data_1B3A
# 
_entry.id   1B3A 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.286 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1B3A         
RCSB  RCSB000229   
WWPDB D_1000000229 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1B3A 
_pdbx_database_status.recvd_initial_deposition_date   1998-12-07 
_pdbx_database_status.deposit_site                    NDB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Wilken, J.'     1 
'Hoover, D.'     2 
'Thompson, D.A.' 3 
'Barlow, P.N.'   4 
'Mcsparron, H.'  5 
'Picard, L.'     6 
'Wlodawer, A.'   7 
'Lubkowski, J.'  8 
'Kent, S.B.H.'   9 
# 
_citation.id                        primary 
_citation.title                     
'Total chemical synthesis and high-resolution crystal structure of the potent anti-HIV protein AOP-RANTES.' 
_citation.journal_abbrev            Chem.Biol. 
_citation.journal_volume            6 
_citation.page_first                43 
_citation.page_last                 51 
_citation.year                      1999 
_citation.journal_id_ASTM           CBOLE2 
_citation.country                   UK 
_citation.journal_id_ISSN           1074-5521 
_citation.journal_id_CSD            2050 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   9889151 
_citation.pdbx_database_id_DOI      '10.1016/S1074-5521(99)80019-2' 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Wilken, J.'     1 
primary 'Hoover, D.'     2 
primary 'Thompson, D.A.' 3 
primary 'Barlow, P.N.'   4 
primary 'McSparron, H.'  5 
primary 'Picard, L.'     6 
primary 'Wlodawer, A.'   7 
primary 'Lubkowski, J.'  8 
primary 'Kent, S.B.'     9 
# 
_cell.entry_id           1B3A 
_cell.length_a           23.635 
_cell.length_b           56.307 
_cell.length_c           94.030 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1B3A 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     syn 'PROTEIN (RANTES)'          7774.933 2   ? ? ? 'OXIME LINK BETWEEN AOP GROUP AND PRO3' 
2 non-polymer syn 'SULFATE ION'               96.063   4   ? ? ? ?                                       
3 non-polymer syn PENTYLOXYAMINO-ACETALDEHYDE 145.199  2   ? ? ? ?                                       
4 water       nat water                       18.015   222 ? ? ? ?                                       
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       PYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS 
_entity_poly.pdbx_seq_one_letter_code_can   PYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS 
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  PRO n 
1 2  TYR n 
1 3  SER n 
1 4  SER n 
1 5  ASP n 
1 6  THR n 
1 7  THR n 
1 8  PRO n 
1 9  CYS n 
1 10 CYS n 
1 11 PHE n 
1 12 ALA n 
1 13 TYR n 
1 14 ILE n 
1 15 ALA n 
1 16 ARG n 
1 17 PRO n 
1 18 LEU n 
1 19 PRO n 
1 20 ARG n 
1 21 ALA n 
1 22 HIS n 
1 23 ILE n 
1 24 LYS n 
1 25 GLU n 
1 26 TYR n 
1 27 PHE n 
1 28 TYR n 
1 29 THR n 
1 30 SER n 
1 31 GLY n 
1 32 LYS n 
1 33 CYS n 
1 34 SER n 
1 35 ASN n 
1 36 PRO n 
1 37 ALA n 
1 38 VAL n 
1 39 VAL n 
1 40 PHE n 
1 41 VAL n 
1 42 THR n 
1 43 ARG n 
1 44 LYS n 
1 45 ASN n 
1 46 ARG n 
1 47 GLN n 
1 48 VAL n 
1 49 CYS n 
1 50 ALA n 
1 51 ASN n 
1 52 PRO n 
1 53 GLU n 
1 54 LYS n 
1 55 LYS n 
1 56 TRP n 
1 57 VAL n 
1 58 ARG n 
1 59 GLU n 
1 60 TYR n 
1 61 ILE n 
1 62 ASN n 
1 63 SER n 
1 64 LEU n 
1 65 GLU n 
1 66 MET n 
1 67 SER n 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    CCL5_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P13501 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1B3A A 1 ? 67 ? P13501 10 ? 76 ? 2 68 
2 1 1B3A B 1 ? 67 ? P13501 10 ? 76 ? 2 68 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                     ? 'C3 H7 N O2'     89.093  
AOP non-polymer         . PENTYLOXYAMINO-ACETALDEHYDE ? 'C7 H15 N O2'    145.199 
ARG 'L-peptide linking' y ARGININE                    ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                  ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'             ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE                    ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE                   ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'             ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                     ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                   ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                       ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE                  ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                     ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                      ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                  ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE               ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                     ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                      ? 'C3 H7 N O3'     105.093 
SO4 non-polymer         . 'SULFATE ION'               ? 'O4 S -2'        96.063  
THR 'L-peptide linking' y THREONINE                   ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                  ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                    ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                      ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1B3A 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      1.98 
_exptl_crystal.density_percent_sol   32.7 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              4.6 
_exptl_crystal_grow.pdbx_details    'pH 4.6' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
_diffrn.id                     1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'MAR scanner 345 mm plate' 
_diffrn_detector.pdbx_collection_date   1998-05 
_diffrn_detector.details                MIRRORS 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'SI CRYSTAL' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97946 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSLS BEAMLINE X9B' 
_diffrn_source.pdbx_synchrotron_site       NSLS 
_diffrn_source.pdbx_synchrotron_beamline   X9B 
_diffrn_source.pdbx_wavelength             0.97946 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1B3A 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             20.0 
_reflns.d_resolution_high            1.6 
_reflns.number_obs                   17338 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.8 
_reflns.pdbx_Rmerge_I_obs            0.043 
_reflns.pdbx_Rsym_value              0.056 
_reflns.pdbx_netI_over_sigmaI        31.8 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              4.3 
_reflns.R_free_details               ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             1.60 
_reflns_shell.d_res_low              1.66 
_reflns_shell.percent_possible_all   100 
_reflns_shell.Rmerge_I_obs           0.196 
_reflns_shell.pdbx_Rsym_value        0.25 
_reflns_shell.meanI_over_sigI_obs    7.5 
_reflns_shell.pdbx_redundancy        4.2 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1B3A 
_refine.ls_number_reflns_obs                     ? 
_refine.ls_number_reflns_all                     16956 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             20.0 
_refine.ls_d_res_high                            1.6 
_refine.ls_percent_reflns_obs                    99.8 
_refine.ls_R_factor_obs                          0.1673 
_refine.ls_R_factor_all                          0.175 
_refine.ls_R_factor_R_work                       ? 
_refine.ls_R_factor_R_free                       0.2406 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 10.0 
_refine.ls_number_reflns_R_free                  1696 
_refine.ls_number_parameters                     5447 
_refine.ls_number_restraints                     4683 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    'MOEWS & KRETSINGER, J.MOL.BIOL. 91 (1973) 201-228' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               'FREE R' 
_refine.details                                  
;ANISOTROPIC SCALING APPLIED BY THE METHOD OF PARKIN, MOEZZI & HOPE, 
J.APPL.CRYST. 28 (1995) 53-56
;
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'ENGH AND HUBER' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1B3A 
_refine_analyze.Luzzati_coordinate_error_obs    ? 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      2 
_refine_analyze.occupancy_sum_hydrogen          0.0 
_refine_analyze.occupancy_sum_non_hydrogen      1358.0 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1094 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         40 
_refine_hist.number_atoms_solvent             223 
_refine_hist.number_atoms_total               1357 
_refine_hist.d_res_high                       1.6 
_refine_hist.d_res_low                        20.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
s_bond_d               0.008 ? ? ? 'X-RAY DIFFRACTION' ? 
s_angle_d              0.024 ? ? ? 'X-RAY DIFFRACTION' ? 
s_similar_dist         0.00  ? ? ? 'X-RAY DIFFRACTION' ? 
s_from_restr_planes    0.030 ? ? ? 'X-RAY DIFFRACTION' ? 
s_zero_chiral_vol      0.048 ? ? ? 'X-RAY DIFFRACTION' ? 
s_non_zero_chiral_vol  0.06  ? ? ? 'X-RAY DIFFRACTION' ? 
s_anti_bump_dis_restr  0.01  ? ? ? 'X-RAY DIFFRACTION' ? 
s_rigid_bond_adp_cmpnt 0.00  ? ? ? 'X-RAY DIFFRACTION' ? 
s_similar_adp_cmpnt    0.072 ? ? ? 'X-RAY DIFFRACTION' ? 
s_approx_iso_adps      0.00  ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_pdbx_refine.entry_id                                    1B3A 
_pdbx_refine.R_factor_all_no_cutoff                      0.175 
_pdbx_refine.R_factor_obs_no_cutoff                      0.1673 
_pdbx_refine.free_R_factor_no_cutoff                     0.2406 
_pdbx_refine.free_R_val_test_set_size_perc_no_cutoff     10.0 
_pdbx_refine.free_R_val_test_set_ct_no_cutoff            1696 
_pdbx_refine.R_factor_all_4sig_cutoff                    0.1682 
_pdbx_refine.R_factor_obs_4sig_cutoff                    0.1629 
_pdbx_refine.free_R_factor_4sig_cutoff                   0.2316 
_pdbx_refine.free_R_val_test_set_size_perc_4sig_cutoff   10.0 
_pdbx_refine.free_R_val_test_set_ct_4sig_cutoff          1566 
_pdbx_refine.number_reflns_obs_4sig_cutoff               15688 
_pdbx_refine.number_reflns_obs_no_cutoff                 ? 
_pdbx_refine.pdbx_refine_id                              'X-RAY DIFFRACTION' 
_pdbx_refine.free_R_error_no_cutoff                      ? 
# 
_struct_ncs_oper.id             1 
_struct_ncs_oper.code           given 
_struct_ncs_oper.details        ? 
_struct_ncs_oper.matrix[1][1]   -0.993225 
_struct_ncs_oper.matrix[1][2]   0.114072 
_struct_ncs_oper.matrix[1][3]   0.022194 
_struct_ncs_oper.matrix[2][1]   0.079982 
_struct_ncs_oper.matrix[2][2]   0.532445 
_struct_ncs_oper.matrix[2][3]   0.842677 
_struct_ncs_oper.matrix[3][1]   0.084309 
_struct_ncs_oper.matrix[3][2]   0.838743 
_struct_ncs_oper.matrix[3][3]   -0.537961 
_struct_ncs_oper.vector[1]      29.97141 
_struct_ncs_oper.vector[2]      -13.80924 
_struct_ncs_oper.vector[3]      20.89648 
# 
_struct.entry_id                  1B3A 
_struct.title                     
'TOTAL CHEMICAL SYNTHESIS AND HIGH-RESOLUTION CRYSTAL STRUCTURE OF THE POTENT ANTI-HIV PROTEIN AOP-RANTES' 
_struct.pdbx_descriptor           RANTES 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1B3A 
_struct_keywords.pdbx_keywords   'ANTI-HIV PROTEIN' 
_struct_keywords.text            'CHEMICAL PROTEIN SYNTHESIS, CHEMOKINE, HIV-1, RANTES, ANTI-HIV PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 2 ? 
F N N 3 ? 
G N N 2 ? 
H N N 3 ? 
I N N 4 ? 
J N N 4 ? 
# 
loop_
_struct_biol.id 
1 
2 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ARG A 20 ? HIS A 22 ? ARG A 21 HIS A 23 5 ? 3  
HELX_P HELX_P2 2 LYS A 55 ? GLU A 65 ? LYS A 56 GLU A 66 1 ? 11 
HELX_P HELX_P3 3 ARG B 20 ? HIS B 22 ? ARG B 21 HIS B 23 5 ? 3  
HELX_P HELX_P4 4 LYS B 55 ? GLU B 65 ? LYS B 56 GLU B 66 1 ? 11 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 9  SG ? ? ? 1_555 A CYS 33 SG ? ? A CYS 10 A CYS 34 1_555 ? ? ? ? ? ? ? 2.030 ? 
disulf2 disulf ? ? A CYS 10 SG ? ? ? 1_555 A CYS 49 SG ? ? A CYS 11 A CYS 50 1_555 ? ? ? ? ? ? ? 2.024 ? 
disulf3 disulf ? ? B CYS 9  SG ? ? ? 1_555 B CYS 33 SG ? ? B CYS 10 B CYS 34 1_555 ? ? ? ? ? ? ? 2.031 ? 
disulf4 disulf ? ? B CYS 10 SG ? ? ? 1_555 B CYS 49 SG ? ? B CYS 11 B CYS 50 1_555 ? ? ? ? ? ? ? 2.052 ? 
covale1 covale ? ? F AOP .  C1 ? ? ? 1_555 A PRO 1  N  ? ? A AOP 1  A PRO 2  1_555 ? ? ? ? ? ? ? 1.325 ? 
covale2 covale ? ? H AOP .  C1 ? ? ? 1_555 B PRO 1  N  ? ? B AOP 1  B PRO 2  1_555 ? ? ? ? ? ? ? 1.334 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLN A 47 ? ALA A 50 ? GLN A 48 ALA A 51 
A 2 VAL A 38 ? THR A 42 ? VAL A 39 THR A 43 
A 3 ILE A 23 ? TYR A 28 ? ILE A 24 TYR A 29 
B 1 GLN B 47 ? ALA B 50 ? GLN B 48 ALA B 51 
B 2 VAL B 38 ? THR B 42 ? VAL B 39 THR B 43 
B 3 ILE B 23 ? TYR B 28 ? ILE B 24 TYR B 29 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O VAL A 48 ? O VAL A 49 N PHE A 40 ? N PHE A 41 
A 2 3 O VAL A 39 ? O VAL A 40 N PHE A 27 ? N PHE A 28 
B 1 2 O VAL B 48 ? O VAL B 49 N PHE B 40 ? N PHE B 41 
B 2 3 O VAL B 39 ? O VAL B 40 N PHE B 27 ? N PHE B 28 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE SO4 A 197' 
AC2 Software ? ? ? ? 8 'BINDING SITE FOR RESIDUE SO4 A 196' 
AC3 Software ? ? ? ? 9 'BINDING SITE FOR RESIDUE SO4 A 198' 
AC4 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE SO4 B 199' 
AC5 Software ? ? ? ? 8 'BINDING SITE FOR RESIDUE AOP A 1'   
AC6 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE AOP B 1'   
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 7 PRO A 8  ? PRO A 9    . ? 1_555 ? 
2  AC1 7 PHE A 27 ? PHE A 28   . ? 1_555 ? 
3  AC1 7 GLN A 47 ? GLN A 48   . ? 1_555 ? 
4  AC1 7 HOH I .  ? HOH A 1085 . ? 1_555 ? 
5  AC1 7 HOH I .  ? HOH A 1091 . ? 1_555 ? 
6  AC1 7 ALA B 21 ? ALA B 22   . ? 4_566 ? 
7  AC1 7 ILE B 23 ? ILE B 24   . ? 4_566 ? 
8  AC2 8 HIS A 22 ? HIS A 23   . ? 1_555 ? 
9  AC2 8 THR A 42 ? THR A 43   . ? 1_555 ? 
10 AC2 8 ARG A 43 ? ARG A 44   . ? 1_555 ? 
11 AC2 8 LYS A 44 ? LYS A 45   . ? 1_555 ? 
12 AC2 8 ARG A 46 ? ARG A 47   . ? 1_555 ? 
13 AC2 8 SER A 67 ? SER A 68   . ? 1_455 ? 
14 AC2 8 HOH I .  ? HOH A 1122 . ? 1_555 ? 
15 AC2 8 HOH J .  ? HOH B 1130 . ? 3_655 ? 
16 AC3 9 SER A 30 ? SER A 31   . ? 1_555 ? 
17 AC3 9 GLY A 31 ? GLY A 32   . ? 1_555 ? 
18 AC3 9 HOH I .  ? HOH A 1100 . ? 1_555 ? 
19 AC3 9 HOH I .  ? HOH A 1129 . ? 1_555 ? 
20 AC3 9 HOH I .  ? HOH A 1160 . ? 1_555 ? 
21 AC3 9 HOH I .  ? HOH A 1161 . ? 1_555 ? 
22 AC3 9 HOH I .  ? HOH A 1169 . ? 1_555 ? 
23 AC3 9 SER B 30 ? SER B 31   . ? 1_655 ? 
24 AC3 9 GLY B 31 ? GLY B 32   . ? 1_655 ? 
25 AC4 7 HIS B 22 ? HIS B 23   . ? 1_555 ? 
26 AC4 7 THR B 42 ? THR B 43   . ? 1_555 ? 
27 AC4 7 ARG B 43 ? ARG B 44   . ? 1_555 ? 
28 AC4 7 LYS B 44 ? LYS B 45   . ? 1_555 ? 
29 AC4 7 ARG B 46 ? ARG B 47   . ? 1_555 ? 
30 AC4 7 SER B 67 ? SER B 68   . ? 1_655 ? 
31 AC4 7 HOH J .  ? HOH B 1066 . ? 1_555 ? 
32 AC5 8 PRO A 1  ? PRO A 2    . ? 1_555 ? 
33 AC5 8 TYR A 2  ? TYR A 3    . ? 1_555 ? 
34 AC5 8 HOH I .  ? HOH A 1034 . ? 1_555 ? 
35 AC5 8 CYS B 10 ? CYS B 11   . ? 1_555 ? 
36 AC5 8 PHE B 11 ? PHE B 12   . ? 1_555 ? 
37 AC5 8 ALA B 12 ? ALA B 13   . ? 1_555 ? 
38 AC5 8 TYR B 13 ? TYR B 14   . ? 1_555 ? 
39 AC5 8 ASN B 35 ? ASN B 36   . ? 1_555 ? 
40 AC6 7 PHE A 11 ? PHE A 12   . ? 1_555 ? 
41 AC6 7 TYR A 13 ? TYR A 14   . ? 1_555 ? 
42 AC6 7 HIS A 22 ? HIS A 23   . ? 3_645 ? 
43 AC6 7 HOH I .  ? HOH A 1124 . ? 3_645 ? 
44 AC6 7 HOH I .  ? HOH A 1206 . ? 1_555 ? 
45 AC6 7 PRO B 1  ? PRO B 2    . ? 1_555 ? 
46 AC6 7 HOH J .  ? HOH B 1130 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1B3A 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1B3A 
_atom_sites.fract_transf_matrix[1][1]   0.042310 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.017760 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.010635 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . PRO A 1 1  ? 25.721 23.611 41.028 1.00 27.33  ? 2    PRO A N   1 
ATOM   2    C CA  . PRO A 1 1  ? 26.831 23.701 41.962 1.00 37.03  ? 2    PRO A CA  1 
ATOM   3    C C   . PRO A 1 1  ? 27.312 25.105 42.304 1.00 35.50  ? 2    PRO A C   1 
ATOM   4    O O   . PRO A 1 1  ? 28.135 25.191 43.223 1.00 30.03  ? 2    PRO A O   1 
ATOM   5    C CB  . PRO A 1 1  ? 27.984 22.991 41.210 1.00 30.58  ? 2    PRO A CB  1 
ATOM   6    C CG  . PRO A 1 1  ? 27.370 22.419 39.983 1.00 38.52  ? 2    PRO A CG  1 
ATOM   7    C CD  . PRO A 1 1  ? 26.189 23.305 39.661 1.00 27.09  ? 2    PRO A CD  1 
ATOM   8    N N   . TYR A 1 2  ? 26.891 26.155 41.615 1.00 26.56  ? 3    TYR A N   1 
ATOM   9    C CA  . TYR A 1 2  ? 27.512 27.466 41.742 1.00 24.42  ? 3    TYR A CA  1 
ATOM   10   C C   . TYR A 1 2  ? 26.556 28.533 42.254 1.00 21.43  ? 3    TYR A C   1 
ATOM   11   O O   . TYR A 1 2  ? 25.857 28.211 43.217 1.00 21.85  ? 3    TYR A O   1 
ATOM   12   C CB  . TYR A 1 2  ? 28.142 27.865 40.395 1.00 22.85  ? 3    TYR A CB  1 
ATOM   13   C CG  . TYR A 1 2  ? 29.090 26.735 40.002 1.00 33.33  ? 3    TYR A CG  1 
ATOM   14   C CD1 . TYR A 1 2  ? 30.045 26.277 40.897 1.00 32.85  ? 3    TYR A CD1 1 
ATOM   15   C CD2 . TYR A 1 2  ? 29.007 26.132 38.751 1.00 32.67  ? 3    TYR A CD2 1 
ATOM   16   C CE1 . TYR A 1 2  ? 30.903 25.240 40.540 1.00 28.85  ? 3    TYR A CE1 1 
ATOM   17   C CE2 . TYR A 1 2  ? 29.861 25.107 38.397 1.00 37.67  ? 3    TYR A CE2 1 
ATOM   18   C CZ  . TYR A 1 2  ? 30.807 24.662 39.300 1.00 34.99  ? 3    TYR A CZ  1 
ATOM   19   O OH  . TYR A 1 2  ? 31.662 23.637 38.951 1.00 38.09  ? 3    TYR A OH  1 
ATOM   20   N N   . SER A 1 3  ? 26.580 29.730 41.676 1.00 17.21  ? 4    SER A N   1 
ATOM   21   C CA  . SER A 1 3  ? 25.916 30.838 42.354 1.00 20.52  ? 4    SER A CA  1 
ATOM   22   C C   . SER A 1 3  ? 24.395 30.653 42.488 1.00 17.21  ? 4    SER A C   1 
ATOM   23   O O   . SER A 1 3  ? 23.761 30.300 41.498 1.00 19.08  ? 4    SER A O   1 
ATOM   24   C CB  . SER A 1 3  ? 26.118 32.190 41.658 1.00 22.18  ? 4    SER A CB  1 
ATOM   25   O OG  . SER A 1 3  ? 25.346 33.164 42.340 1.00 20.17  ? 4    SER A OG  1 
ATOM   26   N N   . SER A 1 4  ? 23.910 30.946 43.700 1.00 16.42  ? 5    SER A N   1 
ATOM   27   C CA  . SER A 1 4  ? 22.460 30.806 43.914 1.00 15.36  ? 5    SER A CA  1 
ATOM   28   C C   . SER A 1 4  ? 21.765 32.155 43.843 1.00 10.30  ? 5    SER A C   1 
