data_1B0P
# 
_entry.id   1B0P 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.292 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1B0P         
RCSB  RCSB000065   
WWPDB D_1000000065 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1B0P 
_pdbx_database_status.recvd_initial_deposition_date   1998-11-12 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Chabriere, E.' 1 
'Charon, M.H.'  2 
'Volbeda, A.'   3 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Crystal structures of the key anaerobic enzyme pyruvate:ferredoxin oxidoreductase, free and in complex with pyruvate.' 
Nat.Struct.Biol.           6  182 190 1999 NSBIEW US 1072-8368 2024 ? 10048931 10.1038/5870 
1       
'Crystallization and Preliminary Crystallographic Analysis of the Pyruvate- Ferredoxin Oxidoreductase from Desulfovibrio Africanus' 
'Acta Crystallogr.,Sect.D' 55 329 331 1999 ABCRE6 DK 0907-4449 0766 ? ?        ?            
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Chabriere, E.'          1  
primary 'Charon, M.H.'           2  
primary 'Volbeda, A.'            3  
primary 'Pieulle, L.'            4  
primary 'Hatchikian, E.C.'       5  
primary 'Fontecilla-Camps, J.C.' 6  
1       'Pieulle, L.'            7  
1       'Chabriere, E.'          8  
1       'Hatchikian, E.C.'       9  
1       'Fontecilla-Camps, J.F.' 10 
1       'Charon, M.H.'           11 
# 
_cell.entry_id           1B0P 
_cell.length_a           84.800 
_cell.length_b           144.900 
_cell.length_c           203.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1B0P 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     nat 'PROTEIN (PYRUVATE-FERREDOXIN OXIDOREDUCTASE)' 133703.906 2   1.2.7.1 ? ? ? 
2 non-polymer syn 'MAGNESIUM ION'                                24.305     2   ?       ? ? ? 
3 non-polymer syn 'CALCIUM ION'                                  40.078     2   ?       ? ? ? 
4 non-polymer syn 'IRON/SULFUR CLUSTER'                          351.640    6   ?       ? ? ? 
5 non-polymer syn 'THIAMINE DIPHOSPHATE'                         425.314    2   ?       ? ? ? 
6 water       nat water                                          18.015     543 ?       ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GKKMMTTDGNTATAHVAYAMSEVAAIYPITPSSTMGEEADDWAAQGRKNIFGQTLTIREMQSEAGAAGAVHGALAAGALT
TTFTASQGLLLMIPNMYKISGELLPGVFHVTARAIAAHALSIFGDHQDIYAARQTGFAMLASSSVQEAHDMALVAHLAAI
ESNVPFMHFFDGFRTSHEIQKIEVLDYADMASLVNQKALAEFRAKSMNPEHPHVRGTAQNPDIYFQGREAANPYYLKVPG
IVAEYMQKVASLTGRSYKLFDYVGAPDAERVIVSMGSSCETIEEVINHLAAKGEKIGLIKVRLYRPFVSEAFFAALPASA
KVITVLDRTKEPGAPGDPLYLDVCSAFVERGEAMPKILAGRYGLGSKEFSPAMVKSVYDNMSGAKKNHFTVGIEDDVTGT
SLPVDNAFADTTPKGTIQCQFWGLGADGTVGANKQAIKIIGDNTDLFAQGYFSYDSKKSGGITISHLRFGEKPIQSTYLV
NRADYVACHNPAYVGIYDILEGIKDGGTFVLNSPWSSLEDMDKHLPSGIKRTIANKKLKFYNIDAVKIATDVGLGGRINM
IMQTAFFKLAGVLPFEKAVDLLKKSIHKAYGKKGEKIVKMNTDAVDQAVTSLQEFKYPDSWKDAPAETKAEPMTNEFFKN
VVKPILTQQGDKLPVSAFEADGRFPLGTSQFEKRGVAINVPQWVPENCIQCNQCAFVCPHSAILPVLAKEEELVGAPANF
TALEAKGKELKGYKFRIQINTLDCMGCGNCADICPPKEKALVMQPLDTQRDAQVPNLEYAARIPVKSEVLPRDSLKGSQF
QEPLMEFSGACSGCGETPYVRVITQLFGERMFIANATGCSSIWGASAPSMPYKTNRLGQGPAWGNSLFEDAAEYGFGMNM
SMFARRTHLADLAAKALESDASGDVKEALQGWLAGKNDPIKSKEYGDKLKKLLAGQKDGLLGQIAAMSDLYTKKSVWIFG
GDGWAYDIGYGGLDHVLASGEDVNVFVMDTEVYSNTGGQSSKATPTGAVAKFAAAGKRTGKKDLARMVMTYGYVYVATVS
MGYSKQQFLKVLKEAESFPGPSLVIAYATCINQGLRKGMGKSQDVMNTAVKSGYWPLFRYDPRLAAQGKNPFQLDSKAPD
GSVEEFLMAQNRFAVLDRSFPEDAKRLRAQVAHELDVRFKELEHMAATNIFESFAPAGGKADGSVDFGEGAEFCTRDDTP
MMARPDSGEACDQNRAGTSEQQGDLSKRTKK
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GKKMMTTDGNTATAHVAYAMSEVAAIYPITPSSTMGEEADDWAAQGRKNIFGQTLTIREMQSEAGAAGAVHGALAAGALT
TTFTASQGLLLMIPNMYKISGELLPGVFHVTARAIAAHALSIFGDHQDIYAARQTGFAMLASSSVQEAHDMALVAHLAAI
ESNVPFMHFFDGFRTSHEIQKIEVLDYADMASLVNQKALAEFRAKSMNPEHPHVRGTAQNPDIYFQGREAANPYYLKVPG
IVAEYMQKVASLTGRSYKLFDYVGAPDAERVIVSMGSSCETIEEVINHLAAKGEKIGLIKVRLYRPFVSEAFFAALPASA
KVITVLDRTKEPGAPGDPLYLDVCSAFVERGEAMPKILAGRYGLGSKEFSPAMVKSVYDNMSGAKKNHFTVGIEDDVTGT
SLPVDNAFADTTPKGTIQCQFWGLGADGTVGANKQAIKIIGDNTDLFAQGYFSYDSKKSGGITISHLRFGEKPIQSTYLV
NRADYVACHNPAYVGIYDILEGIKDGGTFVLNSPWSSLEDMDKHLPSGIKRTIANKKLKFYNIDAVKIATDVGLGGRINM
IMQTAFFKLAGVLPFEKAVDLLKKSIHKAYGKKGEKIVKMNTDAVDQAVTSLQEFKYPDSWKDAPAETKAEPMTNEFFKN
VVKPILTQQGDKLPVSAFEADGRFPLGTSQFEKRGVAINVPQWVPENCIQCNQCAFVCPHSAILPVLAKEEELVGAPANF
TALEAKGKELKGYKFRIQINTLDCMGCGNCADICPPKEKALVMQPLDTQRDAQVPNLEYAARIPVKSEVLPRDSLKGSQF
QEPLMEFSGACSGCGETPYVRVITQLFGERMFIANATGCSSIWGASAPSMPYKTNRLGQGPAWGNSLFEDAAEYGFGMNM
SMFARRTHLADLAAKALESDASGDVKEALQGWLAGKNDPIKSKEYGDKLKKLLAGQKDGLLGQIAAMSDLYTKKSVWIFG
GDGWAYDIGYGGLDHVLASGEDVNVFVMDTEVYSNTGGQSSKATPTGAVAKFAAAGKRTGKKDLARMVMTYGYVYVATVS
MGYSKQQFLKVLKEAESFPGPSLVIAYATCINQGLRKGMGKSQDVMNTAVKSGYWPLFRYDPRLAAQGKNPFQLDSKAPD
GSVEEFLMAQNRFAVLDRSFPEDAKRLRAQVAHELDVRFKELEHMAATNIFESFAPAGGKADGSVDFGEGAEFCTRDDTP
MMARPDSGEACDQNRAGTSEQQGDLSKRTKK
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1    GLY n 
1 2    LYS n 
1 3    LYS n 
1 4    MET n 
1 5    MET n 
1 6    THR n 
1 7    THR n 
1 8    ASP n 
1 9    GLY n 
1 10   ASN n 
1 11   THR n 
1 12   ALA n 
1 13   THR n 
1 14   ALA n 
1 15   HIS n 
1 16   VAL n 
1 17   ALA n 
1 18   TYR n 
1 19   ALA n 
1 20   MET n 
1 21   SER n 
1 22   GLU n 
1 23   VAL n 
1 24   ALA n 
1 25   ALA n 
1 26   ILE n 
1 27   TYR n 
1 28   PRO n 
1 29   ILE n 
1 30   THR n 
1 31   PRO n 
1 32   SER n 
1 33   SER n 
1 34   THR n 
1 35   MET n 
1 36   GLY n 
1 37   GLU n 
1 38   GLU n 
1 39   ALA n 
1 40   ASP n 
1 41   ASP n 
1 42   TRP n 
1 43   ALA n 
1 44   ALA n 
1 45   GLN n 
1 46   GLY n 
1 47   ARG n 
1 48   LYS n 
1 49   ASN n 
1 50   ILE n 
1 51   PHE n 
1 52   GLY n 
1 53   GLN n 
1 54   THR n 
1 55   LEU n 
1 56   THR n 
1 57   ILE n 
1 58   ARG n 
1 59   GLU n 
1 60   MET n 
1 61   GLN n 
1 62   SER n 
1 63   GLU n 
1 64   ALA n 
1 65   GLY n 
1 66   ALA n 
1 67   ALA n 
1 68   GLY n 
1 69   ALA n 
1 70   VAL n 
1 71   HIS n 
1 72   GLY n 
1 73   ALA n 
1 74   LEU n 
1 75   ALA n 
1 76   ALA n 
1 77   GLY n 
1 78   ALA n 
1 79   LEU n 
1 80   THR n 
1 81   THR n 
1 82   THR n 
1 83   PHE n 
1 84   THR n 
1 85   ALA n 
1 86   SER n 
1 87   GLN n 
1 88   GLY n 
1 89   LEU n 
1 90   LEU n 
1 91   LEU n 
1 92   MET n 
1 93   ILE n 
1 94   PRO n 
1 95   ASN n 
1 96   MET n 
1 97   TYR n 
1 98   LYS n 
1 99   ILE n 
1 100  SER n 
1 101  GLY n 
1 102  GLU n 
1 103  LEU n 
1 104  LEU n 
1 105  PRO n 
1 106  GLY n 
1 107  VAL n 
1 108  PHE n 
1 109  HIS n 
1 110  VAL n 
1 111  THR n 
1 112  ALA n 
1 113  ARG n 
1 114  ALA n 
1 115  ILE n 
1 116  ALA n 
1 117  ALA n 
1 118  HIS n 
1 119  ALA n 
1 120  LEU n 
1 121  SER n 
1 122  ILE n 
1 123  PHE n 
1 124  GLY n 
1 125  ASP n 
1 126  HIS n 
1 127  GLN n 
1 128  ASP n 
1 129  ILE n 
1 130  TYR n 
1 131  ALA n 
1 132  ALA n 
1 133  ARG n 
1 134  GLN n 
1 135  THR n 
1 136  GLY n 
1 137  PHE n 
1 138  ALA n 
1 139  MET n 
1 140  LEU n 
1 141  ALA n 
1 142  SER n 
1 143  SER n 
1 144  SER n 
1 145  VAL n 
1 146  GLN n 
1 147  GLU n 
1 148  ALA n 
1 149  HIS n 
1 150  ASP n 
1 151  MET n 
1 152  ALA n 
1 153  LEU n 
1 154  VAL n 
1 155  ALA n 
1 156  HIS n 
1 157  LEU n 
1 158  ALA n 
1 159  ALA n 
1 160  ILE n 
1 161  GLU n 
1 162  SER n 
1 163  ASN n 
1 164  VAL n 
1 165  PRO n 
1 166  PHE n 
1 167  MET n 
1 168  HIS n 
1 169  PHE n 
1 170  PHE n 
1 171  ASP n 
1 172  GLY n 
1 173  PHE n 
1 174  ARG n 
1 175  THR n 
1 176  SER n 
1 177  HIS n 
1 178  GLU n 
1 179  ILE n 
1 180  GLN n 
1 181  LYS n 
1 182  ILE n 
1 183  GLU n 
1 184  VAL n 
1 185  LEU n 
1 186  ASP n 
1 187  TYR n 
1 188  ALA n 
1 189  ASP n 
1 190  MET n 
1 191  ALA n 
1 192  SER n 
1 193  LEU n 
1 194  VAL n 
1 195  ASN n 
1 196  GLN n 
1 197  LYS n 
1 198  ALA n 
1 199  LEU n 
1 200  ALA n 
1 201  GLU n 
1 202  PHE n 
1 203  ARG n 
1 204  ALA n 
1 205  LYS n 
1 206  SER n 
1 207  MET n 
1 208  ASN n 
1 209  PRO n 
1 210  GLU n 
1 211  HIS n 
1 212  PRO n 
1 213  HIS n 
1 214  VAL n 
1 215  ARG n 
1 216  GLY n 
1 217  THR n 
1 218  ALA n 
1 219  GLN n 
1 220  ASN n 
1 221  PRO n 
1 222  ASP n 
1 223  ILE n 
1 224  TYR n 
1 225  PHE n 
1 226  GLN n 
1 227  GLY n 
1 228  ARG n 
1 229  GLU n 
1 230  ALA n 
1 231  ALA n 
1 232  ASN n 
1 233  PRO n 
1 234  TYR n 
1 235  TYR n 
1 236  LEU n 
1 237  LYS n 
1 238  VAL n 
1 239  PRO n 
1 240  GLY n 
1 241  ILE n 
1 242  VAL n 
1 243  ALA n 
1 244  GLU n 
1 245  TYR n 
1 246  MET n 
1 247  GLN n 
1 248  LYS n 
1 249  VAL n 
1 250  ALA n 
1 251  SER n 
1 252  LEU n 
1 253  THR n 
1 254  GLY n 
1 255  ARG n 
1 256  SER n 
1 257  TYR n 
1 258  LYS n 
1 259  LEU n 
1 260  PHE n 
1 261  ASP n 
1 262  TYR n 
1 263  VAL n 
1 264  GLY n 
1 265  ALA n 
1 266  PRO n 
1 267  ASP n 
1 268  ALA n 
1 269  GLU n 
1 270  ARG n 
1 271  VAL n 
1 272  ILE n 
1 273  VAL n 
1 274  SER n 
1 275  MET n 
1 276  GLY n 
1 277  SER n 
1 278  SER n 
1 279  CYS n 
1 280  GLU n 
1 281  THR n 
1 282  ILE n 
1 283  GLU n 
1 284  GLU n 
1 285  VAL n 
1 286  ILE n 
1 287  ASN n 
1 288  HIS n 
1 289  LEU n 
1 290  ALA n 
1 291  ALA n 
1 292  LYS n 
1 293  GLY n 
1 294  GLU n 
1 295  LYS n 
1 296  ILE n 
1 297  GLY n 
1 298  LEU n 
1 299  ILE n 
1 300  LYS n 
1 301  VAL n 
1 302  ARG n 
1 303  LEU n 
1 304  TYR n 
1 305  ARG n 
1 306  PRO n 
1 307  PHE n 
1 308  VAL n 
1 309  SER n 
1 310  GLU n 
1 311  ALA n 
1 312  PHE n 
1 313  PHE n 
1 314  ALA n 
1 315  ALA n 
1 316  LEU n 
1 317  PRO n 
1 318  ALA n 
1 319  SER n 
1 320  ALA n 
1 321  LYS n 
1 322  VAL n 
1 323  ILE n 
1 324  THR n 
1 325  VAL n 
1 326  LEU n 
1 327  ASP n 
1 328  ARG n 
1 329  THR n 
1 330  LYS n 
1 331  GLU n 
1 332  PRO n 
1 333  GLY n 
1 334  ALA n 
1 335  PRO n 
1 336  GLY n 
1 337  ASP n 
1 338  PRO n 
1 339  LEU n 
1 340  TYR n 
1 341  LEU n 
1 342  ASP n 
1 343  VAL n 
1 344  CYS n 
1 345  SER n 
1 346  ALA n 
1 347  PHE n 
1 348  VAL n 
1 349  GLU n 
1 350  ARG n 
1 351  GLY n 
1 352  GLU n 
1 353  ALA n 
1 354  MET n 
1 355  PRO n 
1 356  LYS n 
1 357  ILE n 
1 358  LEU n 
1 359  ALA n 
1 360  GLY n 
1 361  ARG n 
1 362  TYR n 
1 363  GLY n 
1 364  LEU n 
1 365  GLY n 
1 366  SER n 
1 367  LYS n 
1 368  GLU n 
1 369  PHE n 
1 370  SER n 
1 371  PRO n 
1 372  ALA n 
1 373  MET n 
1 374  VAL n 
1 375  LYS n 
1 376  SER n 
1 377  VAL n 
1 378  TYR n 
1 379  ASP n 
1 380  ASN n 
1 381  MET n 
1 382  SER n 
1 383  GLY n 
1 384  ALA n 
1 385  LYS n 
1 386  LYS n 
1 387  ASN n 
1 388  HIS n 
1 389  PHE n 
1 390  THR n 
1 391  VAL n 
1 392  GLY n 
1 393  ILE n 
1 394  GLU n 
1 395  ASP n 
1 396  ASP n 
1 397  VAL n 
1 398  THR n 
1 399  GLY n 
1 400  THR n 
1 401  SER n 
1 402  LEU n 
1 403  PRO n 
1 404  VAL n 
1 405  ASP n 
1 406  ASN n 
1 407  ALA n 
1 408  PHE n 
1 409  ALA n 
1 410  ASP n 
1 411  THR n 
1 412  THR n 
1 413  PRO n 
1 414  LYS n 
1 415  GLY n 
1 416  THR n 
1 417  ILE n 
1 418  GLN n 
1 419  CYS n 
1 420  GLN n 
1 421  PHE n 
1 422  TRP n 
1 423  GLY n 
1 424  LEU n 
1 425  GLY n 
1 426  ALA n 
1 427  ASP n 
1 428  GLY n 
1 429  THR n 
1 430  VAL n 
1 431  GLY n 
1 432  ALA n 
1 433  ASN n 
1 434  LYS n 
1 435  GLN n 
1 436  ALA n 
1 437  ILE n 
1 438  LYS n 
1 439  ILE n 
1 440  ILE n 
1 441  GLY n 
1 442  ASP n 
1 443  ASN n 
1 444  THR n 
1 445  ASP n 
1 446  LEU n 
1 447  PHE n 
1 448  ALA n 
1 449  GLN n 
1 450  GLY n 
1 451  TYR n 
1 452  PHE n 
1 453  SER n 
1 454  TYR n 
1 455  ASP n 
1 456  SER n 
1 457  LYS n 
1 458  LYS n 
1 459  SER n 
1 460  GLY n 
1 461  GLY n 
1 462  ILE n 
1 463  THR n 
1 464  ILE n 
1 465  SER n 
1 466  HIS n 
1 467  LEU n 
1 468  ARG n 
1 469  PHE n 
1 470  GLY n 
1 471  GLU n 
1 472  LYS n 
1 473  PRO n 
1 474  ILE n 
1 475  GLN n 
1 476  SER n 
1 477  THR n 
1 478  TYR n 
1 479  LEU n 
1 480  VAL n 
1 481  ASN n 
1 482  ARG n 
1 483  ALA n 
1 484  ASP n 
1 485  TYR n 
1 486  VAL n 
1 487  ALA n 
1 488  CYS n 
1 489  HIS n 
1 490  ASN n 
1 491  PRO n 
1 492  ALA n 
1 493  TYR n 
1 494  VAL n 
1 495  GLY n 
1 496  ILE n 
1 497  TYR n 
1 498  ASP n 
1 499  ILE n 
1 500  LEU n 
1 501  GLU n 
1 502  GLY n 
1 503  ILE n 
1 504  LYS n 
1 505  ASP n 
1 506  GLY n 
1 507  GLY n 
1 508  THR n 
1 509  PHE n 
1 510  VAL n 
1 511  LEU n 
1 512  ASN n 
1 513  SER n 
1 514  PRO n 
1 515  TRP n 
1 516  SER n 
1 517  SER n 
1 518  LEU n 
1 519  GLU n 
1 520  ASP n 
1 521  MET n 
1 522  ASP n 
1 523  LYS n 
1 524  HIS n 
1 525  LEU n 
1 526  PRO n 
1 527  SER n 
1 528  GLY n 
1 529  ILE n 
1 530  LYS n 
1 531  ARG n 
1 532  THR n 
1 533  ILE n 
1 534  ALA n 
1 535  ASN n 
1 536  LYS n 
1 537  LYS n 
1 538  LEU n 
1 539  LYS n 
1 540  PHE n 
1 541  TYR n 
1 542  ASN n 
1 543  ILE n 
1 544  ASP n 
1 545  ALA n 
1 546  VAL n 
1 547  LYS n 
1 548  ILE n 
1 549  ALA n 
1 550  THR n 
1 551  ASP n 
1 552  VAL n 
1 553  GLY n 
1 554  LEU n 
1 555  GLY n 
1 556  GLY n 
1 557  ARG n 
1 558  ILE n 
1 559  ASN n 
1 560  MET n 
1 561  ILE n 
1 562  MET n 
1 563  GLN n 
1 564  THR n 
1 565  ALA n 
1 566  PHE n 
1 567  PHE n 
1 568  LYS n 
1 569  LEU n 
1 570  ALA n 
1 571  GLY n 
1 572  VAL n 
1 573  LEU n 
1 574  PRO n 
1 575  PHE n 
1 576  GLU n 
1 577  LYS n 
1 578  ALA n 
1 579  VAL n 
1 580  ASP n 
1 581  LEU n 
1 582  LEU n 
1 583  LYS n 
1 584  LYS n 
1 585  SER n 
1 586  ILE n 
1 587  HIS n 
1 588  LYS n 
1 589  ALA n 
1 590  TYR n 
1 591  GLY n 
1 592  LYS n 
1 593  LYS n 
1 594  GLY n 
1 595  GLU n 
1 596  LYS n 
1 597  ILE n 
1 598  VAL n 
1 599  LYS n 
1 600  MET n 
1 601  ASN n 
1 602  THR n 
1 603  ASP n 
1 604  ALA n 
1 605  VAL n 
1 606  ASP n 
1 607  GLN n 
1 608  ALA n 
1 609  VAL n 
1 610  THR n 
1 611  SER n 
1 612  LEU n 
1 613  GLN n 
1 614  GLU n 
1 615  PHE n 
1 616  LYS n 
1 617  TYR n 
1 618  PRO n 
1 619  ASP n 
1 620  SER n 
1 621  TRP n 
1 622  LYS n 
1 623  ASP n 
1 624  ALA n 
1 625  PRO n 
1 626  ALA n 
1 627  GLU n 
1 628  THR n 
1 629  LYS n 
1 630  ALA n 
1 631  GLU n 
1 632  PRO n 
1 633  MET n 
1 634  THR n 
1 635  ASN n 
1 636  GLU n 
1 637  PHE n 
1 638  PHE n 
1 639  LYS n 
1 640  ASN n 
1 641  VAL n 
1 642  VAL n 
1 643  LYS n 
1 644  PRO n 
1 645  ILE n 
1 646  LEU n 
1 647  THR n 
1 648  GLN n 
1 649  GLN n 
1 650  GLY n 
1 651  ASP n 
1 652  LYS n 
1 653  LEU n 
1 654  PRO n 
1 655  VAL n 
1 656  SER n 
1 657  ALA n 
1 658  PHE n 
1 659  GLU n 
1 660  ALA n 
1 661  ASP n 
1 662  GLY n 
1 663  ARG n 
1 664  PHE n 
1 665  PRO n 
1 666  LEU n 
1 667  GLY n 
1 668  THR n 
1 669  SER n 
1 670  GLN n 
1 671  PHE n 
1 672  GLU n 
1 673  LYS n 
1 674  ARG n 
1 675  GLY n 
1 676  VAL n 
1 677  ALA n 
1 678  ILE n 
1 679  ASN n 
1 680  VAL n 
1 681  PRO n 
1 682  GLN n 
1 683  TRP n 
1 684  VAL n 
1 685  PRO n 
1 686  GLU n 
1 687  ASN n 
1 688  CYS n 
1 689  ILE n 
1 690  GLN n 
1 691  CYS n 
1 692  ASN n 
1 693  GLN n 
1 694  CYS n 
1 695  ALA n 
1 696  PHE n 
1 697  VAL n 
1 698  CYS n 
1 699  PRO n 
1 700  HIS n 
1 701  SER n 
1 702  ALA n 
1 703  ILE n 
1 704  LEU n 
1 705  PRO n 
1 706  VAL n 
1 707  LEU n 
1 708  ALA n 
1 709  LYS n 
1 710  GLU n 
1 711  GLU n 
1 712  GLU n 
1 713  LEU n 
1 714  VAL n 
1 715  GLY n 
1 716  ALA n 
1 717  PRO n 
1 718  ALA n 
1 719  ASN n 
1 720  PHE n 
1 721  THR n 
1 722  ALA n 
1 723  LEU n 
1 724  GLU n 
1 725  ALA n 
1 726  LYS n 
1 727  GLY n 
1 728  LYS n 
1 729  GLU n 
1 730  LEU n 
1 731  LYS n 
1 732  GLY n 
1 733  TYR n 
1 734  LYS n 
1 735  PHE n 
1 736  ARG n 
1 737  ILE n 
1 738  GLN n 
1 739  ILE n 
1 740  ASN n 
1 741  THR n 
1 742  LEU n 
1 743  ASP n 
1 744  CYS n 
1 745  MET n 
1 746  GLY n 
1 747  CYS n 
1 748  GLY n 
1 749  ASN n 
1 750  CYS n 
1 751  ALA n 
1 752  ASP n 
1 753  ILE n 
1 754  CYS n 
1 755  PRO n 
1 756  PRO n 
1 757  LYS n 
1 758  GLU n 
1 759  LYS n 
1 760  ALA n 
1 761  LEU n 
1 762  VAL n 
1 763  MET n 
1 764  GLN n 
1 765  PRO n 
1 766  LEU n 
1 767  ASP n 
1 768  THR n 
1 769  GLN n 
1 770  ARG n 
1 771  ASP n 
1 772  ALA n 
1 773  GLN n 
1 774  VAL n 
1 775  PRO n 
1 776  ASN n 
1 777  LEU n 
1 778  GLU n 
1 779  TYR n 
1 780  ALA n 
1 781  ALA n 
1 782  ARG n 
1 783  ILE n 
1 784  PRO n 
1 785  VAL n 
1 786  LYS n 
1 787  SER n 
1 788  GLU n 
1 789  VAL n 
1 790  LEU n 
1 791  PRO n 
1 792  ARG n 
1 793  ASP n 
1 794  SER n 
1 795  LEU n 
1 796  LYS n 
1 797  GLY n 
1 798  SER n 
1 799  GLN n 
1 800  PHE n 
1 801  GLN n 
1 802  GLU n 
1 803  PRO n 
1 804  LEU n 
1 805  MET n 
1 806  GLU n 
1 807  PHE n 
1 808  SER n 
1 809  GLY n 
1 810  ALA n 
1 811  CYS n 
1 812  SER n 
1 813  GLY n 
1 814  CYS n 
1 815  GLY n 
1 816  GLU n 
1 817  THR n 
1 818  PRO n 
1 819  TYR n 
1 820  VAL n 
1 821  ARG n 
1 822  VAL n 
1 823  ILE n 
1 824  THR n 
1 825  GLN n 
1 826  LEU n 
1 827  PHE n 
1 828  GLY n 
1 829  GLU n 
1 830  ARG n 
1 831  MET n 
1 832  PHE n 
1 833  ILE n 
1 834  ALA n 
1 835  ASN n 
1 836  ALA n 
1 837  THR n 
1 838  GLY n 
1 839  CYS n 
1 840  SER n 
1 841  SER n 
1 842  ILE n 
1 843  TRP n 
1 844  GLY n 
1 845  ALA n 
1 846  SER n 
1 847  ALA n 
1 848  PRO n 
1 849  SER n 
1 850  MET n 
1 851  PRO n 
1 852  TYR n 
1 853  LYS n 
1 854  THR n 
1 855  ASN n 
1 856  ARG n 
1 857  LEU n 
1 858  GLY n 
1 859  GLN n 
1 860  GLY n 
1 861  PRO n 
1 862  ALA n 
1 863  TRP n 
1 864  GLY n 
1 865  ASN n 
1 866  SER n 
1 867  LEU n 
1 868  PHE n 
1 869  GLU n 
1 870  ASP n 
1 871  ALA n 
1 872  ALA n 
1 873  GLU n 
1 874  TYR n 
1 875  GLY n 
1 876  PHE n 
1 877  GLY n 
1 878  MET n 
1 879  ASN n 
1 880  MET n 
1 881  SER n 
1 882  MET n 
1 883  PHE n 
1 884  ALA n 
1 885  ARG n 
1 886  ARG n 
1 887  THR n 
1 888  HIS n 
1 889  LEU n 
1 890  ALA n 
1 891  ASP n 
1 892  LEU n 
1 893  ALA n 
1 894  ALA n 
1 895  LYS n 
1 896  ALA n 
1 897  LEU n 
1 898  GLU n 
1 899  SER n 
1 900  ASP n 
1 901  ALA n 
1 902  SER n 
1 903  GLY n 
1 904  ASP n 
1 905  VAL n 
1 906  LYS n 
1 907  GLU n 
1 908  ALA n 
1 909  LEU n 
1 910  GLN n 
1 911  GLY n 
1 912  TRP n 
1 913  LEU n 
1 914  ALA n 
1 915  GLY n 
1 916  LYS n 
1 917  ASN n 
1 918  ASP n 
1 919  PRO n 
1 920  ILE n 
1 921  LYS n 
1 922  SER n 
1 923  LYS n 
1 924  GLU n 
1 925  TYR n 
1 926  GLY n 
1 927  ASP n 
1 928  LYS n 
1 929  LEU n 
1 930  LYS n 
1 931  LYS n 
1 932  LEU n 
1 933  LEU n 
1 934  ALA n 
1 935  GLY n 
1 936  GLN n 
1 937  LYS n 
1 938  ASP n 
1 939  GLY n 
1 940  LEU n 
1 941  LEU n 
1 942  GLY n 
1 943  GLN n 
1 944  ILE n 
1 945  ALA n 
1 946  ALA n 
1 947  MET n 
1 948  SER n 
1 949  ASP n 
1 950  LEU n 
1 951  TYR n 
1 952  THR n 
1 953  LYS n 
1 954  LYS n 
1 955  SER n 
1 956  VAL n 
1 957  TRP n 
1 958  ILE n 
1 959  PHE n 
1 960  GLY n 
1 961  GLY n 
1 962  ASP n 
1 963  GLY n 
1 964  TRP n 
1 965  ALA n 
1 966  TYR n 
1 967  ASP n 
1 968  ILE n 
1 969  GLY n 
1 970  TYR n 
1 971  GLY n 
1 972  GLY n 
1 973  LEU n 
1 974  ASP n 
1 975  HIS n 
1 976  VAL n 
1 977  LEU n 
1 978  ALA n 
1 979  SER n 
1 980  GLY n 
1 981  GLU n 
1 982  ASP n 
1 983  VAL n 
1 984  ASN n 
1 985  VAL n 
1 986  PHE n 
1 987  VAL n 
1 988  MET n 
1 989  ASP n 
1 990  THR n 
1 991  GLU n 
1 992  VAL n 
1 993  TYR n 
1 994  SER n 
1 995  ASN n 
1 996  THR n 
1 997  GLY n 
1 998  GLY n 
1 999  GLN n 
1 1000 SER n 
1 1001 SER n 
1 1002 LYS n 
1 1003 ALA n 
1 1004 THR n 
1 1005 PRO n 
1 1006 THR n 
1 1007 GLY n 
1 1008 ALA n 
1 1009 VAL n 
1 1010 ALA n 
1 1011 LYS n 
1 1012 PHE n 
1 1013 ALA n 
1 1014 ALA n 
1 1015 ALA n 
1 1016 GLY n 
1 1017 LYS n 
1 1018 ARG n 
1 1019 THR n 
1 1020 GLY n 
1 1021 LYS n 
1 1022 LYS n 
1 1023 ASP n 
1 1024 LEU n 
1 1025 ALA n 
1 1026 ARG n 
1 1027 MET n 
1 1028 VAL n 
1 1029 MET n 
1 1030 THR n 
1 1031 TYR n 
1 1032 GLY n 
1 1033 TYR n 
1 1034 VAL n 
1 1035 TYR n 
1 1036 VAL n 
1 1037 ALA n 
1 1038 THR n 
1 1039 VAL n 
1 1040 SER n 
1 1041 MET n 
1 1042 GLY n 
1 1043 TYR n 
1 1044 SER n 
1 1045 LYS n 
1 1046 GLN n 
1 1047 GLN n 
1 1048 PHE n 
1 1049 LEU n 
1 1050 LYS n 
1 1051 VAL n 
1 1052 LEU n 
1 1053 LYS n 
1 1054 GLU n 
1 1055 ALA n 
1 1056 GLU n 
1 1057 SER n 
1 1058 PHE n 
1 1059 PRO n 
1 1060 GLY n 
1 1061 PRO n 
1 1062 SER n 
1 1063 LEU n 
1 1064 VAL n 
1 1065 ILE n 
1 1066 ALA n 
1 1067 TYR n 
1 1068 ALA n 
1 1069 THR n 
1 1070 CYS n 
1 1071 ILE n 
1 1072 ASN n 
1 1073 GLN n 
1 1074 GLY n 
1 1075 LEU n 
1 1076 ARG n 
1 1077 LYS n 
1 1078 GLY n 
1 1079 MET n 
1 1080 GLY n 
1 1081 LYS n 
1 1082 SER n 
1 1083 GLN n 
1 1084 ASP n 
1 1085 VAL n 
1 1086 MET n 
1 1087 ASN n 
1 1088 THR n 
1 1089 ALA n 
1 1090 VAL n 
1 1091 LYS n 
1 1092 SER n 
1 1093 GLY n 
1 1094 TYR n 
1 1095 TRP n 
1 1096 PRO n 
1 1097 LEU n 
1 1098 PHE n 
1 1099 ARG n 
1 1100 TYR n 
1 1101 ASP n 
1 1102 PRO n 
1 1103 ARG n 
1 1104 LEU n 
1 1105 ALA n 
1 1106 ALA n 
1 1107 GLN n 
1 1108 GLY n 
1 1109 LYS n 
1 1110 ASN n 
1 1111 PRO n 
1 1112 PHE n 
1 1113 GLN n 
1 1114 LEU n 
1 1115 ASP n 
1 1116 SER n 
1 1117 LYS n 
1 1118 ALA n 
1 1119 PRO n 
1 1120 ASP n 
1 1121 GLY n 
1 1122 SER n 
1 1123 VAL n 
1 1124 GLU n 
1 1125 GLU n 
1 1126 PHE n 
1 1127 LEU n 
1 1128 MET n 
1 1129 ALA n 
1 1130 GLN n 
1 1131 ASN n 
1 1132 ARG n 
1 1133 PHE n 
1 1134 ALA n 
1 1135 VAL n 
1 1136 LEU n 
1 1137 ASP n 
1 1138 ARG n 
1 1139 SER n 
1 1140 PHE n 
1 1141 PRO n 
1 1142 GLU n 
1 1143 ASP n 
1 1144 ALA n 
1 1145 LYS n 
1 1146 ARG n 
1 1147 LEU n 
1 1148 ARG n 
1 1149 ALA n 
1 1150 GLN n 
1 1151 VAL n 
1 1152 ALA n 
1 1153 HIS n 
1 1154 GLU n 
1 1155 LEU n 
1 1156 ASP n 
1 1157 VAL n 
1 1158 ARG n 
1 1159 PHE n 
1 1160 LYS n 
1 1161 GLU n 
1 1162 LEU n 
1 1163 GLU n 
1 1164 HIS n 
1 1165 MET n 
1 1166 ALA n 
1 1167 ALA n 
1 1168 THR n 
1 1169 ASN n 
1 1170 ILE n 
1 1171 PHE n 
1 1172 GLU n 
1 1173 SER n 
1 1174 PHE n 
1 1175 ALA n 
1 1176 PRO n 
1 1177 ALA n 
1 1178 GLY n 
1 1179 GLY n 
1 1180 LYS n 
1 1181 ALA n 
1 1182 ASP n 
1 1183 GLY n 
1 1184 SER n 
1 1185 VAL n 
1 1186 ASP n 
1 1187 PHE n 
1 1188 GLY n 
1 1189 GLU n 
1 1190 GLY n 
1 1191 ALA n 
1 1192 GLU n 
1 1193 PHE n 
1 1194 CYS n 
1 1195 THR n 
1 1196 ARG n 
1 1197 ASP n 
1 1198 ASP n 
1 1199 THR n 
1 1200 PRO n 
1 1201 MET n 
1 1202 MET n 
1 1203 ALA n 
1 1204 ARG n 
1 1205 PRO n 
1 1206 ASP n 
1 1207 SER n 
1 1208 GLY n 
1 1209 GLU n 
1 1210 ALA n 
1 1211 CYS n 
1 1212 ASP n 
1 1213 GLN n 
1 1214 ASN n 
1 1215 ARG n 
1 1216 ALA n 
1 1217 GLY n 
1 1218 THR n 
1 1219 SER n 
1 1220 GLU n 
1 1221 GLN n 
1 1222 GLN n 
1 1223 GLY n 
1 1224 ASP n 
1 1225 LEU n 
1 1226 SER n 
1 1227 LYS n 
1 1228 ARG n 
1 1229 THR n 
1 1230 LYS n 
1 1231 LYS n 
# 
_entity_src_nat.entity_id                  1 
_entity_src_nat.pdbx_src_id                1 
_entity_src_nat.pdbx_alt_source_flag       sample 
_entity_src_nat.pdbx_beg_seq_num           ? 
_entity_src_nat.pdbx_end_seq_num           ? 
_entity_src_nat.common_name                ? 
_entity_src_nat.pdbx_organism_scientific   'Desulfovibrio africanus' 
_entity_src_nat.pdbx_ncbi_taxonomy_id      873 
_entity_src_nat.genus                      Desulfovibrio 
_entity_src_nat.species                    ? 
_entity_src_nat.strain                     'NCIB 8401' 
_entity_src_nat.tissue                     ? 
_entity_src_nat.tissue_fraction            ? 
_entity_src_nat.pdbx_secretion             ? 
_entity_src_nat.pdbx_fragment              ? 
_entity_src_nat.pdbx_variant               ? 
_entity_src_nat.pdbx_cell_line             ? 
_entity_src_nat.pdbx_atcc                  ? 
_entity_src_nat.pdbx_cellular_location     CYTOPLASM 
_entity_src_nat.pdbx_organ                 ? 
_entity_src_nat.pdbx_organelle             ? 
_entity_src_nat.pdbx_cell                  ? 
_entity_src_nat.pdbx_plasmid_name          ? 
_entity_src_nat.pdbx_plasmid_details       ? 
_entity_src_nat.details                    ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    P94692_DESAF 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P94692 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1B0P A 1 ? 1231 ? P94692 2 ? 1232 ? 2 1232 
2 1 1B0P B 1 ? 1231 ? P94692 2 ? 1232 ? 2 1232 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                ? 'C3 H7 N O2'           89.093  
ARG 'L-peptide linking' y ARGININE               ? 'C6 H15 N4 O2 1'       175.209 
ASN 'L-peptide linking' y ASPARAGINE             ? 'C4 H8 N2 O3'          132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'        ? 'C4 H7 N O4'           133.103 
CA  non-polymer         . 'CALCIUM ION'          ? 'Ca 2'                 40.078  
CYS 'L-peptide linking' y CYSTEINE               ? 'C3 H7 N O2 S'         121.158 
GLN 'L-peptide linking' y GLUTAMINE              ? 'C5 H10 N2 O3'         146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'        ? 'C5 H9 N O4'           147.129 
GLY 'peptide linking'   y GLYCINE                ? 'C2 H5 N O2'           75.067  
HIS 'L-peptide linking' y HISTIDINE              ? 'C6 H10 N3 O2 1'       156.162 
HOH non-polymer         . WATER                  ? 'H2 O'                 18.015  
ILE 'L-peptide linking' y ISOLEUCINE             ? 'C6 H13 N O2'          131.173 
LEU 'L-peptide linking' y LEUCINE                ? 'C6 H13 N O2'          131.173 
LYS 'L-peptide linking' y LYSINE                 ? 'C6 H15 N2 O2 1'       147.195 
MET 'L-peptide linking' y METHIONINE             ? 'C5 H11 N O2 S'        149.211 
MG  non-polymer         . 'MAGNESIUM ION'        ? 'Mg 2'                 24.305  
PHE 'L-peptide linking' y PHENYLALANINE          ? 'C9 H11 N O2'          165.189 
PRO 'L-peptide linking' y PROLINE                ? 'C5 H9 N O2'           115.130 
SER 'L-peptide linking' y SERINE                 ? 'C3 H7 N O3'           105.093 
SF4 non-polymer         . 'IRON/SULFUR CLUSTER'  ? 'Fe4 S4'               351.640 
THR 'L-peptide linking' y THREONINE              ? 'C4 H9 N O3'           119.119 
TPP non-polymer         . 'THIAMINE DIPHOSPHATE' ? 'C12 H19 N4 O7 P2 S 1' 425.314 
TRP 'L-peptide linking' y TRYPTOPHAN             ? 'C11 H12 N2 O2'        204.225 
TYR 'L-peptide linking' y TYROSINE               ? 'C9 H11 N O3'          181.189 
VAL 'L-peptide linking' y VALINE                 ? 'C5 H11 N O2'          117.146 
# 
_exptl.entry_id          1B0P 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.34 
_exptl_crystal.density_percent_sol   42 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.0 
_exptl_crystal_grow.pdbx_details    
;CRYSTALLIZATION CONDITIONS: 
PEG6000 11% 
MGCL2 100MM 
CACODYLATE 100MM PH 6.0
;
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'PRINCETON 2K' 
_diffrn_detector.pdbx_collection_date   1996-03 
_diffrn_detector.details                MIRROR 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'SILICON CRYSTAL' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0704 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE BM02' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   BM02 
_diffrn_source.pdbx_wavelength             1.0704 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1B0P 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             20 
_reflns.d_resolution_high            2.31 
_reflns.number_obs                   75568 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         68.1 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.082 
_reflns.pdbx_netI_over_sigmaI        7.4 
_reflns.B_iso_Wilson_estimate        12.0 
_reflns.pdbx_redundancy              3.2 
_reflns.R_free_details               ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.31 
_reflns_shell.d_res_low              2.49 
_reflns_shell.percent_possible_all   28.2 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.119 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 1B0P 
_refine.ls_number_reflns_obs                     69688 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             6.00 
_refine.ls_d_res_high                            2.31 
_refine.ls_percent_reflns_obs                    68.6 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.199 
_refine.ls_R_factor_R_free                       0.271 
_refine.ls_R_factor_R_free_error                 0.0045 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_number_reflns_R_free                  3556 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               6.4 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          MAD 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1B0P 
_refine_analyze.Luzzati_coordinate_error_obs    0.25 
_refine_analyze.Luzzati_sigma_a_obs             0.25 
_refine_analyze.Luzzati_d_res_low_obs           4.00 
_refine_analyze.Luzzati_coordinate_error_free   0.35 
_refine_analyze.Luzzati_sigma_a_free            0.36 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        18764 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         104 
_refine_hist.number_atoms_solvent             543 
_refine_hist.number_atoms_total               19411 
_refine_hist.d_res_high                       2.31 
_refine_hist.d_res_low                        6.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d                0.017 ?    ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_na             ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_prot           ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d               ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_na            ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_prot          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg             1.99  ?    ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_na          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_prot        ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d      25.1  ?    ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d      1.87  ?    ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
x_mcbond_it             0.43  1.50 ? ? 'X-RAY DIFFRACTION' ? 
x_mcangle_it            0.76  2.00 ? ? 'X-RAY DIFFRACTION' ? 
x_scbond_it             0.61  2.00 ? ? 'X-RAY DIFFRACTION' ? 
x_scangle_it            0.99  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_restr_ncs.dom_id 
_refine_ls_restr_ncs.ncs_model_details 
_refine_ls_restr_ncs.rms_dev_position 
_refine_ls_restr_ncs.weight_position 
_refine_ls_restr_ncs.rms_dev_B_iso 
_refine_ls_restr_ncs.weight_B_iso 
_refine_ls_restr_ncs.pdbx_type 
_refine_ls_restr_ncs.pdbx_auth_asym_id 
_refine_ls_restr_ncs.pdbx_ens_id 
_refine_ls_restr_ncs.pdbx_refine_id 
_refine_ls_restr_ncs.pdbx_ordinal 
_refine_ls_restr_ncs.pdbx_number 
1 RESTRAINTS 0.73 1   0.73 5 . . 1 'X-RAY DIFFRACTION' 1 ? 
2 ?          0.77 1   0.95 5 . . 2 'X-RAY DIFFRACTION' 2 ? 
3 ?          0.30 10  0.42 5 . . 3 'X-RAY DIFFRACTION' 3 ? 
4 ?          0.14 100 0.12 1 . . 4 'X-RAY DIFFRACTION' 4 ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   8 
_refine_ls_shell.d_res_high                       2.31 
_refine_ls_shell.d_res_low                        2.40 
_refine_ls_shell.number_reflns_R_work             2181 
_refine_ls_shell.R_factor_R_work                  0.227 
_refine_ls_shell.percent_reflns_obs               20.0 
_refine_ls_shell.R_factor_R_free                  0.306 
_refine_ls_shell.R_factor_R_free_error            0.027 
_refine_ls_shell.percent_reflns_R_free            5.4 
_refine_ls_shell.number_reflns_R_free             124 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
_pdbx_xplor_file.serial_no        1 
_pdbx_xplor_file.param_file       PARHCSDX.PRO 
_pdbx_xplor_file.topol_file       TOPHCSDX.PRO 
_pdbx_xplor_file.pdbx_refine_id   'X-RAY DIFFRACTION' 
# 
_struct_ncs_oper.id             1 
_struct_ncs_oper.code           given 
_struct_ncs_oper.details        ? 
_struct_ncs_oper.matrix[1][1]   -0.995625 
_struct_ncs_oper.matrix[1][2]   0.043420 
_struct_ncs_oper.matrix[1][3]   -0.082740 
_struct_ncs_oper.matrix[2][1]   0.041889 
_struct_ncs_oper.matrix[2][2]   -0.584115 
_struct_ncs_oper.matrix[2][3]   -0.812509 
_struct_ncs_oper.matrix[3][1]   -0.083525 
_struct_ncs_oper.matrix[3][2]   -0.810509 
_struct_ncs_oper.matrix[3][3]   0.579741 
_struct_ncs_oper.vector[1]      -39.02300 
_struct_ncs_oper.vector[2]      -68.05900 
_struct_ncs_oper.vector[3]      -36.97600 
# 
loop_
_struct_ncs_dom.id 
_struct_ncs_dom.pdbx_ens_id 
_struct_ncs_dom.details 
1 1 ? 
2 2 ? 
3 3 ? 
4 4 ? 
# 
loop_
_struct_ncs_ens.id 
_struct_ncs_ens.details 
1 ? 
2 ? 
3 ? 
4 ? 
# 
_struct.entry_id                  1B0P 
_struct.title                     'CRYSTAL STRUCTURE OF PYRUVATE-FERREDOXIN OXIDOREDUCTASE FROM DESULFOVIBRIO AFRICANUS' 
_struct.pdbx_descriptor           'PYRUVATE-FERREDOXIN OXIDOREDUCTASE' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1B0P 
_struct_keywords.pdbx_keywords   OXIDOREDUCTASE 
_struct_keywords.text            'OXIDOREDUCTASE, PYRUVATE CATABOLISM, IRON-SULFUR CLUSTER, TPP-DEPENDENT ENZYME' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 4 ? 
F N N 4 ? 
G N N 4 ? 
H N N 5 ? 
I N N 2 ? 
J N N 3 ? 
K N N 4 ? 
L N N 4 ? 
M N N 4 ? 
N N N 5 ? 
O N N 6 ? 
P N N 6 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   1   GLY A 9    ? MET A 20   ? GLY A 10   MET A 21   1 ? 12 
HELX_P HELX_P2   2   SER A 33   ? ALA A 44   ? SER A 34   ALA A 45   1 ? 12 
HELX_P HELX_P3   3   GLU A 63   ? ALA A 75   ? GLU A 64   ALA A 76   1 ? 13 
HELX_P HELX_P4   4   SER A 86   ? GLY A 101  ? SER A 87   GLY A 102  1 ? 16 
HELX_P HELX_P5   5   GLN A 127  ? ALA A 132  ? GLN A 128  ALA A 133  1 ? 6  
HELX_P HELX_P6   6   VAL A 145  ? SER A 162  ? VAL A 146  SER A 163  1 ? 18 
HELX_P HELX_P7   7   TYR A 187  ? LEU A 193  ? TYR A 188  LEU A 194  1 ? 7  
HELX_P HELX_P8   8   GLN A 196  ? LYS A 205  ? GLN A 197  LYS A 206  1 ? 10 
HELX_P HELX_P9   9   PRO A 221  ? THR A 253  ? PRO A 222  THR A 254  1 ? 33 
HELX_P HELX_P10  10  SER A 277  ? LYS A 292  ? SER A 278  LYS A 293  5 ? 16 
HELX_P HELX_P11  11  SER A 309  ? ALA A 314  ? SER A 310  ALA A 315  1 ? 6  
HELX_P HELX_P12  12  PRO A 338  ? ARG A 350  ? PRO A 339  ARG A 351  1 ? 13 
HELX_P HELX_P13  13  LEU A 364  ? SER A 366  ? LEU A 365  SER A 367  5 ? 3  
HELX_P HELX_P14  14  PRO A 371  ? SER A 382  ? PRO A 372  SER A 383  1 ? 12 
HELX_P HELX_P15  15  THR A 429  ? ASN A 443  ? THR A 430  ASN A 444  1 ? 15 
HELX_P HELX_P16  16  PRO A 491  ? VAL A 494  ? PRO A 492  VAL A 495  5 ? 4  
HELX_P HELX_P17  17  LEU A 518  ? HIS A 524  ? LEU A 519  HIS A 525  1 ? 7  
HELX_P HELX_P18  18  SER A 527  ? ASN A 535  ? SER A 528  ASN A 536  1 ? 9  
HELX_P HELX_P19  19  ALA A 545  ? ASP A 551  ? ALA A 546  ASP A 552  1 ? 7  
HELX_P HELX_P20  20  ASN A 559  ? LEU A 569  ? ASN A 560  LEU A 570  1 ? 11 
HELX_P HELX_P21  21  PHE A 575  ? LYS A 588  ? PHE A 576  LYS A 589  1 ? 14 
HELX_P HELX_P22  22  ILE A 597  ? SER A 611  ? ILE A 598  SER A 612  1 ? 15 
HELX_P HELX_P23  23  ASP A 619  ? ASP A 623  ? ASP A 620  ASP A 624  5 ? 5  
HELX_P HELX_P24  24  GLU A 636  ? ASN A 640  ? GLU A 637  ASN A 641  1 ? 5  
HELX_P HELX_P25  25  VAL A 642  ? LEU A 646  ? VAL A 643  LEU A 647  1 ? 5  
HELX_P HELX_P26  26  GLY A 650  ? LYS A 652  ? GLY A 651  LYS A 653  5 ? 3  
HELX_P HELX_P27  27  VAL A 655  ? ALA A 657  ? VAL A 656  ALA A 658  5 ? 3  
HELX_P HELX_P28  28  THR A 668  ? PHE A 671  ? THR A 669  PHE A 672  5 ? 4  
HELX_P HELX_P29  29  PRO A 685  ? ASN A 687  ? PRO A 686  ASN A 688  5 ? 3  
HELX_P HELX_P30  30  GLN A 693  ? VAL A 697  ? GLN A 694  VAL A 698  1 ? 5  
HELX_P HELX_P31  31  GLU A 710  ? GLU A 712  ? GLU A 711  GLU A 713  5 ? 3  
HELX_P HELX_P32  32  ASN A 749  ? ILE A 753  ? ASN A 750  ILE A 754  1 ? 5  
HELX_P HELX_P33  33  LEU A 766  ? ARG A 782  ? LEU A 767  ARG A 783  1 ? 17 
HELX_P HELX_P34  34  LEU A 795  ? PHE A 800  ? LEU A 796  PHE A 801  1 ? 6  
HELX_P HELX_P35  35  THR A 817  ? ARG A 830  ? THR A 818  ARG A 831  1 ? 14 
HELX_P HELX_P36  36  CYS A 839  ? ALA A 845  ? CYS A 840  ALA A 846  1 ? 7  
HELX_P HELX_P37  37  ALA A 871  ? GLU A 898  ? ALA A 872  GLU A 899  1 ? 28 
HELX_P HELX_P38  38  GLY A 903  ? ALA A 914  ? GLY A 904  ALA A 915  1 ? 12 
HELX_P HELX_P39  39  LYS A 921  ? LEU A 932  ? LYS A 922  LEU A 933  1 ? 12 
HELX_P HELX_P40  40  LEU A 940  ? LEU A 950  ? LEU A 941  LEU A 951  1 ? 11 
HELX_P HELX_P41  41  ASP A 962  ? TYR A 966  ? ASP A 963  TYR A 967  1 ? 5  
HELX_P HELX_P42  42  TYR A 970  ? ALA A 978  ? TYR A 971  ALA A 979  1 ? 9  
HELX_P HELX_P43  43  LEU A 1024 ? TYR A 1031 ? LEU A 1025 TYR A 1032 1 ? 8  
HELX_P HELX_P44  44  LYS A 1045 ? SER A 1057 ? LYS A 1046 SER A 1058 1 ? 13 
HELX_P HELX_P45  45  ILE A 1071 ? GLN A 1073 ? ILE A 1072 GLN A 1074 5 ? 3  
HELX_P HELX_P46  46  MET A 1079 ? LYS A 1091 ? MET A 1080 LYS A 1092 5 ? 13 
HELX_P HELX_P47  47  PRO A 1102 ? GLN A 1107 ? PRO A 1103 GLN A 1108 1 ? 6  
HELX_P HELX_P48  48  VAL A 1123 ? MET A 1128 ? VAL A 1124 MET A 1129 1 ? 6  
HELX_P HELX_P49  49  ASN A 1131 ? SER A 1139 ? ASN A 1132 SER A 1140 1 ? 9  
HELX_P HELX_P50  50  PRO A 1141 ? ALA A 1167 ? PRO A 1142 ALA A 1168 1 ? 27 
HELX_P HELX_P51  51  SER A 1219 ? THR A 1229 ? SER A 1220 THR A 1230 1 ? 11 
HELX_P HELX_P52  52  GLY B 9    ? MET B 20   ? GLY B 10   MET B 21   1 ? 12 
HELX_P HELX_P53  53  SER B 33   ? ALA B 44   ? SER B 34   ALA B 45   1 ? 12 
HELX_P HELX_P54  54  GLU B 63   ? ALA B 75   ? GLU B 64   ALA B 76   1 ? 13 
HELX_P HELX_P55  55  SER B 86   ? GLY B 101  ? SER B 87   GLY B 102  1 ? 16 
HELX_P HELX_P56  56  GLN B 127  ? THR B 135  ? GLN B 128  THR B 136  1 ? 9  
HELX_P HELX_P57  57  VAL B 145  ? SER B 162  ? VAL B 146  SER B 163  1 ? 18 
HELX_P HELX_P58  58  TYR B 187  ? LEU B 193  ? TYR B 188  LEU B 194  1 ? 7  
HELX_P HELX_P59  59  GLN B 196  ? LYS B 205  ? GLN B 197  LYS B 206  1 ? 10 
HELX_P HELX_P60  60  PRO B 209  ? HIS B 211  ? PRO B 210  HIS B 212  5 ? 3  
HELX_P HELX_P61  61  TYR B 224  ? GLU B 229  ? TYR B 225  GLU B 230  1 ? 6  
HELX_P HELX_P62  62  ASN B 232  ? THR B 253  ? ASN B 233  THR B 254  1 ? 22 
HELX_P HELX_P63  63  SER B 277  ? LYS B 292  ? SER B 278  LYS B 293  5 ? 16 
HELX_P HELX_P64  64  SER B 309  ? ALA B 314  ? SER B 310  ALA B 315  1 ? 6  
HELX_P HELX_P65  65  PRO B 338  ? ARG B 350  ? PRO B 339  ARG B 351  1 ? 13 
HELX_P HELX_P66  66  LEU B 364  ? SER B 366  ? LEU B 365  SER B 367  5 ? 3  
HELX_P HELX_P67  67  PRO B 371  ? SER B 382  ? PRO B 372  SER B 383  1 ? 12 
HELX_P HELX_P68  68  THR B 429  ? ASN B 443  ? THR B 430  ASN B 444  1 ? 15 
HELX_P HELX_P69  69  PRO B 491  ? ILE B 496  ? PRO B 492  ILE B 497  5 ? 6  
HELX_P HELX_P70  70  LEU B 518  ? HIS B 524  ? LEU B 519  HIS B 525  1 ? 7  
HELX_P HELX_P71  71  SER B 527  ? ASN B 535  ? SER B 528  ASN B 536  1 ? 9  
HELX_P HELX_P72  72  ALA B 545  ? ASP B 551  ? ALA B 546  ASP B 552  1 ? 7  
HELX_P HELX_P73  73  ASN B 559  ? LEU B 569  ? ASN B 560  LEU B 570  1 ? 11 
HELX_P HELX_P74  74  PHE B 575  ? LYS B 588  ? PHE B 576  LYS B 589  1 ? 14 
HELX_P HELX_P75  75  ILE B 597  ? SER B 611  ? ILE B 598  SER B 612  1 ? 15 
HELX_P HELX_P76  76  ASP B 619  ? ASP B 623  ? ASP B 620  ASP B 624  5 ? 5  
HELX_P HELX_P77  77  GLU B 636  ? ASN B 640  ? GLU B 637  ASN B 641  1 ? 5  
HELX_P HELX_P78  78  VAL B 642  ? LEU B 646  ? VAL B 643  LEU B 647  1 ? 5  
HELX_P HELX_P79  79  GLY B 650  ? LYS B 652  ? GLY B 651  LYS B 653  5 ? 3  
HELX_P HELX_P80  80  VAL B 655  ? ALA B 657  ? VAL B 656  ALA B 658  5 ? 3  
HELX_P HELX_P81  81  THR B 668  ? PHE B 671  ? THR B 669  PHE B 672  5 ? 4  
HELX_P HELX_P82  82  PRO B 685  ? ASN B 687  ? PRO B 686  ASN B 688  5 ? 3  
HELX_P HELX_P83  83  GLN B 693  ? VAL B 697  ? GLN B 694  VAL B 698  1 ? 5  
HELX_P HELX_P84  84  GLU B 710  ? LEU B 713  ? GLU B 711  LEU B 714  5 ? 4  
HELX_P HELX_P85  85  ASN B 749  ? ILE B 753  ? ASN B 750  ILE B 754  1 ? 5  
HELX_P HELX_P86  86  LEU B 766  ? ARG B 782  ? LEU B 767  ARG B 783  1 ? 17 
HELX_P HELX_P87  87  LEU B 795  ? PHE B 800  ? LEU B 796  PHE B 801  1 ? 6  
HELX_P HELX_P88  88  THR B 817  ? ARG B 830  ? THR B 818  ARG B 831  1 ? 14 
HELX_P HELX_P89  89  CYS B 839  ? ALA B 845  ? CYS B 840  ALA B 846  1 ? 7  
HELX_P HELX_P90  90  ALA B 871  ? GLU B 898  ? ALA B 872  GLU B 899  1 ? 28 
HELX_P HELX_P91  91  GLY B 903  ? ALA B 914  ? GLY B 904  ALA B 915  1 ? 12 
HELX_P HELX_P92  92  LYS B 921  ? LEU B 932  ? LYS B 922  LEU B 933  1 ? 12 
HELX_P HELX_P93  93  GLY B 939  ? TYR B 951  ? GLY B 940  TYR B 952  1 ? 13 
HELX_P HELX_P94  94  ASP B 962  ? TYR B 966  ? ASP B 963  TYR B 967  1 ? 5  
HELX_P HELX_P95  95  TYR B 970  ? ALA B 978  ? TYR B 971  ALA B 979  1 ? 9  
HELX_P HELX_P96  96  LEU B 1024 ? TYR B 1031 ? LEU B 1025 TYR B 1032 1 ? 8  
HELX_P HELX_P97  97  LYS B 1045 ? SER B 1057 ? LYS B 1046 SER B 1058 1 ? 13 
HELX_P HELX_P98  98  ILE B 1071 ? GLN B 1073 ? ILE B 1072 GLN B 1074 5 ? 3  
HELX_P HELX_P99  99  MET B 1079 ? LYS B 1091 ? MET B 1080 LYS B 1092 5 ? 13 
HELX_P HELX_P100 100 PRO B 1102 ? GLN B 1107 ? PRO B 1103 GLN B 1108 1 ? 6  
HELX_P HELX_P101 101 VAL B 1123 ? MET B 1128 ? VAL B 1124 MET B 1129 1 ? 6  
HELX_P HELX_P102 102 ASN B 1131 ? SER B 1139 ? ASN B 1132 SER B 1140 1 ? 9  
HELX_P HELX_P103 103 PRO B 1141 ? ALA B 1166 ? PRO B 1142 ALA B 1167 1 ? 26 
HELX_P HELX_P104 104 SER B 1219 ? THR B 1229 ? SER B 1220 THR B 1230 1 ? 11 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1  disulf ? ? A CYS 1194 SG  ? ? ? 1_555 A CYS 1211 SG  ? ? A CYS 1195 A CYS 1212 1_555 ? ? ? ? ? ? ? 2.024 ? 
disulf2  disulf ? ? B CYS 1194 SG  ? ? ? 1_555 B CYS 1211 SG  ? ? B CYS 1195 B CYS 1212 1_555 ? ? ? ? ? ? ? 2.007 ? 
metalc1  metalc ? ? A CYS 688  SG  ? ? ? 1_555 E SF4 .    FE1 ? ? A CYS 689  A SF4 1233 1_555 ? ? ? ? ? ? ? 2.339 ? 
metalc2  metalc ? ? A CYS 691  SG  ? ? ? 1_555 E SF4 .    FE2 ? ? A CYS 692  A SF4 1233 1_555 ? ? ? ? ? ? ? 2.325 ? 
metalc3  metalc ? ? A CYS 694  SG  ? ? ? 1_555 E SF4 .    FE3 ? ? A CYS 695  A SF4 1233 1_555 ? ? ? ? ? ? ? 2.373 ? 
metalc4  metalc ? ? A CYS 698  SG  ? ? ? 1_555 F SF4 .    FE1 ? ? A CYS 699  A SF4 1234 1_555 ? ? ? ? ? ? ? 2.243 ? 
metalc5  metalc ? ? A CYS 744  SG  ? ? ? 1_555 F SF4 .    FE2 ? ? A CYS 745  A SF4 1234 1_555 ? ? ? ? ? ? ? 2.364 ? 
metalc6  metalc ? ? A CYS 747  SG  ? ? ? 1_555 F SF4 .    FE4 ? ? A CYS 748  A SF4 1234 1_555 ? ? ? ? ? ? ? 2.308 ? 
metalc7  metalc ? ? A CYS 750  SG  ? ? ? 1_555 F SF4 .    FE3 ? ? A CYS 751  A SF4 1234 1_555 ? ? ? ? ? ? ? 2.346 ? 
metalc8  metalc ? ? A CYS 754  SG  ? ? ? 1_555 E SF4 .    FE4 ? ? A CYS 755  A SF4 1233 1_555 ? ? ? ? ? ? ? 2.328 ? 
metalc9  metalc ? ? A CYS 811  SG  ? ? ? 1_555 G SF4 .    FE1 ? ? A CYS 812  A SF4 1235 1_555 ? ? ? ? ? ? ? 2.285 ? 
metalc10 metalc ? ? A CYS 814  SG  ? ? ? 1_555 G SF4 .    FE2 ? ? A CYS 815  A SF4 1235 1_555 ? ? ? ? ? ? ? 2.313 ? 
metalc11 metalc ? ? A CYS 839  SG  ? ? ? 1_555 G SF4 .    FE3 ? ? A CYS 840  A SF4 1235 1_555 ? ? ? ? ? ? ? 2.263 ? 
metalc12 metalc ? ? A ASP 962  OD1 ? ? ? 1_555 C MG  .    MG  ? ? A ASP 963  A MG  1237 1_555 ? ? ? ? ? ? ? 1.926 ? 
metalc13 metalc ? ? A ASP 982  OD1 ? ? ? 1_555 D CA  .    CA  ? ? A ASP 983  A CA  1238 1_555 ? ? ? ? ? ? ? 2.673 ? 
metalc14 metalc ? ? A ASN 984  OD1 ? ? ? 1_555 D CA  .    CA  ? ? A ASN 985  A CA  1238 1_555 ? ? ? ? ? ? ? 2.738 ? 
metalc15 metalc ? ? A THR 990  OG1 ? ? ? 1_555 C MG  .    MG  ? ? A THR 991  A MG  1237 1_555 ? ? ? ? ? ? ? 2.196 ? 
metalc16 metalc ? ? A VAL 992  O   ? ? ? 1_555 C MG  .    MG  ? ? A VAL 993  A MG  1237 1_555 ? ? ? ? ? ? ? 2.017 ? 
metalc17 metalc ? ? A ALA 1055 O   ? ? ? 1_555 D CA  .    CA  ? ? A ALA 1056 A CA  1238 1_555 ? ? ? ? ? ? ? 2.864 ? 
metalc18 metalc ? ? A PHE 1058 O   ? ? ? 1_555 D CA  .    CA  ? ? A PHE 1059 A CA  1238 1_555 ? ? ? ? ? ? ? 2.534 ? 
metalc19 metalc ? ? A GLY 1060 O   ? ? ? 1_555 D CA  .    CA  ? ? A GLY 1061 A CA  1238 1_555 ? ? ? ? ? ? ? 2.618 ? 
metalc20 metalc ? ? A CYS 1070 SG  ? ? ? 1_555 G SF4 .    FE4 ? ? A CYS 1071 A SF4 1235 1_555 ? ? ? ? ? ? ? 2.249 ? 
metalc21 metalc ? ? B CYS 688  SG  ? ? ? 1_555 K SF4 .    FE1 ? ? B CYS 689  B SF4 1233 1_555 ? ? ? ? ? ? ? 2.337 ? 
metalc22 metalc ? ? B CYS 691  SG  ? ? ? 1_555 K SF4 .    FE2 ? ? B CYS 692  B SF4 1233 1_555 ? ? ? ? ? ? ? 2.341 ? 
metalc23 metalc ? ? B CYS 694  SG  ? ? ? 1_555 K SF4 .    FE3 ? ? B CYS 695  B SF4 1233 1_555 ? ? ? ? ? ? ? 2.263 ? 
metalc24 metalc ? ? B CYS 698  SG  ? ? ? 1_555 L SF4 .    FE1 ? ? B CYS 699  B SF4 1234 1_555 ? ? ? ? ? ? ? 2.303 ? 
metalc25 metalc ? ? B CYS 744  SG  ? ? ? 1_555 L SF4 .    FE2 ? ? B CYS 745  B SF4 1234 1_555 ? ? ? ? ? ? ? 2.297 ? 
metalc26 metalc ? ? B CYS 747  SG  ? ? ? 1_555 L SF4 .    FE4 ? ? B CYS 748  B SF4 1234 1_555 ? ? ? ? ? ? ? 2.269 ? 
metalc27 metalc ? ? B CYS 750  SG  ? ? ? 1_555 L SF4 .    FE3 ? ? B CYS 751  B SF4 1234 1_555 ? ? ? ? ? ? ? 2.297 ? 
metalc28 metalc ? ? B CYS 754  SG  ? ? ? 1_555 K SF4 .    FE4 ? ? B CYS 755  B SF4 1233 1_555 ? ? ? ? ? ? ? 2.314 ? 
metalc29 metalc ? ? B CYS 811  SG  ? ? ? 1_555 M SF4 .    FE1 ? ? B CYS 812  B SF4 1235 1_555 ? ? ? ? ? ? ? 2.247 ? 
metalc30 metalc ? ? B CYS 814  SG  ? ? ? 1_555 M SF4 .    FE2 ? ? B CYS 815  B SF4 1235 1_555 ? ? ? ? ? ? ? 2.287 ? 
metalc31 metalc ? ? B CYS 839  SG  ? ? ? 1_555 M SF4 .    FE3 ? ? B CYS 840  B SF4 1235 1_555 ? ? ? ? ? ? ? 2.247 ? 
metalc32 metalc ? ? B ASP 962  OD1 ? ? ? 1_555 I MG  .    MG  ? ? B ASP 963  B MG  1237 1_555 ? ? ? ? ? ? ? 1.888 ? 
metalc33 metalc ? ? B ASP 982  OD1 ? ? ? 1_555 J CA  .    CA  ? ? B ASP 983  B CA  1238 1_555 ? ? ? ? ? ? ? 2.814 ? 
metalc34 metalc ? ? B ASN 984  OD1 ? ? ? 1_555 J CA  .    CA  ? ? B ASN 985  B CA  1238 1_555 ? ? ? ? ? ? ? 2.764 ? 
metalc35 metalc ? ? B THR 990  OG1 ? ? ? 1_555 I MG  .    MG  ? ? B THR 991  B MG  1237 1_555 ? ? ? ? ? ? ? 1.939 ? 
metalc36 metalc ? ? B VAL 992  O   ? ? ? 1_555 I MG  .    MG  ? ? B VAL 993  B MG  1237 1_555 ? ? ? ? ? ? ? 2.087 ? 
metalc37 metalc ? ? B ALA 1055 O   ? ? ? 1_555 J CA  .    CA  ? ? B ALA 1056 B CA  1238 1_555 ? ? ? ? ? ? ? 2.834 ? 
metalc38 metalc ? ? B PHE 1058 O   ? ? ? 1_555 J CA  .    CA  ? ? B PHE 1059 B CA  1238 1_555 ? ? ? ? ? ? ? 2.475 ? 
metalc39 metalc ? ? B GLY 1060 O   ? ? ? 1_555 J CA  .    CA  ? ? B GLY 1061 B CA  1238 1_555 ? ? ? ? ? ? ? 2.610 ? 
metalc40 metalc ? ? B CYS 1070 SG  ? ? ? 1_555 M SF4 .    FE4 ? ? B CYS 1071 B SF4 1235 1_555 ? ? ? ? ? ? ? 2.301 ? 
metalc41 metalc ? ? C MG  .    MG  ? ? ? 1_555 O HOH .    O   ? ? A MG  1237 A HOH 1352 1_555 ? ? ? ? ? ? ? 2.432 ? 
metalc42 metalc ? ? C MG  .    MG  ? ? ? 1_555 H TPP .    O1B ? ? A MG  1237 A TPP 1236 1_555 ? ? ? ? ? ? ? 2.023 ? 
metalc43 metalc ? ? C MG  .    MG  ? ? ? 1_555 H TPP .    O2A ? ? A MG  1237 A TPP 1236 1_555 ? ? ? ? ? ? ? 1.834 ? 
metalc44 metalc ? ? I MG  .    MG  ? ? ? 1_555 N TPP .    O2A ? ? B MG  1237 B TPP 1236 1_555 ? ? ? ? ? ? ? 2.243 ? 
metalc45 metalc ? ? I MG  .    MG  ? ? ? 1_555 N TPP .    O1B ? ? B MG  1237 B TPP 1236 1_555 ? ? ? ? ? ? ? 2.015 ? 
metalc46 metalc ? ? I MG  .    MG  ? ? ? 1_555 P HOH .    O   ? ? B MG  1237 B HOH 1489 1_555 ? ? ? ? ? ? ? 2.407 ? 
metalc47 metalc ? ? E SF4 .    FE3 ? ? ? 1_555 A CYS 754  SG  ? ? A SF4 1233 A CYS 755  1_555 ? ? ? ? ? ? ? 4.842 ? 
metalc48 metalc ? ? F SF4 .    FE4 ? ? ? 1_555 A CYS 750  SG  ? ? A SF4 1234 A CYS 751  1_555 ? ? ? ? ? ? ? 4.736 ? 
metalc49 metalc ? ? D CA  .    CA  ? ? ? 1_555 A SER 1062 OG  ? ? A CA  1238 A SER 1063 1_555 ? ? ? ? ? ? ? 3.380 ? 
metalc50 metalc ? ? D CA  .    CA  ? ? ? 1_555 A GLU 1056 O   ? ? A CA  1238 A GLU 1057 1_555 ? ? ? ? ? ? ? 3.272 ? 
metalc51 metalc ? ? L SF4 .    FE2 ? ? ? 1_555 B CYS 750  SG  ? ? B SF4 1234 B CYS 751  1_555 ? ? ? ? ? ? ? 4.692 ? 
metalc52 metalc ? ? J CA  .    CA  ? ? ? 1_555 B GLU 1056 O   ? ? B CA  1238 B GLU 1057 1_555 ? ? ? ? ? ? ? 3.171 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
metalc ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 THR 30  A . ? THR 31  A PRO 31  A ? PRO 32  A 1 -0.94 
2 ARG 305 A . ? ARG 306 A PRO 306 A ? PRO 307 A 1 0.14  
3 ALA 847 A . ? ALA 848 A PRO 848 A ? PRO 849 A 1 0.01  
4 THR 30  B . ? THR 31  B PRO 31  B ? PRO 32  B 1 0.30  
5 ARG 305 B . ? ARG 306 B PRO 306 B ? PRO 307 B 1 1.55  
6 ALA 847 B . ? ALA 848 B PRO 848 B ? PRO 849 B 1 0.05  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 2 ? 
C ? 4 ? 
D ? 6 ? 
E ? 6 ? 
F ? 2 ? 
G ? 2 ? 
H ? 6 ? 
I ? 2 ? 
J ? 2 ? 
K ? 2 ? 
L ? 4 ? 
M ? 5 ? 
N ? 6 ? 
O ? 2 ? 
P ? 2 ? 
Q ? 6 ? 
R ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? parallel      
C 1 2 ? parallel      
C 2 3 ? parallel      
C 3 4 ? parallel      
D 1 2 ? anti-parallel 
D 2 3 ? parallel      
D 3 4 ? parallel      
D 4 5 ? parallel      
D 5 6 ? parallel      
E 1 2 ? parallel      
E 2 3 ? parallel      
E 3 4 ? parallel      
E 4 5 ? anti-parallel 
E 5 6 ? anti-parallel 
F 1 2 ? anti-parallel 
G 1 2 ? anti-parallel 
H 1 2 ? parallel      
H 2 3 ? parallel      
H 3 4 ? parallel      
H 4 5 ? parallel      
H 5 6 ? parallel      
I 1 2 ? anti-parallel 
J 1 2 ? anti-parallel 
K 1 2 ? parallel      
L 1 2 ? parallel      
L 2 3 ? parallel      
L 3 4 ? parallel      
M 1 2 ? anti-parallel 
M 2 3 ? parallel      
M 3 4 ? parallel      
M 4 5 ? parallel      
N 1 2 ? parallel      
N 2 3 ? parallel      
N 3 4 ? parallel      
N 4 5 ? anti-parallel 
N 5 6 ? anti-parallel 
O 1 2 ? anti-parallel 
P 1 2 ? anti-parallel 
Q 1 2 ? parallel      
Q 2 3 ? parallel      
Q 3 4 ? parallel      
Q 4 5 ? parallel      
Q 5 6 ? parallel      
R 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LYS A 2    ? ASP A 8    ? LYS A 3    ASP A 9    
A 2 ILE A 179  ? LEU A 185  ? ILE A 180  LEU A 186  
B 1 VAL A 23   ? ILE A 26   ? VAL A 24   ILE A 27   
B 2 THR A 56   ? GLU A 59   ? THR A 57   GLU A 60   
C 1 THR A 81   ? THR A 84   ? THR A 82   THR A 85   
C 2 VAL A 107  ? ALA A 112  ? VAL A 108  ALA A 113  
C 3 PHE A 166  ? ASP A 171  ? PHE A 167  ASP A 172  
C 4 ALA A 138  ? ALA A 141  ? ALA A 139  ALA A 142  
D 1 PHE A 260  ? GLY A 264  ? PHE A 261  GLY A 265  
D 2 ILE A 296  ? VAL A 301  ? ILE A 297  VAL A 302  
D 3 ARG A 270  ? SER A 274  ? ARG A 271  SER A 275  
D 4 VAL A 322  ? ASP A 327  ? VAL A 323  ASP A 328  
D 5 ILE A 357  ? TYR A 362  ? ILE A 358  TYR A 363  
D 6 PHE A 389  ? VAL A 391  ? PHE A 390  VAL A 392  
E 1 LYS A 539  ? ILE A 543  ? LYS A 540  ILE A 544  
E 2 THR A 508  ? ASN A 512  ? THR A 509  ASN A 513  
E 3 TYR A 485  ? CYS A 488  ? TYR A 486  CYS A 489  
E 4 THR A 416  ? LEU A 424  ? THR A 417  LEU A 425  
E 5 ILE A 462  ? GLY A 470  ? ILE A 463  GLY A 471  
E 6 PHE A 447  ? SER A 453  ? PHE A 448  SER A 454  
F 1 ASN A 679  ? TRP A 683  ? ASN A 680  TRP A 684  
F 2 LEU A 761  ? PRO A 765  ? LEU A 762  PRO A 766  
G 1 ILE A 703  ? LYS A 709  ? ILE A 704  LYS A 710  
G 2 TYR A 733  ? ILE A 739  ? TYR A 734  ILE A 740  
H 1 ALA A 862  ? ASN A 865  ? ALA A 863  ASN A 866  
H 2 MET A 831  ? ASN A 835  ? MET A 832  ASN A 836  
H 3 SER A 955  ? GLY A 961  ? SER A 956  GLY A 962  
H 4 ASN A 984  ? ASP A 989  ? ASN A 985  ASP A 990  
H 5 SER A 1062 ? TYR A 1067 ? SER A 1063 TYR A 1068 
H 6 TYR A 1035 ? VAL A 1039 ? TYR A 1036 VAL A 1040 
I 1 PHE A 1098 ? TYR A 1100 ? PHE A 1099 TYR A 1101 
I 2 PHE A 1112 ? LEU A 1114 ? PHE A 1113 LEU A 1115 
J 1 LYS B 2    ? ASP B 8    ? LYS B 3    ASP B 9    
J 2 ILE B 179  ? LEU B 185  ? ILE B 180  LEU B 186  
K 1 VAL B 23   ? ILE B 26   ? VAL B 24   ILE B 27   
K 2 THR B 56   ? GLU B 59   ? THR B 57   GLU B 60   
L 1 THR B 81   ? THR B 84   ? THR B 82   THR B 85   
L 2 VAL B 107  ? ALA B 112  ? VAL B 108  ALA B 113  
L 3 PHE B 166  ? ASP B 171  ? PHE B 167  ASP B 172  
L 4 ALA B 138  ? ALA B 141  ? ALA B 139  ALA B 142  
M 1 PHE B 260  ? GLY B 264  ? PHE B 261  GLY B 265  
M 2 ILE B 296  ? VAL B 301  ? ILE B 297  VAL B 302  
M 3 ARG B 270  ? SER B 274  ? ARG B 271  SER B 275  
M 4 VAL B 322  ? ASP B 327  ? VAL B 323  ASP B 328  
M 5 ILE B 357  ? ARG B 361  ? ILE B 358  ARG B 362  
N 1 LYS B 539  ? ILE B 543  ? LYS B 540  ILE B 544  
N 2 THR B 508  ? ASN B 512  ? THR B 509  ASN B 513  
N 3 TYR B 485  ? CYS B 488  ? TYR B 486  CYS B 489  
N 4 THR B 416  ? LEU B 424  ? THR B 417  LEU B 425  
N 5 ILE B 462  ? GLY B 470  ? ILE B 463  GLY B 471  
N 6 PHE B 447  ? SER B 453  ? PHE B 448  SER B 454  
O 1 ASN B 679  ? TRP B 683  ? ASN B 680  TRP B 684  
O 2 LEU B 761  ? PRO B 765  ? LEU B 762  PRO B 766  
P 1 ILE B 703  ? LYS B 709  ? ILE B 704  LYS B 710  
P 2 TYR B 733  ? ILE B 739  ? TYR B 734  ILE B 740  
Q 1 ALA B 862  ? ASN B 865  ? ALA B 863  ASN B 866  
Q 2 MET B 831  ? ASN B 835  ? MET B 832  ASN B 836  
Q 3 SER B 955  ? GLY B 961  ? SER B 956  GLY B 962  
Q 4 ASN B 984  ? ASP B 989  ? ASN B 985  ASP B 990  
Q 5 SER B 1062 ? TYR B 1067 ? SER B 1063 TYR B 1068 
Q 6 TYR B 1035 ? VAL B 1039 ? TYR B 1036 VAL B 1040 
R 1 PHE B 1098 ? TYR B 1100 ? PHE B 1099 TYR B 1101 
R 2 PHE B 1112 ? LEU B 1114 ? PHE B 1113 LEU B 1115 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O LYS A 3    ? O LYS A 4    N VAL A 184  ? N VAL A 185  
B 1 2 O ALA A 24   ? O ALA A 25   N THR A 56   ? N THR A 57   
C 1 2 O THR A 82   ? O THR A 83   N VAL A 107  ? N VAL A 108  
C 2 3 O PHE A 108  ? O PHE A 109  N PHE A 166  ? N PHE A 167  
C 3 4 O MET A 167  ? O MET A 168  N ALA A 138  ? N ALA A 139  
D 1 2 O ASP A 261  ? O ASP A 262  N LYS A 300  ? N LYS A 301  
D 2 3 O GLY A 297  ? O GLY A 298  N ARG A 270  ? N ARG A 271  
D 3 4 O VAL A 271  ? O VAL A 272  N VAL A 322  ? N VAL A 323  
D 4 5 O ILE A 323  ? O ILE A 324  N LEU A 358  ? N LEU A 359  
D 5 6 O ARG A 361  ? O ARG A 362  N PHE A 389  ? N PHE A 390  
E 1 2 O LYS A 539  ? O LYS A 540  N PHE A 509  ? N PHE A 510  
E 2 3 O THR A 508  ? O THR A 509  N VAL A 486  ? N VAL A 487  
E 3 4 O TYR A 485  ? O TYR A 486  N GLN A 420  ? N GLN A 421  
E 4 5 O ILE A 417  ? O ILE A 418  N PHE A 469  ? N PHE A 470  
E 5 6 O ILE A 464  ? O ILE A 465  N SER A 453  ? N SER A 454  
F 1 2 O VAL A 680  ? O VAL A 681  N GLN A 764  ? N GLN A 765  
G 1 2 O LEU A 704  ? O LEU A 705  N GLN A 738  ? N GLN A 739  
H 1 2 O ALA A 862  ? O ALA A 863  N ILE A 833  ? N ILE A 834  
H 2 3 O PHE A 832  ? O PHE A 833  N SER A 955  ? N SER A 956  
H 3 4 O ILE A 958  ? O ILE A 959  N ASN A 984  ? N ASN A 985  
H 4 5 O VAL A 985  ? O VAL A 986  N SER A 1062 ? N SER A 1063 
H 5 6 O LEU A 1063 ? O LEU A 1064 N TYR A 1035 ? N TYR A 1036 
I 1 2 O ARG A 1099 ? O ARG A 1100 N GLN A 1113 ? N GLN A 1114 
J 1 2 O LYS B 3    ? O LYS B 4    N VAL B 184  ? N VAL B 185  
K 1 2 O ALA B 24   ? O ALA B 25   N THR B 56   ? N THR B 57   
L 1 2 O THR B 82   ? O THR B 83   N VAL B 107  ? N VAL B 108  
L 2 3 O PHE B 108  ? O PHE B 109  N PHE B 166  ? N PHE B 167  
L 3 4 O MET B 167  ? O MET B 168  N ALA B 138  ? N ALA B 139  
M 1 2 O ASP B 261  ? O ASP B 262  N LYS B 300  ? N LYS B 301  
M 2 3 O GLY B 297  ? O GLY B 298  N ARG B 270  ? N ARG B 271  
M 3 4 O VAL B 271  ? O VAL B 272  N VAL B 322  ? N VAL B 323  
M 4 5 O ILE B 323  ? O ILE B 324  N LEU B 358  ? N LEU B 359  
N 1 2 O LYS B 539  ? O LYS B 540  N PHE B 509  ? N PHE B 510  
N 2 3 O THR B 508  ? O THR B 509  N VAL B 486  ? N VAL B 487  
N 3 4 O TYR B 485  ? O TYR B 486  N GLN B 420  ? N GLN B 421  
N 4 5 O ILE B 417  ? O ILE B 418  N PHE B 469  ? N PHE B 470  
N 5 6 O ILE B 464  ? O ILE B 465  N SER B 453  ? N SER B 454  
O 1 2 O VAL B 680  ? O VAL B 681  N GLN B 764  ? N GLN B 765  
P 1 2 O LEU B 704  ? O LEU B 705  N GLN B 738  ? N GLN B 739  
Q 1 2 O ALA B 862  ? O ALA B 863  N ILE B 833  ? N ILE B 834  
Q 2 3 O PHE B 832  ? O PHE B 833  N SER B 955  ? N SER B 956  
Q 3 4 O ILE B 958  ? O ILE B 959  N ASN B 984  ? N ASN B 985  
Q 4 5 O VAL B 985  ? O VAL B 986  N SER B 1062 ? N SER B 1063 
Q 5 6 O LEU B 1063 ? O LEU B 1064 N TYR B 1035 ? N TYR B 1036 
R 1 2 O ARG B 1099 ? O ARG B 1100 N GLN B 1113 ? N GLN B 1114 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
MGA Author   ? ? ? ? 4  'MG BINDING SITE'                     
MGB Author   ? ? ? ? 4  'MG BINDING SITE'                     
AC1 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE MG A 1237'  
AC2 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE CA A 1238'  
AC3 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE MG B 1237'  
AC4 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE CA B 1238'  
AC5 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE SF4 A 1233' 
AC6 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE SF4 A 1234' 
AC7 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE SF4 A 1235' 
AC8 Software ? ? ? ? 27 'BINDING SITE FOR RESIDUE TPP A 1236' 
AC9 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE SF4 B 1233' 
BC1 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE SF4 B 1234' 
BC2 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE SF4 B 1235' 
BC3 Software ? ? ? ? 26 'BINDING SITE FOR RESIDUE TPP B 1236' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   MGA 4  ASP A 962  ? ASP A 963  . ? 1_555 ? 
2   MGA 4  THR A 990  ? THR A 991  . ? 1_555 ? 
3   MGA 4  VAL A 992  ? VAL A 993  . ? 1_555 ? 
4   MGA 4  TPP H .    ? TPP A 1236 . ? 1_555 ? 
5   MGB 4  ASP B 962  ? ASP B 963  . ? 1_555 ? 
6   MGB 4  THR B 990  ? THR B 991  . ? 1_555 ? 
7   MGB 4  VAL B 992  ? VAL B 993  . ? 1_555 ? 
8   MGB 4  TPP N .    ? TPP B 1236 . ? 1_555 ? 
9   AC1 5  ASP A 962  ? ASP A 963  . ? 1_555 ? 
10  AC1 5  THR A 990  ? THR A 991  . ? 1_555 ? 
11  AC1 5  VAL A 992  ? VAL A 993  . ? 1_555 ? 
12  AC1 5  TPP H .    ? TPP A 1236 . ? 1_555 ? 
13  AC1 5  HOH O .    ? HOH A 1352 . ? 1_555 ? 
14  AC2 7  ASP A 982  ? ASP A 983  . ? 1_555 ? 
15  AC2 7  ASN A 984  ? ASN A 985  . ? 1_555 ? 
16  AC2 7  ALA A 1055 ? ALA A 1056 . ? 1_555 ? 
17  AC2 7  GLU A 1056 ? GLU A 1057 . ? 1_555 ? 
18  AC2 7  PHE A 1058 ? PHE A 1059 . ? 1_555 ? 
19  AC2 7  GLY A 1060 ? GLY A 1061 . ? 1_555 ? 
20  AC2 7  SER A 1062 ? SER A 1063 . ? 1_555 ? 
21  AC3 5  ASP B 962  ? ASP B 963  . ? 1_555 ? 
22  AC3 5  THR B 990  ? THR B 991  . ? 1_555 ? 
23  AC3 5  VAL B 992  ? VAL B 993  . ? 1_555 ? 
24  AC3 5  TPP N .    ? TPP B 1236 . ? 1_555 ? 
25  AC3 5  HOH P .    ? HOH B 1489 . ? 1_555 ? 
26  AC4 7  ASP B 982  ? ASP B 983  . ? 1_555 ? 
27  AC4 7  ASN B 984  ? ASN B 985  . ? 1_555 ? 
28  AC4 7  ALA B 1055 ? ALA B 1056 . ? 1_555 ? 
29  AC4 7  GLU B 1056 ? GLU B 1057 . ? 1_555 ? 
30  AC4 7  PHE B 1058 ? PHE B 1059 . ? 1_555 ? 
31  AC4 7  GLY B 1060 ? GLY B 1061 . ? 1_555 ? 
32  AC4 7  SER B 1062 ? SER B 1063 . ? 1_555 ? 
33  AC5 10 TRP A 683  ? TRP A 684  . ? 1_555 ? 
34  AC5 10 CYS A 688  ? CYS A 689  . ? 1_555 ? 
35  AC5 10 ILE A 689  ? ILE A 690  . ? 1_555 ? 
36  AC5 10 CYS A 691  ? CYS A 692  . ? 1_555 ? 
37  AC5 10 ASN A 692  ? ASN A 693  . ? 1_555 ? 
38  AC5 10 CYS A 694  ? CYS A 695  . ? 1_555 ? 
39  AC5 10 CYS A 754  ? CYS A 755  . ? 1_555 ? 
40  AC5 10 PRO A 755  ? PRO A 756  . ? 1_555 ? 
41  AC5 10 PRO A 756  ? PRO A 757  . ? 1_555 ? 
42  AC5 10 ALA A 760  ? ALA A 761  . ? 1_555 ? 
43  AC6 8  CYS A 698  ? CYS A 699  . ? 1_555 ? 
44  AC6 8  ALA A 702  ? ALA A 703  . ? 1_555 ? 
45  AC6 8  ILE A 703  ? ILE A 704  . ? 1_555 ? 
46  AC6 8  CYS A 744  ? CYS A 745  . ? 1_555 ? 
47  AC6 8  MET A 745  ? MET A 746  . ? 1_555 ? 
48  AC6 8  CYS A 747  ? CYS A 748  . ? 1_555 ? 
49  AC6 8  GLY A 748  ? GLY A 749  . ? 1_555 ? 
50  AC6 8  CYS A 750  ? CYS A 751  . ? 1_555 ? 
51  AC7 8  LYS A 458  ? LYS A 459  . ? 1_555 ? 
52  AC7 8  CYS A 811  ? CYS A 812  . ? 1_555 ? 
53  AC7 8  CYS A 814  ? CYS A 815  . ? 1_555 ? 
54  AC7 8  GLU A 816  ? GLU A 817  . ? 1_555 ? 
55  AC7 8  CYS A 839  ? CYS A 840  . ? 1_555 ? 
56  AC7 8  CYS A 1070 ? CYS A 1071 . ? 1_555 ? 
57  AC7 8  ILE A 1071 ? ILE A 1072 . ? 1_555 ? 
58  AC7 8  MET B 1202 ? MET B 1203 . ? 1_555 ? 
59  AC8 27 TYR A 27   ? TYR A 28   . ? 1_555 ? 
60  AC8 27 PRO A 28   ? PRO A 29   . ? 1_555 ? 
61  AC8 27 ILE A 29   ? ILE A 30   . ? 1_555 ? 
62  AC8 27 GLU A 63   ? GLU A 64   . ? 1_555 ? 
63  AC8 27 GLN A 87   ? GLN A 88   . ? 1_555 ? 
64  AC8 27 GLU A 816  ? GLU A 817  . ? 1_555 ? 
65  AC8 27 THR A 837  ? THR A 838  . ? 1_555 ? 
66  AC8 27 GLY A 838  ? GLY A 839  . ? 1_555 ? 
67  AC8 27 CYS A 839  ? CYS A 840  . ? 1_555 ? 
68  AC8 27 PHE A 868  ? PHE A 869  . ? 1_555 ? 
69  AC8 27 GLU A 869  ? GLU A 870  . ? 1_555 ? 
70  AC8 27 GLY A 961  ? GLY A 962  . ? 1_555 ? 
71  AC8 27 ASP A 962  ? ASP A 963  . ? 1_555 ? 
72  AC8 27 GLY A 963  ? GLY A 964  . ? 1_555 ? 
73  AC8 27 TRP A 964  ? TRP A 965  . ? 1_555 ? 
74  AC8 27 ILE A 968  ? ILE A 969  . ? 1_555 ? 
75  AC8 27 THR A 990  ? THR A 991  . ? 1_555 ? 
76  AC8 27 VAL A 992  ? VAL A 993  . ? 1_555 ? 
77  AC8 27 TYR A 993  ? TYR A 994  . ? 1_555 ? 
78  AC8 27 SER A 994  ? SER A 995  . ? 1_555 ? 
79  AC8 27 ASN A 995  ? ASN A 996  . ? 1_555 ? 
80  AC8 27 THR A 996  ? THR A 997  . ? 1_555 ? 
81  AC8 27 MG  C .    ? MG  A 1237 . ? 1_555 ? 
82  AC8 27 HOH O .    ? HOH A 1246 . ? 1_555 ? 
83  AC8 27 HOH O .    ? HOH A 1337 . ? 1_555 ? 
84  AC8 27 HOH O .    ? HOH A 1352 . ? 1_555 ? 
85  AC8 27 HOH O .    ? HOH A 1409 . ? 1_555 ? 
86  AC9 11 TRP B 683  ? TRP B 684  . ? 1_555 ? 
87  AC9 11 CYS B 688  ? CYS B 689  . ? 1_555 ? 
88  AC9 11 ILE B 689  ? ILE B 690  . ? 1_555 ? 
89  AC9 11 CYS B 691  ? CYS B 692  . ? 1_555 ? 
90  AC9 11 ASN B 692  ? ASN B 693  . ? 1_555 ? 
91  AC9 11 CYS B 694  ? CYS B 695  . ? 1_555 ? 
92  AC9 11 CYS B 754  ? CYS B 755  . ? 1_555 ? 
93  AC9 11 PRO B 755  ? PRO B 756  . ? 1_555 ? 
94  AC9 11 PRO B 756  ? PRO B 757  . ? 1_555 ? 
95  AC9 11 ALA B 760  ? ALA B 761  . ? 1_555 ? 
96  AC9 11 LEU B 761  ? LEU B 762  . ? 1_555 ? 
97  BC1 8  CYS B 698  ? CYS B 699  . ? 1_555 ? 
98  BC1 8  PRO B 699  ? PRO B 700  . ? 1_555 ? 
99  BC1 8  ILE B 703  ? ILE B 704  . ? 1_555 ? 
100 BC1 8  CYS B 744  ? CYS B 745  . ? 1_555 ? 
101 BC1 8  MET B 745  ? MET B 746  . ? 1_555 ? 
102 BC1 8  CYS B 747  ? CYS B 748  . ? 1_555 ? 
103 BC1 8  GLY B 748  ? GLY B 749  . ? 1_555 ? 
104 BC1 8  CYS B 750  ? CYS B 751  . ? 1_555 ? 
105 BC2 8  MET A 1202 ? MET A 1203 . ? 1_555 ? 
106 BC2 8  LYS B 458  ? LYS B 459  . ? 1_555 ? 
107 BC2 8  CYS B 811  ? CYS B 812  . ? 1_555 ? 
108 BC2 8  CYS B 814  ? CYS B 815  . ? 1_555 ? 
109 BC2 8  GLU B 816  ? GLU B 817  . ? 1_555 ? 
110 BC2 8  CYS B 839  ? CYS B 840  . ? 1_555 ? 
111 BC2 8  CYS B 1070 ? CYS B 1071 . ? 1_555 ? 
112 BC2 8  ILE B 1071 ? ILE B 1072 . ? 1_555 ? 
113 BC3 26 PRO B 28   ? PRO B 29   . ? 1_555 ? 
114 BC3 26 ILE B 29   ? ILE B 30   . ? 1_555 ? 
115 BC3 26 GLU B 63   ? GLU B 64   . ? 1_555 ? 
116 BC3 26 GLN B 87   ? GLN B 88   . ? 1_555 ? 
117 BC3 26 GLU B 816  ? GLU B 817  . ? 1_555 ? 
118 BC3 26 THR B 837  ? THR B 838  . ? 1_555 ? 
119 BC3 26 GLY B 838  ? GLY B 839  . ? 1_555 ? 
120 BC3 26 CYS B 839  ? CYS B 840  . ? 1_555 ? 
121 BC3 26 PHE B 868  ? PHE B 869  . ? 1_555 ? 
122 BC3 26 GLU B 869  ? GLU B 870  . ? 1_555 ? 
123 BC3 26 GLY B 961  ? GLY B 962  . ? 1_555 ? 
124 BC3 26 ASP B 962  ? ASP B 963  . ? 1_555 ? 
125 BC3 26 GLY B 963  ? GLY B 964  . ? 1_555 ? 
126 BC3 26 TRP B 964  ? TRP B 965  . ? 1_555 ? 
127 BC3 26 ILE B 968  ? ILE B 969  . ? 1_555 ? 
128 BC3 26 THR B 990  ? THR B 991  . ? 1_555 ? 
129 BC3 26 VAL B 992  ? VAL B 993  . ? 1_555 ? 
130 BC3 26 TYR B 993  ? TYR B 994  . ? 1_555 ? 
131 BC3 26 SER B 994  ? SER B 995  . ? 1_555 ? 
132 BC3 26 ASN B 995  ? ASN B 996  . ? 1_555 ? 
133 BC3 26 THR B 996  ? THR B 997  . ? 1_555 ? 
134 BC3 26 MG  I .    ? MG  B 1237 . ? 1_555 ? 
135 BC3 26 HOH P .    ? HOH B 1272 . ? 1_555 ? 
136 BC3 26 HOH P .    ? HOH B 1474 . ? 1_555 ? 
137 BC3 26 HOH P .    ? HOH B 1489 . ? 1_555 ? 
138 BC3 26 HOH P .    ? HOH B 1666 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1B0P 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1B0P 
_atom_sites.fract_transf_matrix[1][1]   0.011792 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.006901 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004926 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
FE 
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . GLY A 1 1    ? -62.685 -69.436  32.524  1.00 26.01 ? 2    GLY A N     1 
ATOM   2     C  CA    . GLY A 1 1    ? -61.865 -69.770  33.679  1.00 24.17 ? 2    GLY A CA    1 
ATOM   3     C  C     . GLY A 1 1    ? -60.742 -70.720  33.291  1.00 22.92 ? 2    GLY A C     1 
ATOM   4     O  O     . GLY A 1 1    ? -59.785 -70.310  32.662  1.00 22.87 ? 2    GLY A O     1 
ATOM   5     N  N     . LYS A 1 2    ? -60.866 -71.998  33.632  1.00 21.98 ? 3    LYS A N     1 
ATOM   6     C  CA    . LYS A 1 2    ? -59.827 -72.979  33.290  1.00 20.76 ? 3    LYS A CA    1 
ATOM   7     C  C     . LYS A 1 2    ? -59.941 -73.534  31.862  1.00 20.15 ? 3    LYS A C     1 
ATOM   8     O  O     . LYS A 1 2    ? -61.042 -73.665  31.299  1.00 20.14 ? 3    LYS A O     1 
ATOM   9     C  CB    . LYS A 1 2    ? -59.855 -74.157  34.279  1.00 20.37 ? 3    LYS A CB    1 
ATOM   10    C  CG    . LYS A 1 2    ? -59.838 -73.764  35.756  1.00 20.31 ? 3    LYS A CG    1 
ATOM   11    C  CD    . LYS A 1 2    ? -60.251 -74.971  36.584  1.00 20.27 ? 3    LYS A CD    1 
ATOM   12    C  CE    . LYS A 1 2    ? -60.291 -74.655  38.077  1.00 20.21 ? 3    LYS A CE    1 
ATOM   13    N  NZ    . LYS A 1 2    ? -60.603 -75.884  38.878  1.00 20.56 ? 3    LYS A NZ    1 
ATOM   14    N  N     . LYS A 1 3    ? -58.800 -73.926  31.314  1.00 19.18 ? 4    LYS A N     1 
ATOM   15    C  CA    . LYS A 1 3    ? -58.765 -74.510  29.999  1.00 18.55 ? 4    LYS A CA    1 
ATOM   16    C  C     . LYS A 1 3    ? -57.707 -75.599  30.006  1.00 17.77 ? 4    LYS A C     1 
ATOM   17    O  O     . LYS A 1 3    ? -56.571 -75.333  30.359  1.00 17.96 ? 4    LYS A O     1 
ATOM   18    C  CB    . LYS A 1 3    ? -58.430 -73.448  28.958  1.00 19.21 ? 4    LYS A CB    1 
ATOM   19    C  CG    . LYS A 1 3    ? -58.386 -74.005  27.518  1.00 20.51 ? 4    LYS A CG    1 
ATOM   20    C  CD    . LYS A 1 3    ? -58.285 -72.900  26.431  1.00 21.85 ? 4    LYS A CD    1 
ATOM   21    C  CE    . LYS A 1 3    ? -56.938 -72.121  26.518  1.00 22.93 ? 4    LYS A CE    1 
ATOM   22    N  NZ    . LYS A 1 3    ? -56.539 -71.387  25.237  1.00 24.13 ? 4    LYS A NZ    1 
ATOM   23    N  N     . MET A 1 4    ? -58.089 -76.827  29.677  1.00 16.86 ? 5    MET A N     1 
ATOM   24    C  CA    . MET A 1 4    ? -57.145 -77.934  29.633  1.00 16.68 ? 5    MET A CA    1 
ATOM   25    C  C     . MET A 1 4    ? -56.302 -77.780  28.374  1.00 15.91 ? 5    MET A C     1 
ATOM   26    O  O     . MET A 1 4    ? -56.787 -77.246  27.361  1.00 15.99 ? 5    MET A O     1 
ATOM   27    C  CB    . MET A 1 4    ? -57.884 -79.253  29.643  1.00 18.40 ? 5    MET A CB    1 
ATOM   28    C  CG    . MET A 1 4    ? -58.017 -79.843  31.029  1.00 20.95 ? 5    MET A CG    1 
ATOM   29    S  SD    . MET A 1 4    ? -56.487 -80.772  31.400  1.00 25.36 ? 5    MET A SD    1 
ATOM   30    C  CE    . MET A 1 4    ? -56.569 -80.997  33.304  1.00 24.59 ? 5    MET A CE    1 
ATOM   31    N  N     . MET A 1 5    ? -55.059 -78.268  28.402  1.00 14.53 ? 6    MET A N     1 
ATOM   32    C  CA    . MET A 1 5    ? -54.167 -78.045  27.260  1.00 12.96 ? 6    MET A CA    1 
ATOM   33    C  C     . MET A 1 5    ? -52.957 -78.946  27.301  1.00 11.25 ? 6    MET A C     1 
ATOM   34    O  O     . MET A 1 5    ? -52.480 -79.226  28.383  1.00 11.13 ? 6    MET A O     1 
ATOM   35    C  CB    . MET A 1 5    ? -53.708 -76.587  27.333  1.00 13.24 ? 6    MET A CB    1 
ATOM   36    C  CG    . MET A 1 5    ? -52.788 -76.149  26.247  1.00 14.66 ? 6    MET A CG    1 
ATOM   37    S  SD    . MET A 1 5    ? -52.956 -74.378  26.177  1.00 17.55 ? 6    MET A SD    1 
ATOM   38    C  CE    . MET A 1 5    ? -51.301 -73.824  26.320  1.00 16.61 ? 6    MET A CE    1 
ATOM   39    N  N     . THR A 1 6    ? -52.489 -79.432  26.149  1.00 9.54  ? 7    THR A N     1 
ATOM   40    C  CA    . THR A 1 6    ? -51.290 -80.278  26.133  1.00 8.33  ? 7    THR A CA    1 
ATOM   41    C  C     . THR A 1 6    ? -50.204 -79.473  25.429  1.00 7.62  ? 7    THR A C     1 
ATOM   42    O  O     . THR A 1 6    ? -50.279 -79.248  24.214  1.00 7.22  ? 7    THR A O     1 
ATOM   43    C  CB    . THR A 1 6    ? -51.519 -81.718  25.479  1.00 8.18  ? 7    THR A CB    1 
ATOM   44    O  OG1   . THR A 1 6    ? -51.351 -81.680  24.062  1.00 9.21  ? 7    THR A OG1   1 
ATOM   45    C  CG2   . THR A 1 6    ? -52.892 -82.218  25.771  1.00 8.59  ? 7    THR A CG2   1 
ATOM   46    N  N     . THR A 1 7    ? -49.282 -78.924  26.221  1.00 6.90  ? 8    THR A N     1 
ATOM   47    C  CA    . THR A 1 7    ? -48.201 -78.102  25.686  1.00 6.44  ? 8    THR A CA    1 
ATOM   48    C  C     . THR A 1 7    ? -46.941 -78.252  26.485  1.00 6.08  ? 8    THR A C     1 
ATOM   49    O  O     . THR A 1 7    ? -46.975 -78.836  27.565  1.00 6.09  ? 8    THR A O     1 
ATOM   50    C  CB    . THR A 1 7    ? -48.487 -76.593  25.721  1.00 6.85  ? 8    THR A CB    1 
ATOM   51    O  OG1   . THR A 1 7    ? -49.129 -76.244  26.946  1.00 6.75  ? 8    THR A OG1   1 
ATOM   52    C  CG2   . THR A 1 7    ? -49.315 -76.170  24.540  1.00 8.24  ? 8    THR A CG2   1 
ATOM   53    N  N     . ASP A 1 8    ? -45.862 -77.620  25.997  1.00 5.40  ? 9    ASP A N     1 
ATOM   54    C  CA    . ASP A 1 8    ? -44.575 -77.693  26.653  1.00 4.67  ? 9    ASP A CA    1 
ATOM   55    C  C     . ASP A 1 8    ? -44.403 -76.531  27.593  1.00 3.61  ? 9    ASP A C     1 
ATOM   56    O  O     . ASP A 1 8    ? -45.229 -75.624  27.588  1.00 2.89  ? 9    ASP A O     1 
ATOM   57    C  CB    . ASP A 1 8    ? -43.415 -77.816  25.649  1.00 5.13  ? 9    ASP A CB    1 
ATOM   58    C  CG    . ASP A 1 8    ? -43.286 -76.616  24.710  1.00 6.66  ? 9    ASP A CG    1 
ATOM   59    O  OD1   . ASP A 1 8    ? -43.847 -75.564  25.009  1.00 6.53  ? 9    ASP A OD1   1 
ATOM   60    O  OD2   . ASP A 1 8    ? -42.543 -76.681  23.692  1.00 7.45  ? 9    ASP A OD2   1 
ATOM   61    N  N     . GLY A 1 9    ? -43.368 -76.607  28.428  1.00 2.60  ? 10   GLY A N     1 
ATOM   62    C  CA    . GLY A 1 9    ? -43.066 -75.571  29.395  1.00 2.34  ? 10   GLY A CA    1 
ATOM   63    C  C     . GLY A 1 9    ? -42.990 -74.174  28.828  1.00 2.34  ? 10   GLY A C     1 
ATOM   64    O  O     . GLY A 1 9    ? -43.525 -73.253  29.425  1.00 2.00  ? 10   GLY A O     1 
ATOM   65    N  N     . ASN A 1 10   ? -42.382 -74.027  27.644  1.00 2.59  ? 11   ASN A N     1 
ATOM   66    C  CA    . ASN A 1 10   ? -42.233 -72.709  26.994  1.00 2.45  ? 11   ASN A CA    1 
ATOM   67    C  C     . ASN A 1 10   ? -43.544 -72.067  26.665  1.00 2.43  ? 11   ASN A C     1 
ATOM   68    O  O     . ASN A 1 10   ? -43.706 -70.865  26.868  1.00 2.39  ? 11   ASN A O     1 
ATOM   69    C  CB    . ASN A 1 10   ? -41.447 -72.774  25.677  1.00 2.01  ? 11   ASN A CB    1 
ATOM   70    C  CG    . ASN A 1 10   ? -39.956 -72.812  25.882  1.00 2.00  ? 11   ASN A CG    1 
ATOM   71    O  OD1   . ASN A 1 10   ? -39.272 -73.636  25.286  1.00 2.35  ? 11   ASN A OD1   1 
ATOM   72    N  ND2   . ASN A 1 10   ? -39.446 -71.944  26.727  1.00 2.00  ? 11   ASN A ND2   1 
ATOM   73    N  N     . THR A 1 11   ? -44.463 -72.853  26.093  1.00 2.66  ? 12   THR A N     1 
ATOM   74    C  CA    . THR A 1 11   ? -45.746 -72.287  25.719  1.00 2.31  ? 12   THR A CA    1 
ATOM   75    C  C     . THR A 1 11   ? -46.682 -72.081  26.869  1.00 2.00  ? 12   THR A C     1 
ATOM   76    O  O     . THR A 1 11   ? -47.430 -71.122  26.865  1.00 2.11  ? 12   THR A O     1 
ATOM   77    C  CB    . THR A 1 11   ? -46.408 -72.881  24.434  1.00 2.22  ? 12   THR A CB    1 
ATOM   78    O  OG1   . THR A 1 11   ? -47.814 -73.070  24.619  1.00 3.65  ? 12   THR A OG1   1 
ATOM   79    C  CG2   . THR A 1 11   ? -45.795 -74.082  23.973  1.00 2.00  ? 12   THR A CG2   1 
ATOM   80    N  N     . ALA A 1 12   ? -46.507 -72.863  27.925  1.00 2.00  ? 13   ALA A N     1 
ATOM   81    C  CA    . ALA A 1 12   ? -47.350 -72.705  29.086  1.00 2.09  ? 13   ALA A CA    1 
ATOM   82    C  C     . ALA A 1 12   ? -47.029 -71.386  29.722  1.00 2.53  ? 13   ALA A C     1 
ATOM   83    O  O     . ALA A 1 12   ? -47.949 -70.699  30.204  1.00 2.61  ? 13   ALA A O     1 
ATOM   84    C  CB    . ALA A 1 12   ? -47.125 -73.774  30.049  1.00 2.66  ? 13   ALA A CB    1 
ATOM   85    N  N     . THR A 1 13   ? -45.741 -71.004  29.686  1.00 2.84  ? 14   THR A N     1 
ATOM   86    C  CA    . THR A 1 13   ? -45.305 -69.737  30.273  1.00 2.27  ? 14   THR A CA    1 
ATOM   87    C  C     . THR A 1 13   ? -45.428 -68.554  29.309  1.00 2.56  ? 14   THR A C     1 
ATOM   88    O  O     . THR A 1 13   ? -45.651 -67.421  29.748  1.00 2.92  ? 14   THR A O     1 
ATOM   89    C  CB    . THR A 1 13   ? -43.900 -69.799  31.002  1.00 2.00  ? 14   THR A CB    1 
ATOM   90    O  OG1   . THR A 1 13   ? -42.974 -68.893  30.397  1.00 2.00  ? 14   THR A OG1   1 
ATOM   91    C  CG2   . THR A 1 13   ? -43.326 -71.167  31.029  1.00 2.00  ? 14   THR A CG2   1 
ATOM   92    N  N     . ALA A 1 14   ? -45.287 -68.785  28.002  1.00 2.31  ? 15   ALA A N     1 
ATOM   93    C  CA    . ALA A 1 14   ? -45.468 -67.691  27.052  1.00 2.00  ? 15   ALA A CA    1 
ATOM   94    C  C     . ALA A 1 14   ? -46.953 -67.237  27.123  1.00 2.41  ? 15   ALA A C     1 
ATOM   95    O  O     . ALA A 1 14   ? -47.256 -66.045  26.984  1.00 2.22  ? 15   ALA A O     1 
ATOM   96    C  CB    . ALA A 1 14   ? -45.107 -68.131  25.689  1.00 2.00  ? 15   ALA A CB    1 
ATOM   97    N  N     . HIS A 1 15   ? -47.850 -68.200  27.391  1.00 2.28  ? 16   HIS A N     1 
ATOM   98    C  CA    . HIS A 1 15   ? -49.296 -67.988  27.543  1.00 2.31  ? 16   HIS A CA    1 
ATOM   99    C  C     . HIS A 1 15   ? -49.545 -66.859  28.538  1.00 2.33  ? 16   HIS A C     1 
ATOM   100   O  O     . HIS A 1 15   ? -50.268 -65.889  28.249  1.00 2.13  ? 16   HIS A O     1 
ATOM   101   C  CB    . HIS A 1 15   ? -49.953 -69.269  28.094  1.00 2.37  ? 16   HIS A CB    1 
ATOM   102   C  CG    . HIS A 1 15   ? -51.455 -69.182  28.244  1.00 2.49  ? 16   HIS A CG    1 
ATOM   103   N  ND1   . HIS A 1 15   ? -52.079 -68.923  29.452  1.00 2.74  ? 16   HIS A ND1   1 
ATOM   104   C  CD2   . HIS A 1 15   ? -52.450 -69.368  27.348  1.00 2.33  ? 16   HIS A CD2   1 
ATOM   105   C  CE1   . HIS A 1 15   ? -53.388 -68.958  29.289  1.00 2.16  ? 16   HIS A CE1   1 
ATOM   106   N  NE2   . HIS A 1 15   ? -53.643 -69.227  28.023  1.00 2.41  ? 16   HIS A NE2   1 
ATOM   107   N  N     . VAL A 1 16   ? -48.962 -67.029  29.724  1.00 2.21  ? 17   VAL A N     1 
ATOM   108   C  CA    . VAL A 1 16   ? -49.069 -66.066  30.808  1.00 2.72  ? 17   VAL A CA    1 
ATOM   109   C  C     . VAL A 1 16   ? -48.297 -64.770  30.557  1.00 2.73  ? 17   VAL A C     1 
ATOM   110   O  O     . VAL A 1 16   ? -48.784 -63.703  30.854  1.00 3.30  ? 17   VAL A O     1 
ATOM   111   C  CB    . VAL A 1 16   ? -48.544 -66.674  32.111  1.00 2.61  ? 17   VAL A CB    1 
ATOM   112   C  CG1   . VAL A 1 16   ? -48.427 -65.608  33.171  1.00 2.00  ? 17   VAL A CG1   1 
ATOM   113   C  CG2   . VAL A 1 16   ? -49.423 -67.824  32.562  1.00 2.49  ? 17   VAL A CG2   1 
ATOM   114   N  N     . ALA A 1 17   ? -47.066 -64.888  30.068  1.00 3.35  ? 18   ALA A N     1 
ATOM   115   C  CA    . ALA A 1 17   ? -46.183 -63.749  29.802  1.00 3.10  ? 18   ALA A CA    1 
ATOM   116   C  C     . ALA A 1 17   ? -46.880 -62.765  28.885  1.00 2.73  ? 18   ALA A C     1 
ATOM   117   O  O     . ALA A 1 17   ? -46.964 -61.587  29.172  1.00 2.00  ? 18   ALA A O     1 
ATOM   118   C  CB    . ALA A 1 17   ? -44.885 -64.237  29.167  1.00 2.95  ? 18   ALA A CB    1 
ATOM   119   N  N     . TYR A 1 18   ? -47.408 -63.294  27.787  1.00 2.72  ? 19   TYR A N     1 
ATOM   120   C  CA    . TYR A 1 18   ? -48.127 -62.484  26.810  1.00 2.61  ? 19   TYR A CA    1 
ATOM   121   C  C     . TYR A 1 18   ? -49.235 -61.694  27.497  1.00 2.17  ? 19   TYR A C     1 
ATOM   122   O  O     . TYR A 1 18   ? -49.301 -60.486  27.339  1.00 2.00  ? 19   TYR A O     1 
ATOM   123   C  CB    . TYR A 1 18   ? -48.746 -63.353  25.711  1.00 2.72  ? 19   TYR A CB    1 
ATOM   124   C  CG    . TYR A 1 18   ? -49.253 -62.523  24.559  1.00 3.04  ? 19   TYR A CG    1 
ATOM   125   C  CD1   . TYR A 1 18   ? -50.497 -61.862  24.624  1.00 2.93  ? 19   TYR A CD1   1 
ATOM   126   C  CD2   . TYR A 1 18   ? -48.458 -62.309  23.449  1.00 3.34  ? 19   TYR A CD2   1 
ATOM   127   C  CE1   . TYR A 1 18   ? -50.917 -61.012  23.630  1.00 2.79  ? 19   TYR A CE1   1 
ATOM   128   C  CE2   . TYR A 1 18   ? -48.879 -61.434  22.422  1.00 3.94  ? 19   TYR A CE2   1 
ATOM   129   C  CZ    . TYR A 1 18   ? -50.105 -60.793  22.538  1.00 3.45  ? 19   TYR A CZ    1 
ATOM   130   O  OH    . TYR A 1 18   ? -50.491 -59.911  21.570  1.00 3.62  ? 19   TYR A OH    1 
ATOM   131   N  N     . ALA A 1 19   ? -50.083 -62.390  28.261  1.00 2.18  ? 20   ALA A N     1 
ATOM   132   C  CA    . ALA A 1 19   ? -51.209 -61.784  28.993  1.00 2.00  ? 20   ALA A CA    1 
ATOM   133   C  C     . ALA A 1 19   ? -50.830 -60.690  29.949  1.00 2.00  ? 20   ALA A C     1 
ATOM   134   O  O     . ALA A 1 19   ? -51.470 -59.624  29.960  1.00 2.00  ? 20   ALA A O     1 
ATOM   135   C  CB    . ALA A 1 19   ? -51.972 -62.835  29.747  1.00 2.00  ? 20   ALA A CB    1 
ATOM   136   N  N     . MET A 1 20   ? -49.767 -60.945  30.716  1.00 2.00  ? 21   MET A N     1 
ATOM   137   C  CA    . MET A 1 20   ? -49.301 -60.025  31.738  1.00 2.00  ? 21   MET A CA    1 
ATOM   138   C  C     . MET A 1 20   ? -48.402 -58.894  31.326  1.00 2.00  ? 21   MET A C     1 
ATOM   139   O  O     . MET A 1 20   ? -48.280 -57.917  32.069  1.00 2.55  ? 21   MET A O     1 
ATOM   140   C  CB    . MET A 1 20   ? -48.660 -60.800  32.867  1.00 2.04  ? 21   MET A CB    1 
ATOM   141   C  CG    . MET A 1 20   ? -49.601 -61.893  33.420  1.00 2.81  ? 21   MET A CG    1 
ATOM   142   S  SD    . MET A 1 20   ? -51.195 -61.175  34.069  1.00 2.27  ? 21   MET A SD    1 
ATOM   143   C  CE    . MET A 1 20   ? -50.472 -59.927  35.267  1.00 2.00  ? 21   MET A CE    1 
ATOM   144   N  N     . SER A 1 21   ? -47.885 -58.953  30.103  1.00 2.00  ? 22   SER A N     1 
ATOM   145   C  CA    . SER A 1 21   ? -46.968 -57.936  29.593  1.00 2.12  ? 22   SER A CA    1 
ATOM   146   C  C     . SER A 1 21   ? -47.520 -56.937  28.542  1.00 2.28  ? 22   SER A C     1 
ATOM   147   O  O     . SER A 1 21   ? -48.527 -57.183  27.873  1.00 2.27  ? 22   SER A O     1 
ATOM   148   C  CB    . SER A 1 21   ? -45.721 -58.650  29.032  1.00 2.00  ? 22   SER A CB    1 
ATOM   149   O  OG    . SER A 1 21   ? -45.156 -59.507  30.013  1.00 2.00  ? 22   SER A OG    1 
ATOM   150   N  N     . GLU A 1 22   ? -46.863 -55.793  28.425  1.00 2.10  ? 23   GLU A N     1 
ATOM   151   C  CA    . GLU A 1 22   ? -47.262 -54.819  27.422  1.00 2.61  ? 23   GLU A CA    1 
ATOM   152   C  C     . GLU A 1 22   ? -46.175 -54.713  26.368  1.00 2.12  ? 23   GLU A C     1 
ATOM   153   O  O     . GLU A 1 22   ? -46.457 -54.614  25.190  1.00 2.04  ? 23   GLU A O     1 
ATOM   154   C  CB    . GLU A 1 22   ? -47.468 -53.443  28.044  1.00 2.49  ? 23   GLU A CB    1 
ATOM   155   C  CG    . GLU A 1 22   ? -48.589 -53.407  29.030  1.00 3.84  ? 23   GLU A CG    1 
ATOM   156   C  CD    . GLU A 1 22   ? -48.673 -52.077  29.663  1.00 4.00  ? 23   GLU A CD    1 
ATOM   157   O  OE1   . GLU A 1 22   ? -47.713 -51.715  30.346  1.00 4.59  ? 23   GLU A OE1   1 
ATOM   158   O  OE2   . GLU A 1 22   ? -49.664 -51.377  29.440  1.00 4.80  ? 23   GLU A OE2   1 
ATOM   159   N  N     . VAL A 1 23   ? -44.929 -54.772  26.816  1.00 2.00  ? 24   VAL A N     1 
ATOM   160   C  CA    . VAL A 1 23   ? -43.779 -54.663  25.938  1.00 2.24  ? 24   VAL A CA    1 
ATOM   161   C  C     . VAL A 1 23   ? -42.890 -55.899  26.093  1.00 2.00  ? 24   VAL A C     1 
ATOM   162   O  O     . VAL A 1 23   ? -43.025 -56.625  27.058  1.00 2.55  ? 24   VAL A O     1 
ATOM   163   C  CB    . VAL A 1 23   ? -42.981 -53.368  26.314  1.00 2.14  ? 24   VAL A CB    1 
ATOM   164   C  CG1   . VAL A 1 23   ? -41.637 -53.319  25.611  1.00 2.02  ? 24   VAL A CG1   1 
ATOM   165   C  CG2   . VAL A 1 23   ? -43.806 -52.160  25.970  1.00 2.01  ? 24   VAL A CG2   1 
ATOM   166   N  N     . ALA A 1 24   ? -42.023 -56.170  25.132  1.00 2.00  ? 25   ALA A N     1 
ATOM   167   C  CA    . ALA A 1 24   ? -41.117 -57.313  25.243  1.00 2.00  ? 25   ALA A CA    1 
ATOM   168   C  C     . ALA A 1 24   ? -39.986 -57.015  24.329  1.00 2.00  ? 25   ALA A C     1 
ATOM   169   O  O     . ALA A 1 24   ? -40.209 -56.756  23.161  1.00 2.03  ? 25   ALA A O     1 
ATOM   170   C  CB    . ALA A 1 24   ? -41.784 -58.616  24.852  1.00 2.00  ? 25   ALA A CB    1 
ATOM   171   N  N     . ALA A 1 25   ? -38.803 -56.860  24.914  1.00 2.00  ? 26   ALA A N     1 
ATOM   172   C  CA    . ALA A 1 25   ? -37.605 -56.577  24.145  1.00 2.00  ? 26   ALA A CA    1 
ATOM   173   C  C     . ALA A 1 25   ? -36.927 -57.944  24.114  1.00 2.01  ? 26   ALA A C     1 
ATOM   174   O  O     . ALA A 1 25   ? -36.501 -58.449  25.139  1.00 2.04  ? 26   ALA A O     1 
ATOM   175   C  CB    . ALA A 1 25   ? -36.777 -55.532  24.834  1.00 2.00  ? 26   ALA A CB    1 
ATOM   176   N  N     . ILE A 1 26   ? -36.820 -58.513  22.916  1.00 2.27  ? 27   ILE A N     1 
ATOM   177   C  CA    . ILE A 1 26   ? -36.335 -59.871  22.677  1.00 2.13  ? 27   ILE A CA    1 
ATOM   178   C  C     . ILE A 1 26   ? -34.990 -60.175  21.970  1.00 2.31  ? 27   ILE A C     1 
ATOM   179   O  O     . ILE A 1 26   ? -34.439 -59.314  21.312  1.00 2.47  ? 27   ILE A O     1 
ATOM   180   C  CB    . ILE A 1 26   ? -37.514 -60.578  21.900  1.00 2.35  ? 27   ILE A CB    1 
ATOM   181   C  CG1   . ILE A 1 26   ? -38.268 -61.460  22.842  1.00 2.78  ? 27   ILE A CG1   1 
ATOM   182   C  CG2   . ILE A 1 26   ? -37.121 -61.215  20.577  1.00 2.01  ? 27   ILE A CG2   1 
ATOM   183   C  CD1   . ILE A 1 26   ? -39.136 -60.666  23.767  1.00 3.41  ? 27   ILE A CD1   1 
ATOM   184   N  N     . TYR A 1 27   ? -34.447 -61.388  22.188  1.00 2.18  ? 28   TYR A N     1 
ATOM   185   C  CA    . TYR A 1 27   ? -33.255 -61.917  21.504  1.00 2.00  ? 28   TYR A CA    1 
ATOM   186   C  C     . TYR A 1 27   ? -33.321 -63.462  21.548  1.00 2.38  ? 28   TYR A C     1 
ATOM   187   O  O     . TYR A 1 27   ? -33.631 -64.087  22.590  1.00 2.00  ? 28   TYR A O     1 
ATOM   188   C  CB    . TYR A 1 27   ? -31.922 -61.422  22.023  1.00 2.00  ? 28   TYR A CB    1 
ATOM   189   C  CG    . TYR A 1 27   ? -30.811 -61.554  20.977  1.00 2.00  ? 28   TYR A CG    1 
ATOM   190   C  CD1   . TYR A 1 27   ? -30.763 -60.714  19.881  1.00 2.00  ? 28   TYR A CD1   1 
ATOM   191   C  CD2   . TYR A 1 27   ? -29.805 -62.524  21.083  1.00 2.32  ? 28   TYR A CD2   1 
ATOM   192   C  CE1   . TYR A 1 27   ? -29.753 -60.842  18.916  1.00 2.16  ? 28   TYR A CE1   1 
ATOM   193   C  CE2   . TYR A 1 27   ? -28.778 -62.640  20.116  1.00 2.00  ? 28   TYR A CE2   1 
ATOM   194   C  CZ    . TYR A 1 27   ? -28.770 -61.799  19.047  1.00 2.00  ? 28   TYR A CZ    1 
ATOM   195   O  OH    . TYR A 1 27   ? -27.775 -61.899  18.102  1.00 2.00  ? 28   TYR A OH    1 
ATOM   196   N  N     . PRO A 1 28   ? -33.097 -64.105  20.393  1.00 2.27  ? 29   PRO A N     1 
ATOM   197   C  CA    . PRO A 1 28   ? -33.172 -65.569  20.395  1.00 2.47  ? 29   PRO A CA    1 
ATOM   198   C  C     . PRO A 1 28   ? -31.951 -66.328  20.910  1.00 2.00  ? 29   PRO A C     1 
ATOM   199   O  O     . PRO A 1 28   ? -30.824 -65.968  20.592  1.00 2.00  ? 29   PRO A O     1 
ATOM   200   C  CB    . PRO A 1 28   ? -33.483 -65.898  18.931  1.00 2.00  ? 29   PRO A CB    1 
ATOM   201   C  CG    . PRO A 1 28   ? -32.766 -64.894  18.191  1.00 2.16  ? 29   PRO A CG    1 
ATOM   202   C  CD    . PRO A 1 28   ? -32.929 -63.583  19.021  1.00 2.38  ? 29   PRO A CD    1 
ATOM   203   N  N     . ILE A 1 29   ? -32.191 -67.265  21.829  1.00 2.04  ? 30   ILE A N     1 
ATOM   204   C  CA    . ILE A 1 29   ? -31.139 -68.159  22.361  1.00 2.03  ? 30   ILE A CA    1 
ATOM   205   C  C     . ILE A 1 29   ? -31.784 -69.469  22.803  1.00 2.00  ? 30   ILE A C     1 
ATOM   206   O  O     . ILE A 1 29   ? -32.803 -69.473  23.461  1.00 2.58  ? 30   ILE A O     1 
ATOM   207   C  CB    . ILE A 1 29   ? -30.344 -67.511  23.508  1.00 2.05  ? 30   ILE A CB    1 
ATOM   208   C  CG1   . ILE A 1 29   ? -29.111 -68.366  23.827  1.00 2.00  ? 30   ILE A CG1   1 
ATOM   209   C  CG2   . ILE A 1 29   ? -31.222 -67.277  24.712  1.00 2.25  ? 30   ILE A CG2   1 
ATOM   210   C  CD1   . ILE A 1 29   ? -28.341 -67.921  25.009  1.00 2.00  ? 30   ILE A CD1   1 
ATOM   211   N  N     . THR A 1 30   ? -31.244 -70.588  22.367  1.00 2.15  ? 31   THR A N     1 
ATOM   212   C  CA    . THR A 1 30   ? -31.784 -71.908  22.703  1.00 2.03  ? 31   THR A CA    1 
ATOM   213   C  C     . THR A 1 30   ? -31.623 -72.127  24.225  1.00 2.20  ? 31   THR A C     1 
ATOM   214   O  O     . THR A 1 30   ? -30.549 -71.880  24.750  1.00 2.36  ? 31   THR A O     1 
ATOM   215   C  CB    . THR A 1 30   ? -31.006 -72.986  21.884  1.00 2.47  ? 31   THR A CB    1 
ATOM   216   O  OG1   . THR A 1 30   ? -31.006 -72.603  20.507  1.00 2.00  ? 31   THR A OG1   1 
ATOM   217   C  CG2   . THR A 1 30   ? -31.675 -74.392  22.009  1.00 2.07  ? 31   THR A CG2   1 
ATOM   218   N  N     . PRO A 1 31   ? -32.644 -72.694  24.922  1.00 2.00  ? 32   PRO A N     1 
ATOM   219   C  CA    . PRO A 1 31   ? -33.979 -73.169  24.527  1.00 2.01  ? 32   PRO A CA    1 
ATOM   220   C  C     . PRO A 1 31   ? -35.219 -72.310  24.855  1.00 2.26  ? 32   PRO A C     1 
ATOM   221   O  O     . PRO A 1 31   ? -36.325 -72.838  24.924  1.00 2.00  ? 32   PRO A O     1 
ATOM   222   C  CB    . PRO A 1 31   ? -34.042 -74.546  25.222  1.00 2.07  ? 32   PRO A CB    1 
ATOM   223   C  CG    . PRO A 1 31   ? -33.240 -74.338  26.508  1.00 2.00  ? 32   PRO A CG    1 
ATOM   224   C  CD    . PRO A 1 31   ? -32.337 -73.129  26.298  1.00 2.00  ? 32   PRO A CD    1 
ATOM   225   N  N     . SER A 1 32   ? -35.029 -70.989  24.975  1.00 2.02  ? 33   SER A N     1 
ATOM   226   C  CA    . SER A 1 32   ? -36.121 -70.066  25.285  1.00 2.00  ? 33   SER A CA    1 
ATOM   227   C  C     . SER A 1 32   ? -36.677 -69.389  24.040  1.00 2.16  ? 33   SER A C     1 
ATOM   228   O  O     . SER A 1 32   ? -37.609 -68.575  24.129  1.00 2.00  ? 33   SER A O     1 
ATOM   229   C  CB    . SER A 1 32   ? -35.621 -68.972  26.234  1.00 2.00  ? 33   SER A CB    1 
ATOM   230   O  OG    . SER A 1 32   ? -34.734 -68.103  25.589  1.00 2.00  ? 33   SER A OG    1 
ATOM   231   N  N     . SER A 1 33   ? -36.091 -69.707  22.884  1.00 2.00  ? 34   SER A N     1 
ATOM   232   C  CA    . SER A 1 33   ? -36.534 -69.084  21.644  1.00 2.65  ? 34   SER A CA    1 
ATOM   233   C  C     . SER A 1 33   ? -38.023 -69.181  21.376  1.00 2.95  ? 34   SER A C     1 
ATOM   234   O  O     . SER A 1 33   ? -38.646 -68.163  21.014  1.00 3.02  ? 34   SER A O     1 
ATOM   235   C  CB    . SER A 1 33   ? -35.765 -69.612  20.449  1.00 2.39  ? 34   SER A CB    1 
ATOM   236   O  OG    . SER A 1 33   ? -34.427 -69.238  20.572  1.00 3.64  ? 34   SER A OG    1 
ATOM   237   N  N     . THR A 1 34   ? -38.585 -70.377  21.574  1.00 2.62  ? 35   THR A N     1 
ATOM   238   C  CA    . THR A 1 34   ? -40.008 -70.609  21.352  1.00 2.87  ? 35   THR A CA    1 
ATOM   239   C  C     . THR A 1 34   ? -40.948 -69.607  22.028  1.00 2.93  ? 35   THR A C     1 
ATOM   240   O  O     . THR A 1 34   ? -41.982 -69.279  21.453  1.00 3.62  ? 35   THR A O     1 
ATOM   241   C  CB    . THR A 1 34   ? -40.429 -71.989  21.786  1.00 2.51  ? 35   THR A CB    1 
ATOM   242   O  OG1   . THR A 1 34   ? -39.747 -72.954  20.974  1.00 3.23  ? 35   THR A OG1   1 
ATOM   243   C  CG2   . THR A 1 34   ? -41.923 -72.145  21.659  1.00 2.03  ? 35   THR A CG2   1 
ATOM   244   N  N     . MET A 1 35   ? -40.597 -69.111  23.214  1.00 2.08  ? 36   MET A N     1 
ATOM   245   C  CA    . MET A 1 35   ? -41.457 -68.167  23.908  1.00 2.03  ? 36   MET A CA    1 
ATOM   246   C  C     . MET A 1 35   ? -41.586 -66.802  23.225  1.00 2.20  ? 36   MET A C     1 
ATOM   247   O  O     . MET A 1 35   ? -42.674 -66.212  23.228  1.00 2.00  ? 36   MET A O     1 
ATOM   248   C  CB    . MET A 1 35   ? -41.007 -67.975  25.331  1.00 2.00  ? 36   MET A CB    1 
ATOM   249   C  CG    . MET A 1 35   ? -41.144 -69.178  26.162  1.00 2.00  ? 36   MET A CG    1 
ATOM   250   S  SD    . MET A 1 35   ? -40.788 -68.800  27.864  1.00 2.99  ? 36   MET A SD    1 
ATOM   251   C  CE    . MET A 1 35   ? -38.972 -68.883  27.912  1.00 2.00  ? 36   MET A CE    1 
ATOM   252   N  N     . GLY A 1 36   ? -40.484 -66.310  22.636  1.00 2.28  ? 37   GLY A N     1 
ATOM   253   C  CA    . GLY A 1 36   ? -40.500 -65.031  21.922  1.00 2.21  ? 37   GLY A CA    1 
ATOM   254   C  C     . GLY A 1 36   ? -41.126 -65.116  20.534  1.00 2.06  ? 37   GLY A C     1 
ATOM   255   O  O     . GLY A 1 36   ? -41.754 -64.186  20.055  1.00 2.16  ? 37   GLY A O     1 
ATOM   256   N  N     . GLU A 1 37   ? -40.942 -66.242  19.873  1.00 2.00  ? 38   GLU A N     1 
ATOM   257   C  CA    . GLU A 1 37   ? -41.491 -66.413  18.561  1.00 2.06  ? 38   GLU A CA    1 
ATOM   258   C  C     . GLU A 1 37   ? -42.995 -66.536  18.648  1.00 2.49  ? 38   GLU A C     1 
ATOM   259   O  O     . GLU A 1 37   ? -43.715 -65.967  17.831  1.00 2.22  ? 38   GLU A O     1 
ATOM   260   C  CB    . GLU A 1 37   ? -40.845 -67.621  17.891  1.00 2.00  ? 38   GLU A CB    1 
ATOM   261   C  CG    . GLU A 1 37   ? -39.381 -67.351  17.616  1.00 2.07  ? 38   GLU A CG    1 
ATOM   262   C  CD    . GLU A 1 37   ? -38.633 -68.516  17.027  1.00 2.61  ? 38   GLU A CD    1 
ATOM   263   O  OE1   . GLU A 1 37   ? -39.273 -69.514  16.601  1.00 2.95  ? 38   GLU A OE1   1 
ATOM   264   O  OE2   . GLU A 1 37   ? -37.391 -68.423  16.972  1.00 2.16  ? 38   GLU A OE2   1 
ATOM   265   N  N     . GLU A 1 38   ? -43.464 -67.228  19.688  1.00 3.13  ? 39   GLU A N     1 
ATOM   266   C  CA    . GLU A 1 38   ? -44.907 -67.428  19.921  1.00 3.76  ? 39   GLU A CA    1 
ATOM   267   C  C     . GLU A 1 38   ? -45.600 -66.108  20.266  1.00 3.83  ? 39   GLU A C     1 
ATOM   268   O  O     . GLU A 1 38   ? -46.717 -65.850  19.844  1.00 4.50  ? 39   GLU A O     1 
ATOM   269   C  CB    . GLU A 1 38   ? -45.150 -68.409  21.090  1.00 3.95  ? 39   GLU A CB    1 
ATOM   270   C  CG    . GLU A 1 38   ? -44.797 -69.840  20.829  1.00 4.73  ? 39   GLU A CG    1 
ATOM   271   C  CD    . GLU A 1 38   ? -44.975 -70.709  22.060  1.00 5.81  ? 39   GLU A CD    1 
ATOM   272   O  OE1   . GLU A 1 38   ? -44.689 -70.214  23.163  1.00 6.06  ? 39   GLU A OE1   1 
ATOM   273   O  OE2   . GLU A 1 38   ? -45.372 -71.899  21.927  1.00 6.25  ? 39   GLU A OE2   1 
ATOM   274   N  N     . ALA A 1 39   ? -44.948 -65.289  21.075  1.00 3.71  ? 40   ALA A N     1 
ATOM   275   C  CA    . ALA A 1 39   ? -45.542 -64.049  21.468  1.00 4.14  ? 40   ALA A CA    1 
ATOM   276   C  C     . ALA A 1 39   ? -45.653 -63.210  20.224  1.00 4.59  ? 40   ALA A C     1 
ATOM   277   O  O     . ALA A 1 39   ? -46.619 -62.502  20.009  1.00 5.16  ? 40   ALA A O     1 
ATOM   278   C  CB    . ALA A 1 39   ? -44.673 -63.372  22.510  1.00 3.19  ? 40   ALA A CB    1 
ATOM   279   N  N     . ASP A 1 40   ? -44.689 -63.357  19.349  1.00 5.87  ? 41   ASP A N     1 
ATOM   280   C  CA    . ASP A 1 40   ? -44.714 -62.546  18.166  1.00 6.94  ? 41   ASP A CA    1 
ATOM   281   C  C     . ASP A 1 40   ? -45.827 -63.027  17.291  1.00 7.40  ? 41   ASP A C     1 
ATOM   282   O  O     . ASP A 1 40   ? -46.559 -62.222  16.749  1.00 7.24  ? 41   ASP A O     1 
ATOM   283   C  CB    . ASP A 1 40   ? -43.391 -62.583  17.433  1.00 7.85  ? 41   ASP A CB    1 
ATOM   284   C  CG    . ASP A 1 40   ? -43.267 -61.451  16.448  1.00 8.60  ? 41   ASP A CG    1 
ATOM   285   O  OD1   . ASP A 1 40   ? -43.317 -60.286  16.905  1.00 10.12 ? 41   ASP A OD1   1 
ATOM   286   O  OD2   . ASP A 1 40   ? -43.154 -61.719  15.230  1.00 8.67  ? 41   ASP A OD2   1 
ATOM   287   N  N     . ASP A 1 41   ? -45.995 -64.343  17.200  1.00 7.64  ? 42   ASP A N     1 
ATOM   288   C  CA    . ASP A 1 41   ? -47.079 -64.888  16.387  1.00 8.02  ? 42   ASP A CA    1 
ATOM   289   C  C     . ASP A 1 41   ? -48.459 -64.513  16.921  1.00 7.36  ? 42   ASP A C     1 
ATOM   290   O  O     . ASP A 1 41   ? -49.389 -64.234  16.142  1.00 7.57  ? 42   ASP A O     1 
ATOM   291   C  CB    . ASP A 1 41   ? -46.999 -66.421  16.269  1.00 9.34  ? 42   ASP A CB    1 
ATOM   292   C  CG    . ASP A 1 41   ? -45.822 -66.883  15.454  1.00 10.34 ? 42   ASP A CG    1 
ATOM   293   O  OD1   . ASP A 1 41   ? -45.548 -66.285  14.406  1.00 10.96 ? 42   ASP A OD1   1 
ATOM   294   O  OD2   . ASP A 1 41   ? -45.148 -67.839  15.882  1.00 13.19 ? 42   ASP A OD2   1 
ATOM   295   N  N     . TRP A 1 42   ? -48.608 -64.544  18.235  1.00 6.41  ? 43   TRP A N     1 
ATOM   296   C  CA    . TRP A 1 42   ? -49.885 -64.203  18.841  1.00 6.05  ? 43   TRP A CA    1 
ATOM   297   C  C     . TRP A 1 42   ? -50.216 -62.722  18.682  1.00 5.99  ? 43   TRP A C     1 
ATOM   298   O  O     . TRP A 1 42   ? -51.389 -62.339  18.652  1.00 5.74  ? 43   TRP A O     1 
ATOM   299   C  CB    . TRP A 1 42   ? -49.883 -64.556  20.301  1.00 5.25  ? 43   TRP A CB    1 
ATOM   300   C  CG    . TRP A 1 42   ? -49.705 -65.997  20.538  1.00 5.07  ? 43   TRP A CG    1 
ATOM   301   C  CD1   . TRP A 1 42   ? -49.931 -67.007  19.646  1.00 4.93  ? 43   TRP A CD1   1 
ATOM   302   C  CD2   . TRP A 1 42   ? -49.211 -66.610  21.730  1.00 4.50  ? 43   TRP A CD2   1 
ATOM   303   N  NE1   . TRP A 1 42   ? -49.603 -68.208  20.215  1.00 4.75  ? 43   TRP A NE1   1 
ATOM   304   C  CE2   . TRP A 1 42   ? -49.153 -67.995  21.491  1.00 4.77  ? 43   TRP A CE2   1 
ATOM   305   C  CE3   . TRP A 1 42   ? -48.789 -66.120  22.974  1.00 4.81  ? 43   TRP A CE3   1 
ATOM   306   C  CZ2   . TRP A 1 42   ? -48.682 -68.903  22.453  1.00 4.93  ? 43   TRP A CZ2   1 
ATOM   307   C  CZ3   . TRP A 1 42   ? -48.316 -67.020  23.931  1.00 5.00  ? 43   TRP A CZ3   1 
ATOM   308   C  CH2   . TRP A 1 42   ? -48.265 -68.390  23.664  1.00 5.14  ? 43   TRP A CH2   1 
ATOM   309   N  N     . ALA A 1 43   ? -49.175 -61.897  18.589  1.00 5.83  ? 44   ALA A N     1 
ATOM   310   C  CA    . ALA A 1 43   ? -49.362 -60.465  18.395  1.00 6.07  ? 44   ALA A CA    1 
ATOM   311   C  C     . ALA A 1 43   ? -49.809 -60.200  16.938  1.00 6.28  ? 44   ALA A C     1 
ATOM   312   O  O     . ALA A 1 43   ? -50.528 -59.225  16.668  1.00 7.87  ? 44   ALA A O     1 
ATOM   313   C  CB    . ALA A 1 43   ? -48.080 -59.716  18.732  1.00 4.90  ? 44   ALA A CB    1 
ATOM   314   N  N     . ALA A 1 44   ? -49.369 -61.036  16.000  1.00 5.92  ? 45   ALA A N     1 
ATOM   315   C  CA    . ALA A 1 44   ? -49.770 -60.899  14.607  1.00 6.31  ? 45   ALA A CA    1 
ATOM   316   C  C     . ALA A 1 44   ? -51.230 -61.430  14.463  1.00 7.43  ? 45   ALA A C     1 
ATOM   317   O  O     . ALA A 1 44   ? -52.033 -60.880  13.660  1.00 7.37  ? 45   ALA A O     1 
ATOM   318   C  CB    . ALA A 1 44   ? -48.831 -61.654  13.712  1.00 5.16  ? 45   ALA A CB    1 
ATOM   319   N  N     . GLN A 1 45   ? -51.575 -62.486  15.233  1.00 8.05  ? 46   GLN A N     1 
ATOM   320   C  CA    . GLN A 1 45   ? -52.948 -63.063  15.249  1.00 8.78  ? 46   GLN A CA    1 
ATOM   321   C  C     . GLN A 1 45   ? -53.959 -62.121  15.956  1.00 9.09  ? 46   GLN A C     1 
ATOM   322   O  O     . GLN A 1 45   ? -55.161 -62.411  16.014  1.00 9.13  ? 46   GLN A O     1 
ATOM   323   C  CB    . GLN A 1 45   ? -52.984 -64.369  16.013  1.00 8.87  ? 46   GLN A CB    1 
ATOM   324   C  CG    . GLN A 1 45   ? -52.233 -65.483  15.424  1.00 9.50  ? 46   GLN A CG    1 
ATOM   325   C  CD    . GLN A 1 45   ? -51.796 -66.433  16.485  1.00 10.21 ? 46   GLN A CD    1 
ATOM   326   O  OE1   . GLN A 1 45   ? -50.776 -67.068  16.347  1.00 11.82 ? 46   GLN A OE1   1 
ATOM   327   N  NE2   . GLN A 1 45   ? -52.527 -66.492  17.590  1.00 10.47 ? 46   GLN A NE2   1 
ATOM   328   N  N     . GLY A 1 46   ? -53.457 -61.027  16.533  1.00 8.76  ? 47   GLY A N     1 
ATOM   329   C  CA    . GLY A 1 46   ? -54.322 -60.069  17.209  1.00 8.35  ? 47   GLY A CA    1 
ATOM   330   C  C     . GLY A 1 46   ? -54.695 -60.491  18.626  1.00 8.13  ? 47   GLY A C     1 
ATOM   331   O  O     . GLY A 1 46   ? -55.765 -60.141  19.124  1.00 8.23  ? 47   GLY A O     1 
ATOM   332   N  N     . ARG A 1 47   ? -53.837 -61.275  19.264  1.00 7.46  ? 48   ARG A N     1 
ATOM   333   C  CA    . ARG A 1 47   ? -54.091 -61.706  20.620  1.00 6.86  ? 48   ARG A CA    1 
ATOM   334   C  C     . ARG A 1 47   ? -53.920 -60.499  21.500  1.00 6.55  ? 48   ARG A C     1 
ATOM   335   O  O     . ARG A 1 47   ? -53.039 -59.656  21.242  1.00 7.04  ? 48   ARG A O     1 
ATOM   336   C  CB    . ARG A 1 47   ? -53.078 -62.755  21.006  1.00 7.02  ? 48   ARG A CB    1 
ATOM   337   C  CG    . ARG A 1 47   ? -53.486 -63.624  22.130  1.00 7.52  ? 48   ARG A CG    1 
ATOM   338   C  CD    . ARG A 1 47   ? -52.875 -64.976  21.894  1.00 8.09  ? 48   ARG A CD    1 
ATOM   339   N  NE    . ARG A 1 47   ? -52.653 -65.706  23.127  1.00 9.42  ? 48   ARG A NE    1 
ATOM   340   C  CZ    . ARG A 1 47   ? -52.487 -67.027  23.185  1.00 9.61  ? 48   ARG A CZ    1 
ATOM   341   N  NH1   . ARG A 1 47   ? -52.515 -67.766  22.091  1.00 9.44  ? 48   ARG A NH1   1 
ATOM   342   N  NH2   . ARG A 1 47   ? -52.317 -67.623  24.341  1.00 10.40 ? 48   ARG A NH2   1 
ATOM   343   N  N     . LYS A 1 48   ? -54.753 -60.376  22.526  1.00 6.05  ? 49   LYS A N     1 
ATOM   344   C  CA    . LYS A 1 48   ? -54.636 -59.223  23.402  1.00 5.62  ? 49   LYS A CA    1 
ATOM   345   C  C     . LYS A 1 48   ? -54.255 -59.620  24.801  1.00 4.43  ? 49   LYS A C     1 
ATOM   346   O  O     . LYS A 1 48   ? -54.648 -60.679  25.288  1.00 3.70  ? 49   LYS A O     1 
ATOM   347   C  CB    . LYS A 1 48   ? -55.937 -58.405  23.484  1.00 7.28  ? 49   LYS A CB    1 
ATOM   348   C  CG    . LYS A 1 48   ? -56.629 -58.076  22.177  1.00 8.52  ? 49   LYS A CG    1 
ATOM   349   C  CD    . LYS A 1 48   ? -55.728 -57.475  21.124  1.00 9.83  ? 49   LYS A CD    1 
ATOM   350   C  CE    . LYS A 1 48   ? -56.589 -57.119  19.873  1.00 10.92 ? 49   LYS A CE    1 
ATOM   351   N  NZ    . LYS A 1 48   ? -56.050 -55.965  19.047  1.00 12.21 ? 49   LYS A NZ    1 
ATOM   352   N  N     . ASN A 1 49   ? -53.590 -58.691  25.479  1.00 3.55  ? 50   ASN A N     1 
ATOM   353   C  CA    . ASN A 1 49   ? -53.171 -58.901  26.833  1.00 2.83  ? 50   ASN A CA    1 
ATOM   354   C  C     . ASN A 1 49   ? -54.321 -58.508  27.730  1.00 2.83  ? 50   ASN A C     1 
ATOM   355   O  O     . ASN A 1 49   ? -55.433 -58.278  27.261  1.00 3.38  ? 50   ASN A O     1 
ATOM   356   C  CB    . ASN A 1 49   ? -51.904 -58.121  27.130  1.00 3.06  ? 50   ASN A CB    1 
ATOM   357   C  CG    . ASN A 1 49   ? -52.042 -56.659  26.843  1.00 3.45  ? 50   ASN A CG    1 
ATOM   358   O  OD1   . ASN A 1 49   ? -53.145 -56.123  26.802  1.00 3.69  ? 50   ASN A OD1   1 
ATOM   359   N  ND2   . ASN A 1 49   ? -50.921 -55.993  26.662  1.00 3.33  ? 50   ASN A ND2   1 
ATOM   360   N  N     . ILE A 1 50   ? -54.090 -58.491  29.034  1.00 3.27  ? 51   ILE A N     1 
ATOM   361   C  CA    . ILE A 1 50   ? -55.143 -58.147  29.972  1.00 2.91  ? 51   ILE A CA    1 
ATOM   362   C  C     . ILE A 1 50   ? -55.630 -56.686  29.835  1.00 3.77  ? 51   ILE A C     1 
ATOM   363   O  O     . ILE A 1 50   ? -56.612 -56.311  30.469  1.00 4.99  ? 51   ILE A O     1 
ATOM   364   C  CB    . ILE A 1 50   ? -54.710 -58.437  31.442  1.00 2.25  ? 51   ILE A CB    1 
ATOM   365   C  CG1   . ILE A 1 50   ? -53.501 -57.610  31.807  1.00 2.00  ? 51   ILE A CG1   1 
ATOM   366   C  CG2   . ILE A 1 50   ? -54.397 -59.926  31.650  1.00 2.00  ? 51   ILE A CG2   1 
ATOM   367   C  CD1   . ILE A 1 50   ? -53.177 -57.686  33.226  1.00 2.07  ? 51   ILE A CD1   1 
ATOM   368   N  N     . PHE A 1 51   ? -54.932 -55.844  29.069  1.00 3.60  ? 52   PHE A N     1 
ATOM   369   C  CA    . PHE A 1 51   ? -55.362 -54.447  28.886  1.00 3.36  ? 52   PHE A CA    1 
ATOM   370   C  C     . PHE A 1 51   ? -56.107 -54.299  27.567  1.00 3.33  ? 52   PHE A C     1 
ATOM   371   O  O     . PHE A 1 51   ? -56.538 -53.208  27.219  1.00 3.82  ? 52   PHE A O     1 
ATOM   372   C  CB    . PHE A 1 51   ? -54.159 -53.483  28.922  1.00 2.58  ? 52   PHE A CB    1 
ATOM   373   C  CG    . PHE A 1 51   ? -53.351 -53.599  30.187  1.00 3.06  ? 52   PHE A CG    1 
ATOM   374   C  CD1   . PHE A 1 51   ? -53.871 -53.177  31.402  1.00 2.87  ? 52   PHE A CD1   1 
ATOM   375   C  CD2   . PHE A 1 51   ? -52.116 -54.255  30.190  1.00 3.83  ? 52   PHE A CD2   1 
ATOM   376   C  CE1   . PHE A 1 51   ? -53.193 -53.411  32.586  1.00 3.10  ? 52   PHE A CE1   1 
ATOM   377   C  CE2   . PHE A 1 51   ? -51.426 -54.494  31.380  1.00 3.40  ? 52   PHE A CE2   1 
ATOM   378   C  CZ    . PHE A 1 51   ? -51.964 -54.075  32.573  1.00 3.21  ? 52   PHE A CZ    1 
ATOM   379   N  N     . GLY A 1 52   ? -56.276 -55.404  26.856  1.00 3.36  ? 53   GLY A N     1 
ATOM   380   C  CA    . GLY A 1 52   ? -56.954 -55.365  25.565  1.00 4.23  ? 53   GLY A CA    1 
ATOM   381   C  C     . GLY A 1 52   ? -56.081 -54.963  24.382  1.00 4.47  ? 53   GLY A C     1 
ATOM   382   O  O     . GLY A 1 52   ? -56.572 -54.648  23.322  1.00 4.87  ? 53   GLY A O     1 
ATOM   383   N  N     . GLN A 1 53   ? -54.783 -55.146  24.508  1.00 5.38  ? 54   GLN A N     1 
ATOM   384   C  CA    . GLN A 1 53   ? -53.881 -54.699  23.471  1.00 6.12  ? 54   GLN A CA    1 
ATOM   385   C  C     . GLN A 1 53   ? -52.945 -55.783  23.072  1.00 5.63  ? 54   GLN A C     1 
ATOM   386   O  O     . GLN A 1 53   ? -52.582 -56.611  23.893  1.00 5.73  ? 54   GLN A O     1 
ATOM   387   C  CB    . GLN A 1 53   ? -53.006 -53.556  24.031  1.00 7.67  ? 54   GLN A CB    1 
ATOM   388   C  CG    . GLN A 1 53   ? -53.731 -52.498  24.794  1.00 8.57  ? 54   GLN A CG    1 
ATOM   389   C  CD    . GLN A 1 53   ? -54.679 -51.820  23.895  1.00 10.37 ? 54   GLN A CD    1 
ATOM   390   O  OE1   . GLN A 1 53   ? -54.285 -51.375  22.828  1.00 12.03 ? 54   GLN A OE1   1 
ATOM   391   N  NE2   . GLN A 1 53   ? -55.959 -51.786  24.267  1.00 11.51 ? 54   GLN A NE2   1 
ATOM   392   N  N     . THR A 1 54   ? -52.465 -55.713  21.839  1.00 5.49  ? 55   THR A N     1 
ATOM   393   C  CA    . THR A 1 54   ? -51.509 -56.713  21.364  1.00 5.64  ? 55   THR A CA    1 
ATOM   394   C  C     . THR A 1 54   ? -50.146 -56.323  21.980  1.00 5.31  ? 55   THR A C     1 
ATOM   395   O  O     . THR A 1 54   ? -49.929 -55.134  22.320  1.00 6.50  ? 55   THR A O     1 
ATOM   396   C  CB    . THR A 1 54   ? -51.480 -56.804  19.790  1.00 5.53  ? 55   THR A CB    1 
ATOM   397   O  OG1   . THR A 1 54   ? -50.878 -55.638  19.238  1.00 7.17  ? 55   THR A OG1   1 
ATOM   398   C  CG2   . THR A 1 54   ? -52.867 -56.899  19.232  1.00 4.61  ? 55   THR A CG2   1 
ATOM   399   N  N     . LEU A 1 55   ? -49.270 -57.294  22.224  1.00 4.33  ? 56   LEU A N     1 
ATOM   400   C  CA    . LEU A 1 55   ? -47.984 -56.962  22.837  1.00 3.91  ? 56   LEU A CA    1 
ATOM   401   C  C     . LEU A 1 55   ? -47.006 -56.239  21.850  1.00 4.27  ? 56   LEU A C     1 
ATOM   402   O  O     . LEU A 1 55   ? -47.062 -56.468  20.630  1.00 5.23  ? 56   LEU A O     1 
ATOM   403   C  CB    . LEU A 1 55   ? -47.383 -58.265  23.406  1.00 3.54  ? 56   LEU A CB    1 
ATOM   404   C  CG    . LEU A 1 55   ? -45.939 -58.549  23.821  1.00 2.18  ? 56   LEU A CG    1 
ATOM   405   C  CD1   . LEU A 1 55   ? -45.638 -58.028  25.188  1.00 2.21  ? 56   LEU A CD1   1 
ATOM   406   C  CD2   . LEU A 1 55   ? -45.779 -60.052  23.861  1.00 2.26  ? 56   LEU A CD2   1 
ATOM   407   N  N     . THR A 1 56   ? -46.164 -55.332  22.339  1.00 3.26  ? 57   THR A N     1 
ATOM   408   C  CA    . THR A 1 56   ? -45.160 -54.675  21.483  1.00 2.70  ? 57   THR A CA    1 
ATOM   409   C  C     . THR A 1 56   ? -43.872 -55.499  21.676  1.00 2.31  ? 57   THR A C     1 
ATOM   410   O  O     . THR A 1 56   ? -43.316 -55.481  22.761  1.00 2.30  ? 57   THR A O     1 
ATOM   411   C  CB    . THR A 1 56   ? -44.888 -53.205  21.949  1.00 2.94  ? 57   THR A CB    1 
ATOM   412   O  OG1   . THR A 1 56   ? -46.085 -52.439  21.817  1.00 3.65  ? 57   THR A OG1   1 
ATOM   413   C  CG2   . THR A 1 56   ? -43.732 -52.543  21.169  1.00 2.01  ? 57   THR A CG2   1 
ATOM   414   N  N     . ILE A 1 57   ? -43.460 -56.280  20.675  1.00 2.26  ? 58   ILE A N     1 
ATOM   415   C  CA    . ILE A 1 57   ? -42.243 -57.105  20.767  1.00 2.57  ? 58   ILE A CA    1 
ATOM   416   C  C     . ILE A 1 57   ? -41.312 -56.548  19.727  1.00 3.08  ? 58   ILE A C     1 
ATOM   417   O  O     . ILE A 1 57   ? -41.715 -56.352  18.589  1.00 2.80  ? 58   ILE A O     1 
ATOM   418   C  CB    . ILE A 1 57   ? -42.451 -58.604  20.298  1.00 3.32  ? 58   ILE A CB    1 
ATOM   419   C  CG1   . ILE A 1 57   ? -43.700 -59.228  20.914  1.00 3.72  ? 58   ILE A CG1   1 
ATOM   420   C  CG2   . ILE A 1 57   ? -41.239 -59.505  20.645  1.00 2.17  ? 58   ILE A CG2   1 
ATOM   421   C  CD1   . ILE A 1 57   ? -44.865 -59.206  20.005  1.00 4.45  ? 58   ILE A CD1   1 
ATOM   422   N  N     . ARG A 1 58   ? -40.062 -56.307  20.097  1.00 3.67  ? 59   ARG A N     1 
ATOM   423   C  CA    . ARG A 1 58   ? -39.074 -55.809  19.148  1.00 3.67  ? 59   ARG A CA    1 
ATOM   424   C  C     . ARG A 1 58   ? -37.816 -56.648  19.383  1.00 3.06  ? 59   ARG A C     1 
ATOM   425   O  O     . ARG A 1 58   ? -37.511 -56.962  20.536  1.00 2.63  ? 59   ARG A O     1 
ATOM   426   C  CB    . ARG A 1 58   ? -38.762 -54.341  19.403  1.00 5.13  ? 59   ARG A CB    1 
ATOM   427   C  CG    . ARG A 1 58   ? -39.912 -53.394  19.206  1.00 7.70  ? 59   ARG A CG    1 
ATOM   428   C  CD    . ARG A 1 58   ? -40.362 -53.289  17.765  1.00 10.09 ? 59   ARG A CD    1 
ATOM   429   N  NE    . ARG A 1 58   ? -41.427 -52.293  17.609  1.00 13.18 ? 59   ARG A NE    1 
ATOM   430   C  CZ    . ARG A 1 58   ? -42.754 -52.508  17.675  1.00 14.74 ? 59   ARG A CZ    1 
ATOM   431   N  NH1   . ARG A 1 58   ? -43.266 -53.720  17.897  1.00 14.92 ? 59   ARG A NH1   1 
ATOM   432   N  NH2   . ARG A 1 58   ? -43.586 -51.474  17.503  1.00 15.57 ? 59   ARG A NH2   1 
ATOM   433   N  N     . GLU A 1 59   ? -37.170 -57.106  18.305  1.00 2.63  ? 60   GLU A N     1 
ATOM   434   C  CA    . GLU A 1 59   ? -35.946 -57.891  18.431  1.00 2.66  ? 60   GLU A CA    1 
ATOM   435   C  C     . GLU A 1 59   ? -34.753 -56.904  18.501  1.00 2.80  ? 60   GLU A C     1 
ATOM   436   O  O     . GLU A 1 59   ? -34.705 -55.964  17.721  1.00 2.63  ? 60   GLU A O     1 
ATOM   437   C  CB    . GLU A 1 59   ? -35.784 -58.851  17.240  1.00 3.08  ? 60   GLU A CB    1 
ATOM   438   C  CG    . GLU A 1 59   ? -34.465 -59.655  17.252  1.00 4.27  ? 60   GLU A CG    1 
ATOM   439   C  CD    . GLU A 1 59   ? -34.366 -60.708  16.164  1.00 4.79  ? 60   GLU A CD    1 
ATOM   440   O  OE1   . GLU A 1 59   ? -34.161 -60.392  14.963  1.00 5.39  ? 60   GLU A OE1   1 
ATOM   441   O  OE2   . GLU A 1 59   ? -34.500 -61.879  16.534  1.00 5.87  ? 60   GLU A OE2   1 
ATOM   442   N  N     . MET A 1 60   ? -33.840 -57.107  19.461  1.00 2.57  ? 61   MET A N     1 
ATOM   443   C  CA    . MET A 1 60   ? -32.681 -56.270  19.641  1.00 2.04  ? 61   MET A CA    1 
ATOM   444   C  C     . MET A 1 60   ? -31.437 -56.901  19.004  1.00 2.13  ? 61   MET A C     1 
ATOM   445   O  O     . MET A 1 60   ? -31.551 -57.913  18.301  1.00 2.00  ? 61   MET A O     1 
ATOM   446   C  CB    . MET A 1 60   ? -32.475 -56.024  21.118  1.00 2.00  ? 61   MET A CB    1 
ATOM   447   C  CG    . MET A 1 60   ? -33.634 -55.315  21.756  1.00 2.00  ? 61   MET A CG    1 
ATOM   448   S  SD    . MET A 1 60   ? -34.000 -53.778  20.889  1.00 2.00  ? 61   MET A SD    1 
ATOM   449   C  CE    . MET A 1 60   ? -33.000 -52.631  21.642  1.00 2.00  ? 61   MET A CE    1 
ATOM   450   N  N     . GLN A 1 61   ? -30.278 -56.236  19.138  1.00 2.13  ? 62   GLN A N     1 
ATOM   451   C  CA    . GLN A 1 61   ? -29.025 -56.767  18.559  1.00 2.49  ? 62   GLN A CA    1 
ATOM   452   C  C     . GLN A 1 61   ? -28.360 -57.848  19.420  1.00 2.61  ? 62   GLN A C     1 
ATOM   453   O  O     . GLN A 1 61   ? -27.540 -58.626  18.922  1.00 2.84  ? 62   GLN A O     1 
ATOM   454   C  CB    . GLN A 1 61   ? -28.009 -55.659  18.278  1.00 2.25  ? 62   GLN A CB    1 
ATOM   455   C  CG    . GLN A 1 61   ? -27.112 -55.240  19.443  1.00 2.23  ? 62   GLN A CG    1 
ATOM   456   C  CD    . GLN A 1 61   ? -27.784 -54.325  20.463  1.00 2.08  ? 62   GLN A CD    1 
ATOM   457   O  OE1   . GLN A 1 61   ? -28.987 -54.163  20.475  1.00 2.97  ? 62   GLN A OE1   1 
ATOM   458   N  NE2   . GLN A 1 61   ? -27.005 -53.764  21.338  1.00 2.00  ? 62   GLN A NE2   1 
ATOM   459   N  N     . SER A 1 62   ? -28.722 -57.881  20.704  1.00 2.32  ? 63   SER A N     1 
ATOM   460   C  CA    . SER A 1 62   ? -28.198 -58.835  21.668  1.00 2.08  ? 63   SER A CA    1 
ATOM   461   C  C     . SER A 1 62   ? -29.108 -58.834  22.893  1.00 2.50  ? 63   SER A C     1 
ATOM   462   O  O     . SER A 1 62   ? -30.068 -58.028  22.976  1.00 2.50  ? 63   SER A O     1 
ATOM   463   C  CB    . SER A 1 62   ? -26.783 -58.428  22.095  1.00 2.04  ? 63   SER A CB    1 
ATOM   464   O  OG    . SER A 1 62   ? -26.747 -57.261  22.904  1.00 2.00  ? 63   SER A OG    1 
ATOM   465   N  N     . GLU A 1 63   ? -28.814 -59.703  23.854  1.00 2.00  ? 64   GLU A N     1 
ATOM   466   C  CA    . GLU A 1 63   ? -29.614 -59.680  25.038  1.00 2.00  ? 64   GLU A CA    1 
ATOM   467   C  C     . GLU A 1 63   ? -29.207 -58.511  25.947  1.00 2.28  ? 64   GLU A C     1 
ATOM   468   O  O     . GLU A 1 63   ? -29.980 -58.056  26.789  1.00 2.92  ? 64   GLU A O     1 
ATOM   469   C  CB    . GLU A 1 63   ? -29.647 -61.035  25.741  1.00 2.02  ? 64   GLU A CB    1 
ATOM   470   C  CG    . GLU A 1 63   ? -28.499 -61.938  25.438  1.00 2.37  ? 64   GLU A CG    1 
ATOM   471   C  CD    . GLU A 1 63   ? -28.655 -62.744  24.180  1.00 2.52  ? 64   GLU A CD    1 
ATOM   472   O  OE1   . GLU A 1 63   ? -29.528 -63.636  24.093  1.00 3.00  ? 64   GLU A OE1   1 
ATOM   473   O  OE2   . GLU A 1 63   ? -27.856 -62.518  23.265  1.00 3.12  ? 64   GLU A OE2   1 
ATOM   474   N  N     . ALA A 1 64   ? -28.021 -57.949  25.747  1.00 2.86  ? 65   ALA A N     1 
ATOM   475   C  CA    . ALA A 1 64   ? -27.627 -56.781  26.553  1.00 2.58  ? 65   ALA A CA    1 
ATOM   476   C  C     . ALA A 1 64   ? -28.465 -55.640  25.964  1.00 2.86  ? 65   ALA A C     1 
ATOM   477   O  O     . ALA A 1 64   ? -28.862 -54.686  26.637  1.00 3.34  ? 65   ALA A O     1 
ATOM   478   C  CB    . ALA A 1 64   ? -26.163 -56.500  26.379  1.00 2.00  ? 65   ALA A CB    1 
ATOM   479   N  N     . GLY A 1 65   ? -28.765 -55.789  24.682  1.00 3.09  ? 66   GLY A N     1 
ATOM   480   C  CA    . GLY A 1 65   ? -29.541 -54.808  23.982  1.00 2.77  ? 66   GLY A CA    1 
ATOM   481   C  C     . GLY A 1 65   ? -30.947 -54.899  24.483  1.00 2.51  ? 66   GLY A C     1 
ATOM   482   O  O     . GLY A 1 65   ? -31.493 -53.909  24.909  1.00 2.65  ? 66   GLY A O     1 
ATOM   483   N  N     . ALA A 1 66   ? -31.516 -56.104  24.488  1.00 2.71  ? 67   ALA A N     1 
ATOM   484   C  CA    . ALA A 1 66   ? -32.893 -56.316  24.954  1.00 2.01  ? 67   ALA A CA    1 
ATOM   485   C  C     . ALA A 1 66   ? -33.093 -55.866  26.406  1.00 2.19  ? 67   ALA A C     1 
ATOM   486   O  O     . ALA A 1 66   ? -34.085 -55.192  26.708  1.00 2.00  ? 67   ALA A O     1 
ATOM   487   C  CB    . ALA A 1 66   ? -33.273 -57.758  24.808  1.00 2.00  ? 67   ALA A CB    1 
ATOM   488   N  N     . ALA A 1 67   ? -32.142 -56.210  27.284  1.00 2.00  ? 68   ALA A N     1 
ATOM   489   C  CA    . ALA A 1 67   ? -32.230 -55.862  28.688  1.00 2.00  ? 68   ALA A CA    1 
ATOM   490   C  C     . ALA A 1 67   ? -32.175 -54.343  28.877  1.00 2.57  ? 68   ALA A C     1 
ATOM   491   O  O     . ALA A 1 67   ? -32.827 -53.790  29.790  1.00 2.00  ? 68   ALA A O     1 
ATOM   492   C  CB    . ALA A 1 67   ? -31.124 -56.524  29.443  1.00 2.00  ? 68   ALA A CB    1 
ATOM   493   N  N     . GLY A 1 68   ? -31.431 -53.666  27.996  1.00 2.00  ? 69   GLY A N     1 
ATOM   494   C  CA    . GLY A 1 68   ? -31.290 -52.234  28.111  1.00 2.00  ? 69   GLY A CA    1 
ATOM   495   C  C     . GLY A 1 68   ? -32.607 -51.670  27.708  1.00 2.13  ? 69   GLY A C     1 
ATOM   496   O  O     . GLY A 1 68   ? -33.033 -50.656  28.237  1.00 2.24  ? 69   GLY A O     1 
ATOM   497   N  N     . ALA A 1 69   ? -33.259 -52.339  26.763  1.00 2.00  ? 70   ALA A N     1 
ATOM   498   C  CA    . ALA A 1 69   ? -34.578 -51.915  26.320  1.00 2.00  ? 70   ALA A CA    1 
ATOM   499   C  C     . ALA A 1 69   ? -35.624 -52.240  27.383  1.00 2.15  ? 70   ALA A C     1 
ATOM   500   O  O     . ALA A 1 69   ? -36.509 -51.435  27.611  1.00 2.16  ? 70   ALA A O     1 
ATOM   501   C  CB    . ALA A 1 69   ? -34.947 -52.550  25.018  1.00 2.00  ? 70   ALA A CB    1 
ATOM   502   N  N     . VAL A 1 70   ? -35.525 -53.394  28.046  1.00 2.00  ? 71   VAL A N     1 
ATOM   503   C  CA    . VAL A 1 70   ? -36.478 -53.752  29.104  1.00 2.10  ? 71   VAL A CA    1 
ATOM   504   C  C     . VAL A 1 70   ? -36.449 -52.740  30.300  1.00 2.16  ? 71   VAL A C     1 
ATOM   505   O  O     . VAL A 1 70   ? -37.472 -52.421  30.912  1.00 2.00  ? 71   VAL A O     1 
ATOM   506   C  CB    . VAL A 1 70   ? -36.200 -55.203  29.607  1.00 2.00  ? 71   VAL A CB    1 
ATOM   507   C  CG1   . VAL A 1 70   ? -36.896 -55.476  30.895  1.00 2.00  ? 71   VAL A CG1   1 
ATOM   508   C  CG2   . VAL A 1 70   ? -36.669 -56.205  28.581  1.00 2.46  ? 71   VAL A CG2   1 
ATOM   509   N  N     . HIS A 1 71   ? -35.258 -52.238  30.608  1.00 2.41  ? 72   HIS A N     1 
ATOM   510   C  CA    . HIS A 1 71   ? -35.048 -51.306  31.685  1.00 2.06  ? 72   HIS A CA    1 
ATOM   511   C  C     . HIS A 1 71   ? -35.712 -49.976  31.337  1.00 2.02  ? 72   HIS A C     1 
ATOM   512   O  O     . HIS A 1 71   ? -36.385 -49.351  32.159  1.00 2.00  ? 72   HIS A O     1 
ATOM   513   C  CB    . HIS A 1 71   ? -33.550 -51.173  31.878  1.00 2.38  ? 72   HIS A CB    1 
ATOM   514   C  CG    . HIS A 1 71   ? -33.145 -50.142  32.877  1.00 2.05  ? 72   HIS A CG    1 
ATOM   515   N  ND1   . HIS A 1 71   ? -31.854 -49.674  32.967  1.00 2.00  ? 72   HIS A ND1   1 
ATOM   516   C  CD2   . HIS A 1 71   ? -33.855 -49.476  33.812  1.00 2.14  ? 72   HIS A CD2   1 
ATOM   517   C  CE1   . HIS A 1 71   ? -31.782 -48.762  33.916  1.00 2.00  ? 72   HIS A CE1   1 
ATOM   518   N  NE2   . HIS A 1 71   ? -32.984 -48.624  34.446  1.00 2.14  ? 72   HIS A NE2   1 
ATOM   519   N  N     . GLY A 1 72   ? -35.599 -49.608  30.073  1.00 2.27  ? 73   GLY A N     1 
ATOM   520   C  CA    . GLY A 1 72   ? -36.186 -48.362  29.609  1.00 2.00  ? 73   GLY A CA    1 
ATOM   521   C  C     . GLY A 1 72   ? -37.699 -48.390  29.536  1.00 2.18  ? 73   GLY A C     1 
ATOM   522   O  O     . GLY A 1 72   ? -38.371 -47.430  29.925  1.00 2.28  ? 73   GLY A O     1 
ATOM   523   N  N     . ALA A 1 73   ? -38.241 -49.493  29.041  1.00 2.00  ? 74   ALA A N     1 
ATOM   524   C  CA    . ALA A 1 73   ? -39.679 -49.662  28.926  1.00 2.14  ? 74   ALA A CA    1 
ATOM   525   C  C     . ALA A 1 73   ? -40.300 -49.571  30.315  1.00 2.42  ? 74   ALA A C     1 
ATOM   526   O  O     . ALA A 1 73   ? -41.318 -48.898  30.490  1.00 2.84  ? 74   ALA A O     1 
ATOM   527   C  CB    . ALA A 1 73   ? -40.001 -51.027  28.291  1.00 2.00  ? 74   ALA A CB    1 
ATOM   528   N  N     . LEU A 1 74   ? -39.680 -50.248  31.291  1.00 2.41  ? 75   LEU A N     1 
ATOM   529   C  CA    . LEU A 1 74   ? -40.144 -50.249  32.680  1.00 2.00  ? 75   LEU A CA    1 
ATOM   530   C  C     . LEU A 1 74   ? -40.008 -48.866  33.301  1.00 2.10  ? 75   LEU A C     1 
ATOM   531   O  O     . LEU A 1 74   ? -40.917 -48.398  33.969  1.00 2.00  ? 75   LEU A O     1 
ATOM   532   C  CB    . LEU A 1 74   ? -39.355 -51.267  33.505  1.00 2.00  ? 75   LEU A CB    1 
ATOM   533   C  CG    . LEU A 1 74   ? -39.657 -52.759  33.331  1.00 2.30  ? 75   LEU A CG    1 
ATOM   534   C  CD1   . LEU A 1 74   ? -38.454 -53.635  33.649  1.00 2.13  ? 75   LEU A CD1   1 
ATOM   535   C  CD2   . LEU A 1 74   ? -40.771 -53.111  34.234  1.00 2.00  ? 75   LEU A CD2   1 
ATOM   536   N  N     . ALA A 1 75   ? -38.868 -48.208  33.092  1.00 2.16  ? 76   ALA A N     1 
ATOM   537   C  CA    . ALA A 1 75   ? -38.664 -46.886  33.679  1.00 2.00  ? 76   ALA A CA    1 
ATOM   538   C  C     . ALA A 1 75   ? -39.713 -45.936  33.140  1.00 2.19  ? 76   ALA A C     1 
ATOM   539   O  O     . ALA A 1 75   ? -40.126 -45.016  33.840  1.00 2.43  ? 76   ALA A O     1 
ATOM   540   C  CB    . ALA A 1 75   ? -37.299 -46.384  33.361  1.00 2.00  ? 76   ALA A CB    1 
ATOM   541   N  N     . ALA A 1 76   ? -40.145 -46.168  31.895  1.00 2.19  ? 77   ALA A N     1 
ATOM   542   C  CA    . ALA A 1 76   ? -41.158 -45.361  31.256  1.00 2.00  ? 77   ALA A CA    1 
ATOM   543   C  C     . ALA A 1 76   ? -42.612 -45.874  31.443  1.00 2.19  ? 77   ALA A C     1 
ATOM   544   O  O     . ALA A 1 76   ? -43.518 -45.523  30.668  1.00 2.19  ? 77   ALA A O     1 
ATOM   545   C  CB    . ALA A 1 76   ? -40.832 -45.165  29.795  1.00 2.00  ? 77   ALA A CB    1 
ATOM   546   N  N     . GLY A 1 77   ? -42.840 -46.702  32.458  1.00 2.00  ? 78   GLY A N     1 
ATOM   547   C  CA    . GLY A 1 77   ? -44.188 -47.147  32.771  1.00 2.04  ? 78   GLY A CA    1 
ATOM   548   C  C     . GLY A 1 77   ? -44.919 -48.278  32.064  1.00 2.30  ? 78   GLY A C     1 
ATOM   549   O  O     . GLY A 1 77   ? -46.151 -48.352  32.148  1.00 3.06  ? 78   GLY A O     1 
ATOM   550   N  N     . ALA A 1 78   ? -44.207 -49.172  31.399  1.00 2.00  ? 79   ALA A N     1 
ATOM   551   C  CA    . ALA A 1 78   ? -44.858 -50.265  30.714  1.00 2.09  ? 79   ALA A CA    1 
ATOM   552   C  C     . ALA A 1 78   ? -44.422 -51.637  31.265  1.00 2.21  ? 79   ALA A C     1 
ATOM   553   O  O     . ALA A 1 78   ? -43.239 -51.849  31.541  1.00 2.00  ? 79   ALA A O     1 
ATOM   554   C  CB    . ALA A 1 78   ? -44.582 -50.176  29.248  1.00 2.14  ? 79   ALA A CB    1 
ATOM   555   N  N     . LEU A 1 79   ? -45.398 -52.517  31.525  1.00 2.00  ? 80   LEU A N     1 
ATOM   556   C  CA    . LEU A 1 79   ? -45.102 -53.850  32.020  1.00 2.24  ? 80   LEU A CA    1 
ATOM   557   C  C     . LEU A 1 79   ? -44.280 -54.480  30.907  1.00 2.10  ? 80   LEU A C     1 
ATOM   558   O  O     . LEU A 1 79   ? -44.678 -54.407  29.740  1.00 2.18  ? 80   LEU A O     1 
ATOM   559   C  CB    . LEU A 1 79   ? -46.387 -54.627  32.304  1.00 2.51  ? 80   LEU A CB    1 
ATOM   560   C  CG    . LEU A 1 79   ? -47.256 -54.028  33.436  1.00 3.34  ? 80   LEU A CG    1 
ATOM   561   C  CD1   . LEU A 1 79   ? -48.454 -54.914  33.701  1.00 2.55  ? 80   LEU A CD1   1 
ATOM   562   C  CD2   . LEU A 1 79   ? -46.487 -53.817  34.723  1.00 3.14  ? 80   LEU A CD2   1 
ATOM   563   N  N     . THR A 1 80   ? -43.154 -55.098  31.273  1.00 2.00  ? 81   THR A N     1 
ATOM   564   C  CA    . THR A 1 80   ? -42.219 -55.658  30.300  1.00 2.00  ? 81   THR A CA    1 
ATOM   565   C  C     . THR A 1 80   ? -41.581 -56.990  30.719  1.00 2.17  ? 81   THR A C     1 
ATOM   566   O  O     . THR A 1 80   ? -41.411 -57.250  31.899  1.00 2.51  ? 81   THR A O     1 
ATOM   567   C  CB    . THR A 1 80   ? -41.087 -54.596  30.089  1.00 2.49  ? 81   THR A CB    1 
ATOM   568   O  OG1   . THR A 1 80   ? -41.669 -53.303  29.834  1.00 2.00  ? 81   THR A OG1   1 
ATOM   569   C  CG2   . THR A 1 80   ? -40.209 -54.943  28.954  1.00 2.28  ? 81   THR A CG2   1 
ATOM   570   N  N     . THR A 1 81   ? -41.355 -57.891  29.758  1.00 2.52  ? 82   THR A N     1 
ATOM   571   C  CA    . THR A 1 81   ? -40.674 -59.178  30.000  1.00 2.23  ? 82   THR A CA    1 
ATOM   572   C  C     . THR A 1 81   ? -39.663 -59.451  28.896  1.00 2.22  ? 82   THR A C     1 
ATOM   573   O  O     . THR A 1 81   ? -39.543 -58.733  27.895  1.00 2.11  ? 82   THR A O     1 
ATOM   574   C  CB    . THR A 1 81   ? -41.567 -60.445  29.907  1.00 2.00  ? 82   THR A CB    1 
ATOM   575   O  OG1   . THR A 1 81   ? -42.589 -60.240  28.942  1.00 2.86  ? 82   THR A OG1   1 
ATOM   576   C  CG2   . THR A 1 81   ? -42.093 -60.865  31.211  1.00 2.00  ? 82   THR A CG2   1 
ATOM   577   N  N     . THR A 1 82   ? -38.986 -60.568  29.057  1.00 2.00  ? 83   THR A N     1 
ATOM   578   C  CA    . THR A 1 82   ? -38.059 -60.968  28.073  1.00 2.00  ? 83   THR A CA    1 
ATOM   579   C  C     . THR A 1 82   ? -37.900 -62.440  28.304  1.00 2.00  ? 83   THR A C     1 
ATOM   580   O  O     . THR A 1 82   ? -38.195 -62.926  29.388  1.00 2.00  ? 83   THR A O     1 
ATOM   581   C  CB    . THR A 1 82   ? -36.756 -60.179  28.186  1.00 2.00  ? 83   THR A CB    1 
ATOM   582   O  OG1   . THR A 1 82   ? -35.906 -60.541  27.105  1.00 2.51  ? 83   THR A OG1   1 
ATOM   583   C  CG2   . THR A 1 82   ? -36.062 -60.435  29.476  1.00 2.00  ? 83   THR A CG2   1 
ATOM   584   N  N     . PHE A 1 83   ? -37.469 -63.159  27.277  1.00 2.00  ? 84   PHE A N     1 
ATOM   585   C  CA    . PHE A 1 83   ? -37.297 -64.609  27.368  1.00 2.22  ? 84   PHE A CA    1 
ATOM   586   C  C     . PHE A 1 83   ? -35.832 -64.923  27.093  1.00 2.45  ? 84   PHE A C     1 
ATOM   587   O  O     . PHE A 1 83   ? -35.308 -64.539  26.050  1.00 3.25  ? 84   PHE A O     1 
ATOM   588   C  CB    . PHE A 1 83   ? -38.214 -65.268  26.341  1.00 2.00  ? 84   PHE A CB    1 
ATOM   589   C  CG    . PHE A 1 83   ? -39.622 -64.702  26.338  1.00 2.00  ? 84   PHE A CG    1 
ATOM   590   C  CD1   . PHE A 1 83   ? -40.534 -65.051  27.331  1.00 2.20  ? 84   PHE A CD1   1 
ATOM   591   C  CD2   . PHE A 1 83   ? -40.026 -63.809  25.355  1.00 2.00  ? 84   PHE A CD2   1 
ATOM   592   C  CE1   . PHE A 1 83   ? -41.824 -64.521  27.350  1.00 2.00  ? 84   PHE A CE1   1 
ATOM   593   C  CE2   . PHE A 1 83   ? -41.304 -63.265  25.356  1.00 2.16  ? 84   PHE A CE2   1 
ATOM   594   C  CZ    . PHE A 1 83   ? -42.209 -63.623  26.359  1.00 2.49  ? 84   PHE A CZ    1 
ATOM   595   N  N     . THR A 1 84   ? -35.144 -65.576  28.015  1.00 2.00  ? 85   THR A N     1 
ATOM   596   C  CA    . THR A 1 84   ? -33.748 -65.812  27.755  1.00 2.00  ? 85   THR A CA    1 
ATOM   597   C  C     . THR A 1 84   ? -33.148 -66.991  28.466  1.00 2.00  ? 85   THR A C     1 
ATOM   598   O  O     . THR A 1 84   ? -33.835 -67.754  29.103  1.00 2.00  ? 85   THR A O     1 
ATOM   599   C  CB    . THR A 1 84   ? -32.936 -64.562  28.074  1.00 2.22  ? 85   THR A CB    1 
ATOM   600   O  OG1   . THR A 1 84   ? -31.665 -64.637  27.419  1.00 2.72  ? 85   THR A OG1   1 
ATOM   601   C  CG2   . THR A 1 84   ? -32.735 -64.405  29.601  1.00 2.40  ? 85   THR A CG2   1 
ATOM   602   N  N     . ALA A 1 85   ? -31.845 -67.132  28.361  1.00 2.00  ? 86   ALA A N     1 
ATOM   603   C  CA    . ALA A 1 85   ? -31.156 -68.239  28.994  1.00 2.26  ? 86   ALA A CA    1 
ATOM   604   C  C     . ALA A 1 85   ? -29.658 -67.957  28.916  1.00 2.37  ? 86   ALA A C     1 
ATOM   605   O  O     . ALA A 1 85   ? -29.235 -67.036  28.209  1.00 2.57  ? 86   ALA A O     1 
ATOM   606   C  CB    . ALA A 1 85   ? -31.472 -69.546  28.262  1.00 2.00  ? 86   ALA A CB    1 
ATOM   607   N  N     . SER A 1 86   ? -28.890 -68.839  29.551  1.00 2.06  ? 87   SER A N     1 
ATOM   608   C  CA    . SER A 1 86   ? -27.431 -68.831  29.648  1.00 2.09  ? 87   SER A CA    1 
ATOM   609   C  C     . SER A 1 86   ? -26.563 -67.685  29.171  1.00 2.00  ? 87   SER A C     1 
ATOM   610   O  O     . SER A 1 86   ? -26.449 -66.713  29.888  1.00 2.00  ? 87   SER A O     1 
ATOM   611   C  CB    . SER A 1 86   ? -26.817 -70.181  29.227  1.00 2.12  ? 87   SER A CB    1 
ATOM   612   O  OG    . SER A 1 86   ? -26.463 -70.234  27.859  1.00 2.07  ? 87   SER A OG    1 
ATOM   613   N  N     . GLN A 1 87   ? -25.933 -67.788  28.002  1.00 2.00  ? 88   GLN A N     1 
ATOM   614   C  CA    . GLN A 1 87   ? -25.040 -66.733  27.546  1.00 2.09  ? 88   GLN A CA    1 
ATOM   615   C  C     . GLN A 1 87   ? -25.808 -65.420  27.450  1.00 2.00  ? 88   GLN A C     1 
ATOM   616   O  O     . GLN A 1 87   ? -25.234 -64.337  27.647  1.00 2.00  ? 88   GLN A O     1 
ATOM   617   C  CB    . GLN A 1 87   ? -24.418 -67.082  26.188  1.00 2.08  ? 88   GLN A CB    1 
ATOM   618   C  CG    . GLN A 1 87   ? -23.757 -68.443  26.092  1.00 2.12  ? 88   GLN A CG    1 
ATOM   619   C  CD    . GLN A 1 87   ? -22.686 -68.664  27.116  1.00 2.36  ? 88   GLN A CD    1 
ATOM   620   O  OE1   . GLN A 1 87   ? -22.584 -69.746  27.704  1.00 2.49  ? 88   GLN A OE1   1 
ATOM   621   N  NE2   . GLN A 1 87   ? -21.834 -67.673  27.296  1.00 2.04  ? 88   GLN A NE2   1 
ATOM   622   N  N     . GLY A 1 88   ? -27.100 -65.551  27.152  1.00 2.00  ? 89   GLY A N     1 
ATOM   623   C  CA    . GLY A 1 88   ? -28.003 -64.420  27.043  1.00 2.00  ? 89   GLY A CA    1 
ATOM   624   C  C     . GLY A 1 88   ? -28.249 -63.718  28.370  1.00 2.08  ? 89   GLY A C     1 
ATOM   625   O  O     . GLY A 1 88   ? -28.092 -62.481  28.497  1.00 2.00  ? 89   GLY A O     1 
ATOM   626   N  N     . LEU A 1 89   ? -28.576 -64.525  29.379  1.00 2.00  ? 90   LEU A N     1 
ATOM   627   C  CA    . LEU A 1 89   ? -28.827 -64.013  30.717  1.00 2.16  ? 90   LEU A CA    1 
ATOM   628   C  C     . LEU A 1 89   ? -27.613 -63.233  31.226  1.00 2.13  ? 90   LEU A C     1 
ATOM   629   O  O     . LEU A 1 89   ? -27.780 -62.175  31.817  1.00 2.00  ? 90   LEU A O     1 
ATOM   630   C  CB    . LEU A 1 89   ? -29.192 -65.146  31.686  1.00 2.00  ? 90   LEU A CB    1 
ATOM   631   C  CG    . LEU A 1 89   ? -29.505 -64.742  33.108  1.00 2.00  ? 90   LEU A CG    1 
ATOM   632   C  CD1   . LEU A 1 89   ? -30.691 -63.877  33.101  1.00 2.00  ? 90   LEU A CD1   1 
ATOM   633   C  CD2   . LEU A 1 89   ? -29.801 -65.959  33.942  1.00 2.38  ? 90   LEU A CD2   1 
ATOM   634   N  N     . LEU A 1 90   ? -26.413 -63.745  30.929  1.00 2.00  ? 91   LEU A N     1 
ATOM   635   C  CA    . LEU A 1 90   ? -25.145 -63.147  31.324  1.00 2.00  ? 91   LEU A CA    1 
ATOM   636   C  C     . LEU A 1 90   ? -25.039 -61.727  30.800  1.00 2.21  ? 91   LEU A C     1 
ATOM   637   O  O     . LEU A 1 90   ? -24.616 -60.837  31.525  1.00 2.51  ? 91   LEU A O     1 
ATOM   638   C  CB    . LEU A 1 90   ? -23.951 -63.981  30.838  1.00 2.00  ? 91   LEU A CB    1 
ATOM   639   C  CG    . LEU A 1 90   ? -23.675 -65.320  31.553  1.00 2.00  ? 91   LEU A CG    1 
ATOM   640   C  CD1   . LEU A 1 90   ? -22.417 -65.880  31.057  1.00 2.00  ? 91   LEU A CD1   1 
ATOM   641   C  CD2   . LEU A 1 90   ? -23.560 -65.168  33.034  1.00 2.00  ? 91   LEU A CD2   1 
ATOM   642   N  N     . LEU A 1 91   ? -25.471 -61.497  29.568  1.00 2.00  ? 92   LEU A N     1 
ATOM   643   C  CA    . LEU A 1 91   ? -25.419 -60.159  29.038  1.00 2.05  ? 92   LEU A CA    1 
ATOM   644   C  C     . LEU A 1 91   ? -26.465 -59.256  29.686  1.00 2.00  ? 92   LEU A C     1 
ATOM   645   O  O     . LEU A 1 91   ? -26.373 -58.046  29.600  1.00 2.12  ? 92   LEU A O     1 
ATOM   646   C  CB    . LEU A 1 91   ? -25.588 -60.138  27.514  1.00 2.00  ? 92   LEU A CB    1 
ATOM   647   C  CG    . LEU A 1 91   ? -24.533 -60.840  26.667  1.00 2.31  ? 92   LEU A CG    1 
ATOM   648   C  CD1   . LEU A 1 91   ? -24.555 -60.377  25.208  1.00 2.07  ? 92   LEU A CD1   1 
ATOM   649   C  CD2   . LEU A 1 91   ? -23.215 -60.545  27.279  1.00 2.25  ? 92   LEU A CD2   1 
ATOM   650   N  N     . MET A 1 92   ? -27.439 -59.819  30.368  1.00 2.00  ? 93   MET A N     1 
ATOM   651   C  CA    . MET A 1 92   ? -28.456 -58.972  30.965  1.00 2.00  ? 93   MET A CA    1 
ATOM   652   C  C     . MET A 1 92   ? -28.102 -58.543  32.357  1.00 2.00  ? 93   MET A C     1 
ATOM   653   O  O     . MET A 1 92   ? -28.697 -57.617  32.885  1.00 2.00  ? 93   MET A O     1 
ATOM   654   C  CB    . MET A 1 92   ? -29.797 -59.691  31.002  1.00 2.00  ? 93   MET A CB    1 
ATOM   655   C  CG    . MET A 1 92   ? -30.232 -60.254  29.696  1.00 2.00  ? 93   MET A CG    1 
ATOM   656   S  SD    . MET A 1 92   ? -32.036 -60.144  29.635  1.00 3.70  ? 93   MET A SD    1 
ATOM   657   C  CE    . MET A 1 92   ? -32.357 -60.866  27.946  1.00 2.40  ? 93   MET A CE    1 
ATOM   658   N  N     . ILE A 1 93   ? -27.115 -59.214  32.937  1.00 2.00  ? 94   ILE A N     1 
ATOM   659   C  CA    . ILE A 1 93   ? -26.678 -58.950  34.312  1.00 2.11  ? 94   ILE A CA    1 
ATOM   660   C  C     . ILE A 1 93   ? -26.418 -57.492  34.702  1.00 2.00  ? 94   ILE A C     1 
ATOM   661   O  O     . ILE A 1 93   ? -26.883 -57.052  35.732  1.00 2.03  ? 94   ILE A O     1 
ATOM   662   C  CB    . ILE A 1 93   ? -25.505 -59.930  34.738  1.00 2.00  ? 94   ILE A CB    1 
ATOM   663   C  CG1   . ILE A 1 93   ? -26.081 -61.319  34.937  1.00 2.01  ? 94   ILE A CG1   1 
ATOM   664   C  CG2   . ILE A 1 93   ? -24.796 -59.487  36.046  1.00 2.00  ? 94   ILE A CG2   1 
ATOM   665   C  CD1   . ILE A 1 93   ? -25.054 -62.449  34.965  1.00 2.00  ? 94   ILE A CD1   1 
ATOM   666   N  N     . PRO A 1 94   ? -25.629 -56.740  33.931  1.00 2.19  ? 95   PRO A N     1 
ATOM   667   C  CA    . PRO A 1 94   ? -25.426 -55.337  34.366  1.00 2.00  ? 95   PRO A CA    1 
ATOM   668   C  C     . PRO A 1 94   ? -26.756 -54.551  34.509  1.00 2.05  ? 95   PRO A C     1 
ATOM   669   O  O     . PRO A 1 94   ? -26.943 -53.802  35.452  1.00 2.00  ? 95   PRO A O     1 
ATOM   670   C  CB    . PRO A 1 94   ? -24.557 -54.762  33.256  1.00 2.00  ? 95   PRO A CB    1 
ATOM   671   C  CG    . PRO A 1 94   ? -23.745 -55.967  32.805  1.00 2.00  ? 95   PRO A CG    1 
ATOM   672   C  CD    . PRO A 1 94   ? -24.771 -57.093  32.780  1.00 2.00  ? 95   PRO A CD    1 
ATOM   673   N  N     . ASN A 1 95   ? -27.682 -54.745  33.575  1.00 2.24  ? 96   ASN A N     1 
ATOM   674   C  CA    . ASN A 1 95   ? -29.000 -54.074  33.617  1.00 2.32  ? 96   ASN A CA    1 
ATOM   675   C  C     . ASN A 1 95   ? -29.903 -54.663  34.720  1.00 2.32  ? 96   ASN A C     1 
ATOM   676   O  O     . ASN A 1 95   ? -30.815 -54.006  35.177  1.00 2.65  ? 96   ASN A O     1 
ATOM   677   C  CB    . ASN A 1 95   ? -29.710 -54.188  32.242  1.00 2.15  ? 96   ASN A CB    1 
ATOM   678   C  CG    . ASN A 1 95   ? -29.627 -52.922  31.436  1.00 2.00  ? 96   ASN A CG    1 
ATOM   679   O  OD1   . ASN A 1 95   ? -30.253 -51.920  31.790  1.00 2.00  ? 96   ASN A OD1   1 
ATOM   680   N  ND2   . ASN A 1 95   ? -28.884 -52.955  30.340  1.00 2.00  ? 96   ASN A ND2   1 
ATOM   681   N  N     . MET A 1 96   ? -29.704 -55.928  35.077  1.00 2.12  ? 97   MET A N     1 
ATOM   682   C  CA    . MET A 1 96   ? -30.506 -56.532  36.119  1.00 2.19  ? 97   MET A CA    1 
ATOM   683   C  C     . MET A 1 96   ? -30.230 -55.808  37.409  1.00 2.00  ? 97   MET A C     1 
ATOM   684   O  O     . MET A 1 96   ? -31.138 -55.599  38.169  1.00 2.58  ? 97   MET A O     1 
