data_1B4C
# 
_entry.id   1B4C 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.355 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   1B4C         pdb_00001b4c 10.2210/pdb1b4c/pdb 
RCSB  RCSB008303   ?            ?                   
WWPDB D_1000008303 ?            ?                   
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1B4C 
_pdbx_database_status.recvd_initial_deposition_date   1998-12-17 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Weber, D.J.'      1 
'Drohat, A.C.'     2 
'Tjandra, N.'      3 
'Baldisseri, D.M.' 4 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'The use of dipolar couplings for determining the solution structure of rat apo-S100B(betabeta).'  'Protein Sci.' 8  800   
809 1999 PRCIEI US 0961-8368 0795 ? 10211826 ? 
1       'Solution Structure of Rat Apo-S100B(beta beta) as Determined by NMR Spectroscopy'                 Biochemistry   35 11577 
?   1996 BICHAW US 0006-2960 0033 ? ?        ? 
2       '==1==H, ==13==C and ==15==N NMR Assignments and Solution Secondary Structure of Rat Apo-S100Beta' J.Biomol.NMR   6  171   
?   1995 JBNME9 NE 0925-2738 0800 ? ?        ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Drohat, A.C.'     1  ? 
primary 'Tjandra, N.'      2  ? 
primary 'Baldisseri, D.M.' 3  ? 
primary 'Weber, D.J.'      4  ? 
1       'Drohat, A.C.'     5  ? 
1       'Amburgey, J.C.'   6  ? 
1       'Abildgaard, F.'   7  ? 
1       'Starich, M.R.'    8  ? 
1       'Baldisseri, D.M.' 9  ? 
1       'Weber, D.J.'      10 ? 
2       'Amburgey, J.C.'   11 ? 
2       'Abildgaard, F.'   12 ? 
2       'Starich, M.R.'    13 ? 
2       'Shah, S.'         14 ? 
2       'Hilt, D.C.'       15 ? 
2       'Weber, D.J.'      16 ? 
# 
_cell.entry_id           1B4C 
_cell.length_a           1.000 
_cell.length_b           1.000 
_cell.length_c           1.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1B4C 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'PROTEIN (S-100 PROTEIN, BETA CHAIN)' 
_entity.formula_weight             10758.048 
_entity.pdbx_number_of_molecules   2 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              ? 
_entity.details                    'S100B IS A HOMODIMER OF S100BETA SUBUNITS' 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'S100B, S100BETA' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDEDGDGECDFQEFMAFVSM
VTTACHEFFEHE
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDEDGDGECDFQEFMAFVSM
VTTACHEFFEHE
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  MET n 
1 2  SER n 
1 3  GLU n 
1 4  LEU n 
1 5  GLU n 
1 6  LYS n 
1 7  ALA n 
1 8  MET n 
1 9  VAL n 
1 10 ALA n 
1 11 LEU n 
1 12 ILE n 
1 13 ASP n 
1 14 VAL n 
1 15 PHE n 
1 16 HIS n 
1 17 GLN n 
1 18 TYR n 
1 19 SER n 
1 20 GLY n 
1 21 ARG n 
1 22 GLU n 
1 23 GLY n 
1 24 ASP n 
1 25 LYS n 
1 26 HIS n 
1 27 LYS n 
1 28 LEU n 
1 29 LYS n 
1 30 LYS n 
1 31 SER n 
1 32 GLU n 
1 33 LEU n 
1 34 LYS n 
1 35 GLU n 
1 36 LEU n 
1 37 ILE n 
1 38 ASN n 
1 39 ASN n 
1 40 GLU n 
1 41 LEU n 
1 42 SER n 
1 43 HIS n 
1 44 PHE n 
1 45 LEU n 
1 46 GLU n 
1 47 GLU n 
1 48 ILE n 
1 49 LYS n 
1 50 GLU n 
1 51 GLN n 
1 52 GLU n 
1 53 VAL n 
1 54 VAL n 
1 55 ASP n 
1 56 LYS n 
1 57 VAL n 
1 58 MET n 
1 59 GLU n 
1 60 THR n 
1 61 LEU n 
1 62 ASP n 
1 63 GLU n 
1 64 ASP n 
1 65 GLY n 
1 66 ASP n 
1 67 GLY n 
1 68 GLU n 
1 69 CYS n 
1 70 ASP n 
1 71 PHE n 
1 72 GLN n 
1 73 GLU n 
1 74 PHE n 
1 75 MET n 
1 76 ALA n 
1 77 PHE n 
1 78 VAL n 
1 79 SER n 
1 80 MET n 
1 81 VAL n 
1 82 THR n 
1 83 THR n 
1 84 ALA n 
1 85 CYS n 
1 86 HIS n 
1 87 GLU n 
1 88 PHE n 
1 89 PHE n 
1 90 GLU n 
1 91 HIS n 
1 92 GLU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               'Norway rat' 
_entity_src_gen.gene_src_genus                     Rattus 
_entity_src_gen.pdbx_gene_src_gene                 'S100BETA FROM RATTUS NORVEGICUS (RAT)' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Rattus norvegicus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     10116 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'HMS174(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PET11B 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   'SEE MAIN REFERENCE' 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    S100B_RAT 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P04631 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1B4C A 2 ? 92 ? P04631 1 ? 91 ? 1 91 
2 1 1B4C B 2 ? 92 ? P04631 1 ? 91 ? 1 91 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1B4C MET A 1 ? UNP P04631 ? ? 'SEE REMARK 999' 0 1 
2 1B4C MET B 1 ? UNP P04631 ? ? 'SEE REMARK 999' 0 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_pdbx_nmr_exptl.experiment_id   1 
_pdbx_nmr_exptl.conditions_id   1 
_pdbx_nmr_exptl.type            'SEE MAIN REFERENCE' 
_pdbx_nmr_exptl.solution_id     1 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         310 
_pdbx_nmr_exptl_sample_conditions.pressure            1 
_pdbx_nmr_exptl_sample_conditions.pH                  6.5 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      25mM 
_pdbx_nmr_exptl_sample_conditions.pressure_units      atm 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.model             DMX 
_pdbx_nmr_spectrometer.manufacturer      Bruker 
_pdbx_nmr_spectrometer.field_strength    600.13 
_pdbx_nmr_spectrometer.type              ? 
# 
_pdbx_nmr_refine.entry_id           1B4C 
_pdbx_nmr_refine.method             'SEE MAIN REFERENCE' 
_pdbx_nmr_refine.details            'SEE MAIN REFERENCE' 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_details.entry_id   1B4C 
_pdbx_nmr_details.text       'SEE MAIN REFERENCE' 
# 
_pdbx_nmr_ensemble.entry_id                                      1B4C 
_pdbx_nmr_ensemble.conformers_calculated_total_number            21 
_pdbx_nmr_ensemble.conformers_submitted_total_number             21 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'SEE MAIN REFERENCE' 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             1B4C 
_pdbx_nmr_representative.conformer_id         2 
_pdbx_nmr_representative.selection_criteria   ? 
# 
loop_
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
refinement           'X-PLOR V3.851' V3.851 'AXEL T. BRUNGER' 1 
'structure solution' 'X-PLOR V3.851' V3.851 ?                 2 
# 
_exptl.entry_id          1B4C 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_struct.entry_id                  1B4C 
_struct.title                     'SOLUTION STRUCTURE OF RAT APO-S100B USING DIPOLAR COUPLINGS' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1B4C 
_struct_keywords.pdbx_keywords   'METAL BINDING PROTEIN' 
_struct_keywords.text            
;S100BETA, S100B, DIPOLAR COUPLINGS, EF-HAND, S100 PROTEIN, CALCIUM- BINDING PROTEIN, FOUR-HELIX BUNDLE, THREE-DIMENSIONAL STRUCTURE, SOLUTION STRUCTURE, METAL BINDING PROTEIN
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1A  GLU A 3  ? GLY A 20 ? GLU A 2  GLY A 19 1 ? 18 
HELX_P HELX_P2  2A  LYS A 30 ? GLU A 40 ? LYS A 29 GLU A 39 1 ? 11 
HELX_P HELX_P3  3A  PHE A 44 ? GLU A 46 ? PHE A 43 GLU A 45 5 ? 3  
HELX_P HELX_P4  4A  GLN A 51 ? ASP A 62 ? GLN A 50 ASP A 61 1 ? 12 
HELX_P HELX_P5  5A  PHE A 71 ? ALA A 84 ? PHE A 70 ALA A 83 1 ? 14 
HELX_P HELX_P6  6A  SER A 42 ? GLU A 46 ? SER A 41 GLU A 45 1 ? 5  
HELX_P HELX_P7  7A  PHE A 71 ? THR A 83 ? PHE A 70 THR A 82 1 ? 13 
HELX_P HELX_P8  8A  PHE A 88 ? GLU A 90 ? PHE A 87 GLU A 89 5 ? 3  
HELX_P HELX_P9  9A  PHE A 71 ? CYS A 85 ? PHE A 70 CYS A 84 1 ? 15 
HELX_P HELX_P10 10A HIS A 86 ? PHE A 88 ? HIS A 85 PHE A 87 5 ? 3  
HELX_P HELX_P11 11A GLN A 51 ? GLU A 63 ? GLN A 50 GLU A 62 1 ? 13 
HELX_P HELX_P12 1B  GLU B 3  ? GLY B 20 ? GLU B 2  GLY B 19 1 ? 18 
HELX_P HELX_P13 2B  LYS B 30 ? GLU B 40 ? LYS B 29 GLU B 39 1 ? 11 
HELX_P HELX_P14 3B  PHE B 44 ? GLU B 46 ? PHE B 43 GLU B 45 5 ? 3  
HELX_P HELX_P15 4B  GLN B 51 ? ASP B 62 ? GLN B 50 ASP B 61 1 ? 12 
HELX_P HELX_P16 5B  PHE B 71 ? ALA B 84 ? PHE B 70 ALA B 83 1 ? 14 
HELX_P HELX_P17 6B  SER B 42 ? GLU B 46 ? SER B 41 GLU B 45 1 ? 5  
HELX_P HELX_P18 7B  PHE B 71 ? THR B 83 ? PHE B 70 THR B 82 1 ? 13 
HELX_P HELX_P19 8B  PHE B 88 ? GLU B 90 ? PHE B 87 GLU B 89 5 ? 3  
HELX_P HELX_P20 9B  PHE B 71 ? CYS B 85 ? PHE B 70 CYS B 84 1 ? 15 
HELX_P HELX_P21 10B HIS B 86 ? PHE B 88 ? HIS B 85 PHE B 87 5 ? 3  
HELX_P HELX_P22 11B GLN B 51 ? GLU B 63 ? GLN B 50 GLU B 62 1 ? 13 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_database_PDB_matrix.entry_id          1B4C 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1B4C 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . MET A 1 1  ? -10.059 7.534   11.793  1.00 0.00 ? 0  MET A N    1  
ATOM 2     C CA   . MET A 1 1  ? -9.979  7.191   13.240  1.00 0.00 ? 0  MET A CA   1  
ATOM 3     C C    . MET A 1 1  ? -10.131 5.679   13.415  1.00 0.00 ? 0  MET A C    1  
ATOM 4     O O    . MET A 1 1  ? -9.859  5.136   14.468  1.00 0.00 ? 0  MET A O    1  
ATOM 5     C CB   . MET A 1 1  ? -11.100 7.906   13.997  1.00 0.00 ? 0  MET A CB   1  
ATOM 6     C CG   . MET A 1 1  ? -11.067 7.493   15.470  1.00 0.00 ? 0  MET A CG   1  
ATOM 7     S SD   . MET A 1 1  ? -12.084 8.633   16.439  1.00 0.00 ? 0  MET A SD   1  
ATOM 8     C CE   . MET A 1 1  ? -11.536 8.091   18.076  1.00 0.00 ? 0  MET A CE   1  
ATOM 9     H H1   . MET A 1 1  ? -9.958  6.670   11.225  1.00 0.00 ? 0  MET A H1   1  
ATOM 10    H H2   . MET A 1 1  ? -10.979 7.973   11.590  1.00 0.00 ? 0  MET A H2   1  
ATOM 11    H H3   . MET A 1 1  ? -9.296  8.200   11.552  1.00 0.00 ? 0  MET A H3   1  
ATOM 12    H HA   . MET A 1 1  ? -9.023  7.505   13.632  1.00 0.00 ? 0  MET A HA   1  
ATOM 13    H HB2  . MET A 1 1  ? -10.961 8.975   13.919  1.00 0.00 ? 0  MET A HB2  1  
ATOM 14    H HB3  . MET A 1 1  ? -12.053 7.635   13.570  1.00 0.00 ? 0  MET A HB3  1  
ATOM 15    H HG2  . MET A 1 1  ? -11.454 6.489   15.570  1.00 0.00 ? 0  MET A HG2  1  
ATOM 16    H HG3  . MET A 1 1  ? -10.049 7.524   15.830  1.00 0.00 ? 0  MET A HG3  1  
ATOM 17    H HE1  . MET A 1 1  ? -11.488 7.011   18.100  1.00 0.00 ? 0  MET A HE1  1  
ATOM 18    H HE2  . MET A 1 1  ? -10.558 8.495   18.282  1.00 0.00 ? 0  MET A HE2  1  
ATOM 19    H HE3  . MET A 1 1  ? -12.235 8.442   18.823  1.00 0.00 ? 0  MET A HE3  1  
ATOM 20    N N    . SER A 1 2  ? -10.560 4.992   12.392  1.00 0.00 ? 1  SER A N    1  
ATOM 21    C CA   . SER A 1 2  ? -10.725 3.515   12.506  1.00 0.00 ? 1  SER A CA   1  
ATOM 22    C C    . SER A 1 2  ? -9.363  2.875   12.776  1.00 0.00 ? 1  SER A C    1  
ATOM 23    O O    . SER A 1 2  ? -8.334  3.508   12.648  1.00 0.00 ? 1  SER A O    1  
ATOM 24    C CB   . SER A 1 2  ? -11.298 2.960   11.200  1.00 0.00 ? 1  SER A CB   1  
ATOM 25    O OG   . SER A 1 2  ? -10.237 2.731   10.283  1.00 0.00 ? 1  SER A OG   1  
ATOM 26    H H    . SER A 1 2  ? -10.773 5.446   11.550  1.00 0.00 ? 1  SER A H    1  
ATOM 27    H HA   . SER A 1 2  ? -11.396 3.291   13.321  1.00 0.00 ? 1  SER A HA   1  
ATOM 28    H HB2  . SER A 1 2  ? -11.807 2.030   11.393  1.00 0.00 ? 1  SER A HB2  1  
ATOM 29    H HB3  . SER A 1 2  ? -12.000 3.672   10.785  1.00 0.00 ? 1  SER A HB3  1  
ATOM 30    H HG   . SER A 1 2  ? -10.578 2.197   9.562   1.00 0.00 ? 1  SER A HG   1  
ATOM 31    N N    . GLU A 1 3  ? -9.346  1.626   13.150  1.00 0.00 ? 2  GLU A N    1  
ATOM 32    C CA   . GLU A 1 3  ? -8.047  0.954   13.429  1.00 0.00 ? 2  GLU A CA   1  
ATOM 33    C C    . GLU A 1 3  ? -7.130  1.092   12.213  1.00 0.00 ? 2  GLU A C    1  
ATOM 34    O O    . GLU A 1 3  ? -5.927  1.197   12.338  1.00 0.00 ? 2  GLU A O    1  
ATOM 35    C CB   . GLU A 1 3  ? -8.290  -0.529  13.715  1.00 0.00 ? 2  GLU A CB   1  
ATOM 36    C CG   . GLU A 1 3  ? -8.935  -0.688  15.093  1.00 0.00 ? 2  GLU A CG   1  
ATOM 37    C CD   . GLU A 1 3  ? -10.266 0.066   15.124  1.00 0.00 ? 2  GLU A CD   1  
ATOM 38    O OE1  . GLU A 1 3  ? -10.246 1.251   15.414  1.00 0.00 ? 2  GLU A OE1  1  
ATOM 39    O OE2  . GLU A 1 3  ? -11.282 -0.554  14.858  1.00 0.00 ? 2  GLU A OE2  1  
ATOM 40    H H    . GLU A 1 3  ? -10.187 1.131   13.250  1.00 0.00 ? 2  GLU A H    1  
ATOM 41    H HA   . GLU A 1 3  ? -7.579  1.414   14.287  1.00 0.00 ? 2  GLU A HA   1  
ATOM 42    H HB2  . GLU A 1 3  ? -8.946  -0.938  12.960  1.00 0.00 ? 2  GLU A HB2  1  
ATOM 43    H HB3  . GLU A 1 3  ? -7.349  -1.058  13.697  1.00 0.00 ? 2  GLU A HB3  1  
ATOM 44    H HG2  . GLU A 1 3  ? -9.110  -1.736  15.289  1.00 0.00 ? 2  GLU A HG2  1  
ATOM 45    H HG3  . GLU A 1 3  ? -8.277  -0.285  15.847  1.00 0.00 ? 2  GLU A HG3  1  
ATOM 46    N N    . LEU A 1 4  ? -7.689  1.078   11.034  1.00 0.00 ? 3  LEU A N    1  
ATOM 47    C CA   . LEU A 1 4  ? -6.850  1.193   9.809   1.00 0.00 ? 3  LEU A CA   1  
ATOM 48    C C    . LEU A 1 4  ? -6.138  2.553   9.794   1.00 0.00 ? 3  LEU A C    1  
ATOM 49    O O    . LEU A 1 4  ? -4.946  2.633   9.573   1.00 0.00 ? 3  LEU A O    1  
ATOM 50    C CB   . LEU A 1 4  ? -7.746  1.045   8.562   1.00 0.00 ? 3  LEU A CB   1  
ATOM 51    C CG   . LEU A 1 4  ? -6.965  0.381   7.421   1.00 0.00 ? 3  LEU A CG   1  
ATOM 52    C CD1  . LEU A 1 4  ? -7.858  0.281   6.182   1.00 0.00 ? 3  LEU A CD1  1  
ATOM 53    C CD2  . LEU A 1 4  ? -5.723  1.216   7.091   1.00 0.00 ? 3  LEU A CD2  1  
ATOM 54    H H    . LEU A 1 4  ? -8.660  0.973   10.954  1.00 0.00 ? 3  LEU A H    1  
ATOM 55    H HA   . LEU A 1 4  ? -6.108  0.406   9.819   1.00 0.00 ? 3  LEU A HA   1  
ATOM 56    H HB2  . LEU A 1 4  ? -8.600  0.433   8.811   1.00 0.00 ? 3  LEU A HB2  1  
ATOM 57    H HB3  . LEU A 1 4  ? -8.090  2.018   8.240   1.00 0.00 ? 3  LEU A HB3  1  
ATOM 58    H HG   . LEU A 1 4  ? -6.663  -0.612  7.725   1.00 0.00 ? 3  LEU A HG   1  
ATOM 59    H HD11 . LEU A 1 4  ? -8.836  -0.075  6.470   1.00 0.00 ? 3  LEU A HD11 1  
ATOM 60    H HD12 . LEU A 1 4  ? -7.950  1.255   5.726   1.00 0.00 ? 3  LEU A HD12 1  
ATOM 61    H HD13 . LEU A 1 4  ? -7.418  -0.407  5.476   1.00 0.00 ? 3  LEU A HD13 1  
ATOM 62    H HD21 . LEU A 1 4  ? -5.986  2.264   7.076   1.00 0.00 ? 3  LEU A HD21 1  
ATOM 63    H HD22 . LEU A 1 4  ? -4.966  1.046   7.842   1.00 0.00 ? 3  LEU A HD22 1  
ATOM 64    H HD23 . LEU A 1 4  ? -5.339  0.927   6.124   1.00 0.00 ? 3  LEU A HD23 1  
ATOM 65    N N    . GLU A 1 5  ? -6.852  3.623   10.028  1.00 0.00 ? 4  GLU A N    1  
ATOM 66    C CA   . GLU A 1 5  ? -6.196  4.961   10.023  1.00 0.00 ? 4  GLU A CA   1  
ATOM 67    C C    . GLU A 1 5  ? -4.974  4.922   10.943  1.00 0.00 ? 4  GLU A C    1  
ATOM 68    O O    . GLU A 1 5  ? -3.896  5.356   10.590  1.00 0.00 ? 4  GLU A O    1  
ATOM 69    C CB   . GLU A 1 5  ? -7.187  6.024   10.518  1.00 0.00 ? 4  GLU A CB   1  
ATOM 70    C CG   . GLU A 1 5  ? -8.140  6.410   9.383   1.00 0.00 ? 4  GLU A CG   1  
ATOM 71    C CD   . GLU A 1 5  ? -8.882  5.166   8.890   1.00 0.00 ? 4  GLU A CD   1  
ATOM 72    O OE1  . GLU A 1 5  ? -8.357  4.494   8.018   1.00 0.00 ? 4  GLU A OE1  1  
ATOM 73    O OE2  . GLU A 1 5  ? -9.964  4.908   9.393   1.00 0.00 ? 4  GLU A OE2  1  
ATOM 74    H H    . GLU A 1 5  ? -7.812  3.550   10.211  1.00 0.00 ? 4  GLU A H    1  
ATOM 75    H HA   . GLU A 1 5  ? -5.881  5.197   9.016   1.00 0.00 ? 4  GLU A HA   1  
ATOM 76    H HB2  . GLU A 1 5  ? -7.756  5.626   11.346  1.00 0.00 ? 4  GLU A HB2  1  
ATOM 77    H HB3  . GLU A 1 5  ? -6.646  6.901   10.842  1.00 0.00 ? 4  GLU A HB3  1  
ATOM 78    H HG2  . GLU A 1 5  ? -8.854  7.136   9.744   1.00 0.00 ? 4  GLU A HG2  1  
ATOM 79    H HG3  . GLU A 1 5  ? -7.575  6.835   8.567   1.00 0.00 ? 4  GLU A HG3  1  
ATOM 80    N N    . LYS A 1 6  ? -5.144  4.386   12.121  1.00 0.00 ? 5  LYS A N    1  
ATOM 81    C CA   . LYS A 1 6  ? -4.010  4.289   13.081  1.00 0.00 ? 5  LYS A CA   1  
ATOM 82    C C    . LYS A 1 6  ? -2.794  3.692   12.373  1.00 0.00 ? 5  LYS A C    1  
ATOM 83    O O    . LYS A 1 6  ? -1.676  4.141   12.532  1.00 0.00 ? 5  LYS A O    1  
ATOM 84    C CB   . LYS A 1 6  ? -4.417  3.361   14.228  1.00 0.00 ? 5  LYS A CB   1  
ATOM 85    C CG   . LYS A 1 6  ? -5.727  3.858   14.844  1.00 0.00 ? 5  LYS A CG   1  
ATOM 86    C CD   . LYS A 1 6  ? -5.961  3.159   16.185  1.00 0.00 ? 5  LYS A CD   1  
ATOM 87    C CE   . LYS A 1 6  ? -7.397  3.414   16.648  1.00 0.00 ? 5  LYS A CE   1  
ATOM 88    N NZ   . LYS A 1 6  ? -7.648  2.675   17.918  1.00 0.00 ? 5  LYS A NZ   1  
ATOM 89    H H    . LYS A 1 6  ? -6.025  4.035   12.372  1.00 0.00 ? 5  LYS A H    1  
ATOM 90    H HA   . LYS A 1 6  ? -3.781  5.262   13.491  1.00 0.00 ? 5  LYS A HA   1  
ATOM 91    H HB2  . LYS A 1 6  ? -4.552  2.358   13.850  1.00 0.00 ? 5  LYS A HB2  1  
ATOM 92    H HB3  . LYS A 1 6  ? -3.645  3.361   14.982  1.00 0.00 ? 5  LYS A HB3  1  
ATOM 93    H HG2  . LYS A 1 6  ? -5.669  4.926   14.999  1.00 0.00 ? 5  LYS A HG2  1  
ATOM 94    H HG3  . LYS A 1 6  ? -6.546  3.635   14.177  1.00 0.00 ? 5  LYS A HG3  1  
ATOM 95    H HD2  . LYS A 1 6  ? -5.802  2.097   16.070  1.00 0.00 ? 5  LYS A HD2  1  
ATOM 96    H HD3  . LYS A 1 6  ? -5.273  3.550   16.920  1.00 0.00 ? 5  LYS A HD3  1  
ATOM 97    H HE2  . LYS A 1 6  ? -7.540  4.472   16.814  1.00 0.00 ? 5  LYS A HE2  1  
ATOM 98    H HE3  . LYS A 1 6  ? -8.086  3.072   15.890  1.00 0.00 ? 5  LYS A HE3  1  
ATOM 99    H HZ1  . LYS A 1 6  ? -7.121  1.779   17.908  1.00 0.00 ? 5  LYS A HZ1  1  
ATOM 100   H HZ2  . LYS A 1 6  ? -7.334  3.251   18.723  1.00 0.00 ? 5  LYS A HZ2  1  
ATOM 101   H HZ3  . LYS A 1 6  ? -8.666  2.478   18.008  1.00 0.00 ? 5  LYS A HZ3  1  
ATOM 102   N N    . ALA A 1 7  ? -3.021  2.670   11.593  1.00 0.00 ? 6  ALA A N    1  
ATOM 103   C CA   . ALA A 1 7  ? -1.912  2.002   10.857  1.00 0.00 ? 6  ALA A CA   1  
ATOM 104   C C    . ALA A 1 7  ? -1.516  2.826   9.624   1.00 0.00 ? 6  ALA A C    1  
ATOM 105   O O    . ALA A 1 7  ? -0.369  2.834   9.226   1.00 0.00 ? 6  ALA A O    1  
ATOM 106   C CB   . ALA A 1 7  ? -2.377  0.600   10.430  1.00 0.00 ? 6  ALA A CB   1  
ATOM 107   H H    . ALA A 1 7  ? -3.936  2.336   11.489  1.00 0.00 ? 6  ALA A H    1  
ATOM 108   H HA   . ALA A 1 7  ? -1.045  1.920   11.495  1.00 0.00 ? 6  ALA A HA   1  
ATOM 109   H HB1  . ALA A 1 7  ? -3.444  0.615   10.261  1.00 0.00 ? 6  ALA A HB1  1  
ATOM 110   H HB2  . ALA A 1 7  ? -1.877  0.304   9.520   1.00 0.00 ? 6  ALA A HB2  1  
ATOM 111   H HB3  . ALA A 1 7  ? -2.151  -0.109  11.213  1.00 0.00 ? 6  ALA A HB3  1  
ATOM 112   N N    . MET A 1 8  ? -2.434  3.529   9.023   1.00 0.00 ? 7  MET A N    1  
ATOM 113   C CA   . MET A 1 8  ? -2.057  4.344   7.835   1.00 0.00 ? 7  MET A CA   1  
ATOM 114   C C    . MET A 1 8  ? -1.012  5.377   8.273   1.00 0.00 ? 7  MET A C    1  
ATOM 115   O O    . MET A 1 8  ? 0.023   5.545   7.651   1.00 0.00 ? 7  MET A O    1  
ATOM 116   C CB   . MET A 1 8  ? -3.306  5.051   7.285   1.00 0.00 ? 7  MET A CB   1  
ATOM 117   C CG   . MET A 1 8  ? -3.096  5.421   5.811   1.00 0.00 ? 7  MET A CG   1  
ATOM 118   S SD   . MET A 1 8  ? -3.401  3.965   4.779   1.00 0.00 ? 7  MET A SD   1  
ATOM 119   C CE   . MET A 1 8  ? -2.235  4.369   3.456   1.00 0.00 ? 7  MET A CE   1  
ATOM 120   H H    . MET A 1 8  ? -3.356  3.529   9.355   1.00 0.00 ? 7  MET A H    1  
ATOM 121   H HA   . MET A 1 8  ? -1.634  3.701   7.076   1.00 0.00 ? 7  MET A HA   1  
ATOM 122   H HB2  . MET A 1 8  ? -4.155  4.388   7.368   1.00 0.00 ? 7  MET A HB2  1  
ATOM 123   H HB3  . MET A 1 8  ? -3.497  5.947   7.855   1.00 0.00 ? 7  MET A HB3  1  
ATOM 124   H HG2  . MET A 1 8  ? -3.785  6.207   5.536   1.00 0.00 ? 7  MET A HG2  1  
ATOM 125   H HG3  . MET A 1 8  ? -2.082  5.763   5.662   1.00 0.00 ? 7  MET A HG3  1  
ATOM 126   H HE1  . MET A 1 8  ? -2.501  5.323   3.022   1.00 0.00 ? 7  MET A HE1  1  
ATOM 127   H HE2  . MET A 1 8  ? -1.237  4.426   3.859   1.00 0.00 ? 7  MET A HE2  1  
ATOM 128   H HE3  . MET A 1 8  ? -2.272  3.599   2.697   1.00 0.00 ? 7  MET A HE3  1  
ATOM 129   N N    . VAL A 1 9  ? -1.270  6.055   9.358   1.00 0.00 ? 8  VAL A N    1  
ATOM 130   C CA   . VAL A 1 9  ? -0.297  7.062   9.860   1.00 0.00 ? 8  VAL A CA   1  
ATOM 131   C C    . VAL A 1 9  ? 0.989   6.348   10.278  1.00 0.00 ? 8  VAL A C    1  
ATOM 132   O O    . VAL A 1 9  ? 2.078   6.857   10.103  1.00 0.00 ? 8  VAL A O    1  
ATOM 133   C CB   . VAL A 1 9  ? -0.898  7.789   11.064  1.00 0.00 ? 8  VAL A CB   1  
ATOM 134   C CG1  . VAL A 1 9  ? 0.001   8.964   11.451  1.00 0.00 ? 8  VAL A CG1  1  
ATOM 135   C CG2  . VAL A 1 9  ? -2.287  8.315   10.698  1.00 0.00 ? 8  VAL A CG2  1  
ATOM 136   H H    . VAL A 1 9  ? -2.101  5.892   9.850   1.00 0.00 ? 8  VAL A H    1  
ATOM 137   H HA   . VAL A 1 9  ? -0.075  7.780   9.083   1.00 0.00 ? 8  VAL A HA   1  
ATOM 138   H HB   . VAL A 1 9  ? -0.976  7.105   11.897  1.00 0.00 ? 8  VAL A HB   1  
ATOM 139   H HG11 . VAL A 1 9  ? 0.128   9.616   10.599  1.00 0.00 ? 8  VAL A HG11 1  
ATOM 140   H HG12 . VAL A 1 9  ? -0.456  9.516   12.260  1.00 0.00 ? 8  VAL A HG12 1  
ATOM 141   H HG13 . VAL A 1 9  ? 0.964   8.593   11.767  1.00 0.00 ? 8  VAL A HG13 1  
ATOM 142   H HG21 . VAL A 1 9  ? -2.921  7.489   10.413  1.00 0.00 ? 8  VAL A HG21 1  
ATOM 143   H HG22 . VAL A 1 9  ? -2.717  8.821   11.549  1.00 0.00 ? 8  VAL A HG22 1  
ATOM 144   H HG23 . VAL A 1 9  ? -2.205  9.006   9.871   1.00 0.00 ? 8  VAL A HG23 1  
ATOM 145   N N    . ALA A 1 10 ? 0.872   5.164   10.820  1.00 0.00 ? 9  ALA A N    1  
ATOM 146   C CA   . ALA A 1 10 ? 2.090   4.413   11.235  1.00 0.00 ? 9  ALA A CA   1  
ATOM 147   C C    . ALA A 1 10 ? 3.002   4.237   10.021  1.00 0.00 ? 9  ALA A C    1  
ATOM 148   O O    . ALA A 1 10 ? 4.192   4.462   10.087  1.00 0.00 ? 9  ALA A O    1  
ATOM 149   C CB   . ALA A 1 10 ? 1.683   3.037   11.767  1.00 0.00 ? 9  ALA A CB   1  
ATOM 150   H H    . ALA A 1 10 ? -0.013  4.764   10.943  1.00 0.00 ? 9  ALA A H    1  
ATOM 151   H HA   . ALA A 1 10 ? 2.609   4.959   12.007  1.00 0.00 ? 9  ALA A HA   1  
ATOM 152   H HB1  . ALA A 1 10 ? 0.940   3.157   12.542  1.00 0.00 ? 9  ALA A HB1  1  
ATOM 153   H HB2  . ALA A 1 10 ? 1.271   2.447   10.962  1.00 0.00 ? 9  ALA A HB2  1  
ATOM 154   H HB3  . ALA A 1 10 ? 2.549   2.537   12.174  1.00 0.00 ? 9  ALA A HB3  1  
ATOM 155   N N    . LEU A 1 11 ? 2.455   3.826   8.913   1.00 0.00 ? 10 LEU A N    1  
ATOM 156   C CA   . LEU A 1 11 ? 3.303   3.628   7.701   1.00 0.00 ? 10 LEU A CA   1  
ATOM 157   C C    . LEU A 1 11 ? 4.183   4.866   7.512   1.00 0.00 ? 10 LEU A C    1  
ATOM 158   O O    . LEU A 1 11 ? 5.379   4.772   7.317   1.00 0.00 ? 10 LEU A O    1  
ATOM 159   C CB   . LEU A 1 11 ? 2.384   3.455   6.464   1.00 0.00 ? 10 LEU A CB   1  
ATOM 160   C CG   . LEU A 1 11 ? 2.109   1.966   6.191   1.00 0.00 ? 10 LEU A CG   1  
ATOM 161   C CD1  . LEU A 1 11 ? 1.233   1.387   7.303   1.00 0.00 ? 10 LEU A CD1  1  
ATOM 162   C CD2  . LEU A 1 11 ? 1.382   1.826   4.851   1.00 0.00 ? 10 LEU A CD2  1  
ATOM 163   H H    . LEU A 1 11 ? 1.493   3.630   8.883   1.00 0.00 ? 10 LEU A H    1  
ATOM 164   H HA   . LEU A 1 11 ? 3.905   2.739   7.831   1.00 0.00 ? 10 LEU A HA   1  
ATOM 165   H HB2  . LEU A 1 11 ? 1.447   3.958   6.647   1.00 0.00 ? 10 LEU A HB2  1  
ATOM 166   H HB3  . LEU A 1 11 ? 2.855   3.889   5.592   1.00 0.00 ? 10 LEU A HB3  1  
ATOM 167   H HG   . LEU A 1 11 ? 3.043   1.425   6.149   1.00 0.00 ? 10 LEU A HG   1  
ATOM 168   H HD11 . LEU A 1 11 ? 1.642   1.660   8.264   1.00 0.00 ? 10 LEU A HD11 1  
ATOM 169   H HD12 . LEU A 1 11 ? 0.231   1.780   7.213   1.00 0.00 ? 10 LEU A HD12 1  
ATOM 170   H HD13 . LEU A 1 11 ? 1.205   0.311   7.216   1.00 0.00 ? 10 LEU A HD13 1  
ATOM 171   H HD21 . LEU A 1 11 ? 1.957   2.312   4.077   1.00 0.00 ? 10 LEU A HD21 1  
ATOM 172   H HD22 . LEU A 1 11 ? 1.269   0.779   4.611   1.00 0.00 ? 10 LEU A HD22 1  
ATOM 173   H HD23 . LEU A 1 11 ? 0.408   2.287   4.919   1.00 0.00 ? 10 LEU A HD23 1  
ATOM 174   N N    . ILE A 1 12 ? 3.593   6.029   7.588   1.00 0.00 ? 11 ILE A N    1  
ATOM 175   C CA   . ILE A 1 12 ? 4.394   7.273   7.434   1.00 0.00 ? 11 ILE A CA   1  
ATOM 176   C C    . ILE A 1 12 ? 5.391   7.344   8.590   1.00 0.00 ? 11 ILE A C    1  
ATOM 177   O O    . ILE A 1 12 ? 6.555   7.647   8.416   1.00 0.00 ? 11 ILE A O    1  
ATOM 178   C CB   . ILE A 1 12 ? 3.466   8.489   7.485   1.00 0.00 ? 11 ILE A CB   1  
ATOM 179   C CG1  . ILE A 1 12 ? 2.476   8.424   6.320   1.00 0.00 ? 11 ILE A CG1  1  
ATOM 180   C CG2  . ILE A 1 12 ? 4.295   9.770   7.376   1.00 0.00 ? 11 ILE A CG2  1  
ATOM 181   C CD1  . ILE A 1 12 ? 1.376   9.468   6.524   1.00 0.00 ? 11 ILE A CD1  1  
ATOM 182   H H    . ILE A 1 12 ? 2.629   6.081   7.760   1.00 0.00 ? 11 ILE A H    1  
ATOM 183   H HA   . ILE A 1 12 ? 4.912   7.249   6.486   1.00 0.00 ? 11 ILE A HA   1  
ATOM 184   H HB   . ILE A 1 12 ? 2.925   8.489   8.421   1.00 0.00 ? 11 ILE A HB   1  
ATOM 185   H HG12 . ILE A 1 12 ? 2.996   8.623   5.394   1.00 0.00 ? 11 ILE A HG12 1  
ATOM 186   H HG13 . ILE A 1 12 ? 2.032   7.440   6.279   1.00 0.00 ? 11 ILE A HG13 1  
ATOM 187   H HG21 . ILE A 1 12 ? 4.947   9.704   6.518   1.00 0.00 ? 11 ILE A HG21 1  
ATOM 188   H HG22 . ILE A 1 12 ? 3.634   10.617  7.263   1.00 0.00 ? 11 ILE A HG22 1  
ATOM 189   H HG23 . ILE A 1 12 ? 4.887   9.892   8.271   1.00 0.00 ? 11 ILE A HG23 1  
ATOM 190   H HD11 . ILE A 1 12 ? 1.824   10.444  6.638   1.00 0.00 ? 11 ILE A HD11 1  
ATOM 191   H HD12 . ILE A 1 12 ? 0.719   9.471   5.667   1.00 0.00 ? 11 ILE A HD12 1  
ATOM 192   H HD13 . ILE A 1 12 ? 0.810   9.225   7.411   1.00 0.00 ? 11 ILE A HD13 1  
ATOM 193   N N    . ASP A 1 13 ? 4.925   7.056   9.775   1.00 0.00 ? 12 ASP A N    1  
ATOM 194   C CA   . ASP A 1 13 ? 5.803   7.087   10.974  1.00 0.00 ? 12 ASP A CA   1  
ATOM 195   C C    . ASP A 1 13 ? 7.083   6.295   10.711  1.00 0.00 ? 12 ASP A C    1  
ATOM 196   O O    . ASP A 1 13 ? 8.177   6.758   10.964  1.00 0.00 ? 12 ASP A O    1  
ATOM 197   C CB   . ASP A 1 13 ? 5.056   6.433   12.147  1.00 0.00 ? 12 ASP A CB   1  
ATOM 198   C CG   . ASP A 1 13 ? 5.745   6.796   13.465  1.00 0.00 ? 12 ASP A CG   1  
ATOM 199   O OD1  . ASP A 1 13 ? 6.128   7.944   13.613  1.00 0.00 ? 12 ASP A OD1  1  
ATOM 200   O OD2  . ASP A 1 13 ? 5.877   5.919   14.303  1.00 0.00 ? 12 ASP A OD2  1  
ATOM 201   H H    . ASP A 1 13 ? 3.981   6.817   9.878   1.00 0.00 ? 12 ASP A H    1  
ATOM 202   H HA   . ASP A 1 13 ? 6.026   8.108   11.252  1.00 0.00 ? 12 ASP A HA   1  
ATOM 203   H HB2  . ASP A 1 13 ? 4.038   6.792   12.165  1.00 0.00 ? 12 ASP A HB2  1  
ATOM 204   H HB3  . ASP A 1 13 ? 5.057   5.361   12.030  1.00 0.00 ? 12 ASP A HB3  1  
ATOM 205   N N    . VAL A 1 14 ? 6.948   5.084   10.228  1.00 0.00 ? 13 VAL A N    1  
ATOM 206   C CA   . VAL A 1 14 ? 8.156   4.244   9.979   1.00 0.00 ? 13 VAL A CA   1  
ATOM 207   C C    . VAL A 1 14 ? 8.868   4.667   8.691   1.00 0.00 ? 13 VAL A C    1  
ATOM 208   O O    . VAL A 1 14 ? 10.080  4.625   8.621   1.00 0.00 ? 13 VAL A O    1  
ATOM 209   C CB   . VAL A 1 14 ? 7.755   2.769   9.908   1.00 0.00 ? 13 VAL A CB   1  
ATOM 210   C CG1  . VAL A 1 14 ? 8.977   1.921   9.546   1.00 0.00 ? 13 VAL A CG1  1  
ATOM 211   C CG2  . VAL A 1 14 ? 7.214   2.325   11.270  1.00 0.00 ? 13 VAL A CG2  1  
ATOM 212   H H    . VAL A 1 14 ? 6.049   4.720   10.046  1.00 0.00 ? 13 VAL A H    1  
ATOM 213   H HA   . VAL A 1 14 ? 8.861   4.395   10.780  1.00 0.00 ? 13 VAL A HA   1  
ATOM 214   H HB   . VAL A 1 14 ? 6.988   2.640   9.154   1.00 0.00 ? 13 VAL A HB   1  
ATOM 215   H HG11 . VAL A 1 14 ? 9.809   2.202   10.175  1.00 0.00 ? 13 VAL A HG11 1  
ATOM 216   H HG12 . VAL A 1 14 ? 8.748   0.877   9.697   1.00 0.00 ? 13 VAL A HG12 1  
ATOM 217   H HG13 . VAL A 1 14 ? 9.236   2.087   8.510   1.00 0.00 ? 13 VAL A HG13 1  
ATOM 218   H HG21 . VAL A 1 14 ? 7.871   2.679   12.051  1.00 0.00 ? 13 VAL A HG21 1  
ATOM 219   H HG22 . VAL A 1 14 ? 6.227   2.737   11.416  1.00 0.00 ? 13 VAL A HG22 1  
ATOM 220   H HG23 . VAL A 1 14 ? 7.163   1.247   11.303  1.00 0.00 ? 13 VAL A HG23 1  
ATOM 221   N N    . PHE A 1 15 ? 8.166   5.071   7.672   1.00 0.00 ? 14 PHE A N    1  
ATOM 222   C CA   . PHE A 1 15 ? 8.894   5.474   6.436   1.00 0.00 ? 14 PHE A CA   1  
ATOM 223   C C    . PHE A 1 15 ? 9.756   6.696   6.753   1.00 0.00 ? 14 PHE A C    1  
ATOM 224   O O    . PHE A 1 15 ? 10.831  6.875   6.215   1.00 0.00 ? 14 PHE A O    1  
ATOM 225   C CB   . PHE A 1 15 ? 7.911   5.821   5.317   1.00 0.00 ? 14 PHE A CB   1  
ATOM 226   C CG   . PHE A 1 15 ? 8.690   6.157   4.064   1.00 0.00 ? 14 PHE A CG   1  
ATOM 227   C CD1  . PHE A 1 15 ? 9.156   7.462   3.854   1.00 0.00 ? 14 PHE A CD1  1  
ATOM 228   C CD2  . PHE A 1 15 ? 8.951   5.161   3.114   1.00 0.00 ? 14 PHE A CD2  1  
ATOM 229   C CE1  . PHE A 1 15 ? 9.883   7.770   2.695   1.00 0.00 ? 14 PHE A CE1  1  
ATOM 230   C CE2  . PHE A 1 15 ? 9.676   5.470   1.956   1.00 0.00 ? 14 PHE A CE2  1  
ATOM 231   C CZ   . PHE A 1 15 ? 10.142  6.773   1.747   1.00 0.00 ? 14 PHE A CZ   1  
ATOM 232   H H    . PHE A 1 15 ? 7.188   5.109   7.716   1.00 0.00 ? 14 PHE A H    1  
ATOM 233   H HA   . PHE A 1 15 ? 9.518   4.648   6.128   1.00 0.00 ? 14 PHE A HA   1  
ATOM 234   H HB2  . PHE A 1 15 ? 7.266   4.976   5.127   1.00 0.00 ? 14 PHE A HB2  1  
ATOM 235   H HB3  . PHE A 1 15 ? 7.315   6.673   5.609   1.00 0.00 ? 14 PHE A HB3  1  
ATOM 236   H HD1  . PHE A 1 15 ? 8.956   8.231   4.586   1.00 0.00 ? 14 PHE A HD1  1  
ATOM 237   H HD2  . PHE A 1 15 ? 8.592   4.156   3.275   1.00 0.00 ? 14 PHE A HD2  1  
ATOM 238   H HE1  . PHE A 1 15 ? 10.243  8.776   2.533   1.00 0.00 ? 14 PHE A HE1  1  
ATOM 239   H HE2  . PHE A 1 15 ? 9.877   4.701   1.224   1.00 0.00 ? 14 PHE A HE2  1  
ATOM 240   H HZ   . PHE A 1 15 ? 10.702  7.010   0.853   1.00 0.00 ? 14 PHE A HZ   1  