ATOM   29   O O   . SER A 1 4  ? 20.568 32.265 44.143 1.00 11.82  ? 5    SER A O   1 
ATOM   30   C CB  . SER A 1 4  ? 22.188 30.089 45.249 1.00 15.00  ? 5    SER A CB  1 
ATOM   31   O OG  . SER A 1 4  ? 22.767 30.840 46.313 1.00 22.11  ? 5    SER A OG  1 
ATOM   32   N N   . ASP A 1 5  ? 22.432 33.225 43.418 1.00 11.66  ? 6    ASP A N   1 
ATOM   33   C CA  . ASP A 1 5  ? 21.752 34.488 43.138 1.00 13.98  ? 6    ASP A CA  1 
ATOM   34   C C   . ASP A 1 5  ? 21.041 34.432 41.788 1.00 10.70  ? 6    ASP A C   1 
ATOM   35   O O   . ASP A 1 5  ? 21.459 33.678 40.902 1.00 14.21  ? 6    ASP A O   1 
ATOM   36   C CB  . ASP A 1 5  ? 22.742 35.656 43.122 1.00 17.60  ? 6    ASP A CB  1 
ATOM   37   C CG  . ASP A 1 5  ? 23.277 35.945 44.527 1.00 22.70  ? 6    ASP A CG  1 
ATOM   38   O OD1 . ASP A 1 5  ? 22.661 35.451 45.490 1.00 21.39  ? 6    ASP A OD1 1 
ATOM   39   O OD2 . ASP A 1 5  ? 24.287 36.668 44.635 1.00 45.18  ? 6    ASP A OD2 1 
ATOM   40   N N   . THR A 1 6  ? 19.982 35.214 41.614 1.00 10.16  ? 7    THR A N   1 
ATOM   41   C CA  . THR A 1 6  ? 19.400 35.257 40.269 1.00 9.06   ? 7    THR A CA  1 
ATOM   42   C C   . THR A 1 6  ? 20.387 35.938 39.331 1.00 9.50   ? 7    THR A C   1 
ATOM   43   O O   . THR A 1 6  ? 21.252 36.717 39.747 1.00 12.41  ? 7    THR A O   1 
ATOM   44   C CB  . THR A 1 6  ? 18.080 36.051 40.229 1.00 12.56  ? 7    THR A CB  1 
ATOM   45   O OG1 . THR A 1 6  ? 18.319 37.390 40.697 1.00 13.17  ? 7    THR A OG1 1 
ATOM   46   C CG2 . THR A 1 6  ? 17.024 35.423 41.144 1.00 10.78  ? 7    THR A CG2 1 
ATOM   47   N N   . THR A 1 7  ? 20.220 35.664 38.041 1.00 9.38   ? 8    THR A N   1 
ATOM   48   C CA  . THR A 1 7  ? 21.007 36.378 37.025 1.00 10.75  ? 8    THR A CA  1 
ATOM   49   C C   . THR A 1 7  ? 20.091 36.695 35.858 1.00 8.26   ? 8    THR A C   1 
ATOM   50   O O   . THR A 1 7  ? 19.153 35.949 35.564 1.00 11.43  ? 8    THR A O   1 
ATOM   51   C CB  . THR A 1 7  ? 22.205 35.513 36.645 1.00 14.24  ? 8    THR A CB  1 
ATOM   52   O OG1 . THR A 1 7  ? 23.138 36.260 35.836 1.00 14.92  ? 8    THR A OG1 1 
ATOM   53   C CG2 . THR A 1 7  ? 21.815 34.319 35.789 1.00 13.14  ? 8    THR A CG2 1 
ATOM   54   N N   . PRO A 1 8  ? 20.260 37.830 35.176 1.00 8.21   ? 9    PRO A N   1 
ATOM   55   C CA  . PRO A 1 8  ? 19.367 38.168 34.088 1.00 8.91   ? 9    PRO A CA  1 
ATOM   56   C C   . PRO A 1 8  ? 19.549 37.321 32.845 1.00 10.38  ? 9    PRO A C   1 
ATOM   57   O O   . PRO A 1 8  ? 20.658 37.074 32.378 1.00 12.04  ? 9    PRO A O   1 
ATOM   58   C CB  . PRO A 1 8  ? 19.726 39.631 33.781 1.00 12.60  ? 9    PRO A CB  1 
ATOM   59   C CG  . PRO A 1 8  ? 21.149 39.778 34.241 1.00 9.57   ? 9    PRO A CG  1 
ATOM   60   C CD  . PRO A 1 8  ? 21.257 38.890 35.464 1.00 9.64   ? 9    PRO A CD  1 
ATOM   61   N N   . CYS A 1 9  ? 18.404 36.858 32.324 1.00 9.05   ? 10   CYS A N   1 
ATOM   62   C CA  . CYS A 1 9  ? 18.360 36.235 31.013 1.00 8.63   ? 10   CYS A CA  1 
ATOM   63   C C   . CYS A 1 9  ? 17.403 36.962 30.068 1.00 8.24   ? 10   CYS A C   1 
ATOM   64   O O   . CYS A 1 9  ? 16.480 37.667 30.464 1.00 9.72   ? 10   CYS A O   1 
ATOM   65   C CB  . CYS A 1 9  ? 17.961 34.753 31.104 1.00 9.01   ? 10   CYS A CB  1 
ATOM   66   S SG  . CYS A 1 9  ? 19.127 33.769 32.102 1.00 10.20  ? 10   CYS A SG  1 
ATOM   67   N N   . CYS A 1 10 ? 17.678 36.736 28.781 1.00 10.23  ? 11   CYS A N   1 
ATOM   68   C CA  . CYS A 1 10 ? 16.870 37.297 27.726 1.00 10.51  ? 11   CYS A CA  1 
ATOM   69   C C   . CYS A 1 10 ? 16.018 36.265 26.999 1.00 9.84   ? 11   CYS A C   1 
ATOM   70   O O   . CYS A 1 10 ? 16.490 35.186 26.678 1.00 12.45  ? 11   CYS A O   1 
ATOM   71   C CB  . CYS A 1 10 ? 17.811 37.975 26.700 1.00 13.77  ? 11   CYS A CB  1 
ATOM   72   S SG  . CYS A 1 10 ? 18.557 39.517 27.310 1.00 11.49  ? 11   CYS A SG  1 
ATOM   73   N N   . PHE A 1 11 ? 14.755 36.624 26.720 1.00 11.41  ? 12   PHE A N   1 
ATOM   74   C CA  . PHE A 1 11 ? 13.848 35.705 26.008 1.00 13.53  ? 12   PHE A CA  1 
ATOM   75   C C   . PHE A 1 11 ? 13.314 36.280 24.711 1.00 20.72  ? 12   PHE A C   1 
ATOM   76   O O   . PHE A 1 11 ? 12.498 35.690 23.985 1.00 17.01  ? 12   PHE A O   1 
ATOM   77   C CB  . PHE A 1 11 ? 12.712 35.293 26.974 1.00 12.69  ? 12   PHE A CB  1 
ATOM   78   C CG  . PHE A 1 11 ? 13.368 34.425 28.057 1.00 11.37  ? 12   PHE A CG  1 
ATOM   79   C CD1 . PHE A 1 11 ? 13.727 33.119 27.808 1.00 14.81  ? 12   PHE A CD1 1 
ATOM   80   C CD2 . PHE A 1 11 ? 13.654 34.976 29.299 1.00 11.74  ? 12   PHE A CD2 1 
ATOM   81   C CE1 . PHE A 1 11 ? 14.346 32.373 28.797 1.00 13.38  ? 12   PHE A CE1 1 
ATOM   82   C CE2 . PHE A 1 11 ? 14.288 34.229 30.288 1.00 14.43  ? 12   PHE A CE2 1 
ATOM   83   C CZ  . PHE A 1 11 ? 14.656 32.917 30.027 1.00 13.15  ? 12   PHE A CZ  1 
ATOM   84   N N   . ALA A 1 12 ? 13.805 37.462 24.343 1.00 15.00  ? 13   ALA A N   1 
ATOM   85   C CA  . ALA A 1 12 ? 13.450 38.102 23.073 1.00 15.86  ? 13   ALA A CA  1 
ATOM   86   C C   . ALA A 1 12 ? 14.495 39.190 22.788 1.00 20.02  ? 13   ALA A C   1 
ATOM   87   O O   . ALA A 1 12 ? 15.148 39.649 23.731 1.00 16.29  ? 13   ALA A O   1 
ATOM   88   C CB  . ALA A 1 12 ? 12.066 38.705 23.087 1.00 23.66  ? 13   ALA A CB  1 
ATOM   89   N N   . TYR A 1 13 ? 14.621 39.553 21.529 1.00 15.25  ? 14   TYR A N   1 
ATOM   90   C CA  . TYR A 1 13 ? 15.618 40.523 21.070 1.00 10.54  ? 14   TYR A CA  1 
ATOM   91   C C   . TYR A 1 13 ? 14.881 41.726 20.477 1.00 15.64  ? 14   TYR A C   1 
ATOM   92   O O   . TYR A 1 13 ? 13.881 41.603 19.764 1.00 15.38  ? 14   TYR A O   1 
ATOM   93   C CB  . TYR A 1 13 ? 16.582 39.990 20.021 1.00 15.05  ? 14   TYR A CB  1 
ATOM   94   C CG  . TYR A 1 13 ? 17.353 38.743 20.415 1.00 16.41  ? 14   TYR A CG  1 
ATOM   95   C CD1 . TYR A 1 13 ? 18.049 38.675 21.620 1.00 13.01  ? 14   TYR A CD1 1 
ATOM   96   C CD2 . TYR A 1 13 ? 17.404 37.653 19.557 1.00 22.67  ? 14   TYR A CD2 1 
ATOM   97   C CE1 . TYR A 1 13 ? 18.745 37.517 21.931 1.00 13.19  ? 14   TYR A CE1 1 
ATOM   98   C CE2 . TYR A 1 13 ? 18.100 36.498 19.871 1.00 26.84  ? 14   TYR A CE2 1 
ATOM   99   C CZ  . TYR A 1 13 ? 18.773 36.452 21.080 1.00 18.43  ? 14   TYR A CZ  1 
ATOM   100  O OH  . TYR A 1 13 ? 19.468 35.297 21.377 1.00 19.07  ? 14   TYR A OH  1 
ATOM   101  N N   . ILE A 1 14 ? 15.352 42.925 20.793 1.00 17.09  ? 15   ILE A N   1 
ATOM   102  C CA  . ILE A 1 14 ? 14.655 44.092 20.239 1.00 13.68  ? 15   ILE A CA  1 
ATOM   103  C C   . ILE A 1 14 ? 14.807 44.014 18.731 1.00 15.57  ? 15   ILE A C   1 
ATOM   104  O O   . ILE A 1 14 ? 15.870 43.648 18.211 1.00 14.03  ? 15   ILE A O   1 
ATOM   105  C CB  . ILE A 1 14 ? 15.251 45.397 20.804 1.00 15.73  ? 15   ILE A CB  1 
ATOM   106  C CG1 . ILE A 1 14 ? 14.534 46.660 20.343 1.00 14.96  ? 15   ILE A CG1 1 
ATOM   107  C CG2 . ILE A 1 14 ? 16.741 45.479 20.494 1.00 12.06  ? 15   ILE A CG2 1 
ATOM   108  C CD1 . ILE A 1 14 ? 15.044 47.974 20.874 1.00 18.63  ? 15   ILE A CD1 1 
ATOM   109  N N   . ALA A 1 15 ? 13.733 44.327 18.033 1.00 12.39  ? 16   ALA A N   1 
ATOM   110  C CA  . ALA A 1 15 ? 13.682 44.058 16.605 1.00 15.88  ? 16   ALA A CA  1 
ATOM   111  C C   . ALA A 1 15 ? 14.488 45.048 15.789 1.00 22.25  ? 16   ALA A C   1 
ATOM   112  O O   . ALA A 1 15 ? 15.051 44.702 14.750 1.00 26.79  ? 16   ALA A O   1 
ATOM   113  C CB  . ALA A 1 15 ? 12.233 44.084 16.113 1.00 19.59  ? 16   ALA A CB  1 
ATOM   114  N N   . ARG A 1 16 ? 14.515 46.284 16.245 1.00 24.17  ? 17   ARG A N   1 
ATOM   115  C CA  . ARG A 1 16 ? 15.134 47.339 15.448 1.00 25.80  ? 17   ARG A CA  1 
ATOM   116  C C   . ARG A 1 16 ? 16.173 47.996 16.348 1.00 23.29  ? 17   ARG A C   1 
ATOM   117  O O   . ARG A 1 16 ? 16.045 47.972 17.565 1.00 24.58  ? 17   ARG A O   1 
ATOM   118  C CB  . ARG A 1 16 ? 14.124 48.331 14.902 1.00 26.26  ? 17   ARG A CB  1 
ATOM   119  C CG  . ARG A 1 16 ? 12.868 47.787 14.268 1.00 38.87  ? 17   ARG A CG  1 
ATOM   120  C CD  . ARG A 1 16 ? 13.080 46.655 13.279 1.00 60.68  ? 17   ARG A CD  1 
ATOM   121  N NE  . ARG A 1 16 ? 11.833 46.034 12.845 1.00 65.81  ? 17   ARG A NE  1 
ATOM   122  C CZ  . ARG A 1 16 ? 11.579 44.790 12.478 1.00 68.15  ? 17   ARG A CZ  1 
ATOM   123  N NH1 . ARG A 1 16 ? 12.500 43.836 12.448 1.00 57.63  ? 17   ARG A NH1 1 
ATOM   124  N NH2 . ARG A 1 16 ? 10.340 44.448 12.115 1.00 89.19  ? 17   ARG A NH2 1 
ATOM   125  N N   . PRO A 1 17 ? 17.197 48.513 15.702 1.00 18.54  ? 18   PRO A N   1 
ATOM   126  C CA  . PRO A 1 17 ? 18.331 49.096 16.406 1.00 16.38  ? 18   PRO A CA  1 
ATOM   127  C C   . PRO A 1 17 ? 17.881 50.271 17.282 1.00 22.93  ? 18   PRO A C   1 
ATOM   128  O O   . PRO A 1 17 ? 17.200 51.183 16.834 1.00 22.16  ? 18   PRO A O   1 
ATOM   129  C CB  . PRO A 1 17 ? 19.231 49.596 15.280 1.00 21.17  ? 18   PRO A CB  1 
ATOM   130  C CG  . PRO A 1 17 ? 18.788 48.863 14.061 1.00 17.85  ? 18   PRO A CG  1 
ATOM   131  C CD  . PRO A 1 17 ? 17.347 48.534 14.246 1.00 22.33  ? 18   PRO A CD  1 
ATOM   132  N N   . LEU A 1 18 ? 18.297 50.220 18.540 1.00 21.92  ? 19   LEU A N   1 
ATOM   133  C CA  . LEU A 1 18 ? 18.226 51.307 19.486 1.00 25.52  ? 19   LEU A CA  1 
ATOM   134  C C   . LEU A 1 18 ? 18.976 52.533 19.016 1.00 15.10  ? 19   LEU A C   1 
ATOM   135  O O   . LEU A 1 18 ? 19.990 52.394 18.335 1.00 17.88  ? 19   LEU A O   1 
ATOM   136  C CB  . LEU A 1 18 ? 18.921 50.872 20.796 1.00 21.82  ? 19   LEU A CB  1 
ATOM   137  C CG  . LEU A 1 18 ? 18.144 49.836 21.608 1.00 24.03  ? 19   LEU A CG  1 
ATOM   138  C CD1 . LEU A 1 18 ? 19.043 49.152 22.627 1.00 25.58  ? 19   LEU A CD1 1 
ATOM   139  C CD2 . LEU A 1 18 ? 16.961 50.531 22.258 1.00 28.09  ? 19   LEU A CD2 1 
ATOM   140  N N   . PRO A 1 19 ? 18.601 53.761 19.331 1.00 15.87  ? 20   PRO A N   1 
ATOM   141  C CA  . PRO A 1 19 ? 19.522 54.841 18.939 1.00 15.16  ? 20   PRO A CA  1 
ATOM   142  C C   . PRO A 1 19 ? 20.894 54.713 19.603 1.00 16.17  ? 20   PRO A C   1 
ATOM   143  O O   . PRO A 1 19 ? 20.981 54.603 20.818 1.00 14.30  ? 20   PRO A O   1 
ATOM   144  C CB  . PRO A 1 19 ? 18.812 56.103 19.457 1.00 15.54  ? 20   PRO A CB  1 
ATOM   145  C CG  . PRO A 1 19 ? 17.376 55.693 19.576 1.00 26.81  ? 20   PRO A CG  1 
ATOM   146  C CD  . PRO A 1 19 ? 17.389 54.243 19.993 1.00 22.48  ? 20   PRO A CD  1 
ATOM   147  N N   . ARG A 1 20 ? 21.950 54.733 18.802 1.00 10.75  ? 21   ARG A N   1 
ATOM   148  C CA  . ARG A 1 20 ? 23.280 54.512 19.370 1.00 11.14  ? 21   ARG A CA  1 
ATOM   149  C C   . ARG A 1 20 ? 23.614 55.483 20.496 1.00 14.72  ? 21   ARG A C   1 
ATOM   150  O O   . ARG A 1 20 ? 24.169 55.118 21.530 1.00 14.39  ? 21   ARG A O   1 
ATOM   151  C CB  . ARG A 1 20 ? 24.290 54.618 18.214 1.00 12.80  ? 21   ARG A CB  1 
ATOM   152  C CG  . ARG A 1 20 ? 25.729 54.650 18.679 1.00 12.79  ? 21   ARG A CG  1 
ATOM   153  C CD  . ARG A 1 20 ? 26.185 53.381 19.371 1.00 13.28  ? 21   ARG A CD  1 
ATOM   154  N NE  . ARG A 1 20 ? 27.573 53.498 19.826 1.00 10.20  ? 21   ARG A NE  1 
ATOM   155  C CZ  . ARG A 1 20 ? 27.852 53.871 21.077 1.00 12.31  ? 21   ARG A CZ  1 
ATOM   156  N NH1 . ARG A 1 20 ? 26.868 54.156 21.950 1.00 11.88  ? 21   ARG A NH1 1 
ATOM   157  N NH2 . ARG A 1 20 ? 29.098 53.986 21.484 1.00 12.91  ? 21   ARG A NH2 1 
ATOM   158  N N   . ALA A 1 21 ? 23.266 56.753 20.336 1.00 10.39  ? 22   ALA A N   1 
ATOM   159  C CA  . ALA A 1 21 ? 23.653 57.779 21.316 1.00 11.14  ? 22   ALA A CA  1 
ATOM   160  C C   . ALA A 1 21 ? 22.971 57.584 22.665 1.00 12.72  ? 22   ALA A C   1 
ATOM   161  O O   . ALA A 1 21 ? 23.406 58.174 23.661 1.00 17.58  ? 22   ALA A O   1 
ATOM   162  C CB  . ALA A 1 21 ? 23.307 59.170 20.764 1.00 10.80  ? 22   ALA A CB  1 
ATOM   163  N N   . HIS A 1 22 ? 21.908 56.789 22.716 1.00 13.99  ? 23   HIS A N   1 
ATOM   164  C CA  . HIS A 1 22 ? 21.221 56.506 23.974 1.00 10.62  ? 23   HIS A CA  1 
ATOM   165  C C   . HIS A 1 22 ? 21.838 55.321 24.710 1.00 12.25  ? 23   HIS A C   1 
ATOM   166  O O   . HIS A 1 22 ? 21.391 54.979 25.815 1.00 15.38  ? 23   HIS A O   1 
ATOM   167  C CB  . HIS A 1 22 ? 19.759 56.170 23.692 1.00 16.45  ? 23   HIS A CB  1 
ATOM   168  C CG  . HIS A 1 22 ? 18.940 57.357 23.280 1.00 17.23  ? 23   HIS A CG  1 
ATOM   169  N ND1 . HIS A 1 22 ? 17.587 57.287 23.070 1.00 25.75  ? 23   HIS A ND1 1 
ATOM   170  C CD2 . HIS A 1 22 ? 19.305 58.633 23.057 1.00 26.50  ? 23   HIS A CD2 1 
ATOM   171  C CE1 . HIS A 1 22 ? 17.145 58.481 22.721 1.00 31.08  ? 23   HIS A CE1 1 
ATOM   172  N NE2 . HIS A 1 22 ? 18.166 59.315 22.705 1.00 29.06  ? 23   HIS A NE2 1 
ATOM   173  N N   . ILE A 1 23 ? 22.818 54.659 24.105 1.00 10.57  ? 24   ILE A N   1 
ATOM   174  C CA  . ILE A 1 23 ? 23.410 53.509 24.815 1.00 10.21  ? 24   ILE A CA  1 
ATOM   175  C C   . ILE A 1 23 ? 24.717 53.849 25.452 1.00 11.22  ? 24   ILE A C   1 
ATOM   176  O O   . ILE A 1 23 ? 25.595 54.417 24.787 1.00 12.42  ? 24   ILE A O   1 
ATOM   177  C CB  . ILE A 1 23 ? 23.586 52.379 23.777 1.00 9.29   ? 24   ILE A CB  1 
ATOM   178  C CG1 . ILE A 1 23 ? 22.246 52.026 23.118 1.00 13.90  ? 24   ILE A CG1 1 
ATOM   179  C CG2 . ILE A 1 23 ? 24.284 51.165 24.381 1.00 12.60  ? 24   ILE A CG2 1 
ATOM   180  C CD1 . ILE A 1 23 ? 22.403 51.100 21.922 1.00 18.11  ? 24   ILE A CD1 1 
ATOM   181  N N   . LYS A 1 24 ? 24.918 53.541 26.744 1.00 11.97  ? 25   LYS A N   1 
ATOM   182  C CA  . LYS A 1 24 ? 26.196 53.862 27.365 1.00 15.44  ? 25   LYS A CA  1 
ATOM   183  C C   . LYS A 1 24 ? 27.025 52.641 27.775 1.00 10.34  ? 25   LYS A C   1 
ATOM   184  O O   . LYS A 1 24 ? 28.229 52.778 28.026 1.00 10.87  ? 25   LYS A O   1 
ATOM   185  C CB  . LYS A 1 24 ? 25.980 54.756 28.599 1.00 11.30  ? 25   LYS A CB  1 
ATOM   186  C CG  . LYS A 1 24 ? 25.065 54.118 29.654 1.00 10.67  ? 25   LYS A CG  1 
ATOM   187  C CD  . LYS A 1 24 ? 24.990 55.048 30.880 1.00 12.20  ? 25   LYS A CD  1 
ATOM   188  C CE  . LYS A 1 24 ? 24.061 54.419 31.917 1.00 13.39  ? 25   LYS A CE  1 
ATOM   189  N NZ  . LYS A 1 24 ? 24.017 55.270 33.165 1.00 13.68  ? 25   LYS A NZ  1 
ATOM   190  N N   . GLU A 1 25 ? 26.374 51.491 27.900 1.00 9.44   ? 26   GLU A N   1 
ATOM   191  C CA  . GLU A 1 25 ? 27.070 50.290 28.379 1.00 12.60  ? 26   GLU A CA  1 
ATOM   192  C C   . GLU A 1 25 ? 26.442 49.055 27.718 1.00 8.32   ? 26   GLU A C   1 
ATOM   193  O O   . GLU A 1 25 ? 25.345 49.124 27.186 1.00 9.71   ? 26   GLU A O   1 
ATOM   194  C CB  . GLU A 1 25 ? 26.954 50.123 29.889 1.00 10.78  ? 26   GLU A CB  1 
ATOM   195  C CG  . GLU A 1 25 ? 27.540 51.246 30.714 1.00 15.66  ? 26   GLU A CG  1 
ATOM   196  C CD  . GLU A 1 25 ? 27.347 51.059 32.197 1.00 17.01  ? 26   GLU A CD  1 
ATOM   197  O OE1 . GLU A 1 25 ? 27.464 49.902 32.654 1.00 22.22  ? 26   GLU A OE1 1 
ATOM   198  O OE2 . GLU A 1 25 ? 27.093 52.079 32.876 1.00 17.28  ? 26   GLU A OE2 1 
ATOM   199  N N   . TYR A 1 26 ? 27.189 47.950 27.769 1.00 10.03  ? 27   TYR A N   1 
ATOM   200  C CA  . TYR A 1 26 ? 26.626 46.675 27.333 1.00 12.24  ? 27   TYR A CA  1 
ATOM   201  C C   . TYR A 1 26 ? 27.200 45.545 28.198 1.00 11.85  ? 27   TYR A C   1 
ATOM   202  O O   . TYR A 1 26 ? 28.249 45.705 28.800 1.00 13.37  ? 27   TYR A O   1 
ATOM   203  C CB  . TYR A 1 26 ? 26.877 46.413 25.852 1.00 13.25  ? 27   TYR A CB  1 
ATOM   204  C CG  . TYR A 1 26 ? 28.230 45.804 25.565 1.00 18.95  ? 27   TYR A CG  1 
ATOM   205  C CD1 . TYR A 1 26 ? 29.379 46.571 25.557 1.00 17.50  ? 27   TYR A CD1 1 
ATOM   206  C CD2 . TYR A 1 26 ? 28.306 44.431 25.312 1.00 33.20  ? 27   TYR A CD2 1 
ATOM   207  C CE1 . TYR A 1 26 ? 30.615 45.972 25.296 1.00 24.85  ? 27   TYR A CE1 1 
ATOM   208  C CE2 . TYR A 1 26 ? 29.518 43.840 25.047 1.00 23.37  ? 27   TYR A CE2 1 
ATOM   209  C CZ  . TYR A 1 26 ? 30.652 44.616 25.051 1.00 27.68  ? 27   TYR A CZ  1 
ATOM   210  O OH  . TYR A 1 26 ? 31.836 43.960 24.779 1.00 47.01  ? 27   TYR A OH  1 
ATOM   211  N N   . PHE A 1 27 ? 26.475 44.425 28.204 1.00 10.34  ? 28   PHE A N   1 
ATOM   212  C CA  . PHE A 1 27 ? 27.049 43.213 28.811 1.00 9.77   ? 28   PHE A CA  1 
ATOM   213  C C   . PHE A 1 27 ? 26.437 42.003 28.121 1.00 12.82  ? 28   PHE A C   1 
ATOM   214  O O   . PHE A 1 27 ? 25.375 42.103 27.501 1.00 13.06  ? 28   PHE A O   1 
ATOM   215  C CB  . PHE A 1 27 ? 26.836 43.151 30.309 1.00 12.79  ? 28   PHE A CB  1 
ATOM   216  C CG  . PHE A 1 27 ? 25.427 43.137 30.853 1.00 13.42  ? 28   PHE A CG  1 
ATOM   217  C CD1 . PHE A 1 27 ? 24.685 44.288 31.064 1.00 14.38  ? 28   PHE A CD1 1 
ATOM   218  C CD2 . PHE A 1 27 ? 24.836 41.922 31.178 1.00 14.98  ? 28   PHE A CD2 1 
ATOM   219  C CE1 . PHE A 1 27 ? 23.403 44.279 31.592 1.00 11.40  ? 28   PHE A CE1 1 
ATOM   220  C CE2 . PHE A 1 27 ? 23.567 41.890 31.706 1.00 12.93  ? 28   PHE A CE2 1 
ATOM   221  C CZ  . PHE A 1 27 ? 22.836 43.048 31.907 1.00 14.12  ? 28   PHE A CZ  1 
ATOM   222  N N   . TYR A 1 28 ? 27.115 40.878 28.268 1.00 15.50  ? 29   TYR A N   1 
ATOM   223  C CA  . TYR A 1 28 ? 26.469 39.649 27.794 1.00 13.05  ? 29   TYR A CA  1 
ATOM   224  C C   . TYR A 1 28 ? 25.801 38.951 28.960 1.00 12.72  ? 29   TYR A C   1 
ATOM   225  O O   . TYR A 1 28 ? 26.279 38.923 30.080 1.00 13.31  ? 29   TYR A O   1 
ATOM   226  C CB  . TYR A 1 28 ? 27.474 38.707 27.122 1.00 13.66  ? 29   TYR A CB  1 
ATOM   227  C CG  . TYR A 1 28 ? 27.900 39.047 25.714 1.00 14.79  ? 29   TYR A CG  1 
ATOM   228  C CD1 . TYR A 1 28 ? 28.986 39.880 25.467 1.00 24.57  ? 29   TYR A CD1 1 
ATOM   229  C CD2 . TYR A 1 28 ? 27.207 38.543 24.625 1.00 19.66  ? 29   TYR A CD2 1 
ATOM   230  C CE1 . TYR A 1 28 ? 29.371 40.203 24.166 1.00 15.12  ? 29   TYR A CE1 1 
ATOM   231  C CE2 . TYR A 1 28 ? 27.586 38.847 23.333 1.00 21.88  ? 29   TYR A CE2 1 
ATOM   232  C CZ  . TYR A 1 28 ? 28.669 39.671 23.122 1.00 21.15  ? 29   TYR A CZ  1 
ATOM   233  O OH  . TYR A 1 28 ? 29.002 39.932 21.808 1.00 27.79  ? 29   TYR A OH  1 
ATOM   234  N N   . THR A 1 29 ? 24.617 38.354 28.687 1.00 10.10  ? 30   THR A N   1 
ATOM   235  C CA  . THR A 1 29 ? 24.003 37.555 29.750 1.00 10.52  ? 30   THR A CA  1 
ATOM   236  C C   . THR A 1 29 ? 24.831 36.291 29.980 1.00 8.65   ? 30   THR A C   1 
ATOM   237  O O   . THR A 1 29 ? 25.616 35.849 29.136 1.00 10.65  ? 30   THR A O   1 
ATOM   238  C CB  . THR A 1 29 ? 22.555 37.180 29.403 1.00 11.87  ? 30   THR A CB  1 
ATOM   239  O OG1 . THR A 1 29 ? 22.453 36.713 28.042 1.00 10.36  ? 30   THR A OG1 1 
ATOM   240  C CG2 . THR A 1 29 ? 21.672 38.408 29.536 1.00 10.51  ? 30   THR A CG2 1 
ATOM   241  N N   . SER A 1 30 ? 24.621 35.713 31.139 1.00 8.10   ? 31   SER A N   1 
ATOM   242  C CA  . SER A 1 30 ? 25.289 34.481 31.544 1.00 9.90   ? 31   SER A CA  1 
ATOM   243  C C   . SER A 1 30 ? 25.191 33.373 30.530 1.00 9.73   ? 31   SER A C   1 