ATOM   685   C  CB    . MET A 1 96   ? -30.251 -58.042  36.252  1.00 2.00  ? 97   MET A CB    1 
ATOM   686   C  CG    . MET A 1 96   ? -30.832 -58.863  35.103  1.00 2.00  ? 97   MET A CG    1 
ATOM   687   S  SD    . MET A 1 96   ? -30.560 -60.649  35.226  1.00 2.00  ? 97   MET A SD    1 
ATOM   688   C  CE    . MET A 1 96   ? -31.414 -60.971  36.631  1.00 2.00  ? 97   MET A CE    1 
ATOM   689   N  N     . TYR A 1 97   ? -28.992 -55.423  37.683  1.00 2.00  ? 98   TYR A N     1 
ATOM   690   C  CA    . TYR A 1 97   ? -28.753 -54.662  38.923  1.00 2.33  ? 98   TYR A CA    1 
ATOM   691   C  C     . TYR A 1 97   ? -29.506 -53.328  38.866  1.00 2.00  ? 98   TYR A C     1 
ATOM   692   O  O     . TYR A 1 97   ? -29.948 -52.814  39.880  1.00 2.15  ? 98   TYR A O     1 
ATOM   693   C  CB    . TYR A 1 97   ? -27.293 -54.297  39.090  1.00 2.00  ? 98   TYR A CB    1 
ATOM   694   C  CG    . TYR A 1 97   ? -26.394 -55.383  39.529  1.00 2.00  ? 98   TYR A CG    1 
ATOM   695   C  CD1   . TYR A 1 97   ? -26.211 -55.649  40.858  1.00 2.00  ? 98   TYR A CD1   1 
ATOM   696   C  CD2   . TYR A 1 97   ? -25.686 -56.115  38.613  1.00 2.00  ? 98   TYR A CD2   1 
ATOM   697   C  CE1   . TYR A 1 97   ? -25.346 -56.609  41.268  1.00 2.00  ? 98   TYR A CE1   1 
ATOM   698   C  CE2   . TYR A 1 97   ? -24.835 -57.092  39.005  1.00 2.00  ? 98   TYR A CE2   1 
ATOM   699   C  CZ    . TYR A 1 97   ? -24.665 -57.343  40.347  1.00 2.00  ? 98   TYR A CZ    1 
ATOM   700   O  OH    . TYR A 1 97   ? -23.855 -58.393  40.760  1.00 2.00  ? 98   TYR A OH    1 
ATOM   701   N  N     . LYS A 1 98   ? -29.574 -52.755  37.673  1.00 2.00  ? 99   LYS A N     1 
ATOM   702   C  CA    . LYS A 1 98   ? -30.207 -51.458  37.469  1.00 2.18  ? 99   LYS A CA    1 
ATOM   703   C  C     . LYS A 1 98   ? -31.718 -51.555  37.592  1.00 2.09  ? 99   LYS A C     1 
ATOM   704   O  O     . LYS A 1 98   ? -32.344 -50.766  38.285  1.00 2.00  ? 99   LYS A O     1 
ATOM   705   C  CB    . LYS A 1 98   ? -29.798 -50.909  36.103  1.00 2.00  ? 99   LYS A CB    1 
ATOM   706   C  CG    . LYS A 1 98   ? -28.492 -50.099  36.094  1.00 2.03  ? 99   LYS A CG    1 
ATOM   707   C  CD    . LYS A 1 98   ? -28.770 -48.694  36.548  1.00 2.00  ? 99   LYS A CD    1 
ATOM   708   C  CE    . LYS A 1 98   ? -27.584 -47.796  36.577  1.00 2.00  ? 99   LYS A CE    1 
ATOM   709   N  NZ    . LYS A 1 98   ? -27.994 -46.376  36.909  1.00 2.00  ? 99   LYS A NZ    1 
ATOM   710   N  N     . ILE A 1 99   ? -32.270 -52.611  37.000  1.00 2.06  ? 100  ILE A N     1 
ATOM   711   C  CA    . ILE A 1 99   ? -33.701 -52.869  36.998  1.00 2.20  ? 100  ILE A CA    1 
ATOM   712   C  C     . ILE A 1 99   ? -34.160 -53.066  38.450  1.00 2.38  ? 100  ILE A C     1 
ATOM   713   O  O     . ILE A 1 99   ? -35.065 -52.375  38.902  1.00 3.08  ? 100  ILE A O     1 
ATOM   714   C  CB    . ILE A 1 99   ? -34.063 -54.092  36.083  1.00 2.00  ? 100  ILE A CB    1 
ATOM   715   C  CG1   . ILE A 1 99   ? -33.888 -53.731  34.616  1.00 2.00  ? 100  ILE A CG1   1 
ATOM   716   C  CG2   . ILE A 1 99   ? -35.521 -54.475  36.245  1.00 2.26  ? 100  ILE A CG2   1 
ATOM   717   C  CD1   . ILE A 1 99   ? -33.702 -54.894  33.713  1.00 2.00  ? 100  ILE A CD1   1 
ATOM   718   N  N     . SER A 1 100  ? -33.501 -53.948  39.196  1.00 2.41  ? 101  SER A N     1 
ATOM   719   C  CA    . SER A 1 100  ? -33.856 -54.157  40.590  1.00 2.30  ? 101  SER A CA    1 
ATOM   720   C  C     . SER A 1 100  ? -33.479 -52.970  41.515  1.00 2.31  ? 101  SER A C     1 
ATOM   721   O  O     . SER A 1 100  ? -34.157 -52.690  42.503  1.00 2.82  ? 101  SER A O     1 
ATOM   722   C  CB    . SER A 1 100  ? -33.258 -55.457  41.109  1.00 2.00  ? 101  SER A CB    1 
ATOM   723   O  OG    . SER A 1 100  ? -31.857 -55.395  41.101  1.00 2.12  ? 101  SER A OG    1 
ATOM   724   N  N     . GLY A 1 101  ? -32.388 -52.281  41.229  1.00 2.65  ? 102  GLY A N     1 
ATOM   725   C  CA    . GLY A 1 101  ? -32.023 -51.158  42.066  1.00 2.00  ? 102  GLY A CA    1 
ATOM   726   C  C     . GLY A 1 101  ? -33.059 -50.069  41.919  1.00 2.00  ? 102  GLY A C     1 
ATOM   727   O  O     . GLY A 1 101  ? -33.353 -49.359  42.867  1.00 2.21  ? 102  GLY A O     1 
ATOM   728   N  N     . GLU A 1 102  ? -33.656 -49.970  40.743  1.00 2.00  ? 103  GLU A N     1 
ATOM   729   C  CA    . GLU A 1 102  ? -34.661 -48.956  40.509  1.00 2.13  ? 103  GLU A CA    1 
ATOM   730   C  C     . GLU A 1 102  ? -36.079 -49.405  40.844  1.00 2.11  ? 103  GLU A C     1 
ATOM   731   O  O     . GLU A 1 102  ? -37.071 -48.756  40.502  1.00 2.00  ? 103  GLU A O     1 
ATOM   732   C  CB    . GLU A 1 102  ? -34.526 -48.480  39.080  1.00 2.63  ? 103  GLU A CB    1 
ATOM   733   C  CG    . GLU A 1 102  ? -33.252 -47.643  38.927  1.00 3.28  ? 103  GLU A CG    1 
ATOM   734   C  CD    . GLU A 1 102  ? -33.093 -47.022  37.551  1.00 4.32  ? 103  GLU A CD    1 
ATOM   735   O  OE1   . GLU A 1 102  ? -34.016 -47.154  36.691  1.00 4.01  ? 103  GLU A OE1   1 
ATOM   736   O  OE2   . GLU A 1 102  ? -32.017 -46.402  37.333  1.00 4.95  ? 103  GLU A OE2   1 
ATOM   737   N  N     . LEU A 1 103  ? -36.157 -50.552  41.508  1.00 2.48  ? 104  LEU A N     1 
ATOM   738   C  CA    . LEU A 1 103  ? -37.421 -51.149  41.924  1.00 2.30  ? 104  LEU A CA    1 
ATOM   739   C  C     . LEU A 1 103  ? -38.465 -51.158  40.812  1.00 2.29  ? 104  LEU A C     1 
ATOM   740   O  O     . LEU A 1 103  ? -39.505 -50.503  40.923  1.00 2.56  ? 104  LEU A O     1 
ATOM   741   C  CB    . LEU A 1 103  ? -37.931 -50.459  43.205  1.00 2.00  ? 104  LEU A CB    1 
ATOM   742   C  CG    . LEU A 1 103  ? -37.049 -50.780  44.422  1.00 2.00  ? 104  LEU A CG    1 
ATOM   743   C  CD1   . LEU A 1 103  ? -37.332 -49.875  45.561  1.00 2.00  ? 104  LEU A CD1   1 
ATOM   744   C  CD2   . LEU A 1 103  ? -37.225 -52.249  44.836  1.00 2.00  ? 104  LEU A CD2   1 
ATOM   745   N  N     . LEU A 1 104  ? -38.140 -51.844  39.717  1.00 2.02  ? 105  LEU A N     1 
ATOM   746   C  CA    . LEU A 1 104  ? -39.045 -51.982  38.588  1.00 2.08  ? 105  LEU A CA    1 
ATOM   747   C  C     . LEU A 1 104  ? -39.655 -53.390  38.530  1.00 2.16  ? 105  LEU A C     1 
ATOM   748   O  O     . LEU A 1 104  ? -38.940 -54.380  38.670  1.00 2.53  ? 105  LEU A O     1 
ATOM   749   C  CB    . LEU A 1 104  ? -38.296 -51.696  37.297  1.00 2.07  ? 105  LEU A CB    1 
ATOM   750   C  CG    . LEU A 1 104  ? -37.745 -50.288  37.208  1.00 2.00  ? 105  LEU A CG    1 
ATOM   751   C  CD1   . LEU A 1 104  ? -36.764 -50.133  36.023  1.00 2.00  ? 105  LEU A CD1   1 
ATOM   752   C  CD2   . LEU A 1 104  ? -38.921 -49.327  37.137  1.00 2.00  ? 105  LEU A CD2   1 
ATOM   753   N  N     . PRO A 1 105  ? -40.972 -53.493  38.237  1.00 2.36  ? 106  PRO A N     1 
ATOM   754   C  CA    . PRO A 1 105  ? -41.663 -54.780  38.154  1.00 2.06  ? 106  PRO A CA    1 
ATOM   755   C  C     . PRO A 1 105  ? -41.391 -55.572  36.866  1.00 2.26  ? 106  PRO A C     1 
ATOM   756   O  O     . PRO A 1 105  ? -42.326 -56.033  36.211  1.00 2.32  ? 106  PRO A O     1 
ATOM   757   C  CB    . PRO A 1 105  ? -43.125 -54.366  38.261  1.00 2.20  ? 106  PRO A CB    1 
ATOM   758   C  CG    . PRO A 1 105  ? -43.164 -53.090  37.509  1.00 2.00  ? 106  PRO A CG    1 
ATOM   759   C  CD    . PRO A 1 105  ? -41.907 -52.377  37.952  1.00 2.03  ? 106  PRO A CD    1 
ATOM   760   N  N     . GLY A 1 106  ? -40.122 -55.715  36.483  1.00 2.00  ? 107  GLY A N     1 
ATOM   761   C  CA    . GLY A 1 106  ? -39.833 -56.488  35.299  1.00 2.00  ? 107  GLY A CA    1 
ATOM   762   C  C     . GLY A 1 106  ? -39.955 -57.956  35.655  1.00 2.00  ? 107  GLY A C     1 
ATOM   763   O  O     . GLY A 1 106  ? -39.993 -58.280  36.827  1.00 2.00  ? 107  GLY A O     1 
ATOM   764   N  N     . VAL A 1 107  ? -40.148 -58.816  34.661  1.00 2.00  ? 108  VAL A N     1 
ATOM   765   C  CA    . VAL A 1 107  ? -40.215 -60.249  34.864  1.00 2.00  ? 108  VAL A CA    1 
ATOM   766   C  C     . VAL A 1 107  ? -39.440 -60.863  33.721  1.00 2.00  ? 108  VAL A C     1 
ATOM   767   O  O     . VAL A 1 107  ? -39.713 -60.563  32.571  1.00 2.00  ? 108  VAL A O     1 
ATOM   768   C  CB    . VAL A 1 107  ? -41.653 -60.841  34.816  1.00 2.19  ? 108  VAL A CB    1 
ATOM   769   C  CG1   . VAL A 1 107  ? -41.587 -62.394  35.092  1.00 2.00  ? 108  VAL A CG1   1 
ATOM   770   C  CG2   . VAL A 1 107  ? -42.535 -60.165  35.818  1.00 2.00  ? 108  VAL A CG2   1 
ATOM   771   N  N     . PHE A 1 108  ? -38.465 -61.702  34.051  1.00 2.00  ? 109  PHE A N     1 
ATOM   772   C  CA    . PHE A 1 108  ? -37.646 -62.372  33.059  1.00 2.00  ? 109  PHE A CA    1 
ATOM   773   C  C     . PHE A 1 108  ? -38.080 -63.802  33.085  1.00 2.17  ? 109  PHE A C     1 
ATOM   774   O  O     . PHE A 1 108  ? -38.200 -64.372  34.167  1.00 2.08  ? 109  PHE A O     1 
ATOM   775   C  CB    . PHE A 1 108  ? -36.191 -62.405  33.486  1.00 2.00  ? 109  PHE A CB    1 
ATOM   776   C  CG    . PHE A 1 108  ? -35.469 -61.157  33.265  1.00 2.07  ? 109  PHE A CG    1 
ATOM   777   C  CD1   . PHE A 1 108  ? -36.151 -59.969  33.001  1.00 2.07  ? 109  PHE A CD1   1 
ATOM   778   C  CD2   . PHE A 1 108  ? -34.077 -61.162  33.284  1.00 2.00  ? 109  PHE A CD2   1 
ATOM   779   C  CE1   . PHE A 1 108  ? -35.457 -58.802  32.755  1.00 2.50  ? 109  PHE A CE1   1 
ATOM   780   C  CE2   . PHE A 1 108  ? -33.354 -60.003  33.038  1.00 2.01  ? 109  PHE A CE2   1 
ATOM   781   C  CZ    . PHE A 1 108  ? -34.027 -58.815  32.769  1.00 2.59  ? 109  PHE A CZ    1 
ATOM   782   N  N     . HIS A 1 109  ? -38.322 -64.395  31.922  1.00 2.00  ? 110  HIS A N     1 
ATOM   783   C  CA    . HIS A 1 109  ? -38.654 -65.796  31.899  1.00 2.00  ? 110  HIS A CA    1 
ATOM   784   C  C     . HIS A 1 109  ? -37.444 -66.547  31.305  1.00 2.00  ? 110  HIS A C     1 
ATOM   785   O  O     . HIS A 1 109  ? -37.108 -66.376  30.144  1.00 2.00  ? 110  HIS A O     1 
ATOM   786   C  CB    . HIS A 1 109  ? -39.925 -66.021  31.109  1.00 2.00  ? 110  HIS A CB    1 
ATOM   787   C  CG    . HIS A 1 109  ? -41.151 -65.538  31.816  1.00 2.00  ? 110  HIS A CG    1 
ATOM   788   N  ND1   . HIS A 1 109  ? -41.759 -64.333  31.517  1.00 2.03  ? 110  HIS A ND1   1 
ATOM   789   C  CD2   . HIS A 1 109  ? -41.867 -66.077  32.824  1.00 2.00  ? 110  HIS A CD2   1 
ATOM   790   C  CE1   . HIS A 1 109  ? -42.800 -64.154  32.311  1.00 2.00  ? 110  HIS A CE1   1 
ATOM   791   N  NE2   . HIS A 1 109  ? -42.889 -65.197  33.115  1.00 2.00  ? 110  HIS A NE2   1 
ATOM   792   N  N     . VAL A 1 110  ? -36.738 -67.312  32.125  1.00 2.00  ? 111  VAL A N     1 
ATOM   793   C  CA    . VAL A 1 110  ? -35.588 -68.041  31.623  1.00 2.12  ? 111  VAL A CA    1 
ATOM   794   C  C     . VAL A 1 110  ? -35.665 -69.549  31.714  1.00 2.00  ? 111  VAL A C     1 
ATOM   795   O  O     . VAL A 1 110  ? -36.097 -70.120  32.706  1.00 2.00  ? 111  VAL A O     1 
ATOM   796   C  CB    . VAL A 1 110  ? -34.236 -67.559  32.270  1.00 2.13  ? 111  VAL A CB    1 
ATOM   797   C  CG1   . VAL A 1 110  ? -34.437 -66.265  33.035  1.00 2.12  ? 111  VAL A CG1   1 
ATOM   798   C  CG2   . VAL A 1 110  ? -33.556 -68.660  33.114  1.00 2.00  ? 111  VAL A CG2   1 
ATOM   799   N  N     . THR A 1 111  ? -35.202 -70.169  30.645  1.00 2.12  ? 112  THR A N     1 
ATOM   800   C  CA    . THR A 1 111  ? -35.114 -71.609  30.516  1.00 2.00  ? 112  THR A CA    1 
ATOM   801   C  C     . THR A 1 111  ? -33.644 -71.898  30.917  1.00 2.03  ? 112  THR A C     1 
ATOM   802   O  O     . THR A 1 111  ? -32.730 -71.801  30.101  1.00 2.00  ? 112  THR A O     1 
ATOM   803   C  CB    . THR A 1 111  ? -35.447 -72.014  29.073  1.00 2.00  ? 112  THR A CB    1 
ATOM   804   O  OG1   . THR A 1 111  ? -34.588 -71.332  28.166  1.00 2.14  ? 112  THR A OG1   1 
ATOM   805   C  CG2   . THR A 1 111  ? -36.822 -71.556  28.700  1.00 2.00  ? 112  THR A CG2   1 
ATOM   806   N  N     . ALA A 1 112  ? -33.429 -72.146  32.213  1.00 2.00  ? 113  ALA A N     1 
ATOM   807   C  CA    . ALA A 1 112  ? -32.108 -72.378  32.774  1.00 2.12  ? 113  ALA A CA    1 
ATOM   808   C  C     . ALA A 1 112  ? -31.284 -73.378  31.980  1.00 2.34  ? 113  ALA A C     1 
ATOM   809   O  O     . ALA A 1 112  ? -31.572 -74.567  31.929  1.00 2.17  ? 113  ALA A O     1 
ATOM   810   C  CB    . ALA A 1 112  ? -32.204 -72.748  34.243  1.00 2.16  ? 113  ALA A CB    1 
ATOM   811   N  N     . ARG A 1 113  ? -30.225 -72.836  31.388  1.00 2.57  ? 114  ARG A N     1 
ATOM   812   C  CA    . ARG A 1 113  ? -29.312 -73.532  30.509  1.00 2.16  ? 114  ARG A CA    1 
ATOM   813   C  C     . ARG A 1 113  ? -27.856 -73.359  30.922  1.00 2.34  ? 114  ARG A C     1 
ATOM   814   O  O     . ARG A 1 113  ? -27.478 -72.345  31.507  1.00 2.47  ? 114  ARG A O     1 
ATOM   815   C  CB    . ARG A 1 113  ? -29.498 -72.951  29.107  1.00 2.13  ? 114  ARG A CB    1 
ATOM   816   C  CG    . ARG A 1 113  ? -28.456 -73.407  28.112  1.00 2.04  ? 114  ARG A CG    1 
ATOM   817   C  CD    . ARG A 1 113  ? -28.463 -72.562  26.867  1.00 2.33  ? 114  ARG A CD    1 
ATOM   818   N  NE    . ARG A 1 113  ? -27.134 -72.497  26.281  1.00 2.00  ? 114  ARG A NE    1 
ATOM   819   C  CZ    . ARG A 1 113  ? -26.879 -72.093  25.045  1.00 2.11  ? 114  ARG A CZ    1 
ATOM   820   N  NH1   . ARG A 1 113  ? -27.857 -71.717  24.238  1.00 2.00  ? 114  ARG A NH1   1 
ATOM   821   N  NH2   . ARG A 1 113  ? -25.623 -72.031  24.633  1.00 2.32  ? 114  ARG A NH2   1 
ATOM   822   N  N     . ALA A 1 114  ? -27.020 -74.317  30.551  1.00 2.00  ? 115  ALA A N     1 
ATOM   823   C  CA    . ALA A 1 114  ? -25.616 -74.291  30.895  1.00 2.00  ? 115  ALA A CA    1 
ATOM   824   C  C     . ALA A 1 114  ? -24.853 -73.148  30.298  1.00 2.30  ? 115  ALA A C     1 
ATOM   825   O  O     . ALA A 1 114  ? -25.206 -72.646  29.270  1.00 2.92  ? 115  ALA A O     1 
ATOM   826   C  CB    . ALA A 1 114  ? -24.952 -75.587  30.450  1.00 2.00  ? 115  ALA A CB    1 
ATOM   827   N  N     . ILE A 1 115  ? -23.731 -72.835  30.931  1.00 3.07  ? 116  ILE A N     1 
ATOM   828   C  CA    . ILE A 1 115  ? -22.769 -71.814  30.529  1.00 3.08  ? 116  ILE A CA    1 
ATOM   829   C  C     . ILE A 1 115  ? -21.581 -72.474  29.785  1.00 3.11  ? 116  ILE A C     1 
ATOM   830   O  O     . ILE A 1 115  ? -21.155 -73.620  30.080  1.00 2.63  ? 116  ILE A O     1 
ATOM   831   C  CB    . ILE A 1 115  ? -22.233 -71.053  31.770  1.00 3.50  ? 116  ILE A CB    1 
ATOM   832   C  CG1   . ILE A 1 115  ? -23.403 -70.422  32.547  1.00 3.88  ? 116  ILE A CG1   1 
ATOM   833   C  CG2   . ILE A 1 115  ? -21.301 -69.924  31.333  1.00 4.06  ? 116  ILE A CG2   1 
ATOM   834   C  CD1   . ILE A 1 115  ? -24.212 -69.361  31.756  1.00 3.09  ? 116  ILE A CD1   1 
ATOM   835   N  N     . ALA A 1 116  ? -21.084 -71.762  28.787  1.00 2.69  ? 117  ALA A N     1 
ATOM   836   C  CA    . ALA A 1 116  ? -19.979 -72.250  27.972  1.00 2.69  ? 117  ALA A CA    1 
ATOM   837   C  C     . ALA A 1 116  ? -18.646 -72.045  28.702  1.00 2.61  ? 117  ALA A C     1 
ATOM   838   O  O     . ALA A 1 116  ? -18.204 -70.912  28.910  1.00 3.20  ? 117  ALA A O     1 
ATOM   839   C  CB    . ALA A 1 116  ? -19.977 -71.502  26.598  1.00 2.05  ? 117  ALA A CB    1 
ATOM   840   N  N     . ALA A 1 117  ? -17.999 -73.121  29.097  1.00 2.00  ? 118  ALA A N     1 
ATOM   841   C  CA    . ALA A 1 117  ? -16.742 -72.992  29.785  1.00 2.00  ? 118  ALA A CA    1 
ATOM   842   C  C     . ALA A 1 117  ? -15.783 -73.854  28.992  1.00 2.45  ? 118  ALA A C     1 
ATOM   843   O  O     . ALA A 1 117  ? -15.124 -73.336  28.086  1.00 2.44  ? 118  ALA A O     1 
ATOM   844   C  CB    . ALA A 1 117  ? -16.867 -73.461  31.176  1.00 2.00  ? 118  ALA A CB    1 
ATOM   845   N  N     . HIS A 1 118  ? -15.709 -75.159  29.303  1.00 2.32  ? 119  HIS A N     1 
ATOM   846   C  CA    . HIS A 1 118  ? -14.852 -76.084  28.541  1.00 2.57  ? 119  HIS A CA    1 
ATOM   847   C  C     . HIS A 1 118  ? -15.490 -76.335  27.153  1.00 2.27  ? 119  HIS A C     1 
ATOM   848   O  O     . HIS A 1 118  ? -14.808 -76.670  26.166  1.00 2.21  ? 119  HIS A O     1 
ATOM   849   C  CB    . HIS A 1 118  ? -14.633 -77.449  29.283  1.00 2.64  ? 119  HIS A CB    1 
ATOM   850   C  CG    . HIS A 1 118  ? -15.830 -78.349  29.276  1.00 2.65  ? 119  HIS A CG    1 
ATOM   851   N  ND1   . HIS A 1 118  ? -16.923 -78.129  30.081  1.00 3.00  ? 119  HIS A ND1   1 
ATOM   852   C  CD2   . HIS A 1 118  ? -16.132 -79.430  28.520  1.00 2.77  ? 119  HIS A CD2   1 
ATOM   853   C  CE1   . HIS A 1 118  ? -17.850 -79.037  29.818  1.00 2.50  ? 119  HIS A CE1   1 
ATOM   854   N  NE2   . HIS A 1 118  ? -17.396 -79.835  28.875  1.00 2.00  ? 119  HIS A NE2   1 
ATOM   855   N  N     . ALA A 1 119  ? -16.810 -76.212  27.109  1.00 2.00  ? 120  ALA A N     1 
ATOM   856   C  CA    . ALA A 1 119  ? -17.588 -76.433  25.911  1.00 2.00  ? 120  ALA A CA    1 
ATOM   857   C  C     . ALA A 1 119  ? -18.943 -75.782  26.108  1.00 2.00  ? 120  ALA A C     1 
ATOM   858   O  O     . ALA A 1 119  ? -19.362 -75.547  27.224  1.00 2.00  ? 120  ALA A O     1 
ATOM   859   C  CB    . ALA A 1 119  ? -17.783 -77.928  25.710  1.00 2.04  ? 120  ALA A CB    1 
ATOM   860   N  N     . LEU A 1 120  ? -19.617 -75.488  25.008  1.00 2.00  ? 121  LEU A N     1 
ATOM   861   C  CA    . LEU A 1 120  ? -20.932 -74.907  25.048  1.00 2.00  ? 121  LEU A CA    1 
ATOM   862   C  C     . LEU A 1 120  ? -21.982 -76.002  25.104  1.00 2.19  ? 121  LEU A C     1 
ATOM   863   O  O     . LEU A 1 120  ? -21.795 -77.053  24.533  1.00 2.31  ? 121  LEU A O     1 
ATOM   864   C  CB    . LEU A 1 120  ? -21.182 -74.069  23.795  1.00 2.00  ? 121  LEU A CB    1 
ATOM   865   C  CG    . LEU A 1 120  ? -22.626 -73.608  23.522  1.00 2.00  ? 121  LEU A CG    1 
ATOM   866   C  CD1   . LEU A 1 120  ? -22.619 -72.270  22.740  1.00 2.02  ? 121  LEU A CD1   1 
ATOM   867   C  CD2   . LEU A 1 120  ? -23.425 -74.657  22.781  1.00 2.00  ? 121  LEU A CD2   1 
ATOM   868   N  N     . SER A 1 121  ? -23.070 -75.755  25.815  1.00 2.02  ? 122  SER A N     1 
ATOM   869   C  CA    . SER A 1 121  ? -24.173 -76.697  25.840  1.00 2.71  ? 122  SER A CA    1 
ATOM   870   C  C     . SER A 1 121  ? -25.460 -75.855  25.810  1.00 2.64  ? 122  SER A C     1 
ATOM   871   O  O     . SER A 1 121  ? -25.543 -74.849  26.486  1.00 2.54  ? 122  SER A O     1 
ATOM   872   C  CB    . SER A 1 121  ? -24.156 -77.591  27.085  1.00 2.50  ? 122  SER A CB    1 
ATOM   873   O  OG    . SER A 1 121  ? -25.326 -78.398  27.123  1.00 2.00  ? 122  SER A OG    1 
ATOM   874   N  N     . ILE A 1 122  ? -26.423 -76.258  24.995  1.00 2.46  ? 123  ILE A N     1 
ATOM   875   C  CA    . ILE A 1 122  ? -27.699 -75.574  24.900  1.00 2.35  ? 123  ILE A CA    1 
ATOM   876   C  C     . ILE A 1 122  ? -28.673 -76.208  25.895  1.00 2.43  ? 123  ILE A C     1 
ATOM   877   O  O     . ILE A 1 122  ? -29.862 -75.809  25.993  1.00 2.00  ? 123  ILE A O     1 
ATOM   878   C  CB    . ILE A 1 122  ? -28.321 -75.727  23.489  1.00 2.24  ? 123  ILE A CB    1 
ATOM   879   C  CG1   . ILE A 1 122  ? -28.535 -77.206  23.150  1.00 2.21  ? 123  ILE A CG1   1 
ATOM   880   C  CG2   . ILE A 1 122  ? -27.492 -75.038  22.446  1.00 2.00  ? 123  ILE A CG2   1 
ATOM   881   C  CD1   . ILE A 1 122  ? -29.394 -77.394  21.929  1.00 2.00  ? 123  ILE A CD1   1 
ATOM   882   N  N     . PHE A 1 123  ? -28.143 -77.192  26.629  1.00 2.82  ? 124  PHE A N     1 
ATOM   883   C  CA    . PHE A 1 123  ? -28.909 -77.997  27.588  1.00 2.77  ? 124  PHE A CA    1 
ATOM   884   C  C     . PHE A 1 123  ? -29.150 -77.512  29.009  1.00 3.04  ? 124  PHE A C     1 
ATOM   885   O  O     . PHE A 1 123  ? -28.503 -76.548  29.461  1.00 2.66  ? 124  PHE A O     1 
ATOM   886   C  CB    . PHE A 1 123  ? -28.419 -79.434  27.522  1.00 2.57  ? 124  PHE A CB    1 
ATOM   887   C  CG    . PHE A 1 123  ? -28.695 -80.045  26.207  1.00 2.18  ? 124  PHE A CG    1 
ATOM   888   C  CD1   . PHE A 1 123  ? -29.981 -80.485  25.893  1.00 2.00  ? 124  PHE A CD1   1 
ATOM   889   C  CD2   . PHE A 1 123  ? -27.727 -80.065  25.232  1.00 2.20  ? 124  PHE A CD2   1 
ATOM   890   C  CE1   . PHE A 1 123  ? -30.299 -80.934  24.618  1.00 2.00  ? 124  PHE A CE1   1 
ATOM   891   C  CE2   . PHE A 1 123  ? -28.046 -80.520  23.943  1.00 2.49  ? 124  PHE A CE2   1 
ATOM   892   C  CZ    . PHE A 1 123  ? -29.339 -80.951  23.648  1.00 2.00  ? 124  PHE A CZ    1 
ATOM   893   N  N     . GLY A 1 124  ? -30.024 -78.235  29.720  1.00 2.36  ? 125  GLY A N     1 
ATOM   894   C  CA    . GLY A 1 124  ? -30.446 -77.801  31.042  1.00 2.08  ? 125  GLY A CA    1 
ATOM   895   C  C     . GLY A 1 124  ? -29.695 -77.921  32.347  1.00 2.27  ? 125  GLY A C     1 
ATOM   896   O  O     . GLY A 1 124  ? -29.266 -79.008  32.753  1.00 2.00  ? 125  GLY A O     1 
ATOM   897   N  N     . ASP A 1 125  ? -29.475 -76.759  32.966  1.00 2.24  ? 126  ASP A N     1 
ATOM   898   C  CA    . ASP A 1 125  ? -28.892 -76.674  34.295  1.00 2.00  ? 126  ASP A CA    1 
ATOM   899   C  C     . ASP A 1 125  ? -29.061 -75.318  34.924  1.00 2.00  ? 126  ASP A C     1 
ATOM   900   O  O     . ASP A 1 125  ? -29.654 -74.438  34.322  1.00 2.61  ? 126  ASP A O     1 
ATOM   901   C  CB    . ASP A 1 125  ? -27.480 -77.289  34.451  1.00 2.32  ? 126  ASP A CB    1 
ATOM   902   C  CG    . ASP A 1 125  ? -26.371 -76.510  33.751  1.00 2.82  ? 126  ASP A CG    1 
ATOM   903   O  OD1   . ASP A 1 125  ? -26.299 -75.258  33.865  1.00 2.00  ? 126  ASP A OD1   1 
ATOM   904   O  OD2   . ASP A 1 125  ? -25.505 -77.220  33.156  1.00 2.51  ? 126  ASP A OD2   1 
ATOM   905   N  N     . HIS A 1 126  ? -28.660 -75.173  36.177  1.00 2.00  ? 127  HIS A N     1 
ATOM   906   C  CA    . HIS A 1 126  ? -28.822 -73.917  36.864  1.00 2.08  ? 127  HIS A CA    1 
ATOM   907   C  C     . HIS A 1 126  ? -27.596 -73.014  36.932  1.00 2.29  ? 127  HIS A C     1 
ATOM   908   O  O     . HIS A 1 126  ? -27.606 -72.072  37.703  1.00 2.14  ? 127  HIS A O     1 
ATOM   909   C  CB    . HIS A 1 126  ? -29.398 -74.144  38.274  1.00 2.57  ? 127  HIS A CB    1 
ATOM   910   C  CG    . HIS A 1 126  ? -30.746 -74.815  38.292  1.00 2.58  ? 127  HIS A CG    1 
ATOM   911   N  ND1   . HIS A 1 126  ? -31.201 -75.525  39.382  1.00 2.71  ? 127  HIS A ND1   1 
ATOM   912   C  CD2   . HIS A 1 126  ? -31.712 -74.930  37.344  1.00 2.44  ? 127  HIS A CD2   1 
ATOM   913   C  CE1   . HIS A 1 126  ? -32.382 -76.056  39.107  1.00 2.04  ? 127  HIS A CE1   1 
ATOM   914   N  NE2   . HIS A 1 126  ? -32.711 -75.705  37.878  1.00 2.37  ? 127  HIS A NE2   1 
ATOM   915   N  N     . GLN A 1 127  ? -26.573 -73.263  36.115  1.00 2.27  ? 128  GLN A N     1 
ATOM   916   C  CA    . GLN A 1 127  ? -25.373 -72.426  36.116  1.00 2.52  ? 128  GLN A CA    1 
ATOM   917   C  C     . GLN A 1 127  ? -25.662 -70.958  35.816  1.00 2.54  ? 128  GLN A C     1 
ATOM   918   O  O     . GLN A 1 127  ? -25.042 -70.069  36.423  1.00 2.26  ? 128  GLN A O     1 
ATOM   919   C  CB    . GLN A 1 127  ? -24.353 -72.931  35.114  1.00 3.15  ? 128  GLN A CB    1 
ATOM   920   C  CG    . GLN A 1 127  ? -23.759 -74.227  35.486  1.00 4.52  ? 128  GLN A CG    1 
ATOM   921   C  CD    . GLN A 1 127  ? -22.772 -74.675  34.471  1.00 5.33  ? 128  GLN A CD    1 
ATOM   922   O  OE1   . GLN A 1 127  ? -23.051 -75.564  33.690  1.00 6.16  ? 128  GLN A OE1   1 
ATOM   923   N  NE2   . GLN A 1 127  ? -21.611 -74.064  34.463  1.00 6.33  ? 128  GLN A NE2   1 
ATOM   924   N  N     . ASP A 1 128  ? -26.626 -70.707  34.918  1.00 2.51  ? 129  ASP A N     1 
ATOM   925   C  CA    . ASP A 1 128  ? -27.025 -69.346  34.550  1.00 2.53  ? 129  ASP A CA    1 
ATOM   926   C  C     . ASP A 1 128  ? -27.864 -68.573  35.572  1.00 2.41  ? 129  ASP A C     1 
ATOM   927   O  O     . ASP A 1 128  ? -27.538 -67.439  35.883  1.00 3.36  ? 129  ASP A O     1 
ATOM   928   C  CB    . ASP A 1 128  ? -27.693 -69.316  33.180  1.00 2.83  ? 129  ASP A CB    1 
ATOM   929   C  CG    . ASP A 1 128  ? -28.906 -70.215  33.087  1.00 3.36  ? 129  ASP A CG    1 
ATOM   930   O  OD1   . ASP A 1 128  ? -29.130 -71.055  33.977  1.00 4.07  ? 129  ASP A OD1   1 
ATOM   931   O  OD2   . ASP A 1 128  ? -29.633 -70.101  32.079  1.00 3.28  ? 129  ASP A OD2   1 
ATOM   932   N  N     . ILE A 1 129  ? -28.952 -69.142  36.076  1.00 2.08  ? 130  ILE A N     1 
ATOM   933   C  CA    . ILE A 1 129  ? -29.728 -68.449  37.096  1.00 2.00  ? 130  ILE A CA    1 
ATOM   934   C  C     . ILE A 1 129  ? -28.896 -68.180  38.362  1.00 2.00  ? 130  ILE A C     1 
ATOM   935   O  O     . ILE A 1 129  ? -29.030 -67.127  38.972  1.00 2.20  ? 130  ILE A O     1 
ATOM   936   C  CB    . ILE A 1 129  ? -31.077 -69.176  37.462  1.00 2.00  ? 130  ILE A CB    1 
ATOM   937   C  CG1   . ILE A 1 129  ? -30.828 -70.553  38.072  1.00 2.15  ? 130  ILE A CG1   1 
ATOM   938   C  CG2   . ILE A 1 129  ? -31.965 -69.275  36.225  1.00 2.00  ? 130  ILE A CG2   1 
ATOM   939   C  CD1   . ILE A 1 129  ? -30.888 -70.597  39.633  1.00 2.00  ? 130  ILE A CD1   1 
ATOM   940   N  N     . TYR A 1 130  ? -28.029 -69.107  38.754  1.00 2.00  ? 131  TYR A N     1 
ATOM   941   C  CA    . TYR A 1 130  ? -27.208 -68.876  39.916  1.00 2.00  ? 131  TYR A CA    1 
ATOM   942   C  C     . TYR A 1 130  ? -26.238 -67.730  39.638  1.00 2.24  ? 131  TYR A C     1 
ATOM   943   O  O     . TYR A 1 130  ? -25.811 -67.069  40.572  1.00 2.16  ? 131  TYR A O     1 
ATOM   944   C  CB    . TYR A 1 130  ? -26.451 -70.117  40.301  1.00 2.00  ? 131  TYR A CB    1 
ATOM   945   C  CG    . TYR A 1 130  ? -27.254 -71.146  41.029  1.00 2.00  ? 131  TYR A CG    1 
ATOM   946   C  CD1   . TYR A 1 130  ? -28.170 -70.795  41.983  1.00 2.00  ? 131  TYR A CD1   1 
ATOM   947   C  CD2   . TYR A 1 130  ? -27.043 -72.494  40.806  1.00 2.54  ? 131  TYR A CD2   1 
ATOM   948   C  CE1   . TYR A 1 130  ? -28.866 -71.773  42.730  1.00 2.00  ? 131  TYR A CE1   1 
ATOM   949   C  CE2   . TYR A 1 130  ? -27.732 -73.477  41.543  1.00 2.51  ? 131  TYR A CE2   1 
ATOM   950   C  CZ    . TYR A 1 130  ? -28.636 -73.109  42.505  1.00 2.00  ? 131  TYR A CZ    1 
ATOM   951   O  OH    . TYR A 1 130  ? -29.252 -74.094  43.267  1.00 2.00  ? 131  TYR A OH    1 
ATOM   952   N  N     . ALA A 1 131  ? -25.858 -67.511  38.373  1.00 2.39  ? 132  ALA A N     1 
ATOM   953   C  CA    . ALA A 1 131  ? -24.967 -66.419  38.016  1.00 2.07  ? 132  ALA A CA    1 
ATOM   954   C  C     . ALA A 1 131  ? -25.663 -65.037  38.166  1.00 2.78  ? 132  ALA A C     1 
ATOM   955   O  O     . ALA A 1 131  ? -24.997 -64.041  38.404  1.00 4.08  ? 132  ALA A O     1 
ATOM   956   C  CB    . ALA A 1 131  ? -24.442 -66.621  36.620  1.00 2.00  ? 132  ALA A CB    1 
ATOM   957   N  N     . ALA A 1 132  ? -26.994 -64.969  38.103  1.00 2.51  ? 133  ALA A N     1 
ATOM   958   C  CA    . ALA A 1 132  ? -27.718 -63.692  38.277  1.00 2.00  ? 133  ALA A CA    1 
ATOM   959   C  C     . ALA A 1 132  ? -28.259 -63.526  39.704  1.00 2.06  ? 133  ALA A C     1 
ATOM   960   O  O     . ALA A 1 132  ? -28.996 -62.584  40.008  1.00 2.00  ? 133  ALA A O     1 
ATOM   961   C  CB    . ALA A 1 132  ? -28.841 -63.583  37.279  1.00 2.00  ? 133  ALA A CB    1 
ATOM   962   N  N     . ARG A 1 133  ? -27.841 -64.453  40.560  1.00 2.01  ? 134  ARG A N     1 
ATOM   963   C  CA    . ARG A 1 133  ? -28.177 -64.553  41.985  1.00 2.63  ? 134  ARG A CA    1 
ATOM   964   C  C     . ARG A 1 133  ? -28.041 -63.237  42.805  1.00 2.76  ? 134  ARG A C     1 
ATOM   965   O  O     . ARG A 1 133  ? -28.809 -62.973  43.739  1.00 2.86  ? 134  ARG A O     1 
ATOM   966   C  CB    . ARG A 1 133  ? -27.189 -65.539  42.607  1.00 2.36  ? 134  ARG A CB    1 
ATOM   967   C  CG    . ARG A 1 133  ? -27.642 -66.314  43.798  1.00 4.75  ? 134  ARG A CG    1 
ATOM   968   C  CD    . ARG A 1 133  ? -26.428 -66.885  44.583  1.00 6.32  ? 134  ARG A CD    1 
ATOM   969   N  NE    . ARG A 1 133  ? -25.308 -67.350  43.752  1.00 8.12  ? 134  ARG A NE    1 
ATOM   970   C  CZ    . ARG A 1 133  ? -24.200 -67.902  44.233  1.00 8.69  ? 134  ARG A CZ    1 
ATOM   971   N  NH1   . ARG A 1 133  ? -24.060 -68.081  45.546  1.00 10.54 ? 134  ARG A NH1   1 
ATOM   972   N  NH2   . ARG A 1 133  ? -23.210 -68.214  43.416  1.00 8.98  ? 134  ARG A NH2   1 
ATOM   973   N  N     . GLN A 1 134  ? -26.989 -62.487  42.523  1.00 2.36  ? 135  GLN A N     1 
ATOM   974   C  CA    . GLN A 1 134  ? -26.686 -61.296  43.288  1.00 2.44  ? 135  GLN A CA    1 
ATOM   975   C  C     . GLN A 1 134  ? -27.237 -59.983  42.725  1.00 2.13  ? 135  GLN A C     1 
ATOM   976   O  O     . GLN A 1 134  ? -27.062 -58.927  43.295  1.00 2.08  ? 135  GLN A O     1 
ATOM   977   C  CB    . GLN A 1 134  ? -25.165 -61.227  43.472  1.00 3.08  ? 135  GLN A CB    1 
ATOM   978   C  CG    . GLN A 1 134  ? -24.389 -60.888  42.245  1.00 4.39  ? 135  GLN A CG    1 
ATOM   979   C  CD    . GLN A 1 134  ? -24.342 -61.991  41.187  1.00 5.96  ? 135  GLN A CD    1 
ATOM   980   O  OE1   . GLN A 1 134  ? -24.209 -63.200  41.504  1.00 6.40  ? 135  GLN A OE1   1 
ATOM   981   N  NE2   . GLN A 1 134  ? -24.406 -61.570  39.889  1.00 6.26  ? 135  GLN A NE2   1 
ATOM   982   N  N     . THR A 1 135  ? -27.939 -60.070  41.614  1.00 2.26  ? 136  THR A N     1 
ATOM   983   C  CA    . THR A 1 135  ? -28.495 -58.915  40.947  1.00 2.00  ? 136  THR A CA    1 
ATOM   984   C  C     . THR A 1 135  ? -29.675 -58.218  41.636  1.00 2.18  ? 136  THR A C     1 
ATOM   985   O  O     . THR A 1 135  ? -30.045 -57.106  41.259  1.00 2.00  ? 136  THR A O     1 
ATOM   986   C  CB    . THR A 1 135  ? -28.883 -59.304  39.533  1.00 2.29  ? 136  THR A CB    1 
ATOM   987   O  OG1   . THR A 1 135  ? -30.023 -60.181  39.568  1.00 2.00  ? 136  THR A OG1   1 
ATOM   988   C  CG2   . THR A 1 135  ? -27.671 -60.010  38.838  1.00 2.11  ? 136  THR A CG2   1 
ATOM   989   N  N     . GLY A 1 136  ? -30.272 -58.855  42.642  1.00 2.21  ? 137  GLY A N     1 
ATOM   990   C  CA    . GLY A 1 136  ? -31.379 -58.228  43.331  1.00 2.00  ? 137  GLY A CA    1 
ATOM   991   C  C     . GLY A 1 136  ? -32.717 -58.695  42.838  1.00 2.00  ? 137  GLY A C     1 
ATOM   992   O  O     . GLY A 1 136  ? -33.732 -58.217  43.275  1.00 2.05  ? 137  GLY A O     1 
ATOM   993   N  N     . PHE A 1 137  ? -32.719 -59.584  41.868  1.00 2.33  ? 138  PHE A N     1 
ATOM   994   C  CA    . PHE A 1 137  ? -33.964 -60.154  41.343  1.00 2.54  ? 138  PHE A CA    1 
ATOM   995   C  C     . PHE A 1 137  ? -34.502 -61.203  42.302  1.00 2.46  ? 138  PHE A C     1 
ATOM   996   O  O     . PHE A 1 137  ? -33.747 -61.856  43.026  1.00 2.14  ? 138  PHE A O     1 
ATOM   997   C  CB    . PHE A 1 137  ? -33.721 -60.869  40.002  1.00 2.00  ? 138  PHE A CB    1 
ATOM   998   C  CG    . PHE A 1 137  ? -33.982 -60.030  38.806  1.00 2.00  ? 138  PHE A CG    1 
ATOM   999   C  CD1   . PHE A 1 137  ? -33.411 -58.775  38.667  1.00 2.00  ? 138  PHE A CD1   1 
ATOM   1000  C  CD2   . PHE A 1 137  ? -34.826 -60.489  37.805  1.00 2.00  ? 138  PHE A CD2   1 
ATOM   1001  C  CE1   . PHE A 1 137  ? -33.678 -58.012  37.571  1.00 2.00  ? 138  PHE A CE1   1 
ATOM   1002  C  CE2   . PHE A 1 137  ? -35.092 -59.718  36.705  1.00 2.00  ? 138  PHE A CE2   1 
ATOM   1003  C  CZ    . PHE A 1 137  ? -34.517 -58.475  36.590  1.00 2.00  ? 138  PHE A CZ    1 
ATOM   1004  N  N     . ALA A 1 138  ? -35.820 -61.337  42.310  1.00 2.71  ? 139  ALA A N     1 
ATOM   1005  C  CA    . ALA A 1 138  ? -36.475 -62.364  43.087  1.00 2.21  ? 139  ALA A CA    1 
ATOM   1006  C  C     . ALA A 1 138  ? -36.368 -63.552  42.124  1.00 2.59  ? 139  ALA A C     1 
ATOM   1007  O  O     . ALA A 1 138  ? -36.356 -63.338  40.906  1.00 2.59  ? 139  ALA A O     1 
ATOM   1008  C  CB    . ALA A 1 138  ? -37.899 -61.973  43.327  1.00 2.00  ? 139  ALA A CB    1 
ATOM   1009  N  N     . MET A 1 139  ? -36.296 -64.791  42.629  1.00 3.00  ? 140  MET A N     1 
ATOM   1010  C  CA    . MET A 1 139  ? -36.135 -65.976  41.771  1.00 2.83  ? 140  MET A CA    1 
ATOM   1011  C  C     . MET A 1 139  ? -37.155 -67.029  42.154  1.00 2.90  ? 140  MET A C     1 
ATOM   1012  O  O     . MET A 1 139  ? -37.139 -67.535  43.269  1.00 3.30  ? 140  MET A O     1 
ATOM   1013  C  CB    . MET A 1 139  ? -34.692 -66.498  41.887  1.00 3.16  ? 140  MET A CB    1 
ATOM   1014  C  CG    . MET A 1 139  ? -33.655 -65.441  41.434  1.00 3.41  ? 140  MET A CG    1 
ATOM   1015  S  SD    . MET A 1 139  ? -31.863 -65.798  41.564  1.00 5.08  ? 140  MET A SD    1 
ATOM   1016  C  CE    . MET A 1 139  ? -31.727 -67.353  40.978  1.00 3.67  ? 140  MET A CE    1 
ATOM   1017  N  N     . LEU A 1 140  ? -37.997 -67.414  41.209  1.00 2.23  ? 141  LEU A N     1 
ATOM   1018  C  CA    . LEU A 1 140  ? -39.061 -68.343  41.501  1.00 2.00  ? 141  LEU A CA    1 
ATOM   1019  C  C     . LEU A 1 140  ? -38.999 -69.491  40.510  1.00 2.00  ? 141  LEU A C     1 
ATOM   1020  O  O     . LEU A 1 140  ? -39.236 -69.338  39.327  1.00 2.00  ? 141  LEU A O     1 
ATOM   1021  C  CB    . LEU A 1 140  ? -40.364 -67.571  41.364  1.00 2.20  ? 141  LEU A CB    1 
ATOM   1022  C  CG    . LEU A 1 140  ? -41.610 -67.680  42.213  1.00 2.00  ? 141  LEU A CG    1 
ATOM   1023  C  CD1   . LEU A 1 140  ? -42.725 -67.463  41.224  1.00 2.27  ? 141  LEU A CD1   1 
ATOM   1024  C  CD2   . LEU A 1 140  ? -41.804 -68.989  42.878  1.00 2.00  ? 141  LEU A CD2   1 
ATOM   1025  N  N     . ALA A 1 141  ? -38.677 -70.654  41.022  1.00 2.21  ? 142  ALA A N     1 
ATOM   1026  C  CA    . ALA A 1 141  ? -38.511 -71.842  40.223  1.00 2.00  ? 142  ALA A CA    1 
ATOM   1027  C  C     . ALA A 1 141  ? -39.799 -72.623  39.899  1.00 2.12  ? 142  ALA A C     1 
ATOM   1028  O  O     . ALA A 1 141  ? -40.771 -72.539  40.629  1.00 2.25  ? 142  ALA A O     1 
ATOM   1029  C  CB    . ALA A 1 141  ? -37.524 -72.721  40.923  1.00 2.00  ? 142  ALA A CB    1 
ATOM   1030  N  N     . SER A 1 142  ? -39.763 -73.393  38.806  1.00 2.38  ? 143  SER A N     1 
ATOM   1031  C  CA    . SER A 1 142  ? -40.846 -74.246  38.318  1.00 2.69  ? 143  SER A CA    1 
ATOM   1032  C  C     . SER A 1 142  ? -40.240 -75.628  38.129  1.00 3.40  ? 143  SER A C     1 
ATOM   1033  O  O     . SER A 1 142  ? -39.094 -75.709  37.676  1.00 4.37  ? 143  SER A O     1 
ATOM   1034  C  CB    . SER A 1 142  ? -41.306 -73.751  36.950  1.00 2.47  ? 143  SER A CB    1 
ATOM   1035  O  OG    . SER A 1 142  ? -42.224 -72.697  37.101  1.00 2.00  ? 143  SER A OG    1 
ATOM   1036  N  N     . SER A 1 143  ? -40.970 -76.706  38.448  1.00 3.61  ? 144  SER A N     1 
ATOM   1037  C  CA    . SER A 1 143  ? -40.440 -78.070  38.280  1.00 3.93  ? 144  SER A CA    1 
ATOM   1038  C  C     . SER A 1 143  ? -41.214 -78.884  37.285  1.00 3.55  ? 144  SER A C     1 
ATOM   1039  O  O     . SER A 1 143  ? -40.958 -80.078  37.115  1.00 3.46  ? 144  SER A O     1 
ATOM   1040  C  CB    . SER A 1 143  ? -40.378 -78.836  39.597  1.00 4.43  ? 144  SER A CB    1 
ATOM   1041  O  OG    . SER A 1 143  ? -41.485 -78.512  40.422  1.00 6.05  ? 144  SER A OG    1 
ATOM   1042  N  N     . SER A 1 144  ? -42.189 -78.243  36.658  1.00 3.30  ? 145  SER A N     1 
ATOM   1043  C  CA    . SER A 1 144  ? -42.999 -78.895  35.657  1.00 3.51  ? 145  SER A CA    1 
ATOM   1044  C  C     . SER A 1 144  ? -43.696 -77.921  34.737  1.00 3.58  ? 145  SER A C     1 
ATOM   1045  O  O     . SER A 1 144  ? -43.742 -76.688  35.014  1.00 3.72  ? 145  SER A O     1 
ATOM   1046  C  CB    . SER A 1 144  ? -44.020 -79.827  36.293  1.00 4.14  ? 145  SER A CB    1 
ATOM   1047  O  OG    . SER A 1 144  ? -44.798 -79.192  37.286  1.00 5.30  ? 145  SER A OG    1 
ATOM   1048  N  N     . VAL A 1 145  ? -44.221 -78.479  33.643  1.00 2.55  ? 146  VAL A N     1 
ATOM   1049  C  CA    . VAL A 1 145  ? -44.939 -77.744  32.619  1.00 2.59  ? 146  VAL A CA    1 
ATOM   1050  C  C     . VAL A 1 145  ? -46.113 -76.999  33.243  1.00 2.62  ? 146  VAL A C     1 
ATOM   1051  O  O     . VAL A 1 145  ? -46.324 -75.798  33.002  1.00 3.25  ? 146  VAL A O     1 
ATOM   1052  C  CB    . VAL A 1 145  ? -45.436 -78.715  31.521  1.00 2.62  ? 146  VAL A CB    1 
ATOM   1053  C  CG1   . VAL A 1 145  ? -46.145 -77.962  30.399  1.00 2.45  ? 146  VAL A CG1   1 
ATOM   1054  C  CG2   . VAL A 1 145  ? -44.246 -79.511  30.972  1.00 2.30  ? 146  VAL A CG2   1 
ATOM   1055  N  N     . GLN A 1 146  ? -46.833 -77.694  34.111  1.00 3.03  ? 147  GLN A N     1 
ATOM   1056  C  CA    . GLN A 1 146  ? -47.972 -77.117  34.818  1.00 3.37  ? 147  GLN A CA    1 
ATOM   1057  C  C     . GLN A 1 146  ? -47.542 -76.013  35.823  1.00 3.76  ? 147  GLN A C     1 
ATOM   1058  O  O     . GLN A 1 146  ? -48.268 -75.017  36.023  1.00 3.39  ? 147  GLN A O     1 
ATOM   1059  C  CB    . GLN A 1 146  ? -48.756 -78.214  35.523  1.00 2.94  ? 147  GLN A CB    1 
ATOM   1060  C  CG    . GLN A 1 146  ? -49.908 -77.717  36.388  1.00 3.45  ? 147  GLN A CG    1 
ATOM   1061  C  CD    . GLN A 1 146  ? -51.080 -77.177  35.581  1.00 3.36  ? 147  GLN A CD    1 
ATOM   1062  O  OE1   . GLN A 1 146  ? -51.110 -76.006  35.225  1.00 4.18  ? 147  GLN A OE1   1 
ATOM   1063  N  NE2   . GLN A 1 146  ? -52.062 -78.013  35.334  1.00 3.24  ? 147  GLN A NE2   1 
ATOM   1064  N  N     . GLU A 1 147  ? -46.395 -76.220  36.475  1.00 3.51  ? 148  GLU A N     1 
ATOM   1065  C  CA    . GLU A 1 147  ? -45.893 -75.245  37.431  1.00 3.52  ? 148  GLU A CA    1 
ATOM   1066  C  C     . GLU A 1 147  ? -45.344 -74.018  36.737  1.00 2.70  ? 148  GLU A C     1 
ATOM   1067  O  O     . GLU A 1 147  ? -45.282 -72.964  37.312  1.00 2.74  ? 148  GLU A O     1 
ATOM   1068  C  CB    . GLU A 1 147  ? -44.801 -75.849  38.307  1.00 4.57  ? 148  GLU A CB    1 
ATOM   1069  C  CG    . GLU A 1 147  ? -45.281 -76.696  39.459  1.00 6.33  ? 148  GLU A CG    1 
ATOM   1070  C  CD    . GLU A 1 147  ? -44.180 -77.021  40.465  1.00 7.95  ? 148  GLU A CD    1 
ATOM   1071  O  OE1   . GLU A 1 147  ? -43.030 -76.559  40.312  1.00 9.30  ? 148  GLU A OE1   1 
ATOM   1072  O  OE2   . GLU A 1 147  ? -44.459 -77.738  41.442  1.00 8.47  ? 148  GLU A OE2   1 
ATOM   1073  N  N     . ALA A 1 148  ? -44.915 -74.172  35.498  1.00 2.72  ? 149  ALA A N     1 
ATOM   1074  C  CA    . ALA A 1 148  ? -44.369 -73.045  34.753  1.00 2.34  ? 149  ALA A CA    1 
ATOM   1075  C  C     . ALA A 1 148  ? -45.468 -72.050  34.487  1.00 2.54  ? 149  ALA A C     1 
ATOM   1076  O  O     . ALA A 1 148  ? -45.242 -70.822  34.528  1.00 3.32  ? 149  ALA A O     1 
ATOM   1077  C  CB    . ALA A 1 148  ? -43.757 -73.502  33.476  1.00 2.00  ? 149  ALA A CB    1 
ATOM   1078  N  N     . HIS A 1 149  ? -46.670 -72.575  34.265  1.00 2.46  ? 150  HIS A N     1 
ATOM   1079  C  CA    . HIS A 1 149  ? -47.848 -71.758  34.000  1.00 2.15  ? 150  HIS A CA    1 
ATOM   1080  C  C     . HIS A 1 149  ? -48.191 -70.953  35.238  1.00 2.47  ? 150  HIS A C     1 
ATOM   1081  O  O     . HIS A 1 149  ? -48.338 -69.724  35.166  1.00 2.77  ? 150  HIS A O     1 
ATOM   1082  C  CB    . HIS A 1 149  ? -49.062 -72.636  33.643  1.00 2.47  ? 150  HIS A CB    1 
ATOM   1083  C  CG    . HIS A 1 149  ? -50.355 -71.900  33.699  1.00 2.55  ? 150  HIS A CG    1 
ATOM   1084  N  ND1   . HIS A 1 149  ? -50.930 -71.523  34.894  1.00 2.57  ? 150  HIS A ND1   1 
ATOM   1085  C  CD2   . HIS A 1 149  ? -51.058 -71.279  32.732  1.00 2.80  ? 150  HIS A CD2   1 
ATOM   1086  C  CE1   . HIS A 1 149  ? -51.917 -70.688  34.655  1.00 2.33  ? 150  HIS A CE1   1 
ATOM   1087  N  NE2   . HIS A 1 149  ? -52.017 -70.519  33.353  1.00 2.04  ? 150  HIS A NE2   1 
ATOM   1088  N  N     . ASP A 1 150  ? -48.337 -71.652  36.365  1.00 2.20  ? 151  ASP A N     1 
ATOM   1089  C  CA    . ASP A 1 150  ? -48.665 -71.020  37.637  1.00 2.12  ? 151  ASP A CA    1 
ATOM   1090  C  C     . ASP A 1 150  ? -47.572 -70.087  38.216  1.00 2.29  ? 151  ASP A C     1 
ATOM   1091  O  O     . ASP A 1 150  ? -47.902 -69.058  38.782  1.00 2.17  ? 151  ASP A O     1 
ATOM   1092  C  CB    . ASP A 1 150  ? -49.005 -72.076  38.676  1.00 2.00  ? 151  ASP A CB    1 
ATOM   1093  C  CG    . ASP A 1 150  ? -50.032 -73.111  38.175  1.00 3.17  ? 151  ASP A CG    1 
ATOM   1094  O  OD1   . ASP A 1 150  ? -50.645 -72.895  37.105  1.00 3.24  ? 151  ASP A OD1   1 
ATOM   1095  O  OD2   . ASP A 1 150  ? -50.226 -74.152  38.857  1.00 2.13  ? 151  ASP A OD2   1 
ATOM   1096  N  N     . MET A 1 151  ? -46.296 -70.472  38.148  1.00 2.12  ? 152  MET A N     1 
ATOM   1097  C  CA    . MET A 1 151  ? -45.248 -69.623  38.691  1.00 2.44  ? 152  MET A CA    1 
ATOM   1098  C  C     . MET A 1 151  ? -45.033 -68.386  37.809  1.00 2.37  ? 152  MET A C     1 
ATOM   1099  O  O     . MET A 1 151  ? -44.632 -67.347  38.280  1.00 2.44  ? 152  MET A O     1 
ATOM   1100  C  CB    . MET A 1 151  ? -43.926 -70.376  38.864  1.00 2.89  ? 152  MET A CB    1 
ATOM   1101  C  CG    . MET A 1 151  ? -43.958 -71.525  39.850  1.00 3.40  ? 152  MET A CG    1 
ATOM   1102  S  SD    . MET A 1 151  ? -44.681 -71.107  41.424  1.00 5.78  ? 152  MET A SD    1 
ATOM   1103  C  CE    . MET A 1 151  ? -44.729 -72.709  42.129  1.00 6.94  ? 152  MET A CE    1 
ATOM   1104  N  N     . ALA A 1 152  ? -45.350 -68.495  36.533  1.00 2.45  ? 153  ALA A N     1 
ATOM   1105  C  CA    . ALA A 1 152  ? -45.191 -67.395  35.633  1.00 2.07  ? 153  ALA A CA    1 
ATOM   1106  C  C     . ALA A 1 152  ? -46.206 -66.393  36.049  1.00 2.34  ? 153  ALA A C     1 
ATOM   1107  O  O     . ALA A 1 152  ? -45.904 -65.198  36.105  1.00 2.52  ? 153  ALA A O     1 
ATOM   1108  C  CB    . ALA A 1 152  ? -45.443 -67.848  34.225  1.00 2.66  ? 153  ALA A CB    1 
ATOM   1109  N  N     . LEU A 1 153  ? -47.395 -66.883  36.418  1.00 2.40  ? 154  LEU A N     1 
ATOM   1110  C  CA    . LEU A 1 153  ? -48.493 -66.014  36.856  1.00 2.00  ? 154  LEU A CA    1 
ATOM   1111  C  C     . LEU A 1 153  ? -48.189 -65.329  38.182  1.00 2.48  ? 154  LEU A C     1 
ATOM   1112  O  O     . LEU A 1 153  ? -48.430 -64.103  38.348  1.00 2.20  ? 154  LEU A O     1 
ATOM   1113  C  CB    . LEU A 1 153  ? -49.799 -66.786  36.977  1.00 2.50  ? 154  LEU A CB    1 
ATOM   1114  C  CG    . LEU A 1 153  ? -51.121 -66.081  36.622  1.00 2.59  ? 154  LEU A CG    1 
ATOM   1115  C  CD1   . LEU A 1 153  ? -52.215 -66.647  37.443  1.00 2.00  ? 154  LEU A CD1   1 
ATOM   1116  C  CD2   . LEU A 1 153  ? -51.081 -64.575  36.771  1.00 2.00  ? 154  LEU A CD2   1 
ATOM   1117  N  N     . VAL A 1 154  ? -47.677 -66.108  39.138  1.00 2.43  ? 155  VAL A N     1 
ATOM   1118  C  CA    . VAL A 1 154  ? -47.337 -65.555  40.442  1.00 2.67  ? 155  VAL A CA    1 
ATOM   1119  C  C     . VAL A 1 154  ? -46.244 -64.485  40.318  1.00 2.81  ? 155  VAL A C     1 
ATOM   1120  O  O     . VAL A 1 154  ? -46.359 -63.403  40.910  1.00 3.85  ? 155  VAL A O     1 
ATOM   1121  C  CB    . VAL A 1 154  ? -46.850 -66.665  41.405  1.00 3.05  ? 155  VAL A CB    1 
ATOM   1122  C  CG1   . VAL A 1 154  ? -46.337 -66.045  42.741  1.00 2.70  ? 155  VAL A CG1   1 
ATOM   1123  C  CG2   . VAL A 1 154  ? -47.952 -67.697  41.646  1.00 2.00  ? 155  VAL A CG2   1 
ATOM   1124  N  N     . ALA A 1 155  ? -45.247 -64.756  39.470  1.00 2.67  ? 156  ALA A N     1 
ATOM   1125  C  CA    . ALA A 1 155  ? -44.112 -63.875  39.258  1.00 2.00  ? 156  ALA A CA    1 
ATOM   1126  C  C     . ALA A 1 155  ? -44.556 -62.496  38.783  1.00 2.04  ? 156  ALA A C     1 
ATOM   1127  O  O     . ALA A 1 155  ? -44.190 -61.489  39.371  1.00 2.00  ? 156  ALA A O     1 
ATOM   1128  C  CB    . ALA A 1 155  ? -43.150 -64.496  38.274  1.00 2.00  ? 156  ALA A CB    1 
ATOM   1129  N  N     . HIS A 1 156  ? -45.384 -62.469  37.750  1.00 2.00  ? 157  HIS A N     1 
ATOM   1130  C  CA    . HIS A 1 156  ? -45.865 -61.218  37.195  1.00 2.14  ? 157  HIS A CA    1 
ATOM   1131  C  C     . HIS A 1 156  ? -46.653 -60.417  38.202  1.00 2.20  ? 157  HIS A C     1 
ATOM   1132  O  O     . HIS A 1 156  ? -46.380 -59.244  38.438  1.00 2.46  ? 157  HIS A O     1 
ATOM   1133  C  CB    . HIS A 1 156  ? -46.757 -61.480  35.993  1.00 2.32  ? 157  HIS A CB    1 
ATOM   1134  C  CG    . HIS A 1 156  ? -46.019 -61.587  34.700  1.00 2.12  ? 157  HIS A CG    1 
ATOM   1135  N  ND1   . HIS A 1 156  ? -45.734 -60.484  33.930  1.00 2.00  ? 157  HIS A ND1   1 
ATOM   1136  C  CD2   . HIS A 1 156  ? -45.567 -62.662  34.009  1.00 2.00  ? 157  HIS A CD2   1 
ATOM   1137  C  CE1   . HIS A 1 156  ? -45.144 -60.868  32.813  1.00 2.00  ? 157  HIS A CE1   1 
ATOM   1138  N  NE2   . HIS A 1 156  ? -45.030 -62.186  32.836  1.00 2.22  ? 157  HIS A NE2   1 
ATOM   1139  N  N     . LEU A 1 157  ? -47.595 -61.093  38.840  1.00 2.82  ? 158  LEU A N     1 
ATOM   1140  C  CA    . LEU A 1 157  ? -48.472 -60.504  39.848  1.00 2.59  ? 158  LEU A CA    1 
ATOM   1141  C  C     . LEU A 1 157  ? -47.709 -59.951  41.062  1.00 2.29  ? 158  LEU A C     1 
ATOM   1142  O  O     . LEU A 1 157  ? -48.036 -58.893  41.588  1.00 2.50  ? 158  LEU A O     1 
ATOM   1143  C  CB    . LEU A 1 157  ? -49.516 -61.563  40.290  1.00 2.16  ? 158  LEU A CB    1 
ATOM   1144  C  CG    . LEU A 1 157  ? -50.606 -62.025  39.321  1.00 2.00  ? 158  LEU A CG    1 
ATOM   1145  C  CD1   . LEU A 1 157  ? -51.389 -63.166  39.888  1.00 2.00  ? 158  LEU A CD1   1 
ATOM   1146  C  CD2   . LEU A 1 157  ? -51.580 -60.855  39.020  1.00 2.42  ? 158  LEU A CD2   1 
ATOM   1147  N  N     . ALA A 1 158  ? -46.699 -60.671  41.518  1.00 2.62  ? 159  ALA A N     1 
ATOM   1148  C  CA    . ALA A 1 158  ? -45.942 -60.226  42.677  1.00 2.65  ? 159  ALA A CA    1 
ATOM   1149  C  C     . ALA A 1 158  ? -44.994 -59.102  42.305  1.00 3.02  ? 159  ALA A C     1 
ATOM   1150  O  O     . ALA A 1 158  ? -44.767 -58.193  43.089  1.00 3.60  ? 159  ALA A O     1 
ATOM   1151  C  CB    . ALA A 1 158  ? -45.184 -61.365  43.275  1.00 2.00  ? 159  ALA A CB    1 
ATOM   1152  N  N     . ALA A 1 159  ? -44.470 -59.124  41.090  1.00 3.20  ? 160  ALA A N     1 
ATOM   1153  C  CA    . ALA A 1 159  ? -43.528 -58.096  40.680  1.00 2.81  ? 160  ALA A CA    1 
ATOM   1154  C  C     . ALA A 1 159  ? -44.259 -56.777  40.659  1.00 3.04  ? 160  ALA A C     1 
ATOM   1155  O  O     . ALA A 1 159  ? -43.745 -55.799  41.134  1.00 3.03  ? 160  ALA A O     1 
ATOM   1156  C  CB    . ALA A 1 159  ? -42.952 -58.418  39.311  1.00 2.55  ? 160  ALA A CB    1 
ATOM   1157  N  N     . ILE A 1 160  ? -45.494 -56.766  40.150  1.00 3.19  ? 161  ILE A N     1 
ATOM   1158  C  CA    . ILE A 1 160  ? -46.302 -55.546  40.085  1.00 2.77  ? 161  ILE A CA    1 
ATOM   1159  C  C     . ILE A 1 160  ? -46.606 -54.983  41.484  1.00 2.97  ? 161  ILE A C     1 
ATOM   1160  O  O     . ILE A 1 160  ? -46.497 -53.761  41.745  1.00 2.72  ? 161  ILE A O     1 
ATOM   1161  C  CB    . ILE A 1 160  ? -47.644 -55.817  39.364  1.00 2.66  ? 161  ILE A CB    1 
ATOM   1162  C  CG1   . ILE A 1 160  ? -47.382 -56.199  37.895  1.00 2.44  ? 161  ILE A CG1   1 
ATOM   1163  C  CG2   . ILE A 1 160  ? -48.621 -54.595  39.489  1.00 2.01  ? 161  ILE A CG2   1 
ATOM   1164  C  CD1   . ILE A 1 160  ? -48.577 -56.826  37.200  1.00 2.00  ? 161  ILE A CD1   1 
ATOM   1165  N  N     . GLU A 1 161  ? -46.962 -55.881  42.393  1.00 2.97  ? 162  GLU A N     1 
ATOM   1166  C  CA    . GLU A 1 161  ? -47.290 -55.460  43.738  1.00 2.74  ? 162  GLU A CA    1 
ATOM   1167  C  C     . GLU A 1 161  ? -46.116 -55.037  44.615  1.00 2.30  ? 162  GLU A C     1 
ATOM   1168  O  O     . GLU A 1 161  ? -46.195 -53.991  45.260  1.00 2.59  ? 162  GLU A O     1 
ATOM   1169  C  CB    . GLU A 1 161  ? -48.128 -56.518  44.458  1.00 2.25  ? 162  GLU A CB    1 
ATOM   1170  C  CG    . GLU A 1 161  ? -48.830 -55.883  45.590  1.00 3.33  ? 162  GLU A CG    1 
ATOM   1171  C  CD    . GLU A 1 161  ? -49.571 -56.805  46.462  1.00 4.11  ? 162  GLU A CD    1 
ATOM   1172  O  OE1   . GLU A 1 161  ? -50.446 -57.501  45.981  1.00 5.68  ? 162  GLU A OE1   1 
ATOM   1173  O  OE2   . GLU A 1 161  ? -49.304 -56.821  47.669  1.00 6.39  ? 162  GLU A OE2   1 
ATOM   1174  N  N     . SER A 1 162  ? -45.020 -55.793  44.556  1.00 2.00  ? 163  SER A N     1 
ATOM   1175  C  CA    . SER A 1 162  ? -43.824 -55.559  45.379  1.00 2.00  ? 163  SER A CA    1 
ATOM   1176  C  C     . SER A 1 162  ? -42.762 -54.640  44.836  1.00 2.11  ? 163  SER A C     1 
ATOM   1177  O  O     . SER A 1 162  ? -41.883 -54.221  45.582  1.00 2.18  ? 163  SER A O     1 
ATOM   1178  C  CB    . SER A 1 162  ? -43.122 -56.877  45.663  1.00 2.00  ? 163  SER A CB    1 
ATOM   1179  O  OG    . SER A 1 162  ? -42.482 -57.334  44.489  1.00 2.00  ? 163  SER A OG    1 
ATOM   1180  N  N     . ASN A 1 163  ? -42.773 -54.411  43.537  1.00 2.00  ? 164  ASN A N     1 
ATOM   1181  C  CA    . ASN A 1 163  ? -41.806 -53.540  42.915  1.00 2.27  ? 164  ASN A CA    1 
ATOM   1182  C  C     . ASN A 1 163  ? -40.416 -54.101  42.855  1.00 2.44  ? 164  ASN A C     1 
ATOM   1183  O  O     . ASN A 1 163  ? -39.456 -53.359  42.625  1.00 3.17  ? 164  ASN A O     1 
ATOM   1184  C  CB    . ASN A 1 163  ? -41.775 -52.155  43.574  1.00 3.81  ? 164  ASN A CB    1 
ATOM   1185  C  CG    . ASN A 1 163  ? -42.925 -51.259  43.125  1.00 5.02  ? 164  ASN A CG    1 
ATOM   1186  O  OD1   . ASN A 1 163  ? -43.669 -50.747  43.959  1.00 5.94  ? 164  ASN A OD1   1 
ATOM   1187  N  ND2   . ASN A 1 163  ? -43.090 -51.088  41.803  1.00 4.90  ? 164  ASN A ND2   1 
ATOM   1188  N  N     . VAL A 1 164  ? -40.290 -55.400  43.071  1.00 2.16  ? 165  VAL A N     1 
ATOM   1189  C  CA    . VAL A 1 164  ? -38.996 -56.080  43.001  1.00 2.00  ? 165  VAL A CA    1 
ATOM   1190  C  C     . VAL A 1 164  ? -39.095 -56.935  41.721  1.00 2.00  ? 165  VAL A C     1 
ATOM   1191  O  O     . VAL A 1 164  ? -40.034 -57.682  41.541  1.00 2.01  ? 165  VAL A O     1 
ATOM   1192  C  CB    . VAL A 1 164  ? -38.713 -56.926  44.343  1.00 2.02  ? 165  VAL A CB    1 
ATOM   1193  C  CG1   . VAL A 1 164  ? -37.595 -58.009  44.168  1.00 2.00  ? 165  VAL A CG1   1 
ATOM   1194  C  CG2   . VAL A 1 164  ? -38.301 -55.973  45.467  1.00 2.00  ? 165  VAL A CG2   1 
ATOM   1195  N  N     . PRO A 1 165  ? -38.184 -56.737  40.767  1.00 2.00  ? 166  PRO A N     1 
ATOM   1196  C  CA    . PRO A 1 165  ? -38.224 -57.515  39.534  1.00 2.06  ? 166  PRO A CA    1 
ATOM   1197  C  C     . PRO A 1 165  ? -38.117 -59.030  39.795  1.00 2.00  ? 166  PRO A C     1 
ATOM   1198  O  O     . PRO A 1 165  ? -37.474 -59.452  40.732  1.00 2.00  ? 166  PRO A O     1 
ATOM   1199  C  CB    . PRO A 1 165  ? -37.016 -56.970  38.771  1.00 2.00  ? 166  PRO A CB    1 
ATOM   1200  C  CG    . PRO A 1 165  ? -36.122 -56.520  39.812  1.00 2.00  ? 166  PRO A CG    1 
ATOM   1201  C  CD    . PRO A 1 165  ? -37.038 -55.822  40.754  1.00 2.00  ? 166  PRO A CD    1 
ATOM   1202  N  N     . PHE A 1 166  ? -38.764 -59.832  38.968  1.00 2.05  ? 167  PHE A N     1 
ATOM   1203  C  CA    . PHE A 1 166  ? -38.745 -61.270  39.121  1.00 2.00  ? 167  PHE A CA    1 
ATOM   1204  C  C     . PHE A 1 166  ? -38.139 -62.017  37.952  1.00 2.18  ? 167  PHE A C     1 
ATOM   1205  O  O     . PHE A 1 166  ? -38.211 -61.573  36.808  1.00 2.00  ? 167  PHE A O     1 
ATOM   1206  C  CB    . PHE A 1 166  ? -40.158 -61.786  39.284  1.00 2.00  ? 167  PHE A CB    1 
ATOM   1207  C  CG    . PHE A 1 166  ? -40.603 -61.902  40.689  1.00 2.23  ? 167  PHE A CG    1 
ATOM   1208  C  CD1   . PHE A 1 166  ? -40.954 -60.769  41.416  1.00 2.00  ? 167  PHE A CD1   1 
ATOM   1209  C  CD2   . PHE A 1 166  ? -40.734 -63.164  41.284  1.00 2.00  ? 167  PHE A CD2   1 
ATOM   1210  C  CE1   . PHE A 1 166  ? -41.437 -60.890  42.704  1.00 2.00  ? 167  PHE A CE1   1 
ATOM   1211  C  CE2   . PHE A 1 166  ? -41.223 -63.275  42.581  1.00 2.00  ? 167  PHE A CE2   1 
ATOM   1212  C  CZ    . PHE A 1 166  ? -41.574 -62.123  43.280  1.00 2.00  ? 167  PHE A CZ    1 
ATOM   1213  N  N     . MET A 1 167  ? -37.560 -63.179  38.259  1.00 2.65  ? 168  MET A N     1 
ATOM   1214  C  CA    . MET A 1 167  ? -36.999 -64.061  37.265  1.00 2.81  ? 168  MET A CA    1 
ATOM   1215  C  C     . MET A 1 167  ? -37.574 -65.467  37.498  1.00 2.35  ? 168  MET A C     1 
ATOM   1216  O  O     . MET A 1 167  ? -37.174 -66.208  38.424  1.00 2.20  ? 168  MET A O     1 
ATOM   1217  C  CB    . MET A 1 167  ? -35.457 -64.066  37.266  1.00 3.65  ? 168  MET A CB    1 
ATOM   1218  C  CG    . MET A 1 167  ? -34.866 -65.425  36.791  1.00 5.14  ? 168  MET A CG    1 
ATOM   1219  S  SD    . MET A 1 167  ? -33.132 -65.480  36.371  1.00 7.10  ? 168  MET A SD    1 
ATOM   1220  C  CE    . MET A 1 167  ? -32.313 -65.377  37.953  1.00 6.19  ? 168  MET A CE    1 
ATOM   1221  N  N     . HIS A 1 168  ? -38.539 -65.813  36.664  1.00 2.00  ? 169  HIS A N     1 
ATOM   1222  C  CA    . HIS A 1 168  ? -39.156 -67.105  36.755  1.00 2.26  ? 169  HIS A CA    1 
ATOM   1223  C  C     . HIS A 1 168  ? -38.322 -68.049  35.887  1.00 2.63  ? 169  HIS A C     1 
ATOM   1224  O  O     . HIS A 1 168  ? -38.096 -67.777  34.702  1.00 2.59  ? 169  HIS A O     1 
ATOM   1225  C  CB    . HIS A 1 168  ? -40.600 -67.019  36.252  1.00 2.00  ? 169  HIS A CB    1 
ATOM   1226  C  CG    . HIS A 1 168  ? -41.131 -68.317  35.734  1.00 2.00  ? 169  HIS A CG    1 
ATOM   1227  N  ND1   . HIS A 1 168  ? -41.357 -69.402  36.551  1.00 2.00  ? 169  HIS A ND1   1 
ATOM   1228  C  CD2   . HIS A 1 168  ? -41.548 -68.676  34.506  1.00 2.00  ? 169  HIS A CD2   1 
ATOM   1229  C  CE1   . HIS A 1 168  ? -41.918 -70.367  35.849  1.00 2.17  ? 169  HIS A CE1   1 
ATOM   1230  N  NE2   . HIS A 1 168  ? -42.044 -69.955  34.603  1.00 2.00  ? 169  HIS A NE2   1 
ATOM   1231  N  N     . PHE A 1 169  ? -37.841 -69.145  36.457  1.00 2.56  ? 170  PHE A N     1 
ATOM   1232  C  CA    . PHE A 1 169  ? -37.060 -70.074  35.646  1.00 2.76  ? 170  PHE A CA    1 
ATOM   1233  C  C     . PHE A 1 169  ? -37.544 -71.518  35.749  1.00 2.81  ? 170  PHE A C     1 
ATOM   1234  O  O     . PHE A 1 169  ? -38.288 -71.864  36.650  1.00 3.42  ? 170  PHE A O     1 
ATOM   1235  C  CB    . PHE A 1 169  ? -35.566 -69.939  35.936  1.00 2.00  ? 170  PHE A CB    1 
ATOM   1236  C  CG    . PHE A 1 169  ? -35.197 -70.256  37.349  1.00 2.62  ? 170  PHE A CG    1 
ATOM   1237  C  CD1   . PHE A 1 169  ? -35.367 -69.300  38.376  1.00 2.00  ? 170  PHE A CD1   1 
ATOM   1238  C  CD2   . PHE A 1 169  ? -34.743 -71.546  37.682  1.00 2.00  ? 170  PHE A CD2   1 
ATOM   1239  C  CE1   . PHE A 1 169  ? -35.095 -69.636  39.708  1.00 2.00  ? 170  PHE A CE1   1 
ATOM   1240  C  CE2   . PHE A 1 169  ? -34.472 -71.883  39.002  1.00 2.04  ? 170  PHE A CE2   1 
ATOM   1241  C  CZ    . PHE A 1 169  ? -34.650 -70.932  40.020  1.00 2.04  ? 170  PHE A CZ    1 
ATOM   1242  N  N     . PHE A 1 170  ? -37.230 -72.308  34.732  1.00 2.60  ? 171  PHE A N     1 
ATOM   1243  C  CA    . PHE A 1 170  ? -37.588 -73.727  34.651  1.00 2.39  ? 171  PHE A CA    1 
ATOM   1244  C  C     . PHE A 1 170  ? -36.495 -74.316  33.792  1.00 2.41  ? 171  PHE A C     1 
ATOM   1245  O  O     . PHE A 1 170  ? -35.959 -73.622  32.939  1.00 2.00  ? 171  PHE A O     1 
ATOM   1246  C  CB    . PHE A 1 170  ? -38.977 -73.982  34.045  1.00 2.07  ? 171  PHE A CB    1 
ATOM   1247  C  CG    . PHE A 1 170  ? -39.302 -73.126  32.842  1.00 2.69  ? 171  PHE A CG    1 
ATOM   1248  C  CD1   . PHE A 1 170  ? -39.626 -71.756  33.003  1.00 2.00  ? 171  PHE A CD1   1 
ATOM   1249  C  CD2   . PHE A 1 170  ? -39.308 -73.679  31.547  1.00 2.07  ? 171  PHE A CD2   1 
ATOM   1250  C  CE1   . PHE A 1 170  ? -39.945 -70.970  31.899  1.00 2.00  ? 171  PHE A CE1   1 
ATOM   1251  C  CE2   . PHE A 1 170  ? -39.629 -72.894  30.434  1.00 2.00  ? 171  PHE A CE2   1 
ATOM   1252  C  CZ    . PHE A 1 170  ? -39.949 -71.547  30.606  1.00 2.00  ? 171  PHE A CZ    1 
ATOM   1253  N  N     . ASP A 1 171  ? -36.175 -75.584  34.012  1.00 2.00  ? 172  ASP A N     1 
ATOM   1254  C  CA    . ASP A 1 171  ? -35.080 -76.232  33.302  1.00 2.15  ? 172  ASP A CA    1 
ATOM   1255  C  C     . ASP A 1 171  ? -35.122 -76.235  31.796  1.00 2.03  ? 172  ASP A C     1 
ATOM   1256  O  O     . ASP A 1 171  ? -36.149 -76.532  31.200  1.00 2.10  ? 172  ASP A O     1 
ATOM   1257  C  CB    . ASP A 1 171  ? -34.864 -77.675  33.840  1.00 2.70  ? 172  ASP A CB    1 
ATOM   1258  C  CG    . ASP A 1 171  ? -34.555 -77.689  35.334  1.00 3.37  ? 172  ASP A CG    1 
ATOM   1259  O  OD1   . ASP A 1 171  ? -34.089 -76.640  35.805  1.00 4.27  ? 172  ASP A OD1   1 
ATOM   1260  O  OD2   . ASP A 1 171  ? -34.773 -78.695  36.044  1.00 4.13  ? 172  ASP A OD2   1 
ATOM   1261  N  N     . GLY A 1 172  ? -33.988 -75.886  31.183  1.00 2.47  ? 173  GLY A N     1 
ATOM   1262  C  CA    . GLY A 1 172  ? -33.860 -75.913  29.724  1.00 2.00  ? 173  GLY A CA    1 
ATOM   1263  C  C     . GLY A 1 172  ? -34.074 -77.329  29.190  1.00 2.00  ? 173  GLY A C     1 
ATOM   1264  O  O     . GLY A 1 172  ? -33.447 -78.269  29.669  1.00 2.07  ? 173  GLY A O     1 
ATOM   1265  N  N     . PHE A 1 173  ? -34.971 -77.476  28.213  1.00 2.06  ? 174  PHE A N     1 
ATOM   1266  C  CA    . PHE A 1 173  ? -35.306 -78.761  27.583  1.00 2.00  ? 174  PHE A CA    1 
ATOM   1267  C  C     . PHE A 1 173  ? -36.099 -79.678  28.483  1.00 2.00  ? 174  PHE A C     1 
ATOM   1268  O  O     . PHE A 1 173  ? -37.215 -80.000  28.171  1.00 2.00  ? 174  PHE A O     1 
ATOM   1269  C  CB    . PHE A 1 173  ? -34.055 -79.445  27.034  1.00 2.10  ? 174  PHE A CB    1 
ATOM   1270  C  CG    . PHE A 1 173  ? -33.553 -78.825  25.768  1.00 2.00  ? 174  PHE A CG    1 
ATOM   1271  C  CD1   . PHE A 1 173  ? -34.256 -78.979  24.592  1.00 2.00  ? 174  PHE A CD1   1 
ATOM   1272  C  CD2   . PHE A 1 173  ? -32.413 -78.046  25.763  1.00 2.27  ? 174  PHE A CD2   1 
ATOM   1273  C  CE1   . PHE A 1 173  ? -33.849 -78.373  23.432  1.00 2.14  ? 174  PHE A CE1   1 
ATOM   1274  C  CE2   . PHE A 1 173  ? -31.981 -77.426  24.600  1.00 2.31  ? 174  PHE A CE2   1 
ATOM   1275  C  CZ    . PHE A 1 173  ? -32.702 -77.586  23.428  1.00 2.43  ? 174  PHE A CZ    1 
ATOM   1276  N  N     . ARG A 1 174  ? -35.569 -79.992  29.662  1.00 2.36  ? 175  ARG A N     1 
ATOM   1277  C  CA    . ARG A 1 174  ? -36.246 -80.868  30.616  1.00 2.30  ? 175  ARG A CA    1 
ATOM   1278  C  C     . ARG A 1 174  ? -37.677 -80.422  30.919  1.00 2.48  ? 175  ARG A C     1 
ATOM   1279  O  O     . ARG A 1 174  ? -38.546 -81.283  31.121  1.00 2.47  ? 175  ARG A O     1 
ATOM   1280  C  CB    . ARG A 1 174  ? -35.473 -80.970  31.925  1.00 2.00  ? 175  ARG A CB    1 
ATOM   1281  C  CG    . ARG A 1 174  ? -35.200 -82.387  32.399  1.00 2.46  ? 175  ARG A CG    1 
ATOM   1282  C  CD    . ARG A 1 174  ? -36.459 -83.228  32.446  1.00 2.84  ? 175  ARG A CD    1 
ATOM   1283  N  NE    . ARG A 1 174  ? -36.403 -84.341  31.524  1.00 2.42  ? 175  ARG A NE    1 
ATOM   1284  C  CZ    . ARG A 1 174  ? -37.467 -84.857  30.909  1.00 3.51  ? 175  ARG A CZ    1 
ATOM   1285  N  NH1   . ARG A 1 174  ? -38.682 -84.353  31.121  1.00 3.34  ? 175  ARG A NH1   1 
ATOM   1286  N  NH2   . ARG A 1 174  ? -37.332 -85.932  30.130  1.00 3.19  ? 175  ARG A NH2   1 
ATOM   1287  N  N     . THR A 1 175  ? -37.918 -79.103  30.986  1.00 2.17  ? 176  THR A N     1 
ATOM   1288  C  CA    . THR A 1 175  ? -39.268 -78.582  31.252  1.00 2.00  ? 176  THR A CA    1 
ATOM   1289  C  C     . THR A 1 175  ? -39.784 -77.770  30.112  1.00 2.00  ? 176  THR A C     1 
ATOM   1290  O  O     . THR A 1 175  ? -40.923 -77.907  29.721  1.00 2.00  ? 176  THR A O     1 
ATOM   1291  C  CB    . THR A 1 175  ? -39.352 -77.699  32.511  1.00 2.19  ? 176  THR A CB    1 
ATOM   1292  O  OG1   . THR A 1 175  ? -39.054 -78.471  33.684  1.00 2.86  ? 176  THR A OG1   1 
ATOM   1293  C  CG2   . THR A 1 175  ? -40.738 -77.117  32.687  1.00 2.00  ? 176  THR A CG2   1 
ATOM   1294  N  N     . SER A 1 176  ? -38.930 -76.941  29.543  1.00 2.01  ? 177  SER A N     1 
ATOM   1295  C  CA    . SER A 1 176  ? -39.339 -76.082  28.442  1.00 2.00  ? 177  SER A CA    1 
ATOM   1296  C  C     . SER A 1 176  ? -39.809 -76.783  27.170  1.00 2.18  ? 177  SER A C     1 
ATOM   1297  O  O     . SER A 1 176  ? -40.610 -76.226  26.424  1.00 2.12  ? 177  SER A O     1 
ATOM   1298  C  CB    . SER A 1 176  ? -38.194 -75.129  28.079  1.00 2.19  ? 177  SER A CB    1 
ATOM   1299  O  OG    . SER A 1 176  ? -37.139 -75.802  27.411  1.00 2.00  ? 177  SER A OG    1 
ATOM   1300  N  N     . HIS A 1 177  ? -39.295 -77.983  26.928  1.00 2.00  ? 178  HIS A N     1 
ATOM   1301  C  CA    . HIS A 1 177  ? -39.576 -78.738  25.731  1.00 2.28  ? 178  HIS A CA    1 
ATOM   1302  C  C     . HIS A 1 177  ? -40.273 -80.061  26.062  1.00 3.45  ? 178  HIS A C     1 
ATOM   1303  O  O     . HIS A 1 177  ? -40.393 -80.951  25.193  1.00 3.81  ? 178  HIS A O     1 
ATOM   1304  C  CB    . HIS A 1 177  ? -38.270 -79.043  24.998  1.00 2.00  ? 178  HIS A CB    1 
ATOM   1305  C  CG    . HIS A 1 177  ? -37.738 -77.906  24.190  1.00 2.07  ? 178  HIS A CG    1 
ATOM   1306  N  ND1   . HIS A 1 177  ? -37.311 -76.727  24.751  1.00 2.00  ? 178  HIS A ND1   1 
ATOM   1307  C  CD2   . HIS A 1 177  ? -37.565 -77.766  22.857  1.00 2.27  ? 178  HIS A CD2   1 
ATOM   1308  C  CE1   . HIS A 1 177  ? -36.901 -75.910  23.807  1.00 2.00  ? 178  HIS A CE1   1 
ATOM   1309  N  NE2   . HIS A 1 177  ? -37.045 -76.514  22.647  1.00 2.00  ? 178  HIS A NE2   1 
ATOM   1310  N  N     . GLU A 1 178  ? -40.621 -80.254  27.338  1.00 3.15  ? 179  GLU A N     1 
ATOM   1311  C  CA    . GLU A 1 178  ? -41.356 -81.437  27.712  1.00 2.66  ? 179  GLU A CA    1 
ATOM   1312  C  C     . GLU A 1 178  ? -42.815 -81.098  27.475  1.00 2.64  ? 179  GLU A C     1 
ATOM   1313  O  O     . GLU A 1 178  ? -43.258 -79.984  27.803  1.00 2.93  ? 179  GLU A O     1 
ATOM   1314  C  CB    . GLU A 1 178  ? -41.143 -81.782  29.182  1.00 2.83  ? 179  GLU A CB    1 
ATOM   1315  C  CG    . GLU A 1 178  ? -41.933 -83.027  29.597  1.00 3.45  ? 179  GLU A CG    1 
ATOM   1316  C  CD    . GLU A 1 178  ? -41.749 -83.351  31.056  1.00 4.40  ? 179  GLU A CD    1 
ATOM   1317  O  OE1   . GLU A 1 178  ? -40.888 -82.722  31.671  1.00 5.62  ? 179  GLU A OE1   1 
ATOM   1318  O  OE2   . GLU A 1 178  ? -42.481 -84.196  31.621  1.00 5.65  ? 179  GLU A OE2   1 
ATOM   1319  N  N     . ILE A 1 179  ? -43.548 -81.973  26.799  1.00 2.42  ? 180  ILE A N     1 
ATOM   1320  C  CA    . ILE A 1 179  ? -44.947 -81.641  26.601  1.00 2.89  ? 180  ILE A CA    1 
ATOM   1321  C  C     . ILE A 1 179  ? -45.803 -82.405  27.614  1.00 3.01  ? 180  ILE A C     1 
ATOM   1322  O  O     . ILE A 1 179  ? -45.535 -83.584  27.943  1.00 2.22  ? 180  ILE A O     1 
ATOM   1323  C  CB    . ILE A 1 179  ? -45.488 -81.682  25.090  1.00 2.82  ? 180  ILE A CB    1 
ATOM   1324  C  CG1   . ILE A 1 179  ? -46.733 -82.527  25.016  1.00 3.01  ? 180  ILE A CG1   1 
ATOM   1325  C  CG2   . ILE A 1 179  ? -44.480 -82.098  24.083  1.00 2.29  ? 180  ILE A CG2   1 
ATOM   1326  C  CD1   . ILE A 1 179  ? -47.865 -81.759  24.449  1.00 4.74  ? 180  ILE A CD1   1 
ATOM   1327  N  N     . GLN A 1 180  ? -46.812 -81.720  28.137  1.00 2.68  ? 181  GLN A N     1 
ATOM   1328  C  CA    . GLN A 1 180  ? -47.635 -82.331  29.160  1.00 3.21  ? 181  GLN A CA    1 
ATOM   1329  C  C     . GLN A 1 180  ? -49.075 -81.856  29.075  1.00 3.00  ? 181  GLN A C     1 
ATOM   1330  O  O     . GLN A 1 180  ? -49.346 -80.746  28.608  1.00 3.14  ? 181  GLN A O     1 
ATOM   1331  C  CB    . GLN A 1 180  ? -47.011 -81.939  30.503  1.00 2.99  ? 181  GLN A CB    1 
ATOM   1332  C  CG    . GLN A 1 180  ? -47.411 -82.732  31.703  1.00 5.00  ? 181  GLN A CG    1 
ATOM   1333  C  CD    . GLN A 1 180  ? -46.414 -83.805  32.073  1.00 5.46  ? 181  GLN A CD    1 
ATOM   1334  O  OE1   . GLN A 1 180  ? -45.190 -83.651  31.927  1.00 7.14  ? 181  GLN A OE1   1 
ATOM   1335  N  NE2   . GLN A 1 180  ? -46.929 -84.910  32.527  1.00 6.13  ? 181  GLN A NE2   1 
ATOM   1336  N  N     . LYS A 1 181  ? -50.011 -82.717  29.449  1.00 3.38  ? 182  LYS A N     1 
ATOM   1337  C  CA    . LYS A 1 181  ? -51.416 -82.296  29.464  1.00 3.36  ? 182  LYS A CA    1 
ATOM   1338  C  C     . LYS A 1 181  ? -51.608 -81.519  30.757  1.00 3.09  ? 182  LYS A C     1 
ATOM   1339  O  O     . LYS A 1 181  ? -51.502 -82.087  31.869  1.00 2.87  ? 182  LYS A O     1 
ATOM   1340  C  CB    . LYS A 1 181  ? -52.396 -83.468  29.448  1.00 3.47  ? 182  LYS A CB    1 
ATOM   1341  C  CG    . LYS A 1 181  ? -53.841 -82.997  29.519  1.00 3.51  ? 182  LYS A CG    1 
ATOM   1342  C  CD    . LYS A 1 181  ? -54.789 -84.113  30.014  1.00 5.61  ? 182  LYS A CD    1 
ATOM   1343  C  CE    . LYS A 1 181  ? -55.353 -84.956  28.860  1.00 5.43  ? 182  LYS A CE    1 
ATOM   1344  N  NZ    . LYS A 1 181  ? -56.557 -85.755  29.268  1.00 5.47  ? 182  LYS A NZ    1 
ATOM   1345  N  N     . ILE A 1 182  ? -51.813 -80.214  30.593  1.00 2.28  ? 183  ILE A N     1 
ATOM   1346  C  CA    . ILE A 1 182  ? -51.991 -79.314  31.707  1.00 2.46  ? 183  ILE A CA    1 
ATOM   1347  C  C     . ILE A 1 182  ? -53.270 -78.489  31.675  1.00 2.95  ? 183  ILE A C     1 
ATOM   1348  O  O     . ILE A 1 182  ? -54.145 -78.639  30.830  1.00 2.27  ? 183  ILE A O     1 
ATOM   1349  C  CB    . ILE A 1 182  ? -50.808 -78.329  31.816  1.00 2.06  ? 183  ILE A CB    1 
ATOM   1350  C  CG1   . ILE A 1 182  ? -50.787 -77.392  30.626  1.00 2.00  ? 183  ILE A CG1   1 
ATOM   1351  C  CG2   . ILE A 1 182  ? -49.501 -79.080  31.939  1.00 2.00  ? 183  ILE A CG2   1 
ATOM   1352  C  CD1   . ILE A 1 182  ? -49.901 -76.191  30.825  1.00 2.02  ? 183  ILE A CD1   1 
ATOM   1353  N  N     . GLU A 1 183  ? -53.320 -77.518  32.560  1.00 4.11  ? 184  GLU A N     1 
ATOM   1354  C  CA    . GLU A 1 183  ? -54.474 -76.692  32.605  1.00 5.57  ? 184  GLU A CA    1 
ATOM   1355  C  C     . GLU A 1 183  ? -54.014 -75.261  32.755  1.00 5.18  ? 184  GLU A C     1 
ATOM   1356  O  O     . GLU A 1 183  ? -53.209 -74.953  33.620  1.00 4.72  ? 184  GLU A O     1 
ATOM   1357  C  CB    . GLU A 1 183  ? -55.299 -77.141  33.783  1.00 7.92  ? 184  GLU A CB    1 
ATOM   1358  C  CG    . GLU A 1 183  ? -56.706 -76.644  33.793  1.00 11.90 ? 184  GLU A CG    1 
ATOM   1359  C  CD    . GLU A 1 183  ? -57.293 -76.813  35.157  1.00 13.92 ? 184  GLU A CD    1 
ATOM   1360  O  OE1   . GLU A 1 183  ? -57.656 -77.992  35.473  1.00 14.46 ? 184  GLU A OE1   1 
ATOM   1361  O  OE2   . GLU A 1 183  ? -57.321 -75.780  35.899  1.00 14.10 ? 184  GLU A OE2   1 
ATOM   1362  N  N     . VAL A 1 184  ? -54.534 -74.383  31.907  1.00 5.80  ? 185  VAL A N     1 
ATOM   1363  C  CA    . VAL A 1 184  ? -54.151 -72.971  31.918  1.00 6.07  ? 185  VAL A CA    1 
ATOM   1364  C  C     . VAL A 1 184  ? -55.330 -72.100  32.219  1.00 6.84  ? 185  VAL A C     1 
ATOM   1365  O  O     . VAL A 1 184  ? -56.469 -72.496  31.985  1.00 8.54  ? 185  VAL A O     1 
ATOM   1366  C  CB    . VAL A 1 184  ? -53.539 -72.543  30.562  1.00 5.53  ? 185  VAL A CB    1 
ATOM   1367  C  CG1   . VAL A 1 184  ? -52.359 -73.459  30.208  1.00 4.64  ? 185  VAL A CG1   1 
ATOM   1368  C  CG2   . VAL A 1 184  ? -54.586 -72.565  29.445  1.00 4.69  ? 185  VAL A CG2   1 
ATOM   1369  N  N     . LEU A 1 185  ? -55.074 -70.928  32.787  1.00 7.08  ? 186  LEU A N     1 
ATOM   1370  C  CA    . LEU A 1 185  ? -56.122 -70.003  33.137  1.00 6.54  ? 186  LEU A CA    1 
ATOM   1371  C  C     . LEU A 1 185  ? -56.431 -69.104  31.982  1.00 7.42  ? 186  LEU A C     1 
ATOM   1372  O  O     . LEU A 1 185  ? -55.640 -68.950  31.075  1.00 8.33  ? 186  LEU A O     1 
ATOM   1373  C  CB    . LEU A 1 185  ? -55.685 -69.163  34.327  1.00 5.89  ? 186  LEU A CB    1 
ATOM   1374  C  CG    . LEU A 1 185  ? -55.735 -69.694  35.772  1.00 6.32  ? 186  LEU A CG    1 
ATOM   1375  C  CD1   . LEU A 1 185  ? -55.381 -68.557  36.757  1.00 6.35  ? 186  LEU A CD1   1 
ATOM   1376  C  CD2   . LEU A 1 185  ? -57.128 -70.205  36.105  1.00 5.77  ? 186  LEU A CD2   1 
ATOM   1377  N  N     . ASP A 1 186  ? -57.565 -68.438  32.037  1.00 8.06  ? 187  ASP A N     1 
ATOM   1378  C  CA    . ASP A 1 186  ? -57.931 -67.515  30.976  1.00 8.58  ? 187  ASP A CA    1 
ATOM   1379  C  C     . ASP A 1 186  ? -57.341 -66.157  31.294  1.00 7.46  ? 187  ASP A C     1 
ATOM   1380  O  O     . ASP A 1 186  ? -57.284 -65.774  32.455  1.00 6.94  ? 187  ASP A O     1 
ATOM   1381  C  CB    . ASP A 1 186  ? -59.465 -67.356  30.912  1.00 10.92 ? 187  ASP A CB    1 
ATOM   1382  C  CG    . ASP A 1 186  ? -60.120 -68.403  30.046  1.00 13.35 ? 187  ASP A CG    1 
ATOM   1383  O  OD1   . ASP A 1 186  ? -59.413 -68.936  29.136  1.00 14.92 ? 187  ASP A OD1   1 
ATOM   1384  O  OD2   . ASP A 1 186  ? -61.328 -68.694  30.267  1.00 14.57 ? 187  ASP A OD2   1 
ATOM   1385  N  N     . TYR A 1 187  ? -57.023 -65.385  30.262  1.00 6.23  ? 188  TYR A N     1 
ATOM   1386  C  CA    . TYR A 1 187  ? -56.474 -64.057  30.485  1.00 5.30  ? 188  TYR A CA    1 
ATOM   1387  C  C     . TYR A 1 187  ? -57.328 -63.194  31.446  1.00 5.61  ? 188  TYR A C     1 
ATOM   1388  O  O     . TYR A 1 187  ? -56.787 -62.480  32.277  1.00 6.07  ? 188  TYR A O     1 
ATOM   1389  C  CB    . TYR A 1 187  ? -56.213 -63.345  29.153  1.00 4.09  ? 188  TYR A CB    1 
ATOM   1390  C  CG    . TYR A 1 187  ? -55.026 -63.906  28.352  1.00 2.81  ? 188  TYR A CG    1 
ATOM   1391  C  CD1   . TYR A 1 187  ? -54.416 -65.093  28.700  1.00 2.45  ? 188  TYR A CD1   1 
ATOM   1392  C  CD2   . TYR A 1 187  ? -54.512 -63.214  27.269  1.00 2.13  ? 188  TYR A CD2   1 
ATOM   1393  C  CE1   . TYR A 1 187  ? -53.337 -65.569  27.994  1.00 2.40  ? 188  TYR A CE1   1 
ATOM   1394  C  CE2   . TYR A 1 187  ? -53.428 -63.680  26.561  1.00 2.00  ? 188  TYR A CE2   1 
ATOM   1395  C  CZ    . TYR A 1 187  ? -52.846 -64.864  26.925  1.00 2.36  ? 188  TYR A CZ    1 
ATOM   1396  O  OH    . TYR A 1 187  ? -51.805 -65.365  26.166  1.00 2.84  ? 188  TYR A OH    1 
ATOM   1397  N  N     . ALA A 1 188  ? -58.648 -63.314  31.403  1.00 6.02  ? 189  ALA A N     1 
ATOM   1398  C  CA    . ALA A 1 188  ? -59.500 -62.556  32.325  1.00 6.63  ? 189  ALA A CA    1 
ATOM   1399  C  C     . ALA A 1 188  ? -59.284 -62.908  33.795  1.00 7.15  ? 189  ALA A C     1 
ATOM   1400  O  O     . ALA A 1 188  ? -59.396 -62.025  34.628  1.00 7.31  ? 189  ALA A O     1 
ATOM   1401  C  CB    . ALA A 1 188  ? -60.939 -62.755  31.985  1.00 6.76  ? 189  ALA A CB    1 
ATOM   1402  N  N     . ASP A 1 189  ? -59.016 -64.187  34.107  1.00 7.88  ? 190  ASP A N     1 
ATOM   1403  C  CA    . ASP A 1 189  ? -58.761 -64.648  35.489  1.00 8.65  ? 190  ASP A CA    1 
ATOM   1404  C  C     . ASP A 1 189  ? -57.459 -64.081  36.007  1.00 8.23  ? 190  ASP A C     1 
ATOM   1405  O  O     . ASP A 1 189  ? -57.293 -63.866  37.212  1.00 8.88  ? 190  ASP A O     1 
ATOM   1406  C  CB    . ASP A 1 189  ? -58.651 -66.174  35.573  1.00 11.09 ? 190  ASP A CB    1 
ATOM   1407  C  CG    . ASP A 1 189  ? -59.922 -66.872  35.141  1.00 12.78 ? 190  ASP A CG    1 
ATOM   1408  O  OD1   . ASP A 1 189  ? -60.251 -66.850  33.944  1.00 14.58 ? 190  ASP A OD1   1 
ATOM   1409  O  OD2   . ASP A 1 189  ? -60.610 -67.434  35.997  1.00 14.74 ? 190  ASP A OD2   1 
ATOM   1410  N  N     . MET A 1 190  ? -56.500 -63.927  35.106  1.00 6.93  ? 191  MET A N     1 
ATOM   1411  C  CA    . MET A 1 190  ? -55.225 -63.374  35.472  1.00 5.74  ? 191  MET A CA    1 
ATOM   1412  C  C     . MET A 1 190  ? -55.455 -61.888  35.742  1.00 5.39  ? 191  MET A C     1 
ATOM   1413  O  O     . MET A 1 190  ? -55.115 -61.354  36.794  1.00 5.80  ? 191  MET A O     1 
ATOM   1414  C  CB    . MET A 1 190  ? -54.272 -63.555  34.299  1.00 5.63  ? 191  MET A CB    1 
ATOM   1415  C  CG    . MET A 1 190  ? -54.015 -65.012  33.944  1.00 5.14  ? 191  MET A CG    1 
ATOM   1416  S  SD    . MET A 1 190  ? -52.951 -65.112  32.505  1.00 5.89  ? 191  MET A SD    1 
ATOM   1417  C  CE    . MET A 1 190  ? -53.438 -66.648  31.861  1.00 5.72  ? 191  MET A CE    1 
ATOM   1418  N  N     . ALA A 1 191  ? -56.188 -61.255  34.848  1.00 4.54  ? 192  ALA A N     1 
ATOM   1419  C  CA    . ALA A 1 191  ? -56.445 -59.835  34.962  1.00 3.80  ? 192  ALA A CA    1 
ATOM   1420  C  C     . ALA A 1 191  ? -57.107 -59.442  36.275  1.00 3.66  ? 192  ALA A C     1 
ATOM   1421  O  O     . ALA A 1 191  ? -56.849 -58.332  36.803  1.00 4.29  ? 192  ALA A O     1 
ATOM   1422  C  CB    . ALA A 1 191  ? -57.279 -59.377  33.794  1.00 2.52  ? 192  ALA A CB    1 
ATOM   1423  N  N     . SER A 1 192  ? -57.871 -60.380  36.845  1.00 3.28  ? 193  SER A N     1 
ATOM   1424  C  CA    . SER A 1 192  ? -58.643 -60.130  38.075  1.00 2.85  ? 193  SER A CA    1 
ATOM   1425  C  C     . SER A 1 192  ? -57.825 -60.144  39.350  1.00 2.73  ? 193  SER A C     1 
ATOM   1426  O  O     . SER A 1 192  ? -58.214 -59.498  40.332  1.00 2.00  ? 193  SER A O     1 
ATOM   1427  C  CB    . SER A 1 192  ? -59.834 -61.096  38.174  1.00 2.00  ? 193  SER A CB    1 
ATOM   1428  O  OG    . SER A 1 192  ? -59.378 -62.429  38.340  1.00 2.14  ? 193  SER A OG    1 
ATOM   1429  N  N     . LEU A 1 193  ? -56.668 -60.819  39.281  1.00 2.81  ? 194  LEU A N     1 
ATOM   1430  C  CA    . LEU A 1 193  ? -55.736 -60.936  40.399  1.00 2.97  ? 194  LEU A CA    1 
ATOM   1431  C  C     . LEU A 1 193  ? -54.785 -59.713  40.532  1.00 3.18  ? 194  LEU A C     1 
ATOM   1432  O  O     . LEU A 1 193  ? -54.195 -59.465  41.583  1.00 3.93  ? 194  LEU A O     1 
ATOM   1433  C  CB    . LEU A 1 193  ? -54.936 -62.235  40.252  1.00 3.08  ? 194  LEU A CB    1 
ATOM   1434  C  CG    . LEU A 1 193  ? -55.425 -63.616  40.813  1.00 3.20  ? 194  LEU A CG    1 
ATOM   1435  C  CD1   . LEU A 1 193  ? -56.869 -63.559  41.302  1.00 3.24  ? 194  LEU A CD1   1 
ATOM   1436  C  CD2   . LEU A 1 193  ? -55.191 -64.762  39.822  1.00 2.23  ? 194  LEU A CD2   1 
ATOM   1437  N  N     . VAL A 1 194  ? -54.695 -58.910  39.494  1.00 3.18  ? 195  VAL A N     1 
ATOM   1438  C  CA    . VAL A 1 194  ? -53.802 -57.738  39.492  1.00 3.59  ? 195  VAL A CA    1 
ATOM   1439  C  C     . VAL A 1 194  ? -54.151 -56.656  40.509  1.00 3.98  ? 195  VAL A C     1 
ATOM   1440  O  O     . VAL A 1 194  ? -55.283 -56.157  40.529  1.00 4.74  ? 195  VAL A O     1 
ATOM   1441  C  CB    . VAL A 1 194  ? -53.776 -57.055  38.088  1.00 3.06  ? 195  VAL A CB    1 
ATOM   1442  C  CG1   . VAL A 1 194  ? -53.134 -55.663  38.165  1.00 2.33  ? 195  VAL A CG1   1 
ATOM   1443  C  CG2   . VAL A 1 194  ? -53.095 -57.937  37.055  1.00 2.29  ? 195  VAL A CG2   1 
ATOM   1444  N  N     . ASN A 1 195  ? -53.148 -56.207  41.261  1.00 3.98  ? 196  ASN A N     1 
ATOM   1445  C  CA    . ASN A 1 195  ? -53.347 -55.149  42.257  1.00 4.10  ? 196  ASN A CA    1 
ATOM   1446  C  C     . ASN A 1 195  ? -53.383 -53.767  41.570  1.00 3.51  ? 196  ASN A C     1 
ATOM   1447  O  O     . ASN A 1 195  ? -52.390 -53.098  41.417  1.00 2.20  ? 196  ASN A O     1 
ATOM   1448  C  CB    . ASN A 1 195  ? -52.228 -55.224  43.293  1.00 4.84  ? 196  ASN A CB    1 
ATOM   1449  C  CG    . ASN A 1 195  ? -52.449 -54.274  44.476  1.00 5.88  ? 196  ASN A CG    1 
ATOM   1450  O  OD1   . ASN A 1 195  ? -52.762 -53.090  44.293  1.00 3.87  ? 196  ASN A OD1   1 
ATOM   1451  N  ND2   . ASN A 1 195  ? -52.275 -54.805  45.703  1.00 5.65  ? 196  ASN A ND2   1 
ATOM   1452  N  N     . GLN A 1 196  ? -54.575 -53.337  41.185  1.00 4.01  ? 197  GLN A N     1 
ATOM   1453  C  CA    . GLN A 1 196  ? -54.737 -52.076  40.463  1.00 4.23  ? 197  GLN A CA    1 
ATOM   1454  C  C     . GLN A 1 196  ? -54.087 -50.836  41.066  1.00 4.13  ? 197  GLN A C     1 
ATOM   1455  O  O     . GLN A 1 196  ? -53.735 -49.906  40.329  1.00 3.13  ? 197  GLN A O     1 
ATOM   1456  C  CB    . GLN A 1 196  ? -56.208 -51.819  40.176  1.00 3.95  ? 197  GLN A CB    1 
ATOM   1457  C  CG    . GLN A 1 196  ? -56.901 -52.988  39.495  1.00 5.14  ? 197  GLN A CG    1 
ATOM   1458  C  CD    . GLN A 1 196  ? -56.423 -53.230  38.089  1.00 5.14  ? 197  GLN A CD    1 
ATOM   1459  O  OE1   . GLN A 1 196  ? -55.997 -52.310  37.386  1.00 6.81  ? 197  GLN A OE1   1 
ATOM   1460  N  NE2   . GLN A 1 196  ? -56.479 -54.465  37.671  1.00 5.49  ? 197  GLN A NE2   1 
ATOM   1461  N  N     . LYS A 1 197  ? -53.966 -50.828  42.399  1.00 4.51  ? 198  LYS A N     1 
ATOM   1462  C  CA    . LYS A 1 197  ? -53.367 -49.718  43.142  1.00 5.16  ? 198  LYS A CA    1 
ATOM   1463  C  C     . LYS A 1 197  ? -51.878 -49.680  42.828  1.00 5.13  ? 198  LYS A C     1 
ATOM   1464  O  O     . LYS A 1 197  ? -51.282 -48.618  42.568  1.00 5.12  ? 198  LYS A O     1 
ATOM   1465  C  CB    . LYS A 1 197  ? -53.536 -49.920  44.662  1.00 6.25  ? 198  LYS A CB    1 
ATOM   1466  C  CG    . LYS A 1 197  ? -54.959 -49.939  45.120  1.00 9.66  ? 198  LYS A CG    1 
ATOM   1467  C  CD    . LYS A 1 197  ? -55.393 -51.218  45.925  1.00 11.50 ? 198  LYS A CD    1 
ATOM   1468  C  CE    . LYS A 1 197  ? -55.530 -52.524  45.114  1.00 12.61 ? 198  LYS A CE    1 
ATOM   1469  N  NZ    . LYS A 1 197  ? -56.518 -52.573  43.951  1.00 14.03 ? 198  LYS A NZ    1 
ATOM   1470  N  N     . ALA A 1 198  ? -51.283 -50.864  42.899  1.00 4.61  ? 199  ALA A N     1 
ATOM   1471  C  CA    . ALA A 1 198  ? -49.882 -51.045  42.654  1.00 4.20  ? 199  ALA A CA    1 
ATOM   1472  C  C     . ALA A 1 198  ? -49.634 -50.677  41.220  1.00 4.45  ? 199  ALA A C     1 
ATOM   1473  O  O     . ALA A 1 198  ? -48.652 -50.007  40.923  1.00 5.57  ? 199  ALA A O     1 
ATOM   1474  C  CB    . ALA A 1 198  ? -49.486 -52.466  42.912  1.00 4.02  ? 199  ALA A CB    1 
ATOM   1475  N  N     . LEU A 1 199  ? -50.565 -51.030  40.342  1.00 3.95  ? 200  LEU A N     1 
ATOM   1476  C  CA    . LEU A 1 199  ? -50.409 -50.734  38.928  1.00 3.35  ? 200  LEU A CA    1 
ATOM   1477  C  C     . LEU A 1 199  ? -50.494 -49.235  38.662  1.00 3.66  ? 200  LEU A C     1 
ATOM   1478  O  O     . LEU A 1 199  ? -49.693 -48.674  37.904  1.00 4.27  ? 200  LEU A O     1 
ATOM   1479  C  CB    . LEU A 1 199  ? -51.469 -51.453  38.118  1.00 2.59  ? 200  LEU A CB    1 
ATOM   1480  C  CG    . LEU A 1 199  ? -51.223 -51.475  36.625  1.00 2.60  ? 200  LEU A CG    1 
ATOM   1481  C  CD1   . LEU A 1 199  ? -49.804 -51.954  36.364  1.00 2.15  ? 200  LEU A CD1   1 
ATOM   1482  C  CD2   . LEU A 1 199  ? -52.253 -52.386  35.991  1.00 2.52  ? 200  LEU A CD2   1 
ATOM   1483  N  N     . ALA A 1 200  ? -51.430 -48.558  39.298  1.00 3.74  ? 201  ALA A N     1 
ATOM   1484  C  CA    . ALA A 1 200  ? -51.564 -47.121  39.055  1.00 4.15  ? 201  ALA A CA    1 
ATOM   1485  C  C     . ALA A 1 200  ? -50.366 -46.427  39.640  1.00 4.62  ? 201  ALA A C     1 
ATOM   1486  O  O     . ALA A 1 200  ? -49.900 -45.441  39.112  1.00 5.06  ? 201  ALA A O     1 
ATOM   1487  C  CB    . ALA A 1 200  ? -52.821 -46.584  39.675  1.00 3.45  ? 201  ALA A CB    1 
ATOM   1488  N  N     . GLU A 1 201  ? -49.858 -46.972  40.736  1.00 5.88  ? 202  GLU A N     1 
ATOM   1489  C  CA    . GLU A 1 201  ? -48.695 -46.422  41.411  1.00 6.42  ? 202  GLU A CA    1 
ATOM   1490  C  C     . GLU A 1 201  ? -47.486 -46.585  40.531  1.00 5.42  ? 202  GLU A C     1 
ATOM   1491  O  O     . GLU A 1 201  ? -46.691 -45.686  40.438  1.00 5.92  ? 202  GLU A O     1 
ATOM   1492  C  CB    . GLU A 1 201  ? -48.489 -47.121  42.738  1.00 8.45  ? 202  GLU A CB    1 
ATOM   1493  C  CG    . GLU A 1 201  ? -49.031 -46.347  43.863  1.00 12.10 ? 202  GLU A CG    1 
ATOM   1494  C  CD    . GLU A 1 201  ? -49.286 -47.156  45.093  1.00 14.88 ? 202  GLU A CD    1 
ATOM   1495  O  OE1   . GLU A 1 201  ? -48.855 -48.313  45.197  1.00 16.77 ? 202  GLU A OE1   1 
ATOM   1496  O  OE2   . GLU A 1 201  ? -49.950 -46.612  45.991  1.00 17.98 ? 202  GLU A OE2   1 
ATOM   1497  N  N     . PHE A 1 202  ? -47.407 -47.709  39.828  1.00 4.55  ? 203  PHE A N     1 
ATOM   1498  C  CA    . PHE A 1 202  ? -46.323 -47.979  38.899  1.00 3.62  ? 203  PHE A CA    1 
ATOM   1499  C  C     . PHE A 1 202  ? -46.324 -46.923  37.790  1.00 3.25  ? 203  PHE A C     1 
ATOM   1500  O  O     . PHE A 1 202  ? -45.315 -46.286  37.526  1.00 3.28  ? 203  PHE A O     1 
ATOM   1501  C  CB    . PHE A 1 202  ? -46.494 -49.360  38.288  1.00 3.09  ? 203  PHE A CB    1 
ATOM   1502  C  CG    . PHE A 1 202  ? -45.546 -49.638  37.143  1.00 3.54  ? 203  PHE A CG    1 
ATOM   1503  C  CD1   . PHE A 1 202  ? -44.155 -49.428  37.282  1.00 2.52  ? 203  PHE A CD1   1 
ATOM   1504  C  CD2   . PHE A 1 202  ? -46.035 -50.121  35.918  1.00 2.70  ? 203  PHE A CD2   1 
ATOM   1505  C  CE1   . PHE A 1 202  ? -43.294 -49.695  36.224  1.00 2.00  ? 203  PHE A CE1   1 
ATOM   1506  C  CE2   . PHE A 1 202  ? -45.155 -50.389  34.862  1.00 2.12  ? 203  PHE A CE2   1 
ATOM   1507  C  CZ    . PHE A 1 202  ? -43.793 -50.174  35.017  1.00 2.00  ? 203  PHE A CZ    1 
ATOM   1508  N  N     . ARG A 1 203  ? -47.493 -46.679  37.211  1.00 3.19  ? 204  ARG A N     1 
ATOM   1509  C  CA    . ARG A 1 203  ? -47.640 -45.689  36.151  1.00 2.76  ? 204  ARG A CA    1 
ATOM   1510  C  C     . ARG A 1 203  ? -47.260 -44.278  36.582  1.00 2.91  ? 204  ARG A C     1 
ATOM   1511  O  O     . ARG A 1 203  ? -46.652 -43.516  35.829  1.00 2.92  ? 204  ARG A O     1 
ATOM   1512  C  CB    . ARG A 1 203  ? -49.087 -45.644  35.681  1.00 2.15  ? 204  ARG A CB    1 
ATOM   1513  C  CG    . ARG A 1 203  ? -49.323 -46.255  34.343  1.00 2.47  ? 204  ARG A CG    1 
ATOM   1514  C  CD    . ARG A 1 203  ? -49.615 -47.742  34.467  1.00 2.93  ? 204  ARG A CD    1 
ATOM   1515  N  NE    . ARG A 1 203  ? -49.067 -48.433  33.320  1.00 3.89  ? 204  ARG A NE    1 
ATOM   1516  C  CZ    . ARG A 1 203  ? -49.652 -49.445  32.702  1.00 4.20  ? 204  ARG A CZ    1 
ATOM   1517  N  NH1   . ARG A 1 203  ? -50.824 -49.903  33.110  1.00 4.89  ? 204  ARG A NH1   1 
ATOM   1518  N  NH2   . ARG A 1 203  ? -49.070 -49.980  31.646  1.00 3.97  ? 204  ARG A NH2   1 
ATOM   1519  N  N     . ALA A 1 204  ? -47.624 -43.931  37.806  1.00 2.68  ? 205  ALA A N     1 
ATOM   1520  C  CA    . ALA A 1 204  ? -47.373 -42.593  38.280  1.00 2.62  ? 205  ALA A CA    1 
ATOM   1521  C  C     . ALA A 1 204  ? -45.943 -42.286  38.688  1.00 2.48  ? 205  ALA A C     1 
ATOM   1522  O  O     . ALA A 1 204  ? -45.551 -41.130  38.668  1.00 2.75  ? 205  ALA A O     1 
ATOM   1523  C  CB    . ALA A 1 204  ? -48.332 -42.236  39.396  1.00 2.00  ? 205  ALA A CB    1 
ATOM   1524  N  N     . LYS A 1 205  ? -45.171 -43.293  39.070  1.00 2.00  ? 206  LYS A N     1 
ATOM   1525  C  CA    . LYS A 1 205  ? -43.798 -43.039  39.496  1.00 2.31  ? 206  LYS A CA    1 
ATOM   1526  C  C     . LYS A 1 205  ? -42.823 -43.077  38.318  1.00 2.36  ? 206  LYS A C     1 
ATOM   1527  O  O     . LYS A 1 205  ? -41.636 -42.781  38.465  1.00 2.00  ? 206  LYS A O     1 
ATOM   1528  C  CB    . LYS A 1 205  ? -43.370 -44.074  40.557  1.00 2.28  ? 206  LYS A CB    1 
ATOM   1529  C  CG    . LYS A 1 205  ? -43.240 -45.503  40.020  1.00 3.16  ? 206  LYS A CG    1 
ATOM   1530  C  CD    . LYS A 1 205  ? -42.428 -46.391  40.996  1.00 4.28  ? 206  LYS A CD    1 
ATOM   1531  C  CE    . LYS A 1 205  ? -42.139 -47.787  40.400  1.00 3.75  ? 206  LYS A CE    1 
ATOM   1532  N  NZ    . LYS A 1 205  ? -41.227 -48.599  41.262  1.00 3.08  ? 206  LYS A NZ    1 
ATOM   1533  N  N     . SER A 1 206  ? -43.347 -43.471  37.163  1.00 2.25  ? 207  SER A N     1 
ATOM   1534  C  CA    . SER A 1 206  ? -42.577 -43.605  35.952  1.00 2.27  ? 207  SER A CA    1 
ATOM   1535  C  C     . SER A 1 206  ? -42.126 -42.318  35.347  1.00 2.75  ? 207  SER A C     1 
ATOM   1536  O  O     . SER A 1 206  ? -42.721 -41.248  35.575  1.00 2.85  ? 207  SER A O     1 
ATOM   1537  C  CB    . SER A 1 206  ? -43.369 -44.354  34.910  1.00 2.00  ? 207  SER A CB    1 
ATOM   1538  O  OG    . SER A 1 206  ? -43.520 -45.699  35.304  1.00 2.60  ? 207  SER A OG    1 
ATOM   1539  N  N     . MET A 1 207  ? -41.139 -42.465  34.465  1.00 2.71  ? 208  MET A N     1 
ATOM   1540  C  CA    . MET A 1 207  ? -40.541 -41.360  33.747  1.00 2.57  ? 208  MET A CA    1 
ATOM   1541  C  C     . MET A 1 207  ? -41.554 -40.646  32.839  1.00 2.62  ? 208  MET A C     1 
ATOM   1542  O  O     . MET A 1 207  ? -42.182 -41.275  31.980  1.00 3.18  ? 208  MET A O     1 
ATOM   1543  C  CB    . MET A 1 207  ? -39.422 -41.903  32.864  1.00 2.76  ? 208  MET A CB    1 
ATOM   1544  C  CG    . MET A 1 207  ? -38.098 -42.261  33.541  1.00 2.64  ? 208  MET A CG    1 
ATOM   1545  S  SD    . MET A 1 207  ? -36.832 -42.730  32.347  1.00 2.00  ? 208  MET A SD    1 
ATOM   1546  C  CE    . MET A 1 207  ? -36.307 -41.215  31.815  1.00 2.00  ? 208  MET A CE    1 
ATOM   1547  N  N     . ASN A 1 208  ? -41.673 -39.330  32.995  1.00 2.46  ? 209  ASN A N     1 
ATOM   1548  C  CA    . ASN A 1 208  ? -42.591 -38.515  32.168  1.00 2.27  ? 209  ASN A CA    1 
ATOM   1549  C  C     . ASN A 1 208  ? -42.200 -37.030  32.276  1.00 2.23  ? 209  ASN A C     1 
ATOM   1550  O  O     . ASN A 1 208  ? -41.992 -36.492  33.370  1.00 2.00  ? 209  ASN A O     1 
ATOM   1551  C  CB    . ASN A 1 208  ? -44.080 -38.751  32.526  1.00 2.00  ? 209  ASN A CB    1 
ATOM   1552  C  CG    . ASN A 1 208  ? -45.022 -38.402  31.369  1.00 2.08  ? 209  ASN A CG    1 
ATOM   1553  O  OD1   . ASN A 1 208  ? -45.146 -37.236  30.998  1.00 2.23  ? 209  ASN A OD1   1 
ATOM   1554  N  ND2   . ASN A 1 208  ? -45.641 -39.410  30.768  1.00 2.00  ? 209  ASN A ND2   1 
ATOM   1555  N  N     . PRO A 1 209  ? -42.028 -36.364  31.134  1.00 2.05  ? 210  PRO A N     1 
ATOM   1556  C  CA    . PRO A 1 209  ? -41.655 -34.979  31.225  1.00 2.30  ? 210  PRO A CA    1 
ATOM   1557  C  C     . PRO A 1 209  ? -42.766 -34.128  31.773  1.00 3.37  ? 210  PRO A C     1 
ATOM   1558  O  O     . PRO A 1 209  ? -42.565 -32.907  32.033  1.00 3.20  ? 210  PRO A O     1 
ATOM   1559  C  CB    . PRO A 1 209  ? -41.321 -34.646  29.798  1.00 2.00  ? 210  PRO A CB    1 
ATOM   1560  C  CG    . PRO A 1 209  ? -42.180 -35.445  29.081  1.00 2.00  ? 210  PRO A CG    1 
ATOM   1561  C  CD    . PRO A 1 209  ? -42.048 -36.765  29.735  1.00 2.00  ? 210  PRO A CD    1 
ATOM   1562  N  N     . GLU A 1 210  ? -43.936 -34.728  31.973  1.00 3.74  ? 211  GLU A N     1 
ATOM   1563  C  CA    . GLU A 1 210  ? -44.997 -33.930  32.513  1.00 4.81  ? 211  GLU A CA    1 
ATOM   1564  C  C     . GLU A 1 210  ? -44.987 -33.885  34.053  1.00 3.98  ? 211  GLU A C     1 
ATOM   1565  O  O     . GLU A 1 210  ? -45.603 -33.013  34.681  1.00 3.10  ? 211  GLU A O     1 
ATOM   1566  C  CB    . GLU A 1 210  ? -46.333 -34.245  31.830  1.00 7.68  ? 211  GLU A CB    1 
ATOM   1567  C  CG    . GLU A 1 210  ? -46.822 -33.005  30.948  1.00 12.20 ? 211  GLU A CG    1 
ATOM   1568  C  CD    . GLU A 1 210  ? -46.976 -33.245  29.402  1.00 14.21 ? 211  GLU A CD    1 
ATOM   1569  O  OE1   . GLU A 1 210  ? -45.961 -33.421  28.648  1.00 15.88 ? 211  GLU A OE1   1 
ATOM   1570  O  OE2   . GLU A 1 210  ? -48.136 -33.156  28.935  1.00 14.85 ? 211  GLU A OE2   1 
ATOM   1571  N  N     . HIS A 1 211  ? -44.135 -34.742  34.609  1.00 2.70  ? 212  HIS A N     1 
ATOM   1572  C  CA    . HIS A 1 211  ? -43.847 -34.886  36.051  1.00 2.82  ? 212  HIS A CA    1 
ATOM   1573  C  C     . HIS A 1 211  ? -42.492 -35.612  36.132  1.00 2.37  ? 212  HIS A C     1 
ATOM   1574  O  O     . HIS A 1 211  ? -42.407 -36.736  36.593  1.00 3.21  ? 212  HIS A O     1 
ATOM   1575  C  CB    . HIS A 1 211  ? -44.963 -35.635  36.829  1.00 2.35  ? 212  HIS A CB    1 
ATOM   1576  C  CG    . HIS A 1 211  ? -45.340 -36.985  36.286  1.00 2.48  ? 212  HIS A CG    1 
ATOM   1577  N  ND1   . HIS A 1 211  ? -46.488 -37.192  35.555  1.00 2.92  ? 212  HIS A ND1   1 
ATOM   1578  C  CD2   . HIS A 1 211  ? -44.783 -38.209  36.445  1.00 2.34  ? 212  HIS A CD2   1 
ATOM   1579  C  CE1   . HIS A 1 211  ? -46.626 -38.480  35.287  1.00 2.00  ? 212  HIS A CE1   1 
ATOM   1580  N  NE2   . HIS A 1 211  ? -45.605 -39.120  35.816  1.00 2.00  ? 212  HIS A NE2   1 
ATOM   1581  N  N     . PRO A 1 212  ? -41.407 -34.942  35.716  1.00 2.46  ? 213  PRO A N     1 
ATOM   1582  C  CA    . PRO A 1 212  ? -40.070 -35.517  35.709  1.00 2.51  ? 213  PRO A CA    1 
ATOM   1583  C  C     . PRO A 1 212  ? -39.295 -35.759  37.020  1.00 2.61  ? 213  PRO A C     1 
ATOM   1584  O  O     . PRO A 1 212  ? -39.609 -35.202  38.073  1.00 2.76  ? 213  PRO A O     1 
ATOM   1585  C  CB    . PRO A 1 212  ? -39.329 -34.522  34.823  1.00 2.45  ? 213  PRO A CB    1 
ATOM   1586  C  CG    . PRO A 1 212  ? -39.846 -33.266  35.288  1.00 2.00  ? 213  PRO A CG    1 
ATOM   1587  C  CD    . PRO A 1 212  ? -41.322 -33.509  35.348  1.00 2.00  ? 213  PRO A CD    1 
ATOM   1588  N  N     . HIS A 1 213  ? -38.296 -36.628  36.930  1.00 2.27  ? 214  HIS A N     1 
ATOM   1589  C  CA    . HIS A 1 213  ? -37.400 -36.906  38.043  1.00 2.37  ? 214  HIS A CA    1 
ATOM   1590  C  C     . HIS A 1 213  ? -36.039 -37.341  37.456  1.00 2.41  ? 214  HIS A C     1 
ATOM   1591  O  O     . HIS A 1 213  ? -35.909 -37.544  36.235  1.00 2.00  ? 214  HIS A O     1 
ATOM   1592  C  CB    . HIS A 1 213  ? -37.979 -37.996  38.957  1.00 2.26  ? 214  HIS A CB    1 
ATOM   1593  C  CG    . HIS A 1 213  ? -38.021 -39.358  38.336  1.00 2.69  ? 214  HIS A CG    1 
ATOM   1594  N  ND1   . HIS A 1 213  ? -39.113 -39.819  37.635  1.00 3.34  ? 214  HIS A ND1   1 
ATOM   1595  C  CD2   . HIS A 1 213  ? -37.105 -40.359  38.306  1.00 2.28  ? 214  HIS A CD2   1 
ATOM   1596  C  CE1   . HIS A 1 213  ? -38.864 -41.045  37.198  1.00 3.51  ? 214  HIS A CE1   1 
ATOM   1597  N  NE2   . HIS A 1 213  ? -37.650 -41.395  37.591  1.00 2.10  ? 214  HIS A NE2   1 
ATOM   1598  N  N     . VAL A 1 214  ? -34.988 -37.353  38.270  1.00 2.21  ? 215  VAL A N     1 
ATOM   1599  C  CA    . VAL A 1 214  ? -33.754 -37.862  37.709  1.00 2.09  ? 215  VAL A CA    1 
ATOM   1600  C  C     . VAL A 1 214  ? -33.430 -39.216  38.305  1.00 2.00  ? 215  VAL A C     1 
ATOM   1601  O  O     . VAL A 1 214  ? -33.622 -39.438  39.496  1.00 2.00  ? 215  VAL A O     1 
ATOM   1602  C  CB    . VAL A 1 214  ? -32.556 -36.856  37.667  1.00 2.36  ? 215  VAL A CB    1 
ATOM   1603  C  CG1   . VAL A 1 214  ? -32.927 -35.512  38.181  1.00 2.19  ? 215  VAL A CG1   1 
ATOM   1604  C  CG2   . VAL A 1 214  ? -31.318 -37.454  38.252  1.00 2.00  ? 215  VAL A CG2   1 
ATOM   1605  N  N     . ARG A 1 215  ? -33.138 -40.175  37.437  1.00 2.00  ? 216  ARG A N     1 
ATOM   1606  C  CA    . ARG A 1 215  ? -32.808 -41.525  37.878  1.00 2.34  ? 216  ARG A CA    1 
ATOM   1607  C  C     . ARG A 1 215  ? -31.423 -41.884  37.361  1.00 2.04  ? 216  ARG A C     1 
ATOM   1608  O  O     . ARG A 1 215  ? -30.982 -41.336  36.354  1.00 2.00  ? 216  ARG A O     1 
ATOM   1609  C  CB    . ARG A 1 215  ? -33.900 -42.542  37.446  1.00 2.00  ? 216  ARG A CB    1 
ATOM   1610  C  CG    . ARG A 1 215  ? -33.908 -42.927  35.998  1.00 2.00  ? 216  ARG A CG    1 
ATOM   1611  C  CD    . ARG A 1 215  ? -35.246 -43.510  35.576  1.00 2.32  ? 216  ARG A CD    1 
ATOM   1612  N  NE    . ARG A 1 215  ? -35.553 -44.816  36.168  1.00 2.43  ? 216  ARG A NE    1 
ATOM   1613  C  CZ    . ARG A 1 215  ? -36.619 -45.076  36.937  1.00 2.75  ? 216  ARG A CZ    1 
ATOM   1614  N  NH1   . ARG A 1 215  ? -37.530 -44.133  37.240  1.00 2.05  ? 216  ARG A NH1   1 
ATOM   1615  N  NH2   . ARG A 1 215  ? -36.756 -46.295  37.451  1.00 3.08  ? 216  ARG A NH2   1 
ATOM   1616  N  N     . GLY A 1 216  ? -30.728 -42.738  38.105  1.00 2.00  ? 217  GLY A N     1 
ATOM   1617  C  CA    . GLY A 1 216  ? -29.394 -43.157  37.723  1.00 2.00  ? 217  GLY A CA    1 
ATOM   1618  C  C     . GLY A 1 216  ? -28.339 -42.102  37.993  1.00 2.00  ? 217  GLY A C     1 
ATOM   1619  O  O     . GLY A 1 216  ? -27.560 -41.746  37.131  1.00 2.00  ? 217  GLY A O     1 
ATOM   1620  N  N     . THR A 1 217  ? -28.314 -41.590  39.208  1.00 2.32  ? 218  THR A N     1 
ATOM   1621  C  CA    . THR A 1 217  ? -27.362 -40.543  39.553  1.00 2.14  ? 218  THR A CA    1 
ATOM   1622  C  C     . THR A 1 217  ? -26.009 -41.157  39.904  1.00 2.03  ? 218  THR A C     1 
ATOM   1623  O  O     . THR A 1 217  ? -25.868 -42.394  39.979  1.00 2.38  ? 218  THR A O     1 
ATOM   1624  C  CB    . THR A 1 217  ? -27.901 -39.710  40.730  1.00 2.41  ? 218  THR A CB    1 
ATOM   1625  O  OG1   . THR A 1 217  ? -27.793 -40.447  41.968  1.00 2.10  ? 218  THR A OG1   1 
ATOM   1626  C  CG2   . THR A 1 217  ? -29.381 -39.368  40.460  1.00 2.00  ? 218  THR A CG2   1 
ATOM   1627  N  N     . ALA A 1 218  ? -24.989 -40.331  40.018  1.00 2.00  ? 219  ALA A N     1 
ATOM   1628  C  CA    . ALA A 1 218  ? -23.686 -40.872  40.406  1.00 2.31  ? 219  ALA A CA    1 
ATOM   1629  C  C     . ALA A 1 218  ? -23.529 -40.478  41.878  1.00 2.30  ? 219  ALA A C     1 
ATOM   1630  O  O     . ALA A 1 218  ? -23.801 -39.326  42.260  1.00 2.64  ? 219  ALA A O     1 
ATOM   1631  C  CB    . ALA A 1 218  ? -22.552 -40.315  39.531  1.00 2.00  ? 219  ALA A CB    1 
ATOM   1632  N  N     . GLN A 1 219  ? -23.181 -41.438  42.722  1.00 2.00  ? 220  GLN A N     1 
ATOM   1633  C  CA    . GLN A 1 219  ? -23.034 -41.163  44.137  1.00 2.07  ? 220  GLN A CA    1 
ATOM   1634  C  C     . GLN A 1 219  ? -21.668 -41.420  44.764  1.00 2.20  ? 220  GLN A C     1 
ATOM   1635  O  O     . GLN A 1 219  ? -20.971 -42.379  44.423  1.00 2.22  ? 220  GLN A O     1 
ATOM   1636  C  CB    . GLN A 1 219  ? -24.144 -41.861  44.925  1.00 2.00  ? 220  GLN A CB    1 
ATOM   1637  C  CG    . GLN A 1 219  ? -25.451 -41.146  44.745  1.00 2.00  ? 220  GLN A CG    1 
ATOM   1638  C  CD    . GLN A 1 219  ? -26.686 -41.894  45.191  1.00 2.19  ? 220  GLN A CD    1 
ATOM   1639  O  OE1   . GLN A 1 219  ? -27.761 -41.638  44.667  1.00 2.75  ? 220  GLN A OE1   1 
ATOM   1640  N  NE2   . GLN A 1 219  ? -26.557 -42.796  46.166  1.00 2.00  ? 220  GLN A NE2   1 
ATOM   1641  N  N     . ASN A 1 220  ? -21.311 -40.542  45.699  1.00 2.26  ? 221  ASN A N     1 
ATOM   1642  C  CA    . ASN A 1 220  ? -20.054 -40.629  46.422  1.00 2.03  ? 221  ASN A CA    1 
ATOM   1643  C  C     . ASN A 1 220  ? -20.212 -41.477  47.685  1.00 2.00  ? 221  ASN A C     1 
ATOM   1644  O  O     . ASN A 1 220  ? -21.300 -41.916  48.000  1.00 2.40  ? 221  ASN A O     1 
ATOM   1645  C  CB    . ASN A 1 220  ? -19.634 -39.220  46.843  1.00 2.90  ? 221  ASN A CB    1 
ATOM   1646  C  CG    . ASN A 1 220  ? -19.359 -38.314  45.679  1.00 2.85  ? 221  ASN A CG    1 
ATOM   1647  O  OD1   . ASN A 1 220  ? -19.922 -37.223  45.603  1.00 4.11  ? 221  ASN A OD1   1 
ATOM   1648  N  ND2   . ASN A 1 220  ? -18.458 -38.729  44.789  1.00 3.08  ? 221  ASN A ND2   1 
ATOM   1649  N  N     . PRO A 1 221  ? -19.124 -41.671  48.451  1.00 2.00  ? 222  PRO A N     1 
ATOM   1650  C  CA    . PRO A 1 221  ? -19.103 -42.447  49.689  1.00 2.20  ? 222  PRO A CA    1 
ATOM   1651  C  C     . PRO A 1 221  ? -20.146 -41.981  50.714  1.00 2.60  ? 222  PRO A C     1 
ATOM   1652  O  O     . PRO A 1 221  ? -20.761 -42.811  51.410  1.00 2.68  ? 222  PRO A O     1 
ATOM   1653  C  CB    . PRO A 1 221  ? -17.695 -42.172  50.216  1.00 2.00  ? 222  PRO A CB    1 
ATOM   1654  C  CG    . PRO A 1 221  ? -16.929 -42.105  49.035  1.00 2.00  ? 222  PRO A CG    1 
ATOM   1655  C  CD    . PRO A 1 221  ? -17.761 -41.194  48.168  1.00 2.00  ? 222  PRO A CD    1 
ATOM   1656  N  N     . ASP A 1 222  ? -20.347 -40.659  50.788  1.00 2.40  ? 223  ASP A N     1 
ATOM   1657  C  CA    . ASP A 1 222  ? -21.287 -40.043  51.717  1.00 2.24  ? 223  ASP A CA    1 
ATOM   1658  C  C     . ASP A 1 222  ? -22.685 -40.624  51.724  1.00 2.00  ? 223  ASP A C     1 
ATOM   1659  O  O     . ASP A 1 222  ? -23.268 -40.814  52.787  1.00 2.00  ? 223  ASP A O     1 
ATOM   1660  C  CB    . ASP A 1 222  ? -21.355 -38.497  51.527  1.00 2.00  ? 223  ASP A CB    1 
ATOM   1661  C  CG    . ASP A 1 222  ? -21.659 -38.046  50.070  1.00 2.14  ? 223  ASP A CG    1 
ATOM   1662  O  OD1   . ASP A 1 222  ? -22.070 -38.855  49.189  1.00 2.00  ? 223  ASP A OD1   1 
ATOM   1663  O  OD2   . ASP A 1 222  ? -21.498 -36.816  49.799  1.00 3.01  ? 223  ASP A OD2   1 
ATOM   1664  N  N     . ILE A 1 223  ? -23.227 -40.896  50.547  1.00 2.00  ? 224  ILE A N     1 
ATOM   1665  C  CA    . ILE A 1 223  ? -24.586 -41.390  50.479  1.00 2.11  ? 224  ILE A CA    1 
ATOM   1666  C  C     . ILE A 1 223  ? -24.859 -42.688  49.723  1.00 2.41  ? 224  ILE A C     1 
ATOM   1667  O  O     . ILE A 1 223  ? -25.987 -43.152  49.739  1.00 2.00  ? 224  ILE A O     1 
ATOM   1668  C  CB    . ILE A 1 223  ? -25.544 -40.335  49.931  1.00 2.00  ? 224  ILE A CB    1 
ATOM   1669  C  CG1   . ILE A 1 223  ? -25.363 -40.156  48.440  1.00 2.00  ? 224  ILE A CG1   1 
ATOM   1670  C  CG2   . ILE A 1 223  ? -25.396 -39.033  50.690  1.00 2.00  ? 224  ILE A CG2   1 
ATOM   1671  C  CD1   . ILE A 1 223  ? -26.327 -39.098  47.833  1.00 2.14  ? 224  ILE A CD1   1 
ATOM   1672  N  N     . TYR A 1 224  ? -23.848 -43.307  49.114  1.00 2.21  ? 225  TYR A N     1 
ATOM   1673  C  CA    . TYR A 1 224  ? -24.133 -44.500  48.379  1.00 2.22  ? 225  TYR A CA    1 
ATOM   1674  C  C     . TYR A 1 224  ? -24.612 -45.663  49.223  1.00 2.91  ? 225  TYR A C     1 
ATOM   1675  O  O     . TYR A 1 224  ? -25.605 -46.330  48.850  1.00 3.31  ? 225  TYR A O     1 
ATOM   1676  C  CB    . TYR A 1 224  ? -22.957 -44.928  47.557  1.00 2.00  ? 225  TYR A CB    1 
ATOM   1677  C  CG    . TYR A 1 224  ? -23.206 -46.213  46.780  1.00 2.00  ? 225  TYR A CG    1 
ATOM   1678  C  CD1   . TYR A 1 224  ? -23.797 -46.183  45.546  1.00 2.00  ? 225  TYR A CD1   1 
ATOM   1679  C  CD2   . TYR A 1 224  ? -22.792 -47.456  47.280  1.00 2.00  ? 225  TYR A CD2   1 
ATOM   1680  C  CE1   . TYR A 1 224  ? -23.983 -47.347  44.803  1.00 2.09  ? 225  TYR A CE1   1 
ATOM   1681  C  CE2   . TYR A 1 224  ? -22.956 -48.613  46.567  1.00 2.00  ? 225  TYR A CE2   1 
ATOM   1682  C  CZ    . TYR A 1 224  ? -23.551 -48.559  45.320  1.00 2.27  ? 225  TYR A CZ    1 
ATOM   1683  O  OH    . TYR A 1 224  ? -23.708 -49.694  44.569  1.00 2.00  ? 225  TYR A OH    1 
ATOM   1684  N  N     . PHE A 1 225  ? -23.963 -45.894  50.368  1.00 2.90  ? 226  PHE A N     1 
ATOM   1685  C  CA    . PHE A 1 225  ? -24.302 -47.012  51.243  1.00 2.27  ? 226  PHE A CA    1 
ATOM   1686  C  C     . PHE A 1 225  ? -25.754 -46.896  51.774  1.00 2.46  ? 226  PHE A C     1 
ATOM   1687  O  O     . PHE A 1 225  ? -26.547 -47.833  51.721  1.00 2.90  ? 226  PHE A O     1 
ATOM   1688  C  CB    . PHE A 1 225  ? -23.225 -47.107  52.334  1.00 2.00  ? 226  PHE A CB    1 
ATOM   1689  C  CG    . PHE A 1 225  ? -23.212 -48.423  53.093  1.00 2.05  ? 226  PHE A CG    1 
ATOM   1690  C  CD1   . PHE A 1 225  ? -24.257 -49.330  53.000  1.00 2.00  ? 226  PHE A CD1   1 
ATOM   1691  C  CD2   . PHE A 1 225  ? -22.209 -48.690  53.987  1.00 2.00  ? 226  PHE A CD2   1 
ATOM   1692  C  CE1   . PHE A 1 225  ? -24.302 -50.456  53.791  1.00 2.00  ? 226  PHE A CE1   1 
ATOM   1693  C  CE2   . PHE A 1 225  ? -22.261 -49.841  54.788  1.00 2.36  ? 226  PHE A CE2   1 
ATOM   1694  C  CZ    . PHE A 1 225  ? -23.311 -50.714  54.689  1.00 2.00  ? 226  PHE A CZ    1 
ATOM   1695  N  N     . GLN A 1 226  ? -26.155 -45.705  52.160  1.00 2.56  ? 227  GLN A N     1 
ATOM   1696  C  CA    . GLN A 1 226  ? -27.515 -45.519  52.644  1.00 2.85  ? 227  GLN A CA    1 
ATOM   1697  C  C     . GLN A 1 226  ? -28.498 -45.747  51.515  1.00 3.02  ? 227  GLN A C     1 
ATOM   1698  O  O     . GLN A 1 226  ? -29.526 -46.379  51.724  1.00 3.51  ? 227  GLN A O     1 
ATOM   1699  C  CB    . GLN A 1 226  ? -27.745 -44.088  53.198  1.00 2.55  ? 227  GLN A CB    1 
ATOM   1700  C  CG    . GLN A 1 226  ? -26.883 -43.705  54.365  1.00 2.00  ? 227  GLN A CG    1 
ATOM   1701  C  CD    . GLN A 1 226  ? -25.666 -42.949  53.918  1.00 2.49  ? 227  GLN A CD    1 
ATOM   1702  O  OE1   . GLN A 1 226  ? -25.565 -41.698  54.075  1.00 2.00  ? 227  GLN A OE1   1 
ATOM   1703  N  NE2   . GLN A 1 226  ? -24.730 -43.678  53.321  1.00 2.00  ? 227  GLN A NE2   1 
ATOM   1704  N  N     . GLY A 1 227  ? -28.239 -45.154  50.347  1.00 2.53  ? 228  GLY A N     1 
ATOM   1705  C  CA    . GLY A 1 227  ? -29.145 -45.350  49.217  1.00 2.84  ? 228  GLY A CA    1 
ATOM   1706  C  C     . GLY A 1 227  ? -29.322 -46.812  48.767  1.00 3.37  ? 228  GLY A C     1 
ATOM   1707  O  O     . GLY A 1 227  ? -30.372 -47.167  48.232  1.00 3.44  ? 228  GLY A O     1 
ATOM   1708  N  N     . ARG A 1 228  ? -28.294 -47.653  48.966  1.00 3.34  ? 229  ARG A N     1 
ATOM   1709  C  CA    . ARG A 1 228  ? -28.309 -49.068  48.577  1.00 2.95  ? 229  ARG A CA    1 
ATOM   1710  C  C     . ARG A 1 228  ? -29.215 -49.831  49.524  1.00 2.61  ? 229  ARG A C     1 
ATOM   1711  O  O     . ARG A 1 228  ? -29.977 -50.668  49.124  1.00 2.48  ? 229  ARG A O     1 
ATOM   1712  C  CB    . ARG A 1 228  ? -26.873 -49.637  48.651  1.00 3.22  ? 229  ARG A CB    1 
ATOM   1713  C  CG    . ARG A 1 228  ? -26.649 -51.065  48.077  1.00 3.03  ? 229  ARG A CG    1 
ATOM   1714  C  CD    . ARG A 1 228  ? -26.380 -51.029  46.559  1.00 2.89  ? 229  ARG A CD    1 
ATOM   1715  N  NE    . ARG A 1 228  ? -26.130 -52.342  45.964  1.00 3.84  ? 229  ARG A NE    1 
ATOM   1716  C  CZ    . ARG A 1 228  ? -27.030 -53.088  45.319  1.00 4.13  ? 229  ARG A CZ    1 
ATOM   1717  N  NH1   . ARG A 1 228  ? -28.278 -52.698  45.150  1.00 4.10  ? 229  ARG A NH1   1 
ATOM   1718  N  NH2   . ARG A 1 228  ? -26.683 -54.264  44.832  1.00 5.50  ? 229  ARG A NH2   1 
ATOM   1719  N  N     . GLU A 1 229  ? -29.168 -49.445  50.785  1.00 3.37  ? 230  GLU A N     1 
ATOM   1720  C  CA    . GLU A 1 229  ? -29.943 -50.045  51.861  1.00 3.55  ? 230  GLU A CA    1 
ATOM   1721  C  C     . GLU A 1 229  ? -31.393 -49.558  51.982  1.00 3.56  ? 230  GLU A C     1 
ATOM   1722  O  O     . GLU A 1 229  ? -32.159 -50.131  52.767  1.00 4.14  ? 230  GLU A O     1 
ATOM   1723  C  CB    . GLU A 1 229  ? -29.270 -49.740  53.196  1.00 4.22  ? 230  GLU A CB    1 
ATOM   1724  C  CG    . GLU A 1 229  ? -27.943 -50.393  53.397  1.00 5.60  ? 230  GLU A CG    1 
ATOM   1725  C  CD    . GLU A 1 229  ? -28.044 -51.904  53.598  1.00 6.26  ? 230  GLU A CD    1 
ATOM   1726  O  OE1   . GLU A 1 229  ? -28.970 -52.387  54.283  1.00 6.73  ? 230  GLU A OE1   1 
ATOM   1727  O  OE2   . GLU A 1 229  ? -27.181 -52.620  53.059  1.00 7.02  ? 230  GLU A OE2   1 
ATOM   1728  N  N     . ALA A 1 230  ? -31.754 -48.504  51.252  1.00 2.79  ? 231  ALA A N     1 
ATOM   1729  C  CA    . ALA A 1 230  ? -33.088 -47.938  51.319  1.00 2.69  ? 231  ALA A CA    1 
ATOM   1730  C  C     . ALA A 1 230  ? -34.185 -48.818  50.726  1.00 3.05  ? 231  ALA A C     1 
ATOM   1731  O  O     . ALA A 1 230  ? -35.379 -48.647  51.049  1.00 3.50  ? 231  ALA A O     1 
ATOM   1732  C  CB    . ALA A 1 230  ? -33.113 -46.599  50.673  1.00 2.12  ? 231  ALA A CB    1 
ATOM   1733  N  N     . ALA A 1 231  ? -33.801 -49.799  49.918  1.00 2.70  ? 232  ALA A N     1 
ATOM   1734  C  CA    . ALA A 1 231  ? -34.794 -50.644  49.298  1.00 2.23  ? 232  ALA A CA    1 
ATOM   1735  C  C     . ALA A 1 231  ? -35.139 -51.845  50.141  1.00 2.26  ? 232  ALA A C     1 
ATOM   1736  O  O     . ALA A 1 231  ? -36.002 -52.613  49.745  1.00 2.55  ? 232  ALA A O     1 
ATOM   1737  C  CB    . ALA A 1 231  ? -34.304 -51.076  47.928  1.00 2.12  ? 232  ALA A CB    1 
ATOM   1738  N  N     . ASN A 1 232  ? -34.542 -51.975  51.329  1.00 2.74  ? 233  ASN A N     1 
ATOM   1739  C  CA    . ASN A 1 232  ? -34.781 -53.135  52.219  1.00 3.42  ? 233  ASN A CA    1 
ATOM   1740  C  C     . ASN A 1 232  ? -36.261 -53.492  52.482  1.00 3.74  ? 233  ASN A C     1 
ATOM   1741  O  O     . ASN A 1 232  ? -36.639 -54.674  52.491  1.00 3.76  ? 233  ASN A O     1 
ATOM   1742  C  CB    . ASN A 1 232  ? -34.059 -52.979  53.568  1.00 4.20  ? 233  ASN A CB    1 
ATOM   1743  C  CG    . ASN A 1 232  ? -32.535 -53.068  53.461  1.00 4.95  ? 233  ASN A CG    1 
ATOM   1744  O  OD1   . ASN A 1 232  ? -31.822 -52.774  54.423  1.00 4.98  ? 233  ASN A OD1   1 
ATOM   1745  N  ND2   . ASN A 1 232  ? -32.032 -53.481  52.304  1.00 5.98  ? 233  ASN A ND2   1 
ATOM   1746  N  N     . PRO A 1 233  ? -37.114 -52.481  52.719  1.00 3.87  ? 234  PRO A N     1 
ATOM   1747  C  CA    . PRO A 1 233  ? -38.521 -52.771  52.968  1.00 4.04  ? 234  PRO A CA    1 
ATOM   1748  C  C     . PRO A 1 233  ? -39.172 -53.717  51.953  1.00 3.90  ? 234  PRO A C     1 
ATOM   1749  O  O     . PRO A 1 233  ? -39.854 -54.661  52.332  1.00 4.41  ? 234  PRO A O     1 
ATOM   1750  C  CB    . PRO A 1 233  ? -39.150 -51.380  52.903  1.00 3.97  ? 234  PRO A CB    1 
ATOM   1751  C  CG    . PRO A 1 233  ? -38.082 -50.519  53.497  1.00 3.27  ? 234  PRO A CG    1 
ATOM   1752  C  CD    . PRO A 1 233  ? -36.864 -51.024  52.803  1.00 3.71  ? 234  PRO A CD    1 
ATOM   1753  N  N     . TYR A 1 234  ? -38.961 -53.415  50.674  1.00 3.68  ? 235  TYR A N     1 
ATOM   1754  C  CA    . TYR A 1 234  ? -39.495 -54.150  49.545  1.00 2.56  ? 235  TYR A CA    1 
ATOM   1755  C  C     . TYR A 1 234  ? -39.046 -55.588  49.530  1.00 2.55  ? 235  TYR A C     1 
ATOM   1756  O  O     . TYR A 1 234  ? -39.810 -56.485  49.138  1.00 3.23  ? 235  TYR A O     1 
ATOM   1757  C  CB    . TYR A 1 234  ? -39.016 -53.477  48.272  1.00 2.10  ? 235  TYR A CB    1 
ATOM   1758  C  CG    . TYR A 1 234  ? -39.475 -52.074  48.201  1.00 2.16  ? 235  TYR A CG    1 
ATOM   1759  C  CD1   . TYR A 1 234  ? -40.701 -51.777  47.654  1.00 2.00  ? 235  TYR A CD1   1 
ATOM   1760  C  CD2   . TYR A 1 234  ? -38.728 -51.042  48.759  1.00 2.73  ? 235  TYR A CD2   1 
ATOM   1761  C  CE1   . TYR A 1 234  ? -41.183 -50.479  47.656  1.00 2.49  ? 235  TYR A CE1   1 
ATOM   1762  C  CE2   . TYR A 1 234  ? -39.215 -49.728  48.781  1.00 2.32  ? 235  TYR A CE2   1 
ATOM   1763  C  CZ    . TYR A 1 234  ? -40.449 -49.469  48.221  1.00 2.43  ? 235  TYR A CZ    1 
ATOM   1764  O  OH    . TYR A 1 234  ? -40.991 -48.210  48.216  1.00 3.07  ? 235  TYR A OH    1 
ATOM   1765  N  N     . TYR A 1 235  ? -37.799 -55.820  49.907  1.00 2.08  ? 236  TYR A N     1 
ATOM   1766  C  CA    . TYR A 1 235  ? -37.296 -57.175  49.897  1.00 2.56  ? 236  TYR A CA    1 
ATOM   1767  C  C     . TYR A 1 235  ? -37.813 -57.945  51.095  1.00 2.96  ? 236  TYR A C     1 
ATOM   1768  O  O     . TYR A 1 235  ? -37.914 -59.215  51.060  1.00 2.69  ? 236  TYR A O     1 
ATOM   1769  C  CB    . TYR A 1 235  ? -35.777 -57.199  49.815  1.00 2.00  ? 236  TYR A CB    1 
ATOM   1770  C  CG    . TYR A 1 235  ? -35.258 -56.877  48.431  1.00 2.00  ? 236  TYR A CG    1 
ATOM   1771  C  CD1   . TYR A 1 235  ? -35.127 -57.869  47.479  1.00 2.00  ? 236  TYR A CD1   1 
ATOM   1772  C  CD2   . TYR A 1 235  ? -34.909 -55.586  48.066  1.00 2.25  ? 236  TYR A CD2   1 
ATOM   1773  C  CE1   . TYR A 1 235  ? -34.672 -57.593  46.205  1.00 2.14  ? 236  TYR A CE1   1 
ATOM   1774  C  CE2   . TYR A 1 235  ? -34.434 -55.290  46.768  1.00 2.05  ? 236  TYR A CE2   1 
ATOM   1775  C  CZ    . TYR A 1 235  ? -34.322 -56.308  45.860  1.00 2.00  ? 236  TYR A CZ    1 
ATOM   1776  O  OH    . TYR A 1 235  ? -33.827 -56.064  44.612  1.00 2.30  ? 236  TYR A OH    1 
ATOM   1777  N  N     . LEU A 1 236  ? -38.146 -57.193  52.155  1.00 2.61  ? 237  LEU A N     1 
ATOM   1778  C  CA    . LEU A 1 236  ? -38.687 -57.820  53.376  1.00 2.98  ? 237  LEU A CA    1 
ATOM   1779  C  C     . LEU A 1 236  ? -40.114 -58.303  53.118  1.00 2.98  ? 237  LEU A C     1 
ATOM   1780  O  O     . LEU A 1 236  ? -40.494 -59.378  53.550  1.00 3.10  ? 237  LEU A O     1 
ATOM   1781  C  CB    . LEU A 1 236  ? -38.704 -56.832  54.556  1.00 2.94  ? 237  LEU A CB    1 
ATOM   1782  C  CG    . LEU A 1 236  ? -37.343 -56.477  55.163  1.00 3.67  ? 237  LEU A CG    1 
ATOM   1783  C  CD1   . LEU A 1 236  ? -37.360 -55.167  55.912  1.00 2.35  ? 237  LEU A CD1   1 
ATOM   1784  C  CD2   . LEU A 1 236  ? -36.903 -57.595  56.046  1.00 3.36  ? 237  LEU A CD2   1 
ATOM   1785  N  N     . LYS A 1 237  ? -40.830 -57.533  52.299  1.00 3.19  ? 238  LYS A N     1 
ATOM   1786  C  CA    . LYS A 1 237  ? -42.232 -57.759  51.951  1.00 3.52  ? 238  LYS A CA    1 
ATOM   1787  C  C     . LYS A 1 237  ? -42.563 -58.687  50.796  1.00 3.51  ? 238  LYS A C     1 
ATOM   1788  O  O     . LYS A 1 237  ? -43.676 -59.220  50.733  1.00 3.78  ? 238  LYS A O     1 
ATOM   1789  C  CB    . LYS A 1 237  ? -42.888 -56.417  51.689  1.00 3.26  ? 238  LYS A CB    1 
ATOM   1790  C  CG    . LYS A 1 237  ? -43.045 -55.617  52.924  1.00 4.97  ? 238  LYS A CG    1 
ATOM   1791  C  CD    . LYS A 1 237  ? -43.095 -54.158  52.580  1.00 8.37  ? 238  LYS A CD    1 
ATOM   1792  C  CE    . LYS A 1 237  ? -43.183 -53.271  53.825  1.00 9.60  ? 238  LYS A CE    1 
ATOM   1793  N  NZ    . LYS A 1 237  ? -43.086 -51.802  53.468  1.00 12.13 ? 238  LYS A NZ    1 
ATOM   1794  N  N     . VAL A 1 238  ? -41.602 -58.876  49.892  1.00 3.74  ? 239  VAL A N     1 
ATOM   1795  C  CA    . VAL A 1 238  ? -41.779 -59.712  48.728  1.00 3.90  ? 239  VAL A CA    1 
ATOM   1796  C  C     . VAL A 1 238  ? -42.170 -61.196  48.940  1.00 4.17  ? 239  VAL A C     1 
ATOM   1797  O  O     . VAL A 1 238  ? -42.986 -61.716  48.171  1.00 4.35  ? 239  VAL A O     1 
ATOM   1798  C  CB    . VAL A 1 238  ? -40.579 -59.535  47.756  1.00 4.37  ? 239  VAL A CB    1 
ATOM   1799  C  CG1   . VAL A 1 238  ? -39.276 -60.014  48.394  1.00 4.68  ? 239  VAL A CG1   1 
ATOM   1800  C  CG2   . VAL A 1 238  ? -40.846 -60.237  46.447  1.00 4.21  ? 239  VAL A CG2   1 
ATOM   1801  N  N     . PRO A 1 239  ? -41.650 -61.881  49.994  1.00 3.60  ? 240  PRO A N     1 
ATOM   1802  C  CA    . PRO A 1 239  ? -42.012 -63.289  50.216  1.00 3.97  ? 240  PRO A CA    1 
ATOM   1803  C  C     . PRO A 1 239  ? -43.502 -63.438  50.628  1.00 4.26  ? 240  PRO A C     1 
ATOM   1804  O  O     . PRO A 1 239  ? -44.180 -64.407  50.236  1.00 4.10  ? 240  PRO A O     1 
ATOM   1805  C  CB    . PRO A 1 239  ? -41.079 -63.716  51.360  1.00 3.12  ? 240  PRO A CB    1 
ATOM   1806  C  CG    . PRO A 1 239  ? -39.915 -62.888  51.197  1.00 3.14  ? 240  PRO A CG    1 
ATOM   1807  C  CD    . PRO A 1 239  ? -40.547 -61.511  50.896  1.00 3.76  ? 240  PRO A CD    1 
ATOM   1808  N  N     . GLY A 1 240  ? -43.985 -62.480  51.431  1.00 4.05  ? 241  GLY A N     1 
ATOM   1809  C  CA    . GLY A 1 240  ? -45.369 -62.471  51.882  1.00 3.05  ? 241  GLY A CA    1 
ATOM   1810  C  C     . GLY A 1 240  ? -46.262 -62.229  50.688  1.00 2.83  ? 241  GLY A C     1 
ATOM   1811  O  O     . GLY A 1 240  ? -47.320 -62.850  50.588  1.00 3.07  ? 241  GLY A O     1 
ATOM   1812  N  N     . ILE A 1 241  ? -45.828 -61.361  49.776  1.00 2.49  ? 242  ILE A N     1 
ATOM   1813  C  CA    . ILE A 1 241  ? -46.586 -61.068  48.559  1.00 2.59  ? 242  ILE A CA    1 
ATOM   1814  C  C     . ILE A 1 241  ? -46.596 -62.264  47.610  1.00 2.67  ? 242  ILE A C     1 
ATOM   1815  O  O     . ILE A 1 241  ? -47.560 -62.454  46.897  1.00 2.72  ? 242  ILE A O     1 
ATOM   1816  C  CB    . ILE A 1 241  ? -46.003 -59.858  47.815  1.00 2.59  ? 242  ILE A CB    1 
ATOM   1817  C  CG1   . ILE A 1 241  ? -46.388 -58.586  48.564  1.00 2.83  ? 242  ILE A CG1   1 
ATOM   1818  C  CG2   . ILE A 1 241  ? -46.485 -59.788  46.381  1.00 2.31  ? 242  ILE A CG2   1 
ATOM   1819  C  CD1   . ILE A 1 241  ? -45.769 -57.342  48.028  1.00 2.00  ? 242  ILE A CD1   1 
ATOM   1820  N  N     . VAL A 1 242  ? -45.512 -63.042  47.591  1.00 2.62  ? 243  VAL A N     1 
ATOM   1821  C  CA    . VAL A 1 242  ? -45.391 -64.210  46.728  1.00 2.58  ? 243  VAL A CA    1 
ATOM   1822  C  C     . VAL A 1 242  ? -46.388 -65.179  47.289  1.00 2.81  ? 243  VAL A C     1 
ATOM   1823  O  O     . VAL A 1 242  ? -47.303 -65.614  46.607  1.00 2.88  ? 243  VAL A O     1 
ATOM   1824  C  CB    . VAL A 1 242  ? -43.959 -64.864  46.810  1.00 2.57  ? 243  VAL A CB    1 
ATOM   1825  C  CG1   . VAL A 1 242  ? -43.962 -66.283  46.228  1.00 2.00  ? 243  VAL A CG1   1 
ATOM   1826  C  CG2   . VAL A 1 242  ? -42.916 -64.004  46.091  1.00 2.63  ? 243  VAL A CG2   1 
ATOM   1827  N  N     . ALA A 1 243  ? -46.230 -65.482  48.566  1.00 3.20  ? 244  ALA A N     1 
ATOM   1828  C  CA    . ALA A 1 243  ? -47.134 -66.392  49.253  1.00 3.07  ? 244  ALA A CA    1 
ATOM   1829  C  C     . ALA A 1 243  ? -48.564 -65.977  49.007  1.00 3.48  ? 244  ALA A C     1 
ATOM   1830  O  O     . ALA A 1 243  ? -49.407 -66.824  48.821  1.00 4.73  ? 244  ALA A O     1 
ATOM   1831  C  CB    . ALA A 1 243  ? -46.868 -66.360  50.720  1.00 2.74  ? 244  ALA A CB    1 
ATOM   1832  N  N     . GLU A 1 244  ? -48.837 -64.674  49.003  1.00 3.76  ? 245  GLU A N     1 
ATOM   1833  C  CA    . GLU A 1 244  ? -50.180 -64.167  48.782  1.00 3.86  ? 245  GLU A CA    1 
ATOM   1834  C  C     . GLU A 1 244  ? -50.752 -64.574  47.416  1.00 3.15  ? 245  GLU A C     1 
ATOM   1835  O  O     . GLU A 1 244  ? -51.929 -64.976  47.299  1.00 2.18  ? 245  GLU A O     1 
ATOM   1836  C  CB    . GLU A 1 244  ? -50.170 -62.631  48.940  1.00 6.54  ? 245  GLU A CB    1 
ATOM   1837  C  CG    . GLU A 1 244  ? -51.327 -61.910  48.231  1.00 9.50  ? 245  GLU A CG    1 
ATOM   1838  C  CD    . GLU A 1 244  ? -51.035 -60.444  47.893  1.00 11.84 ? 245  GLU A CD    1 
ATOM   1839  O  OE1   . GLU A 1 244  ? -49.834 -59.988  47.916  1.00 12.27 ? 245  GLU A OE1   1 
ATOM   1840  O  OE2   . GLU A 1 244  ? -52.043 -59.745  47.585  1.00 12.74 ? 245  GLU A OE2   1 
ATOM   1841  N  N     . TYR A 1 245  ? -49.936 -64.437  46.373  1.00 2.69  ? 246  TYR A N     1 
ATOM   1842  C  CA    . TYR A 1 245  ? -50.379 -64.800  45.043  1.00 2.37  ? 246  TYR A CA    1 
ATOM   1843  C  C     . TYR A 1 245  ? -50.376 -66.318  44.851  1.00 3.10  ? 246  TYR A C     1 
ATOM   1844  O  O     . TYR A 1 245  ? -51.108 -66.849  44.006  1.00 3.24  ? 246  TYR A O     1 
ATOM   1845  C  CB    . TYR A 1 245  ? -49.539 -64.079  44.001  1.00 2.22  ? 246  TYR A CB    1 
ATOM   1846  C  CG    . TYR A 1 245  ? -49.888 -62.632  43.944  1.00 2.40  ? 246  TYR A CG    1 
ATOM   1847  C  CD1   . TYR A 1 245  ? -51.146 -62.245  43.489  1.00 2.14  ? 246  TYR A CD1   1 
ATOM   1848  C  CD2   . TYR A 1 245  ? -49.037 -61.657  44.440  1.00 2.02  ? 246  TYR A CD2   1 
ATOM   1849  C  CE1   . TYR A 1 245  ? -51.554 -60.955  43.532  1.00 2.00  ? 246  TYR A CE1   1 
ATOM   1850  C  CE2   . TYR A 1 245  ? -49.445 -60.325  44.499  1.00 2.24  ? 246  TYR A CE2   1 
ATOM   1851  C  CZ    . TYR A 1 245  ? -50.713 -59.987  44.032  1.00 2.52  ? 246  TYR A CZ    1 
ATOM   1852  O  OH    . TYR A 1 245  ? -51.161 -58.677  43.990  1.00 2.35  ? 246  TYR A OH    1 
ATOM   1853  N  N     . MET A 1 246  ? -49.605 -67.035  45.669  1.00 2.90  ? 247  MET A N     1 
ATOM   1854  C  CA    . MET A 1 246  ? -49.574 -68.471  45.538  1.00 4.02  ? 247  MET A CA    1 
ATOM   1855  C  C     . MET A 1 246  ? -50.943 -68.990  45.989  1.00 5.05  ? 247  MET A C     1 
ATOM   1856  O  O     . MET A 1 246  ? -51.411 -70.038  45.530  1.00 5.47  ? 247  MET A O     1 
ATOM   1857  C  CB    . MET A 1 246  ? -48.429 -69.105  46.364  1.00 2.63  ? 247  MET A CB    1 
ATOM   1858  C  CG    . MET A 1 246  ? -47.101 -69.101  45.669  1.00 2.00  ? 247  MET A CG    1 
ATOM   1859  S  SD    . MET A 1 246  ? -45.824 -69.859  46.644  1.00 2.00  ? 247  MET A SD    1 
ATOM   1860  C  CE    . MET A 1 246  ? -44.591 -70.050  45.561  1.00 2.00  ? 247  MET A CE    1 
ATOM   1861  N  N     . GLN A 1 247  ? -51.570 -68.241  46.896  1.00 5.93  ? 248  GLN A N     1 
ATOM   1862  C  CA    . GLN A 1 247  ? -52.877 -68.595  47.433  1.00 6.70  ? 248  GLN A CA    1 
ATOM   1863  C  C     . GLN A 1 247  ? -53.996 -68.136  46.516  1.00 6.09  ? 248  GLN A C     1 
ATOM   1864  O  O     . GLN A 1 247  ? -54.916 -68.881  46.263  1.00 6.27  ? 248  GLN A O     1 
ATOM   1865  C  CB    . GLN A 1 247  ? -53.037 -67.949  48.795  1.00 8.75  ? 248  GLN A CB    1 
ATOM   1866  C  CG    . GLN A 1 247  ? -52.200 -68.604  49.864  1.00 13.43 ? 248  GLN A CG    1 
ATOM   1867  C  CD    . GLN A 1 247  ? -51.849 -67.669  51.021  1.00 16.69 ? 248  GLN A CD    1 
ATOM   1868  O  OE1   . GLN A 1 247  ? -52.586 -66.704  51.334  1.00 19.49 ? 248  GLN A OE1   1 
ATOM   1869  N  NE2   . GLN A 1 247  ? -50.691 -67.919  51.643  1.00 18.24 ? 248  GLN A NE2   1 
ATOM   1870  N  N     . LYS A 1 248  ? -53.893 -66.905  46.017  1.00 5.20  ? 249  LYS A N     1 
ATOM   1871  C  CA    . LYS A 1 248  ? -54.889 -66.349  45.117  1.00 4.49  ? 249  LYS A CA    1 
ATOM   1872  C  C     . LYS A 1 248  ? -55.039 -67.160  43.857  1.00 4.48  ? 249  LYS A C     1 
ATOM   1873  O  O     . LYS A 1 248  ? -56.131 -67.452  43.421  1.00 4.19  ? 249  LYS A O     1 
ATOM   1874  C  CB    . LYS A 1 248  ? -54.520 -64.933  44.769  1.00 3.95  ? 249  LYS A CB    1 
ATOM   1875  C  CG    . LYS A 1 248  ? -54.981 -64.003  45.834  1.00 3.95  ? 249  LYS A CG    1 
ATOM   1876  C  CD    . LYS A 1 248  ? -54.607 -62.604  45.525  1.00 4.74  ? 249  LYS A CD    1 
ATOM   1877  C  CE    . LYS A 1 248  ? -55.122 -61.681  46.603  1.00 4.78  ? 249  LYS A CE    1 
ATOM   1878  N  NZ    . LYS A 1 248  ? -54.673 -60.347  46.257  1.00 5.83  ? 249  LYS A NZ    1 
ATOM   1879  N  N     . VAL A 1 249  ? -53.922 -67.540  43.270  1.00 4.77  ? 250  VAL A N     1 
ATOM   1880  C  CA    . VAL A 1 249  ? -53.964 -68.373  42.077  1.00 4.77  ? 250  VAL A CA    1 
ATOM   1881  C  C     . VAL A 1 249  ? -54.499 -69.754  42.470  1.00 5.27  ? 250  VAL A C     1 
ATOM   1882  O  O     . VAL A 1 249  ? -55.253 -70.362  41.718  1.00 6.19  ? 250  VAL A O     1 
ATOM   1883  C  CB    . VAL A 1 249  ? -52.545 -68.528  41.428  1.00 4.00  ? 250  VAL A CB    1 
ATOM   1884  C  CG1   . VAL A 1 249  ? -52.593 -69.499  40.242  1.00 2.81  ? 250  VAL A CG1   1 
ATOM   1885  C  CG2   . VAL A 1 249  ? -52.014 -67.134  40.995  1.00 2.78  ? 250  VAL A CG2   1 
ATOM   1886  N  N     . ALA A 1 250  ? -54.183 -70.209  43.675  1.00 5.50  ? 251  ALA A N     1 
ATOM   1887  C  CA    . ALA A 1 250  ? -54.631 -71.527  44.101  1.00 6.24  ? 251  ALA A CA    1 
ATOM   1888  C  C     . ALA A 1 250  ? -56.141 -71.583  44.317  1.00 7.31  ? 251  ALA A C     1 
ATOM   1889  O  O     . ALA A 1 250  ? -56.739 -72.665  44.289  1.00 8.11  ? 251  ALA A O     1 
ATOM   1890  C  CB    . ALA A 1 250  ? -53.913 -71.943  45.348  1.00 4.87  ? 251  ALA A CB    1 
ATOM   1891  N  N     . SER A 1 251  ? -56.774 -70.434  44.528  1.00 7.84  ? 252  SER A N     1 
ATOM   1892  C  CA    . SER A 1 251  ? -58.212 -70.436  44.741  1.00 8.69  ? 252  SER A CA    1 
ATOM   1893  C  C     . SER A 1 251  ? -58.965 -70.457  43.416  1.00 8.64  ? 252  SER A C     1 
ATOM   1894  O  O     . SER A 1 251  ? -60.191 -70.656  43.383  1.00 9.22  ? 252  SER A O     1 
ATOM   1895  C  CB    . SER A 1 251  ? -58.639 -69.259  45.616  1.00 9.06  ? 252  SER A CB    1 
ATOM   1896  O  OG    . SER A 1 251  ? -58.022 -68.073  45.175  1.00 11.55 ? 252  SER A OG    1 
ATOM   1897  N  N     . LEU A 1 252  ? -58.211 -70.265  42.333  1.00 8.34  ? 253  LEU A N     1 
ATOM   1898  C  CA    . LEU A 1 252  ? -58.744 -70.313  40.978  1.00 7.74  ? 253  LEU A CA    1 
ATOM   1899  C  C     . LEU A 1 252  ? -58.387 -71.626  40.303  1.00 7.16  ? 253  LEU A C     1 
ATOM   1900  O  O     . LEU A 1 252  ? -59.159 -72.139  39.508  1.00 7.44  ? 253  LEU A O     1 
ATOM   1901  C  CB    . LEU A 1 252  ? -58.158 -69.206  40.128  1.00 7.63  ? 253  LEU A CB    1 
ATOM   1902  C  CG    . LEU A 1 252  ? -58.582 -67.783  40.445  1.00 8.03  ? 253  LEU A CG    1 
ATOM   1903  C  CD1   . LEU A 1 252  ? -57.817 -66.784  39.532  1.00 7.18  ? 253  LEU A CD1   1 
ATOM   1904  C  CD2   . LEU A 1 252  ? -60.065 -67.703  40.220  1.00 8.06  ? 253  LEU A CD2   1 
ATOM   1905  N  N     . THR A 1 253  ? -57.222 -72.160  40.639  1.00 6.46  ? 254  THR A N     1 
ATOM   1906  C  CA    . THR A 1 253  ? -56.714 -73.377  40.012  1.00 5.80  ? 254  THR A CA    1 
ATOM   1907  C  C     . THR A 1 253  ? -56.865 -74.619  40.877  1.00 5.20  ? 254  THR A C     1 
ATOM   1908  O  O     . THR A 1 253  ? -57.068 -75.723  40.387  1.00 4.93  ? 254  THR A O     1 
ATOM   1909  C  CB    . THR A 1 253  ? -55.213 -73.205  39.691  1.00 5.79  ? 254  THR A CB    1 
ATOM   1910  O  OG1   . THR A 1 253  ? -54.505 -72.853  40.889  1.00 5.94  ? 254  THR A OG1   1 
ATOM   1911  C  CG2   . THR A 1 253  ? -55.023 -72.087  38.699  1.00 6.68  ? 254  THR A CG2   1 
ATOM   1912  N  N     . GLY A 1 254  ? -56.695 -74.435  42.174  1.00 4.86  ? 255  GLY A N     1 
ATOM   1913  C  CA    . GLY A 1 254  ? -56.775 -75.564  43.069  1.00 4.41  ? 255  GLY A CA    1 
ATOM   1914  C  C     . GLY A 1 254  ? -55.405 -76.181  43.304  1.00 4.15  ? 255  GLY A C     1 
ATOM   1915  O  O     . GLY A 1 254  ? -55.294 -77.249  43.897  1.00 4.78  ? 255  GLY A O     1 
ATOM   1916  N  N     . ARG A 1 255  ? -54.366 -75.560  42.766  1.00 4.32  ? 256  ARG A N     1 
ATOM   1917  C  CA    . ARG A 1 255  ? -52.998 -76.040  42.947  1.00 3.99  ? 256  ARG A CA    1 
ATOM   1918  C  C     . ARG A 1 255  ? -52.296 -75.035  43.837  1.00 4.66  ? 256  ARG A C     1 
ATOM   1919  O  O     . ARG A 1 255  ? -52.070 -73.874  43.466  1.00 4.31  ? 256  ARG A O     1 
ATOM   1920  C  CB    . ARG A 1 255  ? -52.285 -76.154  41.608  1.00 3.99  ? 256  ARG A CB    1 
ATOM   1921  C  CG    . ARG A 1 255  ? -52.978 -77.098  40.629  1.00 3.48  ? 256  ARG A CG    1 
ATOM   1922  C  CD    . ARG A 1 255  ? -52.256 -77.250  39.280  1.00 2.93  ? 256  ARG A CD    1 
ATOM   1923  N  NE    . ARG A 1 255  ? -52.282 -76.042  38.467  1.00 2.52  ? 256  ARG A NE    1 
ATOM   1924  C  CZ    . ARG A 1 255  ? -53.358 -75.559  37.839  1.00 2.64  ? 256  ARG A CZ    1 
ATOM   1925  N  NH1   . ARG A 1 255  ? -54.521 -76.179  37.919  1.00 2.42  ? 256  ARG A NH1   1 
ATOM   1926  N  NH2   . ARG A 1 255  ? -53.267 -74.441  37.114  1.00 2.08  ? 256  ARG A NH2   1 
ATOM   1927  N  N     . SER A 1 256  ? -52.049 -75.485  45.058  1.00 5.31  ? 257  SER A N     1 
ATOM   1928  C  CA    . SER A 1 256  ? -51.400 -74.696  46.089  1.00 6.01  ? 257  SER A CA    1 
ATOM   1929  C  C     . SER A 1 256  ? -49.899 -74.921  46.117  1.00 5.57  ? 257  SER A C     1 
ATOM   1930  O  O     . SER A 1 256  ? -49.424 -76.028  45.866  1.00 5.68  ? 257  SER A O     1 
ATOM   1931  C  CB    . SER A 1 256  ? -51.970 -75.030  47.478  1.00 6.68  ? 257  SER A CB    1 
ATOM   1932  O  OG    . SER A 1 256  ? -53.314 -74.575  47.625  1.00 9.30  ? 257  SER A OG    1 
ATOM   1933  N  N     . TYR A 1 257  ? -49.185 -73.863  46.483  1.00 4.70  ? 258  TYR A N     1 
ATOM   1934  C  CA    . TYR A 1 257  ? -47.750 -73.875  46.587  1.00 4.25  ? 258  TYR A CA    1 
ATOM   1935  C  C     . TYR A 1 257  ? -47.319 -73.062  47.814  1.00 4.37  ? 258  TYR A C     1 
ATOM   1936  O  O     . TYR A 1 257  ? -48.059 -72.209  48.312  1.00 4.68  ? 258  TYR A O     1 
ATOM   1937  C  CB    . TYR A 1 257  ? -47.122 -73.174  45.379  1.00 3.54  ? 258  TYR A CB    1 
ATOM   1938  C  CG    . TYR A 1 257  ? -47.420 -73.775  44.059  1.00 2.94  ? 258  TYR A CG    1 
ATOM   1939  C  CD1   . TYR A 1 257  ? -46.807 -74.955  43.662  1.00 3.00  ? 258  TYR A CD1   1 
ATOM   1940  C  CD2   . TYR A 1 257  ? -48.342 -73.183  43.209  1.00 2.98  ? 258  TYR A CD2   1 
ATOM   1941  C  CE1   . TYR A 1 257  ? -47.108 -75.541  42.464  1.00 2.48  ? 258  TYR A CE1   1 
ATOM   1942  C  CE2   . TYR A 1 257  ? -48.650 -73.761  41.991  1.00 2.35  ? 258  TYR A CE2   1 
ATOM   1943  C  CZ    . TYR A 1 257  ? -48.025 -74.943  41.630  1.00 2.48  ? 258  TYR A CZ    1 
ATOM   1944  O  OH    . TYR A 1 257  ? -48.283 -75.516  40.408  1.00 2.34  ? 258  TYR A OH    1 
ATOM   1945  N  N     . LYS A 1 258  ? -46.118 -73.322  48.309  1.00 3.88  ? 259  LYS A N     1 
ATOM   1946  C  CA    . LYS A 1 258  ? -45.597 -72.522  49.381  1.00 3.26  ? 259  LYS A CA    1 
ATOM   1947  C  C     . LYS A 1 258  ? -44.207 -72.120  48.900  1.00 2.82  ? 259  LYS A C     1 
ATOM   1948  O  O     . LYS A 1 258  ? -43.740 -72.614  47.876  1.00 2.09  ? 259  LYS A O     1 
ATOM   1949  C  CB    . LYS A 1 258  ? -45.466 -73.347  50.617  1.00 4.09  ? 259  LYS A CB    1 
ATOM   1950  C  CG    . LYS A 1 258  ? -46.715 -73.730  51.274  1.00 4.45  ? 259  LYS A CG    1 
ATOM   1951  C  CD    . LYS A 1 258  ? -46.250 -74.434  52.528  1.00 7.59  ? 259  LYS A CD    1 
ATOM   1952  C  CE    . LYS A 1 258  ? -47.297 -74.478  53.610  1.00 9.28  ? 259  LYS A CE    1 
ATOM   1953  N  NZ    . LYS A 1 258  ? -48.431 -75.280  53.100  1.00 11.04 ? 259  LYS A NZ    1 
ATOM   1954  N  N     . LEU A 1 259  ? -43.562 -71.198  49.608  1.00 2.22  ? 260  LEU A N     1 
ATOM   1955  C  CA    . LEU A 1 259  ? -42.206 -70.776  49.284  1.00 2.00  ? 260  LEU A CA    1 
ATOM   1956  C  C     . LEU A 1 259  ? -41.317 -72.058  49.256  1.00 2.19  ? 260  LEU A C     1 
ATOM   1957  O  O     . LEU A 1 259  ? -40.579 -72.301  48.311  1.00 2.00  ? 260  LEU A O     1 
ATOM   1958  C  CB    . LEU A 1 259  ? -41.763 -69.774  50.341  1.00 2.00  ? 260  LEU A CB    1 
ATOM   1959  C  CG    . LEU A 1 259  ? -41.990 -68.285  50.068  1.00 2.23  ? 260  LEU A CG    1 
ATOM   1960  C  CD1   . LEU A 1 259  ? -43.285 -67.926  49.384  1.00 2.00  ? 260  LEU A CD1   1 
ATOM   1961  C  CD2   . LEU A 1 259  ? -41.901 -67.578  51.351  1.00 2.41  ? 260  LEU A CD2   1 
ATOM   1962  N  N     . PHE A 1 260  ? -41.450 -72.900  50.271  1.00 2.63  ? 261  PHE A N     1 
ATOM   1963  C  CA    . PHE A 1 260  ? -40.760 -74.204  50.343  1.00 3.23  ? 261  PHE A CA    1 
ATOM   1964  C  C     . PHE A 1 260  ? -41.858 -75.250  50.689  1.00 3.55  ? 261  PHE A C     1 
ATOM   1965  O  O     . PHE A 1 260  ? -42.712 -74.998  51.550  1.00 3.23  ? 261  PHE A O     1 
ATOM   1966  C  CB    . PHE A 1 260  ? -39.654 -74.231  51.419  1.00 2.89  ? 261  PHE A CB    1 
ATOM   1967  C  CG    . PHE A 1 260  ? -38.521 -73.247  51.175  1.00 2.38  ? 261  PHE A CG    1 
ATOM   1968  C  CD1   . PHE A 1 260  ? -38.608 -71.935  51.636  1.00 2.00  ? 261  PHE A CD1   1 
ATOM   1969  C  CD2   . PHE A 1 260  ? -37.346 -73.653  50.540  1.00 2.00  ? 261  PHE A CD2   1 
ATOM   1970  C  CE1   . PHE A 1 260  ? -37.563 -71.055  51.481  1.00 2.00  ? 261  PHE A CE1   1 
ATOM   1971  C  CE2   . PHE A 1 260  ? -36.277 -72.764  50.374  1.00 2.01  ? 261  PHE A CE2   1 
ATOM   1972  C  CZ    . PHE A 1 260  ? -36.390 -71.460  50.848  1.00 2.00  ? 261  PHE A CZ    1 
ATOM   1973  N  N     . ASP A 1 261  ? -41.830 -76.398  50.001  1.00 4.25  ? 262  ASP A N     1 
ATOM   1974  C  CA    . ASP A 1 261  ? -42.797 -77.477  50.182  1.00 4.67  ? 262  ASP A CA    1 
ATOM   1975  C  C     . ASP A 1 261  ? -42.239 -78.845  50.544  1.00 4.21  ? 262  ASP A C     1 
ATOM   1976  O  O     . ASP A 1 261  ? -41.362 -79.386  49.869  1.00 4.64  ? 262  ASP A O     1 
ATOM   1977  C  CB    . ASP A 1 261  ? -43.658 -77.633  48.926  1.00 6.47  ? 262  ASP A CB    1 
ATOM   1978  C  CG    . ASP A 1 261  ? -44.851 -76.693  48.914  1.00 8.65  ? 262  ASP A CG    1 
ATOM   1979  O  OD1   . ASP A 1 261  ? -45.712 -76.820  49.811  1.00 10.01 ? 262  ASP A OD1   1 
ATOM   1980  O  OD2   . ASP A 1 261  ? -44.925 -75.805  48.031  1.00 10.41 ? 262  ASP A OD2   1 
ATOM   1981  N  N     . TYR A 1 262  ? -42.783 -79.437  51.590  1.00 3.15  ? 263  TYR A N     1 
ATOM   1982  C  CA    . TYR A 1 262  ? -42.349 -80.747  51.947  1.00 3.16  ? 263  TYR A CA    1 
ATOM   1983  C  C     . TYR A 1 262  ? -43.263 -81.797  51.343  1.00 3.44  ? 263  TYR A C     1 
ATOM   1984  O  O     . TYR A 1 262  ? -44.467 -81.600  51.292  1.00 3.41  ? 263  TYR A O     1 
ATOM   1985  C  CB    . TYR A 1 262  ? -42.316 -80.931  53.450  1.00 3.06  ? 263  TYR A CB    1 
ATOM   1986  C  CG    . TYR A 1 262  ? -41.752 -82.275  53.847  1.00 2.25  ? 263  TYR A CG    1 
ATOM   1987  C  CD1   . TYR A 1 262  ? -40.395 -82.517  53.776  1.00 2.00  ? 263  TYR A CD1   1 
ATOM   1988  C  CD2   . TYR A 1 262  ? -42.589 -83.325  54.198  1.00 2.08  ? 263  TYR A CD2   1 
ATOM   1989  C  CE1   . TYR A 1 262  ? -39.878 -83.780  54.039  1.00 2.25  ? 263  TYR A CE1   1 
ATOM   1990  C  CE2   . TYR A 1 262  ? -42.090 -84.573  54.456  1.00 2.10  ? 263  TYR A CE2   1 
ATOM   1991  C  CZ    . TYR A 1 262  ? -40.725 -84.803  54.370  1.00 2.19  ? 263  TYR A CZ    1 
ATOM   1992  O  OH    . TYR A 1 262  ? -40.217 -86.075  54.584  1.00 2.05  ? 263  TYR A OH    1 
ATOM   1993  N  N     . VAL A 1 263  ? -42.691 -82.961  51.009  1.00 3.60  ? 264  VAL A N     1 
ATOM   1994  C  CA    . VAL A 1 263  ? -43.422 -84.079  50.406  1.00 3.24  ? 264  VAL A CA    1 
ATOM   1995  C  C     . VAL A 1 263  ? -42.768 -85.366  50.916  1.00 3.67  ? 264  VAL A C     1 
ATOM   1996  O  O     . VAL A 1 263  ? -41.559 -85.452  51.030  1.00 3.67  ? 264  VAL A O     1 
ATOM   1997  C  CB    . VAL A 1 263  ? -43.339 -83.941  48.851  1.00 3.95  ? 264  VAL A CB    1 
ATOM   1998  C  CG1   . VAL A 1 263  ? -42.572 -85.058  48.211  1.00 3.91  ? 264  VAL A CG1   1 
ATOM   1999  C  CG2   . VAL A 1 263  ? -44.691 -83.689  48.241  1.00 2.80  ? 264  VAL A CG2   1 
ATOM   2000  N  N     . GLY A 1 264  ? -43.564 -86.381  51.222  1.00 4.45  ? 265  GLY A N     1 
ATOM   2001  C  CA    . GLY A 1 264  ? -42.998 -87.623  51.722  1.00 4.35  ? 265  GLY A CA    1 
ATOM   2002  C  C     . GLY A 1 264  ? -43.280 -87.873  53.198  1.00 4.77  ? 265  GLY A C     1 
ATOM   2003  O  O     . GLY A 1 264  ? -44.109 -87.225  53.811  1.00 4.47  ? 265  GLY A O     1 
ATOM   2004  N  N     . ALA A 1 265  ? -42.560 -88.815  53.782  1.00 5.80  ? 266  ALA A N     1 
ATOM   2005  C  CA    . ALA A 1 265  ? -42.789 -89.184  55.167  1.00 6.36  ? 266  ALA A CA    1 
ATOM   2006  C  C     . ALA A 1 265  ? -42.760 -88.031  56.149  1.00 6.93  ? 266  ALA A C     1 
ATOM   2007  O  O     . ALA A 1 265  ? -41.853 -87.219  56.122  1.00 7.38  ? 266  ALA A O     1 
ATOM   2008  C  CB    . ALA A 1 265  ? -41.818 -90.255  55.555  1.00 6.11  ? 266  ALA A CB    1 
ATOM   2009  N  N     . PRO A 1 266  ? -43.762 -87.959  57.048  1.00 7.76  ? 267  PRO A N     1 
ATOM   2010  C  CA    . PRO A 1 266  ? -43.867 -86.899  58.061  1.00 7.91  ? 267  PRO A CA    1 
ATOM   2011  C  C     . PRO A 1 266  ? -42.758 -87.029  59.085  1.00 8.20  ? 267  PRO A C     1 
ATOM   2012  O  O     . PRO A 1 266  ? -42.355 -86.057  59.707  1.00 8.78  ? 267  PRO A O     1 
ATOM   2013  C  CB    . PRO A 1 266  ? -45.210 -87.189  58.725  1.00 7.35  ? 267  PRO A CB    1 
ATOM   2014  C  CG    . PRO A 1 266  ? -45.926 -88.024  57.729  1.00 7.47  ? 267  PRO A CG    1 
ATOM   2015  C  CD    . PRO A 1 266  ? -44.885 -88.902  57.175  1.00 6.97  ? 267  PRO A CD    1 
ATOM   2016  N  N     . ASP A 1 267  ? -42.307 -88.249  59.296  1.00 8.71  ? 268  ASP A N     1 
ATOM   2017  C  CA    . ASP A 1 267  ? -41.242 -88.499  60.251  1.00 9.39  ? 268  ASP A CA    1 
