084 C C   . ASN A 1 144 ? 62.300 49.651 38.010 1.00 13.81  ? 159 ASN A C   1 
ATOM   1085 O O   . ASN A 1 144 ? 63.496 49.699 37.688 1.00 16.43  ? 159 ASN A O   1 
ATOM   1086 C CB  . ASN A 1 144 ? 61.189 50.127 35.805 1.00 21.99  ? 159 ASN A CB  1 
ATOM   1087 C CG  . ASN A 1 144 ? 59.986 50.702 35.100 1.00 25.86  ? 159 ASN A CG  1 
ATOM   1088 O OD1 . ASN A 1 144 ? 59.879 51.916 34.917 1.00 32.21  ? 159 ASN A OD1 1 
ATOM   1089 N ND2 . ASN A 1 144 ? 59.083 49.822 34.685 1.00 23.99  ? 159 ASN A ND2 1 
ATOM   1090 N N   . VAL A 1 145 ? 61.847 48.873 38.990 1.00 14.20  ? 160 VAL A N   1 
ATOM   1091 C CA  . VAL A 1 145 ? 62.713 48.016 39.800 1.00 12.01  ? 160 VAL A CA  1 
ATOM   1092 C C   . VAL A 1 145 ? 62.137 46.595 39.863 1.00 12.99  ? 160 VAL A C   1 
ATOM   1093 O O   . VAL A 1 145 ? 60.942 46.388 39.675 1.00 14.06  ? 160 VAL A O   1 
ATOM   1094 C CB  . VAL A 1 145 ? 62.835 48.585 41.229 1.00 13.54  ? 160 VAL A CB  1 
ATOM   1095 C CG1 . VAL A 1 145 ? 63.403 49.995 41.188 1.00 7.11   ? 160 VAL A CG1 1 
ATOM   1096 C CG2 . VAL A 1 145 ? 61.471 48.610 41.907 1.00 6.00   ? 160 VAL A CG2 1 
ATOM   1097 N N   . THR A 1 146 ? 62.975 45.627 40.193 1.00 13.16  ? 162 THR A N   1 
ATOM   1098 C CA  . THR A 1 146 ? 62.543 44.237 40.240 1.00 14.79  ? 162 THR A CA  1 
ATOM   1099 C C   . THR A 1 146 ? 62.745 43.639 41.621 1.00 13.82  ? 162 THR A C   1 
ATOM   1100 O O   . THR A 1 146 ? 63.824 43.780 42.202 1.00 13.37  ? 162 THR A O   1 
ATOM   1101 C CB  . THR A 1 146 ? 63.362 43.397 39.224 1.00 21.92  ? 162 THR A CB  1 
ATOM   1102 O OG1 . THR A 1 146 ? 63.112 43.870 37.893 1.00 30.10  ? 162 THR A OG1 1 
ATOM   1103 C CG2 . THR A 1 146 ? 63.003 41.931 39.317 1.00 17.15  ? 162 THR A CG2 1 
ATOM   1104 N N   . VAL A 1 147 ? 61.718 42.960 42.128 1.00 11.69  ? 163 VAL A N   1 
ATOM   1105 C CA  . VAL A 1 147 ? 61.784 42.307 43.434 1.00 11.45  ? 163 VAL A CA  1 
ATOM   1106 C C   . VAL A 1 147 ? 62.844 41.213 43.411 1.00 13.87  ? 163 VAL A C   1 
ATOM   1107 O O   . VAL A 1 147 ? 62.989 40.490 42.423 1.00 12.07  ? 163 VAL A O   1 
ATOM   1108 C CB  . VAL A 1 147 ? 60.427 41.665 43.832 1.00 8.20   ? 163 VAL A CB  1 
ATOM   1109 C CG1 . VAL A 1 147 ? 60.578 40.862 45.139 1.00 2.00   ? 163 VAL A CG1 1 
ATOM   1110 C CG2 . VAL A 1 147 ? 59.350 42.750 43.964 1.00 2.00   ? 163 VAL A CG2 1 
ATOM   1111 N N   . VAL A 1 148 ? 63.602 41.113 44.490 1.00 15.54  ? 164 VAL A N   1 
ATOM   1112 C CA  . VAL A 1 148 ? 64.640 40.108 44.595 1.00 19.81  ? 164 VAL A CA  1 
ATOM   1113 C C   . VAL A 1 148 ? 64.515 39.540 45.989 1.00 26.53  ? 164 VAL A C   1 
ATOM   1114 O O   . VAL A 1 148 ? 63.929 40.184 46.864 1.00 30.02  ? 164 VAL A O   1 
ATOM   1115 C CB  . VAL A 1 148 ? 66.045 40.718 44.439 1.00 14.50  ? 164 VAL A CB  1 
ATOM   1116 C CG1 . VAL A 1 148 ? 66.191 41.383 43.095 1.00 7.79   ? 164 VAL A CG1 1 
ATOM   1117 C CG2 . VAL A 1 148 ? 66.308 41.717 45.534 1.00 20.12  ? 164 VAL A CG2 1 
ATOM   1118 N N   . THR A 1 149 ? 65.040 38.334 46.191 1.00 30.67  ? 165 THR A N   1 
ATOM   1119 C CA  . THR A 1 149 ? 64.998 37.682 47.501 1.00 32.26  ? 165 THR A CA  1 
ATOM   1120 C C   . THR A 1 149 ? 66.405 37.381 48.015 1.00 33.69  ? 165 THR A C   1 
ATOM   1121 O O   . THR A 1 149 ? 66.603 37.075 49.199 1.00 37.14  ? 165 THR A O   1 
ATOM   1122 C CB  . THR A 1 149 ? 64.172 36.373 47.478 1.00 29.48  ? 165 THR A CB  1 
ATOM   1123 O OG1 . THR A 1 149 ? 64.817 35.400 46.644 1.00 36.54  ? 165 THR A OG1 1 
ATOM   1124 C CG2 . THR A 1 149 ? 62.762 36.644 46.968 1.00 23.10  ? 165 THR A CG2 1 
ATOM   1125 N N   . SER A 1 150 ? 67.386 37.446 47.124 1.00 31.91  ? 166 SER A N   1 
ATOM   1126 C CA  . SER A 1 150 ? 68.756 37.203 47.533 1.00 35.25  ? 166 SER A CA  1 
ATOM   1127 C C   . SER A 1 150 ? 69.317 38.489 48.117 1.00 33.49  ? 166 SER A C   1 
ATOM   1128 O O   . SER A 1 150 ? 69.030 39.578 47.615 1.00 36.81  ? 166 SER A O   1 
ATOM   1129 C CB  . SER A 1 150 ? 69.580 36.713 46.354 1.00 43.44  ? 166 SER A CB  1 
ATOM   1130 O OG  . SER A 1 150 ? 69.007 35.518 45.842 1.00 67.14  ? 166 SER A OG  1 
ATOM   1131 N N   . LEU A 1 151 ? 70.105 38.354 49.182 1.00 31.74  ? 167 LEU A N   1 
ATOM   1132 C CA  . LEU A 1 151 ? 70.680 39.502 49.877 1.00 29.27  ? 167 LEU A CA  1 
ATOM   1133 C C   . LEU A 1 151 ? 69.521 40.309 50.476 1.00 28.17  ? 167 LEU A C   1 
ATOM   1134 O O   . LEU A 1 151 ? 69.488 41.536 50.393 1.00 32.67  ? 167 LEU A O   1 
ATOM   1135 C CB  . LEU A 1 151 ? 71.490 40.370 48.908 1.00 25.28  ? 167 LEU A CB  1 
ATOM   1136 C CG  . LEU A 1 151 ? 73.003 40.215 48.885 1.00 23.21  ? 167 LEU A CG  1 
ATOM   1137 C CD1 . LEU A 1 151 ? 73.383 38.759 48.659 1.00 23.68  ? 167 LEU A CD1 1 
ATOM   1138 C CD2 . LEU A 1 151 ? 73.565 41.119 47.796 1.00 26.39  ? 167 LEU A CD2 1 
ATOM   1139 N N   . CYS A 1 152 ? 68.586 39.615 51.113 1.00 24.35  ? 168 CYS A N   1 
ATOM   1140 C CA  . CYS A 1 152 ? 67.429 40.285 51.671 1.00 20.56  ? 168 CYS A CA  1 
ATOM   1141 C C   . CYS A 1 152 ? 66.656 39.498 52.735 1.00 18.72  ? 168 CYS A C   1 
ATOM   1142 O O   . CYS A 1 152 ? 66.253 38.358 52.508 1.00 25.95  ? 168 CYS A O   1 
ATOM   1143 C CB  . CYS A 1 152 ? 66.496 40.612 50.528 1.00 13.31  ? 168 CYS A CB  1 
ATOM   1144 S SG  . CYS A 1 152 ? 65.088 41.619 51.023 1.00 20.07  ? 168 CYS A SG  1 
ATOM   1145 N N   . ARG A 1 153 ? 66.425 40.123 53.884 1.00 13.55  ? 177 ARG A N   1 
ATOM   1146 C CA  . ARG A 1 153 ? 65.677 39.502 54.972 1.00 8.97   ? 177 ARG A CA  1 
ATOM   1147 C C   . ARG A 1 153 ? 64.212 39.238 54.582 1.00 8.84   ? 177 ARG A C   1 
ATOM   1148 O O   . ARG A 1 153 ? 63.624 39.954 53.779 1.00 11.35  ? 177 ARG A O   1 
ATOM   1149 C CB  . ARG A 1 153 ? 65.704 40.417 56.190 1.00 9.05   ? 177 ARG A CB  1 
ATOM   1150 C CG  . ARG A 1 153 ? 67.093 40.918 56.556 1.00 16.82  ? 177 ARG A CG  1 
ATOM   1151 C CD  . ARG A 1 153 ? 67.100 41.750 57.848 1.00 16.86  ? 177 ARG A CD  1 
ATOM   1152 N NE  . ARG A 1 153 ? 66.416 43.032 57.700 1.00 17.22  ? 177 ARG A NE  1 
ATOM   1153 C CZ  . ARG A 1 153 ? 66.385 43.977 58.629 1.00 8.85   ? 177 ARG A CZ  1 
ATOM   1154 N NH1 . ARG A 1 153 ? 67.000 43.799 59.789 1.00 20.57  ? 177 ARG A NH1 1 
ATOM   1155 N NH2 . ARG A 1 153 ? 65.740 45.105 58.391 1.00 14.11  ? 177 ARG A NH2 1 
ATOM   1156 N N   . ARG A 1 154 ? 63.608 38.219 55.165 1.00 6.79   ? 178 ARG A N   1 
ATOM   1157 C CA  . ARG A 1 154 ? 62.217 37.931 54.862 1.00 8.51   ? 178 ARG A CA  1 
ATOM   1158 C C   . ARG A 1 154 ? 61.340 39.040 55.481 1.00 9.28   ? 178 ARG A C   1 
ATOM   1159 O O   . ARG A 1 154 ? 60.152 39.228 55.138 1.00 7.20   ? 178 ARG A O   1 
ATOM   1160 C CB  . ARG A 1 154 ? 61.850 36.528 55.384 1.00 14.13  ? 178 ARG A CB  1 
ATOM   1161 C CG  . ARG A 1 154 ? 61.323 36.409 56.849 1.00 50.61  ? 178 ARG A CG  1 
ATOM   1162 C CD  . ARG A 1 154 ? 62.124 37.181 57.935 1.00 75.69  ? 178 ARG A CD  1 
ATOM   1163 N NE  . ARG A 1 154 ? 63.548 36.843 58.039 1.00 90.29  ? 178 ARG A NE  1 
ATOM   1164 C CZ  . ARG A 1 154 ? 64.407 37.479 58.837 1.00 96.02  ? 178 ARG A CZ  1 
ATOM   1165 N NH1 . ARG A 1 154 ? 63.995 38.487 59.601 1.00 96.56  ? 178 ARG A NH1 1 
ATOM   1166 N NH2 . ARG A 1 154 ? 65.684 37.111 58.873 1.00 101.35 ? 178 ARG A NH2 1 
ATOM   1167 N N   . SER A 1 155 ? 61.958 39.798 56.381 1.00 8.53   ? 179 SER A N   1 
ATOM   1168 C CA  . SER A 1 155 ? 61.266 40.863 57.069 1.00 8.67   ? 179 SER A CA  1 
ATOM   1169 C C   . SER A 1 155 ? 61.301 42.150 56.269 1.00 9.74   ? 179 SER A C   1 
ATOM   1170 O O   . SER A 1 155 ? 60.892 43.211 56.749 1.00 12.11  ? 179 SER A O   1 
ATOM   1171 C CB  . SER A 1 155 ? 61.855 41.050 58.464 1.00 10.51  ? 179 SER A CB  1 
ATOM   1172 O OG  . SER A 1 155 ? 63.267 40.991 58.430 1.00 31.55  ? 179 SER A OG  1 
ATOM   1173 N N   . ASN A 1 156 ? 61.744 42.037 55.026 1.00 8.27   ? 180 ASN A N   1 
ATOM   1174 C CA  . ASN A 1 156 ? 61.824 43.170 54.127 1.00 8.24   ? 180 ASN A CA  1 
ATOM   1175 C C   . ASN A 1 156 ? 61.420 42.688 52.755 1.00 12.12  ? 180 ASN A C   1 
ATOM   1176 O O   . ASN A 1 156 ? 61.403 41.472 52.505 1.00 14.98  ? 180 ASN A O   1 
ATOM   1177 C CB  . ASN A 1 156 ? 63.264 43.632 54.016 1.00 2.00   ? 180 ASN A CB  1 
ATOM   1178 C CG  . ASN A 1 156 ? 63.636 44.605 55.065 1.00 7.96   ? 180 ASN A CG  1 
ATOM   1179 O OD1 . ASN A 1 156 ? 64.616 44.410 55.774 1.00 19.07  ? 180 ASN A OD1 1 
ATOM   1180 N ND2 . ASN A 1 156 ? 62.892 45.696 55.152 1.00 11.98  ? 180 ASN A ND2 1 
ATOM   1181 N N   . VAL A 1 157 ? 61.086 43.639 51.881 1.00 12.01  ? 181 VAL A N   1 
ATOM   1182 C CA  . VAL A 1 157 ? 60.763 43.372 50.477 1.00 9.75   ? 181 VAL A CA  1 
ATOM   1183 C C   . VAL A 1 157 ? 61.820 44.216 49.762 1.00 13.03  ? 181 VAL A C   1 
ATOM   1184 O O   . VAL A 1 157 ? 61.835 45.450 49.912 1.00 12.42  ? 181 VAL A O   1 
ATOM   1185 C CB  . VAL A 1 157 ? 59.317 43.805 50.083 1.00 2.82   ? 181 VAL A CB  1 
ATOM   1186 C CG1 . VAL A 1 157 ? 59.048 45.217 50.484 1.00 25.66  ? 181 VAL A CG1 1 
ATOM   1187 C CG2 . VAL A 1 157 ? 59.116 43.692 48.602 1.00 2.00   ? 181 VAL A CG2 1 
ATOM   1188 N N   . CYS A 1 158 ? 62.794 43.539 49.143 1.00 13.87  ? 182 CYS A N   1 
ATOM   1189 C CA  . CYS A 1 158 ? 63.893 44.203 48.433 1.00 13.61  ? 182 CYS A CA  1 
ATOM   1190 C C   . CYS A 1 158 ? 63.740 44.282 46.918 1.00 16.68  ? 182 CYS A C   1 
ATOM   1191 O O   . CYS A 1 158 ? 63.158 43.389 46.298 1.00 22.29  ? 182 CYS A O   1 
ATOM   1192 C CB  . CYS A 1 158 ? 65.208 43.508 48.730 1.00 4.25   ? 182 CYS A CB  1 
ATOM   1193 S SG  . CYS A 1 158 ? 65.693 43.469 50.476 1.00 13.94  ? 182 CYS A SG  1 
ATOM   1194 N N   . THR A 1 159 ? 64.295 45.340 46.328 1.00 15.05  ? 183 THR A N   1 
ATOM   1195 C CA  . THR A 1 159 ? 64.260 45.541 44.883 1.00 16.67  ? 183 THR A CA  1 
ATOM   1196 C C   . THR A 1 159 ? 65.693 45.749 44.385 1.00 19.25  ? 183 THR A C   1 
ATOM   1197 O O   . THR A 1 159 ? 66.592 46.035 45.182 1.00 19.72  ? 183 THR A O   1 
ATOM   1198 C CB  . THR A 1 159 ? 63.453 46.794 44.475 1.00 9.96   ? 183 THR A CB  1 