ATOM   244  O O   . SER A 1 30 ? 24.128 33.207 29.941 1.00 10.61  ? 31   SER A O   1 
ATOM   245  C CB  . SER A 1 30 ? 24.684 33.993 32.869 1.00 9.08   ? 31   SER A CB  1 
ATOM   246  O OG  . SER A 1 30 ? 25.249 32.730 33.187 1.00 10.53  ? 31   SER A OG  1 
ATOM   247  N N   . GLY A 1 31 ? 26.251 32.590 30.386 1.00 8.85   ? 32   GLY A N   1 
ATOM   248  C CA  . GLY A 1 31 ? 26.240 31.433 29.499 1.00 10.44  ? 32   GLY A CA  1 
ATOM   249  C C   . GLY A 1 31 ? 25.271 30.373 29.999 1.00 8.97   ? 32   GLY A C   1 
ATOM   250  O O   . GLY A 1 31 ? 24.979 29.422 29.258 1.00 10.80  ? 32   GLY A O   1 
ATOM   251  N N   . LYS A 1 32 ? 24.754 30.506 31.211 1.00 11.08  ? 33   LYS A N   1 
ATOM   252  C CA  . LYS A 1 32 ? 23.791 29.541 31.735 1.00 10.07  ? 33   LYS A CA  1 
ATOM   253  C C   . LYS A 1 32 ? 22.401 29.775 31.159 1.00 11.30  ? 33   LYS A C   1 
ATOM   254  O O   . LYS A 1 32 ? 21.600 28.821 31.203 1.00 9.81   ? 33   LYS A O   1 
ATOM   255  C CB  . LYS A 1 32 ? 23.741 29.654 33.280 1.00 10.28  ? 33   LYS A CB  1 
ATOM   256  C CG  . LYS A 1 32 ? 25.137 29.347 33.852 1.00 13.84  ? 33   LYS A CG  1 
ATOM   257  C CD  . LYS A 1 32 ? 25.082 29.432 35.371 1.00 18.48  ? 33   LYS A CD  1 
ATOM   258  C CE  . LYS A 1 32 ? 25.004 30.858 35.875 1.00 25.32  ? 33   LYS A CE  1 
ATOM   259  N NZ  . LYS A 1 32 ? 25.572 30.924 37.263 1.00 31.90  ? 33   LYS A NZ  1 
ATOM   260  N N   . CYS A 1 33 ? 22.161 30.994 30.671 1.00 9.76   ? 34   CYS A N   1 
ATOM   261  C CA  . CYS A 1 33 ? 20.835 31.266 30.119 1.00 9.75   ? 34   CYS A CA  1 
ATOM   262  C C   . CYS A 1 33 ? 20.599 30.449 28.869 1.00 9.23   ? 34   CYS A C   1 
ATOM   263  O O   . CYS A 1 33 ? 21.541 30.049 28.164 1.00 10.51  ? 34   CYS A O   1 
ATOM   264  C CB  . CYS A 1 33 ? 20.733 32.754 29.729 1.00 10.26  ? 34   CYS A CB  1 
ATOM   265  S SG  . CYS A 1 33 ? 20.903 33.893 31.127 1.00 10.66  ? 34   CYS A SG  1 
ATOM   266  N N   . SER A 1 34 ? 19.308 30.195 28.566 1.00 8.96   ? 35   SER A N   1 
ATOM   267  C CA  . SER A 1 34 ? 19.030 29.365 27.404 1.00 9.49   ? 35   SER A CA  1 
ATOM   268  C C   . SER A 1 34 ? 19.425 30.039 26.108 1.00 15.57  ? 35   SER A C   1 
ATOM   269  O O   . SER A 1 34 ? 19.758 29.360 25.132 1.00 12.96  ? 35   SER A O   1 
ATOM   270  C CB  . SER A 1 34 ? 17.533 28.998 27.341 1.00 12.59  ? 35   SER A CB  1 
ATOM   271  O OG  . SER A 1 34 ? 16.750 30.182 27.258 1.00 21.04  ? 35   SER A OG  1 
ATOM   272  N N   . ASN A 1 35 ? 19.356 31.389 26.096 1.00 12.07  ? 36   ASN A N   1 
ATOM   273  C CA  . ASN A 1 35 ? 19.671 32.096 24.861 1.00 10.73  ? 36   ASN A CA  1 
ATOM   274  C C   . ASN A 1 35 ? 20.907 32.967 25.067 1.00 12.59  ? 36   ASN A C   1 
ATOM   275  O O   . ASN A 1 35 ? 21.051 33.483 26.173 1.00 13.13  ? 36   ASN A O   1 
ATOM   276  C CB  . ASN A 1 35 ? 18.555 33.041 24.406 1.00 13.82  ? 36   ASN A CB  1 
ATOM   277  C CG  . ASN A 1 35 ? 17.229 32.348 24.172 1.00 21.92  ? 36   ASN A CG  1 
ATOM   278  O OD1 . ASN A 1 35 ? 17.165 31.377 23.427 1.00 19.60  ? 36   ASN A OD1 1 
ATOM   279  N ND2 . ASN A 1 35 ? 16.164 32.832 24.790 1.00 17.33  ? 36   ASN A ND2 1 
ATOM   280  N N   . PRO A 1 36 ? 21.710 33.157 24.037 1.00 10.36  ? 37   PRO A N   1 
ATOM   281  C CA  . PRO A 1 36 ? 22.816 34.111 24.135 1.00 11.38  ? 37   PRO A CA  1 
ATOM   282  C C   . PRO A 1 36 ? 22.208 35.511 23.968 1.00 8.83   ? 37   PRO A C   1 
ATOM   283  O O   . PRO A 1 36 ? 21.211 35.664 23.302 1.00 11.82  ? 37   PRO A O   1 
ATOM   284  C CB  . PRO A 1 36 ? 23.685 33.707 22.957 1.00 16.36  ? 37   PRO A CB  1 
ATOM   285  C CG  . PRO A 1 36 ? 22.743 33.163 21.953 1.00 13.21  ? 37   PRO A CG  1 
ATOM   286  C CD  . PRO A 1 36 ? 21.611 32.523 22.713 1.00 12.96  ? 37   PRO A CD  1 
ATOM   287  N N   . ALA A 1 37 ? 22.810 36.510 24.611 1.00 11.82  ? 38   ALA A N   1 
ATOM   288  C CA  . ALA A 1 37 ? 22.236 37.853 24.430 1.00 10.44  ? 38   ALA A CA  1 
ATOM   289  C C   . ALA A 1 37 ? 23.249 38.918 24.819 1.00 12.74  ? 38   ALA A C   1 
ATOM   290  O O   . ALA A 1 37 ? 24.086 38.762 25.696 1.00 10.14  ? 38   ALA A O   1 
ATOM   291  C CB  . ALA A 1 37 ? 20.973 38.024 25.259 1.00 9.06   ? 38   ALA A CB  1 
ATOM   292  N N   . VAL A 1 38 ? 23.113 40.040 24.115 1.00 13.38  ? 39   VAL A N   1 
ATOM   293  C CA  . VAL A 1 38 ? 23.676 41.303 24.538 1.00 13.13  ? 39   VAL A CA  1 
ATOM   294  C C   . VAL A 1 38 ? 22.592 42.087 25.262 1.00 15.11  ? 39   VAL A C   1 
ATOM   295  O O   . VAL A 1 38 ? 21.454 42.166 24.792 1.00 13.54  ? 39   VAL A O   1 
ATOM   296  C CB  . VAL A 1 38 ? 24.154 42.097 23.315 1.00 12.58  ? 39   VAL A CB  1 
ATOM   297  C CG1 . VAL A 1 38 ? 24.546 43.503 23.756 1.00 15.91  ? 39   VAL A CG1 1 
ATOM   298  C CG2 . VAL A 1 38 ? 25.308 41.362 22.644 1.00 14.94  ? 39   VAL A CG2 1 
ATOM   299  N N   . VAL A 1 39 ? 22.934 42.680 26.398 1.00 12.39  ? 40   VAL A N   1 
ATOM   300  C CA  . VAL A 1 39 ? 22.031 43.641 27.002 1.00 9.99   ? 40   VAL A CA  1 
ATOM   301  C C   . VAL A 1 39 ? 22.646 45.020 26.846 1.00 9.76   ? 40   VAL A C   1 
ATOM   302  O O   . VAL A 1 39 ? 23.753 45.220 27.303 1.00 12.13  ? 40   VAL A O   1 
ATOM   303  C CB  . VAL A 1 39 ? 21.763 43.323 28.472 1.00 12.10  ? 40   VAL A CB  1 
ATOM   304  C CG1 . VAL A 1 39 ? 20.875 44.366 29.114 1.00 9.92   ? 40   VAL A CG1 1 
ATOM   305  C CG2 . VAL A 1 39 ? 21.167 41.911 28.532 1.00 10.01  ? 40   VAL A CG2 1 
ATOM   306  N N   . PHE A 1 40 ? 21.888 45.937 26.235 1.00 9.85   ? 41   PHE A N   1 
ATOM   307  C CA  . PHE A 1 40 ? 22.409 47.295 26.182 1.00 9.30   ? 41   PHE A CA  1 
ATOM   308  C C   . PHE A 1 40 ? 21.822 48.090 27.345 1.00 12.23  ? 41   PHE A C   1 
ATOM   309  O O   . PHE A 1 40 ? 20.626 47.968 27.613 1.00 11.55  ? 41   PHE A O   1 
ATOM   310  C CB  . PHE A 1 40 ? 22.004 47.957 24.867 1.00 12.28  ? 41   PHE A CB  1 
ATOM   311  C CG  . PHE A 1 40 ? 22.774 47.432 23.664 1.00 11.53  ? 41   PHE A CG  1 
ATOM   312  C CD1 . PHE A 1 40 ? 24.151 47.584 23.649 1.00 13.12  ? 41   PHE A CD1 1 
ATOM   313  C CD2 . PHE A 1 40 ? 22.121 46.800 22.616 1.00 14.00  ? 41   PHE A CD2 1 
ATOM   314  C CE1 . PHE A 1 40 ? 24.899 47.136 22.564 1.00 10.50  ? 41   PHE A CE1 1 
ATOM   315  C CE2 . PHE A 1 40 ? 22.877 46.327 21.543 1.00 13.27  ? 41   PHE A CE2 1 
ATOM   316  C CZ  . PHE A 1 40 ? 24.248 46.502 21.527 1.00 11.65  ? 41   PHE A CZ  1 
ATOM   317  N N   . VAL A 1 41 ? 22.657 48.917 27.976 1.00 9.13   ? 42   VAL A N   1 
ATOM   318  C CA  . VAL A 1 41 ? 22.181 49.807 29.037 1.00 9.75   ? 42   VAL A CA  1 
ATOM   319  C C   . VAL A 1 41 ? 22.052 51.222 28.494 1.00 9.46   ? 42   VAL A C   1 
ATOM   320  O O   . VAL A 1 41 ? 23.013 51.744 27.931 1.00 11.37  ? 42   VAL A O   1 
ATOM   321  C CB  . VAL A 1 41 ? 23.129 49.782 30.242 1.00 11.14  ? 42   VAL A CB  1 
ATOM   322  C CG1 . VAL A 1 41 ? 22.559 50.596 31.384 1.00 6.21   ? 42   VAL A CG1 1 
ATOM   323  C CG2 . VAL A 1 41 ? 23.363 48.318 30.646 1.00 14.17  ? 42   VAL A CG2 1 
ATOM   324  N N   . THR A 1 42 ? 20.861 51.799 28.627 1.00 12.59  ? 43   THR A N   1 
ATOM   325  C CA  . THR A 1 42 ? 20.602 53.099 28.017 1.00 10.21  ? 43   THR A CA  1 
ATOM   326  C C   . THR A 1 42 ? 20.943 54.206 29.005 1.00 16.12  ? 43   THR A C   1 
ATOM   327  O O   . THR A 1 42 ? 21.220 53.946 30.170 1.00 13.55  ? 43   THR A O   1 
ATOM   328  C CB  . THR A 1 42 ? 19.141 53.252 27.562 1.00 10.31  ? 43   THR A CB  1 
ATOM   329  O OG1 . THR A 1 42 ? 18.277 53.371 28.718 1.00 11.91  ? 43   THR A OG1 1 
ATOM   330  C CG2 . THR A 1 42 ? 18.671 52.034 26.782 1.00 10.35  ? 43   THR A CG2 1 
ATOM   331  N N   . ARG A 1 43 ? 20.953 55.463 28.533 1.00 13.63  ? 44   ARG A N   1 
ATOM   332  C CA  . ARG A 1 43 ? 21.351 56.540 29.457 1.00 13.59  ? 44   ARG A CA  1 
ATOM   333  C C   . ARG A 1 43 ? 20.243 56.818 30.465 1.00 20.00  ? 44   ARG A C   1 
ATOM   334  O O   . ARG A 1 43 ? 20.461 57.523 31.449 1.00 20.99  ? 44   ARG A O   1 
ATOM   335  C CB  . ARG A 1 43 ? 21.752 57.741 28.595 1.00 13.27  ? 44   ARG A CB  1 
ATOM   336  C CG  . ARG A 1 43 ? 23.050 57.348 27.866 1.00 18.02  ? 44   ARG A CG  1 
ATOM   337  C CD  . ARG A 1 43 ? 23.650 58.523 27.110 1.00 17.65  ? 44   ARG A CD  1 
ATOM   338  N NE  . ARG A 1 43 ? 24.888 58.138 26.421 1.00 17.46  ? 44   ARG A NE  1 
ATOM   339  C CZ  . ARG A 1 43 ? 26.050 58.154 27.080 1.00 16.77  ? 44   ARG A CZ  1 
ATOM   340  N NH1 . ARG A 1 43 ? 26.088 58.509 28.361 1.00 24.58  ? 44   ARG A NH1 1 
ATOM   341  N NH2 . ARG A 1 43 ? 27.167 57.809 26.459 1.00 20.24  ? 44   ARG A NH2 1 
ATOM   342  N N   . LYS A 1 44 ? 19.070 56.247 30.254 1.00 16.30  ? 45   LYS A N   1 
ATOM   343  C CA  . LYS A 1 44 ? 18.004 56.268 31.255 1.00 12.79  ? 45   LYS A CA  1 
ATOM   344  C C   . LYS A 1 44 ? 18.057 54.976 32.063 1.00 18.66  ? 45   LYS A C   1 
ATOM   345  O O   . LYS A 1 44 ? 17.124 54.648 32.800 1.00 17.32  ? 45   LYS A O   1 
ATOM   346  C CB  . LYS A 1 44 ? 16.625 56.479 30.637 1.00 19.05  ? 45   LYS A CB  1 
ATOM   347  C CG  . LYS A 1 44 ? 16.438 57.895 30.089 1.00 22.95  ? 45   LYS A CG  1 
ATOM   348  C CD  . LYS A 1 44 ? 15.152 58.008 29.294 1.00 35.06  ? 45   LYS A CD  1 
ATOM   349  C CE  . LYS A 1 44 ? 15.063 59.354 28.590 1.00 48.29  ? 45   LYS A CE  1 
ATOM   350  N NZ  . LYS A 1 44 ? 15.841 60.403 29.317 1.00 68.21  ? 45   LYS A NZ  1 
ATOM   351  N N   . ASN A 1 45 ? 19.193 54.281 31.929 1.00 11.18  ? 46   ASN A N   1 
ATOM   352  C CA  . ASN A 1 45 ? 19.470 53.074 32.699 1.00 10.95  ? 46   ASN A CA  1 
ATOM   353  C C   . ASN A 1 45 ? 18.480 51.946 32.472 1.00 15.42  ? 46   ASN A C   1 
ATOM   354  O O   . ASN A 1 45 ? 18.360 51.053 33.331 1.00 15.97  ? 46   ASN A O   1 
ATOM   355  C CB  . ASN A 1 45 ? 19.545 53.414 34.193 1.00 16.21  ? 46   ASN A CB  1 
ATOM   356  C CG  . ASN A 1 45 ? 20.736 54.310 34.475 1.00 14.74  ? 46   ASN A CG  1 
ATOM   357  O OD1 . ASN A 1 45 ? 21.893 53.966 34.200 1.00 11.56  ? 46   ASN A OD1 1 
ATOM   358  N ND2 . ASN A 1 45 ? 20.457 55.476 35.058 1.00 14.54  ? 46   ASN A ND2 1 
ATOM   359  N N   . ARG A 1 46 ? 17.803 51.936 31.322 1.00 12.57  ? 47   ARG A N   1 
ATOM   360  C CA  . ARG A 1 46 ? 17.025 50.797 30.885 1.00 14.97  ? 47   ARG A CA  1 
ATOM   361  C C   . ARG A 1 46 ? 17.950 49.685 30.378 1.00 14.06  ? 47   ARG A C   1 
ATOM   362  O O   . ARG A 1 46 ? 19.079 49.961 29.972 1.00 14.63  ? 47   ARG A O   1 
ATOM   363  C CB  . ARG A 1 46 ? 16.047 51.177 29.781 1.00 15.47  ? 47   ARG A CB  1 
ATOM   364  C CG  . ARG A 1 46 ? 15.111 52.325 30.084 1.00 32.88  ? 47   ARG A CG  1 
ATOM   365  C CD  . ARG A 1 46 ? 14.073 52.529 28.988 1.00 32.57  ? 47   ARG A CD  1 
ATOM   366  N NE  . ARG A 1 46 ? 13.765 51.327 28.237 1.00 37.00  ? 47   ARG A NE  1 
ATOM   367  C CZ  . ARG A 1 46 ? 13.997 51.060 26.966 1.00 26.41  ? 47   ARG A CZ  1 
ATOM   368  N NH1 . ARG A 1 46 ? 14.592 51.917 26.148 1.00 40.37  ? 47   ARG A NH1 1 
ATOM   369  N NH2 . ARG A 1 46 ? 13.630 49.884 26.466 1.00 51.97  ? 47   ARG A NH2 1 
ATOM   370  N N   . GLN A 1 47 ? 17.457 48.443 30.429 1.00 11.04  ? 48   GLN A N   1 
ATOM   371  C CA  . GLN A 1 47 ? 18.249 47.316 29.942 1.00 11.38  ? 48   GLN A CA  1 
ATOM   372  C C   . GLN A 1 47 ? 17.500 46.612 28.819 1.00 9.78   ? 48   GLN A C   1 
ATOM   373  O O   . GLN A 1 47 ? 16.372 46.195 29.039 1.00 13.38  ? 48   GLN A O   1 
ATOM   374  C CB  . GLN A 1 47 ? 18.597 46.368 31.094 1.00 18.00  ? 48   GLN A CB  1 
ATOM   375  C CG  . GLN A 1 47 ? 19.572 47.114 32.043 1.00 20.19  ? 48   GLN A CG  1 
ATOM   376  C CD  . GLN A 1 47 ? 19.837 46.219 33.229 1.00 19.69  ? 48   GLN A CD  1 
ATOM   377  O OE1 . GLN A 1 47 ? 20.511 45.203 33.118 1.00 21.89  ? 48   GLN A OE1 1 
ATOM   378  N NE2 . GLN A 1 47 ? 19.250 46.576 34.375 1.00 23.65  ? 48   GLN A NE2 1 
ATOM   379  N N   . VAL A 1 48 ? 18.111 46.571 27.645 1.00 10.43  ? 49   VAL A N   1 
ATOM   380  C CA  . VAL A 1 48 ? 17.445 46.044 26.467 1.00 9.50   ? 49   VAL A CA  1 
ATOM   381  C C   . VAL A 1 48 ? 18.186 44.861 25.878 1.00 10.38  ? 49   VAL A C   1 
ATOM   382  O O   . VAL A 1 48 ? 19.380 44.948 25.543 1.00 12.54  ? 49   VAL A O   1 
ATOM   383  C CB  . VAL A 1 48 ? 17.302 47.167 25.419 1.00 10.60  ? 49   VAL A CB  1 
ATOM   384  C CG1 . VAL A 1 48 ? 16.582 46.636 24.198 1.00 13.57  ? 49   VAL A CG1 1 
ATOM   385  C CG2 . VAL A 1 48 ? 16.528 48.358 25.988 1.00 11.63  ? 49   VAL A CG2 1 
ATOM   386  N N   . CYS A 1 49 ? 17.468 43.739 25.745 1.00 12.37  ? 50   CYS A N   1 
ATOM   387  C CA  . CYS A 1 49 ? 18.029 42.554 25.108 1.00 11.13  ? 50   CYS A CA  1 
ATOM   388  C C   . CYS A 1 49 ? 18.164 42.680 23.599 1.00 10.16  ? 50   CYS A C   1 
ATOM   389  O O   . CYS A 1 49 ? 17.231 43.168 22.949 1.00 12.24  ? 50   CYS A O   1 
ATOM   390  C CB  . CYS A 1 49 ? 17.119 41.343 25.382 1.00 11.93  ? 50   CYS A CB  1 
ATOM   391  S SG  . CYS A 1 49 ? 17.084 40.896 27.151 1.00 11.90  ? 50   CYS A SG  1 
ATOM   392  N N   . ALA A 1 50 ? 19.282 42.178 23.102 1.00 11.33  ? 51   ALA A N   1 
ATOM   393  C CA  . ALA A 1 50 ? 19.616 42.259 21.681 1.00 13.93  ? 51   ALA A CA  1 
ATOM   394  C C   . ALA A 1 50 ? 20.331 41.015 21.180 1.00 10.87  ? 51   ALA A C   1 
ATOM   395  O O   . ALA A 1 50 ? 21.042 40.391 21.967 1.00 13.39  ? 51   ALA A O   1 
ATOM   396  C CB  . ALA A 1 50 ? 20.554 43.438 21.447 1.00 13.06  ? 51   ALA A CB  1 
ATOM   397  N N   . ASN A 1 51 ? 20.188 40.709 19.915 1.00 13.07  ? 52   ASN A N   1 
ATOM   398  C CA  . ASN A 1 51 ? 20.783 39.514 19.298 1.00 15.02  ? 52   ASN A CA  1 
ATOM   399  C C   . ASN A 1 51 ? 22.245 39.691 18.948 1.00 18.09  ? 52   ASN A C   1 
ATOM   400  O O   . ASN A 1 51 ? 22.629 40.507 18.095 1.00 17.19  ? 52   ASN A O   1 
ATOM   401  C CB  . ASN A 1 51 ? 19.960 39.221 18.036 1.00 13.96  ? 52   ASN A CB  1 
ATOM   402  C CG  . ASN A 1 51 ? 20.413 37.963 17.322 1.00 23.23  ? 52   ASN A CG  1 
ATOM   403  O OD1 . ASN A 1 51 ? 21.415 37.348 17.677 1.00 17.60  ? 52   ASN A OD1 1 
ATOM   404  N ND2 . ASN A 1 51 ? 19.650 37.603 16.294 1.00 29.37  ? 52   ASN A ND2 1 
ATOM   405  N N   . PRO A 1 52 ? 23.117 38.920 19.577 1.00 15.72  ? 53   PRO A N   1 
ATOM   406  C CA  . PRO A 1 52 ? 24.562 39.071 19.388 1.00 16.93  ? 53   PRO A CA  1 
ATOM   407  C C   . PRO A 1 52 ? 25.007 38.872 17.941 1.00 18.69  ? 53   PRO A C   1 
ATOM   408  O O   . PRO A 1 52 ? 26.119 39.288 17.617 1.00 22.10  ? 53   PRO A O   1 
ATOM   409  C CB  . PRO A 1 52 ? 25.149 37.933 20.238 1.00 23.16  ? 53   PRO A CB  1 
ATOM   410  C CG  . PRO A 1 52 ? 24.079 37.613 21.242 1.00 24.57  ? 53   PRO A CG  1 
ATOM   411  C CD  . PRO A 1 52 ? 22.783 37.853 20.536 1.00 18.05  ? 53   PRO A CD  1 
ATOM   412  N N   . GLU A 1 53 ? 24.155 38.255 17.143 1.00 22.07  ? 54   GLU A N   1 
ATOM   413  C CA  . GLU A 1 53 ? 24.507 37.880 15.784 1.00 20.70  ? 54   GLU A CA  1 
ATOM   414  C C   . GLU A 1 53 ? 24.167 38.981 14.797 1.00 28.81  ? 54   GLU A C   1 
ATOM   415  O O   . GLU A 1 53 ? 24.648 38.975 13.664 1.00 27.08  ? 54   GLU A O   1 
ATOM   416  C CB  . GLU A 1 53 ? 23.763 36.592 15.414 1.00 25.26  ? 54   GLU A CB  1 
ATOM   417  C CG  . GLU A 1 53 ? 24.323 35.375 16.142 1.00 27.54  ? 54   GLU A CG  1 
ATOM   418  C CD  . GLU A 1 53 ? 23.798 34.070 15.572 1.00 43.20  ? 54   GLU A CD  1 
ATOM   419  O OE1 . GLU A 1 53 ? 23.475 34.048 14.361 1.00 55.46  ? 54   GLU A OE1 1 
ATOM   420  O OE2 . GLU A 1 53 ? 23.714 33.078 16.326 1.00 68.78  ? 54   GLU A OE2 1 
ATOM   421  N N   . LYS A 1 54 ? 23.337 39.913 15.259 1.00 22.55  ? 55   LYS A N   1 
ATOM   422  C CA  . LYS A 1 54 ? 22.993 41.041 14.394 1.00 26.20  ? 55   LYS A CA  1 
ATOM   423  C C   . LYS A 1 54 ? 24.168 41.973 14.186 1.00 19.97  ? 55   LYS A C   1 
ATOM   424  O O   . LYS A 1 54 ? 24.919 42.308 15.090 1.00 21.98  ? 55   LYS A O   1 
ATOM   425  C CB  . LYS A 1 54 ? 21.830 41.823 15.003 1.00 26.31  ? 55   LYS A CB  1 
ATOM   426  C CG  . LYS A 1 54 ? 20.467 41.280 14.605 1.00 25.11  ? 55   LYS A CG  1 
ATOM   427  C CD  . LYS A 1 54 ? 20.218 41.606 13.131 1.00 37.06  ? 55   LYS A CD  1 
ATOM   428  C CE  . LYS A 1 54 ? 18.728 41.625 12.824 1.00 49.96  ? 55   LYS A CE  1 
ATOM   429  N NZ  . LYS A 1 54 ? 18.489 41.504 11.358 1.00 46.81  ? 55   LYS A NZ  1 
ATOM   430  N N   . LYS A 1 55 ? 24.340 42.421 12.941 1.00 22.56  ? 56   LYS A N   1 
ATOM   431  C CA  . LYS A 1 55 ? 25.413 43.329 12.598 1.00 21.95  ? 56   LYS A CA  1 
ATOM   432  C C   . LYS A 1 55 ? 25.405 44.618 13.407 1.00 14.09  ? 56   LYS A C   1 
ATOM   433  O O   . LYS A 1 55 ? 26.448 45.094 13.865 1.00 22.10  ? 56   LYS A O   1 
ATOM   434  C CB  . LYS A 1 55 ? 25.300 43.678 11.097 1.00 39.78  ? 56   LYS A CB  1 
ATOM   435  C CG  . LYS A 1 55 ? 23.987 44.352 10.719 1.00 43.07  ? 56   LYS A CG  1 
ATOM   436  C CD  . LYS A 1 55 ? 22.864 43.353 10.508 1.00 53.30  ? 56   LYS A CD  1 
ATOM   437  C CE  . LYS A 1 55 ? 21.491 43.996 10.597 1.00 52.35  ? 56   LYS A CE  1 
ATOM   438  N NZ  . LYS A 1 55 ? 21.531 45.340 11.233 1.00 47.43  ? 56   LYS A NZ  1 
ATOM   439  N N   . TRP A 1 56 ? 24.217 45.207 13.579 1.00 18.06  ? 57   TRP A N   1 
ATOM   440  C CA  . TRP A 1 56 ? 24.139 46.507 14.248 1.00 18.38  ? 57   TRP A CA  1 
ATOM   441  C C   . TRP A 1 56 ? 24.553 46.361 15.713 1.00 19.58  ? 57   TRP A C   1 
ATOM   442  O O   . TRP A 1 56 ? 25.174 47.251 16.288 1.00 19.23  ? 57   TRP A O   1 
ATOM   443  C CB  . TRP A 1 56 ? 22.759 47.138 14.154 1.00 18.24  ? 57   TRP A CB  1 
ATOM   444  C CG  . TRP A 1 56 ? 21.636 46.518 14.906 1.00 17.50  ? 57   TRP A CG  1 
ATOM   445  C CD1 . TRP A 1 56 ? 20.759 45.604 14.414 1.00 19.52  ? 57   TRP A CD1 1 
ATOM   446  C CD2 . TRP A 1 56 ? 21.242 46.749 16.271 1.00 15.65  ? 57   TRP A CD2 1 
ATOM   447  N NE1 . TRP A 1 56 ? 19.837 45.239 15.366 1.00 18.72  ? 57   TRP A NE1 1 
ATOM   448  C CE2 . TRP A 1 56 ? 20.121 45.929 16.512 1.00 23.17  ? 57   TRP A CE2 1 
ATOM   449  C CE3 . TRP A 1 56 ? 21.721 47.555 17.300 1.00 18.64  ? 57   TRP A CE3 1 
ATOM   450  C CZ2 . TRP A 1 56 ? 19.486 45.906 17.756 1.00 17.66  ? 57   TRP A CZ2 1 
ATOM   451  C CZ3 . TRP A 1 56 ? 21.097 47.546 18.541 1.00 16.72  ? 57   TRP A CZ3 1 
ATOM   452  C CH2 . TRP A 1 56 ? 19.984 46.716 18.736 1.00 14.56  ? 57   TRP A CH2 1 
ATOM   453  N N   . VAL A 1 57 ? 24.175 45.201 16.260 1.00 18.72  ? 58   VAL A N   1 
ATOM   454  C CA  . VAL A 1 57 ? 24.571 44.891 17.643 1.00 17.72  ? 58   VAL A CA  1 
ATOM   455  C C   . VAL A 1 57 ? 26.066 44.764 17.776 1.00 17.18  ? 58   VAL A C   1 
ATOM   456  O O   . VAL A 1 57 ? 26.752 45.258 18.686 1.00 16.18  ? 58   VAL A O   1 
ATOM   457  C CB  . VAL A 1 57 ? 23.884 43.568 18.099 1.00 17.35  ? 58   VAL A CB  1 