ATOM 241   N N    . HIS A 1 16 ? 9.278   7.541   7.627   1.00 0.00 ? 15 HIS A N    1  
ATOM 242   C CA   . HIS A 1 16 ? 10.044  8.764   7.995   1.00 0.00 ? 15 HIS A CA   1  
ATOM 243   C C    . HIS A 1 16 ? 11.178  8.403   8.958   1.00 0.00 ? 15 HIS A C    1  
ATOM 244   O O    . HIS A 1 16 ? 12.227  9.017   8.959   1.00 0.00 ? 15 HIS A O    1  
ATOM 245   C CB   . HIS A 1 16 ? 9.101   9.762   8.670   1.00 0.00 ? 15 HIS A CB   1  
ATOM 246   C CG   . HIS A 1 16 ? 9.863   11.006  9.037   1.00 0.00 ? 15 HIS A CG   1  
ATOM 247   N ND1  . HIS A 1 16 ? 9.706   12.197  8.346   1.00 0.00 ? 15 HIS A ND1  1  
ATOM 248   C CD2  . HIS A 1 16 ? 10.787  11.260  10.019  1.00 0.00 ? 15 HIS A CD2  1  
ATOM 249   C CE1  . HIS A 1 16 ? 10.517  13.106  8.918   1.00 0.00 ? 15 HIS A CE1  1  
ATOM 250   N NE2  . HIS A 1 16 ? 11.199  12.587  9.943   1.00 0.00 ? 15 HIS A NE2  1  
ATOM 251   H H    . HIS A 1 16 ? 8.406   7.370   8.041   1.00 0.00 ? 15 HIS A H    1  
ATOM 252   H HA   . HIS A 1 16 ? 10.458  9.210   7.103   1.00 0.00 ? 15 HIS A HA   1  
ATOM 253   H HB2  . HIS A 1 16 ? 8.301   10.017  7.991   1.00 0.00 ? 15 HIS A HB2  1  
ATOM 254   H HB3  . HIS A 1 16 ? 8.687   9.318   9.563   1.00 0.00 ? 15 HIS A HB3  1  
ATOM 255   H HD1  . HIS A 1 16 ? 9.113   12.350  7.581   1.00 0.00 ? 15 HIS A HD1  1  
ATOM 256   H HD2  . HIS A 1 16 ? 11.140  10.539  10.742  1.00 0.00 ? 15 HIS A HD2  1  
ATOM 257   H HE1  . HIS A 1 16 ? 10.605  14.131  8.589   1.00 0.00 ? 15 HIS A HE1  1  
ATOM 258   N N    . GLN A 1 17 ? 10.964  7.422   9.795   1.00 0.00 ? 16 GLN A N    1  
ATOM 259   C CA   . GLN A 1 17 ? 12.014  7.031   10.779  1.00 0.00 ? 16 GLN A CA   1  
ATOM 260   C C    . GLN A 1 17 ? 13.327  6.736   10.052  1.00 0.00 ? 16 GLN A C    1  
ATOM 261   O O    . GLN A 1 17 ? 14.384  7.158   10.476  1.00 0.00 ? 16 GLN A O    1  
ATOM 262   C CB   . GLN A 1 17 ? 11.556  5.787   11.549  1.00 0.00 ? 16 GLN A CB   1  
ATOM 263   C CG   . GLN A 1 17 ? 12.414  5.601   12.806  1.00 0.00 ? 16 GLN A CG   1  
ATOM 264   C CD   . GLN A 1 17 ? 13.831  5.186   12.406  1.00 0.00 ? 16 GLN A CD   1  
ATOM 265   O OE1  . GLN A 1 17 ? 14.782  5.896   12.668  1.00 0.00 ? 16 GLN A OE1  1  
ATOM 266   N NE2  . GLN A 1 17 ? 14.015  4.057   11.776  1.00 0.00 ? 16 GLN A NE2  1  
ATOM 267   H H    . GLN A 1 17 ? 10.104  6.952   9.786   1.00 0.00 ? 16 GLN A H    1  
ATOM 268   H HA   . GLN A 1 17 ? 12.170  7.847   11.468  1.00 0.00 ? 16 GLN A HA   1  
ATOM 269   H HB2  . GLN A 1 17 ? 10.521  5.906   11.836  1.00 0.00 ? 16 GLN A HB2  1  
ATOM 270   H HB3  . GLN A 1 17 ? 11.655  4.917   10.918  1.00 0.00 ? 16 GLN A HB3  1  
ATOM 271   H HG2  . GLN A 1 17 ? 12.452  6.528   13.360  1.00 0.00 ? 16 GLN A HG2  1  
ATOM 272   H HG3  . GLN A 1 17 ? 11.979  4.831   13.426  1.00 0.00 ? 16 GLN A HG3  1  
ATOM 273   H HE21 . GLN A 1 17 ? 13.249  3.485   11.564  1.00 0.00 ? 16 GLN A HE21 1  
ATOM 274   H HE22 . GLN A 1 17 ? 14.919  3.783   11.516  1.00 0.00 ? 16 GLN A HE22 1  
ATOM 275   N N    . TYR A 1 18 ? 13.279  6.015   8.966   1.00 0.00 ? 17 TYR A N    1  
ATOM 276   C CA   . TYR A 1 18 ? 14.535  5.703   8.231   1.00 0.00 ? 17 TYR A CA   1  
ATOM 277   C C    . TYR A 1 18 ? 15.046  6.971   7.546   1.00 0.00 ? 17 TYR A C    1  
ATOM 278   O O    . TYR A 1 18 ? 16.223  7.273   7.575   1.00 0.00 ? 17 TYR A O    1  
ATOM 279   C CB   . TYR A 1 18 ? 14.259  4.624   7.175   1.00 0.00 ? 17 TYR A CB   1  
ATOM 280   C CG   . TYR A 1 18 ? 14.177  3.265   7.840   1.00 0.00 ? 17 TYR A CG   1  
ATOM 281   C CD1  . TYR A 1 18 ? 13.104  2.966   8.689   1.00 0.00 ? 17 TYR A CD1  1  
ATOM 282   C CD2  . TYR A 1 18 ? 15.172  2.306   7.608   1.00 0.00 ? 17 TYR A CD2  1  
ATOM 283   C CE1  . TYR A 1 18 ? 13.025  1.711   9.304   1.00 0.00 ? 17 TYR A CE1  1  
ATOM 284   C CE2  . TYR A 1 18 ? 15.093  1.051   8.223   1.00 0.00 ? 17 TYR A CE2  1  
ATOM 285   C CZ   . TYR A 1 18 ? 14.020  0.754   9.071   1.00 0.00 ? 17 TYR A CZ   1  
ATOM 286   O OH   . TYR A 1 18 ? 13.943  -0.484  9.678   1.00 0.00 ? 17 TYR A OH   1  
ATOM 287   H H    . TYR A 1 18 ? 12.422  5.673   8.639   1.00 0.00 ? 17 TYR A H    1  
ATOM 288   H HA   . TYR A 1 18 ? 15.281  5.346   8.927   1.00 0.00 ? 17 TYR A HA   1  
ATOM 289   H HB2  . TYR A 1 18 ? 13.322  4.838   6.682   1.00 0.00 ? 17 TYR A HB2  1  
ATOM 290   H HB3  . TYR A 1 18 ? 15.056  4.620   6.445   1.00 0.00 ? 17 TYR A HB3  1  
ATOM 291   H HD1  . TYR A 1 18 ? 12.336  3.705   8.869   1.00 0.00 ? 17 TYR A HD1  1  
ATOM 292   H HD2  . TYR A 1 18 ? 16.001  2.534   6.953   1.00 0.00 ? 17 TYR A HD2  1  
ATOM 293   H HE1  . TYR A 1 18 ? 12.197  1.481   9.958   1.00 0.00 ? 17 TYR A HE1  1  
ATOM 294   H HE2  . TYR A 1 18 ? 15.861  0.313   8.044   1.00 0.00 ? 17 TYR A HE2  1  
ATOM 295   H HH   . TYR A 1 18 ? 13.272  -0.997  9.221   1.00 0.00 ? 17 TYR A HH   1  
ATOM 296   N N    . SER A 1 19 ? 14.169  7.714   6.922   1.00 0.00 ? 18 SER A N    1  
ATOM 297   C CA   . SER A 1 19 ? 14.596  8.964   6.222   1.00 0.00 ? 18 SER A CA   1  
ATOM 298   C C    . SER A 1 19 ? 14.325  10.186  7.106   1.00 0.00 ? 18 SER A C    1  
ATOM 299   O O    . SER A 1 19 ? 13.589  11.075  6.728   1.00 0.00 ? 18 SER A O    1  
ATOM 300   C CB   . SER A 1 19 ? 13.807  9.102   4.920   1.00 0.00 ? 18 SER A CB   1  
ATOM 301   O OG   . SER A 1 19 ? 13.951  7.913   4.155   1.00 0.00 ? 18 SER A OG   1  
ATOM 302   H H    . SER A 1 19 ? 13.227  7.445   6.907   1.00 0.00 ? 18 SER A H    1  
ATOM 303   H HA   . SER A 1 19 ? 15.652  8.916   5.992   1.00 0.00 ? 18 SER A HA   1  
ATOM 304   H HB2  . SER A 1 19 ? 12.764  9.256   5.144   1.00 0.00 ? 18 SER A HB2  1  
ATOM 305   H HB3  . SER A 1 19 ? 14.182  9.950   4.362   1.00 0.00 ? 18 SER A HB3  1  
ATOM 306   H HG   . SER A 1 19 ? 13.076  7.627   3.884   1.00 0.00 ? 18 SER A HG   1  
ATOM 307   N N    . GLY A 1 20 ? 14.934  10.254  8.270   1.00 0.00 ? 19 GLY A N    1  
ATOM 308   C CA   . GLY A 1 20 ? 14.742  11.436  9.177   1.00 0.00 ? 19 GLY A CA   1  
ATOM 309   C C    . GLY A 1 20 ? 16.102  12.115  9.350   1.00 0.00 ? 19 GLY A C    1  
ATOM 310   O O    . GLY A 1 20 ? 16.204  13.216  9.854   1.00 0.00 ? 19 GLY A O    1  
ATOM 311   H H    . GLY A 1 20 ? 15.547  9.544   8.552   1.00 0.00 ? 19 GLY A H    1  
ATOM 312   H HA2  . GLY A 1 20 ? 14.034  12.133  8.746   1.00 0.00 ? 19 GLY A HA2  1  
ATOM 313   H HA3  . GLY A 1 20 ? 14.386  11.105  10.139  1.00 0.00 ? 19 GLY A HA3  1  
ATOM 314   N N    . ARG A 1 21 ? 17.142  11.472  8.899   1.00 0.00 ? 20 ARG A N    1  
ATOM 315   C CA   . ARG A 1 21 ? 18.506  12.067  8.985   1.00 0.00 ? 20 ARG A CA   1  
ATOM 316   C C    . ARG A 1 21 ? 18.572  13.313  8.102   1.00 0.00 ? 20 ARG A C    1  
ATOM 317   O O    . ARG A 1 21 ? 19.259  14.259  8.432   1.00 0.00 ? 20 ARG A O    1  
ATOM 318   C CB   . ARG A 1 21 ? 19.544  11.047  8.511   1.00 0.00 ? 20 ARG A CB   1  
ATOM 319   C CG   . ARG A 1 21 ? 19.228  9.676   9.113   1.00 0.00 ? 20 ARG A CG   1  
ATOM 320   C CD   . ARG A 1 21 ? 20.342  8.693   8.752   1.00 0.00 ? 20 ARG A CD   1  
ATOM 321   N NE   . ARG A 1 21 ? 20.449  8.585   7.268   1.00 0.00 ? 20 ARG A NE   1  
ATOM 322   C CZ   . ARG A 1 21 ? 19.642  7.798   6.609   1.00 0.00 ? 20 ARG A CZ   1  
ATOM 323   N NH1  . ARG A 1 21 ? 19.949  6.540   6.444   1.00 0.00 ? 20 ARG A NH1  1  
ATOM 324   N NH2  . ARG A 1 21 ? 18.530  8.268   6.114   1.00 0.00 ? 20 ARG A NH2  1  
ATOM 325   H H    . ARG A 1 21 ? 17.025  10.598  8.470   1.00 0.00 ? 20 ARG A H    1  
ATOM 326   H HA   . ARG A 1 21 ? 18.752  12.398  9.983   1.00 0.00 ? 20 ARG A HA   1  
ATOM 327   H HB2  . ARG A 1 21 ? 19.519  10.981  7.432   1.00 0.00 ? 20 ARG A HB2  1  
ATOM 328   H HB3  . ARG A 1 21 ? 20.527  11.359  8.831   1.00 0.00 ? 20 ARG A HB3  1  
ATOM 329   H HG2  . ARG A 1 21 ? 19.156  9.763   10.187  1.00 0.00 ? 20 ARG A HG2  1  
ATOM 330   H HG3  . ARG A 1 21 ? 18.290  9.316   8.716   1.00 0.00 ? 20 ARG A HG3  1  
ATOM 331   H HD2  . ARG A 1 21 ? 21.280  9.047   9.155   1.00 0.00 ? 20 ARG A HD2  1  
ATOM 332   H HD3  . ARG A 1 21 ? 20.116  7.723   9.169   1.00 0.00 ? 20 ARG A HD3  1  
ATOM 333   H HE   . ARG A 1 21 ? 21.125  9.107   6.786   1.00 0.00 ? 20 ARG A HE   1  
ATOM 334   H HH11 . ARG A 1 21 ? 20.802  6.180   6.823   1.00 0.00 ? 20 ARG A HH11 1  
ATOM 335   H HH12 . ARG A 1 21 ? 19.332  5.936   5.940   1.00 0.00 ? 20 ARG A HH12 1  
ATOM 336   H HH21 . ARG A 1 21 ? 18.295  9.232   6.240   1.00 0.00 ? 20 ARG A HH21 1  
ATOM 337   H HH22 . ARG A 1 21 ? 17.912  7.664   5.610   1.00 0.00 ? 20 ARG A HH22 1  
ATOM 338   N N    . GLU A 1 22 ? 17.864  13.355  7.001   1.00 0.00 ? 21 GLU A N    1  
ATOM 339   C CA   . GLU A 1 22 ? 17.913  14.589  6.151   1.00 0.00 ? 21 GLU A CA   1  
ATOM 340   C C    . GLU A 1 22 ? 16.558  14.823  5.482   1.00 0.00 ? 21 GLU A C    1  
ATOM 341   O O    . GLU A 1 22 ? 16.057  15.929  5.458   1.00 0.00 ? 21 GLU A O    1  
ATOM 342   C CB   . GLU A 1 22 ? 18.985  14.431  5.068   1.00 0.00 ? 21 GLU A CB   1  
ATOM 343   C CG   . GLU A 1 22 ? 20.276  13.887  5.687   1.00 0.00 ? 21 GLU A CG   1  
ATOM 344   C CD   . GLU A 1 22 ? 21.380  13.869  4.627   1.00 0.00 ? 21 GLU A CD   1  
ATOM 345   O OE1  . GLU A 1 22 ? 21.375  12.962  3.811   1.00 0.00 ? 21 GLU A OE1  1  
ATOM 346   O OE2  . GLU A 1 22 ? 22.210  14.762  4.651   1.00 0.00 ? 21 GLU A OE2  1  
ATOM 347   H H    . GLU A 1 22 ? 17.298  12.597  6.745   1.00 0.00 ? 21 GLU A H    1  
ATOM 348   H HA   . GLU A 1 22 ? 18.147  15.444  6.770   1.00 0.00 ? 21 GLU A HA   1  
ATOM 349   H HB2  . GLU A 1 22 ? 18.632  13.744  4.312   1.00 0.00 ? 21 GLU A HB2  1  
ATOM 350   H HB3  . GLU A 1 22 ? 19.183  15.391  4.616   1.00 0.00 ? 21 GLU A HB3  1  
ATOM 351   H HG2  . GLU A 1 22 ? 20.576  14.520  6.509   1.00 0.00 ? 21 GLU A HG2  1  
ATOM 352   H HG3  . GLU A 1 22 ? 20.109  12.882  6.045   1.00 0.00 ? 21 GLU A HG3  1  
ATOM 353   N N    . GLY A 1 23 ? 15.959  13.802  4.934   1.00 0.00 ? 22 GLY A N    1  
ATOM 354   C CA   . GLY A 1 23 ? 14.639  13.991  4.266   1.00 0.00 ? 22 GLY A CA   1  
ATOM 355   C C    . GLY A 1 23 ? 14.721  15.184  3.309   1.00 0.00 ? 22 GLY A C    1  
ATOM 356   O O    . GLY A 1 23 ? 13.720  15.651  2.802   1.00 0.00 ? 22 GLY A O    1  
ATOM 357   H H    . GLY A 1 23 ? 16.375  12.915  4.955   1.00 0.00 ? 22 GLY A H    1  
ATOM 358   H HA2  . GLY A 1 23 ? 14.375  13.093  3.727   1.00 0.00 ? 22 GLY A HA2  1  
ATOM 359   H HA3  . GLY A 1 23 ? 13.880  14.190  5.007   1.00 0.00 ? 22 GLY A HA3  1  
ATOM 360   N N    . ASP A 1 24 ? 15.902  15.683  3.054   1.00 0.00 ? 23 ASP A N    1  
ATOM 361   C CA   . ASP A 1 24 ? 16.029  16.844  2.127   1.00 0.00 ? 23 ASP A CA   1  
ATOM 362   C C    . ASP A 1 24 ? 15.239  16.539  0.855   1.00 0.00 ? 23 ASP A C    1  
ATOM 363   O O    . ASP A 1 24 ? 14.332  17.259  0.487   1.00 0.00 ? 23 ASP A O    1  
ATOM 364   C CB   . ASP A 1 24 ? 17.503  17.063  1.777   1.00 0.00 ? 23 ASP A CB   1  
ATOM 365   C CG   . ASP A 1 24 ? 18.244  17.602  3.002   1.00 0.00 ? 23 ASP A CG   1  
ATOM 366   O OD1  . ASP A 1 24 ? 17.844  17.268  4.105   1.00 0.00 ? 23 ASP A OD1  1  
ATOM 367   O OD2  . ASP A 1 24 ? 19.198  18.339  2.817   1.00 0.00 ? 23 ASP A OD2  1  
ATOM 368   H H    . ASP A 1 24 ? 16.695  15.299  3.482   1.00 0.00 ? 23 ASP A H    1  
ATOM 369   H HA   . ASP A 1 24 ? 15.631  17.731  2.598   1.00 0.00 ? 23 ASP A HA   1  
ATOM 370   H HB2  . ASP A 1 24 ? 17.943  16.125  1.472   1.00 0.00 ? 23 ASP A HB2  1  
ATOM 371   H HB3  . ASP A 1 24 ? 17.580  17.776  0.970   1.00 0.00 ? 23 ASP A HB3  1  
ATOM 372   N N    . LYS A 1 25 ? 15.557  15.458  0.196   1.00 0.00 ? 24 LYS A N    1  
ATOM 373   C CA   . LYS A 1 25 ? 14.805  15.082  -1.035  1.00 0.00 ? 24 LYS A CA   1  
ATOM 374   C C    . LYS A 1 25 ? 13.633  14.187  -0.628  1.00 0.00 ? 24 LYS A C    1  
ATOM 375   O O    . LYS A 1 25 ? 13.433  13.897  0.535   1.00 0.00 ? 24 LYS A O    1  
ATOM 376   C CB   . LYS A 1 25 ? 15.729  14.322  -1.990  1.00 0.00 ? 24 LYS A CB   1  
ATOM 377   C CG   . LYS A 1 25 ? 16.871  15.240  -2.431  1.00 0.00 ? 24 LYS A CG   1  
ATOM 378   C CD   . LYS A 1 25 ? 17.627  14.595  -3.594  1.00 0.00 ? 24 LYS A CD   1  
ATOM 379   C CE   . LYS A 1 25 ? 18.811  15.481  -3.986  1.00 0.00 ? 24 LYS A CE   1  
ATOM 380   N NZ   . LYS A 1 25 ? 19.446  14.944  -5.223  1.00 0.00 ? 24 LYS A NZ   1  
ATOM 381   H H    . LYS A 1 25 ? 16.278  14.880  0.523   1.00 0.00 ? 24 LYS A H    1  
ATOM 382   H HA   . LYS A 1 25 ? 14.433  15.975  -1.520  1.00 0.00 ? 24 LYS A HA   1  
ATOM 383   H HB2  . LYS A 1 25 ? 16.135  13.457  -1.485  1.00 0.00 ? 24 LYS A HB2  1  
ATOM 384   H HB3  . LYS A 1 25 ? 15.170  14.004  -2.856  1.00 0.00 ? 24 LYS A HB3  1  
ATOM 385   H HG2  . LYS A 1 25 ? 16.466  16.191  -2.747  1.00 0.00 ? 24 LYS A HG2  1  
ATOM 386   H HG3  . LYS A 1 25 ? 17.548  15.394  -1.605  1.00 0.00 ? 24 LYS A HG3  1  
ATOM 387   H HD2  . LYS A 1 25 ? 17.988  13.622  -3.293  1.00 0.00 ? 24 LYS A HD2  1  
ATOM 388   H HD3  . LYS A 1 25 ? 16.965  14.488  -4.440  1.00 0.00 ? 24 LYS A HD3  1  
ATOM 389   H HE2  . LYS A 1 25 ? 18.464  16.487  -4.168  1.00 0.00 ? 24 LYS A HE2  1  
ATOM 390   H HE3  . LYS A 1 25 ? 19.535  15.490  -3.184  1.00 0.00 ? 24 LYS A HE3  1  
ATOM 391   H HZ1  . LYS A 1 25 ? 19.279  13.920  -5.283  1.00 0.00 ? 24 LYS A HZ1  1  
ATOM 392   H HZ2  . LYS A 1 25 ? 19.033  15.410  -6.055  1.00 0.00 ? 24 LYS A HZ2  1  
ATOM 393   H HZ3  . LYS A 1 25 ? 20.471  15.128  -5.194  1.00 0.00 ? 24 LYS A HZ3  1  
ATOM 394   N N    . HIS A 1 26 ? 12.875  13.726  -1.587  1.00 0.00 ? 25 HIS A N    1  
ATOM 395   C CA   . HIS A 1 26 ? 11.722  12.816  -1.296  1.00 0.00 ? 25 HIS A CA   1  
ATOM 396   C C    . HIS A 1 26 ? 11.840  11.616  -2.233  1.00 0.00 ? 25 HIS A C    1  
ATOM 397   O O    . HIS A 1 26 ? 10.884  11.202  -2.860  1.00 0.00 ? 25 HIS A O    1  
ATOM 398   C CB   . HIS A 1 26 ? 10.407  13.553  -1.562  1.00 0.00 ? 25 HIS A CB   1  
ATOM 399   C CG   . HIS A 1 26 ? 10.406  14.860  -0.818  1.00 0.00 ? 25 HIS A CG   1  
ATOM 400   N ND1  . HIS A 1 26 ? 9.950   14.969  0.486   1.00 0.00 ? 25 HIS A ND1  1  
ATOM 401   C CD2  . HIS A 1 26 ? 10.804  16.123  -1.182  1.00 0.00 ? 25 HIS A CD2  1  
ATOM 402   C CE1  . HIS A 1 26 ? 10.083  16.256  0.857   1.00 0.00 ? 25 HIS A CE1  1  
ATOM 403   N NE2  . HIS A 1 26 ? 10.599  17.003  -0.123  1.00 0.00 ? 25 HIS A NE2  1  
ATOM 404   H H    . HIS A 1 26 ? 13.077  13.963  -2.516  1.00 0.00 ? 25 HIS A H    1  
ATOM 405   H HA   . HIS A 1 26 ? 11.755  12.479  -0.269  1.00 0.00 ? 25 HIS A HA   1  
ATOM 406   H HB2  . HIS A 1 26 ? 10.307  13.740  -2.621  1.00 0.00 ? 25 HIS A HB2  1  
ATOM 407   H HB3  . HIS A 1 26 ? 9.579   12.947  -1.224  1.00 0.00 ? 25 HIS A HB3  1  
ATOM 408   H HD1  . HIS A 1 26 ? 9.595   14.241  1.038   1.00 0.00 ? 25 HIS A HD1  1  
ATOM 409   H HD2  . HIS A 1 26 ? 11.214  16.393  -2.145  1.00 0.00 ? 25 HIS A HD2  1  
ATOM 410   H HE1  . HIS A 1 26 ? 9.806   16.638  1.828   1.00 0.00 ? 25 HIS A HE1  1  
ATOM 411   N N    . LYS A 1 27 ? 13.023  11.062  -2.331  1.00 0.00 ? 26 LYS A N    1  
ATOM 412   C CA   . LYS A 1 27 ? 13.253  9.886   -3.223  1.00 0.00 ? 26 LYS A CA   1  
ATOM 413   C C    . LYS A 1 27 ? 14.030  8.807   -2.463  1.00 0.00 ? 26 LYS A C    1  
ATOM 414   O O    . LYS A 1 27 ? 14.822  9.109   -1.591  1.00 0.00 ? 26 LYS A O    1  
ATOM 415   C CB   . LYS A 1 27 ? 14.077  10.332  -4.432  1.00 0.00 ? 26 LYS A CB   1  
ATOM 416   C CG   . LYS A 1 27 ? 13.235  11.253  -5.318  1.00 0.00 ? 26 LYS A CG   1  
ATOM 417   C CD   . LYS A 1 27 ? 13.973  11.508  -6.634  1.00 0.00 ? 26 LYS A CD   1  
ATOM 418   C CE   . LYS A 1 27 ? 13.118  12.398  -7.537  1.00 0.00 ? 26 LYS A CE   1  
ATOM 419   N NZ   . LYS A 1 27 ? 13.952  12.912  -8.661  1.00 0.00 ? 26 LYS A NZ   1  
ATOM 420   H H    . LYS A 1 27 ? 13.768  11.426  -1.814  1.00 0.00 ? 26 LYS A H    1  
ATOM 421   H HA   . LYS A 1 27 ? 12.309  9.492   -3.563  1.00 0.00 ? 26 LYS A HA   1  
ATOM 422   H HB2  . LYS A 1 27 ? 14.955  10.862  -4.093  1.00 0.00 ? 26 LYS A HB2  1  
ATOM 423   H HB3  . LYS A 1 27 ? 14.378  9.466   -5.001  1.00 0.00 ? 26 LYS A HB3  1  
ATOM 424   H HG2  . LYS A 1 27 ? 12.283  10.785  -5.522  1.00 0.00 ? 26 LYS A HG2  1  
ATOM 425   H HG3  . LYS A 1 27 ? 13.074  12.192  -4.810  1.00 0.00 ? 26 LYS A HG3  1  
ATOM 426   H HD2  . LYS A 1 27 ? 14.914  12.000  -6.429  1.00 0.00 ? 26 LYS A HD2  1  
ATOM 427   H HD3  . LYS A 1 27 ? 14.159  10.568  -7.130  1.00 0.00 ? 26 LYS A HD3  1  
ATOM 428   H HE2  . LYS A 1 27 ? 12.295  11.823  -7.934  1.00 0.00 ? 26 LYS A HE2  1  
ATOM 429   H HE3  . LYS A 1 27 ? 12.734  13.229  -6.965  1.00 0.00 ? 26 LYS A HE3  1  
ATOM 430   H HZ1  . LYS A 1 27 ? 14.957  12.746  -8.451  1.00 0.00 ? 26 LYS A HZ1  1  
ATOM 431   H HZ2  . LYS A 1 27 ? 13.697  12.416  -9.538  1.00 0.00 ? 26 LYS A HZ2  1  
ATOM 432   H HZ3  . LYS A 1 27 ? 13.785  13.932  -8.777  1.00 0.00 ? 26 LYS A HZ3  1  
ATOM 433   N N    . LEU A 1 28 ? 13.821  7.554   -2.789  1.00 0.00 ? 27 LEU A N    1  
ATOM 434   C CA   . LEU A 1 28 ? 14.555  6.444   -2.094  1.00 0.00 ? 27 LEU A CA   1  
ATOM 435   C C    . LEU A 1 28 ? 15.288  5.615   -3.150  1.00 0.00 ? 27 LEU A C    1  
ATOM 436   O O    . LEU A 1 28 ? 14.771  5.370   -4.222  1.00 0.00 ? 27 LEU A O    1  
ATOM 437   C CB   . LEU A 1 28 ? 13.546  5.564   -1.349  1.00 0.00 ? 27 LEU A CB   1  
ATOM 438   C CG   . LEU A 1 28 ? 14.274  4.624   -0.373  1.00 0.00 ? 27 LEU A CG   1  
ATOM 439   C CD1  . LEU A 1 28 ? 14.900  5.422   0.791   1.00 0.00 ? 27 LEU A CD1  1  
ATOM 440   C CD2  . LEU A 1 28 ? 13.266  3.608   0.181   1.00 0.00 ? 27 LEU A CD2  1  
ATOM 441   H H    . LEU A 1 28 ? 13.181  7.338   -3.500  1.00 0.00 ? 27 LEU A H    1  
ATOM 442   H HA   . LEU A 1 28 ? 15.273  6.850   -1.398  1.00 0.00 ? 27 LEU A HA   1  
ATOM 443   H HB2  . LEU A 1 28 ? 12.858  6.192   -0.801  1.00 0.00 ? 27 LEU A HB2  1  
ATOM 444   H HB3  . LEU A 1 28 ? 12.995  4.975   -2.066  1.00 0.00 ? 27 LEU A HB3  1  
ATOM 445   H HG   . LEU A 1 28 ? 15.055  4.098   -0.903  1.00 0.00 ? 27 LEU A HG   1  
ATOM 446   H HD11 . LEU A 1 28 ? 14.294  6.289   1.013   1.00 0.00 ? 27 LEU A HD11 1  
ATOM 447   H HD12 . LEU A 1 28 ? 14.963  4.797   1.672   1.00 0.00 ? 27 LEU A HD12 1  
ATOM 448   H HD13 . LEU A 1 28 ? 15.894  5.740   0.517   1.00 0.00 ? 27 LEU A HD13 1  
ATOM 449   H HD21 . LEU A 1 28 ? 12.724  3.156   -0.636  1.00 0.00 ? 27 LEU A HD21 1  
ATOM 450   H HD22 . LEU A 1 28 ? 13.792  2.843   0.732   1.00 0.00 ? 27 LEU A HD22 1  
ATOM 451   H HD23 . LEU A 1 28 ? 12.572  4.112   0.838   1.00 0.00 ? 27 LEU A HD23 1  
ATOM 452   N N    . LYS A 1 29 ? 16.496  5.188   -2.870  1.00 0.00 ? 28 LYS A N    1  
ATOM 453   C CA   . LYS A 1 29 ? 17.253  4.386   -3.882  1.00 0.00 ? 28 LYS A CA   1  
ATOM 454   C C    . LYS A 1 29 ? 16.927  2.900   -3.710  1.00 0.00 ? 28 LYS A C    1  
ATOM 455   O O    . LYS A 1 29 ? 16.567  2.457   -2.637  1.00 0.00 ? 28 LYS A O    1  
ATOM 456   C CB   . LYS A 1 29 ? 18.755  4.608   -3.691  1.00 0.00 ? 28 LYS A CB   1  
ATOM 457   C CG   . LYS A 1 29 ? 19.506  4.115   -4.930  1.00 0.00 ? 28 LYS A CG   1  
ATOM 458   C CD   . LYS A 1 29 ? 21.010  4.308   -4.726  1.00 0.00 ? 28 LYS A CD   1  
ATOM 459   C CE   . LYS A 1 29 ? 21.751  3.950   -6.016  1.00 0.00 ? 28 LYS A CE   1  
ATOM 460   N NZ   . LYS A 1 29 ? 23.219  4.069   -5.794  1.00 0.00 ? 28 LYS A NZ   1  
ATOM 461   H H    . LYS A 1 29 ? 16.903  5.398   -2.004  1.00 0.00 ? 28 LYS A H    1  
ATOM 462   H HA   . LYS A 1 29 ? 16.959  4.720   -4.868  1.00 0.00 ? 28 LYS A HA   1  
ATOM 463   H HB2  . LYS A 1 29 ? 18.948  5.661   -3.547  1.00 0.00 ? 28 LYS A HB2  1  
ATOM 464   H HB3  . LYS A 1 29 ? 19.094  4.058   -2.826  1.00 0.00 ? 28 LYS A HB3  1  
ATOM 465   H HG2  . LYS A 1 29 ? 19.294  3.067   -5.086  1.00 0.00 ? 28 LYS A HG2  1  
ATOM 466   H HG3  . LYS A 1 29 ? 19.186  4.680   -5.793  1.00 0.00 ? 28 LYS A HG3  1  
ATOM 467   H HD2  . LYS A 1 29 ? 21.209  5.339   -4.471  1.00 0.00 ? 28 LYS A HD2  1  
ATOM 468   H HD3  . LYS A 1 29 ? 21.351  3.667   -3.928  1.00 0.00 ? 28 LYS A HD3  1  
ATOM 469   H HE2  . LYS A 1 29 ? 21.510  2.936   -6.299  1.00 0.00 ? 28 LYS A HE2  1  
ATOM 470   H HE3  . LYS A 1 29 ? 21.450  4.625   -6.804  1.00 0.00 ? 28 LYS A HE3  1  
ATOM 471   H HZ1  . LYS A 1 29 ? 23.445  5.035   -5.480  1.00 0.00 ? 28 LYS A HZ1  1  
ATOM 472   H HZ2  . LYS A 1 29 ? 23.517  3.388   -5.066  1.00 0.00 ? 28 LYS A HZ2  1  
ATOM 473   H HZ3  . LYS A 1 29 ? 23.722  3.865   -6.681  1.00 0.00 ? 28 LYS A HZ3  1  
ATOM 474   N N    . LYS A 1 30 ? 17.047  2.126   -4.753  1.00 0.00 ? 29 LYS A N    1  
ATOM 475   C CA   . LYS A 1 30 ? 16.743  0.670   -4.648  1.00 0.00 ? 29 LYS A CA   1  
ATOM 476   C C    . LYS A 1 30 ? 17.703  -0.003  -3.661  1.00 0.00 ? 29 LYS A C    1  
ATOM 477   O O    . LYS A 1 30 ? 17.313  -0.836  -2.868  1.00 0.00 ? 29 LYS A O    1  
ATOM 478   C CB   . LYS A 1 30 ? 16.925  0.032   -6.030  1.00 0.00 ? 29 LYS A CB   1  
ATOM 479   C CG   . LYS A 1 30 ? 18.413  0.051   -6.414  1.00 0.00 ? 29 LYS A CG   1  
ATOM 480   C CD   . LYS A 1 30 ? 18.570  -0.164  -7.922  1.00 0.00 ? 29 LYS A CD   1  
ATOM 481   C CE   . LYS A 1 30 ? 20.007  -0.586  -8.236  1.00 0.00 ? 29 LYS A CE   1  
ATOM 482   N NZ   . LYS A 1 30 ? 20.149  -0.814  -9.702  1.00 0.00 ? 29 LYS A NZ   1  
ATOM 483   H H    . LYS A 1 30 ? 17.331  2.494   -5.616  1.00 0.00 ? 29 LYS A H    1  
ATOM 484   H HA   . LYS A 1 30 ? 15.725  0.531   -4.319  1.00 0.00 ? 29 LYS A HA   1  
ATOM 485   H HB2  . LYS A 1 30 ? 16.572  -0.990  -6.004  1.00 0.00 ? 29 LYS A HB2  1  
ATOM 486   H HB3  . LYS A 1 30 ? 16.359  0.590   -6.759  1.00 0.00 ? 29 LYS A HB3  1  
ATOM 487   H HG2  . LYS A 1 30 ? 18.841  1.007   -6.143  1.00 0.00 ? 29 LYS A HG2  1  
ATOM 488   H HG3  . LYS A 1 30 ? 18.929  -0.736  -5.883  1.00 0.00 ? 29 LYS A HG3  1  
ATOM 489   H HD2  . LYS A 1 30 ? 17.888  -0.936  -8.250  1.00 0.00 ? 29 LYS A HD2  1  
ATOM 490   H HD3  . LYS A 1 30 ? 18.349  0.757   -8.439  1.00 0.00 ? 29 LYS A HD3  1  
ATOM 491   H HE2  . LYS A 1 30 ? 20.688  0.193   -7.926  1.00 0.00 ? 29 LYS A HE2  1  
ATOM 492   H HE3  . LYS A 1 30 ? 20.239  -1.499  -7.706  1.00 0.00 ? 29 LYS A HE3  1  
ATOM 493   H HZ1  . LYS A 1 30 ? 19.210  -0.960  -10.123 1.00 0.00 ? 29 LYS A HZ1  1  
ATOM 494   H HZ2  . LYS A 1 30 ? 20.601  0.016   -10.139 1.00 0.00 ? 29 LYS A HZ2  1  
ATOM 495   H HZ3  . LYS A 1 30 ? 20.735  -1.656  -9.868  1.00 0.00 ? 29 LYS A HZ3  1  
ATOM 496   N N    . SER A 1 31 ? 18.959  0.341   -3.721  1.00 0.00 ? 30 SER A N    1  
ATOM 497   C CA   . SER A 1 31 ? 19.953  -0.288  -2.807  1.00 0.00 ? 30 SER A CA   1  
ATOM 498   C C    . SER A 1 31 ? 19.529  -0.100  -1.349  1.00 0.00 ? 30 SER A C    1  
ATOM 499   O O    . SER A 1 31 ? 19.658  -0.997  -0.534  1.00 0.00 ? 30 SER A O    1  
ATOM 500   C CB   . SER A 1 31 ? 21.321  0.359   -3.022  1.00 0.00 ? 30 SER A CB   1  
ATOM 501   O OG   . SER A 1 31 ? 22.299  -0.350  -2.273  1.00 0.00 ? 30 SER A OG   1  
ATOM 502   H H    . SER A 1 31 ? 19.252  1.003   -4.381  1.00 0.00 ? 30 SER A H    1  
ATOM 503   H HA   . SER A 1 31 ? 20.021  -1.343  -3.026  1.00 0.00 ? 30 SER A HA   1  
ATOM 504   H HB2  . SER A 1 31 ? 21.580  0.321   -4.067  1.00 0.00 ? 30 SER A HB2  1  
ATOM 505   H HB3  . SER A 1 31 ? 21.284  1.392   -2.700  1.00 0.00 ? 30 SER A HB3  1  
ATOM 506   H HG   . SER A 1 31 ? 22.699  -1.004  -2.851  1.00 0.00 ? 30 SER A HG   1  
ATOM 507   N N    . GLU A 1 32 ? 19.009  1.051   -1.007  1.00 0.00 ? 31 GLU A N    1  
ATOM 508   C CA   . GLU A 1 32 ? 18.577  1.262   0.408   1.00 0.00 ? 31 GLU A CA   1  
ATOM 509   C C    . GLU A 1 32 ? 17.177  0.674   0.579   1.00 0.00 ? 31 GLU A C    1  
ATOM 510   O O    . GLU A 1 32 ? 16.838  0.137   1.615   1.00 0.00 ? 31 GLU A O    1  
ATOM 511   C CB   . GLU A 1 32 ? 18.582  2.755   0.754   1.00 0.00 ? 31 GLU A CB   1  
ATOM 512   C CG   . GLU A 1 32 ? 20.015  3.215   1.035   1.00 0.00 ? 31 GLU A CG   1  
ATOM 513   C CD   . GLU A 1 32 ? 20.891  2.933   -0.186  1.00 0.00 ? 31 GLU A CD   1  
ATOM 514   O OE1  . GLU A 1 32 ? 21.325  1.802   -0.331  1.00 0.00 ? 31 GLU A OE1  1  
ATOM 515   O OE2  . GLU A 1 32 ? 21.114  3.853   -0.956  1.00 0.00 ? 31 GLU A OE2  1  
ATOM 516   H H    . GLU A 1 32 ? 18.888  1.749   -1.685  1.00 0.00 ? 31 GLU A H    1  
ATOM 517   H HA   . GLU A 1 32 ? 19.273  0.723   1.038   1.00 0.00 ? 31 GLU A HA   1  
ATOM 518   H HB2  . GLU A 1 32 ? 18.179  3.317   -0.076  1.00 0.00 ? 31 GLU A HB2  1  
ATOM 519   H HB3  . GLU A 1 32 ? 17.974  2.923   1.631   1.00 0.00 ? 31 GLU A HB3  1  
ATOM 520   H HG2  . GLU A 1 32 ? 20.017  4.275   1.245   1.00 0.00 ? 31 GLU A HG2  1  
ATOM 521   H HG3  . GLU A 1 32 ? 20.405  2.678   1.887   1.00 0.00 ? 31 GLU A HG3  1  
ATOM 522   N N    . LEU A 1 33 ? 16.370  0.748   -0.446  1.00 0.00 ? 32 LEU A N    1  
ATOM 523   C CA   . LEU A 1 33 ? 15.004  0.166   -0.360  1.00 0.00 ? 32 LEU A CA   1  
ATOM 524   C C    . LEU A 1 33 ? 15.151  -1.329  -0.082  1.00 0.00 ? 32 LEU A C    1  
ATOM 525   O O    . LEU A 1 33 ? 14.512  -1.868  0.797   1.00 0.00 ? 32 LEU A O    1  
ATOM 526   C CB   . LEU A 1 33 ? 14.262  0.401   -1.684  1.00 0.00 ? 32 LEU A CB   1  
ATOM 527   C CG   . LEU A 1 33 ? 12.744  0.255   -1.496  1.00 0.00 ? 32 LEU A CG   1  
ATOM 528   C CD1  . LEU A 1 33 ? 12.038  0.776   -2.753  1.00 0.00 ? 32 LEU A CD1  1  
ATOM 529   C CD2  . LEU A 1 33 ? 12.364  -1.221  -1.267  1.00 0.00 ? 32 LEU A CD2  1  
ATOM 530   H H    . LEU A 1 33 ? 16.673  1.167   -1.279  1.00 0.00 ? 32 LEU A H    1  
ATOM 531   H HA   . LEU A 1 33 ? 14.468  0.611   0.464   1.00 0.00 ? 32 LEU A HA   1  
ATOM 532   H HB2  . LEU A 1 33 ? 14.479  1.399   -2.035  1.00 0.00 ? 32 LEU A HB2  1  
ATOM 533   H HB3  . LEU A 1 33 ? 14.605  -0.313  -2.419  1.00 0.00 ? 32 LEU A HB3  1  
ATOM 534   H HG   . LEU A 1 33 ? 12.431  0.843   -0.645  1.00 0.00 ? 32 LEU A HG   1  
ATOM 535   H HD11 . LEU A 1 33 ? 12.455  0.295   -3.625  1.00 0.00 ? 32 LEU A HD11 1  
ATOM 536   H HD12 . LEU A 1 33 ? 10.983  0.558   -2.692  1.00 0.00 ? 32 LEU A HD12 1  
ATOM 537   H HD13 . LEU A 1 33 ? 12.181  1.844   -2.828  1.00 0.00 ? 32 LEU A HD13 1  
ATOM 538   H HD21 . LEU A 1 33 ? 13.005  -1.864  -1.852  1.00 0.00 ? 32 LEU A HD21 1  
ATOM 539   H HD22 . LEU A 1 33 ? 12.474  -1.460  -0.222  1.00 0.00 ? 32 LEU A HD22 1  
ATOM 540   H HD23 . LEU A 1 33 ? 11.335  -1.383  -1.558  1.00 0.00 ? 32 LEU A HD23 1  
ATOM 541   N N    . LYS A 1 34 ? 15.986  -2.017  -0.811  1.00 0.00 ? 33 LYS A N    1  
ATOM 542   C CA   . LYS A 1 34 ? 16.138  -3.474  -0.557  1.00 0.00 ? 33 LYS A CA   1  
ATOM 543   C C    . LYS A 1 34 ? 16.423  -3.685  0.931   1.00 0.00 ? 33 LYS A C    1  
ATOM 544   O O    . LYS A 1 34 ? 15.729  -4.411  1.614   1.00 0.00 ? 33 LYS A O    1  
ATOM 545   C CB   . LYS A 1 34 ? 17.301  -4.017  -1.403  1.00 0.00 ? 33 LYS A CB   1  
ATOM 546   C CG   . LYS A 1 34 ? 17.141  -5.529  -1.614  1.00 0.00 ? 33 LYS A CG   1  
ATOM 547   C CD   . LYS A 1 34 ? 17.232  -6.262  -0.267  1.00 0.00 ? 33 LYS A CD   1  
ATOM 548   C CE   . LYS A 1 34 ? 17.605  -7.730  -0.497  1.00 0.00 ? 33 LYS A CE   1  
ATOM 549   N NZ   . LYS A 1 34 ? 17.277  -8.521  0.723   1.00 0.00 ? 33 LYS A NZ   1  
ATOM 550   H H    . LYS A 1 34 ? 16.501  -1.588  -1.524  1.00 0.00 ? 33 LYS A H    1  
ATOM 551   H HA   . LYS A 1 34 ? 15.220  -3.972  -0.832  1.00 0.00 ? 33 LYS A HA   1  
ATOM 552   H HB2  . LYS A 1 34 ? 17.303  -3.522  -2.363  1.00 0.00 ? 33 LYS A HB2  1  
ATOM 553   H HB3  . LYS A 1 34 ? 18.238  -3.824  -0.900  1.00 0.00 ? 33 LYS A HB3  1  
ATOM 554   H HG2  . LYS A 1 34 ? 16.179  -5.726  -2.066  1.00 0.00 ? 33 LYS A HG2  1  
ATOM 555   H HG3  . LYS A 1 34 ? 17.924  -5.881  -2.270  1.00 0.00 ? 33 LYS A HG3  1  
ATOM 556   H HD2  . LYS A 1 34 ? 17.985  -5.794  0.351   1.00 0.00 ? 33 LYS A HD2  1  
ATOM 557   H HD3  . LYS A 1 34 ? 16.277  -6.213  0.231   1.00 0.00 ? 33 LYS A HD3  1  
ATOM 558   H HE2  . LYS A 1 34 ? 17.048  -8.118  -1.337  1.00 0.00 ? 33 LYS A HE2  1  
ATOM 559   H HE3  . LYS A 1 34 ? 18.663  -7.805  -0.701  1.00 0.00 ? 33 LYS A HE3  1  
ATOM 560   H HZ1  . LYS A 1 34 ? 16.294  -8.335  1.003   1.00 0.00 ? 33 LYS A HZ1  1  
ATOM 561   H HZ2  . LYS A 1 34 ? 17.394  -9.535  0.519   1.00 0.00 ? 33 LYS A HZ2  1  
ATOM 562   H HZ3  . LYS A 1 34 ? 17.914  -8.246  1.497   1.00 0.00 ? 33 LYS A HZ3  1  
ATOM 563   N N    . GLU A 1 35 ? 17.450  -3.055  1.435   1.00 0.00 ? 34 GLU A N    1  
ATOM 564   C CA   . GLU A 1 35 ? 17.789  -3.228  2.882   1.00 0.00 ? 34 GLU A CA   1  
ATOM 565   C C    . GLU A 1 35 ? 16.515  -3.068  3.725   1.00 0.00 ? 34 GLU A C    1  
ATOM 566   O O    . GLU A 1 35 ? 16.332  -3.752  4.712   1.00 0.00 ? 34 GLU A O    1  
ATOM 567   C CB   . GLU A 1 35 ? 18.830  -2.184  3.299   1.00 0.00 ? 34 GLU A CB   1  
ATOM 568   C CG   . GLU A 1 35 ? 19.363  -2.506  4.699   1.00 0.00 ? 34 GLU A CG   1  
ATOM 569   C CD   . GLU A 1 35 ? 18.319  -2.122  5.749   1.00 0.00 ? 34 GLU A CD   1  
ATOM 570   O OE1  . GLU A 1 35 ? 18.013  -0.946  5.849   1.00 0.00 ? 34 GLU A OE1  1  
ATOM 571   O OE2  . GLU A 1 35 ? 17.843  -3.012  6.436   1.00 0.00 ? 34 GLU A OE2  1  
ATOM 572   H H    . GLU A 1 35 ? 18.003  -2.488  0.855   1.00 0.00 ? 34 GLU A H    1  
ATOM 573   H HA   . GLU A 1 35 ? 18.184  -4.222  3.029   1.00 0.00 ? 34 GLU A HA   1  
ATOM 574   H HB2  . GLU A 1 35 ? 19.647  -2.192  2.593   1.00 0.00 ? 34 GLU A HB2  1  
ATOM 575   H HB3  . GLU A 1 35 ? 18.373  -1.205  3.307   1.00 0.00 ? 34 GLU A HB3  1  
ATOM 576   H HG2  . GLU A 1 35 ? 19.576  -3.563  4.771   1.00 0.00 ? 34 GLU A HG2  1  
ATOM 577   H HG3  . GLU A 1 35 ? 20.269  -1.945  4.876   1.00 0.00 ? 34 GLU A HG3  1  
ATOM 578   N N    . LEU A 1 36 ? 15.624  -2.194  3.341   1.00 0.00 ? 35 LEU A N    1  
ATOM 579   C CA   . LEU A 1 36 ? 14.363  -2.033  4.126   1.00 0.00 ? 35 LEU A CA   1  