ATOM   2018  C  C     . ASP A 1 267  ? -40.016 -88.953  59.506  1.00 9.26  ? 268  ASP A C     1 
ATOM   2019  O  O     . ASP A 1 267  ? -39.313 -89.873  59.945  1.00 9.72  ? 268  ASP A O     1 
ATOM   2020  C  CB    . ASP A 1 267  ? -41.673 -89.570  61.261  1.00 10.13 ? 268  ASP A CB    1 
ATOM   2021  C  CG    . ASP A 1 267  ? -41.942 -90.956  60.611  1.00 11.46 ? 268  ASP A CG    1 
ATOM   2022  O  OD1   . ASP A 1 267  ? -42.332 -91.045  59.429  1.00 11.86 ? 268  ASP A OD1   1 
ATOM   2023  O  OD2   . ASP A 1 267  ? -41.766 -91.988  61.311  1.00 13.22 ? 268  ASP A OD2   1 
ATOM   2024  N  N     . ALA A 1 268  ? -39.756 -88.281  58.393  1.00 9.03  ? 269  ALA A N     1 
ATOM   2025  C  CA    . ALA A 1 268  ? -38.636 -88.623  57.547  1.00 9.23  ? 269  ALA A CA    1 
ATOM   2026  C  C     . ALA A 1 268  ? -37.337 -88.343  58.258  1.00 9.41  ? 269  ALA A C     1 
ATOM   2027  O  O     . ALA A 1 268  ? -37.276 -87.450  59.078  1.00 9.79  ? 269  ALA A O     1 
ATOM   2028  C  CB    . ALA A 1 268  ? -38.713 -87.883  56.245  1.00 8.48  ? 269  ALA A CB    1 
ATOM   2029  N  N     . GLU A 1 269  ? -36.341 -89.187  58.008  1.00 9.54  ? 270  GLU A N     1 
ATOM   2030  C  CA    . GLU A 1 269  ? -35.016 -89.068  58.604  1.00 9.93  ? 270  GLU A CA    1 
ATOM   2031  C  C     . GLU A 1 269  ? -33.971 -88.595  57.590  1.00 8.45  ? 270  GLU A C     1 
ATOM   2032  O  O     . GLU A 1 269  ? -32.959 -87.983  57.932  1.00 7.49  ? 270  GLU A O     1 
ATOM   2033  C  CB    . GLU A 1 269  ? -34.572 -90.421  59.122  1.00 12.60 ? 270  GLU A CB    1 
ATOM   2034  C  CG    . GLU A 1 269  ? -35.358 -90.990  60.271  1.00 16.62 ? 270  GLU A CG    1 
ATOM   2035  C  CD    . GLU A 1 269  ? -34.737 -92.298  60.770  1.00 19.52 ? 270  GLU A CD    1 
ATOM   2036  O  OE1   . GLU A 1 269  ? -33.603 -92.651  60.316  1.00 20.88 ? 270  GLU A OE1   1 
ATOM   2037  O  OE2   . GLU A 1 269  ? -35.385 -92.971  61.617  1.00 21.34 ? 270  GLU A OE2   1 
ATOM   2038  N  N     . ARG A 1 270  ? -34.178 -89.005  56.352  1.00 6.95  ? 271  ARG A N     1 
ATOM   2039  C  CA    . ARG A 1 270  ? -33.308 -88.636  55.259  1.00 5.52  ? 271  ARG A CA    1 
ATOM   2040  C  C     . ARG A 1 270  ? -34.117 -87.814  54.262  1.00 5.06  ? 271  ARG A C     1 
ATOM   2041  O  O     . ARG A 1 270  ? -35.009 -88.328  53.580  1.00 5.40  ? 271  ARG A O     1 
ATOM   2042  C  CB    . ARG A 1 270  ? -32.750 -89.883  54.617  1.00 4.73  ? 271  ARG A CB    1 
ATOM   2043  C  CG    . ARG A 1 270  ? -31.856 -90.623  55.554  1.00 4.26  ? 271  ARG A CG    1 
ATOM   2044  C  CD    . ARG A 1 270  ? -31.575 -92.009  55.020  1.00 4.38  ? 271  ARG A CD    1 
ATOM   2045  N  NE    . ARG A 1 270  ? -32.748 -92.877  54.953  1.00 4.38  ? 271  ARG A NE    1 
ATOM   2046  C  CZ    . ARG A 1 270  ? -33.106 -93.562  53.867  1.00 4.75  ? 271  ARG A CZ    1 
ATOM   2047  N  NH1   . ARG A 1 270  ? -32.387 -93.457  52.743  1.00 4.18  ? 271  ARG A NH1   1 
ATOM   2048  N  NH2   . ARG A 1 270  ? -34.134 -94.428  53.924  1.00 4.19  ? 271  ARG A NH2   1 
ATOM   2049  N  N     . VAL A 1 271  ? -33.785 -86.533  54.194  1.00 4.35  ? 272  VAL A N     1 
ATOM   2050  C  CA    . VAL A 1 271  ? -34.438 -85.562  53.345  1.00 3.29  ? 272  VAL A CA    1 
ATOM   2051  C  C     . VAL A 1 271  ? -33.466 -84.930  52.321  1.00 2.78  ? 272  VAL A C     1 
ATOM   2052  O  O     . VAL A 1 271  ? -32.313 -84.665  52.619  1.00 2.48  ? 272  VAL A O     1 
ATOM   2053  C  CB    . VAL A 1 271  ? -34.982 -84.441  54.237  1.00 3.07  ? 272  VAL A CB    1 
ATOM   2054  C  CG1   . VAL A 1 271  ? -35.452 -83.253  53.403  1.00 3.63  ? 272  VAL A CG1   1 
ATOM   2055  C  CG2   . VAL A 1 271  ? -36.105 -84.944  55.110  1.00 2.84  ? 272  VAL A CG2   1 
ATOM   2056  N  N     . ILE A 1 272  ? -33.991 -84.647  51.137  1.00 2.51  ? 273  ILE A N     1 
ATOM   2057  C  CA    . ILE A 1 272  ? -33.280 -84.014  50.041  1.00 2.26  ? 273  ILE A CA    1 
ATOM   2058  C  C     . ILE A 1 272  ? -33.892 -82.625  49.796  1.00 2.43  ? 273  ILE A C     1 
ATOM   2059  O  O     . ILE A 1 272  ? -35.117 -82.491  49.824  1.00 2.00  ? 273  ILE A O     1 
ATOM   2060  C  CB    . ILE A 1 272  ? -33.523 -84.773  48.721  1.00 2.32  ? 273  ILE A CB    1 
ATOM   2061  C  CG1   . ILE A 1 272  ? -32.822 -86.133  48.707  1.00 2.00  ? 273  ILE A CG1   1 
ATOM   2062  C  CG2   . ILE A 1 272  ? -33.085 -83.895  47.543  1.00 2.11  ? 273  ILE A CG2   1 
ATOM   2063  C  CD1   . ILE A 1 272  ? -33.044 -86.872  47.424  1.00 2.00  ? 273  ILE A CD1   1 
ATOM   2064  N  N     . VAL A 1 273  ? -33.053 -81.601  49.603  1.00 2.46  ? 274  VAL A N     1 
ATOM   2065  C  CA    . VAL A 1 273  ? -33.547 -80.264  49.257  1.00 2.26  ? 274  VAL A CA    1 
ATOM   2066  C  C     . VAL A 1 273  ? -33.186 -80.107  47.779  1.00 2.37  ? 274  VAL A C     1 
ATOM   2067  O  O     . VAL A 1 273  ? -32.044 -80.339  47.400  1.00 2.00  ? 274  VAL A O     1 
ATOM   2068  C  CB    . VAL A 1 273  ? -32.905 -79.153  50.065  1.00 2.47  ? 274  VAL A CB    1 
ATOM   2069  C  CG1   . VAL A 1 273  ? -33.366 -77.805  49.551  1.00 2.00  ? 274  VAL A CG1   1 
ATOM   2070  C  CG2   . VAL A 1 273  ? -33.281 -79.309  51.536  1.00 2.76  ? 274  VAL A CG2   1 
ATOM   2071  N  N     . SER A 1 274  ? -34.180 -79.820  46.929  1.00 2.52  ? 275  SER A N     1 
ATOM   2072  C  CA    . SER A 1 274  ? -33.919 -79.675  45.494  1.00 2.39  ? 275  SER A CA    1 
ATOM   2073  C  C     . SER A 1 274  ? -34.725 -78.535  44.873  1.00 2.26  ? 275  SER A C     1 
ATOM   2074  O  O     . SER A 1 274  ? -35.640 -77.988  45.496  1.00 2.00  ? 275  SER A O     1 
ATOM   2075  C  CB    . SER A 1 274  ? -34.153 -81.006  44.746  1.00 2.40  ? 275  SER A CB    1 
ATOM   2076  O  OG    . SER A 1 274  ? -33.287 -81.149  43.617  1.00 2.41  ? 275  SER A OG    1 
ATOM   2077  N  N     . MET A 1 275  ? -34.426 -78.262  43.605  1.00 2.29  ? 276  MET A N     1 
ATOM   2078  C  CA    . MET A 1 275  ? -35.066 -77.176  42.874  1.00 2.49  ? 276  MET A CA    1 
ATOM   2079  C  C     . MET A 1 275  ? -35.172 -77.550  41.348  1.00 2.28  ? 276  MET A C     1 
ATOM   2080  O  O     . MET A 1 275  ? -34.216 -78.073  40.791  1.00 2.56  ? 276  MET A O     1 
ATOM   2081  C  CB    . MET A 1 275  ? -34.238 -75.889  43.150  1.00 2.00  ? 276  MET A CB    1 
ATOM   2082  C  CG    . MET A 1 275  ? -34.778 -74.625  42.537  1.00 2.30  ? 276  MET A CG    1 
ATOM   2083  S  SD    . MET A 1 275  ? -34.092 -73.096  43.194  1.00 2.00  ? 276  MET A SD    1 
ATOM   2084  C  CE    . MET A 1 275  ? -32.362 -73.289  42.832  1.00 2.01  ? 276  MET A CE    1 
ATOM   2085  N  N     . GLY A 1 276  ? -36.300 -77.267  40.690  1.00 2.00  ? 277  GLY A N     1 
ATOM   2086  C  CA    . GLY A 1 276  ? -36.425 -77.607  39.289  1.00 2.50  ? 277  GLY A CA    1 
ATOM   2087  C  C     . GLY A 1 276  ? -37.102 -78.950  39.047  1.00 3.47  ? 277  GLY A C     1 
ATOM   2088  O  O     . GLY A 1 276  ? -37.655 -79.573  39.966  1.00 3.42  ? 277  GLY A O     1 
ATOM   2089  N  N     . SER A 1 277  ? -37.020 -79.428  37.813  1.00 3.26  ? 278  SER A N     1 
ATOM   2090  C  CA    . SER A 1 277  ? -37.663 -80.677  37.424  1.00 3.19  ? 278  SER A CA    1 
ATOM   2091  C  C     . SER A 1 277  ? -37.232 -81.911  38.178  1.00 3.41  ? 278  SER A C     1 
ATOM   2092  O  O     . SER A 1 277  ? -37.939 -82.929  38.176  1.00 3.83  ? 278  SER A O     1 
ATOM   2093  C  CB    . SER A 1 277  ? -37.436 -80.921  35.967  1.00 2.55  ? 278  SER A CB    1 
ATOM   2094  O  OG    . SER A 1 277  ? -36.068 -81.184  35.786  1.00 3.17  ? 278  SER A OG    1 
ATOM   2095  N  N     . SER A 1 278  ? -36.050 -81.866  38.784  1.00 3.37  ? 279  SER A N     1 
ATOM   2096  C  CA    . SER A 1 278  ? -35.577 -83.004  39.541  1.00 2.58  ? 279  SER A CA    1 
ATOM   2097  C  C     . SER A 1 278  ? -36.545 -83.361  40.677  1.00 2.46  ? 279  SER A C     1 
ATOM   2098  O  O     . SER A 1 278  ? -36.629 -84.517  41.090  1.00 3.21  ? 279  SER A O     1 
ATOM   2099  C  CB    . SER A 1 278  ? -34.137 -82.778  40.057  1.00 3.07  ? 279  SER A CB    1 
ATOM   2100  O  OG    . SER A 1 278  ? -33.965 -81.670  40.948  1.00 3.00  ? 279  SER A OG    1 
ATOM   2101  N  N     . CYS A 1 279  ? -37.321 -82.388  41.129  1.00 2.11  ? 280  CYS A N     1 
ATOM   2102  C  CA    . CYS A 1 279  ? -38.284 -82.594  42.208  1.00 2.46  ? 280  CYS A CA    1 
ATOM   2103  C  C     . CYS A 1 279  ? -39.391 -83.583  41.853  1.00 2.07  ? 280  CYS A C     1 
ATOM   2104  O  O     . CYS A 1 279  ? -39.831 -84.358  42.679  1.00 2.00  ? 280  CYS A O     1 
ATOM   2105  C  CB    . CYS A 1 279  ? -38.926 -81.265  42.604  1.00 2.49  ? 280  CYS A CB    1 
ATOM   2106  S  SG    . CYS A 1 279  ? -37.847 -80.097  43.413  1.00 4.17  ? 280  CYS A SG    1 
ATOM   2107  N  N     . GLU A 1 280  ? -39.843 -83.525  40.613  1.00 2.23  ? 281  GLU A N     1 
ATOM   2108  C  CA    . GLU A 1 280  ? -40.907 -84.395  40.169  1.00 2.03  ? 281  GLU A CA    1 
ATOM   2109  C  C     . GLU A 1 280  ? -40.456 -85.819  40.243  1.00 2.00  ? 281  GLU A C     1 
ATOM   2110  O  O     . GLU A 1 280  ? -41.122 -86.658  40.817  1.00 2.27  ? 281  GLU A O     1 
ATOM   2111  C  CB    . GLU A 1 280  ? -41.329 -84.023  38.742  1.00 2.00  ? 281  GLU A CB    1 
ATOM   2112  C  CG    . GLU A 1 280  ? -42.052 -82.737  38.670  1.00 2.38  ? 281  GLU A CG    1 
ATOM   2113  C  CD    . GLU A 1 280  ? -43.475 -82.862  39.095  1.00 3.03  ? 281  GLU A CD    1 
ATOM   2114  O  OE1   . GLU A 1 280  ? -43.767 -82.707  40.292  1.00 3.67  ? 281  GLU A OE1   1 
ATOM   2115  O  OE2   . GLU A 1 280  ? -44.332 -83.092  38.231  1.00 4.13  ? 281  GLU A OE2   1 
ATOM   2116  N  N     . THR A 1 281  ? -39.281 -86.078  39.709  1.00 2.09  ? 282  THR A N     1 
ATOM   2117  C  CA    . THR A 1 281  ? -38.757 -87.410  39.715  1.00 2.11  ? 282  THR A CA    1 
ATOM   2118  C  C     . THR A 1 281  ? -38.467 -87.842  41.107  1.00 2.61  ? 282  THR A C     1 
ATOM   2119  O  O     . THR A 1 281  ? -38.569 -89.053  41.423  1.00 2.92  ? 282  THR A O     1 
ATOM   2120  C  CB    . THR A 1 281  ? -37.487 -87.486  38.959  1.00 2.00  ? 282  THR A CB    1 
ATOM   2121  O  OG1   . THR A 1 281  ? -37.797 -87.344  37.575  1.00 3.40  ? 282  THR A OG1   1 
ATOM   2122  C  CG2   . THR A 1 281  ? -36.777 -88.813  39.217  1.00 2.00  ? 282  THR A CG2   1 
ATOM   2123  N  N     . ILE A 1 282  ? -38.030 -86.884  41.923  1.00 2.21  ? 283  ILE A N     1 
ATOM   2124  C  CA    . ILE A 1 282  ? -37.701 -87.218  43.304  1.00 2.57  ? 283  ILE A CA    1 
ATOM   2125  C  C     . ILE A 1 282  ? -38.974 -87.589  44.052  1.00 2.72  ? 283  ILE A C     1 
ATOM   2126  O  O     . ILE A 1 282  ? -38.979 -88.594  44.745  1.00 2.95  ? 283  ILE A O     1 
ATOM   2127  C  CB    . ILE A 1 282  ? -36.942 -86.086  44.032  1.00 2.59  ? 283  ILE A CB    1 
ATOM   2128  C  CG1   . ILE A 1 282  ? -35.578 -85.867  43.382  1.00 2.28  ? 283  ILE A CG1   1 
ATOM   2129  C  CG2   . ILE A 1 282  ? -36.752 -86.428  45.523  1.00 2.22  ? 283  ILE A CG2   1 
ATOM   2130  C  CD1   . ILE A 1 282  ? -34.813 -84.679  44.005  1.00 2.39  ? 283  ILE A CD1   1 
ATOM   2131  N  N     . GLU A 1 283  ? -40.055 -86.823  43.864  1.00 2.63  ? 284  GLU A N     1 
ATOM   2132  C  CA    . GLU A 1 283  ? -41.318 -87.149  44.513  1.00 2.70  ? 284  GLU A CA    1 
ATOM   2133  C  C     . GLU A 1 283  ? -41.835 -88.493  44.047  1.00 2.75  ? 284  GLU A C     1 
ATOM   2134  O  O     . GLU A 1 283  ? -42.393 -89.225  44.836  1.00 3.47  ? 284  GLU A O     1 
ATOM   2135  C  CB    . GLU A 1 283  ? -42.393 -86.105  44.267  1.00 2.99  ? 284  GLU A CB    1 
ATOM   2136  C  CG    . GLU A 1 283  ? -43.630 -86.344  45.153  1.00 3.96  ? 284  GLU A CG    1 
ATOM   2137  C  CD    . GLU A 1 283  ? -44.748 -85.281  45.041  1.00 4.82  ? 284  GLU A CD    1 
ATOM   2138  O  OE1   . GLU A 1 283  ? -44.618 -84.253  44.316  1.00 6.11  ? 284  GLU A OE1   1 
ATOM   2139  O  OE2   . GLU A 1 283  ? -45.784 -85.481  45.705  1.00 4.87  ? 284  GLU A OE2   1 
ATOM   2140  N  N     . GLU A 1 284  ? -41.641 -88.819  42.776  1.00 2.56  ? 285  GLU A N     1 
ATOM   2141  C  CA    . GLU A 1 284  ? -42.074 -90.091  42.220  1.00 2.86  ? 285  GLU A CA    1 
ATOM   2142  C  C     . GLU A 1 284  ? -41.337 -91.291  42.864  1.00 3.21  ? 285  GLU A C     1 
ATOM   2143  O  O     . GLU A 1 284  ? -41.929 -92.346  43.058  1.00 3.51  ? 285  GLU A O     1 
ATOM   2144  C  CB    . GLU A 1 284  ? -41.838 -90.112  40.716  1.00 2.75  ? 285  GLU A CB    1 
ATOM   2145  C  CG    . GLU A 1 284  ? -42.299 -91.366  40.067  1.00 2.51  ? 285  GLU A CG    1 
ATOM   2146  C  CD    . GLU A 1 284  ? -41.722 -91.554  38.681  1.00 2.79  ? 285  GLU A CD    1 
ATOM   2147  O  OE1   . GLU A 1 284  ? -42.176 -90.842  37.776  1.00 3.89  ? 285  GLU A OE1   1 
ATOM   2148  O  OE2   . GLU A 1 284  ? -40.889 -92.455  38.473  1.00 2.00  ? 285  GLU A OE2   1 
ATOM   2149  N  N     . VAL A 1 285  ? -40.029 -91.158  43.079  1.00 3.25  ? 286  VAL A N     1 
ATOM   2150  C  CA    . VAL A 1 285  ? -39.246 -92.209  43.749  1.00 3.20  ? 286  VAL A CA    1 
ATOM   2151  C  C     . VAL A 1 285  ? -39.698 -92.335  45.235  1.00 3.44  ? 286  VAL A C     1 
ATOM   2152  O  O     . VAL A 1 285  ? -39.875 -93.452  45.723  1.00 3.38  ? 286  VAL A O     1 
ATOM   2153  C  CB    . VAL A 1 285  ? -37.713 -91.911  43.686  1.00 2.87  ? 286  VAL A CB    1 
ATOM   2154  C  CG1   . VAL A 1 285  ? -36.943 -92.872  44.629  1.00 2.00  ? 286  VAL A CG1   1 
ATOM   2155  C  CG2   . VAL A 1 285  ? -37.224 -92.040  42.205  1.00 2.00  ? 286  VAL A CG2   1 
ATOM   2156  N  N     . ILE A 1 286  ? -39.920 -91.194  45.913  1.00 2.98  ? 287  ILE A N     1 
ATOM   2157  C  CA    . ILE A 1 286  ? -40.373 -91.160  47.319  1.00 2.88  ? 287  ILE A CA    1 
ATOM   2158  C  C     . ILE A 1 286  ? -41.653 -91.975  47.529  1.00 3.21  ? 287  ILE A C     1 
ATOM   2159  O  O     . ILE A 1 286  ? -41.770 -92.731  48.488  1.00 3.56  ? 287  ILE A O     1 
ATOM   2160  C  CB    . ILE A 1 286  ? -40.683 -89.716  47.761  1.00 2.74  ? 287  ILE A CB    1 
ATOM   2161  C  CG1   . ILE A 1 286  ? -39.386 -88.910  47.982  1.00 2.40  ? 287  ILE A CG1   1 
ATOM   2162  C  CG2   . ILE A 1 286  ? -41.614 -89.723  48.969  1.00 2.02  ? 287  ILE A CG2   1 
ATOM   2163  C  CD1   . ILE A 1 286  ? -39.600 -87.461  48.402  1.00 2.00  ? 287  ILE A CD1   1 
ATOM   2164  N  N     . ASN A 1 287  ? -42.605 -91.777  46.618  1.00 3.59  ? 288  ASN A N     1 
ATOM   2165  C  CA    . ASN A 1 287  ? -43.897 -92.431  46.611  1.00 3.73  ? 288  ASN A CA    1 
ATOM   2166  C  C     . ASN A 1 287  ? -43.711 -93.951  46.543  1.00 4.22  ? 288  ASN A C     1 
ATOM   2167  O  O     . ASN A 1 287  ? -44.412 -94.706  47.224  1.00 4.46  ? 288  ASN A O     1 
ATOM   2168  C  CB    . ASN A 1 287  ? -44.744 -91.920  45.441  1.00 3.53  ? 288  ASN A CB    1 
ATOM   2169  C  CG    . ASN A 1 287  ? -45.443 -90.583  45.748  1.00 4.21  ? 288  ASN A CG    1 
ATOM   2170  O  OD1   . ASN A 1 287  ? -46.023 -89.959  44.859  1.00 5.48  ? 288  ASN A OD1   1 
ATOM   2171  N  ND2   . ASN A 1 287  ? -45.423 -90.162  47.005  1.00 3.79  ? 288  ASN A ND2   1 
ATOM   2172  N  N     . HIS A 1 288  ? -42.680 -94.379  45.828  1.00 4.17  ? 289  HIS A N     1 
ATOM   2173  C  CA    . HIS A 1 288  ? -42.395 -95.787  45.697  1.00 4.14  ? 289  HIS A CA    1 
ATOM   2174  C  C     . HIS A 1 288  ? -41.679 -96.304  46.944  1.00 4.14  ? 289  HIS A C     1 
ATOM   2175  O  O     . HIS A 1 288  ? -42.071 -97.305  47.520  1.00 4.22  ? 289  HIS A O     1 
ATOM   2176  C  CB    . HIS A 1 288  ? -41.541 -95.996  44.454  1.00 4.79  ? 289  HIS A CB    1 
ATOM   2177  C  CG    . HIS A 1 288  ? -41.189 -97.429  44.201  1.00 5.78  ? 289  HIS A CG    1 
ATOM   2178  N  ND1   . HIS A 1 288  ? -39.978 -97.978  44.588  1.00 6.65  ? 289  HIS A ND1   1 
ATOM   2179  C  CD2   . HIS A 1 288  ? -41.899 -98.436  43.643  1.00 5.19  ? 289  HIS A CD2   1 
ATOM   2180  C  CE1   . HIS A 1 288  ? -39.961 -99.264  44.281  1.00 5.90  ? 289  HIS A CE1   1 
ATOM   2181  N  NE2   . HIS A 1 288  ? -41.111 -99.565  43.705  1.00 5.87  ? 289  HIS A NE2   1 
ATOM   2182  N  N     . LEU A 1 289  ? -40.647 -95.600  47.385  1.00 4.64  ? 290  LEU A N     1 
ATOM   2183  C  CA    . LEU A 1 289  ? -39.895 -96.008  48.572  1.00 5.12  ? 290  LEU A CA    1 
ATOM   2184  C  C     . LEU A 1 289  ? -40.652 -95.912  49.899  1.00 5.31  ? 290  LEU A C     1 
ATOM   2185  O  O     . LEU A 1 289  ? -40.659 -96.837  50.686  1.00 5.36  ? 290  LEU A O     1 
ATOM   2186  C  CB    . LEU A 1 289  ? -38.599 -95.221  48.652  1.00 4.38  ? 290  LEU A CB    1 
ATOM   2187  C  CG    . LEU A 1 289  ? -37.476 -95.938  47.940  1.00 3.93  ? 290  LEU A CG    1 
ATOM   2188  C  CD1   . LEU A 1 289  ? -37.976 -96.569  46.698  1.00 4.34  ? 290  LEU A CD1   1 
ATOM   2189  C  CD2   . LEU A 1 289  ? -36.358 -94.957  47.648  1.00 4.27  ? 290  LEU A CD2   1 
ATOM   2190  N  N     . ALA A 1 290  ? -41.267 -94.769  50.161  1.00 5.57  ? 291  ALA A N     1 
ATOM   2191  C  CA    . ALA A 1 290  ? -42.015 -94.600  51.380  1.00 5.80  ? 291  ALA A CA    1 
ATOM   2192  C  C     . ALA A 1 290  ? -43.153 -95.599  51.516  1.00 5.99  ? 291  ALA A C     1 
ATOM   2193  O  O     . ALA A 1 290  ? -43.506 -95.976  52.634  1.00 6.46  ? 291  ALA A O     1 
ATOM   2194  C  CB    . ALA A 1 290  ? -42.575 -93.199  51.455  1.00 5.92  ? 291  ALA A CB    1 
ATOM   2195  N  N     . ALA A 1 291  ? -43.790 -95.969  50.413  1.00 5.13  ? 292  ALA A N     1 
ATOM   2196  C  CA    . ALA A 1 291  ? -44.892 -96.914  50.507  1.00 4.69  ? 292  ALA A CA    1 
ATOM   2197  C  C     . ALA A 1 291  ? -44.340 -98.219  50.997  1.00 4.66  ? 292  ALA A C     1 
ATOM   2198  O  O     . ALA A 1 291  ? -45.075 -99.005  51.517  1.00 5.14  ? 292  ALA A O     1 
ATOM   2199  C  CB    . ALA A 1 291  ? -45.547 -97.095  49.170  1.00 5.00  ? 292  ALA A CB    1 
ATOM   2200  N  N     . LYS A 1 292  ? -43.021 -98.386  50.891  1.00 4.78  ? 293  LYS A N     1 
ATOM   2201  C  CA    . LYS A 1 292  ? -42.314 -99.592  51.281  1.00 4.93  ? 293  LYS A CA    1 
ATOM   2202  C  C     . LYS A 1 292  ? -41.650 -99.539  52.663  1.00 5.40  ? 293  LYS A C     1 
ATOM   2203  O  O     . LYS A 1 292  ? -40.926 -100.455 53.079  1.00 4.11  ? 293  LYS A O     1 
ATOM   2204  C  CB    . LYS A 1 292  ? -41.326 -99.969  50.193  1.00 4.98  ? 293  LYS A CB    1 
ATOM   2205  C  CG    . LYS A 1 292  ? -41.992 -100.109 48.840  1.00 5.94  ? 293  LYS A CG    1 
ATOM   2206  C  CD    . LYS A 1 292  ? -40.994 -100.202 47.708  1.00 7.35  ? 293  LYS A CD    1 
ATOM   2207  C  CE    . LYS A 1 292  ? -40.477 -101.598 47.562  1.00 9.07  ? 293  LYS A CE    1 
ATOM   2208  N  NZ    . LYS A 1 292  ? -41.529 -102.527 46.996  1.00 10.72 ? 293  LYS A NZ    1 
ATOM   2209  N  N     . GLY A 1 293  ? -41.910 -98.446  53.368  1.00 5.67  ? 294  GLY A N     1 
ATOM   2210  C  CA    . GLY A 1 293  ? -41.408 -98.305  54.718  1.00 5.86  ? 294  GLY A CA    1 
ATOM   2211  C  C     . GLY A 1 293  ? -40.364 -97.228  54.918  1.00 6.25  ? 294  GLY A C     1 
ATOM   2212  O  O     . GLY A 1 293  ? -40.116 -96.786  56.047  1.00 5.80  ? 294  GLY A O     1 
ATOM   2213  N  N     . GLU A 1 294  ? -39.765 -96.794  53.818  1.00 6.49  ? 295  GLU A N     1 
ATOM   2214  C  CA    . GLU A 1 294  ? -38.705 -95.801  53.884  1.00 7.06  ? 295  GLU A CA    1 
ATOM   2215  C  C     . GLU A 1 294  ? -39.106 -94.452  54.447  1.00 6.99  ? 295  GLU A C     1 
ATOM   2216  O  O     . GLU A 1 294  ? -40.031 -93.817  53.983  1.00 7.23  ? 295  GLU A O     1 
ATOM   2217  C  CB    . GLU A 1 294  ? -38.028 -95.655  52.520  1.00 7.88  ? 295  GLU A CB    1 
ATOM   2218  C  CG    . GLU A 1 294  ? -37.372 -96.939  52.005  1.00 9.23  ? 295  GLU A CG    1 
ATOM   2219  C  CD    . GLU A 1 294  ? -35.945 -96.709  51.479  1.00 10.94 ? 295  GLU A CD    1 
ATOM   2220  O  OE1   . GLU A 1 294  ? -35.376 -95.626  51.699  1.00 12.67 ? 295  GLU A OE1   1 
ATOM   2221  O  OE2   . GLU A 1 294  ? -35.369 -97.604  50.848  1.00 11.90 ? 295  GLU A OE2   1 
ATOM   2222  N  N     . LYS A 1 295  ? -38.426 -94.048  55.501  1.00 7.28  ? 296  LYS A N     1 
ATOM   2223  C  CA    . LYS A 1 295  ? -38.692 -92.782  56.173  1.00 7.64  ? 296  LYS A CA    1 
ATOM   2224  C  C     . LYS A 1 295  ? -38.003 -91.624  55.455  1.00 7.22  ? 296  LYS A C     1 
ATOM   2225  O  O     . LYS A 1 295  ? -37.117 -90.993  56.016  1.00 7.29  ? 296  LYS A O     1 
ATOM   2226  C  CB    . LYS A 1 295  ? -38.208 -92.888  57.630  1.00 8.30  ? 296  LYS A CB    1 
ATOM   2227  C  CG    . LYS A 1 295  ? -39.052 -93.819  58.465  1.00 9.17  ? 296  LYS A CG    1 
ATOM   2228  C  CD    . LYS A 1 295  ? -40.497 -93.339  58.403  1.00 10.93 ? 296  LYS A CD    1 
ATOM   2229  C  CE    . LYS A 1 295  ? -41.485 -94.317  59.021  1.00 11.60 ? 296  LYS A CE    1 
ATOM   2230  N  NZ    . LYS A 1 295  ? -41.268 -94.542  60.495  1.00 11.72 ? 296  LYS A NZ    1 
ATOM   2231  N  N     . ILE A 1 296  ? -38.448 -91.307  54.241  1.00 6.51  ? 297  ILE A N     1 
ATOM   2232  C  CA    . ILE A 1 296  ? -37.800 -90.256  53.451  1.00 5.49  ? 297  ILE A CA    1 
ATOM   2233  C  C     . ILE A 1 296  ? -38.725 -89.120  53.027  1.00 5.39  ? 297  ILE A C     1 
ATOM   2234  O  O     . ILE A 1 296  ? -39.961 -89.247  53.093  1.00 5.23  ? 297  ILE A O     1 
ATOM   2235  C  CB    . ILE A 1 296  ? -37.138 -90.866  52.191  1.00 5.32  ? 297  ILE A CB    1 
ATOM   2236  C  CG1   . ILE A 1 296  ? -38.187 -91.593  51.332  1.00 4.75  ? 297  ILE A CG1   1 
ATOM   2237  C  CG2   . ILE A 1 296  ? -36.072 -91.893  52.598  1.00 5.12  ? 297  ILE A CG2   1 
ATOM   2238  C  CD1   . ILE A 1 296  ? -37.651 -92.077  50.024  1.00 4.26  ? 297  ILE A CD1   1 
ATOM   2239  N  N     . GLY A 1 297  ? -38.107 -88.018  52.572  1.00 4.93  ? 298  GLY A N     1 
ATOM   2240  C  CA    . GLY A 1 297  ? -38.837 -86.832  52.138  1.00 3.66  ? 298  GLY A CA    1 
ATOM   2241  C  C     . GLY A 1 297  ? -38.049 -85.844  51.287  1.00 3.61  ? 298  GLY A C     1 
ATOM   2242  O  O     . GLY A 1 297  ? -36.845 -86.009  51.045  1.00 3.21  ? 298  GLY A O     1 
ATOM   2243  N  N     . LEU A 1 298  ? -38.719 -84.772  50.871  1.00 2.91  ? 299  LEU A N     1 
ATOM   2244  C  CA    . LEU A 1 298  ? -38.112 -83.755  50.025  1.00 2.36  ? 299  LEU A CA    1 
ATOM   2245  C  C     . LEU A 1 298  ? -38.682 -82.363  50.270  1.00 2.35  ? 299  LEU A C     1 
ATOM   2246  O  O     . LEU A 1 298  ? -39.883 -82.186  50.493  1.00 2.45  ? 299  LEU A O     1 
ATOM   2247  C  CB    . LEU A 1 298  ? -38.322 -84.126  48.534  1.00 2.25  ? 299  LEU A CB    1 
ATOM   2248  C  CG    . LEU A 1 298  ? -38.278 -83.076  47.392  1.00 2.46  ? 299  LEU A CG    1 
ATOM   2249  C  CD1   . LEU A 1 298  ? -36.859 -82.596  47.141  1.00 2.13  ? 299  LEU A CD1   1 
ATOM   2250  C  CD2   . LEU A 1 298  ? -38.833 -83.639  46.113  1.00 2.00  ? 299  LEU A CD2   1 
ATOM   2251  N  N     . ILE A 1 299  ? -37.811 -81.375  50.203  1.00 2.00  ? 300  ILE A N     1 
ATOM   2252  C  CA    . ILE A 1 299  ? -38.216 -79.996  50.347  1.00 2.32  ? 300  ILE A CA    1 
ATOM   2253  C  C     . ILE A 1 299  ? -38.024 -79.408  48.951  1.00 2.18  ? 300  ILE A C     1 
ATOM   2254  O  O     . ILE A 1 299  ? -36.916 -79.444  48.410  1.00 2.04  ? 300  ILE A O     1 
ATOM   2255  C  CB    . ILE A 1 299  ? -37.350 -79.220  51.355  1.00 2.00  ? 300  ILE A CB    1 
ATOM   2256  C  CG1   . ILE A 1 299  ? -37.591 -79.758  52.748  1.00 2.00  ? 300  ILE A CG1   1 
ATOM   2257  C  CG2   . ILE A 1 299  ? -37.735 -77.695  51.327  1.00 2.73  ? 300  ILE A CG2   1 
ATOM   2258  C  CD1   . ILE A 1 299  ? -36.735 -79.090  53.806  1.00 2.13  ? 300  ILE A CD1   1 
ATOM   2259  N  N     . LYS A 1 300  ? -39.109 -78.891  48.381  1.00 2.00  ? 301  LYS A N     1 
ATOM   2260  C  CA    . LYS A 1 300  ? -39.100 -78.320  47.040  1.00 2.16  ? 301  LYS A CA    1 
ATOM   2261  C  C     . LYS A 1 300  ? -38.931 -76.846  47.155  1.00 2.21  ? 301  LYS A C     1 
ATOM   2262  O  O     . LYS A 1 300  ? -39.771 -76.212  47.768  1.00 2.11  ? 301  LYS A O     1 
ATOM   2263  C  CB    . LYS A 1 300  ? -40.442 -78.550  46.342  1.00 2.08  ? 301  LYS A CB    1 
ATOM   2264  C  CG    . LYS A 1 300  ? -40.869 -79.978  46.202  1.00 3.17  ? 301  LYS A CG    1 
ATOM   2265  C  CD    . LYS A 1 300  ? -41.997 -80.114  45.212  1.00 3.45  ? 301  LYS A CD    1 
ATOM   2266  C  CE    . LYS A 1 300  ? -42.499 -81.525  45.109  1.00 4.27  ? 301  LYS A CE    1 
ATOM   2267  N  NZ    . LYS A 1 300  ? -43.158 -81.746  43.775  1.00 5.78  ? 301  LYS A NZ    1 
ATOM   2268  N  N     . VAL A 1 301  ? -37.877 -76.263  46.596  1.00 2.32  ? 302  VAL A N     1 
ATOM   2269  C  CA    . VAL A 1 301  ? -37.806 -74.810  46.737  1.00 2.34  ? 302  VAL A CA    1 
ATOM   2270  C  C     . VAL A 1 301  ? -38.478 -74.057  45.581  1.00 2.37  ? 302  VAL A C     1 
ATOM   2271  O  O     . VAL A 1 301  ? -38.214 -74.322  44.408  1.00 2.36  ? 302  VAL A O     1 
ATOM   2272  C  CB    . VAL A 1 301  ? -36.354 -74.235  47.067  1.00 2.69  ? 302  VAL A CB    1 
ATOM   2273  C  CG1   . VAL A 1 301  ? -35.323 -75.320  47.318  1.00 2.00  ? 302  VAL A CG1   1 
ATOM   2274  C  CG2   . VAL A 1 301  ? -35.895 -73.248  46.034  1.00 2.81  ? 302  VAL A CG2   1 
ATOM   2275  N  N     . ARG A 1 302  ? -39.422 -73.191  45.925  1.00 2.21  ? 303  ARG A N     1 
ATOM   2276  C  CA    . ARG A 1 302  ? -40.102 -72.366  44.949  1.00 2.00  ? 303  ARG A CA    1 
ATOM   2277  C  C     . ARG A 1 302  ? -39.434 -70.983  44.908  1.00 2.23  ? 303  ARG A C     1 
ATOM   2278  O  O     . ARG A 1 302  ? -38.940 -70.574  43.869  1.00 2.36  ? 303  ARG A O     1 
ATOM   2279  C  CB    . ARG A 1 302  ? -41.590 -72.230  45.268  1.00 2.26  ? 303  ARG A CB    1 
ATOM   2280  C  CG    . ARG A 1 302  ? -42.480 -73.367  44.762  1.00 2.74  ? 303  ARG A CG    1 
ATOM   2281  C  CD    . ARG A 1 302  ? -42.298 -74.627  45.610  1.00 4.43  ? 303  ARG A CD    1 
ATOM   2282  N  NE    . ARG A 1 302  ? -42.407 -75.805  44.784  1.00 6.94  ? 303  ARG A NE    1 
ATOM   2283  C  CZ    . ARG A 1 302  ? -43.486 -76.561  44.752  1.00 8.58  ? 303  ARG A CZ    1 
ATOM   2284  N  NH1   . ARG A 1 302  ? -44.531 -76.244  45.501  1.00 10.50 ? 303  ARG A NH1   1 
ATOM   2285  N  NH2   . ARG A 1 302  ? -43.537 -77.613  43.967  1.00 9.30  ? 303  ARG A NH2   1 
ATOM   2286  N  N     . LEU A 1 303  ? -39.432 -70.243  46.015  1.00 2.38  ? 304  LEU A N     1 
ATOM   2287  C  CA    . LEU A 1 303  ? -38.805 -68.918  46.030  1.00 2.00  ? 304  LEU A CA    1 
ATOM   2288  C  C     . LEU A 1 303  ? -37.363 -69.099  46.482  1.00 2.15  ? 304  LEU A C     1 
ATOM   2289  O  O     . LEU A 1 303  ? -37.117 -69.376  47.654  1.00 2.00  ? 304  LEU A O     1 
ATOM   2290  C  CB    . LEU A 1 303  ? -39.534 -67.956  46.968  1.00 2.00  ? 304  LEU A CB    1 
ATOM   2291  C  CG    . LEU A 1 303  ? -39.167 -66.472  46.775  1.00 2.18  ? 304  LEU A CG    1 
ATOM   2292  C  CD1   . LEU A 1 303  ? -39.678 -65.929  45.472  1.00 2.00  ? 304  LEU A CD1   1 
ATOM   2293  C  CD2   . LEU A 1 303  ? -39.742 -65.654  47.860  1.00 2.00  ? 304  LEU A CD2   1 
ATOM   2294  N  N     . TYR A 1 304  ? -36.423 -69.032  45.537  1.00 2.00  ? 305  TYR A N     1 
ATOM   2295  C  CA    . TYR A 1 304  ? -35.015 -69.206  45.842  1.00 2.00  ? 305  TYR A CA    1 
ATOM   2296  C  C     . TYR A 1 304  ? -34.453 -67.897  46.389  1.00 2.00  ? 305  TYR A C     1 
ATOM   2297  O  O     . TYR A 1 304  ? -33.637 -67.914  47.275  1.00 2.00  ? 305  TYR A O     1 
ATOM   2298  C  CB    . TYR A 1 304  ? -34.262 -69.662  44.596  1.00 2.00  ? 305  TYR A CB    1 
ATOM   2299  C  CG    . TYR A 1 304  ? -32.770 -69.767  44.804  1.00 2.00  ? 305  TYR A CG    1 
ATOM   2300  C  CD1   . TYR A 1 304  ? -32.224 -70.725  45.680  1.00 2.04  ? 305  TYR A CD1   1 
ATOM   2301  C  CD2   . TYR A 1 304  ? -31.899 -68.855  44.216  1.00 2.35  ? 305  TYR A CD2   1 
ATOM   2302  C  CE1   . TYR A 1 304  ? -30.860 -70.759  45.978  1.00 2.00  ? 305  TYR A CE1   1 
ATOM   2303  C  CE2   . TYR A 1 304  ? -30.524 -68.888  44.518  1.00 2.63  ? 305  TYR A CE2   1 
ATOM   2304  C  CZ    . TYR A 1 304  ? -30.033 -69.846  45.403  1.00 2.12  ? 305  TYR A CZ    1 
ATOM   2305  O  OH    . TYR A 1 304  ? -28.719 -69.815  45.742  1.00 2.34  ? 305  TYR A OH    1 
ATOM   2306  N  N     . ARG A 1 305  ? -34.913 -66.770  45.846  1.00 2.34  ? 306  ARG A N     1 
ATOM   2307  C  CA    . ARG A 1 305  ? -34.532 -65.418  46.262  1.00 2.09  ? 306  ARG A CA    1 
ATOM   2308  C  C     . ARG A 1 305  ? -35.789 -64.505  46.300  1.00 2.09  ? 306  ARG A C     1 
ATOM   2309  O  O     . ARG A 1 305  ? -36.520 -64.379  45.318  1.00 2.00  ? 306  ARG A O     1 
ATOM   2310  C  CB    . ARG A 1 305  ? -33.460 -64.808  45.331  1.00 2.00  ? 306  ARG A CB    1 
ATOM   2311  C  CG    . ARG A 1 305  ? -32.005 -65.302  45.530  1.00 2.00  ? 306  ARG A CG    1 
ATOM   2312  C  CD    . ARG A 1 305  ? -31.351 -64.769  46.754  1.00 2.00  ? 306  ARG A CD    1 
ATOM   2313  N  NE    . ARG A 1 305  ? -30.042 -65.346  47.023  1.00 2.00  ? 306  ARG A NE    1 
ATOM   2314  C  CZ    . ARG A 1 305  ? -29.798 -66.590  47.464  1.00 2.00  ? 306  ARG A CZ    1 
ATOM   2315  N  NH1   . ARG A 1 305  ? -30.771 -67.464  47.680  1.00 2.00  ? 306  ARG A NH1   1 
ATOM   2316  N  NH2   . ARG A 1 305  ? -28.554 -66.937  47.806  1.00 2.04  ? 306  ARG A NH2   1 
ATOM   2317  N  N     . PRO A 1 306  ? -36.093 -63.928  47.474  1.00 2.00  ? 307  PRO A N     1 
ATOM   2318  C  CA    . PRO A 1 306  ? -35.355 -64.066  48.741  1.00 2.00  ? 307  PRO A CA    1 
ATOM   2319  C  C     . PRO A 1 306  ? -35.421 -65.460  49.384  1.00 2.79  ? 307  PRO A C     1 
ATOM   2320  O  O     . PRO A 1 306  ? -36.427 -66.200  49.251  1.00 3.17  ? 307  PRO A O     1 
ATOM   2321  C  CB    . PRO A 1 306  ? -36.005 -63.024  49.632  1.00 2.19  ? 307  PRO A CB    1 
ATOM   2322  C  CG    . PRO A 1 306  ? -36.572 -61.992  48.634  1.00 2.07  ? 307  PRO A CG    1 
ATOM   2323  C  CD    . PRO A 1 306  ? -37.097 -62.854  47.543  1.00 2.00  ? 307  PRO A CD    1 
ATOM   2324  N  N     . PHE A 1 307  ? -34.329 -65.833  50.052  1.00 2.49  ? 308  PHE A N     1 
ATOM   2325  C  CA    . PHE A 1 307  ? -34.272 -67.118  50.702  1.00 2.83  ? 308  PHE A CA    1 
ATOM   2326  C  C     . PHE A 1 307  ? -34.836 -66.820  52.063  1.00 3.11  ? 308  PHE A C     1 
ATOM   2327  O  O     . PHE A 1 307  ? -34.290 -65.976  52.772  1.00 3.64  ? 308  PHE A O     1 
ATOM   2328  C  CB    . PHE A 1 307  ? -32.828 -67.619  50.825  1.00 2.44  ? 308  PHE A CB    1 
ATOM   2329  C  CG    . PHE A 1 307  ? -32.725 -69.090  51.085  1.00 2.43  ? 308  PHE A CG    1 
ATOM   2330  C  CD1   . PHE A 1 307  ? -32.748 -69.994  50.029  1.00 2.78  ? 308  PHE A CD1   1 
ATOM   2331  C  CD2   . PHE A 1 307  ? -32.686 -69.589  52.381  1.00 2.86  ? 308  PHE A CD2   1 
ATOM   2332  C  CE1   . PHE A 1 307  ? -32.745 -71.365  50.249  1.00 2.00  ? 308  PHE A CE1   1 
ATOM   2333  C  CE2   . PHE A 1 307  ? -32.686 -70.978  52.608  1.00 2.55  ? 308  PHE A CE2   1 
ATOM   2334  C  CZ    . PHE A 1 307  ? -32.718 -71.847  51.544  1.00 2.41  ? 308  PHE A CZ    1 
ATOM   2335  N  N     . VAL A 1 308  ? -35.949 -67.460  52.404  1.00 2.83  ? 309  VAL A N     1 
ATOM   2336  C  CA    . VAL A 1 308  ? -36.592 -67.221  53.685  1.00 3.01  ? 309  VAL A CA    1 
ATOM   2337  C  C     . VAL A 1 308  ? -36.442 -68.484  54.507  1.00 3.75  ? 309  VAL A C     1 
ATOM   2338  O  O     . VAL A 1 308  ? -37.144 -69.483  54.255  1.00 4.10  ? 309  VAL A O     1 
ATOM   2339  C  CB    . VAL A 1 308  ? -38.139 -66.858  53.524  1.00 3.00  ? 309  VAL A CB    1 
ATOM   2340  C  CG1   . VAL A 1 308  ? -38.684 -66.337  54.824  1.00 2.00  ? 309  VAL A CG1   1 
ATOM   2341  C  CG2   . VAL A 1 308  ? -38.364 -65.817  52.399  1.00 2.00  ? 309  VAL A CG2   1 
ATOM   2342  N  N     . SER A 1 309  ? -35.538 -68.449  55.481  1.00 4.15  ? 310  SER A N     1 
ATOM   2343  C  CA    . SER A 1 309  ? -35.285 -69.599  56.328  1.00 5.90  ? 310  SER A CA    1 
ATOM   2344  C  C     . SER A 1 309  ? -36.505 -70.038  57.122  1.00 6.66  ? 310  SER A C     1 
ATOM   2345  O  O     . SER A 1 309  ? -36.665 -71.208  57.371  1.00 6.21  ? 310  SER A O     1 
ATOM   2346  C  CB    . SER A 1 309  ? -34.120 -69.328  57.288  1.00 6.68  ? 310  SER A CB    1 
ATOM   2347  O  OG    . SER A 1 309  ? -32.926 -68.964  56.586  1.00 9.44  ? 310  SER A OG    1 
ATOM   2348  N  N     . GLU A 1 310  ? -37.349 -69.099  57.557  1.00 8.54  ? 311  GLU A N     1 
ATOM   2349  C  CA    . GLU A 1 310  ? -38.539 -69.473  58.335  1.00 9.65  ? 311  GLU A CA    1 
ATOM   2350  C  C     . GLU A 1 310  ? -39.401 -70.386  57.485  1.00 8.25  ? 311  GLU A C     1 
ATOM   2351  O  O     . GLU A 1 310  ? -39.914 -71.374  57.964  1.00 8.14  ? 311  GLU A O     1 
ATOM   2352  C  CB    . GLU A 1 310  ? -39.352 -68.245  58.775  1.00 13.13 ? 311  GLU A CB    1 
ATOM   2353  C  CG    . GLU A 1 310  ? -40.738 -68.565  59.449  1.00 18.46 ? 311  GLU A CG    1 
ATOM   2354  C  CD    . GLU A 1 310  ? -41.977 -68.347  58.521  1.00 21.47 ? 311  GLU A CD    1 
ATOM   2355  O  OE1   . GLU A 1 310  ? -42.184 -67.175  58.073  1.00 22.58 ? 311  GLU A OE1   1 
ATOM   2356  O  OE2   . GLU A 1 310  ? -42.739 -69.346  58.264  1.00 22.77 ? 311  GLU A OE2   1 
ATOM   2357  N  N     . ALA A 1 311  ? -39.509 -70.070  56.207  1.00 7.18  ? 312  ALA A N     1 
ATOM   2358  C  CA    . ALA A 1 311  ? -40.306 -70.864  55.300  1.00 5.86  ? 312  ALA A CA    1 
ATOM   2359  C  C     . ALA A 1 311  ? -39.651 -72.196  55.030  1.00 5.15  ? 312  ALA A C     1 
ATOM   2360  O  O     . ALA A 1 311  ? -40.337 -73.191  54.788  1.00 5.85  ? 312  ALA A O     1 
ATOM   2361  C  CB    . ALA A 1 311  ? -40.544 -70.103  54.025  1.00 6.69  ? 312  ALA A CB    1 
ATOM   2362  N  N     . PHE A 1 312  ? -38.324 -72.230  55.066  1.00 4.00  ? 313  PHE A N     1 
ATOM   2363  C  CA    . PHE A 1 312  ? -37.578 -73.476  54.839  1.00 2.99  ? 313  PHE A CA    1 
ATOM   2364  C  C     . PHE A 1 312  ? -37.833 -74.462  55.988  1.00 2.74  ? 313  PHE A C     1 
ATOM   2365  O  O     . PHE A 1 312  ? -38.140 -75.636  55.781  1.00 2.14  ? 313  PHE A O     1 
ATOM   2366  C  CB    . PHE A 1 312  ? -36.060 -73.170  54.748  1.00 2.81  ? 313  PHE A CB    1 
ATOM   2367  C  CG    . PHE A 1 312  ? -35.188 -74.396  54.695  1.00 2.00  ? 313  PHE A CG    1 
ATOM   2368  C  CD1   . PHE A 1 312  ? -35.106 -75.152  53.529  1.00 2.00  ? 313  PHE A CD1   1 
ATOM   2369  C  CD2   . PHE A 1 312  ? -34.508 -74.833  55.830  1.00 2.00  ? 313  PHE A CD2   1 
ATOM   2370  C  CE1   . PHE A 1 312  ? -34.346 -76.370  53.498  1.00 2.13  ? 313  PHE A CE1   1 
ATOM   2371  C  CE2   . PHE A 1 312  ? -33.752 -76.034  55.811  1.00 2.00  ? 313  PHE A CE2   1 
ATOM   2372  C  CZ    . PHE A 1 312  ? -33.677 -76.801  54.638  1.00 2.00  ? 313  PHE A CZ    1 
ATOM   2373  N  N     . PHE A 1 313  ? -37.681 -73.954  57.207  1.00 2.76  ? 314  PHE A N     1 
ATOM   2374  C  CA    . PHE A 1 313  ? -37.853 -74.726  58.439  1.00 2.74  ? 314  PHE A CA    1 
ATOM   2375  C  C     . PHE A 1 313  ? -39.281 -75.120  58.693  1.00 2.87  ? 314  PHE A C     1 
ATOM   2376  O  O     . PHE A 1 313  ? -39.566 -76.059  59.434  1.00 3.70  ? 314  PHE A O     1 
ATOM   2377  C  CB    . PHE A 1 313  ? -37.277 -73.954  59.623  1.00 2.79  ? 314  PHE A CB    1 
ATOM   2378  C  CG    . PHE A 1 313  ? -35.771 -73.956  59.651  1.00 2.51  ? 314  PHE A CG    1 
ATOM   2379  C  CD1   . PHE A 1 313  ? -35.073 -75.140  59.570  1.00 2.28  ? 314  PHE A CD1   1 
ATOM   2380  C  CD2   . PHE A 1 313  ? -35.058 -72.779  59.773  1.00 2.68  ? 314  PHE A CD2   1 
ATOM   2381  C  CE1   . PHE A 1 313  ? -33.693 -75.154  59.616  1.00 2.55  ? 314  PHE A CE1   1 
ATOM   2382  C  CE2   . PHE A 1 313  ? -33.672 -72.794  59.817  1.00 2.43  ? 314  PHE A CE2   1 
ATOM   2383  C  CZ    . PHE A 1 313  ? -32.994 -73.974  59.741  1.00 2.44  ? 314  PHE A CZ    1 
ATOM   2384  N  N     . ALA A 1 314  ? -40.190 -74.388  58.082  1.00 3.24  ? 315  ALA A N     1 
ATOM   2385  C  CA    . ALA A 1 314  ? -41.584 -74.700  58.206  1.00 3.35  ? 315  ALA A CA    1 
ATOM   2386  C  C     . ALA A 1 314  ? -41.808 -76.013  57.430  1.00 3.65  ? 315  ALA A C     1 
ATOM   2387  O  O     . ALA A 1 314  ? -42.710 -76.779  57.760  1.00 4.55  ? 315  ALA A O     1 
ATOM   2388  C  CB    . ALA A 1 314  ? -42.394 -73.574  57.625  1.00 3.11  ? 315  ALA A CB    1 
ATOM   2389  N  N     . ALA A 1 315  ? -40.920 -76.314  56.482  1.00 3.14  ? 316  ALA A N     1 
ATOM   2390  C  CA    . ALA A 1 315  ? -41.036 -77.518  55.642  1.00 3.42  ? 316  ALA A CA    1 
ATOM   2391  C  C     . ALA A 1 315  ? -40.162 -78.691  56.061  1.00 3.52  ? 316  ALA A C     1 
ATOM   2392  O  O     . ALA A 1 315  ? -40.321 -79.780  55.557  1.00 3.72  ? 316  ALA A O     1 
ATOM   2393  C  CB    . ALA A 1 315  ? -40.720 -77.166  54.171  1.00 2.83  ? 316  ALA A CB    1 
ATOM   2394  N  N     . LEU A 1 316  ? -39.270 -78.462  57.011  1.00 4.04  ? 317  LEU A N     1 
ATOM   2395  C  CA    . LEU A 1 316  ? -38.321 -79.474  57.475  1.00 3.99  ? 317  LEU A CA    1 
ATOM   2396  C  C     . LEU A 1 316  ? -38.875 -80.284  58.642  1.00 4.87  ? 317  LEU A C     1 
ATOM   2397  O  O     . LEU A 1 316  ? -39.253 -79.705  59.690  1.00 5.72  ? 317  LEU A O     1 
ATOM   2398  C  CB    . LEU A 1 316  ? -37.030 -78.743  57.894  1.00 3.22  ? 317  LEU A CB    1 
ATOM   2399  C  CG    . LEU A 1 316  ? -35.605 -79.263  58.098  1.00 2.20  ? 317  LEU A CG    1 
ATOM   2400  C  CD1   . LEU A 1 316  ? -35.270 -79.296  59.552  1.00 2.00  ? 317  LEU A CD1   1 
ATOM   2401  C  CD2   . LEU A 1 316  ? -35.391 -80.582  57.397  1.00 2.09  ? 317  LEU A CD2   1 
ATOM   2402  N  N     . PRO A 1 317  ? -38.994 -81.619  58.464  1.00 5.10  ? 318  PRO A N     1 
ATOM   2403  C  CA    . PRO A 1 317  ? -39.502 -82.493  59.507  1.00 5.63  ? 318  PRO A CA    1 
ATOM   2404  C  C     . PRO A 1 317  ? -38.478 -82.487  60.625  1.00 6.33  ? 318  PRO A C     1 
ATOM   2405  O  O     . PRO A 1 317  ? -37.276 -82.640  60.366  1.00 6.53  ? 318  PRO A O     1 
ATOM   2406  C  CB    . PRO A 1 317  ? -39.502 -83.887  58.838  1.00 5.53  ? 318  PRO A CB    1 
ATOM   2407  C  CG    . PRO A 1 317  ? -39.635 -83.600  57.415  1.00 4.87  ? 318  PRO A CG    1 
ATOM   2408  C  CD    . PRO A 1 317  ? -38.769 -82.382  57.228  1.00 5.16  ? 318  PRO A CD    1 
ATOM   2409  N  N     . ALA A 1 318  ? -38.980 -82.338  61.857  1.00 7.03  ? 319  ALA A N     1 
ATOM   2410  C  CA    . ALA A 1 318  ? -38.200 -82.352  63.087  1.00 6.63  ? 319  ALA A CA    1 
ATOM   2411  C  C     . ALA A 1 318  ? -37.418 -83.672  63.138  1.00 6.80  ? 319  ALA A C     1 
ATOM   2412  O  O     . ALA A 1 318  ? -36.284 -83.727  63.629  1.00 6.80  ? 319  ALA A O     1 
ATOM   2413  C  CB    . ALA A 1 318  ? -39.151 -82.258  64.274  1.00 6.40  ? 319  ALA A CB    1 
ATOM   2414  N  N     . SER A 1 319  ? -37.985 -84.713  62.542  1.00 6.94  ? 320  SER A N     1 
ATOM   2415  C  CA    . SER A 1 319  ? -37.324 -86.017  62.552  1.00 7.32  ? 320  SER A CA    1 
ATOM   2416  C  C     . SER A 1 319  ? -36.120 -86.169  61.624  1.00 7.46  ? 320  SER A C     1 
ATOM   2417  O  O     . SER A 1 319  ? -35.387 -87.157  61.760  1.00 7.77  ? 320  SER A O     1 
ATOM   2418  C  CB    . SER A 1 319  ? -38.325 -87.112  62.249  1.00 6.58  ? 320  SER A CB    1 
ATOM   2419  O  OG    . SER A 1 319  ? -38.875 -86.888  60.974  1.00 6.81  ? 320  SER A OG    1 
ATOM   2420  N  N     . ALA A 1 320  ? -35.880 -85.191  60.738  1.00 7.27  ? 321  ALA A N     1 
ATOM   2421  C  CA    . ALA A 1 320  ? -34.770 -85.276  59.778  1.00 7.26  ? 321  ALA A CA    1 
ATOM   2422  C  C     . ALA A 1 320  ? -33.378 -85.381  60.437  1.00 7.10  ? 321  ALA A C     1 
ATOM   2423  O  O     . ALA A 1 320  ? -32.983 -84.540  61.228  1.00 6.43  ? 321  ALA A O     1 
ATOM   2424  C  CB    . ALA A 1 320  ? -34.826 -84.108  58.773  1.00 7.17  ? 321  ALA A CB    1 
ATOM   2425  N  N     . LYS A 1 321  ? -32.688 -86.500  60.180  1.00 7.36  ? 322  LYS A N     1 
ATOM   2426  C  CA    . LYS A 1 321  ? -31.357 -86.736  60.728  1.00 7.10  ? 322  LYS A CA    1 
ATOM   2427  C  C     . LYS A 1 321  ? -30.191 -86.501  59.746  1.00 6.87  ? 322  LYS A C     1 
ATOM   2428  O  O     . LYS A 1 321  ? -29.046 -86.320  60.160  1.00 7.44  ? 322  LYS A O     1 
ATOM   2429  C  CB    . LYS A 1 321  ? -31.277 -88.131  61.365  1.00 7.86  ? 322  LYS A CB    1 
ATOM   2430  C  CG    . LYS A 1 321  ? -31.482 -88.147  62.900  1.00 9.43  ? 322  LYS A CG    1 
ATOM   2431  C  CD    . LYS A 1 321  ? -32.657 -89.009  63.341  0.01 10.28 ? 322  LYS A CD    1 
ATOM   2432  C  CE    . LYS A 1 321  ? -32.933 -88.820  64.831  0.01 11.00 ? 322  LYS A CE    1 
ATOM   2433  N  NZ    . LYS A 1 321  ? -33.987 -89.732  65.364  0.01 11.57 ? 322  LYS A NZ    1 
ATOM   2434  N  N     . VAL A 1 322  ? -30.456 -86.593  58.453  1.00 5.86  ? 323  VAL A N     1 
ATOM   2435  C  CA    . VAL A 1 322  ? -29.428 -86.371  57.455  1.00 4.86  ? 323  VAL A CA    1 
ATOM   2436  C  C     . VAL A 1 322  ? -30.174 -85.674  56.359  1.00 4.95  ? 323  VAL A C     1 
ATOM   2437  O  O     . VAL A 1 322  ? -31.301 -86.012  56.044  1.00 4.63  ? 323  VAL A O     1 
ATOM   2438  C  CB    . VAL A 1 322  ? -28.828 -87.661  56.877  1.00 4.33  ? 323  VAL A CB    1 
ATOM   2439  C  CG1   . VAL A 1 322  ? -27.775 -87.325  55.846  1.00 3.50  ? 323  VAL A CG1   1 
ATOM   2440  C  CG2   . VAL A 1 322  ? -28.227 -88.508  57.965  1.00 3.76  ? 323  VAL A CG2   1 
ATOM   2441  N  N     . ILE A 1 323  ? -29.576 -84.636  55.816  1.00 5.07  ? 324  ILE A N     1 
ATOM   2442  C  CA    . ILE A 1 323  ? -30.253 -83.935  54.758  1.00 5.01  ? 324  ILE A CA    1 
ATOM   2443  C  C     . ILE A 1 323  ? -29.247 -83.546  53.679  1.00 4.57  ? 324  ILE A C     1 
ATOM   2444  O  O     . ILE A 1 323  ? -28.166 -83.037  53.992  1.00 4.42  ? 324  ILE A O     1 
ATOM   2445  C  CB    . ILE A 1 323  ? -31.132 -82.686  55.285  1.00 5.69  ? 324  ILE A CB    1 
ATOM   2446  C  CG1   . ILE A 1 323  ? -30.866 -81.456  54.461  1.00 4.86  ? 324  ILE A CG1   1 
ATOM   2447  C  CG2   . ILE A 1 323  ? -30.899 -82.344  56.746  1.00 6.77  ? 324  ILE A CG2   1 
ATOM   2448  C  CD1   . ILE A 1 323  ? -31.712 -81.465  53.316  1.00 5.42  ? 324  ILE A CD1   1 
ATOM   2449  N  N     . THR A 1 324  ? -29.589 -83.849  52.413  1.00 3.87  ? 325  THR A N     1 
ATOM   2450  C  CA    . THR A 1 324  ? -28.717 -83.492  51.314  1.00 2.78  ? 325  THR A CA    1 
ATOM   2451  C  C     . THR A 1 324  ? -29.319 -82.479  50.380  1.00 2.43  ? 325  THR A C     1 
ATOM   2452  O  O     . THR A 1 324  ? -30.480 -82.557  49.997  1.00 2.00  ? 325  THR A O     1 
ATOM   2453  C  CB    . THR A 1 324  ? -28.030 -84.726  50.622  1.00 2.76  ? 325  THR A CB    1 
ATOM   2454  O  OG1   . THR A 1 324  ? -28.294 -84.777  49.219  1.00 2.77  ? 325  THR A OG1   1 
ATOM   2455  C  CG2   . THR A 1 324  ? -28.458 -85.968  51.238  1.00 2.13  ? 325  THR A CG2   1 
ATOM   2456  N  N     . VAL A 1 325  ? -28.517 -81.450  50.129  1.00 2.36  ? 326  VAL A N     1 
ATOM   2457  C  CA    . VAL A 1 325  ? -28.877 -80.322  49.283  1.00 2.56  ? 326  VAL A CA    1 
ATOM   2458  C  C     . VAL A 1 325  ? -28.323 -80.539  47.876  1.00 2.48  ? 326  VAL A C     1 
ATOM   2459  O  O     . VAL A 1 325  ? -27.120 -80.672  47.703  1.00 2.74  ? 326  VAL A O     1 
ATOM   2460  C  CB    . VAL A 1 325  ? -28.317 -78.999  49.907  1.00 2.63  ? 326  VAL A CB    1 
ATOM   2461  C  CG1   . VAL A 1 325  ? -28.679 -77.843  49.066  1.00 2.17  ? 326  VAL A CG1   1 
ATOM   2462  C  CG2   . VAL A 1 325  ? -28.853 -78.812  51.328  1.00 2.00  ? 326  VAL A CG2   1 
ATOM   2463  N  N     . LEU A 1 326  ? -29.219 -80.684  46.905  1.00 2.71  ? 327  LEU A N     1 
ATOM   2464  C  CA    . LEU A 1 326  ? -28.865 -80.897  45.496  1.00 3.02  ? 327  LEU A CA    1 
ATOM   2465  C  C     . LEU A 1 326  ? -28.763 -79.583  44.695  1.00 3.68  ? 327  LEU A C     1 
ATOM   2466  O  O     . LEU A 1 326  ? -29.660 -78.715  44.756  1.00 3.93  ? 327  LEU A O     1 
ATOM   2467  C  CB    . LEU A 1 326  ? -29.886 -81.819  44.838  1.00 2.86  ? 327  LEU A CB    1 
ATOM   2468  C  CG    . LEU A 1 326  ? -29.577 -83.304  44.762  1.00 2.78  ? 327  LEU A CG    1 
ATOM   2469  C  CD1   . LEU A 1 326  ? -28.554 -83.709  45.801  1.00 3.28  ? 327  LEU A CD1   1 
ATOM   2470  C  CD2   . LEU A 1 326  ? -30.858 -84.099  44.861  1.00 2.02  ? 327  LEU A CD2   1 
ATOM   2471  N  N     . ASP A 1 327  ? -27.660 -79.440  43.956  1.00 3.47  ? 328  ASP A N     1 
ATOM   2472  C  CA    . ASP A 1 327  ? -27.413 -78.251  43.146  1.00 3.27  ? 328  ASP A CA    1 
ATOM   2473  C  C     . ASP A 1 327  ? -27.248 -78.672  41.711  1.00 2.94  ? 328  ASP A C     1 
ATOM   2474  O  O     . ASP A 1 327  ? -26.491 -79.598  41.430  1.00 2.90  ? 328  ASP A O     1 
ATOM   2475  C  CB    . ASP A 1 327  ? -26.143 -77.524  43.584  1.00 3.54  ? 328  ASP A CB    1 
ATOM   2476  C  CG    . ASP A 1 327  ? -26.403 -76.491  44.624  1.00 4.06  ? 328  ASP A CG    1 
ATOM   2477  O  OD1   . ASP A 1 327  ? -26.848 -75.366  44.304  1.00 4.89  ? 328  ASP A OD1   1 
ATOM   2478  O  OD2   . ASP A 1 327  ? -26.132 -76.798  45.778  1.00 5.02  ? 328  ASP A OD2   1 
ATOM   2479  N  N     . ARG A 1 328  ? -27.889 -77.952  40.795  1.00 2.66  ? 329  ARG A N     1 
ATOM   2480  C  CA    . ARG A 1 328  ? -27.795 -78.294  39.390  1.00 2.50  ? 329  ARG A CA    1 
ATOM   2481  C  C     . ARG A 1 328  ? -26.773 -77.380  38.779  1.00 2.74  ? 329  ARG A C     1 
ATOM   2482  O  O     . ARG A 1 328  ? -27.017 -76.837  37.728  1.00 3.63  ? 329  ARG A O     1 
ATOM   2483  C  CB    . ARG A 1 328  ? -29.152 -78.098  38.706  1.00 2.00  ? 329  ARG A CB    1 
ATOM   2484  C  CG    . ARG A 1 328  ? -29.398 -79.105  37.614  1.00 2.00  ? 329  ARG A CG    1 
ATOM   2485  C  CD    . ARG A 1 328  ? -30.658 -78.869  36.809  1.00 2.00  ? 329  ARG A CD    1 
ATOM   2486  N  NE    . ARG A 1 328  ? -30.594 -79.727  35.636  1.00 2.12  ? 329  ARG A NE    1 
ATOM   2487  C  CZ    . ARG A 1 328  ? -31.336 -80.825  35.442  1.00 3.38  ? 329  ARG A CZ    1 
ATOM   2488  N  NH1   . ARG A 1 328  ? -32.259 -81.196  36.328  1.00 3.55  ? 329  ARG A NH1   1 
ATOM   2489  N  NH2   . ARG A 1 328  ? -31.024 -81.667  34.457  1.00 3.10  ? 329  ARG A NH2   1 
ATOM   2490  N  N     . THR A 1 329  ? -25.637 -77.189  39.444  1.00 2.64  ? 330  THR A N     1 
ATOM   2491  C  CA    . THR A 1 329  ? -24.587 -76.294  38.949  1.00 2.72  ? 330  THR A CA    1 
ATOM   2492  C  C     . THR A 1 329  ? -23.215 -76.740  39.427  1.00 2.85  ? 330  THR A C     1 
ATOM   2493  O  O     . THR A 1 329  ? -23.098 -77.630  40.227  1.00 2.96  ? 330  THR A O     1 
ATOM   2494  C  CB    . THR A 1 329  ? -24.765 -74.841  39.505  1.00 2.51  ? 330  THR A CB    1 
ATOM   2495  O  OG1   . THR A 1 329  ? -23.889 -73.935  38.809  1.00 3.10  ? 330  THR A OG1   1 
ATOM   2496  C  CG2   . THR A 1 329  ? -24.390 -74.799  40.968  1.00 2.00  ? 330  THR A CG2   1 
ATOM   2497  N  N     . LYS A 1 330  ? -22.188 -76.015  38.999  1.00 3.24  ? 331  LYS A N     1 
ATOM   2498  C  CA    . LYS A 1 330  ? -20.823 -76.270  39.413  1.00 2.84  ? 331  LYS A CA    1 
ATOM   2499  C  C     . LYS A 1 330  ? -20.105 -74.906  39.549  1.00 2.61  ? 331  LYS A C     1 
ATOM   2500  O  O     . LYS A 1 330  ? -20.030 -74.143  38.590  1.00 2.00  ? 331  LYS A O     1 
ATOM   2501  C  CB    . LYS A 1 330  ? -20.183 -77.201  38.399  1.00 2.51  ? 331  LYS A CB    1 
ATOM   2502  C  CG    . LYS A 1 330  ? -18.676 -77.385  38.447  1.00 2.60  ? 331  LYS A CG    1 
ATOM   2503  C  CD    . LYS A 1 330  ? -18.132 -78.006  39.676  1.00 3.00  ? 331  LYS A CD    1 
ATOM   2504  C  CE    . LYS A 1 330  ? -16.965 -78.913  39.282  1.00 2.11  ? 331  LYS A CE    1 
ATOM   2505  N  NZ    . LYS A 1 330  ? -16.349 -78.407  38.024  1.00 2.41  ? 331  LYS A NZ    1 
ATOM   2506  N  N     . GLU A 1 331  ? -19.711 -74.556  40.773  1.00 2.29  ? 332  GLU A N     1 
ATOM   2507  C  CA    . GLU A 1 331  ? -18.957 -73.307  41.003  1.00 3.00  ? 332  GLU A CA    1 
ATOM   2508  C  C     . GLU A 1 331  ? -17.616 -73.842  41.479  1.00 3.02  ? 332  GLU A C     1 
ATOM   2509  O  O     . GLU A 1 331  ? -17.459 -74.223  42.637  1.00 2.91  ? 332  GLU A O     1 
ATOM   2510  C  CB    . GLU A 1 331  ? -19.575 -72.415  42.099  1.00 2.78  ? 332  GLU A CB    1 
ATOM   2511  C  CG    . GLU A 1 331  ? -21.068 -72.156  41.956  1.00 4.05  ? 332  GLU A CG    1 
ATOM   2512  C  CD    . GLU A 1 331  ? -21.515 -70.737  42.305  1.00 5.03  ? 332  GLU A CD    1 
ATOM   2513  O  OE1   . GLU A 1 331  ? -20.920 -70.081  43.194  1.00 5.02  ? 332  GLU A OE1   1 
ATOM   2514  O  OE2   . GLU A 1 331  ? -22.506 -70.279  41.697  1.00 5.49  ? 332  GLU A OE2   1 
ATOM   2515  N  N     . PRO A 1 332  ? -16.637 -73.890  40.571  1.00 3.35  ? 333  PRO A N     1 
ATOM   2516  C  CA    . PRO A 1 332  ? -15.280 -74.391  40.851  1.00 3.74  ? 333  PRO A CA    1 
ATOM   2517  C  C     . PRO A 1 332  ? -14.604 -73.584  41.972  1.00 4.32  ? 333  PRO A C     1 
ATOM   2518  O  O     . PRO A 1 332  ? -14.677 -72.352  41.988  1.00 4.97  ? 333  PRO A O     1 
ATOM   2519  C  CB    . PRO A 1 332  ? -14.565 -74.213  39.502  1.00 3.33  ? 333  PRO A CB    1 
ATOM   2520  C  CG    . PRO A 1 332  ? -15.667 -74.032  38.484  1.00 2.82  ? 333  PRO A CG    1 
ATOM   2521  C  CD    . PRO A 1 332  ? -16.670 -73.204  39.263  1.00 2.75  ? 333  PRO A CD    1 
ATOM   2522  N  N     . GLY A 1 333  ? -14.011 -74.276  42.945  1.00 4.33  ? 334  GLY A N     1 
ATOM   2523  C  CA    . GLY A 1 333  ? -13.366 -73.578  44.045  1.00 3.45  ? 334  GLY A CA    1 
ATOM   2524  C  C     . GLY A 1 333  ? -14.257 -73.079  45.178  1.00 3.40  ? 334  GLY A C     1 
ATOM   2525  O  O     . GLY A 1 333  ? -13.750 -72.746  46.243  1.00 3.38  ? 334  GLY A O     1 
ATOM   2526  N  N     . ALA A 1 334  ? -15.560 -72.942  44.963  1.00 2.82  ? 335  ALA A N     1 
ATOM   2527  C  CA    . ALA A 1 334  ? -16.428 -72.499  46.039  1.00 2.31  ? 335  ALA A CA    1 
ATOM   2528  C  C     . ALA A 1 334  ? -16.451 -73.586  47.152  1.00 2.60  ? 335  ALA A C     1 
ATOM   2529  O  O     . ALA A 1 334  ? -16.217 -74.764  46.898  1.00 2.00  ? 335  ALA A O     1 
ATOM   2530  C  CB    . ALA A 1 334  ? -17.818 -72.282  45.500  1.00 2.00  ? 335  ALA A CB    1 
ATOM   2531  N  N     . PRO A 1 335  ? -16.679 -73.187  48.418  1.00 2.42  ? 336  PRO A N     1 
ATOM   2532  C  CA    . PRO A 1 335  ? -16.712 -74.209  49.459  1.00 2.18  ? 336  PRO A CA    1 
ATOM   2533  C  C     . PRO A 1 335  ? -17.940 -75.127  49.300  1.00 2.66  ? 336  PRO A C     1 
ATOM   2534  O  O     . PRO A 1 335  ? -18.076 -76.175  49.968  1.00 2.68  ? 336  PRO A O     1 
ATOM   2535  C  CB    . PRO A 1 335  ? -16.789 -73.372  50.738  1.00 2.03  ? 336  PRO A CB    1 
ATOM   2536  C  CG    . PRO A 1 335  ? -17.438 -72.139  50.319  1.00 2.00  ? 336  PRO A CG    1 
ATOM   2537  C  CD    . PRO A 1 335  ? -16.795 -71.842  49.005  1.00 2.06  ? 336  PRO A CD    1 
ATOM   2538  N  N     . GLY A 1 336  ? -18.845 -74.720  48.420  1.00 2.30  ? 337  GLY A N     1 
ATOM   2539  C  CA    . GLY A 1 336  ? -20.048 -75.490  48.178  1.00 2.57  ? 337  GLY A CA    1 
ATOM   2540  C  C     . GLY A 1 336  ? -20.931 -74.689  47.258  1.00 2.92  ? 337  GLY A C     1 
ATOM   2541  O  O     . GLY A 1 336  ? -20.765 -73.453  47.189  1.00 2.79  ? 337  GLY A O     1 
ATOM   2542  N  N     . ASP A 1 337  ? -21.849 -75.388  46.574  1.00 3.03  ? 338  ASP A N     1 
ATOM   2543  C  CA    . ASP A 1 337  ? -22.776 -74.797  45.613  1.00 3.21  ? 338  ASP A CA    1 
ATOM   2544  C  C     . ASP A 1 337  ? -23.828 -73.937  46.293  1.00 2.92  ? 338  ASP A C     1 
ATOM   2545  O  O     . ASP A 1 337  ? -24.080 -74.102  47.483  1.00 2.98  ? 338  ASP A O     1 
ATOM   2546  C  CB    . ASP A 1 337  ? -23.355 -75.880  44.708  1.00 4.31  ? 338  ASP A CB    1 
ATOM   2547  C  CG    . ASP A 1 337  ? -22.319 -76.442  43.775  1.00 5.29  ? 338  ASP A CG    1 
ATOM   2548  O  OD1   . ASP A 1 337  ? -21.461 -75.675  43.285  1.00 6.89  ? 338  ASP A OD1   1 
ATOM   2549  O  OD2   . ASP A 1 337  ? -22.318 -77.660  43.554  1.00 6.93  ? 338  ASP A OD2   1 
ATOM   2550  N  N     . PRO A 1 338  ? -24.452 -73.003  45.543  1.00 2.78  ? 339  PRO A N     1 
ATOM   2551  C  CA    . PRO A 1 338  ? -25.468 -72.050  46.035  1.00 2.74  ? 339  PRO A CA    1 
ATOM   2552  C  C     . PRO A 1 338  ? -26.547 -72.461  47.041  1.00 2.00  ? 339  PRO A C     1 
ATOM   2553  O  O     . PRO A 1 338  ? -26.611 -71.911  48.148  1.00 2.00  ? 339  PRO A O     1 
ATOM   2554  C  CB    . PRO A 1 338  ? -26.003 -71.423  44.736  1.00 2.27  ? 339  PRO A CB    1 
ATOM   2555  C  CG    . PRO A 1 338  ? -24.848 -71.526  43.794  1.00 2.00  ? 339  PRO A CG    1 
ATOM   2556  C  CD    . PRO A 1 338  ? -24.322 -72.887  44.076  1.00 2.33  ? 339  PRO A CD    1 
ATOM   2557  N  N     . LEU A 1 339  ? -27.365 -73.437  46.668  1.00 2.56  ? 340  LEU A N     1 
ATOM   2558  C  CA    . LEU A 1 339  ? -28.454 -73.917  47.541  1.00 2.83  ? 340  LEU A CA    1 
ATOM   2559  C  C     . LEU A 1 339  ? -27.897 -74.528  48.799  1.00 2.66  ? 340  LEU A C     1 
ATOM   2560  O  O     . LEU A 1 339  ? -28.433 -74.296  49.872  1.00 2.89  ? 340  LEU A O     1 
ATOM   2561  C  CB    . LEU A 1 339  ? -29.353 -74.923  46.813  1.00 2.50  ? 340  LEU A CB    1 
ATOM   2562  C  CG    . LEU A 1 339  ? -30.623 -75.410  47.512  1.00 2.33  ? 340  LEU A CG    1 
ATOM   2563  C  CD1   . LEU A 1 339  ? -31.558 -74.284  47.769  1.00 2.03  ? 340  LEU A CD1   1 
ATOM   2564  C  CD2   . LEU A 1 339  ? -31.294 -76.472  46.658  1.00 2.08  ? 340  LEU A CD2   1 
ATOM   2565  N  N     . TYR A 1 340  ? -26.764 -75.223  48.668  1.00 3.11  ? 341  TYR A N     1 
ATOM   2566  C  CA    . TYR A 1 340  ? -26.093 -75.897  49.800  1.00 3.18  ? 341  TYR A CA    1 
ATOM   2567  C  C     . TYR A 1 340  ? -25.613 -74.883  50.823  1.00 3.72  ? 341  TYR A C     1 
ATOM   2568  O  O     . TYR A 1 340  ? -25.818 -75.048  52.042  1.00 4.18  ? 341  TYR A O     1 
ATOM   2569  C  CB    . TYR A 1 340  ? -24.908 -76.716  49.308  1.00 3.00  ? 341  TYR A CB    1 
ATOM   2570  C  CG    . TYR A 1 340  ? -24.013 -77.201  50.417  1.00 3.67  ? 341  TYR A CG    1 
ATOM   2571  C  CD1   . TYR A 1 340  ? -24.404 -78.258  51.237  1.00 4.16  ? 341  TYR A CD1   1 
ATOM   2572  C  CD2   . TYR A 1 340  ? -22.782 -76.606  50.643  1.00 3.42  ? 341  TYR A CD2   1 
ATOM   2573  C  CE1   . TYR A 1 340  ? -23.585 -78.700  52.263  1.00 4.91  ? 341  TYR A CE1   1 
ATOM   2574  C  CE2   . TYR A 1 340  ? -21.958 -77.040  51.649  1.00 4.75  ? 341  TYR A CE2   1 
ATOM   2575  C  CZ    . TYR A 1 340  ? -22.362 -78.083  52.454  1.00 5.02  ? 341  TYR A CZ    1 
ATOM   2576  O  OH    . TYR A 1 340  ? -21.550 -78.493  53.465  1.00 6.65  ? 341  TYR A OH    1 
ATOM   2577  N  N     . LEU A 1 341  ? -24.975 -73.835  50.300  1.00 3.13  ? 342  LEU A N     1 
ATOM   2578  C  CA    . LEU A 1 341  ? -24.472 -72.750  51.077  1.00 2.61  ? 342  LEU A CA    1 
ATOM   2579  C  C     . LEU A 1 341  ? -25.602 -72.039  51.783  1.00 2.64  ? 342  LEU A C     1 
ATOM   2580  O  O     . LEU A 1 341  ? -25.413 -71.616  52.920  1.00 2.78  ? 342  LEU A O     1 
ATOM   2581  C  CB    . LEU A 1 341  ? -23.768 -71.755  50.157  1.00 2.77  ? 342  LEU A CB    1 
ATOM   2582  C  CG    . LEU A 1 341  ? -22.257 -71.727  50.180  1.00 2.21  ? 342  LEU A CG    1 
ATOM   2583  C  CD1   . LEU A 1 341  ? -21.697 -73.110  50.476  1.00 3.28  ? 342  LEU A CD1   1 
ATOM   2584  C  CD2   . LEU A 1 341  ? -21.834 -71.242  48.865  1.00 2.00  ? 342  LEU A CD2   1 
ATOM   2585  N  N     . ASP A 1 342  ? -26.763 -71.912  51.123  1.00 2.55  ? 343  ASP A N     1 
ATOM   2586  C  CA    . ASP A 1 342  ? -27.935 -71.216  51.710  1.00 2.41  ? 343  ASP A CA    1 
ATOM   2587  C  C     . ASP A 1 342  ? -28.571 -72.001  52.846  1.00 2.70  ? 343  ASP A C     1 
ATOM   2588  O  O     . ASP A 1 342  ? -28.972 -71.432  53.860  1.00 3.15  ? 343  ASP A O     1 
ATOM   2589  C  CB    . ASP A 1 342  ? -28.991 -70.935  50.640  1.00 2.12  ? 343  ASP A CB    1 
ATOM   2590  C  CG    . ASP A 1 342  ? -28.544 -69.885  49.626  1.00 2.89  ? 343  ASP A CG    1 
ATOM   2591  O  OD1   . ASP A 1 342  ? -27.688 -69.027  49.955  1.00 2.84  ? 343  ASP A OD1   1 
ATOM   2592  O  OD2   . ASP A 1 342  ? -29.047 -69.915  48.485  1.00 2.28  ? 343  ASP A OD2   1 
ATOM   2593  N  N     . VAL A 1 343  ? -28.659 -73.316  52.647  1.00 2.31  ? 344  VAL A N     1 
ATOM   2594  C  CA    . VAL A 1 343  ? -29.240 -74.217  53.606  1.00 2.00  ? 344  VAL A CA    1 
ATOM   2595  C  C     . VAL A 1 343  ? -28.360 -74.275  54.842  1.00 2.06  ? 344  VAL A C     1 
ATOM   2596  O  O     . VAL A 1 343  ? -28.874 -74.252  55.959  1.00 2.00  ? 344  VAL A O     1 
ATOM   2597  C  CB    . VAL A 1 343  ? -29.408 -75.629  52.988  1.00 2.15  ? 344  VAL A CB    1 
ATOM   2598  C  CG1   . VAL A 1 343  ? -29.595 -76.662  54.061  1.00 2.48  ? 344  VAL A CG1   1 
ATOM   2599  C  CG2   . VAL A 1 343  ? -30.615 -75.673  52.043  1.00 2.00  ? 344  VAL A CG2   1 
ATOM   2600  N  N     . CYS A 1 344  ? -27.037 -74.346  54.638  1.00 2.11  ? 345  CYS A N     1 
ATOM   2601  C  CA    . CYS A 1 344  ? -26.081 -74.381  55.745  1.00 2.40  ? 345  CYS A CA    1 
ATOM   2602  C  C     . CYS A 1 344  ? -26.254 -73.162  56.647  1.00 2.50  ? 345  CYS A C     1 
ATOM   2603  O  O     . CYS A 1 344  ? -26.240 -73.270  57.874  1.00 2.85  ? 345  CYS A O     1 
ATOM   2604  C  CB    . CYS A 1 344  ? -24.658 -74.434  55.218  1.00 2.30  ? 345  CYS A CB    1 
ATOM   2605  S  SG    . CYS A 1 344  ? -24.216 -75.996  54.452  1.00 4.07  ? 345  CYS A SG    1 
ATOM   2606  N  N     . SER A 1 345  ? -26.534 -72.038  55.996  1.00 2.58  ? 346  SER A N     1 
ATOM   2607  C  CA    . SER A 1 345  ? -26.750 -70.751  56.585  1.00 2.98  ? 346  SER A CA    1 
ATOM   2608  C  C     . SER A 1 345  ? -27.944 -70.752  57.512  1.00 3.43  ? 346  SER A C     1 
ATOM   2609  O  O     . SER A 1 345  ? -27.901 -70.227  58.610  1.00 4.27  ? 346  SER A O     1 
ATOM   2610  C  CB    . SER A 1 345  ? -27.052 -69.807  55.448  1.00 3.20  ? 346  SER A CB    1 
ATOM   2611  O  OG    . SER A 1 345  ? -26.559 -68.536  55.700  1.00 4.34  ? 346  SER A OG    1 
ATOM   2612  N  N     . ALA A 1 346  ? -29.052 -71.276  57.017  1.00 3.82  ? 347  ALA A N     1 
ATOM   2613  C  CA    . ALA A 1 346  ? -30.280 -71.318  57.770  1.00 2.97  ? 347  ALA A CA    1 
ATOM   2614  C  C     . ALA A 1 346  ? -30.044 -72.135  59.001  1.00 3.19  ? 347  ALA A C     1 
ATOM   2615  O  O     . ALA A 1 346  ? -30.489 -71.725  60.052  1.00 3.57  ? 347  ALA A O     1 
ATOM   2616  C  CB    . ALA A 1 346  ? -31.395 -71.889  56.931  1.00 2.34  ? 347  ALA A CB    1 
ATOM   2617  N  N     . PHE A 1 347  ? -29.342 -73.275  58.889  1.00 3.43  ? 348  PHE A N     1 
ATOM   2618  C  CA    . PHE A 1 347  ? -29.065 -74.127  60.056  1.00 3.71  ? 348  PHE A CA    1 
ATOM   2619  C  C     . PHE A 1 347  ? -28.173 -73.452  61.083  1.00 4.19  ? 348  PHE A C     1 
ATOM   2620  O  O     . PHE A 1 347  ? -28.469 -73.535  62.258  1.00 4.81  ? 348  PHE A O     1 
ATOM   2621  C  CB    . PHE A 1 347  ? -28.509 -75.521  59.699  1.00 3.26  ? 348  PHE A CB    1 
ATOM   2622  C  CG    . PHE A 1 347  ? -29.562 -76.493  59.205  1.00 3.22  ? 348  PHE A CG    1 
ATOM   2623  C  CD1   . PHE A 1 347  ? -30.491 -77.060  60.082  1.00 2.60  ? 348  PHE A CD1   1 
ATOM   2624  C  CD2   . PHE A 1 347  ? -29.690 -76.780  57.840  1.00 3.01  ? 348  PHE A CD2   1 
ATOM   2625  C  CE1   . PHE A 1 347  ? -31.529 -77.891  59.588  1.00 2.86  ? 348  PHE A CE1   1 
ATOM   2626  C  CE2   . PHE A 1 347  ? -30.737 -77.610  57.371  1.00 2.60  ? 348  PHE A CE2   1 
ATOM   2627  C  CZ    . PHE A 1 347  ? -31.647 -78.159  58.248  1.00 2.00  ? 348  PHE A CZ    1 
ATOM   2628  N  N     . VAL A 1 348  ? -27.121 -72.752  60.687  1.00 4.25  ? 349  VAL A N     1 
ATOM   2629  C  CA    . VAL A 1 348  ? -26.325 -72.099  61.731  1.00 5.32  ? 349  VAL A CA    1 
ATOM   2630  C  C     . VAL A 1 348  ? -27.077 -70.899  62.324  1.00 6.27  ? 349  VAL A C     1 
ATOM   2631  O  O     . VAL A 1 348  ? -27.039 -70.642  63.528  1.00 6.82  ? 349  VAL A O     1 
ATOM   2632  C  CB    . VAL A 1 348  ? -24.892 -71.659  61.266  1.00 4.70  ? 349  VAL A CB    1 
ATOM   2633  C  CG1   . VAL A 1 348  ? -24.361 -72.571  60.167  1.00 2.62  ? 349  VAL A CG1   1 
ATOM   2634  C  CG2   . VAL A 1 348  ? -24.874 -70.201  60.891  1.00 4.73  ? 349  VAL A CG2   1 
ATOM   2635  N  N     . GLU A 1 349  ? -27.801 -70.194  61.479  1.00 7.57  ? 350  GLU A N     1 
ATOM   2636  C  CA    . GLU A 1 349  ? -28.576 -69.037  61.915  1.00 9.27  ? 350  GLU A CA    1 
ATOM   2637  C  C     . GLU A 1 349  ? -29.511 -69.467  63.047  1.00 9.46  ? 350  GLU A C     1 
ATOM   2638  O  O     . GLU A 1 349  ? -29.763 -68.721  64.000  1.00 9.51  ? 350  GLU A O     1 
ATOM   2639  C  CB    . GLU A 1 349  ? -29.405 -68.515  60.721  1.00 10.67 ? 350  GLU A CB    1 
ATOM   2640  C  CG    . GLU A 1 349  ? -30.439 -67.439  61.026  1.00 12.56 ? 350  GLU A CG    1 
ATOM   2641  C  CD    . GLU A 1 349  ? -29.925 -66.048  60.688  1.00 13.97 ? 350  GLU A CD    1 
ATOM   2642  O  OE1   . GLU A 1 349  ? -28.907 -65.985  59.948  1.00 15.58 ? 350  GLU A OE1   1 
ATOM   2643  O  OE2   . GLU A 1 349  ? -30.529 -65.041  61.136  1.00 13.39 ? 350  GLU A OE2   1 
ATOM   2644  N  N     . ARG A 1 350  ? -29.996 -70.693  62.928  1.00 9.68  ? 351  ARG A N     1 
ATOM   2645  C  CA    . ARG A 1 350  ? -30.910 -71.280  63.888  1.00 9.79  ? 351  ARG A CA    1 
ATOM   2646  C  C     . ARG A 1 350  ? -30.266 -71.454  65.245  1.00 10.14 ? 351  ARG A C     1 
ATOM   2647  O  O     . ARG A 1 350  ? -30.865 -71.144  66.284  1.00 10.12 ? 351  ARG A O     1 
ATOM   2648  C  CB    . ARG A 1 350  ? -31.399 -72.634  63.382  1.00 9.33  ? 351  ARG A CB    1 
ATOM   2649  C  CG    . ARG A 1 350  ? -32.779 -72.922  63.817  1.00 8.98  ? 351  ARG A CG    1 
ATOM   2650  C  CD    . ARG A 1 350  ? -32.817 -74.251  64.437  1.00 8.35  ? 351  ARG A CD    1 
ATOM   2651  N  NE    . ARG A 1 350  ? -33.451 -75.274  63.607  1.00 8.66  ? 351  ARG A NE    1 
ATOM   2652  C  CZ    . ARG A 1 350  ? -32.915 -76.462  63.300  1.00 9.19  ? 351  ARG A CZ    1 
ATOM   2653  N  NH1   . ARG A 1 350  ? -31.705 -76.796  63.722  1.00 10.16 ? 351  ARG A NH1   1 
ATOM   2654  N  NH2   . ARG A 1 350  ? -33.628 -77.378  62.666  1.00 8.74  ? 351  ARG A NH2   1 
ATOM   2655  N  N     . GLY A 1 351  ? -29.030 -71.916  65.246  1.00 10.76 ? 352  GLY A N     1 
ATOM   2656  C  CA    . GLY A 1 351  ? -28.350 -72.123  66.511  1.00 12.64 ? 352  GLY A CA    1 
ATOM   2657  C  C     . GLY A 1 351  ? -28.867 -73.311  67.331  1.00 13.88 ? 352  GLY A C     1 
ATOM   2658  O  O     . GLY A 1 351  ? -28.773 -73.326  68.568  1.00 14.49 ? 352  GLY A O     1 
ATOM   2659  N  N     . GLU A 1 352  ? -29.499 -74.276  66.680  1.00 14.28 ? 353  GLU A N     1 
ATOM   2660  C  CA    . GLU A 1 352  ? -29.973 -75.424  67.417  1.00 14.93 ? 353  GLU A CA    1 
ATOM   2661  C  C     . GLU A 1 352  ? -29.287 -76.650  66.856  1.00 15.40 ? 353  GLU A C     1 
ATOM   2662  O  O     . GLU A 1 352  ? -28.104 -76.597  66.526  1.00 15.94 ? 353  GLU A O     1 
ATOM   2663  C  CB    . GLU A 1 352  ? -31.492 -75.527  67.372  1.00 15.53 ? 353  GLU A CB    1 
ATOM   2664  C  CG    . GLU A 1 352  ? -32.169 -74.532  68.316  0.01 16.30 ? 353  GLU A CG    1 
ATOM   2665  C  CD    . GLU A 1 352  ? -33.659 -74.382  68.080  0.01 16.73 ? 353  GLU A CD    1 
ATOM   2666  O  OE1   . GLU A 1 352  ? -34.327 -75.386  67.759  0.01 16.99 ? 353  GLU A OE1   1 
ATOM   2667  O  OE2   . GLU A 1 352  ? -34.164 -73.248  68.219  0.01 17.01 ? 353  GLU A OE2   1 
ATOM   2668  N  N     . ALA A 1 353  ? -30.013 -77.746  66.730  1.00 15.67 ? 354  ALA A N     1 
ATOM   2669  C  CA    . ALA A 1 353  ? -29.454 -78.988  66.221  1.00 15.32 ? 354  ALA A CA    1 
ATOM   2670  C  C     . ALA A 1 353  ? -28.961 -78.925  64.766  1.00 15.41 ? 354  ALA A C     1 
ATOM   2671  O  O     . ALA A 1 353  ? -29.525 -78.222  63.927  1.00 16.43 ? 354  ALA A O     1 
ATOM   2672  C  CB    . ALA A 1 353  ? -30.472 -80.070  66.377  1.00 15.14 ? 354  ALA A CB    1 
ATOM   2673  N  N     . MET A 1 354  ? -27.873 -79.629  64.484  1.00 14.83 ? 355  MET A N     1 
ATOM   2674  C  CA    . MET A 1 354  ? -27.307 -79.677  63.139  1.00 14.46 ? 355  MET A CA    1 
ATOM   2675  C  C     . MET A 1 354  ? -27.510 -81.099  62.649  1.00 13.26 ? 355  MET A C     1 
ATOM   2676  O  O     . MET A 1 354  ? -26.854 -82.020  63.121  1.00 12.81 ? 355  MET A O     1 
ATOM   2677  C  CB    . MET A 1 354  ? -25.792 -79.404  63.150  1.00 15.94 ? 355  MET A CB    1 
ATOM   2678  C  CG    . MET A 1 354  ? -25.340 -77.961  63.474  1.00 17.20 ? 355  MET A CG    1 
ATOM   2679  S  SD    . MET A 1 354  ? -25.946 -76.708  62.346  1.00 17.86 ? 355  MET A SD    1 
ATOM   2680  C  CE    . MET A 1 354  ? -26.922 -75.839  63.452  1.00 17.92 ? 355  MET A CE    1 
ATOM   2681  N  N     . PRO A 1 355  ? -28.401 -81.280  61.673  1.00 12.14 ? 356  PRO A N     1 
ATOM   2682  C  CA    . PRO A 1 355  ? -28.765 -82.543  61.052  1.00 11.62 ? 356  PRO A CA    1 
ATOM   2683  C  C     . PRO A 1 355  ? -27.740 -83.274  60.190  1.00 11.25 ? 356  PRO A C     1 
ATOM   2684  O  O     . PRO A 1 355  ? -28.017 -84.391  59.791  1.00 11.86 ? 356  PRO A O     1 
ATOM   2685  C  CB    . PRO A 1 355  ? -29.973 -82.156  60.196  1.00 11.05 ? 356  PRO A CB    1 
ATOM   2686  C  CG    . PRO A 1 355  ? -30.570 -81.061  60.944  1.00 11.60 ? 356  PRO A CG    1 
ATOM   2687  C  CD    . PRO A 1 355  ? -29.349 -80.235  61.271  1.00 12.10 ? 356  PRO A CD    1 
ATOM   2688  N  N     . LYS A 1 356  ? -26.563 -82.716  59.933  1.00 9.98  ? 357  LYS A N     1 
ATOM   2689  C  CA    . LYS A 1 356  ? -25.605 -83.401  59.026  1.00 9.39  ? 357  LYS A CA    1 
ATOM   2690  C  C     . LYS A 1 356  ? -26.075 -83.181  57.601  1.00 8.07  ? 357  LYS A C     1 
ATOM   2691  O  O     . LYS A 1 356  ? -26.880 -83.955  57.077  1.00 7.52  ? 357  LYS A O     1 
ATOM   2692  C  CB    . LYS A 1 356  ? -25.485 -84.914  59.219  1.00 10.12 ? 357  LYS A CB    1 
ATOM   2693  C  CG    . LYS A 1 356  ? -24.507 -85.539  58.206  1.00 12.58 ? 357  LYS A CG    1 
ATOM   2694  C  CD    . LYS A 1 356  ? -23.054 -84.978  58.417  1.00 14.86 ? 357  LYS A CD    1 
ATOM   2695  C  CE    . LYS A 1 356  ? -22.004 -85.419  57.366  1.00 15.70 ? 357  LYS A CE    1 
ATOM   2696  N  NZ    . LYS A 1 356  ? -20.662 -84.696  57.520  1.00 17.04 ? 357  LYS A NZ    1 
ATOM   2697  N  N     . ILE A 1 357  ? -25.552 -82.104  57.008  1.00 7.25  ? 358  ILE A N     1 
ATOM   2698  C  CA    . ILE A 1 357  ? -25.861 -81.633  55.654  1.00 5.56  ? 358  ILE A CA    1 
ATOM   2699  C  C     . ILE A 1 357  ? -24.801 -82.112  54.647  1.00 4.72  ? 358  ILE A C     1 
ATOM   2700  O  O     . ILE A 1 357  ? -23.593 -81.881  54.825  1.00 4.94  ? 358  ILE A O     1 
ATOM   2701  C  CB    . ILE A 1 357  ? -25.983 -80.043  55.644  1.00 4.78  ? 358  ILE A CB    1 
ATOM   2702  C  CG1   . ILE A 1 357  ? -27.048 -79.574  56.638  1.00 5.16  ? 358  ILE A CG1   1 
ATOM   2703  C  CG2   . ILE A 1 357  ? -26.528 -79.556  54.308  1.00 5.02  ? 358  ILE A CG2   1 
ATOM   2704  C  CD1   . ILE A 1 357  ? -26.595 -79.332  58.043  1.00 5.22  ? 358  ILE A CD1   1 
ATOM   2705  N  N     . LEU A 1 358  ? -25.269 -82.770  53.590  1.00 3.90  ? 359  LEU A N     1 
ATOM   2706  C  CA    . LEU A 1 358  ? -24.412 -83.327  52.536  1.00 2.72  ? 359  LEU A CA    1 
ATOM   2707  C  C     . LEU A 1 358  ? -24.631 -82.523  51.274  1.00 2.49  ? 359  LEU A C     1 
ATOM   2708  O  O     . LEU A 1 358  ? -25.736 -82.095  51.030  1.00 2.54  ? 359  LEU A O     1 
ATOM   2709  C  CB    . LEU A 1 358  ? -24.841 -84.761  52.274  1.00 2.66  ? 359  LEU A CB    1 
ATOM   2710  C  CG    . LEU A 1 358  ? -24.177 -86.016  52.832  1.00 2.51  ? 359  LEU A CG    1 
ATOM   2711  C  CD1   . LEU A 1 358  ? -23.266 -85.724  53.965  1.00 3.35  ? 359  LEU A CD1   1 
ATOM   2712  C  CD2   . LEU A 1 358  ? -25.215 -87.003  53.239  1.00 2.00  ? 359  LEU A CD2   1 
ATOM   2713  N  N     . ALA A 1 359  ? -23.593 -82.286  50.482  1.00 2.24  ? 360  ALA A N     1 
ATOM   2714  C  CA    . ALA A 1 359  ? -23.767 -81.543  49.246  1.00 2.33  ? 360  ALA A CA    1 
ATOM   2715  C  C     . ALA A 1 359  ? -23.710 -82.515  48.087  1.00 2.52  ? 360  ALA A C     1 
ATOM   2716  O  O     . ALA A 1 359  ? -22.856 -83.410  48.051  1.00 2.04  ? 360  ALA A O     1 
ATOM   2717  C  CB    . ALA A 1 359  ? -22.702 -80.444  49.086  1.00 2.00  ? 360  ALA A CB    1 
ATOM   2718  N  N     . GLY A 1 360  ? -24.595 -82.308  47.116  1.00 2.56  ? 361  GLY A N     1 
ATOM   2719  C  CA    . GLY A 1 360  ? -24.637 -83.167  45.940  1.00 3.30  ? 361  GLY A CA    1 
ATOM   2720  C  C     . GLY A 1 360  ? -24.925 -82.413  44.638  1.00 3.26  ? 361  GLY A C     1 
ATOM   2721  O  O     . GLY A 1 360  ? -25.716 -81.488  44.634  1.00 4.20  ? 361  GLY A O     1 
ATOM   2722  N  N     . ARG A 1 361  ? -24.345 -82.831  43.519  1.00 2.99  ? 362  ARG A N     1 
ATOM   2723  C  CA    . ARG A 1 361  ? -24.541 -82.119  42.266  1.00 2.52  ? 362  ARG A CA    1 
ATOM   2724  C  C     . ARG A 1 361  ? -25.041 -83.098  41.233  1.00 2.75  ? 362  ARG A C     1 
ATOM   2725  O  O     . ARG A 1 361  ? -24.617 -84.297  41.201  1.00 2.49  ? 362  ARG A O     1 
ATOM   2726  C  CB    . ARG A 1 361  ? -23.219 -81.465  41.827  1.00 2.54  ? 362  ARG A CB    1 
ATOM   2727  C  CG    . ARG A 1 361  ? -23.162 -80.935  40.389  1.00 2.68  ? 362  ARG A CG    1 
ATOM   2728  C  CD    . ARG A 1 361  ? -21.956 -80.031  40.156  1.00 3.27  ? 362  ARG A CD    1 
ATOM   2729  N  NE    . ARG A 1 361  ? -20.732 -80.611  40.687  1.00 6.32  ? 362  ARG A NE    1 
ATOM   2730  C  CZ    . ARG A 1 361  ? -20.012 -80.107  41.687  1.00 5.95  ? 362  ARG A CZ    1 
ATOM   2731  N  NH1   . ARG A 1 361  ? -20.367 -78.984  42.271  1.00 5.07  ? 362  ARG A NH1   1 
ATOM   2732  N  NH2   . ARG A 1 361  ? -19.003 -80.808  42.189  1.00 7.21  ? 362  ARG A NH2   1 
ATOM   2733  N  N     . TYR A 1 362  ? -25.943 -82.584  40.399  1.00 2.17  ? 363  TYR A N     1 
ATOM   2734  C  CA    . TYR A 1 362  ? -26.562 -83.378  39.356  1.00 2.78  ? 363  TYR A CA    1 
ATOM   2735  C  C     . TYR A 1 362  ? -26.874 -82.625  38.075  1.00 2.65  ? 363  TYR A C     1 
ATOM   2736  O  O     . TYR A 1 362  ? -26.624 -81.448  37.944  1.00 3.43  ? 363  TYR A O     1 
ATOM   2737  C  CB    . TYR A 1 362  ? -27.867 -84.000  39.906  1.00 2.51  ? 363  TYR A CB    1 
ATOM   2738  C  CG    . TYR A 1 362  ? -28.954 -82.988  40.135  1.00 2.07  ? 363  TYR A CG    1 
ATOM   2739  C  CD1   . TYR A 1 362  ? -28.806 -82.009  41.104  1.00 2.07  ? 363  TYR A CD1   1 
ATOM   2740  C  CD2   . TYR A 1 362  ? -30.102 -82.975  39.359  1.00 2.00  ? 363  TYR A CD2   1 
ATOM   2741  C  CE1   . TYR A 1 362  ? -29.756 -81.042  41.304  1.00 2.00  ? 363  TYR A CE1   1 
ATOM   2742  C  CE2   . TYR A 1 362  ? -31.061 -82.011  39.553  1.00 2.00  ? 363  TYR A CE2   1 
ATOM   2743  C  CZ    . TYR A 1 362  ? -30.869 -81.041  40.531  1.00 2.00  ? 363  TYR A CZ    1 
ATOM   2744  O  OH    . TYR A 1 362  ? -31.771 -80.037  40.743  1.00 2.00  ? 363  TYR A OH    1 
ATOM   2745  N  N     . GLY A 1 363  ? -27.393 -83.370  37.121  1.00 3.13  ? 364  GLY A N     1 
ATOM   2746  C  CA    . GLY A 1 363  ? -27.841 -82.882  35.831  1.00 3.23  ? 364  GLY A CA    1 
ATOM   2747  C  C     . GLY A 1 363  ? -27.219 -81.754  35.041  1.00 3.48  ? 364  GLY A C     1 
ATOM   2748  O  O     . GLY A 1 363  ? -27.945 -81.026  34.352  1.00 3.61  ? 364  GLY A O     1 
ATOM   2749  N  N     . LEU A 1 364  ? -25.899 -81.631  35.067  1.00 2.89  ? 365  LEU A N     1 
ATOM   2750  C  CA    . LEU A 1 364  ? -25.261 -80.584  34.307  1.00 2.41  ? 365  LEU A CA    1 
ATOM   2751  C  C     . LEU A 1 364  ? -25.526 -80.842  32.833  1.00 2.70  ? 365  LEU A C     1 
ATOM   2752  O  O     . LEU A 1 364  ? -25.474 -82.004  32.361  1.00 2.00  ? 365  LEU A O     1 
ATOM   2753  C  CB    . LEU A 1 364  ? -23.771 -80.547  34.578  1.00 2.00  ? 365  LEU A CB    1 
ATOM   2754  C  CG    . LEU A 1 364  ? -23.312 -79.548  35.609  1.00 2.00  ? 365  LEU A CG    1 
ATOM   2755  C  CD1   . LEU A 1 364  ? -24.189 -79.591  36.780  1.00 2.05  ? 365  LEU A CD1   1 
ATOM   2756  C  CD2   . LEU A 1 364  ? -21.890 -79.821  35.974  1.00 2.00  ? 365  LEU A CD2   1 
ATOM   2757  N  N     . GLY A 1 365  ? -25.906 -79.767  32.138  1.00 2.59  ? 366  GLY A N     1 
ATOM   2758  C  CA    . GLY A 1 365  ? -26.201 -79.849  30.715  1.00 3.61  ? 366  GLY A CA    1 
ATOM   2759  C  C     . GLY A 1 365  ? -27.144 -80.999  30.315  1.00 4.37  ? 366  GLY A C     1 
ATOM   2760  O  O     . GLY A 1 365  ? -26.790 -81.813  29.441  1.00 5.18  ? 366  GLY A O     1 
ATOM   2761  N  N     . SER A 1 366  ? -28.318 -81.076  30.960  1.00 3.86  ? 367  SER A N     1 
ATOM   2762  C  CA    . SER A 1 366  ? -29.329 -82.119  30.733  1.00 3.06  ? 367  SER A CA    1 
ATOM   2763  C  C     . SER A 1 366  ? -28.940 -83.563  31.085  1.00 3.48  ? 367  SER A C     1 
ATOM   2764  O  O     . SER A 1 366  ? -29.520 -84.549  30.573  1.00 4.09  ? 367  SER A O     1 
ATOM   2765  C  CB    . SER A 1 366  ? -29.901 -82.043  29.319  1.00 3.17  ? 367  SER A CB    1 
ATOM   2766  O  OG    . SER A 1 366  ? -30.991 -81.123  29.248  1.00 4.53  ? 367  SER A OG    1 
ATOM   2767  N  N     . LYS A 1 367  ? -27.981 -83.736  31.983  1.00 3.24  ? 368  LYS A N     1 
ATOM   2768  C  CA    . LYS A 1 367  ? -27.635 -85.087  32.351  1.00 2.71  ? 368  LYS A CA    1 
ATOM   2769  C  C     . LYS A 1 367  ? -28.864 -85.664  33.031  1.00 3.30  ? 368  LYS A C     1 
ATOM   2770  O  O     . LYS A 1 367  ? -29.569 -84.977  33.788  1.00 2.31  ? 368  LYS A O     1 
ATOM   2771  C  CB    . LYS A 1 367  ? -26.457 -85.141  33.315  1.00 2.35  ? 368  LYS A CB    1 
ATOM   2772  C  CG    . LYS A 1 367  ? -26.120 -86.553  33.742  1.00 2.00  ? 368  LYS A CG    1 
ATOM   2773  C  CD    . LYS A 1 367  ? -25.549 -87.339  32.595  1.00 2.00  ? 368  LYS A CD    1 
ATOM   2774  C  CE    . LYS A 1 367  ? -24.066 -87.079  32.409  1.00 2.08  ? 368  LYS A CE    1 
ATOM   2775  N  NZ    . LYS A 1 367  ? -23.551 -87.625  31.156  1.00 2.00  ? 368  LYS A NZ    1 
ATOM   2776  N  N     . GLU A 1 368  ? -29.140 -86.925  32.711  1.00 3.62  ? 369  GLU A N     1 
ATOM   2777  C  CA    . GLU A 1 368  ? -30.247 -87.624  33.307  1.00 4.21  ? 369  GLU A CA    1 
ATOM   2778  C  C     . GLU A 1 368  ? -30.145 -87.617  34.807  1.00 3.47  ? 369  GLU A C     1 
ATOM   2779  O  O     . GLU A 1 368  ? -29.044 -87.652  35.357  1.00 3.62  ? 369  GLU A O     1 
ATOM   2780  C  CB    . GLU A 1 368  ? -30.229 -89.091  32.878  1.00 5.99  ? 369  GLU A CB    1 
ATOM   2781  C  CG    . GLU A 1 368  ? -30.889 -89.355  31.537  1.00 8.19  ? 369  GLU A CG    1 
ATOM   2782  C  CD    . GLU A 1 368  ? -32.368 -89.159  31.625  1.00 9.81  ? 369  GLU A CD    1 
ATOM   2783  O  OE1   . GLU A 1 368  ? -32.843 -88.005  31.428  1.00 11.15 ? 369  GLU A OE1   1 
ATOM   2784  O  OE2   . GLU A 1 368  ? -33.050 -90.166  31.914  1.00 10.86 ? 369  GLU A OE2   1 
ATOM   2785  N  N     . PHE A 1 369  ? -31.301 -87.523  35.453  1.00 2.67  ? 370  PHE A N     1 
ATOM   2786  C  CA    . PHE A 1 369  ? -31.403 -87.619  36.895  1.00 2.07  ? 370  PHE A CA    1 
ATOM   2787  C  C     . PHE A 1 369  ? -32.591 -88.559  36.971  1.00 2.46  ? 370  PHE A C     1 
ATOM   2788  O  O     . PHE A 1 369  ? -33.752 -88.159  36.871  1.00 2.14  ? 370  PHE A O     1 
ATOM   2789  C  CB    . PHE A 1 369  ? -31.666 -86.288  37.563  1.00 2.29  ? 370  PHE A CB    1 
ATOM   2790  C  CG    . PHE A 1 369  ? -31.527 -86.326  39.072  1.00 2.48  ? 370  PHE A CG    1 
ATOM   2791  C  CD1   . PHE A 1 369  ? -30.312 -86.685  39.658  1.00 2.22  ? 370  PHE A CD1   1 
ATOM   2792  C  CD2   . PHE A 1 369  ? -32.631 -86.035  39.914  1.00 2.40  ? 370  PHE A CD2   1 
ATOM   2793  C  CE1   . PHE A 1 369  ? -30.198 -86.763  41.046  1.00 2.34  ? 370  PHE A CE1   1 
ATOM   2794  C  CE2   . PHE A 1 369  ? -32.517 -86.112  41.314  1.00 2.02  ? 370  PHE A CE2   1 
ATOM   2795  C  CZ    . PHE A 1 369  ? -31.319 -86.471  41.875  1.00 2.16  ? 370  PHE A CZ    1 
ATOM   2796  N  N     . SER A 1 370  ? -32.257 -89.844  37.005  1.00 2.25  ? 371  SER A N     1 
ATOM   2797  C  CA    . SER A 1 370  ? -33.231 -90.904  37.026  1.00 2.36  ? 371  SER A CA    1 
ATOM   2798  C  C     . SER A 1 370  ? -33.604 -91.443  38.401  1.00 2.31  ? 371  SER A C     1 
ATOM   2799  O  O     . SER A 1 370  ? -32.999 -91.100  39.383  1.00 2.92  ? 371  SER A O     1 
ATOM   2800  C  CB    . SER A 1 370  ? -32.646 -92.053  36.224  1.00 2.32  ? 371  SER A CB    1 
ATOM   2801  O  OG    . SER A 1 370  ? -31.549 -92.616  36.928  1.00 2.01  ? 371  SER A OG    1 
ATOM   2802  N  N     . PRO A 1 371  ? -34.684 -92.232  38.488  1.00 2.67  ? 372  PRO A N     1 
ATOM   2803  C  CA    . PRO A 1 371  ? -35.080 -92.812  39.767  1.00 2.52  ? 372  PRO A CA    1 
ATOM   2804  C  C     . PRO A 1 371  ? -33.887 -93.539  40.370  1.00 2.58  ? 372  PRO A C     1 
ATOM   2805  O  O     . PRO A 1 371  ? -33.628 -93.332  41.551  1.00 3.19  ? 372  PRO A O     1 
ATOM   2806  C  CB    . PRO A 1 371  ? -36.168 -93.785  39.348  1.00 2.09  ? 372  PRO A CB    1 
ATOM   2807  C  CG    . PRO A 1 371  ? -36.898 -92.966  38.348  1.00 2.00  ? 372  PRO A CG    1 
ATOM   2808  C  CD    . PRO A 1 371  ? -35.763 -92.427  37.489  1.00 2.17  ? 372  PRO A CD    1 
ATOM   2809  N  N     . ALA A 1 372  ? -33.102 -94.283  39.561  1.00 2.88  ? 373  ALA A N     1 
ATOM   2810  C  CA    . ALA A 1 372  ? -31.906 -95.018  40.075  1.00 2.56  ? 373  ALA A CA    1 
ATOM   2811  C  C     . ALA A 1 372  ? -30.892 -94.093  40.721  1.00 2.53  ? 373  ALA A C     1 
ATOM   2812  O  O     . ALA A 1 372  ? -30.219 -94.460  41.659  1.00 2.11  ? 373  ALA A O     1 
ATOM   2813  C  CB    . ALA A 1 372  ? -31.242 -95.799  38.998  1.00 2.02  ? 373  ALA A CB    1 
ATOM   2814  N  N     . MET A 1 373  ? -30.809 -92.877  40.201  1.00 2.91  ? 374  MET A N     1 
ATOM   2815  C  CA    . MET A 1 373  ? -29.918 -91.860  40.729  1.00 3.31  ? 374  MET A CA    1 
ATOM   2816  C  C     . MET A 1 373  ? -30.454 -91.269  42.013  1.00 4.25  ? 374  MET A C     1 
ATOM   2817  O  O     . MET A 1 373  ? -29.668 -90.864  42.881  1.00 5.01  ? 374  MET A O     1 
ATOM   2818  C  CB    . MET A 1 373  ? -29.711 -90.736  39.721  1.00 2.49  ? 374  MET A CB    1 
ATOM   2819  C  CG    . MET A 1 373  ? -28.900 -91.164  38.548  1.00 2.68  ? 374  MET A CG    1 
ATOM   2820  S  SD    . MET A 1 373  ? -28.642 -89.823  37.441  1.00 3.95  ? 374  MET A SD    1 
ATOM   2821  C  CE    . MET A 1 373  ? -28.217 -90.792  35.968  1.00 3.17  ? 374  MET A CE    1 
ATOM   2822  N  N     . VAL A 1 374  ? -31.785 -91.153  42.113  1.00 4.70  ? 375  VAL A N     1 
ATOM   2823  C  CA    . VAL A 1 374  ? -32.422 -90.607  43.306  1.00 4.11  ? 375  VAL A CA    1 
ATOM   2824  C  C     . VAL A 1 374  ? -32.279 -91.627  44.433  1.00 4.27  ? 375  VAL A C     1 
ATOM   2825  O  O     . VAL A 1 374  ? -31.880 -91.291  45.538  1.00 4.75  ? 375  VAL A O     1 
ATOM   2826  C  CB    . VAL A 1 374  ? -33.895 -90.305  43.055  1.00 3.67  ? 375  VAL A CB    1 
ATOM   2827  C  CG1   . VAL A 1 374  ? -34.519 -89.659  44.275  1.00 3.08  ? 375  VAL A CG1   1 
ATOM   2828  C  CG2   . VAL A 1 374  ? -34.041 -89.417  41.860  1.00 2.73  ? 375  VAL A CG2   1 
ATOM   2829  N  N     . LYS A 1 375  ? -32.592 -92.882  44.148  1.00 4.52  ? 376  LYS A N     1 
ATOM   2830  C  CA    . LYS A 1 375  ? -32.448 -93.938  45.139  1.00 4.79  ? 376  LYS A CA    1 
ATOM   2831  C  C     . LYS A 1 375  ? -31.016 -93.887  45.655  1.00 4.53  ? 376  LYS A C     1 
ATOM   2832  O  O     . LYS A 1 375  ? -30.766 -93.969  46.836  1.00 5.54  ? 376  LYS A O     1 
ATOM   2833  C  CB    . LYS A 1 375  ? -32.726 -95.290  44.475  1.00 6.04  ? 376  LYS A CB    1 
ATOM   2834  C  CG    . LYS A 1 375  ? -32.261 -96.557  45.229  1.00 6.19  ? 376  LYS A CG    1 
ATOM   2835  C  CD    . LYS A 1 375  ? -33.204 -96.925  46.338  1.00 8.79  ? 376  LYS A CD    1 
ATOM   2836  C  CE    . LYS A 1 375  ? -33.056 -98.389  46.719  1.00 10.13 ? 376  LYS A CE    1 
ATOM   2837  N  NZ    . LYS A 1 375  ? -32.355 -98.497  48.028  1.00 12.13 ? 376  LYS A NZ    1 
ATOM   2838  N  N     . SER A 1 376  ? -30.059 -93.737  44.763  1.00 4.59  ? 377  SER A N     1 
ATOM   2839  C  CA    . SER A 1 376  ? -28.653 -93.649  45.173  1.00 4.52  ? 377  SER A CA    1 
ATOM   2840  C  C     . SER A 1 376  ? -28.344 -92.474  46.098  1.00 4.22  ? 377  SER A C     1 
ATOM   2841  O  O     . SER A 1 376  ? -27.474 -92.578  46.950  1.00 5.68  ? 377  SER A O     1 
ATOM   2842  C  CB    . SER A 1 376  ? -27.761 -93.573  43.943  1.00 4.68  ? 377  SER A CB    1 
ATOM   2843  O  OG    . SER A 1 376  ? -26.441 -93.413  44.342  1.00 6.04  ? 377  SER A OG    1 
ATOM   2844  N  N     . VAL A 1 377  ? -29.016 -91.344  45.924  1.00 3.31  ? 378  VAL A N     1 
ATOM   2845  C  CA    . VAL A 1 377  ? -28.761 -90.209  46.789  1.00 2.93  ? 378  VAL A CA    1 
ATOM   2846  C  C     . VAL A 1 377  ? -29.228 -90.591  48.195  1.00 3.29  ? 378  VAL A C     1 
ATOM   2847  O  O     . VAL A 1 377  ? -28.570 -90.268  49.167  1.00 3.97  ? 378  VAL A O     1 
ATOM   2848  C  CB    . VAL A 1 377  ? -29.537 -88.915  46.309  1.00 2.89  ? 378  VAL A CB    1 
ATOM   2849  C  CG1   . VAL A 1 377  ? -29.443 -87.840  47.321  1.00 2.00  ? 378  VAL A CG1   1 
ATOM   2850  C  CG2   . VAL A 1 377  ? -28.995 -88.405  45.004  1.00 2.00  ? 378  VAL A CG2   1 
ATOM   2851  N  N     . TYR A 1 378  ? -30.371 -91.274  48.304  1.00 3.56  ? 379  TYR A N     1 
ATOM   2852  C  CA    . TYR A 1 378  ? -30.925 -91.674  49.605  1.00 2.81  ? 379  TYR A CA    1 
ATOM   2853  C  C     . TYR A 1 378  ? -30.104 -92.771  50.277  1.00 2.87  ? 379  TYR A C     1 
ATOM   2854  O  O     . TYR A 1 378  ? -29.951 -92.779  51.497  1.00 2.72  ? 379  TYR A O     1 
ATOM   2855  C  CB    . TYR A 1 378  ? -32.392 -92.118  49.477  1.00 2.84  ? 379  TYR A CB    1 
ATOM   2856  C  CG    . TYR A 1 378  ? -33.388 -90.999  49.309  1.00 2.00  ? 379  TYR A CG    1 
ATOM   2857  C  CD1   . TYR A 1 378  ? -33.663 -90.131  50.327  1.00 2.51  ? 379  TYR A CD1   1 
ATOM   2858  C  CD2   . TYR A 1 378  ? -34.065 -90.841  48.131  1.00 2.23  ? 379  TYR A CD2   1 
ATOM   2859  C  CE1   . TYR A 1 378  ? -34.623 -89.092  50.179  1.00 2.46  ? 379  TYR A CE1   1 
ATOM   2860  C  CE2   . TYR A 1 378  ? -35.022 -89.838  47.954  1.00 2.40  ? 379  TYR A CE2   1 
ATOM   2861  C  CZ    . TYR A 1 378  ? -35.307 -88.967  48.975  1.00 2.66  ? 379  TYR A CZ    1 
ATOM   2862  O  OH    . TYR A 1 378  ? -36.346 -88.048  48.815  1.00 2.38  ? 379  TYR A OH    1 
ATOM   2863  N  N     . ASP A 1 379  ? -29.589 -93.705  49.488  1.00 2.61  ? 380  ASP A N     1 
ATOM   2864  C  CA    . ASP A 1 379  ? -28.785 -94.776  50.053  1.00 3.05  ? 380  ASP A CA    1 
ATOM   2865  C  C     . ASP A 1 379  ? -27.547 -94.128  50.659  1.00 2.93  ? 380  ASP A C     1 
ATOM   2866  O  O     . ASP A 1 379  ? -27.114 -94.464  51.761  1.00 3.33  ? 380  ASP A O     1 
ATOM   2867  C  CB    . ASP A 1 379  ? -28.392 -95.813  48.976  1.00 3.53  ? 380  ASP A CB    1 
ATOM   2868  C  CG    . ASP A 1 379  ? -29.572 -96.693  48.518  1.00 3.88  ? 380  ASP A CG    1 
ATOM   2869  O  OD1   . ASP A 1 379  ? -30.637 -96.671  49.151  1.00 4.48  ? 380  ASP A OD1   1 
ATOM   2870  O  OD2   . ASP A 1 379  ? -29.455 -97.386  47.488  1.00 4.42  ? 380  ASP A OD2   1 
ATOM   2871  N  N     . ASN A 1 380  ? -27.009 -93.143  49.972  1.00 2.91  ? 381  ASN A N     1 
ATOM   2872  C  CA    . ASN A 1 380  ? -25.853 -92.487  50.503  1.00 3.18  ? 381  ASN A CA    1 
ATOM   2873  C  C     . ASN A 1 380  ? -26.155 -91.919  51.905  1.00 3.36  ? 381  ASN A C     1 
ATOM   2874  O  O     . ASN A 1 380  ? -25.306 -92.014  52.793  1.00 3.33  ? 381  ASN A O     1 
ATOM   2875  C  CB    . ASN A 1 380  ? -25.399 -91.408  49.539  1.00 3.47  ? 381  ASN A CB    1 
ATOM   2876  C  CG    . ASN A 1 380  ? -24.210 -90.607  50.064  1.00 4.89  ? 381  ASN A CG    1 
ATOM   2877  O  OD1   . ASN A 1 380  ? -23.082 -91.137  50.214  1.00 5.13  ? 381  ASN A OD1   1 
ATOM   2878  N  ND2   . ASN A 1 380  ? -24.439 -89.311  50.312  1.00 4.53  ? 381  ASN A ND2   1 
ATOM   2879  N  N     . MET A 1 381  ? -27.361 -91.393  52.132  1.00 3.00  ? 382  MET A N     1 
ATOM   2880  C  CA    . MET A 1 381  ? -27.681 -90.829  53.423  1.00 2.89  ? 382  MET A CA    1 
ATOM   2881  C  C     . MET A 1 381  ? -27.714 -91.843  54.533  1.00 3.49  ? 382  MET A C     1 
ATOM   2882  O  O     . MET A 1 381  ? -27.537 -91.487  55.688  1.00 3.49  ? 382  MET A O     1 
ATOM   2883  C  CB    . MET A 1 381  ? -29.002 -90.021  53.390  1.00 3.41  ? 382  MET A CB    1 
ATOM   2884  C  CG    . MET A 1 381  ? -28.848 -88.709  52.684  1.00 2.95  ? 382  MET A CG    1 
ATOM   2885  S  SD    . MET A 1 381  ? -30.146 -87.470  52.968  1.00 5.09  ? 382  MET A SD    1 
ATOM   2886  C  CE    . MET A 1 381  ? -31.219 -87.971  51.615  1.00 2.91  ? 382  MET A CE    1 
ATOM   2887  N  N     . SER A 1 382  ? -27.942 -93.114  54.202  1.00 4.09  ? 383  SER A N     1 
ATOM   2888  C  CA    . SER A 1 382  ? -27.998 -94.151  55.215  1.00 4.55  ? 383  SER A CA    1 
ATOM   2889  C  C     . SER A 1 382  ? -26.693 -94.931  55.261  1.00 5.05  ? 383  SER A C     1 
ATOM   2890  O  O     . SER A 1 382  ? -26.393 -95.617  56.258  1.00 4.94  ? 383  SER A O     1 
ATOM   2891  C  CB    . SER A 1 382  ? -29.166 -95.106  54.959  1.00 4.51  ? 383  SER A CB    1 
ATOM   2892  O  OG    . SER A 1 382  ? -28.825 -95.995  53.912  1.00 6.37  ? 383  SER A OG    1 
ATOM   2893  N  N     . GLY A 1 383  ? -25.915 -94.830  54.186  1.00 4.91  ? 384  GLY A N     1 
ATOM   2894  C  CA    . GLY A 1 383  ? -24.647 -95.544  54.139  1.00 4.33  ? 384  GLY A CA    1 
ATOM   2895  C  C     . GLY A 1 383  ? -23.382 -94.728  54.398  1.00 4.07  ? 384  GLY A C     1 
ATOM   2896  O  O     . GLY A 1 383  ? -23.125 -94.240  55.505  1.00 3.61  ? 384  GLY A O     1 
ATOM   2897  N  N     . ALA A 1 384  ? -22.618 -94.576  53.322  1.00 3.52  ? 385  ALA A N     1 
ATOM   2898  C  CA    . ALA A 1 384  ? -21.360 -93.881  53.290  1.00 3.98  ? 385  ALA A CA    1 
ATOM   2899  C  C     . ALA A 1 384  ? -21.385 -92.409  53.607  1.00 4.69  ? 385  ALA A C     1 
ATOM   2900  O  O     . ALA A 1 384  ? -20.344 -91.839  53.912  1.00 5.10  ? 385  ALA A O     1 
ATOM   2901  C  CB    . ALA A 1 384  ? -20.751 -94.046  51.942  1.00 4.48  ? 385  ALA A CB    1 
ATOM   2902  N  N     . LYS A 1 385  ? -22.543 -91.778  53.448  1.00 5.05  ? 386  LYS A N     1 
ATOM   2903  C  CA    . LYS A 1 385  ? -22.701 -90.363  53.692  1.00 5.29  ? 386  LYS A CA    1 
ATOM   2904  C  C     . LYS A 1 385  ? -21.561 -89.545  53.094  1.00 5.10  ? 386  LYS A C     1 
ATOM   2905  O  O     . LYS A 1 385  ? -20.927 -88.755  53.794  1.00 5.73  ? 386  LYS A O     1 
ATOM   2906  C  CB    . LYS A 1 385  ? -22.884 -90.097  55.174  1.00 5.82  ? 386  LYS A CB    1 
ATOM   2907  C  CG    . LYS A 1 385  ? -24.087 -90.794  55.696  1.00 6.99  ? 386  LYS A CG    1 
ATOM   2908  C  CD    . LYS A 1 385  ? -24.566 -90.169  56.977  1.00 8.59  ? 386  LYS A CD    1 
ATOM   2909  C  CE    . LYS A 1 385  ? -24.162 -90.945  58.218  1.00 8.76  ? 386  LYS A CE    1 
ATOM   2910  N  NZ    . LYS A 1 385  ? -24.704 -92.324  58.250  1.00 10.34 ? 386  LYS A NZ    1 
ATOM   2911  N  N     . LYS A 1 386  ? -21.267 -89.835  51.816  1.00 4.21  ? 387  LYS A N     1 
ATOM   2912  C  CA    . LYS A 1 386  ? -20.246 -89.172  51.011  1.00 3.27  ? 387  LYS A CA    1 
ATOM   2913  C  C     . LYS A 1 386  ? -20.739 -87.752  50.751  1.00 3.29  ? 387  LYS A C     1 
ATOM   2914  O  O     . LYS A 1 386  ? -21.890 -87.536  50.369  1.00 3.14  ? 387  LYS A O     1 
ATOM   2915  C  CB    . LYS A 1 386  ? -20.036 -89.918  49.671  1.00 3.02  ? 387  LYS A CB    1 
ATOM   2916  C  CG    . LYS A 1 386  ? -19.355 -89.053  48.573  1.00 3.29  ? 387  LYS A CG    1 
ATOM   2917  C  CD    . LYS A 1 386  ? -19.097 -89.787  47.248  1.00 3.46  ? 387  LYS A CD    1 
ATOM   2918  C  CE    . LYS A 1 386  ? -17.684 -90.300  47.125  1.00 3.14  ? 387  LYS A CE    1 
ATOM   2919  N  NZ    . LYS A 1 386  ? -16.702 -89.202  47.296  1.00 3.32  ? 387  LYS A NZ    1 
ATOM   2920  N  N     . ASN A 1 387  ? -19.851 -86.793  50.969  1.00 3.34  ? 388  ASN A N     1 
ATOM   2921  C  CA    . ASN A 1 387  ? -20.144 -85.383  50.827  1.00 3.05  ? 388  ASN A CA    1 
ATOM   2922  C  C     . ASN A 1 387  ? -19.603 -84.836  49.517  1.00 2.66  ? 388  ASN A C     1 
ATOM   2923  O  O     . ASN A 1 387  ? -18.777 -85.459  48.868  1.00 2.01  ? 388  ASN A O     1 
ATOM   2924  C  CB    . ASN A 1 387  ? -19.555 -84.618  52.026  1.00 3.14  ? 388  ASN A CB    1 
ATOM   2925  C  CG    . ASN A 1 387  ? -20.321 -83.340  52.329  1.00 3.23  ? 388  ASN A CG    1 
ATOM   2926  O  OD1   . ASN A 1 387  ? -21.266 -83.018  51.623  1.00 3.78  ? 388  ASN A OD1   1 
ATOM   2927  N  ND2   . ASN A 1 387  ? -19.929 -82.616  53.385  1.00 3.12  ? 388  ASN A ND2   1 
ATOM   2928  N  N     . HIS A 1 388  ? -20.125 -83.685  49.108  1.00 2.78  ? 389  HIS A N     1 
ATOM   2929  C  CA    . HIS A 1 388  ? -19.691 -83.047  47.870  1.00 2.55  ? 389  HIS A CA    1 
ATOM   2930  C  C     . HIS A 1 388  ? -19.529 -84.064  46.711  1.00 2.04  ? 389  HIS A C     1 
ATOM   2931  O  O     . HIS A 1 388  ? -18.506 -84.110  46.008  1.00 2.00  ? 389  HIS A O     1 
ATOM   2932  C  CB    . HIS A 1 388  ? -18.405 -82.214  48.113  1.00 2.00  ? 389  HIS A CB    1 
ATOM   2933  C  CG    . HIS A 1 388  ? -18.579 -81.088  49.092  1.00 2.02  ? 389  HIS A CG    1 
ATOM   2934  N  ND1   . HIS A 1 388  ? -18.108 -81.149  50.385  1.00 2.00  ? 389  HIS A ND1   1 
ATOM   2935  C  CD2   . HIS A 1 388  ? -19.173 -79.878  48.969  1.00 2.39  ? 389  HIS A CD2   1 
ATOM   2936  C  CE1   . HIS A 1 388  ? -18.400 -80.025  51.016  1.00 2.00  ? 389  HIS A CE1   1 
ATOM   2937  N  NE2   . HIS A 1 388  ? -19.046 -79.235  50.184  1.00 2.00  ? 389  HIS A NE2   1 
ATOM   2938  N  N     . PHE A 1 389  ? -20.597 -84.844  46.533  1.00 2.02  ? 390  PHE A N     1 
ATOM   2939  C  CA    . PHE A 1 389  ? -20.709 -85.866  45.478  1.00 2.16  ? 390  PHE A CA    1 
ATOM   2940  C  C     . PHE A 1 389  ? -21.319 -85.339  44.147  1.00 2.35  ? 390  PHE A C     1 
ATOM   2941  O  O     . PHE A 1 389  ? -21.612 -84.137  44.007  1.00 2.41  ? 390  PHE A O     1 
ATOM   2942  C  CB    . PHE A 1 389  ? -21.510 -87.096  45.977  1.00 2.00  ? 390  PHE A CB    1 
ATOM   2943  C  CG    . PHE A 1 389  ? -22.995 -86.840  46.209  1.00 2.30  ? 390  PHE A CG    1 
ATOM   2944  C  CD1   . PHE A 1 389  ? -23.924 -86.934  45.159  1.00 2.20  ? 390  PHE A CD1   1 
ATOM   2945  C  CD2   . PHE A 1 389  ? -23.471 -86.530  47.482  1.00 2.34  ? 390  PHE A CD2   1 
ATOM   2946  C  CE1   . PHE A 1 389  ? -25.290 -86.730  45.383  1.00 2.06  ? 390  PHE A CE1   1 
ATOM   2947  C  CE2   . PHE A 1 389  ? -24.842 -86.320  47.710  1.00 2.05  ? 390  PHE A CE2   1 
ATOM   2948  C  CZ    . PHE A 1 389  ? -25.748 -86.422  46.662  1.00 2.18  ? 390  PHE A CZ    1 
ATOM   2949  N  N     . THR A 1 390  ? -21.331 -86.214  43.146  1.00 2.13  ? 391  THR A N     1 
ATOM   2950  C  CA    . THR A 1 390  ? -21.928 -85.945  41.866  1.00 2.26  ? 391  THR A CA    1 
ATOM   2951  C  C     . THR A 1 390  ? -22.694 -87.223  41.590  1.00 2.30  ? 391  THR A C     1 
ATOM   2952  O  O     . THR A 1 390  ? -22.310 -88.271  42.068  1.00 3.27  ? 391  THR A O     1 
ATOM   2953  C  CB    . THR A 1 390  ? -20.904 -85.796  40.735  1.00 2.32  ? 391  THR A CB    1 
ATOM   2954  O  OG1   . THR A 1 390  ? -20.034 -86.920  40.743  1.00 2.67  ? 391  THR A OG1   1 
ATOM   2955  C  CG2   . THR A 1 390  ? -20.122 -84.486  40.839  1.00 2.00  ? 391  THR A CG2   1 
ATOM   2956  N  N     . VAL A 1 391  ? -23.820 -87.116  40.892  1.00 2.77  ? 392  VAL A N     1 
ATOM   2957  C  CA    . VAL A 1 391  ? -24.650 -88.264  40.491  1.00 2.26  ? 392  VAL A CA    1 
ATOM   2958  C  C     . VAL A 1 391  ? -24.999 -88.181  38.988  1.00 2.29  ? 392  VAL A C     1 
ATOM   2959  O  O     . VAL A 1 391  ? -25.514 -87.162  38.521  1.00 2.00  ? 392  VAL A O     1 
ATOM   2960  C  CB    . VAL A 1 391  ? -26.019 -88.311  41.175  1.00 2.18  ? 392  VAL A CB    1 
ATOM   2961  C  CG1   . VAL A 1 391  ? -26.240 -89.675  41.747  1.00 2.58  ? 392  VAL A CG1   1 
ATOM   2962  C  CG2   . VAL A 1 391  ? -26.207 -87.224  42.161  1.00 2.00  ? 392  VAL A CG2   1 
ATOM   2963  N  N     . GLY A 1 392  ? -24.811 -89.288  38.259  1.00 2.62  ? 393  GLY A N     1 
ATOM   2964  C  CA    . GLY A 1 392  ? -25.106 -89.303  36.842  1.00 2.00  ? 393  GLY A CA    1 
ATOM   2965  C  C     . GLY A 1 392  ? -23.877 -89.524  35.995  1.00 2.00  ? 393  GLY A C     1 
ATOM   2966  O  O     . GLY A 1 392  ? -23.988 -89.751  34.801  1.00 2.08  ? 393  GLY A O     1 
ATOM   2967  N  N     . ILE A 1 393  ? -22.703 -89.483  36.610  1.00 2.11  ? 394  ILE A N     1 
ATOM   2968  C  CA    . ILE A 1 393  ? -21.439 -89.683  35.908  1.00 2.19  ? 394  ILE A CA    1 
ATOM   2969  C  C     . ILE A 1 393  ? -20.535 -90.635  36.677  1.00 2.50  ? 394  ILE A C     1 
ATOM   2970  O  O     . ILE A 1 393  ? -20.753 -90.933  37.840  1.00 2.53  ? 394  ILE A O     1 
ATOM   2971  C  CB    . ILE A 1 393  ? -20.607 -88.341  35.724  1.00 2.23  ? 394  ILE A CB    1 
ATOM   2972  C  CG1   . ILE A 1 393  ? -20.446 -87.586  37.046  1.00 2.37  ? 394  ILE A CG1   1 
ATOM   2973  C  CG2   . ILE A 1 393  ? -21.262 -87.403  34.742  1.00 2.16  ? 394  ILE A CG2   1 
ATOM   2974  C  CD1   . ILE A 1 393  ? -19.438 -86.419  36.971  1.00 2.33  ? 394  ILE A CD1   1 
ATOM   2975  N  N     . GLU A 1 394  ? -19.497 -91.099  36.004  1.00 3.39  ? 395  GLU A N     1 
ATOM   2976  C  CA    . GLU A 1 394  ? -18.516 -91.928  36.637  1.00 3.53  ? 395  GLU A CA    1 
ATOM   2977  C  C     . GLU A 1 394  ? -17.307 -91.013  36.796  1.00 3.36  ? 395  GLU A C     1 
ATOM   2978  O  O     . GLU A 1 394  ? -16.649 -90.693  35.811  1.00 2.83  ? 395  GLU A O     1 
ATOM   2979  C  CB    . GLU A 1 394  ? -18.161 -93.125  35.758  1.00 4.71  ? 395  GLU A CB    1 
ATOM   2980  C  CG    . GLU A 1 394  ? -17.344 -94.138  36.521  1.00 8.35  ? 395  GLU A CG    1 
ATOM   2981  C  CD    . GLU A 1 394  ? -16.664 -95.218  35.653  1.00 10.57 ? 395  GLU A CD    1 
ATOM   2982  O  OE1   . GLU A 1 394  ? -17.217 -95.625  34.600  1.00 11.57 ? 395  GLU A OE1   1 
ATOM   2983  O  OE2   . GLU A 1 394  ? -15.563 -95.681  36.057  1.00 12.49 ? 395  GLU A OE2   1 
ATOM   2984  N  N     . ASP A 1 395  ? -17.107 -90.474  37.991  1.00 3.12  ? 396  ASP A N     1 
ATOM   2985  C  CA    . ASP A 1 395  ? -15.929 -89.655  38.227  1.00 3.72  ? 396  ASP A CA    1 
ATOM   2986  C  C     . ASP A 1 395  ? -14.782 -90.581  38.666  1.00 3.60  ? 396  ASP A C     1 
ATOM   2987  O  O     . ASP A 1 395  ? -14.741 -91.026  39.805  1.00 3.67  ? 396  ASP A O     1 
ATOM   2988  C  CB    . ASP A 1 395  ? -16.165 -88.592  39.310  1.00 4.14  ? 396  ASP A CB    1 
ATOM   2989  C  CG    . ASP A 1 395  ? -14.953 -87.675  39.504  1.00 5.49  ? 396  ASP A CG    1 
ATOM   2990  O  OD1   . ASP A 1 395  ? -13.923 -87.866  38.812  1.00 5.69  ? 396  ASP A OD1   1 
ATOM   2991  O  OD2   . ASP A 1 395  ? -15.018 -86.765  40.366  1.00 6.22  ? 396  ASP A OD2   1 
ATOM   2992  N  N     . ASP A 1 396  ? -13.857 -90.863  37.769  1.00 3.19  ? 397  ASP A N     1 
ATOM   2993  C  CA    . ASP A 1 396  ? -12.751 -91.723  38.130  1.00 3.75  ? 397  ASP A CA    1 
ATOM   2994  C  C     . ASP A 1 396  ? -11.430 -90.969  38.217  1.00 3.62  ? 397  ASP A C     1 
ATOM   2995  O  O     . ASP A 1 396  ? -10.393 -91.585  38.275  1.00 4.07  ? 397  ASP A O     1 
ATOM   2996  C  CB    . ASP A 1 396  ? -12.652 -92.956  37.184  1.00 4.95  ? 397  ASP A CB    1 
ATOM   2997  C  CG    . ASP A 1 396  ? -12.470 -92.559  35.719  1.00 6.38  ? 397  ASP A CG    1 
ATOM   2998  O  OD1   . ASP A 1 396  ? -12.529 -91.333  35.455  1.00 8.41  ? 397  ASP A OD1   1 
ATOM   2999  O  OD2   . ASP A 1 396  ? -12.264 -93.429  34.835  1.00 6.05  ? 397  ASP A OD2   1 
ATOM   3000  N  N     . VAL A 1 397  ? -11.452 -89.647  38.115  1.00 3.85  ? 398  VAL A N     1 
ATOM   3001  C  CA    . VAL A 1 397  ? -10.233 -88.883  38.266  1.00 3.72  ? 398  VAL A CA    1 
ATOM   3002  C  C     . VAL A 1 397  ? -10.194 -88.367  39.704  1.00 4.13  ? 398  VAL A C     1 
ATOM   3003  O  O     . VAL A 1 397  ? -9.218  -88.600  40.400  1.00 5.26  ? 398  VAL A O     1 
ATOM   3004  C  CB    . VAL A 1 397  ? -10.044 -87.744  37.196  1.00 4.24  ? 398  VAL A CB    1 
ATOM   3005  C  CG1   . VAL A 1 397  ? -10.606 -88.168  35.851  1.00 2.76  ? 398  VAL A CG1   1 
ATOM   3006  C  CG2   . VAL A 1 397  ? -10.598 -86.382  37.643  1.00 5.03  ? 398  VAL A CG2   1 
ATOM   3007  N  N     . THR A 1 398  ? -11.304 -87.827  40.210  1.00 4.15  ? 399  THR A N     1 
ATOM   3008  C  CA    . THR A 1 398  ? -11.373 -87.307  41.580  1.00 4.02  ? 399  THR A CA    1 
ATOM   3009  C  C     . THR A 1 398  ? -12.410 -88.022  42.503  1.00 4.21  ? 399  THR A C     1 
ATOM   3010  O  O     . THR A 1 398  ? -12.749 -87.540  43.615  1.00 4.05  ? 399  THR A O     1 
ATOM   3011  C  CB    . THR A 1 398  ? -11.614 -85.795  41.539  1.00 4.28  ? 399  THR A CB    1 
ATOM   3012  O  OG1   . THR A 1 398  ? -12.559 -85.497  40.500  1.00 6.04  ? 399  THR A OG1   1 
ATOM   3013  C  CG2   . THR A 1 398  ? -10.374 -85.093  41.201  1.00 3.54  ? 399  THR A CG2   1 
ATOM   3014  N  N     . GLY A 1 399  ? -12.859 -89.201  42.052  1.00 3.93  ? 400  GLY A N     1 
ATOM   3015  C  CA    . GLY A 1 399  ? -13.824 -90.030  42.777  1.00 3.19  ? 400  GLY A CA    1 
ATOM   3016  C  C     . GLY A 1 399  ? -15.011 -89.378  43.496  1.00 3.16  ? 400  GLY A C     1 
ATOM   3017  O  O     . GLY A 1 399  ? -15.360 -89.826  44.585  1.00 3.81  ? 400  GLY A O     1 
ATOM   3018  N  N     . THR A 1 400  ? -15.693 -88.400  42.904  1.00 2.19  ? 401  THR A N     1 
ATOM   3019  C  CA    . THR A 1 400  ? -16.805 -87.741  43.602  1.00 2.26  ? 401  THR A CA    1 
ATOM   3020  C  C     . THR A 1 400  ? -18.191 -88.336  43.328  1.00 2.07  ? 401  THR A C     1 
ATOM   3021  O  O     . THR A 1 400  ? -19.198 -87.962  43.956  1.00 2.00  ? 401  THR A O     1 
ATOM   3022  C  CB    . THR A 1 400  ? -16.822 -86.235  43.220  1.00 2.28  ? 401  THR A CB    1 
ATOM   3023  O  OG1   . THR A 1 400  ? -17.262 -86.101  41.859  1.00 2.00  ? 401  THR A OG1   1 
ATOM   3024  C  CG2   . THR A 1 400  ? -15.384 -85.673  43.319  1.00 2.13  ? 401  THR A CG2   1 
ATOM   3025  N  N     . SER A 1 401  ? -18.233 -89.282  42.408  1.00 2.15  ? 402  SER A N     1 
ATOM   3026  C  CA    . SER A 1 401  ? -19.476 -89.888  42.014  1.00 2.34  ? 402  SER A CA    1 
ATOM   3027  C  C     . SER A 1 401  ? -20.031 -90.991  42.884  1.00 2.95  ? 402  SER A C     1 
ATOM   3028  O  O     . SER A 1 401  ? -19.304 -91.844  43.438  1.00 3.51  ? 402  SER A O     1 
ATOM   3029  C  CB    . SER A 1 401  ? -19.372 -90.384  40.588  1.00 2.07  ? 402  SER A CB    1 
ATOM   3030  O  OG    . SER A 1 401  ? -18.473 -91.458  40.547  1.00 2.18  ? 402  SER A OG    1 
ATOM   3031  N  N     . LEU A 1 402  ? -21.353 -90.998  42.929  1.00 2.61  ? 403  LEU A N     1 
ATOM   3032  C  CA    . LEU A 1 402  ? -22.106 -91.974  43.691  1.00 2.76  ? 403  LEU A CA    1 
ATOM   3033  C  C     . LEU A 1 402  ? -22.359 -93.184  42.818  1.00 2.92  ? 403  LEU A C     1 
ATOM   3034  O  O     . LEU A 1 402  ? -22.492 -93.059  41.607  1.00 2.48  ? 403  LEU A O     1 
ATOM   3035  C  CB    . LEU A 1 402  ? -23.453 -91.363  44.079  1.00 2.91  ? 403  LEU A CB    1 
ATOM   3036  C  CG    . LEU A 1 402  ? -23.670 -90.902  45.521  1.00 4.14  ? 403  LEU A CG    1 
ATOM   3037  C  CD1   . LEU A 1 402  ? -22.480 -90.169  46.126  1.00 3.76  ? 403  LEU A CD1   1 
ATOM   3038  C  CD2   . LEU A 1 402  ? -24.916 -90.066  45.574  1.00 3.56  ? 403  LEU A CD2   1 
ATOM   3039  N  N     . PRO A 1 403  ? -22.302 -94.385  43.400  1.00 2.67  ? 404  PRO A N     1 
ATOM   3040  C  CA    . PRO A 1 403  ? -22.552 -95.579  42.611  1.00 3.03  ? 404  PRO A CA    1 
ATOM   3041  C  C     . PRO A 1 403  ? -24.067 -95.620  42.384  1.00 4.01  ? 404  PRO A C     1 
ATOM   3042  O  O     . PRO A 1 403  ? -24.845 -95.169  43.244  1.00 4.48  ? 404  PRO A O     1 
ATOM   3043  C  CB    . PRO A 1 403  ? -22.085 -96.695  43.538  1.00 2.81  ? 404  PRO A CB    1 
ATOM   3044  C  CG    . PRO A 1 403  ? -22.290 -96.144  44.864  1.00 2.59  ? 404  PRO A CG    1 
ATOM   3045  C  CD    . PRO A 1 403  ? -21.810 -94.740  44.728  1.00 2.31  ? 404  PRO A CD    1 
ATOM   3046  N  N     . VAL A 1 404  ? -24.460 -96.063  41.194  1.00 4.83  ? 405  VAL A N     1 
ATOM   3047  C  CA    . VAL A 1 404  ? -25.853 -96.169  40.800  1.00 5.91  ? 405  VAL A CA    1 
ATOM   3048  C  C     . VAL A 1 404  ? -26.121 -97.585  40.271  1.00 7.42  ? 405  VAL A C     1 
ATOM   3049  O  O     . VAL A 1 404  ? -25.343 -98.115  39.475  1.00 7.70  ? 405  VAL A O     1 
ATOM   3050  C  CB    . VAL A 1 404  ? -26.174 -95.159  39.687  1.00 5.32  ? 405  VAL A CB    1 
ATOM   3051  C  CG1   . VAL A 1 404  ? -27.613 -95.390  39.139  1.00 4.77  ? 405  VAL A CG1   1 
ATOM   3052  C  CG2   . VAL A 1 404  ? -25.986 -93.756  40.191  1.00 4.20  ? 405  VAL A CG2   1 
ATOM   3053  N  N     . ASP A 1 405  ? -27.225 -98.170  40.732  1.00 9.43  ? 406  ASP A N     1 
ATOM   3054  C  CA    . ASP A 1 405  ? -27.676 -99.506  40.350  1.00 11.32 ? 406  ASP A CA    1 
ATOM   3055  C  C     . ASP A 1 405  ? -28.838 -99.288  39.462  1.00 11.93 ? 406  ASP A C     1 
ATOM   3056  O  O     . ASP A 1 405  ? -29.913 -98.935  39.934  1.00 11.93 ? 406  ASP A O     1 
ATOM   3057  C  CB    . ASP A 1 405  ? -28.172 -100.291 41.567  1.00 13.43 ? 406  ASP A CB    1 
ATOM   3058  C  CG    . ASP A 1 405  ? -28.784 -101.662 41.201  1.00 15.95 ? 406  ASP A CG    1 
ATOM   3059  O  OD1   . ASP A 1 405  ? -28.654 -102.146 40.036  1.00 17.48 ? 406  ASP A OD1   1 
ATOM   3060  O  OD2   . ASP A 1 405  ? -29.407 -102.278 42.107  1.00 17.78 ? 406  ASP A OD2   1 
ATOM   3061  N  N     . ASN A 1 406  ? -28.653 -99.586  38.187  1.00 13.31 ? 407  ASN A N     1 
ATOM   3062  C  CA    . ASN A 1 406  ? -29.717 -99.395  37.201  1.00 14.69 ? 407  ASN A CA    1 
ATOM   3063  C  C     . ASN A 1 406  ? -30.824 -100.465 37.167  1.00 14.21 ? 407  ASN A C     1 
ATOM   3064  O  O     . ASN A 1 406  ? -31.794 -100.346 36.431  1.00 14.41 ? 407  ASN A O     1 
ATOM   3065  C  CB    . ASN A 1 406  ? -29.093 -99.138  35.805  1.00 16.44 ? 407  ASN A CB    1 
ATOM   3066  C  CG    . ASN A 1 406  ? -28.295 -97.813  35.761  1.00 18.51 ? 407  ASN A CG    1 
ATOM   3067  O  OD1   . ASN A 1 406  ? -28.841 -96.733  36.046  1.00 19.52 ? 407  ASN A OD1   1 
ATOM   3068  N  ND2   . ASN A 1 406  ? -26.989 -97.900  35.467  1.00 19.87 ? 407  ASN A ND2   1 
ATOM   3069  N  N     . ALA A 1 407  ? -30.717 -101.460 38.031  1.00 13.53 ? 408  ALA A N     1 
ATOM   3070  C  CA    . ALA A 1 407  ? -31.718 -102.511 38.070  1.00 13.42 ? 408  ALA A CA    1 
ATOM   3071  C  C     . ALA A 1 407  ? -32.855 -102.161 39.018  1.00 12.99 ? 408  ALA A C     1 
ATOM   3072  O  O     . ALA A 1 407  ? -33.719 -103.004 39.306  1.00 13.52 ? 408  ALA A O     1 
ATOM   3073  C  CB    . ALA A 1 407  ? -31.079 -103.867 38.453  1.00 13.11 ? 408  ALA A CB    1 
ATOM   3074  N  N     . PHE A 1 408  ? -32.815 -100.930 39.526  1.00 12.10 ? 409  PHE A N     1 
ATOM   3075  C  CA    . PHE A 1 408  ? -33.830 -100.388 40.427  1.00 11.25 ? 409  PHE A CA    1 
ATOM   3076  C  C     . PHE A 1 408  ? -35.139 -100.445 39.660  1.00 11.33 ? 409  PHE A C     1 
ATOM   3077  O  O     . PHE A 1 408  ? -35.151 -100.124 38.479  1.00 11.63 ? 409  PHE A O     1 
ATOM   3078  C  CB    . PHE A 1 408  ? -33.470 -98.933  40.749  1.00 9.91  ? 409  PHE A CB    1 
ATOM   3079  C  CG    . PHE A 1 408  ? -34.472 -98.218  41.632  1.00 7.88  ? 409  PHE A CG    1 
ATOM   3080  C  CD1   . PHE A 1 408  ? -34.712 -98.654  42.933  1.00 7.09  ? 409  PHE A CD1   1 
ATOM   3081  C  CD2   . PHE A 1 408  ? -35.090 -97.043  41.191  1.00 6.68  ? 409  PHE A CD2   1 
ATOM   3082  C  CE1   . PHE A 1 408  ? -35.551 -97.922  43.788  1.00 6.70  ? 409  PHE A CE1   1 
ATOM   3083  C  CE2   . PHE A 1 408  ? -35.924 -96.299  42.031  1.00 5.15  ? 409  PHE A CE2   1 
ATOM   3084  C  CZ    . PHE A 1 408  ? -36.162 -96.718  43.321  1.00 5.75  ? 409  PHE A CZ    1 
ATOM   3085  N  N     . ALA A 1 409  ? -36.237 -100.801 40.325  1.00 11.60 ? 410  ALA A N     1 
ATOM   3086  C  CA    . ALA A 1 409  ? -37.519 -100.960 39.627  1.00 11.77 ? 410  ALA A CA    1 
ATOM   3087  C  C     . ALA A 1 409  ? -38.233 -99.724  39.146  1.00 11.83 ? 410  ALA A C     1 
ATOM   3088  O  O     . ALA A 1 409  ? -38.022 -98.634  39.653  1.00 12.42 ? 410  ALA A O     1 
ATOM   3089  C  CB    . ALA A 1 409  ? -38.457 -101.835 40.403  1.00 11.89 ? 410  ALA A CB    1 
ATOM   3090  N  N     . ASP A 1 410  ? -39.082 -99.913  38.143  1.00 11.81 ? 411  ASP A N     1 
ATOM   3091  C  CA    . ASP A 1 410  ? -39.827 -98.816  37.574  1.00 11.69 ? 411  ASP A CA    1 
ATOM   3092  C  C     . ASP A 1 410  ? -40.606 -98.176  38.693  1.00 10.56 ? 411  ASP A C     1 
ATOM   3093  O  O     . ASP A 1 410  ? -41.168 -98.884  39.528  1.00 10.26 ? 411  ASP A O     1 
ATOM   3094  C  CB    . ASP A 1 410  ? -40.779 -99.304  36.467  1.00 13.76 ? 411  ASP A CB    1 
ATOM   3095  C  CG    . ASP A 1 410  ? -41.214 -98.175  35.530  1.00 15.16 ? 411  ASP A CG    1 
ATOM   3096  O  OD1   . ASP A 1 410  ? -40.337 -97.456  34.949  1.00 16.78 ? 411  ASP A OD1   1 
ATOM   3097  O  OD2   . ASP A 1 410  ? -42.438 -98.019  35.381  1.00 15.84 ? 411  ASP A OD2   1 
ATOM   3098  N  N     . THR A 1 411  ? -40.544 -96.844  38.761  1.00 9.09  ? 412  THR A N     1 
ATOM   3099  C  CA    . THR A 1 411  ? -41.248 -96.119  39.786  1.00 7.67  ? 412  THR A CA    1 
ATOM   3100  C  C     . THR A 1 411  ? -42.393 -95.276  39.255  1.00 7.32  ? 412  THR A C     1 
ATOM   3101  O  O     . THR A 1 411  ? -43.042 -94.575  40.030  1.00 7.63  ? 412  THR A O     1 
ATOM   3102  C  CB    . THR A 1 411  ? -40.277 -95.280  40.684  1.00 7.66  ? 412  THR A CB    1 
ATOM   3103  O  OG1   . THR A 1 411  ? -39.500 -94.352  39.901  1.00 7.62  ? 412  THR A OG1   1 
ATOM   3104  C  CG2   . THR A 1 411  ? -39.339 -96.200  41.401  1.00 7.18  ? 412  THR A CG2   1 
ATOM   3105  N  N     . THR A 1 412  ? -42.674 -95.364  37.951  1.00 6.74  ? 413  THR A N     1 
ATOM   3106  C  CA    . THR A 1 412  ? -43.778 -94.591  37.358  1.00 6.24  ? 413  THR A CA    1 
ATOM   3107  C  C     . THR A 1 412  ? -45.084 -95.132  37.940  1.00 6.87  ? 413  THR A C     1 
ATOM   3108  O  O     . THR A 1 412  ? -45.204 -96.327  38.261  1.00 6.57  ? 413  THR A O     1 
ATOM   3109  C  CB    . THR A 1 412  ? -43.858 -94.702  35.817  1.00 5.37  ? 413  THR A CB    1 
ATOM   3110  O  OG1   . THR A 1 412  ? -44.224 -96.036  35.457  1.00 4.53  ? 413  THR A OG1   1 
ATOM   3111  C  CG2   . THR A 1 412  ? -42.527 -94.358  35.152  1.00 4.81  ? 413  THR A CG2   1 
ATOM   3112  N  N     . PRO A 1 413  ? -46.090 -94.263  38.069  1.00 7.26  ? 414  PRO A N     1 
ATOM   3113  C  CA    . PRO A 1 413  ? -47.388 -94.661  38.621  1.00 7.72  ? 414  PRO A CA    1 
ATOM   3114  C  C     . PRO A 1 413  ? -47.932 -95.962  38.001  1.00 8.73  ? 414  PRO A C     1 
ATOM   3115  O  O     . PRO A 1 413  ? -47.622 -96.303  36.849  1.00 8.87  ? 414  PRO A O     1 
ATOM   3116  C  CB    . PRO A 1 413  ? -48.269 -93.455  38.282  1.00 7.62  ? 414  PRO A CB    1 
ATOM   3117  C  CG    . PRO A 1 413  ? -47.331 -92.317  38.340  1.00 7.70  ? 414  PRO A CG    1 
ATOM   3118  C  CD    . PRO A 1 413  ? -46.109 -92.862  37.615  1.00 7.22  ? 414  PRO A CD    1 
ATOM   3119  N  N     . LYS A 1 414  ? -48.733 -96.705  38.758  1.00 9.66  ? 415  LYS A N     1 
ATOM   3120  C  CA    . LYS A 1 414  ? -49.300 -97.953  38.233  1.00 10.11 ? 415  LYS A CA    1 
ATOM   3121  C  C     . LYS A 1 414  ? -50.192 -97.656  37.037  1.00 9.74  ? 415  LYS A C     1 
ATOM   3122  O  O     . LYS A 1 414  ? -50.972 -96.704  37.043  1.00 10.09 ? 415  LYS A O     1 
ATOM   3123  C  CB    . LYS A 1 414  ? -50.105 -98.669  39.313  1.00 11.46 ? 415  LYS A CB    1 
ATOM   3124  C  CG    . LYS A 1 414  ? -50.291 -100.157 39.088  1.00 12.45 ? 415  LYS A CG    1 
ATOM   3125  C  CD    . LYS A 1 414  ? -51.260 -100.759 40.091  0.01 14.06 ? 415  LYS A CD    1 
ATOM   3126  C  CE    . LYS A 1 414  ? -51.660 -102.168 39.681  0.01 14.88 ? 415  LYS A CE    1 
ATOM   3127  N  NZ    . LYS A 1 414  ? -52.652 -102.766 40.616  0.01 15.65 ? 415  LYS A NZ    1 
ATOM   3128  N  N     . GLY A 1 415  ? -49.986 -98.434  35.979  1.00 9.59  ? 416  GLY A N     1 
ATOM   3129  C  CA    . GLY A 1 415  ? -50.748 -98.303  34.743  1.00 8.92  ? 416  GLY A CA    1 
ATOM   3130  C  C     . GLY A 1 415  ? -50.328 -97.150  33.840  1.00 8.74  ? 416  GLY A C     1 
ATOM   3131  O  O     . GLY A 1 415  ? -51.184 -96.365  33.424  1.00 10.01 ? 416  GLY A O     1 
ATOM   3132  N  N     . THR A 1 416  ? -49.021 -97.007  33.603  1.00 7.44  ? 417  THR A N     1 
ATOM   3133  C  CA    . THR A 1 416  ? -48.466 -95.966  32.747  1.00 5.80  ? 417  THR A CA    1 
ATOM   3134  C  C     . THR A 1 416  ? -47.833 -96.695  31.567  1.00 5.66  ? 417  THR A C     1 
ATOM   3135  O  O     . THR A 1 416  ? -47.115 -97.699  31.765  1.00 6.14  ? 417  THR A O     1 
ATOM   3136  C  CB    . THR A 1 416  ? -47.353 -95.158  33.480  1.00 5.15  ? 417  THR A CB    1 
ATOM   3137  O  OG1   . THR A 1 416  ? -47.938 -94.284  34.453  1.00 4.37  ? 417  THR A OG1   1 
ATOM   3138  C  CG2   . THR A 1 416  ? -46.531 -94.331  32.503  1.00 4.86  ? 417  THR A CG2   1 
ATOM   3139  N  N     . ILE A 1 417  ? -48.214 -96.300  30.353  1.00 4.78  ? 418  ILE A N     1 
ATOM   3140  C  CA    . ILE A 1 417  ? -47.623 -96.891  29.156  1.00 4.52  ? 418  ILE A CA    1 
ATOM   3141  C  C     . ILE A 1 417  ? -46.426 -96.043  28.793  1.00 4.83  ? 418  ILE A C     1 
ATOM   3142  O  O     . ILE A 1 417  ? -46.480 -94.810  28.816  1.00 6.08  ? 418  ILE A O     1 
ATOM   3143  C  CB    . ILE A 1 417  ? -48.614 -97.016  27.977  1.00 3.47  ? 418  ILE A CB    1 
ATOM   3144  C  CG1   . ILE A 1 417  ? -49.645 -98.061  28.321  1.00 3.51  ? 418  ILE A CG1   1 
ATOM   3145  C  CG2   . ILE A 1 417  ? -47.932 -97.478  26.697  1.00 2.36  ? 418  ILE A CG2   1 
ATOM   3146  C  CD1   . ILE A 1 417  ? -50.890 -97.408  28.791  1.00 5.51  ? 418  ILE A CD1   1 
ATOM   3147  N  N     . GLN A 1 418  ? -45.318 -96.707  28.549  1.00 4.63  ? 419  GLN A N     1 
ATOM   3148  C  CA    . GLN A 1 418  ? -44.099 -96.011  28.211  1.00 4.51  ? 419  GLN A CA    1 
ATOM   3149  C  C     . GLN A 1 418  ? -43.700 -96.443  26.808  1.00 4.36  ? 419  GLN A C     1 
ATOM   3150  O  O     . GLN A 1 418  ? -43.563 -97.654  26.554  1.00 3.83  ? 419  GLN A O     1 
ATOM   3151  C  CB    . GLN A 1 418  ? -43.026 -96.365  29.258  1.00 4.86  ? 419  GLN A CB    1 
ATOM   3152  C  CG    . GLN A 1 418  ? -43.352 -95.779  30.607  1.00 5.80  ? 419  GLN A CG    1 
ATOM   3153  C  CD    . GLN A 1 418  ? -42.409 -96.216  31.654  1.00 6.51  ? 419  GLN A CD    1 
ATOM   3154  O  OE1   . GLN A 1 418  ? -41.274 -95.707  31.764  1.00 7.33  ? 419  GLN A OE1   1 
ATOM   3155  N  NE2   . GLN A 1 418  ? -42.843 -97.190  32.441  1.00 7.14  ? 419  GLN A NE2   1 
ATOM   3156  N  N     . CYS A 1 419  ? -43.532 -95.477  25.892  1.00 3.77  ? 420  CYS A N     1 
ATOM   3157  C  CA    . CYS A 1 419  ? -43.172 -95.840  24.520  1.00 3.13  ? 420  CYS A CA    1 
ATOM   3158  C  C     . CYS A 1 419  ? -41.915 -95.119  24.011  1.00 2.96  ? 420  CYS A C     1 
ATOM   3159  O  O     . CYS A 1 419  ? -41.671 -93.944  24.348  1.00 3.28  ? 420  CYS A O     1 
ATOM   3160  C  CB    . CYS A 1 419  ? -44.361 -95.552  23.561  1.00 3.09  ? 420  CYS A CB    1 
ATOM   3161  S  SG    . CYS A 1 419  ? -46.134 -95.787  24.176  1.00 3.70  ? 420  CYS A SG    1 
ATOM   3162  N  N     . GLN A 1 420  ? -41.115 -95.818  23.222  1.00 2.14  ? 421  GLN A N     1 
ATOM   3163  C  CA    . GLN A 1 420  ? -39.938 -95.226  22.585  1.00 2.41  ? 421  GLN A CA    1 
ATOM   3164  C  C     . GLN A 1 420  ? -40.024 -95.385  21.073  1.00 2.56  ? 421  GLN A C     1 
ATOM   3165  O  O     . GLN A 1 420  ? -40.443 -96.440  20.561  1.00 3.41  ? 421  GLN A O     1 
ATOM   3166  C  CB    . GLN A 1 420  ? -38.646 -95.851  23.067  1.00 2.26  ? 421  GLN A CB    1 
ATOM   3167  C  CG    . GLN A 1 420  ? -38.440 -95.682  24.547  1.00 3.33  ? 421  GLN A CG    1 
ATOM   3168  C  CD    . GLN A 1 420  ? -37.255 -96.451  25.071  1.00 3.43  ? 421  GLN A CD    1 
ATOM   3169  O  OE1   . GLN A 1 420  ? -36.313 -95.865  25.623  1.00 4.14  ? 421  GLN A OE1   1 
ATOM   3170  N  NE2   . GLN A 1 420  ? -37.278 -97.761  24.895  1.00 3.44  ? 421  GLN A NE2   1 
ATOM   3171  N  N     . PHE A 1 421  ? -39.672 -94.325  20.362  1.00 2.19  ? 422  PHE A N     1 
ATOM   3172  C  CA    . PHE A 1 421  ? -39.695 -94.311  18.902  1.00 2.22  ? 422  PHE A CA    1 
ATOM   3173  C  C     . PHE A 1 421  ? -38.333 -93.839  18.428  1.00 2.27  ? 422  PHE A C     1 
ATOM   3174  O  O     . PHE A 1 421  ? -37.824 -92.875  18.930  1.00 2.10  ? 422  PHE A O     1 
ATOM   3175  C  CB    . PHE A 1 421  ? -40.731 -93.350  18.377  1.00 2.00  ? 422  PHE A CB    1 
ATOM   3176  C  CG    . PHE A 1 421  ? -42.117 -93.622  18.833  1.00 2.00  ? 422  PHE A CG    1 
ATOM   3177  C  CD1   . PHE A 1 421  ? -42.513 -93.274  20.101  1.00 2.00  ? 422  PHE A CD1   1 
ATOM   3178  C  CD2   . PHE A 1 421  ? -43.052 -94.185  17.961  1.00 2.42  ? 422  PHE A CD2   1 
ATOM   3179  C  CE1   . PHE A 1 421  ? -43.832 -93.477  20.520  1.00 2.98  ? 422  PHE A CE1   1 
ATOM   3180  C  CE2   . PHE A 1 421  ? -44.382 -94.401  18.343  1.00 2.59  ? 422  PHE A CE2   1 
ATOM   3181  C  CZ    . PHE A 1 421  ? -44.779 -94.049  19.627  1.00 3.36  ? 422  PHE A CZ    1 
ATOM   3182  N  N     . TRP A 1 422  ? -37.737 -94.571  17.494  1.00 3.07  ? 423  TRP A N     1 
ATOM   3183  C  CA    . TRP A 1 422  ? -36.424 -94.278  16.928  1.00 3.53  ? 423  TRP A CA    1 
ATOM   3184  C  C     . TRP A 1 422  ? -36.627 -93.882  15.491  1.00 4.09  ? 423  TRP A C     1 
ATOM   3185  O  O     . TRP A 1 422  ? -36.860 -94.757  14.646  1.00 5.13  ? 423  TRP A O     1 
ATOM   3186  C  CB    . TRP A 1 422  ? -35.589 -95.536  16.910  1.00 3.37  ? 423  TRP A CB    1 
ATOM   3187  C  CG    . TRP A 1 422  ? -35.074 -95.850  18.220  1.00 3.51  ? 423  TRP A CG    1 
ATOM   3188  C  CD1   . TRP A 1 422  ? -35.769 -96.382  19.279  1.00 3.33  ? 423  TRP A CD1   1 
ATOM   3189  C  CD2   . TRP A 1 422  ? -33.731 -95.660  18.659  1.00 3.24  ? 423  TRP A CD2   1 
ATOM   3190  N  NE1   . TRP A 1 422  ? -34.921 -96.538  20.351  1.00 3.01  ? 423  TRP A NE1   1 
ATOM   3191  C  CE2   . TRP A 1 422  ? -33.665 -96.106  19.995  1.00 3.38  ? 423  TRP A CE2   1 
ATOM   3192  C  CE3   . TRP A 1 422  ? -32.569 -95.147  18.051  1.00 3.42  ? 423  TRP A CE3   1 
ATOM   3193  C  CZ2   . TRP A 1 422  ? -32.469 -96.058  20.742  1.00 3.52  ? 423  TRP A CZ2   1 
ATOM   3194  C  CZ3   . TRP A 1 422  ? -31.392 -95.097  18.779  1.00 2.83  ? 423  TRP A CZ3   1 
ATOM   3195  C  CH2   . TRP A 1 422  ? -31.347 -95.554  20.118  1.00 3.47  ? 423  TRP A CH2   1 
ATOM   3196  N  N     . GLY A 1 423  ? -36.501 -92.595  15.193  1.00 3.84  ? 424  GLY A N     1 
ATOM   3197  C  CA    . GLY A 1 423  ? -36.715 -92.186  13.829  1.00 3.72  ? 424  GLY A CA    1 
ATOM   3198  C  C     . GLY A 1 423  ? -35.554 -91.571  13.092  1.00 4.04  ? 424  GLY A C     1 
ATOM   3199  O  O     . GLY A 1 423  ? -34.474 -91.380  13.620  1.00 4.08  ? 424  GLY A O     1 
ATOM   3200  N  N     . LEU A 1 424  ? -35.784 -91.338  11.813  1.00 4.57  ? 425  LEU A N     1 
ATOM   3201  C  CA    . LEU A 1 424  ? -34.818 -90.708  10.954  1.00 5.65  ? 425  LEU A CA    1 
ATOM   3202  C  C     . LEU A 1 424  ? -35.237 -89.268  10.855  1.00 5.86  ? 425  LEU A C     1 
ATOM   3203  O  O     . LEU A 1 424  ? -36.419 -88.956  10.891  1.00 6.26  ? 425  LEU A O     1 
ATOM   3204  C  CB    . LEU A 1 424  ? -34.890 -91.296  9.568   1.00 6.22  ? 425  LEU A CB    1 
ATOM   3205  C  CG    . LEU A 1 424  ? -33.989 -90.594  8.567   1.00 7.14  ? 425  LEU A CG    1 
ATOM   3206  C  CD1   . LEU A 1 424  ? -32.522 -90.506  9.069   1.00 6.30  ? 425  LEU A CD1   1 
ATOM   3207  C  CD2   . LEU A 1 424  ? -34.093 -91.446  7.296   1.00 6.95  ? 425  LEU A CD2   1 
ATOM   3208  N  N     . GLY A 1 425  ? -34.265 -88.392  10.717  1.00 5.90  ? 426  GLY A N     1 
ATOM   3209  C  CA    . GLY A 1 425  ? -34.598 -86.988  10.623  1.00 5.46  ? 426  GLY A CA    1 
ATOM   3210  C  C     . GLY A 1 425  ? -35.463 -86.748  9.405   1.00 5.08  ? 426  GLY A C     1 
ATOM   3211  O  O     . GLY A 1 425  ? -35.246 -87.322  8.322   1.00 5.63  ? 426  GLY A O     1 
ATOM   3212  N  N     . ALA A 1 426  ? -36.534 -86.006  9.619   1.00 4.48  ? 427  ALA A N     1 
ATOM   3213  C  CA    . ALA A 1 426  ? -37.441 -85.627  8.543   1.00 3.72  ? 427  ALA A CA    1 
ATOM   3214  C  C     . ALA A 1 426  ? -38.375 -86.717  7.978   1.00 3.07  ? 427  ALA A C     1 
ATOM   3215  O  O     . ALA A 1 426  ? -38.972 -86.565  6.886   1.00 2.36  ? 427  ALA A O     1 
ATOM   3216  C  CB    . ALA A 1 426  ? -36.659 -84.894  7.435   1.00 3.46  ? 427  ALA A CB    1 
ATOM   3217  N  N     . ASP A 1 427  ? -38.555 -87.777  8.767   1.00 2.96  ? 428  ASP A N     1 
ATOM   3218  C  CA    . ASP A 1 427  ? -39.459 -88.873  8.391   1.00 3.02  ? 428  ASP A CA    1 
ATOM   3219  C  C     . ASP A 1 427  ? -40.859 -88.736  9.018   1.00 2.14  ? 428  ASP A C     1 
ATOM   3220  O  O     . ASP A 1 427  ? -41.740 -89.526  8.735   1.00 2.10  ? 428  ASP A O     1 
ATOM   3221  C  CB    . ASP A 1 427  ? -38.846 -90.273  8.632   1.00 3.02  ? 428  ASP A CB    1 
ATOM   3222  C  CG    . ASP A 1 427  ? -38.672 -90.644  10.133  1.00 4.44  ? 428  ASP A CG    1 
ATOM   3223  O  OD1   . ASP A 1 427  ? -38.980 -89.843  11.045  1.00 4.46  ? 428  ASP A OD1   1 
ATOM   3224  O  OD2   . ASP A 1 427  ? -38.191 -91.777  10.391  1.00 4.74  ? 428  ASP A OD2   1 
ATOM   3225  N  N     . GLY A 1 428  ? -41.049 -87.726  9.858   1.00 2.14  ? 429  GLY A N     1 
ATOM   3226  C  CA    . GLY A 1 428  ? -42.351 -87.477  10.461  1.00 2.00  ? 429  GLY A CA    1 
ATOM   3227  C  C     . GLY A 1 428  ? -42.674 -88.055  11.829  1.00 2.00  ? 429  GLY A C     1 
ATOM   3228  O  O     . GLY A 1 428  ? -43.696 -87.752  12.419  1.00 2.01  ? 429  GLY A O     1 
ATOM   3229  N  N     . THR A 1 429  ? -41.768 -88.841  12.362  1.00 2.00  ? 430  THR A N     1 
ATOM   3230  C  CA    . THR A 1 429  ? -41.956 -89.475  13.649  1.00 2.00  ? 430  THR A CA    1 
ATOM   3231  C  C     . THR A 1 429  ? -42.310 -88.524  14.807  1.00 2.07  ? 430  THR A C     1 
ATOM   3232  O  O     . THR A 1 429  ? -43.256 -88.791  15.554  1.00 2.08  ? 430  THR A O     1 
ATOM   3233  C  CB    . THR A 1 429  ? -40.714 -90.328  13.981  1.00 2.00  ? 430  THR A CB    1 
ATOM   3234  O  OG1   . THR A 1 429  ? -40.464 -91.244  12.900  1.00 2.00  ? 430  THR A OG1   1 
ATOM   3235  C  CG2   . THR A 1 429  ? -40.903 -91.105  15.278  1.00 2.19  ? 430  THR A CG2   1 
ATOM   3236  N  N     . VAL A 1 430  ? -41.548 -87.442  14.961  1.00 2.06  ? 431  VAL A N     1 
ATOM   3237  C  CA    . VAL A 1 430  ? -41.776 -86.461  16.022  1.00 2.00  ? 431  VAL A CA    1 
ATOM   3238  C  C     . VAL A 1 430  ? -43.151 -85.798  15.883  1.00 2.00  ? 431  VAL A C     1 
ATOM   3239  O  O     . VAL A 1 430  ? -43.881 -85.662  16.869  1.00 2.00  ? 431  VAL A O     1 
ATOM   3240  C  CB    . VAL A 1 430  ? -40.670 -85.309  16.026  1.00 2.49  ? 431  VAL A CB    1 
ATOM   3241  C  CG1   . VAL A 1 430  ? -41.116 -84.152  16.915  1.00 2.28  ? 431  VAL A CG1   1 
ATOM   3242  C  CG2   . VAL A 1 430  ? -39.323 -85.827  16.510  1.00 2.22  ? 431  VAL A CG2   1 
ATOM   3243  N  N     . GLY A 1 431  ? -43.458 -85.333  14.672  1.00 2.29  ? 432  GLY A N     1 
ATOM   3244  C  CA    . GLY A 1 431  ? -44.731 -84.684  14.392  1.00 2.22  ? 432  GLY A CA    1 
ATOM   3245  C  C     . GLY A 1 431  ? -45.874 -85.662  14.622  1.00 2.46  ? 432  GLY A C     1 
ATOM   3246  O  O     . GLY A 1 431  ? -46.929 -85.305  15.173  1.00 2.97  ? 432  GLY A O     1 
ATOM   3247  N  N     . ALA A 1 432  ? -45.644 -86.918  14.269  1.00 2.00  ? 433  ALA A N     1 
ATOM   3248  C  CA    . ALA A 1 432  ? -46.671 -87.926  14.472  1.00 2.38  ? 433  ALA A CA    1 
ATOM   3249  C  C     . ALA A 1 432  ? -46.882 -88.206  15.951  1.00 2.22  ? 433  ALA A C     1 
ATOM   3250  O  O     . ALA A 1 432  ? -48.025 -88.384  16.384  1.00 2.32  ? 433  ALA A O     1 
ATOM   3251  C  CB    . ALA A 1 432  ? -46.346 -89.204  13.727  1.00 2.43  ? 433  ALA A CB    1 
ATOM   3252  N  N     . ASN A 1 433  ? -45.805 -88.138  16.733  1.00 2.64  ? 434  ASN A N     1 
ATOM   3253  C  CA    . ASN A 1 433  ? -45.864 -88.389  18.179  1.00 3.07  ? 434  ASN A CA    1 
ATOM   3254  C  C     . ASN A 1 433  ? -46.597 -87.225  18.847  1.00 4.14  ? 434  ASN A C     1 
ATOM   3255  O  O     . ASN A 1 433  ? -47.523 -87.434  19.647  1.00 3.69  ? 434  ASN A O     1 
ATOM   3256  C  CB    . ASN A 1 433  ? -44.456 -88.504  18.746  1.00 2.89  ? 434  ASN A CB    1 
ATOM   3257  C  CG    . ASN A 1 433  ? -43.778 -89.802  18.356  1.00 4.06  ? 434  ASN A CG    1 
ATOM   3258  O  OD1   . ASN A 1 433  ? -44.424 -90.817  18.105  1.00 5.01  ? 434  ASN A OD1   1 
ATOM   3259  N  ND2   . ASN A 1 433  ? -42.480 -89.789  18.340  1.00 3.18  ? 434  ASN A ND2   1 
ATOM   3260  N  N     . LYS A 1 434  ? -46.190 -86.001  18.473  1.00 4.75  ? 435  LYS A N     1 
ATOM   3261  C  CA    . LYS A 1 434  ? -46.792 -84.774  18.973  1.00 5.28  ? 435  LYS A CA    1 
ATOM   3262  C  C     . LYS A 1 434  ? -48.267 -84.812  18.627  1.00 6.39  ? 435  LYS A C     1 
ATOM   3263  O  O     . LYS A 1 434  ? -49.081 -84.327  19.390  1.00 6.34  ? 435  LYS A O     1 
ATOM   3264  C  CB    . LYS A 1 434  ? -46.136 -83.534  18.350  1.00 4.06  ? 435  LYS A CB    1 
ATOM   3265  C  CG    . LYS A 1 434  ? -44.779 -83.130  18.945  1.00 3.12  ? 435  LYS A CG    1 
ATOM   3266  C  CD    . LYS A 1 434  ? -44.064 -82.115  18.030  1.00 2.82  ? 435  LYS A CD    1 
ATOM   3267  C  CE    . LYS A 1 434  ? -42.716 -81.697  18.586  1.00 3.00  ? 435  LYS A CE    1 
ATOM   3268  N  NZ    . LYS A 1 434  ? -42.029 -80.665  17.742  1.00 3.58  ? 435  LYS A NZ    1 
ATOM   3269  N  N     . GLN A 1 435  ? -48.615 -85.355  17.465  1.00 8.36  ? 436  GLN A N     1 
ATOM   3270  C  CA    . GLN A 1 435  ? -50.031 -85.479  17.116  1.00 10.50 ? 436  GLN A CA    1 
ATOM   3271  C  C     . GLN A 1 435  ? -50.671 -86.648  17.877  1.00 10.24 ? 436  GLN A C     1 
ATOM   3272  O  O     . GLN A 1 435  ? -51.891 -86.639  18.128  1.00 10.86 ? 436  GLN A O     1 
ATOM   3273  C  CB    . GLN A 1 435  ? -50.260 -85.668  15.615  1.00 13.38 ? 436  GLN A CB    1 
ATOM   3274  C  CG    . GLN A 1 435  ? -50.717 -84.405  14.852  1.00 17.58 ? 436  GLN A CG    1 
ATOM   3275  C  CD    . GLN A 1 435  ? -51.958 -83.690  15.434  1.00 20.38 ? 436  GLN A CD    1 
ATOM   3276  O  OE1   . GLN A 1 435  ? -53.064 -84.272  15.533  1.00 21.72 ? 436  GLN A OE1   1 
ATOM   3277  N  NE2   . GLN A 1 435  ? -51.788 -82.381  15.750  1.00 21.47 ? 436  GLN A NE2   1 
ATOM   3278  N  N     . ALA A 1 436  ? -49.876 -87.665  18.217  1.00 9.27  ? 437  ALA A N     1 
ATOM   3279  C  CA    . ALA A 1 436  ? -50.410 -88.784  18.974  1.00 8.42  ? 437  ALA A CA    1 
ATOM   3280  C  C     . ALA A 1 436  ? -50.770 -88.293  20.379  1.00 8.14  ? 437  ALA A C     1 
ATOM   3281  O  O     . ALA A 1 436  ? -51.797 -88.671  20.904  1.00 8.85  ? 437  ALA A O     1 
ATOM   3282  C  CB    . ALA A 1 436  ? -49.406 -89.908  19.048  1.00 8.47  ? 437  ALA A CB    1 
ATOM   3283  N  N     . ILE A 1 437  ? -49.969 -87.403  20.954  1.00 7.11  ? 438  ILE A N     1 
ATOM   3284  C  CA    . ILE A 1 437  ? -50.253 -86.887  22.283  1.00 6.77  ? 438  ILE A CA    1 
ATOM   3285  C  C     . ILE A 1 437  ? -51.510 -86.013  22.217  1.00 7.51  ? 438  ILE A C     1 
ATOM   3286  O  O     . ILE A 1 437  ? -52.415 -86.114  23.049  1.00 6.97  ? 438  ILE A O     1 
ATOM   3287  C  CB    . ILE A 1 437  ? -49.018 -86.089  22.857  1.00 5.67  ? 438  ILE A CB    1 
ATOM   3288  C  CG1   . ILE A 1 437  ? -47.821 -87.037  23.008  1.00 4.69  ? 438  ILE A CG1   1 
ATOM   3289  C  CG2   . ILE A 1 437  ? -49.316 -85.480  24.232  1.00 4.83  ? 438  ILE A CG2   1 
ATOM   3290  C  CD1   . ILE A 1 437  ? -46.461 -86.396  22.697  1.00 3.90  ? 438  ILE A CD1   1 
ATOM   3291  N  N     . LYS A 1 438  ? -51.619 -85.215  21.166  1.00 9.18  ? 439  LYS A N     1 
ATOM   3292  C  CA    . LYS A 1 438  ? -52.788 -84.310  21.011  1.00 10.74 ? 439  LYS A CA    1 
ATOM   3293  C  C     . LYS A 1 438  ? -54.103 -85.100  20.912  1.00 10.22 ? 439  LYS A C     1 
ATOM   3294  O  O     . LYS A 1 438  ? -55.091 -84.776  21.518  1.00 10.18 ? 439  LYS A O     1 
ATOM   3295  C  CB    . LYS A 1 438  ? -52.619 -83.431  19.768  1.00 12.67 ? 439  LYS A CB    1 
ATOM   3296  C  CG    . LYS A 1 438  ? -52.872 -81.969  20.007  1.00 16.24 ? 439  LYS A CG    1 
ATOM   3297  C  CD    . LYS A 1 438  ? -51.632 -81.063  19.577  1.00 19.41 ? 439  LYS A CD    1 
ATOM   3298  C  CE    . LYS A 1 438  ? -50.376 -81.120  20.529  1.00 20.68 ? 439  LYS A CE    1 
ATOM   3299  N  NZ    . LYS A 1 438  ? -49.278 -80.124  20.149  1.00 21.87 ? 439  LYS A NZ    1 
ATOM   3300  N  N     . ILE A 1 439  ? -54.080 -86.182  20.170  1.00 9.81  ? 440  ILE A N     1 
ATOM   3301  C  CA    . ILE A 1 439  ? -55.258 -86.975  20.007  1.00 8.91  ? 440  ILE A CA    1 
ATOM   3302  C  C     . ILE A 1 439  ? -55.638 -87.638  21.304  1.00 8.52  ? 440  ILE A C     1 
ATOM   3303  O  O     . ILE A 1 439  ? -56.768 -87.519  21.755  1.00 9.09  ? 440  ILE A O     1 
ATOM   3304  C  CB    . ILE A 1 439  ? -55.018 -88.004  18.903  1.00 9.17  ? 440  ILE A CB    1 
ATOM   3305  C  CG1   . ILE A 1 439  ? -54.714 -87.242  17.597  1.00 8.79  ? 440  ILE A CG1   1 
ATOM   3306  C  CG2   . ILE A 1 439  ? -56.217 -88.966  18.768  1.00 8.28  ? 440  ILE A CG2   1 
ATOM   3307  C  CD1   . ILE A 1 439  ? -54.494 -88.146  16.364  1.00 9.98  ? 440  ILE A CD1   1 
ATOM   3308  N  N     . ILE A 1 440  ? -54.694 -88.300  21.941  1.00 7.95  ? 441  ILE A N     1 
ATOM   3309  C  CA    . ILE A 1 440  ? -55.018 -89.002  23.184  1.00 7.45  ? 441  ILE A CA    1 
ATOM   3310  C  C     . ILE A 1 440  ? -55.418 -88.030  24.294  1.00 7.99  ? 441  ILE A C     1 
ATOM   3311  O  O     . ILE A 1 440  ? -56.445 -88.215  24.940  1.00 8.02  ? 441  ILE A O     1 
ATOM   3312  C  CB    . ILE A 1 440  ? -53.854 -89.902  23.636  1.00 6.46  ? 441  ILE A CB    1 
ATOM   3313  C  CG1   . ILE A 1 440  ? -53.670 -91.031  22.636  1.00 5.42  ? 441  ILE A CG1   1 
ATOM   3314  C  CG2   . ILE A 1 440  ? -54.080 -90.412  25.057  1.00 5.86  ? 441  ILE A CG2   1 
ATOM   3315  C  CD1   . ILE A 1 440  ? -52.354 -91.794  22.790  1.00 4.98  ? 441  ILE A CD1   1 
ATOM   3316  N  N     . GLY A 1 441  ? -54.647 -86.955  24.452  1.00 8.27  ? 442  GLY A N     1 
ATOM   3317  C  CA    . GLY A 1 441  ? -54.945 -85.985  25.489  1.00 8.47  ? 442  GLY A CA    1 
ATOM   3318  C  C     . GLY A 1 441  ? -56.304 -85.313  25.323  1.00 9.06  ? 442  GLY A C     1 
ATOM   3319  O  O     . GLY A 1 441  ? -57.029 -85.045  26.304  1.00 8.77  ? 442  GLY A O     1 
ATOM   3320  N  N     . ASP A 1 442  ? -56.717 -85.150  24.078  1.00 9.43  ? 443  ASP A N     1 
ATOM   3321  C  CA    . ASP A 1 442  ? -57.977 -84.477  23.815  1.00 10.56 ? 443  ASP A CA    1 
ATOM   3322  C  C     . ASP A 1 442  ? -59.184 -85.356  23.746  1.00 10.82 ? 443  ASP A C     1 
ATOM   3323  O  O     . ASP A 1 442  ? -60.306 -84.848  23.726  1.00 11.16 ? 443  ASP A O     1 
ATOM   3324  C  CB    . ASP A 1 442  ? -57.909 -83.724  22.502  1.00 11.27 ? 443  ASP A CB    1 
ATOM   3325  C  CG    . ASP A 1 442  ? -56.979 -82.552  22.545  1.00 12.67 ? 443  ASP A CG    1 
ATOM   3326  O  OD1   . ASP A 1 442  ? -56.215 -82.337  23.535  1.00 13.54 ? 443  ASP A OD1   1 
ATOM   3327  O  OD2   . ASP A 1 442  ? -57.010 -81.845  21.529  1.00 14.43 ? 443  ASP A OD2   1 
ATOM   3328  N  N     . ASN A 1 443  ? -58.982 -86.663  23.652  1.00 11.17 ? 444  ASN A N     1 
ATOM   3329  C  CA    . ASN A 1 443  ? -60.135 -87.562  23.540  1.00 11.17 ? 444  ASN A CA    1 
ATOM   3330  C  C     . ASN A 1 443  ? -60.168 -88.583  24.628  1.00 11.54 ? 444  ASN A C     1 
ATOM   3331  O  O     . ASN A 1 443  ? -60.900 -89.588  24.533  1.00 12.22 ? 444  ASN A O     1 
ATOM   3332  C  CB    . ASN A 1 443  ? -60.130 -88.266  22.192  1.00 10.50 ? 444  ASN A CB    1 
ATOM   3333  C  CG    . ASN A 1 443  ? -60.185 -87.294  21.076  1.00 10.46 ? 444  ASN A CG    1 
ATOM   3334  O  OD1   . ASN A 1 443  ? -61.254 -86.736  20.805  1.00 11.14 ? 444  ASN A OD1   1 
ATOM   3335  N  ND2   . ASN A 1 443  ? -59.029 -86.997  20.465  1.00 10.19 ? 444  ASN A ND2   1 
ATOM   3336  N  N     . THR A 1 444  ? -59.316 -88.387  25.622  1.00 11.43 ? 445  THR A N     1 
ATOM   3337  C  CA    . THR A 1 444  ? -59.303 -89.301  26.750  1.00 11.58 ? 445  THR A CA    1 
ATOM   3338  C  C     . THR A 1 444  ? -59.081 -88.419  27.966  1.00 11.72 ? 445  THR A C     1 
ATOM   3339  O  O     . THR A 1 444  ? -58.946 -87.209  27.843  1.00 12.07 ? 445  THR A O     1 
ATOM   3340  C  CB    . THR A 1 444  ? -58.192 -90.376  26.642  1.00 11.34 ? 445  THR A CB    1 
ATOM   3341  O  OG1   . THR A 1 444  ? -56.918 -89.785  26.891  1.00 12.17 ? 445  THR A OG1   1 
ATOM   3342  C  CG2   . THR A 1 444  ? -58.173 -90.989  25.294  1.00 10.82 ? 445  THR A CG2   1 
ATOM   3343  N  N     . ASP A 1 445  ? -59.106 -89.020  29.144  1.00 12.50 ? 446  ASP A N     1 
ATOM   3344  C  CA    . ASP A 1 445  ? -58.898 -88.272  30.370  1.00 12.15 ? 446  ASP A CA    1 
ATOM   3345  C  C     . ASP A 1 445  ? -57.624 -88.832  31.014  1.00 10.51 ? 446  ASP A C     1 
ATOM   3346  O  O     . ASP A 1 445  ? -57.509 -88.910  32.235  1.00 10.50 ? 446  ASP A O     1 
ATOM   3347  C  CB    . ASP A 1 445  ? -60.153 -88.361  31.281  1.00 13.89 ? 446  ASP A CB    1 
ATOM   3348  C  CG    . ASP A 1 445  ? -60.787 -89.756  31.285  1.00 15.81 ? 446  ASP A CG    1 
ATOM   3349  O  OD1   . ASP A 1 445  ? -60.063 -90.770  31.113  1.00 17.25 ? 446  ASP A OD1   1 
ATOM   3350  O  OD2   . ASP A 1 445  ? -62.026 -89.843  31.437  1.00 17.74 ? 446  ASP A OD2   1 