ATOM   458  C CG1 . VAL A 1 57 ? 24.378 43.153 19.472 1.00 13.58  ? 58   VAL A CG1 1 
ATOM   459  C CG2 . VAL A 1 57 ? 22.372 43.682 18.074 1.00 17.13  ? 58   VAL A CG2 1 
ATOM   460  N N   . ARG A 1 58 ? 26.703 44.048 16.824 1.00 19.87  ? 59   ARG A N   1 
ATOM   461  C CA  . ARG A 1 58 ? 28.152 43.895 16.899 1.00 19.86  ? 59   ARG A CA  1 
ATOM   462  C C   . ARG A 1 58 ? 28.849 45.230 16.642 1.00 19.34  ? 59   ARG A C   1 
ATOM   463  O O   . ARG A 1 58 ? 29.890 45.481 17.249 1.00 18.59  ? 59   ARG A O   1 
ATOM   464  C CB  . ARG A 1 58 ? 28.654 42.857 15.885 1.00 23.43  ? 59   ARG A CB  1 
ATOM   465  C CG  . ARG A 1 58 ? 28.291 41.431 16.306 1.00 31.92  ? 59   ARG A CG  1 
ATOM   466  C CD  . ARG A 1 58 ? 28.052 40.569 15.077 1.00 44.03  ? 59   ARG A CD  1 
ATOM   467  N NE  . ARG A 1 58 ? 28.972 40.971 14.007 1.00 52.18  ? 59   ARG A NE  1 
ATOM   468  C CZ  . ARG A 1 58 ? 28.687 40.832 12.717 1.00 56.46  ? 59   ARG A CZ  1 
ATOM   469  N NH1 . ARG A 1 58 ? 27.520 40.300 12.370 1.00 33.69  ? 59   ARG A NH1 1 
ATOM   470  N NH2 . ARG A 1 58 ? 29.558 41.217 11.794 1.00 66.93  ? 59   ARG A NH2 1 
ATOM   471  N N   . GLU A 1 59 ? 28.227 46.035 15.773 1.00 19.72  ? 60   GLU A N   1 
ATOM   472  C CA  . GLU A 1 59 ? 28.811 47.355 15.526 1.00 19.37  ? 60   GLU A CA  1 
ATOM   473  C C   . GLU A 1 59 ? 28.767 48.244 16.753 1.00 14.98  ? 60   GLU A C   1 
ATOM   474  O O   . GLU A 1 59 ? 29.678 49.007 17.080 1.00 18.26  ? 60   GLU A O   1 
ATOM   475  C CB  . GLU A 1 59 ? 28.083 48.026 14.353 1.00 21.61  ? 60   GLU A CB  1 
ATOM   476  C CG  . GLU A 1 59 ? 28.344 47.338 13.013 1.00 31.57  ? 60   GLU A CG  1 
ATOM   477  C CD  . GLU A 1 59 ? 27.687 48.086 11.866 1.00 46.40  ? 60   GLU A CD  1 
ATOM   478  O OE1 . GLU A 1 59 ? 26.442 48.224 11.860 1.00 46.25  ? 60   GLU A OE1 1 
ATOM   479  O OE2 . GLU A 1 59 ? 28.420 48.551 10.967 1.00 56.79  ? 60   GLU A OE2 1 
ATOM   480  N N   . TYR A 1 60 ? 27.641 48.176 17.477 1.00 15.64  ? 61   TYR A N   1 
ATOM   481  C CA  . TYR A 1 60 ? 27.468 48.993 18.670 1.00 16.78  ? 61   TYR A CA  1 
ATOM   482  C C   . TYR A 1 60 ? 28.474 48.574 19.738 1.00 14.80  ? 61   TYR A C   1 
ATOM   483  O O   . TYR A 1 60 ? 29.062 49.385 20.440 1.00 16.11  ? 61   TYR A O   1 
ATOM   484  C CB  . TYR A 1 60 ? 26.046 48.878 19.229 1.00 14.62  ? 61   TYR A CB  1 
ATOM   485  C CG  . TYR A 1 60 ? 24.976 49.703 18.557 1.00 18.14  ? 61   TYR A CG  1 
ATOM   486  C CD1 . TYR A 1 60 ? 25.150 50.308 17.319 1.00 15.87  ? 61   TYR A CD1 1 
ATOM   487  C CD2 . TYR A 1 60 ? 23.732 49.880 19.165 1.00 18.52  ? 61   TYR A CD2 1 
ATOM   488  C CE1 . TYR A 1 60 ? 24.147 51.058 16.721 1.00 15.43  ? 61   TYR A CE1 1 
ATOM   489  C CE2 . TYR A 1 60 ? 22.724 50.624 18.582 1.00 14.08  ? 61   TYR A CE2 1 
ATOM   490  C CZ  . TYR A 1 60 ? 22.928 51.211 17.355 1.00 16.28  ? 61   TYR A CZ  1 
ATOM   491  O OH  . TYR A 1 60 ? 21.926 51.959 16.780 1.00 16.11  ? 61   TYR A OH  1 
ATOM   492  N N   . ILE A 1 61 ? 28.653 47.252 19.856 1.00 15.16  ? 62   ILE A N   1 
ATOM   493  C CA  . ILE A 1 61 ? 29.640 46.734 20.812 1.00 10.42  ? 62   ILE A CA  1 
ATOM   494  C C   . ILE A 1 61 ? 31.034 47.254 20.510 1.00 16.78  ? 62   ILE A C   1 
ATOM   495  O O   . ILE A 1 61 ? 31.736 47.758 21.400 1.00 19.07  ? 62   ILE A O   1 
ATOM   496  C CB  . ILE A 1 61 ? 29.557 45.185 20.797 1.00 12.80  ? 62   ILE A CB  1 
ATOM   497  C CG1 . ILE A 1 61 ? 28.266 44.688 21.434 1.00 18.88  ? 62   ILE A CG1 1 
ATOM   498  C CG2 . ILE A 1 61 ? 30.760 44.578 21.468 1.00 14.86  ? 62   ILE A CG2 1 
ATOM   499  C CD1 . ILE A 1 61 ? 28.035 43.195 21.369 1.00 19.92  ? 62   ILE A CD1 1 
ATOM   500  N N   . ASN A 1 62 ? 31.444 47.148 19.243 1.00 19.57  ? 63   ASN A N   1 
ATOM   501  C CA  . ASN A 1 62 ? 32.760 47.617 18.817 1.00 22.54  ? 63   ASN A CA  1 
ATOM   502  C C   . ASN A 1 62 ? 32.895 49.107 19.167 1.00 17.46  ? 63   ASN A C   1 
ATOM   503  O O   . ASN A 1 62 ? 33.909 49.552 19.675 1.00 20.77  ? 63   ASN A O   1 
ATOM   504  C CB  . ASN A 1 62 ? 33.010 47.376 17.322 1.00 18.26  ? 63   ASN A CB  1 
ATOM   505  C CG  . ASN A 1 62 ? 32.820 45.938 16.868 1.00 26.98  ? 63   ASN A CG  1 
ATOM   506  O OD1 . ASN A 1 62 ? 32.649 45.599 15.676 1.00 29.00  ? 63   ASN A OD1 1 
ATOM   507  N ND2 . ASN A 1 62 ? 32.837 44.994 17.806 1.00 21.15  ? 63   ASN A ND2 1 
ATOM   508  N N   . SER A 1 63 ? 31.827 49.863 18.907 1.00 16.27  ? 64   SER A N   1 
ATOM   509  C CA  . SER A 1 63 ? 31.826 51.303 19.207 1.00 18.56  ? 64   SER A CA  1 
ATOM   510  C C   . SER A 1 63 ? 32.006 51.571 20.684 1.00 16.83  ? 64   SER A C   1 
ATOM   511  O O   . SER A 1 63 ? 32.815 52.367 21.146 1.00 22.05  ? 64   SER A O   1 
ATOM   512  C CB  . SER A 1 63 ? 30.520 51.898 18.684 1.00 19.52  ? 64   SER A CB  1 
ATOM   513  O OG  . SER A 1 63 ? 30.404 53.276 19.017 1.00 19.95  ? 64   SER A OG  1 
ATOM   514  N N   . LEU A 1 64 ? 31.211 50.876 21.512 1.00 15.56  ? 65   LEU A N   1 
ATOM   515  C CA  . LEU A 1 64 ? 31.307 50.985 22.959 1.00 17.65  ? 65   LEU A CA  1 
ATOM   516  C C   . LEU A 1 64 ? 32.688 50.562 23.463 1.00 19.48  ? 65   LEU A C   1 
ATOM   517  O O   . LEU A 1 64 ? 33.147 51.154 24.423 1.00 21.56  ? 65   LEU A O   1 
ATOM   518  C CB  . LEU A 1 64 ? 30.240 50.133 23.659 1.00 16.24  ? 65   LEU A CB  1 
ATOM   519  C CG  . LEU A 1 64 ? 28.801 50.639 23.507 1.00 15.24  ? 65   LEU A CG  1 
ATOM   520  C CD1 . LEU A 1 64 ? 27.809 49.528 23.812 1.00 14.02  ? 65   LEU A CD1 1 
ATOM   521  C CD2 . LEU A 1 64 ? 28.569 51.838 24.407 1.00 15.68  ? 65   LEU A CD2 1 
ATOM   522  N N   . GLU A 1 65 ? 33.280 49.558 22.814 1.00 20.40  ? 66   GLU A N   1 
ATOM   523  C CA  . GLU A 1 65 ? 34.610 49.080 23.212 1.00 27.53  ? 66   GLU A CA  1 
ATOM   524  C C   . GLU A 1 65 ? 35.699 50.064 22.809 1.00 25.93  ? 66   GLU A C   1 
ATOM   525  O O   . GLU A 1 65 ? 36.809 50.068 23.328 1.00 31.70  ? 66   GLU A O   1 
ATOM   526  C CB  . GLU A 1 65 ? 34.893 47.691 22.609 1.00 22.96  ? 66   GLU A CB  1 
ATOM   527  C CG  . GLU A 1 65 ? 33.982 46.637 23.221 1.00 23.15  ? 66   GLU A CG  1 
ATOM   528  C CD  . GLU A 1 65 ? 34.207 45.231 22.699 1.00 36.25  ? 66   GLU A CD  1 
ATOM   529  O OE1 . GLU A 1 65 ? 35.096 44.997 21.861 1.00 35.58  ? 66   GLU A OE1 1 
ATOM   530  O OE2 . GLU A 1 65 ? 33.472 44.316 23.145 1.00 67.90  ? 66   GLU A OE2 1 
ATOM   531  N N   . MET A 1 66 ? 35.327 50.910 21.860 1.00 34.32  ? 67   MET A N   1 
ATOM   532  C CA  . MET A 1 66 ? 36.122 51.914 21.205 1.00 39.29  ? 67   MET A CA  1 
ATOM   533  C C   . MET A 1 66 ? 36.048 53.272 21.896 1.00 52.03  ? 67   MET A C   1 
ATOM   534  O O   . MET A 1 66 ? 35.946 54.244 21.141 1.00 78.66  ? 67   MET A O   1 
ATOM   535  C CB  . MET A 1 66 ? 35.610 52.144 19.766 1.00 40.97  ? 67   MET A CB  1 
ATOM   536  C CG  . MET A 1 66 ? 36.739 52.691 18.898 1.00 43.40  ? 67   MET A CG  1 
ATOM   537  S SD  . MET A 1 66 ? 38.207 51.674 19.137 1.00 49.73  ? 67   MET A SD  1 
ATOM   538  C CE  . MET A 1 66 ? 37.728 50.176 18.287 1.00 35.18  ? 67   MET A CE  1 
ATOM   539  N N   . SER A 1 67 ? 36.086 53.289 23.217 1.00 52.23  ? 68   SER A N   1 
ATOM   540  C CA  . SER A 1 67 ? 36.000 54.530 23.978 1.00 68.49  ? 68   SER A CA  1 
ATOM   541  C C   . SER A 1 67 ? 36.903 55.605 23.379 1.00 82.65  ? 68   SER A C   1 
ATOM   542  O O   . SER A 1 67 ? 37.873 55.244 22.674 1.00 71.34  ? 68   SER A O   1 
ATOM   543  C CB  . SER A 1 67 ? 36.346 54.272 25.444 1.00 72.99  ? 68   SER A CB  1 
ATOM   544  O OG  . SER A 1 67 ? 35.281 53.662 26.155 1.00 60.36  ? 68   SER A OG  1 
ATOM   545  O OXT . SER A 1 67 ? 36.624 56.805 23.579 1.00 103.91 ? 68   SER A OXT 1 
ATOM   546  N N   . PRO B 1 1  ? 6.414  34.862 21.536 1.00 61.02  ? 2    PRO B N   1 
ATOM   547  C CA  . PRO B 1 1  ? 6.844  36.257 21.699 1.00 44.58  ? 2    PRO B CA  1 
ATOM   548  C C   . PRO B 1 1  ? 7.107  36.615 23.155 1.00 33.15  ? 2    PRO B C   1 
ATOM   549  O O   . PRO B 1 1  ? 6.469  36.146 24.096 1.00 28.83  ? 2    PRO B O   1 
ATOM   550  C CB  . PRO B 1 1  ? 5.636  37.034 21.153 1.00 42.15  ? 2    PRO B CB  1 
ATOM   551  C CG  . PRO B 1 1  ? 4.465  36.170 21.490 1.00 33.63  ? 2    PRO B CG  1 
ATOM   552  C CD  . PRO B 1 1  ? 4.954  34.755 21.356 1.00 53.90  ? 2    PRO B CD  1 
ATOM   553  N N   . TYR B 1 2  ? 8.095  37.477 23.384 1.00 28.50  ? 3    TYR B N   1 
ATOM   554  C CA  . TYR B 1 2  ? 8.414  37.936 24.731 1.00 25.43  ? 3    TYR B CA  1 
ATOM   555  C C   . TYR B 1 2  ? 8.880  39.381 24.692 1.00 26.88  ? 3    TYR B C   1 
ATOM   556  O O   . TYR B 1 2  ? 9.263  39.940 23.665 1.00 29.41  ? 3    TYR B O   1 
ATOM   557  C CB  . TYR B 1 2  ? 9.507  37.086 25.395 1.00 22.09  ? 3    TYR B CB  1 
ATOM   558  C CG  . TYR B 1 2  ? 9.091  35.657 25.642 1.00 31.09  ? 3    TYR B CG  1 
ATOM   559  C CD1 . TYR B 1 2  ? 7.934  35.357 26.342 1.00 35.01  ? 3    TYR B CD1 1 
ATOM   560  C CD2 . TYR B 1 2  ? 9.876  34.617 25.154 1.00 36.12  ? 3    TYR B CD2 1 
ATOM   561  C CE1 . TYR B 1 2  ? 7.567  34.038 26.560 1.00 40.81  ? 3    TYR B CE1 1 
ATOM   562  C CE2 . TYR B 1 2  ? 9.510  33.298 25.368 1.00 45.00  ? 3    TYR B CE2 1 
ATOM   563  C CZ  . TYR B 1 2  ? 8.359  33.017 26.072 1.00 47.80  ? 3    TYR B CZ  1 
ATOM   564  O OH  . TYR B 1 2  ? 8.004  31.701 26.279 1.00 66.40  ? 3    TYR B OH  1 
ATOM   565  N N   . SER B 1 3  ? 8.866  40.053 25.848 1.00 28.03  ? 4    SER B N   1 
ATOM   566  C CA  . SER B 1 3  ? 9.463  41.391 25.769 1.00 24.40  ? 4    SER B CA  1 
ATOM   567  C C   . SER B 1 3  ? 10.980 41.253 25.681 1.00 17.43  ? 4    SER B C   1 
ATOM   568  O O   . SER B 1 3  ? 11.566 40.199 25.950 1.00 24.03  ? 4    SER B O   1 
ATOM   569  C CB  . SER B 1 3  ? 9.034  42.262 26.940 1.00 36.37  ? 4    SER B CB  1 
ATOM   570  O OG  . SER B 1 3  ? 9.559  41.866 28.179 1.00 41.73  ? 4    SER B OG  1 
ATOM   571  N N   . SER B 1 4  ? 11.634 42.339 25.308 1.00 19.04  ? 5    SER B N   1 
ATOM   572  C CA  . SER B 1 4  ? 13.095 42.429 25.273 1.00 19.56  ? 5    SER B CA  1 
ATOM   573  C C   . SER B 1 4  ? 13.708 42.838 26.607 1.00 22.34  ? 5    SER B C   1 
ATOM   574  O O   . SER B 1 4  ? 14.920 43.106 26.716 1.00 17.75  ? 5    SER B O   1 
ATOM   575  C CB  . SER B 1 4  ? 13.487 43.447 24.185 1.00 22.99  ? 5    SER B CB  1 
ATOM   576  O OG  . SER B 1 4  ? 12.953 44.714 24.543 1.00 45.25  ? 5    SER B OG  1 
ATOM   577  N N   . ASP B 1 5  ? 12.915 42.903 27.671 1.00 19.53  ? 6    ASP B N   1 
ATOM   578  C CA  . ASP B 1 5  ? 13.466 43.164 29.001 1.00 19.11  ? 6    ASP B CA  1 
ATOM   579  C C   . ASP B 1 5  ? 14.205 41.929 29.509 1.00 16.13  ? 6    ASP B C   1 
ATOM   580  O O   . ASP B 1 5  ? 13.907 40.838 29.051 1.00 14.85  ? 6    ASP B O   1 
ATOM   581  C CB  . ASP B 1 5  ? 12.400 43.459 30.046 1.00 21.64  ? 6    ASP B CB  1 
ATOM   582  C CG  . ASP B 1 5  ? 11.768 44.829 29.889 1.00 31.78  ? 6    ASP B CG  1 
ATOM   583  O OD1 . ASP B 1 5  ? 12.425 45.709 29.303 1.00 37.36  ? 6    ASP B OD1 1 
ATOM   584  O OD2 . ASP B 1 5  ? 10.617 44.962 30.362 1.00 37.79  ? 6    ASP B OD2 1 
ATOM   585  N N   . THR B 1 6  ? 15.137 42.108 30.469 1.00 16.37  ? 7    THR B N   1 
ATOM   586  C CA  . THR B 1 6  ? 15.712 40.895 31.071 1.00 13.55  ? 7    THR B CA  1 
ATOM   587  C C   . THR B 1 6  ? 14.714 40.363 32.091 1.00 17.35  ? 7    THR B C   1 
ATOM   588  O O   . THR B 1 6  ? 13.803 41.065 32.557 1.00 12.52  ? 7    THR B O   1 
ATOM   589  C CB  . THR B 1 6  ? 17.072 41.119 31.741 1.00 12.35  ? 7    THR B CB  1 
ATOM   590  O OG1 . THR B 1 6  ? 16.896 42.101 32.787 1.00 16.15  ? 7    THR B OG1 1 
ATOM   591  C CG2 . THR B 1 6  ? 18.114 41.701 30.789 1.00 12.85  ? 7    THR B CG2 1 
ATOM   592  N N   . THR B 1 7  ? 14.924 39.103 32.432 1.00 12.14  ? 8    THR B N   1 
ATOM   593  C CA  . THR B 1 7  ? 14.113 38.374 33.398 1.00 11.49  ? 8    THR B CA  1 
ATOM   594  C C   . THR B 1 7  ? 15.062 37.646 34.349 1.00 10.61  ? 8    THR B C   1 
ATOM   595  O O   . THR B 1 7  ? 15.987 37.021 33.841 1.00 10.05  ? 8    THR B O   1 
ATOM   596  C CB  . THR B 1 7  ? 13.257 37.303 32.694 1.00 18.00  ? 8    THR B CB  1 
ATOM   597  O OG1 . THR B 1 7  ? 12.328 37.924 31.792 1.00 20.90  ? 8    THR B OG1 1 
ATOM   598  C CG2 . THR B 1 7  ? 12.480 36.509 33.731 1.00 29.18  ? 8    THR B CG2 1 
ATOM   599  N N   . PRO B 1 8  ? 14.939 37.708 35.673 1.00 9.68   ? 9    PRO B N   1 
ATOM   600  C CA  . PRO B 1 8  ? 15.855 36.986 36.557 1.00 9.39   ? 9    PRO B CA  1 
ATOM   601  C C   . PRO B 1 8  ? 15.590 35.476 36.525 1.00 11.85  ? 9    PRO B C   1 
ATOM   602  O O   . PRO B 1 8  ? 14.446 35.014 36.607 1.00 11.19  ? 9    PRO B O   1 
ATOM   603  C CB  . PRO B 1 8  ? 15.591 37.584 37.940 1.00 10.34  ? 9    PRO B CB  1 
ATOM   604  C CG  . PRO B 1 8  ? 14.155 38.075 37.825 1.00 11.43  ? 9    PRO B CG  1 
ATOM   605  C CD  . PRO B 1 8  ? 13.938 38.498 36.408 1.00 10.50  ? 9    PRO B CD  1 
ATOM   606  N N   . CYS B 1 9  ? 16.663 34.692 36.362 1.00 9.84   ? 10   CYS B N   1 
ATOM   607  C CA  . CYS B 1 9  ? 16.521 33.244 36.381 1.00 10.00  ? 10   CYS B CA  1 
ATOM   608  C C   . CYS B 1 9  ? 17.530 32.631 37.337 1.00 8.02   ? 10   CYS B C   1 
ATOM   609  O O   . CYS B 1 9  ? 18.524 33.320 37.689 1.00 9.59   ? 10   CYS B O   1 
ATOM   610  C CB  . CYS B 1 9  ? 16.715 32.603 34.992 1.00 9.38   ? 10   CYS B CB  1 
ATOM   611  S SG  . CYS B 1 9  ? 15.501 33.062 33.741 1.00 10.94  ? 10   CYS B SG  1 
ATOM   612  N N   . CYS B 1 10 ? 17.236 31.385 37.714 1.00 9.21   ? 11   CYS B N   1 
ATOM   613  C CA  . CYS B 1 10 ? 18.072 30.704 38.706 1.00 8.28   ? 11   CYS B CA  1 
ATOM   614  C C   . CYS B 1 10 ? 18.755 29.478 38.136 1.00 9.51   ? 11   CYS B C   1 
ATOM   615  O O   . CYS B 1 10 ? 18.180 28.722 37.356 1.00 12.86  ? 11   CYS B O   1 
ATOM   616  C CB  . CYS B 1 10 ? 17.196 30.252 39.881 1.00 10.53  ? 11   CYS B CB  1 
ATOM   617  S SG  . CYS B 1 10 ? 16.534 31.619 40.863 1.00 10.17  ? 11   CYS B SG  1 
ATOM   618  N N   . PHE B 1 11 ? 20.012 29.281 38.579 1.00 11.69  ? 12   PHE B N   1 
ATOM   619  C CA  . PHE B 1 11 ? 20.798 28.124 38.157 1.00 10.57  ? 12   PHE B CA  1 
ATOM   620  C C   . PHE B 1 11 ? 21.353 27.299 39.303 1.00 13.24  ? 12   PHE B C   1 
ATOM   621  O O   . PHE B 1 11 ? 21.975 26.254 39.011 1.00 14.45  ? 12   PHE B O   1 
ATOM   622  C CB  . PHE B 1 11 ? 21.914 28.611 37.202 1.00 9.04   ? 12   PHE B CB  1 
ATOM   623  C CG  . PHE B 1 11 ? 21.211 29.222 35.974 1.00 10.63  ? 12   PHE B CG  1 
ATOM   624  C CD1 . PHE B 1 11 ? 20.643 28.424 34.998 1.00 11.90  ? 12   PHE B CD1 1 
ATOM   625  C CD2 . PHE B 1 11 ? 21.108 30.588 35.884 1.00 13.55  ? 12   PHE B CD2 1 
ATOM   626  C CE1 . PHE B 1 11 ? 19.986 29.038 33.938 1.00 11.64  ? 12   PHE B CE1 1 
ATOM   627  C CE2 . PHE B 1 11 ? 20.416 31.205 34.844 1.00 11.38  ? 12   PHE B CE2 1 
ATOM   628  C CZ  . PHE B 1 11 ? 19.879 30.406 33.844 1.00 11.52  ? 12   PHE B CZ  1 
ATOM   629  N N   . ALA B 1 12 ? 21.134 27.683 40.543 1.00 11.38  ? 13   ALA B N   1 
ATOM   630  C CA  . ALA B 1 12 ? 21.424 26.854 41.694 1.00 11.82  ? 13   ALA B CA  1 
ATOM   631  C C   . ALA B 1 12 ? 20.493 27.258 42.823 1.00 14.82  ? 13   ALA B C   1 
ATOM   632  O O   . ALA B 1 12 ? 19.983 28.379 42.736 1.00 17.87  ? 13   ALA B O   1 
ATOM   633  C CB  . ALA B 1 12 ? 22.887 27.006 42.118 1.00 19.29  ? 13   ALA B CB  1 
ATOM   634  N N   . TYR B 1 13 ? 20.322 26.398 43.812 1.00 15.29  ? 14   TYR B N   1 
ATOM   635  C CA  . TYR B 1 13 ? 19.473 26.644 44.961 1.00 14.21  ? 14   TYR B CA  1 
ATOM   636  C C   . TYR B 1 13 ? 20.298 26.816 46.228 1.00 18.33  ? 14   TYR B C   1 
ATOM   637  O O   . TYR B 1 13 ? 21.264 26.073 46.428 1.00 17.81  ? 14   TYR B O   1 
ATOM   638  C CB  . TYR B 1 13 ? 18.538 25.455 45.132 1.00 11.10  ? 14   TYR B CB  1 
ATOM   639  C CG  . TYR B 1 13 ? 17.576 25.215 44.008 1.00 16.23  ? 14   TYR B CG  1 
ATOM   640  C CD1 . TYR B 1 13 ? 16.868 26.269 43.421 1.00 18.20  ? 14   TYR B CD1 1 
ATOM   641  C CD2 . TYR B 1 13 ? 17.374 23.919 43.535 1.00 16.26  ? 14   TYR B CD2 1 
ATOM   642  C CE1 . TYR B 1 13 ? 15.981 26.006 42.388 1.00 14.47  ? 14   TYR B CE1 1 
ATOM   643  C CE2 . TYR B 1 13 ? 16.489 23.671 42.505 1.00 25.08  ? 14   TYR B CE2 1 
ATOM   644  C CZ  . TYR B 1 13 ? 15.804 24.718 41.941 1.00 20.47  ? 14   TYR B CZ  1 
ATOM   645  O OH  . TYR B 1 13 ? 14.933 24.452 40.915 1.00 25.99  ? 14   TYR B OH  1 
ATOM   646  N N   . ILE B 1 14 ? 19.946 27.777 47.074 1.00 16.46  ? 15   ILE B N   1 
ATOM   647  C CA  . ILE B 1 14 ? 20.742 27.946 48.286 1.00 18.37  ? 15   ILE B CA  1 
ATOM   648  C C   . ILE B 1 14 ? 20.659 26.652 49.097 1.00 15.33  ? 15   ILE B C   1 
ATOM   649  O O   . ILE B 1 14 ? 19.605 26.056 49.236 1.00 16.52  ? 15   ILE B O   1 
ATOM   650  C CB  . ILE B 1 14 ? 20.325 29.176 49.108 1.00 15.42  ? 15   ILE B CB  1 
ATOM   651  C CG1 . ILE B 1 14 ? 21.325 29.484 50.239 1.00 20.68  ? 15   ILE B CG1 1 
ATOM   652  C CG2 . ILE B 1 14 ? 18.906 29.039 49.626 1.00 15.03  ? 15   ILE B CG2 1 
ATOM   653  C CD1 . ILE B 1 14 ? 21.182 30.847 50.875 1.00 19.84  ? 15   ILE B CD1 1 
ATOM   654  N N   . ALA B 1 15 ? 21.833 26.243 49.612 1.00 20.17  ? 16   ALA B N   1 
ATOM   655  C CA  . ALA B 1 15 ? 21.980 24.989 50.338 1.00 27.42  ? 16   ALA B CA  1 
ATOM   656  C C   . ALA B 1 15 ? 21.313 24.990 51.700 1.00 29.56  ? 16   ALA B C   1 
ATOM   657  O O   . ALA B 1 15 ? 20.699 24.023 52.164 1.00 39.06  ? 16   ALA B O   1 
ATOM   658  C CB  . ALA B 1 15 ? 23.470 24.673 50.527 1.00 24.06  ? 16   ALA B CB  1 
ATOM   659  N N   . ARG B 1 16 ? 21.410 26.112 52.411 1.00 20.15  ? 17   ARG B N   1 
ATOM   660  C CA  . ARG B 1 16 ? 20.785 26.065 53.747 1.00 21.16  ? 17   ARG B CA  1 
ATOM   661  C C   . ARG B 1 16 ? 19.681 27.095 53.832 1.00 18.10  ? 17   ARG B C   1 
ATOM   662  O O   . ARG B 1 16 ? 19.770 28.089 53.109 1.00 21.92  ? 17   ARG B O   1 
ATOM   663  C CB  . ARG B 1 16 ? 21.831 26.301 54.842 1.00 25.41  ? 17   ARG B CB  1 
ATOM   664  C CG  . ARG B 1 16 ? 22.965 25.266 54.784 1.00 34.96  ? 17   ARG B CG  1 
ATOM   665  C CD  . ARG B 1 16 ? 22.420 23.909 55.233 1.00 42.27  ? 17   ARG B CD  1 
ATOM   666  N NE  . ARG B 1 16 ? 21.878 24.030 56.583 1.00 46.54  ? 17   ARG B NE  1 
ATOM   667  C CZ  . ARG B 1 16 ? 20.789 23.468 57.076 1.00 46.28  ? 17   ARG B CZ  1 
ATOM   668  N NH1 . ARG B 1 16 ? 20.029 22.679 56.326 1.00 41.47  ? 17   ARG B NH1 1 
ATOM   669  N NH2 . ARG B 1 16 ? 20.441 23.691 58.340 1.00 47.31  ? 17   ARG B NH2 1 
ATOM   670  N N   . PRO B 1 17 ? 18.694 26.890 54.696 1.00 19.33  ? 18   PRO B N   1 
ATOM   671  C CA  . PRO B 1 17 ? 17.655 27.911 54.851 1.00 16.29  ? 18   PRO B CA  1 