ATOM 580   C C    . LEU A 1 36 ? 13.562  -3.341  4.025   1.00 0.00 ? 35 LEU A C    1  
ATOM 581   O O    . LEU A 1 36 ? 12.965  -3.783  4.987   1.00 0.00 ? 35 LEU A O    1  
ATOM 582   C CB   . LEU A 1 36 ? 13.546  -0.836  3.574   1.00 0.00 ? 35 LEU A CB   1  
ATOM 583   C CG   . LEU A 1 36 ? 13.604  0.357   4.548   1.00 0.00 ? 35 LEU A CG   1  
ATOM 584   C CD1  . LEU A 1 36 ? 13.243  1.647   3.806   1.00 0.00 ? 35 LEU A CD1  1  
ATOM 585   C CD2  . LEU A 1 36 ? 12.609  0.139   5.694   1.00 0.00 ? 35 LEU A CD2  1  
ATOM 586   H H    . LEU A 1 36 ? 15.772  -1.664  2.530   1.00 0.00 ? 35 LEU A H    1  
ATOM 587   H HA   . LEU A 1 36 ? 14.597  -1.882  5.171   1.00 0.00 ? 35 LEU A HA   1  
ATOM 588   H HB2  . LEU A 1 36 ? 13.963  -0.536  2.625   1.00 0.00 ? 35 LEU A HB2  1  
ATOM 589   H HB3  . LEU A 1 36 ? 12.513  -1.126  3.429   1.00 0.00 ? 35 LEU A HB3  1  
ATOM 590   H HG   . LEU A 1 36 ? 14.604  0.444   4.949   1.00 0.00 ? 35 LEU A HG   1  
ATOM 591   H HD11 . LEU A 1 36 ? 12.359  1.483   3.208   1.00 0.00 ? 35 LEU A HD11 1  
ATOM 592   H HD12 . LEU A 1 36 ? 13.051  2.433   4.523   1.00 0.00 ? 35 LEU A HD12 1  
ATOM 593   H HD13 . LEU A 1 36 ? 14.063  1.936   3.166   1.00 0.00 ? 35 LEU A HD13 1  
ATOM 594   H HD21 . LEU A 1 36 ? 12.693  -0.873  6.059   1.00 0.00 ? 35 LEU A HD21 1  
ATOM 595   H HD22 . LEU A 1 36 ? 12.826  0.830   6.495   1.00 0.00 ? 35 LEU A HD22 1  
ATOM 596   H HD23 . LEU A 1 36 ? 11.604  0.309   5.335   1.00 0.00 ? 35 LEU A HD23 1  
ATOM 597   N N    . ILE A 1 37 ? 13.564  -3.980  2.887   1.00 0.00 ? 36 ILE A N    1  
ATOM 598   C CA   . ILE A 1 37 ? 12.828  -5.270  2.747   1.00 0.00 ? 36 ILE A CA   1  
ATOM 599   C C    . ILE A 1 37 ? 13.462  -6.315  3.671   1.00 0.00 ? 36 ILE A C    1  
ATOM 600   O O    . ILE A 1 37 ? 12.793  -7.178  4.203   1.00 0.00 ? 36 ILE A O    1  
ATOM 601   C CB   . ILE A 1 37 ? 12.946  -5.744  1.294   1.00 0.00 ? 36 ILE A CB   1  
ATOM 602   C CG1  . ILE A 1 37 ? 12.516  -4.607  0.360   1.00 0.00 ? 36 ILE A CG1  1  
ATOM 603   C CG2  . ILE A 1 37 ? 12.038  -6.959  1.070   1.00 0.00 ? 36 ILE A CG2  1  
ATOM 604   C CD1  . ILE A 1 37 ? 12.433  -5.116  -1.082  1.00 0.00 ? 36 ILE A CD1  1  
ATOM 605   H H    . ILE A 1 37 ? 14.061  -3.633  2.117   1.00 0.00 ? 36 ILE A H    1  
ATOM 606   H HA   . ILE A 1 37 ? 11.782  -5.150  2.989   1.00 0.00 ? 36 ILE A HA   1  
ATOM 607   H HB   . ILE A 1 37 ? 13.970  -6.017  1.086   1.00 0.00 ? 36 ILE A HB   1  
ATOM 608   H HG12 . ILE A 1 37 ? 11.548  -4.238  0.666   1.00 0.00 ? 36 ILE A HG12 1  
ATOM 609   H HG13 . ILE A 1 37 ? 13.238  -3.807  0.414   1.00 0.00 ? 36 ILE A HG13 1  
ATOM 610   H HG21 . ILE A 1 37 ? 12.181  -7.672  1.868   1.00 0.00 ? 36 ILE A HG21 1  
ATOM 611   H HG22 . ILE A 1 37 ? 11.007  -6.640  1.053   1.00 0.00 ? 36 ILE A HG22 1  
ATOM 612   H HG23 . ILE A 1 37 ? 12.285  -7.423  0.126   1.00 0.00 ? 36 ILE A HG23 1  
ATOM 613   H HD11 . ILE A 1 37 ? 13.287  -5.743  -1.294  1.00 0.00 ? 36 ILE A HD11 1  
ATOM 614   H HD12 . ILE A 1 37 ? 11.526  -5.688  -1.210  1.00 0.00 ? 36 ILE A HD12 1  
ATOM 615   H HD13 . ILE A 1 37 ? 12.427  -4.276  -1.761  1.00 0.00 ? 36 ILE A HD13 1  
ATOM 616   N N    . ASN A 1 38 ? 14.755  -6.260  3.835   1.00 0.00 ? 37 ASN A N    1  
ATOM 617   C CA   . ASN A 1 38 ? 15.456  -7.264  4.689   1.00 0.00 ? 37 ASN A CA   1  
ATOM 618   C C    . ASN A 1 38 ? 15.063  -7.113  6.163   1.00 0.00 ? 37 ASN A C    1  
ATOM 619   O O    . ASN A 1 38 ? 15.167  -8.050  6.929   1.00 0.00 ? 37 ASN A O    1  
ATOM 620   C CB   . ASN A 1 38 ? 16.966  -7.065  4.555   1.00 0.00 ? 37 ASN A CB   1  
ATOM 621   C CG   . ASN A 1 38 ? 17.697  -8.158  5.335   1.00 0.00 ? 37 ASN A CG   1  
ATOM 622   O OD1  . ASN A 1 38 ? 17.887  -8.045  6.530   1.00 0.00 ? 37 ASN A OD1  1  
ATOM 623   N ND2  . ASN A 1 38 ? 18.120  -9.221  4.706   1.00 0.00 ? 37 ASN A ND2  1  
ATOM 624   H H    . ASN A 1 38 ? 15.274  -5.568  3.374   1.00 0.00 ? 37 ASN A H    1  
ATOM 625   H HA   . ASN A 1 38 ? 15.203  -8.256  4.347   1.00 0.00 ? 37 ASN A HA   1  
ATOM 626   H HB2  . ASN A 1 38 ? 17.244  -7.117  3.512   1.00 0.00 ? 37 ASN A HB2  1  
ATOM 627   H HB3  . ASN A 1 38 ? 17.239  -6.099  4.952   1.00 0.00 ? 37 ASN A HB3  1  
ATOM 628   H HD21 . ASN A 1 38 ? 17.967  -9.313  3.742   1.00 0.00 ? 37 ASN A HD21 1  
ATOM 629   H HD22 . ASN A 1 38 ? 18.589  -9.927  5.197   1.00 0.00 ? 37 ASN A HD22 1  
ATOM 630   N N    . ASN A 1 39 ? 14.639  -5.941  6.575   1.00 0.00 ? 38 ASN A N    1  
ATOM 631   C CA   . ASN A 1 39 ? 14.267  -5.725  8.015   1.00 0.00 ? 38 ASN A CA   1  
ATOM 632   C C    . ASN A 1 39 ? 12.789  -5.340  8.135   1.00 0.00 ? 38 ASN A C    1  
ATOM 633   O O    . ASN A 1 39 ? 12.317  -5.032  9.211   1.00 0.00 ? 38 ASN A O    1  
ATOM 634   C CB   . ASN A 1 39 ? 15.129  -4.593  8.586   1.00 0.00 ? 38 ASN A CB   1  
ATOM 635   C CG   . ASN A 1 39 ? 15.070  -4.618  10.115  1.00 0.00 ? 38 ASN A CG   1  
ATOM 636   O OD1  . ASN A 1 39 ? 14.157  -5.174  10.691  1.00 0.00 ? 38 ASN A OD1  1  
ATOM 637   N ND2  . ASN A 1 39 ? 16.015  -4.035  10.801  1.00 0.00 ? 38 ASN A ND2  1  
ATOM 638   H H    . ASN A 1 39 ? 14.583  -5.196  5.941   1.00 0.00 ? 38 ASN A H    1  
ATOM 639   H HA   . ASN A 1 39 ? 14.442  -6.626  8.586   1.00 0.00 ? 38 ASN A HA   1  
ATOM 640   H HB2  . ASN A 1 39 ? 16.152  -4.725  8.264   1.00 0.00 ? 38 ASN A HB2  1  
ATOM 641   H HB3  . ASN A 1 39 ? 14.761  -3.643  8.229   1.00 0.00 ? 38 ASN A HB3  1  
ATOM 642   H HD21 . ASN A 1 39 ? 16.753  -3.588  10.336  1.00 0.00 ? 38 ASN A HD21 1  
ATOM 643   H HD22 . ASN A 1 39 ? 15.988  -4.045  11.781  1.00 0.00 ? 38 ASN A HD22 1  
ATOM 644   N N    . GLU A 1 40 ? 12.056  -5.338  7.045   1.00 0.00 ? 39 GLU A N    1  
ATOM 645   C CA   . GLU A 1 40 ? 10.605  -4.953  7.105   1.00 0.00 ? 39 GLU A CA   1  
ATOM 646   C C    . GLU A 1 40 ? 9.727   -6.073  6.531   1.00 0.00 ? 39 GLU A C    1  
ATOM 647   O O    . GLU A 1 40 ? 8.581   -6.213  6.908   1.00 0.00 ? 39 GLU A O    1  
ATOM 648   C CB   . GLU A 1 40 ? 10.401  -3.674  6.286   1.00 0.00 ? 39 GLU A CB   1  
ATOM 649   C CG   . GLU A 1 40 ? 9.068   -3.024  6.664   1.00 0.00 ? 39 GLU A CG   1  
ATOM 650   C CD   . GLU A 1 40 ? 9.193   -2.378  8.045   1.00 0.00 ? 39 GLU A CD   1  
ATOM 651   O OE1  . GLU A 1 40 ? 9.720   -1.280  8.117   1.00 0.00 ? 39 GLU A OE1  1  
ATOM 652   O OE2  . GLU A 1 40 ? 8.763   -2.993  9.007   1.00 0.00 ? 39 GLU A OE2  1  
ATOM 653   H H    . GLU A 1 40 ? 12.461  -5.580  6.187   1.00 0.00 ? 39 GLU A H    1  
ATOM 654   H HA   . GLU A 1 40 ? 10.309  -4.768  8.129   1.00 0.00 ? 39 GLU A HA   1  
ATOM 655   H HB2  . GLU A 1 40 ? 11.207  -2.985  6.492   1.00 0.00 ? 39 GLU A HB2  1  
ATOM 656   H HB3  . GLU A 1 40 ? 10.396  -3.915  5.234   1.00 0.00 ? 39 GLU A HB3  1  
ATOM 657   H HG2  . GLU A 1 40 ? 8.815   -2.270  5.933   1.00 0.00 ? 39 GLU A HG2  1  
ATOM 658   H HG3  . GLU A 1 40 ? 8.294   -3.777  6.690   1.00 0.00 ? 39 GLU A HG3  1  
ATOM 659   N N    . LEU A 1 41 ? 10.253  -6.873  5.633   1.00 0.00 ? 40 LEU A N    1  
ATOM 660   C CA   . LEU A 1 41 ? 9.447   -7.993  5.035   1.00 0.00 ? 40 LEU A CA   1  
ATOM 661   C C    . LEU A 1 41 ? 10.104  -9.335  5.394   1.00 0.00 ? 40 LEU A C    1  
ATOM 662   O O    . LEU A 1 41 ? 9.788   -10.363 4.829   1.00 0.00 ? 40 LEU A O    1  
ATOM 663   C CB   . LEU A 1 41 ? 9.409   -7.827  3.498   1.00 0.00 ? 40 LEU A CB   1  
ATOM 664   C CG   . LEU A 1 41 ? 8.153   -7.048  3.053   1.00 0.00 ? 40 LEU A CG   1  
ATOM 665   C CD1  . LEU A 1 41 ? 6.875   -7.875  3.314   1.00 0.00 ? 40 LEU A CD1  1  
ATOM 666   C CD2  . LEU A 1 41 ? 8.075   -5.711  3.806   1.00 0.00 ? 40 LEU A CD2  1  
ATOM 667   H H    . LEU A 1 41 ? 11.182  -6.741  5.351   1.00 0.00 ? 40 LEU A H    1  
ATOM 668   H HA   . LEU A 1 41 ? 8.442   -7.983  5.428   1.00 0.00 ? 40 LEU A HA   1  
ATOM 669   H HB2  . LEU A 1 41 ? 10.286  -7.282  3.185   1.00 0.00 ? 40 LEU A HB2  1  
ATOM 670   H HB3  . LEU A 1 41 ? 9.410   -8.797  3.020   1.00 0.00 ? 40 LEU A HB3  1  
ATOM 671   H HG   . LEU A 1 41 ? 8.226   -6.851  1.993   1.00 0.00 ? 40 LEU A HG   1  
ATOM 672   H HD11 . LEU A 1 41 ? 7.101   -8.931  3.265   1.00 0.00 ? 40 LEU A HD11 1  
ATOM 673   H HD12 . LEU A 1 41 ? 6.470   -7.639  4.289   1.00 0.00 ? 40 LEU A HD12 1  
ATOM 674   H HD13 . LEU A 1 41 ? 6.139   -7.637  2.560   1.00 0.00 ? 40 LEU A HD13 1  
ATOM 675   H HD21 . LEU A 1 41 ? 9.065   -5.290  3.900   1.00 0.00 ? 40 LEU A HD21 1  
ATOM 676   H HD22 . LEU A 1 41 ? 7.446   -5.027  3.256   1.00 0.00 ? 40 LEU A HD22 1  
ATOM 677   H HD23 . LEU A 1 41 ? 7.656   -5.872  4.787   1.00 0.00 ? 40 LEU A HD23 1  
ATOM 678   N N    . SER A 1 42 ? 11.018  -9.327  6.324   1.00 0.00 ? 41 SER A N    1  
ATOM 679   C CA   . SER A 1 42 ? 11.700  -10.594 6.716   1.00 0.00 ? 41 SER A CA   1  
ATOM 680   C C    . SER A 1 42 ? 10.741  -11.487 7.510   1.00 0.00 ? 41 SER A C    1  
ATOM 681   O O    . SER A 1 42 ? 10.886  -12.693 7.538   1.00 0.00 ? 41 SER A O    1  
ATOM 682   C CB   . SER A 1 42 ? 12.922  -10.267 7.577   1.00 0.00 ? 41 SER A CB   1  
ATOM 683   O OG   . SER A 1 42 ? 12.570  -9.279  8.536   1.00 0.00 ? 41 SER A OG   1  
ATOM 684   H H    . SER A 1 42 ? 11.260  -8.485  6.764   1.00 0.00 ? 41 SER A H    1  
ATOM 685   H HA   . SER A 1 42 ? 12.020  -11.116 5.827   1.00 0.00 ? 41 SER A HA   1  
ATOM 686   H HB2  . SER A 1 42 ? 13.255  -11.155 8.088   1.00 0.00 ? 41 SER A HB2  1  
ATOM 687   H HB3  . SER A 1 42 ? 13.718  -9.901  6.943   1.00 0.00 ? 41 SER A HB3  1  
ATOM 688   H HG   . SER A 1 42 ? 11.641  -9.066  8.416   1.00 0.00 ? 41 SER A HG   1  
ATOM 689   N N    . HIS A 1 43 ? 9.770   -10.910 8.163   1.00 0.00 ? 42 HIS A N    1  
ATOM 690   C CA   . HIS A 1 43 ? 8.817   -11.733 8.962   1.00 0.00 ? 42 HIS A CA   1  
ATOM 691   C C    . HIS A 1 43 ? 7.851   -12.476 8.034   1.00 0.00 ? 42 HIS A C    1  
ATOM 692   O O    . HIS A 1 43 ? 7.653   -13.669 8.157   1.00 0.00 ? 42 HIS A O    1  
ATOM 693   C CB   . HIS A 1 43 ? 8.019   -10.822 9.897   1.00 0.00 ? 42 HIS A CB   1  
ATOM 694   C CG   . HIS A 1 43 ? 8.957   -10.146 10.859  1.00 0.00 ? 42 HIS A CG   1  
ATOM 695   N ND1  . HIS A 1 43 ? 9.372   -8.834  10.688  1.00 0.00 ? 42 HIS A ND1  1  
ATOM 696   C CD2  . HIS A 1 43 ? 9.570   -10.586 12.006  1.00 0.00 ? 42 HIS A CD2  1  
ATOM 697   C CE1  . HIS A 1 43 ? 10.196  -8.533  11.708  1.00 0.00 ? 42 HIS A CE1  1  
ATOM 698   N NE2  . HIS A 1 43 ? 10.351  -9.566  12.540  1.00 0.00 ? 42 HIS A NE2  1  
ATOM 699   H H    . HIS A 1 43 ? 9.665   -9.936  8.133   1.00 0.00 ? 42 HIS A H    1  
ATOM 700   H HA   . HIS A 1 43 ? 9.370   -12.450 9.550   1.00 0.00 ? 42 HIS A HA   1  
ATOM 701   H HB2  . HIS A 1 43 ? 7.500   -10.075 9.315   1.00 0.00 ? 42 HIS A HB2  1  
ATOM 702   H HB3  . HIS A 1 43 ? 7.302   -11.411 10.449  1.00 0.00 ? 42 HIS A HB3  1  
ATOM 703   H HD1  . HIS A 1 43 ? 9.111   -8.235  9.958   1.00 0.00 ? 42 HIS A HD1  1  
ATOM 704   H HD2  . HIS A 1 43 ? 9.461   -11.574 12.429  1.00 0.00 ? 42 HIS A HD2  1  
ATOM 705   H HE1  . HIS A 1 43 ? 10.674  -7.574  11.837  1.00 0.00 ? 42 HIS A HE1  1  
ATOM 706   N N    . PHE A 1 44 ? 7.240   -11.781 7.114   1.00 0.00 ? 43 PHE A N    1  
ATOM 707   C CA   . PHE A 1 44 ? 6.277   -12.450 6.192   1.00 0.00 ? 43 PHE A CA   1  
ATOM 708   C C    . PHE A 1 44 ? 7.018   -13.441 5.291   1.00 0.00 ? 43 PHE A C    1  
ATOM 709   O O    . PHE A 1 44 ? 6.426   -14.332 4.714   1.00 0.00 ? 43 PHE A O    1  
ATOM 710   C CB   . PHE A 1 44 ? 5.579   -11.394 5.332   1.00 0.00 ? 43 PHE A CB   1  
ATOM 711   C CG   . PHE A 1 44 ? 4.604   -10.619 6.188   1.00 0.00 ? 43 PHE A CG   1  
ATOM 712   C CD1  . PHE A 1 44 ? 3.398   -11.211 6.586   1.00 0.00 ? 43 PHE A CD1  1  
ATOM 713   C CD2  . PHE A 1 44 ? 4.906   -9.310  6.588   1.00 0.00 ? 43 PHE A CD2  1  
ATOM 714   C CE1  . PHE A 1 44 ? 2.496   -10.496 7.381   1.00 0.00 ? 43 PHE A CE1  1  
ATOM 715   C CE2  . PHE A 1 44 ? 4.002   -8.596  7.385   1.00 0.00 ? 43 PHE A CE2  1  
ATOM 716   C CZ   . PHE A 1 44 ? 2.798   -9.190  7.781   1.00 0.00 ? 43 PHE A CZ   1  
ATOM 717   H H    . PHE A 1 44 ? 7.405   -10.819 7.036   1.00 0.00 ? 43 PHE A H    1  
ATOM 718   H HA   . PHE A 1 44 ? 5.539   -12.982 6.773   1.00 0.00 ? 43 PHE A HA   1  
ATOM 719   H HB2  . PHE A 1 44 ? 6.316   -10.721 4.919   1.00 0.00 ? 43 PHE A HB2  1  
ATOM 720   H HB3  . PHE A 1 44 ? 5.045   -11.880 4.529   1.00 0.00 ? 43 PHE A HB3  1  
ATOM 721   H HD1  . PHE A 1 44 ? 3.164   -12.219 6.278   1.00 0.00 ? 43 PHE A HD1  1  
ATOM 722   H HD2  . PHE A 1 44 ? 5.835   -8.853  6.282   1.00 0.00 ? 43 PHE A HD2  1  
ATOM 723   H HE1  . PHE A 1 44 ? 1.567   -10.953 7.687   1.00 0.00 ? 43 PHE A HE1  1  
ATOM 724   H HE2  . PHE A 1 44 ? 4.235   -7.588  7.694   1.00 0.00 ? 43 PHE A HE2  1  
ATOM 725   H HZ   . PHE A 1 44 ? 2.101   -8.640  8.396   1.00 0.00 ? 43 PHE A HZ   1  
ATOM 726   N N    . LEU A 1 45 ? 8.305   -13.284 5.154   1.00 0.00 ? 44 LEU A N    1  
ATOM 727   C CA   . LEU A 1 45 ? 9.080   -14.206 4.275   1.00 0.00 ? 44 LEU A CA   1  
ATOM 728   C C    . LEU A 1 45 ? 8.720   -15.659 4.595   1.00 0.00 ? 44 LEU A C    1  
ATOM 729   O O    . LEU A 1 45 ? 8.801   -16.527 3.750   1.00 0.00 ? 44 LEU A O    1  
ATOM 730   C CB   . LEU A 1 45 ? 10.581  -13.982 4.502   1.00 0.00 ? 44 LEU A CB   1  
ATOM 731   C CG   . LEU A 1 45 ? 11.406  -15.003 3.702   1.00 0.00 ? 44 LEU A CG   1  
ATOM 732   C CD1  . LEU A 1 45 ? 11.004  -14.968 2.220   1.00 0.00 ? 44 LEU A CD1  1  
ATOM 733   C CD2  . LEU A 1 45 ? 12.891  -14.655 3.837   1.00 0.00 ? 44 LEU A CD2  1  
ATOM 734   H H    . LEU A 1 45 ? 8.762   -12.552 5.619   1.00 0.00 ? 44 LEU A H    1  
ATOM 735   H HA   . LEU A 1 45 ? 8.838   -13.995 3.248   1.00 0.00 ? 44 LEU A HA   1  
ATOM 736   H HB2  . LEU A 1 45 ? 10.844  -12.983 4.184   1.00 0.00 ? 44 LEU A HB2  1  
ATOM 737   H HB3  . LEU A 1 45 ? 10.803  -14.090 5.553   1.00 0.00 ? 44 LEU A HB3  1  
ATOM 738   H HG   . LEU A 1 45 ? 11.235  -15.994 4.097   1.00 0.00 ? 44 LEU A HG   1  
ATOM 739   H HD11 . LEU A 1 45 ? 10.824  -13.947 1.916   1.00 0.00 ? 44 LEU A HD11 1  
ATOM 740   H HD12 . LEU A 1 45 ? 11.797  -15.387 1.617   1.00 0.00 ? 44 LEU A HD12 1  
ATOM 741   H HD13 . LEU A 1 45 ? 10.105  -15.549 2.077   1.00 0.00 ? 44 LEU A HD13 1  
ATOM 742   H HD21 . LEU A 1 45 ? 13.168  -14.657 4.880   1.00 0.00 ? 44 LEU A HD21 1  
ATOM 743   H HD22 . LEU A 1 45 ? 13.482  -15.386 3.305   1.00 0.00 ? 44 LEU A HD22 1  
ATOM 744   H HD23 . LEU A 1 45 ? 13.070  -13.675 3.419   1.00 0.00 ? 44 LEU A HD23 1  
ATOM 745   N N    . GLU A 1 46 ? 8.331   -15.938 5.806   1.00 0.00 ? 45 GLU A N    1  
ATOM 746   C CA   . GLU A 1 46 ? 7.982   -17.341 6.162   1.00 0.00 ? 45 GLU A CA   1  
ATOM 747   C C    . GLU A 1 46 ? 6.624   -17.712 5.561   1.00 0.00 ? 45 GLU A C    1  
ATOM 748   O O    . GLU A 1 46 ? 6.413   -18.827 5.126   1.00 0.00 ? 45 GLU A O    1  
ATOM 749   C CB   . GLU A 1 46 ? 7.918   -17.477 7.684   1.00 0.00 ? 45 GLU A CB   1  
ATOM 750   C CG   . GLU A 1 46 ? 7.719   -18.947 8.057   1.00 0.00 ? 45 GLU A CG   1  
ATOM 751   C CD   . GLU A 1 46 ? 7.942   -19.128 9.560   1.00 0.00 ? 45 GLU A CD   1  
ATOM 752   O OE1  . GLU A 1 46 ? 7.763   -18.164 10.285  1.00 0.00 ? 45 GLU A OE1  1  
ATOM 753   O OE2  . GLU A 1 46 ? 8.289   -20.228 9.959   1.00 0.00 ? 45 GLU A OE2  1  
ATOM 754   H H    . GLU A 1 46 ? 8.274   -15.232 6.483   1.00 0.00 ? 45 GLU A H    1  
ATOM 755   H HA   . GLU A 1 46 ? 8.736   -18.006 5.775   1.00 0.00 ? 45 GLU A HA   1  
ATOM 756   H HB2  . GLU A 1 46 ? 8.841   -17.117 8.116   1.00 0.00 ? 45 GLU A HB2  1  
ATOM 757   H HB3  . GLU A 1 46 ? 7.092   -16.896 8.064   1.00 0.00 ? 45 GLU A HB3  1  
ATOM 758   H HG2  . GLU A 1 46 ? 6.713   -19.250 7.803   1.00 0.00 ? 45 GLU A HG2  1  
ATOM 759   H HG3  . GLU A 1 46 ? 8.426   -19.556 7.514   1.00 0.00 ? 45 GLU A HG3  1  
ATOM 760   N N    . GLU A 1 47 ? 5.694   -16.797 5.556   1.00 0.00 ? 46 GLU A N    1  
ATOM 761   C CA   . GLU A 1 47 ? 4.337   -17.108 5.007   1.00 0.00 ? 46 GLU A CA   1  
ATOM 762   C C    . GLU A 1 47 ? 4.266   -16.783 3.511   1.00 0.00 ? 46 GLU A C    1  
ATOM 763   O O    . GLU A 1 47 ? 3.403   -16.048 3.073   1.00 0.00 ? 46 GLU A O    1  
ATOM 764   C CB   . GLU A 1 47 ? 3.293   -16.273 5.751   1.00 0.00 ? 46 GLU A CB   1  
ATOM 765   C CG   . GLU A 1 47 ? 3.350   -16.597 7.245   1.00 0.00 ? 46 GLU A CG   1  
ATOM 766   C CD   . GLU A 1 47 ? 2.156   -15.955 7.953   1.00 0.00 ? 46 GLU A CD   1  
ATOM 767   O OE1  . GLU A 1 47 ? 1.047   -16.123 7.472   1.00 0.00 ? 46 GLU A OE1  1  
ATOM 768   O OE2  . GLU A 1 47 ? 2.370   -15.307 8.964   1.00 0.00 ? 46 GLU A OE2  1  
ATOM 769   H H    . GLU A 1 47 ? 5.880   -15.912 5.933   1.00 0.00 ? 46 GLU A H    1  
ATOM 770   H HA   . GLU A 1 47 ? 4.119   -18.156 5.154   1.00 0.00 ? 46 GLU A HA   1  
ATOM 771   H HB2  . GLU A 1 47 ? 3.498   -15.223 5.601   1.00 0.00 ? 46 GLU A HB2  1  
ATOM 772   H HB3  . GLU A 1 47 ? 2.309   -16.506 5.372   1.00 0.00 ? 46 GLU A HB3  1  
ATOM 773   H HG2  . GLU A 1 47 ? 3.318   -17.669 7.382   1.00 0.00 ? 46 GLU A HG2  1  
ATOM 774   H HG3  . GLU A 1 47 ? 4.266   -16.208 7.663   1.00 0.00 ? 46 GLU A HG3  1  
ATOM 775   N N    . ILE A 1 48 ? 5.150   -17.344 2.721   1.00 0.00 ? 47 ILE A N    1  
ATOM 776   C CA   . ILE A 1 48 ? 5.125   -17.098 1.240   1.00 0.00 ? 47 ILE A CA   1  
ATOM 777   C C    . ILE A 1 48 ? 5.154   -18.448 0.518   1.00 0.00 ? 47 ILE A C    1  
ATOM 778   O O    . ILE A 1 48 ? 5.489   -19.463 1.096   1.00 0.00 ? 47 ILE A O    1  
ATOM 779   C CB   . ILE A 1 48 ? 6.334   -16.242 0.832   1.00 0.00 ? 47 ILE A CB   1  
ATOM 780   C CG1  . ILE A 1 48 ? 6.100   -14.805 1.325   1.00 0.00 ? 47 ILE A CG1  1  
ATOM 781   C CG2  . ILE A 1 48 ? 6.485   -16.252 -0.699  1.00 0.00 ? 47 ILE A CG2  1  
ATOM 782   C CD1  . ILE A 1 48 ? 7.303   -13.913 0.994   1.00 0.00 ? 47 ILE A CD1  1  
ATOM 783   H H    . ILE A 1 48 ? 5.823   -17.948 3.099   1.00 0.00 ? 47 ILE A H    1  
ATOM 784   H HA   . ILE A 1 48 ? 4.214   -16.579 0.968   1.00 0.00 ? 47 ILE A HA   1  
ATOM 785   H HB   . ILE A 1 48 ? 7.229   -16.641 1.287   1.00 0.00 ? 47 ILE A HB   1  
ATOM 786   H HG12 . ILE A 1 48 ? 5.218   -14.404 0.846   1.00 0.00 ? 47 ILE A HG12 1  
ATOM 787   H HG13 . ILE A 1 48 ? 5.949   -14.816 2.395   1.00 0.00 ? 47 ILE A HG13 1  
ATOM 788   H HG21 . ILE A 1 48 ? 5.528   -16.051 -1.155  1.00 0.00 ? 47 ILE A HG21 1  
ATOM 789   H HG22 . ILE A 1 48 ? 7.193   -15.498 -1.003  1.00 0.00 ? 47 ILE A HG22 1  
ATOM 790   H HG23 . ILE A 1 48 ? 6.840   -17.220 -1.020  1.00 0.00 ? 47 ILE A HG23 1  
ATOM 791   H HD11 . ILE A 1 48 ? 8.215   -14.490 1.056   1.00 0.00 ? 47 ILE A HD11 1  
ATOM 792   H HD12 . ILE A 1 48 ? 7.192   -13.522 -0.005  1.00 0.00 ? 47 ILE A HD12 1  
ATOM 793   H HD13 . ILE A 1 48 ? 7.346   -13.094 1.696   1.00 0.00 ? 47 ILE A HD13 1  
ATOM 794   N N    . LYS A 1 49 ? 4.800   -18.470 -0.740  1.00 0.00 ? 48 LYS A N    1  
ATOM 795   C CA   . LYS A 1 49 ? 4.799   -19.756 -1.502  1.00 0.00 ? 48 LYS A CA   1  
ATOM 796   C C    . LYS A 1 49 ? 5.260   -19.507 -2.940  1.00 0.00 ? 48 LYS A C    1  
ATOM 797   O O    . LYS A 1 49 ? 6.078   -20.233 -3.468  1.00 0.00 ? 48 LYS A O    1  
ATOM 798   C CB   . LYS A 1 49 ? 3.382   -20.333 -1.520  1.00 0.00 ? 48 LYS A CB   1  
ATOM 799   C CG   . LYS A 1 49 ? 3.371   -21.626 -2.337  1.00 0.00 ? 48 LYS A CG   1  
ATOM 800   C CD   . LYS A 1 49 ? 2.053   -22.368 -2.104  1.00 0.00 ? 48 LYS A CD   1  
ATOM 801   C CE   . LYS A 1 49 ? 1.880   -23.449 -3.172  1.00 0.00 ? 48 LYS A CE   1  
ATOM 802   N NZ   . LYS A 1 49 ? 0.733   -24.328 -2.808  1.00 0.00 ? 48 LYS A NZ   1  
ATOM 803   H H    . LYS A 1 49 ? 4.526   -17.642 -1.188  1.00 0.00 ? 48 LYS A H    1  
ATOM 804   H HA   . LYS A 1 49 ? 5.467   -20.468 -1.037  1.00 0.00 ? 48 LYS A HA   1  
ATOM 805   H HB2  . LYS A 1 49 ? 3.065   -20.540 -0.508  1.00 0.00 ? 48 LYS A HB2  1  
ATOM 806   H HB3  . LYS A 1 49 ? 2.708   -19.619 -1.970  1.00 0.00 ? 48 LYS A HB3  1  
ATOM 807   H HG2  . LYS A 1 49 ? 3.473   -21.390 -3.386  1.00 0.00 ? 48 LYS A HG2  1  
ATOM 808   H HG3  . LYS A 1 49 ? 4.194   -22.254 -2.028  1.00 0.00 ? 48 LYS A HG3  1  
ATOM 809   H HD2  . LYS A 1 49 ? 2.066   -22.826 -1.126  1.00 0.00 ? 48 LYS A HD2  1  
ATOM 810   H HD3  . LYS A 1 49 ? 1.232   -21.671 -2.165  1.00 0.00 ? 48 LYS A HD3  1  
ATOM 811   H HE2  . LYS A 1 49 ? 1.688   -22.984 -4.128  1.00 0.00 ? 48 LYS A HE2  1  
ATOM 812   H HE3  . LYS A 1 49 ? 2.781   -24.041 -3.235  1.00 0.00 ? 48 LYS A HE3  1  
ATOM 813   H HZ1  . LYS A 1 49 ? 0.106   -23.825 -2.148  1.00 0.00 ? 48 LYS A HZ1  1  
ATOM 814   H HZ2  . LYS A 1 49 ? 0.201   -24.577 -3.665  1.00 0.00 ? 48 LYS A HZ2  1  
ATOM 815   H HZ3  . LYS A 1 49 ? 1.090   -25.194 -2.356  1.00 0.00 ? 48 LYS A HZ3  1  
ATOM 816   N N    . GLU A 1 50 ? 4.743   -18.495 -3.584  1.00 0.00 ? 49 GLU A N    1  
ATOM 817   C CA   . GLU A 1 50 ? 5.164   -18.229 -4.989  1.00 0.00 ? 49 GLU A CA   1  
ATOM 818   C C    . GLU A 1 50 ? 6.598   -17.690 -4.991  1.00 0.00 ? 49 GLU A C    1  
ATOM 819   O O    . GLU A 1 50 ? 6.855   -16.583 -5.421  1.00 0.00 ? 49 GLU A O    1  
ATOM 820   C CB   . GLU A 1 50 ? 4.224   -17.203 -5.626  1.00 0.00 ? 49 GLU A CB   1  
ATOM 821   C CG   . GLU A 1 50 ? 2.772   -17.565 -5.303  1.00 0.00 ? 49 GLU A CG   1  
ATOM 822   C CD   . GLU A 1 50 ? 2.462   -18.962 -5.842  1.00 0.00 ? 49 GLU A CD   1  
ATOM 823   O OE1  . GLU A 1 50 ? 2.837   -19.924 -5.191  1.00 0.00 ? 49 GLU A OE1  1  
ATOM 824   O OE2  . GLU A 1 50 ? 1.855   -19.047 -6.897  1.00 0.00 ? 49 GLU A OE2  1  
ATOM 825   H H    . GLU A 1 50 ? 4.081   -17.919 -3.149  1.00 0.00 ? 49 GLU A H    1  
ATOM 826   H HA   . GLU A 1 50 ? 5.120   -19.155 -5.542  1.00 0.00 ? 49 GLU A HA   1  
ATOM 827   H HB2  . GLU A 1 50 ? 4.446   -16.220 -5.236  1.00 0.00 ? 49 GLU A HB2  1  
ATOM 828   H HB3  . GLU A 1 50 ? 4.362   -17.206 -6.696  1.00 0.00 ? 49 GLU A HB3  1  
ATOM 829   H HG2  . GLU A 1 50 ? 2.627   -17.550 -4.232  1.00 0.00 ? 49 GLU A HG2  1  
ATOM 830   H HG3  . GLU A 1 50 ? 2.111   -16.848 -5.766  1.00 0.00 ? 49 GLU A HG3  1  
ATOM 831   N N    . GLN A 1 51 ? 7.528   -18.456 -4.490  1.00 0.00 ? 50 GLN A N    1  
ATOM 832   C CA   . GLN A 1 51 ? 8.943   -17.986 -4.434  1.00 0.00 ? 50 GLN A CA   1  
ATOM 833   C C    . GLN A 1 51 ? 9.345   -17.332 -5.760  1.00 0.00 ? 50 GLN A C    1  
ATOM 834   O O    . GLN A 1 51 ? 10.206  -16.476 -5.802  1.00 0.00 ? 50 GLN A O    1  
ATOM 835   C CB   . GLN A 1 51 ? 9.858   -19.184 -4.168  1.00 0.00 ? 50 GLN A CB   1  
ATOM 836   C CG   . GLN A 1 51 ? 9.667   -19.666 -2.728  1.00 0.00 ? 50 GLN A CG   1  
ATOM 837   C CD   . GLN A 1 51 ? 10.261  -18.640 -1.761  1.00 0.00 ? 50 GLN A CD   1  
ATOM 838   O OE1  . GLN A 1 51 ? 9.537   -17.915 -1.107  1.00 0.00 ? 50 GLN A OE1  1  
ATOM 839   N NE2  . GLN A 1 51 ? 11.557  -18.546 -1.641  1.00 0.00 ? 50 GLN A NE2  1  
ATOM 840   H H    . GLN A 1 51 ? 7.293   -19.337 -4.130  1.00 0.00 ? 50 GLN A H    1  
ATOM 841   H HA   . GLN A 1 51 ? 9.041   -17.283 -3.620  1.00 0.00 ? 50 GLN A HA   1  
ATOM 842   H HB2  . GLN A 1 51 ? 9.612   -19.983 -4.853  1.00 0.00 ? 50 GLN A HB2  1  
ATOM 843   H HB3  . GLN A 1 51 ? 10.887  -18.890 -4.314  1.00 0.00 ? 50 GLN A HB3  1  
ATOM 844   H HG2  . GLN A 1 51 ? 8.612   -19.785 -2.526  1.00 0.00 ? 50 GLN A HG2  1  
ATOM 845   H HG3  . GLN A 1 51 ? 10.168  -20.613 -2.597  1.00 0.00 ? 50 GLN A HG3  1  
ATOM 846   H HE21 . GLN A 1 51 ? 12.141  -19.130 -2.169  1.00 0.00 ? 50 GLN A HE21 1  
ATOM 847   H HE22 . GLN A 1 51 ? 11.946  -17.892 -1.024  1.00 0.00 ? 50 GLN A HE22 1  
ATOM 848   N N    . GLU A 1 52 ? 8.737   -17.732 -6.844  1.00 0.00 ? 51 GLU A N    1  
ATOM 849   C CA   . GLU A 1 52 ? 9.099   -17.133 -8.161  1.00 0.00 ? 51 GLU A CA   1  
ATOM 850   C C    . GLU A 1 52 ? 8.570   -15.699 -8.248  1.00 0.00 ? 51 GLU A C    1  
ATOM 851   O O    . GLU A 1 52 ? 9.107   -14.883 -8.971  1.00 0.00 ? 51 GLU A O    1  
ATOM 852   C CB   . GLU A 1 52 ? 8.536   -17.979 -9.305  1.00 0.00 ? 51 GLU A CB   1  
ATOM 853   C CG   . GLU A 1 52 ? 7.044   -18.226 -9.073  1.00 0.00 ? 51 GLU A CG   1  
ATOM 854   C CD   . GLU A 1 52 ? 6.470   -19.026 -10.243 1.00 0.00 ? 51 GLU A CD   1  
ATOM 855   O OE1  . GLU A 1 52 ? 7.128   -19.957 -10.678 1.00 0.00 ? 51 GLU A OE1  1  
ATOM 856   O OE2  . GLU A 1 52 ? 5.382   -18.695 -10.684 1.00 0.00 ? 51 GLU A OE2  1  
ATOM 857   H H    . GLU A 1 52 ? 8.045   -18.424 -6.790  1.00 0.00 ? 51 GLU A H    1  
ATOM 858   H HA   . GLU A 1 52 ? 10.175  -17.077 -8.235  1.00 0.00 ? 51 GLU A HA   1  
ATOM 859   H HB2  . GLU A 1 52 ? 8.674   -17.457 -10.241 1.00 0.00 ? 51 GLU A HB2  1  
ATOM 860   H HB3  . GLU A 1 52 ? 9.054   -18.926 -9.341  1.00 0.00 ? 51 GLU A HB3  1  
ATOM 861   H HG2  . GLU A 1 52 ? 6.910   -18.781 -8.156  1.00 0.00 ? 51 GLU A HG2  1  
ATOM 862   H HG3  . GLU A 1 52 ? 6.530   -17.279 -9.000  1.00 0.00 ? 51 GLU A HG3  1  
ATOM 863   N N    . VAL A 1 53 ? 7.564   -15.360 -7.495  1.00 0.00 ? 52 VAL A N    1  
ATOM 864   C CA   . VAL A 1 53 ? 7.074   -13.954 -7.527  1.00 0.00 ? 52 VAL A CA   1  
ATOM 865   C C    . VAL A 1 53 ? 8.098   -13.093 -6.789  1.00 0.00 ? 52 VAL A C    1  
ATOM 866   O O    . VAL A 1 53 ? 8.517   -12.061 -7.276  1.00 0.00 ? 52 VAL A O    1  
ATOM 867   C CB   . VAL A 1 53 ? 5.714   -13.858 -6.824  1.00 0.00 ? 52 VAL A CB   1  
ATOM 868   C CG1  . VAL A 1 53 ? 5.346   -12.388 -6.597  1.00 0.00 ? 52 VAL A CG1  1  
ATOM 869   C CG2  . VAL A 1 53 ? 4.641   -14.518 -7.693  1.00 0.00 ? 52 VAL A CG2  1  
ATOM 870   H H    . VAL A 1 53 ? 7.166   -15.999 -6.865  1.00 0.00 ? 52 VAL A H    1  
ATOM 871   H HA   . VAL A 1 53 ? 6.987   -13.603 -8.546  1.00 0.00 ? 52 VAL A HA   1  
ATOM 872   H HB   . VAL A 1 53 ? 5.768   -14.365 -5.871  1.00 0.00 ? 52 VAL A HB   1  
ATOM 873   H HG11 . VAL A 1 53 ? 5.526   -11.828 -7.503  1.00 0.00 ? 52 VAL A HG11 1  
ATOM 874   H HG12 . VAL A 1 53 ? 4.302   -12.315 -6.330  1.00 0.00 ? 52 VAL A HG12 1  
ATOM 875   H HG13 . VAL A 1 53 ? 5.951   -11.984 -5.799  1.00 0.00 ? 52 VAL A HG13 1  
ATOM 876   H HG21 . VAL A 1 53 ? 5.019   -15.450 -8.088  1.00 0.00 ? 52 VAL A HG21 1  
ATOM 877   H HG22 . VAL A 1 53 ? 3.763   -14.710 -7.094  1.00 0.00 ? 52 VAL A HG22 1  
ATOM 878   H HG23 . VAL A 1 53 ? 4.382   -13.860 -8.510  1.00 0.00 ? 52 VAL A HG23 1  
ATOM 879   N N    . VAL A 1 54 ? 8.517   -13.502 -5.624  1.00 0.00 ? 53 VAL A N    1  
ATOM 880   C CA   . VAL A 1 54 ? 9.521   -12.694 -4.883  1.00 0.00 ? 53 VAL A CA   1  
ATOM 881   C C    . VAL A 1 54 ? 10.819  -12.656 -5.688  1.00 0.00 ? 53 VAL A C    1  
ATOM 882   O O    . VAL A 1 54 ? 11.525  -11.668 -5.711  1.00 0.00 ? 53 VAL A O    1  
ATOM 883   C CB   . VAL A 1 54 ? 9.791   -13.338 -3.524  1.00 0.00 ? 53 VAL A CB   1  
ATOM 884   C CG1  . VAL A 1 54 ? 10.742  -12.451 -2.718  1.00 0.00 ? 53 VAL A CG1  1  
ATOM 885   C CG2  . VAL A 1 54 ? 8.475   -13.494 -2.764  1.00 0.00 ? 53 VAL A CG2  1  
ATOM 886   H H    . VAL A 1 54 ? 8.179   -14.334 -5.229  1.00 0.00 ? 53 VAL A H    1  
ATOM 887   H HA   . VAL A 1 54 ? 9.141   -11.693 -4.740  1.00 0.00 ? 53 VAL A HA   1  
ATOM 888   H HB   . VAL A 1 54 ? 10.242  -14.309 -3.670  1.00 0.00 ? 53 VAL A HB   1  
ATOM 889   H HG11 . VAL A 1 54 ? 10.375  -11.435 -2.720  1.00 0.00 ? 53 VAL A HG11 1  
ATOM 890   H HG12 . VAL A 1 54 ? 10.796  -12.812 -1.701  1.00 0.00 ? 53 VAL A HG12 1  
ATOM 891   H HG13 . VAL A 1 54 ? 11.725  -12.480 -3.163  1.00 0.00 ? 53 VAL A HG13 1  
ATOM 892   H HG21 . VAL A 1 54 ? 7.980   -12.536 -2.698  1.00 0.00 ? 53 VAL A HG21 1  
ATOM 893   H HG22 . VAL A 1 54 ? 7.838   -14.194 -3.285  1.00 0.00 ? 53 VAL A HG22 1  
ATOM 894   H HG23 . VAL A 1 54 ? 8.678   -13.863 -1.770  1.00 0.00 ? 53 VAL A HG23 1  
ATOM 895   N N    . ASP A 1 55 ? 11.136  -13.736 -6.347  1.00 0.00 ? 54 ASP A N    1  
ATOM 896   C CA   . ASP A 1 55 ? 12.385  -13.782 -7.153  1.00 0.00 ? 54 ASP A CA   1  
ATOM 897   C C    . ASP A 1 55 ? 12.373  -12.648 -8.178  1.00 0.00 ? 54 ASP A C    1  
ATOM 898   O O    . ASP A 1 55 ? 13.360  -11.968 -8.376  1.00 0.00 ? 54 ASP A O    1  
ATOM 899   C CB   . ASP A 1 55 ? 12.473  -15.126 -7.880  1.00 0.00 ? 54 ASP A CB   1  
ATOM 900   C CG   . ASP A 1 55 ? 13.789  -15.204 -8.655  1.00 0.00 ? 54 ASP A CG   1  
ATOM 901   O OD1  . ASP A 1 55 ? 14.790  -15.551 -8.051  1.00 0.00 ? 54 ASP A OD1  1  
ATOM 902   O OD2  . ASP A 1 55 ? 13.773  -14.915 -9.840  1.00 0.00 ? 54 ASP A OD2  1  
ATOM 903   H H    . ASP A 1 55 ? 10.550  -14.521 -6.309  1.00 0.00 ? 54 ASP A H    1  
ATOM 904   H HA   . ASP A 1 55 ? 13.238  -13.671 -6.499  1.00 0.00 ? 54 ASP A HA   1  
ATOM 905   H HB2  . ASP A 1 55 ? 12.431  -15.929 -7.158  1.00 0.00 ? 54 ASP A HB2  1  
ATOM 906   H HB3  . ASP A 1 55 ? 11.646  -15.218 -8.568  1.00 0.00 ? 54 ASP A HB3  1  
ATOM 907   N N    . LYS A 1 56 ? 11.266  -12.444 -8.842  1.00 0.00 ? 55 LYS A N    1  
ATOM 908   C CA   . LYS A 1 56 ? 11.207  -11.359 -9.860  1.00 0.00 ? 55 LYS A CA   1  
ATOM 909   C C    . LYS A 1 56 ? 11.223  -9.997  -9.165  1.00 0.00 ? 55 LYS A C    1  
ATOM 910   O O    . LYS A 1 56 ? 11.681  -9.022  -9.724  1.00 0.00 ? 55 LYS A O    1  
ATOM 911   C CB   . LYS A 1 56 ? 9.945   -11.502 -10.710 1.00 0.00 ? 55 LYS A CB   1  
ATOM 912   C CG   . LYS A 1 56 ? 10.137  -12.632 -11.725 1.00 0.00 ? 55 LYS A CG   1  
ATOM 913   C CD   . LYS A 1 56 ? 8.811   -12.916 -12.433 1.00 0.00 ? 55 LYS A CD   1  
ATOM 914   C CE   . LYS A 1 56 ? 9.010   -14.032 -13.460 1.00 0.00 ? 55 LYS A CE   1  
ATOM 915   N NZ   . LYS A 1 56 ? 7.706   -14.352 -14.107 1.00 0.00 ? 55 LYS A NZ   1  
ATOM 916   H H    . LYS A 1 56 ? 10.478  -13.007 -8.676  1.00 0.00 ? 55 LYS A H    1  
ATOM 917   H HA   . LYS A 1 56 ? 12.086  -11.422 -10.483 1.00 0.00 ? 55 LYS A HA   1  