ATOM   3351  N  N     . LEU A 1 446  ? -56.700 -89.260  30.150  1.00 9.12  ? 447  LEU A N     1 
ATOM   3352  C  CA    . LEU A 1 446  ? -55.384 -89.812  30.546  1.00 7.59  ? 447  LEU A CA    1 
ATOM   3353  C  C     . LEU A 1 446  ? -54.361 -88.675  30.584  1.00 6.79  ? 447  LEU A C     1 
ATOM   3354  O  O     . LEU A 1 446  ? -54.524 -87.640  29.912  1.00 6.20  ? 447  LEU A O     1 
ATOM   3355  C  CB    . LEU A 1 446  ? -54.863 -90.808  29.505  1.00 6.18  ? 447  LEU A CB    1 
ATOM   3356  C  CG    . LEU A 1 446  ? -55.523 -92.146  29.213  1.00 5.99  ? 447  LEU A CG    1 
ATOM   3357  C  CD1   . LEU A 1 446  ? -54.902 -92.788  27.983  1.00 5.14  ? 447  LEU A CD1   1 
ATOM   3358  C  CD2   . LEU A 1 446  ? -55.332 -93.024  30.402  1.00 5.42  ? 447  LEU A CD2   1 
ATOM   3359  N  N     . PHE A 1 447  ? -53.334 -88.850  31.402  1.00 5.98  ? 448  PHE A N     1 
ATOM   3360  C  CA    . PHE A 1 447  ? -52.277 -87.841  31.442  1.00 6.05  ? 448  PHE A CA    1 
ATOM   3361  C  C     . PHE A 1 447  ? -51.283 -88.225  30.354  1.00 6.46  ? 448  PHE A C     1 
ATOM   3362  O  O     . PHE A 1 447  ? -51.075 -89.428  30.062  1.00 6.43  ? 448  PHE A O     1 
ATOM   3363  C  CB    . PHE A 1 447  ? -51.628 -87.738  32.819  1.00 4.63  ? 448  PHE A CB    1 
ATOM   3364  C  CG    . PHE A 1 447  ? -52.579 -87.270  33.873  1.00 3.66  ? 448  PHE A CG    1 
ATOM   3365  C  CD1   . PHE A 1 447  ? -53.368 -88.178  34.567  1.00 2.41  ? 448  PHE A CD1   1 
ATOM   3366  C  CD2   . PHE A 1 447  ? -52.691 -85.916  34.168  1.00 3.47  ? 448  PHE A CD2   1 
ATOM   3367  C  CE1   . PHE A 1 447  ? -54.236 -87.764  35.530  1.00 2.07  ? 448  PHE A CE1   1 
ATOM   3368  C  CE2   . PHE A 1 447  ? -53.573 -85.485  35.142  1.00 2.61  ? 448  PHE A CE2   1 
ATOM   3369  C  CZ    . PHE A 1 447  ? -54.341 -86.406  35.824  1.00 2.08  ? 448  PHE A CZ    1 
ATOM   3370  N  N     . ALA A 1 448  ? -50.730 -87.202  29.704  1.00 6.00  ? 449  ALA A N     1 
ATOM   3371  C  CA    . ALA A 1 448  ? -49.817 -87.453  28.613  1.00 5.48  ? 449  ALA A CA    1 
ATOM   3372  C  C     . ALA A 1 448  ? -48.575 -86.617  28.797  1.00 5.41  ? 449  ALA A C     1 
ATOM   3373  O  O     . ALA A 1 448  ? -48.652 -85.478  29.300  1.00 5.92  ? 449  ALA A O     1 
ATOM   3374  C  CB    . ALA A 1 448  ? -50.498 -87.141  27.279  1.00 4.43  ? 449  ALA A CB    1 
ATOM   3375  N  N     . GLN A 1 449  ? -47.442 -87.201  28.412  1.00 4.45  ? 450  GLN A N     1 
ATOM   3376  C  CA    . GLN A 1 449  ? -46.147 -86.548  28.487  1.00 3.59  ? 450  GLN A CA    1 
ATOM   3377  C  C     . GLN A 1 449  ? -45.447 -86.955  27.205  1.00 3.54  ? 450  GLN A C     1 
ATOM   3378  O  O     . GLN A 1 449  ? -45.713 -88.030  26.691  1.00 4.41  ? 450  GLN A O     1 
ATOM   3379  C  CB    . GLN A 1 449  ? -45.342 -87.046  29.695  1.00 2.46  ? 450  GLN A CB    1 
ATOM   3380  C  CG    . GLN A 1 449  ? -43.925 -86.478  29.801  1.00 2.00  ? 450  GLN A CG    1 
ATOM   3381  C  CD    . GLN A 1 449  ? -43.035 -87.287  30.719  1.00 2.29  ? 450  GLN A CD    1 
ATOM   3382  O  OE1   . GLN A 1 449  ? -42.740 -88.481  30.455  1.00 2.90  ? 450  GLN A OE1   1 
ATOM   3383  N  NE2   . GLN A 1 449  ? -42.665 -86.705  31.835  1.00 2.00  ? 450  GLN A NE2   1 
ATOM   3384  N  N     . GLY A 1 450  ? -44.620 -86.073  26.664  1.00 2.93  ? 451  GLY A N     1 
ATOM   3385  C  CA    . GLY A 1 450  ? -43.859 -86.367  25.457  1.00 2.75  ? 451  GLY A CA    1 
ATOM   3386  C  C     . GLY A 1 450  ? -42.499 -85.693  25.584  1.00 2.49  ? 451  GLY A C     1 
ATOM   3387  O  O     . GLY A 1 450  ? -42.420 -84.596  26.126  1.00 3.53  ? 451  GLY A O     1 
ATOM   3388  N  N     . TYR A 1 451  ? -41.419 -86.342  25.196  1.00 2.03  ? 452  TYR A N     1 
ATOM   3389  C  CA    . TYR A 1 451  ? -40.114 -85.681  25.257  1.00 2.18  ? 452  TYR A CA    1 
ATOM   3390  C  C     . TYR A 1 451  ? -39.272 -86.261  24.127  1.00 2.48  ? 452  TYR A C     1 
ATOM   3391  O  O     . TYR A 1 451  ? -39.201 -87.462  23.959  1.00 2.13  ? 452  TYR A O     1 
ATOM   3392  C  CB    . TYR A 1 451  ? -39.453 -85.903  26.633  1.00 2.36  ? 452  TYR A CB    1 
ATOM   3393  C  CG    . TYR A 1 451  ? -38.103 -85.242  26.800  1.00 2.11  ? 452  TYR A CG    1 
ATOM   3394  C  CD1   . TYR A 1 451  ? -38.014 -83.898  27.140  1.00 2.68  ? 452  TYR A CD1   1 
ATOM   3395  C  CD2   . TYR A 1 451  ? -36.923 -85.940  26.566  1.00 2.00  ? 452  TYR A CD2   1 
ATOM   3396  C  CE1   . TYR A 1 451  ? -36.782 -83.257  27.240  1.00 2.31  ? 452  TYR A CE1   1 
ATOM   3397  C  CE2   . TYR A 1 451  ? -35.696 -85.319  26.649  1.00 2.00  ? 452  TYR A CE2   1 
ATOM   3398  C  CZ    . TYR A 1 451  ? -35.631 -83.973  26.985  1.00 2.95  ? 452  TYR A CZ    1 
ATOM   3399  O  OH    . TYR A 1 451  ? -34.416 -83.298  27.034  1.00 4.13  ? 452  TYR A OH    1 
ATOM   3400  N  N     . PHE A 1 452  ? -38.600 -85.416  23.368  1.00 3.09  ? 453  PHE A N     1 
ATOM   3401  C  CA    . PHE A 1 452  ? -37.821 -85.903  22.239  1.00 3.65  ? 453  PHE A CA    1 
ATOM   3402  C  C     . PHE A 1 452  ? -36.326 -85.629  22.259  1.00 4.48  ? 453  PHE A C     1 
ATOM   3403  O  O     . PHE A 1 452  ? -35.886 -84.595  22.753  1.00 4.91  ? 453  PHE A O     1 
ATOM   3404  C  CB    . PHE A 1 452  ? -38.401 -85.299  20.975  1.00 3.20  ? 453  PHE A CB    1 
ATOM   3405  C  CG    . PHE A 1 452  ? -39.894 -85.404  20.907  1.00 4.19  ? 453  PHE A CG    1 
ATOM   3406  C  CD1   . PHE A 1 452  ? -40.510 -86.590  20.491  1.00 3.55  ? 453  PHE A CD1   1 
ATOM   3407  C  CD2   . PHE A 1 452  ? -40.701 -84.321  21.297  1.00 3.97  ? 453  PHE A CD2   1 
ATOM   3408  C  CE1   . PHE A 1 452  ? -41.873 -86.709  20.463  1.00 2.95  ? 453  PHE A CE1   1 
ATOM   3409  C  CE2   . PHE A 1 452  ? -42.079 -84.430  21.269  1.00 3.35  ? 453  PHE A CE2   1 
ATOM   3410  C  CZ    . PHE A 1 452  ? -42.661 -85.645  20.844  1.00 4.27  ? 453  PHE A CZ    1 
ATOM   3411  N  N     . SER A 1 453  ? -35.536 -86.537  21.696  1.00 4.99  ? 454  SER A N     1 
ATOM   3412  C  CA    . SER A 1 453  ? -34.115 -86.310  21.626  1.00 5.85  ? 454  SER A CA    1 
ATOM   3413  C  C     . SER A 1 453  ? -33.783 -86.197  20.194  1.00 5.91  ? 454  SER A C     1 
ATOM   3414  O  O     . SER A 1 453  ? -34.401 -86.855  19.369  1.00 5.97  ? 454  SER A O     1 
ATOM   3415  C  CB    . SER A 1 453  ? -33.327 -87.410  22.265  1.00 7.44  ? 454  SER A CB    1 
ATOM   3416  O  OG    . SER A 1 453  ? -33.516 -87.302  23.666  1.00 9.80  ? 454  SER A OG    1 
ATOM   3417  N  N     . TYR A 1 454  ? -32.825 -85.324  19.897  1.00 5.87  ? 455  TYR A N     1 
ATOM   3418  C  CA    . TYR A 1 454  ? -32.452 -85.059  18.526  1.00 6.04  ? 455  TYR A CA    1 
ATOM   3419  C  C     . TYR A 1 454  ? -30.983 -85.353  18.292  1.00 6.78  ? 455  TYR A C     1 
ATOM   3420  O  O     . TYR A 1 454  ? -30.273 -85.695  19.235  1.00 7.74  ? 455  TYR A O     1 
ATOM   3421  C  CB    . TYR A 1 454  ? -32.780 -83.600  18.149  1.00 4.60  ? 455  TYR A CB    1 
ATOM   3422  C  CG    . TYR A 1 454  ? -34.231 -83.179  18.368  1.00 3.43  ? 455  TYR A CG    1 
ATOM   3423  C  CD1   . TYR A 1 454  ? -35.214 -83.388  17.399  1.00 3.36  ? 455  TYR A CD1   1 
ATOM   3424  C  CD2   . TYR A 1 454  ? -34.614 -82.582  19.552  1.00 2.46  ? 455  TYR A CD2   1 
ATOM   3425  C  CE1   . TYR A 1 454  ? -36.574 -83.001  17.637  1.00 2.77  ? 455  TYR A CE1   1 
ATOM   3426  C  CE2   . TYR A 1 454  ? -35.904 -82.205  19.798  1.00 2.25  ? 455  TYR A CE2   1 
ATOM   3427  C  CZ    . TYR A 1 454  ? -36.895 -82.402  18.856  1.00 2.66  ? 455  TYR A CZ    1 
ATOM   3428  O  OH    . TYR A 1 454  ? -38.178 -81.993  19.200  1.00 2.50  ? 455  TYR A OH    1 
ATOM   3429  N  N     . ASP A 1 455  ? -30.542 -85.217  17.036  1.00 6.76  ? 456  ASP A N     1 
ATOM   3430  C  CA    . ASP A 1 455  ? -29.154 -85.454  16.658  1.00 6.79  ? 456  ASP A CA    1 
ATOM   3431  C  C     . ASP A 1 455  ? -28.433 -84.114  16.489  1.00 6.83  ? 456  ASP A C     1 
ATOM   3432  O  O     . ASP A 1 455  ? -29.072 -83.083  16.314  1.00 6.74  ? 456  ASP A O     1 
ATOM   3433  C  CB    . ASP A 1 455  ? -29.111 -86.255  15.327  1.00 6.68  ? 456  ASP A CB    1 
ATOM   3434  C  CG    . ASP A 1 455  ? -27.842 -87.132  15.177  1.00 7.06  ? 456  ASP A CG    1 
ATOM   3435  O  OD1   . ASP A 1 455  ? -26.728 -86.675  15.511  1.00 8.06  ? 456  ASP A OD1   1 
ATOM   3436  O  OD2   . ASP A 1 455  ? -27.920 -88.285  14.675  1.00 7.50  ? 456  ASP A OD2   1 
ATOM   3437  N  N     . SER A 1 456  ? -27.102 -84.129  16.610  1.00 7.48  ? 457  SER A N     1 
ATOM   3438  C  CA    . SER A 1 456  ? -26.277 -82.922  16.392  1.00 7.53  ? 457  SER A CA    1 
ATOM   3439  C  C     . SER A 1 456  ? -26.113 -82.756  14.874  1.00 7.16  ? 457  SER A C     1 
ATOM   3440  O  O     . SER A 1 456  ? -25.851 -81.646  14.397  1.00 7.40  ? 457  SER A O     1 
ATOM   3441  C  CB    . SER A 1 456  ? -24.901 -83.075  17.047  1.00 8.44  ? 457  SER A CB    1 
ATOM   3442  O  OG    . SER A 1 456  ? -24.811 -82.265  18.223  1.00 10.98 ? 457  SER A OG    1 
ATOM   3443  N  N     . LYS A 1 457  ? -26.260 -83.868  14.147  1.00 5.99  ? 458  LYS A N     1 
ATOM   3444  C  CA    . LYS A 1 457  ? -26.222 -83.916  12.673  1.00 6.22  ? 458  LYS A CA    1 
ATOM   3445  C  C     . LYS A 1 457  ? -27.458 -83.192  12.185  1.00 5.91  ? 458  LYS A C     1 
ATOM   3446  O  O     . LYS A 1 457  ? -28.530 -83.374  12.727  1.00 6.56  ? 458  LYS A O     1 
ATOM   3447  C  CB    . LYS A 1 457  ? -26.316 -85.370  12.122  1.00 6.11  ? 458  LYS A CB    1 
ATOM   3448  C  CG    . LYS A 1 457  ? -25.192 -86.309  12.552  1.00 6.07  ? 458  LYS A CG    1 
ATOM   3449  C  CD    . LYS A 1 457  ? -23.875 -85.556  12.627  1.00 7.06  ? 458  LYS A CD    1 
ATOM   3450  C  CE    . LYS A 1 457  ? -22.720 -86.461  13.031  1.00 8.32  ? 458  LYS A CE    1 
ATOM   3451  N  NZ    . LYS A 1 457  ? -21.716 -86.411  11.911  1.00 9.84  ? 458  LYS A NZ    1 
ATOM   3452  N  N     . LYS A 1 458  ? -27.318 -82.432  11.115  1.00 5.86  ? 459  LYS A N     1 
ATOM   3453  C  CA    . LYS A 1 458  ? -28.429 -81.677  10.600  1.00 5.41  ? 459  LYS A CA    1 
ATOM   3454  C  C     . LYS A 1 458  ? -29.206 -82.430  9.556   1.00 5.83  ? 459  LYS A C     1 
ATOM   3455  O  O     . LYS A 1 458  ? -30.402 -82.210  9.428   1.00 5.69  ? 459  LYS A O     1 
ATOM   3456  C  CB    . LYS A 1 458  ? -27.943 -80.320  10.132  1.00 4.29  ? 459  LYS A CB    1 
ATOM   3457  C  CG    . LYS A 1 458  ? -27.445 -79.511  11.285  1.00 3.20  ? 459  LYS A CG    1 
ATOM   3458  C  CD    . LYS A 1 458  ? -26.534 -78.450  10.810  1.00 2.99  ? 459  LYS A CD    1 
ATOM   3459  C  CE    . LYS A 1 458  ? -26.314 -77.381  11.882  1.00 2.80  ? 459  LYS A CE    1 
ATOM   3460  N  NZ    . LYS A 1 458  ? -27.507 -76.526  12.070  1.00 2.84  ? 459  LYS A NZ    1 
ATOM   3461  N  N     . SER A 1 459  ? -28.534 -83.289  8.785   1.00 6.74  ? 460  SER A N     1 
ATOM   3462  C  CA    . SER A 1 459  ? -29.232 -84.125  7.801   1.00 7.45  ? 460  SER A CA    1 
ATOM   3463  C  C     . SER A 1 459  ? -28.979 -85.569  8.116   1.00 7.47  ? 460  SER A C     1 
ATOM   3464  O  O     . SER A 1 459  ? -27.877 -85.936  8.491   1.00 7.39  ? 460  SER A O     1 
ATOM   3465  C  CB    . SER A 1 459  ? -28.819 -83.876  6.360   1.00 8.39  ? 460  SER A CB    1 
ATOM   3466  O  OG    . SER A 1 459  ? -29.850 -83.190  5.665   1.00 10.56 ? 460  SER A OG    1 
ATOM   3467  N  N     . GLY A 1 460  ? -30.016 -86.386  7.961   1.00 7.59  ? 461  GLY A N     1 
ATOM   3468  C  CA    . GLY A 1 460  ? -29.901 -87.801  8.245   1.00 7.33  ? 461  GLY A CA    1 
ATOM   3469  C  C     . GLY A 1 460  ? -29.727 -88.117  9.718   1.00 7.46  ? 461  GLY A C     1 
ATOM   3470  O  O     . GLY A 1 460  ? -29.221 -89.185  10.061  1.00 6.91  ? 461  GLY A O     1 
ATOM   3471  N  N     . GLY A 1 461  ? -30.138 -87.195  10.585  1.00 7.71  ? 462  GLY A N     1 
ATOM   3472  C  CA    . GLY A 1 461  ? -30.004 -87.408  12.015  1.00 8.32  ? 462  GLY A CA    1 
ATOM   3473  C  C     . GLY A 1 461  ? -31.039 -88.320  12.658  1.00 8.84  ? 462  GLY A C     1 
ATOM   3474  O  O     . GLY A 1 461  ? -32.161 -88.495  12.157  1.00 9.08  ? 462  GLY A O     1 
ATOM   3475  N  N     . ILE A 1 462  ? -30.637 -88.905  13.779  1.00 8.84  ? 463  ILE A N     1 
ATOM   3476  C  CA    . ILE A 1 462  ? -31.453 -89.798  14.563  1.00 9.31  ? 463  ILE A CA    1 
ATOM   3477  C  C     . ILE A 1 462  ? -32.349 -88.975  15.431  1.00 8.79  ? 463  ILE A C     1 
ATOM   3478  O  O     . ILE A 1 462  ? -32.012 -87.879  15.835  1.00 8.93  ? 463  ILE A O     1 
ATOM   3479  C  CB    . ILE A 1 462  ? -30.572 -90.645  15.546  1.00 10.69 ? 463  ILE A CB    1 
ATOM   3480  C  CG1   . ILE A 1 462  ? -31.411 -91.544  16.445  1.00 10.72 ? 463  ILE A CG1   1 
ATOM   3481  C  CG2   . ILE A 1 462  ? -29.831 -89.739  16.530  1.00 10.97 ? 463  ILE A CG2   1 
ATOM   3482  C  CD1   . ILE A 1 462  ? -30.752 -91.748  17.823  1.00 10.97 ? 463  ILE A CD1   1 
ATOM   3483  N  N     . THR A 1 463  ? -33.491 -89.546  15.753  1.00 8.99  ? 464  THR A N     1 
ATOM   3484  C  CA    . THR A 1 463  ? -34.446 -88.927  16.650  1.00 8.88  ? 464  THR A CA    1 
ATOM   3485  C  C     . THR A 1 463  ? -34.922 -90.059  17.557  1.00 8.05  ? 464  THR A C     1 
ATOM   3486  O  O     . THR A 1 463  ? -35.052 -91.207  17.100  1.00 8.45  ? 464  THR A O     1 
ATOM   3487  C  CB    . THR A 1 463  ? -35.637 -88.355  15.854  1.00 9.67  ? 464  THR A CB    1 
ATOM   3488  O  OG1   . THR A 1 463  ? -35.589 -86.928  15.893  1.00 11.34 ? 464  THR A OG1   1 
ATOM   3489  C  CG2   . THR A 1 463  ? -36.974 -88.810  16.398  1.00 10.12 ? 464  THR A CG2   1 
ATOM   3490  N  N     . ILE A 1 464  ? -35.060 -89.797  18.852  1.00 6.87  ? 465  ILE A N     1 
ATOM   3491  C  CA    . ILE A 1 464  ? -35.640 -90.810  19.722  1.00 5.55  ? 465  ILE A CA    1 
ATOM   3492  C  C     . ILE A 1 464  ? -36.689 -90.186  20.615  1.00 4.71  ? 465  ILE A C     1 
ATOM   3493  O  O     . ILE A 1 464  ? -36.409 -89.326  21.423  1.00 5.05  ? 465  ILE A O     1 
ATOM   3494  C  CB    . ILE A 1 464  ? -34.611 -91.719  20.441  1.00 5.57  ? 465  ILE A CB    1 
ATOM   3495  C  CG1   . ILE A 1 464  ? -35.118 -92.136  21.811  1.00 5.81  ? 465  ILE A CG1   1 
ATOM   3496  C  CG2   . ILE A 1 464  ? -33.234 -91.142  20.413  1.00 6.09  ? 465  ILE A CG2   1 
ATOM   3497  C  CD1   . ILE A 1 464  ? -36.185 -93.207  21.763  1.00 7.01  ? 465  ILE A CD1   1 
ATOM   3498  N  N     . SER A 1 465  ? -37.939 -90.548  20.363  1.00 3.93  ? 466  SER A N     1 
ATOM   3499  C  CA    . SER A 1 465  ? -39.063 -90.011  21.141  1.00 3.20  ? 466  SER A CA    1 
ATOM   3500  C  C     . SER A 1 465  ? -39.469 -90.832  22.387  1.00 2.99  ? 466  SER A C     1 
ATOM   3501  O  O     . SER A 1 465  ? -39.431 -92.064  22.363  1.00 2.98  ? 466  SER A O     1 
ATOM   3502  C  CB    . SER A 1 465  ? -40.255 -89.885  20.217  1.00 2.38  ? 466  SER A CB    1 
ATOM   3503  O  OG    . SER A 1 465  ? -39.842 -89.385  18.944  1.00 3.19  ? 466  SER A OG    1 
ATOM   3504  N  N     . HIS A 1 466  ? -39.809 -90.149  23.480  1.00 2.41  ? 467  HIS A N     1 
ATOM   3505  C  CA    . HIS A 1 466  ? -40.267 -90.796  24.718  1.00 2.53  ? 467  HIS A CA    1 
ATOM   3506  C  C     . HIS A 1 466  ? -41.603 -90.251  25.129  1.00 2.73  ? 467  HIS A C     1 
ATOM   3507  O  O     . HIS A 1 466  ? -41.698 -89.064  25.464  1.00 3.57  ? 467  HIS A O     1 
ATOM   3508  C  CB    . HIS A 1 466  ? -39.347 -90.509  25.853  1.00 2.08  ? 467  HIS A CB    1 
ATOM   3509  C  CG    . HIS A 1 466  ? -37.946 -90.835  25.548  1.00 2.00  ? 467  HIS A CG    1 
ATOM   3510  N  ND1   . HIS A 1 466  ? -37.166 -90.031  24.741  1.00 2.09  ? 467  HIS A ND1   1 
ATOM   3511  C  CD2   . HIS A 1 466  ? -37.178 -91.867  25.931  1.00 2.00  ? 467  HIS A CD2   1 
ATOM   3512  C  CE1   . HIS A 1 466  ? -35.966 -90.560  24.648  1.00 2.36  ? 467  HIS A CE1   1 
ATOM   3513  N  NE2   . HIS A 1 466  ? -35.947 -91.675  25.358  1.00 2.44  ? 467  HIS A NE2   1 
ATOM   3514  N  N     . LEU A 1 467  ? -42.618 -91.112  25.116  1.00 2.41  ? 468  LEU A N     1 
ATOM   3515  C  CA    . LEU A 1 467  ? -43.973 -90.739  25.488  1.00 2.15  ? 468  LEU A CA    1 
ATOM   3516  C  C     . LEU A 1 467  ? -44.487 -91.593  26.653  1.00 2.29  ? 468  LEU A C     1 
ATOM   3517  O  O     . LEU A 1 467  ? -44.142 -92.761  26.791  1.00 2.33  ? 468  LEU A O     1 
ATOM   3518  C  CB    . LEU A 1 467  ? -44.921 -90.945  24.294  1.00 2.00  ? 468  LEU A CB    1 
ATOM   3519  C  CG    . LEU A 1 467  ? -44.669 -90.450  22.870  1.00 2.00  ? 468  LEU A CG    1 
ATOM   3520  C  CD1   . LEU A 1 467  ? -45.974 -90.415  22.155  1.00 2.00  ? 468  LEU A CD1   1 
ATOM   3521  C  CD2   . LEU A 1 467  ? -44.015 -89.090  22.822  1.00 2.00  ? 468  LEU A CD2   1 
ATOM   3522  N  N     . ARG A 1 468  ? -45.346 -91.017  27.477  1.00 2.66  ? 469  ARG A N     1 
ATOM   3523  C  CA    . ARG A 1 468  ? -45.948 -91.774  28.567  1.00 2.84  ? 469  ARG A CA    1 
ATOM   3524  C  C     . ARG A 1 468  ? -47.407 -91.405  28.676  1.00 3.00  ? 469  ARG A C     1 
ATOM   3525  O  O     . ARG A 1 468  ? -47.766 -90.226  28.585  1.00 2.55  ? 469  ARG A O     1 
ATOM   3526  C  CB    . ARG A 1 468  ? -45.284 -91.477  29.903  1.00 3.41  ? 469  ARG A CB    1 
ATOM   3527  C  CG    . ARG A 1 468  ? -43.952 -92.107  30.102  1.00 4.03  ? 469  ARG A CG    1 
ATOM   3528  C  CD    . ARG A 1 468  ? -43.446 -91.851  31.515  1.00 3.95  ? 469  ARG A CD    1 
ATOM   3529  N  NE    . ARG A 1 468  ? -42.096 -91.271  31.475  1.00 5.94  ? 469  ARG A NE    1 
ATOM   3530  C  CZ    . ARG A 1 468  ? -40.989 -91.985  31.622  1.00 5.66  ? 469  ARG A CZ    1 
ATOM   3531  N  NH1   . ARG A 1 468  ? -41.110 -93.281  31.812  1.00 8.55  ? 469  ARG A NH1   1 
ATOM   3532  N  NH2   . ARG A 1 468  ? -39.789 -91.435  31.585  1.00 4.61  ? 469  ARG A NH2   1 
ATOM   3533  N  N     . PHE A 1 469  ? -48.241 -92.413  28.910  1.00 3.45  ? 470  PHE A N     1 
ATOM   3534  C  CA    . PHE A 1 469  ? -49.674 -92.188  29.070  1.00 4.19  ? 470  PHE A CA    1 
ATOM   3535  C  C     . PHE A 1 469  ? -50.172 -92.916  30.296  1.00 4.73  ? 470  PHE A C     1 
ATOM   3536  O  O     . PHE A 1 469  ? -49.855 -94.100  30.493  1.00 5.04  ? 470  PHE A O     1 
ATOM   3537  C  CB    . PHE A 1 469  ? -50.423 -92.713  27.854  1.00 4.62  ? 470  PHE A CB    1 
ATOM   3538  C  CG    . PHE A 1 469  ? -49.997 -92.079  26.593  1.00 4.98  ? 470  PHE A CG    1 
ATOM   3539  C  CD1   . PHE A 1 469  ? -50.533 -90.818  26.209  1.00 4.91  ? 470  PHE A CD1   1 
ATOM   3540  C  CD2   . PHE A 1 469  ? -49.005 -92.681  25.810  1.00 4.19  ? 470  PHE A CD2   1 
ATOM   3541  C  CE1   . PHE A 1 469  ? -50.078 -90.174  25.067  1.00 4.51  ? 470  PHE A CE1   1 
ATOM   3542  C  CE2   . PHE A 1 469  ? -48.540 -92.037  24.662  1.00 4.13  ? 470  PHE A CE2   1 
ATOM   3543  C  CZ    . PHE A 1 469  ? -49.069 -90.794  24.286  1.00 4.13  ? 470  PHE A CZ    1 
ATOM   3544  N  N     . GLY A 1 470  ? -50.991 -92.260  31.102  1.00 5.16  ? 471  GLY A N     1 
ATOM   3545  C  CA    . GLY A 1 470  ? -51.477 -92.943  32.286  1.00 6.36  ? 471  GLY A CA    1 
ATOM   3546  C  C     . GLY A 1 470  ? -52.641 -92.259  32.946  1.00 7.50  ? 471  GLY A C     1 
ATOM   3547  O  O     . GLY A 1 470  ? -52.950 -91.116  32.639  1.00 7.75  ? 471  GLY A O     1 
ATOM   3548  N  N     . GLU A 1 471  ? -53.282 -92.957  33.872  1.00 9.10  ? 472  GLU A N     1 
ATOM   3549  C  CA    . GLU A 1 471  ? -54.440 -92.404  34.575  1.00 10.44 ? 472  GLU A CA    1 
ATOM   3550  C  C     . GLU A 1 471  ? -54.018 -91.568  35.762  1.00 9.82  ? 472  GLU A C     1 
ATOM   3551  O  O     . GLU A 1 471  ? -54.853 -90.914  36.392  1.00 10.68 ? 472  GLU A O     1 
ATOM   3552  C  CB    . GLU A 1 471  ? -55.370 -93.546  35.050  1.00 12.73 ? 472  GLU A CB    1 
ATOM   3553  C  CG    . GLU A 1 471  ? -56.161 -94.247  33.947  0.01 15.09 ? 472  GLU A CG    1 
ATOM   3554  C  CD    . GLU A 1 471  ? -57.506 -93.592  33.670  0.01 16.49 ? 472  GLU A CD    1 
ATOM   3555  O  OE1   . GLU A 1 471  ? -57.540 -92.538  32.999  0.01 17.32 ? 472  GLU A OE1   1 
ATOM   3556  O  OE2   . GLU A 1 471  ? -58.534 -94.140  34.121  0.01 17.33 ? 472  GLU A OE2   1 
ATOM   3557  N  N     . LYS A 1 472  ? -52.728 -91.643  36.089  1.00 8.86  ? 473  LYS A N     1 
ATOM   3558  C  CA    . LYS A 1 472  ? -52.132 -90.927  37.206  1.00 7.46  ? 473  LYS A CA    1 
ATOM   3559  C  C     . LYS A 1 472  ? -51.179 -89.876  36.671  1.00 5.92  ? 473  LYS A C     1 
ATOM   3560  O  O     . LYS A 1 472  ? -50.379 -90.172  35.797  1.00 4.95  ? 473  LYS A O     1 
ATOM   3561  C  CB    . LYS A 1 472  ? -51.370 -91.918  38.083  1.00 8.51  ? 473  LYS A CB    1 
ATOM   3562  C  CG    . LYS A 1 472  ? -52.250 -93.022  38.747  1.00 10.55 ? 473  LYS A CG    1 
ATOM   3563  C  CD    . LYS A 1 472  ? -53.311 -92.413  39.703  1.00 12.10 ? 473  LYS A CD    1 
ATOM   3564  C  CE    . LYS A 1 472  ? -54.627 -93.276  39.759  1.00 14.61 ? 473  LYS A CE    1 
ATOM   3565  N  NZ    . LYS A 1 472  ? -55.852 -92.622  40.401  1.00 14.86 ? 473  LYS A NZ    1 
ATOM   3566  N  N     . PRO A 1 473  ? -51.200 -88.654  37.234  1.00 4.95  ? 474  PRO A N     1 
ATOM   3567  C  CA    . PRO A 1 473  ? -50.299 -87.598  36.750  1.00 4.99  ? 474  PRO A CA    1 
ATOM   3568  C  C     . PRO A 1 473  ? -48.898 -88.141  36.584  1.00 4.54  ? 474  PRO A C     1 
ATOM   3569  O  O     . PRO A 1 473  ? -48.493 -89.064  37.292  1.00 4.86  ? 474  PRO A O     1 
ATOM   3570  C  CB    . PRO A 1 473  ? -50.364 -86.545  37.854  1.00 4.21  ? 474  PRO A CB    1 
ATOM   3571  C  CG    . PRO A 1 473  ? -51.712 -86.658  38.322  1.00 4.44  ? 474  PRO A CG    1 
ATOM   3572  C  CD    . PRO A 1 473  ? -51.891 -88.185  38.435  1.00 4.80  ? 474  PRO A CD    1 
ATOM   3573  N  N     . ILE A 1 474  ? -48.256 -87.685  35.519  1.00 3.90  ? 475  ILE A N     1 
ATOM   3574  C  CA    . ILE A 1 474  ? -46.904 -88.095  35.194  1.00 3.12  ? 475  ILE A CA    1 
ATOM   3575  C  C     . ILE A 1 474  ? -45.803 -87.133  35.719  1.00 3.06  ? 475  ILE A C     1 
ATOM   3576  O  O     . ILE A 1 474  ? -45.663 -86.001  35.245  1.00 3.31  ? 475  ILE A O     1 
ATOM   3577  C  CB    . ILE A 1 474  ? -46.784 -88.285  33.678  1.00 2.58  ? 475  ILE A CB    1 
ATOM   3578  C  CG1   . ILE A 1 474  ? -47.755 -89.370  33.224  1.00 2.00  ? 475  ILE A CG1   1 
ATOM   3579  C  CG2   . ILE A 1 474  ? -45.356 -88.710  33.331  1.00 2.61  ? 475  ILE A CG2   1 
ATOM   3580  C  CD1   . ILE A 1 474  ? -48.119 -89.298  31.793  1.00 2.03  ? 475  ILE A CD1   1 
ATOM   3581  N  N     . GLN A 1 475  ? -45.035 -87.587  36.708  1.00 2.94  ? 476  GLN A N     1 
ATOM   3582  C  CA    . GLN A 1 475  ? -43.932 -86.792  37.293  1.00 2.46  ? 476  GLN A CA    1 
ATOM   3583  C  C     . GLN A 1 475  ? -42.586 -87.322  36.826  1.00 2.31  ? 476  GLN A C     1 
ATOM   3584  O  O     . GLN A 1 475  ? -41.591 -87.101  37.472  1.00 2.10  ? 476  GLN A O     1 
ATOM   3585  C  CB    . GLN A 1 475  ? -43.948 -86.916  38.804  1.00 2.00  ? 476  GLN A CB    1 
ATOM   3586  C  CG    . GLN A 1 475  ? -45.174 -86.383  39.418  1.00 2.13  ? 476  GLN A CG    1 
ATOM   3587  C  CD    . GLN A 1 475  ? -45.044 -86.276  40.884  1.00 2.71  ? 476  GLN A CD    1 
ATOM   3588  O  OE1   . GLN A 1 475  ? -45.110 -87.275  41.580  1.00 3.17  ? 476  GLN A OE1   1 
ATOM   3589  N  NE2   . GLN A 1 475  ? -44.861 -85.062  41.380  1.00 2.35  ? 476  GLN A NE2   1 
ATOM   3590  N  N     . SER A 1 476  ? -42.563 -88.023  35.708  1.00 2.14  ? 477  SER A N     1 
ATOM   3591  C  CA    . SER A 1 476  ? -41.334 -88.623  35.226  1.00 2.50  ? 477  SER A CA    1 
ATOM   3592  C  C     . SER A 1 476  ? -40.448 -87.733  34.398  1.00 2.09  ? 477  SER A C     1 
ATOM   3593  O  O     . SER A 1 476  ? -40.416 -87.811  33.192  1.00 2.13  ? 477  SER A O     1 
ATOM   3594  C  CB    . SER A 1 476  ? -41.698 -89.880  34.456  1.00 2.84  ? 477  SER A CB    1 
ATOM   3595  O  OG    . SER A 1 476  ? -42.778 -90.520  35.115  1.00 3.03  ? 477  SER A OG    1 
ATOM   3596  N  N     . THR A 1 477  ? -39.714 -86.860  35.049  1.00 2.63  ? 478  THR A N     1 
ATOM   3597  C  CA    . THR A 1 477  ? -38.824 -85.954  34.304  1.00 2.63  ? 478  THR A CA    1 
ATOM   3598  C  C     . THR A 1 477  ? -37.469 -86.606  33.972  1.00 2.77  ? 478  THR A C     1 
ATOM   3599  O  O     . THR A 1 477  ? -36.397 -86.063  34.264  1.00 2.53  ? 478  THR A O     1 
ATOM   3600  C  CB    . THR A 1 477  ? -38.670 -84.589  35.001  1.00 2.00  ? 478  THR A CB    1 
ATOM   3601  O  OG1   . THR A 1 477  ? -38.256 -84.792  36.355  1.00 2.00  ? 478  THR A OG1   1 
ATOM   3602  C  CG2   . THR A 1 477  ? -40.033 -83.866  35.017  1.00 2.00  ? 478  THR A CG2   1 
ATOM   3603  N  N     . TYR A 1 478  ? -37.560 -87.761  33.308  1.00 2.19  ? 479  TYR A N     1 
ATOM   3604  C  CA    . TYR A 1 478  ? -36.402 -88.507  32.868  1.00 2.29  ? 479  TYR A CA    1 
ATOM   3605  C  C     . TYR A 1 478  ? -36.814 -89.329  31.651  1.00 2.22  ? 479  TYR A C     1 
ATOM   3606  O  O     . TYR A 1 478  ? -37.984 -89.525  31.389  1.00 2.00  ? 479  TYR A O     1 
ATOM   3607  C  CB    . TYR A 1 478  ? -35.813 -89.381  33.998  1.00 2.42  ? 479  TYR A CB    1 
ATOM   3608  C  CG    . TYR A 1 478  ? -36.789 -90.378  34.591  1.00 3.02  ? 479  TYR A CG    1 
ATOM   3609  C  CD1   . TYR A 1 478  ? -37.759 -89.962  35.521  1.00 3.19  ? 479  TYR A CD1   1 
ATOM   3610  C  CD2   . TYR A 1 478  ? -36.796 -91.714  34.175  1.00 2.74  ? 479  TYR A CD2   1 
ATOM   3611  C  CE1   . TYR A 1 478  ? -38.713 -90.837  36.004  1.00 3.21  ? 479  TYR A CE1   1 
ATOM   3612  C  CE2   . TYR A 1 478  ? -37.747 -92.599  34.653  1.00 2.74  ? 479  TYR A CE2   1 
ATOM   3613  C  CZ    . TYR A 1 478  ? -38.700 -92.139  35.571  1.00 3.04  ? 479  TYR A CZ    1 
ATOM   3614  O  OH    . TYR A 1 478  ? -39.655 -92.985  36.067  1.00 4.67  ? 479  TYR A OH    1 
ATOM   3615  N  N     . LEU A 1 479  ? -35.854 -89.760  30.854  1.00 2.72  ? 480  LEU A N     1 
ATOM   3616  C  CA    . LEU A 1 479  ? -36.198 -90.547  29.679  1.00 3.18  ? 480  LEU A CA    1 
ATOM   3617  C  C     . LEU A 1 479  ? -36.876 -91.859  30.077  1.00 3.31  ? 480  LEU A C     1 
ATOM   3618  O  O     . LEU A 1 479  ? -36.981 -92.146  31.255  1.00 3.55  ? 480  LEU A O     1 
ATOM   3619  C  CB    . LEU A 1 479  ? -34.950 -90.821  28.847  1.00 2.96  ? 480  LEU A CB    1 
ATOM   3620  C  CG    . LEU A 1 479  ? -34.187 -89.588  28.351  1.00 2.78  ? 480  LEU A CG    1 
ATOM   3621  C  CD1   . LEU A 1 479  ? -33.011 -90.059  27.541  1.00 2.06  ? 480  LEU A CD1   1 
ATOM   3622  C  CD2   . LEU A 1 479  ? -35.098 -88.676  27.567  1.00 2.00  ? 480  LEU A CD2   1 
ATOM   3623  N  N     . VAL A 1 480  ? -37.483 -92.540  29.106  1.00 3.97  ? 481  VAL A N     1 
ATOM   3624  C  CA    . VAL A 1 480  ? -38.142 -93.825  29.329  1.00 4.24  ? 481  VAL A CA    1 
ATOM   3625  C  C     . VAL A 1 480  ? -36.996 -94.850  29.280  1.00 5.88  ? 481  VAL A C     1 
ATOM   3626  O  O     . VAL A 1 480  ? -36.217 -94.870  28.323  1.00 6.10  ? 481  VAL A O     1 
ATOM   3627  C  CB    . VAL A 1 480  ? -39.107 -94.213  28.164  1.00 3.69  ? 481  VAL A CB    1 
ATOM   3628  C  CG1   . VAL A 1 480  ? -39.405 -95.751  28.222  1.00 3.10  ? 481  VAL A CG1   1 
ATOM   3629  C  CG2   . VAL A 1 480  ? -40.410 -93.431  28.226  1.00 2.03  ? 481  VAL A CG2   1 
ATOM   3630  N  N     . ASN A 1 481  ? -36.864 -95.681  30.302  1.00 7.07  ? 482  ASN A N     1 
ATOM   3631  C  CA    . ASN A 1 481  ? -35.829 -96.671  30.258  1.00 8.10  ? 482  ASN A CA    1 
ATOM   3632  C  C     . ASN A 1 481  ? -36.358 -98.102  30.390  1.00 8.49  ? 482  ASN A C     1 
ATOM   3633  O  O     . ASN A 1 481  ? -35.578 -99.046  30.272  1.00 9.04  ? 482  ASN A O     1 
ATOM   3634  C  CB    . ASN A 1 481  ? -34.754 -96.346  31.286  1.00 9.79  ? 482  ASN A CB    1 
ATOM   3635  C  CG    . ASN A 1 481  ? -35.333 -95.918  32.616  1.00 11.86 ? 482  ASN A CG    1 
ATOM   3636  O  OD1   . ASN A 1 481  ? -36.118 -96.660  33.222  1.00 13.27 ? 482  ASN A OD1   1 
ATOM   3637  N  ND2   . ASN A 1 481  ? -34.945 -94.720  33.088  1.00 12.09 ? 482  ASN A ND2   1 
ATOM   3638  N  N     . ARG A 1 482  ? -37.673 -98.261  30.591  1.00 8.63  ? 483  ARG A N     1 
ATOM   3639  C  CA    . ARG A 1 482  ? -38.333 -99.586  30.721  1.00 8.67  ? 483  ARG A CA    1 
ATOM   3640  C  C     . ARG A 1 482  ? -39.538 -99.519  29.818  1.00 7.60  ? 483  ARG A C     1 
ATOM   3641  O  O     . ARG A 1 482  ? -40.648 -99.346  30.295  1.00 7.36  ? 483  ARG A O     1 
ATOM   3642  C  CB    . ARG A 1 482  ? -38.875 -99.822  32.146  1.00 10.61 ? 483  ARG A CB    1 
ATOM   3643  C  CG    . ARG A 1 482  ? -37.852 -99.975  33.249  1.00 14.06 ? 483  ARG A CG    1 
ATOM   3644  C  CD    . ARG A 1 482  ? -37.332 -101.414 33.388  1.00 16.82 ? 483  ARG A CD    1 
ATOM   3645  N  NE    . ARG A 1 482  ? -36.760 -101.649 34.720  1.00 19.37 ? 483  ARG A NE    1 
ATOM   3646  C  CZ    . ARG A 1 482  ? -35.465 -101.800 34.979  1.00 20.56 ? 483  ARG A CZ    1 
ATOM   3647  N  NH1   . ARG A 1 482  ? -34.566 -101.752 33.987  1.00 21.31 ? 483  ARG A NH1   1 
ATOM   3648  N  NH2   . ARG A 1 482  ? -35.071 -101.968 36.245  1.00 21.01 ? 483  ARG A NH2   1 
ATOM   3649  N  N     . ALA A 1 483  ? -39.347 -99.730  28.528  1.00 6.90  ? 484  ALA A N     1 
ATOM   3650  C  CA    . ALA A 1 483  ? -40.452 -99.591  27.596  1.00 5.71  ? 484  ALA A CA    1 
ATOM   3651  C  C     . ALA A 1 483  ? -41.483 -100.722 27.429  1.00 5.91  ? 484  ALA A C     1 
ATOM   3652  O  O     . ALA A 1 483  ? -41.153 -101.914 27.434  1.00 5.37  ? 484  ALA A O     1 
ATOM   3653  C  CB    . ALA A 1 483  ? -39.911 -99.198  26.250  1.00 4.23  ? 484  ALA A CB    1 
ATOM   3654  N  N     . ASP A 1 484  ? -42.743 -100.303 27.267  1.00 6.16  ? 485  ASP A N     1 
ATOM   3655  C  CA    . ASP A 1 484  ? -43.856 -101.192 26.988  1.00 6.34  ? 485  ASP A CA    1 
ATOM   3656  C  C     . ASP A 1 484  ? -43.929 -101.274 25.482  1.00 6.33  ? 485  ASP A C     1 
ATOM   3657  O  O     . ASP A 1 484  ? -44.359 -102.318 24.933  1.00 7.21  ? 485  ASP A O     1 
ATOM   3658  C  CB    . ASP A 1 484  ? -45.176 -100.610 27.441  1.00 7.04  ? 485  ASP A CB    1 
ATOM   3659  C  CG    . ASP A 1 484  ? -45.269 -100.490 28.922  1.00 8.11  ? 485  ASP A CG    1 
ATOM   3660  O  OD1   . ASP A 1 484  ? -45.441 -101.549 29.579  1.00 8.43  ? 485  ASP A OD1   1 
ATOM   3661  O  OD2   . ASP A 1 484  ? -45.182 -99.332  29.412  1.00 8.00  ? 485  ASP A OD2   1 
ATOM   3662  N  N     . TYR A 1 485  ? -43.491 -100.195 24.821  1.00 5.13  ? 486  TYR A N     1 
ATOM   3663  C  CA    . TYR A 1 485  ? -43.536 -100.110 23.357  1.00 4.19  ? 486  TYR A CA    1 
ATOM   3664  C  C     . TYR A 1 485  ? -42.301 -99.488  22.720  1.00 3.31  ? 486  TYR A C     1 
ATOM   3665  O  O     . TYR A 1 485  ? -41.931 -98.386  23.063  1.00 2.89  ? 486  TYR A O     1 
ATOM   3666  C  CB    . TYR A 1 485  ? -44.818 -99.355  22.949  1.00 3.91  ? 486  TYR A CB    1 
ATOM   3667  C  CG    . TYR A 1 485  ? -45.086 -99.259  21.480  1.00 3.80  ? 486  TYR A CG    1 
ATOM   3668  C  CD1   . TYR A 1 485  ? -44.568 -98.207  20.751  1.00 3.66  ? 486  TYR A CD1   1 
ATOM   3669  C  CD2   . TYR A 1 485  ? -45.905 -100.182 20.815  1.00 4.55  ? 486  TYR A CD2   1 
ATOM   3670  C  CE1   . TYR A 1 485  ? -44.821 -98.051  19.414  1.00 3.78  ? 486  TYR A CE1   1 
ATOM   3671  C  CE2   . TYR A 1 485  ? -46.179 -100.014 19.424  1.00 5.15  ? 486  TYR A CE2   1 
ATOM   3672  C  CZ    . TYR A 1 485  ? -45.608 -98.936  18.748  1.00 4.53  ? 486  TYR A CZ    1 
ATOM   3673  O  OH    . TYR A 1 485  ? -45.721 -98.773  17.388  1.00 6.44  ? 486  TYR A OH    1 
ATOM   3674  N  N     . VAL A 1 486  ? -41.628 -100.229 21.839  1.00 2.78  ? 487  VAL A N     1 
ATOM   3675  C  CA    . VAL A 1 486  ? -40.448 -99.700  21.148  1.00 2.78  ? 487  VAL A CA    1 
ATOM   3676  C  C     . VAL A 1 486  ? -40.655 -99.796  19.641  1.00 2.99  ? 487  VAL A C     1 
ATOM   3677  O  O     . VAL A 1 486  ? -40.880 -100.893 19.117  1.00 3.19  ? 487  VAL A O     1 
ATOM   3678  C  CB    . VAL A 1 486  ? -39.111 -100.421 21.513  1.00 2.41  ? 487  VAL A CB    1 
ATOM   3679  C  CG1   . VAL A 1 486  ? -37.955 -99.793  20.746  1.00 2.00  ? 487  VAL A CG1   1 
ATOM   3680  C  CG2   . VAL A 1 486  ? -38.839 -100.309 22.990  1.00 2.04  ? 487  VAL A CG2   1 
ATOM   3681  N  N     . ALA A 1 487  ? -40.494 -98.657  18.966  1.00 2.21  ? 488  ALA A N     1 
ATOM   3682  C  CA    . ALA A 1 487  ? -40.663 -98.545  17.543  1.00 2.00  ? 488  ALA A CA    1 
ATOM   3683  C  C     . ALA A 1 487  ? -39.382 -98.094  16.882  1.00 2.23  ? 488  ALA A C     1 
ATOM   3684  O  O     . ALA A 1 487  ? -38.835 -97.061  17.249  1.00 2.38  ? 488  ALA A O     1 
ATOM   3685  C  CB    . ALA A 1 487  ? -41.726 -97.533  17.276  1.00 2.02  ? 488  ALA A CB    1 
ATOM   3686  N  N     . CYS A 1 488  ? -38.897 -98.865  15.915  1.00 2.45  ? 489  CYS A N     1 
ATOM   3687  C  CA    . CYS A 1 488  ? -37.686 -98.510  15.163  1.00 2.45  ? 489  CYS A CA    1 
ATOM   3688  C  C     . CYS A 1 488  ? -38.141 -98.233  13.723  1.00 3.11  ? 489  CYS A C     1 
ATOM   3689  O  O     . CYS A 1 488  ? -38.489 -99.173  12.967  1.00 2.74  ? 489  CYS A O     1 
ATOM   3690  C  CB    . CYS A 1 488  ? -36.717 -99.650  15.187  1.00 2.02  ? 489  CYS A CB    1 
ATOM   3691  S  SG    . CYS A 1 488  ? -35.326 -99.267  14.252  1.00 2.69  ? 489  CYS A SG    1 
ATOM   3692  N  N     . HIS A 1 489  ? -38.182 -96.942  13.369  1.00 3.00  ? 490  HIS A N     1 
ATOM   3693  C  CA    . HIS A 1 489  ? -38.686 -96.502  12.083  1.00 2.83  ? 490  HIS A CA    1 
ATOM   3694  C  C     . HIS A 1 489  ? -37.761 -96.494  10.896  1.00 3.71  ? 490  HIS A C     1 
ATOM   3695  O  O     . HIS A 1 489  ? -38.192 -96.214  9.768   1.00 3.89  ? 490  HIS A O     1 
ATOM   3696  C  CB    . HIS A 1 489  ? -39.310 -95.132  12.256  1.00 2.96  ? 490  HIS A CB    1 
ATOM   3697  C  CG    . HIS A 1 489  ? -40.514 -95.130  13.142  1.00 2.53  ? 490  HIS A CG    1 
ATOM   3698  N  ND1   . HIS A 1 489  ? -41.217 -93.981  13.450  1.00 2.28  ? 490  HIS A ND1   1 
ATOM   3699  C  CD2   . HIS A 1 489  ? -41.169 -96.146  13.751  1.00 2.00  ? 490  HIS A CD2   1 
ATOM   3700  C  CE1   . HIS A 1 489  ? -42.254 -94.292  14.203  1.00 2.00  ? 490  HIS A CE1   1 
ATOM   3701  N  NE2   . HIS A 1 489  ? -42.247 -95.598  14.400  1.00 2.00  ? 490  HIS A NE2   1 
ATOM   3702  N  N     . ASN A 1 490  ? -36.480 -96.719  11.169  1.00 4.38  ? 491  ASN A N     1 
ATOM   3703  C  CA    . ASN A 1 490  ? -35.412 -96.779  10.158  1.00 4.55  ? 491  ASN A CA    1 
ATOM   3704  C  C     . ASN A 1 490  ? -34.712 -98.126  10.435  1.00 4.98  ? 491  ASN A C     1 
ATOM   3705  O  O     . ASN A 1 490  ? -34.011 -98.261  11.448  1.00 4.91  ? 491  ASN A O     1 
ATOM   3706  C  CB    . ASN A 1 490  ? -34.419 -95.620  10.394  1.00 4.12  ? 491  ASN A CB    1 
ATOM   3707  C  CG    . ASN A 1 490  ? -33.306 -95.529  9.328   1.00 4.36  ? 491  ASN A CG    1 
ATOM   3708  O  OD1   . ASN A 1 490  ? -32.658 -94.463  9.182   1.00 4.02  ? 491  ASN A OD1   1 
ATOM   3709  N  ND2   . ASN A 1 490  ? -33.085 -96.620  8.566   1.00 3.55  ? 491  ASN A ND2   1 
ATOM   3710  N  N     . PRO A 1 491  ? -34.890 -99.123  9.546   1.00 4.92  ? 492  PRO A N     1 
ATOM   3711  C  CA    . PRO A 1 491  ? -34.304 -100.467 9.652   1.00 5.03  ? 492  PRO A CA    1 
ATOM   3712  C  C     . PRO A 1 491  ? -32.781 -100.492 9.803   1.00 5.21  ? 492  PRO A C     1 
ATOM   3713  O  O     . PRO A 1 491  ? -32.205 -101.473 10.292  1.00 5.69  ? 492  PRO A O     1 
ATOM   3714  C  CB    . PRO A 1 491  ? -34.755 -101.147 8.348   1.00 5.46  ? 492  PRO A CB    1 
ATOM   3715  C  CG    . PRO A 1 491  ? -35.028 -100.011 7.417   1.00 5.18  ? 492  PRO A CG    1 
ATOM   3716  C  CD    . PRO A 1 491  ? -35.689 -98.997  8.321   1.00 5.44  ? 492  PRO A CD    1 
ATOM   3717  N  N     . ALA A 1 492  ? -32.124 -99.406  9.410   1.00 4.73  ? 493  ALA A N     1 
ATOM   3718  C  CA    . ALA A 1 492  ? -30.687 -99.335  9.511   1.00 4.39  ? 493  ALA A CA    1 
ATOM   3719  C  C     . ALA A 1 492  ? -30.171 -99.175  10.964  1.00 4.54  ? 493  ALA A C     1 
ATOM   3720  O  O     . ALA A 1 492  ? -28.982 -99.441  11.231  1.00 4.13  ? 493  ALA A O     1 
ATOM   3721  C  CB    . ALA A 1 492  ? -30.180 -98.225  8.621   1.00 5.11  ? 493  ALA A CB    1 
ATOM   3722  N  N     . TYR A 1 493  ? -31.051 -98.746  11.879  1.00 4.21  ? 494  TYR A N     1 
ATOM   3723  C  CA    . TYR A 1 493  ? -30.707 -98.559  13.303  1.00 4.55  ? 494  TYR A CA    1 
ATOM   3724  C  C     . TYR A 1 493  ? -30.523 -99.897  14.001  1.00 5.51  ? 494  TYR A C     1 
ATOM   3725  O  O     . TYR A 1 493  ? -29.872 -99.997  15.035  1.00 5.71  ? 494  TYR A O     1 
ATOM   3726  C  CB    . TYR A 1 493  ? -31.828 -97.818  14.049  1.00 3.21  ? 494  TYR A CB    1 
ATOM   3727  C  CG    . TYR A 1 493  ? -32.019 -96.393  13.611  1.00 2.25  ? 494  TYR A CG    1 
ATOM   3728  C  CD1   . TYR A 1 493  ? -31.089 -95.782  12.800  1.00 2.02  ? 494  TYR A CD1   1 
ATOM   3729  C  CD2   . TYR A 1 493  ? -33.104 -95.652  14.042  1.00 2.00  ? 494  TYR A CD2   1 
ATOM   3730  C  CE1   . TYR A 1 493  ? -31.223 -94.457  12.431  1.00 2.68  ? 494  TYR A CE1   1 
ATOM   3731  C  CE2   . TYR A 1 493  ? -33.267 -94.323  13.677  1.00 2.02  ? 494  TYR A CE2   1 
ATOM   3732  C  CZ    . TYR A 1 493  ? -32.308 -93.729  12.869  1.00 2.30  ? 494  TYR A CZ    1 
ATOM   3733  O  OH    . TYR A 1 493  ? -32.386 -92.418  12.492  1.00 2.00  ? 494  TYR A OH    1 
ATOM   3734  N  N     . VAL A 1 494  ? -31.099 -100.929 13.408  1.00 6.78  ? 495  VAL A N     1 
ATOM   3735  C  CA    . VAL A 1 494  ? -31.078 -102.252 13.989  1.00 8.30  ? 495  VAL A CA    1 
ATOM   3736  C  C     . VAL A 1 494  ? -29.663 -102.765 14.217  1.00 9.32  ? 495  VAL A C     1 
ATOM   3737  O  O     . VAL A 1 494  ? -29.343 -103.365 15.264  1.00 9.92  ? 495  VAL A O     1 
ATOM   3738  C  CB    . VAL A 1 494  ? -31.948 -103.200 13.141  1.00 7.85  ? 495  VAL A CB    1 
ATOM   3739  C  CG1   . VAL A 1 494  ? -31.103 -104.273 12.473  1.00 7.92  ? 495  VAL A CG1   1 
ATOM   3740  C  CG2   . VAL A 1 494  ? -33.059 -103.761 13.992  1.00 7.28  ? 495  VAL A CG2   1 
ATOM   3741  N  N     . GLY A 1 495  ? -28.805 -102.466 13.259  1.00 10.24 ? 496  GLY A N     1 
ATOM   3742  C  CA    . GLY A 1 495  ? -27.421 -102.876 13.381  1.00 11.58 ? 496  GLY A CA    1 
ATOM   3743  C  C     . GLY A 1 495  ? -26.467 -101.872 14.074  1.00 12.13 ? 496  GLY A C     1 
ATOM   3744  O  O     . GLY A 1 495  ? -25.314 -102.237 14.431  1.00 13.01 ? 496  GLY A O     1 
ATOM   3745  N  N     . ILE A 1 496  ? -26.896 -100.631 14.295  1.00 11.43 ? 497  ILE A N     1 
ATOM   3746  C  CA    . ILE A 1 496  ? -25.976 -99.696  14.929  1.00 10.99 ? 497  ILE A CA    1 
ATOM   3747  C  C     . ILE A 1 496  ? -26.288 -99.268  16.359  1.00 10.67 ? 497  ILE A C     1 
ATOM   3748  O  O     . ILE A 1 496  ? -25.384 -99.090  17.155  1.00 10.84 ? 497  ILE A O     1 
ATOM   3749  C  CB    . ILE A 1 496  ? -25.699 -98.477  14.017  1.00 10.54 ? 497  ILE A CB    1 
ATOM   3750  C  CG1   . ILE A 1 496  ? -27.001 -97.817  13.601  1.00 10.93 ? 497  ILE A CG1   1 
ATOM   3751  C  CG2   . ILE A 1 496  ? -25.063 -98.937  12.742  1.00 10.70 ? 497  ILE A CG2   1 
ATOM   3752  C  CD1   . ILE A 1 496  ? -26.867 -96.826  12.450  1.00 10.18 ? 497  ILE A CD1   1 
ATOM   3753  N  N     . TYR A 1 497  ? -27.562 -99.189  16.710  1.00 10.34 ? 498  TYR A N     1 
ATOM   3754  C  CA    . TYR A 1 497  ? -27.932 -98.747  18.052  1.00 9.64  ? 498  TYR A CA    1 
ATOM   3755  C  C     . TYR A 1 497  ? -28.556 -99.796  18.941  1.00 9.48  ? 498  TYR A C     1 
ATOM   3756  O  O     . TYR A 1 497  ? -29.118 -100.784 18.462  1.00 9.61  ? 498  TYR A O     1 
ATOM   3757  C  CB    . TYR A 1 497  ? -28.937 -97.607  17.948  1.00 9.05  ? 498  TYR A CB    1 
ATOM   3758  C  CG    . TYR A 1 497  ? -28.432 -96.455  17.173  1.00 8.78  ? 498  TYR A CG    1 
ATOM   3759  C  CD1   . TYR A 1 497  ? -27.376 -95.690  17.649  1.00 8.95  ? 498  TYR A CD1   1 
ATOM   3760  C  CD2   . TYR A 1 497  ? -29.009 -96.105  15.975  1.00 9.14  ? 498  TYR A CD2   1 
ATOM   3761  C  CE1   . TYR A 1 497  ? -26.901 -94.601  16.944  1.00 8.56  ? 498  TYR A CE1   1 
ATOM   3762  C  CE2   . TYR A 1 497  ? -28.547 -95.007  15.254  1.00 9.03  ? 498  TYR A CE2   1 
ATOM   3763  C  CZ    . TYR A 1 497  ? -27.503 -94.274  15.749  1.00 8.96  ? 498  TYR A CZ    1 
ATOM   3764  O  OH    . TYR A 1 497  ? -27.064 -93.207  15.040  1.00 9.82  ? 498  TYR A OH    1 
ATOM   3765  N  N     . ASP A 1 498  ? -28.554 -99.524  20.240  1.00 9.83  ? 499  ASP A N     1 
ATOM   3766  C  CA    . ASP A 1 498  ? -29.179 -100.453 21.179  1.00 9.75  ? 499  ASP A CA    1 
ATOM   3767  C  C     . ASP A 1 498  ? -30.713 -100.156 21.318  1.00 8.77  ? 499  ASP A C     1 
ATOM   3768  O  O     . ASP A 1 498  ? -31.206 -99.726  22.355  1.00 7.65  ? 499  ASP A O     1 
ATOM   3769  C  CB    . ASP A 1 498  ? -28.453 -100.384 22.511  1.00 11.41 ? 499  ASP A CB    1 
ATOM   3770  C  CG    . ASP A 1 498  ? -28.673 -101.631 23.362  1.00 14.00 ? 499  ASP A CG    1 
ATOM   3771  O  OD1   . ASP A 1 498  ? -29.576 -102.485 23.077  1.00 15.08 ? 499  ASP A OD1   1 
ATOM   3772  O  OD2   . ASP A 1 498  ? -27.922 -101.761 24.349  1.00 16.42 ? 499  ASP A OD2   1 
ATOM   3773  N  N     . ILE A 1 499  ? -31.443 -100.441 20.244  1.00 8.01  ? 500  ILE A N     1 
ATOM   3774  C  CA    . ILE A 1 499  ? -32.887 -100.199 20.135  1.00 7.58  ? 500  ILE A CA    1 
ATOM   3775  C  C     . ILE A 1 499  ? -33.765 -100.767 21.260  1.00 6.78  ? 500  ILE A C     1 
ATOM   3776  O  O     . ILE A 1 499  ? -34.766 -100.155 21.662  1.00 6.29  ? 500  ILE A O     1 
ATOM   3777  C  CB    . ILE A 1 499  ? -33.486 -100.822 18.797  1.00 7.69  ? 500  ILE A CB    1 
ATOM   3778  C  CG1   . ILE A 1 499  ? -32.574 -100.588 17.579  1.00 7.49  ? 500  ILE A CG1   1 
ATOM   3779  C  CG2   . ILE A 1 499  ? -34.794 -100.138 18.470  1.00 7.90  ? 500  ILE A CG2   1 
ATOM   3780  C  CD1   . ILE A 1 499  ? -32.301 -99.139  17.302  1.00 6.99  ? 500  ILE A CD1   1 
ATOM   3781  N  N     . LEU A 1 500  ? -33.393 -101.961 21.714  1.00 6.78  ? 501  LEU A N     1 
ATOM   3782  C  CA    . LEU A 1 500  ? -34.113 -102.734 22.727  1.00 6.50  ? 501  LEU A CA    1 
ATOM   3783  C  C     . LEU A 1 500  ? -33.683 -102.642 24.202  1.00 7.39  ? 501  LEU A C     1 
ATOM   3784  O  O     . LEU A 1 500  ? -34.190 -103.375 25.045  1.00 7.78  ? 501  LEU A O     1 
ATOM   3785  C  CB    . LEU A 1 500  ? -34.120 -104.197 22.280  1.00 4.74  ? 501  LEU A CB    1 
ATOM   3786  C  CG    . LEU A 1 500  ? -35.332 -104.660 21.499  1.00 3.63  ? 501  LEU A CG    1 
ATOM   3787  C  CD1   . LEU A 1 500  ? -35.993 -103.553 20.736  1.00 2.86  ? 501  LEU A CD1   1 
ATOM   3788  C  CD2   . LEU A 1 500  ? -34.876 -105.768 20.583  1.00 3.43  ? 501  LEU A CD2   1 
ATOM   3789  N  N     . GLU A 1 501  ? -32.753 -101.765 24.532  1.00 8.55  ? 502  GLU A N     1 
ATOM   3790  C  CA    . GLU A 1 501  ? -32.321 -101.652 25.916  1.00 10.37 ? 502  GLU A CA    1 
ATOM   3791  C  C     . GLU A 1 501  ? -33.486 -101.362 26.858  1.00 10.23 ? 502  GLU A C     1 
ATOM   3792  O  O     . GLU A 1 501  ? -34.335 -100.520 26.584  1.00 10.84 ? 502  GLU A O     1 
ATOM   3793  C  CB    . GLU A 1 501  ? -31.235 -100.583 26.028  1.00 12.25 ? 502  GLU A CB    1 
ATOM   3794  C  CG    . GLU A 1 501  ? -30.785 -100.251 27.438  1.00 16.77 ? 502  GLU A CG    1 
ATOM   3795  C  CD    . GLU A 1 501  ? -29.749 -99.108  27.463  1.00 20.35 ? 502  GLU A CD    1 
ATOM   3796  O  OE1   . GLU A 1 501  ? -29.118 -98.819  26.398  1.00 22.76 ? 502  GLU A OE1   1 
ATOM   3797  O  OE2   . GLU A 1 501  ? -29.559 -98.491  28.546  1.00 22.38 ? 502  GLU A OE2   1 
ATOM   3798  N  N     . GLY A 1 502  ? -33.579 -102.135 27.929  1.00 10.70 ? 503  GLY A N     1 
ATOM   3799  C  CA    . GLY A 1 502  ? -34.646 -101.922 28.898  1.00 10.44 ? 503  GLY A CA    1 
ATOM   3800  C  C     . GLY A 1 502  ? -36.099 -102.206 28.510  1.00 10.80 ? 503  GLY A C     1 
ATOM   3801  O  O     . GLY A 1 502  ? -36.985 -101.942 29.334  1.00 11.77 ? 503  GLY A O     1 
ATOM   3802  N  N     . ILE A 1 503  ? -36.386 -102.643 27.279  1.00 9.67  ? 504  ILE A N     1 
ATOM   3803  C  CA    . ILE A 1 503  ? -37.770 -102.932 26.929  1.00 8.72  ? 504  ILE A CA    1 
ATOM   3804  C  C     . ILE A 1 503  ? -38.293 -103.957 27.932  1.00 9.51  ? 504  ILE A C     1 
ATOM   3805  O  O     . ILE A 1 503  ? -37.554 -104.843 28.386  1.00 10.12 ? 504  ILE A O     1 
ATOM   3806  C  CB    . ILE A 1 503  ? -37.916 -103.467 25.458  1.00 7.36  ? 504  ILE A CB    1 
ATOM   3807  C  CG1   . ILE A 1 503  ? -39.400 -103.582 25.076  1.00 5.89  ? 504  ILE A CG1   1 
ATOM   3808  C  CG2   . ILE A 1 503  ? -37.143 -104.778 25.262  1.00 6.07  ? 504  ILE A CG2   1 
ATOM   3809  C  CD1   . ILE A 1 503  ? -39.668 -103.730 23.602  1.00 4.55  ? 504  ILE A CD1   1 
ATOM   3810  N  N     . LYS A 1 504  ? -39.515 -103.770 28.390  1.00 9.64  ? 505  LYS A N     1 
ATOM   3811  C  CA    . LYS A 1 504  ? -40.072 -104.731 29.321  1.00 10.28 ? 505  LYS A CA    1 
ATOM   3812  C  C     . LYS A 1 504  ? -40.198 -106.128 28.708  1.00 10.29 ? 505  LYS A C     1 
ATOM   3813  O  O     . LYS A 1 504  ? -40.293 -106.300 27.483  1.00 9.65  ? 505  LYS A O     1 
ATOM   3814  C  CB    . LYS A 1 504  ? -41.459 -104.302 29.792  1.00 10.65 ? 505  LYS A CB    1 
ATOM   3815  C  CG    . LYS A 1 504  ? -41.499 -103.270 30.871  1.00 11.85 ? 505  LYS A CG    1 
ATOM   3816  C  CD    . LYS A 1 504  ? -42.724 -102.371 30.669  1.00 13.20 ? 505  LYS A CD    1 
ATOM   3817  C  CE    . LYS A 1 504  ? -43.248 -101.786 32.004  1.00 15.17 ? 505  LYS A CE    1 
ATOM   3818  N  NZ    . LYS A 1 504  ? -42.288 -100.959 32.833  1.00 15.09 ? 505  LYS A NZ    1 
ATOM   3819  N  N     . ASP A 1 505  ? -40.128 -107.122 29.584  1.00 10.68 ? 506  ASP A N     1 
ATOM   3820  C  CA    . ASP A 1 505  ? -40.317 -108.521 29.225  1.00 11.06 ? 506  ASP A CA    1 
ATOM   3821  C  C     . ASP A 1 505  ? -41.735 -108.515 28.644  1.00 10.38 ? 506  ASP A C     1 
ATOM   3822  O  O     . ASP A 1 505  ? -42.625 -107.920 29.241  1.00 9.76  ? 506  ASP A O     1 
ATOM   3823  C  CB    . ASP A 1 505  ? -40.364 -109.350 30.515  1.00 12.42 ? 506  ASP A CB    1 
ATOM   3824  C  CG    . ASP A 1 505  ? -39.077 -110.081 30.815  1.00 14.26 ? 506  ASP A CG    1 
ATOM   3825  O  OD1   . ASP A 1 505  ? -38.019 -109.435 30.994  1.00 15.04 ? 506  ASP A OD1   1 
ATOM   3826  O  OD2   . ASP A 1 505  ? -39.131 -111.337 30.908  1.00 16.59 ? 506  ASP A OD2   1 
ATOM   3827  N  N     . GLY A 1 506  ? -41.927 -109.114 27.471  1.00 10.00 ? 507  GLY A N     1 
ATOM   3828  C  CA    . GLY A 1 506  ? -43.253 -109.161 26.865  1.00 9.74  ? 507  GLY A CA    1 
ATOM   3829  C  C     . GLY A 1 506  ? -43.742 -107.881 26.190  1.00 9.33  ? 507  GLY A C     1 
ATOM   3830  O  O     . GLY A 1 506  ? -44.904 -107.795 25.782  1.00 9.87  ? 507  GLY A O     1 
ATOM   3831  N  N     . GLY A 1 507  ? -42.854 -106.896 26.080  1.00 8.57  ? 508  GLY A N     1 
ATOM   3832  C  CA    . GLY A 1 507  ? -43.182 -105.646 25.437  1.00 8.17  ? 508  GLY A CA    1 
ATOM   3833  C  C     . GLY A 1 507  ? -43.236 -105.861 23.929  1.00 8.25  ? 508  GLY A C     1 
ATOM   3834  O  O     . GLY A 1 507  ? -42.814 -106.926 23.434  1.00 8.26  ? 508  GLY A O     1 
ATOM   3835  N  N     . THR A 1 508  ? -43.805 -104.896 23.203  1.00 7.38  ? 509  THR A N     1 
ATOM   3836  C  CA    . THR A 1 508  ? -43.892 -105.020 21.754  1.00 6.58  ? 509  THR A CA    1 
ATOM   3837  C  C     . THR A 1 508  ? -42.842 -104.155 21.070  1.00 5.87  ? 509  THR A C     1 
ATOM   3838  O  O     . THR A 1 508  ? -42.541 -103.045 21.499  1.00 5.77  ? 509  THR A O     1 
ATOM   3839  C  CB    . THR A 1 508  ? -45.315 -104.689 21.196  1.00 6.09  ? 509  THR A CB    1 
ATOM   3840  O  OG1   . THR A 1 508  ? -45.268 -103.486 20.442  1.00 6.53  ? 509  THR A OG1   1 
ATOM   3841  C  CG2   . THR A 1 508  ? -46.318 -104.544 22.300  1.00 5.11  ? 509  THR A CG2   1 
ATOM   3842  N  N     . PHE A 1 509  ? -42.265 -104.707 20.024  1.00 5.17  ? 510  PHE A N     1 
ATOM   3843  C  CA    . PHE A 1 509  ? -41.245 -104.031 19.248  1.00 4.68  ? 510  PHE A CA    1 
ATOM   3844  C  C     . PHE A 1 509  ? -41.727 -104.071 17.812  1.00 5.14  ? 510  PHE A C     1 
ATOM   3845  O  O     . PHE A 1 509  ? -41.882 -105.165 17.272  1.00 6.01  ? 510  PHE A O     1 
ATOM   3846  C  CB    . PHE A 1 509  ? -39.940 -104.816 19.409  1.00 3.42  ? 510  PHE A CB    1 
ATOM   3847  C  CG    . PHE A 1 509  ? -38.829 -104.414 18.469  1.00 2.98  ? 510  PHE A CG    1 
ATOM   3848  C  CD1   . PHE A 1 509  ? -38.494 -103.083 18.259  1.00 2.10  ? 510  PHE A CD1   1 
ATOM   3849  C  CD2   . PHE A 1 509  ? -38.059 -105.404 17.815  1.00 3.20  ? 510  PHE A CD2   1 
ATOM   3850  C  CE1   . PHE A 1 509  ? -37.422 -102.745 17.418  1.00 2.00  ? 510  PHE A CE1   1 
ATOM   3851  C  CE2   . PHE A 1 509  ? -36.989 -105.062 16.979  1.00 2.00  ? 510  PHE A CE2   1 
ATOM   3852  C  CZ    . PHE A 1 509  ? -36.682 -103.736 16.785  1.00 2.00  ? 510  PHE A CZ    1 
ATOM   3853  N  N     . VAL A 1 510  ? -42.107 -102.925 17.239  1.00 5.13  ? 511  VAL A N     1 
ATOM   3854  C  CA    . VAL A 1 510  ? -42.492 -102.901 15.831  1.00 4.96  ? 511  VAL A CA    1 
ATOM   3855  C  C     . VAL A 1 510  ? -41.308 -102.296 15.060  1.00 5.15  ? 511  VAL A C     1 
ATOM   3856  O  O     . VAL A 1 510  ? -40.691 -101.314 15.507  1.00 5.02  ? 511  VAL A O     1 
ATOM   3857  C  CB    . VAL A 1 510  ? -43.845 -102.129 15.499  1.00 4.84  ? 511  VAL A CB    1 
ATOM   3858  C  CG1   . VAL A 1 510  ? -44.733 -102.052 16.678  1.00 4.54  ? 511  VAL A CG1   1 
ATOM   3859  C  CG2   . VAL A 1 510  ? -43.593 -100.800 14.899  1.00 4.17  ? 511  VAL A CG2   1 
ATOM   3860  N  N     . LEU A 1 511  ? -40.973 -102.932 13.933  1.00 4.93  ? 512  LEU A N     1 
ATOM   3861  C  CA    . LEU A 1 511  ? -39.874 -102.524 13.078  1.00 4.66  ? 512  LEU A CA    1 
ATOM   3862  C  C     . LEU A 1 511  ? -40.318 -102.289 11.643  1.00 5.03  ? 512  LEU A C     1 
ATOM   3863  O  O     . LEU A 1 511  ? -41.136 -103.058 11.102  1.00 5.62  ? 512  LEU A O     1 
ATOM   3864  C  CB    . LEU A 1 511  ? -38.743 -103.570 13.120  1.00 3.52  ? 512  LEU A CB    1 
ATOM   3865  C  CG    . LEU A 1 511  ? -37.692 -103.540 12.007  1.00 2.57  ? 512  LEU A CG    1 
ATOM   3866  C  CD1   . LEU A 1 511  ? -36.828 -102.342 12.178  1.00 2.12  ? 512  LEU A CD1   1 
ATOM   3867  C  CD2   . LEU A 1 511  ? -36.873 -104.824 11.986  1.00 2.00  ? 512  LEU A CD2   1 
ATOM   3868  N  N     . ASN A 1 512  ? -39.839 -101.172 11.079  1.00 4.61  ? 513  ASN A N     1 
ATOM   3869  C  CA    . ASN A 1 512  ? -40.098 -100.814 9.714   1.00 4.28  ? 513  ASN A CA    1 
ATOM   3870  C  C     . ASN A 1 512  ? -38.887 -101.357 8.957   1.00 4.73  ? 513  ASN A C     1 
ATOM   3871  O  O     . ASN A 1 512  ? -37.734 -100.966 9.204   1.00 4.46  ? 513  ASN A O     1 
ATOM   3872  C  CB    . ASN A 1 512  ? -40.159 -99.303  9.574   1.00 3.95  ? 513  ASN A CB    1 
ATOM   3873  C  CG    . ASN A 1 512  ? -40.047 -98.828  8.127   1.00 4.35  ? 513  ASN A CG    1 
ATOM   3874  O  OD1   . ASN A 1 512  ? -39.609 -97.690  7.849   1.00 3.82  ? 513  ASN A OD1   1 
ATOM   3875  N  ND2   . ASN A 1 512  ? -40.491 -99.668  7.200   1.00 4.37  ? 513  ASN A ND2   1 
ATOM   3876  N  N     . SER A 1 513  ? -39.153 -102.308 8.081   1.00 4.80  ? 514  SER A N     1 
ATOM   3877  C  CA    . SER A 1 513  ? -38.122 -102.909 7.244   1.00 5.60  ? 514  SER A CA    1 
ATOM   3878  C  C     . SER A 1 513  ? -38.828 -103.798 6.256   1.00 6.19  ? 514  SER A C     1 
ATOM   3879  O  O     . SER A 1 513  ? -39.971 -104.188 6.485   1.00 6.18  ? 514  SER A O     1 
ATOM   3880  C  CB    . SER A 1 513  ? -37.176 -103.789 8.053   1.00 5.14  ? 514  SER A CB    1 
ATOM   3881  O  OG    . SER A 1 513  ? -37.811 -105.003 8.367   1.00 4.79  ? 514  SER A OG    1 
ATOM   3882  N  N     . PRO A 1 514  ? -38.175 -104.099 5.130   1.00 6.78  ? 515  PRO A N     1 
ATOM   3883  C  CA    . PRO A 1 514  ? -38.696 -104.959 4.061   1.00 7.44  ? 515  PRO A CA    1 
ATOM   3884  C  C     . PRO A 1 514  ? -38.271 -106.434 4.267   1.00 7.72  ? 515  PRO A C     1 
ATOM   3885  O  O     . PRO A 1 514  ? -38.464 -107.256 3.387   1.00 8.15  ? 515  PRO A O     1 
ATOM   3886  C  CB    . PRO A 1 514  ? -38.001 -104.387 2.832   1.00 7.22  ? 515  PRO A CB    1 
ATOM   3887  C  CG    . PRO A 1 514  ? -36.617 -104.117 3.366   1.00 6.90  ? 515  PRO A CG    1 
ATOM   3888  C  CD    . PRO A 1 514  ? -36.946 -103.411 4.688   1.00 7.46  ? 515  PRO A CD    1 
ATOM   3889  N  N     . TRP A 1 515  ? -37.646 -106.738 5.403   1.00 7.90  ? 516  TRP A N     1 
ATOM   3890  C  CA    . TRP A 1 515  ? -37.145 -108.077 5.702   1.00 8.16  ? 516  TRP A CA    1 
ATOM   3891  C  C     . TRP A 1 515  ? -38.275 -108.992 6.191   1.00 9.25  ? 516  TRP A C     1 
ATOM   3892  O  O     . TRP A 1 515  ? -38.200 -109.563 7.294   1.00 9.73  ? 516  TRP A O     1 
ATOM   3893  C  CB    . TRP A 1 515  ? -36.050 -107.963 6.776   1.00 7.44  ? 516  TRP A CB    1 
ATOM   3894  C  CG    . TRP A 1 515  ? -35.030 -106.880 6.485   1.00 6.54  ? 516  TRP A CG    1 
ATOM   3895  C  CD1   . TRP A 1 515  ? -34.548 -106.528 5.259   1.00 6.50  ? 516  TRP A CD1   1 
ATOM   3896  C  CD2   . TRP A 1 515  ? -34.341 -106.046 7.436   1.00 5.59  ? 516  TRP A CD2   1 
ATOM   3897  N  NE1   . TRP A 1 515  ? -33.589 -105.541 5.388   1.00 5.59  ? 516  TRP A NE1   1 
ATOM   3898  C  CE2   . TRP A 1 515  ? -33.445 -105.226 6.708   1.00 5.04  ? 516  TRP A CE2   1 
ATOM   3899  C  CE3   . TRP A 1 515  ? -34.393 -105.909 8.830   1.00 5.71  ? 516  TRP A CE3   1 
ATOM   3900  C  CZ2   . TRP A 1 515  ? -32.608 -104.286 7.323   1.00 4.78  ? 516  TRP A CZ2   1 
ATOM   3901  C  CZ3   . TRP A 1 515  ? -33.543 -104.948 9.452   1.00 5.52  ? 516  TRP A CZ3   1 
ATOM   3902  C  CH2   . TRP A 1 515  ? -32.674 -104.162 8.692   1.00 4.66  ? 516  TRP A CH2   1 
ATOM   3903  N  N     . SER A 1 516  ? -39.277 -109.203 5.335   1.00 10.14 ? 517  SER A N     1 
ATOM   3904  C  CA    . SER A 1 516  ? -40.479 -110.000 5.660   1.00 11.00 ? 517  SER A CA    1 
ATOM   3905  C  C     . SER A 1 516  ? -40.342 -111.557 5.854   1.00 11.58 ? 517  SER A C     1 
ATOM   3906  O  O     . SER A 1 516  ? -41.091 -112.177 6.650   1.00 11.90 ? 517  SER A O     1 
ATOM   3907  C  CB    . SER A 1 516  ? -41.591 -109.685 4.641   1.00 11.36 ? 517  SER A CB    1 
ATOM   3908  O  OG    . SER A 1 516  ? -41.788 -108.279 4.389   1.00 13.18 ? 517  SER A OG    1 
ATOM   3909  N  N     . SER A 1 517  ? -39.432 -112.178 5.105   1.00 11.10 ? 518  SER A N     1 
ATOM   3910  C  CA    . SER A 1 517  ? -39.207 -113.593 5.214   1.00 10.57 ? 518  SER A CA    1 
ATOM   3911  C  C     . SER A 1 517  ? -38.246 -113.815 6.351   1.00 10.84 ? 518  SER A C     1 
ATOM   3912  O  O     . SER A 1 517  ? -37.505 -112.912 6.697   1.00 10.76 ? 518  SER A O     1 
ATOM   3913  C  CB    . SER A 1 517  ? -38.615 -114.133 3.921   1.00 10.12 ? 518  SER A CB    1 
ATOM   3914  O  OG    . SER A 1 517  ? -37.319 -113.612 3.689   1.00 10.90 ? 518  SER A OG    1 
ATOM   3915  N  N     . LEU A 1 518  ? -38.283 -115.008 6.943   1.00 11.19 ? 519  LEU A N     1 
ATOM   3916  C  CA    . LEU A 1 518  ? -37.384 -115.351 8.036   1.00 12.00 ? 519  LEU A CA    1 
ATOM   3917  C  C     . LEU A 1 518  ? -35.952 -115.193 7.567   1.00 12.87 ? 519  LEU A C     1 
ATOM   3918  O  O     . LEU A 1 518  ? -35.161 -114.570 8.252   1.00 12.84 ? 519  LEU A O     1 
ATOM   3919  C  CB    . LEU A 1 518  ? -37.574 -116.804 8.544   1.00 10.81 ? 519  LEU A CB    1 
ATOM   3920  C  CG    . LEU A 1 518  ? -36.615 -117.127 9.699   1.00 9.62  ? 519  LEU A CG    1 
ATOM   3921  C  CD1   . LEU A 1 518  ? -36.752 -116.112 10.825  1.00 8.46  ? 519  LEU A CD1   1 
ATOM   3922  C  CD2   . LEU A 1 518  ? -36.872 -118.519 10.229  1.00 8.84  ? 519  LEU A CD2   1 
ATOM   3923  N  N     . GLU A 1 519  ? -35.615 -115.795 6.425   1.00 14.37 ? 520  GLU A N     1 
ATOM   3924  C  CA    . GLU A 1 519  ? -34.269 -115.708 5.866   1.00 15.26 ? 520  GLU A CA    1 
ATOM   3925  C  C     . GLU A 1 519  ? -33.815 -114.257 5.802   1.00 14.82 ? 520  GLU A C     1 
ATOM   3926  O  O     . GLU A 1 519  ? -32.686 -113.947 6.135   1.00 14.35 ? 520  GLU A O     1 
ATOM   3927  C  CB    . GLU A 1 519  ? -34.262 -116.285 4.470   1.00 17.65 ? 520  GLU A CB    1 
ATOM   3928  C  CG    . GLU A 1 519  ? -32.984 -116.003 3.727   1.00 21.72 ? 520  GLU A CG    1 
ATOM   3929  C  CD    . GLU A 1 519  ? -33.070 -116.355 2.257   1.00 24.15 ? 520  GLU A CD    1 
ATOM   3930  O  OE1   . GLU A 1 519  ? -34.177 -116.746 1.796   1.00 26.43 ? 520  GLU A OE1   1 
ATOM   3931  O  OE2   . GLU A 1 519  ? -32.028 -116.228 1.560   1.00 25.66 ? 520  GLU A OE2   1 
ATOM   3932  N  N     . ASP A 1 520  ? -34.691 -113.359 5.360   1.00 14.49 ? 521  ASP A N     1 
ATOM   3933  C  CA    . ASP A 1 520  ? -34.290 -111.946 5.315   1.00 14.20 ? 521  ASP A CA    1 
ATOM   3934  C  C     . ASP A 1 520  ? -34.017 -111.371 6.708   1.00 13.09 ? 521  ASP A C     1 
ATOM   3935  O  O     . ASP A 1 520  ? -32.947 -110.823 6.959   1.00 12.67 ? 521  ASP A O     1 
ATOM   3936  C  CB    . ASP A 1 520  ? -35.358 -111.090 4.666   1.00 15.78 ? 521  ASP A CB    1 
ATOM   3937  C  CG    . ASP A 1 520  ? -35.468 -111.303 3.188   1.00 17.50 ? 521  ASP A CG    1 
ATOM   3938  O  OD1   . ASP A 1 520  ? -34.480 -111.746 2.562   1.00 18.56 ? 521  ASP A OD1   1 
ATOM   3939  O  OD2   . ASP A 1 520  ? -36.568 -110.987 2.648   1.00 19.61 ? 521  ASP A OD2   1 
ATOM   3940  N  N     . MET A 1 521  ? -34.999 -111.502 7.605   1.00 12.04 ? 522  MET A N     1 
ATOM   3941  C  CA    . MET A 1 521  ? -34.893 -110.994 8.968   1.00 11.29 ? 522  MET A CA    1 
ATOM   3942  C  C     . MET A 1 521  ? -33.676 -111.563 9.711   1.00 11.70 ? 522  MET A C     1 
ATOM   3943  O  O     . MET A 1 521  ? -32.960 -110.826 10.379  1.00 11.10 ? 522  MET A O     1 
ATOM   3944  C  CB    . MET A 1 521  ? -36.180 -111.302 9.727   1.00 9.88  ? 522  MET A CB    1 
ATOM   3945  C  CG    . MET A 1 521  ? -36.293 -110.574 11.031  1.00 8.48  ? 522  MET A CG    1 
ATOM   3946  S  SD    . MET A 1 521  ? -36.403 -108.749 10.897  1.00 8.06  ? 522  MET A SD    1 
ATOM   3947  C  CE    . MET A 1 521  ? -38.188 -108.666 10.496  1.00 6.83  ? 522  MET A CE    1 
ATOM   3948  N  N     . ASP A 1 522  ? -33.437 -112.869 9.557   1.00 12.46 ? 523  ASP A N     1 
ATOM   3949  C  CA    . ASP A 1 522  ? -32.305 -113.577 10.183  1.00 13.27 ? 523  ASP A CA    1 
ATOM   3950  C  C     . ASP A 1 522  ? -31.004 -113.001 9.688   1.00 13.38 ? 523  ASP A C     1 
ATOM   3951  O  O     . ASP A 1 522  ? -30.046 -112.881 10.438  1.00 13.88 ? 523  ASP A O     1 
ATOM   3952  C  CB    . ASP A 1 522  ? -32.287 -115.060 9.782   1.00 14.01 ? 523  ASP A CB    1 
ATOM   3953  C  CG    . ASP A 1 522  ? -33.040 -115.924 10.734  1.00 15.40 ? 523  ASP A CG    1 
ATOM   3954  O  OD1   . ASP A 1 522  ? -33.383 -115.385 11.807  1.00 16.81 ? 523  ASP A OD1   1 
ATOM   3955  O  OD2   . ASP A 1 522  ? -33.289 -117.121 10.415  1.00 15.91 ? 523  ASP A OD2   1 
ATOM   3956  N  N     . LYS A 1 523  ? -30.958 -112.774 8.383   1.00 13.59 ? 524  LYS A N     1 
ATOM   3957  C  CA    . LYS A 1 523  ? -29.803 -112.233 7.694   1.00 13.53 ? 524  LYS A CA    1 
ATOM   3958  C  C     . LYS A 1 523  ? -29.550 -110.775 8.121   1.00 12.99 ? 524  LYS A C     1 
ATOM   3959  O  O     . LYS A 1 523  ? -28.398 -110.379 8.295   1.00 12.91 ? 524  LYS A O     1 
ATOM   3960  C  CB    . LYS A 1 523  ? -30.113 -112.280 6.208   1.00 14.66 ? 524  LYS A CB    1 
ATOM   3961  C  CG    . LYS A 1 523  ? -28.958 -112.071 5.287   1.00 17.28 ? 524  LYS A CG    1 
ATOM   3962  C  CD    . LYS A 1 523  ? -29.452 -111.573 3.918   1.00 18.83 ? 524  LYS A CD    1 
ATOM   3963  C  CE    . LYS A 1 523  ? -30.774 -112.253 3.478   1.00 20.47 ? 524  LYS A CE    1 
ATOM   3964  N  NZ    . LYS A 1 523  ? -31.262 -111.774 2.115   1.00 22.31 ? 524  LYS A NZ    1 
ATOM   3965  N  N     . HIS A 1 524  ? -30.606 -110.005 8.370   1.00 12.09 ? 525  HIS A N     1 
ATOM   3966  C  CA    . HIS A 1 524  ? -30.413 -108.610 8.739   1.00 11.81 ? 525  HIS A CA    1 
ATOM   3967  C  C     . HIS A 1 524  ? -30.455 -108.180 10.212  1.00 11.25 ? 525  HIS A C     1 
ATOM   3968  O  O     . HIS A 1 524  ? -29.988 -107.076 10.569  1.00 11.27 ? 525  HIS A O     1 
ATOM   3969  C  CB    . HIS A 1 524  ? -31.371 -107.743 7.947   1.00 12.69 ? 525  HIS A CB    1 
ATOM   3970  C  CG    . HIS A 1 524  ? -31.088 -107.703 6.478   1.00 14.04 ? 525  HIS A CG    1 
ATOM   3971  N  ND1   . HIS A 1 524  ? -31.559 -108.654 5.601   1.00 14.67 ? 525  HIS A ND1   1 
ATOM   3972  C  CD2   . HIS A 1 524  ? -30.464 -106.771 5.719   1.00 14.60 ? 525  HIS A CD2   1 
ATOM   3973  C  CE1   . HIS A 1 524  ? -31.255 -108.307 4.364   1.00 14.79 ? 525  HIS A CE1   1 
ATOM   3974  N  NE2   . HIS A 1 524  ? -30.590 -107.168 4.410   1.00 15.32 ? 525  HIS A NE2   1 
ATOM   3975  N  N     . LEU A 1 525  ? -30.974 -109.049 11.068  1.00 10.85 ? 526  LEU A N     1 
ATOM   3976  C  CA    . LEU A 1 525  ? -31.104 -108.758 12.496  1.00 10.29 ? 526  LEU A CA    1 
ATOM   3977  C  C     . LEU A 1 525  ? -29.875 -109.242 13.255  1.00 10.63 ? 526  LEU A C     1 
ATOM   3978  O  O     . LEU A 1 525  ? -29.468 -110.381 13.072  1.00 11.31 ? 526  LEU A O     1 
ATOM   3979  C  CB    . LEU A 1 525  ? -32.347 -109.437 12.999  1.00 8.54  ? 526  LEU A CB    1 
ATOM   3980  C  CG    . LEU A 1 525  ? -33.279 -108.559 13.784  1.00 8.88  ? 526  LEU A CG    1 
ATOM   3981  C  CD1   . LEU A 1 525  ? -33.647 -107.248 13.016  1.00 8.13  ? 526  LEU A CD1   1 
ATOM   3982  C  CD2   . LEU A 1 525  ? -34.489 -109.408 14.147  1.00 7.38  ? 526  LEU A CD2   1 
ATOM   3983  N  N     . PRO A 1 526  ? -29.229 -108.370 14.070  1.00 11.04 ? 527  PRO A N     1 
ATOM   3984  C  CA    . PRO A 1 526  ? -28.045 -108.825 14.799  1.00 10.93 ? 527  PRO A CA    1 
ATOM   3985  C  C     . PRO A 1 526  ? -28.530 -109.851 15.798  1.00 10.88 ? 527  PRO A C     1 
ATOM   3986  O  O     . PRO A 1 526  ? -29.665 -109.754 16.294  1.00 11.21 ? 527  PRO A O     1 
ATOM   3987  C  CB    . PRO A 1 526  ? -27.575 -107.562 15.535  1.00 11.14 ? 527  PRO A CB    1 
ATOM   3988  C  CG    . PRO A 1 526  ? -28.328 -106.431 14.902  1.00 10.68 ? 527  PRO A CG    1 
ATOM   3989  C  CD    . PRO A 1 526  ? -29.633 -107.043 14.577  1.00 11.31 ? 527  PRO A CD    1 
ATOM   3990  N  N     . SER A 1 527  ? -27.665 -110.800 16.124  1.00 10.85 ? 528  SER A N     1 
ATOM   3991  C  CA    . SER A 1 527  ? -28.006 -111.879 17.044  1.00 10.97 ? 528  SER A CA    1 
ATOM   3992  C  C     . SER A 1 527  ? -28.455 -111.341 18.370  1.00 10.06 ? 528  SER A C     1 
ATOM   3993  O  O     . SER A 1 527  ? -29.332 -111.918 19.014  1.00 10.54 ? 528  SER A O     1 
ATOM   3994  C  CB    . SER A 1 527  ? -26.807 -112.827 17.232  1.00 12.05 ? 528  SER A CB    1 
ATOM   3995  O  OG    . SER A 1 527  ? -25.654 -112.131 17.703  1.00 14.33 ? 528  SER A OG    1 
ATOM   3996  N  N     . GLY A 1 528  ? -27.847 -110.231 18.771  1.00 9.17  ? 529  GLY A N     1 
ATOM   3997  C  CA    . GLY A 1 528  ? -28.194 -109.599 20.030  1.00 8.02  ? 529  GLY A CA    1 
ATOM   3998  C  C     . GLY A 1 528  ? -29.658 -109.241 20.061  1.00 7.42  ? 529  GLY A C     1 
ATOM   3999  O  O     . GLY A 1 528  ? -30.336 -109.412 21.096  1.00 7.87  ? 529  GLY A O     1 
ATOM   4000  N  N     . ILE A 1 529  ? -30.168 -108.820 18.909  1.00 6.53  ? 530  ILE A N     1 
ATOM   4001  C  CA    . ILE A 1 529  ? -31.557 -108.454 18.818  1.00 6.48  ? 530  ILE A CA    1 
ATOM   4002  C  C     . ILE A 1 529  ? -32.451 -109.683 18.800  1.00 6.54  ? 530  ILE A C     1 
ATOM   4003  O  O     . ILE A 1 529  ? -33.547 -109.664 19.362  1.00 6.49  ? 530  ILE A O     1 
ATOM   4004  C  CB    . ILE A 1 529  ? -31.793 -107.492 17.651  1.00 6.00  ? 530  ILE A CB    1 
ATOM   4005  C  CG1   . ILE A 1 529  ? -31.084 -106.181 17.974  1.00 5.78  ? 530  ILE A CG1   1 
ATOM   4006  C  CG2   . ILE A 1 529  ? -33.289 -107.224 17.455  1.00 6.19  ? 530  ILE A CG2   1 
ATOM   4007  C  CD1   . ILE A 1 529  ? -31.462 -105.007 17.083  1.00 6.61  ? 530  ILE A CD1   1 
ATOM   4008  N  N     . LYS A 1 530  ? -31.957 -110.771 18.220  1.00 6.80  ? 531  LYS A N     1 
ATOM   4009  C  CA    . LYS A 1 530  ? -32.749 -112.007 18.171  1.00 7.67  ? 531  LYS A CA    1 
ATOM   4010  C  C     . LYS A 1 530  ? -32.907 -112.648 19.552  1.00 8.66  ? 531  LYS A C     1 
ATOM   4011  O  O     . LYS A 1 530  ? -34.016 -113.008 19.981  1.00 8.85  ? 531  LYS A O     1 
ATOM   4012  C  CB    . LYS A 1 530  ? -32.199 -112.977 17.121  1.00 6.95  ? 531  LYS A CB    1 
ATOM   4013  C  CG    . LYS A 1 530  ? -32.363 -112.418 15.698  1.00 7.11  ? 531  LYS A CG    1 
ATOM   4014  C  CD    . LYS A 1 530  ? -32.038 -113.365 14.560  1.00 6.83  ? 531  LYS A CD    1 
ATOM   4015  C  CE    . LYS A 1 530  ? -30.557 -113.475 14.309  1.00 7.81  ? 531  LYS A CE    1 
ATOM   4016  N  NZ    . LYS A 1 530  ? -30.245 -114.173 13.011  1.00 8.91  ? 531  LYS A NZ    1 
ATOM   4017  N  N     . ARG A 1 531  ? -31.820 -112.658 20.310  1.00 9.97  ? 532  ARG A N     1 
ATOM   4018  C  CA    . ARG A 1 531  ? -31.838 -113.203 21.657  1.00 10.78 ? 532  ARG A CA    1 
ATOM   4019  C  C     . ARG A 1 531  ? -32.766 -112.416 22.543  1.00 10.21 ? 532  ARG A C     1 
ATOM   4020  O  O     . ARG A 1 531  ? -33.570 -112.980 23.262  1.00 10.59 ? 532  ARG A O     1 
ATOM   4021  C  CB    . ARG A 1 531  ? -30.462 -113.113 22.277  1.00 13.00 ? 532  ARG A CB    1 
ATOM   4022  C  CG    . ARG A 1 531  ? -29.803 -114.461 22.422  1.00 16.69 ? 532  ARG A CG    1 
ATOM   4023  C  CD    . ARG A 1 531  ? -29.302 -114.944 21.090  1.00 19.23 ? 532  ARG A CD    1 
ATOM   4024  N  NE    . ARG A 1 531  ? -28.091 -114.228 20.752  1.00 21.63 ? 532  ARG A NE    1 
ATOM   4025  C  CZ    . ARG A 1 531  ? -26.958 -114.343 21.421  1.00 22.89 ? 532  ARG A CZ    1 
ATOM   4026  N  NH1   . ARG A 1 531  ? -26.882 -115.170 22.465  1.00 23.85 ? 532  ARG A NH1   1 
ATOM   4027  N  NH2   . ARG A 1 531  ? -25.912 -113.599 21.060  1.00 23.76 ? 532  ARG A NH2   1 
ATOM   4028  N  N     . THR A 1 532  ? -32.639 -111.101 22.486  1.00 9.15  ? 533  THR A N     1 
ATOM   4029  C  CA    . THR A 1 532  ? -33.461 -110.244 23.303  1.00 8.08  ? 533  THR A CA    1 
ATOM   4030  C  C     . THR A 1 532  ? -34.923 -110.488 23.026  1.00 7.64  ? 533  THR A C     1 
ATOM   4031  O  O     . THR A 1 532  ? -35.715 -110.706 23.970  1.00 7.26  ? 533  THR A O     1 
ATOM   4032  C  CB    . THR A 1 532  ? -33.106 -108.760 23.071  1.00 7.86  ? 533  THR A CB    1 
ATOM   4033  O  OG1   . THR A 1 532  ? -31.743 -108.537 23.457  1.00 6.74  ? 533  THR A OG1   1 
ATOM   4034  C  CG2   . THR A 1 532  ? -34.066 -107.828 23.857  1.00 7.50  ? 533  THR A CG2   1 
ATOM   4035  N  N     . ILE A 1 533  ? -35.254 -110.509 21.734  1.00 7.19  ? 534  ILE A N     1 
ATOM   4036  C  CA    . ILE A 1 533  ? -36.628 -110.705 21.299  1.00 7.27  ? 534  ILE A CA    1 
ATOM   4037  C  C     . ILE A 1 533  ? -37.199 -112.031 21.788  1.00 8.16  ? 534  ILE A C     1 
ATOM   4038  O  O     . ILE A 1 533  ? -38.328 -112.076 22.256  1.00 8.22  ? 534  ILE A O     1 
ATOM   4039  C  CB    . ILE A 1 533  ? -36.755 -110.630 19.753  1.00 6.68  ? 534  ILE A CB    1 
ATOM   4040  C  CG1   . ILE A 1 533  ? -36.438 -109.221 19.256  1.00 5.20  ? 534  ILE A CG1   1 
ATOM   4041  C  CG2   . ILE A 1 533  ? -38.178 -111.060 19.311  1.00 5.63  ? 534  ILE A CG2   1 
ATOM   4042  C  CD1   . ILE A 1 533  ? -36.489 -109.117 17.736  1.00 4.38  ? 534  ILE A CD1   1 
ATOM   4043  N  N     . ALA A 1 534  ? -36.373 -113.084 21.723  1.00 9.03  ? 535  ALA A N     1 
ATOM   4044  C  CA    . ALA A 1 534  ? -36.764 -114.432 22.113  1.00 9.00  ? 535  ALA A CA    1 
ATOM   4045  C  C     . ALA A 1 534  ? -36.830 -114.642 23.616  1.00 9.40  ? 535  ALA A C     1 
ATOM   4046  O  O     . ALA A 1 534  ? -37.770 -115.284 24.122  1.00 9.96  ? 535  ALA A O     1 
ATOM   4047  C  CB    . ALA A 1 534  ? -35.824 -115.444 21.480  1.00 9.42  ? 535  ALA A CB    1 
ATOM   4048  N  N     . ASN A 1 535  ? -35.846 -114.112 24.331  1.00 9.31  ? 536  ASN A N     1 
ATOM   4049  C  CA    . ASN A 1 535  ? -35.787 -114.276 25.782  1.00 9.86  ? 536  ASN A CA    1 
ATOM   4050  C  C     . ASN A 1 535  ? -36.733 -113.348 26.517  1.00 9.79  ? 536  ASN A C     1 
ATOM   4051  O  O     . ASN A 1 535  ? -37.191 -113.655 27.617  1.00 9.97  ? 536  ASN A O     1 
ATOM   4052  C  CB    . ASN A 1 535  ? -34.364 -114.048 26.314  1.00 10.94 ? 536  ASN A CB    1 
ATOM   4053  C  CG    . ASN A 1 535  ? -33.376 -115.120 25.843  1.00 11.80 ? 536  ASN A CG    1 
ATOM   4054  O  OD1   . ASN A 1 535  ? -32.327 -114.798 25.280  1.00 12.32 ? 536  ASN A OD1   1 
ATOM   4055  N  ND2   . ASN A 1 535  ? -33.722 -116.400 26.046  1.00 11.93 ? 536  ASN A ND2   1 
ATOM   4056  N  N     . LYS A 1 536  ? -36.987 -112.181 25.957  1.00 9.15  ? 537  LYS A N     1 
ATOM   4057  C  CA    . LYS A 1 536  ? -37.890 -111.297 26.633  1.00 8.75  ? 537  LYS A CA    1 
ATOM   4058  C  C     . LYS A 1 536  ? -39.294 -111.584 26.183  1.00 9.01  ? 537  LYS A C     1 
ATOM   4059  O  O     . LYS A 1 536  ? -40.207 -110.857 26.538  1.00 9.53  ? 537  LYS A O     1 
ATOM   4060  C  CB    . LYS A 1 536  ? -37.520 -109.862 26.358  1.00 7.92  ? 537  LYS A CB    1 
ATOM   4061  C  CG    . LYS A 1 536  ? -36.220 -109.461 27.033  1.00 7.02  ? 537  LYS A CG    1 
ATOM   4062  C  CD    . LYS A 1 536  ? -36.301 -108.011 27.530  1.00 5.77  ? 537  LYS A CD    1 
ATOM   4063  C  CE    . LYS A 1 536  ? -34.957 -107.502 27.904  1.00 5.10  ? 537  LYS A CE    1 
ATOM   4064  N  NZ    . LYS A 1 536  ? -35.102 -106.124 28.469  1.00 5.28  ? 537  LYS A NZ    1 
ATOM   4065  N  N     . LYS A 1 537  ? -39.451 -112.629 25.374  1.00 9.15  ? 538  LYS A N     1 
ATOM   4066  C  CA    . LYS A 1 537  ? -40.760 -113.028 24.871  1.00 9.28  ? 538  LYS A CA    1 
ATOM   4067  C  C     . LYS A 1 537  ? -41.535 -111.848 24.333  1.00 8.57  ? 538  LYS A C     1 
ATOM   4068  O  O     . LYS A 1 537  ? -42.717 -111.692 24.641  1.00 8.66  ? 538  LYS A O     1 
ATOM   4069  C  CB    . LYS A 1 537  ? -41.572 -113.672 25.998  1.00 10.69 ? 538  LYS A CB    1 
ATOM   4070  C  CG    . LYS A 1 537  ? -40.990 -114.989 26.495  1.00 12.01 ? 538  LYS A CG    1 
ATOM   4071  C  CD    . LYS A 1 537  ? -41.881 -115.665 27.494  1.00 12.88 ? 538  LYS A CD    1 
ATOM   4072  C  CE    . LYS A 1 537  ? -41.235 -116.935 28.027  0.01 13.99 ? 538  LYS A CE    1 
ATOM   4073  N  NZ    . LYS A 1 537  ? -39.980 -116.628 28.774  0.01 14.75 ? 538  LYS A NZ    1 
ATOM   4074  N  N     . LEU A 1 538  ? -40.880 -111.056 23.490  1.00 7.82  ? 539  LEU A N     1 
ATOM   4075  C  CA    . LEU A 1 538  ? -41.488 -109.869 22.934  1.00 7.64  ? 539  LEU A CA    1 
ATOM   4076  C  C     . LEU A 1 538  ? -42.419 -110.155 21.810  1.00 7.75  ? 539  LEU A C     1 
ATOM   4077  O  O     . LEU A 1 538  ? -42.163 -111.018 20.987  1.00 8.03  ? 539  LEU A O     1 
ATOM   4078  C  CB    . LEU A 1 538  ? -40.429 -108.894 22.385  1.00 7.04  ? 539  LEU A CB    1 
ATOM   4079  C  CG    . LEU A 1 538  ? -39.222 -108.424 23.192  1.00 6.26  ? 539  LEU A CG    1 
ATOM   4080  C  CD1   . LEU A 1 538  ? -38.478 -107.341 22.382  1.00 5.24  ? 539  LEU A CD1   1 
ATOM   4081  C  CD2   . LEU A 1 538  ? -39.712 -107.877 24.518  1.00 5.58  ? 539  LEU A CD2   1 
ATOM   4082  N  N     . LYS A 1 539  ? -43.499 -109.398 21.778  1.00 8.02  ? 540  LYS A N     1 
ATOM   4083  C  CA    . LYS A 1 539  ? -44.445 -109.463 20.699  1.00 8.22  ? 540  LYS A CA    1 
ATOM   4084  C  C     . LYS A 1 539  ? -43.738 -108.554 19.657  1.00 7.64  ? 540  LYS A C     1 
ATOM   4085  O  O     . LYS A 1 539  ? -43.718 -107.339 19.779  1.00 8.15  ? 540  LYS A O     1 
ATOM   4086  C  CB    . LYS A 1 539  ? -45.776 -108.822 21.137  1.00 10.18 ? 540  LYS A CB    1 
ATOM   4087  C  CG    . LYS A 1 539  ? -46.785 -109.683 21.971  1.00 11.18 ? 540  LYS A CG    1 
ATOM   4088  C  CD    . LYS A 1 539  ? -47.902 -108.708 22.490  1.00 13.64 ? 540  LYS A CD    1 
ATOM   4089  C  CE    . LYS A 1 539  ? -49.222 -109.373 22.975  1.00 14.82 ? 540  LYS A CE    1 
ATOM   4090  N  NZ    . LYS A 1 539  ? -50.227 -109.682 21.879  1.00 15.42 ? 540  LYS A NZ    1 
ATOM   4091  N  N     . PHE A 1 540  ? -43.038 -109.183 18.734  1.00 6.74  ? 541  PHE A N     1 
ATOM   4092  C  CA    . PHE A 1 540  ? -42.305 -108.520 17.671  1.00 5.99  ? 541  PHE A CA    1 
ATOM   4093  C  C     . PHE A 1 540  ? -43.205 -108.386 16.422  1.00 6.14  ? 541  PHE A C     1 
ATOM   4094  O  O     . PHE A 1 540  ? -43.943 -109.327 16.067  1.00 6.32  ? 541  PHE A O     1 
ATOM   4095  C  CB    . PHE A 1 540  ? -41.066 -109.386 17.383  1.00 4.72  ? 541  PHE A CB    1 
ATOM   4096  C  CG    . PHE A 1 540  ? -40.219 -108.914 16.253  1.00 3.72  ? 541  PHE A CG    1 
ATOM   4097  C  CD1   . PHE A 1 540  ? -39.882 -107.564 16.118  1.00 2.84  ? 541  PHE A CD1   1 
ATOM   4098  C  CD2   . PHE A 1 540  ? -39.689 -109.836 15.345  1.00 3.09  ? 541  PHE A CD2   1 
ATOM   4099  C  CE1   . PHE A 1 540  ? -39.029 -107.144 15.101  1.00 2.00  ? 541  PHE A CE1   1 
ATOM   4100  C  CE2   . PHE A 1 540  ? -38.827 -109.418 14.320  1.00 2.78  ? 541  PHE A CE2   1 
ATOM   4101  C  CZ    . PHE A 1 540  ? -38.500 -108.058 14.208  1.00 2.54  ? 541  PHE A CZ    1 
ATOM   4102  N  N     . TYR A 1 541  ? -43.155 -107.218 15.781  1.00 5.29  ? 542  TYR A N     1 
ATOM   4103  C  CA    . TYR A 1 541  ? -43.926 -106.947 14.575  1.00 5.22  ? 542  TYR A CA    1 
ATOM   4104  C  C     . TYR A 1 541  ? -43.055 -106.314 13.519  1.00 5.11  ? 542  TYR A C     1 
ATOM   4105  O  O     . TYR A 1 541  ? -42.440 -105.282 13.771  1.00 5.11  ? 542  TYR A O     1 
ATOM   4106  C  CB    . TYR A 1 541  ? -45.034 -105.920 14.823  1.00 5.20  ? 542  TYR A CB    1 
ATOM   4107  C  CG    . TYR A 1 541  ? -46.137 -106.355 15.728  1.00 5.33  ? 542  TYR A CG    1 
ATOM   4108  C  CD1   . TYR A 1 541  ? -45.974 -106.334 17.110  1.00 5.23  ? 542  TYR A CD1   1 
ATOM   4109  C  CD2   . TYR A 1 541  ? -47.361 -106.733 15.212  1.00 4.85  ? 542  TYR A CD2   1 
ATOM   4110  C  CE1   . TYR A 1 541  ? -46.995 -106.672 17.948  1.00 5.35  ? 542  TYR A CE1   1 
ATOM   4111  C  CE2   . TYR A 1 541  ? -48.397 -107.070 16.042  1.00 5.50  ? 542  TYR A CE2   1 
ATOM   4112  C  CZ    . TYR A 1 541  ? -48.214 -107.042 17.414  1.00 5.97  ? 542  TYR A CZ    1 
ATOM   4113  O  OH    . TYR A 1 541  ? -49.262 -107.367 18.260  1.00 6.55  ? 542  TYR A OH    1 
ATOM   4114  N  N     . ASN A 1 542  ? -43.050 -106.888 12.321  1.00 5.60  ? 543  ASN A N     1 
ATOM   4115  C  CA    . ASN A 1 542  ? -42.328 -106.305 11.184  1.00 5.13  ? 543  ASN A CA    1 
ATOM   4116  C  C     . ASN A 1 542  ? -43.366 -105.716 10.205  1.00 5.57  ? 543  ASN A C     1 
ATOM   4117  O  O     . ASN A 1 542  ? -44.479 -106.252 10.049  1.00 6.18  ? 543  ASN A O     1 
ATOM   4118  C  CB    . ASN A 1 542  ? -41.491 -107.341 10.461  1.00 4.44  ? 543  ASN A CB    1 
ATOM   4119  C  CG    . ASN A 1 542  ? -40.680 -106.735 9.357   1.00 4.86  ? 543  ASN A CG    1 
ATOM   4120  O  OD1   . ASN A 1 542  ? -39.701 -106.014 9.609   1.00 5.06  ? 543  ASN A OD1   1 
ATOM   4121  N  ND2   . ASN A 1 542  ? -41.127 -106.933 8.121   1.00 5.43  ? 543  ASN A ND2   1 
ATOM   4122  N  N     . ILE A 1 543  ? -43.039 -104.582 9.595   1.00 5.63  ? 544  ILE A N     1 
ATOM   4123  C  CA    . ILE A 1 543  ? -43.948 -103.980 8.666   1.00 5.43  ? 544  ILE A CA    1 
ATOM   4124  C  C     . ILE A 1 543  ? -43.068 -103.215 7.713   1.00 6.23  ? 544  ILE A C     1 
ATOM   4125  O  O     . ILE A 1 543  ? -42.145 -102.530 8.163   1.00 6.20  ? 544  ILE A O     1 
ATOM   4126  C  CB    . ILE A 1 543  ? -44.975 -103.056 9.387   1.00 5.70  ? 544  ILE A CB    1 
ATOM   4127  C  CG1   . ILE A 1 543  ? -45.977 -102.480 8.385   1.00 5.22  ? 544  ILE A CG1   1 
ATOM   4128  C  CG2   . ILE A 1 543  ? -44.246 -101.912 10.126  1.00 5.03  ? 544  ILE A CG2   1 
ATOM   4129  C  CD1   . ILE A 1 543  ? -47.241 -101.998 9.016   1.00 5.83  ? 544  ILE A CD1   1 
ATOM   4130  N  N     . ASP A 1 544  ? -43.228 -103.512 6.416   1.00 6.73  ? 545  ASP A N     1 
ATOM   4131  C  CA    . ASP A 1 544  ? -42.496 -102.843 5.336   1.00 7.60  ? 545  ASP A CA    1 
ATOM   4132  C  C     . ASP A 1 544  ? -43.348 -101.576 5.114   1.00 7.99  ? 545  ASP A C     1 
ATOM   4133  O  O     . ASP A 1 544  ? -44.350 -101.613 4.383   1.00 8.47  ? 545  ASP A O     1 
ATOM   4134  C  CB    . ASP A 1 544  ? -42.489 -103.732 4.083   1.00 7.15  ? 545  ASP A CB    1 
ATOM   4135  C  CG    . ASP A 1 544  ? -41.639 -103.180 2.956   1.00 8.17  ? 545  ASP A CG    1 
ATOM   4136  O  OD1   . ASP A 1 544  ? -41.348 -101.969 2.933   1.00 8.96  ? 545  ASP A OD1   1 
ATOM   4137  O  OD2   . ASP A 1 544  ? -41.263 -103.977 2.059   1.00 9.09  ? 545  ASP A OD2   1 
ATOM   4138  N  N     . ALA A 1 545  ? -43.021 -100.516 5.858   1.00 7.82  ? 546  ALA A N     1 
ATOM   4139  C  CA    . ALA A 1 545  ? -43.747 -99.245  5.760   1.00 8.11  ? 546  ALA A CA    1 
ATOM   4140  C  C     . ALA A 1 545  ? -43.582 -98.537  4.409   1.00 8.07  ? 546  ALA A C     1 
ATOM   4141  O  O     . ALA A 1 545  ? -44.496 -97.845  3.960   1.00 8.46  ? 546  ALA A O     1 
ATOM   4142  C  CB    . ALA A 1 545  ? -43.331 -98.305  6.912   1.00 7.41  ? 546  ALA A CB    1 
ATOM   4143  N  N     . VAL A 1 546  ? -42.426 -98.718  3.760   1.00 8.35  ? 547  VAL A N     1 
ATOM   4144  C  CA    . VAL A 1 546  ? -42.178 -98.068  2.471   1.00 8.56  ? 547  VAL A CA    1 
ATOM   4145  C  C     . VAL A 1 546  ? -42.984 -98.675  1.322   1.00 8.61  ? 547  VAL A C     1 
ATOM   4146  O  O     . VAL A 1 546  ? -43.413 -97.988  0.384   1.00 8.21  ? 547  VAL A O     1 
ATOM   4147  C  CB    . VAL A 1 546  ? -40.689 -98.042  2.141   1.00 8.55  ? 547  VAL A CB    1 
ATOM   4148  C  CG1   . VAL A 1 546  ? -40.469 -97.585  0.677   1.00 7.68  ? 547  VAL A CG1   1 
ATOM   4149  C  CG2   . VAL A 1 546  ? -39.983 -97.125  3.125   1.00 7.85  ? 547  VAL A CG2   1 
ATOM   4150  N  N     . LYS A 1 547  ? -43.219 -99.974  1.424   1.00 9.22  ? 548  LYS A N     1 
ATOM   4151  C  CA    . LYS A 1 547  ? -43.986 -100.642 0.397   1.00 9.30  ? 548  LYS A CA    1 
ATOM   4152  C  C     . LYS A 1 547  ? -45.430 -100.251 0.487   1.00 9.04  ? 548  LYS A C     1 
ATOM   4153  O  O     . LYS A 1 547  ? -46.049 -99.979  -0.526  1.00 9.09  ? 548  LYS A O     1 
ATOM   4154  C  CB    . LYS A 1 547  ? -43.885 -102.133 0.502   1.00 9.83  ? 548  LYS A CB    1 
ATOM   4155  C  CG    . LYS A 1 547  ? -44.447 -102.788 -0.711  1.00 11.56 ? 548  LYS A CG    1 
ATOM   4156  C  CD    . LYS A 1 547  ? -44.233 -104.283 -0.657  1.00 13.39 ? 548  LYS A CD    1 
ATOM   4157  C  CE    . LYS A 1 547  ? -45.133 -104.957 -1.669  1.00 15.52 ? 548  LYS A CE    1 
ATOM   4158  N  NZ    . LYS A 1 547  ? -45.107 -104.388 -3.081  1.00 16.68 ? 548  LYS A NZ    1 
ATOM   4159  N  N     . ILE A 1 548  ? -45.998 -100.268 1.683   1.00 8.82  ? 549  ILE A N     1 
ATOM   4160  C  CA    . ILE A 1 548  ? -47.392 -99.861  1.820   1.00 8.99  ? 549  ILE A CA    1 
ATOM   4161  C  C     . ILE A 1 548  ? -47.521 -98.383  1.405   1.00 9.92  ? 549  ILE A C     1 
ATOM   4162  O  O     . ILE A 1 548  ? -48.402 -98.003  0.625   1.00 10.36 ? 549  ILE A O     1 
ATOM   4163  C  CB    . ILE A 1 548  ? -47.859 -100.053 3.263   1.00 8.26  ? 549  ILE A CB    1 
ATOM   4164  C  CG1   . ILE A 1 548  ? -47.809 -101.553 3.611   1.00 8.55  ? 549  ILE A CG1   1 
ATOM   4165  C  CG2   . ILE A 1 548  ? -49.227 -99.464  3.456   1.00 7.15  ? 549  ILE A CG2   1 
ATOM   4166  C  CD1   . ILE A 1 548  ? -47.823 -101.916 5.127   1.00 8.47  ? 549  ILE A CD1   1 
ATOM   4167  N  N     . ALA A 1 549  ? -46.556 -97.575  1.828   1.00 10.58 ? 550  ALA A N     1 
ATOM   4168  C  CA    . ALA A 1 549  ? -46.581 -96.153  1.513   1.00 11.20 ? 550  ALA A CA    1 
ATOM   4169  C  C     . ALA A 1 549  ? -46.607 -95.940  -0.009  1.00 11.88 ? 550  ALA A C     1 
ATOM   4170  O  O     . ALA A 1 549  ? -47.287 -95.032  -0.513  1.00 12.06 ? 550  ALA A O     1 
ATOM   4171  C  CB    . ALA A 1 549  ? -45.363 -95.471  2.143   1.00 10.18 ? 550  ALA A CB    1 
ATOM   4172  N  N     . THR A 1 550  ? -45.919 -96.822  -0.729  1.00 12.38 ? 551  THR A N     1 
ATOM   4173  C  CA    . THR A 1 550  ? -45.803 -96.689  -2.163  1.00 13.54 ? 551  THR A CA    1 
ATOM   4174  C  C     . THR A 1 550  ? -47.011 -97.264  -2.852  1.00 14.54 ? 551  THR A C     1 
ATOM   4175  O  O     . THR A 1 550  ? -47.575 -96.667  -3.781  1.00 14.90 ? 551  THR A O     1 
ATOM   4176  C  CB    . THR A 1 550  ? -44.524 -97.381  -2.648  1.00 13.24 ? 551  THR A CB    1 
ATOM   4177  O  OG1   . THR A 1 550  ? -43.375 -96.689  -2.128  1.00 13.31 ? 551  THR A OG1   1 
ATOM   4178  C  CG2   . THR A 1 550  ? -44.480 -97.388  -4.178  1.00 13.95 ? 551  THR A CG2   1 
ATOM   4179  N  N     . ASP A 1 551  ? -47.448 -98.391  -2.318  1.00 15.30 ? 552  ASP A N     1 
ATOM   4180  C  CA    . ASP A 1 551  ? -48.574 -99.116  -2.842  1.00 16.28 ? 552  ASP A CA    1 
ATOM   4181  C  C     . ASP A 1 551  ? -49.845 -98.282  -2.806  1.00 17.12 ? 552  ASP A C     1 
ATOM   4182  O  O     . ASP A 1 551  ? -50.758 -98.531  -3.597  1.00 17.64 ? 552  ASP A O     1 
ATOM   4183  C  CB    . ASP A 1 551  ? -48.807 -100.414 -2.051  1.00 16.89 ? 552  ASP A CB    1 
ATOM   4184  C  CG    . ASP A 1 551  ? -47.818 -101.554 -2.418  1.00 17.22 ? 552  ASP A CG    1 
ATOM   4185  O  OD1   . ASP A 1 551  ? -46.957 -101.394 -3.331  1.00 17.70 ? 552  ASP A OD1   1 
ATOM   4186  O  OD2   . ASP A 1 551  ? -47.926 -102.632 -1.778  1.00 17.00 ? 552  ASP A OD2   1 
ATOM   4187  N  N     . VAL A 1 552  ? -49.949 -97.353  -1.856  1.00 17.19 ? 553  VAL A N     1 
ATOM   4188  C  CA    . VAL A 1 552  ? -51.139 -96.497  -1.755  1.00 16.99 ? 553  VAL A CA    1 
ATOM   4189  C  C     . VAL A 1 552  ? -50.869 -95.150  -2.411  1.00 17.24 ? 553  VAL A C     1 
ATOM   4190  O  O     . VAL A 1 552  ? -51.699 -94.233  -2.342  1.00 17.75 ? 553  VAL A O     1 
ATOM   4191  C  CB    . VAL A 1 552  ? -51.584 -96.256  -0.307  1.00 17.16 ? 553  VAL A CB    1 
ATOM   4192  C  CG1   . VAL A 1 552  ? -52.072 -97.527  0.327   1.00 16.39 ? 553  VAL A CG1   1 
ATOM   4193  C  CG2   . VAL A 1 552  ? -50.436 -95.625  0.504   1.00 17.95 ? 553  VAL A CG2   1 
ATOM   4194  N  N     . GLY A 1 553  ? -49.682 -95.015  -3.005  1.00 17.22 ? 554  GLY A N     1 
ATOM   4195  C  CA    . GLY A 1 553  ? -49.338 -93.784  -3.712  1.00 17.13 ? 554  GLY A CA    1 
ATOM   4196  C  C     . GLY A 1 553  ? -48.796 -92.600  -2.928  1.00 17.27 ? 554  GLY A C     1 
ATOM   4197  O  O     . GLY A 1 553  ? -48.722 -91.475  -3.471  1.00 18.05 ? 554  GLY A O     1 
ATOM   4198  N  N     . LEU A 1 554  ? -48.512 -92.839  -1.643  1.00 16.99 ? 555  LEU A N     1 
ATOM   4199  C  CA    . LEU A 1 554  ? -47.934 -91.876  -0.721  1.00 16.17 ? 555  LEU A CA    1 
ATOM   4200  C  C     . LEU A 1 554  ? -46.412 -91.860  -0.936  1.00 16.38 ? 555  LEU A C     1 
ATOM   4201  O  O     . LEU A 1 554  ? -45.668 -91.188  -0.229  1.00 16.55 ? 555  LEU A O     1 
ATOM   4202  C  CB    . LEU A 1 554  ? -48.263 -92.315  0.700   1.00 15.85 ? 555  LEU A CB    1 
ATOM   4203  C  CG    . LEU A 1 554  ? -49.724 -92.091  1.113   1.00 15.84 ? 555  LEU A CG    1 
ATOM   4204  C  CD1   . LEU A 1 554  ? -49.973 -92.763  2.451   1.00 14.72 ? 555  LEU A CD1   1 
ATOM   4205  C  CD2   . LEU A 1 554  ? -50.047 -90.558  1.158   1.00 15.87 ? 555  LEU A CD2   1 
ATOM   4206  N  N     . GLY A 1 555  ? -45.962 -92.688  -1.866  1.00 16.56 ? 556  GLY A N     1 
ATOM   4207  C  CA    . GLY A 1 555  ? -44.561 -92.751  -2.207  1.00 17.24 ? 556  GLY A CA    1 
ATOM   4208  C  C     . GLY A 1 555  ? -43.557 -92.852  -1.075  1.00 17.44 ? 556  GLY A C     1 
ATOM   4209  O  O     . GLY A 1 555  ? -42.837 -91.873  -0.785  1.00 18.05 ? 556  GLY A O     1 
ATOM   4210  N  N     . GLY A 1 556  ? -43.520 -94.013  -0.428  1.00 16.80 ? 557  GLY A N     1 
ATOM   4211  C  CA    . GLY A 1 556  ? -42.561 -94.239  0.636   1.00 16.39 ? 557  GLY A CA    1 
ATOM   4212  C  C     . GLY A 1 556  ? -42.628 -93.483  1.948   1.00 15.77 ? 557  GLY A C     1 
ATOM   4213  O  O     . GLY A 1 556  ? -41.835 -93.812  2.839   1.00 15.97 ? 557  GLY A O     1 
ATOM   4214  N  N     . ARG A 1 557  ? -43.521 -92.490  2.079   1.00 14.94 ? 558  ARG A N     1 
ATOM   4215  C  CA    . ARG A 1 557  ? -43.647 -91.723  3.329   1.00 13.49 ? 558  ARG A CA    1 
ATOM   4216  C  C     . ARG A 1 557  ? -44.243 -92.718  4.303   1.00 12.42 ? 558  ARG A C     1 
ATOM   4217  O  O     . ARG A 1 557  ? -45.271 -93.339  4.025   1.00 12.98 ? 558  ARG A O     1 
ATOM   4218  C  CB    . ARG A 1 557  ? -44.572 -90.506  3.172   1.00 13.96 ? 558  ARG A CB    1 
ATOM   4219  C  CG    . ARG A 1 557  ? -43.956 -89.291  2.466   1.00 15.20 ? 558  ARG A CG    1 
ATOM   4220  C  CD    . ARG A 1 557  ? -42.865 -88.602  3.298   1.00 15.52 ? 558  ARG A CD    1 
ATOM   4221  N  NE    . ARG A 1 557  ? -42.190 -87.562  2.521   1.00 16.90 ? 558  ARG A NE    1 
ATOM   4222  C  CZ    . ARG A 1 557  ? -42.644 -86.312  2.359   1.00 17.61 ? 558  ARG A CZ    1 
ATOM   4223  N  NH1   . ARG A 1 557  ? -43.791 -85.909  2.906   1.00 17.26 ? 558  ARG A NH1   1 
ATOM   4224  N  NH2   . ARG A 1 557  ? -41.921 -85.435  1.676   1.00 17.93 ? 558  ARG A NH2   1 
ATOM   4225  N  N     . ILE A 1 558  ? -43.561 -92.922  5.417   1.00 10.86 ? 559  ILE A N     1 
ATOM   4226  C  CA    . ILE A 1 558  ? -44.005 -93.897  6.403   1.00 8.77  ? 559  ILE A CA    1 
ATOM   4227  C  C     . ILE A 1 558  ? -44.697 -93.319  7.631   1.00 8.43  ? 559  ILE A C     1 
ATOM   4228  O  O     . ILE A 1 558  ? -45.243 -94.075  8.415   1.00 8.33  ? 559  ILE A O     1 
ATOM   4229  C  CB    . ILE A 1 558  ? -42.770 -94.729  6.894   1.00 7.57  ? 559  ILE A CB    1 
ATOM   4230  C  CG1   . ILE A 1 558  ? -41.808 -93.825  7.688   1.00 6.61  ? 559  ILE A CG1   1 
ATOM   4231  C  CG2   . ILE A 1 558  ? -42.054 -95.367  5.685   1.00 6.36  ? 559  ILE A CG2   1 
ATOM   4232  C  CD1   . ILE A 1 558  ? -40.721 -94.538  8.436   1.00 5.80  ? 559  ILE A CD1   1 
ATOM   4233  N  N     . ASN A 1 559  ? -44.702 -91.995  7.786   1.00 8.21  ? 560  ASN A N     1 
ATOM   4234  C  CA    . ASN A 1 559  ? -45.244 -91.376  8.999   1.00 8.79  ? 560  ASN A CA    1 
ATOM   4235  C  C     . ASN A 1 559  ? -46.598 -91.911  9.463   1.00 9.10  ? 560  ASN A C     1 
ATOM   4236  O  O     . ASN A 1 559  ? -46.755 -92.320  10.639  1.00 8.45  ? 560  ASN A O     1 
ATOM   4237  C  CB    . ASN A 1 559  ? -45.246 -89.825  8.906   1.00 8.16  ? 560  ASN A CB    1 
ATOM   4238  C  CG    . ASN A 1 559  ? -46.107 -89.323  7.791   1.00 8.76  ? 560  ASN A CG    1 
ATOM   4239  O  OD1   . ASN A 1 559  ? -47.269 -88.991  8.002   1.00 9.57  ? 560  ASN A OD1   1 
ATOM   4240  N  ND2   . ASN A 1 559  ? -45.558 -89.284  6.575   1.00 8.79  ? 560  ASN A ND2   1 
ATOM   4241  N  N     . MET A 1 560  ? -47.502 -92.022  8.488   1.00 9.72  ? 561  MET A N     1 
ATOM   4242  C  CA    . MET A 1 560  ? -48.877 -92.461  8.696   1.00 9.90  ? 561  MET A CA    1 
ATOM   4243  C  C     . MET A 1 560  ? -48.996 -93.954  8.938   1.00 8.95  ? 561  MET A C     1 
ATOM   4244  O  O     . MET A 1 560  ? -49.926 -94.415  9.591   1.00 8.89  ? 561  MET A O     1 
ATOM   4245  C  CB    . MET A 1 560  ? -49.746 -92.051  7.515   1.00 12.32 ? 561  MET A CB    1 
ATOM   4246  C  CG    . MET A 1 560  ? -51.236 -92.126  7.805   1.00 16.02 ? 561  MET A CG    1 
ATOM   4247  S  SD    . MET A 1 560  ? -51.774 -91.035  9.198   1.00 20.89 ? 561  MET A SD    1 
ATOM   4248  C  CE    . MET A 1 560  ? -52.381 -92.217  10.320  1.00 20.05 ? 561  MET A CE    1 
ATOM   4249  N  N     . ILE A 1 561  ? -48.094 -94.726  8.357   1.00 7.61  ? 562  ILE A N     1 
ATOM   4250  C  CA    . ILE A 1 561  ? -48.119 -96.157  8.590   1.00 6.37  ? 562  ILE A CA    1 
ATOM   4251  C  C     . ILE A 1 561  ? -47.546 -96.433  9.989   1.00 6.52  ? 562  ILE A C     1 
ATOM   4252  O  O     . ILE A 1 561  ? -48.104 -97.238  10.741  1.00 7.57  ? 562  ILE A O     1 
ATOM   4253  C  CB    . ILE A 1 561  ? -47.330 -96.954  7.524   1.00 5.60  ? 562  ILE A CB    1 
ATOM   4254  C  CG1   . ILE A 1 561  ? -48.075 -96.959  6.184   1.00 5.02  ? 562  ILE A CG1   1 
ATOM   4255  C  CG2   . ILE A 1 561  ? -47.179 -98.393  7.958   1.00 4.29  ? 562  ILE A CG2   1 
ATOM   4256  C  CD1   . ILE A 1 561  ? -47.466 -96.087  5.174   1.00 5.40  ? 562  ILE A CD1   1 
ATOM   4257  N  N     . MET A 1 562  ? -46.474 -95.740  10.383  1.00 5.81  ? 563  MET A N     1 
ATOM   4258  C  CA    . MET A 1 562  ? -45.928 -95.976  11.710  1.00 4.52  ? 563  MET A CA    1 
ATOM   4259  C  C     . MET A 1 562  ? -46.875 -95.447  12.782  1.00 4.13  ? 563  MET A C     1 
ATOM   4260  O  O     . MET A 1 562  ? -47.011 -96.054  13.833  1.00 4.50  ? 563  MET A O     1 
ATOM   4261  C  CB    . MET A 1 562  ? -44.516 -95.405  11.861  1.00 3.96  ? 563  MET A CB    1 
ATOM   4262  C  CG    . MET A 1 562  ? -43.493 -96.086  10.995  1.00 3.65  ? 563  MET A CG    1 
ATOM   4263  S  SD    . MET A 1 562  ? -43.753 -97.886  10.842  1.00 3.67  ? 563  MET A SD    1 
ATOM   4264  C  CE    . MET A 1 562  ? -42.859 -98.526  12.297  1.00 2.07  ? 563  MET A CE    1 
ATOM   4265  N  N     . GLN A 1 563  ? -47.575 -94.356  12.496  1.00 3.68  ? 564  GLN A N     1 
ATOM   4266  C  CA    . GLN A 1 563  ? -48.549 -93.801  13.439  1.00 3.23  ? 564  GLN A CA    1 
ATOM   4267  C  C     . GLN A 1 563  ? -49.644 -94.819  13.670  1.00 2.85  ? 564  GLN A C     1 
ATOM   4268  O  O     . GLN A 1 563  ? -50.148 -94.987  14.757  1.00 2.56  ? 564  GLN A O     1 
ATOM   4269  C  CB    . GLN A 1 563  ? -49.200 -92.539  12.871  1.00 2.88  ? 564  GLN A CB    1 
ATOM   4270  C  CG    . GLN A 1 563  ? -50.253 -91.961  13.772  1.00 3.99  ? 564  GLN A CG    1 
ATOM   4271  C  CD    . GLN A 1 563  ? -49.688 -91.084  14.924  1.00 4.70  ? 564  GLN A CD    1 
ATOM   4272  O  OE1   . GLN A 1 563  ? -48.890 -91.557  15.767  1.00 4.53  ? 564  GLN A OE1   1 
ATOM   4273  N  NE2   . GLN A 1 563  ? -50.147 -89.795  14.979  1.00 3.66  ? 564  GLN A NE2   1 
ATOM   4274  N  N     . THR A 1 564  ? -50.029 -95.492  12.608  1.00 3.71  ? 565  THR A N     1 
ATOM   4275  C  CA    . THR A 1 564  ? -51.080 -96.489  12.686  1.00 3.78  ? 565  THR A CA    1 
ATOM   4276  C  C     . THR A 1 564  ? -50.629 -97.672  13.527  1.00 4.66  ? 565  THR A C     1 
ATOM   4277  O  O     . THR A 1 564  ? -51.416 -98.175  14.326  1.00 4.62  ? 565  THR A O     1 
ATOM   4278  C  CB    . THR A 1 564  ? -51.491 -96.898  11.285  1.00 3.98  ? 565  THR A CB    1 
ATOM   4279  O  OG1   . THR A 1 564  ? -52.099 -95.765  10.669  1.00 4.92  ? 565  THR A OG1   1 
ATOM   4280  C  CG2   . THR A 1 564  ? -52.471 -98.087  11.295  1.00 4.33  ? 565  THR A CG2   1 
ATOM   4281  N  N     . ALA A 1 565  ? -49.341 -98.044  13.419  1.00 5.13  ? 566  ALA A N     1 
ATOM   4282  C  CA    . ALA A 1 565  ? -48.766 -99.162  14.207  1.00 5.69  ? 566  ALA A CA    1 
ATOM   4283  C  C     . ALA A 1 565  ? -48.907 -98.842  15.707  1.00 5.78  ? 566  ALA A C     1 
ATOM   4284  O  O     . ALA A 1 565  ? -49.400 -99.657  16.477  1.00 6.79  ? 566  ALA A O     1 
ATOM   4285  C  CB    . ALA A 1 565  ? -47.279 -99.387  13.848  1.00 5.42  ? 566  ALA A CB    1 
ATOM   4286  N  N     . PHE A 1 566  ? -48.551 -97.619  16.088  1.00 5.26  ? 567  PHE A N     1 
ATOM   4287  C  CA    . PHE A 1 566  ? -48.659 -97.149  17.471  1.00 4.74  ? 567  PHE A CA    1 
ATOM   4288  C  C     . PHE A 1 566  ? -50.105 -97.204  18.052  1.00 4.88  ? 567  PHE A C     1 
ATOM   4289  O  O     . PHE A 1 566  ? -50.301 -97.736  19.141  1.00 4.70  ? 567  PHE A O     1 
ATOM   4290  C  CB    . PHE A 1 566  ? -48.085 -95.726  17.583  1.00 3.13  ? 567  PHE A CB    1 
ATOM   4291  C  CG    . PHE A 1 566  ? -48.514 -95.004  18.816  1.00 2.78  ? 567  PHE A CG    1 
ATOM   4292  C  CD1   . PHE A 1 566  ? -47.959 -95.340  20.064  1.00 2.16  ? 567  PHE A CD1   1 
ATOM   4293  C  CD2   . PHE A 1 566  ? -49.533 -94.050  18.759  1.00 2.00  ? 567  PHE A CD2   1 
ATOM   4294  C  CE1   . PHE A 1 566  ? -48.418 -94.748  21.215  1.00 2.00  ? 567  PHE A CE1   1 
ATOM   4295  C  CE2   . PHE A 1 566  ? -50.000 -93.457  19.909  1.00 2.00  ? 567  PHE A CE2   1 
ATOM   4296  C  CZ    . PHE A 1 566  ? -49.447 -93.804  21.143  1.00 2.38  ? 567  PHE A CZ    1 
ATOM   4297  N  N     . PHE A 1 567  ? -51.095 -96.627  17.362  1.00 5.12  ? 568  PHE A N     1 
ATOM   4298  C  CA    . PHE A 1 567  ? -52.477 -96.656  17.854  1.00 5.64  ? 568  PHE A CA    1 
ATOM   4299  C  C     . PHE A 1 567  ? -53.040 -98.057  17.951  1.00 5.99  ? 568  PHE A C     1 
ATOM   4300  O  O     . PHE A 1 567  ? -53.749 -98.364  18.900  1.00 6.91  ? 568  PHE A O     1 
ATOM   4301  C  CB    . PHE A 1 567  ? -53.389 -95.790  16.999  1.00 6.45  ? 568  PHE A CB    1 
ATOM   4302  C  CG    . PHE A 1 567  ? -53.320 -94.348  17.347  1.00 7.25  ? 568  PHE A CG    1 
ATOM   4303  C  CD1   . PHE A 1 567  ? -54.020 -93.856  18.432  1.00 7.62  ? 568  PHE A CD1   1 
ATOM   4304  C  CD2   . PHE A 1 567  ? -52.516 -93.475  16.611  1.00 7.88  ? 568  PHE A CD2   1 
ATOM   4305  C  CE1   . PHE A 1 567  ? -53.912 -92.486  18.777  1.00 8.97  ? 568  PHE A CE1   1 
ATOM   4306  C  CE2   . PHE A 1 567  ? -52.411 -92.122  16.957  1.00 8.12  ? 568  PHE A CE2   1 
ATOM   4307  C  CZ    . PHE A 1 567  ? -53.105 -91.633  18.032  1.00 8.15  ? 568  PHE A CZ    1 
ATOM   4308  N  N     . LYS A 1 568  ? -52.667 -98.922  17.021  1.00 5.49  ? 569  LYS A N     1 
ATOM   4309  C  CA    . LYS A 1 568  ? -53.130 -100.286 17.051  1.00 5.97  ? 569  LYS A CA    1 
ATOM   4310  C  C     . LYS A 1 568  ? -52.408 -101.172 18.089  1.00 6.49  ? 569  LYS A C     1 
ATOM   4311  O  O     . LYS A 1 568  ? -53.041 -101.954 18.782  1.00 6.84  ? 569  LYS A O     1 
ATOM   4312  C  CB    . LYS A 1 568  ? -53.050 -100.947 15.647  1.00 4.98  ? 569  LYS A CB    1 
ATOM   4313  C  CG    . LYS A 1 568  ? -53.654 -102.412 15.643  1.00 4.30  ? 569  LYS A CG    1 
ATOM   4314  C  CD    . LYS A 1 568  ? -53.472 -103.233 14.342  1.00 3.08  ? 569  LYS A CD    1 
ATOM   4315  C  CE    . LYS A 1 568  ? -53.746 -104.714 14.597  1.00 2.97  ? 569  LYS A CE    1 
ATOM   4316  N  NZ    . LYS A 1 568  ? -53.617 -105.652 13.425  1.00 2.49  ? 569  LYS A NZ    1 
ATOM   4317  N  N     . LEU A 1 569  ? -51.103 -100.994 18.257  1.00 7.30  ? 570  LEU A N     1 
ATOM   4318  C  CA    . LEU A 1 569  ? -50.330 -101.846 19.173  1.00 7.32  ? 570  LEU A CA    1 
ATOM   4319  C  C     . LEU A 1 569  ? -49.806 -101.345 20.507  1.00 8.37  ? 570  LEU A C     1 
ATOM   4320  O  O     . LEU A 1 569  ? -49.309 -102.185 21.269  1.00 8.63  ? 570  LEU A O     1 
ATOM   4321  C  CB    . LEU A 1 569  ? -49.125 -102.405 18.435  1.00 6.21  ? 570  LEU A CB    1 
ATOM   4322  C  CG    . LEU A 1 569  ? -49.248 -103.590 17.482  1.00 5.81  ? 570  LEU A CG    1 
ATOM   4323  C  CD1   . LEU A 1 569  ? -50.693 -104.031 17.327  1.00 5.37  ? 570  LEU A CD1   1 
ATOM   4324  C  CD2   . LEU A 1 569  ? -48.620 -103.230 16.170  1.00 4.77  ? 570  LEU A CD2   1 
ATOM   4325  N  N     . ALA A 1 570  ? -49.770 -100.020 20.723  1.00 9.24  ? 571  ALA A N     1 
ATOM   4326  C  CA    . ALA A 1 570  ? -49.250 -99.401  21.962  1.00 10.66 ? 571  ALA A CA    1 
ATOM   4327  C  C     . ALA A 1 570  ? -50.102 -99.738  23.169  1.00 12.02 ? 571  ALA A C     1 
ATOM   4328  O  O     . ALA A 1 570  ? -49.618 -99.660  24.314  1.00 12.52 ? 571  ALA A O     1 
ATOM   4329  C  CB    . ALA A 1 570  ? -49.186 -97.886  21.829  1.00 9.93  ? 571  ALA A CB    1 
ATOM   4330  N  N     . GLY A 1 571  ? -51.379 -100.036 22.905  1.00 12.87 ? 572  GLY A N     1 
ATOM   4331  C  CA    . GLY A 1 571  ? -52.317 -100.403 23.952  1.00 14.27 ? 572  GLY A CA    1 
ATOM   4332  C  C     . GLY A 1 571  ? -52.813 -99.253  24.813  1.00 15.47 ? 572  GLY A C     1 
ATOM   4333  O  O     . GLY A 1 571  ? -53.323 -99.486  25.920  1.00 15.79 ? 572  GLY A O     1 
ATOM   4334  N  N     . VAL A 1 572  ? -52.700 -98.024  24.314  1.00 16.02 ? 573  VAL A N     1 
ATOM   4335  C  CA    . VAL A 1 572  ? -53.143 -96.903  25.119  1.00 17.02 ? 573  VAL A CA    1 
ATOM   4336  C  C     . VAL A 1 572  ? -54.660 -96.743  24.960  1.00 17.84 ? 573  VAL A C     1 
ATOM   4337  O  O     . VAL A 1 572  ? -55.387 -96.406  25.913  1.00 18.09 ? 573  VAL A O     1 
ATOM   4338  C  CB    . VAL A 1 572  ? -52.418 -95.610  24.708  1.00 16.70 ? 573  VAL A CB    1 
ATOM   4339  C  CG1   . VAL A 1 572  ? -50.912 -95.783  24.792  1.00 16.64 ? 573  VAL A CG1   1 
ATOM   4340  C  CG2   . VAL A 1 572  ? -52.806 -95.240  23.299  1.00 17.50 ? 573  VAL A CG2   1 
ATOM   4341  N  N     . LEU A 1 573  ? -55.138 -97.099  23.774  1.00 18.61 ? 574  LEU A N     1 
ATOM   4342  C  CA    . LEU A 1 573  ? -56.544 -96.949  23.428  1.00 19.54 ? 574  LEU A CA    1 
ATOM   4343  C  C     . LEU A 1 573  ? -57.127 -98.176  22.720  1.00 20.87 ? 574  LEU A C     1 
ATOM   4344  O  O     . LEU A 1 573  ? -56.397 -99.054  22.243  1.00 21.01 ? 574  LEU A O     1 
ATOM   4345  C  CB    . LEU A 1 573  ? -56.702 -95.752  22.489  1.00 18.41 ? 574  LEU A CB    1 
ATOM   4346  C  CG    . LEU A 1 573  ? -57.014 -94.398  23.098  1.00 18.06 ? 574  LEU A CG    1 
ATOM   4347  C  CD1   . LEU A 1 573  ? -57.072 -93.335  22.000  1.00 17.96 ? 574  LEU A CD1   1 
ATOM   4348  C  CD2   . LEU A 1 573  ? -58.344 -94.517  23.810  1.00 18.47 ? 574  LEU A CD2   1 
ATOM   4349  N  N     . PRO A 1 574  ? -58.464 -98.281  22.699  1.00 21.89 ? 575  PRO A N     1 
ATOM   4350  C  CA    . PRO A 1 574  ? -59.145 -99.399  22.037  1.00 22.33 ? 575  PRO A CA    1 
ATOM   4351  C  C     . PRO A 1 574  ? -58.953 -99.253  20.538  1.00 22.41 ? 575  PRO A C     1 
ATOM   4352  O  O     . PRO A 1 574  ? -59.001 -98.139  20.016  1.00 22.50 ? 575  PRO A O     1 
ATOM   4353  C  CB    . PRO A 1 574  ? -60.601 -99.173  22.419  1.00 22.79 ? 575  PRO A CB    1 
ATOM   4354  C  CG    . PRO A 1 574  ? -60.469 -98.655  23.825  1.00 22.91 ? 575  PRO A CG    1 
ATOM   4355  C  CD    . PRO A 1 574  ? -59.378 -97.597  23.631  1.00 22.45 ? 575  PRO A CD    1 
ATOM   4356  N  N     . PHE A 1 575  ? -58.781 -100.383 19.857  1.00 22.51 ? 576  PHE A N     1 
ATOM   4357  C  CA    . PHE A 1 575  ? -58.555 -100.389 18.414  1.00 22.86 ? 576  PHE A CA    1 
ATOM   4358  C  C     . PHE A 1 575  ? -59.554 -99.490  17.677  1.00 23.32 ? 576  PHE A C     1 
ATOM   4359  O  O     . PHE A 1 575  ? -59.169 -98.522  16.988  1.00 24.06 ? 576  PHE A O     1 
ATOM   4360  C  CB    . PHE A 1 575  ? -58.648 -101.817 17.863  1.00 22.21 ? 576  PHE A CB    1 
ATOM   4361  C  CG    . PHE A 1 575  ? -57.515 -102.722 18.285  0.01 21.53 ? 576  PHE A CG    1 
ATOM   4362  C  CD1   . PHE A 1 575  ? -57.083 -102.773 19.612  0.01 21.22 ? 576  PHE A CD1   1 
ATOM   4363  C  CD2   . PHE A 1 575  ? -56.908 -103.562 17.353  0.01 21.22 ? 576  PHE A CD2   1 
ATOM   4364  C  CE1   . PHE A 1 575  ? -56.069 -103.650 20.000  0.01 20.96 ? 576  PHE A CE1   1 
ATOM   4365  C  CE2   . PHE A 1 575  ? -55.893 -104.442 17.733  0.01 20.96 ? 576  PHE A CE2   1 
ATOM   4366  C  CZ    . PHE A 1 575  ? -55.474 -104.487 19.058  0.01 20.89 ? 576  PHE A CZ    1 
ATOM   4367  N  N     . GLU A 1 576  ? -60.836 -99.787  17.874  1.00 23.32 ? 577  GLU A N     1 
ATOM   4368  C  CA    . GLU A 1 576  ? -61.900 -99.050  17.233  1.00 23.52 ? 577  GLU A CA    1 
ATOM   4369  C  C     . GLU A 1 576  ? -61.845 -97.562  17.466  1.00 22.93 ? 577  GLU A C     1 
ATOM   4370  O  O     . GLU A 1 576  ? -61.894 -96.795  16.499  1.00 22.94 ? 577  GLU A O     1 
ATOM   4371  C  CB    . GLU A 1 576  ? -63.259 -99.581  17.665  1.00 25.01 ? 577  GLU A CB    1 
ATOM   4372  C  CG    . GLU A 1 576  ? -63.685 -100.833 16.902  1.00 27.23 ? 577  GLU A CG    1 
ATOM   4373  C  CD    . GLU A 1 576  ? -65.011 -101.398 17.406  1.00 28.95 ? 577  GLU A CD    1 
ATOM   4374  O  OE1   . GLU A 1 576  ? -65.958 -100.590 17.669  1.00 30.25 ? 577  GLU A OE1   1 
ATOM   4375  O  OE2   . GLU A 1 576  ? -65.096 -102.646 17.549  1.00 29.04 ? 577  GLU A OE2   1 
ATOM   4376  N  N     . LYS A 1 577  ? -61.697 -97.161  18.730  1.00 22.09 ? 578  LYS A N     1 
ATOM   4377  C  CA    . LYS A 1 577  ? -61.664 -95.744  19.079  1.00 21.58 ? 578  LYS A CA    1 
ATOM   4378  C  C     . LYS A 1 577  ? -60.473 -95.019  18.445  1.00 21.20 ? 578  LYS A C     1 
ATOM   4379  O  O     . LYS A 1 577  ? -60.617 -93.951  17.827  1.00 20.51 ? 578  LYS A O     1 
ATOM   4380  C  CB    . LYS A 1 577  ? -61.634 -95.591  20.607  1.00 21.12 ? 578  LYS A CB    1 
ATOM   4381  C  CG    . LYS A 1 577  ? -61.944 -94.180  21.086  1.00 21.44 ? 578  LYS A CG    1 
ATOM   4382  C  CD    . LYS A 1 577  ? -61.904 -94.035  22.624  1.00 21.34 ? 578  LYS A CD    1 
ATOM   4383  C  CE    . LYS A 1 577  ? -61.920 -92.553  23.063  1.00 21.26 ? 578  LYS A CE    1 
ATOM   4384  N  NZ    . LYS A 1 577  ? -61.834 -92.423  24.554  1.00 21.54 ? 578  LYS A NZ    1 
ATOM   4385  N  N     . ALA A 1 578  ? -59.319 -95.678  18.537  1.00 21.06 ? 579  ALA A N     1 
ATOM   4386  C  CA    . ALA A 1 578  ? -58.059 -95.151  18.046  1.00 21.07 ? 579  ALA A CA    1 
ATOM   4387  C  C     . ALA A 1 578  ? -58.124 -94.806  16.564  1.00 21.66 ? 579  ALA A C     1 
ATOM   4388  O  O     . ALA A 1 578  ? -57.959 -93.632  16.175  1.00 21.50 ? 579  ALA A O     1 
ATOM   4389  C  CB    . ALA A 1 578  ? -56.962 -96.148  18.317  1.00 20.74 ? 579  ALA A CB    1 
ATOM   4390  N  N     . VAL A 1 579  ? -58.492 -95.804  15.754  1.00 21.99 ? 580  VAL A N     1 
ATOM   4391  C  CA    . VAL A 1 579  ? -58.575 -95.627  14.300  1.00 22.10 ? 580  VAL A CA    1 
ATOM   4392  C  C     . VAL A 1 579  ? -59.649 -94.625  13.846  1.00 22.81 ? 580  VAL A C     1 
ATOM   4393  O  O     . VAL A 1 579  ? -59.507 -93.970  12.794  1.00 23.26 ? 580  VAL A O     1 
ATOM   4394  C  CB    . VAL A 1 579  ? -58.790 -96.964  13.592  1.00 21.83 ? 580  VAL A CB    1 
ATOM   4395  C  CG1   . VAL A 1 579  ? -58.623 -96.766  12.096  1.00 21.22 ? 580  VAL A CG1   1 
ATOM   4396  C  CG2   . VAL A 1 579  ? -57.787 -98.019  14.130  1.00 21.06 ? 580  VAL A CG2   1 
ATOM   4397  N  N     . ASP A 1 580  ? -60.710 -94.510  14.642  1.00 23.13 ? 581  ASP A N     1 
ATOM   4398  C  CA    . ASP A 1 580  ? -61.778 -93.575  14.374  1.00 23.57 ? 581  ASP A CA    1 
ATOM   4399  C  C     . ASP A 1 580  ? -61.153 -92.179  14.611  1.00 23.81 ? 581  ASP A C     1 
ATOM   4400  O  O     . ASP A 1 580  ? -61.114 -91.323  13.702  1.00 23.68 ? 581  ASP A O     1 
ATOM   4401  C  CB    . ASP A 1 580  ? -62.934 -93.867  15.339  1.00 24.54 ? 581  ASP A CB    1 
ATOM   4402  C  CG    . ASP A 1 580  ? -63.665 -92.602  15.796  1.00 25.51 ? 581  ASP A CG    1 
ATOM   4403  O  OD1   . ASP A 1 580  ? -64.259 -91.917  14.926  1.00 25.90 ? 581  ASP A OD1   1 
ATOM   4404  O  OD2   . ASP A 1 580  ? -63.643 -92.303  17.024  1.00 25.95 ? 581  ASP A OD2   1 
ATOM   4405  N  N     . LEU A 1 581  ? -60.593 -92.007  15.808  1.00 23.84 ? 582  LEU A N     1 
ATOM   4406  C  CA    . LEU A 1 581  ? -59.910 -90.775  16.219  1.00 24.10 ? 582  LEU A CA    1 
ATOM   4407  C  C     . LEU A 1 581  ? -58.849 -90.358  15.204  1.00 23.93 ? 582  LEU A C     1 
ATOM   4408  O  O     . LEU A 1 581  ? -58.739 -89.180  14.845  1.00 24.01 ? 582  LEU A O     1 
ATOM   4409  C  CB    . LEU A 1 581  ? -59.204 -91.013  17.551  1.00 23.77 ? 582  LEU A CB    1 
ATOM   4410  C  CG    . LEU A 1 581  ? -59.884 -90.574  18.827  1.00 23.64 ? 582  LEU A CG    1 
ATOM   4411  C  CD1   . LEU A 1 581  ? -61.365 -90.845  18.763  1.00 24.20 ? 582  LEU A CD1   1 
ATOM   4412  C  CD2   . LEU A 1 581  ? -59.242 -91.299  19.956  1.00 23.21 ? 582  LEU A CD2   1 
ATOM   4413  N  N     . LEU A 1 582  ? -58.104 -91.366  14.753  1.00 23.79 ? 583  LEU A N     1 
ATOM   4414  C  CA    . LEU A 1 582  ? -57.017 -91.229  13.799  1.00 23.95 ? 583  LEU A CA    1 
ATOM   4415  C  C     . LEU A 1 582  ? -57.477 -90.683  12.455  1.00 24.42 ? 583  LEU A C     1 
ATOM   4416  O  O     . LEU A 1 582  ? -56.996 -89.610  12.002  1.00 24.59 ? 583  LEU A O     1 
ATOM   4417  C  CB    . LEU A 1 582  ? -56.329 -92.589  13.564  1.00 23.01 ? 583  LEU A CB    1 
ATOM   4418  C  CG    . LEU A 1 582  ? -54.805 -92.560  13.399  1.00 22.21 ? 583  LEU A CG    1 
ATOM   4419  C  CD1   . LEU A 1 582  ? -54.347 -93.713  12.568  1.00 22.05 ? 583  LEU A CD1   1 
ATOM   4420  C  CD2   . LEU A 1 582  ? -54.367 -91.285  12.767  1.00 21.52 ? 583  LEU A CD2   1 
ATOM   4421  N  N     . LYS A 1 583  ? -58.405 -91.412  11.831  1.00 24.44 ? 584  LYS A N     1 
ATOM   4422  C  CA    . LYS A 1 583  ? -58.894 -91.021  10.527  1.00 24.74 ? 584  LYS A CA    1 
ATOM   4423  C  C     . LYS A 1 583  ? -59.494 -89.608  10.499  1.00 25.28 ? 584  LYS A C     1 
ATOM   4424  O  O     . LYS A 1 583  ? -59.209 -88.837  9.564   1.00 25.70 ? 584  LYS A O     1 
ATOM   4425  C  CB    . LYS A 1 583  ? -59.857 -92.067  9.978   1.00 24.73 ? 584  LYS A CB    1 
ATOM   4426  C  CG    . LYS A 1 583  ? -61.213 -92.135  10.648  0.01 24.24 ? 584  LYS A CG    1 
ATOM   4427  C  CD    . LYS A 1 583  ? -62.322 -92.074  9.610   0.01 23.96 ? 584  LYS A CD    1 
ATOM   4428  C  CE    . LYS A 1 583  ? -63.694 -92.102  10.257  0.01 23.76 ? 584  LYS A CE    1 
ATOM   4429  N  NZ    . LYS A 1 583  ? -64.771 -91.849  9.258   0.01 23.60 ? 584  LYS A NZ    1 
ATOM   4430  N  N     . LYS A 1 584  ? -60.191 -89.229  11.577  1.00 25.32 ? 585  LYS A N     1 
ATOM   4431  C  CA    . LYS A 1 584  ? -60.811 -87.905  11.686  1.00 25.74 ? 585  LYS A CA    1 
ATOM   4432  C  C     . LYS A 1 584  ? -59.752 -86.811  11.711  1.00 26.26 ? 585  LYS A C     1 
ATOM   4433  O  O     . LYS A 1 584  ? -59.976 -85.687  11.223  1.00 26.51 ? 585  LYS A O     1 
ATOM   4434  C  CB    . LYS A 1 584  ? -61.675 -87.826  12.953  1.00 25.79 ? 585  LYS A CB    1 
ATOM   4435  C  CG    . LYS A 1 584  ? -62.856 -88.833  12.965  1.00 26.36 ? 585  LYS A CG    1 
ATOM   4436  C  CD    . LYS A 1 584  ? -64.014 -88.466  13.956  1.00 26.49 ? 585  LYS A CD    1 
ATOM   4437  C  CE    . LYS A 1 584  ? -65.379 -89.065  13.461  1.00 26.81 ? 585  LYS A CE    1 
ATOM   4438  N  NZ    . LYS A 1 584  ? -66.578 -88.877  14.355  1.00 26.70 ? 585  LYS A NZ    1 
ATOM   4439  N  N     . SER A 1 585  ? -58.575 -87.189  12.205  1.00 26.20 ? 586  SER A N     1 
ATOM   4440  C  CA    . SER A 1 585  ? -57.434 -86.303  12.328  1.00 26.45 ? 586  SER A CA    1 
ATOM   4441  C  C     . SER A 1 585  ? -56.681 -86.126  11.026  1.00 26.12 ? 586  SER A C     1 
ATOM   4442  O  O     . SER A 1 585  ? -55.987 -85.107  10.806  1.00 26.27 ? 586  SER A O     1 
ATOM   4443  C  CB    . SER A 1 585  ? -56.520 -86.872  13.395  1.00 27.30 ? 586  SER A CB    1 
ATOM   4444  O  OG    . SER A 1 585  ? -57.319 -87.178  14.539  1.00 28.62 ? 586  SER A OG    1 
ATOM   4445  N  N     . ILE A 1 586  ? -56.800 -87.148  10.188  1.00 25.72 ? 587  ILE A N     1 
ATOM   4446  C  CA    . ILE A 1 586  ? -56.166 -87.171  8.869   1.00 25.54 ? 587  ILE A CA    1 
ATOM   4447  C  C     . ILE A 1 586  ? -56.992 -86.244  8.002   1.00 25.70 ? 587  ILE A C     1 
ATOM   4448  O  O     . ILE A 1 586  ? -56.452 -85.368  7.292   1.00 25.65 ? 587  ILE A O     1 
ATOM   4449  C  CB    . ILE A 1 586  ? -56.183 -88.607  8.283   1.00 25.07 ? 587  ILE A CB    1 
ATOM   4450  C  CG1   . ILE A 1 586  ? -54.980 -89.398  8.828   1.00 24.68 ? 587  ILE A CG1   1 
ATOM   4451  C  CG2   . ILE A 1 586  ? -56.163 -88.570  6.756   1.00 24.49 ? 587  ILE A CG2   1 
ATOM   4452  C  CD1   . ILE A 1 586  ? -55.262 -90.839  9.112   1.00 23.93 ? 587  ILE A CD1   1 
ATOM   4453  N  N     . HIS A 1 587  ? -58.306 -86.443  8.100   1.00 25.83 ? 588  HIS A N     1 
ATOM   4454  C  CA    . HIS A 1 587  ? -59.279 -85.632  7.387   1.00 26.63 ? 588  HIS A CA    1 
ATOM   4455  C  C     . HIS A 1 587  ? -59.017 -84.111  7.654   1.00 27.07 ? 588  HIS A C     1 
ATOM   4456  O  O     . HIS A 1 587  ? -58.735 -83.303  6.733   1.00 26.97 ? 588  HIS A O     1 
ATOM   4457  C  CB    . HIS A 1 587  ? -60.690 -86.011  7.884   1.00 26.94 ? 588  HIS A CB    1 
ATOM   4458  C  CG    . HIS A 1 587  ? -61.295 -87.191  7.176   1.00 27.32 ? 588  HIS A CG    1 
ATOM   4459  N  ND1   . HIS A 1 587  ? -61.813 -88.281  7.844   1.00 27.27 ? 588  HIS A ND1   1 
ATOM   4460  C  CD2   . HIS A 1 587  ? -61.450 -87.456  5.853   1.00 27.63 ? 588  HIS A CD2   1 
ATOM   4461  C  CE1   . HIS A 1 587  ? -62.253 -89.169  6.967   1.00 27.56 ? 588  HIS A CE1   1 
ATOM   4462  N  NE2   . HIS A 1 587  ? -62.045 -88.693  5.751   1.00 27.79 ? 588  HIS A NE2   1 
ATOM   4463  N  N     . LYS A 1 588  ? -58.993 -83.795  8.948   1.00 27.41 ? 589  LYS A N     1 
ATOM   4464  C  CA    . LYS A 1 588  ? -58.801 -82.456  9.476   1.00 27.70 ? 589  LYS A CA    1 
ATOM   4465  C  C     . LYS A 1 588  ? -57.455 -81.779  9.183   1.00 28.36 ? 589  LYS A C     1 
ATOM   4466  O  O     . LYS A 1 588  ? -57.403 -80.557  8.894   1.00 29.02 ? 589  LYS A O     1 
ATOM   4467  C  CB    . LYS A 1 588  ? -59.052 -82.490  10.998  1.00 27.20 ? 589  LYS A CB    1 
ATOM   4468  C  CG    . LYS A 1 588  ? -59.205 -81.124  11.648  0.01 25.93 ? 589  LYS A CG    1 
ATOM   4469  C  CD    . LYS A 1 588  ? -59.812 -81.258  13.036  0.01 25.15 ? 589  LYS A CD    1 
ATOM   4470  C  CE    . LYS A 1 588  ? -59.262 -80.212  13.990  0.01 24.63 ? 589  LYS A CE    1 
ATOM   4471  N  NZ    . LYS A 1 588  ? -57.820 -80.455  14.276  0.01 24.28 ? 589  LYS A NZ    1 
ATOM   4472  N  N     . ALA A 1 589  ? -56.368 -82.534  9.280   1.00 28.49 ? 590  ALA A N     1 
ATOM   4473  C  CA    . ALA A 1 589  ? -55.067 -81.924  9.043   1.00 29.04 ? 590  ALA A CA    1 
ATOM   4474  C  C     . ALA A 1 589  ? -54.677 -82.010  7.581   1.00 28.91 ? 590  ALA A C     1 
ATOM   4475  O  O     . ALA A 1 589  ? -55.470 -81.709  6.701   1.00 29.23 ? 590  ALA A O     1 
ATOM   4476  C  CB    . ALA A 1 589  ? -53.999 -82.564  9.953   1.00 29.26 ? 590  ALA A CB    1 
ATOM   4477  N  N     . TYR A 1 590  ? -53.428 -82.378  7.352   0.01 28.98 ? 591  TYR A N     1 
ATOM   4478  C  CA    . TYR A 1 590  ? -52.849 -82.553  6.039   1.00 28.85 ? 591  TYR A CA    1 
ATOM   4479  C  C     . TYR A 1 590  ? -52.243 -81.434  5.203   0.01 28.51 ? 591  TYR A C     1 
ATOM   4480  O  O     . TYR A 1 590  ? -52.823 -80.365  5.001   0.01 28.54 ? 591  TYR A O     1 
ATOM   4481  C  CB    . TYR A 1 590  ? -53.581 -83.658  5.238   1.00 29.48 ? 591  TYR A CB    1 
ATOM   4482  C  CG    . TYR A 1 590  ? -52.816 -84.909  5.544   1.00 29.58 ? 591  TYR A CG    1 
ATOM   4483  C  CD1   . TYR A 1 590  ? -51.574 -85.102  4.928   1.00 29.65 ? 591  TYR A CD1   1 
ATOM   4484  C  CD2   . TYR A 1 590  ? -53.085 -85.641  6.708   1.00 29.38 ? 591  TYR A CD2   1 
ATOM   4485  C  CE1   . TYR A 1 590  ? -50.614 -85.923  5.468   1.00 29.84 ? 591  TYR A CE1   1 
ATOM   4486  C  CE2   . TYR A 1 590  ? -52.106 -86.485  7.267   1.00 29.63 ? 591  TYR A CE2   1 
ATOM   4487  C  CZ    . TYR A 1 590  ? -50.870 -86.594  6.639   1.00 29.75 ? 591  TYR A CZ    1 
ATOM   4488  O  OH    . TYR A 1 590  ? -49.813 -87.252  7.227   1.00 31.39 ? 591  TYR A OH    1 
ATOM   4489  N  N     . GLY A 1 591  ? -51.003 -81.716  4.799   0.01 28.04 ? 592  GLY A N     1 
ATOM   4490  C  CA    . GLY A 1 591  ? -50.163 -80.813  4.032   0.01 27.40 ? 592  GLY A CA    1 
ATOM   4491  C  C     . GLY A 1 591  ? -50.759 -80.014  2.895   0.01 26.97 ? 592  GLY A C     1 
ATOM   4492  O  O     . GLY A 1 591  ? -51.010 -78.818  3.050   0.01 26.92 ? 592  GLY A O     1 
ATOM   4493  N  N     . LYS A 1 592  ? -50.919 -80.647  1.737   0.01 26.56 ? 593  LYS A N     1 
ATOM   4494  C  CA    . LYS A 1 592  ? -51.479 -79.964  0.579   0.01 26.24 ? 593  LYS A CA    1 
ATOM   4495  C  C     . LYS A 1 592  ? -53.013 -79.965  0.546   0.01 26.53 ? 593  LYS A C     1 
ATOM   4496  O  O     . LYS A 1 592  ? -53.609 -78.910  0.321   0.01 26.40 ? 593  LYS A O     1 
ATOM   4497  C  CB    . LYS A 1 592  ? -50.894 -80.529  -0.722  0.01 25.50 ? 593  LYS A CB    1 
ATOM   4498  C  CG    . LYS A 1 592  ? -50.157 -79.494  -1.580  0.01 24.61 ? 593  LYS A CG    1 
ATOM   4499  C  CD    . LYS A 1 592  ? -48.736 -79.205  -1.087  0.01 23.93 ? 593  LYS A CD    1 
ATOM   4500  C  CE    . LYS A 1 592  ? -48.135 -78.003  -1.825  0.01 23.51 ? 593  LYS A CE    1 
ATOM   4501  N  NZ    . LYS A 1 592  ? -46.645 -77.877  -1.718  0.01 23.21 ? 593  LYS A NZ    1 
ATOM   4502  N  N     . LYS A 1 593  ? -53.630 -81.137  0.769   1.00 27.13 ? 594  LYS A N     1 
ATOM   4503  C  CA    . LYS A 1 593  ? -55.112 -81.335  0.792   1.00 27.68 ? 594  LYS A CA    1 
ATOM   4504  C  C     . LYS A 1 593  ? -55.711 -81.842  -0.560  1.00 28.27 ? 594  LYS A C     1 
ATOM   4505  O  O     . LYS A 1 593  ? -54.969 -82.157  -1.527  1.00 28.18 ? 594  LYS A O     1 
ATOM   4506  C  CB    . LYS A 1 593  ? -55.849 -80.032  1.240   1.00 27.41 ? 594  LYS A CB    1 
ATOM   4507  C  CG    . LYS A 1 593  ? -57.006 -80.189  2.212   1.00 26.60 ? 594  LYS A CG    1 
ATOM   4508  C  CD    . LYS A 1 593  ? -57.366 -78.827  2.829   0.01 26.58 ? 594  LYS A CD    1 
ATOM   4509  C  CE    . LYS A 1 593  ? -58.204 -77.961  1.891   0.01 26.49 ? 594  LYS A CE    1 
ATOM   4510  N  NZ    . LYS A 1 593  ? -58.236 -76.515  2.291   1.00 27.35 ? 594  LYS A NZ    1 
ATOM   4511  N  N     . GLY A 1 594  ? -57.045 -81.988  -0.595  1.00 28.68 ? 595  GLY A N     1 
ATOM   4512  C  CA    . GLY A 1 594  ? -57.704 -82.409  -1.824  1.00 29.15 ? 595  GLY A CA    1 
ATOM   4513  C  C     . GLY A 1 594  ? -58.722 -83.541  -1.864  1.00 29.40 ? 595  GLY A C     1 
ATOM   4514  O  O     . GLY A 1 594  ? -59.318 -83.766  -2.932  1.00 29.98 ? 595  GLY A O     1 
ATOM   4515  N  N     . GLU A 1 595  ? -58.955 -84.226  -0.740  1.00 29.28 ? 596  GLU A N     1 
ATOM   4516  C  CA    . GLU A 1 595  ? -59.886 -85.384  -0.657  1.00 28.75 ? 596  GLU A CA    1 
ATOM   4517  C  C     . GLU A 1 595  ? -59.326 -86.617  -1.340  1.00 27.67 ? 596  GLU A C     1 
ATOM   4518  O  O     . GLU A 1 595  ? -59.774 -87.750  -1.107  1.00 27.60 ? 596  GLU A O     1 
ATOM   4519  C  CB    . GLU A 1 595  ? -61.287 -85.093  -1.199  1.00 30.29 ? 596  GLU A CB    1 
ATOM   4520  C  CG    . GLU A 1 595  ? -62.275 -86.308  -1.112  1.00 32.32 ? 596  GLU A CG    1 
ATOM   4521  C  CD    . GLU A 1 595  ? -62.368 -86.976  0.299   1.00 33.39 ? 596  GLU A CD    1 
ATOM   4522  O  OE1   . GLU A 1 595  ? -62.866 -86.328  1.261   1.00 33.67 ? 596  GLU A OE1   1 
ATOM   4523  O  OE2   . GLU A 1 595  ? -61.953 -88.161  0.434   1.00 33.64 ? 596  GLU A OE2   1 
ATOM   4524  N  N     . LYS A 1 596  ? -58.323 -86.400  -2.175  1.00 26.30 ? 597  LYS A N     1 
ATOM   4525  C  CA    . LYS A 1 596  ? -57.659 -87.506  -2.842  1.00 24.87 ? 597  LYS A CA    1 
ATOM   4526  C  C     . LYS A 1 596  ? -56.471 -87.869  -1.932  1.00 24.19 ? 597  LYS A C     1 
ATOM   4527  O  O     . LYS A 1 596  ? -56.318 -89.031  -1.531  1.00 23.93 ? 597  LYS A O     1 
ATOM   4528  C  CB    . LYS A 1 596  ? -57.164 -87.073  -4.236  1.00 24.13 ? 597  LYS A CB    1 
ATOM   4529  C  CG    . LYS A 1 596  ? -56.503 -88.175  -5.043  0.01 22.66 ? 597  LYS A CG    1 
ATOM   4530  C  CD    . LYS A 1 596  ? -55.911 -87.647  -6.346  0.01 21.76 ? 597  LYS A CD    1 
ATOM   4531  C  CE    . LYS A 1 596  ? -55.108 -88.732  -7.054  0.01 21.18 ? 597  LYS A CE    1 
ATOM   4532  N  NZ    . LYS A 1 596  ? -54.452 -88.249  -8.303  0.01 20.78 ? 597  LYS A NZ    1 
ATOM   4533  N  N     . ILE A 1 597  ? -55.671 -86.868  -1.553  1.00 23.39 ? 598  ILE A N     1 
ATOM   4534  C  CA    . ILE A 1 597  ? -54.533 -87.166  -0.719  1.00 22.74 ? 598  ILE A CA    1 
ATOM   4535  C  C     . ILE A 1 597  ? -55.110 -87.672  0.588   1.00 22.33 ? 598  ILE A C     1 
ATOM   4536  O  O     . ILE A 1 597  ? -54.679 -88.712  1.110   1.00 22.27 ? 598  ILE A O     1 
ATOM   4537  C  CB    . ILE A 1 597  ? -53.568 -85.958  -0.568  1.00 23.20 ? 598  ILE A CB    1 
ATOM   4538  C  CG1   . ILE A 1 597  ? -53.327 -85.314  -1.958  1.00 23.36 ? 598  ILE A CG1   1 
ATOM   4539  C  CG2   . ILE A 1 597  ? -52.182 -86.456  -0.077  1.00 23.38 ? 598  ILE A CG2   1 
ATOM   4540  C  CD1   . ILE A 1 597  ? -52.363 -84.077  -1.986  1.00 23.67 ? 598  ILE A CD1   1 
ATOM   4541  N  N     . VAL A 1 598  ? -56.210 -87.065  1.015   1.00 21.61 ? 599  VAL A N     1 
ATOM   4542  C  CA    . VAL A 1 598  ? -56.849 -87.523  2.247   1.00 21.33 ? 599  VAL A CA    1 
ATOM   4543  C  C     . VAL A 1 598  ? -57.084 -89.026  2.100   1.00 21.50 ? 599  VAL A C     1 
ATOM   4544  O  O     . VAL A 1 598  ? -56.739 -89.817  2.975   1.00 21.60 ? 599  VAL A O     1 
ATOM   4545  C  CB    . VAL A 1 598  ? -58.229 -86.835  2.480   1.00 21.15 ? 599  VAL A CB    1 
ATOM   4546  C  CG1   . VAL A 1 598  ? -58.938 -87.449  3.687   1.00 20.05 ? 599  VAL A CG1   1 
ATOM   4547  C  CG2   . VAL A 1 598  ? -58.037 -85.304  2.677   1.00 21.06 ? 599  VAL A CG2   1 
ATOM   4548  N  N     . LYS A 1 599  ? -57.555 -89.417  0.925   1.00 21.72 ? 600  LYS A N     1 
ATOM   4549  C  CA    . LYS A 1 599  ? -57.861 -90.829  0.636   1.00 21.76 ? 600  LYS A CA    1 
ATOM   4550  C  C     . LYS A 1 599  ? -56.636 -91.734  0.629   1.00 21.90 ? 600  LYS A C     1 
ATOM   4551  O  O     . LYS A 1 599  ? -56.744 -92.904  0.968   1.00 21.59 ? 600  LYS A O     1 
ATOM   4552  C  CB    . LYS A 1 599  ? -58.572 -90.958  -0.713  1.00 21.57 ? 600  LYS A CB    1 
ATOM   4553  C  CG    . LYS A 1 599  ? -59.892 -91.714  -0.673  1.00 21.40 ? 600  LYS A CG    1 
ATOM   4554  C  CD    . LYS A 1 599  ? -59.777 -93.224  -0.397  1.00 20.85 ? 600  LYS A CD    1 
ATOM   4555  C  CE    . LYS A 1 599  ? -61.203 -93.778  -0.123  1.00 21.75 ? 600  LYS A CE    1 
ATOM   4556  N  NZ    . LYS A 1 599  ? -61.415 -95.275  -0.074  1.00 22.77 ? 600  LYS A NZ    1 
ATOM   4557  N  N     . MET A 1 600  ? -55.498 -91.215  0.174   1.00 21.99 ? 601  MET A N     1 
ATOM   4558  C  CA    . MET A 1 600  ? -54.273 -92.016  0.171   1.00 22.19 ? 601  MET A CA    1 
ATOM   4559  C  C     . MET A 1 600  ? -53.891 -92.284  1.625   1.00 21.85 ? 601  MET A C     1 
ATOM   4560  O  O     . MET A 1 600  ? -53.346 -93.350  1.967   1.00 21.50 ? 601  MET A O     1 
ATOM   4561  C  CB    . MET A 1 600  ? -53.137 -91.266  -0.506  1.00 22.76 ? 601  MET A CB    1 
ATOM   4562  C  CG    . MET A 1 600  ? -53.454 -90.867  -1.893  1.00 24.40 ? 601  MET A CG    1 
ATOM   4563  S  SD    . MET A 1 600  ? -51.930 -90.616  -2.748  1.00 27.51 ? 601  MET A SD    1 
ATOM   4564  C  CE    . MET A 1 600  ? -52.541 -90.592  -4.424  1.00 26.88 ? 601  MET A CE    1 
ATOM   4565  N  N     . ASN A 1 601  ? -54.197 -91.303  2.475   1.00 21.58 ? 602  ASN A N     1 
ATOM   4566  C  CA    . ASN A 1 601  ? -53.886 -91.401  3.896   1.00 21.48 ? 602  ASN A CA    1 
ATOM   4567  C  C     . ASN A 1 601  ? -54.822 -92.388  4.574   1.00 21.41 ? 602  ASN A C     1 
ATOM   4568  O  O     . ASN A 1 601  ? -54.390 -93.205  5.387   1.00 21.58 ? 602  ASN A O     1 
ATOM   4569  C  CB    . ASN A 1 601  ? -53.909 -90.021  4.566   1.00 21.05 ? 602  ASN A CB    1 
ATOM   4570  C  CG    . ASN A 1 601  ? -52.670 -89.201  4.244   1.00 20.61 ? 602  ASN A CG    1 
ATOM   4571  O  OD1   . ASN A 1 601  ? -52.579 -88.616  3.165   1.00 20.69 ? 602  ASN A OD1   1 
ATOM   4572  N  ND2   . ASN A 1 601  ? -51.694 -89.195  5.157   1.00 19.93 ? 602  ASN A ND2   1 
ATOM   4573  N  N     . THR A 1 602  ? -56.084 -92.386  4.167   1.00 21.08 ? 603  THR A N     1 
ATOM   4574  C  CA    . THR A 1 602  ? -57.033 -93.332  4.754   1.00 21.32 ? 603  THR A CA    1 
ATOM   4575  C  C     . THR A 1 602  ? -56.727 -94.744  4.219   1.00 21.15 ? 603  THR A C     1 
ATOM   4576  O  O     . THR A 1 602  ? -57.111 -95.756  4.814   1.00 20.96 ? 603  THR A O     1 
ATOM   4577  C  CB    . THR A 1 602  ? -58.508 -92.958  4.424   1.00 21.64 ? 603  THR A CB    1 
ATOM   4578  O  OG1   . THR A 1 602  ? -58.719 -91.556  4.691   1.00 23.28 ? 603  THR A OG1   1 
ATOM   4579  C  CG2   . THR A 1 602  ? -59.458 -93.754  5.275   1.00 20.49 ? 603  THR A CG2   1 
ATOM   4580  N  N     . ASP A 1 603  ? -56.036 -94.790  3.082   1.00 20.91 ? 604  ASP A N     1 
ATOM   4581  C  CA    . ASP A 1 603  ? -55.660 -96.046  2.453   1.00 20.23 ? 604  ASP A CA    1 
ATOM   4582  C  C     . ASP A 1 603  ? -54.491 -96.625  3.234   1.00 19.21 ? 604  ASP A C     1 
ATOM   4583  O  O     . ASP A 1 603  ? -54.546 -97.761  3.683   1.00 19.26 ? 604  ASP A O     1 
ATOM   4584  C  CB    . ASP A 1 603  ? -55.278 -95.830  0.968   1.00 21.27 ? 604  ASP A CB    1 
ATOM   4585  C  CG    . ASP A 1 603  ? -56.513 -95.685  0.030   1.00 22.05 ? 604  ASP A CG    1 
ATOM   4586  O  OD1   . ASP A 1 603  ? -57.643 -96.108  0.421   1.00 21.61 ? 604  ASP A OD1   1 
ATOM   4587  O  OD2   . ASP A 1 603  ? -56.339 -95.145  -1.109  1.00 22.09 ? 604  ASP A OD2   1 
ATOM   4588  N  N     . ALA A 1 604  ? -53.475 -95.807  3.472   1.00 18.24 ? 605  ALA A N     1 
ATOM   4589  C  CA    . ALA A 1 604  ? -52.301 -96.248  4.216   1.00 17.07 ? 605  ALA A CA    1 
ATOM   4590  C  C     . ALA A 1 604  ? -52.723 -96.797  5.593   1.00 16.20 ? 605  ALA A C     1 
ATOM   4591  O  O     . ALA A 1 604  ? -52.317 -97.872  5.992   1.00 15.67 ? 605  ALA A O     1 
ATOM   4592  C  CB    . ALA A 1 604  ? -51.313 -95.078  4.372   1.00 17.04 ? 605  ALA A CB    1 
ATOM   4593  N  N     . VAL A 1 605  ? -53.608 -96.091  6.282   1.00 15.65 ? 606  VAL A N     1 
ATOM   4594  C  CA    . VAL A 1 605  ? -54.045 -96.518  7.596   1.00 14.72 ? 606  VAL A CA    1 
ATOM   4595  C  C     . VAL A 1 605  ? -54.621 -97.913  7.520   1.00 15.08 ? 606  VAL A C     1 
ATOM   4596  O  O     . VAL A 1 605  ? -54.199 -98.807  8.241   1.00 15.73 ? 606  VAL A O     1 
ATOM   4597  C  CB    . VAL A 1 605  ? -55.098 -95.567  8.177   1.00 14.20 ? 606  VAL A CB    1 
ATOM   4598  C  CG1   . VAL A 1 605  ? -55.684 -96.147  9.478   1.00 13.38 ? 606  VAL A CG1   1 
ATOM   4599  C  CG2   . VAL A 1 605  ? -54.506 -94.187  8.398   1.00 13.67 ? 606  VAL A CG2   1 
ATOM   4600  N  N     . ASP A 1 606  ? -55.545 -98.144  6.607   1.00 15.33 ? 607  ASP A N     1 
ATOM   4601  C  CA    . ASP A 1 606  ? -56.141 -99.478  6.520   1.00 15.33 ? 607  ASP A CA    1 
ATOM   4602  C  C     . ASP A 1 606  ? -55.262 -100.555 5.940   1.00 14.46 ? 607  ASP A C     1 
ATOM   4603  O  O     . ASP A 1 606  ? -55.456 -101.719 6.218   1.00 13.41 ? 607  ASP A O     1 
ATOM   4604  C  CB    . ASP A 1 606  ? -57.440 -99.411  5.753   1.00 17.05 ? 607  ASP A CB    1 
ATOM   4605  C  CG    . ASP A 1 606  ? -58.500 -98.668  6.513   1.00 18.99 ? 607  ASP A CG    1 
ATOM   4606  O  OD1   . ASP A 1 606  ? -59.089 -99.318  7.417   1.00 19.01 ? 607  ASP A OD1   1 
ATOM   4607  O  OD2   . ASP A 1 606  ? -58.705 -97.440  6.240   1.00 20.32 ? 607  ASP A OD2   1 
ATOM   4608  N  N     . GLN A 1 607  ? -54.322 -100.168 5.085   1.00 14.54 ? 608  GLN A N     1 
ATOM   4609  C  CA    . GLN A 1 607  ? -53.439 -101.155 4.506   1.00 14.42 ? 608  GLN A CA    1 
ATOM   4610  C  C     . GLN A 1 607  ? -52.496 -101.584 5.617   1.00 13.74 ? 608  GLN A C     1 
ATOM   4611  O  O     . GLN A 1 607  ? -52.173 -102.760 5.720   1.00 14.08 ? 608  GLN A O     1 
ATOM   4612  C  CB    . GLN A 1 607  ? -52.681 -100.612 3.271   1.00 16.45 ? 608  GLN A CB    1 
ATOM   4613  C  CG    . GLN A 1 607  ? -51.912 -101.723 2.481   1.00 19.07 ? 608  GLN A CG    1 
ATOM   4614  C  CD    . GLN A 1 607  ? -51.459 -101.349 1.026   1.00 20.65 ? 608  GLN A CD    1 
ATOM   4615  O  OE1   . GLN A 1 607  ? -52.191 -100.668 0.275   1.00 21.03 ? 608  GLN A OE1   1 
ATOM   4616  N  NE2   . GLN A 1 607  ? -50.262 -101.863 0.618   1.00 20.44 ? 608  GLN A NE2   1 
ATOM   4617  N  N     . ALA A 1 608  ? -52.192 -100.662 6.541   1.00 12.95 ? 609  ALA A N     1 
ATOM   4618  C  CA    . ALA A 1 608  ? -51.283 -100.917 7.675   1.00 11.36 ? 609  ALA A CA    1 
ATOM   4619  C  C     . ALA A 1 608  ? -51.871 -101.803 8.723   1.00 10.92 ? 609  ALA A C     1 
ATOM   4620  O  O     . ALA A 1 608  ? -51.216 -102.709 9.185   1.00 10.60 ? 609  ALA A O     1 
ATOM   4621  C  CB    . ALA A 1 608  ? -50.845 -99.654  8.316   1.00 10.36 ? 609  ALA A CB    1 
ATOM   4622  N  N     . VAL A 1 609  ? -53.091 -101.525 9.147   1.00 10.85 ? 610  VAL A N     1 
ATOM   4623  C  CA    . VAL A 1 609  ? -53.720 -102.331 10.182  1.00 11.17 ? 610  VAL A CA    1 
ATOM   4624  C  C     . VAL A 1 609  ? -53.821 -103.812 9.839   1.00 12.17 ? 610  VAL A C     1 
ATOM   4625  O  O     . VAL A 1 609  ? -53.661 -104.684 10.720  1.00 12.65 ? 610  VAL A O     1 
ATOM   4626  C  CB    . VAL A 1 609  ? -55.108 -101.807 10.522  1.00 10.56 ? 610  VAL A CB    1 
ATOM   4627  C  CG1   . VAL A 1 609  ? -55.872 -102.819 11.390  1.00 9.70  ? 610  VAL A CG1   1 
ATOM   4628  C  CG2   . VAL A 1 609  ? -54.981 -100.477 11.226  1.00 10.17 ? 610  VAL A CG2   1 
ATOM   4629  N  N     . THR A 1 610  ? -54.059 -104.096 8.561   1.00 13.01 ? 611  THR A N     1 
ATOM   4630  C  CA    . THR A 1 610  ? -54.174 -105.473 8.070   1.00 13.65 ? 611  THR A CA    1 
ATOM   4631  C  C     . THR A 1 610  ? -52.813 -106.179 8.036   1.00 13.66 ? 611  THR A C     1 
ATOM   4632  O  O     . THR A 1 610  ? -52.730 -107.411 8.133   1.00 14.76 ? 611  THR A O     1 
ATOM   4633  C  CB    . THR A 1 610  ? -54.784 -105.562 6.609   1.00 14.24 ? 611  THR A CB    1 
ATOM   4634  O  OG1   . THR A 1 610  ? -55.782 -104.539 6.380   1.00 14.05 ? 611  THR A OG1   1 
ATOM   4635  C  CG2   . THR A 1 610  ? -55.387 -106.954 6.394   1.00 14.22 ? 611  THR A CG2   1 
ATOM   4636  N  N     . SER A 1 611  ? -51.756 -105.414 7.819   1.00 13.18 ? 612  SER A N     1 
ATOM   4637  C  CA    . SER A 1 611  ? -50.411 -105.976 7.747   1.00 12.63 ? 612  SER A CA    1 
ATOM   4638  C  C     . SER A 1 611  ? -49.708 -106.025 9.100   1.00 12.18 ? 612  SER A C     1 
ATOM   4639  O  O     . SER A 1 611  ? -48.611 -106.580 9.236   1.00 12.86 ? 612  SER A O     1 
ATOM   4640  C  CB    . SER A 1 611  ? -49.588 -105.160 6.757   1.00 12.75 ? 612  SER A CB    1 
ATOM   4641  O  OG    . SER A 1 611  ? -50.245 -105.097 5.510   1.00 13.07 ? 612  SER A OG    1 
ATOM   4642  N  N     . LEU A 1 612  ? -50.341 -105.419 10.094  1.00 11.49 ? 613  LEU A N     1 
ATOM   4643  C  CA    . LEU A 1 612  ? -49.804 -105.369 11.440  1.00 10.42 ? 613  LEU A CA    1 
ATOM   4644  C  C     . LEU A 1 612  ? -50.125 -106.639 12.262  1.00 10.16 ? 613  LEU A C     1 
ATOM   4645  O  O     . LEU A 1 612  ? -51.065 -106.660 13.088  1.00 10.45 ? 613  LEU A O     1 
ATOM   4646  C  CB    . LEU A 1 612  ? -50.294 -104.107 12.133  1.00 9.43  ? 613  LEU A CB    1 
ATOM   4647  C  CG    . LEU A 1 612  ? -49.288 -103.001 12.516  1.00 9.66  ? 613  LEU A CG    1 
ATOM   4648  C  CD1   . LEU A 1 612  ? -47.809 -103.332 12.153  1.00 8.99  ? 613  LEU A CD1   1 
ATOM   4649  C  CD2   . LEU A 1 612  ? -49.749 -101.691 11.909  1.00 8.21  ? 613  LEU A CD2   1 
ATOM   4650  N  N     . GLN A 1 613  ? -49.387 -107.712 11.961  1.00 8.87  ? 614  GLN A N     1 
ATOM   4651  C  CA    . GLN A 1 613  ? -49.510 -108.977 12.659  1.00 8.20  ? 614  GLN A CA    1 
ATOM   4652  C  C     . GLN A 1 613  ? -48.120 -109.383 13.150  1.00 7.68  ? 614  GLN A C     1 
ATOM   4653  O  O     . GLN A 1 613  ? -47.092 -109.034 12.563  1.00 6.19  ? 614  GLN A O     1 
ATOM   4654  C  CB    . GLN A 1 613  ? -50.057 -110.064 11.745  1.00 8.78  ? 614  GLN A CB    1 
ATOM   4655  C  CG    . GLN A 1 613  ? -51.280 -109.655 10.911  1.00 9.85  ? 614  GLN A CG    1 
ATOM   4656  C  CD    . GLN A 1 613  ? -52.459 -109.193 11.733  1.00 9.99  ? 614  GLN A CD    1 
ATOM   4657  O  OE1   . GLN A 1 613  ? -52.718 -109.700 12.803  1.00 10.63 ? 614  GLN A OE1   1 
ATOM   4658  N  NE2   . GLN A 1 613  ? -53.186 -108.214 11.216  1.00 12.15 ? 614  GLN A NE2   1 
ATOM   4659  N  N     . GLU A 1 614  ? -48.087 -110.123 14.242  1.00 7.46  ? 615  GLU A N     1 
ATOM   4660  C  CA    . GLU A 1 614  ? -46.831 -110.534 14.781  1.00 8.31  ? 615  GLU A CA    1 
ATOM   4661  C  C     . GLU A 1 614  ? -45.897 -111.323 13.878  1.00 8.00  ? 615  GLU A C     1 
ATOM   4662  O  O     . GLU A 1 614  ? -46.325 -112.058 13.012  1.00 7.83  ? 615  GLU A O     1 
ATOM   4663  C  CB    . GLU A 1 614  ? -47.060 -111.328 16.017  1.00 9.49  ? 615  GLU A CB    1 
ATOM   4664  C  CG    . GLU A 1 614  ? -47.379 -110.502 17.209  1.00 12.31 ? 615  GLU A CG    1 
ATOM   4665  C  CD    . GLU A 1 614  ? -47.522 -111.400 18.416  1.00 13.77 ? 615  GLU A CD    1 
ATOM   4666  O  OE1   . GLU A 1 614  ? -46.557 -112.145 18.697  1.00 15.14 ? 615  GLU A OE1   1 
ATOM   4667  O  OE2   . GLU A 1 614  ? -48.602 -111.405 19.044  1.00 14.66 ? 615  GLU A OE2   1 
ATOM   4668  N  N     . PHE A 1 615  ? -44.607 -111.062 14.038  1.00 7.95  ? 616  PHE A N     1 
ATOM   4669  C  CA    . PHE A 1 615  ? -43.572 -111.762 13.321  1.00 7.88  ? 616  PHE A CA    1 
ATOM   4670  C  C     . PHE A 1 615  ? -43.226 -112.860 14.353  1.00 8.90  ? 616  PHE A C     1 
ATOM   4671  O  O     . PHE A 1 615  ? -42.636 -112.593 15.412  1.00 9.02  ? 616  PHE A O     1 
ATOM   4672  C  CB    . PHE A 1 615  ? -42.386 -110.820 13.002  1.00 5.70  ? 616  PHE A CB    1 
ATOM   4673  C  CG    . PHE A 1 615  ? -41.293 -111.463 12.175  1.00 3.57  ? 616  PHE A CG    1 
ATOM   4674  C  CD1   . PHE A 1 615  ? -40.424 -112.400 12.739  1.00 3.38  ? 616  PHE A CD1   1 
ATOM   4675  C  CD2   . PHE A 1 615  ? -41.143 -111.144 10.852  1.00 2.82  ? 616  PHE A CD2   1 
ATOM   4676  C  CE1   . PHE A 1 615  ? -39.429 -113.016 12.013  1.00 2.92  ? 616  PHE A CE1   1 
ATOM   4677  C  CE2   . PHE A 1 615  ? -40.147 -111.745 10.095  1.00 3.68  ? 616  PHE A CE2   1 
ATOM   4678  C  CZ    . PHE A 1 615  ? -39.281 -112.696 10.687  1.00 3.60  ? 616  PHE A CZ    1 
ATOM   4679  N  N     . LYS A 1 616  ? -43.715 -114.072 14.078  1.00 10.36 ? 617  LYS A N     1 
ATOM   4680  C  CA    . LYS A 1 616  ? -43.527 -115.243 14.954  1.00 11.04 ? 617  LYS A CA    1 
ATOM   4681  C  C     . LYS A 1 616  ? -42.186 -115.971 14.775  1.00 11.46 ? 617  LYS A C     1 
ATOM   4682  O  O     . LYS A 1 616  ? -42.111 -117.047 14.150  1.00 12.40 ? 617  LYS A O     1 
ATOM   4683  C  CB    . LYS A 1 616  ? -44.689 -116.226 14.770  1.00 11.60 ? 617  LYS A CB    1 