ATOM   1199 O OG1 . THR A 1 159 ? 64.150 47.968 44.904 1.00 20.63  ? 183 THR A OG1 1 
ATOM   1200 C CG2 . THR A 1 159 ? 62.082 46.784 45.069 1.00 2.55   ? 183 THR A CG2 1 
ATOM   1201 N N   . LEU A 1 160 ? 65.893 45.592 43.075 1.00 21.89  ? 184 LEU A N   1 
ATOM   1202 C CA  . LEU A 1 160 ? 67.190 45.783 42.424 1.00 19.82  ? 184 LEU A CA  1 
ATOM   1203 C C   . LEU A 1 160 ? 66.908 46.172 40.994 1.00 23.43  ? 184 LEU A C   1 
ATOM   1204 O O   . LEU A 1 160 ? 66.032 45.574 40.371 1.00 28.09  ? 184 LEU A O   1 
ATOM   1205 C CB  . LEU A 1 160 ? 67.989 44.488 42.412 1.00 7.03   ? 184 LEU A CB  1 
ATOM   1206 C CG  . LEU A 1 160 ? 69.461 44.712 42.075 1.00 17.56  ? 184 LEU A CG  1 
ATOM   1207 C CD1 . LEU A 1 160 ? 70.012 45.816 42.955 1.00 26.12  ? 184 LEU A CD1 1 
ATOM   1208 C CD2 . LEU A 1 160 ? 70.280 43.443 42.266 1.00 15.21  ? 184 LEU A CD2 1 
ATOM   1209 N N   . VAL A 1 161 ? 67.580 47.208 40.494 1.00 25.85  ? 185 VAL A N   1 
ATOM   1210 C CA  . VAL A 1 161 ? 67.395 47.643 39.104 1.00 27.01  ? 185 VAL A CA  1 
ATOM   1211 C C   . VAL A 1 161 ? 68.508 46.939 38.355 1.00 30.48  ? 185 VAL A C   1 
ATOM   1212 O O   . VAL A 1 161 ? 69.561 47.519 38.113 1.00 32.96  ? 185 VAL A O   1 
ATOM   1213 C CB  . VAL A 1 161 ? 67.580 49.166 38.923 1.00 23.45  ? 185 VAL A CB  1 
ATOM   1214 C CG1 . VAL A 1 161 ? 67.422 49.531 37.492 1.00 13.48  ? 185 VAL A CG1 1 
ATOM   1215 C CG2 . VAL A 1 161 ? 66.589 49.936 39.756 1.00 35.72  ? 185 VAL A CG2 1 
ATOM   1216 N N   . ARG A 1 162 ? 68.274 45.676 38.017 1.00 35.48  ? 186 ARG A N   1 
ATOM   1217 C CA  . ARG A 1 162 ? 69.263 44.847 37.337 1.00 38.00  ? 186 ARG A CA  1 
ATOM   1218 C C   . ARG A 1 162 ? 70.132 45.457 36.234 1.00 38.36  ? 186 ARG A C   1 
ATOM   1219 O O   . ARG A 1 162 ? 69.638 46.020 35.252 1.00 36.41  ? 186 ARG A O   1 
ATOM   1220 C CB  . ARG A 1 162 ? 68.635 43.539 36.868 1.00 42.19  ? 186 ARG A CB  1 
ATOM   1221 C CG  . ARG A 1 162 ? 68.543 42.498 37.964 1.00 57.83  ? 186 ARG A CG  1 
ATOM   1222 C CD  . ARG A 1 162 ? 68.477 41.099 37.373 1.00 80.50  ? 186 ARG A CD  1 
ATOM   1223 N NE  . ARG A 1 162 ? 67.246 40.406 37.745 1.00 99.73  ? 186 ARG A NE  1 
ATOM   1224 C CZ  . ARG A 1 162 ? 67.100 39.665 38.842 1.00 105.94 ? 186 ARG A CZ  1 
ATOM   1225 N NH1 . ARG A 1 162 ? 68.115 39.512 39.687 1.00 106.21 ? 186 ARG A NH1 1 
ATOM   1226 N NH2 . ARG A 1 162 ? 65.935 39.076 39.098 1.00 109.73 ? 186 ARG A NH2 1 
ATOM   1227 N N   . GLY A 1 163 A 71.443 45.352 36.446 1.00 39.09  ? 186 GLY A N   1 
ATOM   1228 C CA  . GLY A 1 163 A 72.417 45.853 35.498 1.00 39.77  ? 186 GLY A CA  1 
ATOM   1229 C C   . GLY A 1 163 A 72.578 47.355 35.336 1.00 38.94  ? 186 GLY A C   1 
ATOM   1230 O O   . GLY A 1 163 A 72.913 47.820 34.235 1.00 42.09  ? 186 GLY A O   1 
ATOM   1231 N N   . ARG A 1 164 ? 72.328 48.119 36.395 1.00 32.25  ? 187 ARG A N   1 
ATOM   1232 C CA  . ARG A 1 164 ? 72.491 49.567 36.330 1.00 25.81  ? 187 ARG A CA  1 
ATOM   1233 C C   . ARG A 1 164 ? 72.751 50.112 37.710 1.00 19.93  ? 187 ARG A C   1 
ATOM   1234 O O   . ARG A 1 164 ? 72.554 49.421 38.704 1.00 18.24  ? 187 ARG A O   1 
ATOM   1235 C CB  . ARG A 1 164 ? 71.258 50.256 35.753 1.00 31.78  ? 187 ARG A CB  1 
ATOM   1236 C CG  . ARG A 1 164 ? 71.089 50.117 34.265 1.00 36.66  ? 187 ARG A CG  1 
ATOM   1237 C CD  . ARG A 1 164 ? 70.334 51.298 33.712 1.00 45.74  ? 187 ARG A CD  1 
ATOM   1238 N NE  . ARG A 1 164 ? 68.995 51.444 34.284 1.00 47.76  ? 187 ARG A NE  1 
ATOM   1239 C CZ  . ARG A 1 164 ? 68.466 52.608 34.662 1.00 50.99  ? 187 ARG A CZ  1 
ATOM   1240 N NH1 . ARG A 1 164 ? 69.161 53.739 34.546 1.00 46.10  ? 187 ARG A NH1 1 
ATOM   1241 N NH2 . ARG A 1 164 ? 67.214 52.649 35.096 1.00 54.96  ? 187 ARG A NH2 1 
ATOM   1242 N N   . GLN A 1 165 ? 73.220 51.349 37.769 1.00 14.63  ? 188 GLN A N   1 
ATOM   1243 C CA  . GLN A 1 165 ? 73.483 51.968 39.045 1.00 11.47  ? 188 GLN A CA  1 
ATOM   1244 C C   . GLN A 1 165 ? 72.366 52.937 39.301 1.00 13.76  ? 188 GLN A C   1 
ATOM   1245 O O   . GLN A 1 165 ? 72.480 54.126 39.022 1.00 17.89  ? 188 GLN A O   1 
ATOM   1246 C CB  . GLN A 1 165 ? 74.845 52.647 39.051 1.00 9.14   ? 188 GLN A CB  1 
ATOM   1247 C CG  . GLN A 1 165 ? 75.969 51.632 39.264 1.00 23.24  ? 188 GLN A CG  1 
ATOM   1248 C CD  . GLN A 1 165 ? 77.380 52.165 39.054 1.00 21.71  ? 188 GLN A CD  1 
ATOM   1249 O OE1 . GLN A 1 165 ? 77.590 53.340 38.742 1.00 26.71  ? 188 GLN A OE1 1 
ATOM   1250 N NE2 . GLN A 1 165 ? 78.360 51.283 39.220 1.00 34.07  ? 188 GLN A NE2 1 
ATOM   1251 N N   . ALA A 1 166 A 71.254 52.394 39.775 1.00 13.53  ? 188 ALA A N   1 
ATOM   1252 C CA  . ALA A 1 166 A 70.082 53.187 40.072 1.00 14.00  ? 188 ALA A CA  1 
ATOM   1253 C C   . ALA A 1 166 A 69.348 52.559 41.260 1.00 16.44  ? 188 ALA A C   1 
ATOM   1254 O O   . ALA A 1 166 A 69.550 51.375 41.587 1.00 16.62  ? 188 ALA A O   1 
ATOM   1255 C CB  . ALA A 1 166 A 69.180 53.242 38.853 1.00 15.89  ? 188 ALA A CB  1 
ATOM   1256 N N   . GLY A 1 167 ? 68.534 53.377 41.924 1.00 15.28  ? 189 GLY A N   1 
ATOM   1257 C CA  . GLY A 1 167 ? 67.774 52.935 43.077 1.00 13.09  ? 189 GLY A CA  1 
ATOM   1258 C C   . GLY A 1 167 ? 67.368 54.123 43.925 1.00 12.50  ? 189 GLY A C   1 
ATOM   1259 O O   . GLY A 1 167 ? 67.616 55.262 43.533 1.00 14.05  ? 189 GLY A O   1 
ATOM   1260 N N   . VAL A 1 168 ? 66.691 53.874 45.045 1.00 12.86  ? 190 VAL A N   1 
ATOM   1261 C CA  . VAL A 1 168 ? 66.275 54.957 45.934 1.00 9.68   ? 190 VAL A CA  1 
ATOM   1262 C C   . VAL A 1 168 ? 67.492 55.477 46.699 1.00 8.08   ? 190 VAL A C   1 
ATOM   1263 O O   . VAL A 1 168 ? 68.476 54.754 46.927 1.00 2.27   ? 190 VAL A O   1 
ATOM   1264 C CB  . VAL A 1 168 ? 65.140 54.547 46.937 1.00 2.00   ? 190 VAL A CB  1 
ATOM   1265 C CG1 . VAL A 1 168 ? 63.947 53.996 46.184 1.00 2.00   ? 190 VAL A CG1 1 
ATOM   1266 C CG2 . VAL A 1 168 ? 65.650 53.564 47.983 1.00 2.00   ? 190 VAL A CG2 1 
ATOM   1267 N N   . CYS A 1 169 ? 67.419 56.748 47.060 1.00 5.08   ? 191 CYS A N   1 
ATOM   1268 C CA  . CYS A 1 169 ? 68.483 57.405 47.775 1.00 4.55   ? 191 CYS A CA  1 
ATOM   1269 C C   . CYS A 1 169 ? 67.858 58.220 48.897 1.00 2.19   ? 191 CYS A C   1 
ATOM   1270 O O   . CYS A 1 169 ? 66.648 58.197 49.086 1.00 3.54   ? 191 CYS A O   1 
ATOM   1271 C CB  . CYS A 1 169 ? 69.264 58.292 46.819 1.00 3.19   ? 191 CYS A CB  1 
ATOM   1272 S SG  . CYS A 1 169 ? 70.874 58.823 47.454 1.00 11.59  ? 191 CYS A SG  1 
ATOM   1273 N N   . PHE A 1 170 ? 68.673 58.947 49.637 1.00 2.00   ? 192 PHE A N   1 
ATOM   1274 C CA  . PHE A 1 170 ? 68.179 59.725 50.759 1.00 2.00   ? 192 PHE A CA  1 
ATOM   1275 C C   . PHE A 1 170 ? 67.061 60.690 50.419 1.00 2.17   ? 192 PHE A C   1 
ATOM   1276 O O   . PHE A 1 170 ? 67.183 61.485 49.497 1.00 4.37   ? 192 PHE A O   1 
ATOM   1277 C CB  . PHE A 1 170 ? 69.345 60.441 51.421 1.00 2.00   ? 192 PHE A CB  1 
ATOM   1278 C CG  . PHE A 1 170 ? 70.441 59.509 51.821 1.00 3.55   ? 192 PHE A CG  1 
ATOM   1279 C CD1 . PHE A 1 170 ? 70.307 58.714 52.950 1.00 13.69  ? 192 PHE A CD1 1 
ATOM   1280 C CD2 . PHE A 1 170 ? 71.562 59.360 51.032 1.00 2.00   ? 192 PHE A CD2 1 
ATOM   1281 C CE1 . PHE A 1 170 ? 71.276 57.775 53.285 1.00 17.93  ? 192 PHE A CE1 1 
ATOM   1282 C CE2 . PHE A 1 170 ? 72.526 58.431 51.353 1.00 9.98   ? 192 PHE A CE2 1 
ATOM   1283 C CZ  . PHE A 1 170 ? 72.389 57.630 52.486 1.00 11.73  ? 192 PHE A CZ  1 
ATOM   1284 N N   . GLY A 1 171 ? 65.965 60.594 51.166 1.00 2.00   ? 193 GLY A N   1 
ATOM   1285 C CA  . GLY A 1 171 ? 64.824 61.465 50.949 1.00 2.00   ? 193 GLY A CA  1 
ATOM   1286 C C   . GLY A 1 171 ? 63.671 60.712 50.330 1.00 3.58   ? 193 GLY A C   1 
ATOM   1287 O O   . GLY A 1 171 ? 62.604 61.282 50.115 1.00 6.18   ? 193 GLY A O   1 
ATOM   1288 N N   . ASP A 1 172 ? 63.902 59.445 49.993 1.00 6.30   ? 194 ASP A N   1 
ATOM   1289 C CA  . ASP A 1 172 ? 62.871 58.588 49.416 1.00 3.98   ? 194 ASP A CA  1 
ATOM   1290 C C   . ASP A 1 172 ? 62.215 57.734 50.468 1.00 4.84   ? 194 ASP A C   1 
ATOM   1291 O O   . ASP A 1 172 ? 61.208 57.092 50.196 1.00 10.07  ? 194 ASP A O   1 
ATOM   1292 C CB  . ASP A 1 172 ? 63.451 57.674 48.346 1.00 8.55   ? 194 ASP A CB  1 
ATOM   1293 C CG  . ASP A 1 172 ? 63.816 58.421 47.092 1.00 12.10  ? 194 ASP A CG  1 
ATOM   1294 O OD1 . ASP A 1 172 ? 63.198 59.468 46.836 1.00 10.73  ? 194 ASP A OD1 1 
ATOM   1295 O OD2 . ASP A 1 172 ? 64.711 57.962 46.358 1.00 19.42  ? 194 ASP A OD2 1 
ATOM   1296 N N   . SER A 1 173 ? 62.772 57.752 51.675 1.00 4.10   ? 195 SER A N   1 
ATOM   1297 C CA  . SER A 1 173 ? 62.260 56.977 52.794 1.00 2.00   ? 195 SER A CA  1 
ATOM   1298 C C   . SER A 1 173 ? 60.816 57.355 53.001 1.00 3.49   ? 195 SER A C   1 
ATOM   1299 O O   . SER A 1 173 ? 60.466 58.541 52.954 1.00 2.00   ? 195 SER A O   1 
ATOM   1300 C CB  . SER A 1 173 ? 63.039 57.296 54.049 1.00 2.00   ? 195 SER A CB  1 
ATOM   1301 O OG  . SER A 1 173 ? 64.445 57.038 53.802 1.00 17.41  ? 195 SER A OG  1 
ATOM   1302 N N   . GLY A 1 174 ? 59.975 56.347 53.183 1.00 2.00   ? 196 GLY A N   1 
ATOM   1303 C CA  . GLY A 1 174 ? 58.573 56.602 53.388 1.00 2.00   ? 196 GLY A CA  1 
ATOM   1304 C C   . GLY A 1 174 ? 57.864 56.438 52.072 1.00 4.20   ? 196 GLY A C   1 
ATOM   1305 O O   . GLY A 1 174 ? 56.701 56.035 52.054 1.00 7.74   ? 196 GLY A O   1 
ATOM   1306 N N   . SER A 1 175 ? 58.554 56.708 50.965 1.00 2.00   ? 197 SER A N   1 
ATOM   1307 C CA  . SER A 1 175 ? 57.938 56.580 49.660 1.00 2.00   ? 197 SER A CA  1 
ATOM   1308 C C   . SER A 1 175 ? 57.410 55.190 49.390 1.00 2.67   ? 197 SER A C   1 
ATOM   1309 O O   . SER A 1 175 ? 57.968 54.215 49.873 1.00 7.20   ? 197 SER A O   1 
ATOM   1310 C CB  . SER A 1 175 ? 58.893 57.014 48.593 1.00 2.00   ? 197 SER A CB  1 
ATOM   1311 O OG  . SER A 1 175 ? 59.085 58.401 48.740 1.00 8.04   ? 197 SER A OG  1 
ATOM   1312 N N   . PRO A 1 176 ? 56.312 55.080 48.627 1.00 2.27   ? 198 PRO A N   1 