ATOM 918   H HB2  . LYS A 1 56 ? 9.107   -11.731 -10.068 1.00 0.00 ? 55 LYS A HB2  1  
ATOM 919   H HB3  . LYS A 1 56 ? 9.755   -10.578 -11.235 1.00 0.00 ? 55 LYS A HB3  1  
ATOM 920   H HG2  . LYS A 1 56 ? 10.879  -12.338 -12.454 1.00 0.00 ? 55 LYS A HG2  1  
ATOM 921   H HG3  . LYS A 1 56 ? 10.468  -13.523 -11.214 1.00 0.00 ? 55 LYS A HG3  1  
ATOM 922   H HD2  . LYS A 1 56 ? 8.073   -13.222 -11.706 1.00 0.00 ? 55 LYS A HD2  1  
ATOM 923   H HD3  . LYS A 1 56 ? 8.472   -12.023 -12.937 1.00 0.00 ? 55 LYS A HD3  1  
ATOM 924   H HE2  . LYS A 1 56 ? 9.715   -13.708 -14.212 1.00 0.00 ? 55 LYS A HE2  1  
ATOM 925   H HE3  . LYS A 1 56 ? 9.392   -14.913 -12.965 1.00 0.00 ? 55 LYS A HE3  1  
ATOM 926   H HZ1  . LYS A 1 56 ? 6.940   -14.252 -13.412 1.00 0.00 ? 55 LYS A HZ1  1  
ATOM 927   H HZ2  . LYS A 1 56 ? 7.544   -13.698 -14.900 1.00 0.00 ? 55 LYS A HZ2  1  
ATOM 928   H HZ3  . LYS A 1 56 ? 7.724   -15.329 -14.461 1.00 0.00 ? 55 LYS A HZ3  1  
ATOM 929   N N    . VAL A 1 57 ? 10.766  -9.912  -7.944  1.00 0.00 ? 56 VAL A N    1  
ATOM 930   C CA   . VAL A 1 57 ? 10.809  -8.603  -7.235  1.00 0.00 ? 56 VAL A CA   1  
ATOM 931   C C    . VAL A 1 57 ? 12.275  -8.225  -7.018  1.00 0.00 ? 56 VAL A C    1  
ATOM 932   O O    . VAL A 1 57 ? 12.728  -7.180  -7.442  1.00 0.00 ? 56 VAL A O    1  
ATOM 933   C CB   . VAL A 1 57 ? 10.103  -8.733  -5.880  1.00 0.00 ? 56 VAL A CB   1  
ATOM 934   C CG1  . VAL A 1 57 ? 10.346  -7.473  -5.045  1.00 0.00 ? 56 VAL A CG1  1  
ATOM 935   C CG2  . VAL A 1 57 ? 8.599   -8.907  -6.107  1.00 0.00 ? 56 VAL A CG2  1  
ATOM 936   H H    . VAL A 1 57 ? 10.428  -10.701 -7.475  1.00 0.00 ? 56 VAL A H    1  
ATOM 937   H HA   . VAL A 1 57 ? 10.326  -7.831  -7.818  1.00 0.00 ? 56 VAL A HA   1  
ATOM 938   H HB   . VAL A 1 57 ? 10.490  -9.592  -5.354  1.00 0.00 ? 56 VAL A HB   1  
ATOM 939   H HG11 . VAL A 1 57 ? 10.181  -6.598  -5.657  1.00 0.00 ? 56 VAL A HG11 1  
ATOM 940   H HG12 . VAL A 1 57 ? 9.665   -7.460  -4.207  1.00 0.00 ? 56 VAL A HG12 1  
ATOM 941   H HG13 . VAL A 1 57 ? 11.363  -7.473  -4.683  1.00 0.00 ? 56 VAL A HG13 1  
ATOM 942   H HG21 . VAL A 1 57 ? 8.432   -9.680  -6.843  1.00 0.00 ? 56 VAL A HG21 1  
ATOM 943   H HG22 . VAL A 1 57 ? 8.124   -9.185  -5.178  1.00 0.00 ? 56 VAL A HG22 1  
ATOM 944   H HG23 . VAL A 1 57 ? 8.178   -7.977  -6.461  1.00 0.00 ? 56 VAL A HG23 1  
ATOM 945   N N    . MET A 1 58 ? 13.020  -9.068  -6.355  1.00 0.00 ? 57 MET A N    1  
ATOM 946   C CA   . MET A 1 58 ? 14.455  -8.758  -6.107  1.00 0.00 ? 57 MET A CA   1  
ATOM 947   C C    . MET A 1 58 ? 15.145  -8.414  -7.427  1.00 0.00 ? 57 MET A C    1  
ATOM 948   O O    . MET A 1 58 ? 16.098  -7.659  -7.456  1.00 0.00 ? 57 MET A O    1  
ATOM 949   C CB   . MET A 1 58 ? 15.139  -9.969  -5.468  1.00 0.00 ? 57 MET A CB   1  
ATOM 950   C CG   . MET A 1 58 ? 14.539  -10.225 -4.085  1.00 0.00 ? 57 MET A CG   1  
ATOM 951   S SD   . MET A 1 58 ? 15.045  -8.905  -2.955  1.00 0.00 ? 57 MET A SD   1  
ATOM 952   C CE   . MET A 1 58 ? 14.101  -9.461  -1.515  1.00 0.00 ? 57 MET A CE   1  
ATOM 953   H H    . MET A 1 58 ? 12.634  -9.896  -5.999  1.00 0.00 ? 57 MET A H    1  
ATOM 954   H HA   . MET A 1 58 ? 14.533  -7.907  -5.446  1.00 0.00 ? 57 MET A HA   1  
ATOM 955   H HB2  . MET A 1 58 ? 14.988  -10.838 -6.093  1.00 0.00 ? 57 MET A HB2  1  
ATOM 956   H HB3  . MET A 1 58 ? 16.196  -9.775  -5.369  1.00 0.00 ? 57 MET A HB3  1  
ATOM 957   H HG2  . MET A 1 58 ? 13.461  -10.242 -4.157  1.00 0.00 ? 57 MET A HG2  1  
ATOM 958   H HG3  . MET A 1 58 ? 14.890  -11.175 -3.709  1.00 0.00 ? 57 MET A HG3  1  
ATOM 959   H HE1  . MET A 1 58 ? 13.995  -10.537 -1.548  1.00 0.00 ? 57 MET A HE1  1  
ATOM 960   H HE2  . MET A 1 58 ? 14.620  -9.172  -0.611  1.00 0.00 ? 57 MET A HE2  1  
ATOM 961   H HE3  . MET A 1 58 ? 13.124  -9.005  -1.526  1.00 0.00 ? 57 MET A HE3  1  
ATOM 962   N N    . GLU A 1 59 ? 14.658  -8.926  -8.529  1.00 0.00 ? 58 GLU A N    1  
ATOM 963   C CA   . GLU A 1 59 ? 15.272  -8.585  -9.846  1.00 0.00 ? 58 GLU A CA   1  
ATOM 964   C C    . GLU A 1 59 ? 14.657  -7.279  -10.348 1.00 0.00 ? 58 GLU A C    1  
ATOM 965   O O    . GLU A 1 59 ? 15.316  -6.483  -10.985 1.00 0.00 ? 58 GLU A O    1  
ATOM 966   C CB   . GLU A 1 59 ? 15.045  -9.712  -10.856 1.00 0.00 ? 58 GLU A CB   1  
ATOM 967   C CG   . GLU A 1 59 ? 15.646  -9.318  -12.207 1.00 0.00 ? 58 GLU A CG   1  
ATOM 968   C CD   . GLU A 1 59 ? 15.745  -10.555 -13.102 1.00 0.00 ? 58 GLU A CD   1  
ATOM 969   O OE1  . GLU A 1 59 ? 16.568  -11.407 -12.813 1.00 0.00 ? 58 GLU A OE1  1  
ATOM 970   O OE2  . GLU A 1 59 ? 14.996  -10.628 -14.062 1.00 0.00 ? 58 GLU A OE2  1  
ATOM 971   H H    . GLU A 1 59 ? 13.865  -9.494  -8.494  1.00 0.00 ? 58 GLU A H    1  
ATOM 972   H HA   . GLU A 1 59 ? 16.329  -8.395  -9.720  1.00 0.00 ? 58 GLU A HA   1  
ATOM 973   H HB2  . GLU A 1 59 ? 15.519  -10.615 -10.499 1.00 0.00 ? 58 GLU A HB2  1  
ATOM 974   H HB3  . GLU A 1 59 ? 13.985  -9.883  -10.973 1.00 0.00 ? 58 GLU A HB3  1  
ATOM 975   H HG2  . GLU A 1 59 ? 15.016  -8.579  -12.680 1.00 0.00 ? 58 GLU A HG2  1  
ATOM 976   H HG3  . GLU A 1 59 ? 16.633  -8.907  -12.056 1.00 0.00 ? 58 GLU A HG3  1  
ATOM 977   N N    . THR A 1 60 ? 13.412  -7.031  -10.048 1.00 0.00 ? 59 THR A N    1  
ATOM 978   C CA   . THR A 1 60 ? 12.800  -5.751  -10.499 1.00 0.00 ? 59 THR A CA   1  
ATOM 979   C C    . THR A 1 60 ? 13.452  -4.614  -9.711  1.00 0.00 ? 59 THR A C    1  
ATOM 980   O O    . THR A 1 60 ? 13.850  -3.617  -10.280 1.00 0.00 ? 59 THR A O    1  
ATOM 981   C CB   . THR A 1 60 ? 11.285  -5.771  -10.268 1.00 0.00 ? 59 THR A CB   1  
ATOM 982   O OG1  . THR A 1 60 ? 10.770  -7.043  -10.634 1.00 0.00 ? 59 THR A OG1  1  
ATOM 983   C CG2  . THR A 1 60 ? 10.616  -4.687  -11.119 1.00 0.00 ? 59 THR A CG2  1  
ATOM 984   H H    . THR A 1 60 ? 12.894  -7.666  -9.512  1.00 0.00 ? 59 THR A H    1  
ATOM 985   H HA   . THR A 1 60 ? 13.019  -5.587  -11.543 1.00 0.00 ? 59 THR A HA   1  
ATOM 986   H HB   . THR A 1 60 ? 11.077  -5.584  -9.226  1.00 0.00 ? 59 THR A HB   1  
ATOM 987   H HG1  . THR A 1 60 ? 9.825   -6.950  -10.779 1.00 0.00 ? 59 THR A HG1  1  
ATOM 988   H HG21 . THR A 1 60 ? 10.913  -4.803  -12.151 1.00 0.00 ? 59 THR A HG21 1  
ATOM 989   H HG22 . THR A 1 60 ? 9.543   -4.781  -11.045 1.00 0.00 ? 59 THR A HG22 1  
ATOM 990   H HG23 . THR A 1 60 ? 10.918  -3.713  -10.765 1.00 0.00 ? 59 THR A HG23 1  
ATOM 991   N N    . LEU A 1 61 ? 13.611  -4.751  -8.423  1.00 0.00 ? 60 LEU A N    1  
ATOM 992   C CA   . LEU A 1 61 ? 14.288  -3.674  -7.649  1.00 0.00 ? 60 LEU A CA   1  
ATOM 993   C C    . LEU A 1 61 ? 15.693  -3.481  -8.227  1.00 0.00 ? 60 LEU A C    1  
ATOM 994   O O    . LEU A 1 61 ? 16.048  -2.407  -8.670  1.00 0.00 ? 60 LEU A O    1  
ATOM 995   C CB   . LEU A 1 61 ? 14.394  -4.100  -6.170  1.00 0.00 ? 60 LEU A CB   1  
ATOM 996   C CG   . LEU A 1 61 ? 13.123  -3.718  -5.383  1.00 0.00 ? 60 LEU A CG   1  
ATOM 997   C CD1  . LEU A 1 61 ? 13.100  -2.211  -5.081  1.00 0.00 ? 60 LEU A CD1  1  
ATOM 998   C CD2  . LEU A 1 61 ? 11.869  -4.104  -6.181  1.00 0.00 ? 60 LEU A CD2  1  
ATOM 999   H H    . LEU A 1 61 ? 13.322  -5.559  -7.946  1.00 0.00 ? 60 LEU A H    1  
ATOM 1000  H HA   . LEU A 1 61 ? 13.758  -2.739  -7.730  1.00 0.00 ? 60 LEU A HA   1  
ATOM 1001  H HB2  . LEU A 1 61 ? 14.524  -5.171  -6.125  1.00 0.00 ? 60 LEU A HB2  1  
ATOM 1002  H HB3  . LEU A 1 61 ? 15.251  -3.624  -5.714  1.00 0.00 ? 60 LEU A HB3  1  
ATOM 1003  H HG   . LEU A 1 61 ? 13.122  -4.258  -4.446  1.00 0.00 ? 60 LEU A HG   1  
ATOM 1004  H HD11 . LEU A 1 61 ? 14.089  -1.877  -4.806  1.00 0.00 ? 60 LEU A HD11 1  
ATOM 1005  H HD12 . LEU A 1 61 ? 12.765  -1.668  -5.951  1.00 0.00 ? 60 LEU A HD12 1  
ATOM 1006  H HD13 . LEU A 1 61 ? 12.422  -2.024  -4.261  1.00 0.00 ? 60 LEU A HD13 1  
ATOM 1007  H HD21 . LEU A 1 61 ? 12.021  -5.063  -6.652  1.00 0.00 ? 60 LEU A HD21 1  
ATOM 1008  H HD22 . LEU A 1 61 ? 11.024  -4.165  -5.510  1.00 0.00 ? 60 LEU A HD22 1  
ATOM 1009  H HD23 . LEU A 1 61 ? 11.673  -3.358  -6.936  1.00 0.00 ? 60 LEU A HD23 1  
ATOM 1010  N N    . ASP A 1 62 ? 16.493  -4.511  -8.229  1.00 0.00 ? 61 ASP A N    1  
ATOM 1011  C CA   . ASP A 1 62 ? 17.868  -4.375  -8.783  1.00 0.00 ? 61 ASP A CA   1  
ATOM 1012  C C    . ASP A 1 62 ? 17.791  -3.770  -10.186 1.00 0.00 ? 61 ASP A C    1  
ATOM 1013  O O    . ASP A 1 62 ? 18.740  -3.184  -10.668 1.00 0.00 ? 61 ASP A O    1  
ATOM 1014  C CB   . ASP A 1 62 ? 18.528  -5.753  -8.857  1.00 0.00 ? 61 ASP A CB   1  
ATOM 1015  C CG   . ASP A 1 62 ? 19.985  -5.597  -9.296  1.00 0.00 ? 61 ASP A CG   1  
ATOM 1016  O OD1  . ASP A 1 62 ? 20.204  -5.296  -10.458 1.00 0.00 ? 61 ASP A OD1  1  
ATOM 1017  O OD2  . ASP A 1 62 ? 20.858  -5.781  -8.463  1.00 0.00 ? 61 ASP A OD2  1  
ATOM 1018  H H    . ASP A 1 62 ? 16.192  -5.372  -7.868  1.00 0.00 ? 61 ASP A H    1  
ATOM 1019  H HA   . ASP A 1 62 ? 18.451  -3.730  -8.144  1.00 0.00 ? 61 ASP A HA   1  
ATOM 1020  H HB2  . ASP A 1 62 ? 18.493  -6.222  -7.884  1.00 0.00 ? 61 ASP A HB2  1  
ATOM 1021  H HB3  . ASP A 1 62 ? 18.003  -6.367  -9.573  1.00 0.00 ? 61 ASP A HB3  1  
ATOM 1022  N N    . GLU A 1 63 ? 16.665  -3.910  -10.848 1.00 0.00 ? 62 GLU A N    1  
ATOM 1023  C CA   . GLU A 1 63 ? 16.518  -3.347  -12.231 1.00 0.00 ? 62 GLU A CA   1  
ATOM 1024  C C    . GLU A 1 63 ? 15.722  -2.051  -12.168 1.00 0.00 ? 62 GLU A C    1  
ATOM 1025  O O    . GLU A 1 63 ? 14.891  -1.760  -13.005 1.00 0.00 ? 62 GLU A O    1  
ATOM 1026  C CB   . GLU A 1 63 ? 15.777  -4.323  -13.094 1.00 0.00 ? 62 GLU A CB   1  
ATOM 1027  C CG   . GLU A 1 63 ? 16.655  -5.542  -13.381 1.00 0.00 ? 62 GLU A CG   1  
ATOM 1028  C CD   . GLU A 1 63 ? 17.794  -5.141  -14.319 1.00 0.00 ? 62 GLU A CD   1  
ATOM 1029  O OE1  . GLU A 1 63 ? 17.631  -4.165  -15.033 1.00 0.00 ? 62 GLU A OE1  1  
ATOM 1030  O OE2  . GLU A 1 63 ? 18.810  -5.816  -14.308 1.00 0.00 ? 62 GLU A OE2  1  
ATOM 1031  H H    . GLU A 1 63 ? 15.916  -4.388  -10.436 1.00 0.00 ? 62 GLU A H    1  
ATOM 1032  H HA   . GLU A 1 63 ? 17.494  -3.124  -12.636 1.00 0.00 ? 62 GLU A HA   1  
ATOM 1033  H HB2  . GLU A 1 63 ? 14.891  -4.619  -12.564 1.00 0.00 ? 62 GLU A HB2  1  
ATOM 1034  H HB3  . GLU A 1 63 ? 15.507  -3.840  -14.014 1.00 0.00 ? 62 GLU A HB3  1  
ATOM 1035  H HG2  . GLU A 1 63 ? 17.066  -5.916  -12.454 1.00 0.00 ? 62 GLU A HG2  1  
ATOM 1036  H HG3  . GLU A 1 63 ? 16.060  -6.312  -13.848 1.00 0.00 ? 62 GLU A HG3  1  
ATOM 1037  N N    . ASP A 1 64 ? 15.988  -1.287  -11.183 1.00 0.00 ? 63 ASP A N    1  
ATOM 1038  C CA   . ASP A 1 64 ? 15.286  0.017   -11.004 1.00 0.00 ? 63 ASP A CA   1  
ATOM 1039  C C    . ASP A 1 64 ? 15.215  0.758   -12.336 1.00 0.00 ? 63 ASP A C    1  
ATOM 1040  O O    . ASP A 1 64 ? 14.218  1.363   -12.676 1.00 0.00 ? 63 ASP A O    1  
ATOM 1041  C CB   . ASP A 1 64 ? 16.119  0.870   -10.040 1.00 0.00 ? 63 ASP A CB   1  
ATOM 1042  C CG   . ASP A 1 64 ? 15.490  2.259   -9.903  1.00 0.00 ? 63 ASP A CG   1  
ATOM 1043  O OD1  . ASP A 1 64 ? 14.272  2.339   -9.903  1.00 0.00 ? 63 ASP A OD1  1  
ATOM 1044  O OD2  . ASP A 1 64 ? 16.236  3.218   -9.801  1.00 0.00 ? 63 ASP A OD2  1  
ATOM 1045  H H    . ASP A 1 64 ? 16.657  -1.580  -10.552 1.00 0.00 ? 63 ASP A H    1  
ATOM 1046  H HA   . ASP A 1 64 ? 14.309  -0.097  -10.562 1.00 0.00 ? 63 ASP A HA   1  
ATOM 1047  H HB2  . ASP A 1 64 ? 16.142  0.391   -9.073  1.00 0.00 ? 63 ASP A HB2  1  
ATOM 1048  H HB3  . ASP A 1 64 ? 17.124  0.967   -10.421 1.00 0.00 ? 63 ASP A HB3  1  
ATOM 1049  N N    . GLY A 1 65 ? 16.267  0.687   -13.099 1.00 0.00 ? 64 GLY A N    1  
ATOM 1050  C CA   . GLY A 1 65 ? 16.294  1.355   -14.434 1.00 0.00 ? 64 GLY A CA   1  
ATOM 1051  C C    . GLY A 1 65 ? 15.939  2.846   -14.327 1.00 0.00 ? 64 GLY A C    1  
ATOM 1052  O O    . GLY A 1 65 ? 16.042  3.568   -15.299 1.00 0.00 ? 64 GLY A O    1  
ATOM 1053  H H    . GLY A 1 65 ? 17.045  0.165   -12.809 1.00 0.00 ? 64 GLY A H    1  
ATOM 1054  H HA2  . GLY A 1 65 ? 17.288  1.260   -14.847 1.00 0.00 ? 64 GLY A HA2  1  
ATOM 1055  H HA3  . GLY A 1 65 ? 15.581  0.855   -15.071 1.00 0.00 ? 64 GLY A HA3  1  
ATOM 1056  N N    . ASP A 1 66 ? 15.514  3.323   -13.172 1.00 0.00 ? 65 ASP A N    1  
ATOM 1057  C CA   . ASP A 1 66 ? 15.142  4.782   -13.031 1.00 0.00 ? 65 ASP A CA   1  
ATOM 1058  C C    . ASP A 1 66 ? 16.187  5.579   -12.207 1.00 0.00 ? 65 ASP A C    1  
ATOM 1059  O O    . ASP A 1 66 ? 16.109  6.790   -12.149 1.00 0.00 ? 65 ASP A O    1  
ATOM 1060  C CB   . ASP A 1 66 ? 13.784  4.874   -12.333 1.00 0.00 ? 65 ASP A CB   1  
ATOM 1061  C CG   . ASP A 1 66 ? 13.230  6.292   -12.480 1.00 0.00 ? 65 ASP A CG   1  
ATOM 1062  O OD1  . ASP A 1 66 ? 12.586  6.553   -13.483 1.00 0.00 ? 65 ASP A OD1  1  
ATOM 1063  O OD2  . ASP A 1 66 ? 13.458  7.091   -11.588 1.00 0.00 ? 65 ASP A OD2  1  
ATOM 1064  H H    . ASP A 1 66 ? 15.414  2.729   -12.400 1.00 0.00 ? 65 ASP A H    1  
ATOM 1065  H HA   . ASP A 1 66 ? 15.053  5.200   -14.023 1.00 0.00 ? 65 ASP A HA   1  
ATOM 1066  H HB2  . ASP A 1 66 ? 13.099  4.169   -12.782 1.00 0.00 ? 65 ASP A HB2  1  
ATOM 1067  H HB3  . ASP A 1 66 ? 13.903  4.643   -11.285 1.00 0.00 ? 65 ASP A HB3  1  
ATOM 1068  N N    . GLY A 1 67 ? 17.164  4.957   -11.580 1.00 0.00 ? 66 GLY A N    1  
ATOM 1069  C CA   . GLY A 1 67 ? 18.168  5.744   -10.803 1.00 0.00 ? 66 GLY A CA   1  
ATOM 1070  C C    . GLY A 1 67 ? 17.602  6.129   -9.433  1.00 0.00 ? 66 GLY A C    1  
ATOM 1071  O O    . GLY A 1 67 ? 18.334  6.288   -8.477  1.00 0.00 ? 66 GLY A O    1  
ATOM 1072  H H    . GLY A 1 67 ? 17.273  3.994   -11.634 1.00 0.00 ? 66 GLY A H    1  
ATOM 1073  H HA2  . GLY A 1 67 ? 19.063  5.151   -10.670 1.00 0.00 ? 66 GLY A HA2  1  
ATOM 1074  H HA3  . GLY A 1 67 ? 18.409  6.635   -11.363 1.00 0.00 ? 66 GLY A HA3  1  
ATOM 1075  N N    . GLU A 1 68 ? 16.306  6.275   -9.319  1.00 0.00 ? 67 GLU A N    1  
ATOM 1076  C CA   . GLU A 1 68 ? 15.713  6.646   -7.994  1.00 0.00 ? 67 GLU A CA   1  
ATOM 1077  C C    . GLU A 1 68 ? 14.290  6.092   -7.877  1.00 0.00 ? 67 GLU A C    1  
ATOM 1078  O O    . GLU A 1 68 ? 13.490  6.230   -8.781  1.00 0.00 ? 67 GLU A O    1  
ATOM 1079  C CB   . GLU A 1 68 ? 15.682  8.169   -7.858  1.00 0.00 ? 67 GLU A CB   1  
ATOM 1080  C CG   . GLU A 1 68 ? 17.113  8.711   -7.812  1.00 0.00 ? 67 GLU A CG   1  
ATOM 1081  C CD   . GLU A 1 68 ? 17.093  10.166  -7.342  1.00 0.00 ? 67 GLU A CD   1  
ATOM 1082  O OE1  . GLU A 1 68 ? 16.712  10.396  -6.206  1.00 0.00 ? 67 GLU A OE1  1  
ATOM 1083  O OE2  . GLU A 1 68 ? 17.461  11.026  -8.126  1.00 0.00 ? 67 GLU A OE2  1  
ATOM 1084  H H    . GLU A 1 68 ? 15.734  6.153   -10.106 1.00 0.00 ? 67 GLU A H    1  
ATOM 1085  H HA   . GLU A 1 68 ? 16.324  6.225   -7.207  1.00 0.00 ? 67 GLU A HA   1  
ATOM 1086  H HB2  . GLU A 1 68 ? 15.162  8.596   -8.704  1.00 0.00 ? 67 GLU A HB2  1  
ATOM 1087  H HB3  . GLU A 1 68 ? 15.169  8.438   -6.948  1.00 0.00 ? 67 GLU A HB3  1  
ATOM 1088  H HG2  . GLU A 1 68 ? 17.701  8.118   -7.126  1.00 0.00 ? 67 GLU A HG2  1  
ATOM 1089  H HG3  . GLU A 1 68 ? 17.549  8.659   -8.798  1.00 0.00 ? 67 GLU A HG3  1  
ATOM 1090  N N    . CYS A 1 69 ? 13.962  5.477   -6.764  1.00 0.00 ? 68 CYS A N    1  
ATOM 1091  C CA   . CYS A 1 69 ? 12.583  4.922   -6.574  1.00 0.00 ? 68 CYS A CA   1  
ATOM 1092  C C    . CYS A 1 69 ? 11.803  5.836   -5.623  1.00 0.00 ? 68 CYS A C    1  
ATOM 1093  O O    . CYS A 1 69 ? 12.253  6.145   -4.538  1.00 0.00 ? 68 CYS A O    1  
ATOM 1094  C CB   . CYS A 1 69 ? 12.678  3.520   -5.968  1.00 0.00 ? 68 CYS A CB   1  
ATOM 1095  S SG   . CYS A 1 69 ? 13.512  2.415   -7.135  1.00 0.00 ? 68 CYS A SG   1  
ATOM 1096  H H    . CYS A 1 69 ? 14.622  5.388   -6.045  1.00 0.00 ? 68 CYS A H    1  
ATOM 1097  H HA   . CYS A 1 69 ? 12.071  4.870   -7.526  1.00 0.00 ? 68 CYS A HA   1  
ATOM 1098  H HB2  . CYS A 1 69 ? 13.242  3.563   -5.048  1.00 0.00 ? 68 CYS A HB2  1  
ATOM 1099  H HB3  . CYS A 1 69 ? 11.685  3.147   -5.766  1.00 0.00 ? 68 CYS A HB3  1  
ATOM 1100  H HG   . CYS A 1 69 ? 14.057  1.807   -6.630  1.00 0.00 ? 68 CYS A HG   1  
ATOM 1101  N N    . ASP A 1 70 ? 10.642  6.278   -6.025  1.00 0.00 ? 69 ASP A N    1  
ATOM 1102  C CA   . ASP A 1 70 ? 9.839   7.181   -5.147  1.00 0.00 ? 69 ASP A CA   1  
ATOM 1103  C C    . ASP A 1 70 ? 9.059   6.359   -4.117  1.00 0.00 ? 69 ASP A C    1  
ATOM 1104  O O    . ASP A 1 70 ? 9.204   5.156   -4.027  1.00 0.00 ? 69 ASP A O    1  
ATOM 1105  C CB   . ASP A 1 70 ? 8.856   7.979   -6.007  1.00 0.00 ? 69 ASP A CB   1  
ATOM 1106  C CG   . ASP A 1 70 ? 9.619   9.032   -6.812  1.00 0.00 ? 69 ASP A CG   1  
ATOM 1107  O OD1  . ASP A 1 70 ? 10.181  8.675   -7.834  1.00 0.00 ? 69 ASP A OD1  1  
ATOM 1108  O OD2  . ASP A 1 70 ? 9.629   10.178  -6.393  1.00 0.00 ? 69 ASP A OD2  1  
ATOM 1109  H H    . ASP A 1 70 ? 10.300  6.023   -6.907  1.00 0.00 ? 69 ASP A H    1  
ATOM 1110  H HA   . ASP A 1 70 ? 10.500  7.865   -4.634  1.00 0.00 ? 69 ASP A HA   1  
ATOM 1111  H HB2  . ASP A 1 70 ? 8.344   7.309   -6.683  1.00 0.00 ? 69 ASP A HB2  1  
ATOM 1112  H HB3  . ASP A 1 70 ? 8.135   8.468   -5.370  1.00 0.00 ? 69 ASP A HB3  1  
ATOM 1113  N N    . PHE A 1 71 ? 8.220   7.003   -3.348  1.00 0.00 ? 70 PHE A N    1  
ATOM 1114  C CA   . PHE A 1 71 ? 7.415   6.263   -2.333  1.00 0.00 ? 70 PHE A CA   1  
ATOM 1115  C C    . PHE A 1 71 ? 6.320   5.478   -3.058  1.00 0.00 ? 70 PHE A C    1  
ATOM 1116  O O    . PHE A 1 71 ? 5.940   4.402   -2.641  1.00 0.00 ? 70 PHE A O    1  
ATOM 1117  C CB   . PHE A 1 71 ? 6.793   7.263   -1.350  1.00 0.00 ? 70 PHE A CB   1  
ATOM 1118  C CG   . PHE A 1 71 ? 6.045   6.534   -0.255  1.00 0.00 ? 70 PHE A CG   1  
ATOM 1119  C CD1  . PHE A 1 71 ? 4.782   5.985   -0.511  1.00 0.00 ? 70 PHE A CD1  1  
ATOM 1120  C CD2  . PHE A 1 71 ? 6.612   6.417   1.020   1.00 0.00 ? 70 PHE A CD2  1  
ATOM 1121  C CE1  . PHE A 1 71 ? 4.088   5.320   0.508   1.00 0.00 ? 70 PHE A CE1  1  
ATOM 1122  C CE2  . PHE A 1 71 ? 5.918   5.752   2.037   1.00 0.00 ? 70 PHE A CE2  1  
ATOM 1123  C CZ   . PHE A 1 71 ? 4.657   5.203   1.781   1.00 0.00 ? 70 PHE A CZ   1  
ATOM 1124  H H    . PHE A 1 71 ? 8.106   7.971   -3.451  1.00 0.00 ? 70 PHE A H    1  
ATOM 1125  H HA   . PHE A 1 71 ? 8.050   5.563   -1.812  1.00 0.00 ? 70 PHE A HA   1  
ATOM 1126  H HB2  . PHE A 1 71 ? 7.575   7.865   -0.911  1.00 0.00 ? 70 PHE A HB2  1  
ATOM 1127  H HB3  . PHE A 1 71 ? 6.107   7.906   -1.883  1.00 0.00 ? 70 PHE A HB3  1  
ATOM 1128  H HD1  . PHE A 1 71 ? 4.340   6.076   -1.492  1.00 0.00 ? 70 PHE A HD1  1  
ATOM 1129  H HD2  . PHE A 1 71 ? 7.584   6.841   1.219   1.00 0.00 ? 70 PHE A HD2  1  
ATOM 1130  H HE1  . PHE A 1 71 ? 3.115   4.897   0.311   1.00 0.00 ? 70 PHE A HE1  1  
ATOM 1131  H HE2  . PHE A 1 71 ? 6.356   5.663   3.021   1.00 0.00 ? 70 PHE A HE2  1  
ATOM 1132  H HZ   . PHE A 1 71 ? 4.122   4.689   2.566   1.00 0.00 ? 70 PHE A HZ   1  
ATOM 1133  N N    . GLN A 1 72 ? 5.820   5.992   -4.145  1.00 0.00 ? 71 GLN A N    1  
ATOM 1134  C CA   . GLN A 1 72 ? 4.766   5.252   -4.892  1.00 0.00 ? 71 GLN A CA   1  
ATOM 1135  C C    . GLN A 1 72 ? 5.326   3.895   -5.327  1.00 0.00 ? 71 GLN A C    1  
ATOM 1136  O O    . GLN A 1 72 ? 4.630   2.899   -5.329  1.00 0.00 ? 71 GLN A O    1  
ATOM 1137  C CB   . GLN A 1 72 ? 4.358   6.055   -6.129  1.00 0.00 ? 71 GLN A CB   1  
ATOM 1138  C CG   . GLN A 1 72 ? 3.760   7.394   -5.693  1.00 0.00 ? 71 GLN A CG   1  
ATOM 1139  C CD   . GLN A 1 72 ? 3.636   8.318   -6.906  1.00 0.00 ? 71 GLN A CD   1  
ATOM 1140  O OE1  . GLN A 1 72 ? 4.608   8.906   -7.338  1.00 0.00 ? 71 GLN A OE1  1  
ATOM 1141  N NE2  . GLN A 1 72 ? 2.473   8.472   -7.478  1.00 0.00 ? 71 GLN A NE2  1  
ATOM 1142  H H    . GLN A 1 72 ? 6.145   6.855   -4.476  1.00 0.00 ? 71 GLN A H    1  
ATOM 1143  H HA   . GLN A 1 72 ? 3.903   5.097   -4.261  1.00 0.00 ? 71 GLN A HA   1  
ATOM 1144  H HB2  . GLN A 1 72 ? 5.227   6.232   -6.746  1.00 0.00 ? 71 GLN A HB2  1  
ATOM 1145  H HB3  . GLN A 1 72 ? 3.622   5.501   -6.692  1.00 0.00 ? 71 GLN A HB3  1  
ATOM 1146  H HG2  . GLN A 1 72 ? 2.782   7.229   -5.264  1.00 0.00 ? 71 GLN A HG2  1  
ATOM 1147  H HG3  . GLN A 1 72 ? 4.403   7.854   -4.957  1.00 0.00 ? 71 GLN A HG3  1  
ATOM 1148  H HE21 . GLN A 1 72 ? 1.689   7.998   -7.129  1.00 0.00 ? 71 GLN A HE21 1  
ATOM 1149  H HE22 . GLN A 1 72 ? 2.384   9.062   -8.255  1.00 0.00 ? 71 GLN A HE22 1  
ATOM 1150  N N    . GLU A 1 73 ? 6.579   3.844   -5.687  1.00 0.00 ? 72 GLU A N    1  
ATOM 1151  C CA   . GLU A 1 73 ? 7.181   2.548   -6.112  1.00 0.00 ? 72 GLU A CA   1  
ATOM 1152  C C    . GLU A 1 73 ? 7.376   1.641   -4.891  1.00 0.00 ? 72 GLU A C    1  
ATOM 1153  O O    . GLU A 1 73 ? 7.350   0.433   -4.993  1.00 0.00 ? 72 GLU A O    1  
ATOM 1154  C CB   . GLU A 1 73 ? 8.529   2.798   -6.792  1.00 0.00 ? 72 GLU A CB   1  
ATOM 1155  C CG   . GLU A 1 73 ? 8.304   3.498   -8.134  1.00 0.00 ? 72 GLU A CG   1  
ATOM 1156  C CD   . GLU A 1 73 ? 9.655   3.837   -8.766  1.00 0.00 ? 72 GLU A CD   1  
ATOM 1157  O OE1  . GLU A 1 73 ? 10.382  2.914   -9.094  1.00 0.00 ? 72 GLU A OE1  1  
ATOM 1158  O OE2  . GLU A 1 73 ? 9.940   5.015   -8.912  1.00 0.00 ? 72 GLU A OE2  1  
ATOM 1159  H H    . GLU A 1 73 ? 7.126   4.657   -5.673  1.00 0.00 ? 72 GLU A H    1  
ATOM 1160  H HA   . GLU A 1 73 ? 6.513   2.049   -6.797  1.00 0.00 ? 72 GLU A HA   1  
ATOM 1161  H HB2  . GLU A 1 73 ? 9.141   3.423   -6.158  1.00 0.00 ? 72 GLU A HB2  1  
ATOM 1162  H HB3  . GLU A 1 73 ? 9.028   1.856   -6.960  1.00 0.00 ? 72 GLU A HB3  1  
ATOM 1163  H HG2  . GLU A 1 73 ? 7.750   2.844   -8.792  1.00 0.00 ? 72 GLU A HG2  1  
ATOM 1164  H HG3  . GLU A 1 73 ? 7.744   4.408   -7.976  1.00 0.00 ? 72 GLU A HG3  1  
ATOM 1165  N N    . PHE A 1 74 ? 7.524   2.220   -3.731  1.00 0.00 ? 73 PHE A N    1  
ATOM 1166  C CA   . PHE A 1 74 ? 7.679   1.404   -2.488  1.00 0.00 ? 73 PHE A CA   1  
ATOM 1167  C C    . PHE A 1 74 ? 6.318   0.834   -2.088  1.00 0.00 ? 73 PHE A C    1  
ATOM 1168  O O    . PHE A 1 74 ? 6.223   -0.303  -1.674  1.00 0.00 ? 73 PHE A O    1  
ATOM 1169  C CB   . PHE A 1 74 ? 8.256   2.268   -1.363  1.00 0.00 ? 73 PHE A CB   1  
ATOM 1170  C CG   . PHE A 1 74 ? 8.267   1.494   -0.063  1.00 0.00 ? 73 PHE A CG   1  
ATOM 1171  C CD1  . PHE A 1 74 ? 9.220   0.489   0.146   1.00 0.00 ? 73 PHE A CD1  1  
ATOM 1172  C CD2  . PHE A 1 74 ? 7.332   1.789   0.938   1.00 0.00 ? 73 PHE A CD2  1  
ATOM 1173  C CE1  . PHE A 1 74 ? 9.236   -0.222  1.353   1.00 0.00 ? 73 PHE A CE1  1  
ATOM 1174  C CE2  . PHE A 1 74 ? 7.350   1.080   2.145   1.00 0.00 ? 73 PHE A CE2  1  
ATOM 1175  C CZ   . PHE A 1 74 ? 8.302   0.075   2.353   1.00 0.00 ? 73 PHE A CZ   1  
ATOM 1176  H H    . PHE A 1 74 ? 7.484   3.196   -3.667  1.00 0.00 ? 73 PHE A H    1  
ATOM 1177  H HA   . PHE A 1 74 ? 8.299   0.536   -2.652  1.00 0.00 ? 73 PHE A HA   1  
ATOM 1178  H HB2  . PHE A 1 74 ? 9.267   2.555   -1.616  1.00 0.00 ? 73 PHE A HB2  1  
ATOM 1179  H HB3  . PHE A 1 74 ? 7.652   3.156   -1.248  1.00 0.00 ? 73 PHE A HB3  1  
ATOM 1180  H HD1  . PHE A 1 74 ? 9.940   0.259   -0.623  1.00 0.00 ? 73 PHE A HD1  1  
ATOM 1181  H HD2  . PHE A 1 74 ? 6.597   2.564   0.778   1.00 0.00 ? 73 PHE A HD2  1  
ATOM 1182  H HE1  . PHE A 1 74 ? 9.971   -0.997  1.513   1.00 0.00 ? 73 PHE A HE1  1  
ATOM 1183  H HE2  . PHE A 1 74 ? 6.629   1.308   2.916   1.00 0.00 ? 73 PHE A HE2  1  
ATOM 1184  H HZ   . PHE A 1 74 ? 8.316   -0.472  3.284   1.00 0.00 ? 73 PHE A HZ   1  
ATOM 1185  N N    . MET A 1 75 ? 5.262   1.578   -2.214  1.00 0.00 ? 74 MET A N    1  
ATOM 1186  C CA   . MET A 1 75 ? 3.941   1.004   -1.837  1.00 0.00 ? 74 MET A CA   1  
ATOM 1187  C C    . MET A 1 75 ? 3.585   -0.104  -2.836  1.00 0.00 ? 74 MET A C    1  
ATOM 1188  O O    . MET A 1 75 ? 2.903   -1.048  -2.488  1.00 0.00 ? 74 MET A O    1  
ATOM 1189  C CB   . MET A 1 75 ? 2.865   2.098   -1.839  1.00 0.00 ? 74 MET A CB   1  
ATOM 1190  C CG   . MET A 1 75 ? 1.711   1.696   -0.913  1.00 0.00 ? 74 MET A CG   1  
ATOM 1191  S SD   . MET A 1 75 ? 2.218   1.934   0.815   1.00 0.00 ? 74 MET A SD   1  
ATOM 1192  C CE   . MET A 1 75 ? 2.093   0.214   1.377   1.00 0.00 ? 74 MET A CE   1  
ATOM 1193  H H    . MET A 1 75 ? 5.330   2.492   -2.564  1.00 0.00 ? 74 MET A H    1  
ATOM 1194  H HA   . MET A 1 75 ? 4.015   0.552   -0.859  1.00 0.00 ? 74 MET A HA   1  
ATOM 1195  H HB2  . MET A 1 75 ? 3.297   3.025   -1.491  1.00 0.00 ? 74 MET A HB2  1  
ATOM 1196  H HB3  . MET A 1 75 ? 2.488   2.235   -2.843  1.00 0.00 ? 74 MET A HB3  1  
ATOM 1197  H HG2  . MET A 1 75 ? 0.851   2.316   -1.124  1.00 0.00 ? 74 MET A HG2  1  
ATOM 1198  H HG3  . MET A 1 75 ? 1.457   0.661   -1.082  1.00 0.00 ? 74 MET A HG3  1  
ATOM 1199  H HE1  . MET A 1 75 ? 2.553   -0.441  0.656   1.00 0.00 ? 74 MET A HE1  1  
ATOM 1200  H HE2  . MET A 1 75 ? 2.599   0.110   2.326   1.00 0.00 ? 74 MET A HE2  1  
ATOM 1201  H HE3  . MET A 1 75 ? 1.053   -0.053  1.488   1.00 0.00 ? 74 MET A HE3  1  
ATOM 1202  N N    . ALA A 1 76 ? 4.042   -0.038  -4.055  1.00 0.00 ? 75 ALA A N    1  
ATOM 1203  C CA   . ALA A 1 76 ? 3.726   -1.127  -5.026  1.00 0.00 ? 75 ALA A CA   1  
ATOM 1204  C C    . ALA A 1 76 ? 4.599   -2.359  -4.745  1.00 0.00 ? 75 ALA A C    1  
ATOM 1205  O O    . ALA A 1 76 ? 4.091   -3.447  -4.564  1.00 0.00 ? 75 ALA A O    1  
ATOM 1206  C CB   . ALA A 1 76 ? 3.998   -0.630  -6.447  1.00 0.00 ? 75 ALA A CB   1  
ATOM 1207  H H    . ALA A 1 76 ? 4.609   0.701   -4.364  1.00 0.00 ? 75 ALA A H    1  
ATOM 1208  H HA   . ALA A 1 76 ? 2.696   -1.444  -4.952  1.00 0.00 ? 75 ALA A HA   1  
ATOM 1209  H HB1  . ALA A 1 76 ? 5.015   -0.273  -6.515  1.00 0.00 ? 75 ALA A HB1  1  
ATOM 1210  H HB2  . ALA A 1 76 ? 3.853   -1.440  -7.146  1.00 0.00 ? 75 ALA A HB2  1  
ATOM 1211  H HB3  . ALA A 1 76 ? 3.317   0.175   -6.684  1.00 0.00 ? 75 ALA A HB3  1  
ATOM 1212  N N    . PHE A 1 77 ? 5.898   -2.217  -4.711  1.00 0.00 ? 76 PHE A N    1  
ATOM 1213  C CA   . PHE A 1 77 ? 6.753   -3.415  -4.446  1.00 0.00 ? 76 PHE A CA   1  
ATOM 1214  C C    . PHE A 1 77 ? 6.343   -4.047  -3.114  1.00 0.00 ? 76 PHE A C    1  
ATOM 1215  O O    . PHE A 1 77 ? 6.404   -5.247  -2.939  1.00 0.00 ? 76 PHE A O    1  
ATOM 1216  C CB   . PHE A 1 77 ? 8.238   -3.018  -4.387  1.00 0.00 ? 76 PHE A CB   1  
ATOM 1217  C CG   . PHE A 1 77 ? 8.769   -2.743  -5.783  1.00 0.00 ? 76 PHE A CG   1  
ATOM 1218  C CD1  . PHE A 1 77 ? 8.741   -3.748  -6.763  1.00 0.00 ? 76 PHE A CD1  1  
ATOM 1219  C CD2  . PHE A 1 77 ? 9.287   -1.478  -6.100  1.00 0.00 ? 76 PHE A CD2  1  
ATOM 1220  C CE1  . PHE A 1 77 ? 9.226   -3.485  -8.049  1.00 0.00 ? 76 PHE A CE1  1  
ATOM 1221  C CE2  . PHE A 1 77 ? 9.774   -1.220  -7.386  1.00 0.00 ? 76 PHE A CE2  1  
ATOM 1222  C CZ   . PHE A 1 77 ? 9.741   -2.222  -8.361  1.00 0.00 ? 76 PHE A CZ   1  
ATOM 1223  H H    . PHE A 1 77 ? 6.307   -1.340  -4.863  1.00 0.00 ? 76 PHE A H    1  
ATOM 1224  H HA   . PHE A 1 77 ? 6.600   -4.136  -5.231  1.00 0.00 ? 76 PHE A HA   1  
ATOM 1225  H HB2  . PHE A 1 77 ? 8.345   -2.133  -3.777  1.00 0.00 ? 76 PHE A HB2  1  
ATOM 1226  H HB3  . PHE A 1 77 ? 8.804   -3.824  -3.944  1.00 0.00 ? 76 PHE A HB3  1  
ATOM 1227  H HD1  . PHE A 1 77 ? 8.353   -4.726  -6.530  1.00 0.00 ? 76 PHE A HD1  1  
ATOM 1228  H HD2  . PHE A 1 77 ? 9.320   -0.705  -5.349  1.00 0.00 ? 76 PHE A HD2  1  
ATOM 1229  H HE1  . PHE A 1 77 ? 9.203   -4.258  -8.799  1.00 0.00 ? 76 PHE A HE1  1  
ATOM 1230  H HE2  . PHE A 1 77 ? 10.171  -0.245  -7.627  1.00 0.00 ? 76 PHE A HE2  1  
ATOM 1231  H HZ   . PHE A 1 77 ? 10.115  -2.022  -9.354  1.00 0.00 ? 76 PHE A HZ   1  
ATOM 1232  N N    . VAL A 1 78 ? 5.920   -3.249  -2.177  1.00 0.00 ? 77 VAL A N    1  
ATOM 1233  C CA   . VAL A 1 78 ? 5.500   -3.810  -0.862  1.00 0.00 ? 77 VAL A CA   1  
ATOM 1234  C C    . VAL A 1 78 ? 4.209   -4.615  -1.049  1.00 0.00 ? 77 VAL A C    1  
ATOM 1235  O O    . VAL A 1 78 ? 3.992   -5.617  -0.396  1.00 0.00 ? 77 VAL A O    1  
ATOM 1236  C CB   . VAL A 1 78 ? 5.260   -2.661  0.127   1.00 0.00 ? 77 VAL A CB   1  
ATOM 1237  C CG1  . VAL A 1 78 ? 4.559   -3.189  1.385   1.00 0.00 ? 77 VAL A CG1  1  
ATOM 1238  C CG2  . VAL A 1 78 ? 6.604   -2.035  0.520   1.00 0.00 ? 77 VAL A CG2  1  
ATOM 1239  H H    . VAL A 1 78 ? 5.871   -2.283  -2.342  1.00 0.00 ? 77 VAL A H    1  
ATOM 1240  H HA   . VAL A 1 78 ? 6.278   -4.458  -0.482  1.00 0.00 ? 77 VAL A HA   1  
ATOM 1241  H HB   . VAL A 1 78 ? 4.638   -1.912  -0.341  1.00 0.00 ? 77 VAL A HB   1  
ATOM 1242  H HG11 . VAL A 1 78 ? 5.039   -4.101  1.708   1.00 0.00 ? 77 VAL A HG11 1  
ATOM 1243  H HG12 . VAL A 1 78 ? 4.623   -2.451  2.170   1.00 0.00 ? 77 VAL A HG12 1  
ATOM 1244  H HG13 . VAL A 1 78 ? 3.522   -3.388  1.161   1.00 0.00 ? 77 VAL A HG13 1  
ATOM 1245  H HG21 . VAL A 1 78 ? 7.236   -1.951  -0.352  1.00 0.00 ? 77 VAL A HG21 1  
ATOM 1246  H HG22 . VAL A 1 78 ? 6.433   -1.053  0.935   1.00 0.00 ? 77 VAL A HG22 1  
ATOM 1247  H HG23 . VAL A 1 78 ? 7.093   -2.656  1.257   1.00 0.00 ? 77 VAL A HG23 1  
ATOM 1248  N N    . SER A 1 79 ? 3.350   -4.185  -1.932  1.00 0.00 ? 78 SER A N    1  
ATOM 1249  C CA   . SER A 1 79 ? 2.074   -4.925  -2.156  1.00 0.00 ? 78 SER A CA   1  
ATOM 1250  C C    . SER A 1 79 ? 2.362   -6.260  -2.850  1.00 0.00 ? 78 SER A C    1  
ATOM 1251  O O    . SER A 1 79 ? 1.937   -7.305  -2.398  1.00 0.00 ? 78 SER A O    1  
ATOM 1252  C CB   . SER A 1 79 ? 1.147   -4.084  -3.036  1.00 0.00 ? 78 SER A CB   1  
ATOM 1253  O OG   . SER A 1 79 ? 1.450   -4.326  -4.403  1.00 0.00 ? 78 SER A OG   1  
ATOM 1254  H H    . SER A 1 79 ? 3.542   -3.373  -2.447  1.00 0.00 ? 78 SER A H    1  
ATOM 1255  H HA   . SER A 1 79 ? 1.597   -5.111  -1.205  1.00 0.00 ? 78 SER A HA   1  
ATOM 1256  H HB2  . SER A 1 79 ? 0.121   -4.355  -2.847  1.00 0.00 ? 78 SER A HB2  1  