ATOM   4684  C  CG    . LYS A 1 616  ? -45.994 -115.865 15.472  0.01 12.55 ? 617  LYS A CG    1 
ATOM   4685  C  CD    . LYS A 1 616  ? -46.943 -115.090 14.573  0.01 13.28 ? 617  LYS A CD    1 
ATOM   4686  C  CE    . LYS A 1 616  ? -48.324 -114.983 15.207  0.01 13.78 ? 617  LYS A CE    1 
ATOM   4687  N  NZ    . LYS A 1 616  ? -49.264 -114.163 14.394  0.01 14.14 ? 617  LYS A NZ    1 
ATOM   4688  N  N     . TYR A 1 617  ? -41.143 -115.369 15.354  1.00 11.21 ? 618  TYR A N     1 
ATOM   4689  C  CA    . TYR A 1 617  ? -39.754 -115.850 15.340  1.00 10.29 ? 618  TYR A CA    1 
ATOM   4690  C  C     . TYR A 1 617  ? -39.530 -117.202 15.999  1.00 11.00 ? 618  TYR A C     1 
ATOM   4691  O  O     . TYR A 1 617  ? -40.140 -117.539 17.021  1.00 11.39 ? 618  TYR A O     1 
ATOM   4692  C  CB    . TYR A 1 617  ? -38.864 -114.816 16.039  1.00 8.21  ? 618  TYR A CB    1 
ATOM   4693  C  CG    . TYR A 1 617  ? -39.355 -114.412 17.408  1.00 6.07  ? 618  TYR A CG    1 
ATOM   4694  C  CD1   . TYR A 1 617  ? -39.020 -115.153 18.548  1.00 5.50  ? 618  TYR A CD1   1 
ATOM   4695  C  CD2   . TYR A 1 617  ? -40.262 -113.361 17.548  1.00 5.31  ? 618  TYR A CD2   1 
ATOM   4696  C  CE1   . TYR A 1 617  ? -39.591 -114.869 19.805  1.00 4.36  ? 618  TYR A CE1   1 
ATOM   4697  C  CE2   . TYR A 1 617  ? -40.845 -113.065 18.785  1.00 4.47  ? 618  TYR A CE2   1 
ATOM   4698  C  CZ    . TYR A 1 617  ? -40.514 -113.829 19.906  1.00 4.76  ? 618  TYR A CZ    1 
ATOM   4699  O  OH    . TYR A 1 617  ? -41.185 -113.601 21.098  1.00 3.41  ? 618  TYR A OH    1 
ATOM   4700  N  N     . PRO A 1 618  ? -38.554 -117.947 15.505  1.00 11.53 ? 619  PRO A N     1 
ATOM   4701  C  CA    . PRO A 1 618  ? -38.345 -119.247 16.148  1.00 12.12 ? 619  PRO A CA    1 
ATOM   4702  C  C     . PRO A 1 618  ? -37.636 -119.114 17.504  1.00 12.55 ? 619  PRO A C     1 
ATOM   4703  O  O     . PRO A 1 618  ? -37.096 -118.045 17.858  1.00 12.32 ? 619  PRO A O     1 
ATOM   4704  C  CB    . PRO A 1 618  ? -37.545 -120.032 15.102  1.00 12.03 ? 619  PRO A CB    1 
ATOM   4705  C  CG    . PRO A 1 618  ? -36.669 -118.936 14.466  1.00 12.08 ? 619  PRO A CG    1 
ATOM   4706  C  CD    . PRO A 1 618  ? -37.570 -117.683 14.439  1.00 12.02 ? 619  PRO A CD    1 
ATOM   4707  N  N     . ASP A 1 619  ? -37.744 -120.204 18.263  1.00 13.24 ? 620  ASP A N     1 
ATOM   4708  C  CA    . ASP A 1 619  ? -37.242 -120.383 19.631  1.00 13.77 ? 620  ASP A CA    1 
ATOM   4709  C  C     . ASP A 1 619  ? -35.734 -120.357 19.622  1.00 13.04 ? 620  ASP A C     1 
ATOM   4710  O  O     . ASP A 1 619  ? -35.101 -119.944 20.584  1.00 12.44 ? 620  ASP A O     1 
ATOM   4711  C  CB    . ASP A 1 619  ? -37.762 -121.735 20.150  1.00 15.60 ? 620  ASP A CB    1 
ATOM   4712  C  CG    . ASP A 1 619  ? -37.336 -122.040 21.582  1.00 17.64 ? 620  ASP A CG    1 
ATOM   4713  O  OD1   . ASP A 1 619  ? -37.915 -121.422 22.502  1.00 18.48 ? 620  ASP A OD1   1 
ATOM   4714  O  OD2   . ASP A 1 619  ? -36.457 -122.928 21.790  1.00 18.81 ? 620  ASP A OD2   1 
ATOM   4715  N  N     . SER A 1 620  ? -35.194 -120.801 18.494  1.00 12.40 ? 621  SER A N     1 
ATOM   4716  C  CA    . SER A 1 620  ? -33.771 -120.859 18.252  1.00 11.88 ? 621  SER A CA    1 
ATOM   4717  C  C     . SER A 1 620  ? -33.080 -119.483 18.303  1.00 11.69 ? 621  SER A C     1 
ATOM   4718  O  O     . SER A 1 620  ? -31.855 -119.390 18.381  1.00 11.59 ? 621  SER A O     1 
ATOM   4719  C  CB    . SER A 1 620  ? -33.545 -121.521 16.893  1.00 12.22 ? 621  SER A CB    1 
ATOM   4720  O  OG    . SER A 1 620  ? -34.389 -120.973 15.873  1.00 12.45 ? 621  SER A OG    1 
ATOM   4721  N  N     . TRP A 1 621  ? -33.866 -118.415 18.228  1.00 11.28 ? 622  TRP A N     1 
ATOM   4722  C  CA    . TRP A 1 621  ? -33.317 -117.073 18.297  1.00 11.31 ? 622  TRP A CA    1 
ATOM   4723  C  C     . TRP A 1 621  ? -32.683 -116.931 19.692  1.00 12.45 ? 622  TRP A C     1 
ATOM   4724  O  O     . TRP A 1 621  ? -31.810 -116.078 19.920  1.00 12.28 ? 622  TRP A O     1 
ATOM   4725  C  CB    . TRP A 1 621  ? -34.426 -116.007 18.049  1.00 10.06 ? 622  TRP A CB    1 
ATOM   4726  C  CG    . TRP A 1 621  ? -34.642 -115.654 16.555  1.00 8.67  ? 622  TRP A CG    1 
ATOM   4727  C  CD1   . TRP A 1 621  ? -34.204 -116.378 15.481  1.00 8.59  ? 622  TRP A CD1   1 
ATOM   4728  C  CD2   . TRP A 1 621  ? -35.302 -114.480 15.996  1.00 8.06  ? 622  TRP A CD2   1 
ATOM   4729  N  NE1   . TRP A 1 621  ? -34.542 -115.729 14.303  1.00 7.92  ? 622  TRP A NE1   1 
ATOM   4730  C  CE2   . TRP A 1 621  ? -35.208 -114.569 14.591  1.00 7.43  ? 622  TRP A CE2   1 
ATOM   4731  C  CE3   . TRP A 1 621  ? -35.945 -113.358 16.547  1.00 7.61  ? 622  TRP A CE3   1 
ATOM   4732  C  CZ2   . TRP A 1 621  ? -35.730 -113.583 13.735  1.00 7.00  ? 622  TRP A CZ2   1 
ATOM   4733  C  CZ3   . TRP A 1 621  ? -36.465 -112.370 15.676  1.00 6.21  ? 622  TRP A CZ3   1 
ATOM   4734  C  CH2   . TRP A 1 621  ? -36.349 -112.501 14.301  1.00 6.34  ? 622  TRP A CH2   1 
ATOM   4735  N  N     . LYS A 1 622  ? -33.114 -117.788 20.623  1.00 14.18 ? 623  LYS A N     1 
ATOM   4736  C  CA    . LYS A 1 622  ? -32.593 -117.781 22.006  1.00 15.71 ? 623  LYS A CA    1 
ATOM   4737  C  C     . LYS A 1 622  ? -31.101 -118.035 22.024  1.00 16.11 ? 623  LYS A C     1 
ATOM   4738  O  O     . LYS A 1 622  ? -30.355 -117.485 22.837  1.00 16.60 ? 623  LYS A O     1 
ATOM   4739  C  CB    . LYS A 1 622  ? -33.265 -118.866 22.853  1.00 16.33 ? 623  LYS A CB    1 
ATOM   4740  C  CG    . LYS A 1 622  ? -34.568 -118.419 23.482  1.00 18.42 ? 623  LYS A CG    1 
ATOM   4741  C  CD    . LYS A 1 622  ? -35.453 -119.602 23.923  1.00 19.24 ? 623  LYS A CD    1 
ATOM   4742  C  CE    . LYS A 1 622  ? -36.878 -119.095 24.286  1.00 20.01 ? 623  LYS A CE    1 
ATOM   4743  N  NZ    . LYS A 1 622  ? -36.941 -118.184 25.464  1.00 20.74 ? 623  LYS A NZ    1 
ATOM   4744  N  N     . ASP A 1 623  ? -30.670 -118.832 21.067  1.00 16.95 ? 624  ASP A N     1 
ATOM   4745  C  CA    . ASP A 1 623  ? -29.276 -119.209 20.969  1.00 17.99 ? 624  ASP A CA    1 
ATOM   4746  C  C     . ASP A 1 623  ? -28.689 -118.839 19.607  1.00 17.87 ? 624  ASP A C     1 
ATOM   4747  O  O     . ASP A 1 623  ? -27.955 -119.626 18.996  1.00 17.92 ? 624  ASP A O     1 
ATOM   4748  C  CB    . ASP A 1 623  ? -29.124 -120.727 21.268  1.00 19.79 ? 624  ASP A CB    1 
ATOM   4749  C  CG    . ASP A 1 623  ? -30.485 -121.433 21.554  1.00 21.43 ? 624  ASP A CG    1 
ATOM   4750  O  OD1   . ASP A 1 623  ? -30.969 -121.377 22.708  1.00 22.69 ? 624  ASP A OD1   1 
ATOM   4751  O  OD2   . ASP A 1 623  ? -31.074 -122.055 20.631  1.00 22.82 ? 624  ASP A OD2   1 
ATOM   4752  N  N     . ALA A 1 624  ? -29.069 -117.656 19.119  1.00 17.50 ? 625  ALA A N     1 
ATOM   4753  C  CA    . ALA A 1 624  ? -28.568 -117.128 17.858  1.00 16.91 ? 625  ALA A CA    1 
ATOM   4754  C  C     . ALA A 1 624  ? -27.078 -116.796 18.176  1.00 16.81 ? 625  ALA A C     1 
ATOM   4755  O  O     . ALA A 1 624  ? -26.761 -116.401 19.298  1.00 16.45 ? 625  ALA A O     1 
ATOM   4756  C  CB    . ALA A 1 624  ? -29.386 -115.856 17.473  1.00 16.55 ? 625  ALA A CB    1 
ATOM   4757  N  N     . PRO A 1 625  ? -26.157 -116.957 17.211  1.00 17.02 ? 626  PRO A N     1 
ATOM   4758  C  CA    . PRO A 1 625  ? -24.732 -116.681 17.465  1.00 17.96 ? 626  PRO A CA    1 
ATOM   4759  C  C     . PRO A 1 625  ? -24.051 -115.471 16.787  1.00 19.25 ? 626  PRO A C     1 
ATOM   4760  O  O     . PRO A 1 625  ? -24.259 -115.216 15.595  1.00 19.27 ? 626  PRO A O     1 
ATOM   4761  C  CB    . PRO A 1 625  ? -24.080 -117.966 16.985  1.00 17.37 ? 626  PRO A CB    1 
ATOM   4762  C  CG    . PRO A 1 625  ? -24.924 -118.261 15.667  1.00 17.20 ? 626  PRO A CG    1 
ATOM   4763  C  CD    . PRO A 1 625  ? -26.325 -117.621 15.906  1.00 16.68 ? 626  PRO A CD    1 
ATOM   4764  N  N     . ALA A 1 626  ? -23.075 -114.896 17.504  1.00 20.79 ? 627  ALA A N     1 
ATOM   4765  C  CA    . ALA A 1 626  ? -22.295 -113.713 17.091  1.00 22.63 ? 627  ALA A CA    1 
ATOM   4766  C  C     . ALA A 1 626  ? -21.527 -113.689 15.720  1.00 23.84 ? 627  ALA A C     1 
ATOM   4767  O  O     . ALA A 1 626  ? -20.988 -114.717 15.272  1.00 24.22 ? 627  ALA A O     1 
ATOM   4768  C  CB    . ALA A 1 626  ? -21.356 -113.319 18.238  1.00 22.41 ? 627  ALA A CB    1 
ATOM   4769  N  N     . GLU A 1 627  ? -21.483 -112.483 15.114  1.00 24.92 ? 628  GLU A N     1 
ATOM   4770  C  CA    . GLU A 1 627  ? -20.856 -112.145 13.810  1.00 25.78 ? 628  GLU A CA    1 
ATOM   4771  C  C     . GLU A 1 627  ? -19.345 -111.870 13.857  0.01 25.91 ? 628  GLU A C     1 
ATOM   4772  O  O     . GLU A 1 627  ? -18.849 -111.286 14.818  0.01 25.91 ? 628  GLU A O     1 
ATOM   4773  C  CB    . GLU A 1 627  ? -21.563 -110.894 13.234  0.01 25.90 ? 628  GLU A CB    1 
ATOM   4774  C  CG    . GLU A 1 627  ? -20.852 -110.155 12.081  0.01 26.38 ? 628  GLU A CG    1 
ATOM   4775  C  CD    . GLU A 1 627  ? -20.950 -108.634 12.200  0.01 26.62 ? 628  GLU A CD    1 
ATOM   4776  O  OE1   . GLU A 1 627  ? -22.058 -108.080 12.026  0.01 26.79 ? 628  GLU A OE1   1 
ATOM   4777  O  OE2   . GLU A 1 627  ? -19.911 -107.991 12.470  0.01 26.80 ? 628  GLU A OE2   1 
ATOM   4778  N  N     . THR A 1 628  ? -18.628 -112.259 12.802  0.01 26.24 ? 629  THR A N     1 
ATOM   4779  C  CA    . THR A 1 628  ? -17.183 -112.027 12.719  0.01 26.58 ? 629  THR A CA    1 
ATOM   4780  C  C     . THR A 1 628  ? -16.942 -110.630 12.128  0.01 26.74 ? 629  THR A C     1 
ATOM   4781  O  O     . THR A 1 628  ? -17.565 -110.256 11.132  0.01 26.79 ? 629  THR A O     1 
ATOM   4782  C  CB    . THR A 1 628  ? -16.484 -113.092 11.843  0.01 26.65 ? 629  THR A CB    1 
ATOM   4783  O  OG1   . THR A 1 628  ? -16.896 -114.400 12.260  0.01 26.73 ? 629  THR A OG1   1 
ATOM   4784  C  CG2   . THR A 1 628  ? -14.970 -112.988 11.982  0.01 26.74 ? 629  THR A CG2   1 
ATOM   4785  N  N     . LYS A 1 629  ? -16.024 -109.878 12.730  0.01 26.92 ? 630  LYS A N     1 
ATOM   4786  C  CA    . LYS A 1 629  ? -15.723 -108.512 12.300  0.01 27.05 ? 630  LYS A CA    1 
ATOM   4787  C  C     . LYS A 1 629  ? -15.237 -108.259 10.874  0.01 26.98 ? 630  LYS A C     1 
ATOM   4788  O  O     . LYS A 1 629  ? -14.309 -108.904 10.383  0.01 27.01 ? 630  LYS A O     1 
ATOM   4789  C  CB    . LYS A 1 629  ? -14.774 -107.841 13.294  0.01 27.29 ? 630  LYS A CB    1 
ATOM   4790  C  CG    . LYS A 1 629  ? -15.458 -107.404 14.574  0.01 27.58 ? 630  LYS A CG    1 
ATOM   4791  C  CD    . LYS A 1 629  ? -14.470 -106.841 15.575  0.01 27.80 ? 630  LYS A CD    1 
ATOM   4792  C  CE    . LYS A 1 629  ? -15.193 -106.350 16.817  0.01 27.94 ? 630  LYS A CE    1 
ATOM   4793  N  NZ    . LYS A 1 629  ? -14.252 -105.989 17.910  0.01 28.03 ? 630  LYS A NZ    1 
ATOM   4794  N  N     . ALA A 1 630  ? -15.879 -107.281 10.238  0.01 26.85 ? 631  ALA A N     1 
ATOM   4795  C  CA    . ALA A 1 630  ? -15.564 -106.854 8.879   0.01 26.71 ? 631  ALA A CA    1 
ATOM   4796  C  C     . ALA A 1 630  ? -15.690 -105.332 8.866   0.01 26.62 ? 631  ALA A C     1 
ATOM   4797  O  O     . ALA A 1 630  ? -16.497 -104.759 8.129   0.01 26.57 ? 631  ALA A O     1 
ATOM   4798  C  CB    . ALA A 1 630  ? -16.536 -107.484 7.889   0.01 26.70 ? 631  ALA A CB    1 
ATOM   4799  N  N     . GLU A 1 631  ? -14.891 -104.693 9.715   0.01 26.59 ? 632  GLU A N     1 
ATOM   4800  C  CA    . GLU A 1 631  ? -14.887 -103.244 9.854   0.01 26.61 ? 632  GLU A CA    1 
ATOM   4801  C  C     . GLU A 1 631  ? -13.492 -102.664 9.622   0.01 26.75 ? 632  GLU A C     1 
ATOM   4802  O  O     . GLU A 1 631  ? -12.485 -103.335 9.844   0.01 26.60 ? 632  GLU A O     1 
ATOM   4803  C  CB    . GLU A 1 631  ? -15.361 -102.856 11.257  0.01 26.53 ? 632  GLU A CB    1 
ATOM   4804  C  CG    . GLU A 1 631  ? -14.528 -103.479 12.373  0.01 26.54 ? 632  GLU A CG    1 
ATOM   4805  C  CD    . GLU A 1 631  ? -14.341 -102.553 13.557  0.01 26.57 ? 632  GLU A CD    1 
ATOM   4806  O  OE1   . GLU A 1 631  ? -13.751 -101.467 13.375  0.01 26.62 ? 632  GLU A OE1   1 
ATOM   4807  O  OE2   . GLU A 1 631  ? -14.769 -102.916 14.673  0.01 26.62 ? 632  GLU A OE2   1 
ATOM   4808  N  N     . PRO A 1 632  ? -13.423 -101.417 9.137   1.00 27.08 ? 633  PRO A N     1 
ATOM   4809  C  CA    . PRO A 1 632  ? -12.149 -100.716 8.867   1.00 27.23 ? 633  PRO A CA    1 
ATOM   4810  C  C     . PRO A 1 632  ? -11.349 -100.276 10.088  1.00 26.93 ? 633  PRO A C     1 
ATOM   4811  O  O     . PRO A 1 632  ? -11.869 -100.151 11.202  1.00 27.21 ? 633  PRO A O     1 
ATOM   4812  C  CB    . PRO A 1 632  ? -12.580 -99.474  8.065   1.00 27.52 ? 633  PRO A CB    1 
ATOM   4813  C  CG    . PRO A 1 632  ? -14.053 -99.244  8.530   1.00 27.28 ? 633  PRO A CG    1 
ATOM   4814  C  CD    . PRO A 1 632  ? -14.569 -100.680 8.553   1.00 27.22 ? 633  PRO A CD    1 
ATOM   4815  N  N     . MET A 1 633  ? -10.061 -100.070 9.854   1.00 26.74 ? 634  MET A N     1 
ATOM   4816  C  CA    . MET A 1 633  ? -9.150  -99.601  10.884  1.00 26.33 ? 634  MET A CA    1 
ATOM   4817  C  C     . MET A 1 633  ? -9.685  -98.214  11.223  1.00 24.33 ? 634  MET A C     1 
ATOM   4818  O  O     . MET A 1 633  ? -10.391 -97.571  10.412  1.00 24.36 ? 634  MET A O     1 
ATOM   4819  C  CB    . MET A 1 633  ? -7.707  -99.477  10.337  1.00 29.13 ? 634  MET A CB    1 
ATOM   4820  C  CG    . MET A 1 633  ? -6.596  -99.697  11.379  1.00 32.56 ? 634  MET A CG    1 
ATOM   4821  S  SD    . MET A 1 633  ? -7.003  -99.029  13.057  1.00 37.16 ? 634  MET A SD    1 
ATOM   4822  C  CE    . MET A 1 633  ? -5.324  -98.981  13.866  1.00 36.76 ? 634  MET A CE    1 
ATOM   4823  N  N     . THR A 1 634  ? -9.360  -97.757  12.422  1.00 21.78 ? 635  THR A N     1 
ATOM   4824  C  CA    . THR A 1 634  ? -9.816  -96.472  12.852  1.00 19.01 ? 635  THR A CA    1 
ATOM   4825  C  C     . THR A 1 634  ? -8.757  -95.853  13.756  1.00 17.78 ? 635  THR A C     1 
ATOM   4826  O  O     . THR A 1 634  ? -7.571  -96.132  13.614  1.00 17.56 ? 635  THR A O     1 
ATOM   4827  C  CB    . THR A 1 634  ? -11.208 -96.671  13.467  1.00 18.43 ? 635  THR A CB    1 
ATOM   4828  O  OG1   . THR A 1 634  ? -12.090 -95.704  12.923  1.00 18.52 ? 635  THR A OG1   1 
ATOM   4829  C  CG2   . THR A 1 634  ? -11.205 -96.641  14.954  1.00 17.98 ? 635  THR A CG2   1 
ATOM   4830  N  N     . ASN A 1 635  ? -9.159  -94.867  14.532  1.00 16.80 ? 636  ASN A N     1 
ATOM   4831  C  CA    . ASN A 1 635  ? -8.287  -94.169  15.479  1.00 15.29 ? 636  ASN A CA    1 
ATOM   4832  C  C     . ASN A 1 635  ? -8.367  -94.844  16.825  1.00 13.96 ? 636  ASN A C     1 
ATOM   4833  O  O     . ASN A 1 635  ? -9.426  -95.385  17.157  1.00 13.56 ? 636  ASN A O     1 
ATOM   4834  C  CB    . ASN A 1 635  ? -8.900  -92.795  15.745  1.00 15.49 ? 636  ASN A CB    1 
ATOM   4835  C  CG    . ASN A 1 635  ? -8.112  -91.736  15.199  1.00 15.92 ? 636  ASN A CG    1 
ATOM   4836  O  OD1   . ASN A 1 635  ? -6.995  -91.987  14.778  1.00 17.66 ? 636  ASN A OD1   1 
ATOM   4837  N  ND2   . ASN A 1 635  ? -8.671  -90.524  15.126  1.00 17.16 ? 636  ASN A ND2   1 
ATOM   4838  N  N     . GLU A 1 636  ? -7.331  -94.749  17.652  1.00 12.92 ? 637  GLU A N     1 
ATOM   4839  C  CA    . GLU A 1 636  ? -7.527  -95.295  18.983  1.00 12.32 ? 637  GLU A CA    1 
ATOM   4840  C  C     . GLU A 1 636  ? -8.705  -94.415  19.552  1.00 10.57 ? 637  GLU A C     1 
ATOM   4841  O  O     . GLU A 1 636  ? -9.768  -94.962  19.894  1.00 10.65 ? 637  GLU A O     1 
ATOM   4842  C  CB    . GLU A 1 636  ? -6.254  -95.223  19.866  1.00 14.62 ? 637  GLU A CB    1 
ATOM   4843  C  CG    . GLU A 1 636  ? -6.297  -96.184  21.153  1.00 17.99 ? 637  GLU A CG    1 
ATOM   4844  C  CD    . GLU A 1 636  ? -5.118  -96.026  22.206  1.00 20.23 ? 637  GLU A CD    1 
ATOM   4845  O  OE1   . GLU A 1 636  ? -4.238  -95.118  22.072  1.00 22.29 ? 637  GLU A OE1   1 
ATOM   4846  O  OE2   . GLU A 1 636  ? -5.073  -96.831  23.188  1.00 21.04 ? 637  GLU A OE2   1 
ATOM   4847  N  N     . PHE A 1 637  ? -8.598  -93.077  19.432  1.00 8.05  ? 638  PHE A N     1 
ATOM   4848  C  CA    . PHE A 1 637  ? -9.613  -92.118  19.921  1.00 5.97  ? 638  PHE A CA    1 
ATOM   4849  C  C     . PHE A 1 637  ? -11.023 -92.283  19.314  1.00 5.25  ? 638  PHE A C     1 
ATOM   4850  O  O     . PHE A 1 637  ? -12.006 -92.035  19.991  1.00 5.07  ? 638  PHE A O     1 
ATOM   4851  C  CB    . PHE A 1 637  ? -9.129  -90.680  19.716  1.00 4.49  ? 638  PHE A CB    1 
ATOM   4852  C  CG    . PHE A 1 637  ? -10.000 -89.615  20.376  1.00 3.37  ? 638  PHE A CG    1 
ATOM   4853  C  CD1   . PHE A 1 637  ? -9.807  -89.274  21.704  1.00 2.67  ? 638  PHE A CD1   1 
ATOM   4854  C  CD2   . PHE A 1 637  ? -10.975 -88.924  19.651  1.00 3.13  ? 638  PHE A CD2   1 
ATOM   4855  C  CE1   . PHE A 1 637  ? -10.567 -88.260  22.302  1.00 2.43  ? 638  PHE A CE1   1 
ATOM   4856  C  CE2   . PHE A 1 637  ? -11.739 -87.911  20.235  1.00 2.62  ? 638  PHE A CE2   1 
ATOM   4857  C  CZ    . PHE A 1 637  ? -11.532 -87.582  21.561  1.00 2.61  ? 638  PHE A CZ    1 
ATOM   4858  N  N     . PHE A 1 638  ? -11.116 -92.643  18.038  1.00 4.53  ? 639  PHE A N     1 
ATOM   4859  C  CA    . PHE A 1 638  ? -12.407 -92.848  17.401  1.00 3.93  ? 639  PHE A CA    1 
ATOM   4860  C  C     . PHE A 1 638  ? -13.024 -94.061  18.011  1.00 4.20  ? 639  PHE A C     1 
ATOM   4861  O  O     . PHE A 1 638  ? -14.196 -94.061  18.397  1.00 3.74  ? 639  PHE A O     1 
ATOM   4862  C  CB    . PHE A 1 638  ? -12.269 -93.092  15.890  1.00 4.00  ? 639  PHE A CB    1 
ATOM   4863  C  CG    . PHE A 1 638  ? -13.606 -93.165  15.173  1.00 3.64  ? 639  PHE A CG    1 
ATOM   4864  C  CD1   . PHE A 1 638  ? -14.309 -92.013  14.884  1.00 2.71  ? 639  PHE A CD1   1 
ATOM   4865  C  CD2   . PHE A 1 638  ? -14.226 -94.399  14.951  1.00 3.36  ? 639  PHE A CD2   1 
ATOM   4866  C  CE1   . PHE A 1 638  ? -15.620 -92.074  14.401  1.00 2.33  ? 639  PHE A CE1   1 
ATOM   4867  C  CE2   . PHE A 1 638  ? -15.528 -94.474  14.474  1.00 2.98  ? 639  PHE A CE2   1 
ATOM   4868  C  CZ    . PHE A 1 638  ? -16.229 -93.305  14.202  1.00 2.99  ? 639  PHE A CZ    1 
ATOM   4869  N  N     . LYS A 1 639  ? -12.195 -95.093  18.138  1.00 5.11  ? 640  LYS A N     1 
ATOM   4870  C  CA    . LYS A 1 639  ? -12.595 -96.364  18.703  1.00 5.80  ? 640  LYS A CA    1 
ATOM   4871  C  C     . LYS A 1 639  ? -13.035 -96.259  20.148  1.00 5.76  ? 640  LYS A C     1 
ATOM   4872  O  O     . LYS A 1 639  ? -14.006 -96.899  20.549  1.00 5.47  ? 640  LYS A O     1 
ATOM   4873  C  CB    . LYS A 1 639  ? -11.383 -97.250  18.717  1.00 8.18  ? 640  LYS A CB    1 
ATOM   4874  C  CG    . LYS A 1 639  ? -11.646 -98.722  18.841  1.00 10.47 ? 640  LYS A CG    1 
ATOM   4875  C  CD    . LYS A 1 639  ? -11.329 -99.345  17.473  1.00 13.05 ? 640  LYS A CD    1 
ATOM   4876  C  CE    . LYS A 1 639  ? -9.852  -99.060  17.015  1.00 14.45 ? 640  LYS A CE    1 
ATOM   4877  N  NZ    . LYS A 1 639  ? -9.489  -99.691  15.688  1.00 15.28 ? 640  LYS A NZ    1 
ATOM   4878  N  N     . ASN A 1 640  ? -12.276 -95.465  20.914  1.00 5.64  ? 641  ASN A N     1 
ATOM   4879  C  CA    . ASN A 1 640  ? -12.453 -95.314  22.353  1.00 5.39  ? 641  ASN A CA    1 
ATOM   4880  C  C     . ASN A 1 640  ? -13.425 -94.296  22.895  1.00 4.84  ? 641  ASN A C     1 
ATOM   4881  O  O     . ASN A 1 640  ? -14.084 -94.546  23.908  1.00 4.77  ? 641  ASN A O     1 
ATOM   4882  C  CB    . ASN A 1 640  ? -11.092 -95.105  23.024  1.00 6.28  ? 641  ASN A CB    1 
ATOM   4883  C  CG    . ASN A 1 640  ? -10.219 -96.391  23.049  1.00 7.86  ? 641  ASN A CG    1 
ATOM   4884  O  OD1   . ASN A 1 640  ? -10.728 -97.534  23.020  1.00 7.74  ? 641  ASN A OD1   1 
ATOM   4885  N  ND2   . ASN A 1 640  ? -8.881  -96.191  23.117  1.00 8.98  ? 641  ASN A ND2   1 
ATOM   4886  N  N     . VAL A 1 641  ? -13.458 -93.136  22.253  1.00 4.34  ? 642  VAL A N     1 
ATOM   4887  C  CA    . VAL A 1 641  ? -14.310 -92.038  22.659  1.00 3.68  ? 642  VAL A CA    1 
ATOM   4888  C  C     . VAL A 1 641  ? -15.385 -91.690  21.624  1.00 3.60  ? 642  VAL A C     1 
ATOM   4889  O  O     . VAL A 1 641  ? -16.568 -91.853  21.911  1.00 3.20  ? 642  VAL A O     1 
ATOM   4890  C  CB    . VAL A 1 641  ? -13.461 -90.795  22.964  1.00 3.88  ? 642  VAL A CB    1 
ATOM   4891  C  CG1   . VAL A 1 641  ? -14.354 -89.614  23.359  1.00 3.61  ? 642  VAL A CG1   1 
ATOM   4892  C  CG2   . VAL A 1 641  ? -12.460 -91.130  24.047  1.00 3.61  ? 642  VAL A CG2   1 
ATOM   4893  N  N     . VAL A 1 642  ? -15.002 -91.326  20.402  1.00 3.35  ? 643  VAL A N     1 
ATOM   4894  C  CA    . VAL A 1 642  ? -16.025 -90.919  19.461  1.00 3.75  ? 643  VAL A CA    1 
ATOM   4895  C  C     . VAL A 1 642  ? -17.058 -91.922  19.034  1.00 3.89  ? 643  VAL A C     1 
ATOM   4896  O  O     . VAL A 1 642  ? -18.239 -91.619  19.033  1.00 4.43  ? 643  VAL A O     1 
ATOM   4897  C  CB    . VAL A 1 642  ? -15.512 -89.977  18.328  1.00 3.56  ? 643  VAL A CB    1 
ATOM   4898  C  CG1   . VAL A 1 642  ? -14.028 -90.069  18.142  1.00 3.75  ? 643  VAL A CG1   1 
ATOM   4899  C  CG2   . VAL A 1 642  ? -16.214 -90.226  17.064  1.00 3.48  ? 643  VAL A CG2   1 
ATOM   4900  N  N     . LYS A 1 643  ? -16.658 -93.152  18.819  1.00 4.33  ? 644  LYS A N     1 
ATOM   4901  C  CA    . LYS A 1 643  ? -17.618 -94.146  18.417  1.00 4.79  ? 644  LYS A CA    1 
ATOM   4902  C  C     . LYS A 1 643  ? -18.645 -94.397  19.511  1.00 4.01  ? 644  LYS A C     1 
ATOM   4903  O  O     . LYS A 1 643  ? -19.849 -94.411  19.227  1.00 3.91  ? 644  LYS A O     1 
ATOM   4904  C  CB    . LYS A 1 643  ? -16.902 -95.439  18.036  1.00 6.74  ? 644  LYS A CB    1 
ATOM   4905  C  CG    . LYS A 1 643  ? -17.838 -96.596  17.766  1.00 9.14  ? 644  LYS A CG    1 
ATOM   4906  C  CD    . LYS A 1 643  ? -18.309 -96.643  16.325  1.00 11.80 ? 644  LYS A CD    1 
ATOM   4907  C  CE    . LYS A 1 643  ? -18.591 -98.110  15.952  1.00 13.20 ? 644  LYS A CE    1 
ATOM   4908  N  NZ    . LYS A 1 643  ? -19.141 -98.270  14.573  1.00 15.70 ? 644  LYS A NZ    1 
ATOM   4909  N  N     . PRO A 1 644  ? -18.198 -94.642  20.767  1.00 3.46  ? 645  PRO A N     1 
ATOM   4910  C  CA    . PRO A 1 644  ? -19.184 -94.879  21.831  1.00 3.16  ? 645  PRO A CA    1 
ATOM   4911  C  C     . PRO A 1 644  ? -20.219 -93.768  21.909  1.00 3.22  ? 645  PRO A C     1 
ATOM   4912  O  O     . PRO A 1 644  ? -21.383 -94.051  22.160  1.00 4.07  ? 645  PRO A O     1 
ATOM   4913  C  CB    . PRO A 1 644  ? -18.327 -94.936  23.087  1.00 3.07  ? 645  PRO A CB    1 
ATOM   4914  C  CG    . PRO A 1 644  ? -17.093 -95.564  22.601  1.00 3.17  ? 645  PRO A CG    1 
ATOM   4915  C  CD    . PRO A 1 644  ? -16.836 -94.854  21.282  1.00 3.17  ? 645  PRO A CD    1 
ATOM   4916  N  N     . ILE A 1 645  ? -19.798 -92.523  21.645  1.00 2.49  ? 646  ILE A N     1 
ATOM   4917  C  CA    . ILE A 1 645  ? -20.663 -91.357  21.685  1.00 2.07  ? 646  ILE A CA    1 
ATOM   4918  C  C     . ILE A 1 645  ? -21.663 -91.401  20.543  1.00 2.31  ? 646  ILE A C     1 
ATOM   4919  O  O     . ILE A 1 645  ? -22.866 -91.125  20.714  1.00 2.08  ? 646  ILE A O     1 
ATOM   4920  C  CB    . ILE A 1 645  ? -19.819 -90.079  21.559  1.00 2.19  ? 646  ILE A CB    1 
ATOM   4921  C  CG1   . ILE A 1 645  ? -19.004 -89.874  22.823  1.00 2.15  ? 646  ILE A CG1   1 
ATOM   4922  C  CG2   . ILE A 1 645  ? -20.679 -88.894  21.315  1.00 2.00  ? 646  ILE A CG2   1 
ATOM   4923  C  CD1   . ILE A 1 645  ? -17.880 -88.906  22.666  1.00 2.23  ? 646  ILE A CD1   1 
ATOM   4924  N  N     . LEU A 1 646  ? -21.148 -91.733  19.366  1.00 2.34  ? 647  LEU A N     1 
ATOM   4925  C  CA    . LEU A 1 646  ? -21.976 -91.831  18.189  1.00 2.70  ? 647  LEU A CA    1 
ATOM   4926  C  C     . LEU A 1 646  ? -23.025 -92.926  18.314  1.00 3.35  ? 647  LEU A C     1 
ATOM   4927  O  O     . LEU A 1 646  ? -24.132 -92.765  17.820  1.00 3.68  ? 647  LEU A O     1 
ATOM   4928  C  CB    . LEU A 1 646  ? -21.125 -92.061  16.938  1.00 2.12  ? 647  LEU A CB    1 
ATOM   4929  C  CG    . LEU A 1 646  ? -20.213 -90.890  16.538  1.00 2.94  ? 647  LEU A CG    1 
ATOM   4930  C  CD1   . LEU A 1 646  ? -19.379 -91.280  15.341  1.00 2.18  ? 647  LEU A CD1   1 
ATOM   4931  C  CD2   . LEU A 1 646  ? -21.002 -89.634  16.238  1.00 2.00  ? 647  LEU A CD2   1 
ATOM   4932  N  N     . THR A 1 647  ? -22.704 -94.038  18.959  1.00 4.08  ? 648  THR A N     1 
ATOM   4933  C  CA    . THR A 1 647  ? -23.705 -95.086  19.081  1.00 5.69  ? 648  THR A CA    1 
ATOM   4934  C  C     . THR A 1 647  ? -24.617 -94.853  20.293  1.00 6.00  ? 648  THR A C     1 
ATOM   4935  O  O     . THR A 1 647  ? -25.379 -95.735  20.678  1.00 5.35  ? 648  THR A O     1 
ATOM   4936  C  CB    . THR A 1 647  ? -23.095 -96.532  19.041  1.00 5.58  ? 648  THR A CB    1 
ATOM   4937  O  OG1   . THR A 1 647  ? -22.724 -96.968  20.350  1.00 7.62  ? 648  THR A OG1   1 
ATOM   4938  C  CG2   . THR A 1 647  ? -21.862 -96.556  18.187  1.00 5.84  ? 648  THR A CG2   1 
ATOM   4939  N  N     . GLN A 1 648  ? -24.605 -93.616  20.802  1.00 7.05  ? 649  GLN A N     1 
ATOM   4940  C  CA    . GLN A 1 648  ? -25.432 -93.195  21.931  1.00 7.86  ? 649  GLN A CA    1 
ATOM   4941  C  C     . GLN A 1 648  ? -25.035 -93.826  23.256  1.00 8.09  ? 649  GLN A C     1 
ATOM   4942  O  O     . GLN A 1 648  ? -25.891 -94.114  24.079  1.00 9.62  ? 649  GLN A O     1 
ATOM   4943  C  CB    . GLN A 1 648  ? -26.897 -93.502  21.672  1.00 8.96  ? 649  GLN A CB    1 
ATOM   4944  C  CG    . GLN A 1 648  ? -27.425 -93.049  20.344  1.00 10.49 ? 649  GLN A CG    1 
ATOM   4945  C  CD    . GLN A 1 648  ? -27.268 -91.574  20.147  1.00 11.60 ? 649  GLN A CD    1 
ATOM   4946  O  OE1   . GLN A 1 648  ? -27.709 -90.757  20.973  1.00 11.37 ? 649  GLN A OE1   1 
ATOM   4947  N  NE2   . GLN A 1 648  ? -26.627 -91.207  19.042  1.00 12.38 ? 649  GLN A NE2   1 
ATOM   4948  N  N     . GLN A 1 649  ? -23.764 -94.120  23.458  1.00 7.70  ? 650  GLN A N     1 
ATOM   4949  C  CA    . GLN A 1 649  ? -23.333 -94.691  24.731  1.00 6.98  ? 650  GLN A CA    1 
ATOM   4950  C  C     . GLN A 1 649  ? -22.383 -93.692  25.435  1.00 6.07  ? 650  GLN A C     1 
ATOM   4951  O  O     . GLN A 1 649  ? -21.595 -94.065  26.311  1.00 6.02  ? 650  GLN A O     1 
ATOM   4952  C  CB    . GLN A 1 649  ? -22.647 -96.029  24.482  1.00 8.53  ? 650  GLN A CB    1 
ATOM   4953  C  CG    . GLN A 1 649  ? -23.568 -97.117  23.919  1.00 11.45 ? 650  GLN A CG    1 
ATOM   4954  C  CD    . GLN A 1 649  ? -24.663 -97.572  24.924  1.00 13.67 ? 650  GLN A CD    1 
ATOM   4955  O  OE1   . GLN A 1 649  ? -25.879 -97.498  24.625  1.00 14.41 ? 650  GLN A OE1   1 
ATOM   4956  N  NE2   . GLN A 1 649  ? -24.230 -98.051  26.115  1.00 13.77 ? 650  GLN A NE2   1 
ATOM   4957  N  N     . GLY A 1 650  ? -22.483 -92.417  25.056  1.00 4.69  ? 651  GLY A N     1 
ATOM   4958  C  CA    . GLY A 1 650  ? -21.637 -91.379  25.630  1.00 3.89  ? 651  GLY A CA    1 
ATOM   4959  C  C     . GLY A 1 650  ? -21.618 -91.238  27.140  1.00 3.65  ? 651  GLY A C     1 
ATOM   4960  O  O     . GLY A 1 650  ? -20.602 -90.852  27.732  1.00 2.49  ? 651  GLY A O     1 
ATOM   4961  N  N     . ASP A 1 651  ? -22.738 -91.556  27.780  1.00 4.40  ? 652  ASP A N     1 
ATOM   4962  C  CA    . ASP A 1 651  ? -22.799 -91.426  29.237  1.00 5.73  ? 652  ASP A CA    1 
ATOM   4963  C  C     . ASP A 1 651  ? -22.006 -92.486  29.934  1.00 5.13  ? 652  ASP A C     1 
ATOM   4964  O  O     . ASP A 1 651  ? -21.824 -92.395  31.147  1.00 4.69  ? 652  ASP A O     1 
ATOM   4965  C  CB    . ASP A 1 651  ? -24.198 -91.541  29.803  1.00 7.28  ? 652  ASP A CB    1 
ATOM   4966  C  CG    . ASP A 1 651  ? -25.151 -90.575  29.197  1.00 9.84  ? 652  ASP A CG    1 
ATOM   4967  O  OD1   . ASP A 1 651  ? -25.555 -90.825  28.023  1.00 11.71 ? 652  ASP A OD1   1 
ATOM   4968  O  OD2   . ASP A 1 651  ? -25.535 -89.614  29.909  1.00 10.68 ? 652  ASP A OD2   1 
ATOM   4969  N  N     . LYS A 1 652  ? -21.583 -93.505  29.206  1.00 4.26  ? 653  LYS A N     1 
ATOM   4970  C  CA    . LYS A 1 652  ? -20.814 -94.552  29.864  1.00 4.82  ? 653  LYS A CA    1 
ATOM   4971  C  C     . LYS A 1 652  ? -19.362 -94.143  30.000  1.00 4.09  ? 653  LYS A C     1 
ATOM   4972  O  O     . LYS A 1 652  ? -18.628 -94.695  30.832  1.00 4.41  ? 653  LYS A O     1 
ATOM   4973  C  CB    . LYS A 1 652  ? -21.012 -95.924  29.192  1.00 5.30  ? 653  LYS A CB    1 
ATOM   4974  C  CG    . LYS A 1 652  ? -22.458 -96.366  29.242  1.00 6.26  ? 653  LYS A CG    1 
ATOM   4975  C  CD    . LYS A 1 652  ? -22.613 -97.873  28.978  1.00 8.30  ? 653  LYS A CD    1 
ATOM   4976  C  CE    . LYS A 1 652  ? -23.986 -98.335  29.459  0.01 8.03  ? 653  LYS A CE    1 
ATOM   4977  N  NZ    . LYS A 1 652  ? -24.116 -99.816  29.474  0.01 8.59  ? 653  LYS A NZ    1 
ATOM   4978  N  N     . LEU A 1 653  ? -18.977 -93.132  29.222  1.00 3.40  ? 654  LEU A N     1 
ATOM   4979  C  CA    . LEU A 1 653  ? -17.634 -92.565  29.282  1.00 2.46  ? 654  LEU A CA    1 
ATOM   4980  C  C     . LEU A 1 653  ? -17.469 -91.838  30.639  1.00 2.60  ? 654  LEU A C     1 
ATOM   4981  O  O     . LEU A 1 653  ? -18.265 -90.952  30.998  1.00 2.24  ? 654  LEU A O     1 
ATOM   4982  C  CB    . LEU A 1 653  ? -17.470 -91.548  28.175  1.00 2.31  ? 654  LEU A CB    1 
ATOM   4983  C  CG    . LEU A 1 653  ? -16.793 -91.902  26.862  1.00 2.55  ? 654  LEU A CG    1 
ATOM   4984  C  CD1   . LEU A 1 653  ? -16.684 -93.392  26.601  1.00 2.39  ? 654  LEU A CD1   1 
ATOM   4985  C  CD2   . LEU A 1 653  ? -17.527 -91.163  25.757  1.00 2.00  ? 654  LEU A CD2   1 
ATOM   4986  N  N     . PRO A 1 654  ? -16.436 -92.227  31.412  1.00 2.24  ? 655  PRO A N     1 
ATOM   4987  C  CA    . PRO A 1 654  ? -16.090 -91.681  32.722  1.00 2.00  ? 655  PRO A CA    1 
ATOM   4988  C  C     . PRO A 1 654  ? -15.436 -90.304  32.545  1.00 2.00  ? 655  PRO A C     1 
ATOM   4989  O  O     . PRO A 1 654  ? -15.263 -89.881  31.417  1.00 2.00  ? 655  PRO A O     1 
ATOM   4990  C  CB    . PRO A 1 654  ? -15.130 -92.741  33.255  1.00 2.00  ? 655  PRO A CB    1 
ATOM   4991  C  CG    . PRO A 1 654  ? -14.433 -93.153  32.036  1.00 2.00  ? 655  PRO A CG    1 
ATOM   4992  C  CD    . PRO A 1 654  ? -15.506 -93.303  31.019  1.00 2.00  ? 655  PRO A CD    1 
ATOM   4993  N  N     . VAL A 1 655  ? -15.043 -89.609  33.600  1.00 2.00  ? 656  VAL A N     1 
ATOM   4994  C  CA    . VAL A 1 655  ? -14.454 -88.305  33.329  1.00 2.80  ? 656  VAL A CA    1 
ATOM   4995  C  C     . VAL A 1 655  ? -13.030 -88.306  32.748  1.00 2.93  ? 656  VAL A C     1 
ATOM   4996  O  O     . VAL A 1 655  ? -12.624 -87.408  32.005  1.00 2.67  ? 656  VAL A O     1 
ATOM   4997  C  CB    . VAL A 1 655  ? -14.626 -87.330  34.507  1.00 2.55  ? 656  VAL A CB    1 
ATOM   4998  C  CG1   . VAL A 1 655  ? -15.777 -87.786  35.366  1.00 2.67  ? 656  VAL A CG1   1 
ATOM   4999  C  CG2   . VAL A 1 655  ? -13.364 -87.165  35.278  1.00 2.51  ? 656  VAL A CG2   1 
ATOM   5000  N  N     . SER A 1 656  ? -12.336 -89.406  32.967  1.00 3.22  ? 657  SER A N     1 
ATOM   5001  C  CA    . SER A 1 656  ? -10.955 -89.565  32.509  1.00 3.26  ? 657  SER A CA    1 
ATOM   5002  C  C     . SER A 1 656  ? -10.816 -89.667  30.996  1.00 3.54  ? 657  SER A C     1 
ATOM   5003  O  O     . SER A 1 656  ? -9.681  -89.686  30.489  1.00 3.72  ? 657  SER A O     1 
ATOM   5004  C  CB    . SER A 1 656  ? -10.378 -90.851  33.093  1.00 3.20  ? 657  SER A CB    1 
ATOM   5005  O  OG    . SER A 1 656  ? -11.146 -91.968  32.652  1.00 3.27  ? 657  SER A OG    1 
ATOM   5006  N  N     . ALA A 1 657  ? -11.950 -89.861  30.309  1.00 3.03  ? 658  ALA A N     1 
ATOM   5007  C  CA    . ALA A 1 657  ? -11.983 -90.022  28.863  1.00 2.59  ? 658  ALA A CA    1 
ATOM   5008  C  C     . ALA A 1 657  ? -11.834 -88.674  28.158  1.00 2.64  ? 658  ALA A C     1 
ATOM   5009  O  O     . ALA A 1 657  ? -11.361 -88.617  27.028  1.00 2.88  ? 658  ALA A O     1 
ATOM   5010  C  CB    . ALA A 1 657  ? -13.280 -90.708  28.446  1.00 2.34  ? 658  ALA A CB    1 
ATOM   5011  N  N     . PHE A 1 658  ? -12.063 -87.591  28.895  1.00 2.92  ? 659  PHE A N     1 
ATOM   5012  C  CA    . PHE A 1 658  ? -11.978 -86.236  28.338  1.00 2.95  ? 659  PHE A CA    1 
ATOM   5013  C  C     . PHE A 1 658  ? -10.825 -85.383  28.818  1.00 2.97  ? 659  PHE A C     1 
ATOM   5014  O  O     . PHE A 1 658  ? -10.297 -85.598  29.918  1.00 3.43  ? 659  PHE A O     1 
ATOM   5015  C  CB    . PHE A 1 658  ? -13.301 -85.527  28.624  1.00 2.41  ? 659  PHE A CB    1 
ATOM   5016  C  CG    . PHE A 1 658  ? -14.480 -86.376  28.308  1.00 2.24  ? 659  PHE A CG    1 
ATOM   5017  C  CD1   . PHE A 1 658  ? -14.921 -86.508  26.997  1.00 2.00  ? 659  PHE A CD1   1 
ATOM   5018  C  CD2   . PHE A 1 658  ? -15.102 -87.113  29.302  1.00 2.06  ? 659  PHE A CD2   1 
ATOM   5019  C  CE1   . PHE A 1 658  ? -15.953 -87.351  26.681  1.00 2.00  ? 659  PHE A CE1   1 
ATOM   5020  C  CE2   . PHE A 1 658  ? -16.139 -87.965  28.990  1.00 2.01  ? 659  PHE A CE2   1 
ATOM   5021  C  CZ    . PHE A 1 658  ? -16.563 -88.081  27.668  1.00 2.00  ? 659  PHE A CZ    1 
ATOM   5022  N  N     . GLU A 1 659  ? -10.413 -84.445  27.967  1.00 3.39  ? 660  GLU A N     1 
ATOM   5023  C  CA    . GLU A 1 659  ? -9.359  -83.477  28.282  1.00 3.28  ? 660  GLU A CA    1 
ATOM   5024  C  C     . GLU A 1 659  ? -9.947  -82.482  29.248  1.00 2.89  ? 660  GLU A C     1 
ATOM   5025  O  O     . GLU A 1 659  ? -11.126 -82.154  29.159  1.00 3.36  ? 660  GLU A O     1 
ATOM   5026  C  CB    . GLU A 1 659  ? -8.914  -82.768  27.020  1.00 4.78  ? 660  GLU A CB    1 
ATOM   5027  C  CG    . GLU A 1 659  ? -8.046  -83.637  26.150  1.00 7.96  ? 660  GLU A CG    1 
ATOM   5028  C  CD    . GLU A 1 659  ? -6.550  -83.517  26.467  1.00 11.03 ? 660  GLU A CD    1 
ATOM   5029  O  OE1   . GLU A 1 659  ? -6.148  -83.328  27.661  1.00 12.63 ? 660  GLU A OE1   1 
ATOM   5030  O  OE2   . GLU A 1 659  ? -5.757  -83.597  25.494  1.00 12.90 ? 660  GLU A OE2   1 
ATOM   5031  N  N     . ALA A 1 660  ? -9.146  -82.020  30.195  1.00 2.56  ? 661  ALA A N     1 
ATOM   5032  C  CA    . ALA A 1 660  ? -9.621  -81.099  31.213  1.00 2.33  ? 661  ALA A CA    1 
ATOM   5033  C  C     . ALA A 1 660  ? -9.993  -79.736  30.647  1.00 2.90  ? 661  ALA A C     1 
ATOM   5034  O  O     . ALA A 1 660  ? -10.871 -79.067  31.179  1.00 2.69  ? 661  ALA A O     1 
ATOM   5035  C  CB    . ALA A 1 660  ? -8.564  -80.954  32.303  1.00 2.63  ? 661  ALA A CB    1 
ATOM   5036  N  N     . ASP A 1 661  ? -9.279  -79.277  29.618  1.00 3.28  ? 662  ASP A N     1 
ATOM   5037  C  CA    . ASP A 1 661  ? -9.622  -77.990  29.039  1.00 3.86  ? 662  ASP A CA    1 
ATOM   5038  C  C     . ASP A 1 661  ? -10.732 -78.112  27.997  1.00 3.47  ? 662  ASP A C     1 
ATOM   5039  O  O     . ASP A 1 661  ? -11.205 -77.100  27.452  1.00 3.71  ? 662  ASP A O     1 
ATOM   5040  C  CB    . ASP A 1 661  ? -8.391  -77.278  28.470  1.00 5.01  ? 662  ASP A CB    1 
ATOM   5041  C  CG    . ASP A 1 661  ? -7.738  -78.026  27.329  1.00 5.86  ? 662  ASP A CG    1 
ATOM   5042  O  OD1   . ASP A 1 661  ? -8.241  -79.085  26.893  1.00 7.13  ? 662  ASP A OD1   1 
ATOM   5043  O  OD2   . ASP A 1 661  ? -6.689  -77.538  26.859  1.00 7.16  ? 662  ASP A OD2   1 
ATOM   5044  N  N     . GLY A 1 662  ? -11.147 -79.350  27.732  1.00 2.79  ? 663  GLY A N     1 
ATOM   5045  C  CA    . GLY A 1 662  ? -12.224 -79.603  26.795  1.00 2.00  ? 663  GLY A CA    1 
ATOM   5046  C  C     . GLY A 1 662  ? -11.817 -79.700  25.351  1.00 2.00  ? 663  GLY A C     1 
ATOM   5047  O  O     . GLY A 1 662  ? -12.673 -79.738  24.503  1.00 2.00  ? 663  GLY A O     1 
ATOM   5048  N  N     . ARG A 1 663  ? -10.530 -79.783  25.050  1.00 2.00  ? 664  ARG A N     1 
ATOM   5049  C  CA    . ARG A 1 663  ? -10.112 -79.895  23.654  1.00 2.00  ? 664  ARG A CA    1 
ATOM   5050  C  C     . ARG A 1 663  ? -10.434 -81.288  23.022  1.00 2.39  ? 664  ARG A C     1 
ATOM   5051  O  O     . ARG A 1 663  ? -10.593 -82.300  23.742  1.00 2.04  ? 664  ARG A O     1 
ATOM   5052  C  CB    . ARG A 1 663  ? -8.610  -79.592  23.503  1.00 2.00  ? 664  ARG A CB    1 
ATOM   5053  C  CG    . ARG A 1 663  ? -7.715  -80.706  23.966  1.00 2.00  ? 664  ARG A CG    1 
ATOM   5054  C  CD    . ARG A 1 663  ? -6.284  -80.355  23.816  1.00 2.09  ? 664  ARG A CD    1 
ATOM   5055  N  NE    . ARG A 1 663  ? -5.994  -79.121  24.538  1.00 2.99  ? 664  ARG A NE    1 
ATOM   5056  C  CZ    . ARG A 1 663  ? -5.002  -78.289  24.229  1.00 2.41  ? 664  ARG A CZ    1 
ATOM   5057  N  NH1   . ARG A 1 663  ? -4.195  -78.582  23.213  1.00 2.05  ? 664  ARG A NH1   1 
ATOM   5058  N  NH2   . ARG A 1 663  ? -4.884  -77.122  24.865  1.00 2.00  ? 664  ARG A NH2   1 
ATOM   5059  N  N     . PHE A 1 664  ? -10.556 -81.296  21.685  1.00 2.00  ? 665  PHE A N     1 
ATOM   5060  C  CA    . PHE A 1 664  ? -10.798 -82.474  20.885  1.00 2.05  ? 665  PHE A CA    1 
ATOM   5061  C  C     . PHE A 1 664  ? -9.793  -82.460  19.773  1.00 2.00  ? 665  PHE A C     1 
ATOM   5062  O  O     . PHE A 1 664  ? -9.364  -81.401  19.338  1.00 2.00  ? 665  PHE A O     1 
ATOM   5063  C  CB    . PHE A 1 664  ? -12.209 -82.505  20.291  1.00 2.00  ? 665  PHE A CB    1 
ATOM   5064  C  CG    . PHE A 1 664  ? -13.161 -83.324  21.083  1.00 2.00  ? 665  PHE A CG    1 
ATOM   5065  C  CD1   . PHE A 1 664  ? -13.630 -82.863  22.296  1.00 2.35  ? 665  PHE A CD1   1 
ATOM   5066  C  CD2   . PHE A 1 664  ? -13.589 -84.549  20.626  1.00 2.04  ? 665  PHE A CD2   1 
ATOM   5067  C  CE1   . PHE A 1 664  ? -14.524 -83.610  23.057  1.00 2.89  ? 665  PHE A CE1   1 
ATOM   5068  C  CE2   . PHE A 1 664  ? -14.484 -85.310  21.376  1.00 2.99  ? 665  PHE A CE2   1 
ATOM   5069  C  CZ    . PHE A 1 664  ? -14.956 -84.830  22.609  1.00 2.32  ? 665  PHE A CZ    1 
ATOM   5070  N  N     . PRO A 1 665  ? -9.374  -83.647  19.305  1.00 2.56  ? 666  PRO A N     1 
ATOM   5071  C  CA    . PRO A 1 665  ? -8.389  -83.687  18.217  1.00 2.42  ? 666  PRO A CA    1 
ATOM   5072  C  C     . PRO A 1 665  ? -9.081  -83.470  16.896  1.00 2.54  ? 666  PRO A C     1 
ATOM   5073  O  O     . PRO A 1 665  ? -10.267 -83.751  16.758  1.00 3.35  ? 666  PRO A O     1 
ATOM   5074  C  CB    . PRO A 1 665  ? -7.792  -85.091  18.350  1.00 2.79  ? 666  PRO A CB    1 
ATOM   5075  C  CG    . PRO A 1 665  ? -8.947  -85.921  18.820  1.00 2.66  ? 666  PRO A CG    1 
ATOM   5076  C  CD    . PRO A 1 665  ? -9.667  -85.001  19.825  1.00 2.58  ? 666  PRO A CD    1 
ATOM   5077  N  N     . LEU A 1 666  ? -8.372  -82.878  15.955  1.00 2.58  ? 667  LEU A N     1 
ATOM   5078  C  CA    . LEU A 1 666  ? -8.920  -82.630  14.638  1.00 2.79  ? 667  LEU A CA    1 
ATOM   5079  C  C     . LEU A 1 666  ? -9.145  -83.938  13.856  1.00 3.27  ? 667  LEU A C     1 
ATOM   5080  O  O     . LEU A 1 666  ? -8.563  -84.954  14.185  1.00 3.77  ? 667  LEU A O     1 
ATOM   5081  C  CB    . LEU A 1 666  ? -7.951  -81.745  13.840  1.00 2.02  ? 667  LEU A CB    1 
ATOM   5082  C  CG    . LEU A 1 666  ? -8.110  -80.213  13.764  1.00 2.48  ? 667  LEU A CG    1 
ATOM   5083  C  CD1   . LEU A 1 666  ? -7.626  -79.567  15.020  1.00 2.00  ? 667  LEU A CD1   1 
ATOM   5084  C  CD2   . LEU A 1 666  ? -7.338  -79.674  12.534  1.00 2.21  ? 667  LEU A CD2   1 
ATOM   5085  N  N     . GLY A 1 667  ? -10.069 -83.917  12.890  1.00 3.44  ? 668  GLY A N     1 
ATOM   5086  C  CA    . GLY A 1 667  ? -10.271 -85.043  11.996  1.00 2.72  ? 668  GLY A CA    1 
ATOM   5087  C  C     . GLY A 1 667  ? -11.021 -86.292  12.337  1.00 2.69  ? 668  GLY A C     1 
ATOM   5088  O  O     . GLY A 1 667  ? -10.902 -87.292  11.618  1.00 2.70  ? 668  GLY A O     1 
ATOM   5089  N  N     . THR A 1 668  ? -11.827 -86.236  13.378  1.00 2.81  ? 669  THR A N     1 
ATOM   5090  C  CA    . THR A 1 668  ? -12.608 -87.406  13.795  1.00 3.11  ? 669  THR A CA    1 
ATOM   5091  C  C     . THR A 1 668  ? -13.685 -87.842  12.764  1.00 3.32  ? 669  THR A C     1 
ATOM   5092  O  O     . THR A 1 668  ? -14.025 -89.031  12.660  1.00 3.54  ? 669  THR A O     1 
ATOM   5093  C  CB    . THR A 1 668  ? -13.271 -87.175  15.192  1.00 2.61  ? 669  THR A CB    1 
ATOM   5094  O  OG1   . THR A 1 668  ? -14.147 -86.053  15.143  1.00 2.28  ? 669  THR A OG1   1 
ATOM   5095  C  CG2   . THR A 1 668  ? -12.223 -86.913  16.233  1.00 2.71  ? 669  THR A CG2   1 
ATOM   5096  N  N     . SER A 1 669  ? -14.175 -86.882  11.976  1.00 2.97  ? 670  SER A N     1 
ATOM   5097  C  CA    . SER A 1 669  ? -15.190 -87.177  10.975  1.00 2.47  ? 670  SER A CA    1 
ATOM   5098  C  C     . SER A 1 669  ? -14.716 -88.137  9.859   1.00 2.21  ? 670  SER A C     1 
ATOM   5099  O  O     . SER A 1 669  ? -15.534 -88.752  9.146   1.00 2.00  ? 670  SER A O     1 
ATOM   5100  C  CB    . SER A 1 669  ? -15.730 -85.874  10.385  1.00 2.00  ? 670  SER A CB    1 
ATOM   5101  O  OG    . SER A 1 669  ? -14.840 -85.310  9.453   1.00 2.00  ? 670  SER A OG    1 
ATOM   5102  N  N     . GLN A 1 670  ? -13.402 -88.291  9.742   1.00 2.01  ? 671  GLN A N     1 
ATOM   5103  C  CA    . GLN A 1 670  ? -12.824 -89.161  8.720   1.00 2.24  ? 671  GLN A CA    1 
ATOM   5104  C  C     . GLN A 1 670  ? -13.312 -90.590  8.816   1.00 2.66  ? 671  GLN A C     1 
ATOM   5105  O  O     . GLN A 1 670  ? -13.248 -91.282  7.841   1.00 3.05  ? 671  GLN A O     1 
ATOM   5106  C  CB    . GLN A 1 670  ? -11.305 -89.165  8.797   1.00 2.35  ? 671  GLN A CB    1 
ATOM   5107  C  CG    . GLN A 1 670  ? -10.663 -87.816  8.535   1.00 3.20  ? 671  GLN A CG    1 
ATOM   5108  C  CD    . GLN A 1 670  ? -10.770 -87.402  7.086   1.00 3.65  ? 671  GLN A CD    1 
ATOM   5109  O  OE1   . GLN A 1 670  ? -10.328 -88.120  6.201   1.00 4.18  ? 671  GLN A OE1   1 
ATOM   5110  N  NE2   . GLN A 1 670  ? -11.418 -86.257  6.828   1.00 4.30  ? 671  GLN A NE2   1 
ATOM   5111  N  N     . PHE A 1 671  ? -13.863 -91.021  9.953   1.00 3.01  ? 672  PHE A N     1 
ATOM   5112  C  CA    . PHE A 1 671  ? -14.329 -92.412  10.094  1.00 3.49  ? 672  PHE A CA    1 
ATOM   5113  C  C     . PHE A 1 671  ? -15.835 -92.580  10.255  1.00 3.91  ? 672  PHE A C     1 
ATOM   5114  O  O     . PHE A 1 671  ? -16.347 -93.721  10.384  1.00 3.01  ? 672  PHE A O     1 
ATOM   5115  C  CB    . PHE A 1 671  ? -13.673 -93.073  11.300  1.00 3.27  ? 672  PHE A CB    1 
ATOM   5116  C  CG    . PHE A 1 671  ? -12.235 -92.870  11.366  1.00 2.87  ? 672  PHE A CG    1 
ATOM   5117  C  CD1   . PHE A 1 671  ? -11.391 -93.622  10.560  1.00 3.13  ? 672  PHE A CD1   1 
ATOM   5118  C  CD2   . PHE A 1 671  ? -11.718 -91.884  12.183  1.00 3.46  ? 672  PHE A CD2   1 
ATOM   5119  C  CE1   . PHE A 1 671  ? -10.022 -93.397  10.555  1.00 3.49  ? 672  PHE A CE1   1 
ATOM   5120  C  CE2   . PHE A 1 671  ? -10.348 -91.625  12.202  1.00 4.04  ? 672  PHE A CE2   1 
ATOM   5121  C  CZ    . PHE A 1 671  ? -9.484  -92.391  11.376  1.00 3.29  ? 672  PHE A CZ    1 
ATOM   5122  N  N     . GLU A 1 672  ? -16.547 -91.463  10.289  1.00 4.41  ? 673  GLU A N     1 
ATOM   5123  C  CA    . GLU A 1 672  ? -17.988 -91.542  10.459  1.00 5.51  ? 673  GLU A CA    1 
ATOM   5124  C  C     . GLU A 1 672  ? -18.613 -92.300  9.312   1.00 5.16  ? 673  GLU A C     1 
ATOM   5125  O  O     . GLU A 1 672  ? -19.312 -93.284  9.551   1.00 5.66  ? 673  GLU A O     1 
ATOM   5126  C  CB    . GLU A 1 672  ? -18.617 -90.152  10.667  1.00 7.07  ? 673  GLU A CB    1 
ATOM   5127  C  CG    . GLU A 1 672  ? -18.070 -89.472  11.934  1.00 9.65  ? 673  GLU A CG    1 
ATOM   5128  C  CD    . GLU A 1 672  ? -18.909 -88.327  12.423  1.00 11.27 ? 673  GLU A CD    1 
ATOM   5129  O  OE1   . GLU A 1 672  ? -19.963 -88.600  13.054  1.00 12.12 ? 673  GLU A OE1   1 
ATOM   5130  O  OE2   . GLU A 1 672  ? -18.491 -87.160  12.208  1.00 12.36 ? 673  GLU A OE2   1 
ATOM   5131  N  N     . LYS A 1 673  ? -18.336 -91.888  8.075   1.00 4.59  ? 674  LYS A N     1 
ATOM   5132  C  CA    . LYS A 1 673  ? -18.865 -92.578  6.889   1.00 3.55  ? 674  LYS A CA    1 
ATOM   5133  C  C     . LYS A 1 673  ? -20.309 -93.023  7.142   1.00 3.36  ? 674  LYS A C     1 
ATOM   5134  O  O     . LYS A 1 673  ? -20.614 -94.201  7.149   1.00 3.20  ? 674  LYS A O     1 
ATOM   5135  C  CB    . LYS A 1 673  ? -17.988 -93.794  6.630   1.00 2.91  ? 674  LYS A CB    1 
ATOM   5136  C  CG    . LYS A 1 673  ? -16.576 -93.441  6.272   1.00 2.33  ? 674  LYS A CG    1 
ATOM   5137  C  CD    . LYS A 1 673  ? -16.547 -92.616  4.988   1.00 2.24  ? 674  LYS A CD    1 
ATOM   5138  C  CE    . LYS A 1 673  ? -15.124 -92.366  4.504   1.00 2.00  ? 674  LYS A CE    1 
ATOM   5139  N  NZ    . LYS A 1 673  ? -14.455 -91.273  5.254   1.00 2.00  ? 674  LYS A NZ    1 
ATOM   5140  N  N     . ARG A 1 674  ? -21.198 -92.081  7.373   1.00 3.54  ? 675  ARG A N     1 
ATOM   5141  C  CA    . ARG A 1 674  ? -22.569 -92.435  7.698   1.00 3.96  ? 675  ARG A CA    1 
ATOM   5142  C  C     . ARG A 1 674  ? -23.344 -93.074  6.579   1.00 4.57  ? 675  ARG A C     1 
ATOM   5143  O  O     . ARG A 1 674  ? -24.183 -93.920  6.866   1.00 5.61  ? 675  ARG A O     1 
ATOM   5144  C  CB    . ARG A 1 674  ? -23.345 -91.229  8.212   1.00 4.00  ? 675  ARG A CB    1 
ATOM   5145  C  CG    . ARG A 1 674  ? -22.696 -90.460  9.327   1.00 4.71  ? 675  ARG A CG    1 
ATOM   5146  C  CD    . ARG A 1 674  ? -23.231 -89.047  9.334   1.00 5.58  ? 675  ARG A CD    1 
ATOM   5147  N  NE    . ARG A 1 674  ? -24.649 -88.971  9.717   1.00 7.07  ? 675  ARG A NE    1 
ATOM   5148  C  CZ    . ARG A 1 674  ? -25.487 -87.993  9.362   1.00 6.57  ? 675  ARG A CZ    1 
ATOM   5149  N  NH1   . ARG A 1 674  ? -25.077 -87.003  8.593   1.00 6.16  ? 675  ARG A NH1   1 
ATOM   5150  N  NH2   . ARG A 1 674  ? -26.693 -87.934  9.901   1.00 6.99  ? 675  ARG A NH2   1 
ATOM   5151  N  N     . GLY A 1 675  ? -23.112 -92.642  5.332   1.00 4.61  ? 676  GLY A N     1 
ATOM   5152  C  CA    . GLY A 1 675  ? -23.808 -93.196  4.173   1.00 4.46  ? 676  GLY A CA    1 
ATOM   5153  C  C     . GLY A 1 675  ? -25.298 -92.932  4.196   1.00 4.56  ? 676  GLY A C     1 
ATOM   5154  O  O     . GLY A 1 675  ? -26.074 -93.867  3.971   1.00 4.54  ? 676  GLY A O     1 
ATOM   5155  N  N     . VAL A 1 676  ? -25.685 -91.685  4.518   1.00 4.06  ? 677  VAL A N     1 
ATOM   5156  C  CA    . VAL A 1 676  ? -27.091 -91.289  4.610   1.00 4.02  ? 677  VAL A CA    1 
ATOM   5157  C  C     . VAL A 1 676  ? -27.750 -90.659  3.377   1.00 4.57  ? 677  VAL A C     1 
ATOM   5158  O  O     . VAL A 1 676  ? -28.915 -90.268  3.423   1.00 4.93  ? 677  VAL A O     1 
ATOM   5159  C  CB    . VAL A 1 676  ? -27.356 -90.384  5.809   1.00 3.78  ? 677  VAL A CB    1 
ATOM   5160  C  CG1   . VAL A 1 676  ? -27.161 -91.178  7.097   1.00 2.89  ? 677  VAL A CG1   1 
ATOM   5161  C  CG2   . VAL A 1 676  ? -26.456 -89.130  5.743   1.00 3.56  ? 677  VAL A CG2   1 
ATOM   5162  N  N     . ALA A 1 677  ? -27.010 -90.559  2.286   1.00 4.44  ? 678  ALA A N     1 
ATOM   5163  C  CA    . ALA A 1 677  ? -27.557 -90.022  1.053   1.00 5.08  ? 678  ALA A CA    1 
ATOM   5164  C  C     . ALA A 1 677  ? -28.492 -91.075  0.430   1.00 4.66  ? 678  ALA A C     1 
ATOM   5165  O  O     . ALA A 1 677  ? -28.247 -92.271  0.601   1.00 5.50  ? 678  ALA A O     1 
ATOM   5166  C  CB    . ALA A 1 677  ? -26.391 -89.663  0.040   1.00 3.98  ? 678  ALA A CB    1 
ATOM   5167  N  N     . ILE A 1 678  ? -29.611 -90.633  -0.165  1.00 4.16  ? 679  ILE A N     1 
ATOM   5168  C  CA    . ILE A 1 678  ? -30.525 -91.531  -0.890  1.00 3.69  ? 679  ILE A CA    1 
ATOM   5169  C  C     . ILE A 1 678  ? -29.857 -91.738  -2.274  1.00 3.80  ? 679  ILE A C     1 
ATOM   5170  O  O     . ILE A 1 678  ? -29.747 -92.870  -2.777  1.00 4.51  ? 679  ILE A O     1 
ATOM   5171  C  CB    . ILE A 1 678  ? -31.923 -90.868  -1.154  1.00 3.36  ? 679  ILE A CB    1 
ATOM   5172  C  CG1   . ILE A 1 678  ? -32.601 -90.412  0.135   1.00 3.59  ? 679  ILE A CG1   1 
ATOM   5173  C  CG2   . ILE A 1 678  ? -32.842 -91.779  -1.879  1.00 2.55  ? 679  ILE A CG2   1 
ATOM   5174  C  CD1   . ILE A 1 678  ? -32.470 -91.381  1.264   1.00 3.97  ? 679  ILE A CD1   1 
ATOM   5175  N  N     . ASN A 1 679  ? -29.433 -90.623  -2.884  1.00 3.51  ? 680  ASN A N     1 
ATOM   5176  C  CA    . ASN A 1 679  ? -28.794 -90.627  -4.195  1.00 3.31  ? 680  ASN A CA    1 
ATOM   5177  C  C     . ASN A 1 679  ? -27.441 -89.956  -4.201  1.00 3.24  ? 680  ASN A C     1 
ATOM   5178  O  O     . ASN A 1 679  ? -27.281 -88.837  -3.679  1.00 3.46  ? 680  ASN A O     1 
ATOM   5179  C  CB    . ASN A 1 679  ? -29.684 -89.934  -5.220  1.00 3.35  ? 680  ASN A CB    1 
ATOM   5180  C  CG    . ASN A 1 679  ? -31.001 -90.642  -5.416  1.00 4.24  ? 680  ASN A CG    1 
ATOM   5181  O  OD1   . ASN A 1 679  ? -31.083 -91.897  -5.347  1.00 4.16  ? 680  ASN A OD1   1 
ATOM   5182  N  ND2   . ASN A 1 679  ? -32.059 -89.852  -5.660  1.00 4.74  ? 680  ASN A ND2   1 
ATOM   5183  N  N     . VAL A 1 680  ? -26.464 -90.625  -4.799  1.00 2.73  ? 681  VAL A N     1 
ATOM   5184  C  CA    . VAL A 1 680  ? -25.110 -90.099  -4.897  1.00 2.41  ? 681  VAL A CA    1 
ATOM   5185  C  C     . VAL A 1 680  ? -24.747 -89.986  -6.366  1.00 3.01  ? 681  VAL A C     1 
ATOM   5186  O  O     . VAL A 1 680  ? -25.268 -90.745  -7.192  1.00 3.78  ? 681  VAL A O     1 
ATOM   5187  C  CB    . VAL A 1 680  ? -24.105 -91.030  -4.221  1.00 2.69  ? 681  VAL A CB    1 
ATOM   5188  C  CG1   . VAL A 1 680  ? -24.522 -91.274  -2.766  1.00 2.06  ? 681  VAL A CG1   1 
ATOM   5189  C  CG2   . VAL A 1 680  ? -23.967 -92.347  -4.981  1.00 2.00  ? 681  VAL A CG2   1 
ATOM   5190  N  N     . PRO A 1 681  ? -23.895 -89.016  -6.733  1.00 2.76  ? 682  PRO A N     1 
ATOM   5191  C  CA    . PRO A 1 681  ? -23.520 -88.884  -8.141  1.00 3.23  ? 682  PRO A CA    1 
ATOM   5192  C  C     . PRO A 1 681  ? -22.670 -90.033  -8.598  1.00 3.85  ? 682  PRO A C     1 
ATOM   5193  O  O     . PRO A 1 681  ? -22.062 -90.694  -7.769  1.00 4.76  ? 682  PRO A O     1 
ATOM   5194  C  CB    . PRO A 1 681  ? -22.706 -87.582  -8.158  1.00 2.47  ? 682  PRO A CB    1 
ATOM   5195  C  CG    . PRO A 1 681  ? -22.118 -87.550  -6.829  1.00 2.18  ? 682  PRO A CG    1 
ATOM   5196  C  CD    . PRO A 1 681  ? -23.277 -87.941  -5.948  1.00 2.43  ? 682  PRO A CD    1 
ATOM   5197  N  N     . GLN A 1 682  ? -22.691 -90.301  -9.906  1.00 4.45  ? 683  GLN A N     1 
ATOM   5198  C  CA    . GLN A 1 682  ? -21.893 -91.350  -10.522 1.00 4.67  ? 683  GLN A CA    1 
ATOM   5199  C  C     . GLN A 1 682  ? -21.094 -90.628  -11.618 1.00 4.47  ? 683  GLN A C     1 
ATOM   5200  O  O     . GLN A 1 682  ? -21.648 -89.853  -12.378 1.00 5.00  ? 683  GLN A O     1 
ATOM   5201  C  CB    . GLN A 1 682  ? -22.803 -92.421  -11.130 1.00 5.12  ? 683  GLN A CB    1 
ATOM   5202  C  CG    . GLN A 1 682  ? -22.057 -93.383  -12.072 1.00 6.39  ? 683  GLN A CG    1 
ATOM   5203  C  CD    . GLN A 1 682  ? -22.966 -94.296  -12.946 1.00 6.92  ? 683  GLN A CD    1 
ATOM   5204  O  OE1   . GLN A 1 682  ? -22.849 -95.527  -12.896 1.00 8.69  ? 683  GLN A OE1   1 
ATOM   5205  N  NE2   . GLN A 1 682  ? -23.807 -93.695  -13.788 1.00 7.08  ? 683  GLN A NE2   1 
ATOM   5206  N  N     . TRP A 1 683  ? -19.786 -90.798  -11.650 1.00 3.88  ? 684  TRP A N     1 
ATOM   5207  C  CA    . TRP A 1 683  ? -18.972 -90.143  -12.671 1.00 3.55  ? 684  TRP A CA    1 
ATOM   5208  C  C     . TRP A 1 683  ? -19.143 -90.912  -13.972 1.00 3.89  ? 684  TRP A C     1 
ATOM   5209  O  O     . TRP A 1 683  ? -19.211 -92.140  -13.956 1.00 4.77  ? 684  TRP A O     1 
ATOM   5210  C  CB    . TRP A 1 683  ? -17.495 -90.196  -12.257 1.00 3.13  ? 684  TRP A CB    1 
ATOM   5211  C  CG    . TRP A 1 683  ? -16.544 -89.334  -13.087 1.00 3.14  ? 684  TRP A CG    1 
ATOM   5212  C  CD1   . TRP A 1 683  ? -16.737 -88.056  -13.448 1.00 3.03  ? 684  TRP A CD1   1 
ATOM   5213  C  CD2   . TRP A 1 683  ? -15.232 -89.690  -13.564 1.00 2.61  ? 684  TRP A CD2   1 
ATOM   5214  N  NE1   . TRP A 1 683  ? -15.633 -87.567  -14.109 1.00 3.20  ? 684  TRP A NE1   1 
ATOM   5215  C  CE2   . TRP A 1 683  ? -14.692 -88.552  -14.191 1.00 2.90  ? 684  TRP A CE2   1 
ATOM   5216  C  CE3   . TRP A 1 683  ? -14.463 -90.856  -13.510 1.00 2.51  ? 684  TRP A CE3   1 
ATOM   5217  C  CZ2   . TRP A 1 683  ? -13.408 -88.537  -14.766 1.00 2.30  ? 684  TRP A CZ2   1 
ATOM   5218  C  CZ3   . TRP A 1 683  ? -13.187 -90.852  -14.082 1.00 2.45  ? 684  TRP A CZ3   1 
ATOM   5219  C  CH2   . TRP A 1 683  ? -12.675 -89.692  -14.704 1.00 2.39  ? 684  TRP A CH2   1 
ATOM   5220  N  N     . VAL A 1 684  ? -19.163 -90.194  -15.088 1.00 4.13  ? 685  VAL A N     1 
ATOM   5221  C  CA    . VAL A 1 684  ? -19.303 -90.776  -16.409 1.00 4.15  ? 685  VAL A CA    1 
ATOM   5222  C  C     . VAL A 1 684  ? -18.116 -90.195  -17.113 1.00 4.83  ? 685  VAL A C     1 
ATOM   5223  O  O     . VAL A 1 684  ? -18.233 -89.145  -17.717 1.00 4.77  ? 685  VAL A O     1 
ATOM   5224  C  CB    . VAL A 1 684  ? -20.620 -90.312  -17.090 1.00 3.83  ? 685  VAL A CB    1 
ATOM   5225  C  CG1   . VAL A 1 684  ? -20.759 -90.975  -18.439 1.00 3.21  ? 685  VAL A CG1   1 
ATOM   5226  C  CG2   . VAL A 1 684  ? -21.845 -90.668  -16.192 1.00 2.51  ? 685  VAL A CG2   1 
ATOM   5227  N  N     . PRO A 1 685  ? -16.963 -90.906  -17.085 1.00 5.43  ? 686  PRO A N     1 
ATOM   5228  C  CA    . PRO A 1 685  ? -15.659 -90.562  -17.666 1.00 6.02  ? 686  PRO A CA    1 
ATOM   5229  C  C     . PRO A 1 685  ? -15.617 -90.052  -19.097 1.00 7.15  ? 686  PRO A C     1 
ATOM   5230  O  O     . PRO A 1 685  ? -14.835 -89.169  -19.434 1.00 7.59  ? 686  PRO A O     1 
ATOM   5231  C  CB    . PRO A 1 685  ? -14.871 -91.853  -17.525 1.00 5.64  ? 686  PRO A CB    1 
ATOM   5232  C  CG    . PRO A 1 685  ? -15.516 -92.545  -16.387 1.00 5.37  ? 686  PRO A CG    1 
ATOM   5233  C  CD    . PRO A 1 685  ? -16.961 -92.313  -16.649 1.00 5.45  ? 686  PRO A CD    1 
ATOM   5234  N  N     . GLU A 1 686  ? -16.468 -90.586  -19.952 1.00 8.36  ? 687  GLU A N     1 
ATOM   5235  C  CA    . GLU A 1 686  ? -16.463 -90.148  -21.338 1.00 9.58  ? 687  GLU A CA    1 
ATOM   5236  C  C     . GLU A 1 686  ? -16.873 -88.684  -21.498 1.00 9.51  ? 687  GLU A C     1 
ATOM   5237  O  O     . GLU A 1 686  ? -16.489 -88.044  -22.481 1.00 9.91  ? 687  GLU A O     1 
ATOM   5238  C  CB    . GLU A 1 686  ? -17.450 -90.951  -22.185 1.00 10.77 ? 687  GLU A CB    1 
ATOM   5239  C  CG    . GLU A 1 686  ? -17.602 -92.393  -21.826 1.00 14.02 ? 687  GLU A CG    1 
ATOM   5240  C  CD    . GLU A 1 686  ? -18.840 -92.615  -21.003 1.00 15.83 ? 687  GLU A CD    1 
ATOM   5241  O  OE1   . GLU A 1 686  ? -19.947 -92.749  -21.617 1.00 16.57 ? 687  GLU A OE1   1 
ATOM   5242  O  OE2   . GLU A 1 686  ? -18.703 -92.641  -19.750 1.00 17.00 ? 687  GLU A OE2   1 
ATOM   5243  N  N     . ASN A 1 687  ? -17.676 -88.154  -20.580 1.00 8.79  ? 688  ASN A N     1 
ATOM   5244  C  CA    . ASN A 1 687  ? -18.155 -86.797  -20.766 1.00 8.35  ? 688  ASN A CA    1 
ATOM   5245  C  C     . ASN A 1 687  ? -17.423 -85.757  -19.937 1.00 8.10  ? 688  ASN A C     1 
ATOM   5246  O  O     . ASN A 1 687  ? -17.633 -84.559  -20.083 1.00 7.77  ? 688  ASN A O     1 
ATOM   5247  C  CB    . ASN A 1 687  ? -19.657 -86.749  -20.519 1.00 9.18  ? 688  ASN A CB    1 
ATOM   5248  C  CG    . ASN A 1 687  ? -20.422 -87.769  -21.347 1.00 10.64 ? 688  ASN A CG    1 
ATOM   5249  O  OD1   . ASN A 1 687  ? -21.256 -88.496  -20.820 1.00 11.98 ? 688  ASN A OD1   1 
ATOM   5250  N  ND2   . ASN A 1 687  ? -20.142 -87.829  -22.649 1.00 11.38 ? 688  ASN A ND2   1 
ATOM   5251  N  N     . CYS A 1 688  ? -16.498 -86.218  -19.119 1.00 7.55  ? 689  CYS A N     1 
ATOM   5252  C  CA    . CYS A 1 688  ? -15.779 -85.310  -18.266 1.00 7.28  ? 689  CYS A CA    1 
ATOM   5253  C  C     . CYS A 1 688  ? -14.771 -84.403  -18.982 1.00 7.15  ? 689  CYS A C     1 
ATOM   5254  O  O     . CYS A 1 688  ? -14.038 -84.830  -19.877 1.00 7.67  ? 689  CYS A O     1 
ATOM   5255  C  CB    . CYS A 1 688  ? -15.134 -86.124  -17.152 1.00 7.39  ? 689  CYS A CB    1 
ATOM   5256  S  SG    . CYS A 1 688  ? -14.310 -85.181  -15.851 1.00 6.65  ? 689  CYS A SG    1 
ATOM   5257  N  N     . ILE A 1 689  ? -14.829 -83.107  -18.670 1.00 6.72  ? 690  ILE A N     1 
ATOM   5258  C  CA    . ILE A 1 689  ? -13.925 -82.134  -19.276 1.00 5.51  ? 690  ILE A CA    1 
ATOM   5259  C  C     . ILE A 1 689  ? -12.769 -81.796  -18.333 1.00 5.29  ? 690  ILE A C     1 
ATOM   5260  O  O     . ILE A 1 689  ? -12.010 -80.839  -18.546 1.00 4.72  ? 690  ILE A O     1 
ATOM   5261  C  CB    . ILE A 1 689  ? -14.677 -80.887  -19.745 1.00 5.15  ? 690  ILE A CB    1 
ATOM   5262  C  CG1   . ILE A 1 689  ? -15.133 -80.032  -18.568 1.00 4.87  ? 690  ILE A CG1   1 
ATOM   5263  C  CG2   . ILE A 1 689  ? -15.901 -81.311  -20.576 1.00 4.96  ? 690  ILE A CG2   1 
ATOM   5264  C  CD1   . ILE A 1 689  ? -15.647 -78.659  -19.025 1.00 4.35  ? 690  ILE A CD1   1 
ATOM   5265  N  N     . GLN A 1 690  ? -12.678 -82.581  -17.261 1.00 5.23  ? 691  GLN A N     1 
ATOM   5266  C  CA    . GLN A 1 690  ? -11.614 -82.448  -16.269 1.00 5.60  ? 691  GLN A CA    1 
ATOM   5267  C  C     . GLN A 1 690  ? -11.470 -81.063  -15.693 1.00 5.82  ? 691  GLN A C     1 
ATOM   5268  O  O     . GLN A 1 690  ? -10.351 -80.571  -15.497 1.00 6.15  ? 691  GLN A O     1 
ATOM   5269  C  CB    . GLN A 1 690  ? -10.290 -82.862  -16.890 1.00 5.92  ? 691  GLN A CB    1 
ATOM   5270  C  CG    . GLN A 1 690  ? -10.318 -84.272  -17.479 1.00 7.13  ? 691  GLN A CG    1 
ATOM   5271  C  CD    . GLN A 1 690  ? -8.940  -84.807  -17.834 1.00 8.36  ? 691  GLN A CD    1 
ATOM   5272  O  OE1   . GLN A 1 690  ? -8.836  -85.722  -18.648 1.00 9.99  ? 691  GLN A OE1   1 
ATOM   5273  N  NE2   . GLN A 1 690  ? -7.878  -84.247  -17.245 1.00 9.50  ? 691  GLN A NE2   1 
ATOM   5274  N  N     . CYS A 1 691  ? -12.584 -80.507  -15.247 1.00 5.60  ? 692  CYS A N     1 
ATOM   5275  C  CA    . CYS A 1 691  ? -12.557 -79.169  -14.740 1.00 5.37  ? 692  CYS A CA    1 
ATOM   5276  C  C     . CYS A 1 691  ? -12.413 -78.906  -13.213 1.00 5.22  ? 692  CYS A C     1 
ATOM   5277  O  O     . CYS A 1 691  ? -11.925 -77.814  -12.770 1.00 3.85  ? 692  CYS A O     1 
ATOM   5278  C  CB    . CYS A 1 691  ? -13.749 -78.435  -15.364 1.00 6.19  ? 692  CYS A CB    1 
ATOM   5279  S  SG    . CYS A 1 691  ? -15.407 -78.780  -14.716 1.00 5.21  ? 692  CYS A SG    1 
ATOM   5280  N  N     . ASN A 1 692  ? -12.727 -79.949  -12.437 1.00 4.47  ? 693  ASN A N     1 
ATOM   5281  C  CA    . ASN A 1 692  ? -12.710 -79.884  -10.983 1.00 3.82  ? 693  ASN A CA    1 
ATOM   5282  C  C     . ASN A 1 692  ? -13.746 -78.972  -10.342 1.00 3.65  ? 693  ASN A C     1 
ATOM   5283  O  O     . ASN A 1 692  ? -13.666 -78.677  -9.148  1.00 3.46  ? 693  ASN A O     1 
ATOM   5284  C  CB    . ASN A 1 692  ? -11.353 -79.519  -10.465 1.00 3.68  ? 693  ASN A CB    1 
ATOM   5285  C  CG    . ASN A 1 692  ? -10.390 -80.637  -10.582 1.00 3.74  ? 693  ASN A CG    1 
ATOM   5286  O  OD1   . ASN A 1 692  ? -9.184  -80.410  -10.528 1.00 4.68  ? 693  ASN A OD1   1 
ATOM   5287  N  ND2   . ASN A 1 692  ? -10.889 -81.868  -10.693 1.00 3.30  ? 693  ASN A ND2   1 
ATOM   5288  N  N     . GLN A 1 693  ? -14.726 -78.530  -11.121 1.00 3.51  ? 694  GLN A N     1 
ATOM   5289  C  CA    . GLN A 1 693  ? -15.784 -77.699  -10.574 1.00 3.25  ? 694  GLN A CA    1 
ATOM   5290  C  C     . GLN A 1 693  ? -16.683 -78.481  -9.630  1.00 3.25  ? 694  GLN A C     1 
ATOM   5291  O  O     . GLN A 1 693  ? -17.216 -77.913  -8.690  1.00 2.62  ? 694  GLN A O     1 
ATOM   5292  C  CB    . GLN A 1 693  ? -16.591 -77.103  -11.684 1.00 3.03  ? 694  GLN A CB    1 
ATOM   5293  C  CG    . GLN A 1 693  ? -15.821 -76.071  -12.411 1.00 3.58  ? 694  GLN A CG    1 
ATOM   5294  C  CD    . GLN A 1 693  ? -16.709 -75.315  -13.305 1.00 4.66  ? 694  GLN A CD    1 
ATOM   5295  O  OE1   . GLN A 1 693  ? -17.813 -74.927  -12.909 1.00 6.49  ? 694  GLN A OE1   1 
ATOM   5296  N  NE2   . GLN A 1 693  ? -16.280 -75.116  -14.527 1.00 4.48  ? 694  GLN A NE2   1 
ATOM   5297  N  N     . CYS A 1 694  ? -16.875 -79.776  -9.903  1.00 3.48  ? 695  CYS A N     1 
ATOM   5298  C  CA    . CYS A 1 694  ? -17.667 -80.636  -9.016  1.00 3.67  ? 695  CYS A CA    1 
ATOM   5299  C  C     . CYS A 1 694  ? -17.046 -80.671  -7.614  1.00 3.46  ? 695  CYS A C     1 
ATOM   5300  O  O     . CYS A 1 694  ? -17.752 -80.584  -6.623  1.00 3.34  ? 695  CYS A O     1 
ATOM   5301  C  CB    . CYS A 1 694  ? -17.708 -82.090  -9.532  1.00 4.80  ? 695  CYS A CB    1 
ATOM   5302  S  SG    . CYS A 1 694  ? -16.118 -82.836  -10.092 1.00 5.24  ? 695  CYS A SG    1 
ATOM   5303  N  N     . ALA A 1 695  ? -15.726 -80.874  -7.553  1.00 3.04  ? 696  ALA A N     1 
ATOM   5304  C  CA    . ALA A 1 695  ? -15.026 -80.962  -6.279  1.00 3.01  ? 696  ALA A CA    1 
ATOM   5305  C  C     . ALA A 1 695  ? -15.088 -79.655  -5.478  1.00 2.84  ? 696  ALA A C     1 
ATOM   5306  O  O     . ALA A 1 695  ? -15.386 -79.667  -4.288  1.00 2.73  ? 696  ALA A O     1 
ATOM   5307  C  CB    . ALA A 1 695  ? -13.591 -81.398  -6.496  1.00 2.36  ? 696  ALA A CB    1 
ATOM   5308  N  N     . PHE A 1 696  ? -14.859 -78.538  -6.161  1.00 2.87  ? 697  PHE A N     1 
ATOM   5309  C  CA    . PHE A 1 696  ? -14.878 -77.178  -5.602  1.00 2.19  ? 697  PHE A CA    1 
ATOM   5310  C  C     . PHE A 1 696  ? -16.183 -76.822  -4.886  1.00 2.38  ? 697  PHE A C     1 
ATOM   5311  O  O     . PHE A 1 696  ? -16.210 -76.251  -3.793  1.00 2.06  ? 697  PHE A O     1 
ATOM   5312  C  CB    . PHE A 1 696  ? -14.739 -76.216  -6.773  1.00 2.00  ? 697  PHE A CB    1 
ATOM   5313  C  CG    . PHE A 1 696  ? -14.344 -74.871  -6.387  1.00 2.01  ? 697  PHE A CG    1 
ATOM   5314  C  CD1   . PHE A 1 696  ? -15.288 -73.931  -5.990  1.00 2.35  ? 697  PHE A CD1   1 
ATOM   5315  C  CD2   . PHE A 1 696  ? -13.016 -74.519  -6.430  1.00 2.35  ? 697  PHE A CD2   1 
ATOM   5316  C  CE1   . PHE A 1 696  ? -14.899 -72.654  -5.642  1.00 2.72  ? 697  PHE A CE1   1 
ATOM   5317  C  CE2   . PHE A 1 696  ? -12.602 -73.248  -6.092  1.00 2.57  ? 697  PHE A CE2   1 
ATOM   5318  C  CZ    . PHE A 1 696  ? -13.539 -72.304  -5.693  1.00 2.28  ? 697  PHE A CZ    1 
ATOM   5319  N  N     . VAL A 1 697  ? -17.262 -77.278  -5.494  1.00 2.60  ? 698  VAL A N     1 
ATOM   5320  C  CA    . VAL A 1 697  ? -18.640 -77.003  -5.107  1.00 2.44  ? 698  VAL A CA    1 
ATOM   5321  C  C     . VAL A 1 697  ? -19.302 -77.857  -3.996  1.00 2.99  ? 698  VAL A C     1 
ATOM   5322  O  O     . VAL A 1 697  ? -20.320 -77.452  -3.406  1.00 2.54  ? 698  VAL A O     1 
ATOM   5323  C  CB    . VAL A 1 697  ? -19.405 -77.039  -6.435  1.00 2.21  ? 698  VAL A CB    1 
ATOM   5324  C  CG1   . VAL A 1 697  ? -20.534 -78.049  -6.453  1.00 2.00  ? 698  VAL A CG1   1 
ATOM   5325  C  CG2   . VAL A 1 697  ? -19.719 -75.654  -6.887  1.00 2.00  ? 698  VAL A CG2   1 
ATOM   5326  N  N     . CYS A 1 698  ? -18.710 -79.017  -3.693  1.00 2.97  ? 699  CYS A N     1 
ATOM   5327  C  CA    . CYS A 1 698  ? -19.255 -79.945  -2.679  1.00 2.62  ? 699  CYS A CA    1 
ATOM   5328  C  C     . CYS A 1 698  ? -19.291 -79.432  -1.210  1.00 2.45  ? 699  CYS A C     1 
ATOM   5329  O  O     . CYS A 1 698  ? -18.250 -79.109  -0.629  1.00 2.63  ? 699  CYS A O     1 
ATOM   5330  C  CB    . CYS A 1 698  ? -18.513 -81.268  -2.783  1.00 2.00  ? 699  CYS A CB    1 
ATOM   5331  S  SG    . CYS A 1 698  ? -19.197 -82.502  -1.684  1.00 2.56  ? 699  CYS A SG    1 
ATOM   5332  N  N     . PRO A 1 699  ? -20.483 -79.405  -0.572  1.00 2.20  ? 700  PRO A N     1 
ATOM   5333  C  CA    . PRO A 1 699  ? -20.586 -78.924  0.806   1.00 2.13  ? 700  PRO A CA    1 
ATOM   5334  C  C     . PRO A 1 699  ? -20.059 -79.897  1.827   1.00 2.65  ? 700  PRO A C     1 
ATOM   5335  O  O     . PRO A 1 699  ? -20.144 -79.644  3.024   1.00 3.01  ? 700  PRO A O     1 
ATOM   5336  C  CB    . PRO A 1 699  ? -22.087 -78.731  0.994   1.00 2.00  ? 700  PRO A CB    1 
ATOM   5337  C  CG    . PRO A 1 699  ? -22.635 -78.685  -0.393  1.00 2.00  ? 700  PRO A CG    1 
ATOM   5338  C  CD    . PRO A 1 699  ? -21.817 -79.713  -1.092  1.00 2.00  ? 700  PRO A CD    1 
ATOM   5339  N  N     . HIS A 1 700  ? -19.572 -81.055  1.373   1.00 3.01  ? 701  HIS A N     1 
ATOM   5340  C  CA    . HIS A 1 700  ? -19.064 -82.054  2.309   1.00 2.37  ? 701  HIS A CA    1 
ATOM   5341  C  C     . HIS A 1 700  ? -17.723 -82.697  2.013   1.00 2.66  ? 701  HIS A C     1 
ATOM   5342  O  O     . HIS A 1 700  ? -17.253 -83.564  2.787   1.00 3.17  ? 701  HIS A O     1 
ATOM   5343  C  CB    . HIS A 1 700  ? -20.122 -83.105  2.547   1.00 2.10  ? 701  HIS A CB    1 
ATOM   5344  C  CG    . HIS A 1 700  ? -21.228 -82.627  3.421   1.00 2.00  ? 701  HIS A CG    1 
ATOM   5345  N  ND1   . HIS A 1 700  ? -22.245 -81.820  2.952   1.00 2.00  ? 701  HIS A ND1   1 
ATOM   5346  C  CD2   . HIS A 1 700  ? -21.444 -82.782  4.745   1.00 2.00  ? 701  HIS A CD2   1 
ATOM   5347  C  CE1   . HIS A 1 700  ? -23.040 -81.498  3.954   1.00 2.00  ? 701  HIS A CE1   1 
ATOM   5348  N  NE2   . HIS A 1 700  ? -22.575 -82.063  5.053   1.00 2.00  ? 701  HIS A NE2   1 
ATOM   5349  N  N     . SER A 1 701  ? -17.061 -82.218  0.954   1.00 2.40  ? 702  SER A N     1 
ATOM   5350  C  CA    . SER A 1 701  ? -15.758 -82.737  0.534   1.00 2.28  ? 702  SER A CA    1 
ATOM   5351  C  C     . SER A 1 701  ? -15.898 -84.204  0.126   1.00 2.20  ? 702  SER A C     1 
ATOM   5352  O  O     . SER A 1 701  ? -15.001 -84.994  0.409   1.00 2.31  ? 702  SER A O     1 
ATOM   5353  C  CB    . SER A 1 701  ? -14.724 -82.602  1.678   1.00 2.38  ? 702  SER A CB    1 
ATOM   5354  O  OG    . SER A 1 701  ? -13.384 -82.462  1.206   1.00 2.84  ? 702  SER A OG    1 
ATOM   5355  N  N     . ALA A 1 702  ? -17.006 -84.539  -0.556  1.00 2.14  ? 703  ALA A N     1 
ATOM   5356  C  CA    . ALA A 1 702  ? -17.313 -85.907  -0.986  1.00 2.26  ? 703  ALA A CA    1 
ATOM   5357  C  C     . ALA A 1 702  ? -16.821 -86.345  -2.370  1.00 2.43  ? 703  ALA A C     1 
ATOM   5358  O  O     . ALA A 1 702  ? -17.008 -87.511  -2.766  1.00 2.00  ? 703  ALA A O     1 
ATOM   5359  C  CB    . ALA A 1 702  ? -18.789 -86.160  -0.847  1.00 2.27  ? 703  ALA A CB    1 
ATOM   5360  N  N     . ILE A 1 703  ? -16.219 -85.398  -3.098  1.00 2.58  ? 704  ILE A N     1 
ATOM   5361  C  CA    . ILE A 1 703  ? -15.661 -85.648  -4.421  1.00 2.39  ? 704  ILE A CA    1 
ATOM   5362  C  C     . ILE A 1 703  ? -14.163 -85.489  -4.293  1.00 2.74  ? 704  ILE A C     1 
ATOM   5363  O  O     . ILE A 1 703  ? -13.698 -84.472  -3.747  1.00 3.35  ? 704  ILE A O     1 
ATOM   5364  C  CB    . ILE A 1 703  ? -16.186 -84.636  -5.433  1.00 2.23  ? 704  ILE A CB    1 
ATOM   5365  C  CG1   . ILE A 1 703  ? -17.699 -84.782  -5.539  1.00 2.00  ? 704  ILE A CG1   1 
ATOM   5366  C  CG2   . ILE A 1 703  ? -15.468 -84.775  -6.748  1.00 2.00  ? 704  ILE A CG2   1 
ATOM   5367  C  CD1   . ILE A 1 703  ? -18.317 -83.953  -6.567  1.00 2.22  ? 704  ILE A CD1   1 
ATOM   5368  N  N     . LEU A 1 704  ? -13.422 -86.494  -4.769  1.00 2.78  ? 705  LEU A N     1 
ATOM   5369  C  CA    . LEU A 1 704  ? -11.958 -86.494  -4.731  1.00 2.81  ? 705  LEU A CA    1 
ATOM   5370  C  C     . LEU A 1 704  ? -11.279 -86.540  -6.115  1.00 2.79  ? 705  LEU A C     1 
ATOM   5371  O  O     . LEU A 1 704  ? -11.351 -87.532  -6.806  1.00 2.30  ? 705  LEU A O     1 
ATOM   5372  C  CB    . LEU A 1 704  ? -11.459 -87.675  -3.898  1.00 3.12  ? 705  LEU A CB    1 
ATOM   5373  C  CG    . LEU A 1 704  ? -9.969  -88.100  -3.879  1.00 2.62  ? 705  LEU A CG    1 
ATOM   5374  C  CD1   . LEU A 1 704  ? -9.103  -87.023  -3.342  1.00 3.28  ? 705  LEU A CD1   1 
ATOM   5375  C  CD2   . LEU A 1 704  ? -9.769  -89.331  -3.020  1.00 2.22  ? 705  LEU A CD2   1 
ATOM   5376  N  N     . PRO A 1 705  ? -10.676 -85.420  -6.564  1.00 3.05  ? 706  PRO A N     1 
ATOM   5377  C  CA    . PRO A 1 705  ? -9.981  -85.367  -7.869  1.00 2.73  ? 706  PRO A CA    1 
ATOM   5378  C  C     . PRO A 1 705  ? -8.721  -86.187  -7.692  1.00 2.68  ? 706  PRO A C     1 
ATOM   5379  O  O     . PRO A 1 705  ? -8.047  -86.059  -6.672  1.00 2.91  ? 706  PRO A O     1 
ATOM   5380  C  CB    . PRO A 1 705  ? -9.637  -83.880  -8.014  1.00 2.32  ? 706  PRO A CB    1 
ATOM   5381  C  CG    . PRO A 1 705  ? -10.771 -83.237  -7.360  1.00 2.46  ? 706  PRO A CG    1 
ATOM   5382  C  CD    . PRO A 1 705  ? -10.914 -84.057  -6.065  1.00 2.37  ? 706  PRO A CD    1 
ATOM   5383  N  N     . VAL A 1 706  ? -8.428  -87.073  -8.628  1.00 3.11  ? 707  VAL A N     1 
ATOM   5384  C  CA    . VAL A 1 706  ? -7.242  -87.910  -8.500  1.00 3.67  ? 707  VAL A CA    1 
ATOM   5385  C  C     . VAL A 1 706  ? -6.404  -87.638  -9.730  1.00 4.05  ? 707  VAL A C     1 
ATOM   5386  O  O     . VAL A 1 706  ? -6.916  -87.546  -10.846 1.00 3.40  ? 707  VAL A O     1 
ATOM   5387  C  CB    . VAL A 1 706  ? -7.573  -89.425  -8.357  1.00 3.31  ? 707  VAL A CB    1 
ATOM   5388  C  CG1   . VAL A 1 706  ? -6.285  -90.208  -8.291  1.00 3.74  ? 707  VAL A CG1   1 
ATOM   5389  C  CG2   . VAL A 1 706  ? -8.378  -89.681  -7.099  1.00 2.71  ? 707  VAL A CG2   1 
ATOM   5390  N  N     . LEU A 1 707  ? -5.120  -87.419  -9.492  1.00 4.74  ? 708  LEU A N     1 
ATOM   5391  C  CA    . LEU A 1 707  ? -4.178  -87.106  -10.569 1.00 5.55  ? 708  LEU A CA    1 
ATOM   5392  C  C     . LEU A 1 707  ? -2.947  -87.914  -10.307 1.00 6.00  ? 708  LEU A C     1 
ATOM   5393  O  O     . LEU A 1 707  ? -2.077  -87.498  -9.550  1.00 6.64  ? 708  LEU A O     1 
ATOM   5394  C  CB    . LEU A 1 707  ? -3.812  -85.617  -10.543 1.00 4.19  ? 708  LEU A CB    1 
ATOM   5395  C  CG    . LEU A 1 707  ? -3.008  -85.278  -11.773 1.00 2.55  ? 708  LEU A CG    1 
ATOM   5396  C  CD1   . LEU A 1 707  ? -3.911  -85.149  -12.941 1.00 2.00  ? 708  LEU A CD1   1 
ATOM   5397  C  CD2   . LEU A 1 707  ? -2.257  -84.033  -11.499 1.00 3.10  ? 708  LEU A CD2   1 
ATOM   5398  N  N     . ALA A 1 708  ? -2.846  -89.055  -10.957 1.00 7.31  ? 709  ALA A N     1 
ATOM   5399  C  CA    . ALA A 1 708  ? -1.722  -89.942  -10.682 1.00 8.15  ? 709  ALA A CA    1 
ATOM   5400  C  C     . ALA A 1 708  ? -0.994  -90.327  -11.916 1.00 9.56  ? 709  ALA A C     1 
ATOM   5401  O  O     . ALA A 1 708  ? -1.576  -90.310  -12.994 1.00 9.94  ? 709  ALA A O     1 
ATOM   5402  C  CB    . ALA A 1 708  ? -2.230  -91.183  -10.018 1.00 7.10  ? 709  ALA A CB    1 
ATOM   5403  N  N     . LYS A 1 709  ? 0.308   -90.550  -11.783 1.00 11.40 ? 710  LYS A N     1 
ATOM   5404  C  CA    . LYS A 1 709  ? 1.089   -91.063  -12.903 1.00 13.55 ? 710  LYS A CA    1 
ATOM   5405  C  C     . LYS A 1 709  ? 0.847   -92.582  -12.837 1.00 14.14 ? 710  LYS A C     1 
ATOM   5406  O  O     . LYS A 1 709  ? 0.596   -93.091  -11.755 1.00 14.02 ? 710  LYS A O     1 
ATOM   5407  C  CB    . LYS A 1 709  ? 2.552   -90.708  -12.737 1.00 14.62 ? 710  LYS A CB    1 
ATOM   5408  C  CG    . LYS A 1 709  ? 3.043   -90.929  -11.357 1.00 16.14 ? 710  LYS A CG    1 
ATOM   5409  C  CD    . LYS A 1 709  ? 3.732   -89.688  -10.853 1.00 18.27 ? 710  LYS A CD    1 
ATOM   5410  C  CE    . LYS A 1 709  ? 4.794   -90.047  -9.808  1.00 19.16 ? 710  LYS A CE    1 
ATOM   5411  N  NZ    . LYS A 1 709  ? 5.451   -88.813  -9.293  1.00 21.01 ? 710  LYS A NZ    1 
ATOM   5412  N  N     . GLU A 1 710  ? 0.915   -93.282  -13.973 1.00 15.20 ? 711  GLU A N     1 
ATOM   5413  C  CA    . GLU A 1 710  ? 0.602   -94.712  -14.051 1.00 16.22 ? 711  GLU A CA    1 
ATOM   5414  C  C     . GLU A 1 710  ? 1.159   -95.698  -13.065 1.00 15.94 ? 711  GLU A C     1 
ATOM   5415  O  O     . GLU A 1 710  ? 0.502   -96.710  -12.778 1.00 15.98 ? 711  GLU A O     1 
ATOM   5416  C  CB    . GLU A 1 710  ? 0.722   -95.272  -15.478 1.00 18.13 ? 711  GLU A CB    1 
ATOM   5417  C  CG    . GLU A 1 710  ? 1.928   -94.816  -16.299 1.00 20.84 ? 711  GLU A CG    1 
ATOM   5418  C  CD    . GLU A 1 710  ? 1.753   -95.045  -17.811 1.00 21.49 ? 711  GLU A CD    1 
ATOM   5419  O  OE1   . GLU A 1 710  ? 1.427   -96.186  -18.204 1.00 22.44 ? 711  GLU A OE1   1 
ATOM   5420  O  OE2   . GLU A 1 710  ? 1.948   -94.090  -18.604 1.00 22.65 ? 711  GLU A OE2   1 
ATOM   5421  N  N     . GLU A 1 711  ? 2.328   -95.368  -12.519 1.00 15.53 ? 712  GLU A N     1 
ATOM   5422  C  CA    . GLU A 1 711  ? 3.039   -96.190  -11.552 1.00 15.26 ? 712  GLU A CA    1 
ATOM   5423  C  C     . GLU A 1 711  ? 2.420   -96.090  -10.210 1.00 14.83 ? 712  GLU A C     1 
ATOM   5424  O  O     . GLU A 1 711  ? 2.876   -96.694  -9.251  1.00 14.56 ? 712  GLU A O     1 
ATOM   5425  C  CB    . GLU A 1 711  ? 4.479   -95.746  -11.426 1.00 16.23 ? 712  GLU A CB    1 
ATOM   5426  C  CG    . GLU A 1 711  ? 4.659   -94.267  -11.484 1.00 18.85 ? 712  GLU A CG    1 
ATOM   5427  C  CD    . GLU A 1 711  ? 5.447   -93.886  -12.695 1.00 19.88 ? 712  GLU A CD    1 
ATOM   5428  O  OE1   . GLU A 1 711  ? 6.588   -94.369  -12.825 1.00 21.15 ? 712  GLU A OE1   1 
ATOM   5429  O  OE2   . GLU A 1 711  ? 4.924   -93.147  -13.543 1.00 20.68 ? 712  GLU A OE2   1 
ATOM   5430  N  N     . GLU A 1 712  ? 1.470   -95.191  -10.110 1.00 14.64 ? 713  GLU A N     1 
ATOM   5431  C  CA    . GLU A 1 712  ? 0.766   -95.012  -8.866  1.00 14.02 ? 713  GLU A CA    1 
ATOM   5432  C  C     . GLU A 1 712  ? -0.589  -95.710  -8.957  1.00 13.57 ? 713  GLU A C     1 
ATOM   5433  O  O     . GLU A 1 712  ? -1.353  -95.752  -7.986  1.00 13.60 ? 713  GLU A O     1 
ATOM   5434  C  CB    . GLU A 1 712  ? 0.550   -93.540  -8.566  1.00 14.09 ? 713  GLU A CB    1 
ATOM   5435  C  CG    . GLU A 1 712  ? 1.793   -92.692  -8.450  1.00 14.14 ? 713  GLU A CG    1 
ATOM   5436  C  CD    . GLU A 1 712  ? 1.418   -91.226  -8.219  1.00 14.66 ? 713  GLU A CD    1 
ATOM   5437  O  OE1   . GLU A 1 712  ? 1.181   -90.477  -9.208  1.00 14.49 ? 713  GLU A OE1   1 
ATOM   5438  O  OE2   . GLU A 1 712  ? 1.322   -90.828  -7.032  1.00 15.27 ? 713  GLU A OE2   1 
ATOM   5439  N  N     . LEU A 1 713  ? -0.928  -96.181  -10.146 1.00 12.56 ? 714  LEU A N     1 
ATOM   5440  C  CA    . LEU A 1 713  ? -2.184  -96.869  -10.297 1.00 11.94 ? 714  LEU A CA    1 
ATOM   5441  C  C     . LEU A 1 713  ? -2.017  -98.381  -10.355 1.00 12.26 ? 714  LEU A C     1 
ATOM   5442  O  O     . LEU A 1 713  ? -2.966  -99.076  -10.668 1.00 12.40 ? 714  LEU A O     1 
ATOM   5443  C  CB    . LEU A 1 713  ? -2.889  -96.397  -11.553 1.00 10.92 ? 714  LEU A CB    1 
ATOM   5444  C  CG    . LEU A 1 713  ? -3.472  -94.999  -11.598 1.00 9.63  ? 714  LEU A CG    1 
ATOM   5445  C  CD1   . LEU A 1 713  ? -3.590  -94.441  -10.179 1.00 8.84  ? 714  LEU A CD1   1 
ATOM   5446  C  CD2   . LEU A 1 713  ? -2.632  -94.119  -12.482 1.00 8.66  ? 714  LEU A CD2   1 
ATOM   5447  N  N     . VAL A 1 714  ? -0.828  -98.875  -10.023 1.00 12.89 ? 715  VAL A N     1 
ATOM   5448  C  CA    . VAL A 1 714  ? -0.535  -100.305 -10.080 1.00 13.66 ? 715  VAL A CA    1 
ATOM   5449  C  C     . VAL A 1 714  ? -1.528  -101.227 -9.362  1.00 14.41 ? 715  VAL A C     1 
ATOM   5450  O  O     . VAL A 1 714  ? -2.121  -102.108 -9.994  1.00 15.53 ? 715  VAL A O     1 
ATOM   5451  C  CB    . VAL A 1 714  ? 0.941   -100.609 -9.649  1.00 13.28 ? 715  VAL A CB    1 
ATOM   5452  C  CG1   . VAL A 1 714  ? 1.134   -102.098 -9.381  1.00 11.84 ? 715  VAL A CG1   1 
ATOM   5453  C  CG2   . VAL A 1 714  ? 1.904   -100.149 -10.759 1.00 12.94 ? 715  VAL A CG2   1 
ATOM   5454  N  N     . GLY A 1 715  ? -1.711  -101.057 -8.062  1.00 14.48 ? 716  GLY A N     1 
ATOM   5455  C  CA    . GLY A 1 715  ? -2.662  -101.922 -7.395  1.00 14.68 ? 716  GLY A CA    1 
ATOM   5456  C  C     . GLY A 1 715  ? -4.093  -101.383 -7.444  1.00 14.52 ? 716  GLY A C     1 
ATOM   5457  O  O     . GLY A 1 715  ? -4.888  -101.662 -6.532  1.00 14.10 ? 716  GLY A O     1 
ATOM   5458  N  N     . ALA A 1 716  ? -4.421  -100.637 -8.511  1.00 14.38 ? 717  ALA A N     1 
ATOM   5459  C  CA    . ALA A 1 716  ? -5.749  -100.027 -8.672  1.00 13.74 ? 717  ALA A CA    1 
ATOM   5460  C  C     . ALA A 1 716  ? -6.789  -101.033 -9.122  1.00 13.07 ? 717  ALA A C     1 
ATOM   5461  O  O     . ALA A 1 716  ? -6.493  -101.911 -9.934  1.00 13.48 ? 717  ALA A O     1 
ATOM   5462  C  CB    . ALA A 1 716  ? -5.686  -98.862  -9.676  1.00 13.78 ? 717  ALA A CB    1 
ATOM   5463  N  N     . PRO A 1 717  ? -8.008  -100.933 -8.573  1.00 12.23 ? 718  PRO A N     1 
ATOM   5464  C  CA    . PRO A 1 717  ? -9.111  -101.831 -8.922  1.00 11.94 ? 718  PRO A CA    1 
ATOM   5465  C  C     . PRO A 1 717  ? -9.451  -101.712 -10.423 1.00 12.07 ? 718  PRO A C     1 
ATOM   5466  O  O     . PRO A 1 717  ? -9.237  -100.653 -11.049 1.00 11.82 ? 718  PRO A O     1 
ATOM   5467  C  CB    . PRO A 1 717  ? -10.250 -101.340 -8.024  1.00 11.51 ? 718  PRO A CB    1 
ATOM   5468  C  CG    . PRO A 1 717  ? -9.519  -100.821 -6.820  1.00 11.67 ? 718  PRO A CG    1 
ATOM   5469  C  CD    . PRO A 1 717  ? -8.383  -100.053 -7.451  1.00 12.13 ? 718  PRO A CD    1 
ATOM   5470  N  N     . ALA A 1 718  ? -9.927  -102.819 -10.981 1.00 11.73 ? 719  ALA A N     1 
ATOM   5471  C  CA    . ALA A 1 718  ? -10.263 -102.906 -12.378 1.00 12.13 ? 719  ALA A CA    1 
ATOM   5472  C  C     . ALA A 1 718  ? -11.081 -101.727 -12.841 1.00 12.40 ? 719  ALA A C     1 
ATOM   5473  O  O     . ALA A 1 718  ? -10.700 -101.085 -13.810 1.00 14.00 ? 719  ALA A O     1 
ATOM   5474  C  CB    . ALA A 1 718  ? -10.991 -104.237 -12.670 1.00 12.27 ? 719  ALA A CB    1 
ATOM   5475  N  N     . ASN A 1 719  ? -12.150 -101.385 -12.118 1.00 11.84 ? 720  ASN A N     1 
ATOM   5476  C  CA    . ASN A 1 719  ? -13.026 -100.271 -12.491 1.00 10.55 ? 720  ASN A CA    1 
ATOM   5477  C  C     . ASN A 1 719  ? -12.620 -98.861  -12.092 1.00 9.49  ? 720  ASN A C     1 
ATOM   5478  O  O     . ASN A 1 719  ? -13.422 -97.940  -12.192 1.00 9.20  ? 720  ASN A O     1 
ATOM   5479  C  CB    . ASN A 1 719  ? -14.445 -100.530 -12.005 1.00 11.18 ? 720  ASN A CB    1 
ATOM   5480  C  CG    . ASN A 1 719  ? -14.528 -100.788 -10.496 1.00 11.68 ? 720  ASN A CG    1 
ATOM   5481  O  OD1   . ASN A 1 719  ? -15.547 -101.308 -9.992  1.00 12.80 ? 720  ASN A OD1   1 
ATOM   5482  N  ND2   . ASN A 1 719  ? -13.469 -100.447 -9.768  1.00 11.57 ? 720  ASN A ND2   1 
ATOM   5483  N  N     . PHE A 1 720  ? -11.391 -98.693  -11.625 1.00 8.73  ? 721  PHE A N     1 
ATOM   5484  C  CA    . PHE A 1 720  ? -10.884 -97.377  -11.220 1.00 8.31  ? 721  PHE A CA    1 
ATOM   5485  C  C     . PHE A 1 720  ? -10.546 -96.617  -12.524 1.00 8.60  ? 721  PHE A C     1 
ATOM   5486  O  O     . PHE A 1 720  ? -9.389  -96.249  -12.756 1.00 8.72  ? 721  PHE A O     1 
ATOM   5487  C  CB    . PHE A 1 720  ? -9.616  -97.592  -10.383 1.00 7.86  ? 721  PHE A CB    1 
ATOM   5488  C  CG    . PHE A 1 720  ? -9.216  -96.407  -9.561  1.00 7.10  ? 721  PHE A CG    1 
ATOM   5489  C  CD1   . PHE A 1 720  ? -9.964  -96.040  -8.439  1.00 6.95  ? 721  PHE A CD1   1 
ATOM   5490  C  CD2   . PHE A 1 720  ? -8.086  -95.668  -9.887  1.00 6.58  ? 721  PHE A CD2   1 
ATOM   5491  C  CE1   . PHE A 1 720  ? -9.578  -94.950  -7.648  1.00 6.13  ? 721  PHE A CE1   1 
ATOM   5492  C  CE2   . PHE A 1 720  ? -7.702  -94.582  -9.102  1.00 6.76  ? 721  PHE A CE2   1 
ATOM   5493  C  CZ    . PHE A 1 720  ? -8.447  -94.226  -7.979  1.00 6.29  ? 721  PHE A CZ    1 
ATOM   5494  N  N     . THR A 1 721  ? -11.557 -96.383  -13.370 1.00 8.43  ? 722  THR A N     1 
ATOM   5495  C  CA    . THR A 1 721  ? -11.338 -95.742  -14.666 1.00 8.43  ? 722  THR A CA    1 
ATOM   5496  C  C     . THR A 1 721  ? -10.724 -94.344  -14.566 1.00 8.90  ? 722  THR A C     1 
ATOM   5497  O  O     . THR A 1 721  ? -11.290 -93.471  -13.915 1.00 8.71  ? 722  THR A O     1 
ATOM   5498  C  CB    . THR A 1 721  ? -12.649 -95.596  -15.438 1.00 8.30  ? 722  THR A CB    1 
ATOM   5499  O  OG1   . THR A 1 721  ? -13.475 -96.761  -15.242 1.00 8.20  ? 722  THR A OG1   1 
ATOM   5500  C  CG2   . THR A 1 721  ? -12.355 -95.357  -16.939 1.00 7.73  ? 722  THR A CG2   1 
ATOM   5501  N  N     . ALA A 1 722  ? -9.613  -94.121  -15.266 1.00 9.23  ? 723  ALA A N     1 
ATOM   5502  C  CA    . ALA A 1 722  ? -8.967  -92.812  -15.236 1.00 9.87  ? 723  ALA A CA    1 
ATOM   5503  C  C     . ALA A 1 722  ? -8.589  -92.273  -16.621 1.00 9.81  ? 723  ALA A C     1 
ATOM   5504  O  O     . ALA A 1 722  ? -7.851  -92.904  -17.363 1.00 11.27 ? 723  ALA A O     1 
ATOM   5505  C  CB    . ALA A 1 722  ? -7.730  -92.851  -14.314 1.00 10.00 ? 723  ALA A CB    1 
ATOM   5506  N  N     . LEU A 1 723  ? -9.089  -91.100  -16.952 1.00 9.45  ? 724  LEU A N     1 
ATOM   5507  C  CA    . LEU A 1 723  ? -8.804  -90.457  -18.229 1.00 9.32  ? 724  LEU A CA    1 
ATOM   5508  C  C     . LEU A 1 723  ? -7.351  -89.961  -18.311 1.00 9.76  ? 724  LEU A C     1 
ATOM   5509  O  O     . LEU A 1 723  ? -6.686  -89.841  -17.278 1.00 9.45  ? 724  LEU A O     1 
ATOM   5510  C  CB    . LEU A 1 723  ? -9.707  -89.225  -18.359 1.00 7.97  ? 724  LEU A CB    1 
ATOM   5511  C  CG    . LEU A 1 723  ? -11.201 -89.437  -18.116 1.00 6.89  ? 724  LEU A CG    1 
ATOM   5512  C  CD1   . LEU A 1 723  ? -11.846 -88.095  -17.981 1.00 6.25  ? 724  LEU A CD1   1 
ATOM   5513  C  CD2   . LEU A 1 723  ? -11.812 -90.208  -19.280 1.00 6.13  ? 724  LEU A CD2   1 
ATOM   5514  N  N     . GLU A 1 724  ? -6.856  -89.689  -19.526 1.00 10.08 ? 725  GLU A N     1 
ATOM   5515  C  CA    . GLU A 1 724  ? -5.500  -89.140  -19.680 1.00 11.02 ? 725  GLU A CA    1 
ATOM   5516  C  C     . GLU A 1 724  ? -5.641  -87.645  -19.329 1.00 11.32 ? 725  GLU A C     1 
ATOM   5517  O  O     . GLU A 1 724  ? -6.550  -86.961  -19.814 1.00 11.48 ? 725  GLU A O     1 
ATOM   5518  C  CB    . GLU A 1 724  ? -5.009  -89.277  -21.128 1.00 12.43 ? 725  GLU A CB    1 
ATOM   5519  C  CG    . GLU A 1 724  ? -3.562  -88.870  -21.375 0.01 14.35 ? 725  GLU A CG    1 
ATOM   5520  C  CD    . GLU A 1 724  ? -3.273  -88.610  -22.847 0.01 15.40 ? 725  GLU A CD    1 
ATOM   5521  O  OE1   . GLU A 1 724  ? -3.362  -89.554  -23.662 0.01 16.07 ? 725  GLU A OE1   1 
ATOM   5522  O  OE2   . GLU A 1 724  ? -2.957  -87.451  -23.190 0.01 16.06 ? 725  GLU A OE2   1 
ATOM   5523  N  N     . ALA A 1 725  ? -4.769  -87.139  -18.478 1.00 11.36 ? 726  ALA A N     1 
ATOM   5524  C  CA    . ALA A 1 725  ? -4.862  -85.747  -18.082 1.00 11.89 ? 726  ALA A CA    1 
ATOM   5525  C  C     . ALA A 1 725  ? -4.761  -84.737  -19.200 1.00 12.39 ? 726  ALA A C     1 
ATOM   5526  O  O     . ALA A 1 725  ? -3.904  -84.809  -20.087 1.00 12.42 ? 726  ALA A O     1 
ATOM   5527  C  CB    . ALA A 1 725  ? -3.870  -85.423  -16.986 1.00 11.58 ? 726  ALA A CB    1 
ATOM   5528  N  N     . LYS A 1 726  ? -5.744  -83.853  -19.192 1.00 13.48 ? 727  LYS A N     1 
ATOM   5529  C  CA    . LYS A 1 726  ? -5.846  -82.771  -20.139 1.00 14.39 ? 727  LYS A CA    1 
ATOM   5530  C  C     . LYS A 1 726  ? -5.030  -81.657  -19.551 1.00 14.83 ? 727  LYS A C     1 
ATOM   5531  O  O     . LYS A 1 726  ? -5.251  -81.271  -18.409 1.00 14.90 ? 727  LYS A O     1 
ATOM   5532  C  CB    . LYS A 1 726  ? -7.300  -82.289  -20.256 1.00 15.18 ? 727  LYS A CB    1 
ATOM   5533  C  CG    . LYS A 1 726  ? -8.232  -83.154  -21.146 1.00 17.03 ? 727  LYS A CG    1 
ATOM   5534  C  CD    . LYS A 1 726  ? -9.678  -82.600  -21.154 1.00 18.09 ? 727  LYS A CD    1 
ATOM   5535  C  CE    . LYS A 1 726  ? -10.640 -83.403  -22.051 1.00 19.08 ? 727  LYS A CE    1 
ATOM   5536  N  NZ    . LYS A 1 726  ? -11.022 -84.755  -21.510 1.00 20.64 ? 727  LYS A NZ    1 
ATOM   5537  N  N     . GLY A 1 727  ? -4.070  -81.145  -20.311 1.00 16.22 ? 728  GLY A N     1 
ATOM   5538  C  CA    . GLY A 1 727  ? -3.291  -80.029  -19.811 1.00 17.36 ? 728  GLY A CA    1 
ATOM   5539  C  C     . GLY A 1 727  ? -1.846  -80.025  -20.209 1.00 18.24 ? 728  GLY A C     1 
ATOM   5540  O  O     . GLY A 1 727  ? -1.211  -81.092  -20.255 1.00 18.92 ? 728  GLY A O     1 
ATOM   5541  N  N     . LYS A 1 728  ? -1.350  -78.825  -20.526 1.00 18.77 ? 729  LYS A N     1 
ATOM   5542  C  CA    . LYS A 1 728  ? 0.049   -78.591  -20.893 1.00 19.42 ? 729  LYS A CA    1 
ATOM   5543  C  C     . LYS A 1 728  ? 0.896   -79.167  -19.733 1.00 19.05 ? 729  LYS A C     1 
ATOM   5544  O  O     . LYS A 1 728  ? 1.630   -80.152  -19.907 1.00 18.92 ? 729  LYS A O     1 
ATOM   5545  C  CB    . LYS A 1 728  ? 0.242   -77.058  -21.093 1.00 20.79 ? 729  LYS A CB    1 
ATOM   5546  C  CG    . LYS A 1 728  ? 1.634   -76.452  -20.794 1.00 22.71 ? 729  LYS A CG    1 
ATOM   5547  C  CD    . LYS A 1 728  ? 1.590   -74.885  -20.689 1.00 23.68 ? 729  LYS A CD    1 
ATOM   5548  C  CE    . LYS A 1 728  ? 2.817   -74.316  -19.906 1.00 24.94 ? 729  LYS A CE    1 
ATOM   5549  N  NZ    . LYS A 1 728  ? 3.114   -72.825  -20.052 1.00 25.99 ? 729  LYS A NZ    1 
ATOM   5550  N  N     . GLU A 1 729  ? 0.648   -78.662  -18.524 1.00 18.73 ? 730  GLU A N     1 
ATOM   5551  C  CA    . GLU A 1 729  ? 1.346   -79.131  -17.330 1.00 18.71 ? 730  GLU A CA    1 
ATOM   5552  C  C     . GLU A 1 729  ? 1.033   -80.578  -16.900 1.00 17.51 ? 730  GLU A C     1 
ATOM   5553  O  O     . GLU A 1 729  ? 1.878   -81.220  -16.279 1.00 17.72 ? 730  GLU A O     1 
ATOM   5554  C  CB    . GLU A 1 729  ? 1.065   -78.223  -16.127 1.00 19.77 ? 730  GLU A CB    1 
ATOM   5555  C  CG    . GLU A 1 729  ? 1.488   -76.786  -16.287 1.00 21.60 ? 730  GLU A CG    1 
ATOM   5556  C  CD    . GLU A 1 729  ? 0.358   -75.878  -16.797 1.00 23.42 ? 730  GLU A CD    1 
ATOM   5557  O  OE1   . GLU A 1 729  ? -0.763  -76.404  -17.106 1.00 23.39 ? 730  GLU A OE1   1 
ATOM   5558  O  OE2   . GLU A 1 729  ? 0.615   -74.639  -16.908 1.00 23.45 ? 730  GLU A OE2   1 
ATOM   5559  N  N     . LEU A 1 730  ? -0.155  -81.085  -17.214 1.00 15.90 ? 731  LEU A N     1 
ATOM   5560  C  CA    . LEU A 1 730  ? -0.523  -82.434  -16.777 1.00 15.17 ? 731  LEU A CA    1 
ATOM   5561  C  C     . LEU A 1 730  ? -0.492  -83.482  -17.928 1.00 16.03 ? 731  LEU A C     1 
ATOM   5562  O  O     . LEU A 1 730  ? -1.499  -84.123  -18.259 1.00 15.82 ? 731  LEU A O     1 
ATOM   5563  C  CB    . LEU A 1 730  ? -1.905  -82.378  -16.084 1.00 13.15 ? 731  LEU A CB    1 
ATOM   5564  C  CG    . LEU A 1 730  ? -2.327  -81.151  -15.227 1.00 11.36 ? 731  LEU A CG    1 
ATOM   5565  C  CD1   . LEU A 1 730  ? -3.674  -81.375  -14.595 1.00 9.91  ? 731  LEU A CD1   1 
ATOM   5566  C  CD2   . LEU A 1 730  ? -1.335  -80.882  -14.132 1.00 11.24 ? 731  LEU A CD2   1 
ATOM   5567  N  N     . LYS A 1 731  ? 0.684   -83.727  -18.495 1.00 17.16 ? 732  LYS A N     1 
ATOM   5568  C  CA    . LYS A 1 731  ? 0.752   -84.663  -19.617 1.00 17.95 ? 732  LYS A CA    1 
ATOM   5569  C  C     . LYS A 1 731  ? 0.712   -86.183  -19.285 1.00 17.02 ? 732  LYS A C     1 
ATOM   5570  O  O     . LYS A 1 731  ? -0.203  -86.934  -19.715 1.00 17.15 ? 732  LYS A O     1 
ATOM   5571  C  CB    . LYS A 1 731  ? 1.962   -84.331  -20.519 1.00 20.36 ? 732  LYS A CB    1 
ATOM   5572  C  CG    . LYS A 1 731  ? 1.620   -84.285  -22.034 1.00 22.89 ? 732  LYS A CG    1 
ATOM   5573  C  CD    . LYS A 1 731  ? 2.859   -84.119  -22.926 1.00 24.76 ? 732  LYS A CD    1 
ATOM   5574  C  CE    . LYS A 1 731  ? 2.555   -83.150  -24.106 1.00 25.98 ? 732  LYS A CE    1 
ATOM   5575  N  NZ    . LYS A 1 731  ? 3.663   -82.997  -25.154 1.00 26.27 ? 732  LYS A NZ    1 
ATOM   5576  N  N     . GLY A 1 732  ? 1.687   -86.636  -18.515 1.00 15.14 ? 733  GLY A N     1 
ATOM   5577  C  CA    . GLY A 1 732  ? 1.720   -88.046  -18.188 1.00 13.36 ? 733  GLY A CA    1 
ATOM   5578  C  C     . GLY A 1 732  ? 0.703   -88.571  -17.194 1.00 11.82 ? 733  GLY A C     1 
ATOM   5579  O  O     . GLY A 1 732  ? 0.485   -89.794  -17.104 1.00 12.00 ? 733  GLY A O     1 
ATOM   5580  N  N     . TYR A 1 733  ? 0.024   -87.660  -16.499 1.00 10.01 ? 734  TYR A N     1 
ATOM   5581  C  CA    . TYR A 1 733  ? -0.925  -88.079  -15.468 1.00 7.82  ? 734  TYR A CA    1 
ATOM   5582  C  C     . TYR A 1 733  ? -2.210  -88.655  -15.997 1.00 7.44  ? 734  TYR A C     1 
ATOM   5583  O  O     . TYR A 1 733  ? -2.564  -88.525  -17.172 1.00 7.17  ? 734  TYR A O     1 
ATOM   5584  C  CB    . TYR A 1 733  ? -1.263  -86.920  -14.537 1.00 6.57  ? 734  TYR A CB    1 
ATOM   5585  C  CG    . TYR A 1 733  ? -0.080  -86.308  -13.841 1.00 4.69  ? 734  TYR A CG    1 
ATOM   5586  C  CD1   . TYR A 1 733  ? 0.451   -86.879  -12.703 1.00 4.30  ? 734  TYR A CD1   1 
ATOM   5587  C  CD2   . TYR A 1 733  ? 0.506   -85.176  -14.335 1.00 3.76  ? 734  TYR A CD2   1 
ATOM   5588  C  CE1   . TYR A 1 733  ? 1.544   -86.324  -12.078 1.00 4.17  ? 734  TYR A CE1   1 
ATOM   5589  C  CE2   . TYR A 1 733  ? 1.589   -84.622  -13.724 1.00 4.23  ? 734  TYR A CE2   1 
ATOM   5590  C  CZ    . TYR A 1 733  ? 2.103   -85.191  -12.604 1.00 4.60  ? 734  TYR A CZ    1 
ATOM   5591  O  OH    . TYR A 1 733  ? 3.202   -84.574  -12.032 1.00 6.65  ? 734  TYR A OH    1 
ATOM   5592  N  N     . LYS A 1 734  ? -2.910  -89.272  -15.075 1.00 6.98  ? 735  LYS A N     1 
ATOM   5593  C  CA    . LYS A 1 734  ? -4.179  -89.862  -15.341 1.00 7.35  ? 735  LYS A CA    1 
ATOM   5594  C  C     . LYS A 1 734  ? -5.102  -89.105  -14.385 1.00 7.00  ? 735  LYS A C     1 
ATOM   5595  O  O     . LYS A 1 734  ? -4.719  -88.800  -13.241 1.00 6.66  ? 735  LYS A O     1 
ATOM   5596  C  CB    . LYS A 1 734  ? -4.134  -91.365  -15.017 1.00 8.48  ? 735  LYS A CB    1 
ATOM   5597  C  CG    . LYS A 1 734  ? -3.125  -92.156  -15.856 1.00 10.45 ? 735  LYS A CG    1 
ATOM   5598  C  CD    . LYS A 1 734  ? -3.304  -91.929  -17.370 1.00 12.58 ? 735  LYS A CD    1 
ATOM   5599  C  CE    . LYS A 1 734  ? -3.518  -93.234  -18.187 1.00 14.84 ? 735  LYS A CE    1 
ATOM   5600  N  NZ    . LYS A 1 734  ? -4.970  -93.443  -18.693 1.00 16.26 ? 735  LYS A NZ    1 
ATOM   5601  N  N     . PHE A 1 735  ? -6.292  -88.771  -14.877 1.00 6.41  ? 736  PHE A N     1 
ATOM   5602  C  CA    . PHE A 1 735  ? -7.292  -88.056  -14.106 1.00 6.27  ? 736  PHE A CA    1 
ATOM   5603  C  C     . PHE A 1 735  ? -8.565  -88.868  -13.854 1.00 6.06  ? 736  PHE A C     1 
ATOM   5604  O  O     . PHE A 1 735  ? -9.089  -89.482  -14.787 1.00 6.69  ? 736  PHE A O     1 
ATOM   5605  C  CB    . PHE A 1 735  ? -7.649  -86.766  -14.859 1.00 6.57  ? 736  PHE A CB    1 
ATOM   5606  C  CG    . PHE A 1 735  ? -8.671  -85.902  -14.176 1.00 5.69  ? 736  PHE A CG    1 
ATOM   5607  C  CD1   . PHE A 1 735  ? -10.039 -86.135  -14.331 1.00 5.04  ? 736  PHE A CD1   1 
ATOM   5608  C  CD2   . PHE A 1 735  ? -8.247  -84.823  -13.406 1.00 6.12  ? 736  PHE A CD2   1 
ATOM   5609  C  CE1   . PHE A 1 735  ? -10.969 -85.314  -13.733 1.00 4.90  ? 736  PHE A CE1   1 
ATOM   5610  C  CE2   . PHE A 1 735  ? -9.176  -83.985  -12.803 1.00 6.15  ? 736  PHE A CE2   1 
ATOM   5611  C  CZ    . PHE A 1 735  ? -10.549 -84.239  -12.970 1.00 5.71  ? 736  PHE A CZ    1 
ATOM   5612  N  N     . ARG A 1 736  ? -9.034  -88.854  -12.597 1.00 5.25  ? 737  ARG A N     1 
ATOM   5613  C  CA    . ARG A 1 736  ? -10.273 -89.503  -12.177 1.00 4.86  ? 737  ARG A CA    1 
ATOM   5614  C  C     . ARG A 1 736  ? -11.026 -88.716  -11.088 1.00 5.02  ? 737  ARG A C     1 
ATOM   5615  O  O     . ARG A 1 736  ? -10.434 -88.335  -10.061 1.00 5.59  ? 737  ARG A O     1 
ATOM   5616  C  CB    . ARG A 1 736  ? -10.053 -90.951  -11.658 1.00 4.55  ? 737  ARG A CB    1 
ATOM   5617  C  CG    . ARG A 1 736  ? -11.116 -91.415  -10.675 1.00 3.57  ? 737  ARG A CG    1 
ATOM   5618  C  CD    . ARG A 1 736  ? -11.167 -92.901  -10.415 1.00 4.78  ? 737  ARG A CD    1 
ATOM   5619  N  NE    . ARG A 1 736  ? -12.211 -93.488  -11.248 1.00 7.24  ? 737  ARG A NE    1 
ATOM   5620  C  CZ    . ARG A 1 736  ? -13.333 -94.058  -10.819 1.00 6.87  ? 737  ARG A CZ    1 
ATOM   5621  N  NH1   . ARG A 1 736  ? -13.594 -94.168  -9.534  1.00 6.26  ? 737  ARG A NH1   1 
ATOM   5622  N  NH2   . ARG A 1 736  ? -14.244 -94.413  -11.707 1.00 7.49  ? 737  ARG A NH2   1 
ATOM   5623  N  N     . ILE A 1 737  ? -12.314 -88.453  -11.308 1.00 4.04  ? 738  ILE A N     1 
ATOM   5624  C  CA    . ILE A 1 737  ? -13.121 -87.818  -10.274 1.00 3.93  ? 738  ILE A CA    1 
ATOM   5625  C  C     . ILE A 1 737  ? -13.607 -89.022  -9.446  1.00 4.19  ? 738  ILE A C     1 
ATOM   5626  O  O     . ILE A 1 737  ? -14.174 -89.967  -10.001 1.00 5.10  ? 738  ILE A O     1 
ATOM   5627  C  CB    . ILE A 1 737  ? -14.311 -87.006  -10.885 1.00 3.45  ? 738  ILE A CB    1 
ATOM   5628  C  CG1   . ILE A 1 737  ? -13.799 -85.659  -11.388 1.00 2.00  ? 738  ILE A CG1   1 
ATOM   5629  C  CG2   . ILE A 1 737  ? -15.479 -86.874  -9.884  1.00 2.56  ? 738  ILE A CG2   1 
ATOM   5630  C  CD1   . ILE A 1 737  ? -13.179 -84.790  -10.301 1.00 2.00  ? 738  ILE A CD1   1 
ATOM   5631  N  N     . GLN A 1 738  ? -13.259 -89.063  -8.160  1.00 4.37  ? 739  GLN A N     1 
ATOM   5632  C  CA    . GLN A 1 738  ? -13.638 -90.179  -7.293  1.00 3.89  ? 739  GLN A CA    1 
ATOM   5633  C  C     . GLN A 1 738  ? -14.699 -89.773  -6.289  1.00 4.11  ? 739  GLN A C     1 
ATOM   5634  O  O     . GLN A 1 738  ? -14.463 -88.864  -5.447  1.00 4.16  ? 739  GLN A O     1 
ATOM   5635  C  CB    . GLN A 1 738  ? -12.417 -90.762  -6.594  1.00 4.28  ? 739  GLN A CB    1 
ATOM   5636  C  CG    . GLN A 1 738  ? -12.697 -91.906  -5.600  1.00 5.10  ? 739  GLN A CG    1 
ATOM   5637  C  CD    . GLN A 1 738  ? -13.351 -93.120  -6.237  1.00 6.64  ? 739  GLN A CD    1 
ATOM   5638  O  OE1   . GLN A 1 738  ? -14.508 -93.457  -5.912  1.00 7.80  ? 739  GLN A OE1   1 
ATOM   5639  N  NE2   . GLN A 1 738  ? -12.627 -93.785  -7.146  1.00 5.92  ? 739  GLN A NE2   1 
ATOM   5640  N  N     . ILE A 1 739  ? -15.871 -90.416  -6.389  1.00 3.57  ? 740  ILE A N     1 
ATOM   5641  C  CA    . ILE A 1 739  ? -16.966 -90.109  -5.481  1.00 3.79  ? 740  ILE A CA    1 
ATOM   5642  C  C     . ILE A 1 739  ? -16.779 -90.899  -4.171  1.00 4.41  ? 740  ILE A C     1 
ATOM   5643  O  O     . ILE A 1 739  ? -16.336 -92.073  -4.187  1.00 5.17  ? 740  ILE A O     1 
ATOM   5644  C  CB    . ILE A 1 739  ? -18.347 -90.445  -6.119  1.00 3.29  ? 740  ILE A CB    1 
ATOM   5645  C  CG1   . ILE A 1 739  ? -18.390 -89.920  -7.556  1.00 2.20  ? 740  ILE A CG1   1 
ATOM   5646  C  CG2   . ILE A 1 739  ? -19.508 -89.841  -5.304  1.00 2.60  ? 740  ILE A CG2   1 
ATOM   5647  C  CD1   . ILE A 1 739  ? -18.314 -88.411  -7.669  1.00 2.26  ? 740  ILE A CD1   1 
ATOM   5648  N  N     . ASN A 1 740  ? -17.046 -90.207  -3.053  1.00 4.92  ? 741  ASN A N     1 
ATOM   5649  C  CA    . ASN A 1 740  ? -16.975 -90.739  -1.667  1.00 4.98  ? 741  ASN A CA    1 
ATOM   5650  C  C     . ASN A 1 740  ? -18.461 -90.994  -1.300  1.00 4.58  ? 741  ASN A C     1 
ATOM   5651  O  O     . ASN A 1 740  ? -19.103 -90.239  -0.550  1.00 5.19  ? 741  ASN A O     1 
ATOM   5652  C  CB    . ASN A 1 740  ? -16.332 -89.674  -0.756  1.00 4.94  ? 741  ASN A CB    1 
ATOM   5653  C  CG    . ASN A 1 740  ? -16.133 -90.129  0.718   1.00 5.24  ? 741  ASN A CG    1 
ATOM   5654  O  OD1   . ASN A 1 740  ? -15.360 -89.477  1.458   1.00 5.74  ? 741  ASN A OD1   1 
ATOM   5655  N  ND2   . ASN A 1 740  ? -16.870 -91.156  1.172   1.00 4.16  ? 741  ASN A ND2   1 
ATOM   5656  N  N     . THR A 1 741  ? -18.978 -92.087  -1.839  1.00 3.93  ? 742  THR A N     1 
ATOM   5657  C  CA    . THR A 1 741  ? -20.366 -92.447  -1.686  1.00 3.28  ? 742  THR A CA    1 
ATOM   5658  C  C     . THR A 1 741  ? -20.905 -92.450  -0.267  1.00 3.34  ? 742  THR A C     1 
ATOM   5659  O  O     . THR A 1 741  ? -22.068 -92.082  -0.063  1.00 2.98  ? 742  THR A O     1 
ATOM   5660  C  CB    . THR A 1 741  ? -20.693 -93.758  -2.466  1.00 2.69  ? 742  THR A CB    1 
ATOM   5661  O  OG1   . THR A 1 741  ? -19.911 -94.850  -1.969  1.00 2.08  ? 742  THR A OG1   1 
ATOM   5662  C  CG2   . THR A 1 741  ? -20.353 -93.583  -3.910  1.00 2.00  ? 742  THR A CG2   1 
ATOM   5663  N  N     . LEU A 1 742  ? -20.046 -92.746  0.712   1.00 2.93  ? 743  LEU A N     1 
ATOM   5664  C  CA    . LEU A 1 742  ? -20.491 -92.776  2.093   1.00 2.68  ? 743  LEU A CA    1 
ATOM   5665  C  C     . LEU A 1 742  ? -20.542 -91.423  2.796   1.00 3.27  ? 743  LEU A C     1 
ATOM   5666  O  O     . LEU A 1 742  ? -21.336 -91.223  3.735   1.00 2.80  ? 743  LEU A O     1 
ATOM   5667  C  CB    . LEU A 1 742  ? -19.689 -93.792  2.879   1.00 2.30  ? 743  LEU A CB    1 
ATOM   5668  C  CG    . LEU A 1 742  ? -20.013 -95.195  2.360   1.00 2.51  ? 743  LEU A CG    1 
ATOM   5669  C  CD1   . LEU A 1 742  ? -19.338 -96.248  3.215   1.00 2.00  ? 743  LEU A CD1   1 
ATOM   5670  C  CD2   . LEU A 1 742  ? -21.515 -95.375  2.373   1.00 2.00  ? 743  LEU A CD2   1 
ATOM   5671  N  N     . ASP A 1 743  ? -19.717 -90.478  2.334   1.00 3.72  ? 744  ASP A N     1 
ATOM   5672  C  CA    . ASP A 1 743  ? -19.712 -89.156  2.930   1.00 3.37  ? 744  ASP A CA    1 
ATOM   5673  C  C     . ASP A 1 743  ? -20.581 -88.153  2.203   1.00 2.93  ? 744  ASP A C     1 
ATOM   5674  O  O     . ASP A 1 743  ? -20.935 -87.111  2.743   1.00 3.66  ? 744  ASP A O     1 
ATOM   5675  C  CB    . ASP A 1 743  ? -18.301 -88.660  3.107   1.00 4.12  ? 744  ASP A CB    1 
ATOM   5676  C  CG    . ASP A 1 743  ? -17.676 -89.242  4.333   1.00 5.21  ? 744  ASP A CG    1 
ATOM   5677  O  OD1   . ASP A 1 743  ? -18.369 -89.297  5.392   1.00 6.02  ? 744  ASP A OD1   1 
ATOM   5678  O  OD2   . ASP A 1 743  ? -16.515 -89.665  4.238   1.00 5.30  ? 744  ASP A OD2   1 
ATOM   5679  N  N     . CYS A 1 744  ? -20.978 -88.514  1.002   1.00 2.36  ? 745  CYS A N     1 
ATOM   5680  C  CA    . CYS A 1 744  ? -21.842 -87.708  0.185   1.00 2.23  ? 745  CYS A CA    1 
ATOM   5681  C  C     . CYS A 1 744  ? -23.183 -87.582  0.918   1.00 2.49  ? 745  CYS A C     1 
ATOM   5682  O  O     . CYS A 1 744  ? -23.624 -88.539  1.580   1.00 3.31  ? 745  CYS A O     1 
ATOM   5683  C  CB    . CYS A 1 744  ? -22.003 -88.419  -1.161  1.00 2.00  ? 745  CYS A CB    1 
ATOM   5684  S  SG    . CYS A 1 744  ? -23.215 -87.727  -2.317  1.00 2.11  ? 745  CYS A SG    1 
ATOM   5685  N  N     . MET A 1 745  ? -23.820 -86.410  0.820   1.00 2.69  ? 746  MET A N     1 
ATOM   5686  C  CA    . MET A 1 745  ? -25.098 -86.135  1.473   1.00 2.46  ? 746  MET A CA    1 
ATOM   5687  C  C     . MET A 1 745  ? -26.256 -86.084  0.522   1.00 2.45  ? 746  MET A C     1 
ATOM   5688  O  O     . MET A 1 745  ? -27.330 -85.627  0.889   1.00 2.93  ? 746  MET A O     1 
ATOM   5689  C  CB    . MET A 1 745  ? -25.043 -84.819  2.268   1.00 3.21  ? 746  MET A CB    1 
ATOM   5690  C  CG    . MET A 1 745  ? -24.082 -84.850  3.456   1.00 3.65  ? 746  MET A CG    1 
ATOM   5691  S  SD    . MET A 1 745  ? -24.648 -86.004  4.722   1.00 7.05  ? 746  MET A SD    1 
ATOM   5692  C  CE    . MET A 1 745  ? -25.619 -84.823  5.726   1.00 5.45  ? 746  MET A CE    1 
ATOM   5693  N  N     . GLY A 1 746  ? -26.021 -86.433  -0.733  1.00 3.01  ? 747  GLY A N     1 
ATOM   5694  C  CA    . GLY A 1 746  ? -27.103 -86.482  -1.707  1.00 3.01  ? 747  GLY A CA    1 
ATOM   5695  C  C     . GLY A 1 746  ? -27.746 -85.181  -2.111  1.00 3.67  ? 747  GLY A C     1 
ATOM   5696  O  O     . GLY A 1 746  ? -28.887 -85.203  -2.537  1.00 4.36  ? 747  GLY A O     1 
ATOM   5697  N  N     . CYS A 1 747  ? -27.001 -84.069  -2.089  1.00 3.56  ? 748  CYS A N     1 
ATOM   5698  C  CA    . CYS A 1 747  ? -27.556 -82.756  -2.442  1.00 3.00  ? 748  CYS A CA    1 
ATOM   5699  C  C     . CYS A 1 747  ? -27.814 -82.469  -3.911  1.00 2.42  ? 748  CYS A C     1 
ATOM   5700  O  O     . CYS A 1 747  ? -28.871 -81.950  -4.277  1.00 2.00  ? 748  CYS A O     1 
ATOM   5701  C  CB    . CYS A 1 747  ? -26.710 -81.639  -1.810  1.00 2.96  ? 748  CYS A CB    1 
ATOM   5702  S  SG    . CYS A 1 747  ? -25.126 -81.175  -2.557  1.00 2.18  ? 748  CYS A SG    1 
ATOM   5703  N  N     . GLY A 1 748  ? -26.828 -82.782  -4.740  1.00 2.64  ? 749  GLY A N     1 
ATOM   5704  C  CA    . GLY A 1 748  ? -26.956 -82.589  -6.183  1.00 2.82  ? 749  GLY A CA    1 
ATOM   5705  C  C     . GLY A 1 748  ? -26.238 -81.400  -6.823  1.00 2.60  ? 749  GLY A C     1 
ATOM   5706  O  O     . GLY A 1 748  ? -26.201 -81.284  -8.047  1.00 2.39  ? 749  GLY A O     1 
ATOM   5707  N  N     . ASN A 1 749  ? -25.691 -80.500  -6.010  1.00 2.31  ? 750  ASN A N     1 
ATOM   5708  C  CA    . ASN A 1 749  ? -24.949 -79.364  -6.535  1.00 2.25  ? 750  ASN A CA    1 
ATOM   5709  C  C     . ASN A 1 749  ? -23.917 -79.761  -7.580  1.00 2.72  ? 750  ASN A C     1 
ATOM   5710  O  O     . ASN A 1 749  ? -23.807 -79.090  -8.623  1.00 3.72  ? 750  ASN A O     1 
ATOM   5711  C  CB    . ASN A 1 749  ? -24.221 -78.611  -5.419  1.00 2.00  ? 750  ASN A CB    1 
ATOM   5712  C  CG    . ASN A 1 749  ? -25.150 -77.732  -4.630  1.00 2.04  ? 750  ASN A CG    1 
ATOM   5713  O  OD1   . ASN A 1 749  ? -25.318 -77.909  -3.425  1.00 3.36  ? 750  ASN A OD1   1 
ATOM   5714  N  ND2   . ASN A 1 749  ? -25.811 -76.812  -5.314  1.00 2.00  ? 750  ASN A ND2   1 
ATOM   5715  N  N     . CYS A 1 750  ? -23.146 -80.814  -7.321  1.00 2.00  ? 751  CYS A N     1 
ATOM   5716  C  CA    . CYS A 1 750  ? -22.141 -81.188  -8.286  1.00 2.03  ? 751  CYS A CA    1 
ATOM   5717  C  C     . CYS A 1 750  ? -22.686 -81.529  -9.672  1.00 2.29  ? 751  CYS A C     1 
ATOM   5718  O  O     . CYS A 1 750  ? -22.229 -80.961  -10.643 1.00 2.59  ? 751  CYS A O     1 
ATOM   5719  C  CB    . CYS A 1 750  ? -21.255 -82.337  -7.768  1.00 2.86  ? 751  CYS A CB    1 
ATOM   5720  S  SG    . CYS A 1 750  ? -22.148 -83.863  -7.324  1.00 2.00  ? 751  CYS A SG    1 
ATOM   5721  N  N     . ALA A 1 751  ? -23.655 -82.448  -9.749  1.00 2.69  ? 752  ALA A N     1 
ATOM   5722  C  CA    . ALA A 1 751  ? -24.272 -82.913  -10.994 1.00 2.26  ? 752  ALA A CA    1 
ATOM   5723  C  C     . ALA A 1 751  ? -24.934 -81.747  -11.688 1.00 3.21  ? 752  ALA A C     1 
ATOM   5724  O  O     . ALA A 1 751  ? -24.868 -81.583  -12.913 1.00 3.28  ? 752  ALA A O     1 
ATOM   5725  C  CB    . ALA A 1 751  ? -25.311 -83.976  -10.664 1.00 2.25  ? 752  ALA A CB    1 
ATOM   5726  N  N     . ASP A 1 752  ? -25.531 -80.898  -10.875 1.00 3.62  ? 753  ASP A N     1 
ATOM   5727  C  CA    . ASP A 1 752  ? -26.205 -79.730  -11.361 1.00 4.27  ? 753  ASP A CA    1 
ATOM   5728  C  C     . ASP A 1 752  ? -25.220 -78.767  -12.000 1.00 4.72  ? 753  ASP A C     1 
ATOM   5729  O  O     . ASP A 1 752  ? -25.552 -78.098  -12.972 1.00 5.80  ? 753  ASP A O     1 
ATOM   5730  C  CB    . ASP A 1 752  ? -26.904 -79.024  -10.203 1.00 4.22  ? 753  ASP A CB    1 
ATOM   5731  C  CG    . ASP A 1 752  ? -27.878 -78.021  -10.679 1.00 4.64  ? 753  ASP A CG    1 
ATOM   5732  O  OD1   . ASP A 1 752  ? -28.973 -78.415  -11.149 1.00 5.65  ? 753  ASP A OD1   1 
ATOM   5733  O  OD2   . ASP A 1 752  ? -27.544 -76.829  -10.632 1.00 6.10  ? 753  ASP A OD2   1 
ATOM   5734  N  N     . ILE A 1 753  ? -24.010 -78.698  -11.462 1.00 4.56  ? 754  ILE A N     1 
ATOM   5735  C  CA    . ILE A 1 753  ? -22.985 -77.780  -11.957 1.00 4.10  ? 754  ILE A CA    1 
ATOM   5736  C  C     . ILE A 1 753  ? -22.118 -78.300  -13.109 1.00 4.55  ? 754  ILE A C     1 
ATOM   5737  O  O     . ILE A 1 753  ? -21.762 -77.517  -14.000 1.00 4.42  ? 754  ILE A O     1 
ATOM   5738  C  CB    . ILE A 1 753  ? -22.162 -77.265  -10.745 1.00 3.58  ? 754  ILE A CB    1 
ATOM   5739  C  CG1   . ILE A 1 753  ? -22.511 -75.823  -10.553 1.00 3.28  ? 754  ILE A CG1   1 
ATOM   5740  C  CG2   . ILE A 1 753  ? -20.661 -77.530  -10.850 1.00 2.84  ? 754  ILE A CG2   1 
ATOM   5741  C  CD1   . ILE A 1 753  ? -23.997 -75.611  -10.555 1.00 2.54  ? 754  ILE A CD1   1 
ATOM   5742  N  N     . CYS A 1 754  ? -21.802 -79.613  -13.081 1.00 4.71  ? 755  CYS A N     1 
ATOM   5743  C  CA    . CYS A 1 754  ? -21.011 -80.317  -14.089 1.00 4.77  ? 755  CYS A CA    1 
ATOM   5744  C  C     . CYS A 1 754  ? -21.280 -79.649  -15.440 1.00 5.74  ? 755  CYS A C     1 
ATOM   5745  O  O     . CYS A 1 754  ? -22.409 -79.631  -15.906 1.00 6.25  ? 755  CYS A O     1 
ATOM   5746  C  CB    . CYS A 1 754  ? -21.438 -81.773  -14.096 1.00 4.48  ? 755  CYS A CB    1 
ATOM   5747  S  SG    . CYS A 1 754  ? -20.368 -82.823  -15.111 1.00 4.06  ? 755  CYS A SG    1 
ATOM   5748  N  N     . PRO A 1 755  ? -20.252 -79.068  -16.081 1.00 6.51  ? 756  PRO A N     1 
ATOM   5749  C  CA    . PRO A 1 755  ? -20.505 -78.391  -17.361 1.00 7.84  ? 756  PRO A CA    1 
ATOM   5750  C  C     . PRO A 1 755  ? -21.052 -79.116  -18.600 1.00 9.34  ? 756  PRO A C     1 
ATOM   5751  O  O     . PRO A 1 755  ? -22.073 -78.695  -19.149 1.00 10.00 ? 756  PRO A O     1 
ATOM   5752  C  CB    . PRO A 1 755  ? -19.184 -77.672  -17.635 1.00 6.72  ? 756  PRO A CB    1 
ATOM   5753  C  CG    . PRO A 1 755  ? -18.579 -77.518  -16.257 1.00 6.15  ? 756  PRO A CG    1 
ATOM   5754  C  CD    . PRO A 1 755  ? -18.862 -78.851  -15.654 1.00 6.07  ? 756  PRO A CD    1 
ATOM   5755  N  N     . PRO A 1 756  ? -20.458 -80.255  -19.011 1.00 10.55 ? 757  PRO A N     1 
ATOM   5756  C  CA    . PRO A 1 756  ? -21.064 -80.835  -20.211 1.00 11.23 ? 757  PRO A CA    1 
ATOM   5757  C  C     . PRO A 1 756  ? -22.567 -81.072  -20.186 1.00 12.26 ? 757  PRO A C     1 
ATOM   5758  O  O     . PRO A 1 756  ? -23.146 -81.429  -19.152 1.00 11.75 ? 757  PRO A O     1 
ATOM   5759  C  CB    . PRO A 1 756  ? -20.240 -82.098  -20.441 1.00 10.59 ? 757  PRO A CB    1 
ATOM   5760  C  CG    . PRO A 1 756  ? -19.760 -82.433  -19.083 1.00 10.78 ? 757  PRO A CG    1 
ATOM   5761  C  CD    . PRO A 1 756  ? -19.382 -81.116  -18.494 1.00 10.45 ? 757  PRO A CD    1 
ATOM   5762  N  N     . LYS A 1 757  ? -23.182 -80.722  -21.318 1.00 13.55 ? 758  LYS A N     1 
ATOM   5763  C  CA    . LYS A 1 757  ? -24.627 -80.883  -21.541 1.00 14.79 ? 758  LYS A CA    1 
ATOM   5764  C  C     . LYS A 1 757  ? -24.876 -82.360  -21.341 1.00 14.57 ? 758  LYS A C     1 
ATOM   5765  O  O     . LYS A 1 757  ? -25.937 -82.749  -20.876 1.00 14.74 ? 758  LYS A O     1 
ATOM   5766  C  CB    . LYS A 1 757  ? -25.056 -80.511  -22.981 1.00 15.73 ? 758  LYS A CB    1 
ATOM   5767  C  CG    . LYS A 1 757  ? -24.108 -79.624  -23.776 0.01 16.62 ? 758  LYS A CG    1 
ATOM   5768  C  CD    . LYS A 1 757  ? -24.677 -79.383  -25.176 0.01 17.40 ? 758  LYS A CD    1 
ATOM   5769  C  CE    . LYS A 1 757  ? -23.674 -78.720  -26.114 0.01 17.86 ? 758  LYS A CE    1 
ATOM   5770  N  NZ    . LYS A 1 757  ? -22.570 -79.640  -26.516 0.01 18.26 ? 758  LYS A NZ    1 
ATOM   5771  N  N     . GLU A 1 758  ? -23.919 -83.162  -21.804 1.00 14.38 ? 759  GLU A N     1 
ATOM   5772  C  CA    . GLU A 1 758  ? -23.947 -84.609  -21.642 1.00 14.27 ? 759  GLU A CA    1 
ATOM   5773  C  C     . GLU A 1 758  ? -23.148 -84.753  -20.374 1.00 13.01 ? 759  GLU A C     1 
ATOM   5774  O  O     . GLU A 1 758  ? -21.931 -84.874  -20.420 1.00 13.17 ? 759  GLU A O     1 
ATOM   5775  C  CB    . GLU A 1 758  ? -23.215 -85.304  -22.797 1.00 15.96 ? 759  GLU A CB    1 
ATOM   5776  C  CG    . GLU A 1 758  ? -24.001 -85.294  -24.101 1.00 18.17 ? 759  GLU A CG    1 
ATOM   5777  C  CD    . GLU A 1 758  ? -25.454 -85.763  -23.928 1.00 19.20 ? 759  GLU A CD    1 
ATOM   5778  O  OE1   . GLU A 1 758  ? -25.661 -86.831  -23.340 1.00 20.02 ? 759  GLU A OE1   1 
ATOM   5779  O  OE2   . GLU A 1 758  ? -26.386 -85.056  -24.385 1.00 20.14 ? 759  GLU A OE2   1 
ATOM   5780  N  N     . LYS A 1 759  ? -23.861 -84.695  -19.254 1.00 11.31 ? 760  LYS A N     1 
ATOM   5781  C  CA    . LYS A 1 759  ? -23.310 -84.751  -17.900 1.00 9.66  ? 760  LYS A CA    1 
ATOM   5782  C  C     . LYS A 1 759  ? -22.283 -85.810  -17.559 1.00 9.02  ? 760  LYS A C     1 
ATOM   5783  O  O     . LYS A 1 759  ? -22.475 -86.980  -17.859 1.00 9.66  ? 760  LYS A O     1 
ATOM   5784  C  CB    . LYS A 1 759  ? -24.437 -84.876  -16.860 1.00 8.77  ? 760  LYS A CB    1 
ATOM   5785  C  CG    . LYS A 1 759  ? -25.338 -83.667  -16.724 1.00 7.15  ? 760  LYS A CG    1 
ATOM   5786  C  CD    . LYS A 1 759  ? -24.630 -82.525  -16.124 1.00 5.59  ? 760  LYS A CD    1 
ATOM   5787  C  CE    . LYS A 1 759  ? -25.522 -81.316  -16.148 1.00 5.45  ? 760  LYS A CE    1 
ATOM   5788  N  NZ    . LYS A 1 759  ? -24.819 -80.066  -15.738 1.00 4.48  ? 760  LYS A NZ    1 
ATOM   5789  N  N     . ALA A 1 760  ? -21.214 -85.379  -16.884 1.00 7.42  ? 761  ALA A N     1 
ATOM   5790  C  CA    . ALA A 1 760  ? -20.177 -86.269  -16.404 1.00 5.82  ? 761  ALA A CA    1 
ATOM   5791  C  C     . ALA A 1 760  ? -20.585 -86.775  -15.012 1.00 5.29  ? 761  ALA A C     1 
ATOM   5792  O  O     . ALA A 1 760  ? -19.877 -87.589  -14.405 1.00 5.61  ? 761  ALA A O     1 
ATOM   5793  C  CB    . ALA A 1 760  ? -18.864 -85.533  -16.285 1.00 5.40  ? 761  ALA A CB    1 
ATOM   5794  N  N     . LEU A 1 761  ? -21.679 -86.237  -14.470 1.00 4.06  ? 762  LEU A N     1 
ATOM   5795  C  CA    . LEU A 1 761  ? -22.167 -86.641  -13.163 1.00 2.63  ? 762  LEU A CA    1 
ATOM   5796  C  C     . LEU A 1 761  ? -23.656 -86.824  -13.192 1.00 2.53  ? 762  LEU A C     1 
ATOM   5797  O  O     . LEU A 1 761  ? -24.391 -85.897  -13.532 1.00 2.00  ? 762  LEU A O     1 
ATOM   5798  C  CB    . LEU A 1 761  ? -21.817 -85.591  -12.137 1.00 2.12  ? 762  LEU A CB    1 
ATOM   5799  C  CG    . LEU A 1 761  ? -20.405 -85.552  -11.601 1.00 2.00  ? 762  LEU A CG    1 
ATOM   5800  C  CD1   . LEU A 1 761  ? -20.402 -84.515  -10.522 1.00 2.00  ? 762  LEU A CD1   1 
ATOM   5801  C  CD2   . LEU A 1 761  ? -20.011 -86.932  -11.060 1.00 2.00  ? 762  LEU A CD2   1 
ATOM   5802  N  N     . VAL A 1 762  ? -24.091 -88.020  -12.797 1.00 2.54  ? 763  VAL A N     1 
ATOM   5803  C  CA    . VAL A 1 762  ? -25.507 -88.394  -12.770 1.00 2.62  ? 763  VAL A CA    1 
ATOM   5804  C  C     . VAL A 1 762  ? -25.886 -89.028  -11.428 1.00 2.76  ? 763  VAL A C     1 
ATOM   5805  O  O     . VAL A 1 762  ? -25.298 -90.026  -11.009 1.00 3.90  ? 763  VAL A O     1 
ATOM   5806  C  CB    . VAL A 1 762  ? -25.810 -89.439  -13.912 1.00 3.29  ? 763  VAL A CB    1 
ATOM   5807  C  CG1   . VAL A 1 762  ? -27.252 -89.999  -13.807 1.00 2.00  ? 763  VAL A CG1   1 
ATOM   5808  C  CG2   . VAL A 1 762  ? -25.535 -88.815  -15.292 1.00 2.46  ? 763  VAL A CG2   1 
ATOM   5809  N  N     . MET A 1 763  ? -26.918 -88.502  -10.795 1.00 2.70  ? 764  MET A N     1 
ATOM   5810  C  CA    . MET A 1 763  ? -27.387 -89.026  -9.520  1.00 2.98  ? 764  MET A CA    1 
ATOM   5811  C  C     . MET A 1 763  ? -27.947 -90.418  -9.637  1.00 2.76  ? 764  MET A C     1 
ATOM   5812  O  O     . MET A 1 763  ? -28.699 -90.687  -10.540 1.00 2.39  ? 764  MET A O     1 
ATOM   5813  C  CB    . MET A 1 763  ? -28.469 -88.127  -8.938  1.00 3.75  ? 764  MET A CB    1 
ATOM   5814  C  CG    . MET A 1 763  ? -27.983 -86.757  -8.539  1.00 4.11  ? 764  MET A CG    1 
ATOM   5815  S  SD    . MET A 1 763  ? -26.725 -86.759  -7.236  1.00 4.53  ? 764  MET A SD    1 
ATOM   5816  C  CE    . MET A 1 763  ? -25.568 -86.118  -8.155  1.00 4.21  ? 764  MET A CE    1 
ATOM   5817  N  N     . GLN A 1 764  ? -27.587 -91.286  -8.702  1.00 3.63  ? 765  GLN A N     1 
ATOM   5818  C  CA    . GLN A 1 764  ? -28.035 -92.676  -8.697  1.00 4.61  ? 765  GLN A CA    1 
ATOM   5819  C  C     . GLN A 1 764  ? -28.217 -93.116  -7.266  1.00 4.73  ? 765  GLN A C     1 
ATOM   5820  O  O     . GLN A 1 764  ? -27.625 -92.558  -6.348  1.00 5.29  ? 765  GLN A O     1 
ATOM   5821  C  CB    . GLN A 1 764  ? -26.977 -93.616  -9.303  1.00 5.20  ? 765  GLN A CB    1 
ATOM   5822  C  CG    . GLN A 1 764  ? -26.499 -93.289  -10.713 1.00 7.23  ? 765  GLN A CG    1 
ATOM   5823  C  CD    . GLN A 1 764  ? -27.548 -93.465  -11.809 1.00 8.32  ? 765  GLN A CD    1 
ATOM   5824  O  OE1   . GLN A 1 764  ? -27.261 -93.221  -12.963 1.00 10.40 ? 765  GLN A OE1   1 
ATOM   5825  N  NE2   . GLN A 1 764  ? -28.741 -93.923  -11.465 1.00 9.17  ? 765  GLN A NE2   1 
ATOM   5826  N  N     . PRO A 1 765  ? -29.024 -94.149  -7.058  1.00 4.99  ? 766  PRO A N     1 
ATOM   5827  C  CA    . PRO A 1 765  ? -29.262 -94.666  -5.707  1.00 5.41  ? 766  PRO A CA    1 
ATOM   5828  C  C     . PRO A 1 765  ? -27.945 -95.090  -5.047  1.00 5.73  ? 766  PRO A C     1 
ATOM   5829  O  O     . PRO A 1 765  ? -27.085 -95.667  -5.707  1.00 6.62  ? 766  PRO A O     1 
ATOM   5830  C  CB    . PRO A 1 765  ? -30.177 -95.866  -5.969  1.00 4.65  ? 766  PRO A CB    1 
ATOM   5831  C  CG    . PRO A 1 765  ? -30.956 -95.437  -7.138  1.00 4.55  ? 766  PRO A CG    1 
ATOM   5832  C  CD    . PRO A 1 765  ? -29.933 -94.769  -8.039  1.00 4.51  ? 766  PRO A CD    1 
ATOM   5833  N  N     . LEU A 1 766  ? -27.800 -94.854  -3.752  1.00 6.21  ? 767  LEU A N     1 
ATOM   5834  C  CA    . LEU A 1 766  ? -26.572 -95.231  -3.076  1.00 7.33  ? 767  LEU A CA    1 
ATOM   5835  C  C     . LEU A 1 766  ? -26.172 -96.723  -3.211  1.00 8.84  ? 767  LEU A C     1 
ATOM   5836  O  O     . LEU A 1 766  ? -24.988 -97.016  -3.357  1.00 9.00  ? 767  LEU A O     1 
ATOM   5837  C  CB    . LEU A 1 766  ? -26.646 -94.818  -1.616  1.00 6.32  ? 767  LEU A CB    1 
ATOM   5838  C  CG    . LEU A 1 766  ? -25.413 -95.202  -0.790  1.00 5.47  ? 767  LEU A CG    1 
ATOM   5839  C  CD1   . LEU A 1 766  ? -24.172 -94.593  -1.396  1.00 3.46  ? 767  LEU A CD1   1 
ATOM   5840  C  CD2   . LEU A 1 766  ? -25.618 -94.762  0.678   1.00 4.14  ? 767  LEU A CD2   1 
ATOM   5841  N  N     . ASP A 1 767  ? -27.142 -97.644  -3.182  1.00 10.41 ? 768  ASP A N     1 
ATOM   5842  C  CA    . ASP A 1 767  ? -26.872 -99.090  -3.336  1.00 12.32 ? 768  ASP A CA    1 
ATOM   5843  C  C     . ASP A 1 767  ? -26.197 -99.502  -4.658  1.00 11.80 ? 768  ASP A C     1 
ATOM   5844  O  O     . ASP A 1 767  ? -25.424 -100.514 -4.706  1.00 11.84 ? 768  ASP A O     1 
ATOM   5845  C  CB    . ASP A 1 767  ? -28.157 -99.900  -3.275  1.00 15.72 ? 768  ASP A CB    1 
ATOM   5846  C  CG    . ASP A 1 767  ? -28.781 -99.896  -1.918  1.00 19.24 ? 768  ASP A CG    1 
ATOM   5847  O  OD1   . ASP A 1 767  ? -28.009 -99.869  -0.924  1.00 21.23 ? 768  ASP A OD1   1 
ATOM   5848  O  OD2   . ASP A 1 767  ? -30.048 -99.938  -1.858  1.00 21.32 ? 768  ASP A OD2   1 
ATOM   5849  N  N     . THR A 1 768  ? -26.570 -98.795  -5.737  1.00 9.97  ? 769  THR A N     1 
ATOM   5850  C  CA    . THR A 1 768  ? -26.005 -99.076  -7.042  1.00 8.44  ? 769  THR A CA    1 
ATOM   5851  C  C     . THR A 1 768  ? -24.553 -98.578  -7.091  1.00 8.58  ? 769  THR A C     1 
ATOM   5852  O  O     . THR A 1 768  ? -23.742 -99.028  -7.913  1.00 9.08  ? 769  THR A O     1 
ATOM   5853  C  CB    . THR A 1 768  ? -26.809 -98.399  -8.173  1.00 7.84  ? 769  THR A CB    1 
ATOM   5854  O  OG1   . THR A 1 768  ? -26.698 -96.976  -8.067  1.00 7.21  ? 769  THR A OG1   1 
ATOM   5855  C  CG2   . THR A 1 768  ? -28.251 -98.813  -8.109  1.00 7.06  ? 769  THR A CG2   1 
ATOM   5856  N  N     . GLN A 1 769  ? -24.183 -97.738  -6.127  1.00 7.72  ? 770  GLN A N     1 
ATOM   5857  C  CA    . GLN A 1 769  ? -22.858 -97.162  -6.141  1.00 6.71  ? 770  GLN A CA    1 
ATOM   5858  C  C     . GLN A 1 769  ? -21.828 -97.618  -5.100  1.00 6.56  ? 770  GLN A C     1 
ATOM   5859  O  O     . GLN A 1 769  ? -20.626 -97.763  -5.408  1.00 5.42  ? 770  GLN A O     1 
ATOM   5860  C  CB    . GLN A 1 769  ? -23.040 -95.643  -6.108  1.00 6.40  ? 770  GLN A CB    1 
ATOM   5861  C  CG    . GLN A 1 769  ? -23.983 -95.172  -7.207  1.00 6.14  ? 770  GLN A CG    1 
ATOM   5862  C  CD    . GLN A 1 769  ? -23.408 -95.420  -8.621  1.00 6.41  ? 770  GLN A CD    1 
ATOM   5863  O  OE1   . GLN A 1 769  ? -22.231 -95.142  -8.858  1.00 6.22  ? 770  GLN A OE1   1 
ATOM   5864  N  NE2   . GLN A 1 769  ? -24.247 -95.887  -9.560  1.00 4.78  ? 770  GLN A NE2   1 
ATOM   5865  N  N     . ARG A 1 770  ? -22.297 -97.919  -3.893  1.00 6.83  ? 771  ARG A N     1 
ATOM   5866  C  CA    . ARG A 1 770  ? -21.366 -98.274  -2.833  1.00 7.73  ? 771  ARG A CA    1 
ATOM   5867  C  C     . ARG A 1 770  ? -20.406 -99.427  -2.963  1.00 7.84  ? 771  ARG A C     1 
ATOM   5868  O  O     . ARG A 1 770  ? -19.263 -99.259  -2.566  1.00 7.74  ? 771  ARG A O     1 
ATOM   5869  C  CB    . ARG A 1 770  ? -22.025 -98.307  -1.451  1.00 8.55  ? 771  ARG A CB    1 
ATOM   5870  C  CG    . ARG A 1 770  ? -23.500 -98.570  -1.440  1.00 10.50 ? 771  ARG A CG    1 
ATOM   5871  C  CD    . ARG A 1 770  ? -23.859 -99.623  -0.443  1.00 11.47 ? 771  ARG A CD    1 
ATOM   5872  N  NE    . ARG A 1 770  ? -23.040 -99.569  0.761   1.00 12.28 ? 771  ARG A NE    1 
ATOM   5873  C  CZ    . ARG A 1 770  ? -23.355 -98.853  1.823   1.00 12.98 ? 771  ARG A CZ    1 
ATOM   5874  N  NH1   . ARG A 1 770  ? -24.466 -98.117  1.813   1.00 13.50 ? 771  ARG A NH1   1 
ATOM   5875  N  NH2   . ARG A 1 770  ? -22.599 -98.945  2.915   1.00 13.98 ? 771  ARG A NH2   1 
ATOM   5876  N  N     . ASP A 1 771  ? -20.841 -100.586 -3.475  1.00 8.60  ? 772  ASP A N     1 
ATOM   5877  C  CA    . ASP A 1 771  ? -19.946 -101.734 -3.624  1.00 9.09  ? 772  ASP A CA    1 
ATOM   5878  C  C     . ASP A 1 771  ? -18.785 -101.428 -4.551  1.00 8.65  ? 772  ASP A C     1 
ATOM   5879  O  O     . ASP A 1 771  ? -17.638 -101.843 -4.289  1.00 9.30  ? 772  ASP A O     1 
ATOM   5880  C  CB    . ASP A 1 771  ? -20.686 -102.950 -4.141  1.00 11.09 ? 772  ASP A CB    1 
ATOM   5881  C  CG    . ASP A 1 771  ? -21.787 -103.395 -3.197  1.00 13.51 ? 772  ASP A CG    1 
ATOM   5882  O  OD1   . ASP A 1 771  ? -21.814 -102.897 -2.041  1.00 14.70 ? 772  ASP A OD1   1 
ATOM   5883  O  OD2   . ASP A 1 771  ? -22.628 -104.236 -3.615  1.00 14.80 ? 772  ASP A OD2   1 
ATOM   5884  N  N     . ALA A 1 772  ? -19.066 -100.732 -5.643  1.00 7.10  ? 773  ALA A N     1 
ATOM   5885  C  CA    . ALA A 1 772  ? -18.009 -100.392 -6.557  1.00 6.32  ? 773  ALA A CA    1 
ATOM   5886  C  C     . ALA A 1 772  ? -17.067 -99.312  -5.991  1.00 6.53  ? 773  ALA A C     1 
ATOM   5887  O  O     . ALA A 1 772  ? -15.850 -99.543  -5.848  1.00 7.04  ? 773  ALA A O     1 
ATOM   5888  C  CB    . ALA A 1 772  ? -18.603 -99.926  -7.848  1.00 5.96  ? 773  ALA A CB    1 
ATOM   5889  N  N     . GLN A 1 773  ? -17.662 -98.174  -5.586  1.00 5.75  ? 774  GLN A N     1 
ATOM   5890  C  CA    . GLN A 1 773  ? -16.938 -96.983  -5.101  1.00 4.25  ? 774  GLN A CA    1 
ATOM   5891  C  C     . GLN A 1 773  ? -16.390 -96.910  -3.669  1.00 3.70  ? 774  GLN A C     1 
ATOM   5892  O  O     . GLN A 1 773  ? -15.553 -96.050  -3.357  1.00 2.32  ? 774  GLN A O     1 
ATOM   5893  C  CB    . GLN A 1 773  ? -17.771 -95.726  -5.358  1.00 3.83  ? 774  GLN A CB    1 
ATOM   5894  C  CG    . GLN A 1 773  ? -18.335 -95.624  -6.742  1.00 2.85  ? 774  GLN A CG    1 
ATOM   5895  C  CD    . GLN A 1 773  ? -17.295 -95.787  -7.808  1.00 2.87  ? 774  GLN A CD    1 
ATOM   5896  O  OE1   . GLN A 1 773  ? -17.535 -96.445  -8.820  1.00 3.28  ? 774  GLN A OE1   1 
ATOM   5897  N  NE2   . GLN A 1 773  ? -16.144 -95.172  -7.616  1.00 3.07  ? 774  GLN A NE2   1 
ATOM   5898  N  N     . VAL A 1 774  ? -16.870 -97.754  -2.769  1.00 3.75  ? 775  VAL A N     1 
ATOM   5899  C  CA    . VAL A 1 774  ? -16.296 -97.685  -1.439  1.00 3.96  ? 775  VAL A CA    1 
ATOM   5900  C  C     . VAL A 1 774  ? -14.827 -98.143  -1.531  1.00 4.70  ? 775  VAL A C     1 
ATOM   5901  O  O     . VAL A 1 774  ? -13.929 -97.433  -1.071  1.00 5.03  ? 775  VAL A O     1 
ATOM   5902  C  CB    . VAL A 1 774  ? -17.110 -98.474  -0.404  1.00 4.03  ? 775  VAL A CB    1 
ATOM   5903  C  CG1   . VAL A 1 774  ? -16.352 -98.518  0.883   1.00 3.31  ? 775  VAL A CG1   1 
ATOM   5904  C  CG2   . VAL A 1 774  ? -18.496 -97.795  -0.154  1.00 2.74  ? 775  VAL A CG2   1 
ATOM   5905  N  N     . PRO A 1 775  ? -14.556 -99.294  -2.180  1.00 5.11  ? 776  PRO A N     1 
ATOM   5906  C  CA    . PRO A 1 775  ? -13.163 -99.746  -2.294  1.00 5.26  ? 776  PRO A CA    1 
ATOM   5907  C  C     . PRO A 1 775  ? -12.323 -98.828  -3.160  1.00 5.51  ? 776  PRO A C     1 
ATOM   5908  O  O     . PRO A 1 775  ? -11.111 -98.679  -2.928  1.00 6.31  ? 776  PRO A O     1 
ATOM   5909  C  CB    . PRO A 1 775  ? -13.281 -101.158 -2.916  1.00 5.10  ? 776  PRO A CB    1 
ATOM   5910  C  CG    . PRO A 1 775  ? -14.597 -101.174 -3.601  1.00 5.34  ? 776  PRO A CG    1 
ATOM   5911  C  CD    . PRO A 1 775  ? -15.475 -100.366 -2.605  1.00 5.55  ? 776  PRO A CD    1 
ATOM   5912  N  N     . ASN A 1 776  ? -12.948 -98.212  -4.161  1.00 5.80  ? 777  ASN A N     1 
ATOM   5913  C  CA    . ASN A 1 776  ? -12.226 -97.295  -5.036  1.00 5.92  ? 777  ASN A CA    1 
ATOM   5914  C  C     . ASN A 1 776  ? -11.830 -96.047  -4.241  1.00 5.83  ? 777  ASN A C     1 
ATOM   5915  O  O     . ASN A 1 776  ? -10.741 -95.501  -4.396  1.00 6.17  ? 777  ASN A O     1 
ATOM   5916  C  CB    . ASN A 1 776  ? -13.102 -96.850  -6.194  1.00 6.96  ? 777  ASN A CB    1 
ATOM   5917  C  CG    . ASN A 1 776  ? -13.195 -97.864  -7.290  1.00 8.05  ? 777  ASN A CG    1 
ATOM   5918  O  OD1   . ASN A 1 776  ? -14.149 -97.838  -8.067  1.00 8.80  ? 777  ASN A OD1   1 
ATOM   5919  N  ND2   . ASN A 1 776  ? -12.188 -98.718  -7.414  1.00 8.54  ? 777  ASN A ND2   1 
ATOM   5920  N  N     . LEU A 1 777  ? -12.722 -95.573  -3.396  1.00 5.86  ? 778  LEU A N     1 
ATOM   5921  C  CA    . LEU A 1 777  ? -12.408 -94.395  -2.607  1.00 5.92  ? 778  LEU A CA    1 
ATOM   5922  C  C     . LEU A 1 777  ? -11.288 -94.714  -1.636  1.00 7.26  ? 778  LEU A C     1 
ATOM   5923  O  O     . LEU A 1 777  ? -10.488 -93.845  -1.314  1.00 7.22  ? 778  LEU A O     1 
ATOM   5924  C  CB    . LEU A 1 777  ? -13.656 -93.916  -1.864  1.00 4.90  ? 778  LEU A CB    1 
ATOM   5925  C  CG    . LEU A 1 777  ? -13.723 -92.591  -1.085  1.00 3.29  ? 778  LEU A CG    1 
ATOM   5926  C  CD1   . LEU A 1 777  ? -13.457 -92.901  0.348   1.00 2.21  ? 778  LEU A CD1   1 
ATOM   5927  C  CD2   . LEU A 1 777  ? -12.769 -91.510  -1.636  1.00 2.32  ? 778  LEU A CD2   1 
ATOM   5928  N  N     . GLU A 1 778  ? -11.219 -95.965  -1.185  1.00 9.16  ? 779  GLU A N     1 
ATOM   5929  C  CA    . GLU A 1 778  ? -10.181 -96.394  -0.254  1.00 10.84 ? 779  GLU A CA    1 
ATOM   5930  C  C     . GLU A 1 778  ? -8.860  -96.365  -0.980  1.00 11.02 ? 779  GLU A C     1 
ATOM   5931  O  O     . GLU A 1 778  ? -7.887  -95.790  -0.495  1.00 12.01 ? 779  GLU A O     1 
ATOM   5932  C  CB    . GLU A 1 778  ? -10.476 -97.801  0.261   1.00 12.90 ? 779  GLU A CB    1 
ATOM   5933  C  CG    . GLU A 1 778  ? -11.308 -97.808  1.540   1.00 16.34 ? 779  GLU A CG    1 
ATOM   5934  C  CD    . GLU A 1 778  ? -12.116 -99.095  1.752   0.01 17.85 ? 779  GLU A CD    1 
ATOM   5935  O  OE1   . GLU A 1 778  ? -11.700 -100.184 1.299   0.01 18.98 ? 779  GLU A OE1   1 
ATOM   5936  O  OE2   . GLU A 1 778  ? -13.187 -99.007  2.388   0.01 18.97 ? 779  GLU A OE2   1 
ATOM   5937  N  N     . TYR A 1 779  ? -8.833  -96.912  -2.183  1.00 10.54 ? 780  TYR A N     1 
ATOM   5938  C  CA    . TYR A 1 779  ? -7.592  -96.909  -2.940  1.00 9.77  ? 780  TYR A CA    1 
ATOM   5939  C  C     . TYR A 1 779  ? -7.156  -95.471  -3.242  1.00 9.18  ? 780  TYR A C     1 
ATOM   5940  O  O     . TYR A 1 779  ? -6.005  -95.099  -3.005  1.00 8.60  ? 780  TYR A O     1 
ATOM   5941  C  CB    . TYR A 1 779  ? -7.759  -97.671  -4.263  1.00 9.80  ? 780  TYR A CB    1 
ATOM   5942  C  CG    . TYR A 1 779  ? -6.500  -97.665  -5.111  1.00 10.06 ? 780  TYR A CG    1 
ATOM   5943  C  CD1   . TYR A 1 779  ? -5.471  -98.578  -4.861  1.00 10.22 ? 780  TYR A CD1   1 
ATOM   5944  C  CD2   . TYR A 1 779  ? -6.331  -96.762  -6.166  1.00 9.49  ? 780  TYR A CD2   1 
ATOM   5945  C  CE1   . TYR A 1 779  ? -4.304  -98.590  -5.644  1.00 10.34 ? 780  TYR A CE1   1 
ATOM   5946  C  CE2   . TYR A 1 779  ? -5.173  -96.775  -6.957  1.00 9.73  ? 780  TYR A CE2   1 
ATOM   5947  C  CZ    . TYR A 1 779  ? -4.170  -97.686  -6.690  1.00 10.46 ? 780  TYR A CZ    1 
ATOM   5948  O  OH    . TYR A 1 779  ? -3.026  -97.724  -7.471  1.00 11.00 ? 780  TYR A OH    1 
ATOM   5949  N  N     . ALA A 1 780  ? -8.084  -94.672  -3.755  1.00 8.94  ? 781  ALA A N     1 
ATOM   5950  C  CA    . ALA A 1 780  ? -7.793  -93.298  -4.154  1.00 9.68  ? 781  ALA A CA    1 
ATOM   5951  C  C     . ALA A 1 780  ? -7.180  -92.461  -3.037  1.00 10.61 ? 781  ALA A C     1 
ATOM   5952  O  O     . ALA A 1 780  ? -6.411  -91.523  -3.286  1.00 11.12 ? 781  ALA A O     1 
ATOM   5953  C  CB    . ALA A 1 780  ? -9.052  -92.619  -4.710  1.00 9.06  ? 781  ALA A CB    1 
ATOM   5954  N  N     . ALA A 1 781  ? -7.481  -92.819  -1.801  1.00 11.61 ? 782  ALA A N     1 
ATOM   5955  C  CA    . ALA A 1 781  ? -6.933  -92.103  -0.671  1.00 12.36 ? 782  ALA A CA    1 
ATOM   5956  C  C     . ALA A 1 781  ? -5.431  -92.351  -0.518  1.00 13.30 ? 782  ALA A C     1 
ATOM   5957  O  O     . ALA A 1 781  ? -4.752  -91.550  0.089   1.00 13.86 ? 782  ALA A O     1 
ATOM   5958  C  CB    . ALA A 1 781  ? -7.662  -92.505  0.574   1.00 12.98 ? 782  ALA A CB    1 
ATOM   5959  N  N     . ARG A 1 782  ? -4.905  -93.453  -1.044  1.00 14.44 ? 783  ARG A N     1 
ATOM   5960  C  CA    . ARG A 1 782  ? -3.469  -93.750  -0.951  1.00 15.28 ? 783  ARG A CA    1 
ATOM   5961  C  C     . ARG A 1 782  ? -2.640  -92.887  -1.907  1.00 14.61 ? 783  ARG A C     1 
ATOM   5962  O  O     . ARG A 1 782  ? -1.418  -92.716  -1.712  1.00 14.44 ? 783  ARG A O     1 
ATOM   5963  C  CB    . ARG A 1 782  ? -3.212  -95.217  -1.309  1.00 17.40 ? 783  ARG A CB    1 
ATOM   5964  C  CG    . ARG A 1 782  ? -3.746  -96.221  -0.316  1.00 20.02 ? 783  ARG A CG    1 
ATOM   5965  C  CD    . ARG A 1 782  ? -4.315  -97.415  -1.053  1.00 22.13 ? 783  ARG A CD    1 
ATOM   5966  N  NE    . ARG A 1 782  ? -4.275  -98.646  -0.262  1.00 24.86 ? 783  ARG A NE    1 
ATOM   5967  C  CZ    . ARG A 1 782  ? -5.202  -99.612  -0.307  1.00 26.27 ? 783  ARG A CZ    1 
ATOM   5968  N  NH1   . ARG A 1 782  ? -6.276  -99.493  -1.092  1.00 27.12 ? 783  ARG A NH1   1 
ATOM   5969  N  NH2   . ARG A 1 782  ? -5.007  -100.754 0.362   1.00 27.12 ? 783  ARG A NH2   1 
ATOM   5970  N  N     . ILE A 1 783  ? -3.309  -92.381  -2.954  1.00 13.33 ? 784  ILE A N     1 
ATOM   5971  C  CA    . ILE A 1 783  ? -2.660  -91.585  -3.996  1.00 11.90 ? 784  ILE A CA    1 
ATOM   5972  C  C     . ILE A 1 783  ? -2.241  -90.227  -3.442  1.00 11.38 ? 784  ILE A C     1 
ATOM   5973  O  O     . ILE A 1 783  ? -3.051  -89.474  -2.900  1.00 11.58 ? 784  ILE A O     1 
ATOM   5974  C  CB    . ILE A 1 783  ? -3.586  -91.360  -5.246  1.00 11.27 ? 784  ILE A CB    1 
ATOM   5975  C  CG1   . ILE A 1 783  ? -4.201  -92.660  -5.734  1.00 10.62 ? 784  ILE A CG1   1 
ATOM   5976  C  CG2   . ILE A 1 783  ? -2.804  -90.722  -6.379  1.00 10.33 ? 784  ILE A CG2   1 
ATOM   5977  C  CD1   . ILE A 1 783  ? -3.211  -93.620  -6.183  1.00 11.70 ? 784  ILE A CD1   1 
ATOM   5978  N  N     . PRO A 1 784  ? -0.959  -89.896  -3.556  1.00 10.70 ? 785  PRO A N     1 
ATOM   5979  C  CA    . PRO A 1 784  ? -0.507  -88.600  -3.045  1.00 10.39 ? 785  PRO A CA    1 
ATOM   5980  C  C     . PRO A 1 784  ? -1.250  -87.435  -3.706  1.00 9.95  ? 785  PRO A C     1 
ATOM   5981  O  O     . PRO A 1 784  ? -1.528  -87.462  -4.893  1.00 9.41  ? 785  PRO A O     1 
ATOM   5982  C  CB    . PRO A 1 784  ? 0.983   -88.584  -3.413  1.00 10.43 ? 785  PRO A CB    1 
ATOM   5983  C  CG    . PRO A 1 784  ? 1.360   -90.018  -3.433  1.00 10.50 ? 785  PRO A CG    1 
ATOM   5984  C  CD    . PRO A 1 784  ? 0.162   -90.680  -4.096  1.00 10.64 ? 785  PRO A CD    1 
ATOM   5985  N  N     . VAL A 1 785  ? -1.570  -86.412  -2.922  1.00 10.23 ? 786  VAL A N     1 
ATOM   5986  C  CA    . VAL A 1 785  ? -2.262  -85.239  -3.438  1.00 10.37 ? 786  VAL A CA    1 
ATOM   5987  C  C     . VAL A 1 785  ? -1.253  -84.331  -4.120  1.00 10.81 ? 786  VAL A C     1 
ATOM   5988  O  O     . VAL A 1 785  ? -0.298  -83.893  -3.489  1.00 11.41 ? 786  VAL A O     1 
ATOM   5989  C  CB    . VAL A 1 785  ? -3.058  -84.503  -2.333  1.00 10.15 ? 786  VAL A CB    1 
ATOM   5990  C  CG1   . VAL A 1 785  ? -3.506  -83.129  -2.824  1.00 9.11  ? 786  VAL A CG1   1 
ATOM   5991  C  CG2   . VAL A 1 785  ? -4.301  -85.326  -1.968  1.00 8.63  ? 786  VAL A CG2   1 
ATOM   5992  N  N     . LYS A 1 786  ? -1.461  -84.117  -5.423  1.00 11.38 ? 787  LYS A N     1 
ATOM   5993  C  CA    . LYS A 1 786  ? -0.591  -83.317  -6.298  1.00 12.01 ? 787  LYS A CA    1 
ATOM   5994  C  C     . LYS A 1 786  ? -0.712  -81.784  -6.112  1.00 12.46 ? 787  LYS A C     1 
ATOM   5995  O  O     . LYS A 1 786  ? -0.990  -81.015  -7.054  1.00 11.81 ? 787  LYS A O     1 
ATOM   5996  C  CB    . LYS A 1 786  ? -0.857  -83.688  -7.760  1.00 12.16 ? 787  LYS A CB    1 
ATOM   5997  C  CG    . LYS A 1 786  ? -0.747  -85.160  -8.064  1.00 12.82 ? 787  LYS A CG    1 
ATOM   5998  C  CD    . LYS A 1 786  ? 0.605   -85.707  -7.664  1.00 12.79 ? 787  LYS A CD    1 
ATOM   5999  C  CE    . LYS A 1 786  ? 0.791   -87.108  -8.189  1.00 13.07 ? 787  LYS A CE    1 
ATOM   6000  N  NZ    . LYS A 1 786  ? 0.307   -88.138  -7.257  1.00 13.41 ? 787  LYS A NZ    1 
ATOM   6001  N  N     . SER A 1 787  ? -0.420  -81.344  -4.902  1.00 13.01 ? 788  SER A N     1 
ATOM   6002  C  CA    . SER A 1 787  ? -0.513  -79.940  -4.580  1.00 14.47 ? 788  SER A CA    1 
ATOM   6003  C  C     . SER A 1 787  ? 0.475   -79.028  -5.297  1.00 14.69 ? 788  SER A C     1 
ATOM   6004  O  O     . SER A 1 787  ? 0.201   -77.850  -5.481  1.00 15.03 ? 788  SER A O     1 
ATOM   6005  C  CB    . SER A 1 787  ? -0.389  -79.769  -3.072  1.00 15.07 ? 788  SER A CB    1 
ATOM   6006  O  OG    . SER A 1 787  ? 0.683   -80.548  -2.576  1.00 16.75 ? 788  SER A OG    1 
ATOM   6007  N  N     . GLU A 1 788  ? 1.616   -79.569  -5.706  1.00 15.18 ? 789  GLU A N     1 
ATOM   6008  C  CA    . GLU A 1 788  ? 2.660   -78.792  -6.395  1.00 15.40 ? 789  GLU A CA    1 
ATOM   6009  C  C     . GLU A 1 788  ? 2.458   -78.601  -7.894  1.00 14.61 ? 789  GLU A C     1 
ATOM   6010  O  O     . GLU A 1 788  ? 2.928   -77.621  -8.471  1.00 15.57 ? 789  GLU A O     1 
ATOM   6011  C  CB    . GLU A 1 788  ? 4.021   -79.455  -6.178  1.00 17.14 ? 789  GLU A CB    1 
ATOM   6012  C  CG    . GLU A 1 788  ? 4.934   -78.752  -5.190  1.00 20.15 ? 789  GLU A CG    1 
ATOM   6013  C  CD    . GLU A 1 788  ? 4.162   -78.028  -4.083  1.00 22.54 ? 789  GLU A CD    1 
ATOM   6014  O  OE1   . GLU A 1 788  ? 3.711   -78.673  -3.095  1.00 23.79 ? 789  GLU A OE1   1 
ATOM   6015  O  OE2   . GLU A 1 788  ? 4.008   -76.784  -4.203  1.00 24.41 ? 789  GLU A OE2   1 
ATOM   6016  N  N     . VAL A 1 789  ? 1.674   -79.473  -8.497  1.00 12.88 ? 790  VAL A N     1 