ATOM   1313 C CA  . PRO A 1 176 ? 55.716 53.787 48.315 1.00 5.30   ? 198 PRO A CA  1 
ATOM   1314 C C   . PRO A 1 176 ? 56.414 52.943 47.257 1.00 8.67   ? 198 PRO A C   1 
ATOM   1315 O O   . PRO A 1 176 ? 57.273 53.427 46.519 1.00 11.33  ? 198 PRO A O   1 
ATOM   1316 C CB  . PRO A 1 176 ? 54.340 54.189 47.826 1.00 2.00   ? 198 PRO A CB  1 
ATOM   1317 C CG  . PRO A 1 176 ? 54.618 55.441 47.111 1.00 2.00   ? 198 PRO A CG  1 
ATOM   1318 C CD  . PRO A 1 176 ? 55.500 56.164 48.055 1.00 2.00   ? 198 PRO A CD  1 
ATOM   1319 N N   . LEU A 1 177 ? 56.056 51.663 47.229 1.00 9.13   ? 199 LEU A N   1 
ATOM   1320 C CA  . LEU A 1 177 ? 56.552 50.728 46.228 1.00 8.22   ? 199 LEU A CA  1 
ATOM   1321 C C   . LEU A 1 177 ? 55.275 50.133 45.681 1.00 9.36   ? 199 LEU A C   1 
ATOM   1322 O O   . LEU A 1 177 ? 54.601 49.358 46.381 1.00 6.63   ? 199 LEU A O   1 
ATOM   1323 C CB  . LEU A 1 177 ? 57.382 49.601 46.825 1.00 9.65   ? 199 LEU A CB  1 
ATOM   1324 C CG  . LEU A 1 177 ? 57.811 48.638 45.716 1.00 3.70   ? 199 LEU A CG  1 
ATOM   1325 C CD1 . LEU A 1 177 ? 58.571 49.419 44.628 1.00 2.00   ? 199 LEU A CD1 1 
ATOM   1326 C CD2 . LEU A 1 177 ? 58.625 47.490 46.270 1.00 2.00   ? 199 LEU A CD2 1 
ATOM   1327 N N   . VAL A 1 178 ? 54.912 50.534 44.466 1.00 7.86   ? 200 VAL A N   1 
ATOM   1328 C CA  . VAL A 1 178 ? 53.697 50.031 43.851 1.00 9.80   ? 200 VAL A CA  1 
ATOM   1329 C C   . VAL A 1 178 ? 53.990 48.892 42.875 1.00 11.23  ? 200 VAL A C   1 
ATOM   1330 O O   . VAL A 1 178 ? 54.677 49.068 41.877 1.00 13.72  ? 200 VAL A O   1 
ATOM   1331 C CB  . VAL A 1 178 ? 52.871 51.180 43.200 1.00 7.79   ? 200 VAL A CB  1 
ATOM   1332 C CG1 . VAL A 1 178 ? 53.768 52.080 42.404 1.00 15.49  ? 200 VAL A CG1 1 
ATOM   1333 C CG2 . VAL A 1 178 ? 51.739 50.632 42.336 1.00 2.00   ? 200 VAL A CG2 1 
ATOM   1334 N N   . CYS A 1 179 ? 53.550 47.700 43.244 1.00 12.75  ? 201 CYS A N   1 
ATOM   1335 C CA  . CYS A 1 179 ? 53.720 46.510 42.436 1.00 13.67  ? 201 CYS A CA  1 
ATOM   1336 C C   . CYS A 1 179 ? 52.319 46.059 42.104 1.00 13.51  ? 201 CYS A C   1 
ATOM   1337 O O   . CYS A 1 179 ? 51.523 45.812 43.013 1.00 16.58  ? 201 CYS A O   1 
ATOM   1338 C CB  . CYS A 1 179 ? 54.353 45.383 43.243 1.00 17.51  ? 201 CYS A CB  1 
ATOM   1339 S SG  . CYS A 1 179 ? 55.946 45.732 44.022 1.00 21.01  ? 201 CYS A SG  1 
ATOM   1340 N N   . ASN A 1 180 ? 52.032 45.909 40.818 1.00 13.77  ? 204 ASN A N   1 
ATOM   1341 C CA  . ASN A 1 180 ? 50.718 45.467 40.355 1.00 14.01  ? 204 ASN A CA  1 
ATOM   1342 C C   . ASN A 1 180 ? 49.644 46.406 40.878 1.00 12.54  ? 204 ASN A C   1 
ATOM   1343 O O   . ASN A 1 180 ? 48.587 45.979 41.315 1.00 14.19  ? 204 ASN A O   1 
ATOM   1344 C CB  . ASN A 1 180 ? 50.439 44.026 40.808 1.00 18.69  ? 204 ASN A CB  1 
ATOM   1345 C CG  . ASN A 1 180 ? 51.479 43.028 40.294 1.00 35.79  ? 204 ASN A CG  1 
ATOM   1346 O OD1 . ASN A 1 180 ? 51.848 43.053 39.122 1.00 47.76  ? 204 ASN A OD1 1 
ATOM   1347 N ND2 . ASN A 1 180 ? 51.948 42.142 41.173 1.00 39.64  ? 204 ASN A ND2 1 
ATOM   1348 N N   . GLY A 1 181 ? 49.961 47.691 40.905 1.00 13.43  ? 205 GLY A N   1 
ATOM   1349 C CA  . GLY A 1 181 ? 49.004 48.675 41.367 1.00 15.06  ? 205 GLY A CA  1 
ATOM   1350 C C   . GLY A 1 181 ? 48.644 48.610 42.834 1.00 16.03  ? 205 GLY A C   1 
ATOM   1351 O O   . GLY A 1 181 ? 47.614 49.151 43.238 1.00 21.44  ? 205 GLY A O   1 
ATOM   1352 N N   . LEU A 1 182 ? 49.490 47.979 43.641 1.00 12.53  ? 208 LEU A N   1 
ATOM   1353 C CA  . LEU A 1 182 ? 49.231 47.889 45.064 1.00 8.01   ? 208 LEU A CA  1 
ATOM   1354 C C   . LEU A 1 182 ? 50.482 48.295 45.806 1.00 8.35   ? 208 LEU A C   1 
ATOM   1355 O O   . LEU A 1 182 ? 51.580 47.937 45.396 1.00 11.54  ? 208 LEU A O   1 
ATOM   1356 C CB  . LEU A 1 182 ? 48.871 46.461 45.435 1.00 9.63   ? 208 LEU A CB  1 
ATOM   1357 C CG  . LEU A 1 182 ? 47.559 45.874 44.916 1.00 7.64   ? 208 LEU A CG  1 
ATOM   1358 C CD1 . LEU A 1 182 ? 47.311 44.557 45.633 1.00 11.71  ? 208 LEU A CD1 1 
ATOM   1359 C CD2 . LEU A 1 182 ? 46.405 46.820 45.181 1.00 2.00   ? 208 LEU A CD2 1 
ATOM   1360 N N   . ILE A 1 183 ? 50.336 49.028 46.902 1.00 7.45   ? 209 ILE A N   1 
ATOM   1361 C CA  . ILE A 1 183 ? 51.504 49.437 47.683 1.00 9.24   ? 209 ILE A CA  1 
ATOM   1362 C C   . ILE A 1 183 ? 52.089 48.258 48.484 1.00 10.24  ? 209 ILE A C   1 
ATOM   1363 O O   . ILE A 1 183 ? 51.565 47.875 49.537 1.00 7.93   ? 209 ILE A O   1 
ATOM   1364 C CB  . ILE A 1 183 ? 51.190 50.618 48.625 1.00 2.00   ? 209 ILE A CB  1 
ATOM   1365 C CG1 . ILE A 1 183 ? 50.954 51.884 47.814 1.00 2.03   ? 209 ILE A CG1 1 
ATOM   1366 C CG2 . ILE A 1 183 ? 52.379 50.890 49.533 1.00 2.00   ? 209 ILE A CG2 1 
ATOM   1367 C CD1 . ILE A 1 183 ? 49.736 51.871 47.017 1.00 5.92   ? 209 ILE A CD1 1 
ATOM   1368 N N   . HIS A 1 184 ? 53.168 47.680 47.961 1.00 8.85   ? 210 HIS A N   1 
ATOM   1369 C CA  . HIS A 1 184 ? 53.828 46.541 48.596 1.00 10.19  ? 210 HIS A CA  1 
ATOM   1370 C C   . HIS A 1 184 ? 55.084 46.873 49.410 1.00 8.45   ? 210 HIS A C   1 
ATOM   1371 O O   . HIS A 1 184 ? 55.656 45.987 50.041 1.00 10.37  ? 210 HIS A O   1 
ATOM   1372 C CB  . HIS A 1 184 ? 54.172 45.480 47.540 1.00 17.49  ? 210 HIS A CB  1 
ATOM   1373 C CG  . HIS A 1 184 ? 53.076 44.491 47.287 1.00 24.84  ? 210 HIS A CG  1 
ATOM   1374 N ND1 . HIS A 1 184 ? 53.010 43.272 47.932 1.00 24.44  ? 210 HIS A ND1 1 
ATOM   1375 C CD2 . HIS A 1 184 ? 52.012 44.530 46.447 1.00 22.55  ? 210 HIS A CD2 1 
ATOM   1376 C CE1 . HIS A 1 184 ? 51.956 42.602 47.500 1.00 17.56  ? 210 HIS A CE1 1 
ATOM   1377 N NE2 . HIS A 1 184 ? 51.334 43.344 46.600 1.00 26.36  ? 210 HIS A NE2 1 
ATOM   1378 N N   . GLY A 1 185 ? 55.515 48.129 49.390 1.00 8.04   ? 211 GLY A N   1 
ATOM   1379 C CA  . GLY A 1 185 ? 56.690 48.518 50.148 1.00 2.53   ? 211 GLY A CA  1 
ATOM   1380 C C   . GLY A 1 185 ? 56.692 49.976 50.596 1.00 3.00   ? 211 GLY A C   1 
ATOM   1381 O O   . GLY A 1 185 ? 55.975 50.826 50.060 1.00 2.00   ? 211 GLY A O   1 
ATOM   1382 N N   . ILE A 1 186 ? 57.450 50.248 51.647 1.00 5.24   ? 212 ILE A N   1 
ATOM   1383 C CA  . ILE A 1 186 ? 57.603 51.603 52.168 1.00 5.89   ? 212 ILE A CA  1 
ATOM   1384 C C   . ILE A 1 186 ? 59.113 51.790 52.235 1.00 7.67   ? 212 ILE A C   1 
ATOM   1385 O O   . ILE A 1 186 ? 59.781 51.112 53.023 1.00 9.22   ? 212 ILE A O   1 
ATOM   1386 C CB  . ILE A 1 186 ? 57.007 51.756 53.567 1.00 2.00   ? 212 ILE A CB  1 
ATOM   1387 C CG1 . ILE A 1 186 ? 55.497 51.579 53.510 1.00 5.97   ? 212 ILE A CG1 1 
ATOM   1388 C CG2 . ILE A 1 186 ? 57.310 53.129 54.107 1.00 7.95   ? 212 ILE A CG2 1 
ATOM   1389 C CD1 . ILE A 1 186 ? 54.832 51.735 54.827 1.00 2.37   ? 212 ILE A CD1 1 
ATOM   1390 N N   . ALA A 1 187 ? 59.650 52.612 51.333 1.00 5.71   ? 213 ALA A N   1 
ATOM   1391 C CA  . ALA A 1 187 ? 61.084 52.872 51.246 1.00 6.27   ? 213 ALA A CA  1 
ATOM   1392 C C   . ALA A 1 187 ? 61.683 53.047 52.640 1.00 7.85   ? 213 ALA A C   1 
ATOM   1393 O O   . ALA A 1 187 ? 61.270 53.945 53.392 1.00 4.78   ? 213 ALA A O   1 
ATOM   1394 C CB  . ALA A 1 187 ? 61.348 54.082 50.376 1.00 4.93   ? 213 ALA A CB  1 
ATOM   1395 N N   . SER A 1 188 ? 62.687 52.214 52.938 1.00 5.55   ? 214 SER A N   1 
ATOM   1396 C CA  . SER A 1 188 ? 63.334 52.160 54.238 1.00 2.00   ? 214 SER A CA  1 
ATOM   1397 C C   . SER A 1 188 ? 64.843 52.442 54.308 1.00 2.75   ? 214 SER A C   1 
ATOM   1398 O O   . SER A 1 188 ? 65.240 53.464 54.869 1.00 5.24   ? 214 SER A O   1 
ATOM   1399 C CB  . SER A 1 188 ? 63.002 50.802 54.857 1.00 2.00   ? 214 SER A CB  1 
ATOM   1400 O OG  . SER A 1 188 ? 63.642 50.593 56.085 1.00 3.55   ? 214 SER A OG  1 
ATOM   1401 N N   . PHE A 1 189 ? 65.682 51.538 53.798 1.00 4.96   ? 215 PHE A N   1 
ATOM   1402 C CA  . PHE A 1 189 ? 67.143 51.716 53.851 1.00 3.22   ? 215 PHE A CA  1 
ATOM   1403 C C   . PHE A 1 189 ? 67.908 51.133 52.653 1.00 6.33   ? 215 PHE A C   1 
ATOM   1404 O O   . PHE A 1 189 ? 67.461 50.184 52.014 1.00 9.55   ? 215 PHE A O   1 
ATOM   1405 C CB  . PHE A 1 189 ? 67.705 51.103 55.130 1.00 2.00   ? 215 PHE A CB  1 
ATOM   1406 C CG  . PHE A 1 189 ? 67.598 49.610 55.187 1.00 2.00   ? 215 PHE A CG  1 
ATOM   1407 C CD1 . PHE A 1 189 ? 66.472 49.001 55.722 1.00 2.00   ? 215 PHE A CD1 1 
ATOM   1408 C CD2 . PHE A 1 189 ? 68.638 48.810 54.733 1.00 2.00   ? 215 PHE A CD2 1 
ATOM   1409 C CE1 . PHE A 1 189 ? 66.390 47.600 55.812 1.00 6.57   ? 215 PHE A CE1 1 
ATOM   1410 C CE2 . PHE A 1 189 ? 68.568 47.415 54.816 1.00 2.00   ? 215 PHE A CE2 1 
ATOM   1411 C CZ  . PHE A 1 189 ? 67.446 46.806 55.355 1.00 2.00   ? 215 PHE A CZ  1 
ATOM   1412 N N   . VAL A 1 190 ? 69.066 51.715 52.351 1.00 8.15   ? 216 VAL A N   1 
ATOM   1413 C CA  . VAL A 1 190 ? 69.906 51.256 51.248 1.00 7.02   ? 216 VAL A CA  1 
ATOM   1414 C C   . VAL A 1 190 ? 71.234 50.739 51.779 1.00 10.33  ? 216 VAL A C   1 
ATOM   1415 O O   . VAL A 1 190 ? 71.646 51.054 52.899 1.00 16.38  ? 216 VAL A O   1 
ATOM   1416 C CB  . VAL A 1 190 ? 70.166 52.341 50.201 1.00 2.00   ? 216 VAL A CB  1 
ATOM   1417 C CG1 . VAL A 1 190 ? 68.864 52.755 49.565 1.00 10.64  ? 216 VAL A CG1 1 
ATOM   1418 C CG2 . VAL A 1 190 ? 70.880 53.527 50.817 1.00 2.00   ? 216 VAL A CG2 1 
ATOM   1419 N N   . ARG A 1 191 ? 71.918 49.975 50.949 1.00 7.88   ? 217 ARG A N   1 
ATOM   1420 C CA  . ARG A 1 191 ? 73.166 49.365 51.322 1.00 5.16   ? 217 ARG A CA  1 
ATOM   1421 C C   . ARG A 1 191 ? 74.206 49.530 50.201 1.00 9.99   ? 217 ARG A C   1 
ATOM   1422 O O   . ARG A 1 191 ? 73.902 49.375 49.009 1.00 11.48  ? 217 ARG A O   1 
ATOM   1423 C CB  . ARG A 1 191 ? 72.883 47.910 51.623 1.00 2.00   ? 217 ARG A CB  1 
ATOM   1424 C CG  . ARG A 1 191 ? 74.077 47.088 51.902 1.00 2.00   ? 217 ARG A CG  1 
ATOM   1425 C CD  . ARG A 1 191 ? 73.653 45.677 52.149 1.00 2.00   ? 217 ARG A CD  1 
ATOM   1426 N NE  . ARG A 1 191 ? 74.812 44.865 52.464 1.00 25.22  ? 217 ARG A NE  1 