ATOM 1257  H HB3  . SER A 1 79 ? 1.287   -3.035  -2.805  1.00 0.00 ? 78 SER A HB3  1  
ATOM 1258  H HG   . SER A 1 79 ? 1.962   -3.582  -4.729  1.00 0.00 ? 78 SER A HG   1  
ATOM 1259  N N    . MET A 1 80 ? 3.063   -6.239  -3.950  1.00 0.00 ? 79 MET A N    1  
ATOM 1260  C CA   . MET A 1 80 ? 3.351   -7.511  -4.671  1.00 0.00 ? 79 MET A CA   1  
ATOM 1261  C C    . MET A 1 80 ? 3.938   -8.533  -3.702  1.00 0.00 ? 79 MET A C    1  
ATOM 1262  O O    . MET A 1 80 ? 3.487   -9.657  -3.622  1.00 0.00 ? 79 MET A O    1  
ATOM 1263  C CB   . MET A 1 80 ? 4.355   -7.241  -5.793  1.00 0.00 ? 79 MET A CB   1  
ATOM 1264  C CG   . MET A 1 80 ? 3.729   -6.301  -6.824  1.00 0.00 ? 79 MET A CG   1  
ATOM 1265  S SD   . MET A 1 80 ? 4.784   -6.236  -8.298  1.00 0.00 ? 79 MET A SD   1  
ATOM 1266  C CE   . MET A 1 80 ? 4.850   -4.435  -8.484  1.00 0.00 ? 79 MET A CE   1  
ATOM 1267  H H    . MET A 1 80 ? 3.386   -5.391  -4.321  1.00 0.00 ? 79 MET A H    1  
ATOM 1268  H HA   . MET A 1 80 ? 2.439   -7.900  -5.094  1.00 0.00 ? 79 MET A HA   1  
ATOM 1269  H HB2  . MET A 1 80 ? 5.242   -6.784  -5.379  1.00 0.00 ? 79 MET A HB2  1  
ATOM 1270  H HB3  . MET A 1 80 ? 4.619   -8.172  -6.271  1.00 0.00 ? 79 MET A HB3  1  
ATOM 1271  H HG2  . MET A 1 80 ? 2.750   -6.669  -7.097  1.00 0.00 ? 79 MET A HG2  1  
ATOM 1272  H HG3  . MET A 1 80 ? 3.635   -5.314  -6.397  1.00 0.00 ? 79 MET A HG3  1  
ATOM 1273  H HE1  . MET A 1 80 ? 3.847   -4.033  -8.447  1.00 0.00 ? 79 MET A HE1  1  
ATOM 1274  H HE2  . MET A 1 80 ? 5.443   -4.013  -7.684  1.00 0.00 ? 79 MET A HE2  1  
ATOM 1275  H HE3  . MET A 1 80 ? 5.300   -4.186  -9.432  1.00 0.00 ? 79 MET A HE3  1  
ATOM 1276  N N    . VAL A 1 81 ? 4.945   -8.156  -2.972  1.00 0.00 ? 80 VAL A N    1  
ATOM 1277  C CA   . VAL A 1 81 ? 5.566   -9.116  -2.015  1.00 0.00 ? 80 VAL A CA   1  
ATOM 1278  C C    . VAL A 1 81 ? 4.517   -9.581  -1.002  1.00 0.00 ? 80 VAL A C    1  
ATOM 1279  O O    . VAL A 1 81 ? 4.434   -10.747 -0.673  1.00 0.00 ? 80 VAL A O    1  
ATOM 1280  C CB   . VAL A 1 81 ? 6.719   -8.430  -1.278  1.00 0.00 ? 80 VAL A CB   1  
ATOM 1281  C CG1  . VAL A 1 81 ? 7.272   -9.369  -0.204  1.00 0.00 ? 80 VAL A CG1  1  
ATOM 1282  C CG2  . VAL A 1 81 ? 7.830   -8.089  -2.273  1.00 0.00 ? 80 VAL A CG2  1  
ATOM 1283  H H    . VAL A 1 81 ? 5.295   -7.243  -3.062  1.00 0.00 ? 80 VAL A H    1  
ATOM 1284  H HA   . VAL A 1 81 ? 5.946   -9.965  -2.568  1.00 0.00 ? 80 VAL A HA   1  
ATOM 1285  H HB   . VAL A 1 81 ? 6.360   -7.524  -0.812  1.00 0.00 ? 80 VAL A HB   1  
ATOM 1286  H HG11 . VAL A 1 81 ? 7.410   -10.355 -0.624  1.00 0.00 ? 80 VAL A HG11 1  
ATOM 1287  H HG12 . VAL A 1 81 ? 8.220   -8.992  0.150   1.00 0.00 ? 80 VAL A HG12 1  
ATOM 1288  H HG13 . VAL A 1 81 ? 6.576   -9.423  0.620   1.00 0.00 ? 80 VAL A HG13 1  
ATOM 1289  H HG21 . VAL A 1 81 ? 7.407   -7.577  -3.124  1.00 0.00 ? 80 VAL A HG21 1  
ATOM 1290  H HG22 . VAL A 1 81 ? 8.559   -7.451  -1.794  1.00 0.00 ? 80 VAL A HG22 1  
ATOM 1291  H HG23 . VAL A 1 81 ? 8.310   -8.999  -2.603  1.00 0.00 ? 80 VAL A HG23 1  
ATOM 1292  N N    . THR A 1 82 ? 3.708   -8.683  -0.512  1.00 0.00 ? 81 THR A N    1  
ATOM 1293  C CA   . THR A 1 82 ? 2.661   -9.088  0.466   1.00 0.00 ? 81 THR A CA   1  
ATOM 1294  C C    . THR A 1 82 ? 1.604   -9.925  -0.258  1.00 0.00 ? 81 THR A C    1  
ATOM 1295  O O    . THR A 1 82 ? 1.215   -10.984 0.195   1.00 0.00 ? 81 THR A O    1  
ATOM 1296  C CB   . THR A 1 82 ? 2.006   -7.839  1.061   1.00 0.00 ? 81 THR A CB   1  
ATOM 1297  O OG1  . THR A 1 82 ? 3.015   -6.944  1.507   1.00 0.00 ? 81 THR A OG1  1  
ATOM 1298  C CG2  . THR A 1 82 ? 1.117   -8.237  2.240   1.00 0.00 ? 81 THR A CG2  1  
ATOM 1299  H H    . THR A 1 82 ? 3.783   -7.748  -0.794  1.00 0.00 ? 81 THR A H    1  
ATOM 1300  H HA   . THR A 1 82 ? 3.109   -9.673  1.255   1.00 0.00 ? 81 THR A HA   1  
ATOM 1301  H HB   . THR A 1 82 ? 1.402   -7.355  0.308   1.00 0.00 ? 81 THR A HB   1  
ATOM 1302  H HG1  . THR A 1 82 ? 3.115   -7.059  2.455   1.00 0.00 ? 81 THR A HG1  1  
ATOM 1303  H HG21 . THR A 1 82 ? 0.425   -9.005  1.926   1.00 0.00 ? 81 THR A HG21 1  
ATOM 1304  H HG22 . THR A 1 82 ? 1.733   -8.615  3.043   1.00 0.00 ? 81 THR A HG22 1  
ATOM 1305  H HG23 . THR A 1 82 ? 0.566   -7.374  2.584   1.00 0.00 ? 81 THR A HG23 1  
ATOM 1306  N N    . THR A 1 83 ? 1.143   -9.455  -1.384  1.00 0.00 ? 82 THR A N    1  
ATOM 1307  C CA   . THR A 1 83 ? 0.116   -10.210 -2.156  1.00 0.00 ? 82 THR A CA   1  
ATOM 1308  C C    . THR A 1 83 ? 0.757   -11.437 -2.812  1.00 0.00 ? 82 THR A C    1  
ATOM 1309  O O    . THR A 1 83 ? 0.075   -12.352 -3.230  1.00 0.00 ? 82 THR A O    1  
ATOM 1310  C CB   . THR A 1 83 ? -0.484  -9.307  -3.236  1.00 0.00 ? 82 THR A CB   1  
ATOM 1311  O OG1  . THR A 1 83 ? 0.547   -8.859  -4.102  1.00 0.00 ? 82 THR A OG1  1  
ATOM 1312  C CG2  . THR A 1 83 ? -1.163  -8.104  -2.580  1.00 0.00 ? 82 THR A CG2  1  
ATOM 1313  H H    . THR A 1 83 ? 1.478   -8.600  -1.727  1.00 0.00 ? 82 THR A H    1  
ATOM 1314  H HA   . THR A 1 83 ? -0.667  -10.533 -1.486  1.00 0.00 ? 82 THR A HA   1  
ATOM 1315  H HB   . THR A 1 83 ? -1.216  -9.862  -3.803  1.00 0.00 ? 82 THR A HB   1  
ATOM 1316  H HG1  . THR A 1 83 ? 0.244   -8.056  -4.533  1.00 0.00 ? 82 THR A HG1  1  
ATOM 1317  H HG21 . THR A 1 83 ? -1.772  -8.441  -1.754  1.00 0.00 ? 82 THR A HG21 1  
ATOM 1318  H HG22 . THR A 1 83 ? -0.411  -7.419  -2.217  1.00 0.00 ? 82 THR A HG22 1  
ATOM 1319  H HG23 . THR A 1 83 ? -1.787  -7.603  -3.306  1.00 0.00 ? 82 THR A HG23 1  
ATOM 1320  N N    . ALA A 1 84 ? 2.060   -11.467 -2.911  1.00 0.00 ? 83 ALA A N    1  
ATOM 1321  C CA   . ALA A 1 84 ? 2.727   -12.641 -3.546  1.00 0.00 ? 83 ALA A CA   1  
ATOM 1322  C C    . ALA A 1 84 ? 2.207   -13.917 -2.889  1.00 0.00 ? 83 ALA A C    1  
ATOM 1323  O O    . ALA A 1 84 ? 1.942   -14.904 -3.547  1.00 0.00 ? 83 ALA A O    1  
ATOM 1324  C CB   . ALA A 1 84 ? 4.241   -12.549 -3.349  1.00 0.00 ? 83 ALA A CB   1  
ATOM 1325  H H    . ALA A 1 84 ? 2.597   -10.724 -2.564  1.00 0.00 ? 83 ALA A H    1  
ATOM 1326  H HA   . ALA A 1 84 ? 2.498   -12.659 -4.601  1.00 0.00 ? 83 ALA A HA   1  
ATOM 1327  H HB1  . ALA A 1 84 ? 4.462   -12.442 -2.297  1.00 0.00 ? 83 ALA A HB1  1  
ATOM 1328  H HB2  . ALA A 1 84 ? 4.708   -13.448 -3.724  1.00 0.00 ? 83 ALA A HB2  1  
ATOM 1329  H HB3  . ALA A 1 84 ? 4.624   -11.694 -3.886  1.00 0.00 ? 83 ALA A HB3  1  
ATOM 1330  N N    . CYS A 1 85 ? 2.042   -13.901 -1.596  1.00 0.00 ? 84 CYS A N    1  
ATOM 1331  C CA   . CYS A 1 85 ? 1.520   -15.110 -0.902  1.00 0.00 ? 84 CYS A CA   1  
ATOM 1332  C C    . CYS A 1 85 ? 0.027   -15.240 -1.210  1.00 0.00 ? 84 CYS A C    1  
ATOM 1333  O O    . CYS A 1 85 ? -0.814  -14.782 -0.462  1.00 0.00 ? 84 CYS A O    1  
ATOM 1334  C CB   . CYS A 1 85 ? 1.722   -14.964 0.608   1.00 0.00 ? 84 CYS A CB   1  
ATOM 1335  S SG   . CYS A 1 85 ? 1.285   -16.518 1.428   1.00 0.00 ? 84 CYS A SG   1  
ATOM 1336  H H    . CYS A 1 85 ? 2.252   -13.089 -1.085  1.00 0.00 ? 84 CYS A H    1  
ATOM 1337  H HA   . CYS A 1 85 ? 2.042   -15.987 -1.257  1.00 0.00 ? 84 CYS A HA   1  
ATOM 1338  H HB2  . CYS A 1 85 ? 2.757   -14.729 0.811   1.00 0.00 ? 84 CYS A HB2  1  
ATOM 1339  H HB3  . CYS A 1 85 ? 1.092   -14.171 0.981   1.00 0.00 ? 84 CYS A HB3  1  
ATOM 1340  H HG   . CYS A 1 85 ? 2.086   -17.039 1.522   1.00 0.00 ? 84 CYS A HG   1  
ATOM 1341  N N    . HIS A 1 86 ? -0.303  -15.848 -2.319  1.00 0.00 ? 85 HIS A N    1  
ATOM 1342  C CA   . HIS A 1 86 ? -1.738  -16.000 -2.702  1.00 0.00 ? 85 HIS A CA   1  
ATOM 1343  C C    . HIS A 1 86 ? -2.572  -16.422 -1.489  1.00 0.00 ? 85 HIS A C    1  
ATOM 1344  O O    . HIS A 1 86 ? -2.193  -17.292 -0.730  1.00 0.00 ? 85 HIS A O    1  
ATOM 1345  C CB   . HIS A 1 86 ? -1.861  -17.057 -3.805  1.00 0.00 ? 85 HIS A CB   1  
ATOM 1346  C CG   . HIS A 1 86 ? -1.532  -18.416 -3.250  1.00 0.00 ? 85 HIS A CG   1  
ATOM 1347  N ND1  . HIS A 1 86 ? -2.249  -19.550 -3.600  1.00 0.00 ? 85 HIS A ND1  1  
ATOM 1348  C CD2  . HIS A 1 86 ? -0.569  -18.839 -2.368  1.00 0.00 ? 85 HIS A CD2  1  
ATOM 1349  C CE1  . HIS A 1 86 ? -1.711  -20.590 -2.937  1.00 0.00 ? 85 HIS A CE1  1  
ATOM 1350  N NE2  . HIS A 1 86 ? -0.684  -20.212 -2.171  1.00 0.00 ? 85 HIS A NE2  1  
ATOM 1351  H H    . HIS A 1 86 ? 0.397   -16.196 -2.909  1.00 0.00 ? 85 HIS A H    1  
ATOM 1352  H HA   . HIS A 1 86 ? -2.107  -15.056 -3.074  1.00 0.00 ? 85 HIS A HA   1  
ATOM 1353  H HB2  . HIS A 1 86 ? -2.871  -17.060 -4.187  1.00 0.00 ? 85 HIS A HB2  1  
ATOM 1354  H HB3  . HIS A 1 86 ? -1.176  -16.821 -4.606  1.00 0.00 ? 85 HIS A HB3  1  
ATOM 1355  H HD1  . HIS A 1 86 ? -3.008  -19.587 -4.218  1.00 0.00 ? 85 HIS A HD1  1  
ATOM 1356  H HD2  . HIS A 1 86 ? 0.166   -18.203 -1.898  1.00 0.00 ? 85 HIS A HD2  1  
ATOM 1357  H HE1  . HIS A 1 86 ? -2.067  -21.607 -3.015  1.00 0.00 ? 85 HIS A HE1  1  
ATOM 1358  N N    . GLU A 1 87 ? -3.712  -15.812 -1.309  1.00 0.00 ? 86 GLU A N    1  
ATOM 1359  C CA   . GLU A 1 87 ? -4.585  -16.172 -0.157  1.00 0.00 ? 86 GLU A CA   1  
ATOM 1360  C C    . GLU A 1 87 ? -3.817  -15.997 1.155   1.00 0.00 ? 86 GLU A C    1  
ATOM 1361  O O    . GLU A 1 87 ? -3.643  -16.933 1.910   1.00 0.00 ? 86 GLU A O    1  
ATOM 1362  C CB   . GLU A 1 87 ? -5.035  -17.629 -0.294  1.00 0.00 ? 86 GLU A CB   1  
ATOM 1363  C CG   . GLU A 1 87 ? -6.209  -17.893 0.653   1.00 0.00 ? 86 GLU A CG   1  
ATOM 1364  C CD   . GLU A 1 87 ? -6.477  -19.397 0.727   1.00 0.00 ? 86 GLU A CD   1  
ATOM 1365  O OE1  . GLU A 1 87 ? -5.793  -20.135 0.038   1.00 0.00 ? 86 GLU A OE1  1  
ATOM 1366  O OE2  . GLU A 1 87 ? -7.362  -19.785 1.472   1.00 0.00 ? 86 GLU A OE2  1  
ATOM 1367  H H    . GLU A 1 87 ? -3.998  -15.118 -1.939  1.00 0.00 ? 86 GLU A H    1  
ATOM 1368  H HA   . GLU A 1 87 ? -5.453  -15.529 -0.152  1.00 0.00 ? 86 GLU A HA   1  
ATOM 1369  H HB2  . GLU A 1 87 ? -5.344  -17.816 -1.312  1.00 0.00 ? 86 GLU A HB2  1  
ATOM 1370  H HB3  . GLU A 1 87 ? -4.217  -18.285 -0.040  1.00 0.00 ? 86 GLU A HB3  1  
ATOM 1371  H HG2  . GLU A 1 87 ? -5.967  -17.520 1.638   1.00 0.00 ? 86 GLU A HG2  1  
ATOM 1372  H HG3  . GLU A 1 87 ? -7.090  -17.390 0.283   1.00 0.00 ? 86 GLU A HG3  1  
ATOM 1373  N N    . PHE A 1 88 ? -3.365  -14.806 1.440   1.00 0.00 ? 87 PHE A N    1  
ATOM 1374  C CA   . PHE A 1 88 ? -2.623  -14.584 2.712   1.00 0.00 ? 87 PHE A CA   1  
ATOM 1375  C C    . PHE A 1 88 ? -3.599  -14.720 3.884   1.00 0.00 ? 87 PHE A C    1  
ATOM 1376  O O    . PHE A 1 88 ? -3.219  -15.058 4.987   1.00 0.00 ? 87 PHE A O    1  
ATOM 1377  C CB   . PHE A 1 88 ? -1.986  -13.187 2.712   1.00 0.00 ? 87 PHE A CB   1  
ATOM 1378  C CG   . PHE A 1 88 ? -2.924  -12.193 2.069   1.00 0.00 ? 87 PHE A CG   1  
ATOM 1379  C CD1  . PHE A 1 88 ? -2.976  -12.081 0.674   1.00 0.00 ? 87 PHE A CD1  1  
ATOM 1380  C CD2  . PHE A 1 88 ? -3.734  -11.377 2.867   1.00 0.00 ? 87 PHE A CD2  1  
ATOM 1381  C CE1  . PHE A 1 88 ? -3.841  -11.155 0.078   1.00 0.00 ? 87 PHE A CE1  1  
ATOM 1382  C CE2  . PHE A 1 88 ? -4.597  -10.450 2.271   1.00 0.00 ? 87 PHE A CE2  1  
ATOM 1383  C CZ   . PHE A 1 88 ? -4.651  -10.339 0.876   1.00 0.00 ? 87 PHE A CZ   1  
ATOM 1384  H H    . PHE A 1 88 ? -3.522  -14.061 0.824   1.00 0.00 ? 87 PHE A H    1  
ATOM 1385  H HA   . PHE A 1 88 ? -1.848  -15.331 2.807   1.00 0.00 ? 87 PHE A HA   1  
ATOM 1386  H HB2  . PHE A 1 88 ? -1.781  -12.882 3.728   1.00 0.00 ? 87 PHE A HB2  1  
ATOM 1387  H HB3  . PHE A 1 88 ? -1.062  -13.217 2.154   1.00 0.00 ? 87 PHE A HB3  1  
ATOM 1388  H HD1  . PHE A 1 88 ? -2.351  -12.710 0.057   1.00 0.00 ? 87 PHE A HD1  1  
ATOM 1389  H HD2  . PHE A 1 88 ? -3.693  -11.463 3.943   1.00 0.00 ? 87 PHE A HD2  1  
ATOM 1390  H HE1  . PHE A 1 88 ? -3.882  -11.070 -0.998  1.00 0.00 ? 87 PHE A HE1  1  
ATOM 1391  H HE2  . PHE A 1 88 ? -5.220  -9.820  2.887   1.00 0.00 ? 87 PHE A HE2  1  
ATOM 1392  H HZ   . PHE A 1 88 ? -5.317  -9.624  0.416   1.00 0.00 ? 87 PHE A HZ   1  
ATOM 1393  N N    . PHE A 1 89 ? -4.859  -14.472 3.645   1.00 0.00 ? 88 PHE A N    1  
ATOM 1394  C CA   . PHE A 1 89 ? -5.866  -14.600 4.734   1.00 0.00 ? 88 PHE A CA   1  
ATOM 1395  C C    . PHE A 1 89 ? -5.741  -15.983 5.377   1.00 0.00 ? 88 PHE A C    1  
ATOM 1396  O O    . PHE A 1 89 ? -5.933  -16.148 6.566   1.00 0.00 ? 88 PHE A O    1  
ATOM 1397  C CB   . PHE A 1 89 ? -7.274  -14.433 4.156   1.00 0.00 ? 88 PHE A CB   1  
ATOM 1398  C CG   . PHE A 1 89 ? -7.341  -13.158 3.350   1.00 0.00 ? 88 PHE A CG   1  
ATOM 1399  C CD1  . PHE A 1 89 ? -7.564  -11.933 3.992   1.00 0.00 ? 88 PHE A CD1  1  
ATOM 1400  C CD2  . PHE A 1 89 ? -7.182  -13.200 1.960   1.00 0.00 ? 88 PHE A CD2  1  
ATOM 1401  C CE1  . PHE A 1 89 ? -7.628  -10.751 3.242   1.00 0.00 ? 88 PHE A CE1  1  
ATOM 1402  C CE2  . PHE A 1 89 ? -7.245  -12.019 1.211   1.00 0.00 ? 88 PHE A CE2  1  
ATOM 1403  C CZ   . PHE A 1 89 ? -7.468  -10.795 1.852   1.00 0.00 ? 88 PHE A CZ   1  
ATOM 1404  H H    . PHE A 1 89 ? -5.144  -14.211 2.745   1.00 0.00 ? 88 PHE A H    1  
ATOM 1405  H HA   . PHE A 1 89 ? -5.699  -13.854 5.496   1.00 0.00 ? 88 PHE A HA   1  
ATOM 1406  H HB2  . PHE A 1 89 ? -7.502  -15.274 3.519   1.00 0.00 ? 88 PHE A HB2  1  
ATOM 1407  H HB3  . PHE A 1 89 ? -7.991  -14.387 4.962   1.00 0.00 ? 88 PHE A HB3  1  
ATOM 1408  H HD1  . PHE A 1 89 ? -7.687  -11.899 5.064   1.00 0.00 ? 88 PHE A HD1  1  
ATOM 1409  H HD2  . PHE A 1 89 ? -7.009  -14.145 1.465   1.00 0.00 ? 88 PHE A HD2  1  
ATOM 1410  H HE1  . PHE A 1 89 ? -7.799  -9.805  3.736   1.00 0.00 ? 88 PHE A HE1  1  
ATOM 1411  H HE2  . PHE A 1 89 ? -7.122  -12.052 0.139   1.00 0.00 ? 88 PHE A HE2  1  
ATOM 1412  H HZ   . PHE A 1 89 ? -7.517  -9.884  1.274   1.00 0.00 ? 88 PHE A HZ   1  
ATOM 1413  N N    . GLU A 1 90 ? -5.417  -16.977 4.599   1.00 0.00 ? 89 GLU A N    1  
ATOM 1414  C CA   . GLU A 1 90 ? -5.277  -18.349 5.162   1.00 0.00 ? 89 GLU A CA   1  
ATOM 1415  C C    . GLU A 1 90 ? -3.989  -18.429 5.983   1.00 0.00 ? 89 GLU A C    1  
ATOM 1416  O O    . GLU A 1 90 ? -3.081  -19.171 5.663   1.00 0.00 ? 89 GLU A O    1  
ATOM 1417  C CB   . GLU A 1 90 ? -5.219  -19.366 4.020   1.00 0.00 ? 89 GLU A CB   1  
ATOM 1418  C CG   . GLU A 1 90 ? -5.372  -20.780 4.585   1.00 0.00 ? 89 GLU A CG   1  
ATOM 1419  C CD   . GLU A 1 90 ? -5.273  -21.798 3.449   1.00 0.00 ? 89 GLU A CD   1  
ATOM 1420  O OE1  . GLU A 1 90 ? -6.005  -21.653 2.484   1.00 0.00 ? 89 GLU A OE1  1  
ATOM 1421  O OE2  . GLU A 1 90 ? -4.466  -22.706 3.562   1.00 0.00 ? 89 GLU A OE2  1  
ATOM 1422  H H    . GLU A 1 90 ? -5.266  -16.821 3.644   1.00 0.00 ? 89 GLU A H    1  
ATOM 1423  H HA   . GLU A 1 90 ? -6.123  -18.567 5.796   1.00 0.00 ? 89 GLU A HA   1  
ATOM 1424  H HB2  . GLU A 1 90 ? -6.020  -19.169 3.321   1.00 0.00 ? 89 GLU A HB2  1  
ATOM 1425  H HB3  . GLU A 1 90 ? -4.270  -19.285 3.512   1.00 0.00 ? 89 GLU A HB3  1  
ATOM 1426  H HG2  . GLU A 1 90 ? -4.588  -20.965 5.306   1.00 0.00 ? 89 GLU A HG2  1  
ATOM 1427  H HG3  . GLU A 1 90 ? -6.334  -20.873 5.067   1.00 0.00 ? 89 GLU A HG3  1  
ATOM 1428  N N    . HIS A 1 91 ? -3.905  -17.672 7.043   1.00 0.00 ? 90 HIS A N    1  
ATOM 1429  C CA   . HIS A 1 91 ? -2.678  -17.705 7.888   1.00 0.00 ? 90 HIS A CA   1  
ATOM 1430  C C    . HIS A 1 91 ? -2.667  -18.992 8.715   1.00 0.00 ? 90 HIS A C    1  
ATOM 1431  O O    . HIS A 1 91 ? -3.536  -19.224 9.531   1.00 0.00 ? 90 HIS A O    1  
ATOM 1432  C CB   . HIS A 1 91 ? -2.675  -16.495 8.825   1.00 0.00 ? 90 HIS A CB   1  
ATOM 1433  C CG   . HIS A 1 91 ? -1.358  -16.422 9.547   1.00 0.00 ? 90 HIS A CG   1  
ATOM 1434  N ND1  . HIS A 1 91 ? -0.614  -17.553 9.845   1.00 0.00 ? 90 HIS A ND1  1  
ATOM 1435  C CD2  . HIS A 1 91 ? -0.638  -15.360 10.037  1.00 0.00 ? 90 HIS A CD2  1  
ATOM 1436  C CE1  . HIS A 1 91 ? 0.498   -17.150 10.487  1.00 0.00 ? 90 HIS A CE1  1  
ATOM 1437  N NE2  . HIS A 1 91 ? 0.533   -15.822 10.630  1.00 0.00 ? 90 HIS A NE2  1  
ATOM 1438  H H    . HIS A 1 91 ? -4.650  -17.083 7.283   1.00 0.00 ? 90 HIS A H    1  
ATOM 1439  H HA   . HIS A 1 91 ? -1.803  -17.674 7.256   1.00 0.00 ? 90 HIS A HA   1  
ATOM 1440  H HB2  . HIS A 1 91 ? -2.821  -15.593 8.249   1.00 0.00 ? 90 HIS A HB2  1  
ATOM 1441  H HB3  . HIS A 1 91 ? -3.474  -16.595 9.545   1.00 0.00 ? 90 HIS A HB3  1  
ATOM 1442  H HD1  . HIS A 1 91 ? -0.854  -18.478 9.627   1.00 0.00 ? 90 HIS A HD1  1  
ATOM 1443  H HD2  . HIS A 1 91 ? -0.936  -14.324 9.973   1.00 0.00 ? 90 HIS A HD2  1  
ATOM 1444  H HE1  . HIS A 1 91 ? 1.268   -17.818 10.842  1.00 0.00 ? 90 HIS A HE1  1  
ATOM 1445  N N    . GLU A 1 92 ? -1.688  -19.832 8.510   1.00 0.00 ? 91 GLU A N    1  
ATOM 1446  C CA   . GLU A 1 92 ? -1.623  -21.105 9.283   1.00 0.00 ? 91 GLU A CA   1  
ATOM 1447  C C    . GLU A 1 92 ? -0.183  -21.622 9.292   1.00 0.00 ? 91 GLU A C    1  
ATOM 1448  O O    . GLU A 1 92 ? 0.186   -22.271 10.257  1.00 0.00 ? 91 GLU A O    1  
ATOM 1449  C CB   . GLU A 1 92 ? -2.534  -22.146 8.628   1.00 0.00 ? 91 GLU A CB   1  
ATOM 1450  C CG   . GLU A 1 92 ? -2.702  -23.343 9.567   1.00 0.00 ? 91 GLU A CG   1  
ATOM 1451  C CD   . GLU A 1 92 ? -3.646  -22.966 10.711  1.00 0.00 ? 91 GLU A CD   1  
ATOM 1452  O OE1  . GLU A 1 92 ? -4.845  -22.946 10.482  1.00 0.00 ? 91 GLU A OE1  1  
ATOM 1453  O OE2  . GLU A 1 92 ? -3.155  -22.704 11.796  1.00 0.00 ? 91 GLU A OE2  1  
ATOM 1454  O OXT  . GLU A 1 92 ? 0.526   -21.360 8.335   1.00 0.00 ? 91 GLU A OXT  1  
ATOM 1455  H H    . GLU A 1 92 ? -0.998  -19.626 7.846   1.00 0.00 ? 91 GLU A H    1  
ATOM 1456  H HA   . GLU A 1 92 ? -1.948  -20.929 10.298  1.00 0.00 ? 91 GLU A HA   1  
ATOM 1457  H HB2  . GLU A 1 92 ? -3.499  -21.704 8.429   1.00 0.00 ? 91 GLU A HB2  1  
ATOM 1458  H HB3  . GLU A 1 92 ? -2.091  -22.479 7.701   1.00 0.00 ? 91 GLU A HB3  1  
ATOM 1459  H HG2  . GLU A 1 92 ? -3.116  -24.175 9.017   1.00 0.00 ? 91 GLU A HG2  1  
ATOM 1460  H HG3  . GLU A 1 92 ? -1.742  -23.621 9.973   1.00 0.00 ? 91 GLU A HG3  1  
ATOM 1461  N N    . MET B 1 1  ? 7.873   -7.941  13.299  1.00 0.00 ? 0  MET B N    1  
ATOM 1462  C CA   . MET B 1 1  ? 7.536   -7.618  14.713  1.00 0.00 ? 0  MET B CA   1  
ATOM 1463  C C    . MET B 1 1  ? 7.650   -6.108  14.932  1.00 0.00 ? 0  MET B C    1  
ATOM 1464  O O    . MET B 1 1  ? 7.195   -5.580  15.928  1.00 0.00 ? 0  MET B O    1  
ATOM 1465  C CB   . MET B 1 1  ? 8.507   -8.343  15.647  1.00 0.00 ? 0  MET B CB   1  
ATOM 1466  C CG   . MET B 1 1  ? 8.213   -7.950  17.096  1.00 0.00 ? 0  MET B CG   1  
ATOM 1467  S SD   . MET B 1 1  ? 9.046   -9.102  18.215  1.00 0.00 ? 0  MET B SD   1  
ATOM 1468  C CE   . MET B 1 1  ? 8.215   -8.583  19.736  1.00 0.00 ? 0  MET B CE   1  
ATOM 1469  H H1   . MET B 1 1  ? 7.871   -7.069  12.733  1.00 0.00 ? 0  MET B H1   1  
ATOM 1470  H H2   . MET B 1 1  ? 8.816   -8.377  13.257  1.00 0.00 ? 0  MET B H2   1  
ATOM 1471  H H3   . MET B 1 1  ? 7.166   -8.604  12.918  1.00 0.00 ? 0  MET B H3   1  
ATOM 1472  H HA   . MET B 1 1  ? 6.527   -7.937  14.925  1.00 0.00 ? 0  MET B HA   1  
ATOM 1473  H HB2  . MET B 1 1  ? 8.388   -9.410  15.531  1.00 0.00 ? 0  MET B HB2  1  
ATOM 1474  H HB3  . MET B 1 1  ? 9.521   -8.065  15.400  1.00 0.00 ? 0  MET B HB3  1  
ATOM 1475  H HG2  . MET B 1 1  ? 8.573   -6.948  17.277  1.00 0.00 ? 0  MET B HG2  1  
ATOM 1476  H HG3  . MET B 1 1  ? 7.147   -7.986  17.269  1.00 0.00 ? 0  MET B HG3  1  
ATOM 1477  H HE1  . MET B 1 1  ? 8.160   -7.504  19.765  1.00 0.00 ? 0  MET B HE1  1  
ATOM 1478  H HE2  . MET B 1 1  ? 7.217   -8.991  19.760  1.00 0.00 ? 0  MET B HE2  1  
ATOM 1479  H HE3  . MET B 1 1  ? 8.771   -8.945  20.590  1.00 0.00 ? 0  MET B HE3  1  
ATOM 1480  N N    . SER B 1 2  ? 8.252   -5.406  14.011  1.00 0.00 ? 1  SER B N    1  
ATOM 1481  C CA   . SER B 1 2  ? 8.390   -3.931  14.172  1.00 0.00 ? 1  SER B CA   1  
ATOM 1482  C C    . SER B 1 2  ? 7.000   -3.296  14.205  1.00 0.00 ? 1  SER B C    1  
ATOM 1483  O O    . SER B 1 2  ? 6.012   -3.928  13.888  1.00 0.00 ? 1  SER B O    1  
ATOM 1484  C CB   . SER B 1 2  ? 9.184   -3.359  12.997  1.00 0.00 ? 1  SER B CB   1  
ATOM 1485  O OG   . SER B 1 2  ? 8.301   -3.117  11.909  1.00 0.00 ? 1  SER B OG   1  
ATOM 1486  H H    . SER B 1 2  ? 8.612   -5.849  13.214  1.00 0.00 ? 1  SER B H    1  
ATOM 1487  H HA   . SER B 1 2  ? 8.905   -3.719  15.098  1.00 0.00 ? 1  SER B HA   1  
ATOM 1488  H HB2  . SER B 1 2  ? 9.647   -2.431  13.289  1.00 0.00 ? 1  SER B HB2  1  
ATOM 1489  H HB3  . SER B 1 2  ? 9.950   -4.064  12.703  1.00 0.00 ? 1  SER B HB3  1  
ATOM 1490  H HG   . SER B 1 2  ? 8.763   -2.573  11.267  1.00 0.00 ? 1  SER B HG   1  
ATOM 1491  N N    . GLU B 1 3  ? 6.913   -2.052  14.588  1.00 0.00 ? 2  GLU B N    1  
ATOM 1492  C CA   . GLU B 1 3  ? 5.582   -1.385  14.641  1.00 0.00 ? 2  GLU B CA   1  
ATOM 1493  C C    . GLU B 1 3  ? 4.896   -1.507  13.280  1.00 0.00 ? 2  GLU B C    1  
ATOM 1494  O O    . GLU B 1 3  ? 3.690   -1.615  13.188  1.00 0.00 ? 2  GLU B O    1  
ATOM 1495  C CB   . GLU B 1 3  ? 5.767   0.094   14.985  1.00 0.00 ? 2  GLU B CB   1  
ATOM 1496  C CG   . GLU B 1 3  ? 6.157   0.234   16.457  1.00 0.00 ? 2  GLU B CG   1  
ATOM 1497  C CD   . GLU B 1 3  ? 7.463   -0.519  16.714  1.00 0.00 ? 2  GLU B CD   1  
ATOM 1498  O OE1  . GLU B 1 3  ? 7.396   -1.708  16.980  1.00 0.00 ? 2  GLU B OE1  1  
ATOM 1499  O OE2  . GLU B 1 3  ? 8.509   0.105   16.641  1.00 0.00 ? 2  GLU B OE2  1  
ATOM 1500  H H    . GLU B 1 3  ? 7.721   -1.559  14.841  1.00 0.00 ? 2  GLU B H    1  
ATOM 1501  H HA   . GLU B 1 3  ? 4.972   -1.858  15.396  1.00 0.00 ? 2  GLU B HA   1  
ATOM 1502  H HB2  . GLU B 1 3  ? 6.545   0.513   14.364  1.00 0.00 ? 2  GLU B HB2  1  
ATOM 1503  H HB3  . GLU B 1 3  ? 4.842   0.623   14.808  1.00 0.00 ? 2  GLU B HB3  1  
ATOM 1504  H HG2  . GLU B 1 3  ? 6.291   1.280   16.695  1.00 0.00 ? 2  GLU B HG2  1  
ATOM 1505  H HG3  . GLU B 1 3  ? 5.377   -0.180  17.078  1.00 0.00 ? 2  GLU B HG3  1  
ATOM 1506  N N    . LEU B 1 4  ? 5.655   -1.476  12.219  1.00 0.00 ? 3  LEU B N    1  
ATOM 1507  C CA   . LEU B 1 4  ? 5.046   -1.575  10.863  1.00 0.00 ? 3  LEU B CA   1  
ATOM 1508  C C    . LEU B 1 4  ? 4.353   -2.935  10.704  1.00 0.00 ? 3  LEU B C    1  
ATOM 1509  O O    . LEU B 1 4  ? 3.220   -3.013  10.274  1.00 0.00 ? 3  LEU B O    1  
ATOM 1510  C CB   . LEU B 1 4  ? 6.149   -1.410  9.797   1.00 0.00 ? 3  LEU B CB   1  
ATOM 1511  C CG   . LEU B 1 4  ? 5.581   -0.730  8.544   1.00 0.00 ? 3  LEU B CG   1  
ATOM 1512  C CD1  . LEU B 1 4  ? 6.679   -0.612  7.485   1.00 0.00 ? 3  LEU B CD1  1  
ATOM 1513  C CD2  . LEU B 1 4  ? 4.419   -1.561  7.989   1.00 0.00 ? 3  LEU B CD2  1  
ATOM 1514  H H    . LEU B 1 4  ? 6.625   -1.370  12.314  1.00 0.00 ? 3  LEU B H    1  
ATOM 1515  H HA   . LEU B 1 4  ? 4.312   -0.789  10.752  1.00 0.00 ? 3  LEU B HA   1  
ATOM 1516  H HB2  . LEU B 1 4  ? 6.943   -0.800  10.201  1.00 0.00 ? 3  LEU B HB2  1  
ATOM 1517  H HB3  . LEU B 1 4  ? 6.548   -2.377  9.527   1.00 0.00 ? 3  LEU B HB3  1  
ATOM 1518  H HG   . LEU B 1 4  ? 5.227   0.258   8.803   1.00 0.00 ? 3  LEU B HG   1  
ATOM 1519  H HD11 . LEU B 1 4  ? 7.589   -0.259  7.947   1.00 0.00 ? 3  LEU B HD11 1  
ATOM 1520  H HD12 . LEU B 1 4  ? 6.853   -1.580  7.039   1.00 0.00 ? 3  LEU B HD12 1  
ATOM 1521  H HD13 . LEU B 1 4  ? 6.369   0.086   6.721   1.00 0.00 ? 3  LEU B HD13 1  
ATOM 1522  H HD21 . LEU B 1 4  ? 4.684   -2.608  8.006   1.00 0.00 ? 3  LEU B HD21 1  
ATOM 1523  H HD22 . LEU B 1 4  ? 3.541   -1.402  8.596   1.00 0.00 ? 3  LEU B HD22 1  
ATOM 1524  H HD23 . LEU B 1 4  ? 4.212   -1.259  6.972   1.00 0.00 ? 3  LEU B HD23 1  
ATOM 1525  N N    . GLU B 1 5  ? 5.018   -4.007  11.047  1.00 0.00 ? 4  GLU B N    1  
ATOM 1526  C CA   . GLU B 1 5  ? 4.377   -5.346  10.907  1.00 0.00 ? 4  GLU B CA   1  
ATOM 1527  C C    . GLU B 1 5  ? 3.011   -5.320  11.597  1.00 0.00 ? 4  GLU B C    1  
ATOM 1528  O O    . GLU B 1 5  ? 2.014   -5.750  11.052  1.00 0.00 ? 4  GLU B O    1  
ATOM 1529  C CB   . GLU B 1 5  ? 5.268   -6.415  11.555  1.00 0.00 ? 4  GLU B CB   1  
ATOM 1530  C CG   . GLU B 1 5  ? 6.408   -6.785  10.602  1.00 0.00 ? 4  GLU B CG   1  
ATOM 1531  C CD   . GLU B 1 5  ? 7.222   -5.534  10.266  1.00 0.00 ? 4  GLU B CD   1  
ATOM 1532  O OE1  . GLU B 1 5  ? 6.858   -4.850  9.324   1.00 0.00 ? 4  GLU B OE1  1  
ATOM 1533  O OE2  . GLU B 1 5  ? 8.196   -5.282  10.956  1.00 0.00 ? 4  GLU B OE2  1  
ATOM 1534  H H    . GLU B 1 5  ? 5.930   -3.937  11.397  1.00 0.00 ? 4  GLU B H    1  
ATOM 1535  H HA   . GLU B 1 5  ? 4.246   -5.568  9.857   1.00 0.00 ? 4  GLU B HA   1  
ATOM 1536  H HB2  . GLU B 1 5  ? 5.679   -6.028  12.476  1.00 0.00 ? 4  GLU B HB2  1  
ATOM 1537  H HB3  . GLU B 1 5  ? 4.680   -7.297  11.766  1.00 0.00 ? 4  GLU B HB3  1  
ATOM 1538  H HG2  . GLU B 1 5  ? 7.049   -7.516  11.074  1.00 0.00 ? 4  GLU B HG2  1  
ATOM 1539  H HG3  . GLU B 1 5  ? 5.998   -7.199  9.694   1.00 0.00 ? 4  GLU B HG3  1  
ATOM 1540  N N    . LYS B 1 6  ? 2.968   -4.801  12.793  1.00 0.00 ? 5  LYS B N    1  
ATOM 1541  C CA   . LYS B 1 6  ? 1.682   -4.717  13.538  1.00 0.00 ? 5  LYS B CA   1  
ATOM 1542  C C    . LYS B 1 6  ? 0.609   -4.112  12.633  1.00 0.00 ? 5  LYS B C    1  
ATOM 1543  O O    . LYS B 1 6  ? -0.519  -4.563  12.586  1.00 0.00 ? 5  LYS B O    1  
ATOM 1544  C CB   . LYS B 1 6  ? 1.876   -3.805  14.751  1.00 0.00 ? 5  LYS B CB   1  
ATOM 1545  C CG   . LYS B 1 6  ? 3.058   -4.310  15.583  1.00 0.00 ? 5  LYS B CG   1  
ATOM 1546  C CD   . LYS B 1 6  ? 3.048   -3.630  16.953  1.00 0.00 ? 5  LYS B CD   1  
ATOM 1547  C CE   . LYS B 1 6  ? 4.380   -3.890  17.660  1.00 0.00 ? 5  LYS B CE   1  
ATOM 1548  N NZ   . LYS B 1 6  ? 4.400   -3.168  18.964  1.00 0.00 ? 5  LYS B NZ   1  
ATOM 1549  H H    . LYS B 1 6  ? 3.789   -4.453  13.201  1.00 0.00 ? 5  LYS B H    1  
ATOM 1550  H HA   . LYS B 1 6  ? 1.387   -5.697  13.887  1.00 0.00 ? 5  LYS B HA   1  
ATOM 1551  H HB2  . LYS B 1 6  ? 2.073   -2.797  14.417  1.00 0.00 ? 5  LYS B HB2  1  
ATOM 1552  H HB3  . LYS B 1 6  ? 0.982   -3.816  15.357  1.00 0.00 ? 5  LYS B HB3  1  
ATOM 1553  H HG2  . LYS B 1 6  ? 2.976   -5.380  15.710  1.00 0.00 ? 5  LYS B HG2  1  
ATOM 1554  H HG3  . LYS B 1 6  ? 3.981   -4.077  15.074  1.00 0.00 ? 5  LYS B HG3  1  
ATOM 1555  H HD2  . LYS B 1 6  ? 2.908   -2.566  16.826  1.00 0.00 ? 5  LYS B HD2  1  
ATOM 1556  H HD3  . LYS B 1 6  ? 2.242   -4.031  17.549  1.00 0.00 ? 5  LYS B HD3  1  
ATOM 1557  H HE2  . LYS B 1 6  ? 4.494   -4.950  17.834  1.00 0.00 ? 5  LYS B HE2  1  
ATOM 1558  H HE3  . LYS B 1 6  ? 5.192   -3.537  17.041  1.00 0.00 ? 5  LYS B HE3  1  
ATOM 1559  H HZ1  . LYS B 1 6  ? 3.880   -2.273  18.873  1.00 0.00 ? 5  LYS B HZ1  1  
ATOM 1560  H HZ2  . LYS B 1 6  ? 3.950   -3.756  19.693  1.00 0.00 ? 5  LYS B HZ2  1  
ATOM 1561  H HZ3  . LYS B 1 6  ? 5.386   -2.972  19.236  1.00 0.00 ? 5  LYS B HZ3  1  
ATOM 1562  N N    . ALA B 1 7  ? 0.967   -3.079  11.920  1.00 0.00 ? 6  ALA B N    1  
ATOM 1563  C CA   . ALA B 1 7  ? 0.004   -2.402  11.008  1.00 0.00 ? 6  ALA B CA   1  
ATOM 1564  C C    . ALA B 1 7  ? -0.165  -3.209  9.714   1.00 0.00 ? 6  ALA B C    1  
ATOM 1565  O O    . ALA B 1 7  ? -1.223  -3.211  9.118   1.00 0.00 ? 6  ALA B O    1  
ATOM 1566  C CB   . ALA B 1 7  ? 0.533   -0.994  10.690  1.00 0.00 ? 6  ALA B CB   1  
ATOM 1567  H H    . ALA B 1 7  ? 1.884   -2.743  11.984  1.00 0.00 ? 6  ALA B H    1  
ATOM 1568  H HA   . ALA B 1 7  ? -0.963  -2.329  11.483  1.00 0.00 ? 6  ALA B HA   1  
ATOM 1569  H HB1  . ALA B 1 7  ? 1.613   -1.006  10.712  1.00 0.00 ? 6  ALA B HB1  1  
ATOM 1570  H HB2  . ALA B 1 7  ? 0.201   -0.685  9.709   1.00 0.00 ? 6  ALA B HB2  1  
ATOM 1571  H HB3  . ALA B 1 7  ? 0.170   -0.295  11.429  1.00 0.00 ? 6  ALA B HB3  1  
ATOM 1572  N N    . MET B 1 8  ? 0.847   -3.902  9.276   1.00 0.00 ? 7  MET B N    1  
ATOM 1573  C CA   . MET B 1 8  ? 0.690   -4.702  8.028   1.00 0.00 ? 7  MET B CA   1  
ATOM 1574  C C    . MET B 1 8  ? -0.414  -5.741  8.261   1.00 0.00 ? 7  MET B C    1  
ATOM 1575  O O    . MET B 1 8  ? -1.321  -5.901  7.462   1.00 0.00 ? 7  MET B O    1  
ATOM 1576  C CB   . MET B 1 8  ? 2.018   -5.400  7.699   1.00 0.00 ? 7  MET B CB   1  
ATOM 1577  C CG   . MET B 1 8  ? 2.074   -5.749  6.207   1.00 0.00 ? 7  MET B CG   1  
ATOM 1578  S SD   . MET B 1 8  ? 2.553   -4.279  5.265   1.00 0.00 ? 7  MET B SD   1  
ATOM 1579  C CE   . MET B 1 8  ? 1.640   -4.666  3.750   1.00 0.00 ? 7  MET B CE   1  
ATOM 1580  H H    . MET B 1 8  ? 1.696   -3.906  9.765   1.00 0.00 ? 7  MET B H    1  
ATOM 1581  H HA   . MET B 1 8  ? 0.406   -4.048  7.215   1.00 0.00 ? 7  MET B HA   1  
ATOM 1582  H HB2  . MET B 1 8  ? 2.837   -4.738  7.941   1.00 0.00 ? 7  MET B HB2  1  
ATOM 1583  H HB3  . MET B 1 8  ? 2.108   -6.304  8.282   1.00 0.00 ? 7  MET B HB3  1  
ATOM 1584  H HG2  . MET B 1 8  ? 2.803   -6.531  6.048   1.00 0.00 ? 7  MET B HG2  1  
ATOM 1585  H HG3  . MET B 1 8  ? 1.103   -6.090  5.876   1.00 0.00 ? 7  MET B HG3  1  
ATOM 1586  H HE1  . MET B 1 8  ? 1.982   -5.614  3.358   1.00 0.00 ? 7  MET B HE1  1  
ATOM 1587  H HE2  . MET B 1 8  ? 0.587   -4.729  3.969   1.00 0.00 ? 7  MET B HE2  1  
ATOM 1588  H HE3  . MET B 1 8  ? 1.809   -3.885  3.021   1.00 0.00 ? 7  MET B HE3  1  
ATOM 1589  N N    . VAL B 1 9  ? -0.350  -6.434  9.364   1.00 0.00 ? 8  VAL B N    1  
ATOM 1590  C CA   . VAL B 1 9  ? -1.393  -7.448  9.672   1.00 0.00 ? 8  VAL B CA   1  
ATOM 1591  C C    . VAL B 1 9  ? -2.735  -6.741  9.866   1.00 0.00 ? 8  VAL B C    1  
ATOM 1592  O O    . VAL B 1 9  ? -3.775  -7.247  9.493   1.00 0.00 ? 8  VAL B O    1  
ATOM 1593  C CB   . VAL B 1 9  ? -1.014  -8.191  10.954  1.00 0.00 ? 8  VAL B CB   1  
ATOM 1594  C CG1  . VAL B 1 9  ? -1.963  -9.373  11.160  1.00 0.00 ? 8  VAL B CG1  1  