ATOM   6017  C  CA    . VAL A 1 789  ? 1.473   -79.454  -9.935  1.00 11.57 ? 790  VAL A CA    1 
ATOM   6018  C  C     . VAL A 1 789  ? 0.890   -78.213  -10.592 1.00 10.53 ? 790  VAL A C     1 
ATOM   6019  O  O     . VAL A 1 789  ? 1.291   -77.846  -11.689 1.00 10.79 ? 790  VAL A O     1 
ATOM   6020  C  CB    . VAL A 1 789  ? 0.708   -80.742  -10.407 1.00 11.62 ? 790  VAL A CB    1 
ATOM   6021  C  CG1   . VAL A 1 789  ? -0.813  -80.505  -10.499 1.00 11.49 ? 790  VAL A CG1   1 
ATOM   6022  C  CG2   . VAL A 1 789  ? 1.277   -81.225  -11.710 1.00 11.58 ? 790  VAL A CG2   1 
ATOM   6023  N  N     . LEU A 1 790  ? -0.095  -77.597  -9.960  1.00 9.36  ? 791  LEU A N     1 
ATOM   6024  C  CA    . LEU A 1 790  ? -0.744  -76.404  -10.526 1.00 7.71  ? 791  LEU A CA    1 
ATOM   6025  C  C     . LEU A 1 790  ? -0.842  -75.405  -9.393  1.00 7.22  ? 791  LEU A C     1 
ATOM   6026  O  O     . LEU A 1 790  ? -0.722  -75.801  -8.212  1.00 8.19  ? 791  LEU A O     1 
ATOM   6027  C  CB    . LEU A 1 790  ? -2.163  -76.738  -11.005 1.00 6.41  ? 791  LEU A CB    1 
ATOM   6028  C  CG    . LEU A 1 790  ? -2.371  -77.466  -12.313 1.00 5.29  ? 791  LEU A CG    1 
ATOM   6029  C  CD1   . LEU A 1 790  ? -3.842  -77.739  -12.557 1.00 5.21  ? 791  LEU A CD1   1 
ATOM   6030  C  CD2   . LEU A 1 790  ? -1.784  -76.651  -13.397 1.00 4.66  ? 791  LEU A CD2   1 
ATOM   6031  N  N     . PRO A 1 791  ? -1.076  -74.113  -9.709  1.00 6.35  ? 792  PRO A N     1 
ATOM   6032  C  CA    . PRO A 1 791  ? -1.194  -73.079  -8.662  1.00 5.70  ? 792  PRO A CA    1 
ATOM   6033  C  C     . PRO A 1 791  ? -2.311  -73.359  -7.630  1.00 5.32  ? 792  PRO A C     1 
ATOM   6034  O  O     . PRO A 1 791  ? -3.456  -73.682  -7.945  1.00 5.62  ? 792  PRO A O     1 
ATOM   6035  C  CB    . PRO A 1 791  ? -1.470  -71.805  -9.455  1.00 5.43  ? 792  PRO A CB    1 
ATOM   6036  C  CG    . PRO A 1 791  ? -0.859  -72.104  -10.811 1.00 5.20  ? 792  PRO A CG    1 
ATOM   6037  C  CD    . PRO A 1 791  ? -1.237  -73.526  -11.052 1.00 5.86  ? 792  PRO A CD    1 
ATOM   6038  N  N     . ARG A 1 792  ? -1.950  -73.197  -6.385  1.00 4.80  ? 793  ARG A N     1 
ATOM   6039  C  CA    . ARG A 1 792  ? -2.827  -73.444  -5.287  1.00 5.02  ? 793  ARG A CA    1 
ATOM   6040  C  C     . ARG A 1 792  ? -4.122  -72.636  -5.363  1.00 5.23  ? 793  ARG A C     1 
ATOM   6041  O  O     . ARG A 1 792  ? -5.169  -73.120  -4.933  1.00 5.55  ? 793  ARG A O     1 
ATOM   6042  C  CB    . ARG A 1 792  ? -2.038  -73.129  -4.026  1.00 5.15  ? 793  ARG A CB    1 
ATOM   6043  C  CG    . ARG A 1 792  ? -2.689  -73.483  -2.784  1.00 5.03  ? 793  ARG A CG    1 
ATOM   6044  C  CD    . ARG A 1 792  ? -1.766  -73.347  -1.622  1.00 4.02  ? 793  ARG A CD    1 
ATOM   6045  N  NE    . ARG A 1 792  ? -2.379  -74.041  -0.492  1.00 3.72  ? 793  ARG A NE    1 
ATOM   6046  C  CZ    . ARG A 1 792  ? -1.885  -74.108  0.742   1.00 3.15  ? 793  ARG A CZ    1 
ATOM   6047  N  NH1   . ARG A 1 792  ? -0.707  -73.540  1.054   1.00 2.65  ? 793  ARG A NH1   1 
ATOM   6048  N  NH2   . ARG A 1 792  ? -2.617  -74.715  1.675   1.00 2.44  ? 793  ARG A NH2   1 
ATOM   6049  N  N     . ASP A 1 793  ? -4.048  -71.440  -5.944  1.00 5.35  ? 794  ASP A N     1 
ATOM   6050  C  CA    . ASP A 1 793  ? -5.205  -70.546  -6.091  1.00 6.09  ? 794  ASP A CA    1 
ATOM   6051  C  C     . ASP A 1 793  ? -5.852  -70.442  -7.478  1.00 5.50  ? 794  ASP A C     1 
ATOM   6052  O  O     . ASP A 1 793  ? -6.441  -69.433  -7.812  1.00 5.39  ? 794  ASP A O     1 
ATOM   6053  C  CB    . ASP A 1 793  ? -4.936  -69.142  -5.533  1.00 7.03  ? 794  ASP A CB    1 
ATOM   6054  C  CG    . ASP A 1 793  ? -3.710  -68.493  -6.134  1.00 9.06  ? 794  ASP A CG    1 
ATOM   6055  O  OD1   . ASP A 1 793  ? -3.256  -68.932  -7.225  1.00 10.46 ? 794  ASP A OD1   1 
ATOM   6056  O  OD2   . ASP A 1 793  ? -3.182  -67.540  -5.504  1.00 10.75 ? 794  ASP A OD2   1 
ATOM   6057  N  N     . SER A 1 794  ? -5.653  -71.466  -8.295  1.00 5.31  ? 795  SER A N     1 
ATOM   6058  C  CA    . SER A 1 794  ? -6.288  -71.574  -9.602  1.00 4.59  ? 795  SER A CA    1 
ATOM   6059  C  C     . SER A 1 794  ? -7.429  -72.558  -9.306  1.00 4.48  ? 795  SER A C     1 
ATOM   6060  O  O     . SER A 1 794  ? -7.344  -73.332  -8.359  1.00 4.54  ? 795  SER A O     1 
ATOM   6061  C  CB    . SER A 1 794  ? -5.312  -72.133  -10.650 1.00 3.84  ? 795  SER A CB    1 
ATOM   6062  O  OG    . SER A 1 794  ? -4.975  -73.474  -10.410 1.00 3.85  ? 795  SER A OG    1 
ATOM   6063  N  N     . LEU A 1 795  ? -8.509  -72.491  -10.077 1.00 4.98  ? 796  LEU A N     1 
ATOM   6064  C  CA    . LEU A 1 795  ? -9.689  -73.344  -9.873  1.00 4.52  ? 796  LEU A CA    1 
ATOM   6065  C  C     . LEU A 1 795  ? -9.266  -74.806  -9.782  1.00 4.17  ? 796  LEU A C     1 
ATOM   6066  O  O     . LEU A 1 795  ? -9.300  -75.412  -8.712  1.00 3.82  ? 796  LEU A O     1 
ATOM   6067  C  CB    . LEU A 1 795  ? -10.690 -73.159  -11.030 1.00 4.11  ? 796  LEU A CB    1 
ATOM   6068  C  CG    . LEU A 1 795  ? -12.181 -73.474  -10.913 1.00 3.92  ? 796  LEU A CG    1 
ATOM   6069  C  CD1   . LEU A 1 795  ? -12.746 -73.708  -12.302 1.00 3.84  ? 796  LEU A CD1   1 
ATOM   6070  C  CD2   . LEU A 1 795  ? -12.435 -74.640  -10.098 1.00 3.15  ? 796  LEU A CD2   1 
ATOM   6071  N  N     . LYS A 1 796  ? -8.833  -75.334  -10.915 1.00 4.08  ? 797  LYS A N     1 
ATOM   6072  C  CA    . LYS A 1 796  ? -8.410  -76.715  -11.052 1.00 3.99  ? 797  LYS A CA    1 
ATOM   6073  C  C     . LYS A 1 796  ? -7.320  -77.086  -10.054 1.00 3.38  ? 797  LYS A C     1 
ATOM   6074  O  O     . LYS A 1 796  ? -7.375  -78.164  -9.440  1.00 2.90  ? 797  LYS A O     1 
ATOM   6075  C  CB    . LYS A 1 796  ? -7.911  -76.901  -12.483 1.00 4.86  ? 797  LYS A CB    1 
ATOM   6076  C  CG    . LYS A 1 796  ? -7.941  -78.285  -12.984 1.00 6.18  ? 797  LYS A CG    1 
ATOM   6077  C  CD    . LYS A 1 796  ? -7.734  -78.341  -14.503 1.00 8.40  ? 797  LYS A CD    1 
ATOM   6078  C  CE    . LYS A 1 796  ? -7.573  -79.819  -14.932 1.00 9.66  ? 797  LYS A CE    1 
ATOM   6079  N  NZ    . LYS A 1 796  ? -7.283  -79.993  -16.388 1.00 11.98 ? 797  LYS A NZ    1 
ATOM   6080  N  N     . GLY A 1 797  ? -6.436  -76.110  -9.807  1.00 3.12  ? 798  GLY A N     1 
ATOM   6081  C  CA    . GLY A 1 797  ? -5.286  -76.267  -8.929  1.00 2.82  ? 798  GLY A CA    1 
ATOM   6082  C  C     . GLY A 1 797  ? -5.598  -76.357  -7.471  1.00 2.56  ? 798  GLY A C     1 
ATOM   6083  O  O     . GLY A 1 797  ? -4.962  -77.124  -6.734  1.00 2.33  ? 798  GLY A O     1 
ATOM   6084  N  N     . SER A 1 798  ? -6.639  -75.628  -7.089  1.00 2.49  ? 799  SER A N     1 
ATOM   6085  C  CA    . SER A 1 798  ? -7.087  -75.596  -5.712  1.00 2.20  ? 799  SER A CA    1 
ATOM   6086  C  C     . SER A 1 798  ? -7.696  -76.952  -5.314  1.00 2.48  ? 799  SER A C     1 
ATOM   6087  O  O     . SER A 1 798  ? -7.633  -77.350  -4.133  1.00 2.61  ? 799  SER A O     1 
ATOM   6088  C  CB    . SER A 1 798  ? -8.105  -74.504  -5.542  1.00 2.00  ? 799  SER A CB    1 
ATOM   6089  O  OG    . SER A 1 798  ? -9.177  -74.711  -6.439  1.00 2.04  ? 799  SER A OG    1 
ATOM   6090  N  N     . GLN A 1 799  ? -8.236  -77.678  -6.296  1.00 2.39  ? 800  GLN A N     1 
ATOM   6091  C  CA    . GLN A 1 799  ? -8.846  -78.973  -6.019  1.00 2.84  ? 800  GLN A CA    1 
ATOM   6092  C  C     . GLN A 1 799  ? -7.867  -80.120  -6.051  1.00 3.19  ? 800  GLN A C     1 
ATOM   6093  O  O     . GLN A 1 799  ? -8.282  -81.272  -5.937  1.00 3.44  ? 800  GLN A O     1 
ATOM   6094  C  CB    . GLN A 1 799  ? -10.040 -79.225  -6.943  1.00 3.00  ? 800  GLN A CB    1 
ATOM   6095  C  CG    . GLN A 1 799  ? -11.201 -78.287  -6.627  1.00 2.64  ? 800  GLN A CG    1 
ATOM   6096  C  CD    . GLN A 1 799  ? -11.488 -78.275  -5.129  1.00 2.44  ? 800  GLN A CD    1 
ATOM   6097  O  OE1   . GLN A 1 799  ? -11.762 -79.325  -4.548  1.00 2.67  ? 800  GLN A OE1   1 
ATOM   6098  N  NE2   . GLN A 1 799  ? -11.359 -77.106  -4.491  1.00 2.00  ? 800  GLN A NE2   1 
ATOM   6099  N  N     . PHE A 1 800  ? -6.584  -79.784  -6.264  1.00 3.73  ? 801  PHE A N     1 
ATOM   6100  C  CA    . PHE A 1 800  ? -5.479  -80.737  -6.245  1.00 4.11  ? 801  PHE A CA    1 
ATOM   6101  C  C     . PHE A 1 800  ? -4.713  -80.477  -4.940  1.00 4.60  ? 801  PHE A C     1 
ATOM   6102  O  O     . PHE A 1 800  ? -3.549  -80.862  -4.807  1.00 4.60  ? 801  PHE A O     1 
ATOM   6103  C  CB    . PHE A 1 800  ? -4.536  -80.609  -7.453  1.00 4.75  ? 801  PHE A CB    1 
ATOM   6104  C  CG    . PHE A 1 800  ? -5.090  -81.164  -8.732  1.00 4.88  ? 801  PHE A CG    1 
ATOM   6105  C  CD1   . PHE A 1 800  ? -5.861  -82.300  -8.744  1.00 5.49  ? 801  PHE A CD1   1 
ATOM   6106  C  CD2   . PHE A 1 800  ? -4.835  -80.525  -9.934  1.00 5.60  ? 801  PHE A CD2   1 
ATOM   6107  C  CE1   . PHE A 1 800  ? -6.388  -82.816  -9.956  1.00 6.97  ? 801  PHE A CE1   1 
ATOM   6108  C  CE2   . PHE A 1 800  ? -5.354  -81.030  -11.151 1.00 6.69  ? 801  PHE A CE2   1 
ATOM   6109  C  CZ    . PHE A 1 800  ? -6.135  -82.187  -11.158 1.00 6.21  ? 801  PHE A CZ    1 
ATOM   6110  N  N     . GLN A 1 801  ? -5.353  -79.720  -4.029  1.00 4.69  ? 802  GLN A N     1 
ATOM   6111  C  CA    . GLN A 1 801  ? -4.833  -79.424  -2.675  1.00 4.29  ? 802  GLN A CA    1 
ATOM   6112  C  C     . GLN A 1 801  ? -5.657  -80.270  -1.661  1.00 4.67  ? 802  GLN A C     1 
ATOM   6113  O  O     . GLN A 1 801  ? -6.781  -80.708  -1.957  1.00 4.78  ? 802  GLN A O     1 
ATOM   6114  C  CB    . GLN A 1 801  ? -5.034  -77.955  -2.310  1.00 3.78  ? 802  GLN A CB    1 
ATOM   6115  C  CG    . GLN A 1 801  ? -4.458  -76.959  -3.325  1.00 3.81  ? 802  GLN A CG    1 
ATOM   6116  C  CD    . GLN A 1 801  ? -2.925  -77.024  -3.446  1.00 4.55  ? 802  GLN A CD    1 
ATOM   6117  O  OE1   . GLN A 1 801  ? -2.197  -77.240  -2.452  1.00 4.69  ? 802  GLN A OE1   1 
ATOM   6118  N  NE2   . GLN A 1 801  ? -2.427  -76.835  -4.675  1.00 4.71  ? 802  GLN A NE2   1 
ATOM   6119  N  N     . GLU A 1 802  ? -5.099  -80.522  -0.482  1.00 4.65  ? 803  GLU A N     1 
ATOM   6120  C  CA    . GLU A 1 802  ? -5.820  -81.283  0.520   1.00 4.85  ? 803  GLU A CA    1 
ATOM   6121  C  C     . GLU A 1 802  ? -6.845  -80.393  1.200   1.00 4.76  ? 803  GLU A C     1 
ATOM   6122  O  O     . GLU A 1 802  ? -6.494  -79.284  1.655   1.00 5.68  ? 803  GLU A O     1 
ATOM   6123  C  CB    . GLU A 1 802  ? -4.851  -81.795  1.580   1.00 5.66  ? 803  GLU A CB    1 
ATOM   6124  C  CG    . GLU A 1 802  ? -3.892  -82.902  1.125   1.00 6.54  ? 803  GLU A CG    1 
ATOM   6125  C  CD    . GLU A 1 802  ? -2.721  -82.992  2.041   1.00 6.75  ? 803  GLU A CD    1 
ATOM   6126  O  OE1   . GLU A 1 802  ? -1.769  -82.184  1.859   1.00 7.01  ? 803  GLU A OE1   1 
ATOM   6127  O  OE2   . GLU A 1 802  ? -2.803  -83.820  2.979   1.00 7.51  ? 803  GLU A OE2   1 
ATOM   6128  N  N     . PRO A 1 803  ? -8.138  -80.791  1.207   1.00 4.05  ? 804  PRO A N     1 
ATOM   6129  C  CA    . PRO A 1 803  ? -9.138  -79.944  1.879   1.00 3.42  ? 804  PRO A CA    1 
ATOM   6130  C  C     . PRO A 1 803  ? -8.978  -80.284  3.348   1.00 3.29  ? 804  PRO A C     1 
ATOM   6131  O  O     . PRO A 1 803  ? -8.881  -81.481  3.689   1.00 3.41  ? 804  PRO A O     1 
ATOM   6132  C  CB    . PRO A 1 803  ? -10.455 -80.481  1.358   1.00 3.23  ? 804  PRO A CB    1 
ATOM   6133  C  CG    . PRO A 1 803  ? -10.148 -81.956  1.155   1.00 3.31  ? 804  PRO A CG    1 
ATOM   6134  C  CD    . PRO A 1 803  ? -8.772  -81.930  0.531   1.00 3.34  ? 804  PRO A CD    1 
ATOM   6135  N  N     . LEU A 1 804  ? -8.895  -79.254  4.204   1.00 2.76  ? 805  LEU A N     1 
ATOM   6136  C  CA    . LEU A 1 804  ? -8.706  -79.475  5.614   1.00 2.01  ? 805  LEU A CA    1 
ATOM   6137  C  C     . LEU A 1 804  ? -9.931  -79.295  6.449   1.00 2.34  ? 805  LEU A C     1 
ATOM   6138  O  O     . LEU A 1 804  ? -9.810  -78.978  7.640   1.00 2.31  ? 805  LEU A O     1 
ATOM   6139  C  CB    . LEU A 1 804  ? -7.603  -78.579  6.128   1.00 2.71  ? 805  LEU A CB    1 
ATOM   6140  C  CG    . LEU A 1 804  ? -6.150  -79.056  6.038   1.00 2.91  ? 805  LEU A CG    1 
ATOM   6141  C  CD1   . LEU A 1 804  ? -5.953  -80.054  4.932   1.00 2.47  ? 805  LEU A CD1   1 
ATOM   6142  C  CD2   . LEU A 1 804  ? -5.200  -77.874  5.917   1.00 2.00  ? 805  LEU A CD2   1 
ATOM   6143  N  N     . MET A 1 805  ? -11.108 -79.433  5.830   1.00 2.00  ? 806  MET A N     1 
ATOM   6144  C  CA    . MET A 1 805  ? -12.384 -79.340  6.531   1.00 2.00  ? 806  MET A CA    1 
ATOM   6145  C  C     . MET A 1 805  ? -13.216 -80.304  5.754   1.00 2.00  ? 806  MET A C     1 
ATOM   6146  O  O     . MET A 1 805  ? -13.558 -80.022  4.634   1.00 2.24  ? 806  MET A O     1 
ATOM   6147  C  CB    . MET A 1 805  ? -12.976 -77.948  6.422   1.00 2.00  ? 806  MET A CB    1 
ATOM   6148  C  CG    . MET A 1 805  ? -14.113 -77.622  7.413   1.00 2.16  ? 806  MET A CG    1 
ATOM   6149  S  SD    . MET A 1 805  ? -15.657 -78.529  7.207   1.00 2.32  ? 806  MET A SD    1 
ATOM   6150  C  CE    . MET A 1 805  ? -16.248 -77.775  5.756   1.00 2.00  ? 806  MET A CE    1 
ATOM   6151  N  N     . GLU A 1 806  ? -13.485 -81.489  6.304   1.00 2.79  ? 807  GLU A N     1 
ATOM   6152  C  CA    . GLU A 1 806  ? -14.251 -82.514  5.577   1.00 2.66  ? 807  GLU A CA    1 
ATOM   6153  C  C     . GLU A 1 806  ? -15.330 -83.259  6.346   1.00 2.09  ? 807  GLU A C     1 
ATOM   6154  O  O     . GLU A 1 806  ? -15.159 -83.553  7.522   1.00 2.00  ? 807  GLU A O     1 
ATOM   6155  C  CB    . GLU A 1 806  ? -13.313 -83.566  5.029   1.00 2.22  ? 807  GLU A CB    1 
ATOM   6156  C  CG    . GLU A 1 806  ? -12.405 -83.108  3.984   1.00 3.35  ? 807  GLU A CG    1 
ATOM   6157  C  CD    . GLU A 1 806  ? -11.621 -84.266  3.418   1.00 4.02  ? 807  GLU A CD    1 
ATOM   6158  O  OE1   . GLU A 1 806  ? -10.962 -84.953  4.199   1.00 4.82  ? 807  GLU A OE1   1 
ATOM   6159  O  OE2   . GLU A 1 806  ? -11.668 -84.511  2.206   1.00 4.32  ? 807  GLU A OE2   1 
ATOM   6160  N  N     . PHE A 1 807  ? -16.389 -83.633  5.624   1.00 2.00  ? 808  PHE A N     1 
ATOM   6161  C  CA    . PHE A 1 807  ? -17.509 -84.386  6.167   1.00 2.00  ? 808  PHE A CA    1 
ATOM   6162  C  C     . PHE A 1 807  ? -18.144 -83.790  7.436   1.00 2.09  ? 808  PHE A C     1 
ATOM   6163  O  O     . PHE A 1 807  ? -18.222 -84.451  8.467   1.00 2.30  ? 808  PHE A O     1 
ATOM   6164  C  CB    . PHE A 1 807  ? -17.076 -85.854  6.420   1.00 2.07  ? 808  PHE A CB    1 
ATOM   6165  C  CG    . PHE A 1 807  ? -16.038 -86.356  5.445   1.00 2.00  ? 808  PHE A CG    1 
ATOM   6166  C  CD1   . PHE A 1 807  ? -16.222 -86.228  4.064   1.00 2.00  ? 808  PHE A CD1   1 
ATOM   6167  C  CD2   . PHE A 1 807  ? -14.863 -86.924  5.902   1.00 2.40  ? 808  PHE A CD2   1 
ATOM   6168  C  CE1   . PHE A 1 807  ? -15.234 -86.656  3.147   1.00 2.00  ? 808  PHE A CE1   1 
ATOM   6169  C  CE2   . PHE A 1 807  ? -13.866 -87.358  4.983   1.00 2.64  ? 808  PHE A CE2   1 
ATOM   6170  C  CZ    . PHE A 1 807  ? -14.067 -87.218  3.599   1.00 2.00  ? 808  PHE A CZ    1 
ATOM   6171  N  N     . SER A 1 808  ? -18.644 -82.561  7.370   1.00 2.15  ? 809  SER A N     1 
ATOM   6172  C  CA    . SER A 1 808  ? -19.241 -81.983  8.556   1.00 2.77  ? 809  SER A CA    1 
ATOM   6173  C  C     . SER A 1 808  ? -20.741 -82.303  8.701   1.00 2.39  ? 809  SER A C     1 
ATOM   6174  O  O     . SER A 1 808  ? -21.364 -82.849  7.811   1.00 2.70  ? 809  SER A O     1 
ATOM   6175  C  CB    . SER A 1 808  ? -19.027 -80.468  8.572   1.00 2.21  ? 809  SER A CB    1 
ATOM   6176  O  OG    . SER A 1 808  ? -19.910 -79.911  7.636   1.00 3.20  ? 809  SER A OG    1 
ATOM   6177  N  N     . GLY A 1 809  ? -21.291 -81.949  9.854   1.00 2.54  ? 810  GLY A N     1 
ATOM   6178  C  CA    . GLY A 1 809  ? -22.694 -82.169  10.142  1.00 2.45  ? 810  GLY A CA    1 
ATOM   6179  C  C     . GLY A 1 809  ? -23.617 -81.135  9.510   1.00 2.51  ? 810  GLY A C     1 
ATOM   6180  O  O     . GLY A 1 809  ? -24.819 -81.134  9.767   1.00 2.95  ? 810  GLY A O     1 
ATOM   6181  N  N     . ALA A 1 810  ? -23.069 -80.274  8.654   1.00 2.17  ? 811  ALA A N     1 
ATOM   6182  C  CA    . ALA A 1 810  ? -23.871 -79.264  7.949   1.00 2.38  ? 811  ALA A CA    1 
ATOM   6183  C  C     . ALA A 1 810  ? -24.998 -79.956  7.167   1.00 2.18  ? 811  ALA A C     1 
ATOM   6184  O  O     . ALA A 1 810  ? -24.895 -81.138  6.913   1.00 2.00  ? 811  ALA A O     1 
ATOM   6185  C  CB    . ALA A 1 810  ? -22.977 -78.481  6.985   1.00 2.00  ? 811  ALA A CB    1 
ATOM   6186  N  N     . CYS A 1 811  ? -26.071 -79.232  6.818   1.00 2.00  ? 812  CYS A N     1 
ATOM   6187  C  CA    . CYS A 1 811  ? -27.185 -79.830  6.073   1.00 2.00  ? 812  CYS A CA    1 
ATOM   6188  C  C     . CYS A 1 811  ? -26.736 -80.196  4.672   1.00 2.36  ? 812  CYS A C     1 
ATOM   6189  O  O     . CYS A 1 811  ? -25.731 -79.620  4.194   1.00 2.56  ? 812  CYS A O     1 
ATOM   6190  C  CB    . CYS A 1 811  ? -28.337 -78.843  5.906   1.00 2.00  ? 812  CYS A CB    1 
ATOM   6191  S  SG    . CYS A 1 811  ? -28.992 -78.047  7.402   1.00 2.09  ? 812  CYS A SG    1 
ATOM   6192  N  N     . SER A 1 812  ? -27.443 -81.133  4.008   1.00 2.00  ? 813  SER A N     1 
ATOM   6193  C  CA    . SER A 1 812  ? -27.110 -81.451  2.634   1.00 2.10  ? 813  SER A CA    1 
ATOM   6194  C  C     . SER A 1 812  ? -27.276 -80.215  1.745   1.00 2.36  ? 813  SER A C     1 
ATOM   6195  O  O     . SER A 1 812  ? -28.353 -79.622  1.696   1.00 2.66  ? 813  SER A O     1 
ATOM   6196  C  CB    . SER A 1 812  ? -28.031 -82.481  2.060   1.00 2.30  ? 813  SER A CB    1 
ATOM   6197  O  OG    . SER A 1 812  ? -28.041 -83.623  2.862   1.00 4.69  ? 813  SER A OG    1 
ATOM   6198  N  N     . GLY A 1 813  ? -26.207 -79.825  1.064   1.00 2.16  ? 814  GLY A N     1 
ATOM   6199  C  CA    . GLY A 1 813  ? -26.260 -78.704  0.154   1.00 2.02  ? 814  GLY A CA    1 
ATOM   6200  C  C     . GLY A 1 813  ? -26.034 -77.385  0.816   1.00 2.00  ? 814  GLY A C     1 
ATOM   6201  O  O     . GLY A 1 813  ? -26.303 -76.387  0.196   1.00 2.00  ? 814  GLY A O     1 
ATOM   6202  N  N     . CYS A 1 814  ? -25.549 -77.397  2.063   1.00 2.23  ? 815  CYS A N     1 
ATOM   6203  C  CA    . CYS A 1 814  ? -25.281 -76.183  2.842   1.00 2.27  ? 815  CYS A CA    1 
ATOM   6204  C  C     . CYS A 1 814  ? -24.520 -75.117  2.043   1.00 2.00  ? 815  CYS A C     1 
ATOM   6205  O  O     . CYS A 1 814  ? -23.583 -75.463  1.325   1.00 2.00  ? 815  CYS A O     1 
ATOM   6206  C  CB    . CYS A 1 814  ? -24.476 -76.514  4.107   1.00 2.05  ? 815  CYS A CB    1 
ATOM   6207  S  SG    . CYS A 1 814  ? -24.139 -74.989  5.090   1.00 2.00  ? 815  CYS A SG    1 
ATOM   6208  N  N     . GLY A 1 815  ? -24.965 -73.853  2.133   1.00 2.05  ? 816  GLY A N     1 
ATOM   6209  C  CA    . GLY A 1 815  ? -24.332 -72.757  1.407   1.00 2.00  ? 816  GLY A CA    1 
ATOM   6210  C  C     . GLY A 1 815  ? -23.036 -72.225  2.005   1.00 2.21  ? 816  GLY A C     1 
ATOM   6211  O  O     . GLY A 1 815  ? -22.314 -71.485  1.342   1.00 2.65  ? 816  GLY A O     1 
ATOM   6212  N  N     . GLU A 1 816  ? -22.719 -72.636  3.236   1.00 2.14  ? 817  GLU A N     1 
ATOM   6213  C  CA    . GLU A 1 816  ? -21.535 -72.198  3.973   1.00 2.00  ? 817  GLU A CA    1 
ATOM   6214  C  C     . GLU A 1 816  ? -20.285 -73.025  3.808   1.00 2.00  ? 817  GLU A C     1 
ATOM   6215  O  O     . GLU A 1 816  ? -19.209 -72.475  3.617   1.00 2.00  ? 817  GLU A O     1 
ATOM   6216  C  CB    . GLU A 1 816  ? -21.825 -72.127  5.486   1.00 2.20  ? 817  GLU A CB    1 
ATOM   6217  C  CG    . GLU A 1 816  ? -23.117 -71.382  5.899   1.00 2.10  ? 817  GLU A CG    1 
ATOM   6218  C  CD    . GLU A 1 816  ? -23.229 -71.105  7.403   1.00 2.09  ? 817  GLU A CD    1 
ATOM   6219  O  OE1   . GLU A 1 816  ? -22.653 -71.868  8.218   1.00 2.44  ? 817  GLU A OE1   1 
ATOM   6220  O  OE2   . GLU A 1 816  ? -23.906 -70.129  7.763   1.00 2.00  ? 817  GLU A OE2   1 
ATOM   6221  N  N     . THR A 1 817  ? -20.416 -74.343  3.899   1.00 2.02  ? 818  THR A N     1 
ATOM   6222  C  CA    . THR A 1 817  ? -19.254 -75.242  3.817   1.00 2.08  ? 818  THR A CA    1 
ATOM   6223  C  C     . THR A 1 817  ? -18.372 -75.242  2.570   1.00 2.23  ? 818  THR A C     1 
ATOM   6224  O  O     . THR A 1 817  ? -17.174 -75.425  2.678   1.00 2.00  ? 818  THR A O     1 
ATOM   6225  C  CB    . THR A 1 817  ? -19.620 -76.667  4.171   1.00 2.00  ? 818  THR A CB    1 
ATOM   6226  O  OG1   . THR A 1 817  ? -20.724 -77.034  3.377   1.00 2.00  ? 818  THR A OG1   1 
ATOM   6227  C  CG2   . THR A 1 817  ? -19.991 -76.784  5.638   1.00 2.00  ? 818  THR A CG2   1 
ATOM   6228  N  N     . PRO A 1 818  ? -18.947 -75.032  1.373   1.00 2.62  ? 819  PRO A N     1 
ATOM   6229  C  CA    . PRO A 1 818  ? -18.087 -75.031  0.189   1.00 2.30  ? 819  PRO A CA    1 
ATOM   6230  C  C     . PRO A 1 818  ? -17.051 -73.934  0.272   1.00 2.33  ? 819  PRO A C     1 
ATOM   6231  O  O     . PRO A 1 818  ? -15.905 -74.139  -0.129  1.00 2.79  ? 819  PRO A O     1 
ATOM   6232  C  CB    . PRO A 1 818  ? -19.077 -74.808  -0.966  1.00 2.14  ? 819  PRO A CB    1 
ATOM   6233  C  CG    . PRO A 1 818  ? -20.309 -75.478  -0.513  1.00 2.19  ? 819  PRO A CG    1 
ATOM   6234  C  CD    . PRO A 1 818  ? -20.367 -74.987  0.967   1.00 3.15  ? 819  PRO A CD    1 
ATOM   6235  N  N     . TYR A 1 819  ? -17.437 -72.783  0.821   1.00 2.58  ? 820  TYR A N     1 
ATOM   6236  C  CA    . TYR A 1 819  ? -16.525 -71.670  0.960   1.00 2.00  ? 820  TYR A CA    1 
ATOM   6237  C  C     . TYR A 1 819  ? -15.430 -72.006  1.935   1.00 2.48  ? 820  TYR A C     1 
ATOM   6238  O  O     . TYR A 1 819  ? -14.242 -71.851  1.611   1.00 3.37  ? 820  TYR A O     1 
ATOM   6239  C  CB    . TYR A 1 819  ? -17.234 -70.437  1.483   1.00 2.00  ? 820  TYR A CB    1 
ATOM   6240  C  CG    . TYR A 1 819  ? -18.228 -69.832  0.534   1.00 2.00  ? 820  TYR A CG    1 
ATOM   6241  C  CD1   . TYR A 1 819  ? -17.816 -68.946  -0.449  1.00 2.00  ? 820  TYR A CD1   1 
ATOM   6242  C  CD2   . TYR A 1 819  ? -19.602 -70.090  0.662   1.00 2.11  ? 820  TYR A CD2   1 
ATOM   6243  C  CE1   . TYR A 1 819  ? -18.728 -68.323  -1.270  1.00 2.13  ? 820  TYR A CE1   1 
ATOM   6244  C  CE2   . TYR A 1 819  ? -20.536 -69.455  -0.164  1.00 2.01  ? 820  TYR A CE2   1 
ATOM   6245  C  CZ    . TYR A 1 819  ? -20.089 -68.574  -1.112  1.00 2.12  ? 820  TYR A CZ    1 
ATOM   6246  O  OH    . TYR A 1 819  ? -20.992 -67.853  -1.863  1.00 3.41  ? 820  TYR A OH    1 
ATOM   6247  N  N     . VAL A 1 820  ? -15.784 -72.496  3.122   1.00 2.33  ? 821  VAL A N     1 
ATOM   6248  C  CA    . VAL A 1 820  ? -14.729 -72.783  4.093   1.00 2.30  ? 821  VAL A CA    1 
ATOM   6249  C  C     . VAL A 1 820  ? -13.796 -73.937  3.754   1.00 2.50  ? 821  VAL A C     1 
ATOM   6250  O  O     . VAL A 1 820  ? -12.673 -73.965  4.235   1.00 2.09  ? 821  VAL A O     1 
ATOM   6251  C  CB    . VAL A 1 820  ? -15.215 -72.863  5.590   1.00 2.56  ? 821  VAL A CB    1 
ATOM   6252  C  CG1   . VAL A 1 820  ? -16.595 -72.276  5.779   1.00 2.00  ? 821  VAL A CG1   1 
ATOM   6253  C  CG2   . VAL A 1 820  ? -15.084 -74.254  6.143   1.00 2.55  ? 821  VAL A CG2   1 
ATOM   6254  N  N     . ARG A 1 821  ? -14.234 -74.862  2.902   1.00 2.24  ? 822  ARG A N     1 
ATOM   6255  C  CA    . ARG A 1 821  ? -13.361 -75.948  2.539   1.00 2.59  ? 822  ARG A CA    1 
ATOM   6256  C  C     . ARG A 1 821  ? -12.276 -75.428  1.621   1.00 2.82  ? 822  ARG A C     1 
ATOM   6257  O  O     . ARG A 1 821  ? -11.123 -75.809  1.798   1.00 3.63  ? 822  ARG A O     1 
ATOM   6258  C  CB    . ARG A 1 821  ? -14.092 -77.118  1.868   1.00 2.54  ? 822  ARG A CB    1 
ATOM   6259  C  CG    . ARG A 1 821  ? -13.214 -78.345  1.736   1.00 4.14  ? 822  ARG A CG    1 
ATOM   6260  C  CD    . ARG A 1 821  ? -13.779 -79.404  0.762   1.00 5.38  ? 822  ARG A CD    1 
ATOM   6261  N  NE    . ARG A 1 821  ? -13.943 -78.728  -0.502  1.00 7.21  ? 822  ARG A NE    1 
ATOM   6262  C  CZ    . ARG A 1 821  ? -13.438 -79.118  -1.658  1.00 8.34  ? 822  ARG A CZ    1 
ATOM   6263  N  NH1   . ARG A 1 821  ? -12.719 -80.262  -1.750  1.00 7.53  ? 822  ARG A NH1   1 
ATOM   6264  N  NH2   . ARG A 1 821  ? -13.583 -78.276  -2.706  1.00 8.36  ? 822  ARG A NH2   1 
ATOM   6265  N  N     . VAL A 1 822  ? -12.594 -74.527  0.674   1.00 3.06  ? 823  VAL A N     1 
ATOM   6266  C  CA    . VAL A 1 822  ? -11.546 -74.060  -0.242  1.00 2.48  ? 823  VAL A CA    1 
ATOM   6267  C  C     . VAL A 1 822  ? -10.589 -73.045  0.403   1.00 2.66  ? 823  VAL A C     1 
ATOM   6268  O  O     . VAL A 1 822  ? -9.429  -72.900  -0.017  1.00 2.50  ? 823  VAL A O     1 
ATOM   6269  C  CB    . VAL A 1 822  ? -12.059 -73.607  -1.687  1.00 2.45  ? 823  VAL A CB    1 
ATOM   6270  C  CG1   . VAL A 1 822  ? -13.454 -74.108  -2.005  1.00 2.06  ? 823  VAL A CG1   1 
ATOM   6271  C  CG2   . VAL A 1 822  ? -11.909 -72.120  -1.904  1.00 2.00  ? 823  VAL A CG2   1 
ATOM   6272  N  N     . ILE A 1 823  ? -11.061 -72.342  1.428   1.00 2.81  ? 824  ILE A N     1 
ATOM   6273  C  CA    . ILE A 1 823  ? -10.201 -71.372  2.096   1.00 2.18  ? 824  ILE A CA    1 
ATOM   6274  C  C     . ILE A 1 823  ? -9.095  -72.212  2.699   1.00 2.27  ? 824  ILE A C     1 
ATOM   6275  O  O     . ILE A 1 823  ? -7.903  -71.902  2.509   1.00 2.00  ? 824  ILE A O     1 
ATOM   6276  C  CB    . ILE A 1 823  ? -10.928 -70.594  3.192   1.00 2.33  ? 824  ILE A CB    1 
ATOM   6277  C  CG1   . ILE A 1 823  ? -12.019 -69.704  2.591   1.00 2.18  ? 824  ILE A CG1   1 
ATOM   6278  C  CG2   . ILE A 1 823  ? -9.938  -69.728  3.984   1.00 2.00  ? 824  ILE A CG2   1 
ATOM   6279  C  CD1   . ILE A 1 823  ? -12.841 -69.001  3.611   1.00 2.00  ? 824  ILE A CD1   1 
ATOM   6280  N  N     . THR A 1 824  ? -9.490  -73.322  3.332   1.00 2.00  ? 825  THR A N     1 
ATOM   6281  C  CA    . THR A 1 824  ? -8.506  -74.233  3.929   1.00 2.39  ? 825  THR A CA    1 
ATOM   6282  C  C     . THR A 1 824  ? -7.578  -74.768  2.872   1.00 2.31  ? 825  THR A C     1 
ATOM   6283  O  O     . THR A 1 824  ? -6.449  -75.044  3.197   1.00 2.85  ? 825  THR A O     1 
ATOM   6284  C  CB    . THR A 1 824  ? -9.095  -75.487  4.725   1.00 2.10  ? 825  THR A CB    1 
ATOM   6285  O  OG1   . THR A 1 824  ? -9.742  -76.408  3.841   1.00 2.00  ? 825  THR A OG1   1 
ATOM   6286  C  CG2   . THR A 1 824  ? -10.032 -75.041  5.811   1.00 2.00  ? 825  THR A CG2   1 
ATOM   6287  N  N     . GLN A 1 825  ? -8.046  -74.914  1.630   1.00 2.12  ? 826  GLN A N     1 
ATOM   6288  C  CA    . GLN A 1 825  ? -7.205  -75.434  0.561   1.00 2.40  ? 826  GLN A CA    1 
ATOM   6289  C  C     . GLN A 1 825  ? -6.120  -74.475  0.119   1.00 2.85  ? 826  GLN A C     1 
ATOM   6290  O  O     . GLN A 1 825  ? -5.148  -74.877  -0.517  1.00 2.91  ? 826  GLN A O     1 
ATOM   6291  C  CB    . GLN A 1 825  ? -8.051  -75.867  -0.612  1.00 2.00  ? 826  GLN A CB    1 
ATOM   6292  C  CG    . GLN A 1 825  ? -8.549  -77.285  -0.420  1.00 2.66  ? 826  GLN A CG    1 
ATOM   6293  C  CD    . GLN A 1 825  ? -9.656  -77.640  -1.365  1.00 2.09  ? 826  GLN A CD    1 
ATOM   6294  O  OE1   . GLN A 1 825  ? -10.510 -76.819  -1.650  1.00 2.60  ? 826  GLN A OE1   1 
ATOM   6295  N  NE2   . GLN A 1 825  ? -9.635  -78.849  -1.877  1.00 2.00  ? 826  GLN A NE2   1 
ATOM   6296  N  N     . LEU A 1 826  ? -6.307  -73.199  0.455   1.00 3.44  ? 827  LEU A N     1 
ATOM   6297  C  CA    . LEU A 1 826  ? -5.357  -72.146  0.154   1.00 3.34  ? 827  LEU A CA    1 
ATOM   6298  C  C     . LEU A 1 826  ? -4.502  -71.793  1.370   1.00 3.68  ? 827  LEU A C     1 
ATOM   6299  O  O     . LEU A 1 826  ? -3.300  -71.544  1.238   1.00 4.56  ? 827  LEU A O     1 
ATOM   6300  C  CB    . LEU A 1 826  ? -6.077  -70.874  -0.288  1.00 3.34  ? 827  LEU A CB    1 
ATOM   6301  C  CG    . LEU A 1 826  ? -6.390  -70.681  -1.772  1.00 3.16  ? 827  LEU A CG    1 
ATOM   6302  C  CD1   . LEU A 1 826  ? -7.463  -71.638  -2.242  1.00 3.10  ? 827  LEU A CD1   1 
ATOM   6303  C  CD2   . LEU A 1 826  ? -6.856  -69.284  -1.980  1.00 3.12  ? 827  LEU A CD2   1 
ATOM   6304  N  N     . PHE A 1 827  ? -5.068  -71.828  2.568   1.00 3.14  ? 828  PHE A N     1 
ATOM   6305  C  CA    . PHE A 1 827  ? -4.278  -71.406  3.735   1.00 3.08  ? 828  PHE A CA    1 
ATOM   6306  C  C     . PHE A 1 827  ? -4.281  -72.349  4.919   1.00 3.20  ? 828  PHE A C     1 
ATOM   6307  O  O     . PHE A 1 827  ? -3.649  -72.089  5.938   1.00 3.70  ? 828  PHE A O     1 
ATOM   6308  C  CB    . PHE A 1 827  ? -4.805  -70.052  4.248   1.00 2.10  ? 828  PHE A CB    1 
ATOM   6309  C  CG    . PHE A 1 827  ? -5.185  -69.107  3.168   1.00 2.00  ? 828  PHE A CG    1 
ATOM   6310  C  CD1   . PHE A 1 827  ? -4.210  -68.405  2.454   1.00 2.31  ? 828  PHE A CD1   1 
ATOM   6311  C  CD2   . PHE A 1 827  ? -6.528  -68.879  2.870   1.00 2.00  ? 828  PHE A CD2   1 
ATOM   6312  C  CE1   . PHE A 1 827  ? -4.590  -67.465  1.435   1.00 2.34  ? 828  PHE A CE1   1 
ATOM   6313  C  CE2   . PHE A 1 827  ? -6.920  -67.956  1.873   1.00 2.00  ? 828  PHE A CE2   1 
ATOM   6314  C  CZ    . PHE A 1 827  ? -5.944  -67.244  1.153   1.00 2.01  ? 828  PHE A CZ    1 
ATOM   6315  N  N     . GLY A 1 828  ? -5.004  -73.440  4.799   1.00 3.41  ? 829  GLY A N     1 
ATOM   6316  C  CA    . GLY A 1 828  ? -5.139  -74.348  5.913   1.00 3.47  ? 829  GLY A CA    1 
ATOM   6317  C  C     . GLY A 1 828  ? -4.000  -74.654  6.861   1.00 3.10  ? 829  GLY A C     1 
ATOM   6318  O  O     . GLY A 1 828  ? -4.217  -74.723  8.067   1.00 3.34  ? 829  GLY A O     1 
ATOM   6319  N  N     . GLU A 1 829  ? -2.807  -74.885  6.340   1.00 3.03  ? 830  GLU A N     1 
ATOM   6320  C  CA    . GLU A 1 829  ? -1.642  -75.250  7.178   1.00 2.88  ? 830  GLU A CA    1 
ATOM   6321  C  C     . GLU A 1 829  ? -1.045  -74.148  8.065   1.00 2.70  ? 830  GLU A C     1 
ATOM   6322  O  O     . GLU A 1 829  ? -0.315  -74.435  9.008   1.00 2.56  ? 830  GLU A O     1 
ATOM   6323  C  CB    . GLU A 1 829  ? -0.546  -75.866  6.285   1.00 3.39  ? 830  GLU A CB    1 
ATOM   6324  C  CG    . GLU A 1 829  ? 0.337   -74.863  5.540   1.00 4.80  ? 830  GLU A CG    1 
ATOM   6325  C  CD    . GLU A 1 829  ? -0.312  -74.154  4.364   1.00 5.48  ? 830  GLU A CD    1 
ATOM   6326  O  OE1   . GLU A 1 829  ? -1.459  -74.508  4.040   1.00 7.17  ? 830  GLU A OE1   1 
ATOM   6327  O  OE2   . GLU A 1 829  ? 0.328   -73.251  3.750   1.00 5.31  ? 830  GLU A OE2   1 
ATOM   6328  N  N     . ARG A 1 830  ? -1.409  -72.897  7.776   1.00 2.77  ? 831  ARG A N     1 
ATOM   6329  C  CA    . ARG A 1 830  ? -0.967  -71.686  8.482   1.00 2.06  ? 831  ARG A CA    1 
ATOM   6330  C  C     . ARG A 1 830  ? -2.096  -70.988  9.241   1.00 2.34  ? 831  ARG A C     1 
ATOM   6331  O  O     . ARG A 1 830  ? -1.862  -69.906  9.779   1.00 2.15  ? 831  ARG A O     1 
ATOM   6332  C  CB    . ARG A 1 830  ? -0.518  -70.620  7.455   1.00 2.23  ? 831  ARG A CB    1 
ATOM   6333  C  CG    . ARG A 1 830  ? 0.647   -71.011  6.547   1.00 2.57  ? 831  ARG A CG    1 
ATOM   6334  C  CD    . ARG A 1 830  ? 1.141   -69.861  5.720   1.00 2.00  ? 831  ARG A CD    1 
ATOM   6335  N  NE    . ARG A 1 830  ? 0.099   -69.236  4.885   1.00 2.57  ? 831  ARG A NE    1 
ATOM   6336  C  CZ    . ARG A 1 830  ? -0.241  -67.940  4.980   1.00 2.19  ? 831  ARG A CZ    1 
ATOM   6337  N  NH1   . ARG A 1 830  ? 0.357   -67.194  5.886   1.00 2.00  ? 831  ARG A NH1   1 
ATOM   6338  N  NH2   . ARG A 1 830  ? -1.016  -67.341  4.074   1.00 2.00  ? 831  ARG A NH2   1 
ATOM   6339  N  N     . MET A 1 831  ? -3.308  -71.554  9.274   1.00 2.71  ? 832  MET A N     1 
ATOM   6340  C  CA    . MET A 1 831  ? -4.401  -70.826  9.897   1.00 2.77  ? 832  MET A CA    1 
ATOM   6341  C  C     . MET A 1 831  ? -4.905  -71.080  11.290  1.00 2.63  ? 832  MET A C     1 
ATOM   6342  O  O     . MET A 1 831  ? -4.761  -72.154  11.839  1.00 4.02  ? 832  MET A O     1 
ATOM   6343  C  CB    . MET A 1 831  ? -5.584  -70.617  8.910   1.00 2.54  ? 832  MET A CB    1 
ATOM   6344  C  CG    . MET A 1 831  ? -6.387  -71.805  8.557   1.00 3.58  ? 832  MET A CG    1 
ATOM   6345  S  SD    . MET A 1 831  ? -7.484  -71.575  7.062   1.00 3.94  ? 832  MET A SD    1 
ATOM   6346  C  CE    . MET A 1 831  ? -8.638  -70.364  7.644   1.00 4.30  ? 832  MET A CE    1 
ATOM   6347  N  N     . PHE A 1 832  ? -5.346  -69.987  11.896  1.00 2.62  ? 833  PHE A N     1 
ATOM   6348  C  CA    . PHE A 1 832  ? -5.954  -69.935  13.223  1.00 2.40  ? 833  PHE A CA    1 
ATOM   6349  C  C     . PHE A 1 832  ? -7.370  -69.507  12.842  1.00 2.00  ? 833  PHE A C     1 
ATOM   6350  O  O     . PHE A 1 832  ? -7.518  -68.656  11.991  1.00 2.00  ? 833  PHE A O     1 
ATOM   6351  C  CB    . PHE A 1 832  ? -5.389  -68.764  14.039  1.00 2.32  ? 833  PHE A CB    1 
ATOM   6352  C  CG    . PHE A 1 832  ? -4.099  -69.046  14.744  1.00 2.00  ? 833  PHE A CG    1 
ATOM   6353  C  CD1   . PHE A 1 832  ? -4.100  -69.532  16.035  1.00 2.00  ? 833  PHE A CD1   1 
ATOM   6354  C  CD2   . PHE A 1 832  ? -2.890  -68.775  14.145  1.00 2.00  ? 833  PHE A CD2   1 
ATOM   6355  C  CE1   . PHE A 1 832  ? -2.920  -69.736  16.708  1.00 2.00  ? 833  PHE A CE1   1 
ATOM   6356  C  CE2   . PHE A 1 832  ? -1.713  -68.985  14.831  1.00 2.00  ? 833  PHE A CE2   1 
ATOM   6357  C  CZ    . PHE A 1 832  ? -1.731  -69.465  16.109  1.00 2.00  ? 833  PHE A CZ    1 
ATOM   6358  N  N     . ILE A 1 833  ? -8.392  -70.135  13.399  1.00 2.00  ? 834  ILE A N     1 
ATOM   6359  C  CA    . ILE A 1 833  ? -9.766  -69.739  13.108  1.00 2.00  ? 834  ILE A CA    1 
ATOM   6360  C  C     . ILE A 1 833  ? -10.492 -69.357  14.388  1.00 2.00  ? 834  ILE A C     1 
ATOM   6361  O  O     . ILE A 1 833  ? -10.563 -70.143  15.334  1.00 2.00  ? 834  ILE A O     1 
ATOM   6362  C  CB    . ILE A 1 833  ? -10.591 -70.853  12.405  1.00 2.00  ? 834  ILE A CB    1 
ATOM   6363  C  CG1   . ILE A 1 833  ? -10.164 -70.999  10.946  1.00 2.00  ? 834  ILE A CG1   1 
ATOM   6364  C  CG2   . ILE A 1 833  ? -12.090 -70.545  12.518  1.00 2.00  ? 834  ILE A CG2   1 
ATOM   6365  C  CD1   . ILE A 1 833  ? -10.334 -72.380  10.390  1.00 2.00  ? 834  ILE A CD1   1 
ATOM   6366  N  N     . ALA A 1 834  ? -10.968 -68.123  14.430  1.00 2.00  ? 835  ALA A N     1 
ATOM   6367  C  CA    . ALA A 1 834  ? -11.738 -67.655  15.563  1.00 2.13  ? 835  ALA A CA    1 
ATOM   6368  C  C     . ALA A 1 834  ? -13.177 -67.681  15.059  1.00 2.00  ? 835  ALA A C     1 
ATOM   6369  O  O     . ALA A 1 834  ? -13.608 -66.743  14.393  1.00 2.00  ? 835  ALA A O     1 
ATOM   6370  C  CB    . ALA A 1 834  ? -11.338 -66.242  15.949  1.00 2.00  ? 835  ALA A CB    1 
ATOM   6371  N  N     . ASN A 1 835  ? -13.902 -68.747  15.392  1.00 2.00  ? 836  ASN A N     1 
ATOM   6372  C  CA    . ASN A 1 835  ? -15.278 -68.929  14.933  1.00 2.00  ? 836  ASN A CA    1 
ATOM   6373  C  C     . ASN A 1 835  ? -16.400 -68.400  15.830  1.00 2.00  ? 836  ASN A C     1 
ATOM   6374  O  O     . ASN A 1 835  ? -16.481 -68.758  16.978  1.00 2.00  ? 836  ASN A O     1 
ATOM   6375  C  CB    . ASN A 1 835  ? -15.503 -70.433  14.694  1.00 2.35  ? 836  ASN A CB    1 
ATOM   6376  C  CG    . ASN A 1 835  ? -16.393 -70.723  13.501  1.00 2.00  ? 836  ASN A CG    1 
ATOM   6377  O  OD1   . ASN A 1 835  ? -17.598 -70.491  13.528  1.00 2.00  ? 836  ASN A OD1   1 
ATOM   6378  N  ND2   . ASN A 1 835  ? -15.797 -71.272  12.455  1.00 2.00  ? 836  ASN A ND2   1 
ATOM   6379  N  N     . ALA A 1 836  ? -17.300 -67.580  15.303  1.00 2.00  ? 837  ALA A N     1 
ATOM   6380  C  CA    . ALA A 1 836  ? -18.419 -67.099  16.129  1.00 2.00  ? 837  ALA A CA    1 
ATOM   6381  C  C     . ALA A 1 836  ? -19.456 -68.222  16.280  1.00 2.00  ? 837  ALA A C     1 
ATOM   6382  O  O     . ALA A 1 836  ? -19.570 -69.077  15.419  1.00 2.00  ? 837  ALA A O     1 
ATOM   6383  C  CB    . ALA A 1 836  ? -19.067 -65.859  15.502  1.00 2.00  ? 837  ALA A CB    1 
ATOM   6384  N  N     . THR A 1 837  ? -20.174 -68.262  17.391  1.00 2.00  ? 838  THR A N     1 
ATOM   6385  C  CA    . THR A 1 837  ? -21.199 -69.274  17.569  1.00 2.00  ? 838  THR A CA    1 
ATOM   6386  C  C     . THR A 1 837  ? -22.242 -69.142  16.457  1.00 2.00  ? 838  THR A C     1 
ATOM   6387  O  O     . THR A 1 837  ? -22.569 -68.035  16.011  1.00 2.00  ? 838  THR A O     1 
ATOM   6388  C  CB    . THR A 1 837  ? -21.916 -69.110  18.925  1.00 2.12  ? 838  THR A CB    1 
ATOM   6389  O  OG1   . THR A 1 837  ? -20.944 -69.011  19.968  1.00 2.38  ? 838  THR A OG1   1 
ATOM   6390  C  CG2   . THR A 1 837  ? -22.842 -70.293  19.213  1.00 2.01  ? 838  THR A CG2   1 
ATOM   6391  N  N     . GLY A 1 838  ? -22.713 -70.283  15.978  1.00 2.00  ? 839  GLY A N     1 
ATOM   6392  C  CA    . GLY A 1 838  ? -23.715 -70.298  14.945  1.00 2.00  ? 839  GLY A CA    1 
ATOM   6393  C  C     . GLY A 1 838  ? -23.616 -71.562  14.174  1.00 2.00  ? 839  GLY A C     1 
ATOM   6394  O  O     . GLY A 1 838  ? -22.947 -72.475  14.588  1.00 3.16  ? 839  GLY A O     1 
ATOM   6395  N  N     . CYS A 1 839  ? -24.212 -71.603  13.010  1.00 2.13  ? 840  CYS A N     1 
ATOM   6396  C  CA    . CYS A 1 839  ? -24.155 -72.799  12.224  1.00 2.71  ? 840  CYS A CA    1 
ATOM   6397  C  C     . CYS A 1 839  ? -22.730 -73.253  12.065  1.00 3.29  ? 840  CYS A C     1 
ATOM   6398  O  O     . CYS A 1 839  ? -22.396 -74.419  12.217  1.00 3.88  ? 840  CYS A O     1 
ATOM   6399  C  CB    . CYS A 1 839  ? -24.778 -72.524  10.879  1.00 2.29  ? 840  CYS A CB    1 
ATOM   6400  S  SG    . CYS A 1 839  ? -26.377 -73.325  10.867  1.00 2.00  ? 840  CYS A SG    1 
ATOM   6401  N  N     . SER A 1 840  ? -21.889 -72.259  11.856  1.00 4.12  ? 841  SER A N     1 
ATOM   6402  C  CA    . SER A 1 840  ? -20.451 -72.403  11.652  1.00 4.05  ? 841  SER A CA    1 
ATOM   6403  C  C     . SER A 1 840  ? -19.753 -73.199  12.729  1.00 3.07  ? 841  SER A C     1 
ATOM   6404  O  O     . SER A 1 840  ? -18.777 -73.858  12.463  1.00 2.76  ? 841  SER A O     1 
ATOM   6405  C  CB    . SER A 1 840  ? -19.826 -71.006  11.657  1.00 4.12  ? 841  SER A CB    1 
ATOM   6406  O  OG    . SER A 1 840  ? -19.205 -70.782  10.451  1.00 5.63  ? 841  SER A OG    1 
ATOM   6407  N  N     . SER A 1 841  ? -20.138 -72.945  13.971  1.00 2.71  ? 842  SER A N     1 
ATOM   6408  C  CA    . SER A 1 841  ? -19.542 -73.612  15.101  1.00 2.32  ? 842  SER A CA    1 
ATOM   6409  C  C     . SER A 1 841  ? -20.265 -74.911  15.414  1.00 2.58  ? 842  SER A C     1 
ATOM   6410  O  O     . SER A 1 841  ? -19.714 -75.749  16.131  1.00 2.36  ? 842  SER A O     1 
ATOM   6411  C  CB    . SER A 1 841  ? -19.565 -72.700  16.321  1.00 2.09  ? 842  SER A CB    1 
ATOM   6412  O  OG    . SER A 1 841  ? -20.877 -72.537  16.829  1.00 2.00  ? 842  SER A OG    1 
ATOM   6413  N  N     . ILE A 1 842  ? -21.503 -75.068  14.928  1.00 2.35  ? 843  ILE A N     1 
ATOM   6414  C  CA    . ILE A 1 842  ? -22.246 -76.300  15.194  1.00 2.67  ? 843  ILE A CA    1 
ATOM   6415  C  C     . ILE A 1 842  ? -21.820 -77.468  14.292  1.00 3.25  ? 843  ILE A C     1 
ATOM   6416  O  O     . ILE A 1 842  ? -21.747 -78.610  14.762  1.00 3.26  ? 843  ILE A O     1 
ATOM   6417  C  CB    . ILE A 1 842  ? -23.794 -76.090  15.223  1.00 2.70  ? 843  ILE A CB    1 
ATOM   6418  C  CG1   . ILE A 1 842  ? -24.179 -75.239  16.435  1.00 2.47  ? 843  ILE A CG1   1 
ATOM   6419  C  CG2   . ILE A 1 842  ? -24.528 -77.423  15.314  1.00 2.14  ? 843  ILE A CG2   1 
ATOM   6420  C  CD1   . ILE A 1 842  ? -23.356 -75.583  17.686  1.00 2.31  ? 843  ILE A CD1   1 
ATOM   6421  N  N     . TRP A 1 843  ? -21.606 -77.207  12.997  1.00 3.84  ? 844  TRP A N     1 
ATOM   6422  C  CA    . TRP A 1 843  ? -21.096 -78.256  12.113  1.00 4.55  ? 844  TRP A CA    1 
ATOM   6423  C  C     . TRP A 1 843  ? -19.542 -78.282  12.210  1.00 5.14  ? 844  TRP A C     1 
ATOM   6424  O  O     . TRP A 1 843  ? -18.899 -79.290  11.880  1.00 5.87  ? 844  TRP A O     1 
ATOM   6425  C  CB    . TRP A 1 843  ? -21.559 -78.090  10.638  1.00 3.99  ? 844  TRP A CB    1 
ATOM   6426  C  CG    . TRP A 1 843  ? -21.272 -76.790  9.957   1.00 3.54  ? 844  TRP A CG    1 
ATOM   6427  C  CD1   . TRP A 1 843  ? -22.204 -75.855  9.604   1.00 3.92  ? 844  TRP A CD1   1 
ATOM   6428  C  CD2   . TRP A 1 843  ? -19.987 -76.274  9.500   1.00 2.94  ? 844  TRP A CD2   1 
ATOM   6429  N  NE1   . TRP A 1 843  ? -21.592 -74.796  8.957   1.00 3.54  ? 844  TRP A NE1   1 
ATOM   6430  C  CE2   . TRP A 1 843  ? -20.235 -75.021  8.892   1.00 2.86  ? 844  TRP A CE2   1 
ATOM   6431  C  CE3   . TRP A 1 843  ? -18.670 -76.743  9.555   1.00 2.29  ? 844  TRP A CE3   1 
ATOM   6432  C  CZ2   . TRP A 1 843  ? -19.203 -74.222  8.349   1.00 2.21  ? 844  TRP A CZ2   1 
ATOM   6433  C  CZ3   . TRP A 1 843  ? -17.642 -75.951  9.013   1.00 2.57  ? 844  TRP A CZ3   1 
ATOM   6434  C  CH2   . TRP A 1 843  ? -17.923 -74.700  8.421   1.00 2.18  ? 844  TRP A CH2   1 
ATOM   6435  N  N     . GLY A 1 844  ? -18.966 -77.143  12.627  1.00 5.17  ? 845  GLY A N     1 
ATOM   6436  C  CA    . GLY A 1 844  ? -17.533 -77.005  12.801  1.00 4.82  ? 845  GLY A CA    1 
ATOM   6437  C  C     . GLY A 1 844  ? -16.977 -77.801  13.966  1.00 4.45  ? 845  GLY A C     1 
ATOM   6438  O  O     . GLY A 1 844  ? -15.887 -78.328  13.874  1.00 4.75  ? 845  GLY A O     1 
ATOM   6439  N  N     . ALA A 1 845  ? -17.737 -77.928  15.045  1.00 4.14  ? 846  ALA A N     1 
ATOM   6440  C  CA    . ALA A 1 845  ? -17.258 -78.659  16.190  1.00 3.35  ? 846  ALA A CA    1 
ATOM   6441  C  C     . ALA A 1 845  ? -18.304 -79.047  17.235  1.00 3.52  ? 846  ALA A C     1 
ATOM   6442  O  O     . ALA A 1 845  ? -18.156 -78.745  18.403  1.00 3.03  ? 846  ALA A O     1 
ATOM   6443  C  CB    . ALA A 1 845  ? -16.095 -77.907  16.848  1.00 3.38  ? 846  ALA A CB    1 
ATOM   6444  N  N     . SER A 1 846  ? -19.381 -79.709  16.849  1.00 3.75  ? 847  SER A N     1 
ATOM   6445  C  CA    . SER A 1 846  ? -20.249 -80.141  17.909  1.00 4.75  ? 847  SER A CA    1 
ATOM   6446  C  C     . SER A 1 846  ? -19.741 -81.586  18.136  1.00 5.07  ? 847  SER A C     1 
ATOM   6447  O  O     . SER A 1 846  ? -19.708 -82.373  17.196  1.00 6.05  ? 847  SER A O     1 
ATOM   6448  C  CB    . SER A 1 846  ? -21.740 -80.043  17.515  1.00 5.18  ? 847  SER A CB    1 
ATOM   6449  O  OG    . SER A 1 846  ? -22.075 -80.907  16.454  1.00 6.42  ? 847  SER A OG    1 
ATOM   6450  N  N     . ALA A 1 847  ? -19.191 -81.860  19.330  1.00 4.48  ? 848  ALA A N     1 
ATOM   6451  C  CA    . ALA A 1 847  ? -18.642 -83.164  19.709  1.00 4.21  ? 848  ALA A CA    1 
ATOM   6452  C  C     . ALA A 1 847  ? -19.588 -84.333  19.407  1.00 4.78  ? 848  ALA A C     1 
ATOM   6453  O  O     . ALA A 1 847  ? -20.812 -84.208  19.535  1.00 5.89  ? 848  ALA A O     1 
ATOM   6454  C  CB    . ALA A 1 847  ? -18.271 -83.162  21.150  1.00 3.43  ? 848  ALA A CB    1 
ATOM   6455  N  N     . PRO A 1 848  ? -19.036 -85.531  19.106  1.00 4.50  ? 849  PRO A N     1 
ATOM   6456  C  CA    . PRO A 1 848  ? -17.628 -85.933  19.012  1.00 4.09  ? 849  PRO A CA    1 
ATOM   6457  C  C     . PRO A 1 848  ? -17.048 -85.812  17.613  1.00 4.66  ? 849  PRO A C     1 
ATOM   6458  O  O     . PRO A 1 848  ? -15.999 -86.391  17.342  1.00 4.57  ? 849  PRO A O     1 
ATOM   6459  C  CB    . PRO A 1 848  ? -17.723 -87.399  19.349  1.00 4.34  ? 849  PRO A CB    1 
ATOM   6460  C  CG    . PRO A 1 848  ? -18.914 -87.781  18.542  1.00 3.49  ? 849  PRO A CG    1 
ATOM   6461  C  CD    . PRO A 1 848  ? -19.897 -86.633  18.670  1.00 3.57  ? 849  PRO A CD    1 
ATOM   6462  N  N     . SER A 1 849  ? -17.784 -85.156  16.712  1.00 4.59  ? 850  SER A N     1 
ATOM   6463  C  CA    . SER A 1 849  ? -17.365 -85.016  15.325  1.00 4.49  ? 850  SER A CA    1 
ATOM   6464  C  C     . SER A 1 849  ? -16.590 -83.754  15.047  1.00 4.17  ? 850  SER A C     1 
ATOM   6465  O  O     . SER A 1 849  ? -17.096 -82.656  15.305  1.00 4.25  ? 850  SER A O     1 
ATOM   6466  C  CB    . SER A 1 849  ? -18.578 -85.086  14.412  1.00 4.58  ? 850  SER A CB    1 
ATOM   6467  O  OG    . SER A 1 849  ? -18.263 -84.567  13.134  1.00 5.68  ? 850  SER A OG    1 
ATOM   6468  N  N     . MET A 1 850  ? -15.385 -83.921  14.493  1.00 3.69  ? 851  MET A N     1 
ATOM   6469  C  CA    . MET A 1 850  ? -14.500 -82.801  14.174  1.00 3.08  ? 851  MET A CA    1 
ATOM   6470  C  C     . MET A 1 850  ? -14.118 -82.820  12.708  1.00 2.84  ? 851  MET A C     1 
ATOM   6471  O  O     . MET A 1 850  ? -13.213 -83.526  12.323  1.00 3.12  ? 851  MET A O     1 
ATOM   6472  C  CB    . MET A 1 850  ? -13.259 -82.866  15.056  1.00 2.06  ? 851  MET A CB    1 
ATOM   6473  C  CG    . MET A 1 850  ? -13.573 -82.845  16.529  1.00 2.00  ? 851  MET A CG    1 
ATOM   6474  S  SD    . MET A 1 850  ? -14.168 -81.286  17.194  1.00 2.00  ? 851  MET A SD    1 
ATOM   6475  C  CE    . MET A 1 850  ? -15.711 -81.696  17.852  1.00 2.00  ? 851  MET A CE    1 
ATOM   6476  N  N     . PRO A 1 851  ? -14.802 -82.026  11.867  1.00 2.84  ? 852  PRO A N     1 
ATOM   6477  C  CA    . PRO A 1 851  ? -14.505 -81.978  10.424  1.00 2.68  ? 852  PRO A CA    1 
ATOM   6478  C  C     . PRO A 1 851  ? -13.133 -81.433  10.051  1.00 2.56  ? 852  PRO A C     1 
ATOM   6479  O  O     . PRO A 1 851  ? -12.523 -81.905  9.085   1.00 2.40  ? 852  PRO A O     1 
ATOM   6480  C  CB    . PRO A 1 851  ? -15.610 -81.069  9.876   1.00 2.67  ? 852  PRO A CB    1 
ATOM   6481  C  CG    . PRO A 1 851  ? -15.942 -80.198  11.032  1.00 2.04  ? 852  PRO A CG    1 
ATOM   6482  C  CD    . PRO A 1 851  ? -15.972 -81.190  12.168  1.00 2.53  ? 852  PRO A CD    1 
ATOM   6483  N  N     . TYR A 1 852  ? -12.674 -80.425  10.789  1.00 2.00  ? 853  TYR A N     1 
ATOM   6484  C  CA    . TYR A 1 852  ? -11.399 -79.860  10.485  1.00 2.07  ? 853  TYR A CA    1 
ATOM   6485  C  C     . TYR A 1 852  ? -10.369 -80.939  10.713  1.00 2.00  ? 853  TYR A C     1 
ATOM   6486  O  O     . TYR A 1 852  ? -10.440 -81.648  11.691  1.00 2.00  ? 853  TYR A O     1 
ATOM   6487  C  CB    . TYR A 1 852  ? -11.120 -78.617  11.339  1.00 2.00  ? 853  TYR A CB    1 
ATOM   6488  C  CG    . TYR A 1 852  ? -11.915 -77.429  10.903  1.00 2.00  ? 853  TYR A CG    1 
ATOM   6489  C  CD1   . TYR A 1 852  ? -13.181 -77.214  11.391  1.00 2.46  ? 853  TYR A CD1   1 
ATOM   6490  C  CD2   . TYR A 1 852  ? -11.427 -76.555  9.967   1.00 2.00  ? 853  TYR A CD2   1 
ATOM   6491  C  CE1   . TYR A 1 852  ? -13.956 -76.159  10.970  1.00 2.90  ? 853  TYR A CE1   1 
ATOM   6492  C  CE2   . TYR A 1 852  ? -12.179 -75.496  9.522   1.00 2.82  ? 853  TYR A CE2   1 
ATOM   6493  C  CZ    . TYR A 1 852  ? -13.455 -75.294  10.034  1.00 2.95  ? 853  TYR A CZ    1 
ATOM   6494  O  OH    . TYR A 1 852  ? -14.182 -74.186  9.653   1.00 2.57  ? 853  TYR A OH    1 
ATOM   6495  N  N     . LYS A 1 853  ? -9.430  -81.054  9.778   1.00 2.44  ? 854  LYS A N     1 
ATOM   6496  C  CA    . LYS A 1 853  ? -8.355  -82.058  9.824   1.00 2.73  ? 854  LYS A CA    1 
ATOM   6497  C  C     . LYS A 1 853  ? -7.006  -81.479  9.473   1.00 2.30  ? 854  LYS A C     1 
ATOM   6498  O  O     . LYS A 1 853  ? -6.903  -80.344  9.015   1.00 2.00  ? 854  LYS A O     1 
ATOM   6499  C  CB    . LYS A 1 853  ? -8.648  -83.206  8.852   1.00 3.12  ? 854  LYS A CB    1 
ATOM   6500  C  CG    . LYS A 1 853  ? -8.661  -82.761  7.390   1.00 4.65  ? 854  LYS A CG    1 
ATOM   6501  C  CD    . LYS A 1 853  ? -8.989  -83.931  6.434   1.00 6.79  ? 854  LYS A CD    1 
ATOM   6502  C  CE    . LYS A 1 853  ? -7.842  -84.196  5.455   1.00 7.83  ? 854  LYS A CE    1 
ATOM   6503  N  NZ    . LYS A 1 853  ? -8.262  -84.999  4.282   1.00 9.71  ? 854  LYS A NZ    1 
ATOM   6504  N  N     . THR A 1 854  ? -5.975  -82.291  9.685   1.00 2.35  ? 855  THR A N     1 
ATOM   6505  C  CA    . THR A 1 854  ? -4.592  -81.894  9.383   1.00 2.46  ? 855  THR A CA    1 
ATOM   6506  C  C     . THR A 1 854  ? -4.152  -82.488  8.051   1.00 2.43  ? 855  THR A C     1 
ATOM   6507  O  O     . THR A 1 854  ? -4.684  -83.518  7.608   1.00 2.00  ? 855  THR A O     1 
ATOM   6508  C  CB    . THR A 1 854  ? -3.603  -82.442  10.426  1.00 2.82  ? 855  THR A CB    1 
ATOM   6509  O  OG1   . THR A 1 854  ? -3.644  -83.875  10.378  1.00 3.89  ? 855  THR A OG1   1 
ATOM   6510  C  CG2   . THR A 1 854  ? -3.936  -81.969  11.872  1.00 2.49  ? 855  THR A CG2   1 
ATOM   6511  N  N     . ASN A 1 855  ? -3.129  -81.894  7.446   1.00 2.53  ? 856  ASN A N     1 
ATOM   6512  C  CA    . ASN A 1 855  ? -2.634  -82.422  6.183   1.00 3.15  ? 856  ASN A CA    1 
ATOM   6513  C  C     . ASN A 1 855  ? -1.649  -83.601  6.393   1.00 3.76  ? 856  ASN A C     1 
ATOM   6514  O  O     . ASN A 1 855  ? -1.436  -84.068  7.535   1.00 3.85  ? 856  ASN A O     1 
ATOM   6515  C  CB    . ASN A 1 855  ? -2.057  -81.295  5.302   1.00 2.45  ? 856  ASN A CB    1 
ATOM   6516  C  CG    . ASN A 1 855  ? -0.960  -80.526  5.966   1.00 2.14  ? 856  ASN A CG    1 
ATOM   6517  O  OD1   . ASN A 1 855  ? -0.310  -81.030  6.884   1.00 2.00  ? 856  ASN A OD1   1 
ATOM   6518  N  ND2   . ASN A 1 855  ? -0.708  -79.307  5.473   1.00 2.00  ? 856  ASN A ND2   1 
ATOM   6519  N  N     . ARG A 1 856  ? -1.075  -84.105  5.315   1.00 4.05  ? 857  ARG A N     1 
ATOM   6520  C  CA    . ARG A 1 856  ? -0.136  -85.207  5.434   1.00 5.11  ? 857  ARG A CA    1 
ATOM   6521  C  C     . ARG A 1 856  ? 1.070   -84.883  6.343   1.00 4.67  ? 857  ARG A C     1 
ATOM   6522  O  O     . ARG A 1 856  ? 1.831   -85.809  6.763   1.00 4.01  ? 857  ARG A O     1 
ATOM   6523  C  CB    . ARG A 1 856  ? 0.363   -85.618  4.059   1.00 7.51  ? 857  ARG A CB    1 
ATOM   6524  C  CG    . ARG A 1 856  ? 1.253   -84.576  3.414   1.00 11.31 ? 857  ARG A CG    1 
ATOM   6525  C  CD    . ARG A 1 856  ? 1.618   -84.982  2.005   1.00 14.14 ? 857  ARG A CD    1 
ATOM   6526  N  NE    . ARG A 1 856  ? 1.980   -83.819  1.202   1.00 18.06 ? 857  ARG A NE    1 
ATOM   6527  C  CZ    . ARG A 1 856  ? 1.412   -83.503  0.031   1.00 20.14 ? 857  ARG A CZ    1 
ATOM   6528  N  NH1   . ARG A 1 856  ? 0.439   -84.276  -0.491  1.00 20.60 ? 857  ARG A NH1   1 
ATOM   6529  N  NH2   . ARG A 1 856  ? 1.853   -82.430  -0.640  1.00 21.07 ? 857  ARG A NH2   1 
ATOM   6530  N  N     . LEU A 1 857  ? 1.287   -83.578  6.568   1.00 3.60  ? 858  LEU A N     1 
ATOM   6531  C  CA    . LEU A 1 857  ? 2.361   -83.105  7.449   1.00 3.22  ? 858  LEU A CA    1 
ATOM   6532  C  C     . LEU A 1 857  ? 1.860   -82.716  8.860   1.00 2.68  ? 858  LEU A C     1 
ATOM   6533  O  O     . LEU A 1 857  ? 2.552   -82.046  9.600   1.00 3.04  ? 858  LEU A O     1 
ATOM   6534  C  CB    . LEU A 1 857  ? 3.118   -81.944  6.806   1.00 3.79  ? 858  LEU A CB    1 
ATOM   6535  C  CG    . LEU A 1 857  ? 4.322   -82.262  5.920   1.00 4.50  ? 858  LEU A CG    1 
ATOM   6536  C  CD1   . LEU A 1 857  ? 4.348   -83.755  5.639   1.00 4.65  ? 858  LEU A CD1   1 
ATOM   6537  C  CD2   . LEU A 1 857  ? 4.302   -81.478  4.629   1.00 4.28  ? 858  LEU A CD2   1 
ATOM   6538  N  N     . GLY A 1 858  ? 0.647   -83.135  9.215   1.00 2.41  ? 859  GLY A N     1 
ATOM   6539  C  CA    . GLY A 1 858  ? 0.078   -82.851  10.527  1.00 2.32  ? 859  GLY A CA    1 
ATOM   6540  C  C     . GLY A 1 858  ? -0.338  -81.416  10.831  1.00 2.90  ? 859  GLY A C     1 
ATOM   6541  O  O     . GLY A 1 858  ? -0.750  -81.091  11.957  1.00 2.37  ? 859  GLY A O     1 
ATOM   6542  N  N     . GLN A 1 859  ? -0.266  -80.578  9.805   1.00 2.90  ? 860  GLN A N     1 
ATOM   6543  C  CA    . GLN A 1 859  ? -0.633  -79.171  9.899   1.00 3.33  ? 860  GLN A CA    1 
ATOM   6544  C  C     . GLN A 1 859  ? -2.101  -79.025  9.502   1.00 3.07  ? 860  GLN A C     1 
ATOM   6545  O  O     . GLN A 1 859  ? -2.607  -79.677  8.592   1.00 3.19  ? 860  GLN A O     1 
ATOM   6546  C  CB    . GLN A 1 859  ? 0.233   -78.334  8.937   1.00 3.67  ? 860  GLN A CB    1 
ATOM   6547  C  CG    . GLN A 1 859  ? 1.702   -78.755  8.860   1.00 3.90  ? 860  GLN A CG    1 
ATOM   6548  C  CD    . GLN A 1 859  ? 2.468   -78.097  7.687   1.00 4.75  ? 860  GLN A CD    1 
ATOM   6549  O  OE1   . GLN A 1 859  ? 3.579   -77.621  7.874   1.00 5.71  ? 860  GLN A OE1   1 
ATOM   6550  N  NE2   . GLN A 1 859  ? 1.899   -78.119  6.483   1.00 4.15  ? 860  GLN A NE2   1 
ATOM   6551  N  N     . GLY A 1 860  ? -2.782  -78.122  10.167  1.00 2.85  ? 861  GLY A N     1 
ATOM   6552  C  CA    . GLY A 1 860  ? -4.183  -77.910  9.864   1.00 2.53  ? 861  GLY A CA    1 
ATOM   6553  C  C     . GLY A 1 860  ? -4.683  -76.711  10.640  1.00 2.08  ? 861  GLY A C     1 
ATOM   6554  O  O     . GLY A 1 860  ? -3.967  -76.148  11.452  1.00 2.41  ? 861  GLY A O     1 
ATOM   6555  N  N     . PRO A 1 861  ? -5.955  -76.381  10.510  1.00 2.00  ? 862  PRO A N     1 
ATOM   6556  C  CA    . PRO A 1 861  ? -6.495  -75.220  11.220  1.00 2.20  ? 862  PRO A CA    1 
ATOM   6557  C  C     . PRO A 1 861  ? -6.641  -75.281  12.742  1.00 2.08  ? 862  PRO A C     1 
ATOM   6558  O  O     . PRO A 1 861  ? -7.317  -76.154  13.254  1.00 2.00  ? 862  PRO A O     1 
ATOM   6559  C  CB    . PRO A 1 861  ? -7.845  -75.020  10.518  1.00 2.26  ? 862  PRO A CB    1 
ATOM   6560  C  CG    . PRO A 1 861  ? -7.550  -75.494  9.064   1.00 2.00  ? 862  PRO A CG    1 
ATOM   6561  C  CD    . PRO A 1 861  ? -6.868  -76.819  9.442   1.00 2.00  ? 862  PRO A CD    1 
ATOM   6562  N  N     . ALA A 1 862  ? -6.023  -74.340  13.457  1.00 2.00  ? 863  ALA A N     1 
ATOM   6563  C  CA    . ALA A 1 862  ? -6.148  -74.298  14.911  1.00 2.00  ? 863  ALA A CA    1 
ATOM   6564  C  C     . ALA A 1 862  ? -7.509  -73.635  15.078  1.00 2.00  ? 863  ALA A C     1 
ATOM   6565  O  O     . ALA A 1 862  ? -7.701  -72.452  14.792  1.00 2.00  ? 863  ALA A O     1 
ATOM   6566  C  CB    . ALA A 1 862  ? -5.023  -73.471  15.531  1.00 2.00  ? 863  ALA A CB    1 
ATOM   6567  N  N     . TRP A 1 863  ? -8.483  -74.415  15.494  1.00 2.17  ? 864  TRP A N     1 
ATOM   6568  C  CA    . TRP A 1 863  ? -9.842  -73.908  15.580  1.00 2.00  ? 864  TRP A CA    1 
ATOM   6569  C  C     . TRP A 1 863  ? -10.349 -73.649  16.990  1.00 2.18  ? 864  TRP A C     1 
ATOM   6570  O  O     . TRP A 1 863  ? -10.133 -74.461  17.901  1.00 2.00  ? 864  TRP A O     1 
ATOM   6571  C  CB    . TRP A 1 863  ? -10.780 -74.896  14.864  1.00 2.00  ? 864  TRP A CB    1 
ATOM   6572  C  CG    . TRP A 1 863  ? -12.188 -74.389  14.518  1.00 2.10  ? 864  TRP A CG    1 
ATOM   6573  C  CD1   . TRP A 1 863  ? -12.614 -73.951  13.292  1.00 2.00  ? 864  TRP A CD1   1 
ATOM   6574  C  CD2   . TRP A 1 863  ? -13.343 -74.345  15.379  1.00 2.00  ? 864  TRP A CD2   1 
ATOM   6575  N  NE1   . TRP A 1 863  ? -13.940 -73.657  13.342  1.00 2.00  ? 864  TRP A NE1   1 
ATOM   6576  C  CE2   . TRP A 1 863  ? -14.415 -73.891  14.607  1.00 2.00  ? 864  TRP A CE2   1 
ATOM   6577  C  CE3   . TRP A 1 863  ? -13.570 -74.662  16.725  1.00 2.00  ? 864  TRP A CE3   1 
ATOM   6578  C  CZ2   . TRP A 1 863  ? -15.700 -73.752  15.132  1.00 2.00  ? 864  TRP A CZ2   1 
ATOM   6579  C  CZ3   . TRP A 1 863  ? -14.835 -74.522  17.238  1.00 2.00  ? 864  TRP A CZ3   1 
ATOM   6580  C  CH2   . TRP A 1 863  ? -15.882 -74.073  16.444  1.00 2.00  ? 864  TRP A CH2   1 
ATOM   6581  N  N     . GLY A 1 864  ? -11.038 -72.517  17.157  1.00 2.00  ? 865  GLY A N     1 
ATOM   6582  C  CA    . GLY A 1 864  ? -11.632 -72.217  18.438  1.00 2.00  ? 865  GLY A CA    1 
ATOM   6583  C  C     . GLY A 1 864  ? -12.968 -71.471  18.411  1.00 2.12  ? 865  GLY A C     1 
ATOM   6584  O  O     . GLY A 1 864  ? -13.187 -70.609  17.550  1.00 2.00  ? 865  GLY A O     1 
ATOM   6585  N  N     . ASN A 1 865  ? -13.878 -71.842  19.325  1.00 2.04  ? 866  ASN A N     1 
ATOM   6586  C  CA    . ASN A 1 865  ? -15.158 -71.147  19.486  1.00 2.00  ? 866  ASN A CA    1 
ATOM   6587  C  C     . ASN A 1 865  ? -15.141 -70.525  20.893  1.00 2.34  ? 866  ASN A C     1 
ATOM   6588  O  O     . ASN A 1 865  ? -15.030 -71.247  21.875  1.00 2.23  ? 866  ASN A O     1 
ATOM   6589  C  CB    . ASN A 1 865  ? -16.358 -72.094  19.372  1.00 2.18  ? 866  ASN A CB    1 
ATOM   6590  C  CG    . ASN A 1 865  ? -17.679 -71.435  19.803  1.00 2.14  ? 866  ASN A CG    1 
ATOM   6591  O  OD1   . ASN A 1 865  ? -17.942 -70.275  19.498  1.00 2.16  ? 866  ASN A OD1   1 
ATOM   6592  N  ND2   . ASN A 1 865  ? -18.513 -72.183  20.504  1.00 2.04  ? 866  ASN A ND2   1 
ATOM   6593  N  N     . SER A 1 866  ? -15.138 -69.185  20.966  1.00 2.69  ? 867  SER A N     1 
ATOM   6594  C  CA    . SER A 1 866  ? -15.169 -68.455  22.238  1.00 2.61  ? 867  SER A CA    1 
ATOM   6595  C  C     . SER A 1 866  ? -16.636 -68.226  22.513  1.00 2.37  ? 867  SER A C     1 
ATOM   6596  O  O     . SER A 1 866  ? -17.269 -69.030  23.174  1.00 2.72  ? 867  SER A O     1 
ATOM   6597  C  CB    . SER A 1 866  ? -14.459 -67.085  22.158  1.00 2.17  ? 867  SER A CB    1 
ATOM   6598  O  OG    . SER A 1 866  ? -14.321 -66.538  23.452  1.00 2.00  ? 867  SER A OG    1 
ATOM   6599  N  N     . LEU A 1 867  ? -17.202 -67.151  21.982  1.00 2.39  ? 868  LEU A N     1 
ATOM   6600  C  CA    . LEU A 1 867  ? -18.616 -66.886  22.233  1.00 2.18  ? 868  LEU A CA    1 
ATOM   6601  C  C     . LEU A 1 867  ? -19.274 -66.414  20.945  1.00 2.15  ? 868  LEU A C     1 
ATOM   6602  O  O     . LEU A 1 867  ? -18.679 -66.422  19.886  1.00 2.16  ? 868  LEU A O     1 
ATOM   6603  C  CB    . LEU A 1 867  ? -18.822 -65.865  23.382  1.00 2.04  ? 868  LEU A CB    1 
ATOM   6604  C  CG    . LEU A 1 867  ? -18.355 -66.192  24.814  1.00 2.20  ? 868  LEU A CG    1 
ATOM   6605  C  CD1   . LEU A 1 867  ? -18.361 -64.972  25.675  1.00 2.00  ? 868  LEU A CD1   1 
ATOM   6606  C  CD2   . LEU A 1 867  ? -19.220 -67.273  25.432  1.00 2.00  ? 868  LEU A CD2   1 
ATOM   6607  N  N     . PHE A 1 868  ? -20.527 -66.028  21.036  1.00 2.32  ? 869  PHE A N     1 
ATOM   6608  C  CA    . PHE A 1 868  ? -21.231 -65.571  19.871  1.00 2.29  ? 869  PHE A CA    1 
ATOM   6609  C  C     . PHE A 1 868  ? -20.832 -64.117  19.612  1.00 2.16  ? 869  PHE A C     1 
ATOM   6610  O  O     . PHE A 1 868  ? -20.457 -63.749  18.513  1.00 2.38  ? 869  PHE A O     1 
ATOM   6611  C  CB    . PHE A 1 868  ? -22.742 -65.686  20.155  1.00 2.12  ? 869  PHE A CB    1 
ATOM   6612  C  CG    . PHE A 1 868  ? -23.600 -65.335  18.999  1.00 2.05  ? 869  PHE A CG    1 
ATOM   6613  C  CD1   . PHE A 1 868  ? -23.093 -65.403  17.699  1.00 2.12  ? 869  PHE A CD1   1 
ATOM   6614  C  CD2   . PHE A 1 868  ? -24.894 -64.883  19.193  1.00 2.03  ? 869  PHE A CD2   1 
ATOM   6615  C  CE1   . PHE A 1 868  ? -23.851 -65.021  16.624  1.00 2.00  ? 869  PHE A CE1   1 
ATOM   6616  C  CE2   . PHE A 1 868  ? -25.674 -64.487  18.107  1.00 2.00  ? 869  PHE A CE2   1 
ATOM   6617  C  CZ    . PHE A 1 868  ? -25.142 -64.559  16.823  1.00 2.00  ? 869  PHE A CZ    1 
ATOM   6618  N  N     . GLU A 1 869  ? -20.764 -63.344  20.680  1.00 2.32  ? 870  GLU A N     1 
ATOM   6619  C  CA    . GLU A 1 869  ? -20.509 -61.918  20.582  1.00 2.36  ? 870  GLU A CA    1 
ATOM   6620  C  C     . GLU A 1 869  ? -19.115 -61.447  20.390  1.00 2.58  ? 870  GLU A C     1 
ATOM   6621  O  O     . GLU A 1 869  ? -18.949 -60.294  20.030  1.00 2.82  ? 870  GLU A O     1 
ATOM   6622  C  CB    . GLU A 1 869  ? -21.067 -61.208  21.816  1.00 2.75  ? 870  GLU A CB    1 
ATOM   6623  C  CG    . GLU A 1 869  ? -20.403 -61.610  23.167  1.00 2.88  ? 870  GLU A CG    1 
ATOM   6624  C  CD    . GLU A 1 869  ? -21.039 -62.839  23.859  1.00 3.10  ? 870  GLU A CD    1 
ATOM   6625  O  OE1   . GLU A 1 869  ? -21.865 -63.541  23.243  1.00 2.32  ? 870  GLU A OE1   1 
ATOM   6626  O  OE2   . GLU A 1 869  ? -20.742 -63.073  25.056  1.00 3.12  ? 870  GLU A OE2   1 
ATOM   6627  N  N     . ASP A 1 870  ? -18.120 -62.327  20.540  1.00 2.49  ? 871  ASP A N     1 
ATOM   6628  C  CA    . ASP A 1 870  ? -16.722 -61.908  20.459  1.00 2.00  ? 871  ASP A CA    1 
ATOM   6629  C  C     . ASP A 1 870  ? -15.806 -62.450  19.397  1.00 2.43  ? 871  ASP A C     1 
ATOM   6630  O  O     . ASP A 1 870  ? -14.604 -62.166  19.457  1.00 2.91  ? 871  ASP A O     1 
ATOM   6631  C  CB    . ASP A 1 870  ? -16.048 -62.221  21.786  1.00 2.00  ? 871  ASP A CB    1 
ATOM   6632  C  CG    . ASP A 1 870  ? -15.935 -63.740  22.046  1.00 2.38  ? 871  ASP A CG    1 
ATOM   6633  O  OD1   . ASP A 1 870  ? -16.659 -64.544  21.392  1.00 2.00  ? 871  ASP A OD1   1 
ATOM   6634  O  OD2   . ASP A 1 870  ? -15.093 -64.123  22.897  1.00 2.22  ? 871  ASP A OD2   1 
ATOM   6635  N  N     . ALA A 1 871  ? -16.304 -63.234  18.452  1.00 2.03  ? 872  ALA A N     1 
ATOM   6636  C  CA    . ALA A 1 871  ? -15.388 -63.815  17.469  1.00 2.17  ? 872  ALA A CA    1 
ATOM   6637  C  C     . ALA A 1 871  ? -14.274 -62.914  16.983  1.00 2.01  ? 872  ALA A C     1 
ATOM   6638  O  O     . ALA A 1 871  ? -13.109 -63.294  17.092  1.00 2.15  ? 872  ALA A O     1 
ATOM   6639  C  CB    . ALA A 1 871  ? -16.128 -64.389  16.314  1.00 2.00  ? 872  ALA A CB    1 
ATOM   6640  N  N     . ALA A 1 872  ? -14.622 -61.723  16.503  1.00 2.00  ? 873  ALA A N     1 
ATOM   6641  C  CA    . ALA A 1 872  ? -13.640 -60.756  15.983  1.00 2.00  ? 873  ALA A CA    1 
ATOM   6642  C  C     . ALA A 1 872  ? -12.546 -60.519  17.000  1.00 2.00  ? 873  ALA A C     1 
ATOM   6643  O  O     . ALA A 1 872  ? -11.363 -60.643  16.693  1.00 2.32  ? 873  ALA A O     1 
ATOM   6644  C  CB    . ALA A 1 872  ? -14.305 -59.400  15.624  1.00 2.00  ? 873  ALA A CB    1 
ATOM   6645  N  N     . GLU A 1 873  ? -12.923 -60.217  18.234  1.00 2.21  ? 874  GLU A N     1 
ATOM   6646  C  CA    . GLU A 1 873  ? -11.910 -59.929  19.216  1.00 2.14  ? 874  GLU A CA    1 
ATOM   6647  C  C     . GLU A 1 873  ? -11.175 -61.143  19.692  1.00 2.00  ? 874  GLU A C     1 
ATOM   6648  O  O     . GLU A 1 873  ? -10.048 -61.023  20.073  1.00 2.64  ? 874  GLU A O     1 
ATOM   6649  C  CB    . GLU A 1 873  ? -12.411 -59.007  20.347  1.00 2.13  ? 874  GLU A CB    1 
ATOM   6650  C  CG    . GLU A 1 873  ? -13.735 -59.287  20.890  1.00 3.52  ? 874  GLU A CG    1 
ATOM   6651  C  CD    . GLU A 1 873  ? -14.871 -58.600  20.131  1.00 4.51  ? 874  GLU A CD    1 
ATOM   6652  O  OE1   . GLU A 1 873  ? -15.253 -59.084  19.048  1.00 4.36  ? 874  GLU A OE1   1 
ATOM   6653  O  OE2   . GLU A 1 873  ? -15.452 -57.623  20.659  1.00 4.31  ? 874  GLU A OE2   1 
ATOM   6654  N  N     . TYR A 1 874  ? -11.780 -62.322  19.601  1.00 2.05  ? 875  TYR A N     1 
ATOM   6655  C  CA    . TYR A 1 874  ? -11.127 -63.576  19.995  1.00 2.00  ? 875  TYR A CA    1 
ATOM   6656  C  C     . TYR A 1 874  ? -9.973  -63.743  18.977  1.00 2.22  ? 875  TYR A C     1 
ATOM   6657  O  O     . TYR A 1 874  ? -8.845  -64.033  19.325  1.00 2.64  ? 875  TYR A O     1 
ATOM   6658  C  CB    . TYR A 1 874  ? -12.163 -64.721  19.881  1.00 2.26  ? 875  TYR A CB    1 
ATOM   6659  C  CG    . TYR A 1 874  ? -11.710 -66.131  20.262  1.00 2.77  ? 875  TYR A CG    1 
ATOM   6660  C  CD1   . TYR A 1 874  ? -10.741 -66.348  21.229  1.00 2.57  ? 875  TYR A CD1   1 
ATOM   6661  C  CD2   . TYR A 1 874  ? -12.265 -67.246  19.655  1.00 3.11  ? 875  TYR A CD2   1 
ATOM   6662  C  CE1   . TYR A 1 874  ? -10.339 -67.605  21.577  1.00 2.05  ? 875  TYR A CE1   1 
ATOM   6663  C  CE2   . TYR A 1 874  ? -11.863 -68.548  20.018  1.00 2.78  ? 875  TYR A CE2   1 
ATOM   6664  C  CZ    . TYR A 1 874  ? -10.897 -68.705  20.979  1.00 2.44  ? 875  TYR A CZ    1 
ATOM   6665  O  OH    . TYR A 1 874  ? -10.492 -69.961  21.368  1.00 2.04  ? 875  TYR A OH    1 
ATOM   6666  N  N     . GLY A 1 875  ? -10.241 -63.462  17.713  1.00 2.11  ? 876  GLY A N     1 
ATOM   6667  C  CA    . GLY A 1 875  ? -9.208  -63.586  16.710  1.00 2.19  ? 876  GLY A CA    1 
ATOM   6668  C  C     . GLY A 1 875  ? -8.146  -62.506  16.808  1.00 2.69  ? 876  GLY A C     1 
ATOM   6669  O  O     . GLY A 1 875  ? -6.993  -62.772  16.496  1.00 3.18  ? 876  GLY A O     1 
ATOM   6670  N  N     . PHE A 1 876  ? -8.521  -61.291  17.204  1.00 2.18  ? 877  PHE A N     1 
ATOM   6671  C  CA    . PHE A 1 876  ? -7.578  -60.188  17.338  1.00 2.00  ? 877  PHE A CA    1 
ATOM   6672  C  C     . PHE A 1 876  ? -6.589  -60.540  18.439  1.00 2.10  ? 877  PHE A C     1 
ATOM   6673  O  O     . PHE A 1 876  ? -5.423  -60.157  18.403  1.00 2.00  ? 877  PHE A O     1 
ATOM   6674  C  CB    . PHE A 1 876  ? -8.336  -58.923  17.709  1.00 2.00  ? 877  PHE A CB    1 
ATOM   6675  C  CG    . PHE A 1 876  ? -7.490  -57.707  17.758  1.00 2.00  ? 877  PHE A CG    1 
ATOM   6676  C  CD1   . PHE A 1 876  ? -7.000  -57.157  16.600  1.00 2.32  ? 877  PHE A CD1   1 
ATOM   6677  C  CD2   . PHE A 1 876  ? -7.169  -57.122  18.965  1.00 2.00  ? 877  PHE A CD2   1 
ATOM   6678  C  CE1   . PHE A 1 876  ? -6.207  -56.058  16.641  1.00 2.05  ? 877  PHE A CE1   1 
ATOM   6679  C  CE2   . PHE A 1 876  ? -6.380  -56.021  19.012  1.00 2.00  ? 877  PHE A CE2   1 
ATOM   6680  C  CZ    . PHE A 1 876  ? -5.892  -55.483  17.846  1.00 2.12  ? 877  PHE A CZ    1 
ATOM   6681  N  N     . GLY A 1 877  ? -7.077  -61.265  19.440  1.00 2.26  ? 878  GLY A N     1 
ATOM   6682  C  CA    . GLY A 1 877  ? -6.228  -61.702  20.521  1.00 2.07  ? 878  GLY A CA    1 
ATOM   6683  C  C     . GLY A 1 877  ? -5.162  -62.671  20.030  1.00 2.00  ? 878  GLY A C     1 
ATOM   6684  O  O     . GLY A 1 877  ? -4.000  -62.524  20.377  1.00 2.00  ? 878  GLY A O     1 
ATOM   6685  N  N     . MET A 1 878  ? -5.559  -63.656  19.235  1.00 2.00  ? 879  MET A N     1 
ATOM   6686  C  CA    . MET A 1 878  ? -4.625  -64.667  18.700  1.00 2.22  ? 879  MET A CA    1 
ATOM   6687  C  C     . MET A 1 878  ? -3.484  -63.970  17.937  1.00 2.10  ? 879  MET A C     1 
ATOM   6688  O  O     . MET A 1 878  ? -2.319  -64.357  17.997  1.00 2.00  ? 879  MET A O     1 
ATOM   6689  C  CB    . MET A 1 878  ? -5.377  -65.608  17.742  1.00 2.00  ? 879  MET A CB    1 
ATOM   6690  C  CG    . MET A 1 878  ? -6.632  -66.193  18.329  1.00 2.00  ? 879  MET A CG    1 
ATOM   6691  S  SD    . MET A 1 878  ? -7.367  -67.359  17.232  1.00 2.00  ? 879  MET A SD    1 
ATOM   6692  C  CE    . MET A 1 878  ? -8.699  -67.909  18.197  1.00 2.65  ? 879  MET A CE    1 
ATOM   6693  N  N     . ASN A 1 879  ? -3.894  -62.965  17.187  1.00 2.29  ? 880  ASN A N     1 
ATOM   6694  C  CA    . ASN A 1 879  ? -3.043  -62.102  16.389  1.00 3.17  ? 880  ASN A CA    1 
ATOM   6695  C  C     . ASN A 1 879  ? -2.117  -61.277  17.312  1.00 3.27  ? 880  ASN A C     1 
ATOM   6696  O  O     . ASN A 1 879  ? -0.921  -61.220  17.043  1.00 3.90  ? 880  ASN A O     1 
ATOM   6697  C  CB    . ASN A 1 879  ? -3.935  -61.220  15.511  1.00 3.48  ? 880  ASN A CB    1 
ATOM   6698  C  CG    . ASN A 1 879  ? -3.321  -59.889  15.184  1.00 5.53  ? 880  ASN A CG    1 
ATOM   6699  O  OD1   . ASN A 1 879  ? -3.722  -58.837  15.742  1.00 6.95  ? 880  ASN A OD1   1 
ATOM   6700  N  ND2   . ASN A 1 879  ? -2.410  -59.888  14.205  1.00 5.78  ? 880  ASN A ND2   1 
ATOM   6701  N  N     . MET A 1 880  ? -2.626  -60.725  18.429  1.00 2.95  ? 881  MET A N     1 
ATOM   6702  C  CA    . MET A 1 880  ? -1.775  -59.977  19.377  1.00 2.11  ? 881  MET A CA    1 
ATOM   6703  C  C     . MET A 1 880  ? -0.676  -60.924  19.881  1.00 2.00  ? 881  MET A C     1 
ATOM   6704  O  O     . MET A 1 880  ? 0.494   -60.563  19.974  1.00 2.00  ? 881  MET A O     1 
ATOM   6705  C  CB    . MET A 1 880  ? -2.592  -59.428  20.554  1.00 2.34  ? 881  MET A CB    1 
ATOM   6706  C  CG    . MET A 1 880  ? -3.227  -58.055  20.316  1.00 2.37  ? 881  MET A CG    1 
ATOM   6707  S  SD    . MET A 1 880  ? -4.475  -57.662  21.532  1.00 3.97  ? 881  MET A SD    1 
ATOM   6708  C  CE    . MET A 1 880  ? -3.454  -56.868  22.743  1.00 3.46  ? 881  MET A CE    1 
ATOM   6709  N  N     . SER A 1 881  ? -1.051  -62.172  20.100  1.00 2.00  ? 882  SER A N     1 
ATOM   6710  C  CA    . SER A 1 881  ? -0.119  -63.180  20.557  1.00 2.00  ? 882  SER A CA    1 
ATOM   6711  C  C     . SER A 1 881  ? 0.987   -63.468  19.552  1.00 2.10  ? 882  SER A C     1 
ATOM   6712  O  O     . SER A 1 881  ? 2.147   -63.513  19.905  1.00 2.13  ? 882  SER A O     1 
ATOM   6713  C  CB    . SER A 1 881  ? -0.834  -64.465  20.821  1.00 2.00  ? 882  SER A CB    1 
ATOM   6714  O  OG    . SER A 1 881  ? 0.133   -65.447  21.043  1.00 2.00  ? 882  SER A OG    1 
ATOM   6715  N  N     . MET A 1 882  ? 0.628   -63.704  18.300  1.00 2.72  ? 883  MET A N     1 
ATOM   6716  C  CA    . MET A 1 882  ? 1.633   -63.955  17.283  1.00 2.33  ? 883  MET A CA    1 
ATOM   6717  C  C     . MET A 1 882  ? 2.495   -62.699  17.148  1.00 2.57  ? 883  MET A C     1 
ATOM   6718  O  O     . MET A 1 882  ? 3.701   -62.805  16.908  1.00 3.11  ? 883  MET A O     1 
ATOM   6719  C  CB    . MET A 1 882  ? 1.004   -64.308  15.934  1.00 2.21  ? 883  MET A CB    1 
ATOM   6720  C  CG    . MET A 1 882  ? 0.178   -65.590  15.945  1.00 3.41  ? 883  MET A CG    1 
ATOM   6721  S  SD    . MET A 1 882  ? 1.061   -66.995  16.722  1.00 3.30  ? 883  MET A SD    1 
ATOM   6722  C  CE    . MET A 1 882  ? 2.086   -67.238  15.503  1.00 3.25  ? 883  MET A CE    1 
ATOM   6723  N  N     . PHE A 1 883  ? 1.906   -61.513  17.293  1.00 2.05  ? 884  PHE A N     1 
ATOM   6724  C  CA    . PHE A 1 883  ? 2.710   -60.314  17.160  1.00 2.14  ? 884  PHE A CA    1 
ATOM   6725  C  C     . PHE A 1 883  ? 3.791   -60.321  18.251  1.00 2.41  ? 884  PHE A C     1 
ATOM   6726  O  O     . PHE A 1 883  ? 5.003   -60.272  17.977  1.00 2.00  ? 884  PHE A O     1 
ATOM   6727  C  CB    . PHE A 1 883  ? 1.866   -59.050  17.305  1.00 2.29  ? 884  PHE A CB    1 
ATOM   6728  C  CG    . PHE A 1 883  ? 2.673   -57.797  17.190  1.00 3.33  ? 884  PHE A CG    1 
ATOM   6729  C  CD1   . PHE A 1 883  ? 3.139   -57.360  15.947  1.00 3.49  ? 884  PHE A CD1   1 
ATOM   6730  C  CD2   . PHE A 1 883  ? 2.997   -57.054  18.326  1.00 3.89  ? 884  PHE A CD2   1 
ATOM   6731  C  CE1   . PHE A 1 883  ? 3.915   -56.211  15.836  1.00 3.06  ? 884  PHE A CE1   1 
ATOM   6732  C  CE2   . PHE A 1 883  ? 3.774   -55.889  18.218  1.00 3.77  ? 884  PHE A CE2   1 
ATOM   6733  C  CZ    . PHE A 1 883  ? 4.231   -55.481  16.953  1.00 3.76  ? 884  PHE A CZ    1 
ATOM   6734  N  N     . ALA A 1 884  ? 3.332   -60.494  19.486  1.00 2.00  ? 885  ALA A N     1 
ATOM   6735  C  CA    . ALA A 1 884  ? 4.219   -60.482  20.618  1.00 2.00  ? 885  ALA A CA    1 
ATOM   6736  C  C     . ALA A 1 884  ? 5.248   -61.600  20.599  1.00 2.30  ? 885  ALA A C     1 
ATOM   6737  O  O     . ALA A 1 884  ? 6.432   -61.355  20.843  1.00 2.38  ? 885  ALA A O     1 
ATOM   6738  C  CB    . ALA A 1 884  ? 3.410   -60.538  21.902  1.00 2.15  ? 885  ALA A CB    1 
ATOM   6739  N  N     . ARG A 1 885  ? 4.795   -62.815  20.299  1.00 2.00  ? 886  ARG A N     1 
ATOM   6740  C  CA    . ARG A 1 885  ? 5.665   -63.971  20.297  1.00 2.25  ? 886  ARG A CA    1 
ATOM   6741  C  C     . ARG A 1 885  ? 6.653   -64.035  19.143  1.00 2.45  ? 886  ARG A C     1 
ATOM   6742  O  O     . ARG A 1 885  ? 7.820   -64.423  19.318  1.00 2.00  ? 886  ARG A O     1 
ATOM   6743  C  CB    . ARG A 1 885  ? 4.820   -65.234  20.351  1.00 2.00  ? 886  ARG A CB    1 
ATOM   6744  C  CG    . ARG A 1 885  ? 4.025   -65.318  21.647  1.00 2.00  ? 886  ARG A CG    1 
ATOM   6745  C  CD    . ARG A 1 885  ? 3.190   -66.570  21.641  1.00 2.08  ? 886  ARG A CD    1 
ATOM   6746  N  NE    . ARG A 1 885  ? 4.020   -67.767  21.608  1.00 2.26  ? 886  ARG A NE    1 
ATOM   6747  C  CZ    . ARG A 1 885  ? 3.583   -68.971  21.267  1.00 2.00  ? 886  ARG A CZ    1 
ATOM   6748  N  NH1   . ARG A 1 885  ? 2.320   -69.156  20.922  1.00 2.00  ? 886  ARG A NH1   1 
ATOM   6749  N  NH2   . ARG A 1 885  ? 4.401   -70.002  21.342  1.00 2.00  ? 886  ARG A NH2   1 
ATOM   6750  N  N     . ARG A 1 886  ? 6.169   -63.683  17.957  1.00 2.93  ? 887  ARG A N     1 
ATOM   6751  C  CA    . ARG A 1 886  ? 7.032   -63.696  16.787  1.00 3.53  ? 887  ARG A CA    1 
ATOM   6752  C  C     . ARG A 1 886  ? 7.995   -62.520  16.917  1.00 3.59  ? 887  ARG A C     1 
ATOM   6753  O  O     . ARG A 1 886  ? 9.138   -62.648  16.535  1.00 3.89  ? 887  ARG A O     1 
ATOM   6754  C  CB    . ARG A 1 886  ? 6.223   -63.652  15.488  1.00 2.84  ? 887  ARG A CB    1 
ATOM   6755  C  CG    . ARG A 1 886  ? 5.237   -64.830  15.316  1.00 2.98  ? 887  ARG A CG    1 
ATOM   6756  C  CD    . ARG A 1 886  ? 4.656   -64.885  13.882  1.00 2.66  ? 887  ARG A CD    1 
ATOM   6757  N  NE    . ARG A 1 886  ? 5.602   -65.458  12.902  1.00 2.30  ? 887  ARG A NE    1 
ATOM   6758  C  CZ    . ARG A 1 886  ? 6.084   -64.848  11.822  1.00 2.00  ? 887  ARG A CZ    1 
ATOM   6759  N  NH1   . ARG A 1 886  ? 5.772   -63.592  11.519  1.00 2.13  ? 887  ARG A NH1   1 
ATOM   6760  N  NH2   . ARG A 1 886  ? 6.779   -65.557  10.960  1.00 3.68  ? 887  ARG A NH2   1 
ATOM   6761  N  N     . THR A 1 887  ? 7.534   -61.403  17.487  1.00 4.02  ? 888  THR A N     1 
ATOM   6762  C  CA    . THR A 1 887  ? 8.396   -60.247  17.713  1.00 4.27  ? 888  THR A CA    1 
ATOM   6763  C  C     . THR A 1 887  ? 9.512   -60.697  18.672  1.00 4.10  ? 888  THR A C     1 
ATOM   6764  O  O     . THR A 1 887  ? 10.649  -60.240  18.587  1.00 4.67  ? 888  THR A O     1 
ATOM   6765  C  CB    . THR A 1 887  ? 7.640   -59.020  18.372  1.00 4.41  ? 888  THR A CB    1 
ATOM   6766  O  OG1   . THR A 1 887  ? 6.843   -58.319  17.404  1.00 5.07  ? 888  THR A OG1   1 
ATOM   6767  C  CG2   . THR A 1 887  ? 8.634   -58.022  18.870  1.00 5.56  ? 888  THR A CG2   1 
ATOM   6768  N  N     . HIS A 1 888  ? 9.188   -61.587  19.598  1.00 3.86  ? 889  HIS A N     1 
ATOM   6769  C  CA    . HIS A 1 888  ? 10.179  -62.067  20.562  1.00 3.73  ? 889  HIS A CA    1 
ATOM   6770  C  C     . HIS A 1 888  ? 11.182  -62.968  19.835  1.00 4.15  ? 889  HIS A C     1 
ATOM   6771  O  O     . HIS A 1 888  ? 12.381  -62.911  20.092  1.00 5.22  ? 889  HIS A O     1 
ATOM   6772  C  CB    . HIS A 1 888  ? 9.459   -62.768  21.709  1.00 2.70  ? 889  HIS A CB    1 
ATOM   6773  C  CG    . HIS A 1 888  ? 10.348  -63.270  22.806  1.00 3.59  ? 889  HIS A CG    1 
ATOM   6774  N  ND1   . HIS A 1 888  ? 9.902   -64.163  23.759  1.00 3.21  ? 889  HIS A ND1   1 
ATOM   6775  C  CD2   . HIS A 1 888  ? 11.672  -63.089  23.065  1.00 4.12  ? 889  HIS A CD2   1 
ATOM   6776  C  CE1   . HIS A 1 888  ? 10.899  -64.514  24.552  1.00 3.36  ? 889  HIS A CE1   1 
ATOM   6777  N  NE2   . HIS A 1 888  ? 11.987  -63.882  24.154  1.00 3.34  ? 889  HIS A NE2   1 
ATOM   6778  N  N     . LEU A 1 889  ? 10.700  -63.764  18.892  1.00 4.48  ? 890  LEU A N     1 
ATOM   6779  C  CA    . LEU A 1 889  ? 11.565  -64.631  18.102  1.00 4.38  ? 890  LEU A CA    1 
ATOM   6780  C  C     . LEU A 1 889  ? 12.530  -63.755  17.267  1.00 5.06  ? 890  LEU A C     1 
ATOM   6781  O  O     . LEU A 1 889  ? 13.700  -64.094  17.127  1.00 4.62  ? 890  LEU A O     1 
ATOM   6782  C  CB    . LEU A 1 889  ? 10.707  -65.487  17.163  1.00 3.39  ? 890  LEU A CB    1 
ATOM   6783  C  CG    . LEU A 1 889  ? 11.453  -66.252  16.071  1.00 2.39  ? 890  LEU A CG    1 
ATOM   6784  C  CD1   . LEU A 1 889  ? 12.458  -67.122  16.681  1.00 2.43  ? 890  LEU A CD1   1 
ATOM   6785  C  CD2   . LEU A 1 889  ? 10.545  -67.086  15.273  1.00 2.30  ? 890  LEU A CD2   1 
ATOM   6786  N  N     . ALA A 1 890  ? 12.021  -62.640  16.728  1.00 5.67  ? 891  ALA A N     1 
ATOM   6787  C  CA    . ALA A 1 890  ? 12.806  -61.728  15.894  1.00 7.32  ? 891  ALA A CA    1 
ATOM   6788  C  C     . ALA A 1 890  ? 13.933  -61.060  16.676  1.00 8.65  ? 891  ALA A C     1 
ATOM   6789  O  O     . ALA A 1 890  ? 15.047  -60.868  16.159  1.00 8.72  ? 891  ALA A O     1 
ATOM   6790  C  CB    . ALA A 1 890  ? 11.917  -60.685  15.264  1.00 5.52  ? 891  ALA A CB    1 
ATOM   6791  N  N     . ASP A 1 891  ? 13.634  -60.659  17.914  1.00 10.43 ? 892  ASP A N     1 
ATOM   6792  C  CA    . ASP A 1 891  ? 14.643  -60.014  18.748  1.00 11.19 ? 892  ASP A CA    1 
ATOM   6793  C  C     . ASP A 1 891  ? 15.704  -61.072  19.050  1.00 10.58 ? 892  ASP A C     1 
ATOM   6794  O  O     . ASP A 1 891  ? 16.895  -60.806  18.969  1.00 10.89 ? 892  ASP A O     1 
ATOM   6795  C  CB    . ASP A 1 891  ? 14.007  -59.389  20.009  1.00 13.48 ? 892  ASP A CB    1 
ATOM   6796  C  CG    . ASP A 1 891  ? 13.196  -58.096  19.679  1.00 16.68 ? 892  ASP A CG    1 
ATOM   6797  O  OD1   . ASP A 1 891  ? 12.934  -57.883  18.452  1.00 18.33 ? 892  ASP A OD1   1 
ATOM   6798  O  OD2   . ASP A 1 891  ? 12.819  -57.302  20.614  1.00 17.20 ? 892  ASP A OD2   1 
ATOM   6799  N  N     . LEU A 1 892  ? 15.276  -62.299  19.286  1.00 9.48  ? 893  LEU A N     1 
ATOM   6800  C  CA    . LEU A 1 892  ? 16.230  -63.371  19.556  1.00 9.20  ? 893  LEU A CA    1 
ATOM   6801  C  C     . LEU A 1 892  ? 17.107  -63.609  18.346  1.00 9.45  ? 893  LEU A C     1 
ATOM   6802  O  O     . LEU A 1 892  ? 18.300  -63.783  18.469  1.00 9.74  ? 893  LEU A O     1 
ATOM   6803  C  CB    . LEU A 1 892  ? 15.496  -64.680  19.857  1.00 7.81  ? 893  LEU A CB    1 
ATOM   6804  C  CG    . LEU A 1 892  ? 15.374  -65.035  21.330  1.00 6.34  ? 893  LEU A CG    1 
ATOM   6805  C  CD1   . LEU A 1 892  ? 15.274  -63.781  22.152  1.00 5.44  ? 893  LEU A CD1   1 
ATOM   6806  C  CD2   . LEU A 1 892  ? 14.167  -65.879  21.530  1.00 5.98  ? 893  LEU A CD2   1 
ATOM   6807  N  N     . ALA A 1 893  ? 16.482  -63.616  17.174  1.00 10.07 ? 894  ALA A N     1 
ATOM   6808  C  CA    . ALA A 1 893  ? 17.171  -63.844  15.908  1.00 10.44 ? 894  ALA A CA    1 
ATOM   6809  C  C     . ALA A 1 893  ? 18.182  -62.754  15.642  1.00 10.83 ? 894  ALA A C     1 
ATOM   6810  O  O     . ALA A 1 893  ? 19.336  -63.071  15.332  1.00 11.89 ? 894  ALA A O     1 
ATOM   6811  C  CB    . ALA A 1 893  ? 16.157  -63.940  14.746  1.00 9.45  ? 894  ALA A CB    1 
ATOM   6812  N  N     . ALA A 1 894  ? 17.761  -61.494  15.796  1.00 11.44 ? 895  ALA A N     1 
ATOM   6813  C  CA    . ALA A 1 894  ? 18.629  -60.337  15.578  1.00 12.44 ? 895  ALA A CA    1 
ATOM   6814  C  C     . ALA A 1 894  ? 19.765  -60.364  16.603  1.00 13.25 ? 895  ALA A C     1 
ATOM   6815  O  O     . ALA A 1 894  ? 20.801  -59.689  16.414  1.00 14.51 ? 895  ALA A O     1 
ATOM   6816  C  CB    . ALA A 1 894  ? 17.825  -58.998  15.712  1.00 12.39 ? 895  ALA A CB    1 
ATOM   6817  N  N     . LYS A 1 895  ? 19.574  -61.110  17.700  1.00 12.95 ? 896  LYS A N     1 
ATOM   6818  C  CA    . LYS A 1 895  ? 20.616  -61.170  18.712  1.00 12.97 ? 896  LYS A CA    1 
ATOM   6819  C  C     . LYS A 1 895  ? 21.590  -62.299  18.421  1.00 12.98 ? 896  LYS A C     1 
ATOM   6820  O  O     . LYS A 1 895  ? 22.793  -62.116  18.522  1.00 13.55 ? 896  LYS A O     1 
ATOM   6821  C  CB    . LYS A 1 895  ? 20.039  -61.280  20.131  1.00 12.61 ? 896  LYS A CB    1 
ATOM   6822  C  CG    . LYS A 1 895  ? 19.467  -59.966  20.680  0.01 12.70 ? 896  LYS A CG    1 
ATOM   6823  C  CD    . LYS A 1 895  ? 19.012  -60.125  22.126  0.01 12.83 ? 896  LYS A CD    1 
ATOM   6824  C  CE    . LYS A 1 895  ? 17.762  -59.302  22.423  0.01 12.97 ? 896  LYS A CE    1 
ATOM   6825  N  NZ    . LYS A 1 895  ? 17.960  -57.831  22.286  0.01 13.10 ? 896  LYS A NZ    1 
ATOM   6826  N  N     . ALA A 1 896  ? 21.081  -63.449  18.006  1.00 13.02 ? 897  ALA A N     1 
ATOM   6827  C  CA    . ALA A 1 896  ? 21.920  -64.603  17.695  1.00 13.01 ? 897  ALA A CA    1 
ATOM   6828  C  C     . ALA A 1 896  ? 22.865  -64.378  16.499  1.00 13.84 ? 897  ALA A C     1 
ATOM   6829  O  O     . ALA A 1 896  ? 23.772  -65.194  16.270  1.00 13.22 ? 897  ALA A O     1 
ATOM   6830  C  CB    . ALA A 1 896  ? 21.072  -65.779  17.461  1.00 12.53 ? 897  ALA A CB    1 
ATOM   6831  N  N     . LEU A 1 897  ? 22.643  -63.280  15.749  1.00 14.62 ? 898  LEU A N     1 
ATOM   6832  C  CA    . LEU A 1 897  ? 23.501  -62.884  14.614  1.00 15.35 ? 898  LEU A CA    1 
ATOM   6833  C  C     . LEU A 1 897  ? 24.842  -62.330  15.177  1.00 17.45 ? 898  LEU A C     1 
ATOM   6834  O  O     . LEU A 1 897  ? 25.618  -61.712  14.405  1.00 19.09 ? 898  LEU A O     1 
ATOM   6835  C  CB    . LEU A 1 897  ? 22.817  -61.787  13.746  1.00 12.92 ? 898  LEU A CB    1 
ATOM   6836  C  CG    . LEU A 1 897  ? 21.565  -62.191  12.948  1.00 11.37 ? 898  LEU A CG    1 
ATOM   6837  C  CD1   . LEU A 1 897  ? 21.006  -61.046  12.129  1.00 10.59 ? 898  LEU A CD1   1 
ATOM   6838  C  CD2   . LEU A 1 897  ? 21.924  -63.339  12.061  1.00 10.77 ? 898  LEU A CD2   1 
ATOM   6839  N  N     . GLU A 1 898  ? 25.081  -62.524  16.505  1.00 19.25 ? 899  GLU A N     1 
ATOM   6840  C  CA    . GLU A 1 898  ? 26.270  -62.076  17.273  1.00 20.64 ? 899  GLU A CA    1 
ATOM   6841  C  C     . GLU A 1 898  ? 26.941  -63.232  18.011  1.00 21.30 ? 899  GLU A C     1 
ATOM   6842  O  O     . GLU A 1 898  ? 27.886  -63.020  18.782  1.00 21.41 ? 899  GLU A O     1 
ATOM   6843  C  CB    . GLU A 1 898  ? 25.893  -61.063  18.371  1.00 21.72 ? 899  GLU A CB    1 
ATOM   6844  C  CG    . GLU A 1 898  ? 25.267  -59.740  17.902  1.00 24.88 ? 899  GLU A CG    1 
ATOM   6845  C  CD    . GLU A 1 898  ? 24.875  -58.802  19.060  1.00 26.57 ? 899  GLU A CD    1 
ATOM   6846  O  OE1   . GLU A 1 898  ? 24.760  -59.291  20.213  1.00 26.87 ? 899  GLU A OE1   1 
ATOM   6847  O  OE2   . GLU A 1 898  ? 24.702  -57.567  18.818  1.00 27.92 ? 899  GLU A OE2   1 
ATOM   6848  N  N     . SER A 1 899  ? 26.466  -64.455  17.813  1.00 21.82 ? 900  SER A N     1 
ATOM   6849  C  CA    . SER A 1 899  ? 27.064  -65.567  18.541  1.00 22.55 ? 900  SER A CA    1 
ATOM   6850  C  C     . SER A 1 899  ? 28.051  -66.381  17.727  1.00 23.09 ? 900  SER A C     1 
ATOM   6851  O  O     . SER A 1 899  ? 28.408  -66.002  16.601  1.00 22.53 ? 900  SER A O     1 
ATOM   6852  C  CB    . SER A 1 899  ? 25.971  -66.477  19.155  1.00 22.69 ? 900  SER A CB    1 
ATOM   6853  O  OG    . SER A 1 899  ? 25.231  -67.190  18.182  1.00 22.76 ? 900  SER A OG    1 
ATOM   6854  N  N     . ASP A 1 900  ? 28.547  -67.467  18.326  1.00 24.13 ? 901  ASP A N     1 
ATOM   6855  C  CA    . ASP A 1 900  ? 29.452  -68.367  17.598  1.00 25.31 ? 901  ASP A CA    1 
ATOM   6856  C  C     . ASP A 1 900  ? 28.584  -69.330  16.769  1.00 25.34 ? 901  ASP A C     1 
ATOM   6857  O  O     . ASP A 1 900  ? 29.026  -70.413  16.367  1.00 25.37 ? 901  ASP A O     1 
ATOM   6858  C  CB    . ASP A 1 900  ? 30.515  -69.095  18.497  1.00 26.42 ? 901  ASP A CB    1 
ATOM   6859  C  CG    . ASP A 1 900  ? 29.933  -70.238  19.405  1.00 28.14 ? 901  ASP A CG    1 
ATOM   6860  O  OD1   . ASP A 1 900  ? 28.714  -70.204  19.767  1.00 28.60 ? 901  ASP A OD1   1 
ATOM   6861  O  OD2   . ASP A 1 900  ? 30.733  -71.160  19.778  1.00 28.11 ? 901  ASP A OD2   1 
ATOM   6862  N  N     . ALA A 1 901  ? 27.350  -68.898  16.488  1.00 25.10 ? 902  ALA A N     1 
ATOM   6863  C  CA    . ALA A 1 901  ? 26.448  -69.710  15.682  1.00 24.66 ? 902  ALA A CA    1 
ATOM   6864  C  C     . ALA A 1 901  ? 26.932  -69.726  14.216  1.00 24.56 ? 902  ALA A C     1 
ATOM   6865  O  O     . ALA A 1 901  ? 27.268  -68.673  13.621  1.00 24.41 ? 902  ALA A O     1 
ATOM   6866  C  CB    . ALA A 1 901  ? 25.023  -69.182  15.780  1.00 24.84 ? 902  ALA A CB    1 
ATOM   6867  N  N     . SER A 1 902  ? 26.917  -70.915  13.620  1.00 24.13 ? 903  SER A N     1 
ATOM   6868  C  CA    . SER A 1 902  ? 27.390  -71.097  12.248  1.00 23.94 ? 903  SER A CA    1 
ATOM   6869  C  C     . SER A 1 902  ? 26.875  -70.105  11.232  1.00 23.92 ? 903  SER A C     1 
ATOM   6870  O  O     . SER A 1 902  ? 25.822  -69.492  11.423  1.00 23.75 ? 903  SER A O     1 
ATOM   6871  C  CB    . SER A 1 902  ? 27.116  -72.513  11.757  1.00 23.83 ? 903  SER A CB    1 
ATOM   6872  O  OG    . SER A 1 902  ? 25.875  -72.590  11.102  1.00 23.93 ? 903  SER A OG    1 
ATOM   6873  N  N     . GLY A 1 903  ? 27.622  -69.981  10.138  1.00 24.04 ? 904  GLY A N     1 
ATOM   6874  C  CA    . GLY A 1 903  ? 27.277  -69.042  9.081   1.00 24.40 ? 904  GLY A CA    1 
ATOM   6875  C  C     . GLY A 1 903  ? 25.997  -69.433  8.389   1.00 24.46 ? 904  GLY A C     1 
ATOM   6876  O  O     . GLY A 1 903  ? 25.272  -68.569  7.892   1.00 24.63 ? 904  GLY A O     1 
ATOM   6877  N  N     . ASP A 1 904  ? 25.729  -70.740  8.368   1.00 24.98 ? 905  ASP A N     1 
ATOM   6878  C  CA    . ASP A 1 904  ? 24.517  -71.297  7.758   1.00 25.34 ? 905  ASP A CA    1 
ATOM   6879  C  C     . ASP A 1 904  ? 23.351  -70.752  8.513   1.00 24.87 ? 905  ASP A C     1 
ATOM   6880  O  O     . ASP A 1 904  ? 22.439  -70.153  7.922   1.00 24.96 ? 905  ASP A O     1 
ATOM   6881  C  CB    . ASP A 1 904  ? 24.483  -72.823  7.871   1.00 26.41 ? 905  ASP A CB    1 
ATOM   6882  C  CG    . ASP A 1 904  ? 25.246  -73.522  6.736   1.00 27.76 ? 905  ASP A CG    1 
ATOM   6883  O  OD1   . ASP A 1 904  ? 25.503  -72.843  5.716   1.00 28.24 ? 905  ASP A OD1   1 
ATOM   6884  O  OD2   . ASP A 1 904  ? 25.564  -74.747  6.848   1.00 28.40 ? 905  ASP A OD2   1 
ATOM   6885  N  N     . VAL A 1 905  ? 23.452  -70.920  9.835   1.00 24.20 ? 906  VAL A N     1 
ATOM   6886  C  CA    . VAL A 1 905  ? 22.462  -70.482  10.795  1.00 23.32 ? 906  VAL A CA    1 
ATOM   6887  C  C     . VAL A 1 905  ? 22.171  -68.987  10.699  1.00 22.99 ? 906  VAL A C     1 
ATOM   6888  O  O     . VAL A 1 905  ? 20.996  -68.583  10.634  1.00 23.23 ? 906  VAL A O     1 
ATOM   6889  C  CB    . VAL A 1 905  ? 22.908  -70.836  12.207  1.00 23.37 ? 906  VAL A CB    1 
ATOM   6890  C  CG1   . VAL A 1 905  ? 21.978  -70.221  13.214  1.00 23.82 ? 906  VAL A CG1   1 
ATOM   6891  C  CG2   . VAL A 1 905  ? 22.939  -72.343  12.392  1.00 22.56 ? 906  VAL A CG2   1 
ATOM   6892  N  N     . LYS A 1 906  ? 23.222  -68.172  10.620  1.00 22.36 ? 907  LYS A N     1 
ATOM   6893  C  CA    . LYS A 1 906  ? 23.045  -66.725  10.533  1.00 21.70 ? 907  LYS A CA    1 
ATOM   6894  C  C     . LYS A 1 906  ? 22.455  -66.244  9.201   1.00 21.19 ? 907  LYS A C     1 
ATOM   6895  O  O     . LYS A 1 906  ? 21.705  -65.261  9.140   1.00 21.04 ? 907  LYS A O     1 
ATOM   6896  C  CB    . LYS A 1 906  ? 24.365  -66.024  10.834  1.00 22.23 ? 907  LYS A CB    1 
ATOM   6897  C  CG    . LYS A 1 906  ? 24.772  -66.071  12.314  1.00 22.73 ? 907  LYS A CG    1 
ATOM   6898  C  CD    . LYS A 1 906  ? 26.106  -65.366  12.539  1.00 23.09 ? 907  LYS A CD    1 
ATOM   6899  C  CE    . LYS A 1 906  ? 26.587  -65.421  14.000  1.00 23.18 ? 907  LYS A CE    1 
ATOM   6900  N  NZ    . LYS A 1 906  ? 27.908  -64.716  14.156  1.00 23.91 ? 907  LYS A NZ    1 
ATOM   6901  N  N     . GLU A 1 907  ? 22.773  -66.959  8.131   1.00 20.87 ? 908  GLU A N     1 
ATOM   6902  C  CA    . GLU A 1 907  ? 22.284  -66.600  6.802   1.00 20.24 ? 908  GLU A CA    1 
ATOM   6903  C  C     . GLU A 1 907  ? 20.791  -66.916  6.693   1.00 18.40 ? 908  GLU A C     1 
ATOM   6904  O  O     . GLU A 1 907  ? 20.035  -66.170  6.053   1.00 18.52 ? 908  GLU A O     1 
ATOM   6905  C  CB    . GLU A 1 907  ? 23.071  -67.385  5.763   1.00 22.44 ? 908  GLU A CB    1 
ATOM   6906  C  CG    . GLU A 1 907  ? 22.860  -66.959  4.298   1.00 26.40 ? 908  GLU A CG    1 
ATOM   6907  C  CD    . GLU A 1 907  ? 23.536  -67.939  3.284   1.00 29.06 ? 908  GLU A CD    1 
ATOM   6908  O  OE1   . GLU A 1 907  ? 24.021  -69.049  3.702   1.00 30.14 ? 908  GLU A OE1   1 
ATOM   6909  O  OE2   . GLU A 1 907  ? 23.552  -67.601  2.059   1.00 30.60 ? 908  GLU A OE2   1 
ATOM   6910  N  N     . ALA A 1 908  ? 20.390  -68.032  7.303   1.00 15.68 ? 909  ALA A N     1 
ATOM   6911  C  CA    . ALA A 1 908  ? 18.986  -68.458  7.342   1.00 13.96 ? 909  ALA A CA    1 
ATOM   6912  C  C     . ALA A 1 908  ? 18.202  -67.591  8.351   1.00 12.95 ? 909  ALA A C     1 
ATOM   6913  O  O     . ALA A 1 908  ? 16.990  -67.390  8.228   1.00 12.55 ? 909  ALA A O     1 
ATOM   6914  C  CB    . ALA A 1 908  ? 18.904  -69.919  7.749   1.00 12.35 ? 909  ALA A CB    1 
ATOM   6915  N  N     . LEU A 1 909  ? 18.926  -67.105  9.353   1.00 12.09 ? 910  LEU A N     1 
ATOM   6916  C  CA    . LEU A 1 909  ? 18.392  -66.253  10.386  1.00 11.82 ? 910  LEU A CA    1 
ATOM   6917  C  C     . LEU A 1 909  ? 18.152  -64.870  9.763   1.00 12.15 ? 910  LEU A C     1 
ATOM   6918  O  O     . LEU A 1 909  ? 17.101  -64.260  9.984   1.00 12.30 ? 910  LEU A O     1 
ATOM   6919  C  CB    . LEU A 1 909  ? 19.413  -66.185  11.509  1.00 10.78 ? 910  LEU A CB    1 
ATOM   6920  C  CG    . LEU A 1 909  ? 19.038  -66.313  12.974  1.00 10.51 ? 910  LEU A CG    1 
ATOM   6921  C  CD1   . LEU A 1 909  ? 17.988  -67.402  13.240  1.00 9.52  ? 910  LEU A CD1   1 
ATOM   6922  C  CD2   . LEU A 1 909  ? 20.329  -66.616  13.727  1.00 9.77  ? 910  LEU A CD2   1 
ATOM   6923  N  N     . GLN A 1 910  ? 19.083  -64.401  8.935   1.00 12.78 ? 911  GLN A N     1 
ATOM   6924  C  CA    . GLN A 1 910  ? 18.880  -63.100  8.294   1.00 13.67 ? 911  GLN A CA    1 
ATOM   6925  C  C     . GLN A 1 910  ? 17.754  -63.254  7.295   1.00 12.51 ? 911  GLN A C     1 
ATOM   6926  O  O     . GLN A 1 910  ? 17.018  -62.311  7.046   1.00 13.11 ? 911  GLN A O     1 
ATOM   6927  C  CB    . GLN A 1 910  ? 20.128  -62.633  7.565   1.00 15.65 ? 911  GLN A CB    1 
ATOM   6928  C  CG    . GLN A 1 910  ? 21.324  -62.490  8.478   1.00 19.54 ? 911  GLN A CG    1 
ATOM   6929  C  CD    . GLN A 1 910  ? 22.599  -62.165  7.721   1.00 21.45 ? 911  GLN A CD    1 
ATOM   6930  O  OE1   . GLN A 1 910  ? 22.746  -61.057  7.190   1.00 22.99 ? 911  GLN A OE1   1 
ATOM   6931  N  NE2   . GLN A 1 910  ? 23.516  -63.137  7.643   1.00 22.49 ? 911  GLN A NE2   1 
ATOM   6932  N  N     . GLY A 1 911  ? 17.624  -64.456  6.741   1.00 11.24 ? 912  GLY A N     1 
ATOM   6933  C  CA    . GLY A 1 911  ? 16.578  -64.712  5.772   1.00 9.96  ? 912  GLY A CA    1 
ATOM   6934  C  C     . GLY A 1 911  ? 15.219  -64.586  6.431   1.00 9.12  ? 912  GLY A C     1 
ATOM   6935  O  O     . GLY A 1 911  ? 14.376  -63.755  6.037   1.00 8.54  ? 912  GLY A O     1 
ATOM   6936  N  N     . TRP A 1 912  ? 15.054  -65.360  7.504   1.00 8.12  ? 913  TRP A N     1 
ATOM   6937  C  CA    . TRP A 1 912  ? 13.820  -65.346  8.241   1.00 7.20  ? 913  TRP A CA    1 
ATOM   6938  C  C     . TRP A 1 912  ? 13.447  -63.919  8.639   1.00 6.95  ? 913  TRP A C     1 
ATOM   6939  O  O     . TRP A 1 912  ? 12.300  -63.514  8.500   1.00 7.26  ? 913  TRP A O     1 
ATOM   6940  C  CB    . TRP A 1 912  ? 13.926  -66.215  9.484   1.00 7.02  ? 913  TRP A CB    1 
ATOM   6941  C  CG    . TRP A 1 912  ? 12.564  -66.354  10.153  1.00 6.54  ? 913  TRP A CG    1 
ATOM   6942  C  CD1   . TRP A 1 912  ? 11.575  -67.217  9.802   1.00 5.44  ? 913  TRP A CD1   1 
ATOM   6943  C  CD2   . TRP A 1 912  ? 12.025  -65.508  11.182  1.00 6.41  ? 913  TRP A CD2   1 
ATOM   6944  N  NE1   . TRP A 1 912  ? 10.450  -66.958  10.530  1.00 5.99  ? 913  TRP A NE1   1 
ATOM   6945  C  CE2   . TRP A 1 912  ? 10.691  -65.913  11.386  1.00 6.39  ? 913  TRP A CE2   1 
ATOM   6946  C  CE3   . TRP A 1 912  ? 12.545  -64.431  11.944  1.00 6.58  ? 913  TRP A CE3   1 
ATOM   6947  C  CZ2   . TRP A 1 912  ? 9.858   -65.285  12.319  1.00 6.31  ? 913  TRP A CZ2   1 
ATOM   6948  C  CZ3   . TRP A 1 912  ? 11.735  -63.804  12.866  1.00 6.57  ? 913  TRP A CZ3   1 
ATOM   6949  C  CH2   . TRP A 1 912  ? 10.398  -64.226  13.053  1.00 7.29  ? 913  TRP A CH2   1 
ATOM   6950  N  N     . LEU A 1 913  ? 14.437  -63.171  9.105   1.00 6.97  ? 914  LEU A N     1 
ATOM   6951  C  CA    . LEU A 1 913  ? 14.283  -61.776  9.525   1.00 7.01  ? 914  LEU A CA    1 
ATOM   6952  C  C     . LEU A 1 913  ? 13.823  -60.892  8.381   1.00 7.23  ? 914  LEU A C     1 
ATOM   6953  O  O     . LEU A 1 913  ? 12.950  -60.041  8.556   1.00 7.78  ? 914  LEU A O     1 
ATOM   6954  C  CB    . LEU A 1 913  ? 15.613  -61.255  10.035  1.00 6.17  ? 914  LEU A CB    1 
ATOM   6955  C  CG    . LEU A 1 913  ? 15.774  -61.130  11.545  1.00 6.30  ? 914  LEU A CG    1 
ATOM   6956  C  CD1   . LEU A 1 913  ? 14.502  -61.453  12.279  1.00 5.12  ? 914  LEU A CD1   1 
ATOM   6957  C  CD2   . LEU A 1 913  ? 16.903  -61.975  11.986  1.00 5.06  ? 914  LEU A CD2   1 
ATOM   6958  N  N     . ALA A 1 914  ? 14.418  -61.115  7.206   1.00 7.54  ? 915  ALA A N     1 
ATOM   6959  C  CA    . ALA A 1 914  ? 14.072  -60.353  6.019   1.00 7.65  ? 915  ALA A CA    1 
ATOM   6960  C  C     . ALA A 1 914  ? 12.629  -60.610  5.533   1.00 8.10  ? 915  ALA A C     1 
ATOM   6961  O  O     . ALA A 1 914  ? 11.925  -59.638  5.246   1.00 8.69  ? 915  ALA A O     1 
ATOM   6962  C  CB    . ALA A 1 914  ? 15.078  -60.593  4.912   1.00 6.93  ? 915  ALA A CB    1 
ATOM   6963  N  N     . GLY A 1 915  ? 12.184  -61.884  5.474   1.00 7.83  ? 916  GLY A N     1 
ATOM   6964  C  CA    . GLY A 1 915  ? 10.833  -62.188  5.022   1.00 7.58  ? 916  GLY A CA    1 
ATOM   6965  C  C     . GLY A 1 915  ? 9.929   -62.770  6.101   1.00 7.90  ? 916  GLY A C     1 
ATOM   6966  O  O     . GLY A 1 915  ? 9.014   -63.582  5.808   1.00 8.08  ? 916  GLY A O     1 
ATOM   6967  N  N     . LYS A 1 916  ? 10.101  -62.293  7.332   1.00 7.57  ? 917  LYS A N     1 
ATOM   6968  C  CA    . LYS A 1 916  ? 9.321   -62.822  8.447   1.00 7.43  ? 917  LYS A CA    1 
ATOM   6969  C  C     . LYS A 1 916  ? 7.829   -62.792  8.307   1.00 6.95  ? 917  LYS A C     1 
ATOM   6970  O  O     . LYS A 1 916  ? 7.181   -63.681  8.814   1.00 7.02  ? 917  LYS A O     1 
ATOM   6971  C  CB    . LYS A 1 916  ? 9.717   -62.195  9.780   1.00 7.70  ? 917  LYS A CB    1 
ATOM   6972  C  CG    . LYS A 1 916  ? 9.541   -60.721  9.822   1.00 9.43  ? 917  LYS A CG    1 
ATOM   6973  C  CD    . LYS A 1 916  ? 9.716   -60.194  11.242  1.00 10.99 ? 917  LYS A CD    1 
ATOM   6974  C  CE    . LYS A 1 916  ? 9.751   -58.650  11.267  1.00 11.10 ? 917  LYS A CE    1 
ATOM   6975  N  NZ    . LYS A 1 916  ? 11.057  -58.154  10.764  1.00 11.72 ? 917  LYS A NZ    1 
ATOM   6976  N  N     . ASN A 1 917  ? 7.277   -61.779  7.655   1.00 6.76  ? 918  ASN A N     1 
ATOM   6977  C  CA    . ASN A 1 917  ? 5.824   -61.699  7.477   1.00 6.63  ? 918  ASN A CA    1 
ATOM   6978  C  C     . ASN A 1 917  ? 5.389   -62.128  6.087   1.00 6.72  ? 918  ASN A C     1 
ATOM   6979  O  O     . ASN A 1 917  ? 4.260   -61.895  5.651   1.00 7.17  ? 918  ASN A O     1 
ATOM   6980  C  CB    . ASN A 1 917  ? 5.345   -60.294  7.760   1.00 6.58  ? 918  ASN A CB    1 
ATOM   6981  C  CG    . ASN A 1 917  ? 5.533   -59.916  9.201   1.00 6.98  ? 918  ASN A CG    1 
ATOM   6982  O  OD1   . ASN A 1 917  ? 5.790   -58.750  9.500   1.00 8.79  ? 918  ASN A OD1   1 
ATOM   6983  N  ND2   . ASN A 1 917  ? 5.398   -60.890  10.115  1.00 6.40  ? 918  ASN A ND2   1 
ATOM   6984  N  N     . ASP A 1 918  ? 6.318   -62.749  5.388   1.00 6.52  ? 919  ASP A N     1 
ATOM   6985  C  CA    . ASP A 1 918  ? 6.059   -63.251  4.073   1.00 6.50  ? 919  ASP A CA    1 
ATOM   6986  C  C     . ASP A 1 918  ? 5.885   -64.749  4.273   1.00 5.45  ? 919  ASP A C     1 
ATOM   6987  O  O     . ASP A 1 918  ? 6.785   -65.421  4.768   1.00 5.28  ? 919  ASP A O     1 
ATOM   6988  C  CB    . ASP A 1 918  ? 7.276   -62.950  3.231   1.00 8.41  ? 919  ASP A CB    1 
ATOM   6989  C  CG    . ASP A 1 918  ? 7.188   -63.519  1.835   1.00 10.57 ? 919  ASP A CG    1 
ATOM   6990  O  OD1   . ASP A 1 918  ? 6.213   -64.228  1.500   1.00 11.95 ? 919  ASP A OD1   1 
ATOM   6991  O  OD2   . ASP A 1 918  ? 8.131   -63.254  1.046   1.00 13.69 ? 919  ASP A OD2   1 
ATOM   6992  N  N     . PRO A 1 919  ? 4.709   -65.286  3.937   1.00 4.77  ? 920  PRO A N     1 
ATOM   6993  C  CA    . PRO A 1 919  ? 4.480   -66.726  4.110   1.00 4.49  ? 920  PRO A CA    1 
ATOM   6994  C  C     . PRO A 1 919  ? 5.435   -67.650  3.373   1.00 4.46  ? 920  PRO A C     1 
ATOM   6995  O  O     . PRO A 1 919  ? 5.626   -68.781  3.786   1.00 5.39  ? 920  PRO A O     1 
ATOM   6996  C  CB    . PRO A 1 919  ? 3.033   -66.912  3.643   1.00 4.40  ? 920  PRO A CB    1 
ATOM   6997  C  CG    . PRO A 1 919  ? 2.728   -65.690  2.854   1.00 4.35  ? 920  PRO A CG    1 
ATOM   6998  C  CD    . PRO A 1 919  ? 3.476   -64.598  3.551   1.00 4.36  ? 920  PRO A CD    1 
ATOM   6999  N  N     . ILE A 1 920  ? 5.968   -67.213  2.241   1.00 4.36  ? 921  ILE A N     1 
ATOM   7000  C  CA    . ILE A 1 920  ? 6.895   -68.029  1.478   1.00 4.51  ? 921  ILE A CA    1 
ATOM   7001  C  C     . ILE A 1 920  ? 8.313   -67.984  2.068   1.00 4.86  ? 921  ILE A C     1 
ATOM   7002  O  O     . ILE A 1 920  ? 8.889   -69.024  2.439   1.00 4.60  ? 921  ILE A O     1 
ATOM   7003  C  CB    . ILE A 1 920  ? 6.885   -67.572  0.006   1.00 4.41  ? 921  ILE A CB    1 
ATOM   7004  C  CG1   . ILE A 1 920  ? 5.491   -67.856  -0.555  1.00 3.83  ? 921  ILE A CG1   1 
ATOM   7005  C  CG2   . ILE A 1 920  ? 8.013   -68.247  -0.793  1.00 3.56  ? 921  ILE A CG2   1 
ATOM   7006  C  CD1   . ILE A 1 920  ? 5.322   -67.529  -1.978  1.00 4.64  ? 921  ILE A CD1   1 
ATOM   7007  N  N     . LYS A 1 921  ? 8.837   -66.767  2.186   1.00 5.30  ? 922  LYS A N     1 
ATOM   7008  C  CA    . LYS A 1 921  ? 10.172  -66.536  2.744   1.00 6.42  ? 922  LYS A CA    1 
ATOM   7009  C  C     . LYS A 1 921  ? 10.306  -66.899  4.234   1.00 6.04  ? 922  LYS A C     1 
ATOM   7010  O  O     . LYS A 1 921  ? 11.362  -67.356  4.673   1.00 6.79  ? 922  LYS A O     1 
ATOM   7011  C  CB    . LYS A 1 921  ? 10.590  -65.067  2.508   1.00 7.77  ? 922  LYS A CB    1 
ATOM   7012  C  CG    . LYS A 1 921  ? 10.804  -64.728  1.034   1.00 9.71  ? 922  LYS A CG    1 
ATOM   7013  C  CD    . LYS A 1 921  ? 12.025  -65.459  0.542   1.00 12.51 ? 922  LYS A CD    1 
ATOM   7014  C  CE    . LYS A 1 921  ? 12.080  -65.590  -0.985  1.00 14.71 ? 922  LYS A CE    1 
ATOM   7015  N  NZ    . LYS A 1 921  ? 13.154  -66.617  -1.345  1.00 15.39 ? 922  LYS A NZ    1 
ATOM   7016  N  N     . SER A 1 922  ? 9.247   -66.706  5.017   1.00 5.41  ? 923  SER A N     1 
ATOM   7017  C  CA    . SER A 1 922  ? 9.295   -67.053  6.438   1.00 4.50  ? 923  SER A CA    1 
ATOM   7018  C  C     . SER A 1 922  ? 9.400   -68.553  6.595   1.00 4.44  ? 923  SER A C     1 
ATOM   7019  O  O     . SER A 1 922  ? 9.996   -69.042  7.543   1.00 4.51  ? 923  SER A O     1 
ATOM   7020  C  CB    . SER A 1 922  ? 8.052   -66.558  7.169   1.00 3.37  ? 923  SER A CB    1 
ATOM   7021  O  OG    . SER A 1 922  ? 6.903   -67.142  6.622   1.00 2.75  ? 923  SER A OG    1 
ATOM   7022  N  N     . LYS A 1 923  ? 8.824   -69.274  5.640   1.00 4.58  ? 924  LYS A N     1 
ATOM   7023  C  CA    . LYS A 1 923  ? 8.833   -70.732  5.627   1.00 4.44  ? 924  LYS A CA    1 
ATOM   7024  C  C     . LYS A 1 923  ? 10.102  -71.319  4.970   1.00 5.44  ? 924  LYS A C     1 
ATOM   7025  O  O     . LYS A 1 923  ? 10.668  -72.355  5.416   1.00 4.89  ? 924  LYS A O     1 
ATOM   7026  C  CB    . LYS A 1 923  ? 7.652   -71.226  4.832   1.00 3.19  ? 924  LYS A CB    1 
ATOM   7027  C  CG    . LYS A 1 923  ? 7.455   -72.690  5.014   1.00 3.10  ? 924  LYS A CG    1 
ATOM   7028  C  CD    . LYS A 1 923  ? 6.530   -73.197  3.957   1.00 2.77  ? 924  LYS A CD    1 
ATOM   7029  C  CE    . LYS A 1 923  ? 7.091   -74.415  3.345   1.00 2.50  ? 924  LYS A CE    1 
ATOM   7030  N  NZ    . LYS A 1 923  ? 6.730   -75.602  4.178   1.00 3.67  ? 924  LYS A NZ    1 
ATOM   7031  N  N     . GLU A 1 924  ? 10.517  -70.666  3.884   1.00 6.22  ? 925  GLU A N     1 
ATOM   7032  C  CA    . GLU A 1 924  ? 11.669  -71.103  3.127   1.00 7.23  ? 925  GLU A CA    1 
ATOM   7033  C  C     . GLU A 1 924  ? 12.855  -71.097  4.042   1.00 6.83  ? 925  GLU A C     1 
ATOM   7034  O  O     . GLU A 1 924  ? 13.684  -71.984  3.962   1.00 6.93  ? 925  GLU A O     1 
ATOM   7035  C  CB    . GLU A 1 924  ? 11.910  -70.144  1.976   1.00 9.04  ? 925  GLU A CB    1 
ATOM   7036  C  CG    . GLU A 1 924  ? 12.984  -70.598  1.034   1.00 12.32 ? 925  GLU A CG    1 
ATOM   7037  C  CD    . GLU A 1 924  ? 13.227  -69.591  -0.081  1.00 14.74 ? 925  GLU A CD    1 
ATOM   7038  O  OE1   . GLU A 1 924  ? 12.260  -69.269  -0.834  1.00 15.97 ? 925  GLU A OE1   1 
ATOM   7039  O  OE2   . GLU A 1 924  ? 14.386  -69.130  -0.217  1.00 16.16 ? 925  GLU A OE2   1 
ATOM   7040  N  N     . TYR A 1 925  ? 12.932  -70.069  4.887   1.00 6.66  ? 926  TYR A N     1 
ATOM   7041  C  CA    . TYR A 1 925  ? 14.020  -69.911  5.867   1.00 6.32  ? 926  TYR A CA    1 
ATOM   7042  C  C     . TYR A 1 925  ? 13.688  -70.563  7.206   1.00 5.13  ? 926  TYR A C     1 
ATOM   7043  O  O     . TYR A 1 925  ? 14.581  -71.068  7.909   1.00 5.41  ? 926  TYR A O     1 
ATOM   7044  C  CB    . TYR A 1 925  ? 14.377  -68.431  6.053   1.00 7.09  ? 926  TYR A CB    1 
ATOM   7045  C  CG    . TYR A 1 925  ? 15.048  -67.880  4.835   1.00 9.68  ? 926  TYR A CG    1 
ATOM   7046  C  CD1   . TYR A 1 925  ? 16.289  -68.373  4.438   1.00 10.78 ? 926  TYR A CD1   1 
ATOM   7047  C  CD2   . TYR A 1 925  ? 14.433  -66.903  4.034   1.00 10.57 ? 926  TYR A CD2   1 
ATOM   7048  C  CE1   . TYR A 1 925  ? 16.911  -67.920  3.268   1.00 12.11 ? 926  TYR A CE1   1 
ATOM   7049  C  CE2   . TYR A 1 925  ? 15.041  -66.435  2.856   1.00 11.54 ? 926  TYR A CE2   1 
ATOM   7050  C  CZ    . TYR A 1 925  ? 16.281  -66.949  2.475   1.00 12.29 ? 926  TYR A CZ    1 
ATOM   7051  O  OH    . TYR A 1 925  ? 16.904  -66.541  1.290   1.00 13.45 ? 926  TYR A OH    1 
ATOM   7052  N  N     . GLY A 1 926  ? 12.405  -70.574  7.559   1.00 4.27  ? 927  GLY A N     1 
ATOM   7053  C  CA    . GLY A 1 926  ? 11.996  -71.222  8.797   1.00 3.41  ? 927  GLY A CA    1 
ATOM   7054  C  C     . GLY A 1 926  ? 12.310  -72.720  8.748   1.00 3.01  ? 927  GLY A C     1 
ATOM   7055  O  O     . GLY A 1 926  ? 12.652  -73.329  9.748   1.00 2.37  ? 927  GLY A O     1 
ATOM   7056  N  N     . ASP A 1 927  ? 12.181  -73.331  7.583   1.00 3.37  ? 928  ASP A N     1 
ATOM   7057  C  CA    . ASP A 1 927  ? 12.470  -74.751  7.476   1.00 4.68  ? 928  ASP A CA    1 
ATOM   7058  C  C     . ASP A 1 927  ? 13.983  -74.989  7.487   1.00 5.14  ? 928  ASP A C     1 
ATOM   7059  O  O     . ASP A 1 927  ? 14.452  -76.032  7.945   1.00 4.90  ? 928  ASP A O     1 
ATOM   7060  C  CB    . ASP A 1 927  ? 11.861  -75.339  6.211   1.00 5.87  ? 928  ASP A CB    1 
ATOM   7061  C  CG    . ASP A 1 927  ? 10.315  -75.232  6.163   1.00 7.34  ? 928  ASP A CG    1 
ATOM   7062  O  OD1   . ASP A 1 927  ? 9.646   -75.069  7.224   1.00 8.47  ? 928  ASP A OD1   1 
ATOM   7063  O  OD2   . ASP A 1 927  ? 9.767   -75.347  5.036   1.00 7.74  ? 928  ASP A OD2   1 
ATOM   7064  N  N     . LYS A 1 928  ? 14.751  -74.055  6.941   1.00 5.34  ? 929  LYS A N     1 
ATOM   7065  C  CA    . LYS A 1 928  ? 16.180  -74.219  6.991   1.00 6.45  ? 929  LYS A CA    1 
ATOM   7066  C  C     . LYS A 1 928  ? 16.559  -74.203  8.471   1.00 7.39  ? 929  LYS A C     1 
ATOM   7067  O  O     . LYS A 1 928  ? 17.265  -75.100  8.950   1.00 7.96  ? 929  LYS A O     1 
ATOM   7068  C  CB    . LYS A 1 928  ? 16.883  -73.093  6.253   1.00 6.50  ? 929  LYS A CB    1 
ATOM   7069  C  CG    . LYS A 1 928  ? 16.788  -73.235  4.747   1.00 7.01  ? 929  LYS A CG    1 
ATOM   7070  C  CD    . LYS A 1 928  ? 17.362  -72.012  4.101   1.00 7.55  ? 929  LYS A CD    1 
ATOM   7071  C  CE    . LYS A 1 928  ? 17.110  -71.983  2.619   1.00 7.53  ? 929  LYS A CE    1 
ATOM   7072  N  NZ    . LYS A 1 928  ? 18.043  -70.915  2.132   1.00 8.96  ? 929  LYS A NZ    1 
ATOM   7073  N  N     . LEU A 1 929  ? 16.012  -73.228  9.199   1.00 7.83  ? 930  LEU A N     1 
ATOM   7074  C  CA    . LEU A 1 929  ? 16.263  -73.059  10.631  1.00 7.90  ? 930  LEU A CA    1 
ATOM   7075  C  C     . LEU A 1 929  ? 15.844  -74.280  11.444  1.00 9.13  ? 930  LEU A C     1 
ATOM   7076  O  O     . LEU A 1 929  ? 16.403  -74.583  12.510  1.00 9.38  ? 930  LEU A O     1 
ATOM   7077  C  CB    . LEU A 1 929  ? 15.485  -71.861  11.105  1.00 6.04  ? 930  LEU A CB    1 
ATOM   7078  C  CG    . LEU A 1 929  ? 16.278  -70.861  11.910  1.00 5.73  ? 930  LEU A CG    1 
ATOM   7079  C  CD1   . LEU A 1 929  ? 17.792  -70.883  11.481  1.00 4.75  ? 930  LEU A CD1   1 
ATOM   7080  C  CD2   . LEU A 1 929  ? 15.586  -69.474  11.756  1.00 3.51  ? 930  LEU A CD2   1 
ATOM   7081  N  N     . LYS A 1 930  ? 14.841  -74.981  10.955  1.00 10.35 ? 931  LYS A N     1 
ATOM   7082  C  CA    . LYS A 1 930  ? 14.380  -76.145  11.676  1.00 11.94 ? 931  LYS A CA    1 
ATOM   7083  C  C     . LYS A 1 930  ? 15.437  -77.206  11.622  1.00 12.42 ? 931  LYS A C     1 
ATOM   7084  O  O     . LYS A 1 930  ? 15.631  -77.890  12.620  1.00 13.67 ? 931  LYS A O     1 
ATOM   7085  C  CB    . LYS A 1 930  ? 13.061  -76.686  11.105  1.00 12.64 ? 931  LYS A CB    1 
ATOM   7086  C  CG    . LYS A 1 930  ? 11.825  -75.853  11.488  1.00 13.89 ? 931  LYS A CG    1 
ATOM   7087  C  CD    . LYS A 1 930  ? 10.559  -76.458  10.886  1.00 14.78 ? 931  LYS A CD    1 
ATOM   7088  C  CE    . LYS A 1 930  ? 9.306   -75.548  11.132  1.00 16.32 ? 931  LYS A CE    1 
ATOM   7089  N  NZ    . LYS A 1 930  ? 8.011   -76.290  10.806  1.00 16.01 ? 931  LYS A NZ    1 
ATOM   7090  N  N     . LYS A 1 931  ? 16.115  -77.318  10.473  1.00 12.29 ? 932  LYS A N     1 
ATOM   7091  C  CA    . LYS A 1 931  ? 17.183  -78.292  10.222  1.00 11.79 ? 932  LYS A CA    1 
ATOM   7092  C  C     . LYS A 1 931  ? 18.532  -77.969  10.887  1.00 11.05 ? 932  LYS A C     1 
ATOM   7093  O  O     . LYS A 1 931  ? 19.115  -78.801  11.563  1.00 10.80 ? 932  LYS A O     1 
ATOM   7094  C  CB    . LYS A 1 931  ? 17.403  -78.391  8.733   1.00 13.05 ? 932  LYS A CB    1 
ATOM   7095  C  CG    . LYS A 1 931  ? 16.445  -79.317  8.018   1.00 14.83 ? 932  LYS A CG    1 
ATOM   7096  C  CD    . LYS A 1 931  ? 16.498  -79.048  6.500   1.00 16.01 ? 932  LYS A CD    1 
ATOM   7097  C  CE    . LYS A 1 931  ? 15.916  -80.201  5.706   0.01 16.40 ? 932  LYS A CE    1 
ATOM   7098  N  NZ    . LYS A 1 931  ? 16.292  -80.139  4.263   0.01 16.84 ? 932  LYS A NZ    1 
ATOM   7099  N  N     . LEU A 1 932  ? 19.039  -76.772  10.628  1.00 10.11 ? 933  LEU A N     1 
ATOM   7100  C  CA    . LEU A 1 932  ? 20.287  -76.293  11.192  1.00 9.16  ? 933  LEU A CA    1 
ATOM   7101  C  C     . LEU A 1 932  ? 20.258  -76.215  12.719  1.00 9.60  ? 933  LEU A C     1 
ATOM   7102  O  O     . LEU A 1 932  ? 21.315  -76.243  13.353  1.00 10.42 ? 933  LEU A O     1 
ATOM   7103  C  CB    . LEU A 1 932  ? 20.542  -74.885  10.694  1.00 8.28  ? 933  LEU A CB    1 
ATOM   7104  C  CG    . LEU A 1 932  ? 20.699  -74.581  9.211   1.00 7.93  ? 933  LEU A CG    1 
ATOM   7105  C  CD1   . LEU A 1 932  ? 20.773  -73.063  9.028   1.00 7.72  ? 933  LEU A CD1   1 
ATOM   7106  C  CD2   . LEU A 1 932  ? 21.969  -75.194  8.697   1.00 7.13  ? 933  LEU A CD2   1 
ATOM   7107  N  N     . LEU A 1 933  ? 19.073  -76.031  13.309  1.00 9.46  ? 934  LEU A N     1 
ATOM   7108  C  CA    . LEU A 1 933  ? 18.958  -75.915  14.769  1.00 9.17  ? 934  LEU A CA    1 
ATOM   7109  C  C     . LEU A 1 933  ? 18.463  -77.182  15.462  1.00 10.23 ? 934  LEU A C     1 
ATOM   7110  O  O     . LEU A 1 933  ? 18.286  -77.209  16.678  1.00 10.79 ? 934  LEU A O     1 
ATOM   7111  C  CB    . LEU A 1 933  ? 18.090  -74.712  15.156  1.00 7.07  ? 934  LEU A CB    1 
ATOM   7112  C  CG    . LEU A 1 933  ? 18.705  -73.464  14.566  1.00 5.91  ? 934  LEU A CG    1 
ATOM   7113  C  CD1   . LEU A 1 933  ? 17.993  -72.144  15.016  1.00 5.48  ? 934  LEU A CD1   1 
ATOM   7114  C  CD2   . LEU A 1 933  ? 20.135  -73.494  15.020  1.00 5.20  ? 934  LEU A CD2   1 
ATOM   7115  N  N     . ALA A 1 934  ? 18.307  -78.263  14.725  1.00 11.23 ? 935  ALA A N     1 
ATOM   7116  C  CA    . ALA A 1 934  ? 17.837  -79.480  15.345  1.00 12.85 ? 935  ALA A CA    1 
ATOM   7117  C  C     . ALA A 1 934  ? 18.776  -79.902  16.486  1.00 14.73 ? 935  ALA A C     1 
ATOM   7118  O  O     . ALA A 1 934  ? 20.016  -79.829  16.326  1.00 15.52 ? 935  ALA A O     1 
ATOM   7119  C  CB    . ALA A 1 934  ? 17.792  -80.554  14.327  1.00 12.84 ? 935  ALA A CB    1 
ATOM   7120  N  N     . GLY A 1 935  ? 18.191  -80.332  17.619  1.00 16.05 ? 936  GLY A N     1 
ATOM   7121  C  CA    . GLY A 1 935  ? 18.947  -80.792  18.790  1.00 17.11 ? 936  GLY A CA    1 
ATOM   7122  C  C     . GLY A 1 935  ? 19.612  -79.745  19.671  1.00 18.46 ? 936  GLY A C     1 
ATOM   7123  O  O     . GLY A 1 935  ? 20.177  -80.071  20.727  1.00 19.06 ? 936  GLY A O     1 
ATOM   7124  N  N     . GLN A 1 936  ? 19.564  -78.487  19.231  1.00 19.05 ? 937  GLN A N     1 
ATOM   7125  C  CA    . GLN A 1 936  ? 20.156  -77.374  19.961  1.00 19.64 ? 937  GLN A CA    1 
ATOM   7126  C  C     . GLN A 1 936  ? 19.251  -77.182  21.160  1.00 20.28 ? 937  GLN A C     1 
ATOM   7127  O  O     . GLN A 1 936  ? 18.026  -77.061  20.974  1.00 20.50 ? 937  GLN A O     1 
ATOM   7128  C  CB    . GLN A 1 936  ? 20.094  -76.115  19.099  1.00 19.57 ? 937  GLN A CB    1 
ATOM   7129  C  CG    . GLN A 1 936  ? 20.846  -74.949  19.670  1.00 21.26 ? 937  GLN A CG    1 
ATOM   7130  C  CD    . GLN A 1 936  ? 22.337  -75.221  19.667  1.00 22.00 ? 937  GLN A CD    1 
ATOM   7131  O  OE1   . GLN A 1 936  ? 22.866  -75.745  18.687  1.00 22.80 ? 937  GLN A OE1   1 
ATOM   7132  N  NE2   . GLN A 1 936  ? 23.009  -74.941  20.788  1.00 22.21 ? 937  GLN A NE2   1 
ATOM   7133  N  N     . LYS A 1 937  ? 19.811  -77.216  22.376  1.00 20.77 ? 938  LYS A N     1 
ATOM   7134  C  CA    . LYS A 1 937  ? 18.982  -77.028  23.577  1.00 21.31 ? 938  LYS A CA    1 
ATOM   7135  C  C     . LYS A 1 937  ? 19.416  -75.847  24.430  1.00 21.53 ? 938  LYS A C     1 
ATOM   7136  O  O     . LYS A 1 937  ? 18.637  -75.349  25.250  1.00 21.55 ? 938  LYS A O     1 
ATOM   7137  C  CB    . LYS A 1 937  ? 18.943  -78.287  24.474  1.00 21.44 ? 938  LYS A CB    1 
ATOM   7138  C  CG    . LYS A 1 937  ? 18.253  -79.525  23.891  1.00 22.06 ? 938  LYS A CG    1 
ATOM   7139  C  CD    . LYS A 1 937  ? 17.060  -79.151  23.028  1.00 22.74 ? 938  LYS A CD    1 
ATOM   7140  C  CE    . LYS A 1 937  ? 16.052  -80.272  22.957  1.00 23.70 ? 938  LYS A CE    1 
ATOM   7141  N  NZ    . LYS A 1 937  ? 14.988  -80.101  23.999  1.00 24.59 ? 938  LYS A NZ    1 
ATOM   7142  N  N     . ASP A 1 938  ? 20.630  -75.362  24.212  1.00 21.78 ? 939  ASP A N     1 
ATOM   7143  C  CA    . ASP A 1 938  ? 21.118  -74.277  25.038  1.00 22.09 ? 939  ASP A CA    1 
ATOM   7144  C  C     . ASP A 1 938  ? 21.380  -72.954  24.368  1.00 20.86 ? 939  ASP A C     1 
ATOM   7145  O  O     . ASP A 1 938  ? 21.917  -72.901  23.252  1.00 21.11 ? 939  ASP A O     1 
ATOM   7146  C  CB    . ASP A 1 938  ? 22.403  -74.727  25.753  1.00 25.00 ? 939  ASP A CB    1 
ATOM   7147  C  CG    . ASP A 1 938  ? 22.182  -75.964  26.637  1.00 27.43 ? 939  ASP A CG    1 
ATOM   7148  O  OD1   . ASP A 1 938  ? 21.519  -75.815  27.709  1.00 28.44 ? 939  ASP A OD1   1 
ATOM   7149  O  OD2   . ASP A 1 938  ? 22.650  -77.074  26.246  1.00 29.11 ? 939  ASP A OD2   1 
ATOM   7150  N  N     . GLY A 1 939  ? 21.055  -71.885  25.087  1.00 19.10 ? 940  GLY A N     1 
ATOM   7151  C  CA    . GLY A 1 939  ? 21.319  -70.546  24.584  1.00 17.30 ? 940  GLY A CA    1 
ATOM   7152  C  C     . GLY A 1 939  ? 20.352  -69.953  23.595  1.00 16.00 ? 940  GLY A C     1 
ATOM   7153  O  O     . GLY A 1 939  ? 19.317  -70.557  23.316  1.00 16.52 ? 940  GLY A O     1 
ATOM   7154  N  N     . LEU A 1 940  ? 20.659  -68.734  23.130  1.00 14.49 ? 941  LEU A N     1 
ATOM   7155  C  CA    . LEU A 1 940  ? 19.833  -67.999  22.160  1.00 12.73 ? 941  LEU A CA    1 
ATOM   7156  C  C     . LEU A 1 940  ? 19.275  -68.919  21.063  1.00 12.34 ? 941  LEU A C     1 
ATOM   7157  O  O     . LEU A 1 940  ? 18.099  -68.830  20.665  1.00 12.64 ? 941  LEU A O     1 
ATOM   7158  C  CB    . LEU A 1 940  ? 20.650  -66.894  21.511  1.00 11.19 ? 941  LEU A CB    1 
ATOM   7159  C  CG    . LEU A 1 940  ? 20.558  -65.588  22.295  1.00 11.84 ? 941  LEU A CG    1 
ATOM   7160  C  CD1   . LEU A 1 940  ? 21.372  -64.450  21.607  1.00 10.16 ? 941  LEU A CD1   1 
ATOM   7161  C  CD2   . LEU A 1 940  ? 19.066  -65.213  22.465  1.00 10.42 ? 941  LEU A CD2   1 
ATOM   7162  N  N     . LEU A 1 941  ? 20.100  -69.890  20.688  1.00 11.02 ? 942  LEU A N     1 
ATOM   7163  C  CA    . LEU A 1 941  ? 19.768  -70.851  19.644  1.00 9.72  ? 942  LEU A CA    1 
ATOM   7164  C  C     . LEU A 1 941  ? 18.819  -71.966  20.092  1.00 9.12  ? 942  LEU A C     1 
ATOM   7165  O  O     . LEU A 1 941  ? 18.089  -72.581  19.287  1.00 7.75  ? 942  LEU A O     1 
ATOM   7166  C  CB    . LEU A 1 941  ? 21.060  -71.461  19.116  1.00 8.93  ? 942  LEU A CB    1 
ATOM   7167  C  CG    . LEU A 1 941  ? 21.500  -70.972  17.727  1.00 8.46  ? 942  LEU A CG    1 
ATOM   7168  C  CD1   . LEU A 1 941  ? 21.480  -69.418  17.527  1.00 7.46  ? 942  LEU A CD1   1 
ATOM   7169  C  CD2   . LEU A 1 941  ? 22.892  -71.548  17.517  1.00 8.71  ? 942  LEU A CD2   1 
ATOM   7170  N  N     . GLY A 1 942  ? 18.905  -72.273  21.372  1.00 9.04  ? 943  GLY A N     1 
ATOM   7171  C  CA    . GLY A 1 942  ? 18.074  -73.309  21.946  1.00 9.29  ? 943  GLY A CA    1 
ATOM   7172  C  C     . GLY A 1 942  ? 16.702  -72.731  22.150  1.00 9.43  ? 943  GLY A C     1 
ATOM   7173  O  O     . GLY A 1 942  ? 15.715  -73.426  22.000  1.00 10.09 ? 943  GLY A O     1 
ATOM   7174  N  N     . GLN A 1 943  ? 16.647  -71.453  22.479  1.00 9.15  ? 944  GLN A N     1 
ATOM   7175  C  CA    . GLN A 1 943  ? 15.383  -70.806  22.669  1.00 9.44  ? 944  GLN A CA    1 
ATOM   7176  C  C     . GLN A 1 943  ? 14.788  -70.658  21.261  1.00 9.81  ? 944  GLN A C     1 
ATOM   7177  O  O     . GLN A 1 943  ? 13.600  -70.961  21.034  1.00 10.64 ? 944  GLN A O     1 
ATOM   7178  C  CB    . GLN A 1 943  ? 15.571  -69.410  23.290  1.00 10.35 ? 944  GLN A CB    1 
ATOM   7179  C  CG    . GLN A 1 943  ? 16.228  -69.323  24.695  1.00 10.29 ? 944  GLN A CG    1 
ATOM   7180  C  CD    . GLN A 1 943  ? 16.577  -67.863  25.105  1.00 10.96 ? 944  GLN A CD    1 
ATOM   7181  O  OE1   . GLN A 1 943  ? 15.689  -67.039  25.404  1.00 11.58 ? 944  GLN A OE1   1 
ATOM   7182  N  NE2   . GLN A 1 943  ? 17.874  -67.542  25.099  1.00 10.85 ? 944  GLN A NE2   1 
ATOM   7183  N  N     . ILE A 1 944  ? 15.606  -70.218  20.303  1.00 9.11  ? 945  ILE A N     1 
ATOM   7184  C  CA    . ILE A 1 944  ? 15.101  -70.044  18.955  1.00 7.99  ? 945  ILE A CA    1 
ATOM   7185  C  C     . ILE A 1 944  ? 14.556  -71.366  18.435  1.00 7.99  ? 945  ILE A C     1 
ATOM   7186  O  O     . ILE A 1 944  ? 13.510  -71.415  17.798  1.00 8.72  ? 945  ILE A O     1 
ATOM   7187  C  CB    . ILE A 1 944  ? 16.190  -69.499  18.001  1.00 7.74  ? 945  ILE A CB    1 
ATOM   7188  C  CG1   . ILE A 1 944  ? 16.488  -68.029  18.315  1.00 7.55  ? 945  ILE A CG1   1 
ATOM   7189  C  CG2   . ILE A 1 944  ? 15.736  -69.605  16.543  1.00 7.68  ? 945  ILE A CG2   1 
ATOM   7190  C  CD1   . ILE A 1 944  ? 17.702  -67.497  17.586  1.00 7.63  ? 945  ILE A CD1   1 
ATOM   7191  N  N     . ALA A 1 945  ? 15.201  -72.461  18.803  1.00 7.41  ? 946  ALA A N     1 
ATOM   7192  C  CA    . ALA A 1 945  ? 14.774  -73.750  18.307  1.00 6.74  ? 946  ALA A CA    1 
ATOM   7193  C  C     . ALA A 1 945  ? 13.419  -74.163  18.830  1.00 6.73  ? 946  ALA A C     1 
ATOM   7194  O  O     . ALA A 1 945  ? 12.653  -74.822  18.125  1.00 7.26  ? 946  ALA A O     1 
ATOM   7195  C  CB    . ALA A 1 945  ? 15.830  -74.806  18.599  1.00 6.76  ? 946  ALA A CB    1 
ATOM   7196  N  N     . ALA A 1 946  ? 13.131  -73.809  20.079  1.00 6.69  ? 947  ALA A N     1 
ATOM   7197  C  CA    . ALA A 1 946  ? 11.836  -74.107  20.689  1.00 5.76  ? 947  ALA A CA    1 
ATOM   7198  C  C     . ALA A 1 946  ? 10.705  -73.218  20.106  1.00 5.28  ? 947  ALA A C     1 
ATOM   7199  O  O     . ALA A 1 946  ? 9.555   -73.373  20.481  1.00 5.46  ? 947  ALA A O     1 
ATOM   7200  C  CB    . ALA A 1 946  ? 11.934  -73.915  22.199  1.00 5.31  ? 947  ALA A CB    1 
ATOM   7201  N  N     . MET A 1 947  ? 11.041  -72.304  19.194  1.00 4.58  ? 948  MET A N     1 
ATOM   7202  C  CA    . MET A 1 947  ? 10.048  -71.415  18.593  1.00 4.47  ? 948  MET A CA    1 
ATOM   7203  C  C     . MET A 1 947  ? 9.741   -71.731  17.136  1.00 4.31  ? 948  MET A C     1 
ATOM   7204  O  O     . MET A 1 947  ? 9.152   -70.922  16.449  1.00 4.51  ? 948  MET A O     1 
ATOM   7205  C  CB    . MET A 1 947  ? 10.479  -69.940  18.736  1.00 4.08  ? 948  MET A CB    1 
ATOM   7206  C  CG    . MET A 1 947  ? 10.404  -69.423  20.176  1.00 4.61  ? 948  MET A CG    1 
ATOM   7207  S  SD    . MET A 1 947  ? 11.249  -67.881  20.523  1.00 6.52  ? 948  MET A SD    1 
ATOM   7208  C  CE    . MET A 1 947  ? 9.725   -66.620  20.848  1.00 6.54  ? 948  MET A CE    1 
ATOM   7209  N  N     . SER A 1 948  ? 10.079  -72.930  16.680  1.00 4.41  ? 949  SER A N     1 
ATOM   7210  C  CA    . SER A 1 948  ? 9.840   -73.320  15.288  1.00 4.25  ? 949  SER A CA    1 
ATOM   7211  C  C     . SER A 1 948  ? 8.379   -73.280  14.871  1.00 4.26  ? 949  SER A C     1 
ATOM   7212  O  O     . SER A 1 948  ? 8.075   -73.007  13.699  1.00 4.30  ? 949  SER A O     1 
ATOM   7213  C  CB    . SER A 1 948  ? 10.403  -74.692  15.025  1.00 3.89  ? 949  SER A CB    1 
ATOM   7214  O  OG    . SER A 1 948  ? 9.871   -75.613  15.945  1.00 4.33  ? 949  SER A OG    1 
ATOM   7215  N  N     . ASP A 1 949  ? 7.475   -73.511  15.821  1.00 4.41  ? 950  ASP A N     1 
ATOM   7216  C  CA    . ASP A 1 949  ? 6.036   -73.447  15.509  1.00 4.93  ? 950  ASP A CA    1 
ATOM   7217  C  C     . ASP A 1 949  ? 5.543   -72.030  15.216  1.00 4.08  ? 950  ASP A C     1 
ATOM   7218  O  O     . ASP A 1 949  ? 4.395   -71.841  14.821  1.00 3.72  ? 950  ASP A O     1 
ATOM   7219  C  CB    . ASP A 1 949  ? 5.153   -74.138  16.574  1.00 6.28  ? 950  ASP A CB    1 
ATOM   7220  C  CG    . ASP A 1 949  ? 5.165   -73.427  17.939  1.00 7.95  ? 950  ASP A CG    1 
ATOM   7221  O  OD1   . ASP A 1 949  ? 5.772   -72.326  18.090  1.00 9.01  ? 950  ASP A OD1   1 
ATOM   7222  O  OD2   . ASP A 1 949  ? 4.523   -73.982  18.869  1.00 8.78  ? 950  ASP A OD2   1 
ATOM   7223  N  N     . LEU A 1 950  ? 6.460   -71.067  15.323  1.00 4.15  ? 951  LEU A N     1 
ATOM   7224  C  CA    . LEU A 1 950  ? 6.199   -69.647  15.044  1.00 4.29  ? 951  LEU A CA    1 
ATOM   7225  C  C     . LEU A 1 950  ? 6.922   -69.124  13.775  1.00 4.76  ? 951  LEU A C     1 
ATOM   7226  O  O     . LEU A 1 950  ? 6.639   -67.992  13.334  1.00 4.68  ? 951  LEU A O     1 
ATOM   7227  C  CB    . LEU A 1 950  ? 6.690   -68.784  16.181  1.00 3.74  ? 951  LEU A CB    1 
ATOM   7228  C  CG    . LEU A 1 950  ? 6.121   -68.935  17.566  1.00 4.33  ? 951  LEU A CG    1 
ATOM   7229  C  CD1   . LEU A 1 950  ? 7.063   -68.098  18.481  1.00 4.26  ? 951  LEU A CD1   1 
ATOM   7230  C  CD2   . LEU A 1 950  ? 4.695   -68.402  17.594  1.00 3.95  ? 951  LEU A CD2   1 
ATOM   7231  N  N     . TYR A 1 951  ? 7.849   -69.929  13.210  1.00 4.97  ? 952  TYR A N     1 
ATOM   7232  C  CA    . TYR A 1 951  ? 8.625   -69.511  12.037  1.00 3.96  ? 952  TYR A CA    1 
ATOM   7233  C  C     . TYR A 1 951  ? 7.739   -69.070  10.883  1.00 3.91  ? 952  TYR A C     1 
ATOM   7234  O  O     . TYR A 1 951  ? 7.769   -67.897  10.498  1.00 4.39  ? 952  TYR A O     1 
ATOM   7235  C  CB    . TYR A 1 951  ? 9.571   -70.605  11.551  1.00 3.61  ? 952  TYR A CB    1 
ATOM   7236  C  CG    . TYR A 1 951  ? 10.699  -71.027  12.467  1.00 2.81  ? 952  TYR A CG    1 
ATOM   7237  C  CD1   . TYR A 1 951  ? 11.118  -70.239  13.506  1.00 2.27  ? 952  TYR A CD1   1 
ATOM   7238  C  CD2   . TYR A 1 951  ? 11.382  -72.225  12.237  1.00 2.84  ? 952  TYR A CD2   1 
ATOM   7239  C  CE1   . TYR A 1 951  ? 12.190  -70.623  14.299  1.00 2.34  ? 952  TYR A CE1   1 
ATOM   7240  C  CE2   . TYR A 1 951  ? 12.443  -72.614  13.027  1.00 2.49  ? 952  TYR A CE2   1 
ATOM   7241  C  CZ    . TYR A 1 951  ? 12.836  -71.809  14.047  1.00 2.03  ? 952  TYR A CZ    1 
ATOM   7242  O  OH    . TYR A 1 951  ? 13.861  -72.218  14.830  1.00 2.28  ? 952  TYR A OH    1 
ATOM   7243  N  N     . THR A 1 952  ? 6.911   -69.957  10.346  1.00 3.58  ? 953  THR A N     1 
ATOM   7244  C  CA    . THR A 1 952  ? 6.116   -69.506  9.209   1.00 3.81  ? 953  THR A CA    1 
ATOM   7245  C  C     . THR A 1 952  ? 5.002   -68.547  9.560   1.00 3.95  ? 953  THR A C     1 
ATOM   7246  O  O     . THR A 1 952  ? 4.462   -68.605  10.653  1.00 4.52  ? 953  THR A O     1 
ATOM   7247  C  CB    . THR A 1 952  ? 5.773   -70.653  8.176   1.00 3.92  ? 953  THR A CB    1 
ATOM   7248  O  OG1   . THR A 1 952  ? 4.378   -70.686  7.829   1.00 3.29  ? 953  THR A OG1   1 
ATOM   7249  C  CG2   . THR A 1 952  ? 6.286   -71.981  8.653   1.00 2.91  ? 953  THR A CG2   1 
ATOM   7250  N  N     . LYS A 1 953  ? 4.816   -67.532  8.733   1.00 4.10  ? 954  LYS A N     1 
ATOM   7251  C  CA    . LYS A 1 953  ? 3.782   -66.552  9.024   1.00 3.96  ? 954  LYS A CA    1 
ATOM   7252  C  C     . LYS A 1 953  ? 2.402   -67.198  9.099   1.00 3.37  ? 954  LYS A C     1 
ATOM   7253  O  O     . LYS A 1 953  ? 1.994   -67.894  8.166   1.00 3.32  ? 954  LYS A O     1 
ATOM   7254  C  CB    . LYS A 1 953  ? 3.758   -65.453  7.986   1.00 4.31  ? 954  LYS A CB    1 
ATOM   7255  C  CG    . LYS A 1 953  ? 2.997   -64.214  8.473   1.00 5.93  ? 954  LYS A CG    1 
ATOM   7256  C  CD    . LYS A 1 953  ? 1.735   -63.997  7.656   1.00 7.15  ? 954  LYS A CD    1 
ATOM   7257  C  CE    . LYS A 1 953  ? 1.017   -62.674  8.034   1.00 7.18  ? 954  LYS A CE    1 
ATOM   7258  N  NZ    . LYS A 1 953  ? 0.699   -62.581  9.484   1.00 7.04  ? 954  LYS A NZ    1 
ATOM   7259  N  N     . LYS A 1 954  ? 1.705   -66.986  10.210  1.00 2.52  ? 955  LYS A N     1 
ATOM   7260  C  CA    . LYS A 1 954  ? 0.362   -67.559  10.381  1.00 2.70  ? 955  LYS A CA    1 
ATOM   7261  C  C     . LYS A 1 954  ? -0.693  -66.691  9.661   1.00 2.44  ? 955  LYS A C     1 
ATOM   7262  O  O     . LYS A 1 954  ? -0.401  -65.570  9.265   1.00 2.05  ? 955  LYS A O     1 
ATOM   7263  C  CB    . LYS A 1 954  ? 0.031   -67.699  11.869  1.00 2.85  ? 955  LYS A CB    1 
ATOM   7264  C  CG    . LYS A 1 954  ? 1.112   -68.406  12.655  1.00 2.00  ? 955  LYS A CG    1 
ATOM   7265  C  CD    . LYS A 1 954  ? 1.226   -69.835  12.242  1.00 2.86  ? 955  LYS A CD    1 
ATOM   7266  C  CE    . LYS A 1 954  ? 2.248   -70.549  13.046  1.00 2.69  ? 955  LYS A CE    1 
ATOM   7267  N  NZ    . LYS A 1 954  ? 3.331   -70.906  12.166  1.00 2.17  ? 955  LYS A NZ    1 
ATOM   7268  N  N     . SER A 1 955  ? -1.923  -67.182  9.571   1.00 2.06  ? 956  SER A N     1 
ATOM   7269  C  CA    . SER A 1 955  ? -2.976  -66.481  8.854   1.00 2.00  ? 956  SER A CA    1 
ATOM   7270  C  C     . SER A 1 955  ? -4.177  -66.579  9.773   1.00 2.21  ? 956  SER A C     1 
ATOM   7271  O  O     . SER A 1 955  ? -4.755  -67.665  9.928   1.00 2.15  ? 956  SER A O     1 
ATOM   7272  C  CB    . SER A 1 955  ? -3.210  -67.225  7.532   1.00 2.33  ? 956  SER A CB    1 
ATOM   7273  O  OG    . SER A 1 955  ? -4.195  -66.663  6.695   1.00 3.58  ? 956  SER A OG    1 
ATOM   7274  N  N     . VAL A 1 956  ? -4.481  -65.468  10.451  1.00 2.00  ? 957  VAL A N     1 
ATOM   7275  C  CA    . VAL A 1 956  ? -5.580  -65.369  11.395  1.00 2.00  ? 957  VAL A CA    1 
ATOM   7276  C  C     . VAL A 1 956  ? -6.895  -65.045  10.723  1.00 2.24  ? 957  VAL A C     1 
ATOM   7277  O  O     . VAL A 1 956  ? -7.093  -63.968  10.137  1.00 2.47  ? 957  VAL A O     1 
ATOM   7278  C  CB    . VAL A 1 956  ? -5.311  -64.292  12.503  1.00 2.18  ? 957  VAL A CB    1 
ATOM   7279  C  CG1   . VAL A 1 956  ? -6.467  -64.231  13.501  1.00 2.00  ? 957  VAL A CG1   1 
ATOM   7280  C  CG2   . VAL A 1 956  ? -4.005  -64.599  13.218  1.00 2.00  ? 957  VAL A CG2   1 
ATOM   7281  N  N     . TRP A 1 957  ? -7.796  -66.007  10.801  1.00 2.68  ? 958  TRP A N     1 
ATOM   7282  C  CA    . TRP A 1 957  ? -9.140  -65.872  10.258  1.00 2.47  ? 958  TRP A CA    1 
ATOM   7283  C  C     . TRP A 1 957  ? -10.128 -65.842  11.399  1.00 2.38  ? 958  TRP A C     1 
ATOM   7284  O  O     . TRP A 1 957  ? -9.894  -66.398  12.478  1.00 2.04  ? 958  TRP A O     1 
ATOM   7285  C  CB    . TRP A 1 957  ? -9.469  -67.017  9.318   1.00 2.17  ? 958  TRP A CB    1 
ATOM   7286  C  CG    . TRP A 1 957  ? -8.779  -66.879  7.996   1.00 3.14  ? 958  TRP A CG    1 
ATOM   7287  C  CD1   . TRP A 1 957  ? -7.429  -67.095  7.713   1.00 3.12  ? 958  TRP A CD1   1 
ATOM   7288  C  CD2   . TRP A 1 957  ? -9.365  -66.397  6.795   1.00 3.20  ? 958  TRP A CD2   1 
ATOM   7289  N  NE1   . TRP A 1 957  ? -7.174  -66.755  6.403   1.00 2.70  ? 958  TRP A NE1   1 
ATOM   7290  C  CE2   . TRP A 1 957  ? -8.339  -66.320  5.823   1.00 3.06  ? 958  TRP A CE2   1 
ATOM   7291  C  CE3   . TRP A 1 957  ? -10.658 -65.987  6.451   1.00 4.06  ? 958  TRP A CE3   1 
ATOM   7292  C  CZ2   . TRP A 1 957  ? -8.574  -65.847  4.537   1.00 3.35  ? 958  TRP A CZ2   1 
ATOM   7293  C  CZ3   . TRP A 1 957  ? -10.891 -65.509  5.169   1.00 4.10  ? 958  TRP A CZ3   1 
ATOM   7294  C  CH2   . TRP A 1 957  ? -9.852  -65.444  4.229   1.00 3.87  ? 958  TRP A CH2   1 
ATOM   7295  N  N     . ILE A 1 958  ? -11.209 -65.116  11.154  1.00 2.24  ? 959  ILE A N     1 
ATOM   7296  C  CA    . ILE A 1 958  ? -12.303 -64.939  12.077  1.00 2.00  ? 959  ILE A CA    1 
ATOM   7297  C  C     . ILE A 1 958  ? -13.449 -65.364  11.186  1.00 2.00  ? 959  ILE A C     1 
ATOM   7298  O  O     . ILE A 1 958  ? -13.590 -64.809  10.122  1.00 2.00  ? 959  ILE A O     1 
ATOM   7299  C  CB    . ILE A 1 958  ? -12.432 -63.422  12.421  1.00 2.25  ? 959  ILE A CB    1 
ATOM   7300  C  CG1   . ILE A 1 958  ? -11.256 -62.972  13.285  1.00 2.00  ? 959  ILE A CG1   1 
ATOM   7301  C  CG2   . ILE A 1 958  ? -13.814 -63.083  13.023  1.00 2.00  ? 959  ILE A CG2   1 
ATOM   7302  C  CD1   . ILE A 1 958  ? -11.197 -61.476  13.472  1.00 2.00  ? 959  ILE A CD1   1 
ATOM   7303  N  N     . PHE A 1 959  ? -14.190 -66.408  11.549  1.00 2.14  ? 960  PHE A N     1 
ATOM   7304  C  CA    . PHE A 1 959  ? -15.338 -66.869  10.745  1.00 2.00  ? 960  PHE A CA    1 
ATOM   7305  C  C     . PHE A 1 959  ? -16.595 -66.536  11.495  1.00 2.00  ? 960  PHE A C     1 
ATOM   7306  O  O     . PHE A 1 959  ? -16.627 -66.679  12.695  1.00 2.00  ? 960  PHE A O     1 
ATOM   7307  C  CB    . PHE A 1 959  ? -15.371 -68.378  10.600  1.00 2.00  ? 960  PHE A CB    1 
ATOM   7308  C  CG    . PHE A 1 959  ? -14.364 -68.948  9.660   1.00 2.28  ? 960  PHE A CG    1 
ATOM   7309  C  CD1   . PHE A 1 959  ? -13.486 -68.147  8.960   1.00 2.00  ? 960  PHE A CD1   1 
ATOM   7310  C  CD2   . PHE A 1 959  ? -14.324 -70.342  9.452   1.00 2.15  ? 960  PHE A CD2   1 
ATOM   7311  C  CE1   . PHE A 1 959  ? -12.591 -68.707  8.066   1.00 2.00  ? 960  PHE A CE1   1 
ATOM   7312  C  CE2   . PHE A 1 959  ? -13.447 -70.896  8.574   1.00 2.00  ? 960  PHE A CE2   1 
ATOM   7313  C  CZ    . PHE A 1 959  ? -12.571 -70.068  7.872   1.00 2.14  ? 960  PHE A CZ    1 
ATOM   7314  N  N     . GLY A 1 960  ? -17.665 -66.234  10.775  1.00 2.00  ? 961  GLY A N     1 
ATOM   7315  C  CA    . GLY A 1 960  ? -18.919 -65.935  11.423  1.00 2.00  ? 961  GLY A CA    1 
ATOM   7316  C  C     . GLY A 1 960  ? -20.046 -65.812  10.429  1.00 2.00  ? 961  GLY A C     1 
ATOM   7317  O  O     . GLY A 1 960  ? -19.796 -65.590  9.254   1.00 2.00  ? 961  GLY A O     1 
ATOM   7318  N  N     . GLY A 1 961  ? -21.279 -65.994  10.903  1.00 2.00  ? 962  GLY A N     1 
ATOM   7319  C  CA    . GLY A 1 961  ? -22.446 -65.866  10.054  1.00 2.00  ? 962  GLY A CA    1 
ATOM   7320  C  C     . GLY A 1 961  ? -22.899 -64.404  10.040  1.00 2.00  ? 962  GLY A C     1 
ATOM   7321  O  O     . GLY A 1 961  ? -22.225 -63.570  10.621  1.00 2.00  ? 962  GLY A O     1 
ATOM   7322  N  N     . ASP A 1 962  ? -24.033 -64.093  9.419   1.00 2.00  ? 963  ASP A N     1 
ATOM   7323  C  CA    . ASP A 1 962  ? -24.533 -62.711  9.357   1.00 2.18  ? 963  ASP A CA    1 
ATOM   7324  C  C     . ASP A 1 962  ? -25.038 -62.118  10.649  1.00 2.00  ? 963  ASP A C     1 
ATOM   7325  O  O     . ASP A 1 962  ? -24.959 -60.934  10.847  1.00 2.00  ? 963  ASP A O     1 
ATOM   7326  C  CB    . ASP A 1 962  ? -25.646 -62.575  8.328   1.00 2.46  ? 963  ASP A CB    1 
ATOM   7327  C  CG    . ASP A 1 962  ? -26.793 -63.509  8.599   1.00 2.48  ? 963  ASP A CG    1 
ATOM   7328  O  OD1   . ASP A 1 962  ? -26.624 -64.742  8.354   1.00 2.00  ? 963  ASP A OD1   1 
ATOM   7329  O  OD2   . ASP A 1 962  ? -27.829 -62.989  9.057   1.00 2.00  ? 963  ASP A OD2   1 
ATOM   7330  N  N     . GLY A 1 963  ? -25.692 -62.923  11.461  1.00 2.08  ? 964  GLY A N     1 
ATOM   7331  C  CA    . GLY A 1 963  ? -26.181 -62.427  12.725  1.00 2.00  ? 964  GLY A CA    1 
ATOM   7332  C  C     . GLY A 1 963  ? -25.024 -61.959  13.574  1.00 2.00  ? 964  GLY A C     1 
ATOM   7333  O  O     . GLY A 1 963  ? -25.170 -60.972  14.303  1.00 2.00  ? 964  GLY A O     1 
ATOM   7334  N  N     . TRP A 1 964  ? -23.900 -62.674  13.495  1.00 2.00  ? 965  TRP A N     1 
ATOM   7335  C  CA    . TRP A 1 964  ? -22.709 -62.296  14.230  1.00 2.00  ? 965  TRP A CA    1 
ATOM   7336  C  C     . TRP A 1 964  ? -22.109 -60.964  13.717  1.00 2.00  ? 965  TRP A C     1 
ATOM   7337  O  O     . TRP A 1 964  ? -21.881 -60.040  14.484  1.00 2.00  ? 965  TRP A O     1 
ATOM   7338  C  CB    . TRP A 1 964  ? -21.629 -63.381  14.178  1.00 2.00  ? 965  TRP A CB    1 
ATOM   7339  C  CG    . TRP A 1 964  ? -20.279 -62.859  14.621  1.00 2.00  ? 965  TRP A CG    1 
ATOM   7340  C  CD1   . TRP A 1 964  ? -19.921 -62.532  15.887  1.00 2.03  ? 965  TRP A CD1   1 
ATOM   7341  C  CD2   . TRP A 1 964  ? -19.184 -62.448  13.777  1.00 2.00  ? 965  TRP A CD2   1 
ATOM   7342  N  NE1   . TRP A 1 964  ? -18.693 -61.916  15.892  1.00 2.00  ? 965  TRP A NE1   1 
ATOM   7343  C  CE2   . TRP A 1 964  ? -18.216 -61.854  14.608  1.00 2.00  ? 965  TRP A CE2   1 
ATOM   7344  C  CE3   . TRP A 1 964  ? -18.933 -62.518  12.396  1.00 2.00  ? 965  TRP A CE3   1 
ATOM   7345  C  CZ2   . TRP A 1 964  ? -17.005 -61.329  14.105  1.00 2.00  ? 965  TRP A CZ2   1 
ATOM   7346  C  CZ3   . TRP A 1 964  ? -17.742 -62.007  11.898  1.00 2.00  ? 965  TRP A CZ3   1 
ATOM   7347  C  CH2   . TRP A 1 964  ? -16.791 -61.418  12.754  1.00 2.00  ? 965  TRP A CH2   1 
ATOM   7348  N  N     . ALA A 1 965  ? -21.912 -60.866  12.414  1.00 2.00  ? 966  ALA A N     1 
ATOM   7349  C  CA    . ALA A 1 965  ? -21.299 -59.698  11.818  1.00 2.17  ? 966  ALA A CA    1 