ATOM   672  C C   . PRO B 1 17 ? 18.262 29.259 55.195 1.00 15.48  ? 18   PRO B C   1 
ATOM   673  O O   . PRO B 1 17 ? 19.169 29.417 56.025 1.00 16.93  ? 18   PRO B O   1 
ATOM   674  C CB  . PRO B 1 17 ? 16.807 27.408 56.030 1.00 17.00  ? 18   PRO B CB  1 
ATOM   675  C CG  . PRO B 1 17 ? 17.050 25.929 56.034 1.00 23.52  ? 18   PRO B CG  1 
ATOM   676  C CD  . PRO B 1 17 ? 18.471 25.728 55.576 1.00 23.66  ? 18   PRO B CD  1 
ATOM   677  N N   . LEU B 1 18 ? 17.768 30.321 54.575 1.00 16.57  ? 19   LEU B N   1 
ATOM   678  C CA  . LEU B 1 18 ? 18.053 31.680 54.961 1.00 14.26  ? 19   LEU B CA  1 
ATOM   679  C C   . LEU B 1 18 ? 17.425 31.962 56.321 1.00 10.03  ? 19   LEU B C   1 
ATOM   680  O O   . LEU B 1 18 ? 16.417 31.344 56.614 1.00 13.34  ? 19   LEU B O   1 
ATOM   681  C CB  . LEU B 1 18 ? 17.446 32.720 54.004 1.00 13.77  ? 19   LEU B CB  1 
ATOM   682  C CG  . LEU B 1 18 ? 18.092 32.796 52.635 1.00 16.78  ? 19   LEU B CG  1 
ATOM   683  C CD1 . LEU B 1 18 ? 17.226 33.647 51.708 1.00 18.86  ? 19   LEU B CD1 1 
ATOM   684  C CD2 . LEU B 1 18 ? 19.502 33.359 52.760 1.00 16.12  ? 19   LEU B CD2 1 
ATOM   685  N N   . PRO B 1 19 ? 17.955 32.878 57.106 1.00 11.06  ? 20   PRO B N   1 
ATOM   686  C CA  . PRO B 1 19 ? 17.204 33.268 58.313 1.00 11.16  ? 20   PRO B CA  1 
ATOM   687  C C   . PRO B 1 19 ? 15.857 33.832 57.900 1.00 14.29  ? 20   PRO B C   1 
ATOM   688  O O   . PRO B 1 19 ? 15.789 34.729 57.036 1.00 13.09  ? 20   PRO B O   1 
ATOM   689  C CB  . PRO B 1 19 ? 18.075 34.381 58.906 1.00 15.79  ? 20   PRO B CB  1 
ATOM   690  C CG  . PRO B 1 19 ? 19.443 34.167 58.328 1.00 19.77  ? 20   PRO B CG  1 
ATOM   691  C CD  . PRO B 1 19 ? 19.212 33.613 56.939 1.00 14.82  ? 20   PRO B CD  1 
ATOM   692  N N   . ARG B 1 20 ? 14.758 33.338 58.478 1.00 10.96  ? 21   ARG B N   1 
ATOM   693  C CA  . ARG B 1 20 ? 13.449 33.896 58.106 1.00 12.32  ? 21   ARG B CA  1 
ATOM   694  C C   . ARG B 1 20 ? 13.352 35.383 58.333 1.00 12.14  ? 21   ARG B C   1 
ATOM   695  O O   . ARG B 1 20 ? 12.678 36.100 57.570 1.00 11.01  ? 21   ARG B O   1 
ATOM   696  C CB  . ARG B 1 20 ? 12.388 33.136 58.929 1.00 10.37  ? 21   ARG B CB  1 
ATOM   697  C CG  . ARG B 1 20 ? 10.968 33.659 58.769 1.00 11.63  ? 21   ARG B CG  1 
ATOM   698  C CD  . ARG B 1 20 ? 10.464 33.562 57.330 1.00 13.23  ? 21   ARG B CD  1 
ATOM   699  N NE  . ARG B 1 20 ? 9.118  34.139 57.188 1.00 13.05  ? 21   ARG B NE  1 
ATOM   700  C CZ  . ARG B 1 20 ? 8.855  35.427 57.015 1.00 14.37  ? 21   ARG B CZ  1 
ATOM   701  N NH1 . ARG B 1 20 ? 9.831  36.335 56.944 1.00 14.62  ? 21   ARG B NH1 1 
ATOM   702  N NH2 . ARG B 1 20 ? 7.601  35.854 56.891 1.00 17.03  ? 21   ARG B NH2 1 
ATOM   703  N N   . ALA B 1 21 ? 14.013 35.901 59.378 1.00 12.51  ? 22   ALA B N   1 
ATOM   704  C CA  . ALA B 1 21 ? 13.960 37.338 59.645 1.00 13.40  ? 22   ALA B CA  1 
ATOM   705  C C   . ALA B 1 21 ? 14.678 38.181 58.594 1.00 12.36  ? 22   ALA B C   1 
ATOM   706  O O   . ALA B 1 21 ? 14.525 39.411 58.578 1.00 17.58  ? 22   ALA B O   1 
ATOM   707  C CB  . ALA B 1 21 ? 14.570 37.645 61.005 1.00 15.49  ? 22   ALA B CB  1 
ATOM   708  N N   . HIS B 1 22 ? 15.444 37.555 57.711 1.00 12.17  ? 23   HIS B N   1 
ATOM   709  C CA  . HIS B 1 22 ? 16.129 38.336 56.667 1.00 15.24  ? 23   HIS B CA  1 
ATOM   710  C C   . HIS B 1 22 ? 15.307 38.445 55.393 1.00 20.34  ? 23   HIS B C   1 
ATOM   711  O O   . HIS B 1 22 ? 15.782 39.059 54.419 1.00 18.15  ? 23   HIS B O   1 
ATOM   712  C CB  . HIS B 1 22 ? 17.460 37.662 56.303 1.00 13.11  ? 23   HIS B CB  1 
ATOM   713  C CG  . HIS B 1 22 ? 18.468 37.741 57.401 1.00 18.60  ? 23   HIS B CG  1 
ATOM   714  N ND1 . HIS B 1 22 ? 19.802 37.443 57.226 1.00 18.49  ? 23   HIS B ND1 1 
ATOM   715  C CD2 . HIS B 1 22 ? 18.333 38.095 58.702 1.00 17.41  ? 23   HIS B CD2 1 
ATOM   716  C CE1 . HIS B 1 22 ? 20.439 37.603 58.377 1.00 21.51  ? 23   HIS B CE1 1 
ATOM   717  N NE2 . HIS B 1 22 ? 19.572 38.005 59.300 1.00 19.45  ? 23   HIS B NE2 1 
ATOM   718  N N   . ILE B 1 23 ? 14.110 37.859 55.369 1.00 10.66  ? 24   ILE B N   1 
ATOM   719  C CA  . ILE B 1 23 ? 13.359 37.849 54.088 1.00 11.12  ? 24   ILE B CA  1 
ATOM   720  C C   . ILE B 1 23 ? 12.201 38.821 54.059 1.00 13.41  ? 24   ILE B C   1 
ATOM   721  O O   . ILE B 1 23 ? 11.373 38.831 54.952 1.00 15.88  ? 24   ILE B O   1 
ATOM   722  C CB  . ILE B 1 23 ? 12.863 36.408 53.776 1.00 11.19  ? 24   ILE B CB  1 
ATOM   723  C CG1 . ILE B 1 23 ? 14.015 35.428 53.582 1.00 14.79  ? 24   ILE B CG1 1 
ATOM   724  C CG2 . ILE B 1 23 ? 11.946 36.436 52.556 1.00 11.84  ? 24   ILE B CG2 1 
ATOM   725  C CD1 . ILE B 1 23 ? 13.597 33.962 53.526 1.00 19.52  ? 24   ILE B CD1 1 
ATOM   726  N N   . LYS B 1 24 ? 12.144 39.659 53.027 1.00 13.24  ? 25   LYS B N   1 
ATOM   727  C CA  . LYS B 1 24 ? 11.124 40.667 52.837 1.00 13.41  ? 25   LYS B CA  1 
ATOM   728  C C   . LYS B 1 24 ? 9.915  40.106 52.100 1.00 14.33  ? 25   LYS B C   1 
ATOM   729  O O   . LYS B 1 24 ? 8.755  40.340 52.440 1.00 13.59  ? 25   LYS B O   1 
ATOM   730  C CB  . LYS B 1 24 ? 11.695 41.850 52.029 1.00 16.12  ? 25   LYS B CB  1 
ATOM   731  C CG  . LYS B 1 24 ? 12.754 42.681 52.729 1.00 24.74  ? 25   LYS B CG  1 
ATOM   732  C CD  . LYS B 1 24 ? 12.739 44.100 52.153 1.00 20.69  ? 25   LYS B CD  1 
ATOM   733  C CE  . LYS B 1 24 ? 13.177 44.126 50.700 1.00 17.33  ? 25   LYS B CE  1 
ATOM   734  N NZ  . LYS B 1 24 ? 13.695 45.482 50.335 1.00 22.99  ? 25   LYS B NZ  1 
ATOM   735  N N   . GLU B 1 25 ? 10.208 39.331 51.048 1.00 10.70  ? 26   GLU B N   1 
ATOM   736  C CA  . GLU B 1 25 ? 9.128  38.775 50.256 1.00 9.29   ? 26   GLU B CA  1 
ATOM   737  C C   . GLU B 1 25 ? 9.712  37.655 49.380 1.00 8.80   ? 26   GLU B C   1 
ATOM   738  O O   . GLU B 1 25 ? 10.913 37.427 49.402 1.00 9.97   ? 26   GLU B O   1 
ATOM   739  C CB  . GLU B 1 25 ? 8.446  39.798 49.334 1.00 11.39  ? 26   GLU B CB  1 
ATOM   740  C CG  . GLU B 1 25 ? 9.443  40.404 48.347 1.00 15.12  ? 26   GLU B CG  1 
ATOM   741  C CD  . GLU B 1 25 ? 9.879  41.821 48.651 1.00 16.09  ? 26   GLU B CD  1 
ATOM   742  O OE1 . GLU B 1 25 ? 9.411  42.442 49.620 1.00 16.13  ? 26   GLU B OE1 1 
ATOM   743  O OE2 . GLU B 1 25 ? 10.710 42.336 47.872 1.00 18.21  ? 26   GLU B OE2 1 
ATOM   744  N N   . TYR B 1 26 ? 8.843  36.995 48.646 1.00 11.59  ? 27   TYR B N   1 
ATOM   745  C CA  . TYR B 1 26 ? 9.284  35.987 47.698 1.00 10.09  ? 27   TYR B CA  1 
ATOM   746  C C   . TYR B 1 26 ? 8.538  36.192 46.374 1.00 11.38  ? 27   TYR B C   1 
ATOM   747  O O   . TYR B 1 26 ? 7.478  36.784 46.302 1.00 12.47  ? 27   TYR B O   1 
ATOM   748  C CB  . TYR B 1 26 ? 9.055  34.549 48.171 1.00 10.13  ? 27   TYR B CB  1 
ATOM   749  C CG  . TYR B 1 26 ? 7.643  34.048 47.935 1.00 13.24  ? 27   TYR B CG  1 
ATOM   750  C CD1 . TYR B 1 26 ? 6.650  34.426 48.831 1.00 12.56  ? 27   TYR B CD1 1 
ATOM   751  C CD2 . TYR B 1 26 ? 7.311  33.217 46.876 1.00 16.19  ? 27   TYR B CD2 1 
ATOM   752  C CE1 . TYR B 1 26 ? 5.347  33.983 48.644 1.00 15.42  ? 27   TYR B CE1 1 
ATOM   753  C CE2 . TYR B 1 26 ? 6.020  32.771 46.684 1.00 22.65  ? 27   TYR B CE2 1 
ATOM   754  C CZ  . TYR B 1 26 ? 5.056  33.171 47.571 1.00 17.99  ? 27   TYR B CZ  1 
ATOM   755  O OH  . TYR B 1 26 ? 3.775  32.721 47.392 1.00 24.32  ? 27   TYR B OH  1 
ATOM   756  N N   . PHE B 1 27 ? 9.127  35.580 45.341 1.00 10.89  ? 28   PHE B N   1 
ATOM   757  C CA  . PHE B 1 27 ? 8.355  35.411 44.103 1.00 7.90   ? 28   PHE B CA  1 
ATOM   758  C C   . PHE B 1 27 ? 8.868  34.175 43.372 1.00 13.35  ? 28   PHE B C   1 
ATOM   759  O O   . PHE B 1 27 ? 9.932  33.684 43.710 1.00 13.63  ? 28   PHE B O   1 
ATOM   760  C CB  . PHE B 1 27 ? 8.452  36.632 43.210 1.00 12.18  ? 28   PHE B CB  1 
ATOM   761  C CG  . PHE B 1 27 ? 9.847  36.971 42.696 1.00 9.60   ? 28   PHE B CG  1 
ATOM   762  C CD1 . PHE B 1 27 ? 10.688 37.793 43.410 1.00 11.08  ? 28   PHE B CD1 1 
ATOM   763  C CD2 . PHE B 1 27 ? 10.292 36.464 41.493 1.00 10.47  ? 28   PHE B CD2 1 
ATOM   764  C CE1 . PHE B 1 27 ? 11.950 38.123 42.969 1.00 9.20   ? 28   PHE B CE1 1 
ATOM   765  C CE2 . PHE B 1 27 ? 11.558 36.774 41.033 1.00 14.38  ? 28   PHE B CE2 1 
ATOM   766  C CZ  . PHE B 1 27 ? 12.382 37.611 41.759 1.00 12.47  ? 28   PHE B CZ  1 
ATOM   767  N N   . TYR B 1 28 ? 8.126  33.701 42.392 1.00 11.89  ? 29   TYR B N   1 
ATOM   768  C CA  . TYR B 1 28 ? 8.611  32.556 41.603 1.00 9.82   ? 29   TYR B CA  1 
ATOM   769  C C   . TYR B 1 28 ? 9.227  33.106 40.331 1.00 13.94  ? 29   TYR B C   1 
ATOM   770  O O   . TYR B 1 28 ? 8.708  34.077 39.785 1.00 13.85  ? 29   TYR B O   1 
ATOM   771  C CB  . TYR B 1 28 ? 7.473  31.608 41.275 1.00 11.46  ? 29   TYR B CB  1 
ATOM   772  C CG  . TYR B 1 28 ? 6.913  30.745 42.375 1.00 14.88  ? 29   TYR B CG  1 
ATOM   773  C CD1 . TYR B 1 28 ? 7.462  29.489 42.623 1.00 19.84  ? 29   TYR B CD1 1 
ATOM   774  C CD2 . TYR B 1 28 ? 5.856  31.196 43.164 1.00 17.37  ? 29   TYR B CD2 1 
ATOM   775  C CE1 . TYR B 1 28 ? 6.957  28.681 43.636 1.00 23.79  ? 29   TYR B CE1 1 
ATOM   776  C CE2 . TYR B 1 28 ? 5.363  30.388 44.169 1.00 17.17  ? 29   TYR B CE2 1 
ATOM   777  C CZ  . TYR B 1 28 ? 5.909  29.150 44.394 1.00 18.41  ? 29   TYR B CZ  1 
ATOM   778  O OH  . TYR B 1 28 ? 5.403  28.367 45.399 1.00 29.20  ? 29   TYR B OH  1 
ATOM   779  N N   . THR B 1 29 ? 10.333 32.507 39.841 1.00 10.92  ? 30   THR B N   1 
ATOM   780  C CA  . THR B 1 29 ? 10.889 32.973 38.596 1.00 10.71  ? 30   THR B CA  1 
ATOM   781  C C   . THR B 1 29 ? 9.921  32.624 37.453 1.00 10.24  ? 30   THR B C   1 
ATOM   782  O O   . THR B 1 29 ? 9.132  31.680 37.580 1.00 16.36  ? 30   THR B O   1 
ATOM   783  C CB  . THR B 1 29 ? 12.249 32.347 38.256 1.00 10.27  ? 30   THR B CB  1 
ATOM   784  O OG1 . THR B 1 29 ? 12.236 30.941 38.530 1.00 10.71  ? 30   THR B OG1 1 
ATOM   785  C CG2 . THR B 1 29 ? 13.315 33.010 39.127 1.00 14.52  ? 30   THR B CG2 1 
ATOM   786  N N   . SER B 1 30 ? 10.076 33.415 36.419 1.00 10.84  ? 31   SER B N   1 
ATOM   787  C CA  . SER B 1 30 ? 9.229  33.200 35.237 1.00 15.41  ? 31   SER B CA  1 
ATOM   788  C C   . SER B 1 30 ? 9.350  31.788 34.696 1.00 12.17  ? 31   SER B C   1 
ATOM   789  O O   . SER B 1 30 ? 10.373 31.103 34.688 1.00 11.67  ? 31   SER B O   1 
ATOM   790  C CB  . SER B 1 30 ? 9.627  34.221 34.163 1.00 20.60  ? 31   SER B CB  1 
ATOM   791  O OG  . SER B 1 30 ? 9.038  33.904 32.916 1.00 16.71  ? 31   SER B OG  1 
ATOM   792  N N   . GLY B 1 31 ? 8.244  31.282 34.157 1.00 12.17  ? 32   GLY B N   1 
ATOM   793  C CA  . GLY B 1 31 ? 8.238  29.992 33.499 1.00 14.29  ? 32   GLY B CA  1 
ATOM   794  C C   . GLY B 1 31 ? 9.122  29.960 32.252 1.00 17.25  ? 32   GLY B C   1 
ATOM   795  O O   . GLY B 1 31 ? 9.442  28.858 31.798 1.00 17.61  ? 32   GLY B O   1 
ATOM   796  N N   . LYS B 1 32 ? 9.509  31.120 31.731 1.00 13.96  ? 33   LYS B N   1 
ATOM   797  C CA  . LYS B 1 32 ? 10.485 31.178 30.637 1.00 13.24  ? 33   LYS B CA  1 
ATOM   798  C C   . LYS B 1 32 ? 11.853 30.636 31.042 1.00 11.93  ? 33   LYS B C   1 
ATOM   799  O O   . LYS B 1 32 ? 12.576 30.109 30.189 1.00 14.51  ? 33   LYS B O   1 
ATOM   800  C CB  . LYS B 1 32 ? 10.675 32.604 30.139 1.00 21.66  ? 33   LYS B CB  1 
ATOM   801  C CG  . LYS B 1 32 ? 9.409  33.182 29.477 1.00 21.63  ? 33   LYS B CG  1 
ATOM   802  C CD  . LYS B 1 32 ? 9.786  34.554 28.945 1.00 20.71  ? 33   LYS B CD  1 
ATOM   803  C CE  . LYS B 1 32 ? 10.371 35.449 30.029 1.00 30.41  ? 33   LYS B CE  1 
ATOM   804  N NZ  . LYS B 1 32 ? 9.498  36.624 30.311 1.00 49.64  ? 33   LYS B NZ  1 
ATOM   805  N N   . CYS B 1 33 ? 12.172 30.746 32.332 1.00 14.62  ? 34   CYS B N   1 
ATOM   806  C CA  . CYS B 1 33 ? 13.436 30.211 32.831 1.00 12.24  ? 34   CYS B CA  1 
ATOM   807  C C   . CYS B 1 33 ? 13.457 28.691 32.773 1.00 12.93  ? 34   CYS B C   1 
ATOM   808  O O   . CYS B 1 33 ? 12.455 28.008 32.972 1.00 15.93  ? 34   CYS B O   1 
ATOM   809  C CB  . CYS B 1 33 ? 13.715 30.637 34.272 1.00 10.19  ? 34   CYS B CB  1 
ATOM   810  S SG  . CYS B 1 33 ? 13.743 32.421 34.531 1.00 10.95  ? 34   CYS B SG  1 
ATOM   811  N N   . SER B 1 34 ? 14.608 28.098 32.457 1.00 12.48  ? 35   SER B N   1 
ATOM   812  C CA  . SER B 1 34 ? 14.679 26.642 32.326 1.00 16.05  ? 35   SER B CA  1 
ATOM   813  C C   . SER B 1 34 ? 14.435 25.905 33.634 1.00 15.86  ? 35   SER B C   1 
ATOM   814  O O   . SER B 1 34 ? 13.860 24.818 33.624 1.00 18.52  ? 35   SER B O   1 
ATOM   815  C CB  . SER B 1 34 ? 16.075 26.193 31.831 1.00 17.39  ? 35   SER B CB  1 
ATOM   816  O OG  . SER B 1 34 ? 16.251 26.521 30.468 1.00 36.38  ? 35   SER B OG  1 
ATOM   817  N N   . ASN B 1 35 ? 14.885 26.446 34.769 1.00 12.14  ? 36   ASN B N   1 
ATOM   818  C CA  . ASN B 1 35 ? 14.725 25.857 36.076 1.00 12.75  ? 36   ASN B CA  1 
ATOM   819  C C   . ASN B 1 35 ? 13.586 26.535 36.849 1.00 14.26  ? 36   ASN B C   1 
ATOM   820  O O   . ASN B 1 35 ? 13.487 27.762 36.847 1.00 13.55  ? 36   ASN B O   1 
ATOM   821  C CB  . ASN B 1 35 ? 16.014 25.975 36.902 1.00 15.99  ? 36   ASN B CB  1 
ATOM   822  C CG  . ASN B 1 35 ? 17.177 25.332 36.150 1.00 16.99  ? 36   ASN B CG  1 
ATOM   823  O OD1 . ASN B 1 35 ? 17.020 24.196 35.676 1.00 17.33  ? 36   ASN B OD1 1 
ATOM   824  N ND2 . ASN B 1 35 ? 18.288 26.024 36.034 1.00 13.09  ? 36   ASN B ND2 1 
ATOM   825  N N   . PRO B 1 36 ? 12.761 25.751 37.511 1.00 14.62  ? 37   PRO B N   1 
ATOM   826  C CA  . PRO B 1 36 ? 11.739 26.391 38.367 1.00 11.35  ? 37   PRO B CA  1 
ATOM   827  C C   . PRO B 1 36 ? 12.449 26.934 39.597 1.00 13.49  ? 37   PRO B C   1 
ATOM   828  O O   . PRO B 1 36 ? 13.437 26.350 40.027 1.00 13.41  ? 37   PRO B O   1 
ATOM   829  C CB  . PRO B 1 36 ? 10.850 25.222 38.789 1.00 14.24  ? 37   PRO B CB  1 
ATOM   830  C CG  . PRO B 1 36 ? 11.786 24.054 38.795 1.00 20.80  ? 37   PRO B CG  1 
ATOM   831  C CD  . PRO B 1 36 ? 12.679 24.286 37.579 1.00 16.18  ? 37   PRO B CD  1 
ATOM   832  N N   . ALA B 1 37 ? 11.968 28.018 40.185 1.00 10.93  ? 38   ALA B N   1 
ATOM   833  C CA  . ALA B 1 37 ? 12.655 28.470 41.389 1.00 10.55  ? 38   ALA B CA  1 
ATOM   834  C C   . ALA B 1 37 ? 11.757 29.447 42.145 1.00 11.87  ? 38   ALA B C   1 
ATOM   835  O O   . ALA B 1 37 ? 10.956 30.189 41.600 1.00 12.35  ? 38   ALA B O   1 
ATOM   836  C CB  . ALA B 1 37 ? 13.979 29.172 41.084 1.00 11.75  ? 38   ALA B CB  1 
ATOM   837  N N   . VAL B 1 38 ? 11.945 29.432 43.455 1.00 10.56  ? 39   VAL B N   1 
ATOM   838  C CA  . VAL B 1 38 ? 11.470 30.459 44.359 1.00 12.24  ? 39   VAL B CA  1 
ATOM   839  C C   . VAL B 1 38 ? 12.605 31.461 44.566 1.00 14.34  ? 39   VAL B C   1 
ATOM   840  O O   . VAL B 1 38 ? 13.743 30.990 44.715 1.00 14.08  ? 39   VAL B O   1 
ATOM   841  C CB  . VAL B 1 38 ? 11.104 29.824 45.721 1.00 14.35  ? 39   VAL B CB  1 
ATOM   842  C CG1 . VAL B 1 38 ? 10.863 30.967 46.711 1.00 17.43  ? 39   VAL B CG1 1 
ATOM   843  C CG2 . VAL B 1 38 ? 9.883  28.947 45.582 1.00 14.36  ? 39   VAL B CG2 1 
ATOM   844  N N   . VAL B 1 39 ? 12.348 32.762 44.546 1.00 11.07  ? 40   VAL B N   1 
ATOM   845  C CA  . VAL B 1 39 ? 13.378 33.750 44.876 1.00 9.56   ? 40   VAL B CA  1 
ATOM   846  C C   . VAL B 1 39 ? 12.955 34.427 46.179 1.00 7.94   ? 40   VAL B C   1 
ATOM   847  O O   . VAL B 1 39 ? 11.870 34.968 46.284 1.00 11.76  ? 40   VAL B O   1 
ATOM   848  C CB  . VAL B 1 39 ? 13.562 34.786 43.757 1.00 13.54  ? 40   VAL B CB  1 
ATOM   849  C CG1 . VAL B 1 39 ? 14.555 35.861 44.157 1.00 12.48  ? 40   VAL B CG1 1 
ATOM   850  C CG2 . VAL B 1 39 ? 14.020 34.048 42.492 1.00 11.84  ? 40   VAL B CG2 1 
ATOM   851  N N   . PHE B 1 40 ? 13.833 34.359 47.172 1.00 8.61   ? 41   PHE B N   1 
ATOM   852  C CA  . PHE B 1 40 ? 13.604 35.120 48.390 1.00 8.36   ? 41   PHE B CA  1 
ATOM   853  C C   . PHE B 1 40 ? 14.359 36.437 48.299 1.00 10.74  ? 41   PHE B C   1 
ATOM   854  O O   . PHE B 1 40 ? 15.566 36.478 48.010 1.00 10.89  ? 41   PHE B O   1 
ATOM   855  C CB  . PHE B 1 40 ? 14.095 34.316 49.607 1.00 9.64   ? 41   PHE B CB  1 
ATOM   856  C CG  . PHE B 1 40 ? 13.213 33.125 49.907 1.00 6.87   ? 41   PHE B CG  1 
ATOM   857  C CD1 . PHE B 1 40 ? 11.887 33.326 50.276 1.00 9.17   ? 41   PHE B CD1 1 
ATOM   858  C CD2 . PHE B 1 40 ? 13.702 31.830 49.853 1.00 10.18  ? 41   PHE B CD2 1 
ATOM   859  C CE1 . PHE B 1 40 ? 11.045 32.274 50.538 1.00 7.84   ? 41   PHE B CE1 1 
ATOM   860  C CE2 . PHE B 1 40 ? 12.849 30.775 50.151 1.00 10.01  ? 41   PHE B CE2 1 
ATOM   861  C CZ  . PHE B 1 40 ? 11.536 30.975 50.507 1.00 12.67  ? 41   PHE B CZ  1 
ATOM   862  N N   . VAL B 1 41 ? 13.636 37.526 48.542 1.00 9.25   ? 42   VAL B N   1 
ATOM   863  C CA  . VAL B 1 41 ? 14.271 38.852 48.476 1.00 10.17  ? 42   VAL B CA  1 
ATOM   864  C C   . VAL B 1 41 ? 14.607 39.283 49.912 1.00 12.38  ? 42   VAL B C   1 
ATOM   865  O O   . VAL B 1 41 ? 13.678 39.326 50.738 1.00 11.68  ? 42   VAL B O   1 
ATOM   866  C CB  . VAL B 1 41 ? 13.372 39.861 47.775 1.00 10.07  ? 42   VAL B CB  1 
ATOM   867  C CG1 . VAL B 1 41 ? 14.032 41.231 47.725 1.00 13.48  ? 42   VAL B CG1 1 
ATOM   868  C CG2 . VAL B 1 41 ? 13.021 39.422 46.352 1.00 14.87  ? 42   VAL B CG2 1 
ATOM   869  N N   . THR B 1 42 ? 15.862 39.542 50.196 1.00 12.83  ? 43   THR B N   1 
ATOM   870  C CA  . THR B 1 42 ? 16.323 39.782 51.562 1.00 13.70  ? 43   THR B CA  1 
ATOM   871  C C   . THR B 1 42 ? 16.317 41.247 51.949 1.00 14.32  ? 43   THR B C   1 
ATOM   872  O O   . THR B 1 42 ? 15.994 42.117 51.149 1.00 11.60  ? 43   THR B O   1 
ATOM   873  C CB  . THR B 1 42 ? 17.763 39.270 51.734 1.00 14.06  ? 43   THR B CB  1 
ATOM   874  O OG1 . THR B 1 42 ? 18.648 40.155 51.004 1.00 12.48  ? 43   THR B OG1 1 
ATOM   875  C CG2 . THR B 1 42 ? 17.975 37.870 51.197 1.00 13.22  ? 43   THR B CG2 1 
ATOM   876  N N   . ARG B 1 43 ? 16.717 41.495 53.195 1.00 21.20  ? 44   ARG B N   1 
ATOM   877  C CA  . ARG B 1 43 ? 16.799 42.856 53.698 1.00 20.71  ? 44   ARG B CA  1 
ATOM   878  C C   . ARG B 1 43 ? 17.621 43.789 52.806 1.00 13.41  ? 44   ARG B C   1 
ATOM   879  O O   . ARG B 1 43 ? 17.205 44.939 52.607 1.00 21.40  ? 44   ARG B O   1 
ATOM   880  C CB  . ARG B 1 43 ? 17.408 42.852 55.108 1.00 24.96  ? 44   ARG B CB  1 
ATOM   881  C CG  . ARG B 1 43 ? 16.753 41.839 56.039 1.00 27.86  ? 44   ARG B CG  1 
ATOM   882  C CD  . ARG B 1 43 ? 17.563 41.712 57.324 1.00 39.32  ? 44   ARG B CD  1 
ATOM   883  N NE  . ARG B 1 43 ? 18.928 41.252 57.093 1.00 24.96  ? 44   ARG B NE  1 
ATOM   884  C CZ  . ARG B 1 43 ? 19.852 41.174 58.048 1.00 33.51  ? 44   ARG B CZ  1 
ATOM   885  N NH1 . ARG B 1 43 ? 19.595 41.517 59.303 1.00 37.42  ? 44   ARG B NH1 1 