ATOM   1427 C CZ  . ARG A 1 191 ? 74.806 43.545 52.546 1.00 21.94  ? 217 ARG A CZ  1 
ATOM   1428 N NH1 . ARG A 1 191 ? 73.683 42.874 52.348 1.00 37.72  ? 217 ARG A NH1 1 
ATOM   1429 N NH2 . ARG A 1 191 ? 75.942 42.902 52.756 1.00 17.18  ? 217 ARG A NH2 1 
ATOM   1430 N N   . GLY A 1 192 ? 75.444 49.783 50.612 1.00 9.28   ? 218 GLY A N   1 
ATOM   1431 C CA  . GLY A 1 192 ? 76.526 50.033 49.688 1.00 7.50   ? 218 GLY A CA  1 
ATOM   1432 C C   . GLY A 1 192 ? 76.381 51.445 49.161 1.00 4.50   ? 218 GLY A C   1 
ATOM   1433 O O   . GLY A 1 192 ? 77.010 51.811 48.165 1.00 11.26  ? 218 GLY A O   1 
ATOM   1434 N N   . GLY A 1 193 ? 75.611 52.260 49.874 1.00 2.39   ? 219 GLY A N   1 
ATOM   1435 C CA  . GLY A 1 193 ? 75.374 53.628 49.446 1.00 2.00   ? 219 GLY A CA  1 
ATOM   1436 C C   . GLY A 1 193 ? 74.244 53.591 48.438 1.00 3.95   ? 219 GLY A C   1 
ATOM   1437 O O   . GLY A 1 193 ? 73.861 52.508 47.967 1.00 5.49   ? 219 GLY A O   1 
ATOM   1438 N N   . CYS A 1 194 ? 73.661 54.740 48.128 1.00 3.77   ? 220 CYS A N   1 
ATOM   1439 C CA  . CYS A 1 194 ? 72.582 54.736 47.148 1.00 5.85   ? 220 CYS A CA  1 
ATOM   1440 C C   . CYS A 1 194 ? 73.147 54.227 45.832 1.00 7.58   ? 220 CYS A C   1 
ATOM   1441 O O   . CYS A 1 194 ? 74.312 54.519 45.497 1.00 9.38   ? 220 CYS A O   1 
ATOM   1442 C CB  . CYS A 1 194 ? 72.058 56.148 46.872 1.00 2.00   ? 220 CYS A CB  1 
ATOM   1443 S SG  . CYS A 1 194 ? 71.619 57.145 48.300 1.00 4.28   ? 220 CYS A SG  1 
ATOM   1444 N N   . ALA A 1 195 ? 72.326 53.469 45.105 1.00 6.72   ? 221 ALA A N   1 
ATOM   1445 C CA  . ALA A 1 195 ? 72.673 52.963 43.778 1.00 7.90   ? 221 ALA A CA  1 
ATOM   1446 C C   . ALA A 1 195 ? 74.006 52.204 43.643 1.00 9.64   ? 221 ALA A C   1 
ATOM   1447 O O   . ALA A 1 195 ? 74.714 52.368 42.648 1.00 10.95  ? 221 ALA A O   1 
ATOM   1448 C CB  . ALA A 1 195 ? 72.636 54.128 42.797 1.00 2.00   ? 221 ALA A CB  1 
ATOM   1449 N N   . SER A 1 196 ? 74.324 51.352 44.611 1.00 8.27   ? 222 SER A N   1 
ATOM   1450 C CA  . SER A 1 196 ? 75.568 50.601 44.582 1.00 11.13  ? 222 SER A CA  1 
ATOM   1451 C C   . SER A 1 196 ? 75.739 49.754 43.332 1.00 13.45  ? 222 SER A C   1 
ATOM   1452 O O   . SER A 1 196 ? 76.863 49.503 42.876 1.00 16.74  ? 222 SER A O   1 
ATOM   1453 C CB  . SER A 1 196 ? 75.660 49.683 45.801 1.00 13.13  ? 222 SER A CB  1 
ATOM   1454 O OG  . SER A 1 196 ? 74.675 48.669 45.749 1.00 13.26  ? 222 SER A OG  1 
ATOM   1455 N N   . GLY A 1 197 A 74.616 49.303 42.790 1.00 15.26  ? 222 GLY A N   1 
ATOM   1456 C CA  . GLY A 1 197 A 74.645 48.437 41.632 1.00 14.55  ? 222 GLY A CA  1 
ATOM   1457 C C   . GLY A 1 197 A 74.846 47.010 42.124 1.00 17.29  ? 222 GLY A C   1 
ATOM   1458 O O   . GLY A 1 197 A 74.707 46.054 41.356 1.00 18.66  ? 222 GLY A O   1 
ATOM   1459 N N   . LEU A 1 198 ? 75.139 46.854 43.415 1.00 16.73  ? 223 LEU A N   1 
ATOM   1460 C CA  . LEU A 1 198 ? 75.359 45.533 43.975 1.00 18.09  ? 223 LEU A CA  1 
ATOM   1461 C C   . LEU A 1 198 ? 74.350 45.109 45.013 1.00 18.13  ? 223 LEU A C   1 
ATOM   1462 O O   . LEU A 1 198 ? 74.018 43.929 45.083 1.00 25.81  ? 223 LEU A O   1 
ATOM   1463 C CB  . LEU A 1 198 ? 76.758 45.412 44.583 1.00 22.21  ? 223 LEU A CB  1 
ATOM   1464 C CG  . LEU A 1 198 ? 77.956 45.510 43.643 1.00 19.84  ? 223 LEU A CG  1 
ATOM   1465 C CD1 . LEU A 1 198 ? 78.664 46.850 43.844 1.00 19.50  ? 223 LEU A CD1 1 
ATOM   1466 C CD2 . LEU A 1 198 ? 78.902 44.370 43.934 1.00 24.16  ? 223 LEU A CD2 1 
ATOM   1467 N N   . TYR A 1 199 ? 73.885 46.047 45.835 1.00 15.68  ? 224 TYR A N   1 
ATOM   1468 C CA  . TYR A 1 199 ? 72.928 45.737 46.902 1.00 11.65  ? 224 TYR A CA  1 
ATOM   1469 C C   . TYR A 1 199 ? 71.504 46.245 46.677 1.00 12.96  ? 224 TYR A C   1 
ATOM   1470 O O   . TYR A 1 199 ? 71.288 47.363 46.179 1.00 14.90  ? 224 TYR A O   1 
ATOM   1471 C CB  . TYR A 1 199 ? 73.450 46.267 48.223 1.00 4.58   ? 224 TYR A CB  1 
ATOM   1472 C CG  . TYR A 1 199 ? 74.835 45.792 48.507 1.00 6.48   ? 224 TYR A CG  1 
ATOM   1473 C CD1 . TYR A 1 199 ? 75.080 44.458 48.827 1.00 5.49   ? 224 TYR A CD1 1 
ATOM   1474 C CD2 . TYR A 1 199 ? 75.915 46.673 48.444 1.00 9.98   ? 224 TYR A CD2 1 
ATOM   1475 C CE1 . TYR A 1 199 ? 76.387 44.003 49.087 1.00 16.50  ? 224 TYR A CE1 1 
ATOM   1476 C CE2 . TYR A 1 199 ? 77.220 46.235 48.692 1.00 20.30  ? 224 TYR A CE2 1 
ATOM   1477 C CZ  . TYR A 1 199 ? 77.451 44.899 49.015 1.00 21.47  ? 224 TYR A CZ  1 
ATOM   1478 O OH  . TYR A 1 199 ? 78.745 44.477 49.255 1.00 22.44  ? 224 TYR A OH  1 
ATOM   1479 N N   . PRO A 1 200 ? 70.509 45.434 47.070 1.00 9.53   ? 225 PRO A N   1 
ATOM   1480 C CA  . PRO A 1 200 ? 69.091 45.757 46.931 1.00 8.56   ? 225 PRO A CA  1 
ATOM   1481 C C   . PRO A 1 200 ? 68.681 46.821 47.952 1.00 10.32  ? 225 PRO A C   1 
ATOM   1482 O O   . PRO A 1 200 ? 69.296 46.947 49.021 1.00 12.12  ? 225 PRO A O   1 
ATOM   1483 C CB  . PRO A 1 200 ? 68.402 44.429 47.275 1.00 10.38  ? 225 PRO A CB  1 
ATOM   1484 C CG  . PRO A 1 200 ? 69.480 43.386 47.217 1.00 7.54   ? 225 PRO A CG  1 
ATOM   1485 C CD  . PRO A 1 200 ? 70.673 44.129 47.724 1.00 2.71   ? 225 PRO A CD  1 
ATOM   1486 N N   . ASP A 1 201 ? 67.691 47.632 47.611 1.00 7.53   ? 226 ASP A N   1 
ATOM   1487 C CA  . ASP A 1 201 ? 67.210 48.618 48.557 1.00 5.84   ? 226 ASP A CA  1 
ATOM   1488 C C   . ASP A 1 201 ? 66.149 47.845 49.273 1.00 9.04   ? 226 ASP A C   1 
ATOM   1489 O O   . ASP A 1 201 ? 65.542 46.950 48.689 1.00 12.28  ? 226 ASP A O   1 
ATOM   1490 C CB  . ASP A 1 201 ? 66.561 49.780 47.853 1.00 2.00   ? 226 ASP A CB  1 
ATOM   1491 C CG  . ASP A 1 201 ? 67.446 50.392 46.814 1.00 8.65   ? 226 ASP A CG  1 
ATOM   1492 O OD1 . ASP A 1 201 ? 68.658 50.060 46.757 1.00 8.16   ? 226 ASP A OD1 1 
ATOM   1493 O OD2 . ASP A 1 201 ? 66.912 51.210 46.042 1.00 2.00   ? 226 ASP A OD2 1 
ATOM   1494 N N   . ALA A 1 202 ? 65.882 48.197 50.519 1.00 10.80  ? 227 ALA A N   1 
ATOM   1495 C CA  . ALA A 1 202 ? 64.888 47.457 51.270 1.00 7.50   ? 227 ALA A CA  1 
ATOM   1496 C C   . ALA A 1 202 ? 63.673 48.285 51.585 1.00 5.72   ? 227 ALA A C   1 
ATOM   1497 O O   . ALA A 1 202 ? 63.787 49.454 51.950 1.00 3.33   ? 227 ALA A O   1 
ATOM   1498 C CB  . ALA A 1 202 ? 65.504 46.911 52.538 1.00 2.00   ? 227 ALA A CB  1 
ATOM   1499 N N   . PHE A 1 203 ? 62.506 47.682 51.407 1.00 6.99   ? 228 PHE A N   1 
ATOM   1500 C CA  . PHE A 1 203 ? 61.249 48.358 51.702 1.00 8.74   ? 228 PHE A CA  1 
ATOM   1501 C C   . PHE A 1 203 ? 60.581 47.612 52.864 1.00 7.35   ? 228 PHE A C   1 
ATOM   1502 O O   . PHE A 1 203 ? 60.946 46.462 53.162 1.00 4.43   ? 228 PHE A O   1 
ATOM   1503 C CB  . PHE A 1 203 ? 60.350 48.396 50.448 1.00 4.83   ? 228 PHE A CB  1 
ATOM   1504 C CG  . PHE A 1 203 ? 60.979 49.102 49.276 1.00 2.00   ? 228 PHE A CG  1 
ATOM   1505 C CD1 . PHE A 1 203 ? 62.094 48.564 48.637 1.00 5.45   ? 228 PHE A CD1 1 
ATOM   1506 C CD2 . PHE A 1 203 ? 60.494 50.332 48.840 1.00 2.52   ? 228 PHE A CD2 1 
ATOM   1507 C CE1 . PHE A 1 203 ? 62.720 49.250 47.581 1.00 4.00   ? 228 PHE A CE1 1 
ATOM   1508 C CE2 . PHE A 1 203 ? 61.116 51.029 47.781 1.00 2.65   ? 228 PHE A CE2 1 
ATOM   1509 C CZ  . PHE A 1 203 ? 62.226 50.489 47.157 1.00 2.00   ? 228 PHE A CZ  1 
ATOM   1510 N N   . ALA A 1 204 ? 59.707 48.306 53.593 1.00 7.05   ? 229 ALA A N   1 
ATOM   1511 C CA  . ALA A 1 204 ? 58.987 47.704 54.717 1.00 6.89   ? 229 ALA A CA  1 
ATOM   1512 C C   . ALA A 1 204 ? 57.893 46.950 54.009 1.00 8.76   ? 229 ALA A C   1 
ATOM   1513 O O   . ALA A 1 204 ? 57.283 47.480 53.083 1.00 12.90  ? 229 ALA A O   1 
ATOM   1514 C CB  . ALA A 1 204 ? 58.396 48.776 55.602 1.00 4.76   ? 229 ALA A CB  1 
ATOM   1515 N N   . PRO A 1 205 ? 57.663 45.687 54.379 1.00 10.86  ? 230 PRO A N   1 
ATOM   1516 C CA  . PRO A 1 205 ? 56.607 44.923 53.698 1.00 8.49   ? 230 PRO A CA  1 
ATOM   1517 C C   . PRO A 1 205 ? 55.174 45.253 54.159 1.00 9.29   ? 230 PRO A C   1 
ATOM   1518 O O   . PRO A 1 205 ? 54.674 44.658 55.126 1.00 6.97   ? 230 PRO A O   1 
ATOM   1519 C CB  . PRO A 1 205 ? 57.010 43.477 53.994 1.00 3.07   ? 230 PRO A CB  1 
ATOM   1520 C CG  . PRO A 1 205 ? 57.603 43.578 55.356 1.00 2.00   ? 230 PRO A CG  1 
ATOM   1521 C CD  . PRO A 1 205 ? 58.449 44.828 55.281 1.00 8.50   ? 230 PRO A CD  1 
ATOM   1522 N N   . VAL A 1 206 ? 54.513 46.182 53.456 1.00 6.49   ? 231 VAL A N   1 
ATOM   1523 C CA  . VAL A 1 206 ? 53.146 46.590 53.792 1.00 5.25   ? 231 VAL A CA  1 
ATOM   1524 C C   . VAL A 1 206 ? 52.234 45.394 53.991 1.00 10.19  ? 231 VAL A C   1 
ATOM   1525 O O   . VAL A 1 206 ? 51.500 45.328 54.970 1.00 15.02  ? 231 VAL A O   1 
ATOM   1526 C CB  . VAL A 1 206 ? 52.553 47.500 52.722 1.00 2.00   ? 231 VAL A CB  1 
ATOM   1527 C CG1 . VAL A 1 206 ? 51.092 47.714 52.946 1.00 2.00   ? 231 VAL A CG1 1 
ATOM   1528 C CG2 . VAL A 1 206 ? 53.238 48.823 52.755 1.00 2.04   ? 231 VAL A CG2 1 
ATOM   1529 N N   . ALA A 1 207 ? 52.335 44.415 53.101 1.00 12.75  ? 232 ALA A N   1 
ATOM   1530 C CA  . ALA A 1 207 ? 51.512 43.215 53.172 1.00 12.01  ? 232 ALA A CA  1 
ATOM   1531 C C   . ALA A 1 207 ? 51.509 42.538 54.535 1.00 11.96  ? 232 ALA A C   1 
ATOM   1532 O O   . ALA A 1 207 ? 50.464 42.113 54.993 1.00 16.34  ? 232 ALA A O   1 
ATOM   1533 C CB  . ALA A 1 207 ? 51.919 42.228 52.093 1.00 14.58  ? 232 ALA A CB  1 
ATOM   1534 N N   . GLN A 1 208 ? 52.658 42.446 55.195 1.00 14.10  ? 233 GLN A N   1 
ATOM   1535 C CA  . GLN A 1 208 ? 52.734 41.807 56.514 1.00 13.46  ? 233 GLN A CA  1 
ATOM   1536 C C   . GLN A 1 208 ? 52.036 42.639 57.609 1.00 11.35  ? 233 GLN A C   1 
ATOM   1537 O O   . GLN A 1 208 ? 51.901 42.176 58.732 1.00 13.54  ? 233 GLN A O   1 
ATOM   1538 C CB  . GLN A 1 208 ? 54.198 41.556 56.938 1.00 17.80  ? 233 GLN A CB  1 
ATOM   1539 C CG  . GLN A 1 208 ? 55.075 40.669 56.010 1.00 30.98  ? 233 GLN A CG  1 
ATOM   1540 C CD  . GLN A 1 208 ? 56.529 40.502 56.550 1.00 43.28  ? 233 GLN A CD  1 
ATOM   1541 O OE1 . GLN A 1 208 ? 56.764 40.606 57.761 1.00 51.07  ? 233 GLN A OE1 1 