ATOM   7350  C  C     . ALA A 1 965  ? -22.126 -58.419  11.779  1.00 2.00  ? 966  ALA A C     1 
ATOM   7351  O  O     . ALA A 1 965  ? -21.587 -57.317  11.951  1.00 2.00  ? 966  ALA A O     1 
ATOM   7352  C  CB    . ALA A 1 965  ? -20.771 -60.040  10.407  1.00 2.00  ? 966  ALA A CB    1 
ATOM   7353  N  N     . TYR A 1 966  ? -23.414 -58.587  11.523  1.00 2.00  ? 967  TYR A N     1 
ATOM   7354  C  CA    . TYR A 1 966  ? -24.332 -57.488  11.411  1.00 2.00  ? 967  TYR A CA    1 
ATOM   7355  C  C     . TYR A 1 966  ? -25.004 -57.073  12.704  1.00 2.02  ? 967  TYR A C     1 
ATOM   7356  O  O     . TYR A 1 966  ? -25.416 -55.937  12.798  1.00 2.00  ? 967  TYR A O     1 
ATOM   7357  C  CB    . TYR A 1 966  ? -25.420 -57.783  10.383  1.00 2.00  ? 967  TYR A CB    1 
ATOM   7358  C  CG    . TYR A 1 966  ? -24.990 -57.880  8.943   1.00 2.14  ? 967  TYR A CG    1 
ATOM   7359  C  CD1   . TYR A 1 966  ? -24.124 -58.892  8.505   1.00 2.05  ? 967  TYR A CD1   1 
ATOM   7360  C  CD2   . TYR A 1 966  ? -25.554 -57.036  7.977   1.00 2.55  ? 967  TYR A CD2   1 
ATOM   7361  C  CE1   . TYR A 1 966  ? -23.826 -59.076  7.146   1.00 2.00  ? 967  TYR A CE1   1 
ATOM   7362  C  CE2   . TYR A 1 966  ? -25.271 -57.220  6.605   1.00 2.15  ? 967  TYR A CE2   1 
ATOM   7363  C  CZ    . TYR A 1 966  ? -24.402 -58.246  6.218   1.00 2.05  ? 967  TYR A CZ    1 
ATOM   7364  O  OH    . TYR A 1 966  ? -24.099 -58.405  4.898   1.00 2.23  ? 967  TYR A OH    1 
ATOM   7365  N  N     . ASP A 1 967  ? -25.179 -57.996  13.660  1.00 2.25  ? 968  ASP A N     1 
ATOM   7366  C  CA    . ASP A 1 967  ? -25.832 -57.686  14.938  1.00 2.17  ? 968  ASP A CA    1 
ATOM   7367  C  C     . ASP A 1 967  ? -24.947 -57.823  16.170  1.00 2.16  ? 968  ASP A C     1 
ATOM   7368  O  O     . ASP A 1 967  ? -24.127 -56.965  16.433  1.00 2.76  ? 968  ASP A O     1 
ATOM   7369  C  CB    . ASP A 1 967  ? -27.095 -58.534  15.149  1.00 2.04  ? 968  ASP A CB    1 
ATOM   7370  C  CG    . ASP A 1 967  ? -28.112 -58.419  14.001  1.00 2.49  ? 968  ASP A CG    1 
ATOM   7371  O  OD1   . ASP A 1 967  ? -28.140 -57.395  13.302  1.00 2.11  ? 968  ASP A OD1   1 
ATOM   7372  O  OD2   . ASP A 1 967  ? -28.904 -59.380  13.794  1.00 3.12  ? 968  ASP A OD2   1 
ATOM   7373  N  N     . ILE A 1 968  ? -25.045 -58.964  16.851  1.00 2.60  ? 969  ILE A N     1 
ATOM   7374  C  CA    . ILE A 1 968  ? -24.320 -59.234  18.092  1.00 2.20  ? 969  ILE A CA    1 
ATOM   7375  C  C     . ILE A 1 968  ? -22.827 -58.980  18.143  1.00 2.02  ? 969  ILE A C     1 
ATOM   7376  O  O     . ILE A 1 968  ? -22.352 -58.439  19.130  1.00 2.16  ? 969  ILE A O     1 
ATOM   7377  C  CB    . ILE A 1 968  ? -24.658 -60.654  18.718  1.00 2.00  ? 969  ILE A CB    1 
ATOM   7378  C  CG1   . ILE A 1 968  ? -24.472 -60.578  20.224  1.00 2.07  ? 969  ILE A CG1   1 
ATOM   7379  C  CG2   . ILE A 1 968  ? -23.752 -61.764  18.166  1.00 2.00  ? 969  ILE A CG2   1 
ATOM   7380  C  CD1   . ILE A 1 968  ? -24.907 -61.767  21.021  1.00 2.00  ? 969  ILE A CD1   1 
ATOM   7381  N  N     . GLY A 1 969  ? -22.081 -59.352  17.115  1.00 2.00  ? 970  GLY A N     1 
ATOM   7382  C  CA    . GLY A 1 969  ? -20.645 -59.119  17.194  1.00 2.14  ? 970  GLY A CA    1 
ATOM   7383  C  C     . GLY A 1 969  ? -20.148 -57.937  16.410  1.00 2.00  ? 970  GLY A C     1 
ATOM   7384  O  O     . GLY A 1 969  ? -18.956 -57.730  16.304  1.00 2.00  ? 970  GLY A O     1 
ATOM   7385  N  N     . TYR A 1 970  ? -21.091 -57.154  15.893  1.00 2.01  ? 971  TYR A N     1 
ATOM   7386  C  CA    . TYR A 1 970  ? -20.794 -56.015  15.079  1.00 2.08  ? 971  TYR A CA    1 
ATOM   7387  C  C     . TYR A 1 970  ? -19.882 -54.897  15.661  1.00 2.37  ? 971  TYR A C     1 
ATOM   7388  O  O     . TYR A 1 970  ? -19.044 -54.353  14.938  1.00 2.45  ? 971  TYR A O     1 
ATOM   7389  C  CB    . TYR A 1 970  ? -22.088 -55.431  14.535  1.00 2.00  ? 971  TYR A CB    1 
ATOM   7390  C  CG    . TYR A 1 970  ? -21.810 -54.232  13.680  1.00 2.00  ? 971  TYR A CG    1 
ATOM   7391  C  CD1   . TYR A 1 970  ? -20.829 -54.279  12.699  1.00 2.00  ? 971  TYR A CD1   1 
ATOM   7392  C  CD2   . TYR A 1 970  ? -22.462 -53.034  13.903  1.00 2.00  ? 971  TYR A CD2   1 
ATOM   7393  C  CE1   . TYR A 1 970  ? -20.492 -53.147  11.958  1.00 2.45  ? 971  TYR A CE1   1 
ATOM   7394  C  CE2   . TYR A 1 970  ? -22.150 -51.879  13.168  1.00 2.10  ? 971  TYR A CE2   1 
ATOM   7395  C  CZ    . TYR A 1 970  ? -21.162 -51.930  12.202  1.00 2.50  ? 971  TYR A CZ    1 
ATOM   7396  O  OH    . TYR A 1 970  ? -20.764 -50.776  11.528  1.00 2.00  ? 971  TYR A OH    1 
ATOM   7397  N  N     . GLY A 1 971  ? -20.085 -54.504  16.920  1.00 2.22  ? 972  GLY A N     1 
ATOM   7398  C  CA    . GLY A 1 971  ? -19.252 -53.467  17.497  1.00 2.00  ? 972  GLY A CA    1 
ATOM   7399  C  C     . GLY A 1 971  ? -17.810 -53.944  17.542  1.00 2.00  ? 972  GLY A C     1 
ATOM   7400  O  O     . GLY A 1 971  ? -16.915 -53.205  17.188  1.00 2.00  ? 972  GLY A O     1 
ATOM   7401  N  N     . GLY A 1 972  ? -17.597 -55.200  17.939  1.00 2.13  ? 973  GLY A N     1 
ATOM   7402  C  CA    . GLY A 1 972  ? -16.258 -55.790  18.018  1.00 2.12  ? 973  GLY A CA    1 
ATOM   7403  C  C     . GLY A 1 972  ? -15.550 -55.979  16.689  1.00 2.00  ? 973  GLY A C     1 
ATOM   7404  O  O     . GLY A 1 972  ? -14.327 -55.827  16.617  1.00 2.00  ? 973  GLY A O     1 
ATOM   7405  N  N     . LEU A 1 973  ? -16.324 -56.348  15.662  1.00 2.00  ? 974  LEU A N     1 
ATOM   7406  C  CA    . LEU A 1 973  ? -15.830 -56.544  14.301  1.00 2.00  ? 974  LEU A CA    1 
ATOM   7407  C  C     . LEU A 1 973  ? -15.363 -55.153  13.826  1.00 2.25  ? 974  LEU A C     1 
ATOM   7408  O  O     . LEU A 1 973  ? -14.231 -54.985  13.368  1.00 2.00  ? 974  LEU A O     1 
ATOM   7409  C  CB    . LEU A 1 973  ? -16.974 -57.025  13.401  1.00 2.00  ? 974  LEU A CB    1 
ATOM   7410  C  CG    . LEU A 1 973  ? -16.716 -57.131  11.897  1.00 2.00  ? 974  LEU A CG    1 
ATOM   7411  C  CD1   . LEU A 1 973  ? -15.547 -58.098  11.683  1.00 2.00  ? 974  LEU A CD1   1 
ATOM   7412  C  CD2   . LEU A 1 973  ? -17.938 -57.547  11.119  1.00 2.00  ? 974  LEU A CD2   1 
ATOM   7413  N  N     . ASP A 1 974  ? -16.266 -54.179  13.935  1.00 2.00  ? 975  ASP A N     1 
ATOM   7414  C  CA    . ASP A 1 974  ? -15.983 -52.811  13.559  1.00 2.31  ? 975  ASP A CA    1 
ATOM   7415  C  C     . ASP A 1 974  ? -14.685 -52.271  14.223  1.00 2.00  ? 975  ASP A C     1 
ATOM   7416  O  O     . ASP A 1 974  ? -13.878 -51.650  13.575  1.00 2.00  ? 975  ASP A O     1 
ATOM   7417  C  CB    . ASP A 1 974  ? -17.192 -51.924  13.889  1.00 2.00  ? 975  ASP A CB    1 
ATOM   7418  C  CG    . ASP A 1 974  ? -16.929 -50.473  13.596  1.00 2.00  ? 975  ASP A CG    1 
ATOM   7419  O  OD1   . ASP A 1 974  ? -16.861 -50.101  12.405  1.00 2.00  ? 975  ASP A OD1   1 
ATOM   7420  O  OD2   . ASP A 1 974  ? -16.785 -49.698  14.569  1.00 2.20  ? 975  ASP A OD2   1 
ATOM   7421  N  N     . HIS A 1 975  ? -14.499 -52.532  15.506  1.00 2.00  ? 976  HIS A N     1 
ATOM   7422  C  CA    . HIS A 1 975  ? -13.307 -52.097  16.211  1.00 2.10  ? 976  HIS A CA    1 
ATOM   7423  C  C     . HIS A 1 975  ? -12.009 -52.834  15.749  1.00 2.11  ? 976  HIS A C     1 
ATOM   7424  O  O     . HIS A 1 975  ? -10.947 -52.225  15.581  1.00 2.00  ? 976  HIS A O     1 
ATOM   7425  C  CB    . HIS A 1 975  ? -13.514 -52.285  17.706  1.00 2.00  ? 976  HIS A CB    1 
ATOM   7426  C  CG    . HIS A 1 975  ? -12.564 -51.489  18.542  1.00 2.30  ? 976  HIS A CG    1 
ATOM   7427  N  ND1   . HIS A 1 975  ? -11.411 -52.027  19.078  1.00 2.58  ? 976  HIS A ND1   1 
ATOM   7428  C  CD2   . HIS A 1 975  ? -12.608 -50.203  18.955  1.00 2.00  ? 976  HIS A CD2   1 
ATOM   7429  C  CE1   . HIS A 1 975  ? -10.798 -51.104  19.794  1.00 2.09  ? 976  HIS A CE1   1 
ATOM   7430  N  NE2   . HIS A 1 975  ? -11.502 -49.992  19.735  1.00 2.00  ? 976  HIS A NE2   1 
ATOM   7431  N  N     . VAL A 1 976  ? -12.129 -54.120  15.485  1.00 2.00  ? 977  VAL A N     1 
ATOM   7432  C  CA    . VAL A 1 976  ? -11.013 -54.910  15.021  1.00 2.00  ? 977  VAL A CA    1 
ATOM   7433  C  C     . VAL A 1 976  ? -10.552 -54.507  13.597  1.00 2.07  ? 977  VAL A C     1 
ATOM   7434  O  O     . VAL A 1 976  ? -9.355  -54.485  13.314  1.00 2.00  ? 977  VAL A O     1 
ATOM   7435  C  CB    . VAL A 1 976  ? -11.372 -56.438  15.128  1.00 2.22  ? 977  VAL A CB    1 
ATOM   7436  C  CG1   . VAL A 1 976  ? -10.398 -57.314  14.354  1.00 2.00  ? 977  VAL A CG1   1 
ATOM   7437  C  CG2   . VAL A 1 976  ? -11.435 -56.847  16.595  1.00 2.00  ? 977  VAL A CG2   1 
ATOM   7438  N  N     . LEU A 1 977  ? -11.492 -54.151  12.722  1.00 2.34  ? 978  LEU A N     1 
ATOM   7439  C  CA    . LEU A 1 977  ? -11.176 -53.755  11.355  1.00 2.00  ? 978  LEU A CA    1 
ATOM   7440  C  C     . LEU A 1 977  ? -10.601 -52.364  11.429  1.00 2.00  ? 978  LEU A C     1 
ATOM   7441  O  O     . LEU A 1 977  ? -9.637  -52.035  10.748  1.00 2.01  ? 978  LEU A O     1 
ATOM   7442  C  CB    . LEU A 1 977  ? -12.418 -53.822  10.452  1.00 2.00  ? 978  LEU A CB    1 
ATOM   7443  C  CG    . LEU A 1 977  ? -13.067 -55.238  10.266  1.00 2.28  ? 978  LEU A CG    1 
ATOM   7444  C  CD1   . LEU A 1 977  ? -14.257 -55.172  9.324   1.00 2.00  ? 978  LEU A CD1   1 
ATOM   7445  C  CD2   . LEU A 1 977  ? -12.073 -56.298  9.769   1.00 2.00  ? 978  LEU A CD2   1 
ATOM   7446  N  N     . ALA A 1 978  ? -11.104 -51.590  12.364  1.00 2.00  ? 979  ALA A N     1 
ATOM   7447  C  CA    . ALA A 1 978  ? -10.626 -50.248  12.533  1.00 2.02  ? 979  ALA A CA    1 
ATOM   7448  C  C     . ALA A 1 978  ? -9.196  -50.245  13.098  1.00 2.22  ? 979  ALA A C     1 
ATOM   7449  O  O     . ALA A 1 978  ? -8.509  -49.252  12.978  1.00 2.00  ? 979  ALA A O     1 
ATOM   7450  C  CB    . ALA A 1 978  ? -11.550 -49.471  13.427  1.00 2.00  ? 979  ALA A CB    1 
ATOM   7451  N  N     . SER A 1 979  ? -8.731  -51.368  13.635  1.00 2.08  ? 980  SER A N     1 
ATOM   7452  C  CA    . SER A 1 979  ? -7.391  -51.445  14.225  1.00 2.68  ? 980  SER A CA    1 
ATOM   7453  C  C     . SER A 1 979  ? -6.209  -51.394  13.245  1.00 3.20  ? 980  SER A C     1 
ATOM   7454  O  O     . SER A 1 979  ? -5.081  -51.067  13.635  1.00 3.67  ? 980  SER A O     1 
ATOM   7455  C  CB    . SER A 1 979  ? -7.248  -52.729  15.030  1.00 2.91  ? 980  SER A CB    1 
ATOM   7456  O  OG    . SER A 1 979  ? -7.117  -53.829  14.139  1.00 3.45  ? 980  SER A OG    1 
ATOM   7457  N  N     . GLY A 1 980  ? -6.456  -51.748  11.989  1.00 3.29  ? 981  GLY A N     1 
ATOM   7458  C  CA    . GLY A 1 980  ? -5.408  -51.757  10.992  1.00 2.70  ? 981  GLY A CA    1 
ATOM   7459  C  C     . GLY A 1 980  ? -4.585  -53.042  11.060  1.00 3.32  ? 981  GLY A C     1 
ATOM   7460  O  O     . GLY A 1 980  ? -3.676  -53.241  10.249  1.00 3.98  ? 981  GLY A O     1 
ATOM   7461  N  N     . GLU A 1 981  ? -4.909  -53.947  11.981  1.00 3.40  ? 982  GLU A N     1 
ATOM   7462  C  CA    . GLU A 1 981  ? -4.144  -55.180  12.093  1.00 3.65  ? 982  GLU A CA    1 
ATOM   7463  C  C     . GLU A 1 981  ? -4.395  -56.280  11.067  1.00 3.22  ? 982  GLU A C     1 
ATOM   7464  O  O     . GLU A 1 981  ? -5.447  -56.341  10.474  1.00 3.62  ? 982  GLU A O     1 
ATOM   7465  C  CB    . GLU A 1 981  ? -4.176  -55.671  13.535  1.00 4.33  ? 982  GLU A CB    1 
ATOM   7466  C  CG    . GLU A 1 981  ? -3.191  -54.840  14.354  1.00 6.25  ? 982  GLU A CG    1 
ATOM   7467  C  CD    . GLU A 1 981  ? -3.135  -55.192  15.813  1.00 8.54  ? 982  GLU A CD    1 
ATOM   7468  O  OE1   . GLU A 1 981  ? -3.221  -56.393  16.204  1.00 9.84  ? 982  GLU A OE1   1 
ATOM   7469  O  OE2   . GLU A 1 981  ? -2.997  -54.230  16.589  1.00 9.31  ? 982  GLU A OE2   1 
ATOM   7470  N  N     . ASP A 1 982  ? -3.410  -57.128  10.809  1.00 2.96  ? 983  ASP A N     1 
ATOM   7471  C  CA    . ASP A 1 982  ? -3.600  -58.166  9.812   1.00 2.85  ? 983  ASP A CA    1 
ATOM   7472  C  C     . ASP A 1 982  ? -4.436  -59.383  10.251  1.00 2.34  ? 983  ASP A C     1 
ATOM   7473  O  O     . ASP A 1 982  ? -3.893  -60.385  10.693  1.00 2.77  ? 983  ASP A O     1 
ATOM   7474  C  CB    . ASP A 1 982  ? -2.222  -58.581  9.229   1.00 3.01  ? 983  ASP A CB    1 
ATOM   7475  C  CG    . ASP A 1 982  ? -2.324  -59.579  8.066   1.00 3.23  ? 983  ASP A CG    1 
ATOM   7476  O  OD1   . ASP A 1 982  ? -3.446  -59.965  7.689   1.00 4.02  ? 983  ASP A OD1   1 
ATOM   7477  O  OD2   . ASP A 1 982  ? -1.271  -59.959  7.496   1.00 3.16  ? 983  ASP A OD2   1 
ATOM   7478  N  N     . VAL A 1 983  ? -5.754  -59.261  10.126  1.00 2.36  ? 984  VAL A N     1 
ATOM   7479  C  CA    . VAL A 1 983  ? -6.712  -60.348  10.405  1.00 2.40  ? 984  VAL A CA    1 
ATOM   7480  C  C     . VAL A 1 983  ? -7.684  -60.428  9.217   1.00 2.04  ? 984  VAL A C     1 
ATOM   7481  O  O     . VAL A 1 983  ? -7.865  -59.473  8.486   1.00 2.39  ? 984  VAL A O     1 
ATOM   7482  C  CB    . VAL A 1 983  ? -7.534  -60.115  11.678  1.00 2.79  ? 984  VAL A CB    1 
ATOM   7483  C  CG1   . VAL A 1 983  ? -6.612  -59.982  12.900  1.00 2.00  ? 984  VAL A CG1   1 
ATOM   7484  C  CG2   . VAL A 1 983  ? -8.457  -58.859  11.498  1.00 3.76  ? 984  VAL A CG2   1 
ATOM   7485  N  N     . ASN A 1 984  ? -8.262  -61.595  8.986   1.00 2.92  ? 985  ASN A N     1 
ATOM   7486  C  CA    . ASN A 1 984  ? -9.187  -61.785  7.876   1.00 2.44  ? 985  ASN A CA    1 
ATOM   7487  C  C     . ASN A 1 984  ? -10.531 -62.260  8.354   1.00 2.49  ? 985  ASN A C     1 
ATOM   7488  O  O     . ASN A 1 984  ? -10.596 -63.298  8.989   1.00 2.23  ? 985  ASN A O     1 
ATOM   7489  C  CB    . ASN A 1 984  ? -8.626  -62.843  6.964   1.00 2.13  ? 985  ASN A CB    1 
ATOM   7490  C  CG    . ASN A 1 984  ? -7.196  -62.601  6.678   1.00 2.56  ? 985  ASN A CG    1 
ATOM   7491  O  OD1   . ASN A 1 984  ? -6.840  -61.613  6.015   1.00 3.27  ? 985  ASN A OD1   1 
ATOM   7492  N  ND2   . ASN A 1 984  ? -6.337  -63.431  7.253   1.00 3.16  ? 985  ASN A ND2   1 
ATOM   7493  N  N     . VAL A 1 985  ? -11.602 -61.524  8.067   1.00 2.59  ? 986  VAL A N     1 
ATOM   7494  C  CA    . VAL A 1 985  ? -12.893 -62.035  8.510   1.00 2.97  ? 986  VAL A CA    1 
ATOM   7495  C  C     . VAL A 1 985  ? -13.726 -62.547  7.372   1.00 3.09  ? 986  VAL A C     1 
ATOM   7496  O  O     . VAL A 1 985  ? -13.820 -61.903  6.352   1.00 4.28  ? 986  VAL A O     1 
ATOM   7497  C  CB    . VAL A 1 985  ? -13.711 -61.038  9.421   1.00 3.39  ? 986  VAL A CB    1 
ATOM   7498  C  CG1   . VAL A 1 985  ? -13.034 -59.684  9.540   1.00 2.21  ? 986  VAL A CG1   1 
ATOM   7499  C  CG2   . VAL A 1 985  ? -15.160 -60.948  8.989   1.00 2.55  ? 986  VAL A CG2   1 
ATOM   7500  N  N     . PHE A 1 986  ? -14.228 -63.763  7.527   1.00 2.78  ? 987  PHE A N     1 
ATOM   7501  C  CA    . PHE A 1 986  ? -15.070 -64.393  6.544   1.00 2.61  ? 987  PHE A CA    1 
ATOM   7502  C  C     . PHE A 1 986  ? -16.507 -64.580  7.086   1.00 2.41  ? 987  PHE A C     1 
ATOM   7503  O  O     . PHE A 1 986  ? -16.771 -65.407  7.956   1.00 2.00  ? 987  PHE A O     1 
ATOM   7504  C  CB    . PHE A 1 986  ? -14.477 -65.738  6.118   1.00 2.58  ? 987  PHE A CB    1 
ATOM   7505  C  CG    . PHE A 1 986  ? -15.207 -66.363  5.002   1.00 2.00  ? 987  PHE A CG    1 
ATOM   7506  C  CD1   . PHE A 1 986  ? -15.158 -65.798  3.748   1.00 2.23  ? 987  PHE A CD1   1 
ATOM   7507  C  CD2   . PHE A 1 986  ? -15.956 -67.488  5.195   1.00 2.06  ? 987  PHE A CD2   1 
ATOM   7508  C  CE1   . PHE A 1 986  ? -15.848 -66.345  2.693   1.00 2.43  ? 987  PHE A CE1   1 
ATOM   7509  C  CE2   . PHE A 1 986  ? -16.657 -68.056  4.140   1.00 2.36  ? 987  PHE A CE2   1 
ATOM   7510  C  CZ    . PHE A 1 986  ? -16.604 -67.488  2.898   1.00 2.60  ? 987  PHE A CZ    1 
ATOM   7511  N  N     . VAL A 1 987  ? -17.418 -63.804  6.511   1.00 2.32  ? 988  VAL A N     1 
ATOM   7512  C  CA    . VAL A 1 987  ? -18.810 -63.813  6.892   1.00 2.28  ? 988  VAL A CA    1 
ATOM   7513  C  C     . VAL A 1 987  ? -19.644 -64.591  5.887   1.00 2.32  ? 988  VAL A C     1 
ATOM   7514  O  O     . VAL A 1 987  ? -19.740 -64.180  4.738   1.00 2.13  ? 988  VAL A O     1 
ATOM   7515  C  CB    . VAL A 1 987  ? -19.390 -62.360  6.947   1.00 2.65  ? 988  VAL A CB    1 
ATOM   7516  C  CG1   . VAL A 1 987  ? -20.797 -62.364  7.506   1.00 2.46  ? 988  VAL A CG1   1 
ATOM   7517  C  CG2   . VAL A 1 987  ? -18.487 -61.410  7.754   1.00 2.19  ? 988  VAL A CG2   1 
ATOM   7518  N  N     . MET A 1 988  ? -20.198 -65.724  6.310   1.00 2.00  ? 989  MET A N     1 
ATOM   7519  C  CA    . MET A 1 988  ? -21.077 -66.505  5.472   1.00 2.12  ? 989  MET A CA    1 
ATOM   7520  C  C     . MET A 1 988  ? -22.473 -65.872  5.688   1.00 2.46  ? 989  MET A C     1 
ATOM   7521  O  O     . MET A 1 988  ? -23.083 -65.997  6.750   1.00 3.33  ? 989  MET A O     1 
ATOM   7522  C  CB    . MET A 1 988  ? -21.063 -67.970  5.926   1.00 2.91  ? 989  MET A CB    1 
ATOM   7523  C  CG    . MET A 1 988  ? -19.777 -68.748  5.537   1.00 3.04  ? 989  MET A CG    1 
ATOM   7524  S  SD    . MET A 1 988  ? -18.966 -69.363  7.028   1.00 5.14  ? 989  MET A SD    1 
ATOM   7525  C  CE    . MET A 1 988  ? -19.493 -70.831  7.103   1.00 4.20  ? 989  MET A CE    1 
ATOM   7526  N  N     . ASP A 1 989  ? -22.996 -65.205  4.677   1.00 2.30  ? 990  ASP A N     1 
ATOM   7527  C  CA    . ASP A 1 989  ? -24.273 -64.509  4.805   1.00 2.37  ? 990  ASP A CA    1 
ATOM   7528  C  C     . ASP A 1 989  ? -25.492 -65.300  4.304   1.00 2.00  ? 990  ASP A C     1 
ATOM   7529  O  O     . ASP A 1 989  ? -25.732 -65.422  3.128   1.00 2.00  ? 990  ASP A O     1 
ATOM   7530  C  CB    . ASP A 1 989  ? -24.145 -63.109  4.134   1.00 2.40  ? 990  ASP A CB    1 
ATOM   7531  C  CG    . ASP A 1 989  ? -25.316 -62.162  4.454   1.00 2.62  ? 990  ASP A CG    1 
ATOM   7532  O  OD1   . ASP A 1 989  ? -26.357 -62.650  4.937   1.00 2.34  ? 990  ASP A OD1   1 
ATOM   7533  O  OD2   . ASP A 1 989  ? -25.173 -60.914  4.267   1.00 2.00  ? 990  ASP A OD2   1 
ATOM   7534  N  N     . THR A 1 990  ? -26.242 -65.853  5.250   1.00 2.21  ? 991  THR A N     1 
ATOM   7535  C  CA    . THR A 1 990  ? -27.458 -66.615  4.985   1.00 2.00  ? 991  THR A CA    1 
ATOM   7536  C  C     . THR A 1 990  ? -28.678 -65.674  5.077   1.00 2.25  ? 991  THR A C     1 
ATOM   7537  O  O     . THR A 1 990  ? -29.831 -66.069  4.882   1.00 2.35  ? 991  THR A O     1 
ATOM   7538  C  CB    . THR A 1 990  ? -27.621 -67.738  6.003   1.00 2.00  ? 991  THR A CB    1 
ATOM   7539  O  OG1   . THR A 1 990  ? -27.539 -67.220  7.337   1.00 2.04  ? 991  THR A OG1   1 
ATOM   7540  C  CG2   . THR A 1 990  ? -26.579 -68.823  5.784   1.00 2.40  ? 991  THR A CG2   1 
ATOM   7541  N  N     . GLU A 1 991  ? -28.407 -64.441  5.477   1.00 2.20  ? 992  GLU A N     1 
ATOM   7542  C  CA    . GLU A 1 991  ? -29.402 -63.423  5.602   1.00 2.06  ? 992  GLU A CA    1 
ATOM   7543  C  C     . GLU A 1 991  ? -30.442 -63.804  6.618   1.00 2.22  ? 992  GLU A C     1 
ATOM   7544  O  O     . GLU A 1 991  ? -31.637 -63.461  6.479   1.00 2.08  ? 992  GLU A O     1 
ATOM   7545  C  CB    . GLU A 1 991  ? -30.000 -63.123  4.237   1.00 2.00  ? 992  GLU A CB    1 
ATOM   7546  C  CG    . GLU A 1 991  ? -28.964 -62.625  3.314   1.00 2.00  ? 992  GLU A CG    1 
ATOM   7547  C  CD    . GLU A 1 991  ? -29.529 -62.140  2.052   1.00 2.00  ? 992  GLU A CD    1 
ATOM   7548  O  OE1   . GLU A 1 991  ? -30.475 -62.777  1.581   1.00 2.00  ? 992  GLU A OE1   1 
ATOM   7549  O  OE2   . GLU A 1 991  ? -29.057 -61.107  1.549   1.00 2.00  ? 992  GLU A OE2   1 
ATOM   7550  N  N     . VAL A 1 992  ? -29.976 -64.455  7.682   1.00 2.00  ? 993  VAL A N     1 
ATOM   7551  C  CA    . VAL A 1 992  ? -30.880 -64.878  8.739   1.00 2.00  ? 993  VAL A CA    1 
ATOM   7552  C  C     . VAL A 1 992  ? -30.054 -65.550  9.810   1.00 2.07  ? 993  VAL A C     1 
ATOM   7553  O  O     . VAL A 1 992  ? -28.889 -65.850  9.571   1.00 2.48  ? 993  VAL A O     1 
ATOM   7554  C  CB    . VAL A 1 992  ? -31.997 -65.878  8.127   1.00 2.06  ? 993  VAL A CB    1 
ATOM   7555  C  CG1   . VAL A 1 992  ? -31.586 -67.334  8.207   1.00 2.00  ? 993  VAL A CG1   1 
ATOM   7556  C  CG2   . VAL A 1 992  ? -33.343 -65.621  8.714   1.00 2.00  ? 993  VAL A CG2   1 
ATOM   7557  N  N     . TYR A 1 993  ? -30.627 -65.723  11.002  1.00 2.16  ? 994  TYR A N     1 
ATOM   7558  C  CA    . TYR A 1 993  ? -29.945 -66.427  12.076  1.00 2.00  ? 994  TYR A CA    1 
ATOM   7559  C  C     . TYR A 1 993  ? -30.309 -67.877  11.719  1.00 2.38  ? 994  TYR A C     1 
ATOM   7560  O  O     . TYR A 1 993  ? -31.424 -68.319  12.009  1.00 2.33  ? 994  TYR A O     1 
ATOM   7561  C  CB    . TYR A 1 993  ? -30.541 -66.125  13.447  1.00 2.00  ? 994  TYR A CB    1 
ATOM   7562  C  CG    . TYR A 1 993  ? -30.232 -64.791  14.056  1.00 2.00  ? 994  TYR A CG    1 
ATOM   7563  C  CD1   . TYR A 1 993  ? -29.460 -63.874  13.410  1.00 2.55  ? 994  TYR A CD1   1 
ATOM   7564  C  CD2   . TYR A 1 993  ? -30.774 -64.443  15.258  1.00 2.36  ? 994  TYR A CD2   1 
ATOM   7565  C  CE1   . TYR A 1 993  ? -29.226 -62.617  13.939  1.00 3.55  ? 994  TYR A CE1   1 
ATOM   7566  C  CE2   . TYR A 1 993  ? -30.569 -63.193  15.824  1.00 2.96  ? 994  TYR A CE2   1 
ATOM   7567  C  CZ    . TYR A 1 993  ? -29.786 -62.269  15.153  1.00 3.80  ? 994  TYR A CZ    1 
ATOM   7568  O  OH    . TYR A 1 993  ? -29.595 -60.991  15.677  1.00 2.53  ? 994  TYR A OH    1 
ATOM   7569  N  N     . SER A 1 994  ? -29.397 -68.615  11.103  1.00 2.00  ? 995  SER A N     1 
ATOM   7570  C  CA    . SER A 1 994  ? -29.722 -69.972  10.723  1.00 2.55  ? 995  SER A CA    1 
ATOM   7571  C  C     . SER A 1 994  ? -29.815 -71.032  11.790  1.00 2.88  ? 995  SER A C     1 
ATOM   7572  O  O     . SER A 1 994  ? -30.865 -71.628  11.957  1.00 3.65  ? 995  SER A O     1 
ATOM   7573  C  CB    . SER A 1 994  ? -28.802 -70.459  9.616   1.00 2.36  ? 995  SER A CB    1 
ATOM   7574  O  OG    . SER A 1 994  ? -29.059 -69.723  8.446   1.00 2.00  ? 995  SER A OG    1 
ATOM   7575  N  N     . ASN A 1 995  ? -28.739 -71.267  12.530  1.00 3.06  ? 996  ASN A N     1 
ATOM   7576  C  CA    . ASN A 1 995  ? -28.752 -72.322  13.528  1.00 3.36  ? 996  ASN A CA    1 
ATOM   7577  C  C     . ASN A 1 995  ? -29.839 -72.312  14.587  1.00 3.17  ? 996  ASN A C     1 
ATOM   7578  O  O     . ASN A 1 995  ? -30.291 -73.386  15.020  1.00 3.81  ? 996  ASN A O     1 
ATOM   7579  C  CB    . ASN A 1 995  ? -27.370 -72.505  14.186  1.00 4.15  ? 996  ASN A CB    1 
ATOM   7580  C  CG    . ASN A 1 995  ? -27.207 -71.709  15.472  1.00 4.94  ? 996  ASN A CG    1 
ATOM   7581  O  OD1   . ASN A 1 995  ? -27.304 -70.485  15.480  1.00 5.23  ? 996  ASN A OD1   1 
ATOM   7582  N  ND2   . ASN A 1 995  ? -26.979 -72.412  16.571  1.00 5.46  ? 996  ASN A ND2   1 
ATOM   7583  N  N     . THR A 1 996  ? -30.237 -71.133  15.040  1.00 2.73  ? 997  THR A N     1 
ATOM   7584  C  CA    . THR A 1 996  ? -31.252 -71.042  16.076  1.00 2.22  ? 997  THR A CA    1 
ATOM   7585  C  C     . THR A 1 996  ? -32.667 -71.107  15.564  1.00 2.00  ? 997  THR A C     1 
ATOM   7586  O  O     . THR A 1 996  ? -33.574 -71.073  16.358  1.00 2.02  ? 997  THR A O     1 
ATOM   7587  C  CB    . THR A 1 996  ? -31.069 -69.801  16.960  1.00 2.00  ? 997  THR A CB    1 
ATOM   7588  O  OG1   . THR A 1 996  ? -30.845 -68.664  16.136  1.00 2.00  ? 997  THR A OG1   1 
ATOM   7589  C  CG2   . THR A 1 996  ? -29.891 -69.950  17.882  1.00 2.03  ? 997  THR A CG2   1 
ATOM   7590  N  N     . GLY A 1 997  ? -32.863 -71.240  14.254  1.00 2.00  ? 998  GLY A N     1 
ATOM   7591  C  CA    . GLY A 1 997  ? -34.209 -71.328  13.721  1.00 2.00  ? 998  GLY A CA    1 
ATOM   7592  C  C     . GLY A 1 997  ? -34.813 -70.253  12.811  1.00 2.00  ? 998  GLY A C     1 
ATOM   7593  O  O     . GLY A 1 997  ? -36.032 -70.078  12.790  1.00 2.00  ? 998  GLY A O     1 
ATOM   7594  N  N     . GLY A 1 998  ? -34.001 -69.575  12.016  1.00 2.00  ? 999  GLY A N     1 
ATOM   7595  C  CA    . GLY A 1 998  ? -34.521 -68.570  11.109  1.00 2.00  ? 999  GLY A CA    1 
ATOM   7596  C  C     . GLY A 1 998  ? -35.031 -67.245  11.669  1.00 2.11  ? 999  GLY A C     1 
ATOM   7597  O  O     . GLY A 1 998  ? -36.082 -66.765  11.234  1.00 2.06  ? 999  GLY A O     1 
ATOM   7598  N  N     . GLN A 1 999  ? -34.323 -66.656  12.626  1.00 2.00  ? 1000 GLN A N     1 
ATOM   7599  C  CA    . GLN A 1 999  ? -34.754 -65.380  13.198  1.00 2.11  ? 1000 GLN A CA    1 
ATOM   7600  C  C     . GLN A 1 999  ? -34.170 -64.260  12.360  1.00 2.22  ? 1000 GLN A C     1 
ATOM   7601  O  O     . GLN A 1 999  ? -33.070 -64.393  11.818  1.00 3.03  ? 1000 GLN A O     1 
ATOM   7602  C  CB    . GLN A 1 999  ? -34.284 -65.191  14.637  1.00 2.00  ? 1000 GLN A CB    1 
ATOM   7603  C  CG    . GLN A 1 999  ? -34.951 -66.081  15.662  1.00 2.41  ? 1000 GLN A CG    1 
ATOM   7604  C  CD    . GLN A 1 999  ? -34.227 -67.393  15.867  1.00 2.00  ? 1000 GLN A CD    1 
ATOM   7605  O  OE1   . GLN A 1 999  ? -34.818 -68.353  16.294  1.00 2.00  ? 1000 GLN A OE1   1 
ATOM   7606  N  NE2   . GLN A 1 999  ? -32.935 -67.413  15.617  1.00 2.00  ? 1000 GLN A NE2   1 
ATOM   7607  N  N     . SER A 1 1000 ? -34.911 -63.169  12.247  1.00 2.00  ? 1001 SER A N     1 
ATOM   7608  C  CA    . SER A 1 1000 ? -34.491 -62.033  11.471  1.00 2.00  ? 1001 SER A CA    1 
ATOM   7609  C  C     . SER A 1 1000 ? -33.129 -61.469  11.899  1.00 2.05  ? 1001 SER A C     1 
ATOM   7610  O  O     . SER A 1 1000 ? -32.783 -61.406  13.079  1.00 2.14  ? 1001 SER A O     1 
ATOM   7611  C  CB    . SER A 1 1000 ? -35.554 -60.948  11.557  1.00 2.00  ? 1001 SER A CB    1 
ATOM   7612  O  OG    . SER A 1 1000 ? -35.403 -59.999  10.517  1.00 2.40  ? 1001 SER A OG    1 
ATOM   7613  N  N     . SER A 1 1001 ? -32.369 -61.037  10.913  1.00 2.00  ? 1002 SER A N     1 
ATOM   7614  C  CA    . SER A 1 1001 ? -31.070 -60.457  11.129  1.00 2.00  ? 1002 SER A CA    1 
ATOM   7615  C  C     . SER A 1 1001 ? -31.109 -59.060  10.483  1.00 2.09  ? 1002 SER A C     1 
ATOM   7616  O  O     . SER A 1 1001 ? -32.082 -58.709  9.810   1.00 2.00  ? 1002 SER A O     1 
ATOM   7617  C  CB    . SER A 1 1001 ? -30.076 -61.340  10.422  1.00 2.00  ? 1002 SER A CB    1 
ATOM   7618  O  OG    . SER A 1 1001 ? -28.845 -60.728  10.319  1.00 2.58  ? 1002 SER A OG    1 
ATOM   7619  N  N     . LYS A 1 1002 ? -30.124 -58.217  10.769  1.00 2.03  ? 1003 LYS A N     1 
ATOM   7620  C  CA    . LYS A 1 1002 ? -30.094 -56.919  10.137  1.00 2.03  ? 1003 LYS A CA    1 
ATOM   7621  C  C     . LYS A 1 1002 ? -29.589 -57.112  8.664   1.00 2.22  ? 1003 LYS A C     1 
ATOM   7622  O  O     . LYS A 1 1002 ? -29.731 -56.226  7.805   1.00 2.00  ? 1003 LYS A O     1 
ATOM   7623  C  CB    . LYS A 1 1002 ? -29.223 -55.980  10.959  1.00 2.09  ? 1003 LYS A CB    1 
ATOM   7624  C  CG    . LYS A 1 1002 ? -29.759 -54.571  11.051  1.00 2.67  ? 1003 LYS A CG    1 
ATOM   7625  C  CD    . LYS A 1 1002 ? -29.682 -53.963  12.461  1.00 2.19  ? 1003 LYS A CD    1 
ATOM   7626  C  CE    . LYS A 1 1002 ? -28.254 -53.709  12.931  1.00 2.00  ? 1003 LYS A CE    1 
ATOM   7627  N  NZ    . LYS A 1 1002 ? -27.834 -54.690  13.988  1.00 2.00  ? 1003 LYS A NZ    1 
ATOM   7628  N  N     . ALA A 1 1003 ? -29.077 -58.318  8.372   1.00 2.36  ? 1004 ALA A N     1 
ATOM   7629  C  CA    . ALA A 1 1003 ? -28.609 -58.681  7.044   1.00 2.00  ? 1004 ALA A CA    1 
ATOM   7630  C  C     . ALA A 1 1003 ? -29.786 -59.200  6.246   1.00 2.00  ? 1004 ALA A C     1 
ATOM   7631  O  O     . ALA A 1 1003 ? -29.667 -59.411  5.058   1.00 2.00  ? 1004 ALA A O     1 
ATOM   7632  C  CB    . ALA A 1 1003 ? -27.539 -59.732  7.136   1.00 2.00  ? 1004 ALA A CB    1 
ATOM   7633  N  N     . THR A 1 1004 ? -30.936 -59.398  6.892   1.00 2.15  ? 1005 THR A N     1 
ATOM   7634  C  CA    . THR A 1 1004 ? -32.110 -59.923  6.199   1.00 2.02  ? 1005 THR A CA    1 
ATOM   7635  C  C     . THR A 1 1004 ? -32.659 -58.864  5.278   1.00 2.09  ? 1005 THR A C     1 
ATOM   7636  O  O     . THR A 1 1004 ? -32.801 -57.715  5.664   1.00 2.00  ? 1005 THR A O     1 
ATOM   7637  C  CB    . THR A 1 1004 ? -33.165 -60.360  7.184   1.00 2.47  ? 1005 THR A CB    1 
ATOM   7638  O  OG1   . THR A 1 1004 ? -32.627 -61.410  8.005   1.00 3.34  ? 1005 THR A OG1   1 
ATOM   7639  C  CG2   . THR A 1 1004 ? -34.397 -60.889  6.450   1.00 2.76  ? 1005 THR A CG2   1 
ATOM   7640  N  N     . PRO A 1 1005 ? -32.995 -59.244  4.042   1.00 2.19  ? 1006 PRO A N     1 
ATOM   7641  C  CA    . PRO A 1 1005 ? -33.509 -58.242  3.118   1.00 2.02  ? 1006 PRO A CA    1 
ATOM   7642  C  C     . PRO A 1 1005 ? -34.968 -57.910  3.274   1.00 2.00  ? 1006 PRO A C     1 
ATOM   7643  O  O     . PRO A 1 1005 ? -35.688 -58.611  3.969   1.00 2.02  ? 1006 PRO A O     1 
ATOM   7644  C  CB    . PRO A 1 1005 ? -33.228 -58.880  1.767   1.00 2.11  ? 1006 PRO A CB    1 
ATOM   7645  C  CG    . PRO A 1 1005 ? -33.572 -60.333  2.030   1.00 2.00  ? 1006 PRO A CG    1 
ATOM   7646  C  CD    . PRO A 1 1005 ? -32.931 -60.573  3.400   1.00 2.05  ? 1006 PRO A CD    1 
ATOM   7647  N  N     . THR A 1 1006 ? -35.329 -56.754  2.717   1.00 2.00  ? 1007 THR A N     1 
ATOM   7648  C  CA    . THR A 1 1006 ? -36.683 -56.225  2.659   1.00 2.25  ? 1007 THR A CA    1 
ATOM   7649  C  C     . THR A 1 1006 ? -37.576 -57.292  2.057   1.00 2.17  ? 1007 THR A C     1 
ATOM   7650  O  O     . THR A 1 1006 ? -37.228 -57.857  1.035   1.00 2.00  ? 1007 THR A O     1 
ATOM   7651  C  CB    . THR A 1 1006 ? -36.770 -55.080  1.650   1.00 2.30  ? 1007 THR A CB    1 
ATOM   7652  O  OG1   . THR A 1 1006 ? -36.136 -53.913  2.174   1.00 3.15  ? 1007 THR A OG1   1 
ATOM   7653  C  CG2   . THR A 1 1006 ? -38.191 -54.785  1.310   1.00 2.00  ? 1007 THR A CG2   1 
ATOM   7654  N  N     . GLY A 1 1007 ? -38.702 -57.562  2.707   1.00 2.00  ? 1008 GLY A N     1 
ATOM   7655  C  CA    . GLY A 1 1007 ? -39.636 -58.520  2.191   1.00 2.00  ? 1008 GLY A CA    1 
ATOM   7656  C  C     . GLY A 1 1007 ? -39.420 -59.974  2.524   1.00 2.00  ? 1008 GLY A C     1 
ATOM   7657  O  O     . GLY A 1 1007 ? -40.256 -60.796  2.182   1.00 2.00  ? 1008 GLY A O     1 
ATOM   7658  N  N     . ALA A 1 1008 ? -38.304 -60.314  3.145   1.00 2.00  ? 1009 ALA A N     1 
ATOM   7659  C  CA    . ALA A 1 1008 ? -38.047 -61.713  3.461   1.00 2.01  ? 1009 ALA A CA    1 
ATOM   7660  C  C     . ALA A 1 1008 ? -38.809 -62.051  4.708   1.00 2.00  ? 1009 ALA A C     1 
ATOM   7661  O  O     . ALA A 1 1008 ? -38.915 -61.217  5.573   1.00 2.12  ? 1009 ALA A O     1 
ATOM   7662  C  CB    . ALA A 1 1008 ? -36.587 -61.952  3.648   1.00 2.00  ? 1009 ALA A CB    1 
ATOM   7663  N  N     . VAL A 1 1009 ? -39.411 -63.237  4.738   1.00 2.11  ? 1010 VAL A N     1 
ATOM   7664  C  CA    . VAL A 1 1009 ? -40.192 -63.747  5.869   1.00 2.00  ? 1010 VAL A CA    1 
ATOM   7665  C  C     . VAL A 1 1009 ? -39.300 -64.576  6.771   1.00 2.51  ? 1010 VAL A C     1 
ATOM   7666  O  O     . VAL A 1 1009 ? -38.604 -65.520  6.320   1.00 2.73  ? 1010 VAL A O     1 
ATOM   7667  C  CB    . VAL A 1 1009 ? -41.365 -64.670  5.387   1.00 2.33  ? 1010 VAL A CB    1 
ATOM   7668  C  CG1   . VAL A 1 1009 ? -42.044 -65.341  6.571   1.00 2.00  ? 1010 VAL A CG1   1 
ATOM   7669  C  CG2   . VAL A 1 1009 ? -42.336 -63.899  4.573   1.00 2.00  ? 1010 VAL A CG2   1 
ATOM   7670  N  N     . ALA A 1 1010 ? -39.374 -64.277  8.062   1.00 2.95  ? 1011 ALA A N     1 
ATOM   7671  C  CA    . ALA A 1 1010 ? -38.530 -64.961  9.042   1.00 2.57  ? 1011 ALA A CA    1 
ATOM   7672  C  C     . ALA A 1 1010 ? -39.114 -64.668  10.401  1.00 2.05  ? 1011 ALA A C     1 
ATOM   7673  O  O     . ALA A 1 1010 ? -40.056 -63.910  10.492  1.00 2.00  ? 1011 ALA A O     1 
ATOM   7674  C  CB    . ALA A 1 1010 ? -37.067 -64.400  8.961   1.00 2.41  ? 1011 ALA A CB    1 
ATOM   7675  N  N     . LYS A 1 1011 ? -38.563 -65.273  11.451  1.00 2.00  ? 1012 LYS A N     1 
ATOM   7676  C  CA    . LYS A 1 1011 ? -39.054 -64.993  12.779  1.00 2.05  ? 1012 LYS A CA    1 
ATOM   7677  C  C     . LYS A 1 1011 ? -38.736 -63.518  13.063  1.00 2.42  ? 1012 LYS A C     1 
ATOM   7678  O  O     . LYS A 1 1011 ? -37.676 -63.003  12.692  1.00 2.27  ? 1012 LYS A O     1 
ATOM   7679  C  CB    . LYS A 1 1011 ? -38.401 -65.907  13.806  1.00 2.13  ? 1012 LYS A CB    1 
ATOM   7680  C  CG    . LYS A 1 1011 ? -38.422 -67.408  13.403  1.00 2.28  ? 1012 LYS A CG    1 
ATOM   7681  C  CD    . LYS A 1 1011 ? -39.733 -67.835  12.800  1.00 2.00  ? 1012 LYS A CD    1 
ATOM   7682  C  CE    . LYS A 1 1011 ? -40.720 -68.203  13.837  1.00 2.08  ? 1012 LYS A CE    1 
ATOM   7683  N  NZ    . LYS A 1 1011 ? -42.052 -68.518  13.243  1.00 2.69  ? 1012 LYS A NZ    1 
ATOM   7684  N  N     . PHE A 1 1012 ? -39.696 -62.821  13.658  1.00 2.43  ? 1013 PHE A N     1 
ATOM   7685  C  CA    . PHE A 1 1012 ? -39.568 -61.394  13.978  1.00 2.19  ? 1013 PHE A CA    1 
ATOM   7686  C  C     . PHE A 1 1012 ? -39.661 -60.487  12.742  1.00 2.00  ? 1013 PHE A C     1 
ATOM   7687  O  O     . PHE A 1 1012 ? -39.614 -59.268  12.845  1.00 2.00  ? 1013 PHE A O     1 
ATOM   7688  C  CB    . PHE A 1 1012 ? -38.370 -61.150  14.899  1.00 2.04  ? 1013 PHE A CB    1 
ATOM   7689  C  CG    . PHE A 1 1012 ? -38.411 -62.031  16.149  1.00 2.98  ? 1013 PHE A CG    1 
ATOM   7690  C  CD1   . PHE A 1 1012 ? -39.450 -61.888  17.096  1.00 2.19  ? 1013 PHE A CD1   1 
ATOM   7691  C  CD2   . PHE A 1 1012 ? -37.484 -63.080  16.326  1.00 2.15  ? 1013 PHE A CD2   1 
ATOM   7692  C  CE1   . PHE A 1 1012 ? -39.561 -62.779  18.182  1.00 2.17  ? 1013 PHE A CE1   1 
ATOM   7693  C  CE2   . PHE A 1 1012 ? -37.589 -63.954  17.392  1.00 2.00  ? 1013 PHE A CE2   1 
ATOM   7694  C  CZ    . PHE A 1 1012 ? -38.616 -63.823  18.321  1.00 2.05  ? 1013 PHE A CZ    1 
ATOM   7695  N  N     . ALA A 1 1013 ? -39.925 -61.108  11.589  1.00 2.00  ? 1014 ALA A N     1 
ATOM   7696  C  CA    . ALA A 1 1013 ? -40.128 -60.410  10.320  1.00 2.10  ? 1014 ALA A CA    1 
ATOM   7697  C  C     . ALA A 1 1013 ? -41.168 -61.286  9.603   1.00 2.43  ? 1014 ALA A C     1 
ATOM   7698  O  O     . ALA A 1 1013 ? -41.116 -61.504  8.396   1.00 2.36  ? 1014 ALA A O     1 
ATOM   7699  C  CB    . ALA A 1 1013 ? -38.809 -60.313  9.512   1.00 2.00  ? 1014 ALA A CB    1 
ATOM   7700  N  N     . ALA A 1 1014 ? -42.172 -61.717  10.357  1.00 2.77  ? 1015 ALA A N     1 
ATOM   7701  C  CA    . ALA A 1 1014 ? -43.192 -62.633  9.835   1.00 2.86  ? 1015 ALA A CA    1 
ATOM   7702  C  C     . ALA A 1 1014 ? -44.216 -62.175  8.763   1.00 3.30  ? 1015 ALA A C     1 
ATOM   7703  O  O     . ALA A 1 1014 ? -45.092 -62.970  8.384   1.00 3.31  ? 1015 ALA A O     1 
ATOM   7704  C  CB    . ALA A 1 1014 ? -43.881 -63.282  10.964  1.00 2.88  ? 1015 ALA A CB    1 
ATOM   7705  N  N     . ALA A 1 1015 ? -44.194 -60.893  8.376   1.00 2.60  ? 1016 ALA A N     1 
ATOM   7706  C  CA    . ALA A 1 1015 ? -45.068 -60.377  7.301   1.00 2.43  ? 1016 ALA A CA    1 
ATOM   7707  C  C     . ALA A 1 1015 ? -44.138 -59.702  6.310   1.00 2.30  ? 1016 ALA A C     1 
ATOM   7708  O  O     . ALA A 1 1015 ? -44.551 -58.812  5.556   1.00 2.00  ? 1016 ALA A O     1 
ATOM   7709  C  CB    . ALA A 1 1015 ? -46.095 -59.375  7.812   1.00 2.81  ? 1016 ALA A CB    1 
ATOM   7710  N  N     . GLY A 1 1016 ? -42.876 -60.157  6.343   1.00 2.34  ? 1017 GLY A N     1 
ATOM   7711  C  CA    . GLY A 1 1016 ? -41.830 -59.644  5.497   1.00 2.02  ? 1017 GLY A CA    1 
ATOM   7712  C  C     . GLY A 1 1016 ? -41.065 -58.576  6.247   1.00 2.04  ? 1017 GLY A C     1 
ATOM   7713  O  O     . GLY A 1 1016 ? -41.692 -57.707  6.835   1.00 2.00  ? 1017 GLY A O     1 
ATOM   7714  N  N     . LYS A 1 1017 ? -39.718 -58.668  6.222   1.00 2.38  ? 1018 LYS A N     1 
ATOM   7715  C  CA    . LYS A 1 1017 ? -38.787 -57.718  6.885   1.00 2.19  ? 1018 LYS A CA    1 
ATOM   7716  C  C     . LYS A 1 1017 ? -39.112 -56.343  6.353   1.00 2.32  ? 1018 LYS A C     1 
ATOM   7717  O  O     . LYS A 1 1017 ? -39.129 -56.165  5.139   1.00 2.47  ? 1018 LYS A O     1 
ATOM   7718  C  CB    . LYS A 1 1017 ? -37.342 -58.036  6.521   1.00 2.04  ? 1018 LYS A CB    1 
ATOM   7719  C  CG    . LYS A 1 1017 ? -36.375 -57.043  7.057   1.00 2.53  ? 1018 LYS A CG    1 
ATOM   7720  C  CD    . LYS A 1 1017 ? -35.590 -57.574  8.218   1.00 2.49  ? 1018 LYS A CD    1 
ATOM   7721  C  CE    . LYS A 1 1017 ? -34.541 -56.582  8.693   1.00 2.00  ? 1018 LYS A CE    1 
ATOM   7722  N  NZ    . LYS A 1 1017 ? -33.503 -56.271  7.684   1.00 2.00  ? 1018 LYS A NZ    1 
ATOM   7723  N  N     . ARG A 1 1018 ? -39.343 -55.369  7.222   1.00 2.16  ? 1019 ARG A N     1 
ATOM   7724  C  CA    . ARG A 1 1018 ? -39.754 -54.058  6.709   1.00 3.02  ? 1019 ARG A CA    1 
ATOM   7725  C  C     . ARG A 1 1018 ? -38.667 -52.995  6.708   1.00 3.22  ? 1019 ARG A C     1 
ATOM   7726  O  O     . ARG A 1 1018 ? -38.934 -51.809  6.572   1.00 4.16  ? 1019 ARG A O     1 
ATOM   7727  C  CB    . ARG A 1 1018 ? -41.065 -53.556  7.375   1.00 2.00  ? 1019 ARG A CB    1 
ATOM   7728  C  CG    . ARG A 1 1018 ? -42.240 -54.563  7.354   1.00 2.00  ? 1019 ARG A CG    1 
ATOM   7729  C  CD    . ARG A 1 1018 ? -42.652 -54.941  5.925   1.00 2.22  ? 1019 ARG A CD    1 
ATOM   7730  N  NE    . ARG A 1 1018 ? -43.749 -55.906  5.835   1.00 2.00  ? 1019 ARG A NE    1 
ATOM   7731  C  CZ    . ARG A 1 1018 ? -45.037 -55.608  5.611   1.00 2.31  ? 1019 ARG A CZ    1 
ATOM   7732  N  NH1   . ARG A 1 1018 ? -45.434 -54.347  5.460   1.00 2.05  ? 1019 ARG A NH1   1 
ATOM   7733  N  NH2   . ARG A 1 1018 ? -45.931 -56.588  5.466   1.00 2.00  ? 1019 ARG A NH2   1 
ATOM   7734  N  N     . THR A 1 1019 ? -37.436 -53.404  6.910   1.00 3.14  ? 1020 THR A N     1 
ATOM   7735  C  CA    . THR A 1 1019 ? -36.337 -52.444  6.849   1.00 2.68  ? 1020 THR A CA    1 
ATOM   7736  C  C     . THR A 1 1019 ? -35.394 -53.131  5.907   1.00 2.79  ? 1020 THR A C     1 
ATOM   7737  O  O     . THR A 1 1019 ? -35.387 -54.375  5.825   1.00 3.32  ? 1020 THR A O     1 
ATOM   7738  C  CB    . THR A 1 1019 ? -35.666 -52.086  8.225   1.00 2.69  ? 1020 THR A CB    1 
ATOM   7739  O  OG1   . THR A 1 1019 ? -35.316 -53.262  8.995   1.00 2.00  ? 1020 THR A OG1   1 
ATOM   7740  C  CG2   . THR A 1 1019 ? -36.596 -51.152  9.025   1.00 2.77  ? 1020 THR A CG2   1 
ATOM   7741  N  N     . GLY A 1 1020 ? -34.668 -52.349  5.130   1.00 2.20  ? 1021 GLY A N     1 
ATOM   7742  C  CA    . GLY A 1 1020 ? -33.783 -52.972  4.176   1.00 2.45  ? 1021 GLY A CA    1 
ATOM   7743  C  C     . GLY A 1 1020 ? -32.603 -53.692  4.776   1.00 2.07  ? 1021 GLY A C     1 
ATOM   7744  O  O     . GLY A 1 1020 ? -32.415 -53.639  5.968   1.00 2.99  ? 1021 GLY A O     1 
ATOM   7745  N  N     . LYS A 1 1021 ? -31.798 -54.344  3.953   1.00 2.00  ? 1022 LYS A N     1 
ATOM   7746  C  CA    . LYS A 1 1021 ? -30.640 -55.008  4.473   1.00 2.00  ? 1022 LYS A CA    1 
ATOM   7747  C  C     . LYS A 1 1021 ? -29.597 -53.952  4.824   1.00 2.08  ? 1022 LYS A C     1 
ATOM   7748  O  O     . LYS A 1 1021 ? -29.391 -52.981  4.101   1.00 3.05  ? 1022 LYS A O     1 
ATOM   7749  C  CB    . LYS A 1 1021 ? -30.088 -55.956  3.409   1.00 2.59  ? 1022 LYS A CB    1 
ATOM   7750  C  CG    . LYS A 1 1021 ? -28.886 -56.839  3.800   1.00 2.07  ? 1022 LYS A CG    1 
ATOM   7751  C  CD    . LYS A 1 1021 ? -28.295 -57.500  2.519   1.00 2.20  ? 1022 LYS A CD    1 
ATOM   7752  C  CE    . LYS A 1 1021 ? -27.049 -58.328  2.749   1.00 2.00  ? 1022 LYS A CE    1 
ATOM   7753  N  NZ    . LYS A 1 1021 ? -27.392 -59.630  3.296   1.00 2.00  ? 1022 LYS A NZ    1 
ATOM   7754  N  N     . LYS A 1 1022 ? -29.004 -54.077  5.990   1.00 2.27  ? 1023 LYS A N     1 
ATOM   7755  C  CA    . LYS A 1 1022 ? -27.921 -53.179  6.400   1.00 2.22  ? 1023 LYS A CA    1 
ATOM   7756  C  C     . LYS A 1 1022 ? -26.738 -53.368  5.422   1.00 2.18  ? 1023 LYS A C     1 
ATOM   7757  O  O     . LYS A 1 1022 ? -26.364 -54.479  5.070   1.00 2.00  ? 1023 LYS A O     1 
ATOM   7758  C  CB    . LYS A 1 1022 ? -27.471 -53.549  7.835   1.00 2.36  ? 1023 LYS A CB    1 
ATOM   7759  C  CG    . LYS A 1 1022 ? -26.253 -52.858  8.378   1.00 2.00  ? 1023 LYS A CG    1 
ATOM   7760  C  CD    . LYS A 1 1022 ? -26.013 -53.321  9.765   1.00 2.00  ? 1023 LYS A CD    1 
ATOM   7761  C  CE    . LYS A 1 1022 ? -24.578 -53.107  10.149  1.00 2.00  ? 1023 LYS A CE    1 
ATOM   7762  N  NZ    . LYS A 1 1022 ? -24.361 -53.627  11.493  1.00 2.00  ? 1023 LYS A NZ    1 
ATOM   7763  N  N     . ASP A 1 1023 ? -26.145 -52.261  4.997   1.00 2.52  ? 1024 ASP A N     1 
ATOM   7764  C  CA    . ASP A 1 1023 ? -25.019 -52.353  4.107   1.00 2.22  ? 1024 ASP A CA    1 
ATOM   7765  C  C     . ASP A 1 1023 ? -23.733 -52.391  4.951   1.00 2.43  ? 1024 ASP A C     1 
ATOM   7766  O  O     . ASP A 1 1023 ? -23.113 -51.349  5.202   1.00 3.42  ? 1024 ASP A O     1 
ATOM   7767  C  CB    . ASP A 1 1023 ? -25.009 -51.154  3.165   1.00 2.00  ? 1024 ASP A CB    1 
ATOM   7768  C  CG    . ASP A 1 1023 ? -24.277 -51.433  1.855   1.00 3.01  ? 1024 ASP A CG    1 
ATOM   7769  O  OD1   . ASP A 1 1023 ? -23.369 -52.298  1.780   1.00 2.43  ? 1024 ASP A OD1   1 
ATOM   7770  O  OD2   . ASP A 1 1023 ? -24.637 -50.781  0.860   1.00 4.45  ? 1024 ASP A OD2   1 
ATOM   7771  N  N     . LEU A 1 1024 ? -23.365 -53.578  5.428   1.00 2.06  ? 1025 LEU A N     1 
ATOM   7772  C  CA    . LEU A 1 1024 ? -22.149 -53.742  6.210   1.00 2.11  ? 1025 LEU A CA    1 
ATOM   7773  C  C     . LEU A 1 1024 ? -20.899 -53.405  5.373   1.00 2.00  ? 1025 LEU A C     1 
ATOM   7774  O  O     . LEU A 1 1024 ? -20.027 -52.691  5.839   1.00 2.00  ? 1025 LEU A O     1 
ATOM   7775  C  CB    . LEU A 1 1024 ? -22.063 -55.181  6.742   1.00 2.00  ? 1025 LEU A CB    1 
ATOM   7776  C  CG    . LEU A 1 1024 ? -20.776 -55.644  7.396   1.00 2.00  ? 1025 LEU A CG    1 
ATOM   7777  C  CD1   . LEU A 1 1024 ? -20.470 -54.871  8.660   1.00 2.00  ? 1025 LEU A CD1   1 
ATOM   7778  C  CD2   . LEU A 1 1024 ? -20.907 -57.113  7.687   1.00 2.00  ? 1025 LEU A CD2   1 
ATOM   7779  N  N     . ALA A 1 1025 ? -20.854 -53.901  4.137   1.00 2.00  ? 1026 ALA A N     1 
ATOM   7780  C  CA    . ALA A 1 1025 ? -19.755 -53.692  3.196   1.00 2.02  ? 1026 ALA A CA    1 
ATOM   7781  C  C     . ALA A 1 1025 ? -19.420 -52.223  3.020   1.00 2.00  ? 1026 ALA A C     1 
ATOM   7782  O  O     . ALA A 1 1025 ? -18.315 -51.813  3.284   1.00 2.08  ? 1026 ALA A O     1 
ATOM   7783  C  CB    . ALA A 1 1025 ? -20.091 -54.339  1.809   1.00 2.00  ? 1026 ALA A CB    1 
ATOM   7784  N  N     . ARG A 1 1026 ? -20.406 -51.434  2.645   1.00 2.04  ? 1027 ARG A N     1 
ATOM   7785  C  CA    . ARG A 1 1026 ? -20.204 -50.015  2.414   1.00 2.54  ? 1027 ARG A CA    1 
ATOM   7786  C  C     . ARG A 1 1026 ? -19.884 -49.275  3.677   1.00 2.61  ? 1027 ARG A C     1 
ATOM   7787  O  O     . ARG A 1 1026 ? -19.125 -48.288  3.648   1.00 2.97  ? 1027 ARG A O     1 
ATOM   7788  C  CB    . ARG A 1 1026 ? -21.428 -49.404  1.721   1.00 3.07  ? 1027 ARG A CB    1 
ATOM   7789  C  CG    . ARG A 1 1026 ? -21.121 -48.842  0.349   1.00 5.94  ? 1027 ARG A CG    1 
ATOM   7790  C  CD    . ARG A 1 1026 ? -22.180 -49.076  -0.716  1.00 6.55  ? 1027 ARG A CD    1 
ATOM   7791  N  NE    . ARG A 1 1026 ? -23.514 -48.681  -0.308  1.00 8.69  ? 1027 ARG A NE    1 
ATOM   7792  C  CZ    . ARG A 1 1026 ? -23.968 -47.433  -0.256  1.00 10.00 ? 1027 ARG A CZ    1 
ATOM   7793  N  NH1   . ARG A 1 1026 ? -23.177 -46.413  -0.594  1.00 10.70 ? 1027 ARG A NH1   1 
ATOM   7794  N  NH2   . ARG A 1 1026 ? -25.240 -47.211  0.109   1.00 10.72 ? 1027 ARG A NH2   1 
ATOM   7795  N  N     . MET A 1 1027 ? -20.425 -49.753  4.797   1.00 2.57  ? 1028 MET A N     1 
ATOM   7796  C  CA    . MET A 1 1027 ? -20.167 -49.097  6.083   1.00 2.68  ? 1028 MET A CA    1 
ATOM   7797  C  C     . MET A 1 1027 ? -18.686 -49.190  6.413   1.00 2.42  ? 1028 MET A C     1 
ATOM   7798  O  O     . MET A 1 1027 ? -18.071 -48.183  6.764   1.00 2.25  ? 1028 MET A O     1 
ATOM   7799  C  CB    . MET A 1 1027 ? -21.011 -49.708  7.225   1.00 3.01  ? 1028 MET A CB    1 
ATOM   7800  C  CG    . MET A 1 1027 ? -22.417 -49.133  7.317   1.00 4.73  ? 1028 MET A CG    1 
ATOM   7801  S  SD    . MET A 1 1027 ? -23.665 -49.968  8.377   1.00 5.88  ? 1028 MET A SD    1 
ATOM   7802  C  CE    . MET A 1 1027 ? -23.155 -49.278  9.836   1.00 6.08  ? 1028 MET A CE    1 
ATOM   7803  N  N     . VAL A 1 1028 ? -18.105 -50.384  6.254   1.00 2.52  ? 1029 VAL A N     1 
ATOM   7804  C  CA    . VAL A 1 1028 ? -16.690 -50.554  6.539   1.00 2.48  ? 1029 VAL A CA    1 
ATOM   7805  C  C     . VAL A 1 1028 ? -15.782 -50.029  5.445   1.00 2.22  ? 1029 VAL A C     1 
ATOM   7806  O  O     . VAL A 1 1028 ? -14.662 -49.678  5.715   1.00 2.88  ? 1029 VAL A O     1 
ATOM   7807  C  CB    . VAL A 1 1028 ? -16.317 -51.971  7.145   1.00 2.51  ? 1029 VAL A CB    1 
ATOM   7808  C  CG1   . VAL A 1 1028 ? -17.575 -52.711  7.561   1.00 2.00  ? 1029 VAL A CG1   1 
ATOM   7809  C  CG2   . VAL A 1 1028 ? -15.353 -52.744  6.290   1.00 2.00  ? 1029 VAL A CG2   1 
ATOM   7810  N  N     . MET A 1 1029 ? -16.286 -49.866  4.235   1.00 2.38  ? 1030 MET A N     1 
ATOM   7811  C  CA    . MET A 1 1029 ? -15.463 -49.270  3.179   1.00 2.64  ? 1030 MET A CA    1 
ATOM   7812  C  C     . MET A 1 1029 ? -15.179 -47.798  3.476   1.00 2.64  ? 1030 MET A C     1 
ATOM   7813  O  O     . MET A 1 1029 ? -14.294 -47.206  2.868   1.00 2.24  ? 1030 MET A O     1 
ATOM   7814  C  CB    . MET A 1 1029 ? -16.109 -49.382  1.786   1.00 2.64  ? 1030 MET A CB    1 
ATOM   7815  C  CG    . MET A 1 1029 ? -15.919 -50.737  1.125   1.00 2.64  ? 1030 MET A CG    1 
ATOM   7816  S  SD    . MET A 1 1029 ? -16.435 -50.721  -0.541  1.00 3.21  ? 1030 MET A SD    1 
ATOM   7817  C  CE    . MET A 1 1029 ? -18.210 -50.992  -0.346  1.00 3.74  ? 1030 MET A CE    1 
ATOM   7818  N  N     . THR A 1 1030 ? -15.930 -47.194  4.404   1.00 3.03  ? 1031 THR A N     1 
ATOM   7819  C  CA    . THR A 1 1030 ? -15.691 -45.787  4.736   1.00 2.43  ? 1031 THR A CA    1 
ATOM   7820  C  C     . THR A 1 1030 ? -14.348 -45.631  5.459   1.00 2.70  ? 1031 THR A C     1 
ATOM   7821  O  O     . THR A 1 1030 ? -13.879 -44.518  5.587   1.00 2.51  ? 1031 THR A O     1 
ATOM   7822  C  CB    . THR A 1 1030 ? -16.743 -45.264  5.653   1.00 2.24  ? 1031 THR A CB    1 
ATOM   7823  O  OG1   . THR A 1 1030 ? -16.695 -46.000  6.887   1.00 2.48  ? 1031 THR A OG1   1 
ATOM   7824  C  CG2   . THR A 1 1030 ? -18.098 -45.420  5.036   1.00 2.00  ? 1031 THR A CG2   1 
ATOM   7825  N  N     . TYR A 1 1031 ? -13.745 -46.738  5.930   1.00 2.52  ? 1032 TYR A N     1 
ATOM   7826  C  CA    . TYR A 1 1031 ? -12.452 -46.685  6.632   1.00 2.68  ? 1032 TYR A CA    1 
ATOM   7827  C  C     . TYR A 1 1031 ? -11.280 -46.279  5.743   1.00 2.88  ? 1032 TYR A C     1 
ATOM   7828  O  O     . TYR A 1 1031 ? -10.415 -45.522  6.158   1.00 3.35  ? 1032 TYR A O     1 
ATOM   7829  C  CB    . TYR A 1 1031 ? -12.129 -48.020  7.315   1.00 2.12  ? 1032 TYR A CB    1 
ATOM   7830  C  CG    . TYR A 1 1031 ? -12.733 -48.144  8.682   1.00 2.00  ? 1032 TYR A CG    1 
ATOM   7831  C  CD1   . TYR A 1 1031 ? -12.326 -47.307  9.719   1.00 2.01  ? 1032 TYR A CD1   1 
ATOM   7832  C  CD2   . TYR A 1 1031 ? -13.788 -49.006  8.905   1.00 2.27  ? 1032 TYR A CD2   1 
ATOM   7833  C  CE1   . TYR A 1 1031 ? -12.969 -47.308  10.929  1.00 2.04  ? 1032 TYR A CE1   1 
ATOM   7834  C  CE2   . TYR A 1 1031 ? -14.431 -49.032  10.111  1.00 2.37  ? 1032 TYR A CE2   1 
ATOM   7835  C  CZ    . TYR A 1 1031 ? -14.026 -48.182  11.111  1.00 2.30  ? 1032 TYR A CZ    1 
ATOM   7836  O  OH    . TYR A 1 1031 ? -14.689 -48.208  12.294  1.00 2.39  ? 1032 TYR A OH    1 
ATOM   7837  N  N     . GLY A 1 1032 ? -11.247 -46.816  4.525   1.00 3.56  ? 1033 GLY A N     1 
ATOM   7838  C  CA    . GLY A 1 1032 ? -10.181 -46.504  3.578   1.00 2.61  ? 1033 GLY A CA    1 
ATOM   7839  C  C     . GLY A 1 1032 ? -9.000  -47.439  3.705   1.00 2.42  ? 1033 GLY A C     1 
ATOM   7840  O  O     . GLY A 1 1032 ? -8.332  -47.713  2.707   1.00 2.87  ? 1033 GLY A O     1 
ATOM   7841  N  N     . TYR A 1 1033 ? -8.771  -47.970  4.906   1.00 2.00  ? 1034 TYR A N     1 
ATOM   7842  C  CA    . TYR A 1 1033 ? -7.640  -48.861  5.151   1.00 2.00  ? 1034 TYR A CA    1 
ATOM   7843  C  C     . TYR A 1 1033 ? -8.011  -50.322  5.376   1.00 2.05  ? 1034 TYR A C     1 
ATOM   7844  O  O     . TYR A 1 1033 ? -7.186  -51.105  5.880   1.00 2.12  ? 1034 TYR A O     1 
ATOM   7845  C  CB    . TYR A 1 1033 ? -6.791  -48.348  6.308   1.00 2.00  ? 1034 TYR A CB    1 
ATOM   7846  C  CG    . TYR A 1 1033 ? -7.505  -48.133  7.638   1.00 2.02  ? 1034 TYR A CG    1 
ATOM   7847  C  CD1   . TYR A 1 1033 ? -7.746  -49.175  8.523   1.00 2.00  ? 1034 TYR A CD1   1 
ATOM   7848  C  CD2   . TYR A 1 1033 ? -7.875  -46.864  8.032   1.00 2.37  ? 1034 TYR A CD2   1 
ATOM   7849  C  CE1   . TYR A 1 1033 ? -8.324  -48.958  9.765   1.00 2.00  ? 1034 TYR A CE1   1 
ATOM   7850  C  CE2   . TYR A 1 1033 ? -8.472  -46.634  9.280   1.00 2.18  ? 1034 TYR A CE2   1 
ATOM   7851  C  CZ    . TYR A 1 1033 ? -8.689  -47.683  10.137  1.00 2.32  ? 1034 TYR A CZ    1 
ATOM   7852  O  OH    . TYR A 1 1033 ? -9.276  -47.410  11.367  1.00 2.47  ? 1034 TYR A OH    1 
ATOM   7853  N  N     . VAL A 1 1034 ? -9.240  -50.680  4.994   1.00 2.00  ? 1035 VAL A N     1 
ATOM   7854  C  CA    . VAL A 1 1034 ? -9.738  -52.050  5.131   1.00 2.50  ? 1035 VAL A CA    1 
ATOM   7855  C  C     . VAL A 1 1034 ? -10.125 -52.662  3.762   1.00 2.63  ? 1035 VAL A C     1 
ATOM   7856  O  O     . VAL A 1 1034 ? -10.830 -52.047  2.959   1.00 2.00  ? 1035 VAL A O     1 
ATOM   7857  C  CB    . VAL A 1 1034 ? -10.917 -52.128  6.135   1.00 2.00  ? 1035 VAL A CB    1 
ATOM   7858  C  CG1   . VAL A 1 1034 ? -11.510 -53.502  6.157   1.00 2.00  ? 1035 VAL A CG1   1 
ATOM   7859  C  CG2   . VAL A 1 1034 ? -10.455 -51.737  7.508   1.00 2.00  ? 1035 VAL A CG2   1 
ATOM   7860  N  N     . TYR A 1 1035 ? -9.589  -53.856  3.480   1.00 2.61  ? 1036 TYR A N     1 
ATOM   7861  C  CA    . TYR A 1 1035 ? -9.918  -54.542  2.241   1.00 2.23  ? 1036 TYR A CA    1 
ATOM   7862  C  C     . TYR A 1 1035 ? -11.323 -55.097  2.471   1.00 2.64  ? 1036 TYR A C     1 
ATOM   7863  O  O     . TYR A 1 1035 ? -11.580 -55.735  3.491   1.00 2.61  ? 1036 TYR A O     1 
ATOM   7864  C  CB    . TYR A 1 1035 ? -8.934  -55.668  1.994   1.00 2.00  ? 1036 TYR A CB    1 
ATOM   7865  C  CG    . TYR A 1 1035 ? -9.194  -56.403  0.728   1.00 2.00  ? 1036 TYR A CG    1 
ATOM   7866  C  CD1   . TYR A 1 1035 ? -10.097 -57.457  0.686   1.00 2.03  ? 1036 TYR A CD1   1 
ATOM   7867  C  CD2   . TYR A 1 1035 ? -8.528  -56.083  -0.431  1.00 2.00  ? 1036 TYR A CD2   1 
ATOM   7868  C  CE1   . TYR A 1 1035 ? -10.333 -58.198  -0.503  1.00 2.00  ? 1036 TYR A CE1   1 
ATOM   7869  C  CE2   . TYR A 1 1035 ? -8.758  -56.817  -1.626  1.00 2.33  ? 1036 TYR A CE2   1 
ATOM   7870  C  CZ    . TYR A 1 1035 ? -9.670  -57.878  -1.634  1.00 2.00  ? 1036 TYR A CZ    1 
ATOM   7871  O  OH    . TYR A 1 1035 ? -9.897  -58.599  -2.764  1.00 2.00  ? 1036 TYR A OH    1 
ATOM   7872  N  N     . VAL A 1 1036 ? -12.227 -54.854  1.526   1.00 2.51  ? 1037 VAL A N     1 
ATOM   7873  C  CA    . VAL A 1 1036 ? -13.625 -55.297  1.631   1.00 2.28  ? 1037 VAL A CA    1 
ATOM   7874  C  C     . VAL A 1 1036 ? -14.056 -55.993  0.337   1.00 2.51  ? 1037 VAL A C     1 
ATOM   7875  O  O     . VAL A 1 1036 ? -13.876 -55.467  -0.736  1.00 3.21  ? 1037 VAL A O     1 
ATOM   7876  C  CB    . VAL A 1 1036 ? -14.606 -54.073  1.837   1.00 2.05  ? 1037 VAL A CB    1 
ATOM   7877  C  CG1   . VAL A 1 1036 ? -16.016 -54.571  2.040   1.00 2.00  ? 1037 VAL A CG1   1 
ATOM   7878  C  CG2   . VAL A 1 1036 ? -14.166 -53.193  3.016   1.00 2.00  ? 1037 VAL A CG2   1 
ATOM   7879  N  N     . ALA A 1 1037 ? -14.684 -57.143  0.418   1.00 2.27  ? 1038 ALA A N     1 
ATOM   7880  C  CA    . ALA A 1 1037 ? -15.107 -57.764  -0.809  1.00 2.38  ? 1038 ALA A CA    1 
ATOM   7881  C  C     . ALA A 1 1037 ? -16.324 -58.612  -0.562  1.00 2.57  ? 1038 ALA A C     1 
ATOM   7882  O  O     . ALA A 1 1037 ? -16.636 -58.962  0.581   1.00 2.13  ? 1038 ALA A O     1 
ATOM   7883  C  CB    . ALA A 1 1037 ? -14.005 -58.614  -1.365  1.00 3.03  ? 1038 ALA A CB    1 
ATOM   7884  N  N     . THR A 1 1038 ? -17.057 -58.864  -1.644  1.00 2.65  ? 1039 THR A N     1 
ATOM   7885  C  CA    . THR A 1 1038 ? -18.240 -59.694  -1.607  1.00 2.19  ? 1039 THR A CA    1 
ATOM   7886  C  C     . THR A 1 1038 ? -18.041 -60.726  -2.662  1.00 2.00  ? 1039 THR A C     1 
ATOM   7887  O  O     . THR A 1 1038 ? -17.529 -60.412  -3.701  1.00 2.24  ? 1039 THR A O     1 
ATOM   7888  C  CB    . THR A 1 1038 ? -19.488 -58.880  -1.873  1.00 2.00  ? 1039 THR A CB    1 
ATOM   7889  O  OG1   . THR A 1 1038 ? -19.346 -58.155  -3.090  1.00 2.00  ? 1039 THR A OG1   1 
ATOM   7890  C  CG2   . THR A 1 1038 ? -19.702 -57.933  -0.768  1.00 2.00  ? 1039 THR A CG2   1 
ATOM   7891  N  N     . VAL A 1 1039 ? -18.329 -61.975  -2.344  1.00 2.31  ? 1040 VAL A N     1 
ATOM   7892  C  CA    . VAL A 1 1039 ? -18.170 -63.075  -3.282  1.00 2.07  ? 1040 VAL A CA    1 
ATOM   7893  C  C     . VAL A 1 1039 ? -19.465 -63.912  -3.347  1.00 2.17  ? 1040 VAL A C     1 
ATOM   7894  O  O     . VAL A 1 1039 ? -20.401 -63.659  -2.591  1.00 2.00  ? 1040 VAL A O     1 
ATOM   7895  C  CB    . VAL A 1 1039 ? -16.946 -63.948  -2.892  1.00 2.55  ? 1040 VAL A CB    1 
ATOM   7896  C  CG1   . VAL A 1 1039 ? -15.712 -63.095  -2.855  1.00 2.00  ? 1040 VAL A CG1   1 
ATOM   7897  C  CG2   . VAL A 1 1039 ? -17.135 -64.595  -1.509  1.00 2.93  ? 1040 VAL A CG2   1 
ATOM   7898  N  N     . SER A 1 1040 ? -19.549 -64.786  -4.355  1.00 2.15  ? 1041 SER A N     1 
ATOM   7899  C  CA    . SER A 1 1040 ? -20.663 -65.689  -4.567  1.00 2.14  ? 1041 SER A CA    1 
ATOM   7900  C  C     . SER A 1 1040 ? -20.106 -66.772  -5.514  1.00 2.03  ? 1041 SER A C     1 
ATOM   7901  O  O     . SER A 1 1040 ? -19.923 -66.553  -6.703  1.00 2.00  ? 1041 SER A O     1 
ATOM   7902  C  CB    . SER A 1 1040 ? -21.904 -64.966  -5.165  1.00 2.13  ? 1041 SER A CB    1 
ATOM   7903  O  OG    . SER A 1 1040 ? -23.015 -65.866  -5.344  1.00 2.00  ? 1041 SER A OG    1 
ATOM   7904  N  N     . MET A 1 1041 ? -19.847 -67.950  -4.955  1.00 2.40  ? 1042 MET A N     1 
ATOM   7905  C  CA    . MET A 1 1041 ? -19.276 -69.098  -5.681  1.00 2.00  ? 1042 MET A CA    1 
ATOM   7906  C  C     . MET A 1 1041 ? -19.984 -69.504  -6.991  1.00 2.27  ? 1042 MET A C     1 
ATOM   7907  O  O     . MET A 1 1041 ? -19.322 -69.722  -8.002  1.00 2.73  ? 1042 MET A O     1 
ATOM   7908  C  CB    . MET A 1 1041 ? -19.204 -70.308  -4.723  1.00 2.02  ? 1042 MET A CB    1 
ATOM   7909  C  CG    . MET A 1 1041 ? -18.252 -71.393  -5.173  1.00 2.94  ? 1042 MET A CG    1 
ATOM   7910  S  SD    . MET A 1 1041 ? -18.180 -72.869  -4.165  1.00 3.78  ? 1042 MET A SD    1 
ATOM   7911  C  CE    . MET A 1 1041 ? -17.041 -72.333  -2.965  1.00 2.71  ? 1042 MET A CE    1 
ATOM   7912  N  N     . GLY A 1 1042 ? -21.317 -69.625  -6.959  1.00 2.01  ? 1043 GLY A N     1 
ATOM   7913  C  CA    . GLY A 1 1042 ? -22.084 -70.042  -8.104  1.00 2.00  ? 1043 GLY A CA    1 
ATOM   7914  C  C     . GLY A 1 1042 ? -21.977 -69.115  -9.256  1.00 2.00  ? 1043 GLY A C     1 
ATOM   7915  O  O     . GLY A 1 1042 ? -22.326 -69.474  -10.357 1.00 2.00  ? 1043 GLY A O     1 
ATOM   7916  N  N     . TYR A 1 1043 ? -21.608 -67.870  -8.991  1.00 2.65  ? 1044 TYR A N     1 
ATOM   7917  C  CA    . TYR A 1 1043 ? -21.439 -66.882  -10.056 1.00 2.66  ? 1044 TYR A CA    1 
ATOM   7918  C  C     . TYR A 1 1043 ? -20.015 -66.896  -10.621 1.00 2.65  ? 1044 TYR A C     1 
ATOM   7919  O  O     . TYR A 1 1043 ? -19.833 -66.845  -11.834 1.00 2.87  ? 1044 TYR A O     1 
ATOM   7920  C  CB    . TYR A 1 1043 ? -21.776 -65.484  -9.567  1.00 2.12  ? 1044 TYR A CB    1 
ATOM   7921  C  CG    . TYR A 1 1043 ? -21.499 -64.433  -10.599 1.00 2.51  ? 1044 TYR A CG    1 
ATOM   7922  C  CD1   . TYR A 1 1043 ? -22.456 -64.110  -11.560 1.00 2.91  ? 1044 TYR A CD1   1 
ATOM   7923  C  CD2   . TYR A 1 1043 ? -20.288 -63.737  -10.606 1.00 2.24  ? 1044 TYR A CD2   1 
ATOM   7924  C  CE1   . TYR A 1 1043 ? -22.208 -63.087  -12.517 1.00 2.90  ? 1044 TYR A CE1   1 
ATOM   7925  C  CE2   . TYR A 1 1043 ? -20.031 -62.754  -11.542 1.00 2.17  ? 1044 TYR A CE2   1 
ATOM   7926  C  CZ    . TYR A 1 1043 ? -20.992 -62.433  -12.491 1.00 2.67  ? 1044 TYR A CZ    1 
ATOM   7927  O  OH    . TYR A 1 1043 ? -20.717 -61.475  -13.440 1.00 3.32  ? 1044 TYR A OH    1 
ATOM   7928  N  N     . SER A 1 1044 ? -19.015 -66.934  -9.744  1.00 3.18  ? 1045 SER A N     1 
ATOM   7929  C  CA    . SER A 1 1044 ? -17.617 -66.974  -10.174 1.00 3.94  ? 1045 SER A CA    1 
ATOM   7930  C  C     . SER A 1 1044 ? -16.693 -67.612  -9.158  1.00 4.38  ? 1045 SER A C     1 
ATOM   7931  O  O     . SER A 1 1044 ? -16.473 -67.073  -8.074  1.00 5.03  ? 1045 SER A O     1 
ATOM   7932  C  CB    . SER A 1 1044 ? -17.091 -65.572  -10.490 1.00 4.52  ? 1045 SER A CB    1 
ATOM   7933  O  OG    . SER A 1 1044 ? -15.761 -65.628  -11.018 1.00 5.36  ? 1045 SER A OG    1 
ATOM   7934  N  N     . LYS A 1 1045 ? -16.160 -68.771  -9.498  1.00 4.57  ? 1046 LYS A N     1 
ATOM   7935  C  CA    . LYS A 1 1045 ? -15.229 -69.431  -8.614  1.00 4.58  ? 1046 LYS A CA    1 
ATOM   7936  C  C     . LYS A 1 1045 ? -13.904 -68.693  -8.709  1.00 4.98  ? 1046 LYS A C     1 
ATOM   7937  O  O     . LYS A 1 1045 ? -13.193 -68.631  -7.736  1.00 6.01  ? 1046 LYS A O     1 
ATOM   7938  C  CB    . LYS A 1 1045 ? -15.025 -70.869  -9.025  1.00 3.46  ? 1046 LYS A CB    1 
ATOM   7939  C  CG    . LYS A 1 1045 ? -16.284 -71.592  -9.208  1.00 2.46  ? 1046 LYS A CG    1 
ATOM   7940  C  CD    . LYS A 1 1045 ? -16.005 -73.051  -9.323  1.00 2.38  ? 1046 LYS A CD    1 
ATOM   7941  C  CE    . LYS A 1 1045 ? -17.287 -73.821  -9.276  1.00 2.12  ? 1046 LYS A CE    1 
ATOM   7942  N  NZ    . LYS A 1 1045 ? -18.214 -73.349  -10.354 1.00 2.81  ? 1046 LYS A NZ    1 
ATOM   7943  N  N     . GLN A 1 1046 ? -13.552 -68.137  -9.854  1.00 5.03  ? 1047 GLN A N     1 
ATOM   7944  C  CA    . GLN A 1 1046 ? -12.280 -67.419  -9.900  1.00 6.57  ? 1047 GLN A CA    1 
ATOM   7945  C  C     . GLN A 1 1046 ? -12.245 -66.062  -9.228  1.00 6.19  ? 1047 GLN A C     1 
ATOM   7946  O  O     . GLN A 1 1046 ? -11.176 -65.639  -8.795  1.00 6.52  ? 1047 GLN A O     1 
ATOM   7947  C  CB    . GLN A 1 1046 ? -11.624 -67.335  -11.284 1.00 8.07  ? 1047 GLN A CB    1 
ATOM   7948  C  CG    . GLN A 1 1046 ? -12.525 -67.521  -12.446 1.00 11.11 ? 1047 GLN A CG    1 
ATOM   7949  C  CD    . GLN A 1 1046 ? -12.884 -68.986  -12.668 1.00 12.30 ? 1047 GLN A CD    1 
ATOM   7950  O  OE1   . GLN A 1 1046 ? -12.045 -69.783  -13.097 1.00 12.49 ? 1047 GLN A OE1   1 
ATOM   7951  N  NE2   . GLN A 1 1046 ? -14.146 -69.336  -12.382 1.00 13.32 ? 1047 GLN A NE2   1 
ATOM   7952  N  N     . GLN A 1 1047 ? -13.383 -65.374  -9.148  1.00 5.54  ? 1048 GLN A N     1 
ATOM   7953  C  CA    . GLN A 1 1047 ? -13.438 -64.099  -8.450  1.00 4.98  ? 1048 GLN A CA    1 
ATOM   7954  C  C     . GLN A 1 1047 ? -13.290 -64.429  -6.950  1.00 4.56  ? 1048 GLN A C     1 
ATOM   7955  O  O     . GLN A 1 1047 ? -12.629 -63.697  -6.203  1.00 4.36  ? 1048 GLN A O     1 
ATOM   7956  C  CB    . GLN A 1 1047 ? -14.772 -63.371  -8.718  1.00 4.97  ? 1048 GLN A CB    1 
ATOM   7957  C  CG    . GLN A 1 1047 ? -14.842 -61.942  -8.160  1.00 5.80  ? 1048 GLN A CG    1 
ATOM   7958  C  CD    . GLN A 1 1047 ? -15.522 -61.826  -6.788  1.00 6.56  ? 1048 GLN A CD    1 
ATOM   7959  O  OE1   . GLN A 1 1047 ? -15.653 -60.745  -6.258  1.00 6.85  ? 1048 GLN A OE1   1 
ATOM   7960  N  NE2   . GLN A 1 1047 ? -15.984 -62.932  -6.242  1.00 6.83  ? 1048 GLN A NE2   1 
ATOM   7961  N  N     . PHE A 1 1048 ? -13.842 -65.573  -6.531  1.00 3.81  ? 1049 PHE A N     1 
ATOM   7962  C  CA    . PHE A 1 1048 ? -13.776 -65.989  -5.138  1.00 2.80  ? 1049 PHE A CA    1 
ATOM   7963  C  C     . PHE A 1 1048 ? -12.346 -66.285  -4.716  1.00 2.61  ? 1049 PHE A C     1 
ATOM   7964  O  O     . PHE A 1 1048 ? -11.937 -65.883  -3.649  1.00 2.59  ? 1049 PHE A O     1 
ATOM   7965  C  CB    . PHE A 1 1048 ? -14.738 -67.151  -4.894  1.00 2.00  ? 1049 PHE A CB    1 
ATOM   7966  C  CG    . PHE A 1 1048 ? -14.553 -67.830  -3.575  1.00 2.12  ? 1049 PHE A CG    1 
ATOM   7967  C  CD1   . PHE A 1 1048 ? -14.622 -67.123  -2.390  1.00 2.01  ? 1049 PHE A CD1   1 
ATOM   7968  C  CD2   . PHE A 1 1048 ? -14.266 -69.212  -3.516  1.00 2.34  ? 1049 PHE A CD2   1 
ATOM   7969  C  CE1   . PHE A 1 1048 ? -14.397 -67.795  -1.138  1.00 2.70  ? 1049 PHE A CE1   1 
ATOM   7970  C  CE2   . PHE A 1 1048 ? -14.043 -69.865  -2.290  1.00 2.28  ? 1049 PHE A CE2   1 
ATOM   7971  C  CZ    . PHE A 1 1048 ? -14.108 -69.162  -1.098  1.00 2.00  ? 1049 PHE A CZ    1 
ATOM   7972  N  N     . LEU A 1 1049 ? -11.557 -66.908  -5.580  1.00 2.54  ? 1050 LEU A N     1 
ATOM   7973  C  CA    . LEU A 1 1049 ? -10.162 -67.224  -5.240  1.00 3.02  ? 1050 LEU A CA    1 
ATOM   7974  C  C     . LEU A 1 1049 ? -9.302  -65.960  -5.338  1.00 3.31  ? 1050 LEU A C     1 
ATOM   7975  O  O     . LEU A 1 1049 ? -8.286  -65.833  -4.683  1.00 3.49  ? 1050 LEU A O     1 
ATOM   7976  C  CB    . LEU A 1 1049 ? -9.598  -68.316  -6.162  1.00 2.50  ? 1050 LEU A CB    1 
ATOM   7977  C  CG    . LEU A 1 1049 ? -10.262 -69.687  -6.103  1.00 2.59  ? 1050 LEU A CG    1 
ATOM   7978  C  CD1   . LEU A 1 1049 ? -10.229 -70.365  -7.456  1.00 2.00  ? 1050 LEU A CD1   1 
ATOM   7979  C  CD2   . LEU A 1 1049 ? -9.633  -70.522  -4.995  1.00 2.00  ? 1050 LEU A CD2   1 
ATOM   7980  N  N     . LYS A 1 1050 ? -9.705  -65.044  -6.193  1.00 3.36  ? 1051 LYS A N     1 
ATOM   7981  C  CA    . LYS A 1 1050 ? -8.977  -63.810  -6.315  1.00 4.06  ? 1051 LYS A CA    1 
ATOM   7982  C  C     . LYS A 1 1050 ? -9.183  -62.990  -5.019  1.00 4.14  ? 1051 LYS A C     1 
ATOM   7983  O  O     . LYS A 1 1050 ? -8.221  -62.445  -4.450  1.00 4.05  ? 1051 LYS A O     1 
ATOM   7984  C  CB    . LYS A 1 1050 ? -9.454  -63.028  -7.551  1.00 4.86  ? 1051 LYS A CB    1 
ATOM   7985  C  CG    . LYS A 1 1050 ? -8.832  -61.618  -7.653  1.00 6.37  ? 1051 LYS A CG    1 
ATOM   7986  C  CD    . LYS A 1 1050 ? -8.771  -61.061  -9.085  1.00 7.79  ? 1051 LYS A CD    1 
ATOM   7987  C  CE    . LYS A 1 1050 ? -9.998  -60.244  -9.467  1.00 9.78  ? 1051 LYS A CE    1 
ATOM   7988  N  NZ    . LYS A 1 1050 ? -9.610  -58.941  -10.124 1.00 11.75 ? 1051 LYS A NZ    1 
ATOM   7989  N  N     . VAL A 1 1051 ? -10.435 -62.956  -4.543  1.00 3.48  ? 1052 VAL A N     1 
ATOM   7990  C  CA    . VAL A 1 1051 ? -10.807 -62.232  -3.320  1.00 3.01  ? 1052 VAL A CA    1 
ATOM   7991  C  C     . VAL A 1 1051 ? -10.041 -62.795  -2.122  1.00 3.01  ? 1052 VAL A C     1 
ATOM   7992  O  O     . VAL A 1 1051 ? -9.554  -62.030  -1.306  1.00 3.40  ? 1052 VAL A O     1 
ATOM   7993  C  CB    . VAL A 1 1051 ? -12.347 -62.336  -3.048  1.00 2.71  ? 1052 VAL A CB    1 
ATOM   7994  C  CG1   . VAL A 1 1051 ? -12.655 -62.186  -1.584  1.00 2.21  ? 1052 VAL A CG1   1 
ATOM   7995  C  CG2   . VAL A 1 1051 ? -13.076 -61.310  -3.817  1.00 2.00  ? 1052 VAL A CG2   1 
ATOM   7996  N  N     . LEU A 1 1052 ? -10.014 -64.128  -2.007  1.00 2.53  ? 1053 LEU A N     1 
ATOM   7997  C  CA    . LEU A 1 1052 ? -9.317  -64.848  -0.944  1.00 2.63  ? 1053 LEU A CA    1 
ATOM   7998  C  C     . LEU A 1 1052 ? -7.828  -64.545  -0.988  1.00 3.42  ? 1053 LEU A C     1 
ATOM   7999  O  O     . LEU A 1 1052 ? -7.205  -64.286  0.038   1.00 3.47  ? 1053 LEU A O     1 
ATOM   8000  C  CB    . LEU A 1 1052 ? -9.470  -66.359  -1.131  1.00 2.10  ? 1053 LEU A CB    1 
ATOM   8001  C  CG    . LEU A 1 1052 ? -10.801 -67.053  -0.860  1.00 2.00  ? 1053 LEU A CG    1 
ATOM   8002  C  CD1   . LEU A 1 1052 ? -10.604 -68.530  -0.853  1.00 2.00  ? 1053 LEU A CD1   1 
ATOM   8003  C  CD2   . LEU A 1 1052 ? -11.317 -66.637  0.489   1.00 2.02  ? 1053 LEU A CD2   1 
ATOM   8004  N  N     . LYS A 1 1053 ? -7.250  -64.620  -2.180  1.00 3.81  ? 1054 LYS A N     1 
ATOM   8005  C  CA    . LYS A 1 1053 ? -5.853  -64.326  -2.332  1.00 4.43  ? 1054 LYS A CA    1 
ATOM   8006  C  C     . LYS A 1 1053 ? -5.560  -62.849  -2.037  1.00 3.83  ? 1054 LYS A C     1 
ATOM   8007  O  O     . LYS A 1 1053 ? -4.565  -62.562  -1.385  1.00 4.38  ? 1054 LYS A O     1 
ATOM   8008  C  CB    . LYS A 1 1053 ? -5.391  -64.707  -3.734  1.00 6.36  ? 1054 LYS A CB    1 
ATOM   8009  C  CG    . LYS A 1 1053 ? -3.945  -64.379  -4.015  1.00 9.45  ? 1054 LYS A CG    1 
ATOM   8010  C  CD    . LYS A 1 1053 ? -3.770  -63.502  -5.277  1.00 12.08 ? 1054 LYS A CD    1 
ATOM   8011  C  CE    . LYS A 1 1053 ? -2.410  -63.790  -5.981  1.00 14.37 ? 1054 LYS A CE    1 
ATOM   8012  N  NZ    . LYS A 1 1053 ? -1.660  -62.540  -6.395  1.00 15.41 ? 1054 LYS A NZ    1 
ATOM   8013  N  N     . GLU A 1 1054 ? -6.419  -61.915  -2.456  1.00 3.03  ? 1055 GLU A N     1 
ATOM   8014  C  CA    . GLU A 1 1054 ? -6.162  -60.475  -2.216  1.00 2.38  ? 1055 GLU A CA    1 
ATOM   8015  C  C     . GLU A 1 1054 ? -6.458  -60.007  -0.798  1.00 2.42  ? 1055 GLU A C     1 
ATOM   8016  O  O     . GLU A 1 1054 ? -5.925  -58.983  -0.351  1.00 2.00  ? 1055 GLU A O     1 
ATOM   8017  C  CB    . GLU A 1 1054 ? -6.958  -59.574  -3.164  1.00 2.30  ? 1055 GLU A CB    1 
ATOM   8018  C  CG    . GLU A 1 1054 ? -6.524  -59.641  -4.603  1.00 2.43  ? 1055 GLU A CG    1 
ATOM   8019  C  CD    . GLU A 1 1054 ? -7.274  -58.687  -5.501  1.00 2.88  ? 1055 GLU A CD    1 
ATOM   8020  O  OE1   . GLU A 1 1054 ? -8.228  -58.037  -5.021  1.00 2.49  ? 1055 GLU A OE1   1 
ATOM   8021  O  OE2   . GLU A 1 1054 ? -6.914  -58.598  -6.708  1.00 3.43  ? 1055 GLU A OE2   1 
ATOM   8022  N  N     . ALA A 1 1055 ? -7.340  -60.737  -0.115  1.00 2.18  ? 1056 ALA A N     1 
ATOM   8023  C  CA    . ALA A 1 1055 ? -7.732  -60.416  1.257   1.00 2.17  ? 1056 ALA A CA    1 
ATOM   8024  C  C     . ALA A 1 1055 ? -6.687  -60.954  2.222   1.00 2.32  ? 1056 ALA A C     1 
ATOM   8025  O  O     . ALA A 1 1055 ? -6.189  -60.229  3.091   1.00 2.04  ? 1056 ALA A O     1 
ATOM   8026  C  CB    . ALA A 1 1055 ? -9.085  -61.019  1.564   1.00 2.11  ? 1056 ALA A CB    1 
ATOM   8027  N  N     . GLU A 1 1056 ? -6.304  -62.220  2.046   1.00 2.57  ? 1057 GLU A N     1 
ATOM   8028  C  CA    . GLU A 1 1056 ? -5.304  -62.761  2.943   1.00 2.38  ? 1057 GLU A CA    1 
ATOM   8029  C  C     . GLU A 1 1056 ? -3.985  -62.012  2.852   1.00 2.02  ? 1057 GLU A C     1 
ATOM   8030  O  O     . GLU A 1 1056 ? -3.431  -61.689  3.874   1.00 2.52  ? 1057 GLU A O     1 
ATOM   8031  C  CB    . GLU A 1 1056 ? -5.116  -64.267  2.767   1.00 2.57  ? 1057 GLU A CB    1 
ATOM   8032  C  CG    . GLU A 1 1056 ? -4.557  -64.963  4.019   1.00 3.00  ? 1057 GLU A CG    1 
ATOM   8033  C  CD    . GLU A 1 1056 ? -3.054  -64.804  4.161   1.00 3.12  ? 1057 GLU A CD    1 
ATOM   8034  O  OE1   . GLU A 1 1056 ? -2.378  -64.691  3.126   1.00 3.49  ? 1057 GLU A OE1   1 
ATOM   8035  O  OE2   . GLU A 1 1056 ? -2.520  -64.820  5.286   1.00 3.30  ? 1057 GLU A OE2   1 
ATOM   8036  N  N     . SER A 1 1057 ? -3.567  -61.604  1.661   1.00 2.00  ? 1058 SER A N     1 
ATOM   8037  C  CA    . SER A 1 1057 ? -2.283  -60.929  1.498   1.00 2.00  ? 1058 SER A CA    1 
ATOM   8038  C  C     . SER A 1 1057 ? -2.277  -59.479  1.893   1.00 2.83  ? 1058 SER A C     1 
ATOM   8039  O  O     . SER A 1 1057 ? -1.198  -58.913  2.177   1.00 3.36  ? 1058 SER A O     1 
ATOM   8040  C  CB    . SER A 1 1057 ? -1.759  -61.049  0.073   1.00 2.00  ? 1058 SER A CB    1 
ATOM   8041  O  OG    . SER A 1 1057 ? -2.628  -60.415  -0.855  1.00 2.00  ? 1058 SER A OG    1 
ATOM   8042  N  N     . PHE A 1 1058 ? -3.453  -58.851  1.905   1.00 2.56  ? 1059 PHE A N     1 
ATOM   8043  C  CA    . PHE A 1 1058 ? -3.501  -57.471  2.301   1.00 2.54  ? 1059 PHE A CA    1 
ATOM   8044  C  C     . PHE A 1 1058 ? -2.940  -57.317  3.715   1.00 2.85  ? 1059 PHE A C     1 
ATOM   8045  O  O     . PHE A 1 1058 ? -3.431  -57.900  4.669   1.00 2.55  ? 1059 PHE A O     1 
ATOM   8046  C  CB    . PHE A 1 1058 ? -4.927  -56.935  2.225   1.00 2.81  ? 1059 PHE A CB    1 
ATOM   8047  C  CG    . PHE A 1 1058 ? -5.057  -55.517  2.718   1.00 2.45  ? 1059 PHE A CG    1 
ATOM   8048  C  CD1   . PHE A 1 1058 ? -4.621  -54.467  1.940   1.00 2.26  ? 1059 PHE A CD1   1 
ATOM   8049  C  CD2   . PHE A 1 1058 ? -5.614  -55.247  3.952   1.00 2.00  ? 1059 PHE A CD2   1 
ATOM   8050  C  CE1   . PHE A 1 1058 ? -4.738  -53.165  2.371   1.00 2.46  ? 1059 PHE A CE1   1 
ATOM   8051  C  CE2   . PHE A 1 1058 ? -5.740  -53.954  4.400   1.00 2.47  ? 1059 PHE A CE2   1 
ATOM   8052  C  CZ    . PHE A 1 1058 ? -5.302  -52.903  3.607   1.00 2.69  ? 1059 PHE A CZ    1 
ATOM   8053  N  N     . PRO A 1 1059 ? -1.894  -56.512  3.867   1.00 3.40  ? 1060 PRO A N     1 
ATOM   8054  C  CA    . PRO A 1 1059 ? -1.258  -56.283  5.162   1.00 3.99  ? 1060 PRO A CA    1 
ATOM   8055  C  C     . PRO A 1 1059 ? -2.151  -55.466  6.087   1.00 3.90  ? 1060 PRO A C     1 
ATOM   8056  O  O     . PRO A 1 1059 ? -1.715  -54.505  6.694   1.00 4.21  ? 1060 PRO A O     1 
ATOM   8057  C  CB    . PRO A 1 1059 ? 0.019   -55.518  4.766   1.00 3.83  ? 1060 PRO A CB    1 
ATOM   8058  C  CG    . PRO A 1 1059 ? -0.416  -54.694  3.613   1.00 3.37  ? 1060 PRO A CG    1 
ATOM   8059  C  CD    . PRO A 1 1059 ? -1.237  -55.701  2.820   1.00 4.23  ? 1060 PRO A CD    1 
ATOM   8060  N  N     . GLY A 1 1060 ? -3.396  -55.897  6.234   1.00 4.06  ? 1061 GLY A N     1 
ATOM   8061  C  CA    . GLY A 1 1060 ? -4.340  -55.165  7.052   1.00 3.29  ? 1061 GLY A CA    1 
ATOM   8062  C  C     . GLY A 1 1060 ? -5.567  -56.025  7.210   1.00 3.54  ? 1061 GLY A C     1 
ATOM   8063  O  O     . GLY A 1 1060 ? -5.567  -57.210  6.800   1.00 4.47  ? 1061 GLY A O     1 
ATOM   8064  N  N     . PRO A 1 1061 ? -6.646  -55.461  7.778   1.00 2.99  ? 1062 PRO A N     1 
ATOM   8065  C  CA    . PRO A 1 1061 ? -7.895  -56.179  8.004   1.00 2.21  ? 1062 PRO A CA    1 
ATOM   8066  C  C     . PRO A 1 1061 ? -8.672  -56.424  6.736   1.00 2.19  ? 1062 PRO A C     1 
ATOM   8067  O  O     . PRO A 1 1061 ? -8.804  -55.539  5.908   1.00 2.05  ? 1062 PRO A O     1 
ATOM   8068  C  CB    . PRO A 1 1061 ? -8.664  -55.242  8.935   1.00 2.02  ? 1062 PRO A CB    1 
ATOM   8069  C  CG    . PRO A 1 1061 ? -7.630  -54.254  9.468   1.00 2.36  ? 1062 PRO A CG    1 
ATOM   8070  C  CD    . PRO A 1 1061 ? -6.739  -54.080  8.292   1.00 3.12  ? 1062 PRO A CD    1 
ATOM   8071  N  N     . SER A 1 1062 ? -9.189  -57.638  6.590   1.00 2.42  ? 1063 SER A N     1 
ATOM   8072  C  CA    . SER A 1 1062 ? -9.975  -57.987  5.426   1.00 2.25  ? 1063 SER A CA    1 
ATOM   8073  C  C     . SER A 1 1062 ? -11.368 -58.348  5.840   1.00 2.04  ? 1063 SER A C     1 
ATOM   8074  O  O     . SER A 1 1062 ? -11.557 -58.792  6.943   1.00 2.45  ? 1063 SER A O     1 
ATOM   8075  C  CB    . SER A 1 1062 ? -9.324  -59.150  4.721   1.00 2.31  ? 1063 SER A CB    1 
ATOM   8076  O  OG    . SER A 1 1062 ? -8.083  -58.662  4.276   1.00 4.10  ? 1063 SER A OG    1 
ATOM   8077  N  N     . LEU A 1 1063 ? -12.345 -58.045  5.004   1.00 2.00  ? 1064 LEU A N     1 
ATOM   8078  C  CA    . LEU A 1 1063 ? -13.716 -58.390  5.285   1.00 2.03  ? 1064 LEU A CA    1 
ATOM   8079  C  C     . LEU A 1 1063 ? -14.177 -58.964  3.971   1.00 2.23  ? 1064 LEU A C     1 
ATOM   8080  O  O     . LEU A 1 1063 ? -14.130 -58.286  2.936   1.00 2.00  ? 1064 LEU A O     1 
ATOM   8081  C  CB    . LEU A 1 1063 ? -14.604 -57.166  5.578   1.00 2.08  ? 1064 LEU A CB    1 
ATOM   8082  C  CG    . LEU A 1 1063 ? -15.788 -57.283  6.570   1.00 2.43  ? 1064 LEU A CG    1 
ATOM   8083  C  CD1   . LEU A 1 1063 ? -16.891 -56.307  6.240   1.00 2.12  ? 1064 LEU A CD1   1 
ATOM   8084  C  CD2   . LEU A 1 1063 ? -16.336 -58.660  6.662   1.00 2.00  ? 1064 LEU A CD2   1 
ATOM   8085  N  N     . VAL A 1 1064 ? -14.563 -60.230  4.006   1.00 2.00  ? 1065 VAL A N     1 
ATOM   8086  C  CA    . VAL A 1 1064 ? -15.073 -60.904  2.838   1.00 2.15  ? 1065 VAL A CA    1 
ATOM   8087  C  C     . VAL A 1 1064 ? -16.443 -61.391  3.270   1.00 2.26  ? 1065 VAL A C     1 
ATOM   8088  O  O     . VAL A 1 1064 ? -16.558 -61.971  4.363   1.00 2.98  ? 1065 VAL A O     1 
ATOM   8089  C  CB    . VAL A 1 1064 ? -14.150 -62.082  2.417   1.00 2.01  ? 1065 VAL A CB    1 
ATOM   8090  C  CG1   . VAL A 1 1064 ? -14.784 -62.857  1.268   1.00 2.16  ? 1065 VAL A CG1   1 
ATOM   8091  C  CG2   . VAL A 1 1064 ? -12.807 -61.550  1.989   1.00 2.00  ? 1065 VAL A CG2   1 
ATOM   8092  N  N     . ILE A 1 1065 ? -17.487 -61.048  2.506   1.00 2.09  ? 1066 ILE A N     1 
ATOM   8093  C  CA    . ILE A 1 1065 ? -18.867 -61.470  2.811   1.00 2.00  ? 1066 ILE A CA    1 
ATOM   8094  C  C     . ILE A 1 1065 ? -19.291 -62.334  1.663   1.00 2.00  ? 1066 ILE A C     1 
ATOM   8095  O  O     . ILE A 1 1065 ? -19.222 -61.924  0.519   1.00 2.00  ? 1066 ILE A O     1 
ATOM   8096  C  CB    . ILE A 1 1065 ? -19.871 -60.298  2.904   1.00 2.00  ? 1066 ILE A CB    1 
ATOM   8097  C  CG1   . ILE A 1 1065 ? -19.388 -59.267  3.902   1.00 2.00  ? 1066 ILE A CG1   1 
ATOM   8098  C  CG2   . ILE A 1 1065 ? -21.262 -60.787  3.354   1.00 2.00  ? 1066 ILE A CG2   1 
ATOM   8099  C  CD1   . ILE A 1 1065 ? -20.287 -58.056  3.975   1.00 2.01  ? 1066 ILE A CD1   1 
ATOM   8100  N  N     . ALA A 1 1066 ? -19.800 -63.512  1.965   1.00 2.16  ? 1067 ALA A N     1 
ATOM   8101  C  CA    . ALA A 1 1066 ? -20.174 -64.432  0.908   1.00 2.14  ? 1067 ALA A CA    1 
ATOM   8102  C  C     . ALA A 1 1066 ? -21.634 -64.784  0.998   1.00 2.16  ? 1067 ALA A C     1 
ATOM   8103  O  O     . ALA A 1 1066 ? -22.156 -64.870  2.095   1.00 2.00  ? 1067 ALA A O     1 
ATOM   8104  C  CB    . ALA A 1 1066 ? -19.317 -65.704  0.989   1.00 2.00  ? 1067 ALA A CB    1 
ATOM   8105  N  N     . TYR A 1 1067 ? -22.299 -64.927  -0.156  1.00 2.08  ? 1068 TYR A N     1 
ATOM   8106  C  CA    . TYR A 1 1067 ? -23.709 -65.316  -0.184  1.00 2.14  ? 1068 TYR A CA    1 
ATOM   8107  C  C     . TYR A 1 1067 ? -23.805 -66.819  0.130   1.00 2.14  ? 1068 TYR A C     1 
ATOM   8108  O  O     . TYR A 1 1067 ? -23.270 -67.649  -0.605  1.00 2.00  ? 1068 TYR A O     1 
ATOM   8109  C  CB    . TYR A 1 1067 ? -24.317 -65.049  -1.568  1.00 2.26  ? 1068 TYR A CB    1 
ATOM   8110  C  CG    . TYR A 1 1067 ? -25.799 -65.185  -1.592  1.00 2.00  ? 1068 TYR A CG    1 
ATOM   8111  C  CD1   . TYR A 1 1067 ? -26.598 -64.178  -1.117  1.00 2.19  ? 1068 TYR A CD1   1 
ATOM   8112  C  CD2   . TYR A 1 1067 ? -26.406 -66.314  -2.073  1.00 2.22  ? 1068 TYR A CD2   1 
ATOM   8113  C  CE1   . TYR A 1 1067 ? -28.000 -64.295  -1.118  1.00 2.51  ? 1068 TYR A CE1   1 
ATOM   8114  C  CE2   . TYR A 1 1067 ? -27.813 -66.442  -2.086  1.00 2.48  ? 1068 TYR A CE2   1 
ATOM   8115  C  CZ    . TYR A 1 1067 ? -28.569 -65.415  -1.605  1.00 2.18  ? 1068 TYR A CZ    1 
ATOM   8116  O  OH    . TYR A 1 1067 ? -29.911 -65.442  -1.633  1.00 3.38  ? 1068 TYR A OH    1 
ATOM   8117  N  N     . ALA A 1 1068 ? -24.391 -67.149  1.272   1.00 2.00  ? 1069 ALA A N     1 
ATOM   8118  C  CA    . ALA A 1 1068 ? -24.559 -68.545  1.635   1.00 2.11  ? 1069 ALA A CA    1 
ATOM   8119  C  C     . ALA A 1 1068 ? -26.017 -68.958  1.517   1.00 2.00  ? 1069 ALA A C     1 
ATOM   8120  O  O     . ALA A 1 1068 ? -26.895 -68.310  2.075   1.00 2.00  ? 1069 ALA A O     1 
ATOM   8121  C  CB    . ALA A 1 1068 ? -24.055 -68.785  3.033   1.00 2.00  ? 1069 ALA A CB    1 
ATOM   8122  N  N     . THR A 1 1069 ? -26.272 -69.997  0.744   1.00 2.00  ? 1070 THR A N     1 
ATOM   8123  C  CA    . THR A 1 1069 ? -27.623 -70.500  0.608   1.00 2.02  ? 1070 THR A CA    1 
ATOM   8124  C  C     . THR A 1 1069 ? -27.894 -71.314  1.873   1.00 2.00  ? 1070 THR A C     1 
ATOM   8125  O  O     . THR A 1 1069 ? -26.969 -71.883  2.466   1.00 2.57  ? 1070 THR A O     1 
ATOM   8126  C  CB    . THR A 1 1069 ? -27.832 -71.374  -0.677  1.00 2.00  ? 1070 THR A CB    1 
ATOM   8127  O  OG1   . THR A 1 1069 ? -26.852 -72.421  -0.738  1.00 2.00  ? 1070 THR A OG1   1 
ATOM   8128  C  CG2   . THR A 1 1069 ? -27.748 -70.549  -1.913  1.00 2.00  ? 1070 THR A CG2   1 
ATOM   8129  N  N     . CYS A 1 1070 ? -29.153 -71.385  2.280   1.00 2.00  ? 1071 CYS A N     1 
ATOM   8130  C  CA    . CYS A 1 1070 ? -29.528 -72.118  3.473   1.00 2.00  ? 1071 CYS A CA    1 
ATOM   8131  C  C     . CYS A 1 1070 ? -30.913 -72.760  3.324   1.00 2.14  ? 1071 CYS A C     1 
ATOM   8132  O  O     . CYS A 1 1070 ? -31.758 -72.273  2.566   1.00 2.01  ? 1071 CYS A O     1 
ATOM   8133  C  CB    . CYS A 1 1070 ? -29.558 -71.138  4.664   1.00 2.08  ? 1071 CYS A CB    1 
ATOM   8134  S  SG    . CYS A 1 1070 ? -29.953 -71.841  6.310   1.00 2.00  ? 1071 CYS A SG    1 
ATOM   8135  N  N     . ILE A 1 1071 ? -31.156 -73.798  4.126   1.00 2.37  ? 1072 ILE A N     1 
ATOM   8136  C  CA    . ILE A 1 1071 ? -32.433 -74.470  4.126   1.00 2.61  ? 1072 ILE A CA    1 
ATOM   8137  C  C     . ILE A 1 1071 ? -33.566 -73.558  4.599   1.00 3.57  ? 1072 ILE A C     1 
ATOM   8138  O  O     . ILE A 1 1071 ? -34.692 -73.727  4.157   1.00 3.81  ? 1072 ILE A O     1 
ATOM   8139  C  CB    . ILE A 1 1071 ? -32.425 -75.784  4.961   1.00 2.21  ? 1072 ILE A CB    1 
ATOM   8140  C  CG1   . ILE A 1 1071 ? -31.895 -75.558  6.362   1.00 2.07  ? 1072 ILE A CG1   1 
ATOM   8141  C  CG2   . ILE A 1 1071 ? -31.666 -76.877  4.248   1.00 2.00  ? 1072 ILE A CG2   1 
ATOM   8142  C  CD1   . ILE A 1 1071 ? -32.261 -76.691  7.310   1.00 2.00  ? 1072 ILE A CD1   1 
ATOM   8143  N  N     . ASN A 1 1072 ? -33.274 -72.564  5.452   1.00 4.54  ? 1073 ASN A N     1 
ATOM   8144  C  CA    . ASN A 1 1072 ? -34.292 -71.615  5.964   1.00 5.42  ? 1073 ASN A CA    1 
ATOM   8145  C  C     . ASN A 1 1072 ? -34.838 -70.729  4.830   1.00 5.01  ? 1073 ASN A C     1 
ATOM   8146  O  O     . ASN A 1 1072 ? -35.885 -70.088  4.980   1.00 4.59  ? 1073 ASN A O     1 
ATOM   8147  C  CB    . ASN A 1 1072 ? -33.701 -70.649  7.029   1.00 7.91  ? 1073 ASN A CB    1 
ATOM   8148  C  CG    . ASN A 1 1072 ? -33.444 -71.314  8.429   1.00 10.69 ? 1073 ASN A CG    1 
ATOM   8149  O  OD1   . ASN A 1 1072 ? -32.956 -70.624  9.339   1.00 11.35 ? 1073 ASN A OD1   1 
ATOM   8150  N  ND2   . ASN A 1 1072 ? -33.787 -72.617  8.605   1.00 11.30 ? 1073 ASN A ND2   1 
ATOM   8151  N  N     . GLN A 1 1073 ? -34.092 -70.656  3.724   1.00 4.37  ? 1074 GLN A N     1 
ATOM   8152  C  CA    . GLN A 1 1073 ? -34.460 -69.810  2.582   1.00 3.22  ? 1074 GLN A CA    1 
ATOM   8153  C  C     . GLN A 1 1073 ? -35.551 -70.395  1.730   1.00 2.56  ? 1074 GLN A C     1 
ATOM   8154  O  O     . GLN A 1 1073 ? -36.268 -69.683  1.050   1.00 2.00  ? 1074 GLN A O     1 
ATOM   8155  C  CB    . GLN A 1 1073 ? -33.220 -69.516  1.748   1.00 2.44  ? 1074 GLN A CB    1 
ATOM   8156  C  CG    . GLN A 1 1073 ? -32.378 -68.467  2.382   1.00 2.21  ? 1074 GLN A CG    1 
ATOM   8157  C  CD    . GLN A 1 1073 ? -30.921 -68.520  1.970   1.00 2.19  ? 1074 GLN A CD    1 
ATOM   8158  O  OE1   . GLN A 1 1073 ? -30.553 -69.102  0.944   1.00 2.00  ? 1074 GLN A OE1   1 
ATOM   8159  N  NE2   . GLN A 1 1073 ? -30.077 -67.899  2.785   1.00 2.00  ? 1074 GLN A NE2   1 
ATOM   8160  N  N     . GLY A 1 1074 ? -35.676 -71.713  1.796   1.00 2.50  ? 1075 GLY A N     1 
ATOM   8161  C  CA    . GLY A 1 1074 ? -36.703 -72.385  1.032   1.00 2.39  ? 1075 GLY A CA    1 
ATOM   8162  C  C     . GLY A 1 1074 ? -36.480 -72.521  -0.455  1.00 2.01  ? 1075 GLY A C     1 
ATOM   8163  O  O     . GLY A 1 1074 ? -37.433 -72.334  -1.184  1.00 2.35  ? 1075 GLY A O     1 
ATOM   8164  N  N     . LEU A 1 1075 ? -35.277 -72.884  -0.910  1.00 2.26  ? 1076 LEU A N     1 
ATOM   8165  C  CA    . LEU A 1 1075 ? -35.044 -73.060  -2.341  1.00 2.81  ? 1076 LEU A CA    1 
ATOM   8166  C  C     . LEU A 1 1075 ? -36.051 -74.119  -2.757  1.00 3.87  ? 1076 LEU A C     1 
ATOM   8167  O  O     . LEU A 1 1075 ? -36.082 -75.232  -2.208  1.00 3.07  ? 1076 LEU A O     1 
ATOM   8168  C  CB    . LEU A 1 1075 ? -33.603 -73.525  -2.667  1.00 2.55  ? 1076 LEU A CB    1 
ATOM   8169  C  CG    . LEU A 1 1075 ? -32.325 -72.817  -2.158  1.00 2.43  ? 1076 LEU A CG    1 
ATOM   8170  C  CD1   . LEU A 1 1075 ? -31.181 -73.036  -3.134  1.00 2.01  ? 1076 LEU A CD1   1 
ATOM   8171  C  CD2   . LEU A 1 1075 ? -32.507 -71.348  -1.878  1.00 2.38  ? 1076 LEU A CD2   1 
ATOM   8172  N  N     . ARG A 1 1076 ? -36.941 -73.716  -3.652  1.00 5.41  ? 1077 ARG A N     1 
ATOM   8173  C  CA    . ARG A 1 1076 ? -38.021 -74.558  -4.124  1.00 7.38  ? 1077 ARG A CA    1 
ATOM   8174  C  C     . ARG A 1 1076 ? -37.715 -75.811  -4.943  1.00 7.36  ? 1077 ARG A C     1 
ATOM   8175  O  O     . ARG A 1 1076 ? -38.547 -76.739  -4.972  1.00 8.13  ? 1077 ARG A O     1 
ATOM   8176  C  CB    . ARG A 1 1076 ? -39.064 -73.662  -4.764  1.00 9.84  ? 1077 ARG A CB    1 
ATOM   8177  C  CG    . ARG A 1 1076 ? -39.545 -73.964  -6.173  1.00 13.72 ? 1077 ARG A CG    1 
ATOM   8178  C  CD    . ARG A 1 1076 ? -40.320 -72.703  -6.715  1.00 16.98 ? 1077 ARG A CD    1 
ATOM   8179  N  NE    . ARG A 1 1076 ? -41.646 -72.452  -6.100  1.00 19.45 ? 1077 ARG A NE    1 
ATOM   8180  C  CZ    . ARG A 1 1076 ? -41.889 -71.860  -4.915  1.00 20.66 ? 1077 ARG A CZ    1 
ATOM   8181  N  NH1   . ARG A 1 1076 ? -40.884 -71.412  -4.127  1.00 20.29 ? 1077 ARG A NH1   1 
ATOM   8182  N  NH2   . ARG A 1 1076 ? -43.167 -71.736  -4.510  1.00 20.85 ? 1077 ARG A NH2   1 
ATOM   8183  N  N     . LYS A 1 1077 ? -36.542 -75.867  -5.580  1.00 6.87  ? 1078 LYS A N     1 
ATOM   8184  C  CA    . LYS A 1 1077 ? -36.152 -77.047  -6.353  1.00 6.77  ? 1078 LYS A CA    1 
ATOM   8185  C  C     . LYS A 1 1077 ? -35.014 -77.848  -5.677  1.00 5.22  ? 1078 LYS A C     1 
ATOM   8186  O  O     . LYS A 1 1077 ? -34.486 -78.820  -6.204  1.00 3.88  ? 1078 LYS A O     1 
ATOM   8187  C  CB    . LYS A 1 1077 ? -35.766 -76.655  -7.770  1.00 9.92  ? 1078 LYS A CB    1 
ATOM   8188  C  CG    . LYS A 1 1077 ? -36.949 -76.264  -8.635  1.00 13.23 ? 1078 LYS A CG    1 
ATOM   8189  C  CD    . LYS A 1 1077 ? -36.495 -76.088  -10.092 1.00 16.82 ? 1078 LYS A CD    1 
ATOM   8190  C  CE    . LYS A 1 1077 ? -37.573 -75.386  -10.938 1.00 19.41 ? 1078 LYS A CE    1 
ATOM   8191  N  NZ    . LYS A 1 1077 ? -37.022 -74.728  -12.164 1.00 21.50 ? 1078 LYS A NZ    1 
ATOM   8192  N  N     . GLY A 1 1078 ? -34.692 -77.433  -4.470  1.00 3.82  ? 1079 GLY A N     1 
ATOM   8193  C  CA    . GLY A 1 1078 ? -33.683 -78.109  -3.706  1.00 3.03  ? 1079 GLY A CA    1 
ATOM   8194  C  C     . GLY A 1 1078 ? -32.422 -77.299  -3.463  1.00 2.49  ? 1079 GLY A C     1 
ATOM   8195  O  O     . GLY A 1 1078 ? -32.163 -76.296  -4.138  1.00 2.14  ? 1079 GLY A O     1 
ATOM   8196  N  N     . MET A 1 1079 ? -31.648 -77.762  -2.484  1.00 2.19  ? 1080 MET A N     1 
ATOM   8197  C  CA    . MET A 1 1079 ? -30.390 -77.177  -2.135  1.00 2.00  ? 1080 MET A CA    1 
ATOM   8198  C  C     . MET A 1 1079 ? -29.381 -77.585  -3.157  1.00 2.00  ? 1080 MET A C     1 
ATOM   8199  O  O     . MET A 1 1079 ? -28.322 -77.001  -3.220  1.00 2.05  ? 1080 MET A O     1 
ATOM   8200  C  CB    . MET A 1 1079 ? -29.972 -77.575  -0.733  1.00 2.06  ? 1080 MET A CB    1 
ATOM   8201  C  CG    . MET A 1 1079 ? -30.834 -76.920  0.357   1.00 2.06  ? 1080 MET A CG    1 
ATOM   8202  S  SD    . MET A 1 1079 ? -30.634 -75.107  0.535   1.00 2.48  ? 1080 MET A SD    1 
ATOM   8203  C  CE    . MET A 1 1079 ? -28.977 -74.972  1.303   1.00 2.00  ? 1080 MET A CE    1 
ATOM   8204  N  N     . GLY A 1 1080 ? -29.757 -78.530  -4.026  1.00 2.43  ? 1081 GLY A N     1 
ATOM   8205  C  CA    . GLY A 1 1080 ? -28.885 -78.974  -5.113  1.00 2.10  ? 1081 GLY A CA    1 
ATOM   8206  C  C     . GLY A 1 1080 ? -28.727 -77.884  -6.167  1.00 2.09  ? 1081 GLY A C     1 
ATOM   8207  O  O     . GLY A 1 1080 ? -27.905 -77.985  -7.084  1.00 2.00  ? 1081 GLY A O     1 
ATOM   8208  N  N     . LYS A 1 1081 ? -29.513 -76.821  -6.008  1.00 2.19  ? 1082 LYS A N     1 
ATOM   8209  C  CA    . LYS A 1 1081 ? -29.485 -75.675  -6.901  1.00 2.44  ? 1082 LYS A CA    1 
ATOM   8210  C  C     . LYS A 1 1081 ? -28.804 -74.488  -6.246  1.00 2.00  ? 1082 LYS A C     1 
ATOM   8211  O  O     . LYS A 1 1081 ? -28.937 -73.389  -6.750  1.00 2.18  ? 1082 LYS A O     1 
ATOM   8212  C  CB    . LYS A 1 1081 ? -30.921 -75.238  -7.280  1.00 2.47  ? 1082 LYS A CB    1 
ATOM   8213  C  CG    . LYS A 1 1081 ? -31.827 -76.357  -7.753  1.00 2.75  ? 1082 LYS A CG    1 
ATOM   8214  C  CD    . LYS A 1 1081 ? -31.422 -76.882  -9.120  1.00 2.17  ? 1082 LYS A CD    1 
ATOM   8215  C  CE    . LYS A 1 1081 ? -31.499 -75.786  -10.167 1.00 2.00  ? 1082 LYS A CE    1 
ATOM   8216  N  NZ    . LYS A 1 1081 ? -31.294 -76.397  -11.515 1.00 3.28  ? 1082 LYS A NZ    1 
ATOM   8217  N  N     . SER A 1 1082 ? -28.123 -74.688  -5.125  1.00 2.00  ? 1083 SER A N     1 
ATOM   8218  C  CA    . SER A 1 1082 ? -27.473 -73.588  -4.429  1.00 2.00  ? 1083 SER A CA    1 
ATOM   8219  C  C     . SER A 1 1082 ? -26.545 -72.824  -5.340  1.00 2.60  ? 1083 SER A C     1 
ATOM   8220  O  O     . SER A 1 1082 ? -26.575 -71.588  -5.392  1.00 2.69  ? 1083 SER A O     1 
ATOM   8221  C  CB    . SER A 1 1082 ? -26.645 -74.069  -3.239  1.00 2.19  ? 1083 SER A CB    1 
ATOM   8222  O  OG    . SER A 1 1082 ? -27.452 -74.530  -2.163  1.00 2.49  ? 1083 SER A OG    1 
ATOM   8223  N  N     . GLN A 1 1083 ? -25.730 -73.555  -6.081  1.00 2.70  ? 1084 GLN A N     1 
ATOM   8224  C  CA    . GLN A 1 1083 ? -24.749 -72.909  -6.933  1.00 3.06  ? 1084 GLN A CA    1 
ATOM   8225  C  C     . GLN A 1 1083 ? -25.394 -72.085  -7.995  1.00 3.33  ? 1084 GLN A C     1 
ATOM   8226  O  O     . GLN A 1 1083 ? -24.919 -70.999  -8.337  1.00 2.78  ? 1084 GLN A O     1 
ATOM   8227  C  CB    . GLN A 1 1083 ? -23.791 -73.926  -7.529  1.00 2.67  ? 1084 GLN A CB    1 
ATOM   8228  C  CG    . GLN A 1 1083 ? -22.895 -74.560  -6.496  1.00 2.28  ? 1084 GLN A CG    1 
ATOM   8229  C  CD    . GLN A 1 1083 ? -21.827 -73.614  -5.948  1.00 2.29  ? 1084 GLN A CD    1 
ATOM   8230  O  OE1   . GLN A 1 1083 ? -21.387 -73.763  -4.807  1.00 2.09  ? 1084 GLN A OE1   1 
ATOM   8231  N  NE2   . GLN A 1 1083 ? -21.334 -72.718  -6.783  1.00 2.00  ? 1084 GLN A NE2   1 
ATOM   8232  N  N     . ASP A 1 1084 ? -26.544 -72.554  -8.442  1.00 4.12  ? 1085 ASP A N     1 
ATOM   8233  C  CA    . ASP A 1 1084 ? -27.284 -71.832  -9.462  1.00 4.38  ? 1085 ASP A CA    1 
ATOM   8234  C  C     . ASP A 1 1084 ? -27.938 -70.586  -8.838  1.00 3.52  ? 1085 ASP A C     1 
ATOM   8235  O  O     . ASP A 1 1084 ? -28.002 -69.525  -9.450  1.00 3.25  ? 1085 ASP A O     1 
ATOM   8236  C  CB    . ASP A 1 1084 ? -28.322 -72.763  -10.086 1.00 6.39  ? 1085 ASP A CB    1 
ATOM   8237  C  CG    . ASP A 1 1084 ? -29.013 -72.143  -11.294 1.00 9.26  ? 1085 ASP A CG    1 
ATOM   8238  O  OD1   . ASP A 1 1084 ? -28.284 -71.873  -12.282 1.00 11.25 ? 1085 ASP A OD1   1 
ATOM   8239  O  OD2   . ASP A 1 1084 ? -30.271 -71.914  -11.265 1.00 10.55 ? 1085 ASP A OD2   1 
ATOM   8240  N  N     . VAL A 1 1085 ? -28.374 -70.699  -7.597  1.00 2.64  ? 1086 VAL A N     1 
ATOM   8241  C  CA    . VAL A 1 1085 ? -29.009 -69.572  -6.938  1.00 2.66  ? 1086 VAL A CA    1 
ATOM   8242  C  C     . VAL A 1 1085 ? -27.960 -68.510  -6.568  1.00 2.43  ? 1086 VAL A C     1 
ATOM   8243  O  O     . VAL A 1 1085 ? -28.245 -67.299  -6.548  1.00 2.00  ? 1086 VAL A O     1 
ATOM   8244  C  CB    . VAL A 1 1085 ? -29.849 -70.064  -5.706  1.00 2.87  ? 1086 VAL A CB    1 
ATOM   8245  C  CG1   . VAL A 1 1085 ? -30.284 -68.921  -4.795  1.00 2.00  ? 1086 VAL A CG1   1 
ATOM   8246  C  CG2   . VAL A 1 1085 ? -31.068 -70.827  -6.206  1.00 2.45  ? 1086 VAL A CG2   1 
ATOM   8247  N  N     . MET A 1 1086 ? -26.743 -68.954  -6.297  1.00 2.00  ? 1087 MET A N     1 
ATOM   8248  C  CA    . MET A 1 1086 ? -25.712 -67.988  -5.985  1.00 2.27  ? 1087 MET A CA    1 
ATOM   8249  C  C     . MET A 1 1086 ? -25.391 -67.183  -7.259  1.00 2.36  ? 1087 MET A C     1 
ATOM   8250  O  O     . MET A 1 1086 ? -25.208 -65.951  -7.224  1.00 2.00  ? 1087 MET A O     1 
ATOM   8251  C  CB    . MET A 1 1086 ? -24.477 -68.664  -5.427  1.00 2.30  ? 1087 MET A CB    1 
ATOM   8252  C  CG    . MET A 1 1086 ? -24.717 -69.551  -4.220  1.00 2.39  ? 1087 MET A CG    1 
ATOM   8253  S  SD    . MET A 1 1086 ? -23.128 -70.351  -3.748  1.00 3.78  ? 1087 MET A SD    1 
ATOM   8254  C  CE    . MET A 1 1086 ? -23.468 -71.022  -2.152  1.00 2.75  ? 1087 MET A CE    1 
ATOM   8255  N  N     . ASN A 1 1087 ? -25.467 -67.873  -8.397  1.00 2.29  ? 1088 ASN A N     1 
ATOM   8256  C  CA    . ASN A 1 1087 ? -25.224 -67.272  -9.708  1.00 2.09  ? 1088 ASN A CA    1 
ATOM   8257  C  C     . ASN A 1 1087 ? -26.280 -66.197  -9.982  1.00 2.19  ? 1088 ASN A C     1 
ATOM   8258  O  O     . ASN A 1 1087 ? -25.958 -65.028  -10.235 1.00 2.00  ? 1088 ASN A O     1 
ATOM   8259  C  CB    . ASN A 1 1087 ? -25.325 -68.364  -10.756 1.00 2.00  ? 1088 ASN A CB    1 
ATOM   8260  C  CG    . ASN A 1 1087 ? -24.639 -68.009  -12.044 1.00 2.21  ? 1088 ASN A CG    1 
ATOM   8261  O  OD1   . ASN A 1 1087 ? -24.498 -68.865  -12.904 1.00 3.65  ? 1088 ASN A OD1   1 
ATOM   8262  N  ND2   . ASN A 1 1087 ? -24.182 -66.770  -12.190 1.00 2.00  ? 1088 ASN A ND2   1 
ATOM   8263  N  N     . THR A 1 1088 ? -27.544 -66.606  -9.894  1.00 2.33  ? 1089 THR A N     1 
ATOM   8264  C  CA    . THR A 1 1088 ? -28.682 -65.715  -10.125 1.00 2.53  ? 1089 THR A CA    1 
ATOM   8265  C  C     . THR A 1 1088 ? -28.716 -64.525  -9.174  1.00 2.14  ? 1089 THR A C     1 
ATOM   8266  O  O     . THR A 1 1088 ? -29.119 -63.450  -9.568  1.00 2.18  ? 1089 THR A O     1 
ATOM   8267  C  CB    . THR A 1 1088 ? -30.037 -66.491  -10.042 1.00 3.28  ? 1089 THR A CB    1 
ATOM   8268  O  OG1   . THR A 1 1088 ? -30.122 -67.415  -11.130 1.00 4.37  ? 1089 THR A OG1   1 
ATOM   8269  C  CG2   . THR A 1 1088 ? -31.248 -65.545  -10.112 1.00 3.39  ? 1089 THR A CG2   1 
ATOM   8270  N  N     . ALA A 1 1089 ? -28.307 -64.719  -7.924  1.00 2.47  ? 1090 ALA A N     1 
ATOM   8271  C  CA    . ALA A 1 1089 ? -28.279 -63.629  -6.947  1.00 2.12  ? 1090 ALA A CA    1 
ATOM   8272  C  C     . ALA A 1 1089 ? -27.343 -62.496  -7.440  1.00 2.24  ? 1090 ALA A C     1 
ATOM   8273  O  O     . ALA A 1 1089 ? -27.586 -61.313  -7.168  1.00 2.22  ? 1090 ALA A O     1 
ATOM   8274  C  CB    . ALA A 1 1089 ? -27.848 -64.134  -5.583  1.00 2.00  ? 1090 ALA A CB    1 
ATOM   8275  N  N     . VAL A 1 1090 ? -26.307 -62.853  -8.196  1.00 2.15  ? 1091 VAL A N     1 
ATOM   8276  C  CA    . VAL A 1 1090 ? -25.410 -61.846  -8.742  1.00 2.42  ? 1091 VAL A CA    1 
ATOM   8277  C  C     . VAL A 1 1090 ? -25.963 -61.233  -10.045 1.00 2.45  ? 1091 VAL A C     1 
ATOM   8278  O  O     . VAL A 1 1090 ? -26.064 -59.997  -10.195 1.00 2.60  ? 1091 VAL A O     1 
ATOM   8279  C  CB    . VAL A 1 1090 ? -23.991 -62.401  -8.983  1.00 2.36  ? 1091 VAL A CB    1 
ATOM   8280  C  CG1   . VAL A 1 1090 ? -23.079 -61.279  -9.481  1.00 2.28  ? 1091 VAL A CG1   1 
ATOM   8281  C  CG2   . VAL A 1 1090 ? -23.435 -62.970  -7.704  1.00 2.00  ? 1091 VAL A CG2   1 
ATOM   8282  N  N     . LYS A 1 1091 ? -26.394 -62.111  -10.942 1.00 2.33  ? 1092 LYS A N     1 
ATOM   8283  C  CA    . LYS A 1 1091 ? -26.923 -61.711  -12.223 1.00 2.00  ? 1092 LYS A CA    1 
ATOM   8284  C  C     . LYS A 1 1091 ? -28.169 -60.834  -12.136 1.00 2.00  ? 1092 LYS A C     1 
ATOM   8285  O  O     . LYS A 1 1091 ? -28.375 -59.988  -12.966 1.00 2.00  ? 1092 LYS A O     1 
ATOM   8286  C  CB    . LYS A 1 1091 ? -27.209 -62.963  -13.065 1.00 2.00  ? 1092 LYS A CB    1 
ATOM   8287  C  CG    . LYS A 1 1091 ? -25.933 -63.733  -13.539 1.00 2.36  ? 1092 LYS A CG    1 
ATOM   8288  C  CD    . LYS A 1 1091 ? -26.207 -64.852  -14.564 1.00 2.08  ? 1092 LYS A CD    1 
ATOM   8289  C  CE    . LYS A 1 1091 ? -27.074 -65.998  -14.008 1.00 2.51  ? 1092 LYS A CE    1 
ATOM   8290  N  NZ    . LYS A 1 1091 ? -27.471 -66.988  -15.086 1.00 3.10  ? 1092 LYS A NZ    1 
ATOM   8291  N  N     . SER A 1 1092 ? -29.020 -61.061  -11.153 1.00 2.00  ? 1093 SER A N     1 
ATOM   8292  C  CA    . SER A 1 1092 ? -30.233 -60.296  -11.021 1.00 2.00  ? 1093 SER A CA    1 
ATOM   8293  C  C     . SER A 1 1092 ? -29.920 -58.947  -10.381 1.00 2.68  ? 1093 SER A C     1 
ATOM   8294  O  O     . SER A 1 1092 ? -30.786 -58.070  -10.303 1.00 2.00  ? 1093 SER A O     1 
ATOM   8295  C  CB    . SER A 1 1092 ? -31.229 -61.043  -10.146 1.00 2.79  ? 1093 SER A CB    1 
ATOM   8296  O  OG    . SER A 1 1092 ? -30.779 -61.196  -8.802  1.00 2.45  ? 1093 SER A OG    1 
ATOM   8297  N  N     . GLY A 1 1093 ? -28.666 -58.799  -9.941  1.00 2.74  ? 1094 GLY A N     1 
ATOM   8298  C  CA    . GLY A 1 1093 ? -28.197 -57.590  -9.295  1.00 2.23  ? 1094 GLY A CA    1 
ATOM   8299  C  C     . GLY A 1 1093 ? -28.523 -57.560  -7.802  1.00 2.87  ? 1094 GLY A C     1 
ATOM   8300  O  O     . GLY A 1 1093 ? -28.306 -56.542  -7.132  1.00 3.08  ? 1094 GLY A O     1 
ATOM   8301  N  N     . TYR A 1 1094 ? -29.022 -58.679  -7.270  1.00 2.85  ? 1095 TYR A N     1 
ATOM   8302  C  CA    . TYR A 1 1094 ? -29.422 -58.806  -5.861  1.00 2.79  ? 1095 TYR A CA    1 
ATOM   8303  C  C     . TYR A 1 1094 ? -28.227 -58.769  -4.969  1.00 2.75  ? 1095 TYR A C     1 
ATOM   8304  O  O     . TYR A 1 1094 ? -28.281 -58.248  -3.886  1.00 3.16  ? 1095 TYR A O     1 
ATOM   8305  C  CB    . TYR A 1 1094 ? -30.118 -60.162  -5.659  1.00 2.70  ? 1095 TYR A CB    1 
ATOM   8306  C  CG    . TYR A 1 1094 ? -30.592 -60.447  -4.257  1.00 2.83  ? 1095 TYR A CG    1 
ATOM   8307  C  CD1   . TYR A 1 1094 ? -31.840 -60.005  -3.828  1.00 3.40  ? 1095 TYR A CD1   1 
ATOM   8308  C  CD2   . TYR A 1 1094 ? -29.847 -61.233  -3.399  1.00 2.48  ? 1095 TYR A CD2   1 
ATOM   8309  C  CE1   . TYR A 1 1094 ? -32.342 -60.350  -2.595  1.00 3.12  ? 1095 TYR A CE1   1 
ATOM   8310  C  CE2   . TYR A 1 1094 ? -30.329 -61.581  -2.161  1.00 2.71  ? 1095 TYR A CE2   1 
ATOM   8311  C  CZ    . TYR A 1 1094 ? -31.589 -61.139  -1.768  1.00 3.23  ? 1095 TYR A CZ    1 
ATOM   8312  O  OH    . TYR A 1 1094 ? -32.145 -61.486  -0.550  1.00 2.92  ? 1095 TYR A OH    1 
ATOM   8313  N  N     . TRP A 1 1095 ? -27.146 -59.379  -5.440  1.00 3.08  ? 1096 TRP A N     1 
ATOM   8314  C  CA    . TRP A 1 1095 ? -25.899 -59.501  -4.689  1.00 2.42  ? 1096 TRP A CA    1 
ATOM   8315  C  C     . TRP A 1 1095 ? -24.732 -59.174  -5.616  1.00 2.28  ? 1096 TRP A C     1 
ATOM   8316  O  O     . TRP A 1 1095 ? -24.032 -60.072  -6.074  1.00 2.00  ? 1096 TRP A O     1 
ATOM   8317  C  CB    . TRP A 1 1095 ? -25.782 -60.951  -4.178  1.00 2.31  ? 1096 TRP A CB    1 
ATOM   8318  C  CG    . TRP A 1 1095 ? -24.691 -61.186  -3.190  1.00 2.08  ? 1096 TRP A CG    1 
ATOM   8319  C  CD1   . TRP A 1 1095 ? -23.387 -61.490  -3.461  1.00 2.00  ? 1096 TRP A CD1   1 
ATOM   8320  C  CD2   . TRP A 1 1095 ? -24.813 -61.139  -1.771  1.00 2.08  ? 1096 TRP A CD2   1 
ATOM   8321  N  NE1   . TRP A 1 1095 ? -22.684 -61.631  -2.293  1.00 2.16  ? 1096 TRP A NE1   1 
ATOM   8322  C  CE2   . TRP A 1 1095 ? -23.535 -61.422  -1.235  1.00 2.21  ? 1096 TRP A CE2   1 
ATOM   8323  C  CE3   . TRP A 1 1095 ? -25.881 -60.893  -0.894  1.00 2.00  ? 1096 TRP A CE3   1 
ATOM   8324  C  CZ2   . TRP A 1 1095 ? -23.298 -61.462  0.144   1.00 2.00  ? 1096 TRP A CZ2   1 
ATOM   8325  C  CZ3   . TRP A 1 1095 ? -25.650 -60.933  0.477   1.00 2.00  ? 1096 TRP A CZ3   1 
ATOM   8326  C  CH2   . TRP A 1 1095 ? -24.371 -61.214  0.982   1.00 2.00  ? 1096 TRP A CH2   1 
ATOM   8327  N  N     . PRO A 1 1096 ? -24.496 -57.872  -5.900  1.00 2.41  ? 1097 PRO A N     1 
ATOM   8328  C  CA    . PRO A 1 1096 ? -23.380 -57.514  -6.797  1.00 2.13  ? 1097 PRO A CA    1 
ATOM   8329  C  C     . PRO A 1 1096 ? -22.042 -57.850  -6.170  1.00 2.05  ? 1097 PRO A C     1 
ATOM   8330  O  O     . PRO A 1 1096 ? -21.952 -57.955  -4.949  1.00 2.29  ? 1097 PRO A O     1 
ATOM   8331  C  CB    . PRO A 1 1096 ? -23.575 -56.013  -7.027  1.00 2.00  ? 1097 PRO A CB    1 
ATOM   8332  C  CG    . PRO A 1 1096 ? -24.260 -55.561  -5.777  1.00 2.33  ? 1097 PRO A CG    1 
ATOM   8333  C  CD    . PRO A 1 1096 ? -25.209 -56.676  -5.412  1.00 2.20  ? 1097 PRO A CD    1 
ATOM   8334  N  N     . LEU A 1 1097 ? -21.046 -58.148  -7.006  1.00 2.12  ? 1098 LEU A N     1 
ATOM   8335  C  CA    . LEU A 1 1097 ? -19.707 -58.483  -6.526  1.00 2.10  ? 1098 LEU A CA    1 
ATOM   8336  C  C     . LEU A 1 1097 ? -18.744 -57.323  -6.721  1.00 2.51  ? 1098 LEU A C     1 
ATOM   8337  O  O     . LEU A 1 1097 ? -18.694 -56.739  -7.792  1.00 3.16  ? 1098 LEU A O     1 
ATOM   8338  C  CB    . LEU A 1 1097 ? -19.157 -59.707  -7.243  1.00 2.00  ? 1098 LEU A CB    1 
ATOM   8339  C  CG    . LEU A 1 1097 ? -19.958 -60.987  -7.100  1.00 2.00  ? 1098 LEU A CG    1 
ATOM   8340  C  CD1   . LEU A 1 1097 ? -19.131 -62.161  -7.622  1.00 2.00  ? 1098 LEU A CD1   1 
ATOM   8341  C  CD2   . LEU A 1 1097 ? -20.389 -61.176  -5.654  1.00 2.00  ? 1098 LEU A CD2   1 
ATOM   8342  N  N     . PHE A 1 1098 ? -17.925 -57.039  -5.720  1.00 2.13  ? 1099 PHE A N     1 
ATOM   8343  C  CA    . PHE A 1 1098 ? -16.986 -55.951  -5.844  1.00 2.00  ? 1099 PHE A CA    1 
ATOM   8344  C  C     . PHE A 1 1098 ? -15.809 -56.130  -4.910  1.00 2.00  ? 1099 PHE A C     1 
ATOM   8345  O  O     . PHE A 1 1098 ? -15.847 -56.972  -4.046  1.00 3.10  ? 1099 PHE A O     1 
ATOM   8346  C  CB    . PHE A 1 1098 ? -17.713 -54.641  -5.550  1.00 2.00  ? 1099 PHE A CB    1 
ATOM   8347  C  CG    . PHE A 1 1098 ? -18.591 -54.686  -4.322  1.00 2.00  ? 1099 PHE A CG    1 
ATOM   8348  C  CD1   . PHE A 1 1098 ? -18.047 -54.543  -3.045  1.00 2.00  ? 1099 PHE A CD1   1 
ATOM   8349  C  CD2   . PHE A 1 1098 ? -19.974 -54.807  -4.446  1.00 2.00  ? 1099 PHE A CD2   1 
ATOM   8350  C  CE1   . PHE A 1 1098 ? -18.869 -54.513  -1.923  1.00 2.00  ? 1099 PHE A CE1   1 
ATOM   8351  C  CE2   . PHE A 1 1098 ? -20.795 -54.777  -3.335  1.00 2.00  ? 1099 PHE A CE2   1 
ATOM   8352  C  CZ    . PHE A 1 1098 ? -20.253 -54.629  -2.075  1.00 2.00  ? 1099 PHE A CZ    1 
ATOM   8353  N  N     . ARG A 1 1099 ? -14.739 -55.379  -5.113  1.00 2.11  ? 1100 ARG A N     1 
ATOM   8354  C  CA    . ARG A 1 1099 ? -13.584 -55.429  -4.241  1.00 2.00  ? 1100 ARG A CA    1 
ATOM   8355  C  C     . ARG A 1 1099 ? -13.077 -54.013  -3.910  1.00 2.54  ? 1100 ARG A C     1 
ATOM   8356  O  O     . ARG A 1 1099 ? -13.046 -53.134  -4.765  1.00 2.67  ? 1100 ARG A O     1 
ATOM   8357  C  CB    . ARG A 1 1099 ? -12.475 -56.230  -4.899  1.00 2.00  ? 1100 ARG A CB    1 
ATOM   8358  C  CG    . ARG A 1 1099 ? -12.775 -57.714  -4.970  1.00 2.06  ? 1100 ARG A CG    1 
ATOM   8359  C  CD    . ARG A 1 1099 ? -11.783 -58.391  -5.862  1.00 2.38  ? 1100 ARG A CD    1 
ATOM   8360  N  NE    . ARG A 1 1099 ? -11.967 -57.888  -7.202  1.00 2.70  ? 1100 ARG A NE    1 
ATOM   8361  C  CZ    . ARG A 1 1099 ? -11.049 -57.213  -7.871  1.00 3.67  ? 1100 ARG A CZ    1 
ATOM   8362  N  NH1   . ARG A 1 1099 ? -9.866  -56.966  -7.324  1.00 4.79  ? 1100 ARG A NH1   1 
ATOM   8363  N  NH2   . ARG A 1 1099 ? -11.333 -56.740  -9.072  1.00 4.03  ? 1100 ARG A NH2   1 
ATOM   8364  N  N     . TYR A 1 1100 ? -12.708 -53.776  -2.659  1.00 2.52  ? 1101 TYR A N     1 
ATOM   8365  C  CA    . TYR A 1 1100 ? -12.160 -52.481  -2.305  1.00 2.81  ? 1101 TYR A CA    1 
ATOM   8366  C  C     . TYR A 1 1100 ? -10.747 -52.747  -1.780  1.00 2.66  ? 1101 TYR A C     1 
ATOM   8367  O  O     . TYR A 1 1100 ? -10.570 -53.141  -0.650  1.00 3.32  ? 1101 TYR A O     1 
ATOM   8368  C  CB    . TYR A 1 1100 ? -13.032 -51.796  -1.254  1.00 2.22  ? 1101 TYR A CB    1 
ATOM   8369  C  CG    . TYR A 1 1100 ? -12.566 -50.417  -0.917  1.00 2.43  ? 1101 TYR A CG    1 
ATOM   8370  C  CD1   . TYR A 1 1100 ? -11.493 -50.226  -0.058  1.00 2.51  ? 1101 TYR A CD1   1 
ATOM   8371  C  CD2   . TYR A 1 1100 ? -13.188 -49.292  -1.463  1.00 2.29  ? 1101 TYR A CD2   1 
ATOM   8372  C  CE1   . TYR A 1 1100 ? -11.057 -48.980  0.260   1.00 2.90  ? 1101 TYR A CE1   1 
ATOM   8373  C  CE2   . TYR A 1 1100 ? -12.748 -48.016  -1.152  1.00 2.16  ? 1101 TYR A CE2   1 
ATOM   8374  C  CZ    . TYR A 1 1100 ? -11.682 -47.869  -0.283  1.00 3.20  ? 1101 TYR A CZ    1 
ATOM   8375  O  OH    . TYR A 1 1100 ? -11.235 -46.624  0.099   1.00 3.42  ? 1101 TYR A OH    1 
ATOM   8376  N  N     . ASP A 1 1101 ? -9.743  -52.473  -2.591  1.00 2.81  ? 1102 ASP A N     1 
ATOM   8377  C  CA    . ASP A 1 1101 ? -8.361  -52.740  -2.234  1.00 2.98  ? 1102 ASP A CA    1 
ATOM   8378  C  C     . ASP A 1 1101 ? -7.666  -51.420  -1.959  1.00 3.59  ? 1102 ASP A C     1 
ATOM   8379  O  O     . ASP A 1 1101 ? -7.358  -50.687  -2.893  1.00 4.84  ? 1102 ASP A O     1 
ATOM   8380  C  CB    . ASP A 1 1101 ? -7.701  -53.469  -3.412  1.00 2.68  ? 1102 ASP A CB    1 
ATOM   8381  C  CG    . ASP A 1 1101 ? -6.358  -54.096  -3.053  1.00 3.15  ? 1102 ASP A CG    1 
ATOM   8382  O  OD1   . ASP A 1 1101 ? -5.815  -53.718  -1.994  1.00 2.63  ? 1102 ASP A OD1   1 
ATOM   8383  O  OD2   . ASP A 1 1101 ? -5.860  -54.974  -3.812  1.00 3.46  ? 1102 ASP A OD2   1 
ATOM   8384  N  N     . PRO A 1 1102 ? -7.376  -51.108  -0.672  1.00 3.44  ? 1103 PRO A N     1 
ATOM   8385  C  CA    . PRO A 1 1102 ? -6.716  -49.841  -0.317  1.00 3.13  ? 1103 PRO A CA    1 
ATOM   8386  C  C     . PRO A 1 1102 ? -5.345  -49.656  -0.940  1.00 3.47  ? 1103 PRO A C     1 
ATOM   8387  O  O     . PRO A 1 1102 ? -4.916  -48.501  -1.158  1.00 3.65  ? 1103 PRO A O     1 
ATOM   8388  C  CB    . PRO A 1 1102 ? -6.637  -49.896  1.212   1.00 2.49  ? 1103 PRO A CB    1 
ATOM   8389  C  CG    . PRO A 1 1102 ? -7.739  -50.844  1.588   1.00 2.86  ? 1103 PRO A CG    1 
ATOM   8390  C  CD    . PRO A 1 1102 ? -7.648  -51.910  0.531   1.00 2.47  ? 1103 PRO A CD    1 
ATOM   8391  N  N     . ARG A 1 1103 ? -4.652  -50.760  -1.246  1.00 2.94  ? 1104 ARG A N     1 
ATOM   8392  C  CA    . ARG A 1 1103 ? -3.333  -50.602  -1.840  1.00 3.13  ? 1104 ARG A CA    1 
ATOM   8393  C  C     . ARG A 1 1103 ? -3.292  -50.013  -3.254  1.00 3.28  ? 1104 ARG A C     1 
ATOM   8394  O  O     . ARG A 1 1103 ? -2.278  -49.455  -3.665  1.00 3.04  ? 1104 ARG A O     1 
ATOM   8395  C  CB    . ARG A 1 1103 ? -2.420  -51.828  -1.658  1.00 2.67  ? 1104 ARG A CB    1 
ATOM   8396  C  CG    . ARG A 1 1103 ? -2.792  -53.129  -2.309  1.00 2.65  ? 1104 ARG A CG    1 
ATOM   8397  C  CD    . ARG A 1 1103 ? -3.209  -54.091  -1.225  1.00 2.65  ? 1104 ARG A CD    1 
ATOM   8398  N  NE    . ARG A 1 1103 ? -2.672  -55.444  -1.280  1.00 2.32  ? 1104 ARG A NE    1 
ATOM   8399  C  CZ    . ARG A 1 1103 ? -3.395  -56.554  -1.453  1.00 2.78  ? 1104 ARG A CZ    1 
ATOM   8400  N  NH1   . ARG A 1 1103 ? -4.726  -56.533  -1.662  1.00 2.28  ? 1104 ARG A NH1   1 
ATOM   8401  N  NH2   . ARG A 1 1103 ? -2.811  -57.698  -1.183  1.00 2.00  ? 1104 ARG A NH2   1 
ATOM   8402  N  N     . LEU A 1 1104 ? -4.408  -50.093  -3.971  1.00 3.24  ? 1105 LEU A N     1 
ATOM   8403  C  CA    . LEU A 1 1104 ? -4.474  -49.472  -5.271  1.00 3.49  ? 1105 LEU A CA    1 
ATOM   8404  C  C     . LEU A 1 1104 ? -4.583  -47.974  -5.085  1.00 4.51  ? 1105 LEU A C     1 
ATOM   8405  O  O     . LEU A 1 1104 ? -4.118  -47.214  -5.935  1.00 4.09  ? 1105 LEU A O     1 
ATOM   8406  C  CB    . LEU A 1 1104 ? -5.718  -49.891  -5.997  1.00 3.70  ? 1105 LEU A CB    1 
ATOM   8407  C  CG    . LEU A 1 1104 ? -5.833  -51.379  -6.262  1.00 3.30  ? 1105 LEU A CG    1 
ATOM   8408  C  CD1   . LEU A 1 1104 ? -7.034  -51.670  -7.155  1.00 2.52  ? 1105 LEU A CD1   1 
ATOM   8409  C  CD2   . LEU A 1 1104 ? -4.560  -51.799  -6.926  1.00 3.96  ? 1105 LEU A CD2   1 
ATOM   8410  N  N     . ALA A 1 1105 ? -5.197  -47.571  -3.966  1.00 5.71  ? 1106 ALA A N     1 
ATOM   8411  C  CA    . ALA A 1 1105 ? -5.448  -46.159  -3.641  1.00 7.57  ? 1106 ALA A CA    1 
ATOM   8412  C  C     . ALA A 1 1105 ? -4.157  -45.480  -3.395  1.00 8.88  ? 1106 ALA A C     1 
ATOM   8413  O  O     . ALA A 1 1105 ? -4.028  -44.298  -3.608  1.00 9.68  ? 1106 ALA A O     1 
ATOM   8414  C  CB    . ALA A 1 1105 ? -6.334  -46.033  -2.399  1.00 7.14  ? 1106 ALA A CB    1 
ATOM   8415  N  N     . ALA A 1 1106 ? -3.190  -46.279  -2.977  1.00 11.09 ? 1107 ALA A N     1 
ATOM   8416  C  CA    . ALA A 1 1106 ? -1.830  -45.848  -2.664  1.00 12.58 ? 1107 ALA A CA    1 
ATOM   8417  C  C     . ALA A 1 1106 ? -0.960  -45.702  -3.939  1.00 13.73 ? 1107 ALA A C     1 
ATOM   8418  O  O     . ALA A 1 1106 ? 0.167   -45.195  -3.880  1.00 14.88 ? 1107 ALA A O     1 
ATOM   8419  C  CB    . ALA A 1 1106 ? -1.192  -46.885  -1.662  1.00 12.16 ? 1107 ALA A CB    1 
ATOM   8420  N  N     . GLN A 1 1107 ? -1.477  -46.189  -5.067  1.00 14.93 ? 1108 GLN A N     1 
ATOM   8421  C  CA    . GLN A 1 1107 ? -0.811  -46.132  -6.384  1.00 15.67 ? 1108 GLN A CA    1 
ATOM   8422  C  C     . GLN A 1 1107 ? -1.601  -45.182  -7.256  1.00 15.17 ? 1108 GLN A C     1 
ATOM   8423  O  O     . GLN A 1 1107 ? -1.496  -45.269  -8.493  1.00 15.55 ? 1108 GLN A O     1 
ATOM   8424  C  CB    . GLN A 1 1107 ? -0.892  -47.495  -7.123  1.00 17.40 ? 1108 GLN A CB    1 
ATOM   8425  C  CG    . GLN A 1 1107 ? -0.242  -48.694  -6.466  1.00 19.58 ? 1108 GLN A CG    1 
ATOM   8426  C  CD    . GLN A 1 1107 ? -0.554  -50.002  -7.187  1.00 21.87 ? 1108 GLN A CD    1 
ATOM   8427  O  OE1   . GLN A 1 1107 ? -0.143  -51.066  -6.723  1.00 23.93 ? 1108 GLN A OE1   1 
ATOM   8428  N  NE2   . GLN A 1 1107 ? -1.282  -49.940  -8.316  1.00 22.20 ? 1108 GLN A NE2   1 
ATOM   8429  N  N     . GLY A 1 1108 ? -2.542  -44.452  -6.647  1.00 14.24 ? 1109 GLY A N     1 
ATOM   8430  C  CA    . GLY A 1 1108 ? -3.358  -43.518  -7.400  1.00 13.07 ? 1109 GLY A CA    1 
ATOM   8431  C  C     . GLY A 1 1108 ? -4.499  -44.147  -8.167  1.00 12.22 ? 1109 GLY A C     1 
ATOM   8432  O  O     . GLY A 1 1108 ? -5.203  -43.454  -8.875  1.00 12.81 ? 1109 GLY A O     1 
ATOM   8433  N  N     . LYS A 1 1109 ? -4.685  -45.455  -8.017  1.00 11.91 ? 1110 LYS A N     1 
ATOM   8434  C  CA    . LYS A 1 1109 ? -5.754  -46.208  -8.668  1.00 10.71 ? 1110 LYS A CA    1 
ATOM   8435  C  C     . LYS A 1 1109 ? -7.036  -46.130  -7.817  1.00 9.67  ? 1110 LYS A C     1 
ATOM   8436  O  O     . LYS A 1 1109 ? -6.975  -45.838  -6.617  1.00 9.36  ? 1110 LYS A O     1 
ATOM   8437  C  CB    . LYS A 1 1109 ? -5.338  -47.683  -8.752  1.00 12.91 ? 1110 LYS A CB    1 
ATOM   8438  C  CG    . LYS A 1 1109 ? -4.735  -48.164  -10.068 1.00 14.42 ? 1110 LYS A CG    1 
ATOM   8439  C  CD    . LYS A 1 1109 ? -3.353  -47.644  -10.307 1.00 16.48 ? 1110 LYS A CD    1 
ATOM   8440  C  CE    . LYS A 1 1109 ? -2.915  -48.031  -11.708 1.00 18.37 ? 1110 LYS A CE    1 
ATOM   8441  N  NZ    . LYS A 1 1109 ? -1.636  -47.369  -12.113 1.00 20.52 ? 1110 LYS A NZ    1 
ATOM   8442  N  N     . ASN A 1 1110 ? -8.198  -46.381  -8.419  1.00 8.01  ? 1111 ASN A N     1 
ATOM   8443  C  CA    . ASN A 1 1110 ? -9.455  -46.385  -7.668  1.00 6.50  ? 1111 ASN A CA    1 
ATOM   8444  C  C     . ASN A 1 1110 ? -9.457  -47.713  -6.941  1.00 6.01  ? 1111 ASN A C     1 
ATOM   8445  O  O     . ASN A 1 1110 ? -9.231  -48.753  -7.561  1.00 6.39  ? 1111 ASN A O     1 
ATOM   8446  C  CB    . ASN A 1 1110 ? -10.634 -46.345  -8.617  1.00 6.05  ? 1111 ASN A CB    1 
ATOM   8447  C  CG    . ASN A 1 1110 ? -11.960 -46.070  -7.915  1.00 6.35  ? 1111 ASN A CG    1 
ATOM   8448  O  OD1   . ASN A 1 1110 ? -12.992 -46.001  -8.566  1.00 6.97  ? 1111 ASN A OD1   1 
ATOM   8449  N  ND2   . ASN A 1 1110 ? -11.943 -45.885  -6.614  1.00 5.02  ? 1111 ASN A ND2   1 
ATOM   8450  N  N     . PRO A 1 1111 ? -9.577  -47.690  -5.597  1.00 5.08  ? 1112 PRO A N     1 
ATOM   8451  C  CA    . PRO A 1 1111 ? -9.591  -48.942  -4.803  1.00 4.33  ? 1112 PRO A CA    1 
ATOM   8452  C  C     . PRO A 1 1111 ? -10.819 -49.804  -5.022  1.00 3.75  ? 1112 PRO A C     1 
ATOM   8453  O  O     . PRO A 1 1111 ? -10.744 -51.007  -4.875  1.00 3.79  ? 1112 PRO A O     1 
ATOM   8454  C  CB    . PRO A 1 1111 ? -9.487  -48.449  -3.361  1.00 4.51  ? 1112 PRO A CB    1 
ATOM   8455  C  CG    . PRO A 1 1111 ? -9.920  -46.996  -3.414  1.00 3.89  ? 1112 PRO A CG    1 
ATOM   8456  C  CD    . PRO A 1 1111 ? -9.384  -46.508  -4.734  1.00 4.24  ? 1112 PRO A CD    1 
ATOM   8457  N  N     . PHE A 1 1112 ? -11.925 -49.167  -5.431  1.00 3.38  ? 1113 PHE A N     1 
ATOM   8458  C  CA    . PHE A 1 1112 ? -13.184 -49.847  -5.716  1.00 2.65  ? 1113 PHE A CA    1 
ATOM   8459  C  C     . PHE A 1 1112 ? -13.301 -50.413  -7.123  1.00 2.66  ? 1113 PHE A C     1 
ATOM   8460  O  O     . PHE A 1 1112 ? -13.316 -49.683  -8.124  1.00 2.16  ? 1113 PHE A O     1 
ATOM   8461  C  CB    . PHE A 1 1112 ? -14.367 -48.939  -5.479  1.00 2.35  ? 1113 PHE A CB    1 
ATOM   8462  C  CG    . PHE A 1 1112 ? -15.653 -49.684  -5.419  1.00 2.85  ? 1113 PHE A CG    1 
ATOM   8463  C  CD1   . PHE A 1 1112 ? -15.993 -50.406  -4.277  1.00 2.22  ? 1113 PHE A CD1   1 
ATOM   8464  C  CD2   . PHE A 1 1112 ? -16.512 -49.728  -6.521  1.00 2.69  ? 1113 PHE A CD2   1 
ATOM   8465  C  CE1   . PHE A 1 1112 ? -17.179 -51.158  -4.251  1.00 2.87  ? 1113 PHE A CE1   1 
ATOM   8466  C  CE2   . PHE A 1 1112 ? -17.688 -50.481  -6.477  1.00 2.83  ? 1113 PHE A CE2   1 
ATOM   8467  C  CZ    . PHE A 1 1112 ? -18.015 -51.189  -5.346  1.00 2.00  ? 1113 PHE A CZ    1 
ATOM   8468  N  N     . GLN A 1 1113 ? -13.410 -51.731  -7.169  1.00 3.05  ? 1114 GLN A N     1 
ATOM   8469  C  CA    . GLN A 1 1113 ? -13.544 -52.476  -8.413  1.00 3.83  ? 1114 GLN A CA    1 
ATOM   8470  C  C     . GLN A 1 1113 ? -14.883 -53.272  -8.422  1.00 3.38  ? 1114 GLN A C     1 
ATOM   8471  O  O     . GLN A 1 1113 ? -15.099 -54.093  -7.544  1.00 3.51  ? 1114 GLN A O     1 
ATOM   8472  C  CB    . GLN A 1 1113 ? -12.376 -53.455  -8.510  1.00 4.99  ? 1114 GLN A CB    1 
ATOM   8473  C  CG    . GLN A 1 1113 ? -10.991 -52.799  -8.336  1.00 6.34  ? 1114 GLN A CG    1 
ATOM   8474  C  CD    . GLN A 1 1113 ? -9.898  -53.798  -7.833  1.00 6.58  ? 1114 GLN A CD    1 
ATOM   8475  O  OE1   . GLN A 1 1113 ? -9.234  -54.462  -8.621  1.00 6.12  ? 1114 GLN A OE1   1 
ATOM   8476  N  NE2   . GLN A 1 1113 ? -9.694  -53.847  -6.515  1.00 6.85  ? 1114 GLN A NE2   1 
ATOM   8477  N  N     . LEU A 1 1114 ? -15.786 -52.976  -9.364  1.00 2.90  ? 1115 LEU A N     1 
ATOM   8478  C  CA    . LEU A 1 1114 ? -17.056 -53.696  -9.490  1.00 2.68  ? 1115 LEU A CA    1 
ATOM   8479  C  C     . LEU A 1 1114 ? -16.809 -54.939  -10.345 1.00 3.00  ? 1115 LEU A C     1 
ATOM   8480  O  O     . LEU A 1 1114 ? -16.330 -54.836  -11.481 1.00 2.48  ? 1115 LEU A O     1 
ATOM   8481  C  CB    . LEU A 1 1114 ? -18.146 -52.848  -10.159 1.00 2.20  ? 1115 LEU A CB    1 
ATOM   8482  C  CG    . LEU A 1 1114 ? -19.482 -52.687  -9.420  1.00 2.23  ? 1115 LEU A CG    1 
ATOM   8483  C  CD1   . LEU A 1 1114 ? -20.490 -52.171  -10.392 1.00 2.00  ? 1115 LEU A CD1   1 
ATOM   8484  C  CD2   . LEU A 1 1114 ? -19.960 -53.952  -8.767  1.00 2.00  ? 1115 LEU A CD2   1 
ATOM   8485  N  N     . ASP A 1 1115 ? -17.158 -56.103  -9.794  1.00 3.24  ? 1116 ASP A N     1 
ATOM   8486  C  CA    . ASP A 1 1115 ? -16.962 -57.377  -10.466 1.00 3.59  ? 1116 ASP A CA    1 
ATOM   8487  C  C     . ASP A 1 1115 ? -18.156 -58.009  -11.167 1.00 4.11  ? 1116 ASP A C     1 
ATOM   8488  O  O     . ASP A 1 1115 ? -17.982 -59.018  -11.880 1.00 5.22  ? 1116 ASP A O     1 
ATOM   8489  C  CB    . ASP A 1 1115 ? -16.401 -58.390  -9.487  1.00 3.05  ? 1116 ASP A CB    1 
ATOM   8490  C  CG    . ASP A 1 1115 ? -15.016 -58.060  -9.053  1.00 2.78  ? 1116 ASP A CG    1 
ATOM   8491  O  OD1   . ASP A 1 1115 ? -14.245 -57.533  -9.865  1.00 2.00  ? 1116 ASP A OD1   1 
ATOM   8492  O  OD2   . ASP A 1 1115 ? -14.704 -58.352  -7.885  1.00 3.60  ? 1116 ASP A OD2   1 
ATOM   8493  N  N     . SER A 1 1116 ? -19.361 -57.514  -10.910 1.00 3.98  ? 1117 SER A N     1 
ATOM   8494  C  CA    . SER A 1 1116 ? -20.515 -58.086  -11.576 1.00 3.74  ? 1117 SER A CA    1 
ATOM   8495  C  C     . SER A 1 1116 ? -21.177 -57.040  -12.436 1.00 4.30  ? 1117 SER A C     1 
ATOM   8496  O  O     . SER A 1 1116 ? -20.853 -55.853  -12.389 1.00 4.83  ? 1117 SER A O     1 
ATOM   8497  C  CB    . SER A 1 1116 ? -21.488 -58.714  -10.593 1.00 3.07  ? 1117 SER A CB    1 
ATOM   8498  O  OG    . SER A 1 1116 ? -22.028 -57.732  -9.751  1.00 3.23  ? 1117 SER A OG    1 
ATOM   8499  N  N     . LYS A 1 1117 ? -22.047 -57.507  -13.303 1.00 5.31  ? 1118 LYS A N     1 
ATOM   8500  C  CA    . LYS A 1 1117 ? -22.731 -56.647  -14.243 1.00 5.92  ? 1118 LYS A CA    1 
ATOM   8501  C  C     . LYS A 1 1117 ? -24.022 -56.131  -13.680 1.00 4.97  ? 1118 LYS A C     1 
ATOM   8502  O  O     . LYS A 1 1117 ? -24.433 -56.513  -12.594 1.00 4.44  ? 1118 LYS A O     1 
ATOM   8503  C  CB    . LYS A 1 1117 ? -22.966 -57.402  -15.567 1.00 8.03  ? 1118 LYS A CB    1 
ATOM   8504  C  CG    . LYS A 1 1117 ? -21.711 -58.147  -16.059 1.00 10.71 ? 1118 LYS A CG    1 
ATOM   8505  C  CD    . LYS A 1 1117 ? -21.257 -57.762  -17.468 1.00 13.61 ? 1118 LYS A CD    1 
ATOM   8506  C  CE    . LYS A 1 1117 ? -21.966 -58.580  -18.557 1.00 15.98 ? 1118 LYS A CE    1 
ATOM   8507  N  NZ    . LYS A 1 1117 ? -21.229 -58.500  -19.882 1.00 17.66 ? 1118 LYS A NZ    1 
ATOM   8508  N  N     . ALA A 1 1118 ? -24.660 -55.260  -14.445 1.00 4.49  ? 1119 ALA A N     1 
ATOM   8509  C  CA    . ALA A 1 1118 ? -25.905 -54.617  -14.029 1.00 4.16  ? 1119 ALA A CA    1 
ATOM   8510  C  C     . ALA A 1 1118 ? -27.060 -55.603  -13.940 1.00 3.37  ? 1119 ALA A C     1 
ATOM   8511  O  O     . ALA A 1 1118 ? -27.119 -56.580  -14.657 1.00 3.56  ? 1119 ALA A O     1 
ATOM   8512  C  CB    . ALA A 1 1118 ? -26.235 -53.428  -14.965 1.00 3.04  ? 1119 ALA A CB    1 
ATOM   8513  N  N     . PRO A 1 1119 ? -28.024 -55.308  -13.083 1.00 3.10  ? 1120 PRO A N     1 
ATOM   8514  C  CA    . PRO A 1 1119 ? -29.191 -56.157  -12.877 1.00 3.46  ? 1120 PRO A CA    1 
ATOM   8515  C  C     . PRO A 1 1119 ? -29.755 -56.649  -14.179 1.00 3.98  ? 1120 PRO A C     1 
ATOM   8516  O  O     . PRO A 1 1119 ? -30.098 -55.845  -15.038 1.00 4.14  ? 1120 PRO A O     1 
ATOM   8517  C  CB    . PRO A 1 1119 ? -30.140 -55.219  -12.168 1.00 2.61  ? 1120 PRO A CB    1 
ATOM   8518  C  CG    . PRO A 1 1119 ? -29.169 -54.422  -11.318 1.00 2.16  ? 1120 PRO A CG    1 
ATOM   8519  C  CD    . PRO A 1 1119 ? -28.148 -54.053  -12.330 1.00 2.00  ? 1120 PRO A CD    1 
ATOM   8520  N  N     . ASP A 1 1120 ? -29.857 -57.962  -14.350 1.00 4.66  ? 1121 ASP A N     1 
ATOM   8521  C  CA    . ASP A 1 1120 ? -30.385 -58.431  -15.611 1.00 5.32  ? 1121 ASP A CA    1 
ATOM   8522  C  C     . ASP A 1 1120 ? -31.885 -58.363  -15.702 1.00 5.45  ? 1121 ASP A C     1 
ATOM   8523  O  O     . ASP A 1 1120 ? -32.443 -58.463  -16.788 1.00 6.09  ? 1121 ASP A O     1 
ATOM   8524  C  CB    . ASP A 1 1120 ? -29.896 -59.823  -15.965 1.00 6.50  ? 1121 ASP A CB    1 
ATOM   8525  C  CG    . ASP A 1 1120 ? -30.268 -60.879  -14.934 1.00 7.39  ? 1121 ASP A CG    1 
ATOM   8526  O  OD1   . ASP A 1 1120 ? -31.158 -60.695  -14.074 1.00 7.82  ? 1121 ASP A OD1   1 
ATOM   8527  O  OD2   . ASP A 1 1120 ? -29.630 -61.940  -15.006 1.00 9.52  ? 1121 ASP A OD2   1 
ATOM   8528  N  N     . GLY A 1 1121 ? -32.544 -58.143  -14.576 1.00 5.28  ? 1122 GLY A N     1 
ATOM   8529  C  CA    . GLY A 1 1121 ? -33.994 -58.078  -14.608 1.00 5.32  ? 1122 GLY A CA    1 
ATOM   8530  C  C     . GLY A 1 1121 ? -34.680 -59.397  -14.264 1.00 4.89  ? 1122 GLY A C     1 
ATOM   8531  O  O     . GLY A 1 1121 ? -35.826 -59.628  -14.655 1.00 5.56  ? 1122 GLY A O     1 
ATOM   8532  N  N     . SER A 1 1122 ? -33.996 -60.259  -13.524 1.00 4.20  ? 1123 SER A N     1 
ATOM   8533  C  CA    . SER A 1 1122 ? -34.606 -61.489  -13.116 1.00 4.01  ? 1123 SER A CA    1 
ATOM   8534  C  C     . SER A 1 1122 ? -34.835 -61.574  -11.621 1.00 4.23  ? 1123 SER A C     1 
ATOM   8535  O  O     . SER A 1 1122 ? -35.053 -62.681  -11.142 1.00 5.43  ? 1123 SER A O     1 
ATOM   8536  C  CB    . SER A 1 1122 ? -33.766 -62.682  -13.533 1.00 4.03  ? 1123 SER A CB    1 
ATOM   8537  O  OG    . SER A 1 1122 ? -32.474 -62.623  -12.944 1.00 5.19  ? 1123 SER A OG    1 
ATOM   8538  N  N     . VAL A 1 1123 ? -34.798 -60.466  -10.880 1.00 3.53  ? 1124 VAL A N     1 
ATOM   8539  C  CA    . VAL A 1 1123 ? -35.009 -60.538  -9.429  1.00 3.32  ? 1124 VAL A CA    1 
ATOM   8540  C  C     . VAL A 1 1123 ? -36.326 -61.222  -9.078  1.00 3.57  ? 1124 VAL A C     1 
ATOM   8541  O  O     . VAL A 1 1123 ? -36.397 -61.992  -8.131  1.00 3.42  ? 1124 VAL A O     1 
ATOM   8542  C  CB    . VAL A 1 1123 ? -35.184 -59.168  -8.713  1.00 3.24  ? 1124 VAL A CB    1 
ATOM   8543  C  CG1   . VAL A 1 1123 ? -34.538 -59.208  -7.313  1.00 2.00  ? 1124 VAL A CG1   1 
ATOM   8544  C  CG2   . VAL A 1 1123 ? -34.819 -57.992  -9.592  1.00 2.53  ? 1124 VAL A CG2   1 
ATOM   8545  N  N     . GLU A 1 1124 ? -37.388 -60.844  -9.776  1.00 3.99  ? 1125 GLU A N     1 
ATOM   8546  C  CA    . GLU A 1 1124 ? -38.711 -61.387  -9.504  1.00 4.96  ? 1125 GLU A CA    1 
ATOM   8547  C  C     . GLU A 1 1124 ? -38.733 -62.918  -9.510  1.00 4.77  ? 1125 GLU A C     1 
ATOM   8548  O  O     . GLU A 1 1124 ? -39.278 -63.514  -8.607  1.00 5.41  ? 1125 GLU A O     1 
ATOM   8549  C  CB    . GLU A 1 1124 ? -39.701 -60.799  -10.499 1.00 5.63  ? 1125 GLU A CB    1 
ATOM   8550  C  CG    . GLU A 1 1124 ? -41.038 -61.463  -10.522 1.00 8.08  ? 1125 GLU A CG    1 
ATOM   8551  C  CD    . GLU A 1 1124 ? -41.873 -61.289  -9.262  1.00 9.64  ? 1125 GLU A CD    1 
ATOM   8552  O  OE1   . GLU A 1 1124 ? -41.589 -60.388  -8.430  1.00 10.83 ? 1125 GLU A OE1   1 
ATOM   8553  O  OE2   . GLU A 1 1124 ? -42.862 -62.047  -9.150  1.00 10.32 ? 1125 GLU A OE2   1 
ATOM   8554  N  N     . GLU A 1 1125 ? -38.100 -63.528  -10.508 1.00 4.99  ? 1126 GLU A N     1 
ATOM   8555  C  CA    . GLU A 1 1125 ? -37.995 -64.978  -10.645 1.00 5.94  ? 1126 GLU A CA    1 
ATOM   8556  C  C     . GLU A 1 1125 ? -37.067 -65.524  -9.550  1.00 5.20  ? 1126 GLU A C     1 
ATOM   8557  O  O     . GLU A 1 1125 ? -37.362 -66.587  -8.974  1.00 5.33  ? 1126 GLU A O     1 
ATOM   8558  C  CB    . GLU A 1 1125 ? -37.427 -65.348  -12.031 1.00 8.33  ? 1126 GLU A CB    1 
ATOM   8559  C  CG    . GLU A 1 1125 ? -37.323 -66.841  -12.338 0.01 11.55 ? 1126 GLU A CG    1 
ATOM   8560  C  CD    . GLU A 1 1125 ? -36.509 -67.125  -13.596 0.01 13.30 ? 1126 GLU A CD    1 
ATOM   8561  O  OE1   . GLU A 1 1125 ? -35.262 -67.077  -13.521 0.01 14.42 ? 1126 GLU A OE1   1 
ATOM   8562  O  OE2   . GLU A 1 1125 ? -37.112 -67.402  -14.656 0.01 14.44 ? 1126 GLU A OE2   1 
ATOM   8563  N  N     . PHE A 1 1126 ? -35.966 -64.801  -9.267  1.00 3.67  ? 1127 PHE A N     1 
ATOM   8564  C  CA    . PHE A 1 1126 ? -34.988 -65.154  -8.228  1.00 2.63  ? 1127 PHE A CA    1 
ATOM   8565  C  C     . PHE A 1 1126 ? -35.603 -65.223  -6.834  1.00 2.71  ? 1127 PHE A C     1 
ATOM   8566  O  O     . PHE A 1 1126 ? -35.255 -66.123  -6.044  1.00 2.50  ? 1127 PHE A O     1 
ATOM   8567  C  CB    . PHE A 1 1126 ? -33.856 -64.128  -8.192  1.00 2.71  ? 1127 PHE A CB    1 
ATOM   8568  C  CG    . PHE A 1 1126 ? -32.930 -64.271  -7.003  1.00 2.26  ? 1127 PHE A CG    1 
ATOM   8569  C  CD1   . PHE A 1 1126 ? -32.041 -65.343  -6.903  1.00 2.31  ? 1127 PHE A CD1   1 
ATOM   8570  C  CD2   . PHE A 1 1126 ? -33.003 -63.376  -5.960  1.00 2.00  ? 1127 PHE A CD2   1 
ATOM   8571  C  CE1   . PHE A 1 1126 ? -31.256 -65.510  -5.764  1.00 2.29  ? 1127 PHE A CE1   1 
ATOM   8572  C  CE2   . PHE A 1 1126 ? -32.230 -63.538  -4.841  1.00 2.00  ? 1127 PHE A CE2   1 
ATOM   8573  C  CZ    . PHE A 1 1126 ? -31.357 -64.604  -4.734  1.00 2.14  ? 1127 PHE A CZ    1 
ATOM   8574  N  N     . LEU A 1 1127 ? -36.516 -64.282  -6.554  1.00 2.00  ? 1128 LEU A N     1 
ATOM   8575  C  CA    . LEU A 1 1127 ? -37.196 -64.198  -5.267  1.00 2.31  ? 1128 LEU A CA    1 
ATOM   8576  C  C     . LEU A 1 1127 ? -38.309 -65.235  -5.113  1.00 2.40  ? 1128 LEU A C     1 
ATOM   8577  O  O     . LEU A 1 1127 ? -38.466 -65.843  -4.070  1.00 2.44  ? 1128 LEU A O     1 
ATOM   8578  C  CB    . LEU A 1 1127 ? -37.805 -62.811  -5.075  1.00 2.00  ? 1128 LEU A CB    1 
ATOM   8579  C  CG    . LEU A 1 1127 ? -36.889 -61.591  -5.055  1.00 2.00  ? 1128 LEU A CG    1 
ATOM   8580  C  CD1   . LEU A 1 1127 ? -37.732 -60.384  -4.820  1.00 2.01  ? 1128 LEU A CD1   1 
ATOM   8581  C  CD2   . LEU A 1 1127 ? -35.834 -61.687  -3.995  1.00 2.00  ? 1128 LEU A CD2   1 
ATOM   8582  N  N     . MET A 1 1128 ? -39.097 -65.389  -6.162  1.00 2.94  ? 1129 MET A N     1 
ATOM   8583  C  CA    . MET A 1 1128 ? -40.209 -66.299  -6.194  1.00 2.96  ? 1129 MET A CA    1 
ATOM   8584  C  C     . MET A 1 1128 ? -39.766 -67.739  -6.182  1.00 3.36  ? 1129 MET A C     1 
ATOM   8585  O  O     . MET A 1 1128 ? -40.568 -68.633  -5.898  1.00 4.08  ? 1129 MET A O     1 
ATOM   8586  C  CB    . MET A 1 1128 ? -41.068 -66.004  -7.421  1.00 3.77  ? 1129 MET A CB    1 
ATOM   8587  C  CG    . MET A 1 1128 ? -42.016 -64.826  -7.260  1.00 4.87  ? 1129 MET A CG    1 
ATOM   8588  S  SD    . MET A 1 1128 ? -43.250 -65.175  -5.943  1.00 8.06  ? 1129 MET A SD    1 
ATOM   8589  C  CE    . MET A 1 1128 ? -42.637 -64.168  -4.795  1.00 6.00  ? 1129 MET A CE    1 
ATOM   8590  N  N     . ALA A 1 1129 ? -38.488 -67.984  -6.434  1.00 3.33  ? 1130 ALA A N     1 
ATOM   8591  C  CA    . ALA A 1 1129 ? -37.981 -69.364  -6.408  1.00 3.04  ? 1130 ALA A CA    1 
ATOM   8592  C  C     . ALA A 1 1129 ? -37.489 -69.727  -4.991  1.00 2.86  ? 1130 ALA A C     1 
ATOM   8593  O  O     . ALA A 1 1129 ? -36.877 -70.788  -4.764  1.00 2.38  ? 1130 ALA A O     1 
ATOM   8594  C  CB    . ALA A 1 1129 ? -36.855 -69.586  -7.462  1.00 2.69  ? 1130 ALA A CB    1 
ATOM   8595  N  N     . GLN A 1 1130 ? -37.736 -68.832  -4.046  1.00 2.00  ? 1131 GLN A N     1 
ATOM   8596  C  CA    . GLN A 1 1130 ? -37.345 -69.123  -2.694  1.00 2.24  ? 1131 GLN A CA    1 
ATOM   8597  C  C     . GLN A 1 1130 ? -38.578 -68.958  -1.846  1.00 2.31  ? 1131 GLN A C     1 
ATOM   8598  O  O     . GLN A 1 1130 ? -39.278 -67.960  -1.966  1.00 2.54  ? 1131 GLN A O     1 
ATOM   8599  C  CB    . GLN A 1 1130 ? -36.244 -68.196  -2.235  1.00 2.00  ? 1131 GLN A CB    1 
ATOM   8600  C  CG    . GLN A 1 1130 ? -35.003 -68.299  -3.032  1.00 2.00  ? 1131 GLN A CG    1 
ATOM   8601  C  CD    . GLN A 1 1130 ? -34.078 -67.162  -2.664  1.00 2.61  ? 1131 GLN A CD    1 
ATOM   8602  O  OE1   . GLN A 1 1130 ? -33.640 -67.043  -1.493  1.00 2.66  ? 1131 GLN A OE1   1 
ATOM   8603  N  NE2   . GLN A 1 1130 ? -33.797 -66.291  -3.630  1.00 2.00  ? 1131 GLN A NE2   1 
ATOM   8604  N  N     . ASN A 1 1131 ? -38.821 -69.906  -0.949  1.00 2.28  ? 1132 ASN A N     1 
ATOM   8605  C  CA    . ASN A 1 1131 ? -40.020 -69.826  -0.138  1.00 2.14  ? 1132 ASN A CA    1 
ATOM   8606  C  C     . ASN A 1 1131 ? -40.034 -68.636  0.826   1.00 2.22  ? 1132 ASN A C     1 
ATOM   8607  O  O     . ASN A 1 1131 ? -41.104 -68.124  1.119   1.00 2.27  ? 1132 ASN A O     1 
ATOM   8608  C  CB    . ASN A 1 1131 ? -40.290 -71.141  0.578   1.00 2.00  ? 1132 ASN A CB    1 
ATOM   8609  C  CG    . ASN A 1 1131 ? -41.713 -71.241  1.066   1.00 2.14  ? 1132 ASN A CG    1 
ATOM   8610  O  OD1   . ASN A 1 1131 ? -41.995 -71.216  2.279   1.00 2.00  ? 1132 ASN A OD1   1 
ATOM   8611  N  ND2   . ASN A 1 1131 ? -42.633 -71.350  0.121   1.00 2.16  ? 1132 ASN A ND2   1 
ATOM   8612  N  N     . ARG A 1 1132 ? -38.878 -68.148  1.277   1.00 2.18  ? 1133 ARG A N     1 
ATOM   8613  C  CA    . ARG A 1 1132 ? -38.868 -67.016  2.207   1.00 2.08  ? 1133 ARG A CA    1 
ATOM   8614  C  C     . ARG A 1 1132 ? -39.517 -65.802  1.578   1.00 2.67  ? 1133 ARG A C     1 
ATOM   8615  O  O     . ARG A 1 1132 ? -39.903 -64.888  2.278   1.00 3.31  ? 1133 ARG A O     1 
ATOM   8616  C  CB    . ARG A 1 1132 ? -37.447 -66.653  2.674   1.00 2.00  ? 1133 ARG A CB    1 
ATOM   8617  C  CG    . ARG A 1 1132 ? -36.432 -66.377  1.557   1.00 2.00  ? 1133 ARG A CG    1 
ATOM   8618  C  CD    . ARG A 1 1132 ? -35.044 -66.047  2.107   1.00 2.04  ? 1133 ARG A CD    1 
ATOM   8619  N  NE    . ARG A 1 1132 ? -34.039 -65.866  1.059   1.00 2.02  ? 1133 ARG A NE    1 
ATOM   8620  C  CZ    . ARG A 1 1132 ? -33.046 -64.975  1.101   1.00 2.00  ? 1133 ARG A CZ    1 
ATOM   8621  N  NH1   . ARG A 1 1132 ? -32.895 -64.181  2.131   1.00 2.00  ? 1133 ARG A NH1   1 
ATOM   8622  N  NH2   . ARG A 1 1132 ? -32.231 -64.838  0.083   1.00 2.00  ? 1133 ARG A NH2   1 
ATOM   8623  N  N     . PHE A 1 1133 ? -39.588 -65.761  0.249   1.00 3.12  ? 1134 PHE A N     1 
ATOM   8624  C  CA    . PHE A 1 1133 ? -40.233 -64.666  -0.455  1.00 3.13  ? 1134 PHE A CA    1 
ATOM   8625  C  C     . PHE A 1 1133 ? -41.585 -65.102  -0.982  1.00 3.63  ? 1134 PHE A C     1 
ATOM   8626  O  O     . PHE A 1 1133 ? -42.551 -64.375  -0.914  1.00 3.09  ? 1134 PHE A O     1 
ATOM   8627  C  CB    . PHE A 1 1133 ? -39.375 -64.246  -1.605  1.00 3.25  ? 1134 PHE A CB    1 
ATOM   8628  C  CG    . PHE A 1 1133 ? -38.117 -63.593  -1.181  1.00 3.14  ? 1134 PHE A CG    1 
ATOM   8629  C  CD1   . PHE A 1 1133 ? -38.157 -62.360  -0.509  1.00 2.70  ? 1134 PHE A CD1   1 
ATOM   8630  C  CD2   . PHE A 1 1133 ? -36.885 -64.213  -1.418  1.00 3.21  ? 1134 PHE A CD2   1 
ATOM   8631  C  CE1   . PHE A 1 1133 ? -36.986 -61.758  -0.074  1.00 2.64  ? 1134 PHE A CE1   1 
ATOM   8632  C  CE2   . PHE A 1 1133 ? -35.689 -63.622  -0.991  1.00 2.98  ? 1134 PHE A CE2   1 
ATOM   8633  C  CZ    . PHE A 1 1133 ? -35.731 -62.396  -0.318  1.00 2.34  ? 1134 PHE A CZ    1 
ATOM   8634  N  N     . ALA A 1 1134 ? -41.640 -66.327  -1.479  1.00 4.42  ? 1135 ALA A N     1 
ATOM   8635  C  CA    . ALA A 1 1134 ? -42.873 -66.900  -2.029  1.00 5.09  ? 1135 ALA A CA    1 
ATOM   8636  C  C     . ALA A 1 1134 ? -43.998 -67.120  -1.022  1.00 5.48  ? 1135 ALA A C     1 
ATOM   8637  O  O     . ALA A 1 1134 ? -45.165 -67.063  -1.436  1.00 6.61  ? 1135 ALA A O     1 
ATOM   8638  C  CB    . ALA A 1 1134 ? -42.593 -68.175  -2.772  1.00 4.64  ? 1135 ALA A CB    1 
ATOM   8639  N  N     . VAL A 1 1135 ? -43.708 -67.369  0.267   1.00 4.75  ? 1136 VAL A N     1 
ATOM   8640  C  CA    . VAL A 1 1135 ? -44.831 -67.519  1.216   1.00 4.28  ? 1136 VAL A CA    1 
ATOM   8641  C  C     . VAL A 1 1135 ? -45.661 -66.265  1.356   1.00 3.42  ? 1136 VAL A C     1 
ATOM   8642  O  O     . VAL A 1 1135 ? -46.857 -66.365  1.522   1.00 3.20  ? 1136 VAL A O     1 
ATOM   8643  C  CB    . VAL A 1 1135 ? -44.474 -67.913  2.672   1.00 5.20  ? 1136 VAL A CB    1 
ATOM   8644  C  CG1   . VAL A 1 1135 ? -44.702 -69.388  2.881   1.00 4.92  ? 1136 VAL A CG1   1 
ATOM   8645  C  CG2   . VAL A 1 1135 ? -43.093 -67.442  3.070   1.00 5.17  ? 1136 VAL A CG2   1 
ATOM   8646  N  N     . LEU A 1 1136 ? -45.014 -65.105  1.383   1.00 2.51  ? 1137 LEU A N     1 
ATOM   8647  C  CA    . LEU A 1 1136 ? -45.725 -63.856  1.509   1.00 2.82  ? 1137 LEU A CA    1 
ATOM   8648  C  C     . LEU A 1 1136 ? -46.644 -63.701  0.300   1.00 3.26  ? 1137 LEU A C     1 
ATOM   8649  O  O     . LEU A 1 1136 ? -47.803 -63.254  0.417   1.00 2.56  ? 1137 LEU A O     1 
ATOM   8650  C  CB    . LEU A 1 1136 ? -44.753 -62.669  1.555   1.00 2.45  ? 1137 LEU A CB    1 
ATOM   8651  C  CG    . LEU A 1 1136 ? -44.784 -61.756  2.758   1.00 2.21  ? 1137 LEU A CG    1 
ATOM   8652  C  CD1   . LEU A 1 1136 ? -45.012 -60.383  2.356   1.00 2.07  ? 1137 LEU A CD1   1 
ATOM   8653  C  CD2   . LEU A 1 1136 ? -45.836 -62.196  3.708   1.00 2.03  ? 1137 LEU A CD2   1 
ATOM   8654  N  N     . ASP A 1 1137 ? -46.140 -64.071  -0.876  1.00 3.73  ? 1138 ASP A N     1 
ATOM   8655  C  CA    . ASP A 1 1137 ? -46.958 -63.949  -2.068  1.00 4.57  ? 1138 ASP A CA    1 
ATOM   8656  C  C     . ASP A 1 1137 ? -48.277 -64.747  -1.947  1.00 5.19  ? 1138 ASP A C     1 
ATOM   8657  O  O     . ASP A 1 1137 ? -49.349 -64.278  -2.352  1.00 5.85  ? 1138 ASP A O     1 
ATOM   8658  C  CB    . ASP A 1 1137 ? -46.190 -64.349  -3.295  1.00 4.94  ? 1138 ASP A CB    1 
ATOM   8659  C  CG    . ASP A 1 1137 ? -46.729 -63.687  -4.512  1.00 6.38  ? 1138 ASP A CG    1 
ATOM   8660  O  OD1   . ASP A 1 1137 ? -46.708 -62.440  -4.575  1.00 7.48  ? 1138 ASP A OD1   1 
ATOM   8661  O  OD2   . ASP A 1 1137 ? -47.211 -64.396  -5.409  1.00 8.23  ? 1138 ASP A OD2   1 
ATOM   8662  N  N     . ARG A 1 1138 ? -48.216 -65.895  -1.295  1.00 4.93  ? 1139 ARG A N     1 
ATOM   8663  C  CA    . ARG A 1 1138 ? -49.401 -66.681  -1.106  1.00 5.42  ? 1139 ARG A CA    1 
ATOM   8664  C  C     . ARG A 1 1138 ? -50.292 -66.168  -0.002  1.00 6.03  ? 1139 ARG A C     1 
ATOM   8665  O  O     . ARG A 1 1138 ? -51.517 -66.263  -0.104  1.00 7.19  ? 1139 ARG A O     1 
ATOM   8666  C  CB    . ARG A 1 1138 ? -49.026 -68.079  -0.700  1.00 5.47  ? 1139 ARG A CB    1 
ATOM   8667  C  CG    . ARG A 1 1138 ? -48.640 -68.971  -1.811  1.00 5.56  ? 1139 ARG A CG    1 
ATOM   8668  C  CD    . ARG A 1 1138 ? -48.021 -70.204  -1.238  1.00 6.07  ? 1139 ARG A CD    1 
ATOM   8669  N  NE    . ARG A 1 1138 ? -46.697 -70.350  -1.814  1.00 6.67  ? 1139 ARG A NE    1 
ATOM   8670  C  CZ    . ARG A 1 1138 ? -45.637 -70.789  -1.163  1.00 6.28  ? 1139 ARG A CZ    1 
ATOM   8671  N  NH1   . ARG A 1 1138 ? -45.730 -71.146  0.106   1.00 6.75  ? 1139 ARG A NH1   1 
ATOM   8672  N  NH2   . ARG A 1 1138 ? -44.469 -70.795  -1.780  1.00 6.71  ? 1139 ARG A NH2   1 
ATOM   8673  N  N     . SER A 1 1139 ? -49.690 -65.764  1.111   1.00 6.02  ? 1140 SER A N     1 
ATOM   8674  C  CA    . SER A 1 1139 ? -50.455 -65.303  2.262   1.00 6.19  ? 1140 SER A CA    1 
ATOM   8675  C  C     . SER A 1 1139 ? -50.923 -63.861  2.172   1.00 6.74  ? 1140 SER A C     1 
ATOM   8676  O  O     . SER A 1 1139 ? -52.087 -63.584  2.465   1.00 7.75  ? 1140 SER A O     1 
ATOM   8677  C  CB    . SER A 1 1139 ? -49.624 -65.437  3.534   1.00 6.03  ? 1140 SER A CB    1 
ATOM   8678  O  OG    . SER A 1 1139 ? -49.242 -66.772  3.732   1.00 6.91  ? 1140 SER A OG    1 
ATOM   8679  N  N     . PHE A 1 1140 ? -49.971 -62.953  1.905   1.00 6.52  ? 1141 PHE A N     1 
ATOM   8680  C  CA    . PHE A 1 1140 ? -50.180 -61.509  1.822   1.00 5.90  ? 1141 PHE A CA    1 
ATOM   8681  C  C     . PHE A 1 1140 ? -49.649 -61.008  0.490   1.00 5.05  ? 1141 PHE A C     1 
ATOM   8682  O  O     . PHE A 1 1140 ? -48.678 -60.236  0.420   1.00 4.61  ? 1141 PHE A O     1 