ATOM   886  N NH2 . ARG B 1 43 ? 21.073 40.743 57.744 1.00 31.18  ? 44   ARG B NH2 1 
ATOM   887  N N   . LYS B 1 44 ? 18.741 43.294 52.316 1.00 15.03  ? 45   LYS B N   1 
ATOM   888  C CA  . LYS B 1 44 ? 19.640 44.075 51.465 1.00 14.56  ? 45   LYS B CA  1 
ATOM   889  C C   . LYS B 1 44 ? 19.303 43.943 49.984 1.00 10.34  ? 45   LYS B C   1 
ATOM   890  O O   . LYS B 1 44 ? 20.106 44.273 49.126 1.00 13.30  ? 45   LYS B O   1 
ATOM   891  C CB  . LYS B 1 44 ? 21.094 43.647 51.700 1.00 22.71  ? 45   LYS B CB  1 
ATOM   892  C CG  A LYS B 1 44 ? 21.685 43.895 53.074 0.50 41.90  ? 45   LYS B CG  1 
ATOM   893  C CG  B LYS B 1 44 ? 21.579 44.150 53.065 0.50 39.35  ? 45   LYS B CG  1 
ATOM   894  C CD  A LYS B 1 44 ? 23.015 43.153 53.228 0.50 47.45  ? 45   LYS B CD  1 
ATOM   895  C CD  B LYS B 1 44 ? 22.995 43.713 53.390 0.50 47.37  ? 45   LYS B CD  1 
ATOM   896  C CE  A LYS B 1 44 ? 23.624 43.396 54.600 0.50 49.99  ? 45   LYS B CE  1 
ATOM   897  C CE  B LYS B 1 44 ? 23.291 43.826 54.881 0.50 47.36  ? 45   LYS B CE  1 
ATOM   898  N NZ  A LYS B 1 44 ? 22.908 42.662 55.680 0.50 39.10  ? 45   LYS B NZ  1 
ATOM   899  N NZ  B LYS B 1 44 ? 22.608 44.983 55.517 0.50 47.36  ? 45   LYS B NZ  1 
ATOM   900  N N   . ASN B 1 45 ? 18.092 43.452 49.705 1.00 10.83  ? 46   ASN B N   1 
ATOM   901  C CA  . ASN B 1 45 ? 17.594 43.267 48.343 1.00 9.40   ? 46   ASN B CA  1 
ATOM   902  C C   . ASN B 1 45 ? 18.383 42.251 47.534 1.00 11.53  ? 46   ASN B C   1 
ATOM   903  O O   . ASN B 1 45 ? 18.408 42.330 46.298 1.00 11.99  ? 46   ASN B O   1 
ATOM   904  C CB  . ASN B 1 45 ? 17.554 44.590 47.577 1.00 11.98  ? 46   ASN B CB  1 
ATOM   905  C CG  . ASN B 1 45 ? 16.448 45.477 48.122 1.00 16.44  ? 46   ASN B CG  1 
ATOM   906  O OD1 . ASN B 1 45 ? 15.303 45.012 48.270 1.00 18.20  ? 46   ASN B OD1 1 
ATOM   907  N ND2 . ASN B 1 45 ? 16.816 46.708 48.411 1.00 16.32  ? 46   ASN B ND2 1 
ATOM   908  N N   . ARG B 1 46 ? 18.986 41.278 48.198 1.00 10.61  ? 47   ARG B N   1 
ATOM   909  C CA  . ARG B 1 46 ? 19.591 40.145 47.499 1.00 10.59  ? 47   ARG B CA  1 
ATOM   910  C C   . ARG B 1 46 ? 18.458 39.261 46.982 1.00 12.97  ? 47   ARG B C   1 
ATOM   911  O O   . ARG B 1 46 ? 17.378 39.109 47.615 1.00 15.11  ? 47   ARG B O   1 
ATOM   912  C CB  . ARG B 1 46 ? 20.528 39.348 48.403 1.00 11.62  ? 47   ARG B CB  1 
ATOM   913  C CG  . ARG B 1 46 ? 21.705 40.094 49.002 1.00 18.51  ? 47   ARG B CG  1 
ATOM   914  C CD  . ARG B 1 46 ? 22.162 39.534 50.351 1.00 32.40  ? 47   ARG B CD  1 
ATOM   915  N NE  . ARG B 1 46 ? 22.266 38.102 50.346 1.00 36.99  ? 47   ARG B NE  1 
ATOM   916  C CZ  . ARG B 1 46 ? 22.053 37.130 51.186 1.00 30.29  ? 47   ARG B CZ  1 
ATOM   917  N NH1 . ARG B 1 46 ? 21.635 37.301 52.433 1.00 39.52  ? 47   ARG B NH1 1 
ATOM   918  N NH2 . ARG B 1 46 ? 22.264 35.870 50.812 1.00 35.07  ? 47   ARG B NH2 1 
ATOM   919  N N   . GLN B 1 47 ? 18.668 38.701 45.803 1.00 11.98  ? 48   GLN B N   1 
ATOM   920  C CA  . GLN B 1 47 ? 17.660 37.817 45.210 1.00 12.49  ? 48   GLN B CA  1 
ATOM   921  C C   . GLN B 1 47 ? 18.184 36.391 45.251 1.00 11.02  ? 48   GLN B C   1 
ATOM   922  O O   . GLN B 1 47 ? 18.974 36.018 44.385 1.00 12.63  ? 48   GLN B O   1 
ATOM   923  C CB  . GLN B 1 47 ? 17.322 38.183 43.759 1.00 10.61  ? 48   GLN B CB  1 
ATOM   924  C CG  . GLN B 1 47 ? 16.508 39.505 43.767 1.00 12.52  ? 48   GLN B CG  1 
ATOM   925  C CD  . GLN B 1 47 ? 15.935 39.785 42.386 1.00 24.43  ? 48   GLN B CD  1 
ATOM   926  O OE1 . GLN B 1 47 ? 16.149 39.070 41.397 1.00 17.04  ? 48   GLN B OE1 1 
ATOM   927  N NE2 . GLN B 1 47 ? 15.173 40.880 42.353 1.00 28.01  ? 48   GLN B NE2 1 
ATOM   928  N N   . VAL B 1 48 ? 17.804 35.651 46.270 1.00 10.93  ? 49   VAL B N   1 
ATOM   929  C CA  . VAL B 1 48 ? 18.343 34.336 46.543 1.00 7.46   ? 49   VAL B CA  1 
ATOM   930  C C   . VAL B 1 48 ? 17.425 33.230 46.037 1.00 10.33  ? 49   VAL B C   1 
ATOM   931  O O   . VAL B 1 48 ? 16.239 33.116 46.371 1.00 11.07  ? 49   VAL B O   1 
ATOM   932  C CB  . VAL B 1 48 ? 18.548 34.152 48.054 1.00 10.29  ? 49   VAL B CB  1 
ATOM   933  C CG1 . VAL B 1 48 ? 19.179 32.813 48.395 1.00 11.66  ? 49   VAL B CG1 1 
ATOM   934  C CG2 . VAL B 1 48 ? 19.431 35.262 48.625 1.00 12.17  ? 49   VAL B CG2 1 
ATOM   935  N N   . CYS B 1 49 ? 17.983 32.369 45.193 1.00 9.05   ? 50   CYS B N   1 
ATOM   936  C CA  . CYS B 1 49 ? 17.228 31.264 44.600 1.00 9.03   ? 50   CYS B CA  1 
ATOM   937  C C   . CYS B 1 49 ? 17.092 30.070 45.523 1.00 10.80  ? 50   CYS B C   1 
ATOM   938  O O   . CYS B 1 49 ? 18.063 29.727 46.201 1.00 10.49  ? 50   CYS B O   1 
ATOM   939  C CB  . CYS B 1 49 ? 17.969 30.760 43.349 1.00 9.01   ? 50   CYS B CB  1 
ATOM   940  S SG  . CYS B 1 49 ? 18.154 32.025 42.056 1.00 11.53  ? 50   CYS B SG  1 
ATOM   941  N N   . ALA B 1 50 ? 15.926 29.433 45.516 1.00 10.91  ? 51   ALA B N   1 
ATOM   942  C CA  . ALA B 1 50 ? 15.653 28.335 46.427 1.00 9.84   ? 51   ALA B CA  1 
ATOM   943  C C   . ALA B 1 50 ? 14.759 27.287 45.759 1.00 11.62  ? 51   ALA B C   1 
ATOM   944  O O   . ALA B 1 50 ? 13.974 27.578 44.843 1.00 10.54  ? 51   ALA B O   1 
ATOM   945  C CB  . ALA B 1 50 ? 15.006 28.851 47.704 1.00 13.46  ? 51   ALA B CB  1 
ATOM   946  N N   . ASN B 1 51 ? 14.912 26.041 46.228 1.00 13.87  ? 52   ASN B N   1 
ATOM   947  C CA  . ASN B 1 51 ? 14.190 24.930 45.608 1.00 17.45  ? 52   ASN B CA  1 
ATOM   948  C C   . ASN B 1 51 ? 12.727 24.900 46.030 1.00 18.17  ? 52   ASN B C   1 
ATOM   949  O O   . ASN B 1 51 ? 12.401 24.725 47.215 1.00 15.21  ? 52   ASN B O   1 
ATOM   950  C CB  . ASN B 1 51 ? 14.869 23.601 45.992 1.00 19.47  ? 52   ASN B CB  1 
ATOM   951  C CG  . ASN B 1 51 ? 14.240 22.411 45.275 1.00 14.59  ? 52   ASN B CG  1 
ATOM   952  O OD1 . ASN B 1 51 ? 13.096 22.402 44.859 1.00 26.09  ? 52   ASN B OD1 1 
ATOM   953  N ND2 . ASN B 1 51 ? 15.048 21.363 45.108 1.00 27.27  ? 52   ASN B ND2 1 
ATOM   954  N N   . PRO B 1 52 ? 11.820 25.043 45.070 1.00 17.10  ? 53   PRO B N   1 
ATOM   955  C CA  . PRO B 1 52 ? 10.403 25.067 45.418 1.00 17.06  ? 53   PRO B CA  1 
ATOM   956  C C   . PRO B 1 52 ? 9.948  23.814 46.158 1.00 17.27  ? 53   PRO B C   1 
ATOM   957  O O   . PRO B 1 52 ? 8.928  23.814 46.830 1.00 19.17  ? 53   PRO B O   1 
ATOM   958  C CB  . PRO B 1 52 ? 9.731  25.140 44.036 1.00 22.84  ? 53   PRO B CB  1 
ATOM   959  C CG  . PRO B 1 52 ? 10.759 25.766 43.138 1.00 19.65  ? 53   PRO B CG  1 
ATOM   960  C CD  . PRO B 1 52 ? 12.062 25.177 43.624 1.00 16.89  ? 53   PRO B CD  1 
ATOM   961  N N   . GLU B 1 53 ? 10.684 22.708 46.046 1.00 22.99  ? 54   GLU B N   1 
ATOM   962  C CA  . GLU B 1 53 ? 10.194 21.458 46.616 1.00 20.05  ? 54   GLU B CA  1 
ATOM   963  C C   . GLU B 1 53 ? 10.717 21.162 48.009 1.00 28.26  ? 54   GLU B C   1 
ATOM   964  O O   . GLU B 1 53 ? 10.289 20.201 48.670 1.00 29.88  ? 54   GLU B O   1 
ATOM   965  C CB  . GLU B 1 53 ? 10.552 20.322 45.646 1.00 29.14  ? 54   GLU B CB  1 
ATOM   966  C CG  . GLU B 1 53 ? 9.640  20.293 44.419 1.00 36.89  ? 54   GLU B CG  1 
ATOM   967  C CD  . GLU B 1 53 ? 10.063 19.212 43.437 1.00 47.86  ? 54   GLU B CD  1 
ATOM   968  O OE1 . GLU B 1 53 ? 10.198 18.041 43.845 1.00 62.68  ? 54   GLU B OE1 1 
ATOM   969  O OE2 . GLU B 1 53 ? 10.267 19.547 42.248 1.00 65.55  ? 54   GLU B OE2 1 
ATOM   970  N N   . LYS B 1 54 ? 11.657 21.959 48.493 1.00 18.49  ? 55   LYS B N   1 
ATOM   971  C CA  . LYS B 1 54 ? 12.232 21.793 49.815 1.00 19.07  ? 55   LYS B CA  1 
ATOM   972  C C   . LYS B 1 54 ? 11.241 22.248 50.877 1.00 19.34  ? 55   LYS B C   1 
ATOM   973  O O   . LYS B 1 54 ? 10.541 23.262 50.745 1.00 16.46  ? 55   LYS B O   1 
ATOM   974  C CB  . LYS B 1 54 ? 13.539 22.569 49.913 1.00 23.26  ? 55   LYS B CB  1 
ATOM   975  C CG  . LYS B 1 54 ? 14.793 21.726 49.737 1.00 31.83  ? 55   LYS B CG  1 
ATOM   976  C CD  . LYS B 1 54 ? 16.019 22.569 49.469 1.00 44.70  ? 55   LYS B CD  1 
ATOM   977  C CE  . LYS B 1 54 ? 16.868 22.006 48.338 1.00 48.83  ? 55   LYS B CE  1 
ATOM   978  N NZ  . LYS B 1 54 ? 18.040 22.877 48.050 1.00 28.37  ? 55   LYS B NZ  1 
ATOM   979  N N   . LYS B 1 55 ? 11.167 21.499 51.971 1.00 18.64  ? 56   LYS B N   1 
ATOM   980  C CA  . LYS B 1 55 ? 10.207 21.795 53.019 1.00 17.95  ? 56   LYS B CA  1 
ATOM   981  C C   . LYS B 1 55 ? 10.394 23.177 53.623 1.00 16.51  ? 56   LYS B C   1 
ATOM   982  O O   . LYS B 1 55 ? 9.394  23.886 53.814 1.00 17.64  ? 56   LYS B O   1 
ATOM   983  C CB  . LYS B 1 55 ? 10.303 20.720 54.112 1.00 19.84  ? 56   LYS B CB  1 
ATOM   984  C CG  . LYS B 1 55 ? 9.208  20.838 55.167 1.00 21.50  ? 56   LYS B CG  1 
ATOM   985  C CD  . LYS B 1 55 ? 9.521  19.886 56.320 1.00 38.56  ? 56   LYS B CD  1 
ATOM   986  C CE  . LYS B 1 55 ? 8.301  19.608 57.188 1.00 44.50  ? 56   LYS B CE  1 
ATOM   987  N NZ  . LYS B 1 55 ? 7.115  19.225 56.373 1.00 67.29  ? 56   LYS B NZ  1 
ATOM   988  N N   . TRP B 1 56 ? 11.619 23.611 53.925 1.00 16.98  ? 57   TRP B N   1 
ATOM   989  C CA  . TRP B 1 56 ? 11.733 24.951 54.516 1.00 13.97  ? 57   TRP B CA  1 
ATOM   990  C C   . TRP B 1 56 ? 11.248 26.041 53.559 1.00 12.29  ? 57   TRP B C   1 
ATOM   991  O O   . TRP B 1 56 ? 10.729 27.085 53.981 1.00 13.33  ? 57   TRP B O   1 
ATOM   992  C CB  . TRP B 1 56 ? 13.155 25.247 54.903 1.00 13.07  ? 57   TRP B CB  1 
ATOM   993  C CG  . TRP B 1 56 ? 14.187 25.516 53.860 1.00 18.10  ? 57   TRP B CG  1 
ATOM   994  C CD1 . TRP B 1 56 ? 15.023 24.603 53.272 1.00 20.68  ? 57   TRP B CD1 1 
ATOM   995  C CD2 . TRP B 1 56 ? 14.531 26.779 53.264 1.00 16.74  ? 57   TRP B CD2 1 
ATOM   996  N NE1 . TRP B 1 56 ? 15.853 25.213 52.361 1.00 16.24  ? 57   TRP B NE1 1 
ATOM   997  C CE2 . TRP B 1 56 ? 15.569 26.557 52.337 1.00 14.91  ? 57   TRP B CE2 1 
ATOM   998  C CE3 . TRP B 1 56 ? 14.042 28.076 53.445 1.00 16.33  ? 57   TRP B CE3 1 
ATOM   999  C CZ2 . TRP B 1 56 ? 16.150 27.566 51.571 1.00 12.92  ? 57   TRP B CZ2 1 
ATOM   1000 C CZ3 . TRP B 1 56 ? 14.604 29.091 52.699 1.00 13.96  ? 57   TRP B CZ3 1 
ATOM   1001 C CH2 . TRP B 1 56 ? 15.643 28.830 51.778 1.00 17.74  ? 57   TRP B CH2 1 
ATOM   1002 N N   . VAL B 1 57 ? 11.448 25.806 52.259 1.00 15.19  ? 58   VAL B N   1 
ATOM   1003 C CA  . VAL B 1 57 ? 10.983 26.785 51.272 1.00 14.26  ? 58   VAL B CA  1 
ATOM   1004 C C   . VAL B 1 57 ? 9.471  26.894 51.252 1.00 11.25  ? 58   VAL B C   1 
ATOM   1005 O O   . VAL B 1 57 ? 8.934  27.993 51.300 1.00 14.82  ? 58   VAL B O   1 
ATOM   1006 C CB  . VAL B 1 57 ? 11.523 26.424 49.870 1.00 12.83  ? 58   VAL B CB  1 
ATOM   1007 C CG1 . VAL B 1 57 ? 10.912 27.324 48.820 1.00 11.60  ? 58   VAL B CG1 1 
ATOM   1008 C CG2 . VAL B 1 57 ? 13.044 26.518 49.925 1.00 11.54  ? 58   VAL B CG2 1 
ATOM   1009 N N   . ARG B 1 58 ? 8.769  25.764 51.230 1.00 13.85  ? 59   ARG B N   1 
ATOM   1010 C CA  . ARG B 1 58 ? 7.308  25.764 51.352 1.00 15.56  ? 59   ARG B CA  1 
ATOM   1011 C C   . ARG B 1 58 ? 6.836  26.410 52.646 1.00 16.96  ? 59   ARG B C   1 
ATOM   1012 O O   . ARG B 1 58 ? 5.869  27.186 52.611 1.00 17.68  ? 59   ARG B O   1 
ATOM   1013 C CB  . ARG B 1 58 ? 6.808  24.304 51.234 1.00 16.70  ? 59   ARG B CB  1 
ATOM   1014 C CG  . ARG B 1 58 ? 6.931  23.780 49.796 1.00 23.62  ? 59   ARG B CG  1 
ATOM   1015 C CD  . ARG B 1 58 ? 6.471  22.327 49.694 1.00 35.66  ? 59   ARG B CD  1 
ATOM   1016 N NE  . ARG B 1 58 ? 7.557  21.405 50.021 1.00 48.67  ? 59   ARG B NE  1 
ATOM   1017 C CZ  . ARG B 1 58 ? 7.571  20.543 51.031 1.00 53.64  ? 59   ARG B CZ  1 
ATOM   1018 N NH1 . ARG B 1 58 ? 6.542  20.463 51.864 1.00 56.02  ? 59   ARG B NH1 1 
ATOM   1019 N NH2 . ARG B 1 58 ? 8.624  19.755 51.227 1.00 44.61  ? 59   ARG B NH2 1 
ATOM   1020 N N   . GLU B 1 59 ? 7.546  26.097 53.735 1.00 12.35  ? 60   GLU B N   1 
ATOM   1021 C CA  . GLU B 1 59 ? 7.180  26.655 55.034 1.00 10.19  ? 60   GLU B CA  1 
ATOM   1022 C C   . GLU B 1 59 ? 7.304  28.170 55.013 1.00 12.80  ? 60   GLU B C   1 
ATOM   1023 O O   . GLU B 1 59 ? 6.439  28.862 55.517 1.00 14.15  ? 60   GLU B O   1 
ATOM   1024 C CB  . GLU B 1 59 ? 8.027  26.062 56.166 1.00 14.47  ? 60   GLU B CB  1 
ATOM   1025 C CG  . GLU B 1 59 ? 7.774  24.570 56.351 1.00 14.77  ? 60   GLU B CG  1 
ATOM   1026 C CD  . GLU B 1 59 ? 8.657  23.966 57.424 1.00 29.31  ? 60   GLU B CD  1 
ATOM   1027 O OE1 . GLU B 1 59 ? 9.754  24.507 57.675 1.00 24.02  ? 60   GLU B OE1 1 
ATOM   1028 O OE2 . GLU B 1 59 ? 8.218  22.934 57.987 1.00 27.42  ? 60   GLU B OE2 1 
ATOM   1029 N N   . TYR B 1 60 ? 8.392  28.705 54.438 1.00 14.46  ? 61   TYR B N   1 
ATOM   1030 C CA  . TYR B 1 60 ? 8.563  30.142 54.399 1.00 11.51  ? 61   TYR B CA  1 
ATOM   1031 C C   . TYR B 1 60 ? 7.540  30.818 53.495 1.00 11.59  ? 61   TYR B C   1 
ATOM   1032 O O   . TYR B 1 60 ? 7.020  31.890 53.805 1.00 12.71  ? 61   TYR B O   1 
ATOM   1033 C CB  . TYR B 1 60 ? 9.975  30.500 53.895 1.00 10.99  ? 61   TYR B CB  1 
ATOM   1034 C CG  . TYR B 1 60 ? 11.089 30.385 54.919 1.00 8.25   ? 61   TYR B CG  1 
ATOM   1035 C CD1 . TYR B 1 60 ? 10.982 29.650 56.087 1.00 10.83  ? 61   TYR B CD1 1 
ATOM   1036 C CD2 . TYR B 1 60 ? 12.286 31.054 54.652 1.00 9.28   ? 61   TYR B CD2 1 
ATOM   1037 C CE1 . TYR B 1 60 ? 12.030 29.569 56.999 1.00 13.08  ? 61   TYR B CE1 1 
ATOM   1038 C CE2 . TYR B 1 60 ? 13.349 30.972 55.561 1.00 9.97   ? 61   TYR B CE2 1 
ATOM   1039 C CZ  . TYR B 1 60 ? 13.218 30.239 56.709 1.00 13.87  ? 61   TYR B CZ  1 
ATOM   1040 O OH  . TYR B 1 60 ? 14.275 30.181 57.591 1.00 14.28  ? 61   TYR B OH  1 
ATOM   1041 N N   . ILE B 1 61 ? 7.254  30.184 52.354 1.00 13.42  ? 62   ILE B N   1 
ATOM   1042 C CA  . ILE B 1 61 ? 6.188  30.716 51.511 1.00 10.78  ? 62   ILE B CA  1 
ATOM   1043 C C   . ILE B 1 61 ? 4.857  30.704 52.270 1.00 11.65  ? 62   ILE B C   1 
ATOM   1044 O O   . ILE B 1 61 ? 4.134  31.703 52.254 1.00 13.32  ? 62   ILE B O   1 
ATOM   1045 C CB  . ILE B 1 61 ? 6.088  29.926 50.209 1.00 13.87  ? 62   ILE B CB  1 
ATOM   1046 C CG1 . ILE B 1 61 ? 7.267  30.207 49.279 1.00 16.86  ? 62   ILE B CG1 1 
ATOM   1047 C CG2 . ILE B 1 61 ? 4.744  30.199 49.520 1.00 15.99  ? 62   ILE B CG2 1 
ATOM   1048 C CD1 . ILE B 1 61 ? 7.341  29.335 48.048 1.00 20.78  ? 62   ILE B CD1 1 
ATOM   1049 N N   . ASN B 1 62 ? 4.549  29.606 52.966 1.00 12.56  ? 63   ASN B N   1 
ATOM   1050 C CA  . ASN B 1 62 ? 3.334  29.585 53.780 1.00 13.70  ? 63   ASN B CA  1 
ATOM   1051 C C   . ASN B 1 62 ? 3.299  30.744 54.766 1.00 19.18  ? 63   ASN B C   1 
ATOM   1052 O O   . ASN B 1 62 ? 2.274  31.413 54.915 1.00 15.85  ? 63   ASN B O   1 
ATOM   1053 C CB  . ASN B 1 62 ? 3.245  28.309 54.598 1.00 17.34  ? 63   ASN B CB  1 
ATOM   1054 C CG  . ASN B 1 62 ? 2.927  27.056 53.815 1.00 32.38  ? 63   ASN B CG  1 
ATOM   1055 O OD1 . ASN B 1 62 ? 2.468  27.156 52.678 1.00 33.73  ? 63   ASN B OD1 1 
ATOM   1056 N ND2 . ASN B 1 62 ? 3.161  25.907 54.441 1.00 43.25  ? 63   ASN B ND2 1 
ATOM   1057 N N   . SER B 1 63 ? 4.414  30.967 55.481 1.00 15.49  ? 64   SER B N   1 
ATOM   1058 C CA  . SER B 1 63 ? 4.434  32.077 56.432 1.00 16.16  ? 64   SER B CA  1 
ATOM   1059 C C   . SER B 1 63 ? 4.203  33.422 55.757 1.00 14.65  ? 64   SER B C   1 
ATOM   1060 O O   . SER B 1 63 ? 3.531  34.303 56.304 1.00 17.48  ? 64   SER B O   1 
ATOM   1061 C CB  . SER B 1 63 ? 5.743  32.130 57.237 1.00 17.38  ? 64   SER B CB  1 
ATOM   1062 O OG  . SER B 1 63 ? 6.792  32.674 56.468 1.00 20.15  ? 64   SER B OG  1 
ATOM   1063 N N   . LEU B 1 64 ? 4.772  33.620 54.566 1.00 11.93  ? 65   LEU B N   1 
ATOM   1064 C CA  . LEU B 1 64 ? 4.645  34.908 53.890 1.00 11.22  ? 65   LEU B CA  1 
ATOM   1065 C C   . LEU B 1 64 ? 3.212  35.085 53.359 1.00 17.52  ? 65   LEU B C   1 
ATOM   1066 O O   . LEU B 1 64 ? 2.746  36.210 53.275 1.00 17.51  ? 65   LEU B O   1 
ATOM   1067 C CB  . LEU B 1 64 ? 5.666  35.019 52.757 1.00 15.24  ? 65   LEU B CB  1 
ATOM   1068 C CG  . LEU B 1 64 ? 7.127  35.238 53.225 1.00 14.92  ? 65   LEU B CG  1 
ATOM   1069 C CD1 . LEU B 1 64 ? 8.133  34.876 52.149 1.00 16.61  ? 65   LEU B CD1 1 
ATOM   1070 C CD2 . LEU B 1 64 ? 7.307  36.675 53.643 1.00 15.80  ? 65   LEU B CD2 1 
ATOM   1071 N N   . GLU B 1 65 ? 2.551  33.978 53.029 1.00 16.73  ? 66   GLU B N   1 
ATOM   1072 C CA  . GLU B 1 65 ? 1.158  34.009 52.588 1.00 18.70  ? 66   GLU B CA  1 
ATOM   1073 C C   . GLU B 1 65 ? 0.227  34.292 53.762 1.00 24.63  ? 66   GLU B C   1 
ATOM   1074 O O   . GLU B 1 65 ? -0.877 34.852 53.636 1.00 30.63  ? 66   GLU B O   1 
ATOM   1075 C CB  . GLU B 1 65 ? 0.790  32.683 51.911 1.00 18.91  ? 66   GLU B CB  1 
ATOM   1076 C CG  . GLU B 1 65 ? 1.298  32.535 50.486 1.00 19.02  ? 66   GLU B CG  1 
ATOM   1077 C CD  . GLU B 1 65 ? 0.740  33.558 49.520 1.00 28.06  ? 66   GLU B CD  1 
ATOM   1078 O OE1 . GLU B 1 65 ? -0.470 33.852 49.603 1.00 29.90  ? 66   GLU B OE1 1 
ATOM   1079 O OE2 . GLU B 1 65 ? 1.505  34.090 48.690 1.00 41.81  ? 66   GLU B OE2 1 
ATOM   1080 N N   . MET B 1 66 ? 0.632  33.913 54.967 1.00 19.82  ? 67   MET B N   1 
ATOM   1081 C CA  . MET B 1 66 ? -0.222 34.027 56.141 1.00 18.07  ? 67   MET B CA  1 
ATOM   1082 C C   . MET B 1 66 ? -0.169 35.417 56.761 1.00 32.36  ? 67   MET B C   1 
ATOM   1083 O O   . MET B 1 66 ? -1.110 35.785 57.466 1.00 32.33  ? 67   MET B O   1 
ATOM   1084 C CB  . MET B 1 66 ? 0.159  33.004 57.219 1.00 21.30  ? 67   MET B CB  1 
ATOM   1085 C CG  . MET B 1 66 ? -0.014 31.553 56.818 1.00 27.80  ? 67   MET B CG  1 
ATOM   1086 S SD  . MET B 1 66 ? -1.740 31.102 56.538 1.00 30.50  ? 67   MET B SD  1 
ATOM   1087 C CE  . MET B 1 66 ? -2.334 31.020 58.230 1.00 51.54  ? 67   MET B CE  1 
ATOM   1088 N N   . SER B 1 67 ? 0.892  36.174 56.527 1.00 30.93  ? 68   SER B N   1 
ATOM   1089 C CA  . SER B 1 67 ? 1.009  37.519 57.089 1.00 44.07  ? 68   SER B CA  1 
ATOM   1090 C C   . SER B 1 67 ? 0.820  37.561 58.601 1.00 62.58  ? 68   SER B C   1 
ATOM   1091 O O   . SER B 1 67 ? 0.146  38.505 59.088 1.00 65.30  ? 68   SER B O   1 
ATOM   1092 C CB  . SER B 1 67 ? -0.012 38.448 56.418 1.00 36.05  ? 68   SER B CB  1 
ATOM   1093 O OG  . SER B 1 67 ? 0.109  38.387 55.010 1.00 50.97  ? 68   SER B OG  1 
ATOM   1094 O OXT . SER B 1 67 ? 1.330  36.679 59.322 1.00 78.40  ? 68   SER B OXT 1 
HETATM 1095 S S   . SO4 C 2 .  ? 22.981 43.041 35.928 1.00 93.57  ? 197  SO4 A S   1 
HETATM 1096 O O1  . SO4 C 2 .  ? 22.220 42.581 37.117 1.00 76.90  ? 197  SO4 A O1  1 
HETATM 1097 O O2  . SO4 C 2 .  ? 22.244 42.650 34.710 1.00 94.14  ? 197  SO4 A O2  1 
HETATM 1098 O O3  . SO4 C 2 .  ? 23.110 44.521 35.968 1.00 52.23  ? 197  SO4 A O3  1 
HETATM 1099 O O4  . SO4 C 2 .  ? 24.319 42.389 35.928 1.00 87.46  ? 197  SO4 A O4  1 
HETATM 1100 S S   . SO4 D 2 .  ? 16.456 55.662 26.702 1.00 46.72  ? 196  SO4 A S   1 