ATOM   1542 N NE2 . GLN A 1 208 ? 57.493 40.246 55.652 1.00 25.61  ? 233 GLN A NE2 1 
ATOM   1543 N N   . PHE A 1 209 ? 51.598 43.855 57.290 1.00 10.53  ? 234 PHE A N   1 
ATOM   1544 C CA  . PHE A 1 209 ? 50.924 44.725 58.266 1.00 10.68  ? 234 PHE A CA  1 
ATOM   1545 C C   . PHE A 1 209 ? 49.513 45.157 57.882 1.00 13.37  ? 234 PHE A C   1 
ATOM   1546 O O   . PHE A 1 209 ? 48.953 46.048 58.524 1.00 15.59  ? 234 PHE A O   1 
ATOM   1547 C CB  . PHE A 1 209 ? 51.717 46.013 58.477 1.00 2.43   ? 234 PHE A CB  1 
ATOM   1548 C CG  . PHE A 1 209 ? 53.119 45.793 58.888 1.00 11.43  ? 234 PHE A CG  1 
ATOM   1549 C CD1 . PHE A 1 209 ? 53.422 45.410 60.177 1.00 16.26  ? 234 PHE A CD1 1 
ATOM   1550 C CD2 . PHE A 1 209 ? 54.145 45.937 57.971 1.00 20.80  ? 234 PHE A CD2 1 
ATOM   1551 C CE1 . PHE A 1 209 ? 54.727 45.176 60.544 1.00 20.57  ? 234 PHE A CE1 1 
ATOM   1552 C CE2 . PHE A 1 209 ? 55.454 45.704 58.331 1.00 16.57  ? 234 PHE A CE2 1 
ATOM   1553 C CZ  . PHE A 1 209 ? 55.747 45.320 59.615 1.00 12.37  ? 234 PHE A CZ  1 
ATOM   1554 N N   . VAL A 1 210 ? 48.941 44.565 56.840 1.00 14.70  ? 235 VAL A N   1 
ATOM   1555 C CA  . VAL A 1 210 ? 47.607 44.961 56.389 1.00 12.08  ? 235 VAL A CA  1 
ATOM   1556 C C   . VAL A 1 210 ? 46.529 44.900 57.484 1.00 9.20   ? 235 VAL A C   1 
ATOM   1557 O O   . VAL A 1 210 ? 45.753 45.838 57.629 1.00 7.33   ? 235 VAL A O   1 
ATOM   1558 C CB  . VAL A 1 210 ? 47.203 44.193 55.116 1.00 11.50  ? 235 VAL A CB  1 
ATOM   1559 C CG1 . VAL A 1 210 ? 45.931 44.765 54.523 1.00 7.46   ? 235 VAL A CG1 1 
ATOM   1560 C CG2 . VAL A 1 210 ? 48.318 44.291 54.103 1.00 7.18   ? 235 VAL A CG2 1 
ATOM   1561 N N   . ASN A 1 211 ? 46.549 43.868 58.322 1.00 7.86   ? 236 ASN A N   1 
ATOM   1562 C CA  . ASN A 1 211 ? 45.564 43.754 59.406 1.00 6.23   ? 236 ASN A CA  1 
ATOM   1563 C C   . ASN A 1 211 ? 45.636 44.923 60.371 1.00 7.96   ? 236 ASN A C   1 
ATOM   1564 O O   . ASN A 1 211 ? 44.616 45.508 60.736 1.00 12.07  ? 236 ASN A O   1 
ATOM   1565 C CB  . ASN A 1 211 ? 45.769 42.481 60.214 1.00 6.14   ? 236 ASN A CB  1 
ATOM   1566 C CG  . ASN A 1 211 ? 45.201 41.252 59.543 1.00 9.51   ? 236 ASN A CG  1 
ATOM   1567 O OD1 . ASN A 1 211 ? 45.419 40.146 60.021 1.00 21.69  ? 236 ASN A OD1 1 
ATOM   1568 N ND2 . ASN A 1 211 ? 44.504 41.425 58.418 1.00 12.19  ? 236 ASN A ND2 1 
ATOM   1569 N N   . TRP A 1 212 ? 46.841 45.218 60.837 1.00 7.08   ? 237 TRP A N   1 
ATOM   1570 C CA  . TRP A 1 212 ? 47.052 46.326 61.751 1.00 5.21   ? 237 TRP A CA  1 
ATOM   1571 C C   . TRP A 1 212 ? 46.622 47.631 61.093 1.00 4.69   ? 237 TRP A C   1 
ATOM   1572 O O   . TRP A 1 212 ? 45.861 48.395 61.665 1.00 4.16   ? 237 TRP A O   1 
ATOM   1573 C CB  . TRP A 1 212 ? 48.528 46.386 62.137 1.00 11.49  ? 237 TRP A CB  1 
ATOM   1574 C CG  . TRP A 1 212 ? 48.943 47.602 62.910 1.00 15.75  ? 237 TRP A CG  1 
ATOM   1575 C CD1 . TRP A 1 212 ? 48.540 47.960 64.158 1.00 2.00   ? 237 TRP A CD1 1 
ATOM   1576 C CD2 . TRP A 1 212 ? 49.874 48.610 62.480 1.00 17.52  ? 237 TRP A CD2 1 
ATOM   1577 N NE1 . TRP A 1 212 ? 49.162 49.123 64.536 1.00 2.00   ? 237 TRP A NE1 1 
ATOM   1578 C CE2 . TRP A 1 212 ? 49.985 49.540 63.528 1.00 14.21  ? 237 TRP A CE2 1 
ATOM   1579 C CE3 . TRP A 1 212 ? 50.615 48.813 61.311 1.00 16.39  ? 237 TRP A CE3 1 
ATOM   1580 C CZ2 . TRP A 1 212 ? 50.820 50.662 63.442 1.00 20.75  ? 237 TRP A CZ2 1 
ATOM   1581 C CZ3 . TRP A 1 212 ? 51.440 49.926 61.228 1.00 19.23  ? 237 TRP A CZ3 1 
ATOM   1582 C CH2 . TRP A 1 212 ? 51.534 50.836 62.286 1.00 19.71  ? 237 TRP A CH2 1 
ATOM   1583 N N   . ILE A 1 213 ? 47.068 47.866 59.866 1.00 8.41   ? 238 ILE A N   1 
ATOM   1584 C CA  . ILE A 1 213 ? 46.708 49.100 59.187 1.00 11.42  ? 238 ILE A CA  1 
ATOM   1585 C C   . ILE A 1 213 ? 45.210 49.279 59.146 1.00 12.42  ? 238 ILE A C   1 
ATOM   1586 O O   . ILE A 1 213 ? 44.716 50.377 59.385 1.00 16.55  ? 238 ILE A O   1 
ATOM   1587 C CB  . ILE A 1 213 ? 47.246 49.184 57.752 1.00 11.09  ? 238 ILE A CB  1 
ATOM   1588 C CG1 . ILE A 1 213 ? 48.777 49.148 57.758 1.00 9.78   ? 238 ILE A CG1 1 
ATOM   1589 C CG2 . ILE A 1 213 ? 46.777 50.484 57.104 1.00 11.01  ? 238 ILE A CG2 1 
ATOM   1590 C CD1 . ILE A 1 213 ? 49.387 49.361 56.386 1.00 5.52   ? 238 ILE A CD1 1 
ATOM   1591 N N   . ASP A 1 214 ? 44.485 48.199 58.885 1.00 11.20  ? 239 ASP A N   1 
ATOM   1592 C CA  . ASP A 1 214 ? 43.034 48.280 58.809 1.00 14.63  ? 239 ASP A CA  1 
ATOM   1593 C C   . ASP A 1 214 ? 42.346 48.557 60.150 1.00 14.98  ? 239 ASP A C   1 
ATOM   1594 O O   . ASP A 1 214 ? 41.456 49.399 60.233 1.00 15.26  ? 239 ASP A O   1 
ATOM   1595 C CB  . ASP A 1 214 ? 42.433 47.012 58.193 1.00 16.67  ? 239 ASP A CB  1 
ATOM   1596 C CG  . ASP A 1 214 ? 42.848 46.797 56.751 1.00 24.47  ? 239 ASP A CG  1 
ATOM   1597 O OD1 . ASP A 1 214 ? 42.937 47.784 55.978 1.00 21.10  ? 239 ASP A OD1 1 
ATOM   1598 O OD2 . ASP A 1 214 ? 43.082 45.620 56.395 1.00 33.14  ? 239 ASP A OD2 1 
ATOM   1599 N N   . SER A 1 215 ? 42.756 47.872 61.206 1.00 13.92  ? 240 SER A N   1 
ATOM   1600 C CA  . SER A 1 215 ? 42.112 48.074 62.491 1.00 14.90  ? 240 SER A CA  1 
ATOM   1601 C C   . SER A 1 215 ? 42.138 49.533 62.878 1.00 18.08  ? 240 SER A C   1 
ATOM   1602 O O   . SER A 1 215 ? 41.286 49.994 63.637 1.00 22.40  ? 240 SER A O   1 
ATOM   1603 C CB  . SER A 1 215 ? 42.816 47.270 63.559 1.00 12.05  ? 240 SER A CB  1 
ATOM   1604 O OG  . SER A 1 215 ? 44.144 47.710 63.693 1.00 19.97  ? 240 SER A OG  1 
ATOM   1605 N N   . ILE A 1 216 ? 43.141 50.242 62.365 1.00 19.90  ? 241 ILE A N   1 
ATOM   1606 C CA  . ILE A 1 216 ? 43.340 51.661 62.633 1.00 17.31  ? 241 ILE A CA  1 
ATOM   1607 C C   . ILE A 1 216 ? 42.491 52.510 61.694 1.00 15.96  ? 241 ILE A C   1 
ATOM   1608 O O   . ILE A 1 216 ? 41.571 53.207 62.131 1.00 12.94  ? 241 ILE A O   1 
ATOM   1609 C CB  . ILE A 1 216 ? 44.845 52.038 62.479 1.00 15.05  ? 241 ILE A CB  1 
ATOM   1610 C CG1 . ILE A 1 216 ? 45.684 51.249 63.474 1.00 4.66   ? 241 ILE A CG1 1 
ATOM   1611 C CG2 . ILE A 1 216 ? 45.079 53.516 62.734 1.00 18.40  ? 241 ILE A CG2 1 
ATOM   1612 C CD1 . ILE A 1 216 ? 47.125 51.281 63.122 1.00 14.13  ? 241 ILE A CD1 1 
ATOM   1613 N N   . ILE A 1 217 ? 42.775 52.409 60.397 1.00 18.10  ? 242 ILE A N   1 
ATOM   1614 C CA  . ILE A 1 217 ? 42.044 53.185 59.402 1.00 21.95  ? 242 ILE A CA  1 
ATOM   1615 C C   . ILE A 1 217 ? 40.622 52.693 59.279 1.00 26.12  ? 242 ILE A C   1 
ATOM   1616 O O   . ILE A 1 217 ? 39.865 53.205 58.466 1.00 24.68  ? 242 ILE A O   1 
ATOM   1617 C CB  . ILE A 1 217 ? 42.728 53.176 58.000 1.00 18.91  ? 242 ILE A CB  1 
ATOM   1618 C CG1 . ILE A 1 217 ? 42.810 51.769 57.421 1.00 15.30  ? 242 ILE A CG1 1 
ATOM   1619 C CG2 . ILE A 1 217 ? 44.136 53.726 58.080 1.00 14.90  ? 242 ILE A CG2 1 
ATOM   1620 C CD1 . ILE A 1 217 ? 43.455 51.755 56.046 1.00 12.35  ? 242 ILE A CD1 1 
ATOM   1621 N N   . GLN A 1 218 ? 40.287 51.701 60.105 1.00 33.24  ? 243 GLN A N   1 
ATOM   1622 C CA  . GLN A 1 218 ? 38.973 51.063 60.174 1.00 39.89  ? 243 GLN A CA  1 
ATOM   1623 C C   . GLN A 1 218 ? 38.539 50.364 58.883 1.00 44.74  ? 243 GLN A C   1 
ATOM   1624 O O   . GLN A 1 218 ? 37.402 50.595 58.432 1.00 53.84  ? 243 GLN A O   1 
ATOM   1625 C CB  . GLN A 1 218 ? 37.909 52.056 60.636 1.00 48.54  ? 243 GLN A CB  1 
ATOM   1626 C CG  . GLN A 1 218 ? 37.189 51.625 61.896 1.00 65.34  ? 243 GLN A CG  1 
ATOM   1627 C CD  . GLN A 1 218 ? 38.010 51.883 63.136 1.00 81.96  ? 243 GLN A CD  1 
ATOM   1628 O OE1 . GLN A 1 218 ? 38.553 52.974 63.318 1.00 89.86  ? 243 GLN A OE1 1 
ATOM   1629 N NE2 . GLN A 1 218 ? 38.090 50.890 64.011 1.00 88.79  ? 243 GLN A NE2 1 
ATOM   1630 O OXT . GLN A 1 218 ? 39.328 49.557 58.344 1.00 55.66  ? 243 GLN A OXT 1 
HETATM 1631 C C1  . NAG B 2 .   ? 45.170 71.154 59.665 1.00 24.74  ? 1   NAG B C1  1 
HETATM 1632 C C2  . NAG B 2 .   ? 44.218 72.331 59.856 1.00 38.07  ? 1   NAG B C2  1 
HETATM 1633 C C3  . NAG B 2 .   ? 44.350 73.232 58.640 1.00 33.57  ? 1   NAG B C3  1 
HETATM 1634 C C4  . NAG B 2 .   ? 45.797 73.741 58.611 1.00 32.39  ? 1   NAG B C4  1 
HETATM 1635 C C5  . NAG B 2 .   ? 46.736 72.531 58.534 1.00 24.75  ? 1   NAG B C5  1 
HETATM 1636 C C6  . NAG B 2 .   ? 48.222 72.846 58.507 1.00 9.17   ? 1   NAG B C6  1 
HETATM 1637 C C7  . NAG B 2 .   ? 42.106 71.299 59.206 1.00 54.41  ? 1   NAG B C7  1 
HETATM 1638 C C8  . NAG B 2 .   ? 40.723 70.934 59.693 1.00 49.11  ? 1   NAG B C8  1 
HETATM 1639 N N2  . NAG B 2 .   ? 42.853 71.903 60.122 1.00 45.59  ? 1   NAG B N2  1 
HETATM 1640 O O3  . NAG B 2 .   ? 43.415 74.297 58.711 1.00 38.24  ? 1   NAG B O3  1 
HETATM 1641 O O4  . NAG B 2 .   ? 45.991 74.623 57.482 1.00 54.25  ? 1   NAG B O4  1 
HETATM 1642 O O5  . NAG B 2 .   ? 46.509 71.652 59.657 1.00 25.30  ? 1   NAG B O5  1 
HETATM 1643 O O6  . NAG B 2 .   ? 48.574 73.565 59.688 1.00 17.03  ? 1   NAG B O6  1 
HETATM 1644 O O7  . NAG B 2 .   ? 42.492 71.016 58.071 1.00 54.11  ? 1   NAG B O7  1 
HETATM 1645 C C1  . NAG B 2 .   ? 46.305 75.946 57.777 1.00 70.77  ? 2   NAG B C1  1 
HETATM 1646 C C2  . NAG B 2 .   ? 46.439 76.745 56.500 1.00 77.43  ? 2   NAG B C2  1 
HETATM 1647 C C3  . NAG B 2 .   ? 46.911 78.136 56.887 1.00 83.96  ? 2   NAG B C3  1 
HETATM 1648 C C4  . NAG B 2 .   ? 45.775 78.762 57.695 1.00 85.66  ? 2   NAG B C4  1 
HETATM 1649 C C5  . NAG B 2 .   ? 45.447 77.888 58.916 1.00 85.92  ? 2   NAG B C5  1 
HETATM 1650 C C6  . NAG B 2 .   ? 44.163 78.343 59.589 1.00 89.89  ? 2   NAG B C6  1 
HETATM 1651 C C7  . NAG B 2 .   ? 48.569 75.831 55.748 1.00 73.53  ? 2   NAG B C7  1 
HETATM 1652 C C8  . NAG B 2 .   ? 49.279 75.155 54.590 1.00 74.86  ? 2   NAG B C8  1 
HETATM 1653 N N2  . NAG B 2 .   ? 47.290 76.104 55.513 1.00 75.66  ? 2   NAG B N2  1 
HETATM 1654 O O3  . NAG B 2 .   ? 47.179 78.909 55.724 1.00 92.72  ? 2   NAG B O3  1 
HETATM 1655 O O4  . NAG B 2 .   ? 46.129 80.080 58.106 1.00 90.16  ? 2   NAG B O4  1 