ATOM 1595  C CG2  . VAL B 1 9  ? 0.421   -8.711  10.833  1.00 0.00 ? 8  VAL B CG2  1  
ATOM 1596  H H    . VAL B 1 9  ? 0.380   -6.277  9.998   1.00 0.00 ? 8  VAL B H    1  
ATOM 1597  H HA   . VAL B 1 9  ? -1.471  -8.155  8.859   1.00 0.00 ? 8  VAL B HA   1  
ATOM 1598  H HB   . VAL B 1 9  ? -1.086  -7.519  11.797  1.00 0.00 ? 8  VAL B HB   1  
ATOM 1599  H HG11 . VAL B 1 9  ? -1.935  -10.012 10.290  1.00 0.00 ? 8  VAL B HG11 1  
ATOM 1600  H HG12 . VAL B 1 9  ? -1.655  -9.934  12.030  1.00 0.00 ? 8  VAL B HG12 1  
ATOM 1601  H HG13 . VAL B 1 9  ? -2.968  -9.006  11.306  1.00 0.00 ? 8  VAL B HG13 1  
ATOM 1602  H HG21 . VAL B 1 9  ? 1.093   -7.881  10.676  1.00 0.00 ? 8  VAL B HG21 1  
ATOM 1603  H HG22 . VAL B 1 9  ? 0.694   -9.229  11.740  1.00 0.00 ? 8  VAL B HG22 1  
ATOM 1604  H HG23 . VAL B 1 9  ? 0.488   -9.391  9.996   1.00 0.00 ? 8  VAL B HG23 1  
ATOM 1605  N N    . ALA B 1 10 ? -2.720  -5.564  10.435  1.00 0.00 ? 9  ALA B N    1  
ATOM 1606  C CA   . ALA B 1 10 ? -3.994  -4.820  10.638  1.00 0.00 ? 9  ALA B CA   1  
ATOM 1607  C C    . ALA B 1 10 ? -4.677  -4.628  9.284   1.00 0.00 ? 9  ALA B C    1  
ATOM 1608  O O    . ALA B 1 10 ? -5.859  -4.854  9.135   1.00 0.00 ? 9  ALA B O    1  
ATOM 1609  C CB   . ALA B 1 10 ? -3.692  -3.451  11.253  1.00 0.00 ? 9  ALA B CB   1  
ATOM 1610  H H    . ALA B 1 10 ? -1.872  -5.165  10.719  1.00 0.00 ? 9  ALA B H    1  
ATOM 1611  H HA   . ALA B 1 10 ? -4.641  -5.377  11.299  1.00 0.00 ? 9  ALA B HA   1  
ATOM 1612  H HB1  . ALA B 1 10 ? -3.098  -3.581  12.146  1.00 0.00 ? 9  ALA B HB1  1  
ATOM 1613  H HB2  . ALA B 1 10 ? -3.146  -2.850  10.542  1.00 0.00 ? 9  ALA B HB2  1  
ATOM 1614  H HB3  . ALA B 1 10 ? -4.619  -2.957  11.506  1.00 0.00 ? 9  ALA B HB3  1  
ATOM 1615  N N    . LEU B 1 11 ? -3.944  -4.201  8.296   1.00 0.00 ? 10 LEU B N    1  
ATOM 1616  C CA   . LEU B 1 11 ? -4.564  -3.987  6.956   1.00 0.00 ? 10 LEU B CA   1  
ATOM 1617  C C    . LEU B 1 11 ? -5.394  -5.223  6.598   1.00 0.00 ? 10 LEU B C    1  
ATOM 1618  O O    . LEU B 1 11 ? -6.536  -5.126  6.195   1.00 0.00 ? 10 LEU B O    1  
ATOM 1619  C CB   . LEU B 1 11 ? -3.441  -3.796  5.905   1.00 0.00 ? 10 LEU B CB   1  
ATOM 1620  C CG   . LEU B 1 11 ? -3.126  -2.304  5.705   1.00 0.00 ? 10 LEU B CG   1  
ATOM 1621  C CD1  . LEU B 1 11 ? -2.463  -1.739  6.962   1.00 0.00 ? 10 LEU B CD1  1  
ATOM 1622  C CD2  . LEU B 1 11 ? -2.174  -2.144  4.517   1.00 0.00 ? 10 LEU B CD2  1  
ATOM 1623  H H    . LEU B 1 11 ? -2.992  -4.005  8.440   1.00 0.00 ? 10 LEU B H    1  
ATOM 1624  H HA   . LEU B 1 11 ? -5.182  -3.100  6.990   1.00 0.00 ? 10 LEU B HA   1  
ATOM 1625  H HB2  . LEU B 1 11 ? -2.550  -4.302  6.244   1.00 0.00 ? 10 LEU B HB2  1  
ATOM 1626  H HB3  . LEU B 1 11 ? -3.749  -4.219  4.957   1.00 0.00 ? 10 LEU B HB3  1  
ATOM 1627  H HG   . LEU B 1 11 ? -4.040  -1.762  5.505   1.00 0.00 ? 10 LEU B HG   1  
ATOM 1628  H HD11 . LEU B 1 11 ? -3.035  -2.025  7.831   1.00 0.00 ? 10 LEU B HD11 1  
ATOM 1629  H HD12 . LEU B 1 11 ? -1.460  -2.130  7.045   1.00 0.00 ? 10 LEU B HD12 1  
ATOM 1630  H HD13 . LEU B 1 11 ? -2.424  -0.662  6.895   1.00 0.00 ? 10 LEU B HD13 1  
ATOM 1631  H HD21 . LEU B 1 11 ? -2.602  -2.620  3.646   1.00 0.00 ? 10 LEU B HD21 1  
ATOM 1632  H HD22 . LEU B 1 11 ? -2.023  -1.094  4.315   1.00 0.00 ? 10 LEU B HD22 1  
ATOM 1633  H HD23 . LEU B 1 11 ? -1.226  -2.606  4.750   1.00 0.00 ? 10 LEU B HD23 1  
ATOM 1634  N N    . ILE B 1 12 ? -4.823  -6.386  6.762   1.00 0.00 ? 11 ILE B N    1  
ATOM 1635  C CA   . ILE B 1 12 ? -5.580  -7.629  6.451   1.00 0.00 ? 11 ILE B CA   1  
ATOM 1636  C C    . ILE B 1 12 ? -6.766  -7.716  7.411   1.00 0.00 ? 11 ILE B C    1  
ATOM 1637  O O    . ILE B 1 12 ? -7.879  -8.018  7.029   1.00 0.00 ? 11 ILE B O    1  
ATOM 1638  C CB   . ILE B 1 12 ? -4.672  -8.844  6.649   1.00 0.00 ? 11 ILE B CB   1  
ATOM 1639  C CG1  . ILE B 1 12 ? -3.491  -8.762  5.679   1.00 0.00 ? 11 ILE B CG1  1  
ATOM 1640  C CG2  . ILE B 1 12 ? -5.464  -10.124 6.378   1.00 0.00 ? 11 ILE B CG2  1  
ATOM 1641  C CD1  . ILE B 1 12 ? -2.442  -9.809  6.061   1.00 0.00 ? 11 ILE B CD1  1  
ATOM 1642  H H    . ILE B 1 12 ? -3.904  -6.440  7.100   1.00 0.00 ? 11 ILE B H    1  
ATOM 1643  H HA   . ILE B 1 12 ? -5.922  -7.592  5.427   1.00 0.00 ? 11 ILE B HA   1  
ATOM 1644  H HB   . ILE B 1 12 ? -4.305  -8.857  7.666   1.00 0.00 ? 11 ILE B HB   1  
ATOM 1645  H HG12 . ILE B 1 12 ? -3.838  -8.950  4.673   1.00 0.00 ? 11 ILE B HG12 1  
ATOM 1646  H HG13 . ILE B 1 12 ? -3.050  -7.779  5.731   1.00 0.00 ? 11 ILE B HG13 1  
ATOM 1647  H HG21 . ILE B 1 12 ? -5.954  -10.047 5.419   1.00 0.00 ? 11 ILE B HG21 1  
ATOM 1648  H HG22 . ILE B 1 12 ? -4.792  -10.969 6.372   1.00 0.00 ? 11 ILE B HG22 1  
ATOM 1649  H HG23 . ILE B 1 12 ? -6.206  -10.259 7.152   1.00 0.00 ? 11 ILE B HG23 1  
ATOM 1650  H HD11 . ILE B 1 12 ? -2.899  -10.787 6.081   1.00 0.00 ? 11 ILE B HD11 1  
ATOM 1651  H HD12 . ILE B 1 12 ? -1.643  -9.800  5.334   1.00 0.00 ? 11 ILE B HD12 1  
ATOM 1652  H HD13 . ILE B 1 12 ? -2.042  -9.578  7.037   1.00 0.00 ? 11 ILE B HD13 1  
ATOM 1653  N N    . ASP B 1 13 ? -6.517  -7.444  8.664   1.00 0.00 ? 12 ASP B N    1  
ATOM 1654  C CA   . ASP B 1 13 ? -7.594  -7.492  9.688   1.00 0.00 ? 12 ASP B CA   1  
ATOM 1655  C C    . ASP B 1 13 ? -8.809  -6.697  9.212   1.00 0.00 ? 12 ASP B C    1  
ATOM 1656  O O    . ASP B 1 13 ? -9.930  -7.164  9.261   1.00 0.00 ? 12 ASP B O    1  
ATOM 1657  C CB   . ASP B 1 13 ? -7.069  -6.854  10.983  1.00 0.00 ? 12 ASP B CB   1  
ATOM 1658  C CG   . ASP B 1 13 ? -7.980  -7.236  12.153  1.00 0.00 ? 12 ASP B CG   1  
ATOM 1659  O OD1  . ASP B 1 13 ? -8.380  -8.386  12.216  1.00 0.00 ? 12 ASP B OD1  1  
ATOM 1660  O OD2  . ASP B 1 13 ? -8.261  -6.370  12.966  1.00 0.00 ? 12 ASP B OD2  1  
ATOM 1661  H H    . ASP B 1 13 ? -5.608  -7.206  8.935   1.00 0.00 ? 12 ASP B H    1  
ATOM 1662  H HA   . ASP B 1 13 ? -7.860  -8.517  9.908   1.00 0.00 ? 12 ASP B HA   1  
ATOM 1663  H HB2  . ASP B 1 13 ? -6.069  -7.213  11.177  1.00 0.00 ? 12 ASP B HB2  1  
ATOM 1664  H HB3  . ASP B 1 13 ? -7.053  -5.780  10.882  1.00 0.00 ? 12 ASP B HB3  1  
ATOM 1665  N N    . VAL B 1 14 ? -8.595  -5.480  8.778   1.00 0.00 ? 13 VAL B N    1  
ATOM 1666  C CA   . VAL B 1 14 ? -9.742  -4.637  8.330   1.00 0.00 ? 13 VAL B CA   1  
ATOM 1667  C C    . VAL B 1 14 ? -10.214 -5.042  6.930   1.00 0.00 ? 13 VAL B C    1  
ATOM 1668  O O    . VAL B 1 14 ? -11.394 -5.000  6.647   1.00 0.00 ? 13 VAL B O    1  
ATOM 1669  C CB   . VAL B 1 14 ? -9.340  -3.161  8.350   1.00 0.00 ? 13 VAL B CB   1  
ATOM 1670  C CG1  . VAL B 1 14 ? -10.480 -2.309  7.789   1.00 0.00 ? 13 VAL B CG1  1  
ATOM 1671  C CG2  . VAL B 1 14 ? -9.050  -2.736  9.792   1.00 0.00 ? 13 VAL B CG2  1  
ATOM 1672  H H    . VAL B 1 14 ? -7.679  -5.113  8.762   1.00 0.00 ? 13 VAL B H    1  
ATOM 1673  H HA   . VAL B 1 14 ? -10.578 -4.799  8.991   1.00 0.00 ? 13 VAL B HA   1  
ATOM 1674  H HB   . VAL B 1 14 ? -8.452  -3.021  7.746   1.00 0.00 ? 13 VAL B HB   1  
ATOM 1675  H HG11 . VAL B 1 14 ? -11.410 -2.599  8.257   1.00 0.00 ? 13 VAL B HG11 1  
ATOM 1676  H HG12 . VAL B 1 14 ? -10.285 -1.267  7.992   1.00 0.00 ? 13 VAL B HG12 1  
ATOM 1677  H HG13 . VAL B 1 14 ? -10.552 -2.461  6.722   1.00 0.00 ? 13 VAL B HG13 1  
ATOM 1678  H HG21 . VAL B 1 14 ? -9.834  -3.100  10.440  1.00 0.00 ? 13 VAL B HG21 1  
ATOM 1679  H HG22 . VAL B 1 14 ? -8.103  -3.149  10.106  1.00 0.00 ? 13 VAL B HG22 1  
ATOM 1680  H HG23 . VAL B 1 14 ? -9.009  -1.658  9.849   1.00 0.00 ? 13 VAL B HG23 1  
ATOM 1681  N N    . PHE B 1 15 ? -9.341  -5.433  6.046   1.00 0.00 ? 14 PHE B N    1  
ATOM 1682  C CA   . PHE B 1 15 ? -9.837  -5.819  4.695   1.00 0.00 ? 14 PHE B CA   1  
ATOM 1683  C C    . PHE B 1 15 ? -10.738 -7.045  4.839   1.00 0.00 ? 14 PHE B C    1  
ATOM 1684  O O    . PHE B 1 15 ? -11.700 -7.218  4.116   1.00 0.00 ? 14 PHE B O    1  
ATOM 1685  C CB   . PHE B 1 15 ? -8.670  -6.150  3.763   1.00 0.00 ? 14 PHE B CB   1  
ATOM 1686  C CG   . PHE B 1 15 ? -9.214  -6.469  2.388   1.00 0.00 ? 14 PHE B CG   1  
ATOM 1687  C CD1  . PHE B 1 15 ? -9.631  -7.771  2.082   1.00 0.00 ? 14 PHE B CD1  1  
ATOM 1688  C CD2  . PHE B 1 15 ? -9.305  -5.460  1.421   1.00 0.00 ? 14 PHE B CD2  1  
ATOM 1689  C CE1  . PHE B 1 15 ? -10.140 -8.063  0.808   1.00 0.00 ? 14 PHE B CE1  1  
ATOM 1690  C CE2  . PHE B 1 15 ? -9.813  -5.753  0.148   1.00 0.00 ? 14 PHE B CE2  1  
ATOM 1691  C CZ   . PHE B 1 15 ? -10.230 -7.054  -0.158  1.00 0.00 ? 14 PHE B CZ   1  
ATOM 1692  H H    . PHE B 1 15 ? -8.386  -5.470  6.263   1.00 0.00 ? 14 PHE B H    1  
ATOM 1693  H HA   . PHE B 1 15 ? -10.399 -4.988  4.294   1.00 0.00 ? 14 PHE B HA   1  
ATOM 1694  H HB2  . PHE B 1 15 ? -8.004  -5.301  3.703   1.00 0.00 ? 14 PHE B HB2  1  
ATOM 1695  H HB3  . PHE B 1 15 ? -8.133  -7.005  4.145   1.00 0.00 ? 14 PHE B HB3  1  
ATOM 1696  H HD1  . PHE B 1 15 ? -9.561  -8.550  2.827   1.00 0.00 ? 14 PHE B HD1  1  
ATOM 1697  H HD2  . PHE B 1 15 ? -8.984  -4.456  1.656   1.00 0.00 ? 14 PHE B HD2  1  
ATOM 1698  H HE1  . PHE B 1 15 ? -10.463 -9.067  0.571   1.00 0.00 ? 14 PHE B HE1  1  
ATOM 1699  H HE2  . PHE B 1 15 ? -9.883  -4.974  -0.597  1.00 0.00 ? 14 PHE B HE2  1  
ATOM 1700  H HZ   . PHE B 1 15 ? -10.622 -7.278  -1.140  1.00 0.00 ? 14 PHE B HZ   1  
ATOM 1701  N N    . HIS B 1 16 ? -10.420 -7.902  5.772   1.00 0.00 ? 15 HIS B N    1  
ATOM 1702  C CA   . HIS B 1 16 ? -11.235 -9.130  5.982   1.00 0.00 ? 15 HIS B CA   1  
ATOM 1703  C C    . HIS B 1 16 ? -12.523 -8.784  6.734   1.00 0.00 ? 15 HIS B C    1  
ATOM 1704  O O    . HIS B 1 16 ? -13.553 -9.398  6.540   1.00 0.00 ? 15 HIS B O    1  
ATOM 1705  C CB   . HIS B 1 16 ? -10.424 -10.137 6.799   1.00 0.00 ? 15 HIS B CB   1  
ATOM 1706  C CG   . HIS B 1 16 ? -11.234 -11.386 7.008   1.00 0.00 ? 15 HIS B CG   1  
ATOM 1707  N ND1  . HIS B 1 16 ? -10.955 -12.568 6.341   1.00 0.00 ? 15 HIS B ND1  1  
ATOM 1708  C CD2  . HIS B 1 16 ? -12.317 -11.655 7.808   1.00 0.00 ? 15 HIS B CD2  1  
ATOM 1709  C CE1  . HIS B 1 16 ? -11.851 -13.485 6.747   1.00 0.00 ? 15 HIS B CE1  1  
ATOM 1710  N NE2  . HIS B 1 16 ? -12.705 -12.981 7.642   1.00 0.00 ? 15 HIS B NE2  1  
ATOM 1711  H H    . HIS B 1 16 ? -9.635  -7.737  6.336   1.00 0.00 ? 15 HIS B H    1  
ATOM 1712  H HA   . HIS B 1 16 ? -11.483 -9.564  5.025   1.00 0.00 ? 15 HIS B HA   1  
ATOM 1713  H HB2  . HIS B 1 16 ? -9.515  -10.382 6.269   1.00 0.00 ? 15 HIS B HB2  1  
ATOM 1714  H HB3  . HIS B 1 16 ? -10.176 -9.705  7.758   1.00 0.00 ? 15 HIS B HB3  1  
ATOM 1715  H HD1  . HIS B 1 16 ? -10.235 -12.710 5.691   1.00 0.00 ? 15 HIS B HD1  1  
ATOM 1716  H HD2  . HIS B 1 16 ? -12.795 -10.944 8.467   1.00 0.00 ? 15 HIS B HD2  1  
ATOM 1717  H HE1  . HIS B 1 16 ? -11.876 -14.505 6.394   1.00 0.00 ? 15 HIS B HE1  1  
ATOM 1718  N N    . GLN B 1 17 ? -12.463 -7.814  7.608   1.00 0.00 ? 16 GLN B N    1  
ATOM 1719  C CA   . GLN B 1 17 ? -13.672 -7.437  8.396   1.00 0.00 ? 16 GLN B CA   1  
ATOM 1720  C C    . GLN B 1 17 ? -14.837 -7.133  7.452   1.00 0.00 ? 16 GLN B C    1  
ATOM 1721  O O    . GLN B 1 17 ? -15.951 -7.562  7.675   1.00 0.00 ? 16 GLN B O    1  
ATOM 1722  C CB   . GLN B 1 17 ? -13.362 -6.204  9.252   1.00 0.00 ? 16 GLN B CB   1  
ATOM 1723  C CG   . GLN B 1 17 ? -14.430 -6.035  10.339  1.00 0.00 ? 16 GLN B CG   1  
ATOM 1724  C CD   . GLN B 1 17 ? -15.755 -5.616  9.699   1.00 0.00 ? 16 GLN B CD   1  
ATOM 1725  O OE1  . GLN B 1 17 ? -16.735 -6.330  9.779   1.00 0.00 ? 16 GLN B OE1  1  
ATOM 1726  N NE2  . GLN B 1 17 ? -15.828 -4.479  9.062   1.00 0.00 ? 16 GLN B NE2  1  
ATOM 1727  H H    . GLN B 1 17 ? -11.617 -7.343  7.758   1.00 0.00 ? 16 GLN B H    1  
ATOM 1728  H HA   . GLN B 1 17 ? -13.946 -8.263  9.034   1.00 0.00 ? 16 GLN B HA   1  
ATOM 1729  H HB2  . GLN B 1 17 ? -12.394 -6.326  9.716   1.00 0.00 ? 16 GLN B HB2  1  
ATOM 1730  H HB3  . GLN B 1 17 ? -13.350 -5.325  8.624   1.00 0.00 ? 16 GLN B HB3  1  
ATOM 1731  H HG2  . GLN B 1 17 ? -14.563 -6.970  10.864  1.00 0.00 ? 16 GLN B HG2  1  
ATOM 1732  H HG3  . GLN B 1 17 ? -14.114 -5.274  11.036  1.00 0.00 ? 16 GLN B HG3  1  
ATOM 1733  H HE21 . GLN B 1 17 ? -15.038 -3.903  8.997   1.00 0.00 ? 16 GLN B HE21 1  
ATOM 1734  H HE22 . GLN B 1 17 ? -16.672 -4.202  8.650   1.00 0.00 ? 16 GLN B HE22 1  
ATOM 1735  N N    . TYR B 1 18 ? -14.599 -6.397  6.401   1.00 0.00 ? 17 TYR B N    1  
ATOM 1736  C CA   . TYR B 1 18 ? -15.706 -6.075  5.459   1.00 0.00 ? 17 TYR B CA   1  
ATOM 1737  C C    . TYR B 1 18 ? -16.084 -7.335  4.677   1.00 0.00 ? 17 TYR B C    1  
ATOM 1738  O O    . TYR B 1 18 ? -17.246 -7.638  4.493   1.00 0.00 ? 17 TYR B O    1  
ATOM 1739  C CB   . TYR B 1 18 ? -15.250 -4.982  4.484   1.00 0.00 ? 17 TYR B CB   1  
ATOM 1740  C CG   . TYR B 1 18 ? -15.292 -3.633  5.171   1.00 0.00 ? 17 TYR B CG   1  
ATOM 1741  C CD1  . TYR B 1 18 ? -14.387 -3.345  6.200   1.00 0.00 ? 17 TYR B CD1  1  
ATOM 1742  C CD2  . TYR B 1 18 ? -16.233 -2.671  4.779   1.00 0.00 ? 17 TYR B CD2  1  
ATOM 1743  C CE1  . TYR B 1 18 ? -14.423 -2.098  6.836   1.00 0.00 ? 17 TYR B CE1  1  
ATOM 1744  C CE2  . TYR B 1 18 ? -16.268 -1.425  5.415   1.00 0.00 ? 17 TYR B CE2  1  
ATOM 1745  C CZ   . TYR B 1 18 ? -15.363 -1.138  6.444   1.00 0.00 ? 17 TYR B CZ   1  
ATOM 1746  O OH   . TYR B 1 18 ? -15.399 0.091   7.071   1.00 0.00 ? 17 TYR B OH   1  
ATOM 1747  H H    . TYR B 1 18 ? -13.699 -6.050  6.236   1.00 0.00 ? 17 TYR B H    1  
ATOM 1748  H HA   . TYR B 1 18 ? -16.565 -5.729  6.017   1.00 0.00 ? 17 TYR B HA   1  
ATOM 1749  H HB2  . TYR B 1 18 ? -14.240 -5.189  4.161   1.00 0.00 ? 17 TYR B HB2  1  
ATOM 1750  H HB3  . TYR B 1 18 ? -15.905 -4.968  3.624   1.00 0.00 ? 17 TYR B HB3  1  
ATOM 1751  H HD1  . TYR B 1 18 ? -13.661 -4.085  6.503   1.00 0.00 ? 17 TYR B HD1  1  
ATOM 1752  H HD2  . TYR B 1 18 ? -16.932 -2.890  3.985   1.00 0.00 ? 17 TYR B HD2  1  
ATOM 1753  H HE1  . TYR B 1 18 ? -13.725 -1.876  7.630   1.00 0.00 ? 17 TYR B HE1  1  
ATOM 1754  H HE2  . TYR B 1 18 ? -16.994 -0.684  5.113   1.00 0.00 ? 17 TYR B HE2  1  
ATOM 1755  H HH   . TYR B 1 18 ? -14.659 0.610   6.748   1.00 0.00 ? 17 TYR B HH   1  
ATOM 1756  N N    . SER B 1 19 ? -15.108 -8.068  4.209   1.00 0.00 ? 18 SER B N    1  
ATOM 1757  C CA   . SER B 1 19 ? -15.400 -9.308  3.428   1.00 0.00 ? 18 SER B CA   1  
ATOM 1758  C C    . SER B 1 19 ? -15.287 -10.542 4.329   1.00 0.00 ? 18 SER B C    1  
ATOM 1759  O O    . SER B 1 19 ? -14.492 -11.426 4.075   1.00 0.00 ? 18 SER B O    1  
ATOM 1760  C CB   . SER B 1 19 ? -14.392 -9.429  2.284   1.00 0.00 ? 18 SER B CB   1  
ATOM 1761  O OG   . SER B 1 19 ? -14.402 -8.229  1.522   1.00 0.00 ? 18 SER B OG   1  
ATOM 1762  H H    . SER B 1 19 ? -14.179 -7.799  4.364   1.00 0.00 ? 18 SER B H    1  
ATOM 1763  H HA   . SER B 1 19 ? -16.399 -9.258  3.015   1.00 0.00 ? 18 SER B HA   1  
ATOM 1764  H HB2  . SER B 1 19 ? -13.405 -9.584  2.687   1.00 0.00 ? 18 SER B HB2  1  
ATOM 1765  H HB3  . SER B 1 19 ? -14.660 -10.269 1.657   1.00 0.00 ? 18 SER B HB3  1  
ATOM 1766  H HG   . SER B 1 19 ? -13.494 -7.938  1.414   1.00 0.00 ? 18 SER B HG   1  
ATOM 1767  N N    . GLY B 1 20 ? -16.092 -10.627 5.365   1.00 0.00 ? 19 GLY B N    1  
ATOM 1768  C CA   . GLY B 1 20 ? -16.060 -11.821 6.275   1.00 0.00 ? 19 GLY B CA   1  
ATOM 1769  C C    . GLY B 1 20 ? -17.427 -12.503 6.196   1.00 0.00 ? 19 GLY B C    1  
ATOM 1770  O O    . GLY B 1 20 ? -17.613 -13.611 6.659   1.00 0.00 ? 19 GLY B O    1  
ATOM 1771  H H    . GLY B 1 20 ? -16.747 -9.922  5.544   1.00 0.00 ? 19 GLY B H    1  
ATOM 1772  H HA2  . GLY B 1 20 ? -15.285 -12.512 5.968   1.00 0.00 ? 19 GLY B HA2  1  
ATOM 1773  H HA3  . GLY B 1 20 ? -15.881 -11.503 7.290   1.00 0.00 ? 19 GLY B HA3  1  
ATOM 1774  N N    . ARG B 1 21 ? -18.373 -11.855 5.576   1.00 0.00 ? 20 ARG B N    1  
ATOM 1775  C CA   . ARG B 1 21 ? -19.728 -12.452 5.412   1.00 0.00 ? 20 ARG B CA   1  
ATOM 1776  C C    . ARG B 1 21 ? -19.633 -13.686 4.514   1.00 0.00 ? 20 ARG B C    1  
ATOM 1777  O O    . ARG B 1 21 ? -20.364 -14.636 4.704   1.00 0.00 ? 20 ARG B O    1  
ATOM 1778  C CB   . ARG B 1 21 ? -20.669 -11.426 4.775   1.00 0.00 ? 20 ARG B CB   1  
ATOM 1779  C CG   . ARG B 1 21 ? -20.469 -10.064 5.441   1.00 0.00 ? 20 ARG B CG   1  
ATOM 1780  C CD   . ARG B 1 21 ? -21.505 -9.076  4.902   1.00 0.00 ? 20 ARG B CD   1  
ATOM 1781  N NE   . ARG B 1 21 ? -21.347 -8.948  3.424   1.00 0.00 ? 20 ARG B NE   1  
ATOM 1782  C CZ   . ARG B 1 21 ? -20.439 -8.151  2.929   1.00 0.00 ? 20 ARG B CZ   1  
ATOM 1783  N NH1  . ARG B 1 21 ? -20.715 -6.891  2.730   1.00 0.00 ? 20 ARG B NH1  1  
ATOM 1784  N NH2  . ARG B 1 21 ? -19.255 -8.614  2.633   1.00 0.00 ? 20 ARG B NH2  1  
ATOM 1785  H H    . ARG B 1 21 ? -18.184 -10.975 5.187   1.00 0.00 ? 20 ARG B H    1  
ATOM 1786  H HA   . ARG B 1 21 ? -20.147 -12.796 6.346   1.00 0.00 ? 20 ARG B HA   1  
ATOM 1787  H HB2  . ARG B 1 21 ? -20.454 -11.345 3.719   1.00 0.00 ? 20 ARG B HB2  1  
ATOM 1788  H HB3  . ARG B 1 21 ? -21.692 -11.743 4.911   1.00 0.00 ? 20 ARG B HB3  1  
ATOM 1789  H HG2  . ARG B 1 21 ? -20.588 -10.165 6.510   1.00 0.00 ? 20 ARG B HG2  1  
ATOM 1790  H HG3  . ARG B 1 21 ? -19.477 -9.698  5.222   1.00 0.00 ? 20 ARG B HG3  1  
ATOM 1791  H HD2  . ARG B 1 21 ? -22.498 -9.437  5.128   1.00 0.00 ? 20 ARG B HD2  1  
ATOM 1792  H HD3  . ARG B 1 21 ? -21.359 -8.111  5.366   1.00 0.00 ? 20 ARG B HD3  1  
ATOM 1793  H HE   . ARG B 1 21 ? -21.925 -9.463  2.824   1.00 0.00 ? 20 ARG B HE   1  
ATOM 1794  H HH11 . ARG B 1 21 ? -21.623 -6.537  2.956   1.00 0.00 ? 20 ARG B HH11 1  
ATOM 1795  H HH12 . ARG B 1 21 ? -20.020 -6.280  2.351   1.00 0.00 ? 20 ARG B HH12 1  
ATOM 1796  H HH21 . ARG B 1 21 ? -19.043 -9.579  2.786   1.00 0.00 ? 20 ARG B HH21 1  
ATOM 1797  H HH22 . ARG B 1 21 ? -18.559 -8.003  2.254   1.00 0.00 ? 20 ARG B HH22 1  
ATOM 1798  N N    . GLU B 1 22 ? -18.741 -13.712 3.555   1.00 0.00 ? 21 GLU B N    1  
ATOM 1799  C CA   . GLU B 1 22 ? -18.634 -14.934 2.694   1.00 0.00 ? 21 GLU B CA   1  
ATOM 1800  C C    . GLU B 1 22 ? -17.183 -15.158 2.273   1.00 0.00 ? 21 GLU B C    1  
ATOM 1801  O O    . GLU B 1 22 ? -16.682 -16.264 2.322   1.00 0.00 ? 21 GLU B O    1  
ATOM 1802  C CB   . GLU B 1 22 ? -19.499 -14.762 1.440   1.00 0.00 ? 21 GLU B CB   1  
ATOM 1803  C CG   . GLU B 1 22 ? -20.880 -14.227 1.827   1.00 0.00 ? 21 GLU B CG   1  
ATOM 1804  C CD   . GLU B 1 22 ? -21.779 -14.195 0.590   1.00 0.00 ? 21 GLU B CD   1  
ATOM 1805  O OE1  . GLU B 1 22 ? -21.633 -13.277 -0.201  1.00 0.00 ? 21 GLU B OE1  1  
ATOM 1806  O OE2  . GLU B 1 22 ? -22.598 -15.089 0.453   1.00 0.00 ? 21 GLU B OE2  1  
ATOM 1807  H H    . GLU B 1 22 ? -18.141 -12.951 3.414   1.00 0.00 ? 21 GLU B H    1  
ATOM 1808  H HA   . GLU B 1 22 ? -18.972 -15.798 3.249   1.00 0.00 ? 21 GLU B HA   1  
ATOM 1809  H HB2  . GLU B 1 22 ? -19.020 -14.065 0.768   1.00 0.00 ? 21 GLU B HB2  1  
ATOM 1810  H HB3  . GLU B 1 22 ? -19.610 -15.716 0.947   1.00 0.00 ? 21 GLU B HB3  1  
ATOM 1811  H HG2  . GLU B 1 22 ? -21.320 -14.871 2.575   1.00 0.00 ? 21 GLU B HG2  1  
ATOM 1812  H HG3  . GLU B 1 22 ? -20.783 -13.228 2.223   1.00 0.00 ? 21 GLU B HG3  1  
ATOM 1813  N N    . GLY B 1 23 ? -16.498 -14.129 1.853   1.00 0.00 ? 22 GLY B N    1  
ATOM 1814  C CA   . GLY B 1 23 ? -15.080 -14.309 1.427   1.00 0.00 ? 22 GLY B CA   1  
ATOM 1815  C C    . GLY B 1 23 ? -14.988 -15.488 0.454   1.00 0.00 ? 22 GLY B C    1  
ATOM 1816  O O    . GLY B 1 23 ? -13.912 -15.947 0.127   1.00 0.00 ? 22 GLY B O    1  
ATOM 1817  H H    . GLY B 1 23 ? -16.914 -13.243 1.812   1.00 0.00 ? 22 GLY B H    1  
ATOM 1818  H HA2  . GLY B 1 23 ? -14.728 -13.403 0.956   1.00 0.00 ? 22 GLY B HA2  1  
ATOM 1819  H HA3  . GLY B 1 23 ? -14.464 -14.517 2.288   1.00 0.00 ? 22 GLY B HA3  1  
ATOM 1820  N N    . ASP B 1 24 ? -16.103 -15.985 -0.013  1.00 0.00 ? 23 ASP B N    1  
ATOM 1821  C CA   . ASP B 1 24 ? -16.061 -17.133 -0.963  1.00 0.00 ? 23 ASP B CA   1  
ATOM 1822  C C    . ASP B 1 24 ? -15.058 -16.809 -2.070  1.00 0.00 ? 23 ASP B C    1  
ATOM 1823  O O    . ASP B 1 24 ? -14.099 -17.524 -2.282  1.00 0.00 ? 23 ASP B O    1  
ATOM 1824  C CB   . ASP B 1 24 ? -17.449 -17.348 -1.571  1.00 0.00 ? 23 ASP B CB   1  
ATOM 1825  C CG   . ASP B 1 24 ? -18.393 -17.904 -0.504  1.00 0.00 ? 23 ASP B CG   1  
ATOM 1826  O OD1  . ASP B 1 24 ? -18.196 -17.585 0.657   1.00 0.00 ? 23 ASP B OD1  1  
ATOM 1827  O OD2  . ASP B 1 24 ? -19.297 -18.638 -0.866  1.00 0.00 ? 23 ASP B OD2  1  
ATOM 1828  H H    . ASP B 1 24 ? -16.961 -15.607 0.273   1.00 0.00 ? 23 ASP B H    1  
ATOM 1829  H HA   . ASP B 1 24 ? -15.750 -18.026 -0.440  1.00 0.00 ? 23 ASP B HA   1  
ATOM 1830  H HB2  . ASP B 1 24 ? -17.831 -16.405 -1.937  1.00 0.00 ? 23 ASP B HB2  1  
ATOM 1831  H HB3  . ASP B 1 24 ? -17.379 -18.050 -2.389  1.00 0.00 ? 23 ASP B HB3  1  
ATOM 1832  N N    . LYS B 1 25 ? -15.258 -15.719 -2.761  1.00 0.00 ? 24 LYS B N    1  
ATOM 1833  C CA   . LYS B 1 25 ? -14.301 -15.326 -3.834  1.00 0.00 ? 24 LYS B CA   1  
ATOM 1834  C C    . LYS B 1 25 ? -13.222 -14.436 -3.213  1.00 0.00 ? 24 LYS B C    1  
ATOM 1835  O O    . LYS B 1 25 ? -13.233 -14.162 -2.029  1.00 0.00 ? 24 LYS B O    1  
ATOM 1836  C CB   . LYS B 1 25 ? -15.044 -14.554 -4.927  1.00 0.00 ? 24 LYS B CB   1  
ATOM 1837  C CG   . LYS B 1 25 ? -16.086 -15.466 -5.576  1.00 0.00 ? 24 LYS B CG   1  
ATOM 1838  C CD   . LYS B 1 25 ? -16.627 -14.806 -6.845  1.00 0.00 ? 24 LYS B CD   1  
ATOM 1839  C CE   . LYS B 1 25 ? -17.720 -15.687 -7.453  1.00 0.00 ? 24 LYS B CE   1  
ATOM 1840  N NZ   . LYS B 1 25 ? -18.127 -15.133 -8.775  1.00 0.00 ? 24 LYS B NZ   1  
ATOM 1841  H H    . LYS B 1 25 ? -16.027 -15.147 -2.559  1.00 0.00 ? 24 LYS B H    1  
ATOM 1842  H HA   . LYS B 1 25 ? -13.846 -16.212 -4.257  1.00 0.00 ? 24 LYS B HA   1  
ATOM 1843  H HB2  . LYS B 1 25 ? -15.536 -13.696 -4.490  1.00 0.00 ? 24 LYS B HB2  1  
ATOM 1844  H HB3  . LYS B 1 25 ? -14.341 -14.223 -5.676  1.00 0.00 ? 24 LYS B HB3  1  
ATOM 1845  H HG2  . LYS B 1 25 ? -15.629 -16.412 -5.828  1.00 0.00 ? 24 LYS B HG2  1  
ATOM 1846  H HG3  . LYS B 1 25 ? -16.899 -15.632 -4.885  1.00 0.00 ? 24 LYS B HG3  1  
ATOM 1847  H HD2  . LYS B 1 25 ? -17.038 -13.837 -6.600  1.00 0.00 ? 24 LYS B HD2  1  
ATOM 1848  H HD3  . LYS B 1 25 ? -15.825 -14.687 -7.559  1.00 0.00 ? 24 LYS B HD3  1  
ATOM 1849  H HE2  . LYS B 1 25 ? -17.343 -16.690 -7.584  1.00 0.00 ? 24 LYS B HE2  1  
ATOM 1850  H HE3  . LYS B 1 25 ? -18.574 -15.707 -6.792  1.00 0.00 ? 24 LYS B HE3  1  
ATOM 1851  H HZ1  . LYS B 1 25 ? -17.955 -14.109 -8.791  1.00 0.00 ? 24 LYS B HZ1  1  
ATOM 1852  H HZ2  . LYS B 1 25 ? -17.572 -15.588 -9.528  1.00 0.00 ? 24 LYS B HZ2  1  
ATOM 1853  H HZ3  . LYS B 1 25 ? -19.140 -15.318 -8.931  1.00 0.00 ? 24 LYS B HZ3  1  
ATOM 1854  N N    . HIS B 1 26 ? -12.308 -13.961 -4.016  1.00 0.00 ? 25 HIS B N    1  
ATOM 1855  C CA   . HIS B 1 26 ? -11.227 -13.055 -3.514  1.00 0.00 ? 25 HIS B CA   1  
ATOM 1856  C C    . HIS B 1 26 ? -11.181 -11.842 -4.441  1.00 0.00 ? 25 HIS B C    1  
ATOM 1857  O O    . HIS B 1 26 ? -10.131 -11.419 -4.882  1.00 0.00 ? 25 HIS B O    1  
ATOM 1858  C CB   . HIS B 1 26 ? -9.884  -13.787 -3.552  1.00 0.00 ? 25 HIS B CB   1  
ATOM 1859  C CG   . HIS B 1 26 ? -10.011 -15.105 -2.838  1.00 0.00 ? 25 HIS B CG   1  
ATOM 1860  N ND1  . HIS B 1 26 ? -9.793  -15.231 -1.475  1.00 0.00 ? 25 HIS B ND1  1  
ATOM 1861  C CD2  . HIS B 1 26 ? -10.334 -16.363 -3.284  1.00 0.00 ? 25 HIS B CD2  1  
ATOM 1862  C CE1  . HIS B 1 26 ? -9.986  -16.523 -1.151  1.00 0.00 ? 25 HIS B CE1  1  
ATOM 1863  N NE2  . HIS B 1 26 ? -10.318 -17.256 -2.217  1.00 0.00 ? 25 HIS B NE2  1  
ATOM 1864  H H    . HIS B 1 26 ? -12.342 -14.186 -4.970  1.00 0.00 ? 25 HIS B H    1  
ATOM 1865  H HA   . HIS B 1 26 ? -11.443 -12.732 -2.504  1.00 0.00 ? 25 HIS B HA   1  
ATOM 1866  H HB2  . HIS B 1 26 ? -9.597  -13.960 -4.579  1.00 0.00 ? 25 HIS B HB2  1  
ATOM 1867  H HB3  . HIS B 1 26 ? -9.131  -13.185 -3.065  1.00 0.00 ? 25 HIS B HB3  1  
ATOM 1868  H HD1  . HIS B 1 26 ? -9.543  -14.511 -0.859  1.00 0.00 ? 25 HIS B HD1  1  
ATOM 1869  H HD2  . HIS B 1 26 ? -10.566 -16.620 -4.307  1.00 0.00 ? 25 HIS B HD2  1  
ATOM 1870  H HE1  . HIS B 1 26 ? -9.884  -16.918 -0.151  1.00 0.00 ? 25 HIS B HE1  1  
ATOM 1871  N N    . LYS B 1 27 ? -12.330 -11.287 -4.739  1.00 0.00 ? 26 LYS B N    1  
ATOM 1872  C CA   . LYS B 1 27 ? -12.402 -10.100 -5.641  1.00 0.00 ? 26 LYS B CA   1  
ATOM 1873  C C    . LYS B 1 27 ? -13.305 -9.032  -5.017  1.00 0.00 ? 26 LYS B C    1  
ATOM 1874  O O    . LYS B 1 27 ? -14.237 -9.346  -4.303  1.00 0.00 ? 26 LYS B O    1  
ATOM 1875  C CB   . LYS B 1 27 ? -12.997 -10.530 -6.984  1.00 0.00 ? 26 LYS B CB   1  
ATOM 1876  C CG   . LYS B 1 27 ? -12.009 -11.438 -7.718  1.00 0.00 ? 26 LYS B CG   1  
ATOM 1877  C CD   . LYS B 1 27 ? -12.501 -11.675 -9.148  1.00 0.00 ? 26 LYS B CD   1  
ATOM 1878  C CE   . LYS B 1 27 ? -11.497 -12.552 -9.897  1.00 0.00 ? 26 LYS B CE   1  
ATOM 1879  N NZ   . LYS B 1 27 ? -12.117 -13.050 -11.158 1.00 0.00 ? 26 LYS B NZ   1  
ATOM 1880  H H    . LYS B 1 27 ? -13.153 -11.659 -4.367  1.00 0.00 ? 26 LYS B H    1  
ATOM 1881  H HA   . LYS B 1 27 ? -11.414 -9.700  -5.804  1.00 0.00 ? 26 LYS B HA   1  
ATOM 1882  H HB2  . LYS B 1 27 ? -13.920 -11.065 -6.813  1.00 0.00 ? 26 LYS B HB2  1  
ATOM 1883  H HB3  . LYS B 1 27 ? -13.195 -9.656  -7.585  1.00 0.00 ? 26 LYS B HB3  1  
ATOM 1884  H HG2  . LYS B 1 27 ? -11.037 -10.966 -7.744  1.00 0.00 ? 26 LYS B HG2  1  
ATOM 1885  H HG3  . LYS B 1 27 ? -11.937 -12.383 -7.203  1.00 0.00 ? 26 LYS B HG3  1  
ATOM 1886  H HD2  . LYS B 1 27 ? -13.462 -12.169 -9.120  1.00 0.00 ? 26 LYS B HD2  1  
ATOM 1887  H HD3  . LYS B 1 27 ? -12.599 -10.728 -9.656  1.00 0.00 ? 26 LYS B HD3  1  
ATOM 1888  H HE2  . LYS B 1 27 ? -10.618 -11.970 -10.134 1.00 0.00 ? 26 LYS B HE2  1  
ATOM 1889  H HE3  . LYS B 1 27 ? -11.218 -13.390 -9.277  1.00 0.00 ? 26 LYS B HE3  1  
ATOM 1890  H HZ1  . LYS B 1 27 ? -13.143 -12.888 -11.127 1.00 0.00 ? 26 LYS B HZ1  1  
ATOM 1891  H HZ2  . LYS B 1 27 ? -11.712 -12.542 -11.969 1.00 0.00 ? 26 LYS B HZ2  1  
ATOM 1892  H HZ3  . LYS B 1 27 ? -11.929 -14.069 -11.256 1.00 0.00 ? 26 LYS B HZ3  1  
ATOM 1893  N N    . LEU B 1 28 ? -13.045 -7.774  -5.284  1.00 0.00 ? 27 LEU B N    1  
ATOM 1894  C CA   . LEU B 1 28 ? -13.893 -6.674  -4.715  1.00 0.00 ? 27 LEU B CA   1  
ATOM 1895  C C    . LEU B 1 28 ? -14.431 -5.831  -5.873  1.00 0.00 ? 27 LEU B C    1  
ATOM 1896  O O    . LEU B 1 28 ? -13.733 -5.570  -6.832  1.00 0.00 ? 27 LEU B O    1  
ATOM 1897  C CB   . LEU B 1 28 ? -13.036 -5.804  -3.791  1.00 0.00 ? 27 LEU B CB   1  
ATOM 1898  C CG   . LEU B 1 28 ? -13.928 -4.877  -2.947  1.00 0.00 ? 27 LEU B CG   1  
ATOM 1899  C CD1  . LEU B 1 28 ? -14.747 -5.692  -1.923  1.00 0.00 ? 27 LEU B CD1  1  
ATOM 1900  C CD2  . LEU B 1 28 ? -13.037 -3.869  -2.210  1.00 0.00 ? 27 LEU B CD2  1  
ATOM 1901  H H    . LEU B 1 28 ? -12.289 -7.548  -5.867  1.00 0.00 ? 27 LEU B H    1  
ATOM 1902  H HA   . LEU B 1 28 ? -14.723 -7.090  -4.163  1.00 0.00 ? 27 LEU B HA   1  
ATOM 1903  H HB2  . LEU B 1 28 ? -12.454 -6.439  -3.139  1.00 0.00 ? 27 LEU B HB2  1  
ATOM 1904  H HB3  . LEU B 1 28 ? -12.368 -5.205  -4.391  1.00 0.00 ? 27 LEU B HB3  1  
ATOM 1905  H HG   . LEU B 1 28 ? -14.604 -4.345  -3.600  1.00 0.00 ? 27 LEU B HG   1  
ATOM 1906  H HD11 . LEU B 1 28 ? -14.188 -6.562  -1.609  1.00 0.00 ? 27 LEU B HD11 1  
ATOM 1907  H HD12 . LEU B 1 28 ? -14.967 -5.080  -1.059  1.00 0.00 ? 27 LEU B HD12 1  
ATOM 1908  H HD13 . LEU B 1 28 ? -15.676 -6.007  -2.374  1.00 0.00 ? 27 LEU B HD13 1  
ATOM 1909  H HD21 . LEU B 1 28 ? -12.360 -3.406  -2.911  1.00 0.00 ? 27 LEU B HD21 1  
ATOM 1910  H HD22 . LEU B 1 28 ? -13.655 -3.112  -1.750  1.00 0.00 ? 27 LEU B HD22 1  
ATOM 1911  H HD23 . LEU B 1 28 ? -12.469 -4.381  -1.447  1.00 0.00 ? 27 LEU B HD23 1  
ATOM 1912  N N    . LYS B 1 29 ? -15.670 -5.408  -5.806  1.00 0.00 ? 28 LYS B N    1  
ATOM 1913  C CA   . LYS B 1 29 ? -16.238 -4.594  -6.925  1.00 0.00 ? 28 LYS B CA   1  
ATOM 1914  C C    . LYS B 1 29 ? -15.952 -3.110  -6.678  1.00 0.00 ? 28 LYS B C    1  
ATOM 1915  O O    . LYS B 1 29 ? -15.790 -2.681  -5.553  1.00 0.00 ? 28 LYS B O    1  
ATOM 1916  C CB   . LYS B 1 29 ? -17.750 -4.818  -7.006  1.00 0.00 ? 28 LYS B CB   1  
ATOM 1917  C CG   . LYS B 1 29 ? -18.271 -4.310  -8.352  1.00 0.00 ? 28 LYS B CG   1  
ATOM 1918  C CD   . LYS B 1 29 ? -19.787 -4.506  -8.421  1.00 0.00 ? 28 LYS B CD   1  
ATOM 1919  C CE   . LYS B 1 29 ? -20.288 -4.130  -9.816  1.00 0.00 ? 28 LYS B CE   1  
ATOM 1920  N NZ   . LYS B 1 29 ? -21.772 -4.253  -9.860  1.00 0.00 ? 28 LYS B NZ   1  
ATOM 1921  H H    . LYS B 1 29 ? -16.223 -5.631  -5.029  1.00 0.00 ? 28 LYS B H    1  
ATOM 1922  H HA   . LYS B 1 29 ? -15.774 -4.913  -7.848  1.00 0.00 ? 28 LYS B HA   1  
ATOM 1923  H HB2  . LYS B 1 29 ? -17.962 -5.874  -6.913  1.00 0.00 ? 28 LYS B HB2  1  
ATOM 1924  H HB3  . LYS B 1 29 ? -18.239 -4.281  -6.207  1.00 0.00 ? 28 LYS B HB3  1  
ATOM 1925  H HG2  . LYS B 1 29 ? -18.038 -3.259  -8.454  1.00 0.00 ? 28 LYS B HG2  1  
ATOM 1926  H HG3  . LYS B 1 29 ? -17.802 -4.862  -9.152  1.00 0.00 ? 28 LYS B HG3  1  
ATOM 1927  H HD2  . LYS B 1 29 ? -20.024 -5.541  -8.218  1.00 0.00 ? 28 LYS B HD2  1  
ATOM 1928  H HD3  . LYS B 1 29 ? -20.265 -3.876  -7.687  1.00 0.00 ? 28 LYS B HD3  1  
ATOM 1929  H HE2  . LYS B 1 29 ? -20.004 -3.112  -10.039 1.00 0.00 ? 28 LYS B HE2  1  
ATOM 1930  H HE3  . LYS B 1 29 ? -19.850 -4.794  -10.547 1.00 0.00 ? 28 LYS B HE3  1  
ATOM 1931  H HZ1  . LYS B 1 29 ? -22.047 -5.224  -9.604  1.00 0.00 ? 28 LYS B HZ1  1  
ATOM 1932  H HZ2  . LYS B 1 29 ? -22.196 -3.583  -9.187  1.00 0.00 ? 28 LYS B HZ2  1  
ATOM 1933  H HZ3  . LYS B 1 29 ? -22.110 -4.038  -10.819 1.00 0.00 ? 28 LYS B HZ3  1  