HETATM 1101 O O1  . SO4 D 2 .  ? 15.329 56.624 26.736 1.00 67.27  ? 196  SO4 A O1  1 
HETATM 1102 O O2  . SO4 D 2 .  ? 16.064 54.485 27.534 1.00 28.69  ? 196  SO4 A O2  1 
HETATM 1103 O O3  . SO4 D 2 .  ? 16.635 55.150 25.321 1.00 39.70  ? 196  SO4 A O3  1 
HETATM 1104 O O4  . SO4 D 2 .  ? 17.707 56.335 27.132 1.00 30.57  ? 196  SO4 A O4  1 
HETATM 1105 S S   . SO4 E 2 .  ? 28.716 32.819 33.521 1.00 32.03  ? 198  SO4 A S   1 
HETATM 1106 O O1  . SO4 E 2 .  ? 29.825 33.753 33.708 1.00 32.94  ? 198  SO4 A O1  1 
HETATM 1107 O O2  . SO4 E 2 .  ? 29.048 31.449 33.966 1.00 35.38  ? 198  SO4 A O2  1 
HETATM 1108 O O3  . SO4 E 2 .  ? 28.425 32.765 32.064 1.00 43.26  ? 198  SO4 A O3  1 
HETATM 1109 O O4  . SO4 E 2 .  ? 27.518 33.285 34.303 1.00 33.27  ? 198  SO4 A O4  1 
HETATM 1110 O O1  . AOP F 3 .  ? 24.115 23.878 42.589 1.00 30.92  ? 1    AOP A O1  1 
HETATM 1111 C C1  . AOP F 3 .  ? 24.453 23.740 41.390 1.00 26.02  ? 1    AOP A C1  1 
HETATM 1112 C C2  . AOP F 3 .  ? 23.433 23.294 40.324 1.00 33.73  ? 1    AOP A C2  1 
HETATM 1113 N N3  . AOP F 3 .  ? 22.241 22.989 40.703 1.00 44.54  ? 1    AOP A N3  1 
HETATM 1114 O O4  . AOP F 3 .  ? 21.255 22.729 39.881 1.00 47.93  ? 1    AOP A O4  1 
HETATM 1115 C C5  . AOP F 3 .  ? 19.933 22.456 40.400 1.00 48.95  ? 1    AOP A C5  1 
HETATM 1116 C C6  . AOP F 3 .  ? 18.891 22.505 39.275 1.00 44.03  ? 1    AOP A C6  1 
HETATM 1117 C C7  . AOP F 3 .  ? 18.156 23.850 39.291 1.00 52.73  ? 1    AOP A C7  1 
HETATM 1118 C C8  . AOP F 3 .  ? 18.960 24.908 40.034 1.00 48.55  ? 1    AOP A C8  1 
HETATM 1119 C C9  . AOP F 3 .  ? 18.251 26.254 40.013 1.00 38.00  ? 1    AOP A C9  1 
HETATM 1120 S S   . SO4 G 2 .  ? 20.485 40.095 54.149 1.00 24.08  ? 199  SO4 B S   1 
HETATM 1121 O O1  . SO4 G 2 .  ? 20.700 40.527 52.741 1.00 18.67  ? 199  SO4 B O1  1 
HETATM 1122 O O2  . SO4 G 2 .  ? 20.488 38.640 54.189 1.00 35.38  ? 199  SO4 B O2  1 
HETATM 1123 O O3  . SO4 G 2 .  ? 19.167 40.619 54.590 1.00 25.92  ? 199  SO4 B O3  1 
HETATM 1124 O O4  . SO4 G 2 .  ? 21.556 40.672 55.010 1.00 21.70  ? 199  SO4 B O4  1 
HETATM 1125 O O1  . AOP H 3 .  ? 6.932  32.664 21.488 1.00 45.83  ? 1    AOP B O1  1 
HETATM 1126 C C1  . AOP H 3 .  ? 7.293  33.858 21.538 1.00 74.65  ? 1    AOP B C1  1 
HETATM 1127 C C2  . AOP H 3 .  ? 8.750  34.323 21.451 1.00 85.23  ? 1    AOP B C2  1 
HETATM 1128 N N3  . AOP H 3 .  ? 9.764  33.547 21.374 1.00 94.00  ? 1    AOP B N3  1 
HETATM 1129 O O4  . AOP H 3 .  ? 10.991 34.021 21.337 1.00 101.91 ? 1    AOP B O4  1 
HETATM 1130 C C5  . AOP H 3 .  ? 12.136 33.145 21.235 1.00 104.19 ? 1    AOP B C5  1 
HETATM 1131 C C6  . AOP H 3 .  ? 13.437 33.951 21.348 1.00 102.16 ? 1    AOP B C6  1 
HETATM 1132 C C7  . AOP H 3 .  ? 13.949 34.383 19.966 1.00 100.50 ? 1    AOP B C7  1 
HETATM 1133 C C8  . AOP H 3 .  ? 15.467 34.512 19.970 1.00 101.05 ? 1    AOP B C8  1 
HETATM 1134 C C9  . AOP H 3 .  ? 16.145 33.163 19.818 1.00 97.12  ? 1    AOP B C9  1 
HETATM 1135 O O   A HOH I 4 .  ? 17.138 30.248 31.057 0.50 17.54  ? 1001 HOH A O   1 
HETATM 1136 O O   B HOH I 4 .  ? 17.144 29.557 31.911 0.50 19.95  ? 1001 HOH A O   1 
HETATM 1137 O O   . HOH I 4 .  ? 19.978 35.523 27.754 1.00 10.29  ? 1002 HOH A O   1 
HETATM 1138 O O   . HOH I 4 .  ? 28.488 34.231 24.142 1.00 48.31  ? 1003 HOH A O   1 
HETATM 1139 O O   . HOH I 4 .  ? 21.528 31.023 40.136 1.00 16.86  ? 1007 HOH A O   1 
HETATM 1140 O O   . HOH I 4 .  ? 23.149 37.034 33.169 1.00 11.77  ? 1009 HOH A O   1 
HETATM 1141 O O   . HOH I 4 .  ? 22.337 26.309 32.329 1.00 16.77  ? 1010 HOH A O   1 
HETATM 1142 O O   . HOH I 4 .  ? 25.608 35.702 25.979 1.00 21.01  ? 1011 HOH A O   1 
HETATM 1143 O O   . HOH I 4 .  ? 14.074 39.142 26.831 1.00 26.08  ? 1012 HOH A O   1 
HETATM 1144 O O   . HOH I 4 .  ? 17.708 32.963 28.097 1.00 13.86  ? 1013 HOH A O   1 
HETATM 1145 O O   . HOH I 4 .  ? 21.559 54.612 15.788 1.00 25.39  ? 1016 HOH A O   1 
HETATM 1146 O O   . HOH I 4 .  ? 18.457 42.333 18.377 1.00 17.47  ? 1018 HOH A O   1 
HETATM 1147 O O   . HOH I 4 .  ? 22.534 57.654 35.268 1.00 17.74  ? 1020 HOH A O   1 
HETATM 1148 O O   . HOH I 4 .  ? 29.931 54.612 26.940 1.00 24.33  ? 1021 HOH A O   1 
HETATM 1149 O O   . HOH I 4 .  ? 23.591 32.947 38.306 1.00 56.34  ? 1023 HOH A O   1 
HETATM 1150 O O   . HOH I 4 .  ? 19.243 43.014 33.913 1.00 20.18  ? 1024 HOH A O   1 
HETATM 1151 O O   . HOH I 4 .  ? 15.251 44.952 31.228 1.00 23.86  ? 1025 HOH A O   1 
HETATM 1152 O O   . HOH I 4 .  ? 28.343 54.300 32.692 1.00 35.51  ? 1027 HOH A O   1 
HETATM 1153 O O   . HOH I 4 .  ? 15.383 47.615 32.312 1.00 28.12  ? 1028 HOH A O   1 
HETATM 1154 O O   . HOH I 4 .  ? 23.431 34.174 27.548 1.00 11.71  ? 1030 HOH A O   1 
HETATM 1155 O O   . HOH I 4 .  ? 34.956 44.921 19.278 1.00 20.14  ? 1031 HOH A O   1 
HETATM 1156 O O   . HOH I 4 .  ? 33.768 42.236 22.217 1.00 53.98  ? 1032 HOH A O   1 
HETATM 1157 O O   . HOH I 4 .  ? 21.523 23.766 43.683 1.00 21.58  ? 1034 HOH A O   1 
HETATM 1158 O O   . HOH I 4 .  ? 17.315 43.491 15.232 1.00 27.91  ? 1036 HOH A O   1 
HETATM 1159 O O   . HOH I 4 .  ? 19.046 27.860 30.809 1.00 16.46  ? 1037 HOH A O   1 
HETATM 1160 O O   . HOH I 4 .  ? 14.631 50.499 34.776 1.00 32.39  ? 1038 HOH A O   1 
HETATM 1161 O O   . HOH I 4 .  ? 24.537 28.973 39.158 1.00 19.82  ? 1039 HOH A O   1 
HETATM 1162 O O   . HOH I 4 .  ? 13.262 38.103 19.462 1.00 32.49  ? 1041 HOH A O   1 
HETATM 1163 O O   . HOH I 4 .  ? 17.555 48.885 34.378 1.00 22.33  ? 1043 HOH A O   1 
HETATM 1164 O O   . HOH I 4 .  ? 20.035 33.622 19.691 1.00 32.32  ? 1044 HOH A O   1 
HETATM 1165 O O   . HOH I 4 .  ? 12.507 47.837 18.380 1.00 35.25  ? 1045 HOH A O   1 
HETATM 1166 O O   . HOH I 4 .  ? 26.337 56.084 34.474 1.00 27.26  ? 1048 HOH A O   1 
HETATM 1167 O O   . HOH I 4 .  ? 17.579 56.025 35.752 1.00 23.63  ? 1049 HOH A O   1 
HETATM 1168 O O   . HOH I 4 .  ? 25.067 39.173 33.792 1.00 35.10  ? 1054 HOH A O   1 
HETATM 1169 O O   . HOH I 4 .  ? 28.308 39.182 19.290 1.00 28.06  ? 1055 HOH A O   1 
HETATM 1170 O O   . HOH I 4 .  ? 16.831 39.028 15.894 1.00 38.80  ? 1058 HOH A O   1 
HETATM 1171 O O   . HOH I 4 .  ? 29.461 48.414 32.007 1.00 29.13  ? 1060 HOH A O   1 
HETATM 1172 O O   . HOH I 4 .  ? 19.203 38.903 38.382 1.00 16.88  ? 1065 HOH A O   1 
HETATM 1173 O O   . HOH I 4 .  ? 28.963 55.321 24.218 1.00 23.69  ? 1068 HOH A O   1 
HETATM 1174 O O   . HOH I 4 .  ? 29.985 48.411 28.837 1.00 25.37  ? 1069 HOH A O   1 
HETATM 1175 O O   . HOH I 4 .  ? 22.950 57.906 32.234 1.00 24.12  ? 1073 HOH A O   1 
HETATM 1176 O O   . HOH I 4 .  ? 20.692 38.967 41.734 1.00 22.57  ? 1078 HOH A O   1 
HETATM 1177 O O   . HOH I 4 .  ? 14.504 29.905 25.544 1.00 29.53  ? 1082 HOH A O   1 
HETATM 1178 O O   . HOH I 4 .  ? 15.320 53.050 34.171 1.00 24.36  ? 1083 HOH A O   1 
HETATM 1179 O O   . HOH I 4 .  ? 21.986 40.244 38.517 1.00 33.37  ? 1085 HOH A O   1 
HETATM 1180 O O   . HOH I 4 .  ? 25.920 32.794 45.310 1.00 35.14  ? 1086 HOH A O   1 
HETATM 1181 O O   . HOH I 4 .  ? 26.176 57.119 23.980 1.00 30.43  ? 1087 HOH A O   1 
HETATM 1182 O O   . HOH I 4 .  ? 33.997 42.072 19.936 1.00 49.33  ? 1089 HOH A O   1 
HETATM 1183 O O   . HOH I 4 .  ? 32.214 48.421 13.824 1.00 48.16  ? 1090 HOH A O   1 
HETATM 1184 O O   . HOH I 4 .  ? 19.529 42.450 36.559 1.00 27.57  ? 1091 HOH A O   1 
HETATM 1185 O O   . HOH I 4 .  ? 29.453 45.811 31.326 1.00 28.77  ? 1096 HOH A O   1 
HETATM 1186 O O   . HOH I 4 .  ? 27.273 36.488 33.730 1.00 28.43  ? 1097 HOH A O   1 
HETATM 1187 O O   . HOH I 4 .  ? 28.311 37.295 31.767 1.00 44.22  ? 1098 HOH A O   1 
HETATM 1188 O O   . HOH I 4 .  ? 28.560 35.847 29.223 1.00 37.65  ? 1099 HOH A O   1 
HETATM 1189 O O   . HOH I 4 .  ? 29.775 33.290 30.285 1.00 40.51  ? 1100 HOH A O   1 
HETATM 1190 O O   . HOH I 4 .  ? 24.717 34.923 39.839 1.00 53.68  ? 1101 HOH A O   1 
HETATM 1191 O O   . HOH I 4 .  ? 23.666 37.644 39.643 1.00 38.28  ? 1102 HOH A O   1 
HETATM 1192 O O   . HOH I 4 .  ? 18.048 33.743 16.081 1.00 70.60  ? 1103 HOH A O   1 
HETATM 1193 O O   . HOH I 4 .  ? 13.726 32.115 24.601 1.00 59.63  ? 1104 HOH A O   1 
HETATM 1194 O O   . HOH I 4 .  ? 32.749 54.892 18.663 1.00 28.86  ? 1107 HOH A O   1 
HETATM 1195 O O   . HOH I 4 .  ? 27.994 30.852 39.320 1.00 21.08  ? 1108 HOH A O   1 
HETATM 1196 O O   . HOH I 4 .  ? 28.192 33.718 39.247 1.00 28.08  ? 1109 HOH A O   1 
HETATM 1197 O O   . HOH I 4 .  ? 29.939 32.318 37.116 1.00 41.30  ? 1110 HOH A O   1 
HETATM 1198 O O   . HOH I 4 .  ? 29.887 40.882 29.293 1.00 28.11  ? 1118 HOH A O   1 
HETATM 1199 O O   . HOH I 4 .  ? 35.746 54.742 17.287 1.00 77.44  ? 1119 HOH A O   1 
HETATM 1200 O O   . HOH I 4 .  ? 16.453 54.876 23.052 1.00 35.72  ? 1122 HOH A O   1 
HETATM 1201 O O   . HOH I 4 .  ? 25.587 33.985 19.724 1.00 38.27  ? 1123 HOH A O   1 
HETATM 1202 O O   . HOH I 4 .  ? 18.706 59.428 26.769 1.00 28.64  ? 1124 HOH A O   1 
HETATM 1203 O O   . HOH I 4 .  ? 23.948 36.580 47.731 1.00 33.95  ? 1125 HOH A O   1 
HETATM 1204 O O   . HOH I 4 .  ? 24.656 27.922 45.540 1.00 46.66  ? 1127 HOH A O   1 
HETATM 1205 O O   . HOH I 4 .  ? 28.576 29.430 35.622 1.00 57.85  ? 1129 HOH A O   1 
HETATM 1206 O O   . HOH I 4 .  ? 31.427 40.885 21.181 1.00 31.21  ? 1131 HOH A O   1 
HETATM 1207 O O   . HOH I 4 .  ? 14.345 57.308 20.255 1.00 38.82  ? 1135 HOH A O   1 
HETATM 1208 O O   . HOH I 4 .  ? 28.167 34.375 27.499 1.00 56.94  ? 1136 HOH A O   1 
HETATM 1209 O O   . HOH I 4 .  ? 15.124 51.664 14.300 1.00 50.91  ? 1137 HOH A O   1 
HETATM 1210 O O   . HOH I 4 .  ? 17.679 58.261 34.635 1.00 36.07  ? 1138 HOH A O   1 
HETATM 1211 O O   . HOH I 4 .  ? 14.852 55.049 36.021 1.00 31.88  ? 1139 HOH A O   1 
HETATM 1212 O O   . HOH I 4 .  ? 20.896 60.354 25.543 1.00 32.95  ? 1142 HOH A O   1 
HETATM 1213 O O   . HOH I 4 .  ? 31.209 49.733 27.411 1.00 39.87  ? 1143 HOH A O   1 
HETATM 1214 O O   . HOH I 4 .  ? 30.512 54.037 33.985 1.00 46.36  ? 1144 HOH A O   1 
HETATM 1215 O O   . HOH I 4 .  ? 19.015 45.354 11.235 1.00 43.67  ? 1147 HOH A O   1 
HETATM 1216 O O   . HOH I 4 .  ? 9.573  42.178 14.344 1.00 44.93  ? 1148 HOH A O   1 
HETATM 1217 O O   . HOH I 4 .  ? 14.346 40.539 17.108 1.00 28.58  ? 1150 HOH A O   1 
HETATM 1218 O O   . HOH I 4 .  ? 18.704 60.926 28.831 1.00 39.14  ? 1156 HOH A O   1 
HETATM 1219 O O   . HOH I 4 .  ? 32.155 42.599 31.728 1.00 46.74  ? 1158 HOH A O   1 
HETATM 1220 O O   . HOH I 4 .  ? 26.196 34.522 36.505 1.00 48.51  ? 1160 HOH A O   1 
HETATM 1221 O O   . HOH I 4 .  ? 30.906 35.641 35.757 1.00 56.30  ? 1161 HOH A O   1 
HETATM 1222 O O   . HOH I 4 .  ? 29.966 37.023 17.625 1.00 50.47  ? 1164 HOH A O   1 
HETATM 1223 O O   . HOH I 4 .  ? 19.280 55.356 14.867 1.00 44.88  ? 1165 HOH A O   1 
HETATM 1224 O O   . HOH I 4 .  ? 31.135 52.175 32.104 1.00 89.67  ? 1166 HOH A O   1 
HETATM 1225 O O   . HOH I 4 .  ? 32.517 38.679 20.868 1.00 48.11  ? 1168 HOH A O   1 
HETATM 1226 O O   . HOH I 4 .  ? 28.788 29.923 31.151 1.00 31.31  ? 1169 HOH A O   1 
HETATM 1227 O O   . HOH I 4 .  ? 29.953 23.528 44.264 1.00 39.76  ? 1172 HOH A O   1 
HETATM 1228 O O   . HOH I 4 .  ? 32.983 41.656 17.408 1.00 51.17  ? 1173 HOH A O   1 
HETATM 1229 O O   . HOH I 4 .  ? 29.467 21.702 46.214 1.00 56.98  ? 1174 HOH A O   1 
HETATM 1230 O O   . HOH I 4 .  ? 17.068 47.938 10.440 1.00 47.86  ? 1175 HOH A O   1 
HETATM 1231 O O   . HOH I 4 .  ? 29.205 55.371 30.029 1.00 66.15  ? 1176 HOH A O   1 
HETATM 1232 O O   . HOH I 4 .  ? 34.406 52.887 17.105 1.00 72.63  ? 1177 HOH A O   1 
HETATM 1233 O O   . HOH I 4 .  ? 31.231 43.898 13.314 1.00 51.49  ? 1178 HOH A O   1 
HETATM 1234 O O   . HOH I 4 .  ? 17.122 29.401 21.612 1.00 69.08  ? 1179 HOH A O   1 
HETATM 1235 O O   . HOH I 4 .  ? 11.510 40.370 16.264 1.00 51.28  ? 1181 HOH A O   1 
HETATM 1236 O O   . HOH I 4 .  ? 25.253 22.142 35.091 1.00 52.74  ? 1182 HOH A O   1 
HETATM 1237 O O   . HOH I 4 .  ? 16.017 35.782 16.969 1.00 74.32  ? 1183 HOH A O   1 
HETATM 1238 O O   . HOH I 4 .  ? 21.914 34.688 18.493 1.00 46.16  ? 1184 HOH A O   1 
HETATM 1239 O O   . HOH I 4 .  ? 20.171 36.072 13.352 1.00 60.21  ? 1186 HOH A O   1 
HETATM 1240 O O   . HOH I 4 .  ? 13.468 53.958 33.064 1.00 46.14  ? 1190 HOH A O   1 
HETATM 1241 O O   . HOH I 4 .  ? 13.743 41.214 13.961 1.00 44.30  ? 1193 HOH A O   1 
HETATM 1242 O O   . HOH I 4 .  ? 14.750 48.398 7.337  1.00 80.09  ? 1194 HOH A O   1 
HETATM 1243 O O   . HOH I 4 .  ? 23.027 30.799 17.028 1.00 41.96  ? 1199 HOH A O   1 
HETATM 1244 O O   . HOH I 4 .  ? 27.700 21.191 43.466 1.00 75.62  ? 1200 HOH A O   1 
HETATM 1245 O O   . HOH I 4 .  ? 21.599 19.389 40.305 1.00 51.13  ? 1201 HOH A O   1 
HETATM 1246 O O   . HOH I 4 .  ? 13.769 37.879 16.891 1.00 36.54  ? 1202 HOH A O   1 
HETATM 1247 O O   . HOH I 4 .  ? 28.049 57.902 30.005 1.00 83.86  ? 1203 HOH A O   1 
HETATM 1248 O O   . HOH I 4 .  ? 15.123 32.596 17.124 1.00 60.15  ? 1206 HOH A O   1 
HETATM 1249 O O   . HOH I 4 .  ? 22.245 36.832 12.288 1.00 55.33  ? 1207 HOH A O   1 
HETATM 1250 O O   . HOH I 4 .  ? 24.468 19.984 40.487 1.00 146.04 ? 1211 HOH A O   1 
HETATM 1251 O O   . HOH I 4 .  ? 31.339 21.706 42.912 1.00 49.16  ? 1215 HOH A O   1 
HETATM 1252 O O   . HOH I 4 .  ? 30.320 40.493 18.683 1.00 60.77  ? 1216 HOH A O   1 
HETATM 1253 O O   . HOH I 4 .  ? 12.601 28.700 17.336 1.00 65.14  ? 1219 HOH A O   1 
HETATM 1254 O O   . HOH I 4 .  ? 23.187 22.030 37.072 1.00 55.54  ? 1220 HOH A O   1 
HETATM 1255 O O   . HOH I 4 .  ? 27.528 35.811 17.608 1.00 58.82  ? 1222 HOH A O   1 
HETATM 1256 O O   . HOH J 4 .  ? 11.147 29.309 36.733 1.00 13.91  ? 1004 HOH B O   1 
HETATM 1257 O O   . HOH J 4 .  ? 14.734 30.165 37.485 1.00 11.37  ? 1005 HOH B O   1 
HETATM 1258 O O   . HOH J 4 .  ? 16.887 25.657 48.283 1.00 19.61  ? 1006 HOH B O   1 
HETATM 1259 O O   . HOH J 4 .  ? 16.640 28.919 34.895 1.00 13.81  ? 1008 HOH B O   1 
HETATM 1260 O O   . HOH J 4 .  ? 20.121 23.989 32.315 1.00 36.67  ? 1014 HOH B O   1 
HETATM 1261 O O   . HOH J 4 .  ? 16.696 43.184 44.212 1.00 25.71  ? 1015 HOH B O   1 
HETATM 1262 O O   . HOH J 4 .  ? 15.320 49.204 49.984 1.00 35.27  ? 1017 HOH B O   1 
HETATM 1263 O O   . HOH J 4 .  ? 11.865 35.580 36.691 1.00 16.55  ? 1019 HOH B O   1 
HETATM 1264 O O   . HOH J 4 .  ? 6.014  37.567 49.717 1.00 17.81  ? 1022 HOH B O   1 
HETATM 1265 O O   . HOH J 4 .  ? 17.574 40.193 36.980 1.00 27.39  ? 1026 HOH B O   1 
HETATM 1266 O O   . HOH J 4 .  ? 20.525 23.391 47.123 1.00 52.47  ? 1029 HOH B O   1 
HETATM 1267 O O   . HOH J 4 .  ? 13.940 21.583 54.293 1.00 25.25  ? 1033 HOH B O   1 
HETATM 1268 O O   . HOH J 4 .  ? 15.033 44.613 33.554 1.00 56.38  ? 1035 HOH B O   1 
HETATM 1269 O O   . HOH J 4 .  ? 1.147  28.412 50.060 1.00 33.27  ? 1040 HOH B O   1 
HETATM 1270 O O   . HOH J 4 .  ? 22.177 24.697 36.892 1.00 27.04  ? 1042 HOH B O   1 
HETATM 1271 O O   . HOH J 4 .  ? 9.359  29.020 38.900 1.00 21.34  ? 1046 HOH B O   1 
HETATM 1272 O O   . HOH J 4 .  ? 13.958 41.896 36.761 1.00 55.44  ? 1047 HOH B O   1 
HETATM 1273 O O   . HOH J 4 .  ? 14.976 28.987 29.417 1.00 18.34  ? 1050 HOH B O   1 
HETATM 1274 O O   . HOH J 4 .  ? -1.710 29.511 53.974 1.00 42.57  ? 1051 HOH B O   1 
HETATM 1275 O O   . HOH J 4 .  ? 17.393 40.339 60.902 1.00 41.47  ? 1052 HOH B O   1 
HETATM 1276 O O   . HOH J 4 .  ? 8.543  38.900 56.771 1.00 25.48  ? 1053 HOH B O   1 
HETATM 1277 O O   . HOH J 4 .  ? 18.257 23.798 51.267 1.00 45.76  ? 1056 HOH B O   1 
HETATM 1278 O O   . HOH J 4 .  ? 22.147 46.678 57.291 1.00 29.23  ? 1057 HOH B O   1 
HETATM 1279 O O   . HOH J 4 .  ? 10.151 46.620 26.797 1.00 49.32  ? 1059 HOH B O   1 
HETATM 1280 O O   . HOH J 4 .  ? 20.751 25.065 34.617 1.00 26.47  ? 1061 HOH B O   1 
HETATM 1281 O O   . HOH J 4 .  ? -1.105 33.429 46.990 1.00 20.83  ? 1062 HOH B O   1 
HETATM 1282 O O   . HOH J 4 .  ? 8.156  24.304 61.361 1.00 51.50  ? 1063 HOH B O   1 
HETATM 1283 O O   . HOH J 4 .  ? 12.968 42.288 43.582 1.00 38.05  ? 1064 HOH B O   1 
HETATM 1284 O O   . HOH J 4 .  ? 20.504 36.251 54.936 1.00 28.25  ? 1066 HOH B O   1 
HETATM 1285 O O   . HOH J 4 .  ? 15.921 40.794 34.994 1.00 21.14  ? 1067 HOH B O   1 
HETATM 1286 O O   . HOH J 4 .  ? 19.144 25.092 30.556 1.00 25.89  ? 1070 HOH B O   1 
HETATM 1287 O O   . HOH J 4 .  ? 10.813 26.485 34.361 1.00 32.20  ? 1071 HOH B O   1 
HETATM 1288 O O   . HOH J 4 .  ? 22.584 43.199 48.931 1.00 29.79  ? 1072 HOH B O   1 
HETATM 1289 O O   . HOH J 4 .  ? 21.104 39.025 44.341 1.00 24.09  ? 1074 HOH B O   1 
HETATM 1290 O O   . HOH J 4 .  ? 5.467  34.718 42.318 1.00 21.60  ? 1075 HOH B O   1 
HETATM 1291 O O   . HOH J 4 .  ? 9.535  22.618 41.285 1.00 31.96  ? 1076 HOH B O   1 
HETATM 1292 O O   . HOH J 4 .  ? 17.877 44.708 42.438 1.00 21.96  ? 1077 HOH B O   1 
HETATM 1293 O O   . HOH J 4 .  ? 15.929 40.631 38.729 1.00 28.87  ? 1079 HOH B O   1 
HETATM 1294 O O   . HOH J 4 .  ? 7.681  38.555 28.542 1.00 24.34  ? 1080 HOH B O   1 
HETATM 1295 O O   . HOH J 4 .  ? 12.591 47.453 25.187 1.00 60.86  ? 1081 HOH B O   1 
HETATM 1296 O O   . HOH J 4 .  ? 8.639  27.966 36.594 1.00 33.67  ? 1084 HOH B O   1 
HETATM 1297 O O   . HOH J 4 .  ? -0.907 40.303 60.219 1.00 29.65  ? 1088 HOH B O   1 
HETATM 1298 O O   . HOH J 4 .  ? -0.054 28.599 52.667 1.00 42.49  ? 1092 HOH B O   1 
HETATM 1299 O O   . HOH J 4 .  ? 15.372 47.032 52.125 1.00 47.18  ? 1093 HOH B O   1 
HETATM 1300 O O   . HOH J 4 .  ? 11.679 21.895 41.853 1.00 37.39  ? 1094 HOH B O   1 
HETATM 1301 O O   . HOH J 4 .  ? 3.824  26.618 50.908 1.00 28.63  ? 1095 HOH B O   1 
HETATM 1302 O O   . HOH J 4 .  ? 7.760  40.368 55.051 1.00 29.42  ? 1105 HOH B O   1 
HETATM 1303 O O   . HOH J 4 .  ? 23.624 25.973 35.215 1.00 30.46  ? 1106 HOH B O   1 
HETATM 1304 O O   . HOH J 4 .  ? 29.784 60.785 60.978 1.00 38.35  ? 1111 HOH B O   1 
HETATM 1305 O O   . HOH J 4 .  ? 25.102 26.497 39.010 1.00 39.01  ? 1112 HOH B O   1 
HETATM 1306 O O   . HOH J 4 .  ? 14.507 44.014 44.856 1.00 30.31  ? 1113 HOH B O   1 
HETATM 1307 O O   . HOH J 4 .  ? 16.137 45.235 41.047 1.00 34.71  ? 1114 HOH B O   1 
HETATM 1308 O O   . HOH J 4 .  ? 11.835 29.915 27.513 1.00 22.88  ? 1115 HOH B O   1 
HETATM 1309 O O   . HOH J 4 .  ? 20.216 38.469 62.080 1.00 34.06  ? 1116 HOH B O   1 
HETATM 1310 O O   . HOH J 4 .  ? 13.627 38.389 29.119 1.00 29.44  ? 1117 HOH B O   1 
HETATM 1311 O O   . HOH J 4 .  ? 15.330 22.204 36.164 1.00 30.48  ? 1120 HOH B O   1 
HETATM 1312 O O   . HOH J 4 .  ? 13.640 46.107 27.006 1.00 54.56  ? 1121 HOH B O   1 
HETATM 1313 O O   . HOH J 4 .  ? 13.134 44.713 47.603 1.00 43.70  ? 1126 HOH B O   1 
HETATM 1314 O O   . HOH J 4 .  ? 11.654 41.437 33.421 1.00 52.80  ? 1128 HOH B O   1 