HETATM 1656 O O5  . NAG B 2 .   ? 45.236 76.502 58.540 1.00 81.35  ? 2   NAG B O5  1 
HETATM 1657 O O6  . NAG B 2 .   ? 43.037 78.064 58.771 1.00 92.77  ? 2   NAG B O6  1 
HETATM 1658 O O7  . NAG B 2 .   ? 49.156 76.136 56.791 1.00 69.78  ? 2   NAG B O7  1 
HETATM 1659 C C1  . FUC B 2 .   ? 49.757 74.290 59.528 1.00 35.77  ? 3   FUC B C1  1 
HETATM 1660 C C2  . FUC B 2 .   ? 49.806 75.417 60.563 1.00 46.07  ? 3   FUC B C2  1 
HETATM 1661 C C3  . FUC B 2 .   ? 49.948 74.814 61.956 1.00 59.00  ? 3   FUC B C3  1 
HETATM 1662 C C4  . FUC B 2 .   ? 51.173 73.881 62.015 1.00 55.39  ? 3   FUC B C4  1 
HETATM 1663 C C5  . FUC B 2 .   ? 51.099 72.825 60.905 1.00 45.84  ? 3   FUC B C5  1 
HETATM 1664 C C6  . FUC B 2 .   ? 52.361 71.983 60.816 1.00 36.48  ? 3   FUC B C6  1 
HETATM 1665 O O2  . FUC B 2 .   ? 48.618 76.201 60.492 1.00 28.48  ? 3   FUC B O2  1 
HETATM 1666 O O3  . FUC B 2 .   ? 50.084 75.858 62.915 1.00 74.40  ? 3   FUC B O3  1 
HETATM 1667 O O4  . FUC B 2 .   ? 52.374 74.636 61.897 1.00 57.73  ? 3   FUC B O4  1 
HETATM 1668 O O5  . FUC B 2 .   ? 50.913 73.457 59.621 1.00 43.10  ? 3   FUC B O5  1 
HETATM 1669 C C1  . NAG C 2 .   ? 57.938 50.245 33.908 1.00 29.44  ? 1   NAG C C1  1 
HETATM 1670 C C2  . NAG C 2 .   ? 57.680 49.212 32.821 1.00 40.81  ? 1   NAG C C2  1 
HETATM 1671 C C3  . NAG C 2 .   ? 56.423 49.543 32.049 1.00 46.40  ? 1   NAG C C3  1 
HETATM 1672 C C4  . NAG C 2 .   ? 55.247 49.791 32.993 1.00 47.69  ? 1   NAG C C4  1 
HETATM 1673 C C5  . NAG C 2 .   ? 55.636 50.784 34.083 1.00 37.75  ? 1   NAG C C5  1 
HETATM 1674 C C6  . NAG C 2 .   ? 54.570 50.866 35.141 1.00 40.50  ? 1   NAG C C6  1 
HETATM 1675 C C7  . NAG C 2 .   ? 59.575 48.109 31.810 1.00 59.93  ? 1   NAG C C7  1 
HETATM 1676 C C8  . NAG C 2 .   ? 60.735 48.202 30.833 1.00 63.23  ? 1   NAG C C8  1 
HETATM 1677 N N2  . NAG C 2 .   ? 58.803 49.187 31.903 1.00 46.96  ? 1   NAG C N2  1 
HETATM 1678 O O3  . NAG C 2 .   ? 56.129 48.451 31.201 1.00 49.87  ? 1   NAG C O3  1 
HETATM 1679 O O4  . NAG C 2 .   ? 54.132 50.333 32.252 1.00 59.35  ? 1   NAG C O4  1 
HETATM 1680 O O5  . NAG C 2 .   ? 56.812 50.339 34.760 1.00 27.50  ? 1   NAG C O5  1 
HETATM 1681 O O6  . NAG C 2 .   ? 54.594 49.639 35.896 1.00 46.17  ? 1   NAG C O6  1 
HETATM 1682 O O7  . NAG C 2 .   ? 59.361 47.079 32.447 1.00 72.23  ? 1   NAG C O7  1 
HETATM 1683 C C1  . NAG C 2 .   ? 53.114 49.469 31.876 1.00 69.69  ? 2   NAG C C1  1 
HETATM 1684 C C2  . NAG C 2 .   ? 51.814 50.256 31.782 1.00 76.06  ? 2   NAG C C2  1 
HETATM 1685 C C3  . NAG C 2 .   ? 50.700 49.384 31.199 1.00 88.33  ? 2   NAG C C3  1 
HETATM 1686 C C4  . NAG C 2 .   ? 51.141 48.692 29.913 1.00 95.28  ? 2   NAG C C4  1 
HETATM 1687 C C5  . NAG C 2 .   ? 52.481 47.986 30.112 1.00 93.79  ? 2   NAG C C5  1 
HETATM 1688 C C6  . NAG C 2 .   ? 53.016 47.421 28.800 1.00 101.71 ? 2   NAG C C6  1 
HETATM 1689 C C7  . NAG C 2 .   ? 51.296 51.986 33.399 1.00 67.28  ? 2   NAG C C7  1 
HETATM 1690 C C8  . NAG C 2 .   ? 50.891 52.305 34.827 1.00 64.57  ? 2   NAG C C8  1 
HETATM 1691 N N2  . NAG C 2 .   ? 51.438 50.695 33.116 1.00 68.86  ? 2   NAG C N2  1 
HETATM 1692 O O3  . NAG C 2 .   ? 49.550 50.177 30.938 1.00 90.85  ? 2   NAG C O3  1 
HETATM 1693 O O4  . NAG C 2 .   ? 50.158 47.736 29.532 1.00 104.24 ? 2   NAG C O4  1 
HETATM 1694 O O5  . NAG C 2 .   ? 53.459 48.923 30.604 1.00 82.85  ? 2   NAG C O5  1 
HETATM 1695 O O6  . NAG C 2 .   ? 54.391 47.076 28.898 1.00 114.12 ? 2   NAG C O6  1 
HETATM 1696 O O7  . NAG C 2 .   ? 51.507 52.881 32.581 1.00 69.76  ? 2   NAG C O7  1 
HETATM 1697 C C1  . FUC C 2 .   ? 53.326 49.078 36.074 1.00 39.90  ? 3   FUC C C1  1 
HETATM 1698 C C2  . FUC C 2 .   ? 53.473 47.695 36.701 1.00 39.56  ? 3   FUC C C2  1 
HETATM 1699 C C3  . FUC C 2 .   ? 53.919 47.813 38.155 1.00 24.61  ? 3   FUC C C3  1 
HETATM 1700 C C4  . FUC C 2 .   ? 52.969 48.726 38.911 1.00 21.59  ? 3   FUC C C4  1 
HETATM 1701 C C5  . FUC C 2 .   ? 52.903 50.078 38.219 1.00 25.48  ? 3   FUC C C5  1 
HETATM 1702 C C6  . FUC C 2 .   ? 51.922 51.033 38.868 1.00 31.51  ? 3   FUC C C6  1 
HETATM 1703 O O2  . FUC C 2 .   ? 54.441 46.952 35.973 1.00 53.86  ? 3   FUC C O2  1 
HETATM 1704 O O3  . FUC C 2 .   ? 53.900 46.530 38.749 1.00 15.26  ? 3   FUC C O3  1 
HETATM 1705 O O4  . FUC C 2 .   ? 51.684 48.136 38.938 1.00 24.76  ? 3   FUC C O4  1 
HETATM 1706 O O5  . FUC C 2 .   ? 52.476 49.905 36.859 1.00 29.84  ? 3   FUC C O5  1 
HETATM 1707 C C2  . SEI D 3 .   ? 71.249 42.254 56.829 1.00 19.87  ? 300 SEI A C2  1 
HETATM 1708 C C3  . SEI D 3 .   ? 72.298 43.125 56.197 1.00 19.65  ? 300 SEI A C3  1 
HETATM 1709 C C15 . SEI D 3 .   ? 72.848 45.453 56.125 1.00 12.33  ? 300 SEI A C15 1 
HETATM 1710 C C19 . SEI D 3 .   ? 71.685 49.600 56.579 1.00 9.08   ? 300 SEI A C19 1 
HETATM 1711 C C20 . SEI D 3 .   ? 71.136 48.627 57.415 1.00 4.43   ? 300 SEI A C20 1 
HETATM 1712 C C21 . SEI D 3 .   ? 71.547 47.302 57.276 1.00 5.84   ? 300 SEI A C21 1 
HETATM 1713 C C22 . SEI D 3 .   ? 72.486 46.895 56.303 1.00 6.30   ? 300 SEI A C22 1 
HETATM 1714 C C27 . SEI D 3 .   ? 71.308 51.004 56.841 1.00 10.68  ? 300 SEI A C27 1 
HETATM 1715 C C30 . SEI D 3 .   ? 72.350 53.840 55.310 1.00 2.00   ? 300 SEI A C30 1 
HETATM 1716 C C31 . SEI D 3 .   ? 73.634 53.469 56.002 1.00 2.00   ? 300 SEI A C31 1 
HETATM 1717 C C35 . SEI D 3 .   ? 72.224 55.370 55.256 1.00 2.00   ? 300 SEI A C35 1 
HETATM 1718 O O1  . SEI D 3 .   ? 70.063 42.641 56.186 1.00 27.72  ? 300 SEI A O1  1 
HETATM 1719 N N4  . SEI D 3 .   ? 71.887 44.521 56.221 1.00 11.01  ? 300 SEI A N4  1 
HETATM 1720 C C5  . SEI D 3 .   ? 70.478 44.808 55.977 1.00 13.68  ? 300 SEI A C5  1 
HETATM 1721 C C6  . SEI D 3 .   ? 69.620 43.842 56.729 1.00 14.99  ? 300 SEI A C6  1 
HETATM 1722 O O16 . SEI D 3 .   ? 73.975 45.051 55.855 1.00 11.17  ? 300 SEI A O16 1 
HETATM 1723 C C17 . SEI D 3 .   ? 73.042 47.885 55.474 1.00 5.03   ? 300 SEI A C17 1 
HETATM 1724 C C18 . SEI D 3 .   ? 72.597 49.215 55.564 1.00 3.16   ? 300 SEI A C18 1 
HETATM 1725 N N28 . SEI D 3 .   ? 71.050 51.778 55.748 1.00 2.00   ? 300 SEI A N28 1 
HETATM 1726 C C29 . SEI D 3 .   ? 71.151 53.198 56.063 1.00 6.49   ? 300 SEI A C29 1 
HETATM 1727 C C40 . SEI D 3 .   ? 69.827 53.819 55.636 1.00 10.31  ? 300 SEI A C40 1 
HETATM 1728 O O42 . SEI D 3 .   ? 69.456 53.750 54.470 1.00 24.93  ? 300 SEI A O42 1 
HETATM 1729 C C44 . SEI D 3 .   ? 67.761 54.824 56.235 1.00 3.90   ? 300 SEI A C44 1 
HETATM 1730 C C45 . SEI D 3 .   ? 69.412 54.482 58.015 1.00 2.35   ? 300 SEI A C45 1 
HETATM 1731 C C46 . SEI D 3 .   ? 68.126 54.973 58.670 1.00 4.00   ? 300 SEI A C46 1 
HETATM 1732 C C47 . SEI D 3 .   ? 67.162 55.232 57.567 1.00 7.06   ? 300 SEI A C47 1 
HETATM 1733 C C52 . SEI D 3 .   ? 67.870 56.012 55.299 1.00 10.12  ? 300 SEI A C52 1 
HETATM 1734 N N53 . SEI D 3 .   ? 66.873 56.013 54.410 1.00 16.17  ? 300 SEI A N53 1 
HETATM 1735 N N54 . SEI D 3 .   ? 69.081 54.357 56.595 1.00 2.00   ? 300 SEI A N54 1 
HETATM 1736 O O58 . SEI D 3 .   ? 68.779 56.826 55.418 1.00 18.61  ? 300 SEI A O58 1 
HETATM 1737 C C59 . SEI D 3 .   ? 66.725 57.068 53.437 1.00 9.31   ? 300 SEI A C59 1 
HETATM 1738 C C61 . SEI D 3 .   ? 66.756 56.479 51.992 1.00 8.38   ? 300 SEI A C61 1 
HETATM 1739 C C62 . SEI D 3 .   ? 65.697 55.427 51.804 1.00 2.00   ? 300 SEI A C62 1 
HETATM 1740 C C66 . SEI D 3 .   ? 68.128 55.897 51.688 1.00 12.80  ? 300 SEI A C66 1 
HETATM 1741 C C71 . SEI D 3 .   ? 65.536 58.020 53.561 1.00 15.25  ? 300 SEI A C71 1 
HETATM 1742 C C73 . SEI D 3 .   ? 65.391 58.734 55.035 1.00 18.71  ? 300 SEI A C73 1 
HETATM 1743 O O74 . SEI D 3 .   ? 64.996 58.430 52.541 1.00 12.86  ? 300 SEI A O74 1 
HETATM 1744 F F75 . SEI D 3 .   ? 64.122 59.101 55.604 1.00 10.08  ? 300 SEI A F75 1 
HETATM 1745 F F76 . SEI D 3 .   ? 66.120 57.963 55.905 1.00 10.57  ? 300 SEI A F76 1 
HETATM 1746 C C77 . SEI D 3 .   ? 66.017 60.044 54.943 1.00 16.05  ? 300 SEI A C77 1 
HETATM 1747 F F78 . SEI D 3 .   ? 67.273 59.804 54.683 1.00 11.96  ? 300 SEI A F78 1 
HETATM 1748 F F79 . SEI D 3 .   ? 65.435 60.720 53.967 1.00 24.16  ? 300 SEI A F79 1 
HETATM 1749 F F80 . SEI D 3 .   ? 65.803 60.612 56.106 1.00 19.07  ? 300 SEI A F80 1 
HETATM 1750 O O81 . SEI D 3 .   ? 71.252 51.457 57.989 1.00 5.30   ? 300 SEI A O81 1 
HETATM 1751 O O   . HOH E 4 .   ? 76.073 49.996 55.368 1.00 2.00   ? 1   HOH A O   1 
HETATM 1752 O O   . HOH E 4 .   ? 55.817 50.160 63.446 1.00 6.15   ? 2   HOH A O   1 
HETATM 1753 O O   . HOH E 4 .   ? 59.654 54.477 46.159 1.00 10.24  ? 3   HOH A O   1 
HETATM 1754 O O   . HOH E 4 .   ? 61.858 40.452 48.698 1.00 10.59  ? 4   HOH A O   1 
HETATM 1755 O O   . HOH E 4 .   ? 60.142 60.963 48.572 1.00 2.00   ? 5   HOH A O   1 
HETATM 1756 O O   . HOH E 4 .   ? 63.901 61.729 43.569 1.00 16.87  ? 6   HOH A O   1 
HETATM 1757 O O   . HOH E 4 .   ? 54.681 41.894 50.158 1.00 38.91  ? 7   HOH A O   1 
HETATM 1758 O O   . HOH E 4 .   ? 56.936 73.359 59.446 1.00 16.99  ? 8   HOH A O   1 
HETATM 1759 O O   . HOH E 4 .   ? 60.498 46.615 58.503 1.00 13.85  ? 9   HOH A O   1 
HETATM 1760 O O   . HOH E 4 .   ? 59.615 56.632 65.296 1.00 29.26  ? 10  HOH A O   1 
HETATM 1761 O O   . HOH E 4 .   ? 40.271 63.373 60.344 1.00 35.16  ? 11  HOH A O   1 
HETATM 1762 O O   . HOH E 4 .   ? 51.932 61.922 41.319 1.00 20.91  ? 12  HOH A O   1 
HETATM 1763 O O   . HOH E 4 .   ? 57.549 47.827 35.776 1.00 21.42  ? 13  HOH A O   1 
HETATM 1764 O O   . HOH E 4 .   ? 68.336 51.617 72.882 1.00 14.87  ? 14  HOH A O   1 
HETATM 1765 O O   . HOH E 4 .   ? 70.574 49.469 48.455 1.00 3.82   ? 15  HOH A O   1 
HETATM 1766 O O   . HOH E 4 .   ? 62.569 48.006 57.088 1.00 6.57   ? 414 HOH A O   1 
HETATM 1767 O O   . HOH E 4 .   ? 53.960 54.959 52.630 1.00 5.00   ? 415 HOH A O   1 
HETATM 1768 O O   . HOH E 4 .   ? 52.026 65.354 47.334 1.00 14.10  ? 416 HOH A O   1 
HETATM 1769 O O   . HOH E 4 .   ? 41.773 57.257 65.560 1.00 34.22  ? 417 HOH A O   1 
HETATM 1770 O O   . HOH E 4 .   ? 58.443 61.180 67.156 1.00 33.16  ? 418 HOH A O   1 