ATOM 1934  N N    . LYS B 1 30 ? -15.888 -2.322  -7.715  1.00 0.00 ? 29 LYS B N    1  
ATOM 1935  C CA   . LYS B 1 30 ? -15.612 -0.866  -7.539  1.00 0.00 ? 29 LYS B CA   1  
ATOM 1936  C C    . LYS B 1 30 ? -16.734 -0.208  -6.728  1.00 0.00 ? 29 LYS B C    1  
ATOM 1937  O O    . LYS B 1 30 ? -16.493 0.615   -5.868  1.00 0.00 ? 29 LYS B O    1  
ATOM 1938  C CB   . LYS B 1 30 ? -15.548 -0.209  -8.922  1.00 0.00 ? 29 LYS B CB   1  
ATOM 1939  C CG   . LYS B 1 30 ? -16.945 -0.225  -9.563  1.00 0.00 ? 29 LYS B CG   1  
ATOM 1940  C CD   . LYS B 1 30 ? -16.832 0.011   -11.073 1.00 0.00 ? 29 LYS B CD   1  
ATOM 1941  C CE   . LYS B 1 30 ? -18.193 0.437   -11.631 1.00 0.00 ? 29 LYS B CE   1  
ATOM 1942  N NZ   . LYS B 1 30 ? -18.073 0.685   -13.096 1.00 0.00 ? 29 LYS B NZ   1  
ATOM 1943  H H    . LYS B 1 30 ? -16.014 -2.678  -8.619  1.00 0.00 ? 29 LYS B H    1  
ATOM 1944  H HA   . LYS B 1 30 ? -14.669 -0.732  -7.032  1.00 0.00 ? 29 LYS B HA   1  
ATOM 1945  H HB2  . LYS B 1 30 ? -15.208 0.812   -8.820  1.00 0.00 ? 29 LYS B HB2  1  
ATOM 1946  H HB3  . LYS B 1 30 ? -14.860 -0.757  -9.546  1.00 0.00 ? 29 LYS B HB3  1  
ATOM 1947  H HG2  . LYS B 1 30 ? -17.411 -1.184  -9.386  1.00 0.00 ? 29 LYS B HG2  1  
ATOM 1948  H HG3  . LYS B 1 30 ? -17.549 0.555   -9.122  1.00 0.00 ? 29 LYS B HG3  1  
ATOM 1949  H HD2  . LYS B 1 30 ? -16.105 0.788   -11.264 1.00 0.00 ? 29 LYS B HD2  1  
ATOM 1950  H HD3  . LYS B 1 30 ? -16.521 -0.902  -11.555 1.00 0.00 ? 29 LYS B HD3  1  
ATOM 1951  H HE2  . LYS B 1 30 ? -18.915 -0.347  -11.457 1.00 0.00 ? 29 LYS B HE2  1  
ATOM 1952  H HE3  . LYS B 1 30 ? -18.517 1.342   -11.138 1.00 0.00 ? 29 LYS B HE3  1  
ATOM 1953  H HZ1  . LYS B 1 30 ? -17.075 0.837   -13.341 1.00 0.00 ? 29 LYS B HZ1  1  
ATOM 1954  H HZ2  . LYS B 1 30 ? -18.438 -0.139  -13.617 1.00 0.00 ? 29 LYS B HZ2  1  
ATOM 1955  H HZ3  . LYS B 1 30 ? -18.623 1.529   -13.351 1.00 0.00 ? 29 LYS B HZ3  1  
ATOM 1956  N N    . SER B 1 31 ? -17.959 -0.552  -7.014  1.00 0.00 ? 30 SER B N    1  
ATOM 1957  C CA   . SER B 1 31 ? -19.101 0.064   -6.283  1.00 0.00 ? 30 SER B CA   1  
ATOM 1958  C C    . SER B 1 31 ? -18.941 -0.144  -4.775  1.00 0.00 ? 30 SER B C    1  
ATOM 1959  O O    . SER B 1 31 ? -19.215 0.742   -3.984  1.00 0.00 ? 30 SER B O    1  
ATOM 1960  C CB   . SER B 1 31 ? -20.407 -0.581  -6.746  1.00 0.00 ? 30 SER B CB   1  
ATOM 1961  O OG   . SER B 1 31 ? -21.504 0.117   -6.172  1.00 0.00 ? 30 SER B OG   1  
ATOM 1962  H H    . SER B 1 31 ? -18.128 -1.205  -7.725  1.00 0.00 ? 30 SER B H    1  
ATOM 1963  H HA   . SER B 1 31 ? -19.132 1.122   -6.496  1.00 0.00 ? 30 SER B HA   1  
ATOM 1964  H HB2  . SER B 1 31 ? -20.476 -0.529  -7.819  1.00 0.00 ? 30 SER B HB2  1  
ATOM 1965  H HB3  . SER B 1 31 ? -20.425 -1.618  -6.436  1.00 0.00 ? 30 SER B HB3  1  
ATOM 1966  H HG   . SER B 1 31 ? -21.797 0.779   -6.803  1.00 0.00 ? 30 SER B HG   1  
ATOM 1967  N N    . GLU B 1 32 ? -18.486 -1.300  -4.362  1.00 0.00 ? 31 GLU B N    1  
ATOM 1968  C CA   . GLU B 1 32 ? -18.312 -1.530  -2.896  1.00 0.00 ? 31 GLU B CA   1  
ATOM 1969  C C    . GLU B 1 32 ? -16.966 -0.944  -2.471  1.00 0.00 ? 31 GLU B C    1  
ATOM 1970  O O    . GLU B 1 32 ? -16.817 -0.420  -1.385  1.00 0.00 ? 31 GLU B O    1  
ATOM 1971  C CB   . GLU B 1 32 ? -18.373 -3.027  -2.576  1.00 0.00 ? 31 GLU B CB   1  
ATOM 1972  C CG   . GLU B 1 32 ? -19.831 -3.492  -2.560  1.00 0.00 ? 31 GLU B CG   1  
ATOM 1973  C CD   . GLU B 1 32 ? -20.478 -3.194  -3.914  1.00 0.00 ? 31 GLU B CD   1  
ATOM 1974  O OE1  . GLU B 1 32 ? -20.883 -2.061  -4.118  1.00 0.00 ? 31 GLU B OE1  1  
ATOM 1975  O OE2  . GLU B 1 32 ? -20.558 -4.103  -4.723  1.00 0.00 ? 31 GLU B OE2  1  
ATOM 1976  H H    . GLU B 1 32 ? -18.245 -1.987  -5.017  1.00 0.00 ? 31 GLU B H    1  
ATOM 1977  H HA   . GLU B 1 32 ? -19.110 -1.000  -2.391  1.00 0.00 ? 31 GLU B HA   1  
ATOM 1978  H HB2  . GLU B 1 32 ? -17.828 -3.577  -3.329  1.00 0.00 ? 31 GLU B HB2  1  
ATOM 1979  H HB3  . GLU B 1 32 ? -17.930 -3.207  -1.608  1.00 0.00 ? 31 GLU B HB3  1  
ATOM 1980  H HG2  . GLU B 1 32 ? -19.868 -4.555  -2.368  1.00 0.00 ? 31 GLU B HG2  1  
ATOM 1981  H HG3  . GLU B 1 32 ? -20.368 -2.967  -1.784  1.00 0.00 ? 31 GLU B HG3  1  
ATOM 1982  N N    . LEU B 1 33 ? -15.990 -1.003  -3.339  1.00 0.00 ? 32 LEU B N    1  
ATOM 1983  C CA   . LEU B 1 33 ? -14.662 -0.421  -3.003  1.00 0.00 ? 32 LEU B CA   1  
ATOM 1984  C C    . LEU B 1 33 ? -14.861 1.070   -2.735  1.00 0.00 ? 32 LEU B C    1  
ATOM 1985  O O    . LEU B 1 33 ? -14.389 1.597   -1.750  1.00 0.00 ? 32 LEU B O    1  
ATOM 1986  C CB   . LEU B 1 33 ? -13.697 -0.637  -4.178  1.00 0.00 ? 32 LEU B CB   1  
ATOM 1987  C CG   . LEU B 1 33 ? -12.236 -0.493  -3.722  1.00 0.00 ? 32 LEU B CG   1  
ATOM 1988  C CD1  . LEU B 1 33 ? -11.317 -0.996  -4.841  1.00 0.00 ? 32 LEU B CD1  1  
ATOM 1989  C CD2  . LEU B 1 33 ? -11.907 0.980   -3.409  1.00 0.00 ? 32 LEU B CD2  1  
ATOM 1990  H H    . LEU B 1 33 ? -16.139 -1.410  -4.217  1.00 0.00 ? 32 LEU B H    1  
ATOM 1991  H HA   . LEU B 1 33 ? -14.279 -0.878  -2.104  1.00 0.00 ? 32 LEU B HA   1  
ATOM 1992  H HB2  . LEU B 1 33 ? -13.845 -1.630  -4.576  1.00 0.00 ? 32 LEU B HB2  1  
ATOM 1993  H HB3  . LEU B 1 33 ? -13.906 0.087   -4.952  1.00 0.00 ? 32 LEU B HB3  1  
ATOM 1994  H HG   . LEU B 1 33 ? -12.077 -1.092  -2.837  1.00 0.00 ? 32 LEU B HG   1  
ATOM 1995  H HD11 . LEU B 1 33 ? -11.575 -0.503  -5.767  1.00 0.00 ? 32 LEU B HD11 1  
ATOM 1996  H HD12 . LEU B 1 33 ? -10.290 -0.778  -4.591  1.00 0.00 ? 32 LEU B HD12 1  
ATOM 1997  H HD13 . LEU B 1 33 ? -11.441 -2.063  -4.955  1.00 0.00 ? 32 LEU B HD13 1  
ATOM 1998  H HD21 . LEU B 1 33 ? -12.437 1.631   -4.090  1.00 0.00 ? 32 LEU B HD21 1  
ATOM 1999  H HD22 . LEU B 1 33 ? -12.202 1.205   -2.398  1.00 0.00 ? 32 LEU B HD22 1  
ATOM 2000  H HD23 . LEU B 1 33 ? -10.843 1.146   -3.511  1.00 0.00 ? 32 LEU B HD23 1  
ATOM 2001  N N    . LYS B 1 34 ? -15.555 1.768   -3.592  1.00 0.00 ? 33 LYS B N    1  
ATOM 2002  C CA   . LYS B 1 34 ? -15.754 3.220   -3.349  1.00 0.00 ? 33 LYS B CA   1  
ATOM 2003  C C    . LYS B 1 34 ? -16.300 3.411   -1.933  1.00 0.00 ? 33 LYS B C    1  
ATOM 2004  O O    . LYS B 1 34 ? -15.740 4.128   -1.128  1.00 0.00 ? 33 LYS B O    1  
ATOM 2005  C CB   . LYS B 1 34 ? -16.750 3.775   -4.380  1.00 0.00 ? 33 LYS B CB   1  
ATOM 2006  C CG   . LYS B 1 34 ? -16.560 5.289   -4.540  1.00 0.00 ? 33 LYS B CG   1  
ATOM 2007  C CD   . LYS B 1 34 ? -16.891 6.004   -3.221  1.00 0.00 ? 33 LYS B CD   1  
ATOM 2008  C CE   . LYS B 1 34 ? -17.222 7.475   -3.493  1.00 0.00 ? 33 LYS B CE   1  
ATOM 2009  N NZ   . LYS B 1 34 ? -17.118 8.249   -2.224  1.00 0.00 ? 33 LYS B NZ   1  
ATOM 2010  H H    . LYS B 1 34 ? -15.935 1.348   -4.391  1.00 0.00 ? 33 LYS B H    1  
ATOM 2011  H HA   . LYS B 1 34 ? -14.803 3.723   -3.451  1.00 0.00 ? 33 LYS B HA   1  
ATOM 2012  H HB2  . LYS B 1 34 ? -16.581 3.293   -5.332  1.00 0.00 ? 33 LYS B HB2  1  
ATOM 2013  H HB3  . LYS B 1 34 ? -17.761 3.574   -4.055  1.00 0.00 ? 33 LYS B HB3  1  
ATOM 2014  H HG2  . LYS B 1 34 ? -15.534 5.493   -4.811  1.00 0.00 ? 33 LYS B HG2  1  
ATOM 2015  H HG3  . LYS B 1 34 ? -17.215 5.650   -5.319  1.00 0.00 ? 33 LYS B HG3  1  
ATOM 2016  H HD2  . LYS B 1 34 ? -17.740 5.527   -2.752  1.00 0.00 ? 33 LYS B HD2  1  
ATOM 2017  H HD3  . LYS B 1 34 ? -16.039 5.949   -2.562  1.00 0.00 ? 33 LYS B HD3  1  
ATOM 2018  H HE2  . LYS B 1 34 ? -16.526 7.874   -4.216  1.00 0.00 ? 33 LYS B HE2  1  
ATOM 2019  H HE3  . LYS B 1 34 ? -18.227 7.552   -3.880  1.00 0.00 ? 33 LYS B HE3  1  
ATOM 2020  H HZ1  . LYS B 1 34 ? -16.199 8.059   -1.776  1.00 0.00 ? 33 LYS B HZ1  1  
ATOM 2021  H HZ2  . LYS B 1 34 ? -17.200 9.266   -2.431  1.00 0.00 ? 33 LYS B HZ2  1  
ATOM 2022  H HZ3  . LYS B 1 34 ? -17.881 7.963   -1.579  1.00 0.00 ? 33 LYS B HZ3  1  
ATOM 2023  N N    . GLU B 1 35 ? -17.397 2.773   -1.627  1.00 0.00 ? 34 GLU B N    1  
ATOM 2024  C CA   . GLU B 1 35 ? -17.988 2.927   -0.261  1.00 0.00 ? 34 GLU B CA   1  
ATOM 2025  C C    . GLU B 1 35 ? -16.883 2.755   0.792   1.00 0.00 ? 34 GLU B C    1  
ATOM 2026  O O    . GLU B 1 35 ? -16.880 3.426   1.805   1.00 0.00 ? 34 GLU B O    1  
ATOM 2027  C CB   . GLU B 1 35 ? -19.083 1.876   -0.049  1.00 0.00 ? 34 GLU B CB   1  
ATOM 2028  C CG   . GLU B 1 35 ? -19.857 2.178   1.238   1.00 0.00 ? 34 GLU B CG   1  
ATOM 2029  C CD   . GLU B 1 35 ? -19.014 1.781   2.452   1.00 0.00 ? 34 GLU B CD   1  
ATOM 2030  O OE1  . GLU B 1 35 ? -18.727 0.603   2.589   1.00 0.00 ? 34 GLU B OE1  1  
ATOM 2031  O OE2  . GLU B 1 35 ? -18.670 2.661   3.224   1.00 0.00 ? 34 GLU B OE2  1  
ATOM 2032  H H    . GLU B 1 35 ? -17.837 2.214   -2.304  1.00 0.00 ? 34 GLU B H    1  
ATOM 2033  H HA   . GLU B 1 35 ? -18.405 3.918   -0.173  1.00 0.00 ? 34 GLU B HA   1  
ATOM 2034  H HB2  . GLU B 1 35 ? -19.762 1.893   -0.889  1.00 0.00 ? 34 GLU B HB2  1  
ATOM 2035  H HB3  . GLU B 1 35 ? -18.632 0.898   0.026   1.00 0.00 ? 34 GLU B HB3  1  
ATOM 2036  H HG2  . GLU B 1 35 ? -20.083 3.234   1.286   1.00 0.00 ? 34 GLU B HG2  1  
ATOM 2037  H HG3  . GLU B 1 35 ? -20.778 1.614   1.244   1.00 0.00 ? 34 GLU B HG3  1  
ATOM 2038  N N    . LEU B 1 36 ? -15.936 1.887   0.560   1.00 0.00 ? 35 LEU B N    1  
ATOM 2039  C CA   . LEU B 1 36 ? -14.833 1.717   1.554   1.00 0.00 ? 35 LEU B CA   1  
ATOM 2040  C C    . LEU B 1 36 ? -14.031 3.026   1.614   1.00 0.00 ? 35 LEU B C    1  
ATOM 2041  O O    . LEU B 1 36 ? -13.615 3.455   2.672   1.00 0.00 ? 35 LEU B O    1  
ATOM 2042  C CB   . LEU B 1 36 ? -13.927 0.528   1.139   1.00 0.00 ? 35 LEU B CB   1  
ATOM 2043  C CG   . LEU B 1 36 ? -14.154 -0.679  2.071   1.00 0.00 ? 35 LEU B CG   1  
ATOM 2044  C CD1  . LEU B 1 36 ? -13.663 -1.959  1.389   1.00 0.00 ? 35 LEU B CD1  1  
ATOM 2045  C CD2  . LEU B 1 36 ? -13.378 -0.476  3.379   1.00 0.00 ? 35 LEU B CD2  1  
ATOM 2046  H H    . LEU B 1 36 ? -15.936 1.369   -0.271  1.00 0.00 ? 35 LEU B H    1  
ATOM 2047  H HA   . LEU B 1 36 ? -15.247 1.550   2.539   1.00 0.00 ? 35 LEU B HA   1  
ATOM 2048  H HB2  . LEU B 1 36 ? -14.169 0.240   0.128   1.00 0.00 ? 35 LEU B HB2  1  
ATOM 2049  H HB3  . LEU B 1 36 ? -12.886 0.820   1.184   1.00 0.00 ? 35 LEU B HB3  1  
ATOM 2050  H HG   . LEU B 1 36 ? -15.209 -0.772  2.288   1.00 0.00 ? 35 LEU B HG   1  
ATOM 2051  H HD11 . LEU B 1 36 ? -12.687 -1.786  0.958   1.00 0.00 ? 35 LEU B HD11 1  
ATOM 2052  H HD12 . LEU B 1 36 ? -13.599 -2.754  2.117   1.00 0.00 ? 35 LEU B HD12 1  
ATOM 2053  H HD13 . LEU B 1 36 ? -14.355 -2.239  0.609   1.00 0.00 ? 35 LEU B HD13 1  
ATOM 2054  H HD21 . LEU B 1 36 ? -13.528 0.531   3.737   1.00 0.00 ? 35 LEU B HD21 1  
ATOM 2055  H HD22 . LEU B 1 36 ? -13.731 -1.178  4.119   1.00 0.00 ? 35 LEU B HD22 1  
ATOM 2056  H HD23 . LEU B 1 36 ? -12.325 -0.640  3.202   1.00 0.00 ? 35 LEU B HD23 1  
ATOM 2057  N N    . ILE B 1 37 ? -13.833 3.680   0.502   1.00 0.00 ? 36 ILE B N    1  
ATOM 2058  C CA   . ILE B 1 37 ? -13.088 4.973   0.513   1.00 0.00 ? 36 ILE B CA   1  
ATOM 2059  C C    . ILE B 1 37 ? -13.879 6.005   1.324   1.00 0.00 ? 36 ILE B C    1  
ATOM 2060  O O    . ILE B 1 37 ? -13.317 6.861   1.978   1.00 0.00 ? 36 ILE B O    1  
ATOM 2061  C CB   . ILE B 1 37 ? -12.947 5.467   -0.932  1.00 0.00 ? 36 ILE B CB   1  
ATOM 2062  C CG1  . ILE B 1 37 ? -12.356 4.343   -1.790  1.00 0.00 ? 36 ILE B CG1  1  
ATOM 2063  C CG2  . ILE B 1 37 ? -12.018 6.686   -0.975  1.00 0.00 ? 36 ILE B CG2  1  
ATOM 2064  C CD1  . ILE B 1 37 ? -12.020 4.872   -3.188  1.00 0.00 ? 36 ILE B CD1  1  
ATOM 2065  H H    . ILE B 1 37 ? -14.185 3.344   -0.348  1.00 0.00 ? 36 ILE B H    1  
ATOM 2066  H HA   . ILE B 1 37 ? -12.101 4.850   0.935   1.00 0.00 ? 36 ILE B HA   1  
ATOM 2067  H HB   . ILE B 1 37 ? -13.920 5.742   -1.314  1.00 0.00 ? 36 ILE B HB   1  
ATOM 2068  H HG12 . ILE B 1 37 ? -11.456 3.970   -1.322  1.00 0.00 ? 36 ILE B HG12 1  
ATOM 2069  H HG13 . ILE B 1 37 ? -13.073 3.542   -1.875  1.00 0.00 ? 36 ILE B HG13 1  
ATOM 2070  H HG21 . ILE B 1 37 ? -12.303 7.387   -0.205  1.00 0.00 ? 36 ILE B HG21 1  
ATOM 2071  H HG22 . ILE B 1 37 ? -10.999 6.367   -0.813  1.00 0.00 ? 36 ILE B HG22 1  
ATOM 2072  H HG23 . ILE B 1 37 ? -12.096 7.163   -1.941  1.00 0.00 ? 36 ILE B HG23 1  
ATOM 2073  H HD11 . ILE B 1 37 ? -12.825 5.502   -3.538  1.00 0.00 ? 36 ILE B HD11 1  
ATOM 2074  H HD12 . ILE B 1 37 ? -11.106 5.446   -3.144  1.00 0.00 ? 36 ILE B HD12 1  
ATOM 2075  H HD13 . ILE B 1 37 ? -11.891 4.041   -3.865  1.00 0.00 ? 36 ILE B HD13 1  
ATOM 2076  N N    . ASN B 1 38 ? -15.180 5.946   1.255   1.00 0.00 ? 37 ASN B N    1  
ATOM 2077  C CA   . ASN B 1 38 ? -16.024 6.938   1.985   1.00 0.00 ? 37 ASN B CA   1  
ATOM 2078  C C    . ASN B 1 38 ? -15.898 6.767   3.503   1.00 0.00 ? 37 ASN B C    1  
ATOM 2079  O O    . ASN B 1 38 ? -16.139 7.693   4.251   1.00 0.00 ? 37 ASN B O    1  
ATOM 2080  C CB   . ASN B 1 38 ? -17.486 6.740   1.582   1.00 0.00 ? 37 ASN B CB   1  
ATOM 2081  C CG   . ASN B 1 38 ? -18.347 7.822   2.235   1.00 0.00 ? 37 ASN B CG   1  
ATOM 2082  O OD1  . ASN B 1 38 ? -18.745 7.693   3.376   1.00 0.00 ? 37 ASN B OD1  1  
ATOM 2083  N ND2  . ASN B 1 38 ? -18.655 8.893   1.556   1.00 0.00 ? 37 ASN B ND2  1  
ATOM 2084  H H    . ASN B 1 38 ? -15.607 5.260   0.701   1.00 0.00 ? 37 ASN B H    1  
ATOM 2085  H HA   . ASN B 1 38 ? -15.717 7.935   1.708   1.00 0.00 ? 37 ASN B HA   1  
ATOM 2086  H HB2  . ASN B 1 38 ? -17.575 6.807   0.508   1.00 0.00 ? 37 ASN B HB2  1  
ATOM 2087  H HB3  . ASN B 1 38 ? -17.822 5.768   1.912   1.00 0.00 ? 37 ASN B HB3  1  
ATOM 2088  H HD21 . ASN B 1 38 ? -18.334 8.998   0.636   1.00 0.00 ? 37 ASN B HD21 1  
ATOM 2089  H HD22 . ASN B 1 38 ? -19.206 9.592   1.966   1.00 0.00 ? 37 ASN B HD22 1  
ATOM 2090  N N    . ASN B 1 39 ? -15.551 5.590   3.968   1.00 0.00 ? 38 ASN B N    1  
ATOM 2091  C CA   . ASN B 1 39 ? -15.438 5.354   5.448   1.00 0.00 ? 38 ASN B CA   1  
ATOM 2092  C C    . ASN B 1 39 ? -14.004 4.968   5.823   1.00 0.00 ? 38 ASN B C    1  
ATOM 2093  O O    . ASN B 1 39 ? -13.729 4.646   6.962   1.00 0.00 ? 38 ASN B O    1  
ATOM 2094  C CB   . ASN B 1 39 ? -16.385 4.214   5.842   1.00 0.00 ? 38 ASN B CB   1  
ATOM 2095  C CG   . ASN B 1 39 ? -16.598 4.218   7.358   1.00 0.00 ? 38 ASN B CG   1  
ATOM 2096  O OD1  . ASN B 1 39 ? -15.803 4.766   8.094   1.00 0.00 ? 38 ASN B OD1  1  
ATOM 2097  N ND2  . ASN B 1 39 ? -17.648 3.625   7.857   1.00 0.00 ? 38 ASN B ND2  1  
ATOM 2098  H H    . ASN B 1 39 ? -15.381 4.853   3.344   1.00 0.00 ? 38 ASN B H    1  
ATOM 2099  H HA   . ASN B 1 39 ? -15.716 6.247   5.992   1.00 0.00 ? 38 ASN B HA   1  
ATOM 2100  H HB2  . ASN B 1 39 ? -17.335 4.350   5.345   1.00 0.00 ? 38 ASN B HB2  1  
ATOM 2101  H HB3  . ASN B 1 39 ? -15.957 3.269   5.543   1.00 0.00 ? 38 ASN B HB3  1  
ATOM 2102  H HD21 . ASN B 1 39 ? -18.290 3.184   7.263   1.00 0.00 ? 38 ASN B HD21 1  
ATOM 2103  H HD22 . ASN B 1 39 ? -17.794 3.622   8.826   1.00 0.00 ? 38 ASN B HD22 1  
ATOM 2104  N N    . GLU B 1 40 ? -13.090 4.982   4.881   1.00 0.00 ? 39 GLU B N    1  
ATOM 2105  C CA   . GLU B 1 40 ? -11.671 4.597   5.192   1.00 0.00 ? 39 GLU B CA   1  
ATOM 2106  C C    . GLU B 1 40 ? -10.709 5.726   4.797   1.00 0.00 ? 39 GLU B C    1  
ATOM 2107  O O    . GLU B 1 40 ? -9.648  5.861   5.373   1.00 0.00 ? 39 GLU B O    1  
ATOM 2108  C CB   . GLU B 1 40 ? -11.321 3.330   4.404   1.00 0.00 ? 39 GLU B CB   1  
ATOM 2109  C CG   . GLU B 1 40 ? -10.075 2.676   5.004   1.00 0.00 ? 39 GLU B CG   1  
ATOM 2110  C CD   . GLU B 1 40 ? -10.441 2.010   6.332   1.00 0.00 ? 39 GLU B CD   1  
ATOM 2111  O OE1  . GLU B 1 40 ? -10.969 0.911   6.295   1.00 0.00 ? 39 GLU B OE1  1  
ATOM 2112  O OE2  . GLU B 1 40 ? -10.190 2.612   7.363   1.00 0.00 ? 39 GLU B OE2  1  
ATOM 2113  H H    . GLU B 1 40 ? -13.337 5.236   3.967   1.00 0.00 ? 39 GLU B H    1  
ATOM 2114  H HA   . GLU B 1 40 ? -11.561 4.398   6.249   1.00 0.00 ? 39 GLU B HA   1  
ATOM 2115  H HB2  . GLU B 1 40 ? -12.149 2.637   4.455   1.00 0.00 ? 39 GLU B HB2  1  
ATOM 2116  H HB3  . GLU B 1 40 ? -11.131 3.585   3.373   1.00 0.00 ? 39 GLU B HB3  1  
ATOM 2117  H HG2  . GLU B 1 40 ? -9.694  1.932   4.319   1.00 0.00 ? 39 GLU B HG2  1  
ATOM 2118  H HG3  . GLU B 1 40 ? -9.319  3.428   5.176   1.00 0.00 ? 39 GLU B HG3  1  
ATOM 2119  N N    . LEU B 1 41 ? -11.070 6.538   3.831   1.00 0.00 ? 40 LEU B N    1  
ATOM 2120  C CA   . LEU B 1 41 ? -10.174 7.667   3.400   1.00 0.00 ? 40 LEU B CA   1  
ATOM 2121  C C    . LEU B 1 41 ? -10.888 9.002   3.655   1.00 0.00 ? 40 LEU B C    1  
ATOM 2122  O O    . LEU B 1 41 ? -10.480 10.038  3.169   1.00 0.00 ? 40 LEU B O    1  
ATOM 2123  C CB   . LEU B 1 41 ? -9.864  7.521   1.892   1.00 0.00 ? 40 LEU B CB   1  
ATOM 2124  C CG   . LEU B 1 41 ? -8.546  6.750   1.667   1.00 0.00 ? 40 LEU B CG   1  
ATOM 2125  C CD1  . LEU B 1 41 ? -7.337  7.573   2.161   1.00 0.00 ? 40 LEU B CD1  1  
ATOM 2126  C CD2  . LEU B 1 41 ? -8.599  5.402   2.403   1.00 0.00 ? 40 LEU B CD2  1  
ATOM 2127  H H    . LEU B 1 41 ? -11.934 6.409   3.388   1.00 0.00 ? 40 LEU B H    1  
ATOM 2128  H HA   . LEU B 1 41 ? -9.254  7.651   3.965   1.00 0.00 ? 40 LEU B HA   1  
ATOM 2129  H HB2  . LEU B 1 41 ? -10.670 6.980   1.422   1.00 0.00 ? 40 LEU B HB2  1  
ATOM 2130  H HB3  . LEU B 1 41 ? -9.783  8.498   1.435   1.00 0.00 ? 40 LEU B HB3  1  
ATOM 2131  H HG   . LEU B 1 41 ? -8.430  6.567   0.608   1.00 0.00 ? 40 LEU B HG   1  
ATOM 2132  H HD11 . LEU B 1 41 ? -7.554  8.630   2.087   1.00 0.00 ? 40 LEU B HD11 1  
ATOM 2133  H HD12 . LEU B 1 41 ? -7.111  7.325   3.189   1.00 0.00 ? 40 LEU B HD12 1  
ATOM 2134  H HD13 . LEU B 1 41 ? -6.479  7.346   1.547   1.00 0.00 ? 40 LEU B HD13 1  
ATOM 2135  H HD21 . LEU B 1 41 ? -9.588  4.980   2.315   1.00 0.00 ? 40 LEU B HD21 1  
ATOM 2136  H HD22 . LEU B 1 41 ? -7.880  4.726   1.964   1.00 0.00 ? 40 LEU B HD22 1  
ATOM 2137  H HD23 . LEU B 1 41 ? -8.361  5.550   3.445   1.00 0.00 ? 40 LEU B HD23 1  
ATOM 2138  N N    . SER B 1 42 ? -11.952 8.981   4.409   1.00 0.00 ? 41 SER B N    1  
ATOM 2139  C CA   . SER B 1 42 ? -12.697 10.242  4.690   1.00 0.00 ? 41 SER B CA   1  
ATOM 2140  C C    . SER B 1 42 ? -11.897 11.125  5.654   1.00 0.00 ? 41 SER B C    1  
ATOM 2141  O O    . SER B 1 42 ? -12.048 12.330  5.672   1.00 0.00 ? 41 SER B O    1  
ATOM 2142  C CB   . SER B 1 42 ? -14.051 9.903   5.316   1.00 0.00 ? 41 SER B CB   1  
ATOM 2143  O OG   . SER B 1 42 ? -13.871 8.902   6.310   1.00 0.00 ? 41 SER B OG   1  
ATOM 2144  H H    . SER B 1 42 ? -12.267 8.133   4.787   1.00 0.00 ? 41 SER B H    1  
ATOM 2145  H HA   . SER B 1 42 ? -12.857 10.777  3.766   1.00 0.00 ? 41 SER B HA   1  
ATOM 2146  H HB2  . SER B 1 42 ? -14.473 10.783  5.772   1.00 0.00 ? 41 SER B HB2  1  
ATOM 2147  H HB3  . SER B 1 42 ? -14.721 9.545   4.547   1.00 0.00 ? 41 SER B HB3  1  
ATOM 2148  H HG   . SER B 1 42 ? -12.936 8.691   6.353   1.00 0.00 ? 41 SER B HG   1  
ATOM 2149  N N    . HIS B 1 43 ? -11.055 10.539  6.461   1.00 0.00 ? 42 HIS B N    1  
ATOM 2150  C CA   . HIS B 1 43 ? -10.261 11.352  7.427   1.00 0.00 ? 42 HIS B CA   1  
ATOM 2151  C C    . HIS B 1 43 ? -9.149  12.109  6.695   1.00 0.00 ? 42 HIS B C    1  
ATOM 2152  O O    . HIS B 1 43 ? -8.979  13.299  6.867   1.00 0.00 ? 42 HIS B O    1  
ATOM 2153  C CB   . HIS B 1 43 ? -9.639  10.428  8.476   1.00 0.00 ? 42 HIS B CB   1  
ATOM 2154  C CG   . HIS B 1 43 ? -10.731 9.738   9.247   1.00 0.00 ? 42 HIS B CG   1  
ATOM 2155  N ND1  . HIS B 1 43 ? -11.104 8.429   8.988   1.00 0.00 ? 42 HIS B ND1  1  
ATOM 2156  C CD2  . HIS B 1 43 ? -11.538 10.162  10.273  1.00 0.00 ? 42 HIS B CD2  1  
ATOM 2157  C CE1  . HIS B 1 43 ? -12.096 8.114   9.841   1.00 0.00 ? 42 HIS B CE1  1  
ATOM 2158  N NE2  . HIS B 1 43 ? -12.399 9.135   10.647  1.00 0.00 ? 42 HIS B NE2  1  
ATOM 2159  H H    . HIS B 1 43 ? -10.943 9.566   6.437   1.00 0.00 ? 42 HIS B H    1  
ATOM 2160  H HA   . HIS B 1 43 ? -10.912 12.060  7.917   1.00 0.00 ? 42 HIS B HA   1  
ATOM 2161  H HB2  . HIS B 1 43 ? -9.023  9.690   7.985   1.00 0.00 ? 42 HIS B HB2  1  
ATOM 2162  H HB3  . HIS B 1 43 ? -9.033  11.010  9.154   1.00 0.00 ? 42 HIS B HB3  1  
ATOM 2163  H HD1  . HIS B 1 43 ? -10.717 7.840   8.307   1.00 0.00 ? 42 HIS B HD1  1  
ATOM 2164  H HD2  . HIS B 1 43 ? -11.509 11.144  10.722  1.00 0.00 ? 42 HIS B HD2  1  
ATOM 2165  H HE1  . HIS B 1 43 ? -12.586 7.152   9.871   1.00 0.00 ? 42 HIS B HE1  1  
ATOM 2166  N N    . PHE B 1 44 ? -8.382  11.427  5.889   1.00 0.00 ? 43 PHE B N    1  
ATOM 2167  C CA   . PHE B 1 44 ? -7.273  12.109  5.161   1.00 0.00 ? 43 PHE B CA   1  
ATOM 2168  C C    . PHE B 1 44 ? -7.846  13.112  4.157   1.00 0.00 ? 43 PHE B C    1  
ATOM 2169  O O    . PHE B 1 44 ? -7.164  14.011  3.706   1.00 0.00 ? 43 PHE B O    1  
ATOM 2170  C CB   . PHE B 1 44 ? -6.430  11.066  4.424   1.00 0.00 ? 43 PHE B CB   1  
ATOM 2171  C CG   . PHE B 1 44 ? -5.620  10.279  5.429   1.00 0.00 ? 43 PHE B CG   1  
ATOM 2172  C CD1  . PHE B 1 44 ? -4.506  10.866  6.042   1.00 0.00 ? 43 PHE B CD1  1  
ATOM 2173  C CD2  . PHE B 1 44 ? -5.984  8.965   5.752   1.00 0.00 ? 43 PHE B CD2  1  
ATOM 2174  C CE1  . PHE B 1 44 ? -3.756  10.141  6.975   1.00 0.00 ? 43 PHE B CE1  1  
ATOM 2175  C CE2  . PHE B 1 44 ? -5.234  8.240   6.686   1.00 0.00 ? 43 PHE B CE2  1  
ATOM 2176  C CZ   . PHE B 1 44 ? -4.120  8.829   7.298   1.00 0.00 ? 43 PHE B CZ   1  
ATOM 2177  H H    . PHE B 1 44 ? -8.528  10.465  5.770   1.00 0.00 ? 43 PHE B H    1  
ATOM 2178  H HA   . PHE B 1 44 ? -6.651  12.633  5.871   1.00 0.00 ? 43 PHE B HA   1  
ATOM 2179  H HB2  . PHE B 1 44 ? -7.081  10.397  3.878   1.00 0.00 ? 43 PHE B HB2  1  
ATOM 2180  H HB3  . PHE B 1 44 ? -5.764  11.562  3.735   1.00 0.00 ? 43 PHE B HB3  1  
ATOM 2181  H HD1  . PHE B 1 44 ? -4.224  11.878  5.795   1.00 0.00 ? 43 PHE B HD1  1  
ATOM 2182  H HD2  . PHE B 1 44 ? -6.843  8.511   5.280   1.00 0.00 ? 43 PHE B HD2  1  
ATOM 2183  H HE1  . PHE B 1 44 ? -2.897  10.594  7.447   1.00 0.00 ? 43 PHE B HE1  1  
ATOM 2184  H HE2  . PHE B 1 44 ? -5.514  7.227   6.935   1.00 0.00 ? 43 PHE B HE2  1  
ATOM 2185  H HZ   . PHE B 1 44 ? -3.542  8.272   8.019   1.00 0.00 ? 43 PHE B HZ   1  
ATOM 2186  N N    . LEU B 1 45 ? -9.088  12.956  3.791   1.00 0.00 ? 44 LEU B N    1  
ATOM 2187  C CA   . LEU B 1 45 ? -9.697  13.889  2.802   1.00 0.00 ? 44 LEU B CA   1  
ATOM 2188  C C    . LEU B 1 45 ? -9.404  15.338  3.200   1.00 0.00 ? 44 LEU B C    1  
ATOM 2189  O O    . LEU B 1 45 ? -9.336  16.218  2.365   1.00 0.00 ? 44 LEU B O    1  
ATOM 2190  C CB   . LEU B 1 45 ? -11.214 13.661  2.756   1.00 0.00 ? 44 LEU B CB   1  
ATOM 2191  C CG   . LEU B 1 45 ? -11.887 14.693  1.836   1.00 0.00 ? 44 LEU B CG   1  
ATOM 2192  C CD1  . LEU B 1 45 ? -11.229 14.679  0.448   1.00 0.00 ? 44 LEU B CD1  1  
ATOM 2193  C CD2  . LEU B 1 45 ? -13.372 14.342  1.701   1.00 0.00 ? 44 LEU B CD2  1  
ATOM 2194  H H    . LEU B 1 45 ? -9.617  12.217  4.158   1.00 0.00 ? 44 LEU B H    1  
ATOM 2195  H HA   . LEU B 1 45 ? -9.276  13.692  1.831   1.00 0.00 ? 44 LEU B HA   1  
ATOM 2196  H HB2  . LEU B 1 45 ? -11.413 12.667  2.382   1.00 0.00 ? 44 LEU B HB2  1  
ATOM 2197  H HB3  . LEU B 1 45 ? -11.619 13.755  3.752   1.00 0.00 ? 44 LEU B HB3  1  
ATOM 2198  H HG   . LEU B 1 45 ? -11.792 15.678  2.268   1.00 0.00 ? 44 LEU B HG   1  
ATOM 2199  H HD11 . LEU B 1 45 ? -10.995 13.662  0.168   1.00 0.00 ? 44 LEU B HD11 1  
ATOM 2200  H HD12 . LEU B 1 45 ? -11.904 15.106  -0.280  1.00 0.00 ? 44 LEU B HD12 1  
ATOM 2201  H HD13 . LEU B 1 45 ? -10.320 15.262  0.474   1.00 0.00 ? 44 LEU B HD13 1  
ATOM 2202  H HD21 . LEU B 1 45 ? -13.829 14.329  2.679   1.00 0.00 ? 44 LEU B HD21 1  
ATOM 2203  H HD22 . LEU B 1 45 ? -13.861 15.080  1.083   1.00 0.00 ? 44 LEU B HD22 1  
ATOM 2204  H HD23 . LEU B 1 45 ? -13.471 13.368  1.244   1.00 0.00 ? 44 LEU B HD23 1  
ATOM 2205  N N    . GLU B 1 46 ? -9.237  15.601  4.464   1.00 0.00 ? 45 GLU B N    1  
ATOM 2206  C CA   . GLU B 1 46 ? -8.960  16.998  4.895   1.00 0.00 ? 45 GLU B CA   1  
ATOM 2207  C C    . GLU B 1 46 ? -7.519  17.379  4.550   1.00 0.00 ? 45 GLU B C    1  
ATOM 2208  O O    . GLU B 1 46 ? -7.237  18.499  4.174   1.00 0.00 ? 45 GLU B O    1  
ATOM 2209  C CB   . GLU B 1 46 ? -9.168  17.114  6.406   1.00 0.00 ? 45 GLU B CB   1  
ATOM 2210  C CG   . GLU B 1 46 ? -9.042  18.579  6.829   1.00 0.00 ? 45 GLU B CG   1  
ATOM 2211  C CD   . GLU B 1 46 ? -9.529  18.739  8.270   1.00 0.00 ? 45 GLU B CD   1  
ATOM 2212  O OE1  . GLU B 1 46 ? -9.479  17.765  9.003   1.00 0.00 ? 45 GLU B OE1  1  
ATOM 2213  O OE2  . GLU B 1 46 ? -9.944  19.833  8.616   1.00 0.00 ? 45 GLU B OE2  1  
ATOM 2214  H H    . GLU B 1 46 ? -9.298  14.885  5.130   1.00 0.00 ? 45 GLU B H    1  
ATOM 2215  H HA   . GLU B 1 46 ? -9.636  17.668  4.389   1.00 0.00 ? 45 GLU B HA   1  
ATOM 2216  H HB2  . GLU B 1 46 ? -10.152 16.747  6.663   1.00 0.00 ? 45 GLU B HB2  1  
ATOM 2217  H HB3  . GLU B 1 46 ? -8.420  16.528  6.919   1.00 0.00 ? 45 GLU B HB3  1  
ATOM 2218  H HG2  . GLU B 1 46 ? -8.008  18.885  6.760   1.00 0.00 ? 45 GLU B HG2  1  
ATOM 2219  H HG3  . GLU B 1 46 ? -9.644  19.194  6.177   1.00 0.00 ? 45 GLU B HG3  1  
ATOM 2220  N N    . GLU B 1 47 ? -6.600  16.464  4.697   1.00 0.00 ? 46 GLU B N    1  
ATOM 2221  C CA   . GLU B 1 47 ? -5.168  16.784  4.402   1.00 0.00 ? 46 GLU B CA   1  
ATOM 2222  C C    . GLU B 1 47 ? -4.832  16.479  2.938   1.00 0.00 ? 46 GLU B C    1  
ATOM 2223  O O    . GLU B 1 47 ? -3.903  15.751  2.650   1.00 0.00 ? 46 GLU B O    1  
ATOM 2224  C CB   . GLU B 1 47 ? -4.269  15.939  5.308   1.00 0.00 ? 46 GLU B CB   1  
ATOM 2225  C CG   . GLU B 1 47 ? -4.591  16.243  6.772   1.00 0.00 ? 46 GLU B CG   1  
ATOM 2226  C CD   . GLU B 1 47 ? -3.539  15.592  7.672   1.00 0.00 ? 46 GLU B CD   1  
ATOM 2227  O OE1  . GLU B 1 47 ? -2.364  15.767  7.397   1.00 0.00 ? 46 GLU B OE1  1  
ATOM 2228  O OE2  . GLU B 1 47 ? -3.927  14.929  8.619   1.00 0.00 ? 46 GLU B OE2  1  
ATOM 2229  H H    . GLU B 1 47 ? -6.847  15.574  5.023   1.00 0.00 ? 46 GLU B H    1  
ATOM 2230  H HA   . GLU B 1 47 ? -4.982  17.830  4.599   1.00 0.00 ? 46 GLU B HA   1  
ATOM 2231  H HB2  . GLU B 1 47 ? -4.442  14.891  5.110   1.00 0.00 ? 46 GLU B HB2  1  
ATOM 2232  H HB3  . GLU B 1 47 ? -3.235  16.178  5.112   1.00 0.00 ? 46 GLU B HB3  1  
ATOM 2233  H HG2  . GLU B 1 47 ? -4.588  17.312  6.927   1.00 0.00 ? 46 GLU B HG2  1  
ATOM 2234  H HG3  . GLU B 1 47 ? -5.565  15.847  7.016   1.00 0.00 ? 46 GLU B HG3  1  
ATOM 2235  N N    . ILE B 1 48 ? -5.563  17.051  2.011   1.00 0.00 ? 47 ILE B N    1  
ATOM 2236  C CA   . ILE B 1 48 ? -5.275  16.825  0.555   1.00 0.00 ? 47 ILE B CA   1  
ATOM 2237  C C    . ILE B 1 48 ? -5.181  18.185  -0.143  1.00 0.00 ? 47 ILE B C    1  
ATOM 2238  O O    . ILE B 1 48 ? -5.616  19.192  0.380   1.00 0.00 ? 47 ILE B O    1  
ATOM 2239  C CB   . ILE B 1 48 ? -6.391  15.975  -0.072  1.00 0.00 ? 47 ILE B CB   1  
ATOM 2240  C CG1  . ILE B 1 48 ? -6.243  14.530  0.435   1.00 0.00 ? 47 ILE B CG1  1  
ATOM 2241  C CG2  . ILE B 1 48 ? -6.268  16.005  -1.606  1.00 0.00 ? 47 ILE B CG2  1  
ATOM 2242  C CD1  . ILE B 1 48 ? -7.366  13.643  -0.116  1.00 0.00 ? 47 ILE B CD1  1  
ATOM 2243  H H    . ILE B 1 48 ? -6.295  17.649  2.272   1.00 0.00 ? 47 ILE B H    1  
ATOM 2244  H HA   . ILE B 1 48 ? -4.329  16.311  0.441   1.00 0.00 ? 47 ILE B HA   1  
ATOM 2245  H HB   . ILE B 1 48 ? -7.354  16.367  0.222   1.00 0.00 ? 47 ILE B HB   1  
ATOM 2246  H HG12 . ILE B 1 48 ? -5.289  14.137  0.114   1.00 0.00 ? 47 ILE B HG12 1  
ATOM 2247  H HG13 . ILE B 1 48 ? -6.284  14.527  1.514   1.00 0.00 ? 47 ILE B HG13 1  
ATOM 2248  H HG21 . ILE B 1 48 ? -5.244  15.811  -1.888  1.00 0.00 ? 47 ILE B HG21 1  
ATOM 2249  H HG22 . ILE B 1 48 ? -6.909  15.256  -2.041  1.00 0.00 ? 47 ILE B HG22 1  
ATOM 2250  H HG23 . ILE B 1 48 ? -6.563  16.977  -1.971  1.00 0.00 ? 47 ILE B HG23 1  
ATOM 2251  H HD11 . ILE B 1 48 ? -8.276  14.218  -0.210  1.00 0.00 ? 47 ILE B HD11 1  
ATOM 2252  H HD12 . ILE B 1 48 ? -7.079  13.265  -1.085  1.00 0.00 ? 47 ILE B HD12 1  
ATOM 2253  H HD13 . ILE B 1 48 ? -7.531  12.814  0.556   1.00 0.00 ? 47 ILE B HD13 1  
ATOM 2254  N N    . LYS B 1 49 ? -4.609  18.225  -1.318  1.00 0.00 ? 48 LYS B N    1  
ATOM 2255  C CA   . LYS B 1 49 ? -4.477  19.521  -2.050  1.00 0.00 ? 48 LYS B CA   1  
ATOM 2256  C C    . LYS B 1 49 ? -4.675  19.292  -3.550  1.00 0.00 ? 48 LYS B C    1  
ATOM 2257  O O    . LYS B 1 49 ? -5.389  20.025  -4.205  1.00 0.00 ? 48 LYS B O    1  
ATOM 2258  C CB   . LYS B 1 49 ? -3.081  20.099  -1.809  1.00 0.00 ? 48 LYS B CB   1  
ATOM 2259  C CG   . LYS B 1 49 ? -2.930  21.404  -2.593  1.00 0.00 ? 48 LYS B CG   1  
ATOM 2260  C CD   . LYS B 1 49 ? -1.676  22.143  -2.121  1.00 0.00 ? 48 LYS B CD   1  
ATOM 2261  C CE   . LYS B 1 49 ? -1.320  23.239  -3.127  1.00 0.00 ? 48 LYS B CE   1  
ATOM 2262  N NZ   . LYS B 1 49 ? -0.258  24.113  -2.553  1.00 0.00 ? 48 LYS B NZ   1  
ATOM 2263  H H    . LYS B 1 49 ? -4.257  17.404  -1.721  1.00 0.00 ? 48 LYS B H    1  
ATOM 2264  H HA   . LYS B 1 49 ? -5.219  20.227  -1.701  1.00 0.00 ? 48 LYS B HA   1  
ATOM 2265  H HB2  . LYS B 1 49 ? -2.949  20.293  -0.754  1.00 0.00 ? 48 LYS B HB2  1  
ATOM 2266  H HB3  . LYS B 1 49 ? -2.336  19.392  -2.142  1.00 0.00 ? 48 LYS B HB3  1  
ATOM 2267  H HG2  . LYS B 1 49 ? -2.843  21.182  -3.647  1.00 0.00 ? 48 LYS B HG2  1  
ATOM 2268  H HG3  . LYS B 1 49 ? -3.796  22.026  -2.426  1.00 0.00 ? 48 LYS B HG3  1  
ATOM 2269  H HD2  . LYS B 1 49 ? -1.863  22.587  -1.154  1.00 0.00 ? 48 LYS B HD2  1  
ATOM 2270  H HD3  . LYS B 1 49 ? -0.855  21.447  -2.045  1.00 0.00 ? 48 LYS B HD3  1  
ATOM 2271  H HE2  . LYS B 1 49 ? -0.960  22.787  -4.039  1.00 0.00 ? 48 LYS B HE2  1  