HETATM 1315 O O   . HOH J 4 .  ? 8.485  30.334 22.245 1.00 57.42  ? 1130 HOH B O   1 
HETATM 1316 O O   . HOH J 4 .  ? 25.893 25.903 36.453 1.00 35.21  ? 1132 HOH B O   1 
HETATM 1317 O O   . HOH J 4 .  ? 20.285 27.290 58.527 1.00 69.89  ? 1133 HOH B O   1 
HETATM 1318 O O   . HOH J 4 .  ? 5.509  22.262 54.657 1.00 45.66  ? 1134 HOH B O   1 
HETATM 1319 O O   . HOH J 4 .  ? 15.565 41.655 60.445 1.00 60.37  ? 1140 HOH B O   1 
HETATM 1320 O O   . HOH J 4 .  ? 3.073  37.035 49.853 1.00 40.83  ? 1141 HOH B O   1 
HETATM 1321 O O   . HOH J 4 .  ? 27.381 62.114 62.444 1.00 41.82  ? 1145 HOH B O   1 
HETATM 1322 O O   . HOH J 4 .  ? 11.209 23.703 34.610 1.00 40.86  ? 1146 HOH B O   1 
HETATM 1323 O O   . HOH J 4 .  ? 0.882  29.603 47.436 1.00 46.37  ? 1149 HOH B O   1 
HETATM 1324 O O   . HOH J 4 .  ? 17.911 48.869 53.739 1.00 54.65  ? 1151 HOH B O   1 
HETATM 1325 O O   . HOH J 4 .  ? 12.603 18.841 52.087 1.00 34.38  ? 1152 HOH B O   1 
HETATM 1326 O O   . HOH J 4 .  ? 10.535 38.429 27.620 1.00 58.16  ? 1153 HOH B O   1 
HETATM 1327 O O   . HOH J 4 .  ? 14.408 48.749 47.144 1.00 58.80  ? 1154 HOH B O   1 
HETATM 1328 O O   . HOH J 4 .  ? 16.973 22.090 54.385 1.00 52.35  ? 1155 HOH B O   1 
HETATM 1329 O O   . HOH J 4 .  ? 9.663  38.545 33.229 1.00 39.10  ? 1157 HOH B O   1 
HETATM 1330 O O   . HOH J 4 .  ? 6.044  38.432 56.777 1.00 40.30  ? 1159 HOH B O   1 
HETATM 1331 O O   . HOH J 4 .  ? 20.115 47.752 56.026 1.00 30.41  ? 1162 HOH B O   1 
HETATM 1332 O O   . HOH J 4 .  ? 4.117  26.043 47.982 1.00 49.07  ? 1163 HOH B O   1 
HETATM 1333 O O   . HOH J 4 .  ? 6.113  16.284 56.332 1.00 51.66  ? 1167 HOH B O   1 
HETATM 1334 O O   . HOH J 4 .  ? 16.414 44.762 35.711 1.00 47.46  ? 1170 HOH B O   1 
HETATM 1335 O O   . HOH J 4 .  ? 24.397 28.390 55.886 1.00 93.33  ? 1171 HOH B O   1 
HETATM 1336 O O   . HOH J 4 .  ? 11.100 39.835 30.846 1.00 52.43  ? 1180 HOH B O   1 
HETATM 1337 O O   . HOH J 4 .  ? 12.664 44.040 41.335 1.00 49.93  ? 1185 HOH B O   1 
HETATM 1338 O O   . HOH J 4 .  ? 24.069 22.907 57.414 1.00 156.30 ? 1187 HOH B O   1 
HETATM 1339 O O   . HOH J 4 .  ? 6.637  25.664 46.530 1.00 45.83  ? 1188 HOH B O   1 
HETATM 1340 O O   . HOH J 4 .  ? 19.933 18.690 56.471 1.00 68.36  ? 1189 HOH B O   1 
HETATM 1341 O O   . HOH J 4 .  ? 22.557 26.796 57.753 1.00 75.11  ? 1191 HOH B O   1 
HETATM 1342 O O   . HOH J 4 .  ? 4.210  25.818 56.923 1.00 41.47  ? 1192 HOH B O   1 
HETATM 1343 O O   . HOH J 4 .  ? 12.782 21.188 36.269 1.00 49.23  ? 1195 HOH B O   1 
HETATM 1344 O O   . HOH J 4 .  ? 11.149 40.277 35.721 1.00 53.38  ? 1196 HOH B O   1 
HETATM 1345 O O   . HOH J 4 .  ? 13.416 19.667 43.055 1.00 70.58  ? 1197 HOH B O   1 
HETATM 1346 O O   . HOH J 4 .  ? 13.434 46.433 32.539 1.00 58.30  ? 1198 HOH B O   1 
HETATM 1347 O O   . HOH J 4 .  ? 4.362  15.786 54.393 1.00 53.58  ? 1204 HOH B O   1 
HETATM 1348 O O   . HOH J 4 .  ? 8.554  42.272 54.053 1.00 47.01  ? 1205 HOH B O   1 
HETATM 1349 O O   . HOH J 4 .  ? 15.297 17.360 51.450 1.00 57.00  ? 1208 HOH B O   1 
HETATM 1350 O O   . HOH J 4 .  ? 16.049 19.976 41.124 1.00 41.63  ? 1209 HOH B O   1 
HETATM 1351 O O   . HOH J 4 .  ? 14.265 17.564 56.844 1.00 83.54  ? 1210 HOH B O   1 
HETATM 1352 O O   . HOH J 4 .  ? 14.651 22.066 39.682 1.00 42.45  ? 1212 HOH B O   1 
HETATM 1353 O O   . HOH J 4 .  ? 6.235  16.105 51.607 1.00 58.10  ? 1213 HOH B O   1 
HETATM 1354 O O   . HOH J 4 .  ? 12.748 21.695 57.646 1.00 61.60  ? 1214 HOH B O   1 
HETATM 1355 O O   . HOH J 4 .  ? 2.867  24.033 52.290 1.00 50.96  ? 1217 HOH B O   1 
HETATM 1356 O O   . HOH J 4 .  ? 21.116 19.607 59.411 1.00 37.63  ? 1218 HOH B O   1 
HETATM 1357 O O   . HOH J 4 .  ? 22.836 21.600 48.096 1.00 54.20  ? 1221 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  PRO 1  2  2  PRO PRO A . n 
A 1 2  TYR 2  3  3  TYR TYR A . n 
A 1 3  SER 3  4  4  SER SER A . n 
A 1 4  SER 4  5  5  SER SER A . n 
A 1 5  ASP 5  6  6  ASP ASP A . n 
A 1 6  THR 6  7  7  THR THR A . n 
A 1 7  THR 7  8  8  THR THR A . n 
A 1 8  PRO 8  9  9  PRO PRO A . n 
A 1 9  CYS 9  10 10 CYS CYS A . n 
A 1 10 CYS 10 11 11 CYS CYS A . n 
A 1 11 PHE 11 12 12 PHE PHE A . n 
A 1 12 ALA 12 13 13 ALA ALA A . n 
A 1 13 TYR 13 14 14 TYR TYR A . n 
A 1 14 ILE 14 15 15 ILE ILE A . n 
A 1 15 ALA 15 16 16 ALA ALA A . n 
A 1 16 ARG 16 17 17 ARG ARG A . n 
A 1 17 PRO 17 18 18 PRO PRO A . n 
A 1 18 LEU 18 19 19 LEU LEU A . n 
A 1 19 PRO 19 20 20 PRO PRO A . n 
A 1 20 ARG 20 21 21 ARG ARG A . n 
A 1 21 ALA 21 22 22 ALA ALA A . n 
A 1 22 HIS 22 23 23 HIS HIS A . n 
A 1 23 ILE 23 24 24 ILE ILE A . n 
A 1 24 LYS 24 25 25 LYS LYS A . n 
A 1 25 GLU 25 26 26 GLU GLU A . n 
A 1 26 TYR 26 27 27 TYR TYR A . n 
A 1 27 PHE 27 28 28 PHE PHE A . n 
A 1 28 TYR 28 29 29 TYR TYR A . n 
A 1 29 THR 29 30 30 THR THR A . n 
A 1 30 SER 30 31 31 SER SER A . n 
A 1 31 GLY 31 32 32 GLY GLY A . n 
A 1 32 LYS 32 33 33 LYS LYS A . n 
A 1 33 CYS 33 34 34 CYS CYS A . n 
A 1 34 SER 34 35 35 SER SER A . n 
A 1 35 ASN 35 36 36 ASN ASN A . n 
A 1 36 PRO 36 37 37 PRO PRO A . n 
A 1 37 ALA 37 38 38 ALA ALA A . n 
A 1 38 VAL 38 39 39 VAL VAL A . n 
A 1 39 VAL 39 40 40 VAL VAL A . n 
A 1 40 PHE 40 41 41 PHE PHE A . n 
A 1 41 VAL 41 42 42 VAL VAL A . n 
A 1 42 THR 42 43 43 THR THR A . n 
A 1 43 ARG 43 44 44 ARG ARG A . n 
A 1 44 LYS 44 45 45 LYS LYS A . n 
A 1 45 ASN 45 46 46 ASN ASN A . n 
A 1 46 ARG 46 47 47 ARG ARG A . n 
A 1 47 GLN 47 48 48 GLN GLN A . n 
A 1 48 VAL 48 49 49 VAL VAL A . n 
A 1 49 CYS 49 50 50 CYS CYS A . n 
A 1 50 ALA 50 51 51 ALA ALA A . n 
A 1 51 ASN 51 52 52 ASN ASN A . n 
A 1 52 PRO 52 53 53 PRO PRO A . n 
A 1 53 GLU 53 54 54 GLU GLU A . n 
A 1 54 LYS 54 55 55 LYS LYS A . n 
A 1 55 LYS 55 56 56 LYS LYS A . n 
A 1 56 TRP 56 57 57 TRP TRP A . n 
A 1 57 VAL 57 58 58 VAL VAL A . n 
A 1 58 ARG 58 59 59 ARG ARG A . n 
A 1 59 GLU 59 60 60 GLU GLU A . n 
A 1 60 TYR 60 61 61 TYR TYR A . n 
A 1 61 ILE 61 62 62 ILE ILE A . n 
A 1 62 ASN 62 63 63 ASN ASN A . n 
A 1 63 SER 63 64 64 SER SER A . n 
A 1 64 LEU 64 65 65 LEU LEU A . n 
A 1 65 GLU 65 66 66 GLU GLU A . n 
A 1 66 MET 66 67 67 MET MET A . n 
A 1 67 SER 67 68 68 SER SER A . n 
B 1 1  PRO 1  2  2  PRO PRO B . n 
B 1 2  TYR 2  3  3  TYR TYR B . n 
B 1 3  SER 3  4  4  SER SER B . n 
B 1 4  SER 4  5  5  SER SER B . n 
B 1 5  ASP 5  6  6  ASP ASP B . n 
B 1 6  THR 6  7  7  THR THR B . n 
B 1 7  THR 7  8  8  THR THR B . n 
B 1 8  PRO 8  9  9  PRO PRO B . n 
B 1 9  CYS 9  10 10 CYS CYS B . n 
B 1 10 CYS 10 11 11 CYS CYS B . n 
B 1 11 PHE 11 12 12 PHE PHE B . n 
B 1 12 ALA 12 13 13 ALA ALA B . n 
B 1 13 TYR 13 14 14 TYR TYR B . n 
B 1 14 ILE 14 15 15 ILE ILE B . n 
B 1 15 ALA 15 16 16 ALA ALA B . n 
B 1 16 ARG 16 17 17 ARG ARG B . n 
B 1 17 PRO 17 18 18 PRO PRO B . n 
B 1 18 LEU 18 19 19 LEU LEU B . n 
B 1 19 PRO 19 20 20 PRO PRO B . n 
B 1 20 ARG 20 21 21 ARG ARG B . n 
B 1 21 ALA 21 22 22 ALA ALA B . n 
B 1 22 HIS 22 23 23 HIS HIS B . n 
B 1 23 ILE 23 24 24 ILE ILE B . n 
B 1 24 LYS 24 25 25 LYS LYS B . n 
B 1 25 GLU 25 26 26 GLU GLU B . n 
B 1 26 TYR 26 27 27 TYR TYR B . n 
B 1 27 PHE 27 28 28 PHE PHE B . n 
B 1 28 TYR 28 29 29 TYR TYR B . n 
B 1 29 THR 29 30 30 THR THR B . n 
B 1 30 SER 30 31 31 SER SER B . n 
B 1 31 GLY 31 32 32 GLY GLY B . n 
B 1 32 LYS 32 33 33 LYS LYS B . n 
B 1 33 CYS 33 34 34 CYS CYS B . n 
B 1 34 SER 34 35 35 SER SER B . n 
B 1 35 ASN 35 36 36 ASN ASN B . n 
B 1 36 PRO 36 37 37 PRO PRO B . n 
B 1 37 ALA 37 38 38 ALA ALA B . n 
B 1 38 VAL 38 39 39 VAL VAL B . n 
B 1 39 VAL 39 40 40 VAL VAL B . n 
B 1 40 PHE 40 41 41 PHE PHE B . n 
B 1 41 VAL 41 42 42 VAL VAL B . n 
B 1 42 THR 42 43 43 THR THR B . n 
B 1 43 ARG 43 44 44 ARG ARG B . n 
B 1 44 LYS 44 45 45 LYS LYS B . n 
B 1 45 ASN 45 46 46 ASN ASN B . n 
B 1 46 ARG 46 47 47 ARG ARG B . n 
B 1 47 GLN 47 48 48 GLN GLN B . n 
B 1 48 VAL 48 49 49 VAL VAL B . n 
B 1 49 CYS 49 50 50 CYS CYS B . n 
B 1 50 ALA 50 51 51 ALA ALA B . n 
B 1 51 ASN 51 52 52 ASN ASN B . n 
B 1 52 PRO 52 53 53 PRO PRO B . n 
B 1 53 GLU 53 54 54 GLU GLU B . n 
B 1 54 LYS 54 55 55 LYS LYS B . n 
B 1 55 LYS 55 56 56 LYS LYS B . n 
B 1 56 TRP 56 57 57 TRP TRP B . n 
B 1 57 VAL 57 58 58 VAL VAL B . n 
B 1 58 ARG 58 59 59 ARG ARG B . n 
B 1 59 GLU 59 60 60 GLU GLU B . n 
B 1 60 TYR 60 61 61 TYR TYR B . n 
B 1 61 ILE 61 62 62 ILE ILE B . n 
B 1 62 ASN 62 63 63 ASN ASN B . n 
B 1 63 SER 63 64 64 SER SER B . n 
B 1 64 LEU 64 65 65 LEU LEU B . n 
B 1 65 GLU 65 66 66 GLU GLU B . n 
B 1 66 MET 66 67 67 MET MET B . n 
B 1 67 SER 67 68 68 SER SER B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 SO4 1   197  197  SO4 SO4 A . 
D 2 SO4 1   196  196  SO4 SO4 A . 
E 2 SO4 1   198  198  SO4 SO4 A . 
F 3 AOP 1   1    1    AOP AOP A . 
G 2 SO4 1   199  199  SO4 SO4 B . 
H 3 AOP 1   1    1    AOP AOP B . 
I 4 HOH 1   1001 1001 HOH HOH A . 
I 4 HOH 2   1002 1002 HOH HOH A . 
I 4 HOH 3   1003 1003 HOH HOH A . 
I 4 HOH 4   1007 1007 HOH HOH A . 
I 4 HOH 5   1009 1009 HOH HOH A . 
I 4 HOH 6   1010 1010 HOH HOH A . 
I 4 HOH 7   1011 1011 HOH HOH A . 
I 4 HOH 8   1012 1012 HOH HOH A . 
I 4 HOH 9   1013 1013 HOH HOH A . 
I 4 HOH 10  1016 1016 HOH HOH A . 
I 4 HOH 11  1018 1018 HOH HOH A . 
I 4 HOH 12  1020 1020 HOH HOH A . 
I 4 HOH 13  1021 1021 HOH HOH A . 
I 4 HOH 14  1023 1023 HOH HOH A . 
I 4 HOH 15  1024 1024 HOH HOH A . 
I 4 HOH 16  1025 1025 HOH HOH A . 
I 4 HOH 17  1027 1027 HOH HOH A . 
I 4 HOH 18  1028 1028 HOH HOH A . 
I 4 HOH 19  1030 1030 HOH HOH A . 
I 4 HOH 20  1031 1031 HOH HOH A . 
I 4 HOH 21  1032 1032 HOH HOH A . 
I 4 HOH 22  1034 1034 HOH HOH A . 
I 4 HOH 23  1036 1036 HOH HOH A . 
I 4 HOH 24  1037 1037 HOH HOH A . 
I 4 HOH 25  1038 1038 HOH HOH A . 
I 4 HOH 26  1039 1039 HOH HOH A . 
I 4 HOH 27  1041 1041 HOH HOH A . 
I 4 HOH 28  1043 1043 HOH HOH A . 
I 4 HOH 29  1044 1044 HOH HOH A . 
I 4 HOH 30  1045 1045 HOH HOH A . 
I 4 HOH 31  1048 1048 HOH HOH A . 
I 4 HOH 32  1049 1049 HOH HOH A . 
I 4 HOH 33  1054 1054 HOH HOH A . 
I 4 HOH 34  1055 1055 HOH HOH A . 
I 4 HOH 35  1058 1058 HOH HOH A . 
I 4 HOH 36  1060 1060 HOH HOH A . 
I 4 HOH 37  1065 1065 HOH HOH A . 
I 4 HOH 38  1068 1068 HOH HOH A . 
I 4 HOH 39  1069 1069 HOH HOH A . 
I 4 HOH 40  1073 1073 HOH HOH A . 
I 4 HOH 41  1078 1078 HOH HOH A . 
I 4 HOH 42  1082 1082 HOH HOH A . 
I 4 HOH 43  1083 1083 HOH HOH A . 
I 4 HOH 44  1085 1085 HOH HOH A . 
I 4 HOH 45  1086 1086 HOH HOH A . 
I 4 HOH 46  1087 1087 HOH HOH A . 
I 4 HOH 47  1089 1089 HOH HOH A . 
I 4 HOH 48  1090 1090 HOH HOH A . 
I 4 HOH 49  1091 1091 HOH HOH A . 
I 4 HOH 50  1096 1096 HOH HOH A . 
I 4 HOH 51  1097 1097 HOH HOH A . 
I 4 HOH 52  1098 1098 HOH HOH A . 
I 4 HOH 53  1099 1099 HOH HOH A . 
I 4 HOH 54  1100 1100 HOH HOH A . 
I 4 HOH 55  1101 1101 HOH HOH A . 
I 4 HOH 56  1102 1102 HOH HOH A . 
I 4 HOH 57  1103 1103 HOH HOH A . 
I 4 HOH 58  1104 1104 HOH HOH A . 
I 4 HOH 59  1107 1107 HOH HOH A . 
I 4 HOH 60  1108 1108 HOH HOH A . 
I 4 HOH 61  1109 1109 HOH HOH A . 
I 4 HOH 62  1110 1110 HOH HOH A . 
I 4 HOH 63  1118 1118 HOH HOH A . 
I 4 HOH 64  1119 1119 HOH HOH A . 
I 4 HOH 65  1122 1122 HOH HOH A . 
I 4 HOH 66  1123 1123 HOH HOH A . 
I 4 HOH 67  1124 1124 HOH HOH A . 
I 4 HOH 68  1125 1125 HOH HOH A . 
I 4 HOH 69  1127 1127 HOH HOH A . 
I 4 HOH 70  1129 1129 HOH HOH A . 
I 4 HOH 71  1131 1131 HOH HOH A . 
I 4 HOH 72  1135 1135 HOH HOH A . 
I 4 HOH 73  1136 1136 HOH HOH A . 
I 4 HOH 74  1137 1137 HOH HOH A . 
I 4 HOH 75  1138 1138 HOH HOH A . 
I 4 HOH 76  1139 1139 HOH HOH A . 
I 4 HOH 77  1142 1142 HOH HOH A . 
I 4 HOH 78  1143 1143 HOH HOH A . 
I 4 HOH 79  1144 1144 HOH HOH A . 
I 4 HOH 80  1147 1147 HOH HOH A . 
I 4 HOH 81  1148 1148 HOH HOH A . 
I 4 HOH 82  1150 1150 HOH HOH A . 
I 4 HOH 83  1156 1156 HOH HOH A . 
I 4 HOH 84  1158 1158 HOH HOH A . 
I 4 HOH 85  1160 1160 HOH HOH A . 
I 4 HOH 86  1161 1161 HOH HOH A . 
I 4 HOH 87  1164 1164 HOH HOH A . 
I 4 HOH 88  1165 1165 HOH HOH A . 
I 4 HOH 89  1166 1166 HOH HOH A . 
I 4 HOH 90  1168 1168 HOH HOH A . 
I 4 HOH 91  1169 1169 HOH HOH A . 
I 4 HOH 92  1172 1172 HOH HOH A . 
I 4 HOH 93  1173 1173 HOH HOH A . 
I 4 HOH 94  1174 1174 HOH HOH A . 
I 4 HOH 95  1175 1175 HOH HOH A . 
I 4 HOH 96  1176 1176 HOH HOH A . 
I 4 HOH 97  1177 1177 HOH HOH A . 
I 4 HOH 98  1178 1178 HOH HOH A . 
I 4 HOH 99  1179 1179 HOH HOH A . 
I 4 HOH 100 1181 1181 HOH HOH A . 
I 4 HOH 101 1182 1182 HOH HOH A . 
I 4 HOH 102 1183 1183 HOH HOH A . 
I 4 HOH 103 1184 1184 HOH HOH A . 
I 4 HOH 104 1186 1186 HOH HOH A . 
I 4 HOH 105 1190 1190 HOH HOH A . 
I 4 HOH 106 1193 1193 HOH HOH A . 
I 4 HOH 107 1194 1194 HOH HOH A . 
I 4 HOH 108 1199 1199 HOH HOH A . 
I 4 HOH 109 1200 1200 HOH HOH A . 
I 4 HOH 110 1201 1201 HOH HOH A . 
I 4 HOH 111 1202 1202 HOH HOH A . 
I 4 HOH 112 1203 1203 HOH HOH A . 
I 4 HOH 113 1206 1206 HOH HOH A . 
I 4 HOH 114 1207 1207 HOH HOH A . 
I 4 HOH 115 1211 1211 HOH HOH A . 
I 4 HOH 116 1215 1215 HOH HOH A . 
I 4 HOH 117 1216 1216 HOH HOH A . 
I 4 HOH 118 1219 1219 HOH HOH A . 
I 4 HOH 119 1220 1220 HOH HOH A . 
I 4 HOH 120 1222 1222 HOH HOH A . 
J 4 HOH 1   1004 1004 HOH HOH B . 
J 4 HOH 2   1005 1005 HOH HOH B . 
J 4 HOH 3   1006 1006 HOH HOH B . 
J 4 HOH 4   1008 1008 HOH HOH B . 
J 4 HOH 5   1014 1014 HOH HOH B . 
J 4 HOH 6   1015 1015 HOH HOH B . 
J 4 HOH 7   1017 1017 HOH HOH B . 
J 4 HOH 8   1019 1019 HOH HOH B . 
J 4 HOH 9   1022 1022 HOH HOH B . 
J 4 HOH 10  1026 1026 HOH HOH B . 
J 4 HOH 11  1029 1029 HOH HOH B . 
J 4 HOH 12  1033 1033 HOH HOH B . 
J 4 HOH 13  1035 1035 HOH HOH B . 
J 4 HOH 14  1040 1040 HOH HOH B . 
J 4 HOH 15  1042 1042 HOH HOH B . 
J 4 HOH 16  1046 1046 HOH HOH B . 
J 4 HOH 17  1047 1047 HOH HOH B . 
J 4 HOH 18  1050 1050 HOH HOH B . 
J 4 HOH 19  1051 1051 HOH HOH B . 
J 4 HOH 20  1052 1052 HOH HOH B . 
J 4 HOH 21  1053 1053 HOH HOH B . 
J 4 HOH 22  1056 1056 HOH HOH B . 
J 4 HOH 23  1057 1057 HOH HOH B . 
J 4 HOH 24  1059 1059 HOH HOH B . 
J 4 HOH 25  1061 1061 HOH HOH B . 
J 4 HOH 26  1062 1062 HOH HOH B . 
J 4 HOH 27  1063 1063 HOH HOH B . 
J 4 HOH 28  1064 1064 HOH HOH B . 
J 4 HOH 29  1066 1066 HOH HOH B . 
J 4 HOH 30  1067 1067 HOH HOH B . 
J 4 HOH 31  1070 1070 HOH HOH B . 
J 4 HOH 32  1071 1071 HOH HOH B . 
J 4 HOH 33  1072 1072 HOH HOH B . 
J 4 HOH 34  1074 1074 HOH HOH B . 
J 4 HOH 35  1075 1075 HOH HOH B . 
J 4 HOH 36  1076 1076 HOH HOH B . 
J 4 HOH 37  1077 1077 HOH HOH B . 
J 4 HOH 38  1079 1079 HOH HOH B . 
J 4 HOH 39  1080 1080 HOH HOH B . 
J 4 HOH 40  1081 1081 HOH HOH B . 
J 4 HOH 41  1084 1084 HOH HOH B . 
J 4 HOH 42  1088 1088 HOH HOH B . 
J 4 HOH 43  1092 1092 HOH HOH B . 
J 4 HOH 44  1093 1093 HOH HOH B . 
J 4 HOH 45  1094 1094 HOH HOH B . 
J 4 HOH 46  1095 1095 HOH HOH B . 
J 4 HOH 47  1105 1105 HOH HOH B . 
J 4 HOH 48  1106 1106 HOH HOH B . 
J 4 HOH 49  1111 1111 HOH HOH B . 
J 4 HOH 50  1112 1112 HOH HOH B . 
J 4 HOH 51  1113 1113 HOH HOH B . 
J 4 HOH 52  1114 1114 HOH HOH B . 
J 4 HOH 53  1115 1115 HOH HOH B . 
J 4 HOH 54  1116 1116 HOH HOH B . 
J 4 HOH 55  1117 1117 HOH HOH B . 
J 4 HOH 56  1120 1120 HOH HOH B . 
J 4 HOH 57  1121 1121 HOH HOH B . 
J 4 HOH 58  1126 1126 HOH HOH B . 
J 4 HOH 59  1128 1128 HOH HOH B . 
J 4 HOH 60  1130 1130 HOH HOH B . 
J 4 HOH 61  1132 1132 HOH HOH B . 
J 4 HOH 62  1133 1133 HOH HOH B . 
J 4 HOH 63  1134 1134 HOH HOH B . 
J 4 HOH 64  1140 1140 HOH HOH B . 
J 4 HOH 65  1141 1141 HOH HOH B . 
J 4 HOH 66  1145 1145 HOH HOH B . 
J 4 HOH 67  1146 1146 HOH HOH B . 
J 4 HOH 68  1149 1149 HOH HOH B . 
J 4 HOH 69  1151 1151 HOH HOH B . 
J 4 HOH 70  1152 1152 HOH HOH B . 
J 4 HOH 71  1153 1153 HOH HOH B . 
J 4 HOH 72  1154 1154 HOH HOH B . 
J 4 HOH 73  1155 1155 HOH HOH B . 
J 4 HOH 74  1157 1157 HOH HOH B . 
J 4 HOH 75  1159 1159 HOH HOH B . 
J 4 HOH 76  1162 1162 HOH HOH B . 
J 4 HOH 77  1163 1163 HOH HOH B . 
J 4 HOH 78  1167 1167 HOH HOH B . 
J 4 HOH 79  1170 1170 HOH HOH B . 
J 4 HOH 80  1171 1171 HOH HOH B . 
J 4 HOH 81  1180 1180 HOH HOH B . 
J 4 HOH 82  1185 1185 HOH HOH B . 
J 4 HOH 83  1187 1187 HOH HOH B . 
J 4 HOH 84  1188 1188 HOH HOH B . 
J 4 HOH 85  1189 1189 HOH HOH B . 
J 4 HOH 86  1191 1191 HOH HOH B . 
J 4 HOH 87  1192 1192 HOH HOH B . 
J 4 HOH 88  1195 1195 HOH HOH B . 
J 4 HOH 89  1196 1196 HOH HOH B . 
J 4 HOH 90  1197 1197 HOH HOH B . 
J 4 HOH 91  1198 1198 HOH HOH B . 
J 4 HOH 92  1204 1204 HOH HOH B . 
J 4 HOH 93  1205 1205 HOH HOH B . 
J 4 HOH 94  1208 1208 HOH HOH B . 
J 4 HOH 95  1209 1209 HOH HOH B . 
J 4 HOH 96  1210 1210 HOH HOH B . 
J 4 HOH 97  1212 1212 HOH HOH B . 
J 4 HOH 98  1213 1213 HOH HOH B . 
J 4 HOH 99  1214 1214 HOH HOH B . 
J 4 HOH 100 1217 1217 HOH HOH B . 
J 4 HOH 101 1218 1218 HOH HOH B . 
J 4 HOH 102 1221 1221 HOH HOH B . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_defined_assembly ? monomeric 1 
2 author_defined_assembly ? monomeric 1 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C,D,E,F,I 
2 1 B,G,H,J     
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1999-04-23 
2 'Structure model' 1 1 2008-04-26 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2017-10-04 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Refinement description'    
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    4 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            software 
# 
_pdbx_audit_revision_item.ordinal             1 
_pdbx_audit_revision_item.revision_ordinal    4 
_pdbx_audit_revision_item.data_content_type   'Structure model' 
_pdbx_audit_revision_item.item                '_software.name' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
HKL-2000  'data collection' . ? 1 
HKL-2000  'data reduction'  . ? 2 
AMoRE     phasing           . ? 3 
SHELXL-97 refinement        . ? 4 
HKL-2000  'data scaling'    . ? 5 
# 
_pdbx_entry_details.entry_id             1B3A 
_pdbx_entry_details.compound_details     ? 
_pdbx_entry_details.source_details       ? 
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.sequence_details     
;MODRES: 1B3A AOP A 1() AMINOOXYPENTANE LINKED TO PRO2 VIA
  OXIME BOND
MODRES: 1B3A AOP B 1() AMINOOXYPENTANE LINKED TO PRO2 VIA
  OXIME BOND
;
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 NE A ARG 17 ? ? CZ A ARG 17 ? ? NH1 A ARG 17 ? ? 123.36 120.30 3.06  0.50 N 
2 1 CD B ARG 47 ? ? NE B ARG 47 ? ? CZ  B ARG 47 ? ? 136.92 123.60 13.32 1.40 N 
3 1 NE B ARG 47 ? ? CZ B ARG 47 ? ? NH1 B ARG 47 ? ? 124.18 120.30 3.88  0.50 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 TYR A 3  ? ? -118.50 -137.21 
2 1 MET A 67 ? ? -91.43  41.70   
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'SULFATE ION'               SO4 
3 PENTYLOXYAMINO-ACETALDEHYDE AOP 
4 water                       HOH 
#