HETATM 1771 O O   . HOH E 4 .   ? 72.835 50.245 46.655 1.00 4.96   ? 419 HOH A O   1 
HETATM 1772 O O   . HOH E 4 .   ? 63.467 39.228 50.946 1.00 28.38  ? 420 HOH A O   1 
HETATM 1773 O O   . HOH E 4 .   ? 69.923 45.594 51.420 1.00 44.22  ? 421 HOH A O   1 
HETATM 1774 O O   . HOH E 4 .   ? 55.789 43.449 66.907 1.00 50.43  ? 422 HOH A O   1 
HETATM 1775 O O   . HOH E 4 .   ? 69.890 52.732 46.307 1.00 9.72   ? 423 HOH A O   1 
HETATM 1776 O O   . HOH E 4 .   ? 79.722 50.478 48.003 1.00 30.99  ? 424 HOH A O   1 
HETATM 1777 O O   . HOH E 4 .   ? 79.705 49.646 65.301 1.00 54.00  ? 425 HOH A O   1 
HETATM 1778 O O   . HOH E 4 .   ? 65.553 59.714 59.097 1.00 54.60  ? 426 HOH A O   1 
HETATM 1779 O O   . HOH E 4 .   ? 80.911 47.528 48.044 1.00 29.67  ? 427 HOH A O   1 
HETATM 1780 O O   . HOH E 4 .   ? 66.680 49.288 43.126 1.00 40.45  ? 428 HOH A O   1 
HETATM 1781 O O   . HOH E 4 .   ? 44.140 51.256 51.324 1.00 41.85  ? 429 HOH A O   1 
HETATM 1782 O O   . HOH E 4 .   ? 50.544 48.228 34.015 1.00 40.24  ? 430 HOH A O   1 
HETATM 1783 O O   . HOH E 4 .   ? 50.563 56.556 36.411 1.00 45.54  ? 431 HOH A O   1 
HETATM 1784 O O   . HOH E 4 .   ? 63.695 68.805 55.246 1.00 45.83  ? 432 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ILE 1   16  16  ILE ILE A . n 
A 1 2   VAL 2   17  17  VAL VAL A . n 
A 1 3   GLY 3   18  18  GLY GLY A . n 
A 1 4   GLY 4   19  19  GLY GLY A . n 
A 1 5   ARG 5   20  20  ARG ARG A . n 
A 1 6   ARG 6   21  21  ARG ARG A . n 
A 1 7   ALA 7   22  22  ALA ALA A . n 
A 1 8   ARG 8   23  23  ARG ARG A . n 
A 1 9   PRO 9   24  24  PRO PRO A . n 
A 1 10  HIS 10  25  25  HIS HIS A . n 
A 1 11  ALA 11  26  26  ALA ALA A . n 
A 1 12  TRP 12  27  27  TRP TRP A . n 
A 1 13  PRO 13  28  28  PRO PRO A . n 
A 1 14  PHE 14  29  29  PHE PHE A . n 
A 1 15  MET 15  30  30  MET MET A . n 
A 1 16  VAL 16  31  31  VAL VAL A . n 
A 1 17  SER 17  32  32  SER SER A . n 
A 1 18  LEU 18  33  33  LEU LEU A . n 
A 1 19  GLN 19  34  34  GLN GLN A . n 
A 1 20  LEU 20  35  35  LEU LEU A . n 
A 1 21  ALA 21  36  36  ALA ALA A . n 
A 1 22  GLY 22  38  38  GLY GLY A . n 
A 1 23  GLY 23  39  39  GLY GLY A . n 
A 1 24  HIS 24  40  40  HIS HIS A . n 
A 1 25  PHE 25  41  41  PHE PHE A . n 
A 1 26  CYS 26  42  42  CYS CYS A . n 
A 1 27  GLY 27  43  43  GLY GLY A . n 
A 1 28  ALA 28  44  44  ALA ALA A . n 
A 1 29  THR 29  45  45  THR THR A . n 
A 1 30  LEU 30  46  46  LEU LEU A . n 
A 1 31  ILE 31  47  47  ILE ILE A . n 
A 1 32  ALA 32  48  48  ALA ALA A . n 
A 1 33  PRO 33  49  49  PRO PRO A . n 
A 1 34  ASN 34  50  50  ASN ASN A . n 
A 1 35  PHE 35  51  51  PHE PHE A . n 
A 1 36  VAL 36  52  52  VAL VAL A . n 
A 1 37  MET 37  53  53  MET MET A . n 
A 1 38  SER 38  54  54  SER SER A . n 
A 1 39  ALA 39  55  55  ALA ALA A . n 
A 1 40  ALA 40  56  56  ALA ALA A . n 
A 1 41  HIS 41  57  57  HIS HIS A . n 
A 1 42  CYS 42  58  58  CYS CYS A . n 
A 1 43  VAL 43  59  59  VAL VAL A . n 
A 1 44  ALA 44  60  60  ALA ALA A . n 
A 1 45  ASN 45  61  61  ASN ASN A . n 
A 1 46  VAL 46  62  62  VAL VAL A . n 
A 1 47  ASN 47  62  62  ASN ASN A A n 
A 1 48  VAL 48  62  62  VAL VAL A B n 
A 1 49  ARG 49  63  63  ARG ARG A . n 
A 1 50  ALA 50  64  64  ALA ALA A . n 
A 1 51  VAL 51  65  65  VAL VAL A . n 
A 1 52  ARG 52  65  65  ARG ARG A A n 
A 1 53  VAL 53  66  66  VAL VAL A . n 
A 1 54  VAL 54  67  67  VAL VAL A . n 
A 1 55  LEU 55  68  68  LEU LEU A . n 
A 1 56  GLY 56  69  69  GLY GLY A . n 
A 1 57  ALA 57  70  70  ALA ALA A . n 
A 1 58  HIS 58  71  71  HIS HIS A . n 
A 1 59  ASN 59  72  72  ASN ASN A . n 
A 1 60  LEU 60  73  73  LEU LEU A . n 
A 1 61  SER 61  74  74  SER SER A . n 
A 1 62  ARG 62  75  75  ARG ARG A . n 
A 1 63  ARG 63  76  76  ARG ARG A . n 
A 1 64  GLU 64  77  77  GLU GLU A . n 
A 1 65  PRO 65  78  78  PRO PRO A . n 
A 1 66  THR 66  79  79  THR THR A . n 
A 1 67  ARG 67  80  80  ARG ARG A . n 
A 1 68  GLN 68  81  81  GLN GLN A . n 
A 1 69  VAL 69  82  82  VAL VAL A . n 
A 1 70  PHE 70  83  83  PHE PHE A . n 
A 1 71  ALA 71  84  84  ALA ALA A . n 
A 1 72  VAL 72  85  85  VAL VAL A . n 
A 1 73  GLN 73  86  86  GLN GLN A . n 
A 1 74  ARG 74  87  87  ARG ARG A . n 
A 1 75  ILE 75  88  88  ILE ILE A . n 
A 1 76  PHE 76  89  89  PHE PHE A . n 
A 1 77  GLU 77  90  90  GLU GLU A . n 
A 1 78  ASP 78  91  91  ASP ASP A . n 
A 1 79  GLY 79  92  92  GLY GLY A . n 
A 1 80  TYR 80  94  94  TYR TYR A . n 
A 1 81  ASP 81  95  95  ASP ASP A . n 
A 1 82  PRO 82  98  98  PRO PRO A . n 
A 1 83  VAL 83  99  99  VAL VAL A . n 
A 1 84  ASN 84  99  99  ASN ASN A A n 
A 1 85  LEU 85  99  99  LEU LEU A B n 
A 1 86  LEU 86  100 100 LEU LEU A . n 
A 1 87  ASN 87  101 101 ASN ASN A . n 
A 1 88  ASP 88  102 102 ASP ASP A . n 
A 1 89  ILE 89  103 103 ILE ILE A . n 
A 1 90  VAL 90  104 104 VAL VAL A . n 
A 1 91  ILE 91  105 105 ILE ILE A . n 
A 1 92  LEU 92  106 106 LEU LEU A . n 
A 1 93  GLN 93  107 107 GLN GLN A . n 
A 1 94  LEU 94  108 108 LEU LEU A . n 
A 1 95  ASN 95  109 109 ASN ASN A . n 
A 1 96  GLY 96  110 110 GLY GLY A . n 
A 1 97  SER 97  111 111 SER SER A . n 
A 1 98  ALA 98  112 112 ALA ALA A . n 
A 1 99  THR 99  113 113 THR THR A . n 
A 1 100 ILE 100 114 114 ILE ILE A . n 
A 1 101 ASN 101 115 115 ASN ASN A . n 
A 1 102 ALA 102 116 116 ALA ALA A . n 
A 1 103 ASN 103 117 117 ASN ASN A . n 
A 1 104 VAL 104 118 118 VAL VAL A . n 
A 1 105 GLN 105 119 119 GLN GLN A . n 
A 1 106 VAL 106 120 120 VAL VAL A . n 
A 1 107 ALA 107 121 121 ALA ALA A . n 
A 1 108 GLN 108 122 122 GLN GLN A . n 
A 1 109 LEU 109 123 123 LEU LEU A . n 
A 1 110 PRO 110 124 124 PRO PRO A . n 
A 1 111 ALA 111 125 125 ALA ALA A . n 
A 1 112 GLN 112 126 126 GLN GLN A . n 
A 1 113 GLY 113 127 127 GLY GLY A . n 
A 1 114 ARG 114 128 128 ARG ARG A . n 
A 1 115 ARG 115 129 129 ARG ARG A . n 
A 1 116 LEU 116 130 130 LEU LEU A . n 
A 1 117 GLY 117 131 131 GLY GLY A . n 
A 1 118 ASN 118 132 132 ASN ASN A . n 
A 1 119 GLY 119 133 133 GLY GLY A . n 
A 1 120 VAL 120 134 134 VAL VAL A . n 
A 1 121 GLN 121 135 135 GLN GLN A . n 
A 1 122 CYS 122 136 136 CYS CYS A . n 
A 1 123 LEU 123 137 137 LEU LEU A . n 
A 1 124 ALA 124 138 138 ALA ALA A . n 
A 1 125 MET 125 139 139 MET MET A . n 
A 1 126 GLY 126 140 140 GLY GLY A . n 
A 1 127 TRP 127 141 141 TRP TRP A . n 
A 1 128 GLY 128 142 142 GLY GLY A . n 
A 1 129 LEU 129 143 143 LEU LEU A . n 
A 1 130 LEU 130 144 144 LEU LEU A . n 
A 1 131 GLY 131 145 145 GLY GLY A . n 
A 1 132 ARG 132 147 147 ARG ARG A . n 
A 1 133 ASN 133 148 148 ASN ASN A . n 
A 1 134 ARG 134 149 149 ARG ARG A . n 
A 1 135 GLY 135 150 150 GLY GLY A . n 
A 1 136 ILE 136 151 151 ILE ILE A . n 
A 1 137 ALA 137 152 152 ALA ALA A . n 
A 1 138 SER 138 153 153 SER SER A . n 
A 1 139 VAL 139 154 154 VAL VAL A . n 
A 1 140 LEU 140 155 155 LEU LEU A . n 
A 1 141 GLN 141 156 156 GLN GLN A . n 
A 1 142 GLU 142 157 157 GLU GLU A . n 
A 1 143 LEU 143 158 158 LEU LEU A . n 
A 1 144 ASN 144 159 159 ASN ASN A . n 
A 1 145 VAL 145 160 160 VAL VAL A . n 
A 1 146 THR 146 162 162 THR THR A . n 
A 1 147 VAL 147 163 163 VAL VAL A . n 
A 1 148 VAL 148 164 164 VAL VAL A . n 
A 1 149 THR 149 165 165 THR THR A . n 
A 1 150 SER 150 166 166 SER SER A . n 
A 1 151 LEU 151 167 167 LEU LEU A . n 
A 1 152 CYS 152 168 168 CYS CYS A . n 
A 1 153 ARG 153 177 177 ARG ARG A . n 
A 1 154 ARG 154 178 178 ARG ARG A . n 
A 1 155 SER 155 179 179 SER SER A . n 
A 1 156 ASN 156 180 180 ASN ASN A . n 
A 1 157 VAL 157 181 181 VAL VAL A . n 
A 1 158 CYS 158 182 182 CYS CYS A . n 
A 1 159 THR 159 183 183 THR THR A . n 
A 1 160 LEU 160 184 184 LEU LEU A . n 
A 1 161 VAL 161 185 185 VAL VAL A . n 
A 1 162 ARG 162 186 186 ARG ARG A . n 
A 1 163 GLY 163 186 186 GLY GLY A A n 
A 1 164 ARG 164 187 187 ARG ARG A . n 
A 1 165 GLN 165 188 188 GLN GLN A . n 
A 1 166 ALA 166 188 188 ALA ALA A A n 
A 1 167 GLY 167 189 189 GLY GLY A . n 
A 1 168 VAL 168 190 190 VAL VAL A . n 
A 1 169 CYS 169 191 191 CYS CYS A . n 
A 1 170 PHE 170 192 192 PHE PHE A . n 
A 1 171 GLY 171 193 193 GLY GLY A . n 
A 1 172 ASP 172 194 194 ASP ASP A . n 
A 1 173 SER 173 195 195 SER SER A . n 
A 1 174 GLY 174 196 196 GLY GLY A . n 
A 1 175 SER 175 197 197 SER SER A . n 
A 1 176 PRO 176 198 198 PRO PRO A . n 
A 1 177 LEU 177 199 199 LEU LEU A . n 
A 1 178 VAL 178 200 200 VAL VAL A . n 
A 1 179 CYS 179 201 201 CYS CYS A . n 
A 1 180 ASN 180 204 204 ASN ASN A . n 
A 1 181 GLY 181 205 205 GLY GLY A . n 
A 1 182 LEU 182 208 208 LEU LEU A . n 
A 1 183 ILE 183 209 209 ILE ILE A . n 
A 1 184 HIS 184 210 210 HIS HIS A . n 
A 1 185 GLY 185 211 211 GLY GLY A . n 
A 1 186 ILE 186 212 212 ILE ILE A . n 
A 1 187 ALA 187 213 213 ALA ALA A . n 
A 1 188 SER 188 214 214 SER SER A . n 
A 1 189 PHE 189 215 215 PHE PHE A . n 
A 1 190 VAL 190 216 216 VAL VAL A . n 
A 1 191 ARG 191 217 217 ARG ARG A . n 
A 1 192 GLY 192 218 218 GLY GLY A . n 
A 1 193 GLY 193 219 219 GLY GLY A . n 
A 1 194 CYS 194 220 220 CYS CYS A . n 
A 1 195 ALA 195 221 221 ALA ALA A . n 
A 1 196 SER 196 222 222 SER SER A . n 
A 1 197 GLY 197 222 222 GLY GLY A A n 
A 1 198 LEU 198 223 223 LEU LEU A . n 
A 1 199 TYR 199 224 224 TYR TYR A . n 
A 1 200 PRO 200 225 225 PRO PRO A . n 
A 1 201 ASP 201 226 226 ASP ASP A . n 
A 1 202 ALA 202 227 227 ALA ALA A . n 
A 1 203 PHE 203 228 228 PHE PHE A . n 
A 1 204 ALA 204 229 229 ALA ALA A . n 
A 1 205 PRO 205 230 230 PRO PRO A . n 
A 1 206 VAL 206 231 231 VAL VAL A . n 
A 1 207 ALA 207 232 232 ALA ALA A . n 
A 1 208 GLN 208 233 233 GLN GLN A . n 
A 1 209 PHE 209 234 234 PHE PHE A . n 
A 1 210 VAL 210 235 235 VAL VAL A . n 
A 1 211 ASN 211 236 236 ASN ASN A . n 
A 1 212 TRP 212 237 237 TRP TRP A . n 
A 1 213 ILE 213 238 238 ILE ILE A . n 
A 1 214 ASP 214 239 239 ASP ASP A . n 
A 1 215 SER 215 240 240 SER SER A . n 
A 1 216 ILE 216 241 241 ILE ILE A . n 
A 1 217 ILE 217 242 242 ILE ILE A . n 
A 1 218 GLN 218 243 243 GLN GLN A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 3 SEI 1  300 300 SEI SEI A . 