ATOM   8683  C  CB    . PHE A 1 1140 ? -49.472 -60.810  2.977   1.00 7.31  ? 1141 PHE A CB    1 
ATOM   8684  C  CG    . PHE A 1 1140 ? -49.735 -61.452  4.304   1.00 9.58  ? 1141 PHE A CG    1 
ATOM   8685  C  CD1   . PHE A 1 1140 ? -51.016 -61.479  4.827   1.00 10.03 ? 1141 PHE A CD1   1 
ATOM   8686  C  CD2   . PHE A 1 1140 ? -48.710 -62.128  4.984   1.00 10.24 ? 1141 PHE A CD2   1 
ATOM   8687  C  CE1   . PHE A 1 1140 ? -51.278 -62.173  5.986   1.00 10.60 ? 1141 PHE A CE1   1 
ATOM   8688  C  CE2   . PHE A 1 1140 ? -48.959 -62.802  6.124   1.00 11.03 ? 1141 PHE A CE2   1 
ATOM   8689  C  CZ    . PHE A 1 1140 ? -50.260 -62.833  6.636   1.00 11.21 ? 1141 PHE A CZ    1 
ATOM   8690  N  N     . PRO A 1 1141 ? -50.369 -61.358  -0.578  1.00 4.14  ? 1142 PRO A N     1 
ATOM   8691  C  CA    . PRO A 1 1141 ? -50.134 -61.047  -1.985  1.00 4.09  ? 1142 PRO A CA    1 
ATOM   8692  C  C     . PRO A 1 1141 ? -49.969 -59.555  -2.259  1.00 4.03  ? 1142 PRO A C     1 
ATOM   8693  O  O     . PRO A 1 1141 ? -49.155 -59.173  -3.088  1.00 3.38  ? 1142 PRO A O     1 
ATOM   8694  C  CB    . PRO A 1 1141 ? -51.432 -61.501  -2.652  1.00 3.46  ? 1142 PRO A CB    1 
ATOM   8695  C  CG    . PRO A 1 1141 ? -52.070 -62.400  -1.674  1.00 2.99  ? 1142 PRO A CG    1 
ATOM   8696  C  CD    . PRO A 1 1141 ? -51.759 -61.806  -0.387  1.00 3.25  ? 1142 PRO A CD    1 
ATOM   8697  N  N     . GLU A 1 1142 ? -50.818 -58.742  -1.644  1.00 4.91  ? 1143 GLU A N     1 
ATOM   8698  C  CA    . GLU A 1 1142 ? -50.770 -57.318  -1.886  1.00 6.82  ? 1143 GLU A CA    1 
ATOM   8699  C  C     . GLU A 1 1142 ? -49.480 -56.732  -1.345  1.00 6.76  ? 1143 GLU A C     1 
ATOM   8700  O  O     . GLU A 1 1142 ? -48.856 -55.906  -1.985  1.00 7.11  ? 1143 GLU A O     1 
ATOM   8701  C  CB    . GLU A 1 1142 ? -52.001 -56.597  -1.291  1.00 9.30  ? 1143 GLU A CB    1 
ATOM   8702  C  CG    . GLU A 1 1142 ? -53.350 -56.909  -1.979  1.00 13.62 ? 1143 GLU A CG    1 
ATOM   8703  C  CD    . GLU A 1 1142 ? -54.431 -55.756  -1.890  1.00 17.77 ? 1143 GLU A CD    1 
ATOM   8704  O  OE1   . GLU A 1 1142 ? -54.100 -54.523  -1.847  1.00 19.68 ? 1143 GLU A OE1   1 
ATOM   8705  O  OE2   . GLU A 1 1142 ? -55.654 -56.086  -1.912  1.00 19.69 ? 1143 GLU A OE2   1 
ATOM   8706  N  N     . ASP A 1 1143 ? -49.069 -57.205  -0.175  1.00 6.61  ? 1144 ASP A N     1 
ATOM   8707  C  CA    . ASP A 1 1143 ? -47.867 -56.745  0.484   1.00 6.24  ? 1144 ASP A CA    1 
ATOM   8708  C  C     . ASP A 1 1143 ? -46.617 -57.275  -0.187  1.00 5.72  ? 1144 ASP A C     1 
ATOM   8709  O  O     . ASP A 1 1143 ? -45.632 -56.556  -0.316  1.00 5.59  ? 1144 ASP A O     1 
ATOM   8710  C  CB    . ASP A 1 1143 ? -47.914 -57.181  1.946   1.00 7.26  ? 1144 ASP A CB    1 
ATOM   8711  C  CG    . ASP A 1 1143 ? -48.686 -56.216  2.800   1.00 8.85  ? 1144 ASP A CG    1 
ATOM   8712  O  OD1   . ASP A 1 1143 ? -49.425 -55.379  2.222   1.00 9.43  ? 1144 ASP A OD1   1 
ATOM   8713  O  OD2   . ASP A 1 1143 ? -48.500 -56.242  4.043   1.00 10.41 ? 1144 ASP A OD2   1 
ATOM   8714  N  N     . ALA A 1 1144 ? -46.682 -58.533  -0.624  1.00 5.07  ? 1145 ALA A N     1 
ATOM   8715  C  CA    . ALA A 1 1144 ? -45.566 -59.210  -1.277  1.00 4.80  ? 1145 ALA A CA    1 
ATOM   8716  C  C     . ALA A 1 1144 ? -45.172 -58.441  -2.532  1.00 4.70  ? 1145 ALA A C     1 
ATOM   8717  O  O     . ALA A 1 1144 ? -44.024 -58.087  -2.735  1.00 4.18  ? 1145 ALA A O     1 
ATOM   8718  C  CB    . ALA A 1 1144 ? -45.949 -60.636  -1.639  1.00 3.20  ? 1145 ALA A CB    1 
ATOM   8719  N  N     . LYS A 1 1145 ? -46.164 -58.115  -3.330  1.00 5.46  ? 1146 LYS A N     1 
ATOM   8720  C  CA    . LYS A 1 1145 ? -45.922 -57.394  -4.568  1.00 6.65  ? 1146 LYS A CA    1 
ATOM   8721  C  C     . LYS A 1 1145 ? -45.159 -56.078  -4.364  1.00 5.57  ? 1146 LYS A C     1 
ATOM   8722  O  O     . LYS A 1 1145 ? -44.270 -55.738  -5.131  1.00 4.75  ? 1146 LYS A O     1 
ATOM   8723  C  CB    . LYS A 1 1145 ? -47.254 -57.118  -5.265  1.00 7.95  ? 1146 LYS A CB    1 
ATOM   8724  C  CG    . LYS A 1 1145 ? -47.118 -56.712  -6.703  1.00 9.85  ? 1146 LYS A CG    1 
ATOM   8725  C  CD    . LYS A 1 1145 ? -48.411 -56.189  -7.237  1.00 11.43 ? 1146 LYS A CD    1 
ATOM   8726  C  CE    . LYS A 1 1145 ? -48.238 -55.831  -8.693  1.00 12.40 ? 1146 LYS A CE    1 
ATOM   8727  N  NZ    . LYS A 1 1145 ? -49.337 -54.916  -9.104  1.00 13.94 ? 1146 LYS A NZ    1 
ATOM   8728  N  N     . ARG A 1 1146 ? -45.517 -55.383  -3.300  1.00 5.70  ? 1147 ARG A N     1 
ATOM   8729  C  CA    . ARG A 1 1146 ? -44.918 -54.111  -2.922  1.00 5.66  ? 1147 ARG A CA    1 
ATOM   8730  C  C     . ARG A 1 1146 ? -43.452 -54.313  -2.489  1.00 4.45  ? 1147 ARG A C     1 
ATOM   8731  O  O     . ARG A 1 1146 ? -42.553 -53.666  -3.002  1.00 4.02  ? 1147 ARG A O     1 
ATOM   8732  C  CB    . ARG A 1 1146 ? -45.727 -53.479  -1.763  1.00 7.51  ? 1147 ARG A CB    1 
ATOM   8733  C  CG    . ARG A 1 1146 ? -47.079 -52.769  -2.115  1.00 10.96 ? 1147 ARG A CG    1 
ATOM   8734  C  CD    . ARG A 1 1146 ? -47.762 -52.092  -0.860  1.00 13.78 ? 1147 ARG A CD    1 
ATOM   8735  N  NE    . ARG A 1 1146 ? -49.038 -52.674  -0.408  1.00 16.77 ? 1147 ARG A NE    1 
ATOM   8736  C  CZ    . ARG A 1 1146 ? -50.164 -52.642  -1.121  1.00 19.11 ? 1147 ARG A CZ    1 
ATOM   8737  N  NH1   . ARG A 1 1146 ? -50.169 -52.081  -2.302  1.00 20.30 ? 1147 ARG A NH1   1 
ATOM   8738  N  NH2   . ARG A 1 1146 ? -51.302 -53.133  -0.663  1.00 20.08 ? 1147 ARG A NH2   1 
ATOM   8739  N  N     . LEU A 1 1147 ? -43.234 -55.233  -1.553  1.00 3.61  ? 1148 LEU A N     1 
ATOM   8740  C  CA    . LEU A 1 1147 ? -41.919 -55.518  -0.991  1.00 2.68  ? 1148 LEU A CA    1 
ATOM   8741  C  C     . LEU A 1 1147 ? -40.966 -56.074  -2.007  1.00 2.44  ? 1148 LEU A C     1 
ATOM   8742  O  O     . LEU A 1 1147 ? -39.738 -55.863  -1.946  1.00 2.48  ? 1148 LEU A O     1 
ATOM   8743  C  CB    . LEU A 1 1147 ? -42.049 -56.475  0.182   1.00 2.00  ? 1148 LEU A CB    1 
ATOM   8744  C  CG    . LEU A 1 1147 ? -42.851 -55.896  1.359   1.00 2.51  ? 1148 LEU A CG    1 
ATOM   8745  C  CD1   . LEU A 1 1147 ? -43.296 -57.054  2.234   1.00 2.26  ? 1148 LEU A CD1   1 
ATOM   8746  C  CD2   . LEU A 1 1147 ? -42.052 -54.869  2.175   1.00 2.00  ? 1148 LEU A CD2   1 
ATOM   8747  N  N     . ARG A 1 1148 ? -41.523 -56.788  -2.957  1.00 2.06  ? 1149 ARG A N     1 
ATOM   8748  C  CA    . ARG A 1 1148 ? -40.692 -57.351  -3.996  1.00 2.25  ? 1149 ARG A CA    1 
ATOM   8749  C  C     . ARG A 1 1148 ? -40.374 -56.224  -4.959  1.00 2.00  ? 1149 ARG A C     1 
ATOM   8750  O  O     . ARG A 1 1148 ? -39.328 -56.195  -5.564  1.00 2.49  ? 1149 ARG A O     1 
ATOM   8751  C  CB    . ARG A 1 1148 ? -41.373 -58.521  -4.697  1.00 2.00  ? 1149 ARG A CB    1 
ATOM   8752  C  CG    . ARG A 1 1148 ? -41.357 -59.802  -3.887  1.00 2.38  ? 1149 ARG A CG    1 
ATOM   8753  C  CD    . ARG A 1 1148 ? -41.439 -61.069  -4.770  1.00 2.00  ? 1149 ARG A CD    1 
ATOM   8754  N  NE    . ARG A 1 1148 ? -42.548 -61.071  -5.741  1.00 2.00  ? 1149 ARG A NE    1 
ATOM   8755  C  CZ    . ARG A 1 1148 ? -43.834 -61.315  -5.459  1.00 2.31  ? 1149 ARG A CZ    1 
ATOM   8756  N  NH1   . ARG A 1 1148 ? -44.241 -61.599  -4.226  1.00 2.00  ? 1149 ARG A NH1   1 
ATOM   8757  N  NH2   . ARG A 1 1148 ? -44.744 -61.181  -6.414  1.00 2.71  ? 1149 ARG A NH2   1 
ATOM   8758  N  N     . ALA A 1 1149 ? -41.295 -55.303  -5.118  1.00 2.31  ? 1150 ALA A N     1 
ATOM   8759  C  CA    . ALA A 1 1149 ? -41.031 -54.162  -5.976  1.00 3.18  ? 1150 ALA A CA    1 
ATOM   8760  C  C     . ALA A 1 1149 ? -39.989 -53.264  -5.260  1.00 3.53  ? 1150 ALA A C     1 
ATOM   8761  O  O     . ALA A 1 1149 ? -39.115 -52.673  -5.885  1.00 3.69  ? 1150 ALA A O     1 
ATOM   8762  C  CB    . ALA A 1 1149 ? -42.307 -53.398  -6.232  1.00 2.00  ? 1150 ALA A CB    1 
ATOM   8763  N  N     . GLN A 1 1150 ? -40.041 -53.222  -3.941  1.00 4.52  ? 1151 GLN A N     1 
ATOM   8764  C  CA    . GLN A 1 1150 ? -39.106 -52.416  -3.181  1.00 5.86  ? 1151 GLN A CA    1 
ATOM   8765  C  C     . GLN A 1 1150 ? -37.667 -52.986  -3.248  1.00 5.98  ? 1151 GLN A C     1 
ATOM   8766  O  O     . GLN A 1 1150 ? -36.711 -52.258  -3.441  1.00 6.29  ? 1151 GLN A O     1 
ATOM   8767  C  CB    . GLN A 1 1150 ? -39.608 -52.327  -1.734  1.00 7.23  ? 1151 GLN A CB    1 
ATOM   8768  C  CG    . GLN A 1 1150 ? -39.116 -51.139  -0.965  1.00 8.79  ? 1151 GLN A CG    1 
ATOM   8769  C  CD    . GLN A 1 1150 ? -39.396 -51.253  0.519   1.00 10.42 ? 1151 GLN A CD    1 
ATOM   8770  O  OE1   . GLN A 1 1150 ? -40.426 -51.812  0.947   1.00 10.38 ? 1151 GLN A OE1   1 
ATOM   8771  N  NE2   . GLN A 1 1150 ? -38.462 -50.717  1.335   1.00 11.87 ? 1151 GLN A NE2   1 
ATOM   8772  N  N     . VAL A 1 1151 ? -37.532 -54.296  -3.114  1.00 6.54  ? 1152 VAL A N     1 
ATOM   8773  C  CA    . VAL A 1 1151 ? -36.244 -54.961  -3.195  1.00 7.12  ? 1152 VAL A CA    1 
ATOM   8774  C  C     . VAL A 1 1151 ? -35.613 -54.689  -4.548  1.00 6.79  ? 1152 VAL A C     1 
ATOM   8775  O  O     . VAL A 1 1151 ? -34.389 -54.625  -4.654  1.00 7.11  ? 1152 VAL A O     1 
ATOM   8776  C  CB    . VAL A 1 1151 ? -36.393 -56.525  -3.040  1.00 7.79  ? 1152 VAL A CB    1 
ATOM   8777  C  CG1   . VAL A 1 1151 ? -35.183 -57.224  -3.576  1.00 8.01  ? 1152 VAL A CG1   1 
ATOM   8778  C  CG2   . VAL A 1 1151 ? -36.514 -56.896  -1.572  1.00 8.58  ? 1152 VAL A CG2   1 
ATOM   8779  N  N     . ALA A 1 1152 ? -36.444 -54.619  -5.588  1.00 5.92  ? 1153 ALA A N     1 
ATOM   8780  C  CA    . ALA A 1 1152 ? -35.919 -54.379  -6.925  1.00 5.74  ? 1153 ALA A CA    1 
ATOM   8781  C  C     . ALA A 1 1152 ? -35.482 -52.956  -7.077  1.00 5.77  ? 1153 ALA A C     1 
ATOM   8782  O  O     . ALA A 1 1152 ? -34.450 -52.700  -7.677  1.00 6.15  ? 1153 ALA A O     1 
ATOM   8783  C  CB    . ALA A 1 1152 ? -36.912 -54.749  -7.994  1.00 4.91  ? 1153 ALA A CB    1 
ATOM   8784  N  N     . HIS A 1 1153 ? -36.261 -52.022  -6.530  1.00 6.29  ? 1154 HIS A N     1 
ATOM   8785  C  CA    . HIS A 1 1153 ? -35.895 -50.615  -6.596  1.00 6.74  ? 1154 HIS A CA    1 
ATOM   8786  C  C     . HIS A 1 1153 ? -34.565 -50.433  -5.874  1.00 5.52  ? 1154 HIS A C     1 
ATOM   8787  O  O     . HIS A 1 1153 ? -33.634 -49.820  -6.399  1.00 5.28  ? 1154 HIS A O     1 
ATOM   8788  C  CB    . HIS A 1 1153 ? -36.954 -49.708  -5.959  1.00 9.02  ? 1154 HIS A CB    1 
ATOM   8789  C  CG    . HIS A 1 1153 ? -36.499 -48.279  -5.797  1.00 12.52 ? 1154 HIS A CG    1 
ATOM   8790  N  ND1   . HIS A 1 1153 ? -36.089 -47.749  -4.581  1.00 14.20 ? 1154 HIS A ND1   1 
ATOM   8791  C  CD2   . HIS A 1 1153 ? -36.336 -47.285  -6.708  1.00 13.92 ? 1154 HIS A CD2   1 
ATOM   8792  C  CE1   . HIS A 1 1153 ? -35.695 -46.495  -4.754  1.00 14.50 ? 1154 HIS A CE1   1 
ATOM   8793  N  NE2   . HIS A 1 1153 ? -35.836 -46.185  -6.033  1.00 14.47 ? 1154 HIS A NE2   1 
ATOM   8794  N  N     . GLU A 1 1154 ? -34.486 -51.023  -4.689  1.00 4.69  ? 1155 GLU A N     1 
ATOM   8795  C  CA    . GLU A 1 1154 ? -33.296 -50.968  -3.859  1.00 4.29  ? 1155 GLU A CA    1 
ATOM   8796  C  C     . GLU A 1 1154 ? -32.013 -51.407  -4.542  1.00 4.06  ? 1155 GLU A C     1 
ATOM   8797  O  O     . GLU A 1 1154 ? -30.994 -50.705  -4.472  1.00 3.78  ? 1155 GLU A O     1 
ATOM   8798  C  CB    . GLU A 1 1154 ? -33.487 -51.838  -2.618  1.00 4.31  ? 1155 GLU A CB    1 
ATOM   8799  C  CG    . GLU A 1 1154 ? -34.434 -51.270  -1.573  1.00 4.25  ? 1155 GLU A CG    1 
ATOM   8800  C  CD    . GLU A 1 1154 ? -34.635 -52.208  -0.390  1.00 4.78  ? 1155 GLU A CD    1 
ATOM   8801  O  OE1   . GLU A 1 1154 ? -34.146 -53.370  -0.403  1.00 5.62  ? 1155 GLU A OE1   1 
ATOM   8802  O  OE2   . GLU A 1 1154 ? -35.319 -51.796  0.568   1.00 6.58  ? 1155 GLU A OE2   1 
ATOM   8803  N  N     . LEU A 1 1155 ? -32.037 -52.595  -5.135  1.00 3.75  ? 1156 LEU A N     1 
ATOM   8804  C  CA    . LEU A 1 1155 ? -30.820 -53.090  -5.780  1.00 4.47  ? 1156 LEU A CA    1 
ATOM   8805  C  C     . LEU A 1 1155 ? -30.456 -52.272  -7.034  1.00 4.97  ? 1156 LEU A C     1 
ATOM   8806  O  O     . LEU A 1 1155 ? -29.318 -52.301  -7.499  1.00 5.41  ? 1156 LEU A O     1 
ATOM   8807  C  CB    . LEU A 1 1155 ? -30.920 -54.594  -6.102  1.00 2.97  ? 1156 LEU A CB    1 
ATOM   8808  C  CG    . LEU A 1 1155 ? -32.042 -54.954  -7.044  1.00 2.96  ? 1156 LEU A CG    1 
ATOM   8809  C  CD1   . LEU A 1 1155 ? -31.525 -54.892  -8.456  1.00 2.20  ? 1156 LEU A CD1   1 
ATOM   8810  C  CD2   . LEU A 1 1155 ? -32.567 -56.358  -6.701  1.00 3.35  ? 1156 LEU A CD2   1 
ATOM   8811  N  N     . ASP A 1 1156 ? -31.426 -51.549  -7.566  1.00 5.50  ? 1157 ASP A N     1 
ATOM   8812  C  CA    . ASP A 1 1156 ? -31.201 -50.741  -8.734  1.00 6.51  ? 1157 ASP A CA    1 
ATOM   8813  C  C     . ASP A 1 1156 ? -30.427 -49.487  -8.365  1.00 6.01  ? 1157 ASP A C     1 
ATOM   8814  O  O     . ASP A 1 1156 ? -29.454 -49.119  -9.040  1.00 5.62  ? 1157 ASP A O     1 
ATOM   8815  C  CB    . ASP A 1 1156 ? -32.536 -50.346  -9.308  1.00 9.07  ? 1157 ASP A CB    1 
ATOM   8816  C  CG    . ASP A 1 1156 ? -32.447 -50.043  -10.768 1.00 11.93 ? 1157 ASP A CG    1 
ATOM   8817  O  OD1   . ASP A 1 1156 ? -32.466 -51.031  -11.558 1.00 15.26 ? 1157 ASP A OD1   1 
ATOM   8818  O  OD2   . ASP A 1 1156 ? -32.351 -48.838  -11.121 1.00 13.58 ? 1157 ASP A OD2   1 
ATOM   8819  N  N     . VAL A 1 1157 ? -30.889 -48.820  -7.306  1.00 4.66  ? 1158 VAL A N     1 
ATOM   8820  C  CA    . VAL A 1 1157 ? -30.234 -47.611  -6.817  1.00 4.12  ? 1158 VAL A CA    1 
ATOM   8821  C  C     . VAL A 1 1157 ? -28.847 -48.030  -6.336  1.00 4.00  ? 1158 VAL A C     1 
ATOM   8822  O  O     . VAL A 1 1157 ? -27.861 -47.396  -6.687  1.00 4.60  ? 1158 VAL A O     1 
ATOM   8823  C  CB    . VAL A 1 1157 ? -31.042 -46.959  -5.615  1.00 3.73  ? 1158 VAL A CB    1 
ATOM   8824  C  CG1   . VAL A 1 1157 ? -30.224 -45.927  -4.881  1.00 2.32  ? 1158 VAL A CG1   1 
ATOM   8825  C  CG2   . VAL A 1 1157 ? -32.335 -46.351  -6.110  1.00 2.92  ? 1158 VAL A CG2   1 
ATOM   8826  N  N     . ARG A 1 1158 ? -28.777 -49.148  -5.616  1.00 3.44  ? 1159 ARG A N     1 
ATOM   8827  C  CA    . ARG A 1 1158 ? -27.521 -49.632  -5.067  1.00 3.12  ? 1159 ARG A CA    1 
ATOM   8828  C  C     . ARG A 1 1158 ? -26.471 -49.933  -6.113  1.00 3.26  ? 1159 ARG A C     1 
ATOM   8829  O  O     . ARG A 1 1158 ? -25.321 -49.471  -5.978  1.00 3.09  ? 1159 ARG A O     1 
ATOM   8830  C  CB    . ARG A 1 1158 ? -27.714 -50.815  -4.128  1.00 2.58  ? 1159 ARG A CB    1 
ATOM   8831  C  CG    . ARG A 1 1158 ? -26.382 -51.233  -3.449  1.00 2.64  ? 1159 ARG A CG    1 
ATOM   8832  C  CD    . ARG A 1 1158 ? -26.606 -51.984  -2.117  1.00 2.66  ? 1159 ARG A CD    1 
ATOM   8833  N  NE    . ARG A 1 1158 ? -25.374 -52.214  -1.364  1.00 2.56  ? 1159 ARG A NE    1 
ATOM   8834  C  CZ    . ARG A 1 1158 ? -24.667 -53.342  -1.439  1.00 2.22  ? 1159 ARG A CZ    1 
ATOM   8835  N  NH1   . ARG A 1 1158 ? -25.047 -54.329  -2.239  1.00 2.00  ? 1159 ARG A NH1   1 
ATOM   8836  N  NH2   . ARG A 1 1158 ? -23.667 -53.538  -0.606  1.00 2.34  ? 1159 ARG A NH2   1 
ATOM   8837  N  N     . PHE A 1 1159 ? -26.829 -50.705  -7.143  1.00 2.63  ? 1160 PHE A N     1 
ATOM   8838  C  CA    . PHE A 1 1159 ? -25.855 -50.946  -8.215  1.00 2.48  ? 1160 PHE A CA    1 
ATOM   8839  C  C     . PHE A 1 1159 ? -25.367 -49.615  -8.822  1.00 2.51  ? 1160 PHE A C     1 
ATOM   8840  O  O     . PHE A 1 1159 ? -24.204 -49.484  -9.192  1.00 2.00  ? 1160 PHE A O     1 
ATOM   8841  C  CB    . PHE A 1 1159 ? -26.415 -51.768  -9.348  1.00 2.36  ? 1160 PHE A CB    1 
ATOM   8842  C  CG    . PHE A 1 1159 ? -25.351 -52.338  -10.219 1.00 2.05  ? 1160 PHE A CG    1 
ATOM   8843  C  CD1   . PHE A 1 1159 ? -24.728 -53.518  -9.862  1.00 2.00  ? 1160 PHE A CD1   1 
ATOM   8844  C  CD2   . PHE A 1 1159 ? -24.928 -51.677  -11.350 1.00 2.00  ? 1160 PHE A CD2   1 
ATOM   8845  C  CE1   . PHE A 1 1159 ? -23.714 -54.013  -10.614 1.00 2.08  ? 1160 PHE A CE1   1 
ATOM   8846  C  CE2   . PHE A 1 1159 ? -23.922 -52.174  -12.096 1.00 2.47  ? 1160 PHE A CE2   1 
ATOM   8847  C  CZ    . PHE A 1 1159 ? -23.308 -53.351  -11.728 1.00 2.00  ? 1160 PHE A CZ    1 
ATOM   8848  N  N     . LYS A 1 1160 ? -26.266 -48.636  -8.894  1.00 2.96  ? 1161 LYS A N     1 
ATOM   8849  C  CA    . LYS A 1 1160 ? -25.944 -47.321  -9.428  1.00 3.41  ? 1161 LYS A CA    1 
ATOM   8850  C  C     . LYS A 1 1160 ? -24.966 -46.567  -8.589  1.00 3.21  ? 1161 LYS A C     1 
ATOM   8851  O  O     . LYS A 1 1160 ? -24.136 -45.830  -9.116  1.00 3.45  ? 1161 LYS A O     1 
ATOM   8852  C  CB    . LYS A 1 1160 ? -27.195 -46.489  -9.602  1.00 4.38  ? 1161 LYS A CB    1 
ATOM   8853  C  CG    . LYS A 1 1160 ? -27.796 -46.667  -10.966 1.00 5.67  ? 1161 LYS A CG    1 
ATOM   8854  C  CD    . LYS A 1 1160 ? -29.104 -45.941  -11.101 1.00 7.53  ? 1161 LYS A CD    1 
ATOM   8855  C  CE    . LYS A 1 1160 ? -29.611 -46.020  -12.541 1.00 8.05  ? 1161 LYS A CE    1 
ATOM   8856  N  NZ    . LYS A 1 1160 ? -29.626 -47.434  -12.941 1.00 9.65  ? 1161 LYS A NZ    1 
ATOM   8857  N  N     . GLU A 1 1161 ? -25.102 -46.693  -7.281  1.00 3.82  ? 1162 GLU A N     1 
ATOM   8858  C  CA    . GLU A 1 1161 ? -24.173 -46.051  -6.367  1.00 4.25  ? 1162 GLU A CA    1 
ATOM   8859  C  C     . GLU A 1 1161 ? -22.824 -46.753  -6.489  1.00 3.45  ? 1162 GLU A C     1 
ATOM   8860  O  O     . GLU A 1 1161 ? -21.799 -46.102  -6.464  1.00 2.70  ? 1162 GLU A O     1 
ATOM   8861  C  CB    . GLU A 1 1161 ? -24.658 -46.166  -4.921  1.00 6.98  ? 1162 GLU A CB    1 
ATOM   8862  C  CG    . GLU A 1 1161 ? -25.942 -45.385  -4.606  1.00 11.49 ? 1162 GLU A CG    1 
ATOM   8863  C  CD    . GLU A 1 1161 ? -26.408 -45.574  -3.167  1.00 13.84 ? 1162 GLU A CD    1 
ATOM   8864  O  OE1   . GLU A 1 1161 ? -26.483 -46.751  -2.713  1.00 16.09 ? 1162 GLU A OE1   1 
ATOM   8865  O  OE2   . GLU A 1 1161 ? -26.701 -44.553  -2.485  1.00 15.23 ? 1162 GLU A OE2   1 
ATOM   8866  N  N     . LEU A 1 1162 ? -22.838 -48.077  -6.670  1.00 3.59  ? 1163 LEU A N     1 
ATOM   8867  C  CA    . LEU A 1 1162 ? -21.616 -48.891  -6.776  1.00 3.63  ? 1163 LEU A CA    1 
ATOM   8868  C  C     . LEU A 1 1162 ? -20.816 -48.521  -8.017  1.00 4.10  ? 1163 LEU A C     1 
ATOM   8869  O  O     . LEU A 1 1162 ? -19.572 -48.452  -7.998  1.00 3.17  ? 1163 LEU A O     1 
ATOM   8870  C  CB    . LEU A 1 1162 ? -21.974 -50.391  -6.750  1.00 2.77  ? 1163 LEU A CB    1 
ATOM   8871  C  CG    . LEU A 1 1162 ? -22.511 -50.842  -5.396  1.00 2.00  ? 1163 LEU A CG    1 
ATOM   8872  C  CD1   . LEU A 1 1162 ? -22.655 -52.380  -5.354  1.00 2.03  ? 1163 LEU A CD1   1 
ATOM   8873  C  CD2   . LEU A 1 1162 ? -21.573 -50.388  -4.328  1.00 2.00  ? 1163 LEU A CD2   1 
ATOM   8874  N  N     . GLU A 1 1163 ? -21.574 -48.266  -9.083  1.00 5.63  ? 1164 GLU A N     1 
ATOM   8875  C  CA    . GLU A 1 1163 ? -21.040 -47.824  -10.350 1.00 7.11  ? 1164 GLU A CA    1 
ATOM   8876  C  C     . GLU A 1 1163 ? -20.476 -46.415  -10.153 1.00 8.20  ? 1164 GLU A C     1 
ATOM   8877  O  O     . GLU A 1 1163 ? -19.452 -46.107  -10.725 1.00 8.60  ? 1164 GLU A O     1 
ATOM   8878  C  CB    . GLU A 1 1163 ? -22.135 -47.767  -11.399 1.00 7.63  ? 1164 GLU A CB    1 
ATOM   8879  C  CG    . GLU A 1 1163 ? -22.398 -49.088  -12.105 1.00 9.53  ? 1164 GLU A CG    1 
ATOM   8880  C  CD    . GLU A 1 1163 ? -23.497 -48.998  -13.180 1.00 11.06 ? 1164 GLU A CD    1 
ATOM   8881  O  OE1   . GLU A 1 1163 ? -24.355 -48.101  -13.128 1.00 11.39 ? 1164 GLU A OE1   1 
ATOM   8882  O  OE2   . GLU A 1 1163 ? -23.517 -49.848  -14.085 1.00 12.66 ? 1164 GLU A OE2   1 
ATOM   8883  N  N     . HIS A 1 1164 ? -21.152 -45.572  -9.361  1.00 9.00  ? 1165 HIS A N     1 
ATOM   8884  C  CA    . HIS A 1 1164 ? -20.711 -44.208  -9.072  1.00 10.12 ? 1165 HIS A CA    1 
ATOM   8885  C  C     . HIS A 1 1164 ? -19.339 -44.322  -8.363  1.00 9.60  ? 1165 HIS A C     1 
ATOM   8886  O  O     . HIS A 1 1164 ? -18.375 -43.625  -8.738  1.00 9.37  ? 1165 HIS A O     1 
ATOM   8887  C  CB    . HIS A 1 1164 ? -21.743 -43.534  -8.144  1.00 12.98 ? 1165 HIS A CB    1 
ATOM   8888  C  CG    . HIS A 1 1164 ? -21.933 -42.055  -8.354  1.00 16.46 ? 1165 HIS A CG    1 
ATOM   8889  N  ND1   . HIS A 1 1164 ? -21.798 -41.139  -7.326  1.00 18.50 ? 1165 HIS A ND1   1 
ATOM   8890  C  CD2   . HIS A 1 1164 ? -22.384 -41.339  -9.423  1.00 18.50 ? 1165 HIS A CD2   1 
ATOM   8891  C  CE1   . HIS A 1 1164 ? -22.164 -39.931  -7.743  1.00 19.23 ? 1165 HIS A CE1   1 
ATOM   8892  N  NE2   . HIS A 1 1164 ? -22.524 -40.022  -9.013  1.00 19.39 ? 1165 HIS A NE2   1 
ATOM   8893  N  N     . MET A 1 1165 ? -19.231 -45.272  -7.421  1.00 8.36  ? 1166 MET A N     1 
ATOM   8894  C  CA    . MET A 1 1165 ? -17.995 -45.506  -6.660  1.00 7.54  ? 1166 MET A CA    1 
ATOM   8895  C  C     . MET A 1 1165 ? -16.860 -45.936  -7.576  1.00 7.49  ? 1166 MET A C     1 
ATOM   8896  O  O     . MET A 1 1165 ? -15.727 -45.466  -7.458  1.00 8.22  ? 1166 MET A O     1 
ATOM   8897  C  CB    . MET A 1 1165 ? -18.183 -46.607  -5.599  1.00 7.14  ? 1166 MET A CB    1 
ATOM   8898  C  CG    . MET A 1 1165 ? -19.048 -46.279  -4.365  1.00 6.99  ? 1166 MET A CG    1 
ATOM   8899  S  SD    . MET A 1 1165 ? -18.845 -47.559  -3.028  1.00 8.20  ? 1166 MET A SD    1 
ATOM   8900  C  CE    . MET A 1 1165 ? -17.027 -47.284  -2.453  1.00 6.83  ? 1166 MET A CE    1 
ATOM   8901  N  N     . ALA A 1 1166 ? -17.157 -46.868  -8.472  1.00 6.94  ? 1167 ALA A N     1 
ATOM   8902  C  CA    . ALA A 1 1166 ? -16.141 -47.338  -9.414  1.00 6.47  ? 1167 ALA A CA    1 
ATOM   8903  C  C     . ALA A 1 1166 ? -15.667 -46.247  -10.440 1.00 6.53  ? 1167 ALA A C     1 
ATOM   8904  O  O     . ALA A 1 1166 ? -14.563 -46.339  -10.985 1.00 7.46  ? 1167 ALA A O     1 
ATOM   8905  C  CB    . ALA A 1 1166 ? -16.669 -48.499  -10.133 1.00 5.20  ? 1167 ALA A CB    1 
ATOM   8906  N  N     . ALA A 1 1167 ? -16.460 -45.211  -10.686 1.00 5.91  ? 1168 ALA A N     1 
ATOM   8907  C  CA    . ALA A 1 1167 ? -16.069 -44.203  -11.681 1.00 6.68  ? 1168 ALA A CA    1 
ATOM   8908  C  C     . ALA A 1 1167 ? -15.439 -42.933  -11.090 1.00 7.43  ? 1168 ALA A C     1 
ATOM   8909  O  O     . ALA A 1 1167 ? -15.137 -41.986  -11.826 1.00 8.12  ? 1168 ALA A O     1 
ATOM   8910  C  CB    . ALA A 1 1167 ? -17.285 -43.817  -12.537 1.00 5.33  ? 1168 ALA A CB    1 
ATOM   8911  N  N     . THR A 1 1168 ? -15.257 -42.905  -9.775  1.00 8.21  ? 1169 THR A N     1 
ATOM   8912  C  CA    . THR A 1 1168 ? -14.725 -41.736  -9.112  1.00 9.08  ? 1169 THR A CA    1 
ATOM   8913  C  C     . THR A 1 1168 ? -13.218 -41.547  -9.294  1.00 10.47 ? 1169 THR A C     1 
ATOM   8914  O  O     . THR A 1 1168 ? -12.509 -42.494  -9.647  1.00 10.38 ? 1169 THR A O     1 
ATOM   8915  C  CB    . THR A 1 1168 ? -15.078 -41.753  -7.587  1.00 8.60  ? 1169 THR A CB    1 
ATOM   8916  O  OG1   . THR A 1 1168 ? -14.764 -40.488  -6.998  1.00 7.40  ? 1169 THR A OG1   1 
ATOM   8917  C  CG2   . THR A 1 1168 ? -14.313 -42.866  -6.849  1.00 8.67  ? 1169 THR A CG2   1 
ATOM   8918  N  N     . ASN A 1 1169 ? -12.779 -40.290  -9.168  1.00 12.00 ? 1170 ASN A N     1 
ATOM   8919  C  CA    . ASN A 1 1169 ? -11.365 -39.909  -9.209  1.00 13.91 ? 1170 ASN A CA    1 
ATOM   8920  C  C     . ASN A 1 1169 ? -10.879 -39.563  -7.768  1.00 14.06 ? 1170 ASN A C     1 
ATOM   8921  O  O     . ASN A 1 1169 ? -9.683  -39.433  -7.515  1.00 14.42 ? 1170 ASN A O     1 
ATOM   8922  C  CB    . ASN A 1 1169 ? -11.067 -38.747  -10.220 1.00 15.30 ? 1170 ASN A CB    1 
ATOM   8923  C  CG    . ASN A 1 1169 ? -12.095 -37.567  -10.162 1.00 17.58 ? 1170 ASN A CG    1 
ATOM   8924  O  OD1   . ASN A 1 1169 ? -11.837 -36.483  -9.607  1.00 17.29 ? 1170 ASN A OD1   1 
ATOM   8925  N  ND2   . ASN A 1 1169 ? -13.226 -37.760  -10.837 1.00 19.64 ? 1170 ASN A ND2   1 
ATOM   8926  N  N     . ILE A 1 1170 ? -11.827 -39.444  -6.836  1.00 14.65 ? 1171 ILE A N     1 
ATOM   8927  C  CA    . ILE A 1 1170 ? -11.580 -39.098  -5.425  1.00 15.25 ? 1171 ILE A CA    1 
ATOM   8928  C  C     . ILE A 1 1170 ? -11.477 -40.330  -4.555  1.00 16.08 ? 1171 ILE A C     1 
ATOM   8929  O  O     . ILE A 1 1170 ? -12.470 -41.042  -4.401  1.00 16.55 ? 1171 ILE A O     1 
ATOM   8930  C  CB    . ILE A 1 1170 ? -12.778 -38.325  -4.808  1.00 14.83 ? 1171 ILE A CB    1 
ATOM   8931  C  CG1   . ILE A 1 1170 ? -12.975 -36.969  -5.494  1.00 14.68 ? 1171 ILE A CG1   1 
ATOM   8932  C  CG2   . ILE A 1 1170 ? -12.612 -38.204  -3.295  1.00 14.49 ? 1171 ILE A CG2   1 
ATOM   8933  C  CD1   . ILE A 1 1170 ? -14.325 -36.843  -6.198  1.00 15.00 ? 1171 ILE A CD1   1 
ATOM   8934  N  N     . PHE A 1 1171 ? -10.320 -40.558  -3.938  1.00 16.95 ? 1172 PHE A N     1 
ATOM   8935  C  CA    . PHE A 1 1171 ? -10.193 -41.718  -3.059  1.00 17.64 ? 1172 PHE A CA    1 
ATOM   8936  C  C     . PHE A 1 1171 ? -9.254  -41.597  -1.870  1.00 18.90 ? 1172 PHE A C     1 
ATOM   8937  O  O     . PHE A 1 1171 ? -8.199  -40.945  -1.927  1.00 19.44 ? 1172 PHE A O     1 
ATOM   8938  C  CB    . PHE A 1 1171 ? -9.933  -43.007  -3.828  1.00 16.28 ? 1172 PHE A CB    1 
ATOM   8939  C  CG    . PHE A 1 1171 ? -9.088  -42.836  -5.031  1.00 15.27 ? 1172 PHE A CG    1 
ATOM   8940  C  CD1   . PHE A 1 1171 ? -7.702  -42.717  -4.911  1.00 15.11 ? 1172 PHE A CD1   1 
ATOM   8941  C  CD2   . PHE A 1 1171 ? -9.673  -42.831  -6.290  1.00 14.96 ? 1172 PHE A CD2   1 
ATOM   8942  C  CE1   . PHE A 1 1171 ? -6.905  -42.603  -6.023  1.00 14.85 ? 1172 PHE A CE1   1 
ATOM   8943  C  CE2   . PHE A 1 1171 ? -8.897  -42.719  -7.426  1.00 15.61 ? 1172 PHE A CE2   1 
ATOM   8944  C  CZ    . PHE A 1 1171 ? -7.502  -42.606  -7.295  1.00 15.78 ? 1172 PHE A CZ    1 
ATOM   8945  N  N     . GLU A 1 1172 ? -9.658  -42.249  -0.784  1.00 20.04 ? 1173 GLU A N     1 
ATOM   8946  C  CA    . GLU A 1 1172 ? -8.903  -42.241  0.461   1.00 21.01 ? 1173 GLU A CA    1 
ATOM   8947  C  C     . GLU A 1 1172 ? -7.604  -42.992  0.222   1.00 21.29 ? 1173 GLU A C     1 
ATOM   8948  O  O     . GLU A 1 1172 ? -7.618  -44.114  -0.307  1.00 21.49 ? 1173 GLU A O     1 
ATOM   8949  C  CB    . GLU A 1 1172 ? -9.722  -42.938  1.551   1.00 21.14 ? 1173 GLU A CB    1 
ATOM   8950  C  CG    . GLU A 1 1172 ? -11.200 -42.677  1.400   1.00 23.00 ? 1173 GLU A CG    1 
ATOM   8951  C  CD    . GLU A 1 1172 ? -12.010 -42.883  2.678   1.00 24.26 ? 1173 GLU A CD    1 
ATOM   8952  O  OE1   . GLU A 1 1172 ? -12.074 -41.948  3.511   1.00 25.11 ? 1173 GLU A OE1   1 
ATOM   8953  O  OE2   . GLU A 1 1172 ? -12.649 -43.953  2.824   1.00 24.71 ? 1173 GLU A OE2   1 
ATOM   8954  N  N     . SER A 1 1173 ? -6.484  -42.356  0.536   1.00 21.55 ? 1174 SER A N     1 
ATOM   8955  C  CA    . SER A 1 1173 ? -5.194  -43.030  0.370   1.00 21.73 ? 1174 SER A CA    1 
ATOM   8956  C  C     . SER A 1 1173 ? -4.924  -44.058  1.484   1.00 21.47 ? 1174 SER A C     1 
ATOM   8957  O  O     . SER A 1 1173 ? -5.713  -44.205  2.432   1.00 21.60 ? 1174 SER A O     1 
ATOM   8958  C  CB    . SER A 1 1173 ? -4.037  -42.027  0.289   1.00 22.20 ? 1174 SER A CB    1 
ATOM   8959  O  OG    . SER A 1 1173 ? -2.972  -42.555  -0.503  1.00 22.13 ? 1174 SER A OG    1 
ATOM   8960  N  N     . PHE A 1 1174 ? -3.805  -44.769  1.364   1.00 20.98 ? 1175 PHE A N     1 
ATOM   8961  C  CA    . PHE A 1 1174 ? -3.450  -45.796  2.334   1.00 20.67 ? 1175 PHE A CA    1 
ATOM   8962  C  C     . PHE A 1 1174 ? -1.950  -46.022  2.437   1.00 22.18 ? 1175 PHE A C     1 
ATOM   8963  O  O     . PHE A 1 1174 ? -1.254  -46.124  1.432   1.00 22.72 ? 1175 PHE A O     1 
ATOM   8964  C  CB    . PHE A 1 1174 ? -4.128  -47.118  1.947   1.00 17.69 ? 1175 PHE A CB    1 
ATOM   8965  C  CG    . PHE A 1 1174 ? -3.539  -48.336  2.614   1.00 14.61 ? 1175 PHE A CG    1 
ATOM   8966  C  CD1   . PHE A 1 1174 ? -3.780  -48.588  3.957   1.00 13.15 ? 1175 PHE A CD1   1 
ATOM   8967  C  CD2   . PHE A 1 1174 ? -2.752  -49.228  1.894   1.00 13.20 ? 1175 PHE A CD2   1 
ATOM   8968  C  CE1   . PHE A 1 1174 ? -3.253  -49.706  4.587   1.00 12.49 ? 1175 PHE A CE1   1 
ATOM   8969  C  CE2   . PHE A 1 1174 ? -2.221  -50.350  2.518   1.00 12.95 ? 1175 PHE A CE2   1 
ATOM   8970  C  CZ    . PHE A 1 1174 ? -2.474  -50.588  3.872   1.00 12.26 ? 1175 PHE A CZ    1 
ATOM   8971  N  N     . ALA A 1 1175 ? -1.466  -46.113  3.666   1.00 24.10 ? 1176 ALA A N     1 
ATOM   8972  C  CA    . ALA A 1 1175 ? -0.063  -46.405  3.939   1.00 25.74 ? 1176 ALA A CA    1 
ATOM   8973  C  C     . ALA A 1 1175 ? -0.143  -47.703  4.761   1.00 27.18 ? 1176 ALA A C     1 
ATOM   8974  O  O     . ALA A 1 1175 ? -0.874  -47.786  5.767   1.00 26.98 ? 1176 ALA A O     1 
ATOM   8975  C  CB    . ALA A 1 1175 ? 0.564   -45.286  4.728   1.00 26.26 ? 1176 ALA A CB    1 
ATOM   8976  N  N     . PRO A 1 1176 ? 0.582   -48.747  4.319   1.00 28.90 ? 1177 PRO A N     1 
ATOM   8977  C  CA    . PRO A 1 1176 ? 0.615   -50.063  4.959   1.00 30.23 ? 1177 PRO A CA    1 
ATOM   8978  C  C     . PRO A 1 1176 ? 0.428   -50.121  6.467   1.00 31.80 ? 1177 PRO A C     1 
ATOM   8979  O  O     . PRO A 1 1176 ? -0.692  -50.394  6.937   1.00 32.62 ? 1177 PRO A O     1 
ATOM   8980  C  CB    . PRO A 1 1176 ? 1.964   -50.628  4.515   1.00 29.91 ? 1177 PRO A CB    1 
ATOM   8981  C  CG    . PRO A 1 1176 ? 2.052   -50.144  3.113   1.00 29.89 ? 1177 PRO A CG    1 
ATOM   8982  C  CD    . PRO A 1 1176 ? 1.635   -48.668  3.279   1.00 29.43 ? 1177 PRO A CD    1 
ATOM   8983  N  N     . ALA A 1 1177 ? 1.501   -49.849  7.220   1.00 32.91 ? 1178 ALA A N     1 
ATOM   8984  C  CA    . ALA A 1 1177 ? 1.464   -49.938  8.685   1.00 33.65 ? 1178 ALA A CA    1 
ATOM   8985  C  C     . ALA A 1 1177 ? 2.167   -48.748  9.340   1.00 33.95 ? 1178 ALA A C     1 
ATOM   8986  O  O     . ALA A 1 1177 ? 1.975   -47.601  8.925   1.00 34.50 ? 1178 ALA A O     1 
ATOM   8987  C  CB    . ALA A 1 1177 ? 2.125   -51.293  9.138   1.00 33.54 ? 1178 ALA A CB    1 
ATOM   8988  N  N     . GLY A 1 1178 ? 2.917   -49.038  10.407  1.00 34.33 ? 1179 GLY A N     1 
ATOM   8989  C  CA    . GLY A 1 1178 ? 3.679   -48.032  11.137  1.00 33.96 ? 1179 GLY A CA    1 
ATOM   8990  C  C     . GLY A 1 1178 ? 4.550   -48.731  12.178  1.00 33.74 ? 1179 GLY A C     1 
ATOM   8991  O  O     . GLY A 1 1178 ? 4.032   -49.523  12.991  1.00 33.50 ? 1179 GLY A O     1 
ATOM   8992  N  N     . GLY A 1 1179 ? 5.859   -48.453  12.141  1.00 33.34 ? 1180 GLY A N     1 
ATOM   8993  C  CA    . GLY A 1 1179 ? 6.799   -49.048  13.080  1.00 32.66 ? 1180 GLY A CA    1 
ATOM   8994  C  C     . GLY A 1 1179 ? 6.701   -48.629  14.549  1.00 32.29 ? 1180 GLY A C     1 
ATOM   8995  O  O     . GLY A 1 1179 ? 6.408   -47.458  14.894  1.00 32.40 ? 1180 GLY A O     1 
ATOM   8996  N  N     . LYS A 1 1180 ? 6.941   -49.627  15.405  1.00 31.86 ? 1181 LYS A N     1 
ATOM   8997  C  CA    . LYS A 1 1180 ? 6.932   -49.528  16.876  1.00 31.30 ? 1181 LYS A CA    1 
ATOM   8998  C  C     . LYS A 1 1180 ? 8.113   -48.663  17.415  1.00 31.36 ? 1181 LYS A C     1 
ATOM   8999  O  O     . LYS A 1 1180 ? 9.142   -49.210  17.876  1.00 31.61 ? 1181 LYS A O     1 
ATOM   9000  C  CB    . LYS A 1 1180 ? 6.997   -50.954  17.469  1.00 30.65 ? 1181 LYS A CB    1 
ATOM   9001  C  CG    . LYS A 1 1180 ? 8.034   -51.869  16.770  0.01 29.15 ? 1181 LYS A CG    1 
ATOM   9002  C  CD    . LYS A 1 1180 ? 8.452   -53.102  17.582  0.01 28.07 ? 1181 LYS A CD    1 
ATOM   9003  C  CE    . LYS A 1 1180 ? 9.449   -53.954  16.786  0.01 27.34 ? 1181 LYS A CE    1 
ATOM   9004  N  NZ    . LYS A 1 1180 ? 10.139  -55.012  17.585  0.01 26.80 ? 1181 LYS A NZ    1 
ATOM   9005  N  N     . ALA A 1 1181 ? 7.956   -47.328  17.352  1.00 30.64 ? 1182 ALA A N     1 
ATOM   9006  C  CA    . ALA A 1 1181 ? 8.987   -46.370  17.802  1.00 29.75 ? 1182 ALA A CA    1 
ATOM   9007  C  C     . ALA A 1 1181 ? 8.905   -46.009  19.313  1.00 29.04 ? 1182 ALA A C     1 
ATOM   9008  O  O     . ALA A 1 1181 ? 7.784   -45.877  19.860  1.00 29.88 ? 1182 ALA A O     1 
ATOM   9009  C  CB    . ALA A 1 1181 ? 8.912   -45.100  16.952  1.00 30.10 ? 1182 ALA A CB    1 
ATOM   9010  N  N     . ASP A 1 1182 ? 10.065  -45.822  19.972  1.00 26.91 ? 1183 ASP A N     1 
ATOM   9011  C  CA    . ASP A 1 1182 ? 10.100  -45.477  21.406  1.00 24.84 ? 1183 ASP A CA    1 
ATOM   9012  C  C     . ASP A 1 1182 ? 9.881   -43.983  21.735  1.00 22.87 ? 1183 ASP A C     1 
ATOM   9013  O  O     . ASP A 1 1182 ? 10.401  -43.099  21.076  1.00 22.97 ? 1183 ASP A O     1 
ATOM   9014  C  CB    . ASP A 1 1182 ? 11.369  -46.015  22.097  1.00 25.81 ? 1183 ASP A CB    1 
ATOM   9015  C  CG    . ASP A 1 1182 ? 11.276  -47.526  22.441  1.00 27.48 ? 1183 ASP A CG    1 
ATOM   9016  O  OD1   . ASP A 1 1182 ? 10.163  -48.115  22.370  1.00 27.70 ? 1183 ASP A OD1   1 
ATOM   9017  O  OD2   . ASP A 1 1182 ? 12.324  -48.131  22.799  1.00 28.27 ? 1183 ASP A OD2   1 
ATOM   9018  N  N     . GLY A 1 1183 ? 9.064   -43.734  22.746  1.00 20.89 ? 1184 GLY A N     1 
ATOM   9019  C  CA    . GLY A 1 1183 ? 8.734   -42.396  23.163  1.00 18.45 ? 1184 GLY A CA    1 
ATOM   9020  C  C     . GLY A 1 1183 ? 7.218   -42.224  23.223  1.00 16.91 ? 1184 GLY A C     1 
ATOM   9021  O  O     . GLY A 1 1183 ? 6.473   -42.872  22.479  1.00 16.75 ? 1184 GLY A O     1 
ATOM   9022  N  N     . SER A 1 1184 ? 6.762   -41.357  24.124  1.00 14.68 ? 1185 SER A N     1 
ATOM   9023  C  CA    . SER A 1 1184 ? 5.332   -41.062  24.294  1.00 12.09 ? 1185 SER A CA    1 
ATOM   9024  C  C     . SER A 1 1184 ? 5.159   -39.738  25.058  1.00 9.67  ? 1185 SER A C     1 
ATOM   9025  O  O     . SER A 1 1184 ? 6.022   -39.351  25.824  1.00 8.61  ? 1185 SER A O     1 
ATOM   9026  C  CB    . SER A 1 1184 ? 4.619   -42.213  25.037  1.00 12.59 ? 1185 SER A CB    1 
ATOM   9027  O  OG    . SER A 1 1184 ? 5.104   -42.361  26.365  1.00 13.63 ? 1185 SER A OG    1 
ATOM   9028  N  N     . VAL A 1 1185 ? 4.046   -39.051  24.833  1.00 7.66  ? 1186 VAL A N     1 
ATOM   9029  C  CA    . VAL A 1 1185 ? 3.807   -37.776  25.502  1.00 5.87  ? 1186 VAL A CA    1 
ATOM   9030  C  C     . VAL A 1 1185 ? 2.363   -37.623  25.955  1.00 5.28  ? 1186 VAL A C     1 
ATOM   9031  O  O     . VAL A 1 1185 ? 1.438   -38.007  25.244  1.00 5.21  ? 1186 VAL A O     1 
ATOM   9032  C  CB    . VAL A 1 1185 ? 4.254   -36.555  24.640  1.00 5.11  ? 1186 VAL A CB    1 
ATOM   9033  C  CG1   . VAL A 1 1185 ? 3.378   -36.375  23.399  1.00 4.67  ? 1186 VAL A CG1   1 
ATOM   9034  C  CG2   . VAL A 1 1185 ? 4.308   -35.292  25.507  1.00 4.54  ? 1186 VAL A CG2   1 
ATOM   9035  N  N     . ASP A 1 1186 ? 2.193   -37.169  27.195  1.00 4.85  ? 1187 ASP A N     1 
ATOM   9036  C  CA    . ASP A 1 1186 ? 0.873   -36.961  27.785  1.00 4.18  ? 1187 ASP A CA    1 
ATOM   9037  C  C     . ASP A 1 1186 ? 0.241   -35.736  27.163  1.00 3.91  ? 1187 ASP A C     1 
ATOM   9038  O  O     . ASP A 1 1186 ? 0.899   -34.727  26.945  1.00 3.93  ? 1187 ASP A O     1 
ATOM   9039  C  CB    . ASP A 1 1186 ? 0.976   -36.810  29.306  1.00 4.20  ? 1187 ASP A CB    1 
ATOM   9040  C  CG    . ASP A 1 1186 ? -0.363  -36.540  29.945  1.00 5.59  ? 1187 ASP A CG    1 
ATOM   9041  O  OD1   . ASP A 1 1186 ? -1.104  -37.524  30.125  1.00 6.35  ? 1187 ASP A OD1   1 
ATOM   9042  O  OD2   . ASP A 1 1186 ? -0.692  -35.365  30.264  1.00 4.95  ? 1187 ASP A OD2   1 
ATOM   9043  N  N     . PHE A 1 1187 ? -1.055  -35.817  26.929  1.00 3.87  ? 1188 PHE A N     1 
ATOM   9044  C  CA    . PHE A 1 1187 ? -1.772  -34.743  26.293  1.00 3.52  ? 1188 PHE A CA    1 
ATOM   9045  C  C     . PHE A 1 1187 ? -1.749  -33.447  27.038  1.00 3.97  ? 1188 PHE A C     1 
ATOM   9046  O  O     . PHE A 1 1187 ? -1.924  -32.410  26.439  1.00 4.44  ? 1188 PHE A O     1 
ATOM   9047  C  CB    . PHE A 1 1187 ? -3.220  -35.152  25.972  1.00 3.04  ? 1188 PHE A CB    1 
ATOM   9048  C  CG    . PHE A 1 1187 ? -4.070  -35.507  27.186  1.00 2.26  ? 1188 PHE A CG    1 
ATOM   9049  C  CD1   . PHE A 1 1187 ? -4.765  -34.528  27.878  1.00 2.00  ? 1188 PHE A CD1   1 
ATOM   9050  C  CD2   . PHE A 1 1187 ? -4.180  -36.846  27.611  1.00 2.00  ? 1188 PHE A CD2   1 
ATOM   9051  C  CE1   . PHE A 1 1187 ? -5.542  -34.859  28.957  1.00 2.00  ? 1188 PHE A CE1   1 
ATOM   9052  C  CE2   . PHE A 1 1187 ? -4.963  -37.183  28.702  1.00 2.00  ? 1188 PHE A CE2   1 
ATOM   9053  C  CZ    . PHE A 1 1187 ? -5.646  -36.174  29.374  1.00 2.25  ? 1188 PHE A CZ    1 
ATOM   9054  N  N     . GLY A 1 1188 ? -1.459  -33.489  28.328  1.00 4.37  ? 1189 GLY A N     1 
ATOM   9055  C  CA    . GLY A 1 1188 ? -1.485  -32.272  29.103  1.00 4.65  ? 1189 GLY A CA    1 
ATOM   9056  C  C     . GLY A 1 1188 ? -0.140  -31.676  29.315  1.00 5.39  ? 1189 GLY A C     1 
ATOM   9057  O  O     . GLY A 1 1188 ? 0.012   -30.719  30.071  1.00 5.52  ? 1189 GLY A O     1 
ATOM   9058  N  N     . GLU A 1 1189 ? 0.840   -32.209  28.606  1.00 6.09  ? 1190 GLU A N     1 
ATOM   9059  C  CA    . GLU A 1 1189 ? 2.193   -31.711  28.735  1.00 6.22  ? 1190 GLU A CA    1 
ATOM   9060  C  C     . GLU A 1 1189 ? 2.406   -30.354  28.083  1.00 5.14  ? 1190 GLU A C     1 
ATOM   9061  O  O     . GLU A 1 1189 ? 2.298   -30.219  26.862  1.00 4.06  ? 1190 GLU A O     1 
ATOM   9062  C  CB    . GLU A 1 1189 ? 3.130   -32.730  28.136  1.00 9.31  ? 1190 GLU A CB    1 
ATOM   9063  C  CG    . GLU A 1 1189 ? 3.966   -33.412  29.149  1.00 14.39 ? 1190 GLU A CG    1 
ATOM   9064  C  CD    . GLU A 1 1189 ? 5.152   -32.559  29.480  1.00 16.98 ? 1190 GLU A CD    1 
ATOM   9065  O  OE1   . GLU A 1 1189 ? 5.866   -32.257  28.495  1.00 19.16 ? 1190 GLU A OE1   1 
ATOM   9066  O  OE2   . GLU A 1 1189 ? 5.362   -32.178  30.670  1.00 17.55 ? 1190 GLU A OE2   1 
ATOM   9067  N  N     . GLY A 1 1190 ? 2.687   -29.350  28.911  1.00 4.21  ? 1191 GLY A N     1 
ATOM   9068  C  CA    . GLY A 1 1190 ? 2.954   -28.020  28.408  1.00 3.79  ? 1191 GLY A CA    1 
ATOM   9069  C  C     . GLY A 1 1190 ? 1.772   -27.176  28.011  1.00 3.35  ? 1191 GLY A C     1 
ATOM   9070  O  O     . GLY A 1 1190 ? 1.951   -26.166  27.343  1.00 3.36  ? 1191 GLY A O     1 
ATOM   9071  N  N     . ALA A 1 1191 ? 0.574   -27.597  28.392  1.00 3.39  ? 1192 ALA A N     1 
ATOM   9072  C  CA    . ALA A 1 1191 ? -0.633  -26.849  28.070  1.00 3.64  ? 1192 ALA A CA    1 
ATOM   9073  C  C     . ALA A 1 1191 ? -0.732  -25.545  28.892  1.00 4.06  ? 1192 ALA A C     1 
ATOM   9074  O  O     . ALA A 1 1191 ? -0.162  -25.464  29.972  1.00 4.17  ? 1192 ALA A O     1 
ATOM   9075  C  CB    . ALA A 1 1191 ? -1.867  -27.709  28.261  1.00 2.49  ? 1192 ALA A CB    1 
ATOM   9076  N  N     . GLU A 1 1192 ? -1.405  -24.516  28.355  1.00 4.73  ? 1193 GLU A N     1 
ATOM   9077  C  CA    . GLU A 1 1192 ? -1.533  -23.238  29.072  1.00 5.83  ? 1193 GLU A CA    1 
ATOM   9078  C  C     . GLU A 1 1192 ? -2.539  -23.242  30.188  1.00 5.05  ? 1193 GLU A C     1 
ATOM   9079  O  O     . GLU A 1 1192 ? -2.332  -22.584  31.212  1.00 5.40  ? 1193 GLU A O     1 
ATOM   9080  C  CB    . GLU A 1 1192 ? -1.842  -22.062  28.142  1.00 8.05  ? 1193 GLU A CB    1 
ATOM   9081  C  CG    . GLU A 1 1192 ? -0.655  -21.587  27.343  1.00 12.36 ? 1193 GLU A CG    1 
ATOM   9082  C  CD    . GLU A 1 1192 ? -0.425  -22.399  26.094  1.00 15.76 ? 1193 GLU A CD    1 
ATOM   9083  O  OE1   . GLU A 1 1192 ? -1.321  -23.203  25.725  1.00 17.39 ? 1193 GLU A OE1   1 
ATOM   9084  O  OE2   . GLU A 1 1192 ? 0.664   -22.241  25.480  1.00 18.51 ? 1193 GLU A OE2   1 
ATOM   9085  N  N     . PHE A 1 1193 ? -3.582  -24.043  30.017  1.00 4.26  ? 1194 PHE A N     1 
ATOM   9086  C  CA    . PHE A 1 1193 ? -4.654  -24.152  30.980  1.00 3.59  ? 1194 PHE A CA    1 
ATOM   9087  C  C     . PHE A 1 1193 ? -4.811  -25.577  31.455  1.00 3.51  ? 1194 PHE A C     1 
ATOM   9088  O  O     . PHE A 1 1193 ? -4.210  -26.471  30.893  1.00 3.92  ? 1194 PHE A O     1 
ATOM   9089  C  CB    . PHE A 1 1193 ? -5.961  -23.661  30.339  1.00 3.19  ? 1194 PHE A CB    1 
ATOM   9090  C  CG    . PHE A 1 1193 ? -5.930  -22.207  29.936  1.00 2.27  ? 1194 PHE A CG    1 
ATOM   9091  C  CD1   . PHE A 1 1193 ? -5.171  -21.782  28.853  1.00 2.01  ? 1194 PHE A CD1   1 
ATOM   9092  C  CD2   . PHE A 1 1193 ? -6.663  -21.266  30.650  1.00 2.39  ? 1194 PHE A CD2   1 
ATOM   9093  C  CE1   . PHE A 1 1193 ? -5.148  -20.446  28.489  1.00 2.06  ? 1194 PHE A CE1   1 
ATOM   9094  C  CE2   . PHE A 1 1193 ? -6.653  -19.909  30.298  1.00 2.34  ? 1194 PHE A CE2   1 
ATOM   9095  C  CZ    . PHE A 1 1193 ? -5.894  -19.501  29.216  1.00 2.12  ? 1194 PHE A CZ    1 
ATOM   9096  N  N     . CYS A 1 1194 ? -5.629  -25.781  32.487  1.00 3.55  ? 1195 CYS A N     1 
ATOM   9097  C  CA    . CYS A 1 1194 ? -5.866  -27.096  33.029  1.00 3.38  ? 1195 CYS A CA    1 
ATOM   9098  C  C     . CYS A 1 1194 ? -6.412  -28.005  31.940  1.00 2.97  ? 1195 CYS A C     1 
ATOM   9099  O  O     . CYS A 1 1194 ? -7.220  -27.630  31.116  1.00 3.10  ? 1195 CYS A O     1 
ATOM   9100  C  CB    . CYS A 1 1194 ? -6.792  -27.067  34.232  1.00 4.28  ? 1195 CYS A CB    1 
ATOM   9101  S  SG    . CYS A 1 1194 ? -6.243  -26.051  35.647  1.00 5.72  ? 1195 CYS A SG    1 
ATOM   9102  N  N     . THR A 1 1195 ? -5.833  -29.186  31.893  1.00 2.88  ? 1196 THR A N     1 
ATOM   9103  C  CA    . THR A 1 1195 ? -6.134  -30.190  30.915  1.00 2.43  ? 1196 THR A CA    1 
ATOM   9104  C  C     . THR A 1 1195 ? -6.898  -31.354  31.574  1.00 2.97  ? 1196 THR A C     1 
ATOM   9105  O  O     . THR A 1 1195 ? -7.388  -32.257  30.891  1.00 3.43  ? 1196 THR A O     1 
ATOM   9106  C  CB    . THR A 1 1195 ? -4.788  -30.565  30.283  1.00 2.40  ? 1196 THR A CB    1 
ATOM   9107  O  OG1   . THR A 1 1195 ? -4.703  -29.989  28.972  1.00 2.72  ? 1196 THR A OG1   1 
ATOM   9108  C  CG2   . THR A 1 1195 ? -4.518  -32.017  30.281  1.00 2.00  ? 1196 THR A CG2   1 
ATOM   9109  N  N     . ARG A 1 1196 ? -7.049  -31.295  32.898  1.00 3.32  ? 1197 ARG A N     1 
ATOM   9110  C  CA    . ARG A 1 1196 ? -7.786  -32.296  33.662  1.00 4.42  ? 1197 ARG A CA    1 
ATOM   9111  C  C     . ARG A 1 1196 ? -8.593  -31.582  34.754  1.00 5.83  ? 1197 ARG A C     1 
ATOM   9112  O  O     . ARG A 1 1196 ? -8.314  -30.427  35.065  1.00 5.95  ? 1197 ARG A O     1 
ATOM   9113  C  CB    . ARG A 1 1196 ? -6.841  -33.331  34.239  1.00 3.75  ? 1197 ARG A CB    1 
ATOM   9114  C  CG    . ARG A 1 1196 ? -6.336  -34.322  33.188  1.00 3.57  ? 1197 ARG A CG    1 
ATOM   9115  C  CD    . ARG A 1 1196 ? -5.095  -35.054  33.729  1.00 4.02  ? 1197 ARG A CD    1 
ATOM   9116  N  NE    . ARG A 1 1196 ? -4.729  -36.295  33.035  1.00 3.63  ? 1197 ARG A NE    1 
ATOM   9117  C  CZ    . ARG A 1 1196 ? -3.717  -36.401  32.172  1.00 3.48  ? 1197 ARG A CZ    1 
ATOM   9118  N  NH1   . ARG A 1 1196 ? -2.965  -35.345  31.872  1.00 2.64  ? 1197 ARG A NH1   1 
ATOM   9119  N  NH2   . ARG A 1 1196 ? -3.429  -37.576  31.641  1.00 3.11  ? 1197 ARG A NH2   1 
ATOM   9120  N  N     . ASP A 1 1197 ? -9.657  -32.223  35.237  1.00 7.74  ? 1198 ASP A N     1 
ATOM   9121  C  CA    . ASP A 1 1197 ? -10.544 -31.646  36.262  1.00 10.18 ? 1198 ASP A CA    1 
ATOM   9122  C  C     . ASP A 1 1197 ? -10.295 -32.042  37.751  1.00 11.25 ? 1198 ASP A C     1 
ATOM   9123  O  O     . ASP A 1 1197 ? -9.332  -32.734  38.096  1.00 11.48 ? 1198 ASP A O     1 
ATOM   9124  C  CB    . ASP A 1 1197 ? -12.046 -31.851  35.884  1.00 10.69 ? 1198 ASP A CB    1 
ATOM   9125  C  CG    . ASP A 1 1197 ? -12.500 -33.332  35.952  1.00 12.10 ? 1198 ASP A CG    1 
ATOM   9126  O  OD1   . ASP A 1 1197 ? -11.912 -34.141  36.720  1.00 11.00 ? 1198 ASP A OD1   1 
ATOM   9127  O  OD2   . ASP A 1 1197 ? -13.463 -33.680  35.218  1.00 12.92 ? 1198 ASP A OD2   1 
ATOM   9128  N  N     . ASP A 1 1198 ? -11.198 -31.612  38.627  1.00 12.53 ? 1199 ASP A N     1 
ATOM   9129  C  CA    . ASP A 1 1198 ? -11.086 -31.882  40.064  1.00 13.45 ? 1199 ASP A CA    1 
ATOM   9130  C  C     . ASP A 1 1198 ? -11.742 -33.160  40.538  1.00 12.59 ? 1199 ASP A C     1 
ATOM   9131  O  O     . ASP A 1 1198 ? -11.851 -33.374  41.740  1.00 13.05 ? 1199 ASP A O     1 
ATOM   9132  C  CB    . ASP A 1 1198 ? -11.760 -30.754  40.820  1.00 15.53 ? 1199 ASP A CB    1 
ATOM   9133  C  CG    . ASP A 1 1198 ? -11.233 -29.391  40.425  1.00 17.21 ? 1199 ASP A CG    1 
ATOM   9134  O  OD1   . ASP A 1 1198 ? -10.035 -29.297  40.044  1.00 17.14 ? 1199 ASP A OD1   1 
ATOM   9135  O  OD2   . ASP A 1 1198 ? -12.024 -28.423  40.529  1.00 18.13 ? 1199 ASP A OD2   1 
ATOM   9136  N  N     . THR A 1 1199 ? -12.180 -33.991  39.608  1.00 10.82 ? 1200 THR A N     1 
ATOM   9137  C  CA    . THR A 1 1199 ? -12.889 -35.191  39.940  1.00 9.43  ? 1200 THR A CA    1 
ATOM   9138  C  C     . THR A 1 1199 ? -11.992 -36.402  40.215  1.00 7.88  ? 1200 THR A C     1 
ATOM   9139  O  O     . THR A 1 1199 ? -10.831 -36.409  39.823  1.00 7.90  ? 1200 THR A O     1 
ATOM   9140  C  CB    . THR A 1 1199 ? -13.894 -35.421  38.823  1.00 10.17 ? 1200 THR A CB    1 
ATOM   9141  O  OG1   . THR A 1 1199 ? -15.153 -35.853  39.379  1.00 13.00 ? 1200 THR A OG1   1 
ATOM   9142  C  CG2   . THR A 1 1199 ? -13.386 -36.404  37.834  1.00 10.96 ? 1200 THR A CG2   1 
ATOM   9143  N  N     . PRO A 1 1200 ? -12.486 -37.421  40.957  1.00 6.67  ? 1201 PRO A N     1 
ATOM   9144  C  CA    . PRO A 1 1200 ? -11.677 -38.621  41.258  1.00 5.37  ? 1201 PRO A CA    1 
ATOM   9145  C  C     . PRO A 1 1200 ? -11.403 -39.464  40.012  1.00 4.62  ? 1201 PRO A C     1 
ATOM   9146  O  O     . PRO A 1 1200 ? -10.539 -40.320  40.015  1.00 4.21  ? 1201 PRO A O     1 
ATOM   9147  C  CB    . PRO A 1 1200 ? -12.564 -39.413  42.216  1.00 5.59  ? 1201 PRO A CB    1 
ATOM   9148  C  CG    . PRO A 1 1200 ? -13.473 -38.398  42.793  1.00 5.58  ? 1201 PRO A CG    1 
ATOM   9149  C  CD    . PRO A 1 1200 ? -13.777 -37.480  41.660  1.00 6.01  ? 1201 PRO A CD    1 
ATOM   9150  N  N     . MET A 1 1201 ? -12.173 -39.241  38.952  1.00 4.24  ? 1202 MET A N     1 
ATOM   9151  C  CA    . MET A 1 1201 ? -11.991 -39.999  37.725  1.00 3.57  ? 1202 MET A CA    1 
ATOM   9152  C  C     . MET A 1 1201 ? -10.756 -39.630  36.967  1.00 2.65  ? 1202 MET A C     1 
ATOM   9153  O  O     . MET A 1 1201 ? -10.173 -40.475  36.314  1.00 2.18  ? 1202 MET A O     1 
ATOM   9154  C  CB    . MET A 1 1201 ? -13.214 -39.885  36.816  1.00 4.30  ? 1202 MET A CB    1 
ATOM   9155  C  CG    . MET A 1 1201 ? -14.334 -40.828  37.204  1.00 6.22  ? 1202 MET A CG    1 
ATOM   9156  S  SD    . MET A 1 1201 ? -15.984 -40.123  36.973  1.00 10.51 ? 1202 MET A SD    1 
ATOM   9157  C  CE    . MET A 1 1201 ? -15.932 -38.634  38.009  1.00 7.10  ? 1202 MET A CE    1 
ATOM   9158  N  N     . MET A 1 1202 ? -10.387 -38.358  37.001  1.00 2.57  ? 1203 MET A N     1 
ATOM   9159  C  CA    . MET A 1 1202 ? -9.192  -37.913  36.288  1.00 2.88  ? 1203 MET A CA    1 
ATOM   9160  C  C     . MET A 1 1202 ? -7.863  -37.933  37.086  1.00 2.70  ? 1203 MET A C     1 
ATOM   9161  O  O     . MET A 1 1202 ? -6.808  -37.643  36.543  1.00 2.92  ? 1203 MET A O     1 
ATOM   9162  C  CB    . MET A 1 1202 ? -9.439  -36.530  35.657  1.00 3.05  ? 1203 MET A CB    1 
ATOM   9163  C  CG    . MET A 1 1202 ? -10.450 -36.565  34.535  1.00 2.86  ? 1203 MET A CG    1 
ATOM   9164  S  SD    . MET A 1 1202 ? -10.221 -35.117  33.520  1.00 3.24  ? 1203 MET A SD    1 
ATOM   9165  C  CE    . MET A 1 1202 ? -11.795 -35.049  32.599  1.00 2.00  ? 1203 MET A CE    1 
ATOM   9166  N  N     . ALA A 1 1203 ? -7.951  -38.253  38.369  1.00 2.57  ? 1204 ALA A N     1 
ATOM   9167  C  CA    . ALA A 1 1203 ? -6.825  -38.360  39.280  1.00 3.57  ? 1204 ALA A CA    1 
ATOM   9168  C  C     . ALA A 1 1203 ? -5.827  -39.455  38.882  1.00 4.24  ? 1204 ALA A C     1 
ATOM   9169  O  O     . ALA A 1 1203 ? -6.179  -40.641  38.785  1.00 4.12  ? 1204 ALA A O     1 
ATOM   9170  C  CB    . ALA A 1 1203 ? -7.334  -38.630  40.741  1.00 3.45  ? 1204 ALA A CB    1 
ATOM   9171  N  N     . ARG A 1 1204 ? -4.586  -39.044  38.639  1.00 5.10  ? 1205 ARG A N     1 
ATOM   9172  C  CA    . ARG A 1 1204 ? -3.517  -39.975  38.277  1.00 5.79  ? 1205 ARG A CA    1 
ATOM   9173  C  C     . ARG A 1 1204 ? -2.342  -39.661  39.234  1.00 5.70  ? 1205 ARG A C     1 
ATOM   9174  O  O     . ARG A 1 1204 ? -2.337  -38.613  39.894  1.00 5.68  ? 1205 ARG A O     1 
ATOM   9175  C  CB    . ARG A 1 1204 ? -3.083  -39.748  36.816  1.00 7.11  ? 1205 ARG A CB    1 
ATOM   9176  C  CG    . ARG A 1 1204 ? -4.107  -40.005  35.668  1.00 8.23  ? 1205 ARG A CG    1 
ATOM   9177  C  CD    . ARG A 1 1204 ? -4.500  -41.517  35.457  1.00 9.95  ? 1205 ARG A CD    1 
ATOM   9178  N  NE    . ARG A 1 1204 ? -5.898  -41.657  35.855  1.00 10.78 ? 1205 ARG A NE    1 
ATOM   9179  C  CZ    . ARG A 1 1204 ? -6.933  -41.706  35.030  1.00 10.66 ? 1205 ARG A CZ    1 
ATOM   9180  N  NH1   . ARG A 1 1204 ? -6.796  -41.696  33.715  1.00 11.49 ? 1205 ARG A NH1   1 
ATOM   9181  N  NH2   . ARG A 1 1204 ? -8.121  -41.488  35.522  1.00 11.35 ? 1205 ARG A NH2   1 
ATOM   9182  N  N     . PRO A 1 1205 ? -1.356  -40.560  39.339  1.00 5.37  ? 1206 PRO A N     1 
ATOM   9183  C  CA    . PRO A 1 1205 ? -0.182  -40.395  40.201  1.00 6.13  ? 1206 PRO A CA    1 
ATOM   9184  C  C     . PRO A 1 1205 ? 0.462   -39.020  40.078  1.00 7.59  ? 1206 PRO A C     1 
ATOM   9185  O  O     . PRO A 1 1205 ? 0.792   -38.380  41.092  1.00 7.63  ? 1206 PRO A O     1 
ATOM   9186  C  CB    . PRO A 1 1205 ? 0.760   -41.462  39.692  1.00 5.67  ? 1206 PRO A CB    1 
ATOM   9187  C  CG    . PRO A 1 1205 ? -0.191  -42.553  39.278  1.00 5.15  ? 1206 PRO A CG    1 
ATOM   9188  C  CD    . PRO A 1 1205 ? -1.278  -41.810  38.572  1.00 5.00  ? 1206 PRO A CD    1 
ATOM   9189  N  N     . ASP A 1 1206 ? 0.652   -38.552  38.850  1.00 9.08  ? 1207 ASP A N     1 
ATOM   9190  C  CA    . ASP A 1 1206 ? 1.224   -37.227  38.708  1.00 11.52 ? 1207 ASP A CA    1 
ATOM   9191  C  C     . ASP A 1 1206 ? 0.264   -36.023  38.503  1.00 11.84 ? 1207 ASP A C     1 
ATOM   9192  O  O     . ASP A 1 1206 ? 0.666   -34.970  37.999  1.00 12.59 ? 1207 ASP A O     1 
ATOM   9193  C  CB    . ASP A 1 1206 ? 2.351   -37.245  37.681  1.00 13.99 ? 1207 ASP A CB    1 
ATOM   9194  C  CG    . ASP A 1 1206 ? 3.592   -38.034  38.177  1.00 16.27 ? 1207 ASP A CG    1 
ATOM   9195  O  OD1   . ASP A 1 1206 ? 3.906   -38.023  39.406  1.00 17.47 ? 1207 ASP A OD1   1 
ATOM   9196  O  OD2   . ASP A 1 1206 ? 4.252   -38.673  37.324  1.00 17.26 ? 1207 ASP A OD2   1 
ATOM   9197  N  N     . SER A 1 1207 ? -0.992  -36.167  38.932  1.00 11.72 ? 1208 SER A N     1 
ATOM   9198  C  CA    . SER A 1 1207 ? -1.988  -35.092  38.839  1.00 11.44 ? 1208 SER A CA    1 
ATOM   9199  C  C     . SER A 1 1207 ? -1.838  -34.170  40.032  1.00 11.04 ? 1208 SER A C     1 
ATOM   9200  O  O     . SER A 1 1207 ? -1.189  -34.506  41.011  1.00 11.35 ? 1208 SER A O     1 
ATOM   9201  C  CB    . SER A 1 1207 ? -3.415  -35.668  38.921  1.00 11.85 ? 1208 SER A CB    1 
ATOM   9202  O  OG    . SER A 1 1207 ? -3.889  -36.158  37.673  1.00 12.82 ? 1208 SER A OG    1 
ATOM   9203  N  N     . GLY A 1 1208 ? -2.505  -33.032  39.985  1.00 11.02 ? 1209 GLY A N     1 
ATOM   9204  C  CA    . GLY A 1 1208 ? -2.442  -32.142  41.119  1.00 11.44 ? 1209 GLY A CA    1 
ATOM   9205  C  C     . GLY A 1 1208 ? -1.609  -30.901  41.046  1.00 11.68 ? 1209 GLY A C     1 
ATOM   9206  O  O     . GLY A 1 1208 ? -1.579  -30.155  42.003  1.00 12.09 ? 1209 GLY A O     1 
ATOM   9207  N  N     . GLU A 1 1209 ? -0.922  -30.648  39.950  1.00 12.56 ? 1210 GLU A N     1 
ATOM   9208  C  CA    . GLU A 1 1209 ? -0.126  -29.425  39.910  1.00 13.46 ? 1210 GLU A CA    1 
ATOM   9209  C  C     . GLU A 1 1209 ? -0.981  -28.240  39.550  1.00 11.98 ? 1210 GLU A C     1 
ATOM   9210  O  O     . GLU A 1 1209 ? -1.969  -28.371  38.857  1.00 12.44 ? 1210 GLU A O     1 
ATOM   9211  C  CB    . GLU A 1 1209 ? 1.025   -29.567  38.957  1.00 15.82 ? 1210 GLU A CB    1 
ATOM   9212  C  CG    . GLU A 1 1209 ? 0.604   -29.893  37.584  1.00 19.72 ? 1210 GLU A CG    1 
ATOM   9213  C  CD    . GLU A 1 1209 ? 1.804   -30.108  36.704  1.00 22.56 ? 1210 GLU A CD    1 
ATOM   9214  O  OE1   . GLU A 1 1209 ? 2.402   -31.215  36.801  1.00 24.94 ? 1210 GLU A OE1   1 
ATOM   9215  O  OE2   . GLU A 1 1209 ? 2.157   -29.179  35.928  1.00 24.26 ? 1210 GLU A OE2   1 
ATOM   9216  N  N     . ALA A 1 1210 ? -0.577  -27.074  40.012  1.00 11.06 ? 1211 ALA A N     1 
ATOM   9217  C  CA    . ALA A 1 1210 ? -1.334  -25.846  39.802  1.00 9.24  ? 1211 ALA A CA    1 
ATOM   9218  C  C     . ALA A 1 1210 ? -1.492  -25.519  38.326  1.00 8.52  ? 1211 ALA A C     1 
ATOM   9219  O  O     . ALA A 1 1210 ? -0.561  -25.736  37.536  1.00 9.26  ? 1211 ALA A O     1 
ATOM   9220  C  CB    . ALA A 1 1210 ? -0.647  -24.722  40.548  1.00 8.52  ? 1211 ALA A CB    1 
ATOM   9221  N  N     . CYS A 1 1211 ? -2.650  -24.996  37.950  1.00 7.25  ? 1212 CYS A N     1 
ATOM   9222  C  CA    . CYS A 1 1211 ? -2.908  -24.649  36.546  1.00 6.70  ? 1212 CYS A CA    1 
ATOM   9223  C  C     . CYS A 1 1211 ? -4.037  -23.631  36.417  1.00 6.09  ? 1212 CYS A C     1 
ATOM   9224  O  O     . CYS A 1 1211 ? -4.695  -23.323  37.400  1.00 6.80  ? 1212 CYS A O     1 
ATOM   9225  C  CB    . CYS A 1 1211 ? -3.213  -25.916  35.721  1.00 6.11  ? 1212 CYS A CB    1 
ATOM   9226  S  SG    . CYS A 1 1211 ? -4.582  -26.960  36.362  1.00 5.96  ? 1212 CYS A SG    1 
ATOM   9227  N  N     . ASP A 1 1212 ? -4.220  -23.063  35.233  1.00 5.37  ? 1213 ASP A N     1 
ATOM   9228  C  CA    . ASP A 1 1212 ? -5.303  -22.100  35.025  1.00 4.78  ? 1213 ASP A CA    1 
ATOM   9229  C  C     . ASP A 1 1212 ? -6.542  -22.917  34.624  1.00 4.62  ? 1213 ASP A C     1 
ATOM   9230  O  O     . ASP A 1 1212 ? -6.584  -23.518  33.553  1.00 4.50  ? 1213 ASP A O     1 
ATOM   9231  C  CB    . ASP A 1 1212 ? -4.931  -21.095  33.934  1.00 4.57  ? 1213 ASP A CB    1 
ATOM   9232  C  CG    . ASP A 1 1212 ? -5.942  -19.936  33.811  1.00 5.41  ? 1213 ASP A CG    1 
ATOM   9233  O  OD1   . ASP A 1 1212 ? -7.183  -20.170  33.923  1.00 4.82  ? 1213 ASP A OD1   1 
ATOM   9234  O  OD2   . ASP A 1 1212 ? -5.467  -18.775  33.588  1.00 5.95  ? 1213 ASP A OD2   1 
ATOM   9235  N  N     . GLN A 1 1213 ? -7.553  -22.905  35.474  1.00 3.97  ? 1214 GLN A N     1 
ATOM   9236  C  CA    . GLN A 1 1213 ? -8.756  -23.670  35.243  1.00 3.85  ? 1214 GLN A CA    1 
ATOM   9237  C  C     . GLN A 1 1213 ? -9.875  -22.915  34.504  1.00 3.32  ? 1214 GLN A C     1 
ATOM   9238  O  O     . GLN A 1 1213 ? -11.038 -23.203  34.650  1.00 2.99  ? 1214 GLN A O     1 
ATOM   9239  C  CB    . GLN A 1 1213 ? -9.217  -24.163  36.605  1.00 4.86  ? 1214 GLN A CB    1 
ATOM   9240  C  CG    . GLN A 1 1213 ? -10.103 -25.368  36.638  1.00 5.23  ? 1214 GLN A CG    1 
ATOM   9241  C  CD    . GLN A 1 1213 ? -10.465 -25.658  38.077  1.00 5.55  ? 1214 GLN A CD    1 
ATOM   9242  O  OE1   . GLN A 1 1213 ? -10.754 -24.752  38.835  1.00 5.58  ? 1214 GLN A OE1   1 
ATOM   9243  N  NE2   . GLN A 1 1213 ? -10.392 -26.911  38.466  1.00 5.66  ? 1214 GLN A NE2   1 
ATOM   9244  N  N     . ASN A 1 1214 ? -9.514  -21.951  33.690  1.00 3.14  ? 1215 ASN A N     1 
ATOM   9245  C  CA    . ASN A 1 1214 ? -10.511 -21.200  32.931  1.00 3.44  ? 1215 ASN A CA    1 
ATOM   9246  C  C     . ASN A 1 1214 ? -11.609 -20.421  33.675  1.00 3.02  ? 1215 ASN A C     1 
ATOM   9247  O  O     . ASN A 1 1214 ? -12.653 -20.158  33.105  1.00 2.96  ? 1215 ASN A O     1 
ATOM   9248  C  CB    . ASN A 1 1214 ? -11.127 -22.100  31.848  1.00 3.24  ? 1215 ASN A CB    1 
ATOM   9249  C  CG    . ASN A 1 1214 ? -10.162 -22.372  30.705  1.00 3.02  ? 1215 ASN A CG    1 
ATOM   9250  O  OD1   . ASN A 1 1214 ? -9.642  -23.489  30.567  1.00 3.88  ? 1215 ASN A OD1   1 
ATOM   9251  N  ND2   . ASN A 1 1214 ? -9.890  -21.351  29.900  1.00 2.00  ? 1215 ASN A ND2   1 
ATOM   9252  N  N     . ARG A 1 1215 ? -11.348 -19.998  34.910  1.00 3.03  ? 1216 ARG A N     1 
ATOM   9253  C  CA    . ARG A 1 1215 ? -12.323 -19.228  35.675  1.00 2.76  ? 1216 ARG A CA    1 
ATOM   9254  C  C     . ARG A 1 1215 ? -12.026 -17.726  35.694  1.00 2.87  ? 1216 ARG A C     1 
ATOM   9255  O  O     . ARG A 1 1215 ? -12.777 -16.905  36.278  1.00 2.74  ? 1216 ARG A O     1 
ATOM   9256  C  CB    . ARG A 1 1215 ? -12.462 -19.800  37.088  1.00 2.97  ? 1216 ARG A CB    1 
ATOM   9257  C  CG    . ARG A 1 1215 ? -13.128 -21.200  37.128  1.00 2.81  ? 1216 ARG A CG    1 
ATOM   9258  C  CD    . ARG A 1 1215 ? -12.673 -22.065  38.307  1.00 3.56  ? 1216 ARG A CD    1 
ATOM   9259  N  NE    . ARG A 1 1215 ? -12.595 -21.285  39.519  1.00 4.76  ? 1216 ARG A NE    1 
ATOM   9260  C  CZ    . ARG A 1 1215 ? -11.599 -21.332  40.388  1.00 4.73  ? 1216 ARG A CZ    1 
ATOM   9261  N  NH1   . ARG A 1 1215 ? -10.593 -22.179  40.192  1.00 3.62  ? 1216 ARG A NH1   1 
ATOM   9262  N  NH2   . ARG A 1 1215 ? -11.538 -20.391  41.341  1.00 5.79  ? 1216 ARG A NH2   1 
ATOM   9263  N  N     . ALA A 1 1216 ? -10.962 -17.346  34.990  1.00 2.50  ? 1217 ALA A N     1 
ATOM   9264  C  CA    . ALA A 1 1216 ? -10.583 -15.946  34.924  1.00 2.03  ? 1217 ALA A CA    1 
ATOM   9265  C  C     . ALA A 1 1216 ? -10.703 -15.421  33.503  1.00 2.35  ? 1217 ALA A C     1 
ATOM   9266  O  O     . ALA A 1 1216 ? -10.309 -14.286  33.211  1.00 2.00  ? 1217 ALA A O     1 
ATOM   9267  C  CB    . ALA A 1 1216 ? -9.199  -15.765  35.427  1.00 2.42  ? 1217 ALA A CB    1 
ATOM   9268  N  N     . GLY A 1 1217 ? -11.193 -16.279  32.608  1.00 2.00  ? 1218 GLY A N     1 
ATOM   9269  C  CA    . GLY A 1 1217 ? -11.371 -15.860  31.244  1.00 2.08  ? 1218 GLY A CA    1 
ATOM   9270  C  C     . GLY A 1 1217 ? -10.217 -16.227  30.371  1.00 2.63  ? 1218 GLY A C     1 
ATOM   9271  O  O     . GLY A 1 1217 ? -9.291  -16.918  30.769  1.00 3.45  ? 1218 GLY A O     1 
ATOM   9272  N  N     . THR A 1 1218 ? -10.352 -15.829  29.126  1.00 3.11  ? 1219 THR A N     1 
ATOM   9273  C  CA    . THR A 1 1218 ? -9.402  -16.028  28.052  1.00 2.99  ? 1219 THR A CA    1 
ATOM   9274  C  C     . THR A 1 1218 ? -8.064  -15.342  28.290  1.00 3.58  ? 1219 THR A C     1 
ATOM   9275  O  O     . THR A 1 1218 ? -7.969  -14.366  29.029  1.00 2.79  ? 1219 THR A O     1 
ATOM   9276  C  CB    . THR A 1 1218 ? -10.073 -15.467  26.811  1.00 2.84  ? 1219 THR A CB    1 
ATOM   9277  O  OG1   . THR A 1 1218 ? -10.837 -16.501  26.183  1.00 3.90  ? 1219 THR A OG1   1 
ATOM   9278  C  CG2   . THR A 1 1218 ? -9.132  -14.852  25.879  1.00 3.65  ? 1219 THR A CG2   1 
ATOM   9279  N  N     . SER A 1 1219 ? -7.012  -15.860  27.667  1.00 4.61  ? 1220 SER A N     1 
ATOM   9280  C  CA    . SER A 1 1219 ? -5.695  -15.249  27.781  1.00 5.62  ? 1220 SER A CA    1 
ATOM   9281  C  C     . SER A 1 1219 ? -5.757  -13.763  27.457  1.00 7.16  ? 1220 SER A C     1 
ATOM   9282  O  O     . SER A 1 1219 ? -5.147  -12.940  28.122  1.00 7.83  ? 1220 SER A O     1 
ATOM   9283  C  CB    . SER A 1 1219 ? -4.761  -15.862  26.766  1.00 4.99  ? 1220 SER A CB    1 
ATOM   9284  O  OG    . SER A 1 1219 ? -4.333  -17.147  27.133  1.00 5.17  ? 1220 SER A OG    1 
ATOM   9285  N  N     . GLU A 1 1220 ? -6.449  -13.429  26.379  1.00 8.82  ? 1221 GLU A N     1 
ATOM   9286  C  CA    . GLU A 1 1220 ? -6.559  -12.053  25.958  1.00 10.41 ? 1221 GLU A CA    1 
ATOM   9287  C  C     . GLU A 1 1220 ? -7.372  -11.201  26.952  1.00 9.45  ? 1221 GLU A C     1 
ATOM   9288  O  O     . GLU A 1 1220 ? -6.963  -10.085  27.287  1.00 9.49  ? 1221 GLU A O     1 
ATOM   9289  C  CB    . GLU A 1 1220 ? -7.132  -12.018  24.539  1.00 13.52 ? 1221 GLU A CB    1 
ATOM   9290  C  CG    . GLU A 1 1220 ? -6.967  -10.667  23.824  1.00 19.59 ? 1221 GLU A CG    1 
ATOM   9291  C  CD    . GLU A 1 1220 ? -7.869  -10.503  22.574  1.00 22.57 ? 1221 GLU A CD    1 
ATOM   9292  O  OE1   . GLU A 1 1220 ? -8.340  -11.525  21.994  1.00 25.19 ? 1221 GLU A OE1   1 
ATOM   9293  O  OE2   . GLU A 1 1220 ? -8.128  -9.335   22.182  1.00 24.58 ? 1221 GLU A OE2   1 
ATOM   9294  N  N     . GLN A 1 1221 ? -8.472  -11.774  27.458  1.00 7.89  ? 1222 GLN A N     1 
ATOM   9295  C  CA    . GLN A 1 1221 ? -9.363  -11.119  28.436  1.00 5.95  ? 1222 GLN A CA    1 
ATOM   9296  C  C     . GLN A 1 1221 ? -8.634  -10.767  29.722  1.00 5.59  ? 1222 GLN A C     1 
ATOM   9297  O  O     . GLN A 1 1221 ? -8.830  -9.683   30.320  1.00 5.43  ? 1222 GLN A O     1 
ATOM   9298  C  CB    . GLN A 1 1221 ? -10.547 -12.042  28.761  1.00 4.76  ? 1222 GLN A CB    1 
ATOM   9299  C  CG    . GLN A 1 1221 ? -11.579 -11.995  27.676  1.00 3.49  ? 1222 GLN A CG    1 
ATOM   9300  C  CD    . GLN A 1 1221 ? -12.529 -13.166  27.635  1.00 2.72  ? 1222 GLN A CD    1 
ATOM   9301  O  OE1   . GLN A 1 1221 ? -12.532 -14.047  28.490  1.00 2.03  ? 1222 GLN A OE1   1 
ATOM   9302  N  NE2   . GLN A 1 1221 ? -13.404 -13.136  26.644  1.00 2.82  ? 1222 GLN A NE2   1 
ATOM   9303  N  N     . GLN A 1 1222 ? -7.772  -11.684  30.131  1.00 4.82  ? 1223 GLN A N     1 
ATOM   9304  C  CA    . GLN A 1 1222 ? -7.015  -11.503  31.337  1.00 4.76  ? 1223 GLN A CA    1 
ATOM   9305  C  C     . GLN A 1 1222 ? -5.949  -10.433  31.122  1.00 5.42  ? 1223 GLN A C     1 
ATOM   9306  O  O     . GLN A 1 1222 ? -5.777  -9.552   31.968  1.00 5.08  ? 1223 GLN A O     1 
ATOM   9307  C  CB    . GLN A 1 1222 ? -6.362  -12.818  31.751  1.00 3.90  ? 1223 GLN A CB    1 
ATOM   9308  C  CG    . GLN A 1 1222 ? -7.323  -13.939  32.179  1.00 3.53  ? 1223 GLN A CG    1 
ATOM   9309  C  CD    . GLN A 1 1222 ? -6.560  -15.124  32.703  1.00 4.17  ? 1223 GLN A CD    1 
ATOM   9310  O  OE1   . GLN A 1 1222 ? -5.618  -14.956  33.488  1.00 4.90  ? 1223 GLN A OE1   1 
ATOM   9311  N  NE2   . GLN A 1 1222 ? -6.885  -16.327  32.221  1.00 3.59  ? 1223 GLN A NE2   1 
ATOM   9312  N  N     . GLY A 1 1223 ? -5.270  -10.509  29.968  1.00 5.90  ? 1224 GLY A N     1 
ATOM   9313  C  CA    . GLY A 1 1223 ? -4.199  -9.583   29.642  1.00 6.20  ? 1224 GLY A CA    1 
ATOM   9314  C  C     . GLY A 1 1223 ? -4.746  -8.181   29.501  1.00 7.16  ? 1224 GLY A C     1 
ATOM   9315  O  O     . GLY A 1 1223 ? -4.091  -7.190   29.838  1.00 6.96  ? 1224 GLY A O     1 
ATOM   9316  N  N     . ASP A 1 1224 ? -5.968  -8.104   29.001  1.00 7.68  ? 1225 ASP A N     1 
ATOM   9317  C  CA    . ASP A 1 1224 ? -6.614  -6.837   28.849  1.00 8.73  ? 1225 ASP A CA    1 
ATOM   9318  C  C     . ASP A 1 1224 ? -7.067  -6.275   30.224  1.00 8.83  ? 1225 ASP A C     1 
ATOM   9319  O  O     . ASP A 1 1224 ? -6.954  -5.064   30.499  1.00 8.61  ? 1225 ASP A O     1 
ATOM   9320  C  CB    . ASP A 1 1224 ? -7.810  -6.984   27.928  1.00 9.89  ? 1225 ASP A CB    1 
ATOM   9321  C  CG    . ASP A 1 1224 ? -8.499  -5.678   27.715  1.00 11.95 ? 1225 ASP A CG    1 
ATOM   9322  O  OD1   . ASP A 1 1224 ? -7.799  -4.745   27.247  1.00 13.90 ? 1225 ASP A OD1   1 
ATOM   9323  O  OD2   . ASP A 1 1224 ? -9.702  -5.555   28.045  1.00 12.30 ? 1225 ASP A OD2   1 
ATOM   9324  N  N     . LEU A 1 1225 ? -7.619  -7.163   31.055  1.00 8.52  ? 1226 LEU A N     1 
ATOM   9325  C  CA    . LEU A 1 1225 ? -8.104  -6.814   32.380  1.00 7.92  ? 1226 LEU A CA    1 
ATOM   9326  C  C     . LEU A 1 1225 ? -6.942  -6.207   33.156  1.00 8.76  ? 1226 LEU A C     1 
ATOM   9327  O  O     . LEU A 1 1225 ? -7.034  -5.115   33.718  1.00 7.94  ? 1226 LEU A O     1 
ATOM   9328  C  CB    . LEU A 1 1225 ? -8.581  -8.088   33.063  1.00 5.69  ? 1226 LEU A CB    1 
ATOM   9329  C  CG    . LEU A 1 1225 ? -8.977  -7.879   34.502  1.00 4.15  ? 1226 LEU A CG    1 
ATOM   9330  C  CD1   . LEU A 1 1225 ? -10.033 -6.807   34.560  1.00 3.26  ? 1226 LEU A CD1   1 
ATOM   9331  C  CD2   . LEU A 1 1225 ? -9.494  -9.201   35.019  1.00 3.77  ? 1226 LEU A CD2   1 
ATOM   9332  N  N     . SER A 1 1226 ? -5.838  -6.937   33.121  1.00 10.02 ? 1227 SER A N     1 
ATOM   9333  C  CA    . SER A 1 1226 ? -4.615  -6.568   33.780  1.00 11.51 ? 1227 SER A CA    1 
ATOM   9334  C  C     . SER A 1 1226 ? -4.171  -5.198   33.320  1.00 13.01 ? 1227 SER A C     1 
ATOM   9335  O  O     . SER A 1 1226 ? -3.839  -4.363   34.143  1.00 13.95 ? 1227 SER A O     1 
ATOM   9336  C  CB    . SER A 1 1226 ? -3.548  -7.583   33.442  1.00 11.27 ? 1227 SER A CB    1 
ATOM   9337  O  OG    . SER A 1 1226 ? -2.297  -7.155   33.905  1.00 12.41 ? 1227 SER A OG    1 
ATOM   9338  N  N     . LYS A 1 1227 ? -4.165  -4.957   32.015  1.00 14.43 ? 1228 LYS A N     1 
ATOM   9339  C  CA    . LYS A 1 1227 ? -3.760  -3.659   31.500  1.00 16.61 ? 1228 LYS A CA    1 
ATOM   9340  C  C     . LYS A 1 1227 ? -4.768  -2.546   31.792  1.00 17.92 ? 1228 LYS A C     1 
ATOM   9341  O  O     . LYS A 1 1227 ? -4.418  -1.379   31.671  1.00 18.56 ? 1228 LYS A O     1 
ATOM   9342  C  CB    . LYS A 1 1227 ? -3.494  -3.698   29.989  1.00 17.40 ? 1228 LYS A CB    1 
ATOM   9343  C  CG    . LYS A 1 1227 ? -2.033  -3.691   29.602  0.01 18.49 ? 1228 LYS A CG    1 
ATOM   9344  C  CD    . LYS A 1 1227 ? -1.847  -3.109   28.210  0.01 19.44 ? 1228 LYS A CD    1 
ATOM   9345  C  CE    . LYS A 1 1227 ? -0.378  -2.858   27.915  0.01 20.06 ? 1228 LYS A CE    1 
ATOM   9346  N  NZ    . LYS A 1 1227 ? 0.249   -1.979   28.945  0.01 20.58 ? 1228 LYS A NZ    1 
ATOM   9347  N  N     . ARG A 1 1228 ? -6.022  -2.898   32.089  1.00 19.02 ? 1229 ARG A N     1 
ATOM   9348  C  CA    . ARG A 1 1228 ? -7.058  -1.916   32.424  1.00 20.02 ? 1229 ARG A CA    1 
ATOM   9349  C  C     . ARG A 1 1228 ? -7.064  -1.659   33.908  1.00 21.31 ? 1229 ARG A C     1 
ATOM   9350  O  O     . ARG A 1 1228 ? -7.809  -0.821   34.390  1.00 21.50 ? 1229 ARG A O     1 
ATOM   9351  C  CB    . ARG A 1 1228 ? -8.442  -2.451   32.092  1.00 19.96 ? 1229 ARG A CB    1 
ATOM   9352  C  CG    . ARG A 1 1228 ? -8.864  -2.295   30.677  1.00 19.87 ? 1229 ARG A CG    1 
ATOM   9353  C  CD    . ARG A 1 1228 ? -10.302 -2.756   30.534  1.00 20.32 ? 1229 ARG A CD    1 
ATOM   9354  N  NE    . ARG A 1 1228 ? -10.476 -4.203   30.730  1.00 20.43 ? 1229 ARG A NE    1 
ATOM   9355  C  CZ    . ARG A 1 1228 ? -11.302 -4.762   31.616  1.00 20.54 ? 1229 ARG A CZ    1 
ATOM   9356  N  NH1   . ARG A 1 1228 ? -12.033 -4.003   32.419  1.00 20.85 ? 1229 ARG A NH1   1 
ATOM   9357  N  NH2   . ARG A 1 1228 ? -11.444 -6.083   31.660  1.00 19.83 ? 1229 ARG A NH2   1 
ATOM   9358  N  N     . THR A 1 1229 ? -6.234  -2.382   34.644  1.00 22.96 ? 1230 THR A N     1 
ATOM   9359  C  CA    . THR A 1 1229 ? -6.224  -2.243   36.101  1.00 24.43 ? 1230 THR A CA    1 
ATOM   9360  C  C     . THR A 1 1229 ? -4.950  -1.749   36.789  1.00 25.25 ? 1230 THR A C     1 
ATOM   9361  O  O     . THR A 1 1229 ? -4.964  -1.568   38.004  1.00 26.21 ? 1230 THR A O     1 
ATOM   9362  C  CB    . THR A 1 1229 ? -6.605  -3.587   36.771  1.00 24.38 ? 1230 THR A CB    1 
ATOM   9363  O  OG1   . THR A 1 1229 ? -5.809  -4.626   36.195  1.00 25.19 ? 1230 THR A OG1   1 
ATOM   9364  C  CG2   . THR A 1 1229 ? -8.085  -3.919   36.570  1.00 24.50 ? 1230 THR A CG2   1 
ATOM   9365  N  N     . LYS A 1 1230 ? -3.863  -1.568   36.050  0.01 25.71 ? 1231 LYS A N     1 
ATOM   9366  C  CA    . LYS A 1 1230 ? -2.581  -1.107   36.607  0.01 26.16 ? 1231 LYS A CA    1 
ATOM   9367  C  C     . LYS A 1 1230 ? -2.470  -0.720   38.099  0.01 26.52 ? 1231 LYS A C     1 
ATOM   9368  O  O     . LYS A 1 1230 ? -1.633  -1.267   38.814  0.01 26.60 ? 1231 LYS A O     1 
ATOM   9369  C  CB    . LYS A 1 1230 ? -2.009  0.029    35.751  0.01 26.14 ? 1231 LYS A CB    1 
ATOM   9370  C  CG    . LYS A 1 1230 ? -2.894  1.267    35.652  0.01 26.13 ? 1231 LYS A CG    1 
ATOM   9371  C  CD    . LYS A 1 1230 ? -3.713  1.286    34.369  0.01 26.09 ? 1231 LYS A CD    1 
ATOM   9372  C  CE    . LYS A 1 1230 ? -2.850  1.640    33.162  0.01 26.06 ? 1231 LYS A CE    1 
ATOM   9373  N  NZ    . LYS A 1 1230 ? -2.221  2.991    33.289  0.01 26.01 ? 1231 LYS A NZ    1 
ATOM   9374  N  N     . LYS A 1 1231 ? -3.321  0.202    38.556  0.01 26.91 ? 1232 LYS A N     1 
ATOM   9375  C  CA    . LYS A 1 1231 ? -3.316  0.694    39.941  0.01 27.24 ? 1232 LYS A CA    1 
ATOM   9376  C  C     . LYS A 1 1231 ? -1.930  1.164    40.370  0.01 27.41 ? 1232 LYS A C     1 
ATOM   9377  O  O     . LYS A 1 1231 ? -1.482  2.241    39.977  0.01 27.58 ? 1232 LYS A O     1 
ATOM   9378  C  CB    . LYS A 1 1231 ? -3.830  -0.363   40.930  0.01 27.31 ? 1232 LYS A CB    1 
ATOM   9379  C  CG    . LYS A 1 1231 ? -5.284  -0.177   41.380  0.01 27.32 ? 1232 LYS A CG    1 
ATOM   9380  C  CD    . LYS A 1 1231 ? -5.523  1.102    42.201  0.01 27.24 ? 1232 LYS A CD    1 
ATOM   9381  C  CE    . LYS A 1 1231 ? -5.024  1.002    43.646  0.01 27.17 ? 1232 LYS A CE    1 
ATOM   9382  N  NZ    . LYS A 1 1231 ? -3.586  1.356    43.810  0.01 27.08 ? 1232 LYS A NZ    1 
ATOM   9383  N  N     . GLY B 1 1    ? 17.657  -56.537  43.375  1.00 26.32 ? 2    GLY B N     1 
ATOM   9384  C  CA    . GLY B 1 1    ? 16.732  -57.223  44.249  1.00 24.14 ? 2    GLY B CA    1 
ATOM   9385  C  C     . GLY B 1 1    ? 15.644  -56.270  44.707  1.00 22.78 ? 2    GLY B C     1 
ATOM   9386  O  O     . GLY B 1 1    ? 14.794  -55.887  43.916  1.00 22.82 ? 2    GLY B O     1 
ATOM   9387  N  N     . LYS B 1 2    ? 15.684  -55.857  45.967  1.00 21.54 ? 3    LYS B N     1 
ATOM   9388  C  CA    . LYS B 1 2    ? 14.659  -54.970  46.507  1.00 20.51 ? 3    LYS B CA    1 
ATOM   9389  C  C     . LYS B 1 2    ? 14.850  -53.515  46.138  1.00 19.96 ? 3    LYS B C     1 
ATOM   9390  O  O     . LYS B 1 2    ? 15.971  -53.059  45.955  1.00 20.19 ? 3    LYS B O     1 
ATOM   9391  C  CB    . LYS B 1 2    ? 14.611  -55.067  48.028  1.00 20.06 ? 3    LYS B CB    1 
ATOM   9392  C  CG    . LYS B 1 2    ? 14.444  -56.465  48.539  1.00 20.01 ? 3    LYS B CG    1 
ATOM   9393  C  CD    . LYS B 1 2    ? 14.675  -56.477  50.033  1.00 20.13 ? 3    LYS B CD    1 
ATOM   9394  C  CE    . LYS B 1 2    ? 14.679  -57.876  50.601  1.00 19.70 ? 3    LYS B CE    1 
ATOM   9395  N  NZ    . LYS B 1 2    ? 14.898  -57.806  52.068  1.00 20.23 ? 3    LYS B NZ    1 
ATOM   9396  N  N     . LYS B 1 3    ? 13.746  -52.782  46.088  1.00 18.97 ? 4    LYS B N     1 
ATOM   9397  C  CA    . LYS B 1 3    ? 13.796  -51.383  45.767  1.00 18.43 ? 4    LYS B CA    1 
ATOM   9398  C  C     . LYS B 1 3    ? 12.691  -50.673  46.525  1.00 17.54 ? 4    LYS B C     1 
ATOM   9399  O  O     . LYS B 1 3    ? 11.527  -51.004  46.375  1.00 17.45 ? 4    LYS B O     1 
ATOM   9400  C  CB    . LYS B 1 3    ? 13.661  -51.159  44.250  1.00 19.22 ? 4    LYS B CB    1 
ATOM   9401  C  CG    . LYS B 1 3    ? 13.593  -49.666  43.854  1.00 20.66 ? 4    LYS B CG    1 
ATOM   9402  C  CD    . LYS B 1 3    ? 13.525  -49.381  42.302  1.00 22.05 ? 4    LYS B CD    1 
ATOM   9403  C  CE    . LYS B 1 3    ? 12.200  -49.813  41.636  1.00 22.37 ? 4    LYS B CE    1 
ATOM   9404  N  NZ    . LYS B 1 3    ? 12.045  -49.222  40.249  1.00 23.71 ? 4    LYS B NZ    1 
ATOM   9405  N  N     . MET B 1 4    ? 13.070  -49.734  47.391  1.00 17.11 ? 5    MET B N     1 
ATOM   9406  C  CA    . MET B 1 4    ? 12.098  -48.958  48.154  1.00 16.73 ? 5    MET B CA    1 
ATOM   9407  C  C     . MET B 1 4    ? 11.353  -48.011  47.196  1.00 15.49 ? 5    MET B C     1 
ATOM   9408  O  O     . MET B 1 4    ? 11.927  -47.577  46.189  1.00 15.43 ? 5    MET B O     1 
ATOM   9409  C  CB    . MET B 1 4    ? 12.776  -48.228  49.318  1.00 18.27 ? 5    MET B CB    1 
ATOM   9410  C  CG    . MET B 1 4    ? 12.810  -49.032  50.661  1.00 20.87 ? 5    MET B CG    1 
ATOM   9411  S  SD    . MET B 1 4    ? 11.334  -48.748  51.825  1.00 25.00 ? 5    MET B SD    1 
ATOM   9412  C  CE    . MET B 1 4    ? 11.160  -50.345  52.700  1.00 24.36 ? 5    MET B CE    1 
ATOM   9413  N  N     . MET B 1 5    ? 10.082  -47.708  47.490  1.00 14.07 ? 6    MET B N     1 
ATOM   9414  C  CA    . MET B 1 5    ? 9.290   -46.891  46.574  1.00 12.85 ? 6    MET B CA    1 
ATOM   9415  C  C     . MET B 1 5    ? 8.016   -46.296  47.192  1.00 11.47 ? 6    MET B C     1 
ATOM   9416  O  O     . MET B 1 5    ? 7.325   -46.983  47.930  1.00 11.28 ? 6    MET B O     1 
ATOM   9417  C  CB    . MET B 1 5    ? 8.915   -47.825  45.428  1.00 13.33 ? 6    MET B CB    1 
ATOM   9418  C  CG    . MET B 1 5    ? 8.180   -47.240  44.288  1.00 14.69 ? 6    MET B CG    1 
ATOM   9419  S  SD    . MET B 1 5    ? 8.556   -48.335  42.902  1.00 17.72 ? 6    MET B SD    1 
ATOM   9420  C  CE    . MET B 1 5    ? 6.875   -48.737  42.250  1.00 16.91 ? 6    MET B CE    1 
ATOM   9421  N  N     . THR B 1 6    ? 7.713   -45.022  46.954  1.00 9.67  ? 7    THR B N     1 
ATOM   9422  C  CA    . THR B 1 6    ? 6.464   -44.505  47.514  1.00 8.61  ? 7    THR B CA    1 
ATOM   9423  C  C     . THR B 1 6    ? 5.424   -44.394  46.372  1.00 7.85  ? 7    THR B C     1 
ATOM   9424  O  O     . THR B 1 6    ? 5.509   -43.522  45.511  1.00 7.82  ? 7    THR B O     1 
ATOM   9425  C  CB    . THR B 1 6    ? 6.629   -43.170  48.356  1.00 8.44  ? 7    THR B CB    1 
ATOM   9426  O  OG1   . THR B 1 6    ? 6.705   -42.016  47.511  1.00 9.66  ? 7    THR B OG1   1 
ATOM   9427  C  CG2   . THR B 1 6    ? 7.878   -43.220  49.220  1.00 8.95  ? 7    THR B CG2   1 
ATOM   9428  N  N     . THR B 1 7    ? 4.512   -45.347  46.289  1.00 6.95  ? 8    THR B N     1 
ATOM   9429  C  CA    . THR B 1 7    ? 3.502   -45.315  45.229  1.00 6.46  ? 8    THR B CA    1 
ATOM   9430  C  C     . THR B 1 7    ? 2.184   -45.792  45.735  1.00 5.62  ? 8    THR B C     1 
ATOM   9431  O  O     . THR B 1 7    ? 2.054   -46.142  46.892  1.00 4.81  ? 8    THR B O     1 
ATOM   9432  C  CB    . THR B 1 7    ? 3.849   -46.193  44.045  1.00 6.37  ? 8    THR B CB    1 
ATOM   9433  O  OG1   . THR B 1 7    ? 4.464   -47.378  44.521  1.00 6.65  ? 8    THR B OG1   1 
ATOM   9434  C  CG2   . THR B 1 7    ? 4.779   -45.506  43.137  1.00 7.79  ? 8    THR B CG2   1 
ATOM   9435  N  N     . ASP B 1 8    ? 1.212   -45.810  44.840  1.00 5.07  ? 9    ASP B N     1 
ATOM   9436  C  CA    . ASP B 1 8    ? -0.118  -46.214  45.226  1.00 4.63  ? 9    ASP B CA    1 
ATOM   9437  C  C     . ASP B 1 8    ? -0.353  -47.633  44.791  1.00 3.55  ? 9    ASP B C     1 
ATOM   9438  O  O     . ASP B 1 8    ? 0.434   -48.181  44.032  1.00 3.24  ? 9    ASP B O     1 
ATOM   9439  C  CB    . ASP B 1 8    ? -1.182  -45.236  44.678  1.00 5.18  ? 9    ASP B CB    1 
ATOM   9440  C  CG    . ASP B 1 8    ? -1.115  -45.059  43.144  1.00 6.53  ? 9    ASP B CG    1 
ATOM   9441  O  OD1   . ASP B 1 8    ? -0.731  -46.007  42.443  1.00 6.36  ? 9    ASP B OD1   1 
ATOM   9442  O  OD2   . ASP B 1 8    ? -1.491  -43.980  42.642  1.00 6.85  ? 9    ASP B OD2   1 
ATOM   9443  N  N     . GLY B 1 9    ? -1.457  -48.196  45.248  1.00 2.84  ? 10   GLY B N     1 
ATOM   9444  C  CA    . GLY B 1 9    ? -1.801  -49.565  44.925  1.00 2.50  ? 10   GLY B CA    1 
ATOM   9445  C  C     . GLY B 1 9    ? -1.802  -49.916  43.449  1.00 2.50  ? 10   GLY B C     1 
ATOM   9446  O  O     . GLY B 1 9    ? -1.309  -50.979  43.105  1.00 2.00  ? 10   GLY B O     1 
ATOM   9447  N  N     . ASN B 1 10   ? -2.326  -49.029  42.590  1.00 2.26  ? 11   ASN B N     1 
ATOM   9448  C  CA    . ASN B 1 10   ? -2.371  -49.262  41.145  1.00 2.09  ? 11   ASN B CA    1 
ATOM   9449  C  C     . ASN B 1 10   ? -0.982  -49.439  40.541  1.00 2.55  ? 11   ASN B C     1 
ATOM   9450  O  O     . ASN B 1 10   ? -0.729  -50.426  39.848  1.00 2.38  ? 11   ASN B O     1 
ATOM   9451  C  CB    . ASN B 1 10   ? -3.053  -48.107  40.408  1.00 2.00  ? 11   ASN B CB    1 
ATOM   9452  C  CG    . ASN B 1 10   ? -4.565  -48.210  40.421  1.00 2.20  ? 11   ASN B CG    1 
ATOM   9453  O  OD1   . ASN B 1 10   ? -5.257  -47.210  40.614  1.00 2.16  ? 11   ASN B OD1   1 
ATOM   9454  N  ND2   . ASN B 1 10   ? -5.089  -49.412  40.204  1.00 2.00  ? 11   ASN B ND2   1 
ATOM   9455  N  N     . THR B 1 11   ? -0.056  -48.523  40.855  1.00 2.38  ? 12   THR B N     1 
ATOM   9456  C  CA    . THR B 1 11   ? 1.247   -48.648  40.268  1.00 2.22  ? 12   THR B CA    1 
ATOM   9457  C  C     . THR B 1 11   ? 2.098   -49.732  40.863  1.00 2.09  ? 12   THR B C     1 
ATOM   9458  O  O     . THR B 1 11   ? 2.903   -50.305  40.160  1.00 2.31  ? 12   THR B O     1 
ATOM   9459  C  CB    . THR B 1 11   ? 1.991   -47.294  40.080  1.00 2.29  ? 12   THR B CB    1 
ATOM   9460  O  OG1   . THR B 1 11   ? 3.325   -47.354  40.614  1.00 3.14  ? 12   THR B OG1   1 
ATOM   9461  C  CG2   . THR B 1 11   ? 1.232   -46.183  40.638  1.00 2.15  ? 12   THR B CG2   1 
ATOM   9462  N  N     . ALA B 1 12   ? 1.858   -50.074  42.122  1.00 2.06  ? 13   ALA B N     1 
ATOM   9463  C  CA    . ALA B 1 12   ? 2.608   -51.121  42.759  1.00 2.00  ? 13   ALA B CA    1 
ATOM   9464  C  C     . ALA B 1 12   ? 2.233   -52.408  42.051  1.00 2.41  ? 13   ALA B C     1 
ATOM   9465  O  O     . ALA B 1 12   ? 3.095   -53.271  41.845  1.00 2.66  ? 13   ALA B O     1 
ATOM   9466  C  CB    . ALA B 1 12   ? 2.261   -51.202  44.190  1.00 2.00  ? 13   ALA B CB    1 
ATOM   9467  N  N     . THR B 1 13   ? 0.957   -52.533  41.646  1.00 2.74  ? 14   THR B N     1 
ATOM   9468  C  CA    . THR B 1 13   ? 0.526   -53.752  40.937  1.00 2.39  ? 14   THR B CA    1 
ATOM   9469  C  C     . THR B 1 13   ? 0.803   -53.748  39.435  1.00 2.36  ? 14   THR B C     1 
ATOM   9470  O  O     . THR B 1 13   ? 1.054   -54.809  38.879  1.00 2.79  ? 14   THR B O     1 
ATOM   9471  C  CB    . THR B 1 13   ? -0.924  -54.267  41.324  1.00 2.00  ? 14   THR B CB    1 
ATOM   9472  O  OG1   . THR B 1 13   ? -1.786  -54.359  40.183  1.00 3.06  ? 14   THR B OG1   1 
ATOM   9473  C  CG2   . THR B 1 13   ? -1.545  -53.496  42.375  1.00 2.00  ? 14   THR B CG2   1 
ATOM   9474  N  N     . ALA B 1 14   ? 0.838   -52.557  38.818  1.00 2.32  ? 15   ALA B N     1 
ATOM   9475  C  CA    . ALA B 1 14   ? 1.149   -52.393  37.396  1.00 2.23  ? 15   ALA B CA    1 
ATOM   9476  C  C     . ALA B 1 14   ? 2.647   -52.747  37.172  1.00 2.44  ? 15   ALA B C     1 
ATOM   9477  O  O     . ALA B 1 14   ? 3.041   -53.214  36.101  1.00 2.13  ? 15   ALA B O     1 
ATOM   9478  C  CB    . ALA B 1 14   ? 0.875   -50.994  36.967  1.00 2.00  ? 15   ALA B CB    1 
ATOM   9479  N  N     . HIS B 1 15   ? 3.459   -52.471  38.195  1.00 2.33  ? 16   HIS B N     1 
ATOM   9480  C  CA    . HIS B 1 15   ? 4.894   -52.774  38.261  1.00 2.31  ? 16   HIS B CA    1 
ATOM   9481  C  C     . HIS B 1 15   ? 5.129   -54.271  37.911  1.00 2.40  ? 16   HIS B C     1 
ATOM   9482  O  O     . HIS B 1 15   ? 5.920   -54.626  37.010  1.00 2.22  ? 16   HIS B O     1 
ATOM   9483  C  CB    . HIS B 1 15   ? 5.336   -52.537  39.709  1.00 2.00  ? 16   HIS B CB    1 
ATOM   9484  C  CG    . HIS B 1 15   ? 6.806   -52.693  39.931  1.00 2.32  ? 16   HIS B CG    1 
ATOM   9485  N  ND1   . HIS B 1 15   ? 7.357   -53.828  40.492  1.00 2.16  ? 16   HIS B ND1   1 
ATOM   9486  C  CD2   . HIS B 1 15   ? 7.838   -51.861  39.666  1.00 2.04  ? 16   HIS B CD2   1 
ATOM   9487  C  CE1   . HIS B 1 15   ? 8.665   -53.691  40.559  1.00 2.09  ? 16   HIS B CE1   1 
ATOM   9488  N  NE2   . HIS B 1 15   ? 8.986   -52.507  40.068  1.00 2.66  ? 16   HIS B NE2   1 
ATOM   9489  N  N     . VAL B 1 16   ? 4.421   -55.124  38.650  1.00 2.14  ? 17   VAL B N     1 
ATOM   9490  C  CA    . VAL B 1 16   ? 4.434   -56.600  38.483  1.00 3.12  ? 17   VAL B CA    1 
ATOM   9491  C  C     . VAL B 1 16   ? 3.732   -57.062  37.205  1.00 3.24  ? 17   VAL B C     1 
ATOM   9492  O  O     . VAL B 1 16   ? 4.309   -57.837  36.469  1.00 3.89  ? 17   VAL B O     1 
ATOM   9493  C  CB    . VAL B 1 16   ? 3.729   -57.324  39.672  1.00 2.84  ? 17   VAL B CB    1 
ATOM   9494  C  CG1   . VAL B 1 16   ? 3.462   -58.764  39.358  1.00 2.03  ? 17   VAL B CG1   1 
ATOM   9495  C  CG2   . VAL B 1 16   ? 4.554   -57.171  40.932  1.00 3.23  ? 17   VAL B CG2   1 
ATOM   9496  N  N     . ALA B 1 17   ? 2.487   -56.606  36.987  1.00 3.56  ? 18   ALA B N     1 
ATOM   9497  C  CA    . ALA B 1 17   ? 1.662   -56.943  35.807  1.00 3.15  ? 18   ALA B CA    1 
ATOM   9498  C  C     . ALA B 1 17   ? 2.498   -56.818  34.567  1.00 2.93  ? 18   ALA B C     1 
ATOM   9499  O  O     . ALA B 1 17   ? 2.631   -57.799  33.830  1.00 2.81  ? 18   ALA B O     1 
ATOM   9500  C  CB    . ALA B 1 17   ? 0.388   -55.992  35.686  1.00 2.68  ? 18   ALA B CB    1 
ATOM   9501  N  N     . TYR B 1 18   ? 3.138   -55.657  34.400  1.00 2.26  ? 19   TYR B N     1 
ATOM   9502  C  CA    . TYR B 1 18   ? 3.991   -55.395  33.240  1.00 2.28  ? 19   TYR B CA    1 
ATOM   9503  C  C     . TYR B 1 18   ? 5.108   -56.430  33.080  1.00 2.00  ? 19   TYR B C     1 
ATOM   9504  O  O     . TYR B 1 18   ? 5.332   -56.950  31.997  1.00 2.00  ? 19   TYR B O     1 
ATOM   9505  C  CB    . TYR B 1 18   ? 4.631   -53.993  33.331  1.00 2.41  ? 19   TYR B CB    1 
ATOM   9506  C  CG    . TYR B 1 18   ? 5.277   -53.540  32.051  1.00 2.48  ? 19   TYR B CG    1 
ATOM   9507  C  CD1   . TYR B 1 18   ? 6.557   -53.965  31.695  1.00 2.66  ? 19   TYR B CD1   1 
ATOM   9508  C  CD2   . TYR B 1 18   ? 4.578   -52.761  31.157  1.00 2.40  ? 19   TYR B CD2   1 
ATOM   9509  C  CE1   . TYR B 1 18   ? 7.109   -53.634  30.475  1.00 2.46  ? 19   TYR B CE1   1 
ATOM   9510  C  CE2   . TYR B 1 18   ? 5.119   -52.408  29.933  1.00 3.45  ? 19   TYR B CE2   1 
ATOM   9511  C  CZ    . TYR B 1 18   ? 6.390   -52.850  29.588  1.00 3.74  ? 19   TYR B CZ    1 
ATOM   9512  O  OH    . TYR B 1 18   ? 6.931   -52.447  28.354  1.00 3.97  ? 19   TYR B OH    1 
ATOM   9513  N  N     . ALA B 1 19   ? 5.804   -56.724  34.160  1.00 2.00  ? 20   ALA B N     1 
ATOM   9514  C  CA    . ALA B 1 19   ? 6.913   -57.644  34.084  1.00 2.00  ? 20   ALA B CA    1 
ATOM   9515  C  C     . ALA B 1 19   ? 6.525   -59.074  33.777  1.00 2.12  ? 20   ALA B C     1 
ATOM   9516  O  O     . ALA B 1 19   ? 7.249   -59.782  33.082  1.00 2.00  ? 20   ALA B O     1 
ATOM   9517  C  CB    . ALA B 1 19   ? 7.703   -57.594  35.370  1.00 2.01  ? 20   ALA B CB    1 
ATOM   9518  N  N     . MET B 1 20   ? 5.387   -59.494  34.306  1.00 2.04  ? 21   MET B N     1 
ATOM   9519  C  CA    . MET B 1 20   ? 4.883   -60.863  34.131  1.00 2.07  ? 21   MET B CA    1 
ATOM   9520  C  C     . MET B 1 20   ? 4.023   -61.169  32.899  1.00 2.00  ? 21   MET B C     1 
ATOM   9521  O  O     . MET B 1 20   ? 3.801   -62.312  32.563  1.00 2.00  ? 21   MET B O     1 
ATOM   9522  C  CB    . MET B 1 20   ? 4.108   -61.214  35.383  1.00 2.00  ? 21   MET B CB    1 
ATOM   9523  C  CG    . MET B 1 20   ? 4.966   -60.989  36.608  1.00 2.88  ? 21   MET B CG    1 
ATOM   9524  S  SD    . MET B 1 20   ? 6.374   -62.115  36.555  1.00 3.31  ? 21   MET B SD    1 
ATOM   9525  C  CE    . MET B 1 20   ? 5.445   -63.772  36.591  1.00 2.03  ? 21   MET B CE    1 
ATOM   9526  N  N     . SER B 1 21   ? 3.585   -60.131  32.207  1.00 2.00  ? 22   SER B N     1 
ATOM   9527  C  CA    . SER B 1 21   ? 2.730   -60.269  31.039  1.00 2.00  ? 22   SER B CA    1 
ATOM   9528  C  C     . SER B 1 21   ? 3.373   -59.908  29.717  1.00 2.25  ? 22   SER B C     1 
ATOM   9529  O  O     . SER B 1 21   ? 4.345   -59.123  29.649  1.00 2.00  ? 22   SER B O     1 
ATOM   9530  C  CB    . SER B 1 21   ? 1.477   -59.438  31.238  1.00 2.00  ? 22   SER B CB    1 
ATOM   9531  O  OG    . SER B 1 21   ? 0.921   -59.794  32.491  1.00 2.00  ? 22   SER B OG    1 
ATOM   9532  N  N     . GLU B 1 22   ? 2.834   -60.537  28.671  1.00 2.53  ? 23   GLU B N     1 
ATOM   9533  C  CA    . GLU B 1 22   ? 3.312   -60.309  27.300  1.00 2.94  ? 23   GLU B CA    1 
ATOM   9534  C  C     . GLU B 1 22   ? 2.388   -59.464  26.475  1.00 2.33  ? 23   GLU B C     1 
ATOM   9535  O  O     . GLU B 1 22   ? 2.836   -58.601  25.730  1.00 2.89  ? 23   GLU B O     1 
ATOM   9536  C  CB    . GLU B 1 22   ? 3.553   -61.622  26.566  1.00 2.53  ? 23   GLU B CB    1 
ATOM   9537  C  CG    . GLU B 1 22   ? 4.681   -62.373  27.162  1.00 3.78  ? 23   GLU B CG    1 
ATOM   9538  C  CD    . GLU B 1 22   ? 4.774   -63.724  26.613  1.00 4.26  ? 23   GLU B CD    1 
ATOM   9539  O  OE1   . GLU B 1 22   ? 3.815   -64.467  26.825  1.00 4.96  ? 23   GLU B OE1   1 
ATOM   9540  O  OE2   . GLU B 1 22   ? 5.784   -64.040  25.945  1.00 5.49  ? 23   GLU B OE2   1 
ATOM   9541  N  N     . VAL B 1 23   ? 1.101   -59.687  26.675  1.00 2.49  ? 24   VAL B N     1 
ATOM   9542  C  CA    . VAL B 1 23   ? 0.029   -58.999  25.958  1.00 2.26  ? 24   VAL B CA    1 
ATOM   9543  C  C     . VAL B 1 23   ? -0.911  -58.404  26.998  1.00 2.28  ? 24   VAL B C     1 
ATOM   9544  O  O     . VAL B 1 23   ? -0.914  -58.820  28.145  1.00 2.97  ? 24   VAL B O     1 
ATOM   9545  C  CB    . VAL B 1 23   ? -0.743  -60.086  25.101  1.00 2.32  ? 24   VAL B CB    1 
ATOM   9546  C  CG1   . VAL B 1 23   ? -2.031  -59.565  24.538  1.00 2.00  ? 24   VAL B CG1   1 
ATOM   9547  C  CG2   . VAL B 1 23   ? 0.173   -60.657  23.989  1.00 2.00  ? 24   VAL B CG2   1 
ATOM   9548  N  N     . ALA B 1 24   ? -1.671  -57.395  26.630  1.00 2.00  ? 25   ALA B N     1 
ATOM   9549  C  CA    . ALA B 1 24   ? -2.646  -56.854  27.540  1.00 2.00  ? 25   ALA B CA    1 
ATOM   9550  C  C     . ALA B 1 24   ? -3.719  -56.266  26.633  1.00 2.00  ? 25   ALA B C     1 
ATOM   9551  O  O     . ALA B 1 24   ? -3.392  -55.577  25.677  1.00 2.34  ? 25   ALA B O     1 
ATOM   9552  C  CB    . ALA B 1 24   ? -2.020  -55.802  28.431  1.00 2.00  ? 25   ALA B CB    1 
ATOM   9553  N  N     . ALA B 1 25   ? -4.958  -56.716  26.799  1.00 2.00  ? 26   ALA B N     1 
ATOM   9554  C  CA    . ALA B 1 25   ? -6.106  -56.205  26.034  1.00 2.00  ? 26   ALA B CA    1 
ATOM   9555  C  C     . ALA B 1 25   ? -6.826  -55.310  27.057  1.00 2.00  ? 26   ALA B C     1 
ATOM   9556  O  O     . ALA B 1 25   ? -7.330  -55.771  28.060  1.00 2.23  ? 26   ALA B O     1 
ATOM   9557  C  CB    . ALA B 1 25   ? -6.980  -57.322  25.574  1.00 2.00  ? 26   ALA B CB    1 
ATOM   9558  N  N     . ILE B 1 26   ? -6.878  -54.026  26.775  1.00 2.11  ? 27   ILE B N     1 
ATOM   9559  C  CA    . ILE B 1 26   ? -7.395  -53.044  27.726  1.00 2.36  ? 27   ILE B CA    1 
ATOM   9560  C  C     . ILE B 1 26   ? -8.700  -52.246  27.456  1.00 2.31  ? 27   ILE B C     1 
ATOM   9561  O  O     . ILE B 1 26   ? -9.173  -52.176  26.327  1.00 2.00  ? 27   ILE B O     1 
ATOM   9562  C  CB    . ILE B 1 26   ? -6.192  -52.044  28.008  1.00 2.00  ? 27   ILE B CB    1 
ATOM   9563  C  CG1   . ILE B 1 26   ? -5.625  -52.320  29.368  1.00 2.39  ? 27   ILE B CG1   1 
ATOM   9564  C  CG2   . ILE B 1 26   ? -6.536  -50.574  27.849  1.00 2.00  ? 27   ILE B CG2   1 
ATOM   9565  C  CD1   . ILE B 1 26   ? -4.759  -53.468  29.381  1.00 3.08  ? 27   ILE B CD1   1 
ATOM   9566  N  N     . TYR B 1 27   ? -9.305  -51.733  28.537  1.00 2.39  ? 28   TYR B N     1 
ATOM   9567  C  CA    . TYR B 1 27   ? -10.453 -50.804  28.474  1.00 2.08  ? 28   TYR B CA    1 
ATOM   9568  C  C     . TYR B 1 27   ? -10.413 -49.969  29.758  1.00 2.08  ? 28   TYR B C     1 
ATOM   9569  O  O     . TYR B 1 27   ? -10.193 -50.496  30.853  1.00 2.00  ? 28   TYR B O     1 
ATOM   9570  C  CB    . TYR B 1 27   ? -11.816 -51.461  28.241  1.00 2.00  ? 28   TYR B CB    1 
ATOM   9571  C  CG    . TYR B 1 27   ? -12.829 -50.489  27.588  1.00 2.09  ? 28   TYR B CG    1 
ATOM   9572  C  CD1   . TYR B 1 27   ? -12.703 -50.105  26.259  1.00 2.08  ? 28   TYR B CD1   1 
ATOM   9573  C  CD2   . TYR B 1 27   ? -13.846 -49.883  28.334  1.00 2.09  ? 28   TYR B CD2   1 
ATOM   9574  C  CE1   . TYR B 1 27   ? -13.559 -49.116  25.685  1.00 2.07  ? 28   TYR B CE1   1 
ATOM   9575  C  CE2   . TYR B 1 27   ? -14.686 -48.933  27.780  1.00 2.00  ? 28   TYR B CE2   1 
ATOM   9576  C  CZ    . TYR B 1 27   ? -14.539 -48.562  26.459  1.00 2.00  ? 28   TYR B CZ    1 
ATOM   9577  O  OH    . TYR B 1 27   ? -15.412 -47.688  25.878  1.00 2.00  ? 28   TYR B OH    1 
ATOM   9578  N  N     . PRO B 1 28   ? -10.555 -48.641  29.633  1.00 2.00  ? 29   PRO B N     1 
ATOM   9579  C  CA    . PRO B 1 28   ? -10.501 -47.816  30.817  1.00 2.00  ? 29   PRO B CA    1 
ATOM   9580  C  C     . PRO B 1 28   ? -11.793 -47.717  31.566  1.00 2.15  ? 29   PRO B C     1 
ATOM   9581  O  O     . PRO B 1 28   ? -12.865 -47.679  30.955  1.00 2.42  ? 29   PRO B O     1 
ATOM   9582  C  CB    . PRO B 1 28   ? -10.029 -46.480  30.267  1.00 2.33  ? 29   PRO B CB    1 
ATOM   9583  C  CG    . PRO B 1 28   ? -10.644 -46.391  28.984  1.00 2.44  ? 29   PRO B CG    1 
ATOM   9584  C  CD    . PRO B 1 28   ? -10.573 -47.805  28.425  1.00 2.59  ? 29   PRO B CD    1 
ATOM   9585  N  N     . ILE B 1 29   ? -11.683 -47.821  32.895  1.00 2.00  ? 30   ILE B N     1 
ATOM   9586  C  CA    . ILE B 1 29   ? -12.814 -47.716  33.818  1.00 2.00  ? 30   ILE B CA    1 
ATOM   9587  C  C     . ILE B 1 29   ? -12.240 -47.385  35.195  1.00 2.11  ? 30   ILE B C     1 
ATOM   9588  O  O     . ILE B 1 29   ? -11.295 -48.019  35.614  1.00 2.55  ? 30   ILE B O     1 
ATOM   9589  C  CB    . ILE B 1 29   ? -13.679 -49.015  33.898  1.00 2.00  ? 30   ILE B CB    1 
ATOM   9590  C  CG1   . ILE B 1 29   ? -14.904 -48.746  34.755  1.00 2.00  ? 30   ILE B CG1   1 
ATOM   9591  C  CG2   . ILE B 1 29   ? -12.926 -50.128  34.520  1.00 2.00  ? 30   ILE B CG2   1 
ATOM   9592  C  CD1   . ILE B 1 29   ? -15.735 -49.922  35.073  1.00 2.00  ? 30   ILE B CD1   1 
ATOM   9593  N  N     . THR B 1 30   ? -12.763 -46.328  35.838  1.00 2.36  ? 31   THR B N     1 
ATOM   9594  C  CA    . THR B 1 30   ? -12.352 -45.854  37.172  1.00 2.20  ? 31   THR B CA    1 
ATOM   9595  C  C     . THR B 1 30   ? -12.660 -46.954  38.206  1.00 2.43  ? 31   THR B C     1 
ATOM   9596  O  O     . THR B 1 30   ? -13.777 -47.519  38.212  1.00 2.34  ? 31   THR B O     1 
ATOM   9597  C  CB    . THR B 1 30   ? -13.135 -44.543  37.537  1.00 2.04  ? 31   THR B CB    1 
ATOM   9598  O  OG1   . THR B 1 30   ? -13.142 -43.660  36.415  1.00 2.20  ? 31   THR B OG1   1 
ATOM   9599  C  CG2   . THR B 1 30   ? -12.487 -43.791  38.688  1.00 2.32  ? 31   THR B CG2   1 
ATOM   9600  N  N     . PRO B 1 31   ? -11.709 -47.235  39.139  1.00 2.21  ? 32   PRO B N     1 
ATOM   9601  C  CA    . PRO B 1 31   ? -10.368 -46.682  39.399  1.00 2.00  ? 32   PRO B CA    1 
ATOM   9602  C  C     . PRO B 1 31   ? -9.123  -47.518  39.042  1.00 2.23  ? 32   PRO B C     1 
ATOM   9603  O  O     . PRO B 1 31   ? -8.097  -47.416  39.713  1.00 2.16  ? 32   PRO B O     1 
ATOM   9604  C  CB    . PRO B 1 31   ? -10.438 -46.442  40.889  1.00 2.00  ? 32   PRO B CB    1 
ATOM   9605  C  CG    . PRO B 1 31   ? -11.409 -47.529  41.380  1.00 2.00  ? 32   PRO B CG    1 
ATOM   9606  C  CD    . PRO B 1 31   ? -12.102 -48.122  40.238  1.00 2.00  ? 32   PRO B CD    1 
ATOM   9607  N  N     . SER B 1 32   ? -9.196  -48.284  37.955  1.00 2.21  ? 33   SER B N     1 
ATOM   9608  C  CA    . SER B 1 32   ? -8.106  -49.150  37.499  1.00 2.16  ? 33   SER B CA    1 
ATOM   9609  C  C     . SER B 1 32   ? -7.448  -48.588  36.251  1.00 2.30  ? 33   SER B C     1 
ATOM   9610  O  O     . SER B 1 32   ? -6.535  -49.204  35.705  1.00 2.24  ? 33   SER B O     1 
ATOM   9611  C  CB    . SER B 1 32   ? -8.668  -50.525  37.127  1.00 2.00  ? 33   SER B CB    1 
ATOM   9612  O  OG    . SER B 1 32   ? -9.549  -50.414  36.009  1.00 2.06  ? 33   SER B OG    1 
ATOM   9613  N  N     . SER B 1 33   ? -7.924  -47.447  35.777  1.00 2.06  ? 34   SER B N     1 
ATOM   9614  C  CA    . SER B 1 33   ? -7.384  -46.863  34.570  1.00 2.35  ? 34   SER B CA    1 
ATOM   9615  C  C     . SER B 1 33   ? -5.890  -46.578  34.671  1.00 3.02  ? 34   SER B C     1 
ATOM   9616  O  O     . SER B 1 33   ? -5.142  -46.837  33.725  1.00 3.21  ? 34   SER B O     1 
ATOM   9617  C  CB    . SER B 1 33   ? -8.137  -45.597  34.234  1.00 2.61  ? 34   SER B CB    1 
ATOM   9618  O  OG    . SER B 1 33   ? -9.485  -45.900  33.961  1.00 3.12  ? 34   SER B OG    1 
ATOM   9619  N  N     . THR B 1 34   ? -5.440  -46.078  35.819  1.00 2.62  ? 35   THR B N     1 
ATOM   9620  C  CA    . THR B 1 34   ? -4.024  -45.802  35.991  1.00 2.88  ? 35   THR B CA    1 
ATOM   9621  C  C     . THR B 1 34   ? -3.110  -46.979  35.609  1.00 3.20  ? 35   THR B C     1 
ATOM   9622  O  O     . THR B 1 34   ? -2.004  -46.755  35.093  1.00 3.76  ? 35   THR B O     1 
ATOM   9623  C  CB    . THR B 1 34   ? -3.691  -45.419  37.433  1.00 2.77  ? 35   THR B CB    1 
ATOM   9624  O  OG1   . THR B 1 34   ? -4.375  -44.212  37.755  1.00 3.74  ? 35   THR B OG1   1 
ATOM   9625  C  CG2   . THR B 1 34   ? -2.196  -45.187  37.569  1.00 2.65  ? 35   THR B CG2   1 
ATOM   9626  N  N     . MET B 1 35   ? -3.541  -48.211  35.890  1.00 2.17  ? 36   MET B N     1 
ATOM   9627  C  CA    . MET B 1 35   ? -2.719  -49.378  35.567  1.00 2.17  ? 36   MET B CA    1 
ATOM   9628  C  C     . MET B 1 35   ? -2.438  -49.568  34.089  1.00 2.02  ? 36   MET B C     1 
ATOM   9629  O  O     . MET B 1 35   ? -1.271  -49.738  33.694  1.00 2.00  ? 36   MET B O     1 
ATOM   9630  C  CB    . MET B 1 35   ? -3.308  -50.639  36.183  1.00 2.00  ? 36   MET B CB    1 
ATOM   9631  C  CG    . MET B 1 35   ? -3.362  -50.546  37.657  1.00 2.00  ? 36   MET B CG    1 
ATOM   9632  S  SD    . MET B 1 35   ? -3.630  -52.068  38.369  1.00 3.02  ? 36   MET B SD    1 
ATOM   9633  C  CE    . MET B 1 35   ? -5.532  -52.192  38.287  1.00 2.00  ? 36   MET B CE    1 
ATOM   9634  N  N     . GLY B 1 36   ? -3.495  -49.453  33.281  1.00 2.00  ? 37   GLY B N     1 
ATOM   9635  C  CA    . GLY B 1 36   ? -3.392  -49.590  31.834  1.00 2.00  ? 37   GLY B CA    1 
ATOM   9636  C  C     . GLY B 1 36   ? -2.641  -48.455  31.166  1.00 2.00  ? 37   GLY B C     1 
ATOM   9637  O  O     . GLY B 1 36   ? -1.942  -48.657  30.169  1.00 2.00  ? 37   GLY B O     1 
ATOM   9638  N  N     . GLU B 1 37   ? -2.847  -47.248  31.676  1.00 2.00  ? 38   GLU B N     1 
ATOM   9639  C  CA    . GLU B 1 37   ? -2.160  -46.076  31.173  1.00 2.09  ? 38   GLU B CA    1 
ATOM   9640  C  C     . GLU B 1 37   ? -0.666  -46.156  31.491  1.00 2.10  ? 38   GLU B C     1 
ATOM   9641  O  O     . GLU B 1 37   ? 0.152   -45.796  30.681  1.00 2.00  ? 38   GLU B O     1 
ATOM   9642  C  CB    . GLU B 1 37   ? -2.808  -44.794  31.732  1.00 2.00  ? 38   GLU B CB    1 
ATOM   9643  C  CG    . GLU B 1 37   ? -4.166  -44.613  31.103  1.00 2.12  ? 38   GLU B CG    1 
ATOM   9644  C  CD    . GLU B 1 37   ? -4.990  -43.515  31.696  1.00 2.77  ? 38   GLU B CD    1 
ATOM   9645  O  OE1   . GLU B 1 37   ? -4.429  -42.578  32.285  1.00 3.46  ? 38   GLU B OE1   1 
ATOM   9646  O  OE2   . GLU B 1 37   ? -6.230  -43.586  31.586  1.00 2.77  ? 38   GLU B OE2   1 
ATOM   9647  N  N     . GLU B 1 38   ? -0.319  -46.688  32.653  1.00 2.59  ? 39   GLU B N     1 
ATOM   9648  C  CA    . GLU B 1 38   ? 1.073   -46.838  33.017  1.00 3.36  ? 39   GLU B CA    1 
ATOM   9649  C  C     . GLU B 1 38   ? 1.718   -47.891  32.166  1.00 3.68  ? 39   GLU B C     1 
ATOM   9650  O  O     . GLU B 1 38   ? 2.824   -47.687  31.709  1.00 4.91  ? 39   GLU B O     1 
ATOM   9651  C  CB    . GLU B 1 38   ? 1.214   -47.264  34.459  1.00 3.69  ? 39   GLU B CB    1 
ATOM   9652  C  CG    . GLU B 1 38   ? 0.963   -46.154  35.412  1.00 5.00  ? 39   GLU B CG    1 
ATOM   9653  C  CD    . GLU B 1 38   ? 0.961   -46.603  36.856  1.00 6.04  ? 39   GLU B CD    1 
ATOM   9654  O  OE1   . GLU B 1 38   ? 0.589   -47.755  37.134  1.00 6.39  ? 39   GLU B OE1   1 
ATOM   9655  O  OE2   . GLU B 1 38   ? 1.311   -45.790  37.729  1.00 6.77  ? 39   GLU B OE2   1 
ATOM   9656  N  N     . ALA B 1 39   ? 1.039   -49.019  31.957  1.00 3.40  ? 40   ALA B N     1 
ATOM   9657  C  CA    . ALA B 1 39   ? 1.605   -50.104  31.150  1.00 4.21  ? 40   ALA B CA    1 
ATOM   9658  C  C     . ALA B 1 39   ? 1.857   -49.636  29.734  1.00 4.73  ? 40   ALA B C     1 
ATOM   9659  O  O     . ALA B 1 39   ? 2.732   -50.133  29.043  1.00 4.85  ? 40   ALA B O     1 
ATOM   9660  C  CB    . ALA B 1 39   ? 0.672   -51.320  31.118  1.00 2.90  ? 40   ALA B CB    1 
ATOM   9661  N  N     . ASP B 1 40   ? 1.011   -48.736  29.269  1.00 5.95  ? 41   ASP B N     1 
ATOM   9662  C  CA    . ASP B 1 40   ? 1.154   -48.211  27.930  1.00 6.84  ? 41   ASP B CA    1 
ATOM   9663  C  C     . ASP B 1 40   ? 2.336   -47.249  27.884  1.00 7.13  ? 41   ASP B C     1 
ATOM   9664  O  O     . ASP B 1 40   ? 3.093   -47.296  26.922  1.00 6.90  ? 41   ASP B O     1 
ATOM   9665  C  CB    . ASP B 1 40   ? -0.131  -47.496  27.506  1.00 7.81  ? 41   ASP B CB    1 
ATOM   9666  C  CG    . ASP B 1 40   ? -0.240  -47.305  25.996  1.00 8.50  ? 41   ASP B CG    1 
ATOM   9667  O  OD1   . ASP B 1 40   ? -0.427  -48.309  25.262  1.00 9.90  ? 41   ASP B OD1   1 
ATOM   9668  O  OD2   . ASP B 1 40   ? -0.212  -46.145  25.545  1.00 8.52  ? 41   ASP B OD2   1 
ATOM   9669  N  N     . ASP B 1 41   ? 2.510   -46.427  28.930  1.00 7.06  ? 42   ASP B N     1 
ATOM   9670  C  CA    . ASP B 1 41   ? 3.592   -45.446  28.965  1.00 7.96  ? 42   ASP B CA    1 
ATOM   9671  C  C     . ASP B 1 41   ? 4.934   -46.109  29.092  1.00 7.46  ? 42   ASP B C     1 
ATOM   9672  O  O     . ASP B 1 41   ? 5.915   -45.651  28.523  1.00 7.30  ? 42   ASP B O     1 
ATOM   9673  C  CB    . ASP B 1 41   ? 3.423   -44.465  30.121  1.00 9.34  ? 42   ASP B CB    1 
ATOM   9674  C  CG    . ASP B 1 41   ? 2.228   -43.580  29.944  1.00 10.55 ? 42   ASP B CG    1 
ATOM   9675  O  OD1   . ASP B 1 41   ? 1.874   -43.274  28.789  1.00 10.95 ? 42   ASP B OD1   1 
ATOM   9676  O  OD2   . ASP B 1 41   ? 1.614   -43.216  30.964  1.00 13.06 ? 42   ASP B OD2   1 
ATOM   9677  N  N     . TRP B 1 42   ? 4.953   -47.195  29.851  1.00 7.18  ? 43   TRP B N     1 
ATOM   9678  C  CA    . TRP B 1 42   ? 6.161   -47.963  30.062  1.00 6.47  ? 43   TRP B CA    1 
ATOM   9679  C  C     . TRP B 1 42   ? 6.591   -48.720  28.819  1.00 6.33  ? 43   TRP B C     1 
ATOM   9680  O  O     . TRP B 1 42   ? 7.773   -49.016  28.655  1.00 7.11  ? 43   TRP B O     1 
ATOM   9681  C  CB    . TRP B 1 42   ? 5.951   -48.916  31.206  1.00 5.74  ? 43   TRP B CB    1 
ATOM   9682  C  CG    . TRP B 1 42   ? 5.728   -48.208  32.494  1.00 5.29  ? 43   TRP B CG    1 
ATOM   9683  C  CD1   . TRP B 1 42   ? 6.004   -46.894  32.801  1.00 5.16  ? 43   TRP B CD1   1 
ATOM   9684  C  CD2   . TRP B 1 42   ? 5.196   -48.792  33.662  1.00 4.83  ? 43   TRP B CD2   1 
ATOM   9685  N  NE1   . TRP B 1 42   ? 5.672   -46.642  34.118  1.00 4.98  ? 43   TRP B NE1   1 
ATOM   9686  C  CE2   . TRP B 1 42   ? 5.177   -47.796  34.664  1.00 4.61  ? 43   TRP B CE2   1 
ATOM   9687  C  CE3   . TRP B 1 42   ? 4.711   -50.070  33.959  1.00 4.71  ? 43   TRP B CE3   1 
ATOM   9688  C  CZ2   . TRP B 1 42   ? 4.699   -48.041  35.927  1.00 4.79  ? 43   TRP B CZ2   1 
ATOM   9689  C  CZ3   . TRP B 1 42   ? 4.227   -50.309  35.212  1.00 5.35  ? 43   TRP B CZ3   1 
ATOM   9690  C  CH2   . TRP B 1 42   ? 4.223   -49.304  36.186  1.00 5.49  ? 43   TRP B CH2   1 
ATOM   9691  N  N     . ALA B 1 43   ? 5.627   -49.068  27.971  1.00 6.04  ? 44   ALA B N     1 
ATOM   9692  C  CA    . ALA B 1 43   ? 5.881   -49.758  26.707  1.00 5.83  ? 44   ALA B CA    1 
ATOM   9693  C  C     . ALA B 1 43   ? 6.468   -48.768  25.671  1.00 6.18  ? 44   ALA B C     1 
ATOM   9694  O  O     . ALA B 1 43   ? 7.305   -49.116  24.861  1.00 7.53  ? 44   ALA B O     1 
ATOM   9695  C  CB    . ALA B 1 43   ? 4.615   -50.370  26.215  1.00 4.80  ? 44   ALA B CB    1 
ATOM   9696  N  N     . ALA B 1 44   ? 6.043   -47.517  25.724  1.00 6.66  ? 45   ALA B N     1 
ATOM   9697  C  CA    . ALA B 1 44   ? 6.541   -46.456  24.853  1.00 6.67  ? 45   ALA B CA    1 
ATOM   9698  C  C     . ALA B 1 44   ? 7.960   -46.118  25.304  1.00 7.55  ? 45   ALA B C     1 
ATOM   9699  O  O     . ALA B 1 44   ? 8.851   -45.853  24.492  1.00 7.52  ? 45   ALA B O     1 
ATOM   9700  C  CB    . ALA B 1 44   ? 5.676   -45.257  25.001  1.00 5.63  ? 45   ALA B CB    1 
ATOM   9701  N  N     . GLN B 1 45   ? 8.167   -46.131  26.612  1.00 8.17  ? 46   GLN B N     1 
ATOM   9702  C  CA    . GLN B 1 45   ? 9.469   -45.835  27.163  1.00 8.52  ? 46   GLN B CA    1 
ATOM   9703  C  C     . GLN B 1 45   ? 10.378  -47.051  26.887  1.00 8.87  ? 46   GLN B C     1 
ATOM   9704  O  O     . GLN B 1 45   ? 11.606  -47.016  27.088  1.00 8.60  ? 46   GLN B O     1 
ATOM   9705  C  CB    . GLN B 1 45   ? 9.314   -45.527  28.659  1.00 9.37  ? 46   GLN B CB    1 
ATOM   9706  C  CG    . GLN B 1 45   ? 8.399   -44.296  28.950  1.00 10.40 ? 46   GLN B CG    1 
ATOM   9707  C  CD    . GLN B 1 45   ? 7.941   -44.199  30.421  1.00 11.11 ? 46   GLN B CD    1 
ATOM   9708  O  OE1   . GLN B 1 45   ? 6.929   -43.539  30.739  1.00 10.11 ? 46   GLN B OE1   1 
ATOM   9709  N  NE2   . GLN B 1 45   ? 8.658   -44.897  31.314  1.00 11.68 ? 46   GLN B NE2   1 
ATOM   9710  N  N     . GLY B 1 46   ? 9.770   -48.121  26.368  1.00 9.06  ? 47   GLY B N     1 
ATOM   9711  C  CA    . GLY B 1 46   ? 10.535  -49.321  26.040  1.00 8.51  ? 47   GLY B CA    1 
ATOM   9712  C  C     . GLY B 1 46   ? 10.947  -50.200  27.208  1.00 8.24  ? 47   GLY B C     1 
ATOM   9713  O  O     . GLY B 1 46   ? 11.951  -50.931  27.159  1.00 8.11  ? 47   GLY B O     1 
ATOM   9714  N  N     . ARG B 1 47   ? 10.179  -50.118  28.286  1.00 7.73  ? 48   ARG B N     1 
ATOM   9715  C  CA    . ARG B 1 47   ? 10.431  -50.947  29.451  1.00 6.88  ? 48   ARG B CA    1 
ATOM   9716  C  C     . ARG B 1 47   ? 10.274  -52.397  28.998  1.00 6.20  ? 48   ARG B C     1 
ATOM   9717  O  O     . ARG B 1 47   ? 9.492   -52.701  28.088  1.00 6.00  ? 48   ARG B O     1 
ATOM   9718  C  CB    . ARG B 1 47   ? 9.406   -50.597  30.496  1.00 7.13  ? 48   ARG B CB    1 
ATOM   9719  C  CG    . ARG B 1 47   ? 9.636   -51.160  31.878  1.00 8.17  ? 48   ARG B CG    1 
ATOM   9720  C  CD    . ARG B 1 47   ? 8.808   -50.270  32.766  1.00 8.78  ? 48   ARG B CD    1 
ATOM   9721  N  NE    . ARG B 1 47   ? 8.534   -50.816  34.079  1.00 9.84  ? 48   ARG B NE    1 
ATOM   9722  C  CZ    . ARG B 1 47   ? 8.355   -50.044  35.144  1.00 10.09 ? 48   ARG B CZ    1 
ATOM   9723  N  NH1   . ARG B 1 47   ? 8.441   -48.714  35.012  1.00 9.49  ? 48   ARG B NH1   1 
ATOM   9724  N  NH2   . ARG B 1 47   ? 8.051   -50.599  36.322  1.00 10.47 ? 48   ARG B NH2   1 
ATOM   9725  N  N     . LYS B 1 48   ? 11.014  -53.284  29.631  1.00 4.94  ? 49   LYS B N     1 
ATOM   9726  C  CA    . LYS B 1 48   ? 10.947  -54.661  29.242  1.00 4.55  ? 49   LYS B CA    1 
ATOM   9727  C  C     . LYS B 1 48   ? 10.353  -55.585  30.309  1.00 3.87  ? 49   LYS B C     1 
ATOM   9728  O  O     . LYS B 1 48   ? 10.487  -55.362  31.500  1.00 3.16  ? 49   LYS B O     1 
ATOM   9729  C  CB    . LYS B 1 48   ? 12.352  -55.141  28.866  1.00 5.51  ? 49   LYS B CB    1 
ATOM   9730  C  CG    . LYS B 1 48   ? 13.038  -54.305  27.817  1.00 7.28  ? 49   LYS B CG    1 
ATOM   9731  C  CD    . LYS B 1 48   ? 12.375  -54.339  26.458  1.00 8.16  ? 49   LYS B CD    1 
ATOM   9732  C  CE    . LYS B 1 48   ? 13.203  -53.477  25.511  1.00 9.43  ? 49   LYS B CE    1 
ATOM   9733  N  NZ    . LYS B 1 48   ? 12.868  -53.658  24.076  1.00 10.25 ? 49   LYS B NZ    1 
ATOM   9734  N  N     . ASN B 1 49   ? 9.667   -56.623  29.868  1.00 3.47  ? 50   ASN B N     1 
ATOM   9735  C  CA    . ASN B 1 49   ? 9.114   -57.588  30.797  1.00 3.33  ? 50   ASN B CA    1 
ATOM   9736  C  C     . ASN B 1 49   ? 10.248  -58.583  31.077  1.00 2.94  ? 50   ASN B C     1 
ATOM   9737  O  O     . ASN B 1 49   ? 11.390  -58.355  30.666  1.00 2.76  ? 50   ASN B O     1 
ATOM   9738  C  CB    . ASN B 1 49   ? 7.845   -58.266  30.204  1.00 3.55  ? 50   ASN B CB    1 
ATOM   9739  C  CG    . ASN B 1 49   ? 8.077   -58.902  28.830  1.00 3.73  ? 50   ASN B CG    1 
ATOM   9740  O  OD1   . ASN B 1 49   ? 9.193   -59.338  28.508  1.00 3.67  ? 50   ASN B OD1   1 
ATOM   9741  N  ND2   . ASN B 1 49   ? 7.016   -58.986  28.034  1.00 2.89  ? 50   ASN B ND2   1 
ATOM   9742  N  N     . ILE B 1 50   ? 9.920   -59.688  31.745  1.00 3.52  ? 51   ILE B N     1 
ATOM   9743  C  CA    . ILE B 1 50   ? 10.883  -60.719  32.087  1.00 2.80  ? 51   ILE B CA    1 
ATOM   9744  C  C     . ILE B 1 50   ? 11.475  -61.456  30.881  1.00 3.47  ? 51   ILE B C     1 
ATOM   9745  O  O     . ILE B 1 50   ? 12.496  -62.157  31.013  1.00 4.67  ? 51   ILE B O     1 
ATOM   9746  C  CB    . ILE B 1 50   ? 10.299  -61.718  33.107  1.00 2.50  ? 51   ILE B CB    1 
ATOM   9747  C  CG1   . ILE B 1 50   ? 8.973   -62.304  32.612  1.00 2.15  ? 51   ILE B CG1   1 
ATOM   9748  C  CG2   . ILE B 1 50   ? 10.074  -61.047  34.438  1.00 2.00  ? 51   ILE B CG2   1 
ATOM   9749  C  CD1   . ILE B 1 50   ? 8.474   -63.474  33.469  1.00 2.00  ? 51   ILE B CD1   1 
ATOM   9750  N  N     . PHE B 1 51   ? 10.871  -61.296  29.701  1.00 3.49  ? 52   PHE B N     1 
ATOM   9751  C  CA    . PHE B 1 51   ? 11.365  -61.956  28.476  1.00 2.97  ? 52   PHE B CA    1 
ATOM   9752  C  C     . PHE B 1 51   ? 12.154  -60.972  27.654  1.00 3.11  ? 52   PHE B C     1 
ATOM   9753  O  O     . PHE B 1 51   ? 12.482  -61.231  26.505  1.00 3.50  ? 52   PHE B O     1 
ATOM   9754  C  CB    . PHE B 1 51   ? 10.204  -62.501  27.646  1.00 2.36  ? 52   PHE B CB    1 
ATOM   9755  C  CG    . PHE B 1 51   ? 9.308   -63.395  28.419  1.00 2.98  ? 52   PHE B CG    1 
ATOM   9756  C  CD1   . PHE B 1 51   ? 9.757   -64.644  28.845  1.00 2.70  ? 52   PHE B CD1   1 
ATOM   9757  C  CD2   . PHE B 1 51   ? 8.047   -62.965  28.813  1.00 3.20  ? 52   PHE B CD2   1 
ATOM   9758  C  CE1   . PHE B 1 51   ? 8.965   -65.440  29.658  1.00 3.13  ? 52   PHE B CE1   1 
ATOM   9759  C  CE2   . PHE B 1 51   ? 7.239   -63.776  29.639  1.00 3.29  ? 52   PHE B CE2   1 
ATOM   9760  C  CZ    . PHE B 1 51   ? 7.702   -65.008  30.060  1.00 3.02  ? 52   PHE B CZ    1 
ATOM   9761  N  N     . GLY B 1 52   ? 12.432  -59.816  28.246  1.00 3.65  ? 53   GLY B N     1 
ATOM   9762  C  CA    . GLY B 1 52   ? 13.172  -58.770  27.564  1.00 3.87  ? 53   GLY B CA    1 
ATOM   9763  C  C     . GLY B 1 52   ? 12.443  -58.083  26.434  1.00 4.65  ? 53   GLY B C     1 
ATOM   9764  O  O     . GLY B 1 52   ? 13.074  -57.519  25.557  1.00 5.56  ? 53   GLY B O     1 
ATOM   9765  N  N     . GLN B 1 53   ? 11.116  -58.058  26.470  1.00 5.61  ? 54   GLN B N     1 
ATOM   9766  C  CA    . GLN B 1 53   ? 10.323  -57.436  25.412  1.00 6.00  ? 54   GLN B CA    1 
ATOM   9767  C  C     . GLN B 1 53   ? 9.352   -56.377  25.982  1.00 5.87  ? 54   GLN B C     1 
ATOM   9768  O  O     . GLN B 1 53   ? 8.939   -56.467  27.140  1.00 5.98  ? 54   GLN B O     1 
ATOM   9769  C  CB    . GLN B 1 53   ? 9.481   -58.496  24.720  1.00 7.14  ? 54   GLN B CB    1 
ATOM   9770  C  CG    . GLN B 1 53   ? 10.185  -59.760  24.368  1.00 8.79  ? 54   GLN B CG    1 
ATOM   9771  C  CD    . GLN B 1 53   ? 11.269  -59.511  23.370  1.00 10.40 ? 54   GLN B CD    1 
ATOM   9772  O  OE1   . GLN B 1 53   ? 11.025  -58.881  22.355  1.00 11.50 ? 54   GLN B OE1   1 
ATOM   9773  N  NE2   . GLN B 1 53   ? 12.497  -59.998  23.652  1.00 11.55 ? 54   GLN B NE2   1 
ATOM   9774  N  N     . THR B 1 54   ? 8.969   -55.395  25.173  1.00 5.12  ? 55   THR B N     1 
ATOM   9775  C  CA    . THR B 1 54   ? 8.016   -54.421  25.642  1.00 5.31  ? 55   THR B CA    1 
ATOM   9776  C  C     . THR B 1 54   ? 6.642   -55.118  25.555  1.00 5.13  ? 55   THR B C     1 
ATOM   9777  O  O     . THR B 1 54   ? 6.474   -56.091  24.789  1.00 6.31  ? 55   THR B O     1 
ATOM   9778  C  CB    . THR B 1 54   ? 8.071   -53.113  24.820  1.00 5.45  ? 55   THR B CB    1 
ATOM   9779  O  OG1   . THR B 1 54   ? 7.545   -53.331  23.507  1.00 7.06  ? 55   THR B OG1   1 
ATOM   9780  C  CG2   . THR B 1 54   ? 9.502   -52.633  24.683  1.00 4.60  ? 55   THR B CG2   1 
ATOM   9781  N  N     . LEU B 1 55   ? 5.697   -54.716  26.400  1.00 4.19  ? 56   LEU B N     1 
ATOM   9782  C  CA    . LEU B 1 55   ? 4.379   -55.338  26.404  1.00 3.95  ? 56   LEU B CA    1 
ATOM   9783  C  C     . LEU B 1 55   ? 3.517   -54.892  25.207  1.00 4.17  ? 56   LEU B C     1 
ATOM   9784  O  O     . LEU B 1 55   ? 3.626   -53.728  24.740  1.00 4.60  ? 56   LEU B O     1 
ATOM   9785  C  CB    . LEU B 1 55   ? 3.674   -55.053  27.767  1.00 3.90  ? 56   LEU B CB    1 
ATOM   9786  C  CG    . LEU B 1 55   ? 2.149   -55.090  28.074  1.00 2.41  ? 56   LEU B CG    1 
ATOM   9787  C  CD1   . LEU B 1 55   ? 1.668   -56.462  28.428  1.00 2.00  ? 56   LEU B CD1   1 
ATOM   9788  C  CD2   . LEU B 1 55   ? 1.826   -54.148  29.221  1.00 2.00  ? 56   LEU B CD2   1 
ATOM   9789  N  N     . THR B 1 56   ? 2.682   -55.821  24.705  1.00 3.54  ? 57   THR B N     1 
ATOM   9790  C  CA    . THR B 1 56   ? 1.763   -55.554  23.586  1.00 3.08  ? 57   THR B CA    1 
ATOM   9791  C  C     . THR B 1 56   ? 0.435   -55.196  24.207  1.00 2.77  ? 57   THR B C     1 
ATOM   9792  O  O     . THR B 1 56   ? -0.265  -56.095  24.665  1.00 2.76  ? 57   THR B O     1 
ATOM   9793  C  CB    . THR B 1 56   ? 1.542   -56.817  22.679  1.00 3.09  ? 57   THR B CB    1 
ATOM   9794  O  OG1   . THR B 1 56   ? 2.773   -57.156  22.007  1.00 4.03  ? 57   THR B OG1   1 
ATOM   9795  C  CG2   . THR B 1 56   ? 0.456   -56.578  21.655  1.00 2.08  ? 57   THR B CG2   1 
ATOM   9796  N  N     . ILE B 1 57   ? 0.118   -53.900  24.266  1.00 2.63  ? 58   ILE B N     1 
ATOM   9797  C  CA    . ILE B 1 57   ? -1.155  -53.416  24.830  1.00 3.02  ? 58   ILE B CA    1 
ATOM   9798  C  C     . ILE B 1 57   ? -1.959  -52.842  23.698  1.00 3.06  ? 58   ILE B C     1 
ATOM   9799  O  O     . ILE B 1 57   ? -1.455  -52.062  22.927  1.00 3.40  ? 58   ILE B O     1 
ATOM   9800  C  CB    . ILE B 1 57   ? -1.014  -52.193  25.801  1.00 3.45  ? 58   ILE B CB    1 
ATOM   9801  C  CG1   . ILE B 1 57   ? 0.209   -52.321  26.677  1.00 3.43  ? 58   ILE B CG1   1 
ATOM   9802  C  CG2   . ILE B 1 57   ? -2.275  -52.023  26.677  1.00 2.27  ? 58   ILE B CG2   1 
ATOM   9803  C  CD1   . ILE B 1 57   ? 1.362   -51.638  26.081  1.00 4.46  ? 58   ILE B CD1   1 
ATOM   9804  N  N     . ARG B 1 58   ? -3.231  -53.171  23.632  1.00 3.63  ? 59   ARG B N     1 
ATOM   9805  C  CA    . ARG B 1 58   ? -4.103  -52.609  22.608  1.00 3.58  ? 59   ARG B CA    1 
ATOM   9806  C  C     . ARG B 1 58   ? -5.407  -52.262  23.331  1.00 2.72  ? 59   ARG B C     1 
ATOM   9807  O  O     . ARG B 1 58   ? -5.824  -53.017  24.191  1.00 2.39  ? 59   ARG B O     1 
ATOM   9808  C  CB    . ARG B 1 58   ? -4.379  -53.654  21.511  1.00 5.40  ? 59   ARG B CB    1 
ATOM   9809  C  CG    . ARG B 1 58   ? -3.175  -54.161  20.753  1.00 7.90  ? 59   ARG B CG    1 
ATOM   9810  C  CD    . ARG B 1 58   ? -2.436  -53.051  20.017  1.00 10.45 ? 59   ARG B CD    1 
ATOM   9811  N  NE    . ARG B 1 58   ? -1.367  -53.592  19.159  1.00 13.34 ? 59   ARG B NE    1 
ATOM   9812  C  CZ    . ARG B 1 58   ? -0.058  -53.560  19.440  1.00 14.95 ? 59   ARG B CZ    1 
ATOM   9813  N  NH1   . ARG B 1 58   ? 0.380   -52.996  20.574  1.00 14.93 ? 59   ARG B NH1   1 
ATOM   9814  N  NH2   . ARG B 1 58   ? 0.820   -54.136  18.601  1.00 15.67 ? 59   ARG B NH2   1 
ATOM   9815  N  N     . GLU B 1 59   ? -5.991  -51.095  23.058  1.00 2.73  ? 60   GLU B N     1 
ATOM   9816  C  CA    . GLU B 1 59   ? -7.267  -50.714  23.669  1.00 2.28  ? 60   GLU B CA    1 
ATOM   9817  C  C     . GLU B 1 59   ? -8.421  -51.306  22.845  1.00 2.17  ? 60   GLU B C     1 
ATOM   9818  O  O     . GLU B 1 59   ? -8.401  -51.236  21.626  1.00 2.84  ? 60   GLU B O     1 
ATOM   9819  C  CB    . GLU B 1 59   ? -7.400  -49.177  23.726  1.00 2.74  ? 60   GLU B CB    1 
ATOM   9820  C  CG    . GLU B 1 59   ? -8.761  -48.665  24.282  1.00 3.33  ? 60   GLU B CG    1 
ATOM   9821  C  CD    . GLU B 1 59   ? -8.841  -47.142  24.438  1.00 4.27  ? 60   GLU B CD    1 
ATOM   9822  O  OE1   . GLU B 1 59   ? -8.791  -46.412  23.422  1.00 4.42  ? 60   GLU B OE1   1 
ATOM   9823  O  OE2   . GLU B 1 59   ? -9.006  -46.673  25.577  1.00 4.39  ? 60   GLU B OE2   1 
ATOM   9824  N  N     . MET B 1 60   ? -9.440  -51.854  23.495  1.00 2.00  ? 61   MET B N     1 
ATOM   9825  C  CA    . MET B 1 60   ? -10.581 -52.449  22.792  1.00 2.00  ? 61   MET B CA    1 
ATOM   9826  C  C     . MET B 1 60   ? -11.787 -51.502  22.795  1.00 2.00  ? 61   MET B C     1 
ATOM   9827  O  O     . MET B 1 60   ? -11.641 -50.341  23.145  1.00 2.49  ? 61   MET B O     1 
ATOM   9828  C  CB    . MET B 1 60   ? -10.944 -53.814  23.409  1.00 2.17  ? 61   MET B CB    1 
ATOM   9829  C  CG    . MET B 1 60   ? -9.840  -54.848  23.324  1.00 2.00  ? 61   MET B CG    1 
ATOM   9830  S  SD    . MET B 1 60   ? -9.295  -54.965  21.634  1.00 2.00  ? 61   MET B SD    1 
ATOM   9831  C  CE    . MET B 1 60   ? -10.370 -56.286  20.963  1.00 2.00  ? 61   MET B CE    1 
ATOM   9832  N  N     . GLN B 1 61   ? -12.951 -51.960  22.331  1.00 2.12  ? 62   GLN B N     1 
ATOM   9833  C  CA    . GLN B 1 61   ? -14.156 -51.109  22.269  1.00 2.22  ? 62   GLN B CA    1 
ATOM   9834  C  C     . GLN B 1 61   ? -14.997 -51.242  23.530  1.00 2.25  ? 62   GLN B C     1 
ATOM   9835  O  O     . GLN B 1 61   ? -15.919 -50.471  23.765  1.00 2.00  ? 62   GLN B O     1 
ATOM   9836  C  CB    . GLN B 1 61   ? -15.012 -51.419  21.035  1.00 2.00  ? 62   GLN B CB    1 
ATOM   9837  C  CG    . GLN B 1 61   ? -16.016 -52.579  21.206  1.00 2.37  ? 62   GLN B CG    1 
ATOM   9838  C  CD    . GLN B 1 61   ? -15.381 -53.944  21.227  1.00 2.00  ? 62   GLN B CD    1 
ATOM   9839  O  OE1   . GLN B 1 61   ? -14.162 -54.085  21.315  1.00 2.42  ? 62   GLN B OE1   1 
ATOM   9840  N  NE2   . GLN B 1 61   ? -16.208 -54.961  21.199  1.00 2.00  ? 62   GLN B NE2   1 
ATOM   9841  N  N     . SER B 1 62   ? -14.627 -52.219  24.346  1.00 2.00  ? 63   SER B N     1 
ATOM   9842  C  CA    . SER B 1 62   ? -15.297 -52.468  25.598  1.00 2.31  ? 63   SER B CA    1 
ATOM   9843  C  C     . SER B 1 62   ? -14.523 -53.515  26.349  1.00 2.00  ? 63   SER B C     1 
ATOM   9844  O  O     . SER B 1 62   ? -13.563 -54.061  25.826  1.00 2.00  ? 63   SER B O     1 
ATOM   9845  C  CB    . SER B 1 62   ? -16.747 -52.951  25.374  1.00 2.42  ? 63   SER B CB    1 
ATOM   9846  O  OG    . SER B 1 62   ? -16.781 -54.229  24.769  1.00 2.00  ? 63   SER B OG    1 
ATOM   9847  N  N     . GLU B 1 63   ? -14.923 -53.762  27.588  1.00 2.00  ? 64   GLU B N     1 
ATOM   9848  C  CA    . GLU B 1 63   ? -14.238 -54.785  28.370  1.00 2.39  ? 64   GLU B CA    1 
ATOM   9849  C  C     . GLU B 1 63   ? -14.647 -56.195  27.941  1.00 2.22  ? 64   GLU B C     1 
ATOM   9850  O  O     . GLU B 1 63   ? -13.919 -57.150  28.191  1.00 2.71  ? 64   GLU B O     1 
ATOM   9851  C  CB    . GLU B 1 63   ? -14.332 -54.577  29.887  1.00 2.00  ? 64   GLU B CB    1 
ATOM   9852  C  CG    . GLU B 1 63   ? -15.429 -53.733  30.326  1.00 2.59  ? 64   GLU B CG    1 
ATOM   9853  C  CD    . GLU B 1 63   ? -15.153 -52.265  30.243  1.00 2.38  ? 64   GLU B CD    1 
ATOM   9854  O  OE1   . GLU B 1 63   ? -14.331 -51.757  31.018  1.00 2.98  ? 64   GLU B OE1   1 
ATOM   9855  O  OE2   . GLU B 1 63   ? -15.795 -51.619  29.412  1.00 2.79  ? 64   GLU B OE2   1 
ATOM   9856  N  N     . ALA B 1 64   ? -15.772 -56.316  27.234  1.00 2.49  ? 65   ALA B N     1 
ATOM   9857  C  CA    . ALA B 1 64   ? -16.210 -57.613  26.695  1.00 2.38  ? 65   ALA B CA    1 
ATOM   9858  C  C     . ALA B 1 64   ? -15.248 -57.860  25.544  1.00 2.81  ? 65   ALA B C     1 
ATOM   9859  O  O     . ALA B 1 64   ? -14.799 -58.978  25.318  1.00 3.24  ? 65   ALA B O     1 
ATOM   9860  C  CB    . ALA B 1 64   ? -17.636 -57.528  26.161  1.00 2.00  ? 65   ALA B CB    1 
ATOM   9861  N  N     . GLY B 1 65   ? -14.942 -56.781  24.828  1.00 3.05  ? 66   GLY B N     1 
ATOM   9862  C  CA    . GLY B 1 65   ? -14.021 -56.814  23.712  1.00 2.81  ? 66   GLY B CA    1 
ATOM   9863  C  C     . GLY B 1 65   ? -12.636 -57.198  24.193  1.00 2.73  ? 66   GLY B C     1 
ATOM   9864  O  O     . GLY B 1 65   ? -12.005 -58.058  23.602  1.00 2.73  ? 66   GLY B O     1 
ATOM   9865  N  N     . ALA B 1 66   ? -12.201 -56.602  25.301  1.00 2.35  ? 67   ALA B N     1 
ATOM   9866  C  CA    . ALA B 1 66   ? -10.898 -56.853  25.885  1.00 2.00  ? 67   ALA B CA    1 
ATOM   9867  C  C     . ALA B 1 66   ? -10.767 -58.290  26.424  1.00 2.39  ? 67   ALA B C     1 
ATOM   9868  O  O     . ALA B 1 66   ? -9.718  -58.911  26.297  1.00 2.49  ? 67   ALA B O     1 
ATOM   9869  C  CB    . ALA B 1 66   ? -10.663 -55.851  26.995  1.00 2.19  ? 67   ALA B CB    1 
ATOM   9870  N  N     . ALA B 1 67   ? -11.842 -58.803  27.034  1.00 2.50  ? 68   ALA B N     1 
ATOM   9871  C  CA    . ALA B 1 67   ? -11.891 -60.148  27.615  1.00 2.37  ? 68   ALA B CA    1 
ATOM   9872  C  C     . ALA B 1 67   ? -11.899 -61.168  26.480  1.00 2.37  ? 68   ALA B C     1 
ATOM   9873  O  O     . ALA B 1 67   ? -11.290 -62.240  26.579  1.00 2.00  ? 68   ALA B O     1 
ATOM   9874  C  CB    . ALA B 1 67   ? -13.129 -60.297  28.482  1.00 2.32  ? 68   ALA B CB    1 
ATOM   9875  N  N     . GLY B 1 68   ? -12.581 -60.785  25.400  1.00 2.03  ? 69   GLY B N     1 
ATOM   9876  C  CA    . GLY B 1 68   ? -12.634 -61.587  24.204  1.00 2.00  ? 69   GLY B CA    1 
ATOM   9877  C  C     . GLY B 1 68   ? -11.204 -61.661  23.679  1.00 2.58  ? 69   GLY B C     1 
ATOM   9878  O  O     . GLY B 1 68   ? -10.727 -62.774  23.327  1.00 2.93  ? 69   GLY B O     1 
ATOM   9879  N  N     . ALA B 1 69   ? -10.500 -60.517  23.692  1.00 2.00  ? 70   ALA B N     1 
ATOM   9880  C  CA    . ALA B 1 69   ? -9.098  -60.453  23.266  1.00 2.00  ? 70   ALA B CA    1 
ATOM   9881  C  C     . ALA B 1 69   ? -8.176  -61.193  24.232  1.00 2.00  ? 70   ALA B C     1 
ATOM   9882  O  O     . ALA B 1 69   ? -7.299  -61.897  23.775  1.00 2.00  ? 70   ALA B O     1 
ATOM   9883  C  CB    . ALA B 1 69   ? -8.622  -59.009  23.093  1.00 2.00  ? 70   ALA B CB    1 
ATOM   9884  N  N     . VAL B 1 70   ? -8.395  -61.081  25.543  1.00 2.00  ? 71   VAL B N     1 
ATOM   9885  C  CA    . VAL B 1 70   ? -7.544  -61.773  26.514  1.00 2.18  ? 71   VAL B CA    1 
ATOM   9886  C  C     . VAL B 1 70   ? -7.628  -63.330  26.403  1.00 2.27  ? 71   VAL B C     1 
ATOM   9887  O  O     . VAL B 1 70   ? -6.629  -64.041  26.537  1.00 2.38  ? 71   VAL B O     1 
ATOM   9888  C  CB    . VAL B 1 70   ? -7.831  -61.314  27.967  1.00 2.16  ? 71   VAL B CB    1 
ATOM   9889  C  CG1   . VAL B 1 70   ? -7.144  -62.234  28.957  1.00 2.07  ? 71   VAL B CG1   1 
ATOM   9890  C  CG2   . VAL B 1 70   ? -7.354  -59.868  28.203  1.00 2.50  ? 71   VAL B CG2   1 
ATOM   9891  N  N     . HIS B 1 71   ? -8.813  -63.843  26.100  1.00 2.24  ? 72   HIS B N     1 
ATOM   9892  C  CA    . HIS B 1 71   ? -9.023  -65.267  25.937  1.00 2.00  ? 72   HIS B CA    1 
ATOM   9893  C  C     . HIS B 1 71   ? -8.284  -65.723  24.692  1.00 2.00  ? 72   HIS B C     1 
ATOM   9894  O  O     . HIS B 1 71   ? -7.683  -66.801  24.679  1.00 2.09  ? 72   HIS B O     1 
ATOM   9895  C  CB    . HIS B 1 71   ? -10.515 -65.511  25.825  1.00 2.09  ? 72   HIS B CB    1 
ATOM   9896  C  CG    . HIS B 1 71   ? -10.890 -66.907  25.460  1.00 2.00  ? 72   HIS B CG    1 
ATOM   9897  N  ND1   . HIS B 1 71   ? -12.131 -67.222  24.960  1.00 2.12  ? 72   HIS B ND1   1 
ATOM   9898  C  CD2   . HIS B 1 71   ? -10.211 -68.075  25.544  1.00 2.00  ? 72   HIS B CD2   1 
ATOM   9899  C  CE1   . HIS B 1 71   ? -12.204 -68.524  24.754  1.00 2.20  ? 72   HIS B CE1   1 
ATOM   9900  N  NE2   . HIS B 1 71   ? -11.050 -69.062  25.098  1.00 2.00  ? 72   HIS B NE2   1 
ATOM   9901  N  N     . GLY B 1 72   ? -8.281  -64.877  23.665  1.00 2.00  ? 73   GLY B N     1 
ATOM   9902  C  CA    . GLY B 1 72   ? -7.605  -65.210  22.409  1.00 2.20  ? 73   GLY B CA    1 
ATOM   9903  C  C     . GLY B 1 72   ? -6.085  -65.284  22.487  1.00 2.48  ? 73   GLY B C     1 
ATOM   9904  O  O     . GLY B 1 72   ? -5.465  -66.197  21.911  1.00 3.40  ? 73   GLY B O     1 
ATOM   9905  N  N     . ALA B 1 73   ? -5.491  -64.311  23.170  1.00 2.00  ? 74   ALA B N     1 
ATOM   9906  C  CA    . ALA B 1 73   ? -4.047  -64.223  23.362  1.00 2.16  ? 74   ALA B CA    1 
ATOM   9907  C  C     . ALA B 1 73   ? -3.560  -65.415  24.181  1.00 2.08  ? 74   ALA B C     1 
ATOM   9908  O  O     . ALA B 1 73   ? -2.492  -65.952  23.919  1.00 2.00  ? 74   ALA B O     1 
ATOM   9909  C  CB    . ALA B 1 73   ? -3.670  -62.883  24.073  1.00 2.00  ? 74   ALA B CB    1 
ATOM   9910  N  N     . LEU B 1 74   ? -4.351  -65.791  25.185  1.00 2.00  ? 75   LEU B N     1 
ATOM   9911  C  CA    . LEU B 1 74   ? -4.035  -66.917  26.051  1.00 2.00  ? 75   LEU B CA    1 
ATOM   9912  C  C     . LEU B 1 74   ? -4.153  -68.222  25.273  1.00 2.00  ? 75   LEU B C     1 
ATOM   9913  O  O     . LEU B 1 74   ? -3.263  -69.033  25.323  1.00 2.00  ? 75   LEU B O     1 
ATOM   9914  C  CB    . LEU B 1 74   ? -4.962  -66.928  27.270  1.00 2.00  ? 75   LEU B CB    1 
ATOM   9915  C  CG    . LEU B 1 74   ? -4.637  -65.868  28.330  1.00 2.53  ? 75   LEU B CG    1 
ATOM   9916  C  CD1   . LEU B 1 74   ? -5.881  -65.516  29.140  1.00 2.05  ? 75   LEU B CD1   1 
ATOM   9917  C  CD2   . LEU B 1 74   ? -3.470  -66.334  29.205  1.00 2.00  ? 75   LEU B CD2   1 
ATOM   9918  N  N     . ALA B 1 75   ? -5.228  -68.376  24.505  1.00 2.00  ? 76   ALA B N     1 
ATOM   9919  C  CA    . ALA B 1 75   ? -5.451  -69.579  23.680  1.00 2.05  ? 76   ALA B CA    1 
ATOM   9920  C  C     . ALA B 1 75   ? -4.321  -69.750  22.722  1.00 2.00  ? 76   ALA B C     1 
ATOM   9921  O  O     . ALA B 1 75   ? -3.975  -70.877  22.413  1.00 2.27  ? 76   ALA B O     1 
ATOM   9922  C  CB    . ALA B 1 75   ? -6.778  -69.515  22.915  1.00 2.00  ? 76   ALA B CB    1 
ATOM   9923  N  N     . ALA B 1 76   ? -3.769  -68.631  22.243  1.00 2.02  ? 77   ALA B N     1 
ATOM   9924  C  CA    . ALA B 1 76   ? -2.621  -68.629  21.330  1.00 2.04  ? 77   ALA B CA    1 
ATOM   9925  C  C     . ALA B 1 76   ? -1.221  -68.573  22.020  1.00 2.02  ? 77   ALA B C     1 
ATOM   9926  O  O     . ALA B 1 76   ? -0.226  -68.189  21.415  1.00 2.00  ? 77   ALA B O     1 
ATOM   9927  C  CB    . ALA B 1 76   ? -2.758  -67.543  20.299  1.00 2.00  ? 77   ALA B CB    1 
ATOM   9928  N  N     . GLY B 1 77   ? -1.164  -68.914  23.304  1.00 2.13  ? 78   GLY B N     1 
ATOM   9929  C  CA    . GLY B 1 77   ? 0.111   -68.985  24.006  1.00 2.31  ? 78   GLY B CA    1 
ATOM   9930  C  C     . GLY B 1 77   ? 0.877   -67.776  24.528  1.00 2.23  ? 78   GLY B C     1 
ATOM   9931  O  O     . GLY B 1 77   ? 2.097   -67.871  24.739  1.00 2.02  ? 78   GLY B O     1 
ATOM   9932  N  N     . ALA B 1 78   ? 0.209   -66.652  24.727  1.00 2.00  ? 79   ALA B N     1 
ATOM   9933  C  CA    . ALA B 1 78   ? 0.921   -65.505  25.289  1.00 2.05  ? 79   ALA B CA    1 
ATOM   9934  C  C     . ALA B 1 78   ? 0.373   -65.143  26.689  1.00 2.22  ? 79   ALA B C     1 
ATOM   9935  O  O     . ALA B 1 78   ? -0.824  -65.291  26.948  1.00 2.50  ? 79   ALA B O     1 
ATOM   9936  C  CB    . ALA B 1 78   ? 0.843   -64.365  24.370  1.00 2.00  ? 79   ALA B CB    1 
ATOM   9937  N  N     . LEU B 1 79   ? 1.257   -64.869  27.643  1.00 2.00  ? 80   LEU B N     1 
ATOM   9938  C  CA    . LEU B 1 79   ? 0.826   -64.474  28.980  1.00 2.03  ? 80   LEU B CA    1 
ATOM   9939  C  C     . LEU B 1 79   ? 0.093   -63.152  28.745  1.00 2.11  ? 80   LEU B C     1 
ATOM   9940  O  O     . LEU B 1 79   ? 0.600   -62.266  28.044  1.00 2.04  ? 80   LEU B O     1 
ATOM   9941  C  CB    . LEU B 1 79   ? 2.033   -64.292  29.916  1.00 2.14  ? 80   LEU B CB    1 
ATOM   9942  C  CG    . LEU B 1 79   ? 2.865   -65.573  30.151  1.00 2.95  ? 80   LEU B CG    1 
ATOM   9943  C  CD1   . LEU B 1 79   ? 3.973   -65.397  31.183  1.00 2.00  ? 80   LEU B CD1   1 
ATOM   9944  C  CD2   . LEU B 1 79   ? 1.901   -66.679  30.585  1.00 3.13  ? 80   LEU B CD2   1 
ATOM   9945  N  N     . THR B 1 80   ? -1.060  -63.003  29.382  1.00 2.00  ? 81   THR B N     1 
ATOM   9946  C  CA    . THR B 1 80   ? -1.890  -61.854  29.176  1.00 2.00  ? 81   THR B CA    1 
ATOM   9947  C  C     . THR B 1 80   ? -2.602  -61.432  30.476  1.00 2.15  ? 81   THR B C     1 
ATOM   9948  O  O     . THR B 1 80   ? -2.841  -62.276  31.326  1.00 2.57  ? 81   THR B O     1 
ATOM   9949  C  CB    . THR B 1 80   ? -2.934  -62.274  28.069  1.00 2.50  ? 81   THR B CB    1 
ATOM   9950  O  OG1   . THR B 1 80   ? -2.236  -62.844  26.949  1.00 2.00  ? 81   THR B OG1   1 
ATOM   9951  C  CG2   . THR B 1 80   ? -3.814  -61.127  27.585  1.00 2.13  ? 81   THR B CG2   1 
ATOM   9952  N  N     . THR B 1 81   ? -2.768  -60.121  30.683  1.00 2.00  ? 82   THR B N     1 
ATOM   9953  C  CA    . THR B 1 81   ? -3.518  -59.539  31.804  1.00 2.02  ? 82   THR B CA    1 
ATOM   9954  C  C     . THR B 1 81   ? -4.466  -58.446  31.276  1.00 2.26  ? 82   THR B C     1 
ATOM   9955  O  O     . THR B 1 81   ? -4.488  -58.081  30.085  1.00 2.38  ? 82   THR B O     1 
ATOM   9956  C  CB    . THR B 1 81   ? -2.712  -58.730  32.876  1.00 2.00  ? 82   THR B CB    1 
ATOM   9957  O  OG1   . THR B 1 81   ? -1.598  -58.036  32.298  1.00 2.79  ? 82   THR B OG1   1 
ATOM   9958  C  CG2   . THR B 1 81   ? -2.330  -59.543  33.988  1.00 2.07  ? 82   THR B CG2   1 
ATOM   9959  N  N     . THR B 1 82   ? -5.201  -57.874  32.211  1.00 2.00  ? 83   THR B N     1 
ATOM   9960  C  CA    . THR B 1 82   ? -6.099  -56.804  31.909  1.00 2.14  ? 83   THR B CA    1 
ATOM   9961  C  C     . THR B 1 82   ? -6.404  -56.149  33.228  1.00 2.34  ? 83   THR B C     1 
ATOM   9962  O  O     . THR B 1 82   ? -6.296  -56.753  34.286  1.00 2.52  ? 83   THR B O     1 
ATOM   9963  C  CB    . THR B 1 82   ? -7.367  -57.278  31.210  1.00 2.55  ? 83   THR B CB    1 
ATOM   9964  O  OG1   . THR B 1 82   ? -8.097  -56.113  30.767  1.00 2.85  ? 83   THR B OG1   1 
ATOM   9965  C  CG2   . THR B 1 82   ? -8.208  -58.150  32.141  1.00 2.00  ? 83   THR B CG2   1 
ATOM   9966  N  N     . PHE B 1 83   ? -6.699  -54.875  33.174  1.00 2.12  ? 84   PHE B N     1 
ATOM   9967  C  CA    . PHE B 1 83   ? -6.974  -54.139  34.374  1.00 2.47  ? 84   PHE B CA    1 
ATOM   9968  C  C     . PHE B 1 83   ? -8.408  -53.695  34.241  1.00 2.73  ? 84   PHE B C     1 
ATOM   9969  O  O     . PHE B 1 83   ? -8.777  -53.162  33.201  1.00 3.14  ? 84   PHE B O     1 
ATOM   9970  C  CB    . PHE B 1 83   ? -6.028  -52.958  34.404  1.00 2.01  ? 84   PHE B CB    1 
ATOM   9971  C  CG    . PHE B 1 83   ? -4.626  -53.334  34.043  1.00 2.00  ? 84   PHE B CG    1 
ATOM   9972  C  CD1   . PHE B 1 83   ? -3.805  -53.971  34.975  1.00 2.25  ? 84   PHE B CD1   1 
ATOM   9973  C  CD2   . PHE B 1 83   ? -4.131  -53.076  32.763  1.00 2.00  ? 84   PHE B CD2   1 
ATOM   9974  C  CE1   . PHE B 1 83   ? -2.510  -54.352  34.647  1.00 2.35  ? 84   PHE B CE1   1 
ATOM   9975  C  CE2   . PHE B 1 83   ? -2.847  -53.448  32.419  1.00 2.14  ? 84   PHE B CE2   1 
ATOM   9976  C  CZ    . PHE B 1 83   ? -2.027  -54.095  33.375  1.00 2.64  ? 84   PHE B CZ    1 
ATOM   9977  N  N     . THR B 1 84   ? -9.237  -53.995  35.240  1.00 2.77  ? 85   THR B N     1 
ATOM   9978  C  CA    . THR B 1 84   ? -10.634 -53.593  35.174  1.00 2.44  ? 85   THR B CA    1 
ATOM   9979  C  C     . THR B 1 84   ? -11.296 -53.374  36.535  1.00 2.13  ? 85   THR B C     1 
ATOM   9980  O  O     . THR B 1 84   ? -10.645 -53.453  37.577  1.00 2.00  ? 85   THR B O     1 
ATOM   9981  C  CB    . THR B 1 84   ? -11.462 -54.616  34.307  1.00 2.80  ? 85   THR B CB    1 
ATOM   9982  O  OG1   . THR B 1 84   ? -12.704 -54.025  33.925  1.00 3.10  ? 85   THR B OG1   1 
ATOM   9983  C  CG2   . THR B 1 84   ? -11.747 -55.915  35.047  1.00 2.42  ? 85   THR B CG2   1 
ATOM   9984  N  N     . ALA B 1 85   ? -12.609 -53.179  36.509  1.00 2.00  ? 86   ALA B N     1 
ATOM   9985  C  CA    . ALA B 1 85   ? -13.383 -52.927  37.705  1.00 2.00  ? 86   ALA B CA    1 
ATOM   9986  C  C     . ALA B 1 85   ? -14.878 -52.944  37.357  1.00 2.03  ? 86   ALA B C     1 
ATOM   9987  O  O     . ALA B 1 85   ? -15.268 -52.809  36.191  1.00 2.00  ? 86   ALA B O     1 
ATOM   9988  C  CB    . ALA B 1 85   ? -12.996 -51.558  38.286  1.00 2.00  ? 86   ALA B CB    1 
ATOM   9989  N  N     . SER B 1 86   ? -15.687 -53.046  38.406  1.00 2.00  ? 87   SER B N     1 
ATOM   9990  C  CA    . SER B 1 86   ? -17.137 -53.067  38.379  1.00 2.00  ? 87   SER B CA    1 
ATOM   9991  C  C     . SER B 1 86   ? -17.922 -53.312  37.105  1.00 2.00  ? 87   SER B C     1 
ATOM   9992  O  O     . SER B 1 86   ? -18.097 -54.485  36.727  1.00 2.45  ? 87   SER B O     1 
ATOM   9993  C  CB    . SER B 1 86   ? -17.679 -51.872  39.156  1.00 2.00  ? 87   SER B CB    1 
ATOM   9994  O  OG    . SER B 1 86   ? -17.777 -50.748  38.338  1.00 2.00  ? 87   SER B OG    1 
ATOM   9995  N  N     . GLN B 1 87   ? -18.450 -52.273  36.454  1.00 2.00  ? 88   GLN B N     1 
ATOM   9996  C  CA    . GLN B 1 87   ? -19.229 -52.472  35.226  1.00 2.00  ? 88   GLN B CA    1 
ATOM   9997  C  C     . GLN B 1 87   ? -18.391 -53.205  34.167  1.00 2.00  ? 88   GLN B C     1 
ATOM   9998  O  O     . GLN B 1 87   ? -18.891 -54.019  33.400  1.00 2.00  ? 88   GLN B O     1 
ATOM   9999  C  CB    . GLN B 1 87   ? -19.718 -51.109  34.677  1.00 2.42  ? 88   GLN B CB    1 
ATOM   10000 C  CG    . GLN B 1 87   ? -20.407 -50.178  35.677  1.00 2.00  ? 88   GLN B CG    1 
ATOM   10001 C  CD    . GLN B 1 87   ? -21.571 -50.824  36.419  1.00 2.02  ? 88   GLN B CD    1 
ATOM   10002 O  OE1   . GLN B 1 87   ? -21.663 -50.681  37.632  1.00 2.20  ? 88   GLN B OE1   1 
ATOM   10003 N  NE2   . GLN B 1 87   ? -22.467 -51.509  35.702  1.00 2.00  ? 88   GLN B NE2   1 
ATOM   10004 N  N     . GLY B 1 88   ? -17.093 -52.915  34.146  1.00 2.00  ? 89   GLY B N     1 
ATOM   10005 C  CA    . GLY B 1 88   ? -16.211 -53.578  33.218  1.00 2.00  ? 89   GLY B CA    1 
ATOM   10006 C  C     . GLY B 1 88   ? -16.011 -55.054  33.519  1.00 2.11  ? 89   GLY B C     1 
ATOM   10007 O  O     . GLY B 1 88   ? -15.950 -55.896  32.618  1.00 2.16  ? 89   GLY B O     1 
ATOM   10008 N  N     . LEU B 1 89   ? -15.883 -55.377  34.799  1.00 2.02  ? 90   LEU B N     1 
ATOM   10009 C  CA    . LEU B 1 89   ? -15.684 -56.740  35.208  1.00 2.32  ? 90   LEU B CA    1 
ATOM   10010 C  C     . LEU B 1 89   ? -16.901 -57.573  34.780  1.00 2.74  ? 90   LEU B C     1 
ATOM   10011 O  O     . LEU B 1 89   ? -16.736 -58.682  34.296  1.00 3.43  ? 90   LEU B O     1 
ATOM   10012 C  CB    . LEU B 1 89   ? -15.458 -56.820  36.724  1.00 2.00  ? 90   LEU B CB    1 
ATOM   10013 C  CG    . LEU B 1 89   ? -15.124 -58.220  37.243  1.00 2.00  ? 90   LEU B CG    1 
ATOM   10014 C  CD1   . LEU B 1 89   ? -13.836 -58.701  36.642  1.00 2.08  ? 90   LEU B CD1   1 
ATOM   10015 C  CD2   . LEU B 1 89   ? -14.975 -58.191  38.683  1.00 2.00  ? 90   LEU B CD2   1 
ATOM   10016 N  N     . LEU B 1 90