E 4 HOH 1  1   1   HOH HOH A . 
E 4 HOH 2  2   2   HOH HOH A . 
E 4 HOH 3  3   3   HOH HOH A . 
E 4 HOH 4  4   4   HOH HOH A . 
E 4 HOH 5  5   5   HOH HOH A . 
E 4 HOH 6  6   6   HOH HOH A . 
E 4 HOH 7  7   7   HOH HOH A . 
E 4 HOH 8  8   8   HOH HOH A . 
E 4 HOH 9  9   9   HOH HOH A . 
E 4 HOH 10 10  10  HOH HOH A . 
E 4 HOH 11 11  11  HOH HOH A . 
E 4 HOH 12 12  12  HOH HOH A . 
E 4 HOH 13 13  13  HOH HOH A . 
E 4 HOH 14 14  14  HOH HOH A . 
E 4 HOH 15 15  15  HOH HOH A . 
E 4 HOH 16 414 414 HOH HOH A . 
E 4 HOH 17 415 415 HOH HOH A . 
E 4 HOH 18 416 416 HOH HOH A . 
E 4 HOH 19 417 417 HOH HOH A . 
E 4 HOH 20 418 418 HOH HOH A . 
E 4 HOH 21 419 419 HOH HOH A . 
E 4 HOH 22 420 420 HOH HOH A . 
E 4 HOH 23 421 421 HOH HOH A . 
E 4 HOH 24 422 422 HOH HOH A . 
E 4 HOH 25 423 423 HOH HOH A . 
E 4 HOH 26 424 424 HOH HOH A . 
E 4 HOH 27 425 425 HOH HOH A . 
E 4 HOH 28 426 426 HOH HOH A . 
E 4 HOH 29 427 427 HOH HOH A . 
E 4 HOH 30 428 428 HOH HOH A . 
E 4 HOH 31 429 429 HOH HOH A . 
E 4 HOH 32 430 430 HOH HOH A . 
E 4 HOH 33 431 431 HOH HOH A . 
E 4 HOH 34 432 432 HOH HOH A . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 A ASN 95  A ASN 109 ? ASN 'GLYCOSYLATION SITE' 
2 A ASN 144 A ASN 159 ? ASN 'GLYCOSYLATION SITE' 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1998-11-09 
2 'Structure model' 1 1 2008-04-26 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2018-11-14 
5 'Structure model' 2 0 2020-07-29 
# 
loop_
_pdbx_audit_revision_details.ordinal 
_pdbx_audit_revision_details.revision_ordinal 
_pdbx_audit_revision_details.data_content_type 
_pdbx_audit_revision_details.provider 
_pdbx_audit_revision_details.type 
_pdbx_audit_revision_details.description 
_pdbx_audit_revision_details.details 
1 1 'Structure model' repository 'Initial release' ?                          ? 
2 5 'Structure model' repository Remediation       'Carbohydrate remediation' ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1  2 'Structure model' 'Version format compliance' 
2  3 'Structure model' 'Non-polymer description'   
3  3 'Structure model' 'Version format compliance' 
4  4 'Structure model' Advisory                    
5  4 'Structure model' 'Data collection'           
6  4 'Structure model' 'Derived calculations'      
7  5 'Structure model' 'Atomic model'              
8  5 'Structure model' 'Data collection'           
9  5 'Structure model' 'Derived calculations'      
10 5 'Structure model' 'Structure summary'         
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1  4 'Structure model' pdbx_distant_solvent_atoms    
2  4 'Structure model' pdbx_validate_close_contact   
3  4 'Structure model' struct_conn                   
4  5 'Structure model' atom_site                     
5  5 'Structure model' chem_comp                     
6  5 'Structure model' entity                        
7  5 'Structure model' pdbx_branch_scheme            
8  5 'Structure model' pdbx_chem_comp_identifier     
9  5 'Structure model' pdbx_entity_branch            
10 5 'Structure model' pdbx_entity_branch_descriptor 
11 5 'Structure model' pdbx_entity_branch_link       
12 5 'Structure model' pdbx_entity_branch_list       
13 5 'Structure model' pdbx_entity_nonpoly           
14 5 'Structure model' pdbx_nonpoly_scheme           
15 5 'Structure model' pdbx_struct_assembly_gen      
16 5 'Structure model' struct_asym                   
17 5 'Structure model' struct_conn                   
18 5 'Structure model' struct_site                   
19 5 'Structure model' struct_site_gen               
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  5 'Structure model' '_atom_site.B_iso_or_equiv'              
2  5 'Structure model' '_atom_site.Cartn_x'                     
3  5 'Structure model' '_atom_site.Cartn_y'                     
4  5 'Structure model' '_atom_site.Cartn_z'                     
5  5 'Structure model' '_atom_site.auth_asym_id'                
6  5 'Structure model' '_atom_site.auth_atom_id'                
7  5 'Structure model' '_atom_site.auth_comp_id'                
8  5 'Structure model' '_atom_site.auth_seq_id'                 
9  5 'Structure model' '_atom_site.label_asym_id'               
10 5 'Structure model' '_atom_site.label_atom_id'               
11 5 'Structure model' '_atom_site.label_comp_id'               
12 5 'Structure model' '_atom_site.label_entity_id'             
13 5 'Structure model' '_atom_site.type_symbol'                 
14 5 'Structure model' '_chem_comp.name'                        
15 5 'Structure model' '_chem_comp.type'                        
16 5 'Structure model' '_pdbx_struct_assembly_gen.asym_id_list' 
17 5 'Structure model' '_struct_conn.pdbx_dist_value'           
18 5 'Structure model' '_struct_conn.pdbx_leaving_atom_flag'    
19 5 'Structure model' '_struct_conn.pdbx_role'                 
20 5 'Structure model' '_struct_conn.ptnr1_auth_asym_id'        
21 5 'Structure model' '_struct_conn.ptnr1_auth_comp_id'        
22 5 'Structure model' '_struct_conn.ptnr1_auth_seq_id'         
23 5 'Structure model' '_struct_conn.ptnr1_label_asym_id'       
24 5 'Structure model' '_struct_conn.ptnr1_label_atom_id'       
25 5 'Structure model' '_struct_conn.ptnr1_label_comp_id'       
26 5 'Structure model' '_struct_conn.ptnr1_label_seq_id'        
27 5 'Structure model' '_struct_conn.ptnr2_auth_asym_id'        
28 5 'Structure model' '_struct_conn.ptnr2_auth_comp_id'        
29 5 'Structure model' '_struct_conn.ptnr2_auth_seq_id'         
30 5 'Structure model' '_struct_conn.ptnr2_label_asym_id'       
31 5 'Structure model' '_struct_conn.ptnr2_label_atom_id'       
32 5 'Structure model' '_struct_conn.ptnr2_label_comp_id'       
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
XDS    'data scaling'   .   ? 1 
XSCALE 'data scaling'   .   ? 2 
AMoRE  phasing          .   ? 3 
X-PLOR refinement       3.1 ? 4 
XDS    'data reduction' .   ? 5 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   OG 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   SER 
_pdbx_validate_close_contact.auth_seq_id_1    195 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   O74 
_pdbx_validate_close_contact.auth_asym_id_2   A 
_pdbx_validate_close_contact.auth_comp_id_2   SEI 
_pdbx_validate_close_contact.auth_seq_id_2    300 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             1.96 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ALA A 60  ? ? -40.72  -80.86  
2 1 HIS A 71  ? ? -146.12 -52.15  
3 1 ASN A 115 ? ? -150.63 -158.99 
4 1 ARG A 147 ? ? -37.95  -33.77  
5 1 ARG A 186 ? ? -39.81  123.23  
6 1 SER A 214 ? ? -120.37 -70.35  
7 1 ILE A 242 ? ? -69.51  2.08    
# 
loop_
_pdbx_distant_solvent_atoms.id 
_pdbx_distant_solvent_atoms.PDB_model_num 
_pdbx_distant_solvent_atoms.auth_atom_id 
_pdbx_distant_solvent_atoms.label_alt_id 
_pdbx_distant_solvent_atoms.auth_asym_id 
_pdbx_distant_solvent_atoms.auth_comp_id 
_pdbx_distant_solvent_atoms.auth_seq_id 
_pdbx_distant_solvent_atoms.PDB_ins_code 
_pdbx_distant_solvent_atoms.neighbor_macromolecule_distance 
_pdbx_distant_solvent_atoms.neighbor_ligand_distance 
1 1 O ? A HOH 14  ? 7.22  . 
2 1 O ? A HOH 425 ? 10.21 . 
# 
loop_
_pdbx_branch_scheme.asym_id 
_pdbx_branch_scheme.entity_id 
_pdbx_branch_scheme.mon_id 
_pdbx_branch_scheme.num 
_pdbx_branch_scheme.pdb_asym_id 
_pdbx_branch_scheme.pdb_mon_id 
_pdbx_branch_scheme.pdb_seq_num 
_pdbx_branch_scheme.auth_asym_id 
_pdbx_branch_scheme.auth_mon_id 
_pdbx_branch_scheme.auth_seq_num 
_pdbx_branch_scheme.hetero 
B 2 NAG 1 B NAG 1 B NAG 401 n 
B 2 NAG 2 B NAG 2 B NAG 403 n 
B 2 FUC 3 B FUC 3 B FUC 402 n 
C 2 NAG 1 C NAG 1 C NAG 411 n 
C 2 NAG 2 C NAG 2 C NAG 413 n 
C 2 FUC 3 C FUC 3 C FUC 412 n 
# 
loop_
_pdbx_chem_comp_identifier.comp_id 
_pdbx_chem_comp_identifier.type 
_pdbx_chem_comp_identifier.program 
_pdbx_chem_comp_identifier.program_version 
_pdbx_chem_comp_identifier.identifier 
FUC 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 LFucpa                         
FUC 'COMMON NAME'                         GMML     1.0 a-L-fucopyranose               
FUC 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 a-L-Fucp                       
FUC 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 Fuc                            
NAG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DGlcpNAcb                      
NAG 'COMMON NAME'                         GMML     1.0 N-acetyl-b-D-glucopyranosamine 
NAG 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 b-D-GlcpNAc                    
NAG 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 GlcNAc                         
# 
_pdbx_entity_branch.entity_id   2 
_pdbx_entity_branch.type        oligosaccharide 
# 
loop_
_pdbx_entity_branch_descriptor.ordinal 
_pdbx_entity_branch_descriptor.entity_id 
_pdbx_entity_branch_descriptor.descriptor 
_pdbx_entity_branch_descriptor.type 
_pdbx_entity_branch_descriptor.program 
_pdbx_entity_branch_descriptor.program_version 
1 2 'DGlcpNAcb1-4[LFucpa1-6]DGlcpNAcb1-'                                         'Glycam Condensed Sequence' GMML       1.0   
2 2 'WURCS=2.0/2,3,2/[a2122h-1b_1-5_2*NCC/3=O][a1221m-1a_1-5]/1-1-2/a4-b1_a6-c1' WURCS                       PDB2Glycan 1.1.0 
3 2 '[]{[(4+1)][b-D-GlcpNAc]{[(4+1)][b-D-GlcpNAc]{}[(6+1)][a-L-Fucp]{}}}'        LINUCS                      PDB-CARE   ?     
# 
loop_
_pdbx_entity_branch_link.link_id 
_pdbx_entity_branch_link.entity_id 
_pdbx_entity_branch_link.entity_branch_list_num_1 
_pdbx_entity_branch_link.comp_id_1 
_pdbx_entity_branch_link.atom_id_1 
_pdbx_entity_branch_link.leaving_atom_id_1 
_pdbx_entity_branch_link.entity_branch_list_num_2 
_pdbx_entity_branch_link.comp_id_2 
_pdbx_entity_branch_link.atom_id_2 
_pdbx_entity_branch_link.leaving_atom_id_2 
_pdbx_entity_branch_link.value_order 
_pdbx_entity_branch_link.details 
1 2 2 NAG C1 O1 1 NAG O4 HO4 sing ? 
2 2 3 FUC C1 O1 1 NAG O6 HO6 sing ? 
# 
loop_
_pdbx_entity_branch_list.entity_id 
_pdbx_entity_branch_list.comp_id 
_pdbx_entity_branch_list.num 
_pdbx_entity_branch_list.hetero 
2 NAG 1 n 
2 NAG 2 n 
2 FUC 3 n 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 
;1-{3-METHYL-2-[4-(MORPHOLINE-4-CARBONYL)-BENZOYLAMINO]-BUTYRYL}-PYRROLIDINE-2-CARBOXYLIC ACID (3,3,4,4,4-PENTAFLUORO-1-ISOPROPYL-2-OXO-BUTYL)-AMIDE
;
SEI 
4 water HOH 
#