ATOM 2272  H HE3  . LYS B 1 49 ? -2.197  23.831  -3.340  1.00 0.00 ? 48 LYS B HE3  1  
ATOM 2273  H HZ1  . LYS B 1 49 ? 0.243   23.601  -1.799  1.00 0.00 ? 48 LYS B HZ1  1  
ATOM 2274  H HZ2  . LYS B 1 49 ? 0.417   24.374  -3.299  1.00 0.00 ? 48 LYS B HZ2  1  
ATOM 2275  H HZ3  . LYS B 1 49 ? -0.692  24.973  -2.160  1.00 0.00 ? 48 LYS B HZ3  1  
ATOM 2276  N N    . GLU B 1 50 ? -4.050  18.289  -4.106  1.00 0.00 ? 49 GLU B N    1  
ATOM 2277  C CA   . GLU B 1 50 ? -4.214  18.042  -5.567  1.00 0.00 ? 49 GLU B CA   1  
ATOM 2278  C C    . GLU B 1 50 ? -5.623  17.502  -5.830  1.00 0.00 ? 49 GLU B C    1  
ATOM 2279  O O    . GLU B 1 50 ? -5.796  16.401  -6.314  1.00 0.00 ? 49 GLU B O    1  
ATOM 2280  C CB   . GLU B 1 50 ? -3.172  17.025  -6.041  1.00 0.00 ? 49 GLU B CB   1  
ATOM 2281  C CG   . GLU B 1 50 ? -1.802  17.384  -5.460  1.00 0.00 ? 49 GLU B CG   1  
ATOM 2282  C CD   . GLU B 1 50 ? -1.406  18.789  -5.917  1.00 0.00 ? 49 GLU B CD   1  
ATOM 2283  O OE1  . GLU B 1 50 ? -1.893  19.741  -5.331  1.00 0.00 ? 49 GLU B OE1  1  
ATOM 2284  O OE2  . GLU B 1 50 ? -0.621  18.889  -6.847  1.00 0.00 ? 49 GLU B OE2  1  
ATOM 2285  H H    . GLU B 1 50 ? -3.473  17.707  -3.569  1.00 0.00 ? 49 GLU B H    1  
ATOM 2286  H HA   . GLU B 1 50 ? -4.074  18.977  -6.090  1.00 0.00 ? 49 GLU B HA   1  
ATOM 2287  H HB2  . GLU B 1 50 ? -3.457  16.037  -5.710  1.00 0.00 ? 49 GLU B HB2  1  
ATOM 2288  H HB3  . GLU B 1 50 ? -3.119  17.043  -7.118  1.00 0.00 ? 49 GLU B HB3  1  
ATOM 2289  H HG2  . GLU B 1 50 ? -1.848  17.354  -4.381  1.00 0.00 ? 49 GLU B HG2  1  
ATOM 2290  H HG3  . GLU B 1 50 ? -1.067  16.674  -5.809  1.00 0.00 ? 49 GLU B HG3  1  
ATOM 2291  N N    . GLN B 1 51 ? -6.629  18.261  -5.492  1.00 0.00 ? 50 GLN B N    1  
ATOM 2292  C CA   . GLN B 1 51 ? -8.030  17.790  -5.693  1.00 0.00 ? 50 GLN B CA   1  
ATOM 2293  C C    . GLN B 1 51 ? -8.189  17.154  -7.078  1.00 0.00 ? 50 GLN B C    1  
ATOM 2294  O O    . GLN B 1 51 ? -9.026  16.297  -7.284  1.00 0.00 ? 50 GLN B O    1  
ATOM 2295  C CB   . GLN B 1 51 ? -8.982  18.983  -5.578  1.00 0.00 ? 50 GLN B CB   1  
ATOM 2296  C CG   . GLN B 1 51 ? -9.050  19.445  -4.121  1.00 0.00 ? 50 GLN B CG   1  
ATOM 2297  C CD   . GLN B 1 51 ? -9.803  18.405  -3.288  1.00 0.00 ? 50 GLN B CD   1  
ATOM 2298  O OE1  . GLN B 1 51 ? -9.204  17.672  -2.525  1.00 0.00 ? 50 GLN B OE1  1  
ATOM 2299  N NE2  . GLN B 1 51 ? -11.099 18.309  -3.401  1.00 0.00 ? 50 GLN B NE2  1  
ATOM 2300  H H    . GLN B 1 51 ? -6.465  19.137  -5.084  1.00 0.00 ? 50 GLN B H    1  
ATOM 2301  H HA   . GLN B 1 51 ? -8.269  17.075  -4.920  1.00 0.00 ? 50 GLN B HA   1  
ATOM 2302  H HB2  . GLN B 1 51 ? -8.620  19.792  -6.197  1.00 0.00 ? 50 GLN B HB2  1  
ATOM 2303  H HB3  . GLN B 1 51 ? -9.967  18.690  -5.908  1.00 0.00 ? 50 GLN B HB3  1  
ATOM 2304  H HG2  . GLN B 1 51 ? -8.049  19.562  -3.733  1.00 0.00 ? 50 GLN B HG2  1  
ATOM 2305  H HG3  . GLN B 1 51 ? -9.569  20.390  -4.067  1.00 0.00 ? 50 GLN B HG3  1  
ATOM 2306  H HE21 . GLN B 1 51 ? -11.583 18.900  -4.016  1.00 0.00 ? 50 GLN B HE21 1  
ATOM 2307  H HE22 . GLN B 1 51 ? -11.590 17.646  -2.872  1.00 0.00 ? 50 GLN B HE22 1  
ATOM 2308  N N    . GLU B 1 52 ? -7.400  17.569  -8.032  1.00 0.00 ? 51 GLU B N    1  
ATOM 2309  C CA   . GLU B 1 52 ? -7.521  16.988  -9.401  1.00 0.00 ? 51 GLU B CA   1  
ATOM 2310  C C    . GLU B 1 52 ? -6.981  15.556  -9.412  1.00 0.00 ? 51 GLU B C    1  
ATOM 2311  O O    . GLU B 1 52 ? -7.378  14.749  -10.229 1.00 0.00 ? 51 GLU B O    1  
ATOM 2312  C CB   . GLU B 1 52 ? -6.767  17.850  -10.415 1.00 0.00 ? 51 GLU B CB   1  
ATOM 2313  C CG   . GLU B 1 52 ? -5.340  18.094  -9.919  1.00 0.00 ? 51 GLU B CG   1  
ATOM 2314  C CD   . GLU B 1 52 ? -4.570  18.911  -10.958 1.00 0.00 ? 51 GLU B CD   1  
ATOM 2315  O OE1  . GLU B 1 52 ? -5.143  19.848  -11.489 1.00 0.00 ? 51 GLU B OE1  1  
ATOM 2316  O OE2  . GLU B 1 52 ? -3.420  18.587  -11.204 1.00 0.00 ? 51 GLU B OE2  1  
ATOM 2317  H H    . GLU B 1 52 ? -6.731  18.260  -7.847  1.00 0.00 ? 51 GLU B H    1  
ATOM 2318  H HA   . GLU B 1 52 ? -8.566  16.932  -9.665  1.00 0.00 ? 51 GLU B HA   1  
ATOM 2319  H HB2  . GLU B 1 52 ? -6.735  17.341  -11.367 1.00 0.00 ? 51 GLU B HB2  1  
ATOM 2320  H HB3  . GLU B 1 52 ? -7.272  18.797  -10.530 1.00 0.00 ? 51 GLU B HB3  1  
ATOM 2321  H HG2  . GLU B 1 52 ? -5.372  18.637  -8.985  1.00 0.00 ? 51 GLU B HG2  1  
ATOM 2322  H HG3  . GLU B 1 52 ? -4.844  17.147  -9.768  1.00 0.00 ? 51 GLU B HG3  1  
ATOM 2323  N N    . VAL B 1 53 ? -6.122  15.207  -8.497  1.00 0.00 ? 52 VAL B N    1  
ATOM 2324  C CA   . VAL B 1 53 ? -5.631  13.801  -8.461  1.00 0.00 ? 52 VAL B CA   1  
ATOM 2325  C C    . VAL B 1 53 ? -6.767  12.929  -7.927  1.00 0.00 ? 52 VAL B C    1  
ATOM 2326  O O    . VAL B 1 53 ? -7.089  11.905  -8.495  1.00 0.00 ? 52 VAL B O    1  
ATOM 2327  C CB   . VAL B 1 53 ? -4.417  13.697  -7.529  1.00 0.00 ? 52 VAL B CB   1  
ATOM 2328  C CG1  . VAL B 1 53 ? -4.090  12.224  -7.260  1.00 0.00 ? 52 VAL B CG1  1  
ATOM 2329  C CG2  . VAL B 1 53 ? -3.209  14.370  -8.185  1.00 0.00 ? 52 VAL B CG2  1  
ATOM 2330  H H    . VAL B 1 53 ? -5.845  15.837  -7.798  1.00 0.00 ? 52 VAL B H    1  
ATOM 2331  H HA   . VAL B 1 53 ? -5.363  13.466  -9.453  1.00 0.00 ? 52 VAL B HA   1  
ATOM 2332  H HB   . VAL B 1 53 ? -4.640  14.190  -6.594  1.00 0.00 ? 52 VAL B HB   1  
ATOM 2333  H HG11 . VAL B 1 53 ? -4.105  11.676  -8.191  1.00 0.00 ? 52 VAL B HG11 1  
ATOM 2334  H HG12 . VAL B 1 53 ? -3.110  12.148  -6.813  1.00 0.00 ? 52 VAL B HG12 1  
ATOM 2335  H HG13 . VAL B 1 53 ? -4.826  11.808  -6.588  1.00 0.00 ? 52 VAL B HG13 1  
ATOM 2336  H HG21 . VAL B 1 53 ? -3.513  15.306  -8.628  1.00 0.00 ? 52 VAL B HG21 1  
ATOM 2337  H HG22 . VAL B 1 53 ? -2.451  14.554  -7.438  1.00 0.00 ? 52 VAL B HG22 1  
ATOM 2338  H HG23 . VAL B 1 53 ? -2.807  13.723  -8.952  1.00 0.00 ? 52 VAL B HG23 1  
ATOM 2339  N N    . VAL B 1 54 ? -7.386  13.322  -6.850  1.00 0.00 ? 53 VAL B N    1  
ATOM 2340  C CA   . VAL B 1 54 ? -8.504  12.503  -6.309  1.00 0.00 ? 53 VAL B CA   1  
ATOM 2341  C C    . VAL B 1 54 ? -9.638  12.476  -7.332  1.00 0.00 ? 53 VAL B C    1  
ATOM 2342  O O    . VAL B 1 54 ? -10.326 11.488  -7.493  1.00 0.00 ? 53 VAL B O    1  
ATOM 2343  C CB   . VAL B 1 54 ? -9.012  13.128  -5.011  1.00 0.00 ? 53 VAL B CB   1  
ATOM 2344  C CG1  . VAL B 1 54 ? -10.088 12.230  -4.398  1.00 0.00 ? 53 VAL B CG1  1  
ATOM 2345  C CG2  . VAL B 1 54 ? -7.852  13.275  -4.027  1.00 0.00 ? 53 VAL B CG2  1  
ATOM 2346  H H    . VAL B 1 54 ? -7.126  14.149  -6.390  1.00 0.00 ? 53 VAL B H    1  
ATOM 2347  H HA   . VAL B 1 54 ? -8.152  11.501  -6.115  1.00 0.00 ? 53 VAL B HA   1  
ATOM 2348  H HB   . VAL B 1 54 ? -9.434  14.101  -5.222  1.00 0.00 ? 53 VAL B HB   1  
ATOM 2349  H HG11 . VAL B 1 54 ? -9.724  11.215  -4.349  1.00 0.00 ? 53 VAL B HG11 1  
ATOM 2350  H HG12 . VAL B 1 54 ? -10.322 12.577  -3.403  1.00 0.00 ? 53 VAL B HG12 1  
ATOM 2351  H HG13 . VAL B 1 54 ? -10.977 12.265  -5.010  1.00 0.00 ? 53 VAL B HG13 1  
ATOM 2352  H HG21 . VAL B 1 54 ? -7.374  12.317  -3.888  1.00 0.00 ? 53 VAL B HG21 1  
ATOM 2353  H HG22 . VAL B 1 54 ? -7.135  13.982  -4.418  1.00 0.00 ? 53 VAL B HG22 1  
ATOM 2354  H HG23 . VAL B 1 54 ? -8.229  13.630  -3.081  1.00 0.00 ? 53 VAL B HG23 1  
ATOM 2355  N N    . ASP B 1 55 ? -9.837  13.565  -8.022  1.00 0.00 ? 54 ASP B N    1  
ATOM 2356  C CA   . ASP B 1 55 ? -10.923 13.621  -9.036  1.00 0.00 ? 54 ASP B CA   1  
ATOM 2357  C C    . ASP B 1 55 ? -10.726 12.502  -10.058 1.00 0.00 ? 54 ASP B C    1  
ATOM 2358  O O    . ASP B 1 55 ? -11.660 11.824  -10.436 1.00 0.00 ? 54 ASP B O    1  
ATOM 2359  C CB   . ASP B 1 55 ? -10.885 14.975  -9.749  1.00 0.00 ? 54 ASP B CB   1  
ATOM 2360  C CG   . ASP B 1 55 ? -12.043 15.062  -10.744 1.00 0.00 ? 54 ASP B CG   1  
ATOM 2361  O OD1  . ASP B 1 55 ? -13.137 15.401  -10.322 1.00 0.00 ? 54 ASP B OD1  1  
ATOM 2362  O OD2  . ASP B 1 55 ? -11.816 14.790  -11.911 1.00 0.00 ? 54 ASP B OD2  1  
ATOM 2363  H H    . ASP B 1 55 ? -9.269  14.350  -7.871  1.00 0.00 ? 54 ASP B H    1  
ATOM 2364  H HA   . ASP B 1 55 ? -11.878 13.501  -8.545  1.00 0.00 ? 54 ASP B HA   1  
ATOM 2365  H HB2  . ASP B 1 55 ? -10.974 15.768  -9.020  1.00 0.00 ? 54 ASP B HB2  1  
ATOM 2366  H HB3  . ASP B 1 55 ? -9.949  15.077  -10.278 1.00 0.00 ? 54 ASP B HB3  1  
ATOM 2367  N N    . LYS B 1 56 ? -9.518  12.307  -10.518 1.00 0.00 ? 55 LYS B N    1  
ATOM 2368  C CA   . LYS B 1 56 ? -9.277  11.236  -11.524 1.00 0.00 ? 55 LYS B CA   1  
ATOM 2369  C C    . LYS B 1 56 ? -9.411  9.865   -10.861 1.00 0.00 ? 55 LYS B C    1  
ATOM 2370  O O    . LYS B 1 56 ? -9.761  8.897   -11.506 1.00 0.00 ? 55 LYS B O    1  
ATOM 2371  C CB   . LYS B 1 56 ? -7.884  11.392  -12.135 1.00 0.00 ? 55 LYS B CB   1  
ATOM 2372  C CG   . LYS B 1 56 ? -7.897  12.536  -13.152 1.00 0.00 ? 55 LYS B CG   1  
ATOM 2373  C CD   . LYS B 1 56 ? -6.467  12.830  -13.610 1.00 0.00 ? 55 LYS B CD   1  
ATOM 2374  C CE   . LYS B 1 56 ? -6.485  13.961  -14.641 1.00 0.00 ? 55 LYS B CE   1  
ATOM 2375  N NZ   . LYS B 1 56 ? -5.088  14.290  -15.042 1.00 0.00 ? 55 LYS B NZ   1  
ATOM 2376  H H    . LYS B 1 56 ? -8.775  12.869  -10.207 1.00 0.00 ? 55 LYS B H    1  
ATOM 2377  H HA   . LYS B 1 56 ? -10.032 11.307  -12.292 1.00 0.00 ? 55 LYS B HA   1  
ATOM 2378  H HB2  . LYS B 1 56 ? -7.174  11.612  -11.351 1.00 0.00 ? 55 LYS B HB2  1  
ATOM 2379  H HB3  . LYS B 1 56 ? -7.602  10.475  -12.631 1.00 0.00 ? 55 LYS B HB3  1  
ATOM 2380  H HG2  . LYS B 1 56 ? -8.497  12.251  -14.005 1.00 0.00 ? 55 LYS B HG2  1  
ATOM 2381  H HG3  . LYS B 1 56 ? -8.316  13.419  -12.696 1.00 0.00 ? 55 LYS B HG3  1  
ATOM 2382  H HD2  . LYS B 1 56 ? -5.871  13.127  -12.760 1.00 0.00 ? 55 LYS B HD2  1  
ATOM 2383  H HD3  . LYS B 1 56 ? -6.042  11.944  -14.058 1.00 0.00 ? 55 LYS B HD3  1  
ATOM 2384  H HE2  . LYS B 1 56 ? -7.044  13.647  -15.510 1.00 0.00 ? 55 LYS B HE2  1  
ATOM 2385  H HE3  . LYS B 1 56 ? -6.951  14.834  -14.210 1.00 0.00 ? 55 LYS B HE3  1  
ATOM 2386  H HZ1  . LYS B 1 56 ? -4.457  14.181  -14.224 1.00 0.00 ? 55 LYS B HZ1  1  
ATOM 2387  H HZ2  . LYS B 1 56 ? -4.785  13.647  -15.803 1.00 0.00 ? 55 LYS B HZ2  1  
ATOM 2388  H HZ3  . LYS B 1 56 ? -5.046  15.272  -15.381 1.00 0.00 ? 55 LYS B HZ3  1  
ATOM 2389  N N    . VAL B 1 57 ? -9.178  9.763   -9.580  1.00 0.00 ? 56 VAL B N    1  
ATOM 2390  C CA   . VAL B 1 57 ? -9.342  8.444   -8.907  1.00 0.00 ? 56 VAL B CA   1  
ATOM 2391  C C    . VAL B 1 57 ? -10.822 8.063   -8.958  1.00 0.00 ? 56 VAL B C    1  
ATOM 2392  O O    . VAL B 1 57 ? -11.189 7.024   -9.470  1.00 0.00 ? 56 VAL B O    1  
ATOM 2393  C CB   . VAL B 1 57 ? -8.887  8.557   -7.447  1.00 0.00 ? 56 VAL B CB   1  
ATOM 2394  C CG1  . VAL B 1 57 ? -9.271  7.285   -6.686  1.00 0.00 ? 56 VAL B CG1  1  
ATOM 2395  C CG2  . VAL B 1 57 ? -7.367  8.734   -7.402  1.00 0.00 ? 56 VAL B CG2  1  
ATOM 2396  H H    . VAL B 1 57 ? -8.931  10.546  -9.048  1.00 0.00 ? 56 VAL B H    1  
ATOM 2397  H HA   . VAL B 1 57 ? -8.761  7.682   -9.406  1.00 0.00 ? 56 VAL B HA   1  
ATOM 2398  H HB   . VAL B 1 57 ? -9.364  9.408   -6.986  1.00 0.00 ? 56 VAL B HB   1  
ATOM 2399  H HG11 . VAL B 1 57 ? -8.997  6.419   -7.270  1.00 0.00 ? 56 VAL B HG11 1  
ATOM 2400  H HG12 . VAL B 1 57 ? -8.749  7.261   -5.740  1.00 0.00 ? 56 VAL B HG12 1  
ATOM 2401  H HG13 . VAL B 1 57 ? -10.336 7.279   -6.510  1.00 0.00 ? 56 VAL B HG13 1  
ATOM 2402  H HG21 . VAL B 1 57 ? -7.075  9.517   -8.086  1.00 0.00 ? 56 VAL B HG21 1  
ATOM 2403  H HG22 . VAL B 1 57 ? -7.065  9.000   -6.400  1.00 0.00 ? 56 VAL B HG22 1  
ATOM 2404  H HG23 . VAL B 1 57 ? -6.888  7.809   -7.688  1.00 0.00 ? 56 VAL B HG23 1  
ATOM 2405  N N    . MET B 1 58 ? -11.675 8.896   -8.427  1.00 0.00 ? 57 MET B N    1  
ATOM 2406  C CA   . MET B 1 58 ? -13.131 8.582   -8.441  1.00 0.00 ? 57 MET B CA   1  
ATOM 2407  C C    . MET B 1 58 ? -13.575 8.256   -9.867  1.00 0.00 ? 57 MET B C    1  
ATOM 2408  O O    . MET B 1 58 ? -14.505 7.501   -10.075 1.00 0.00 ? 57 MET B O    1  
ATOM 2409  C CB   . MET B 1 58 ? -13.921 9.784   -7.918  1.00 0.00 ? 57 MET B CB   1  
ATOM 2410  C CG   . MET B 1 58 ? -13.576 10.021  -6.446  1.00 0.00 ? 57 MET B CG   1  
ATOM 2411  S SD   . MET B 1 58 ? -14.271 8.685   -5.442  1.00 0.00 ? 57 MET B SD   1  
ATOM 2412  C CE   . MET B 1 58 ? -13.598 9.222   -3.850  1.00 0.00 ? 57 MET B CE   1  
ATOM 2413  H H    . MET B 1 58 ? -11.361 9.720   -7.997  1.00 0.00 ? 57 MET B H    1  
ATOM 2414  H HA   . MET B 1 58 ? -13.322 7.722   -7.817  1.00 0.00 ? 57 MET B HA   1  
ATOM 2415  H HB2  . MET B 1 58 ? -13.664 10.661  -8.494  1.00 0.00 ? 57 MET B HB2  1  
ATOM 2416  H HB3  . MET B 1 58 ? -14.978 9.588   -8.010  1.00 0.00 ? 57 MET B HB3  1  
ATOM 2417  H HG2  . MET B 1 58 ? -12.502 10.040  -6.327  1.00 0.00 ? 57 MET B HG2  1  
ATOM 2418  H HG3  . MET B 1 58 ? -13.991 10.965  -6.126  1.00 0.00 ? 57 MET B HG3  1  
ATOM 2419  H HE1  . MET B 1 58 ? -13.491 10.298  -3.850  1.00 0.00 ? 57 MET B HE1  1  
ATOM 2420  H HE2  . MET B 1 58 ? -14.268 8.920   -3.057  1.00 0.00 ? 57 MET B HE2  1  
ATOM 2421  H HE3  . MET B 1 58 ? -12.633 8.767   -3.694  1.00 0.00 ? 57 MET B HE3  1  
ATOM 2422  N N    . GLU B 1 59 ? -12.901 8.783   -10.859 1.00 0.00 ? 58 GLU B N    1  
ATOM 2423  C CA   . GLU B 1 59 ? -13.272 8.460   -12.268 1.00 0.00 ? 58 GLU B CA   1  
ATOM 2424  C C    . GLU B 1 59 ? -12.573 7.161   -12.670 1.00 0.00 ? 58 GLU B C    1  
ATOM 2425  O O    . GLU B 1 59 ? -13.106 6.374   -13.425 1.00 0.00 ? 58 GLU B O    1  
ATOM 2426  C CB   . GLU B 1 59 ? -12.872 9.601   -13.207 1.00 0.00 ? 58 GLU B CB   1  
ATOM 2427  C CG   . GLU B 1 59 ? -13.224 9.226   -14.648 1.00 0.00 ? 58 GLU B CG   1  
ATOM 2428  C CD   . GLU B 1 59 ? -13.166 10.474  -15.530 1.00 0.00 ? 58 GLU B CD   1  
ATOM 2429  O OE1  . GLU B 1 59 ? -14.030 11.322  -15.380 1.00 0.00 ? 58 GLU B OE1  1  
ATOM 2430  O OE2  . GLU B 1 59 ? -12.258 10.561  -16.341 1.00 0.00 ? 58 GLU B OE2  1  
ATOM 2431  H H    . GLU B 1 59 ? -12.129 9.352   -10.676 1.00 0.00 ? 58 GLU B H    1  
ATOM 2432  H HA   . GLU B 1 59 ? -14.334 8.268   -12.334 1.00 0.00 ? 58 GLU B HA   1  
ATOM 2433  H HB2  . GLU B 1 59 ? -13.405 10.499  -12.927 1.00 0.00 ? 58 GLU B HB2  1  
ATOM 2434  H HB3  . GLU B 1 59 ? -11.809 9.774   -13.131 1.00 0.00 ? 58 GLU B HB3  1  
ATOM 2435  H HG2  . GLU B 1 59 ? -12.517 8.494   -15.011 1.00 0.00 ? 58 GLU B HG2  1  
ATOM 2436  H HG3  . GLU B 1 59 ? -14.220 8.811   -14.679 1.00 0.00 ? 58 GLU B HG3  1  
ATOM 2437  N N    . THR B 1 60 ? -11.400 6.910   -12.159 1.00 0.00 ? 59 THR B N    1  
ATOM 2438  C CA   . THR B 1 60 ? -10.714 5.637   -12.511 1.00 0.00 ? 59 THR B CA   1  
ATOM 2439  C C    . THR B 1 60 ? -11.492 4.489   -11.866 1.00 0.00 ? 59 THR B C    1  
ATOM 2440  O O    . THR B 1 60 ? -11.780 3.500   -12.510 1.00 0.00 ? 59 THR B O    1  
ATOM 2441  C CB   . THR B 1 60 ? -9.264  5.654   -12.015 1.00 0.00 ? 59 THR B CB   1  
ATOM 2442  O OG1  . THR B 1 60 ? -8.696  6.932   -12.266 1.00 0.00 ? 59 THR B OG1  1  
ATOM 2443  C CG2  . THR B 1 60 ? -8.451  4.583   -12.749 1.00 0.00 ? 59 THR B CG2  1  
ATOM 2444  H H    . THR B 1 60 ? -10.987 7.538   -11.530 1.00 0.00 ? 59 THR B H    1  
ATOM 2445  H HA   . THR B 1 60 ? -10.744 5.487   -13.580 1.00 0.00 ? 59 THR B HA   1  
ATOM 2446  H HB   . THR B 1 60 ? -9.244  5.454   -10.955 1.00 0.00 ? 59 THR B HB   1  
ATOM 2447  H HG1  . THR B 1 60 ? -7.741  6.841   -12.243 1.00 0.00 ? 59 THR B HG1  1  
ATOM 2448  H HG21 . THR B 1 60 ? -8.562  4.713   -13.815 1.00 0.00 ? 59 THR B HG21 1  
ATOM 2449  H HG22 . THR B 1 60 ? -7.409  4.677   -12.483 1.00 0.00 ? 59 THR B HG22 1  
ATOM 2450  H HG23 . THR B 1 60 ? -8.809  3.604   -12.466 1.00 0.00 ? 59 THR B HG23 1  
ATOM 2451  N N    . LEU B 1 61 ? -11.877 4.608   -10.625 1.00 0.00 ? 60 LEU B N    1  
ATOM 2452  C CA   . LEU B 1 61 ? -12.677 3.520   -9.998  1.00 0.00 ? 60 LEU B CA   1  
ATOM 2453  C C    . LEU B 1 61 ? -13.957 3.334   -10.818 1.00 0.00 ? 60 LEU B C    1  
ATOM 2454  O O    . LEU B 1 61 ? -14.225 2.266   -11.332 1.00 0.00 ? 60 LEU B O    1  
ATOM 2455  C CB   . LEU B 1 61 ? -13.045 3.925   -8.555  1.00 0.00 ? 60 LEU B CB   1  
ATOM 2456  C CG   . LEU B 1 61 ? -11.932 3.534   -7.561  1.00 0.00 ? 60 LEU B CG   1  
ATOM 2457  C CD1  . LEU B 1 61 ? -11.959 2.022   -7.279  1.00 0.00 ? 60 LEU B CD1  1  
ATOM 2458  C CD2  . LEU B 1 61 ? -10.558 3.931   -8.118  1.00 0.00 ? 60 LEU B CD2  1  
ATOM 2459  H H    . LEU B 1 61 ? -11.680 5.409   -10.093 1.00 0.00 ? 60 LEU B H    1  
ATOM 2460  H HA   . LEU B 1 61 ? -12.139 2.587   -9.996  1.00 0.00 ? 60 LEU B HA   1  
ATOM 2461  H HB2  . LEU B 1 61 ? -13.184 4.996   -8.519  1.00 0.00 ? 60 LEU B HB2  1  
ATOM 2462  H HB3  . LEU B 1 61 ? -13.968 3.443   -8.265  1.00 0.00 ? 60 LEU B HB3  1  
ATOM 2463  H HG   . LEU B 1 61 ? -12.099 4.061   -6.632  1.00 0.00 ? 60 LEU B HG   1  
ATOM 2464  H HD11 . LEU B 1 61 ? -12.980 1.683   -7.189  1.00 0.00 ? 60 LEU B HD11 1  
ATOM 2465  H HD12 . LEU B 1 61 ? -11.473 1.491   -8.083  1.00 0.00 ? 60 LEU B HD12 1  
ATOM 2466  H HD13 . LEU B 1 61 ? -11.437 1.824   -6.355  1.00 0.00 ? 60 LEU B HD13 1  
ATOM 2467  H HD21 . LEU B 1 61 ? -10.627 4.897   -8.596  1.00 0.00 ? 60 LEU B HD21 1  
ATOM 2468  H HD22 . LEU B 1 61 ? -9.846  3.983   -7.308  1.00 0.00 ? 60 LEU B HD22 1  
ATOM 2469  H HD23 . LEU B 1 61 ? -10.229 3.196   -8.837  1.00 0.00 ? 60 LEU B HD23 1  
ATOM 2470  N N    . ASP B 1 62 ? -14.748 4.364   -10.948 1.00 0.00 ? 61 ASP B N    1  
ATOM 2471  C CA   . ASP B 1 62 ? -16.002 4.235   -11.739 1.00 0.00 ? 61 ASP B CA   1  
ATOM 2472  C C    . ASP B 1 62 ? -15.676 3.648   -13.114 1.00 0.00 ? 61 ASP B C    1  
ATOM 2473  O O    . ASP B 1 62 ? -16.522 3.068   -13.765 1.00 0.00 ? 61 ASP B O    1  
ATOM 2474  C CB   . ASP B 1 62 ? -16.643 5.613   -11.910 1.00 0.00 ? 61 ASP B CB   1  
ATOM 2475  C CG   . ASP B 1 62 ? -17.999 5.462   -12.603 1.00 0.00 ? 61 ASP B CG   1  
ATOM 2476  O OD1  . ASP B 1 62 ? -18.007 5.176   -13.789 1.00 0.00 ? 61 ASP B OD1  1  
ATOM 2477  O OD2  . ASP B 1 62 ? -19.005 5.634   -11.935 1.00 0.00 ? 61 ASP B OD2  1  
ATOM 2478  H H    . ASP B 1 62 ? -14.518 5.219   -10.527 1.00 0.00 ? 61 ASP B H    1  
ATOM 2479  H HA   . ASP B 1 62 ? -16.687 3.580   -11.222 1.00 0.00 ? 61 ASP B HA   1  
ATOM 2480  H HB2  . ASP B 1 62 ? -16.782 6.068   -10.940 1.00 0.00 ? 61 ASP B HB2  1  
ATOM 2481  H HB3  . ASP B 1 62 ? -16.001 6.237   -12.513 1.00 0.00 ? 61 ASP B HB3  1  
ATOM 2482  N N    . GLU B 1 63 ? -14.452 3.797   -13.563 1.00 0.00 ? 62 GLU B N    1  
ATOM 2483  C CA   . GLU B 1 63 ? -14.061 3.250   -14.902 1.00 0.00 ? 62 GLU B CA   1  
ATOM 2484  C C    . GLU B 1 63 ? -13.284 1.956   -14.721 1.00 0.00 ? 62 GLU B C    1  
ATOM 2485  O O    . GLU B 1 63 ? -12.316 1.680   -15.401 1.00 0.00 ? 62 GLU B O    1  
ATOM 2486  C CB   . GLU B 1 63 ? -13.180 4.242   -15.609 1.00 0.00 ? 62 GLU B CB   1  
ATOM 2487  C CG   . GLU B 1 63 ? -13.997 5.465   -16.032 1.00 0.00 ? 62 GLU B CG   1  
ATOM 2488  C CD   . GLU B 1 63 ? -14.950 5.076   -17.163 1.00 0.00 ? 62 GLU B CD   1  
ATOM 2489  O OE1  . GLU B 1 63 ? -14.661 4.110   -17.850 1.00 0.00 ? 62 GLU B OE1  1  
ATOM 2490  O OE2  . GLU B 1 63 ? -15.954 5.751   -17.324 1.00 0.00 ? 62 GLU B OE2  1  
ATOM 2491  H H    . GLU B 1 63 ? -13.788 4.271   -13.019 1.00 0.00 ? 62 GLU B H    1  
ATOM 2492  H HA   . GLU B 1 63 ? -14.944 3.049   -15.491 1.00 0.00 ? 62 GLU B HA   1  
ATOM 2493  H HB2  . GLU B 1 63 ? -12.403 4.532   -14.928 1.00 0.00 ? 62 GLU B HB2  1  
ATOM 2494  H HB3  . GLU B 1 63 ? -12.749 3.773   -16.474 1.00 0.00 ? 62 GLU B HB3  1  
ATOM 2495  H HG2  . GLU B 1 63 ? -14.567 5.826   -15.188 1.00 0.00 ? 62 GLU B HG2  1  
ATOM 2496  H HG3  . GLU B 1 63 ? -13.331 6.242   -16.376 1.00 0.00 ? 62 GLU B HG3  1  
ATOM 2497  N N    . ASP B 1 64 ? -13.719 1.178   -13.809 1.00 0.00 ? 63 ASP B N    1  
ATOM 2498  C CA   . ASP B 1 64 ? -13.058 -0.133  -13.519 1.00 0.00 ? 63 ASP B CA   1  
ATOM 2499  C C    . ASP B 1 64 ? -12.747 -0.849  -14.833 1.00 0.00 ? 63 ASP B C    1  
ATOM 2500  O O    . ASP B 1 64 ? -11.703 -1.448  -15.000 1.00 0.00 ? 63 ASP B O    1  
ATOM 2501  C CB   . ASP B 1 64 ? -14.041 -0.993  -12.733 1.00 0.00 ? 63 ASP B CB   1  
ATOM 2502  C CG   . ASP B 1 64 ? -13.442 -2.382  -12.508 1.00 0.00 ? 63 ASP B CG   1  
ATOM 2503  O OD1  . ASP B 1 64 ? -12.244 -2.461  -12.294 1.00 0.00 ? 63 ASP B OD1  1  
ATOM 2504  O OD2  . ASP B 1 64 ? -14.193 -3.343  -12.553 1.00 0.00 ? 63 ASP B OD2  1  
ATOM 2505  H H    . ASP B 1 64 ? -14.488 1.465   -13.302 1.00 0.00 ? 63 ASP B H    1  
ATOM 2506  H HA   . ASP B 1 64 ? -12.163 -0.001  -12.932 1.00 0.00 ? 63 ASP B HA   1  
ATOM 2507  H HB2  . ASP B 1 64 ? -14.237 -0.527  -11.782 1.00 0.00 ? 63 ASP B HB2  1  
ATOM 2508  H HB3  . ASP B 1 64 ? -14.962 -1.085  -13.290 1.00 0.00 ? 63 ASP B HB3  1  
ATOM 2509  N N    . GLY B 1 65 ? -13.646 -0.766  -15.769 1.00 0.00 ? 64 GLY B N    1  
ATOM 2510  C CA   . GLY B 1 65 ? -13.435 -1.414  -17.094 1.00 0.00 ? 64 GLY B CA   1  
ATOM 2511  C C    . GLY B 1 65 ? -13.100 -2.908  -16.949 1.00 0.00 ? 64 GLY B C    1  
ATOM 2512  O O    . GLY B 1 65 ? -13.026 -3.617  -17.934 1.00 0.00 ? 64 GLY B O    1  
ATOM 2513  H H    . GLY B 1 65 ? -14.465 -0.249  -15.615 1.00 0.00 ? 64 GLY B H    1  
ATOM 2514  H HA2  . GLY B 1 65 ? -14.337 -1.313  -17.681 1.00 0.00 ? 64 GLY B HA2  1  
ATOM 2515  H HA3  . GLY B 1 65 ? -12.621 -0.913  -17.597 1.00 0.00 ? 64 GLY B HA3  1  
ATOM 2516  N N    . ASP B 1 66 ? -12.884 -3.400  -15.746 1.00 0.00 ? 65 ASP B N    1  
ATOM 2517  C CA   . ASP B 1 66 ? -12.538 -4.856  -15.562 1.00 0.00 ? 65 ASP B CA   1  
ATOM 2518  C C    . ASP B 1 66 ? -13.710 -5.669  -14.945 1.00 0.00 ? 65 ASP B C    1  
ATOM 2519  O O    . ASP B 1 66 ? -13.640 -6.881  -14.891 1.00 0.00 ? 65 ASP B O    1  
ATOM 2520  C CB   . ASP B 1 66 ? -11.326 -4.961  -14.633 1.00 0.00 ? 65 ASP B CB   1  
ATOM 2521  C CG   . ASP B 1 66 ? -10.750 -6.377  -14.699 1.00 0.00 ? 65 ASP B CG   1  
ATOM 2522  O OD1  . ASP B 1 66 ? -9.937  -6.625  -15.575 1.00 0.00 ? 65 ASP B OD1  1  
ATOM 2523  O OD2  . ASP B 1 66 ? -11.130 -7.190  -13.872 1.00 0.00 ? 65 ASP B OD2  1  
ATOM 2524  H H    . ASP B 1 66 ? -12.924 -2.817  -14.960 1.00 0.00 ? 65 ASP B H    1  
ATOM 2525  H HA   . ASP B 1 66 ? -12.275 -5.279  -16.521 1.00 0.00 ? 65 ASP B HA   1  
ATOM 2526  H HB2  . ASP B 1 66 ? -10.573 -4.251  -14.944 1.00 0.00 ? 65 ASP B HB2  1  
ATOM 2527  H HB3  . ASP B 1 66 ? -11.629 -4.745  -13.620 1.00 0.00 ? 65 ASP B HB3  1  
ATOM 2528  N N    . GLY B 1 67 ? -14.784 -5.058  -14.493 1.00 0.00 ? 66 GLY B N    1  
ATOM 2529  C CA   . GLY B 1 67 ? -15.907 -5.855  -13.919 1.00 0.00 ? 66 GLY B CA   1  
ATOM 2530  C C    . GLY B 1 67 ? -15.592 -6.258  -12.473 1.00 0.00 ? 66 GLY B C    1  
ATOM 2531  O O    . GLY B 1 67 ? -16.483 -6.432  -11.664 1.00 0.00 ? 66 GLY B O    1  
ATOM 2532  H H    . GLY B 1 67 ? -14.886 -4.094  -14.552 1.00 0.00 ? 66 GLY B H    1  
ATOM 2533  H HA2  . GLY B 1 67 ? -16.813 -5.265  -13.937 1.00 0.00 ? 66 GLY B HA2  1  
ATOM 2534  H HA3  . GLY B 1 67 ? -16.047 -6.743  -14.517 1.00 0.00 ? 66 GLY B HA3  1  
ATOM 2535  N N    . GLU B 1 68 ? -14.337 -6.406  -12.133 1.00 0.00 ? 67 GLU B N    1  
ATOM 2536  C CA   . GLU B 1 68 ? -13.987 -6.795  -10.729 1.00 0.00 ? 67 GLU B CA   1  
ATOM 2537  C C    . GLU B 1 68 ? -12.609 -6.243  -10.354 1.00 0.00 ? 67 GLU B C    1  
ATOM 2538  O O    . GLU B 1 68 ? -11.661 -6.367  -11.104 1.00 0.00 ? 67 GLU B O    1  
ATOM 2539  C CB   . GLU B 1 68 ? -13.976 -8.320  -10.610 1.00 0.00 ? 67 GLU B CB   1  
ATOM 2540  C CG   . GLU B 1 68 ? -15.391 -8.863  -10.826 1.00 0.00 ? 67 GLU B CG   1  
ATOM 2541  C CD   . GLU B 1 68 ? -15.451 -10.325 -10.380 1.00 0.00 ? 67 GLU B CD   1  
ATOM 2542  O OE1  . GLU B 1 68 ? -15.276 -10.571 -9.198  1.00 0.00 ? 67 GLU B OE1  1  
ATOM 2543  O OE2  . GLU B 1 68 ? -15.670 -11.174 -11.228 1.00 0.00 ? 67 GLU B OE2  1  
ATOM 2544  H H    . GLU B 1 68 ? -13.636 -6.273  -12.804 1.00 0.00 ? 67 GLU B H    1  
ATOM 2545  H HA   . GLU B 1 68 ? -14.729 -6.386  -10.058 1.00 0.00 ? 67 GLU B HA   1  
ATOM 2546  H HB2  . GLU B 1 68 ? -13.314 -8.735  -11.356 1.00 0.00 ? 67 GLU B HB2  1  
ATOM 2547  H HB3  . GLU B 1 68 ? -13.632 -8.601  -9.627  1.00 0.00 ? 67 GLU B HB3  1  
ATOM 2548  H HG2  . GLU B 1 68 ? -16.093 -8.280  -10.247 1.00 0.00 ? 67 GLU B HG2  1  
ATOM 2549  H HG3  . GLU B 1 68 ? -15.646 -8.798  -11.873 1.00 0.00 ? 67 GLU B HG3  1  
ATOM 2550  N N    . CYS B 1 69 ? -12.486 -5.643  -9.193  1.00 0.00 ? 68 CYS B N    1  
ATOM 2551  C CA   . CYS B 1 69 ? -11.164 -5.089  -8.754  1.00 0.00 ? 68 CYS B CA   1  
ATOM 2552  C C    . CYS B 1 69 ? -10.562 -6.016  -7.692  1.00 0.00 ? 68 CYS B C    1  
ATOM 2553  O O    . CYS B 1 69 ? -11.196 -6.340  -6.708  1.00 0.00 ? 68 CYS B O    1  
ATOM 2554  C CB   . CYS B 1 69 ? -11.369 -3.696  -8.156  1.00 0.00 ? 68 CYS B CB   1  
ATOM 2555  S SG   . CYS B 1 69 ? -11.986 -2.575  -9.436  1.00 0.00 ? 68 CYS B SG   1  
ATOM 2556  H H    . CYS B 1 69 ? -13.263 -5.564  -8.601  1.00 0.00 ? 68 CYS B H    1  
ATOM 2557  H HA   . CYS B 1 69 ? -10.492 -5.024  -9.599  1.00 0.00 ? 68 CYS B HA   1  
ATOM 2558  H HB2  . CYS B 1 69 ? -12.087 -3.752  -7.350  1.00 0.00 ? 68 CYS B HB2  1  
ATOM 2559  H HB3  . CYS B 1 69 ? -10.429 -3.325  -7.775  1.00 0.00 ? 68 CYS B HB3  1  
ATOM 2560  H HG   . CYS B 1 69 ? -12.614 -1.975  -9.028  1.00 0.00 ? 68 CYS B HG   1  
ATOM 2561  N N    . ASP B 1 70 ? -9.347  -6.452  -7.887  1.00 0.00 ? 69 ASP B N    1  
ATOM 2562  C CA   . ASP B 1 70 ? -8.709  -7.366  -6.894  1.00 0.00 ? 69 ASP B CA   1  
ATOM 2563  C C    . ASP B 1 70 ? -8.126  -6.557  -5.731  1.00 0.00 ? 69 ASP B C    1  
ATOM 2564  O O    . ASP B 1 70 ? -8.289  -5.356  -5.652  1.00 0.00 ? 69 ASP B O    1  
ATOM 2565  C CB   . ASP B 1 70 ? -7.587  -8.151  -7.576  1.00 0.00 ? 69 ASP B CB   1  
ATOM 2566  C CG   . ASP B 1 70 ? -8.192  -9.194  -8.518  1.00 0.00 ? 69 ASP B CG   1  
ATOM 2567  O OD1  . ASP B 1 70 ? -8.565  -8.823  -9.619  1.00 0.00 ? 69 ASP B OD1  1  
ATOM 2568  O OD2  . ASP B 1 70 ? -8.272  -10.345 -8.122  1.00 0.00 ? 69 ASP B OD2  1  
ATOM 2569  H H    . ASP B 1 70 ? -8.855  -6.184  -8.692  1.00 0.00 ? 69 ASP B H    1  
ATOM 2570  H HA   . ASP B 1 70 ? -9.448  -8.057  -6.515  1.00 0.00 ? 69 ASP B HA   1  
ATOM 2571  H HB2  . ASP B 1 70 ? -6.965  -7.472  -8.142  1.00 0.00 ? 69 ASP B HB2  1  
ATOM 2572  H HB3  . ASP B 1 70 ? -6.989  -8.649  -6.828  1.00 0.00 ? 69 ASP B HB3  1  
ATOM 2573  N N    . PHE B 1 71 ? -7.435  -7.212  -4.834  1.00 0.00 ? 70 PHE B N    1  
ATOM 2574  C CA   . PHE B 1 71 ? -6.825  -6.486  -3.682  1.00 0.00 ? 70 PHE B CA   1  
ATOM 2575  C C    . PHE B 1 71 ? -5.622  -5.690  -4.191  1.00 0.00 ? 70 PHE B C    1  
ATOM 2576  O O    . PHE B 1 71 ? -5.325  -4.620  -3.699  1.00 0.00 ? 70 PHE B O    1  
ATOM 2577  C CB   . PHE B 1 71 ? -6.384  -7.499  -2.618  1.00 0.00 ? 70 PHE B CB   1  
ATOM 2578  C CG   . PHE B 1 71 ? -5.844  -6.785  -1.398  1.00 0.00 ? 70 PHE B CG   1  
ATOM 2579  C CD1  . PHE B 1 71 ? -4.557  -6.231  -1.419  1.00 0.00 ? 70 PHE B CD1  1  
ATOM 2580  C CD2  . PHE B 1 71 ? -6.628  -6.686  -0.242  1.00 0.00 ? 70 PHE B CD2  1  
ATOM 2581  C CE1  . PHE B 1 71 ? -4.057  -5.579  -0.285  1.00 0.00 ? 70 PHE B CE1  1  
ATOM 2582  C CE2  . PHE B 1 71 ? -6.128  -6.033  0.891   1.00 0.00 ? 70 PHE B CE2  1  
ATOM 2583  C CZ   . PHE B 1 71 ? -4.843  -5.480  0.870   1.00 0.00 ? 70 PHE B CZ   1  
ATOM 2584  H H    . PHE B 1 71 ? -7.302  -8.179  -4.928  1.00 0.00 ? 70 PHE B H    1  
ATOM 2585  H HA   . PHE B 1 71 ? -7.545  -5.793  -3.272  1.00 0.00 ? 70 PHE B HA   1  
ATOM 2586  H HB2  . PHE B 1 71 ? -7.230  -8.107  -2.333  1.00 0.00 ? 70 PHE B HB2  1  
ATOM 2587  H HB3  . PHE B 1 71 ? -5.613  -8.134  -3.030  1.00 0.00 ? 70 PHE B HB3  1  
ATOM 2588  H HD1  . PHE B 1 71 ? -3.949  -6.308  -2.307  1.00 0.00 ? 70 PHE B HD1  1  
ATOM 2589  H HD2  . PHE B 1 71 ? -7.619  -7.113  -0.225  1.00 0.00 ? 70 PHE B HD2  1  
ATOM 2590  H HE1  . PHE B 1 71 ? -3.065  -5.153  -0.300  1.00 0.00 ? 70 PHE B HE1  1  
ATOM 2591  H HE2  . PHE B 1 71 ? -6.733  -5.959  1.782   1.00 0.00 ? 70 PHE B HE2  1  
ATOM 2592  H HZ   . PHE B 1 71 ? -4.457  -4.978  1.744   1.00 0.00 ? 70 PHE B HZ   1  
ATOM 2593  N N    . GLN B 1 72 ? -4.935  -6.188  -5.179  1.00 0.00 ? 71 GLN B N    1  
ATOM 2594  C CA   . GLN B 1 72 ? -3.767  -5.437  -5.718  1.00 0.00 ? 71 GLN B CA   1  
ATOM 2595  C C    . GLN B 1 72 ? -4.246  -4.075  -6.226  1.00 0.00 ? 71 GLN B C    1  
ATOM 2596  O O    . GLN B 1 72 ? -3.564  -3.078  -6.092  1.00 0.00 ? 71 GLN B O    1  
ATOM 2597  C CB   . GLN B 1 72 ? -3.144  -6.224  -6.873  1.00 0.00 ? 71 GLN B CB   1  
ATOM 2598  C CG   . GLN B 1 72 ? -2.629  -7.568  -6.356  1.00 0.00 ? 71 GLN B CG   1  
ATOM 2599  C CD   . GLN B 1 72 ? -2.289  -8.475  -7.540  1.00 0.00 ? 71 GLN B CD   1  
ATOM 2600  O OE1  . GLN B 1 72 ? -3.167  -9.058  -8.145  1.00 0.00 ? 71 GLN B OE1  1  
ATOM 2601  N NE2  . GLN B 1 72 ? -1.043  -8.621  -7.899  1.00 0.00 ? 71 GLN B NE2  1  
ATOM 2602  H H    . GLN B 1 72 ? -5.194  -7.047  -5.574  1.00 0.00 ? 71 GLN B H    1  
ATOM 2603  H HA   . GLN B 1 72 ? -3.031  -5.291  -4.941  1.00 0.00 ? 71 GLN B HA   1  
ATOM 2604  H HB2  . GLN B 1 72 ? -3.890  -6.392  -7.637  1.00 0.00 ? 71 GLN B HB2  1  
ATOM 2605  H HB3  . GLN B 1 72 ? -2.322  -5.661  -7.289  1.00 0.00 ? 71 GLN B HB3  1  
ATOM 2606  H HG2  . GLN B 1 72 ? -1.743  -7.408  -5.758  1.00 0.00 ? 71 GLN B HG2  1  
ATOM 2607  H HG3  . GLN B 1 72 ? -3.391  -8.038  -5.752  1.00 0.00 ? 71 GLN B HG3  1  
ATOM 2608  H HE21 . GLN B 1 72 ? -0.335  -8.151  -7.411  1.00 0.00 ? 71 GLN B HE21 1  
ATOM 2609  H HE22 . GLN B 1 72 ? -0.815  -9.200  -8.656  1.00 0.00 ? 71 GLN B HE22 1  
ATOM 2610  N N    . GLU B 1 73 ? -5.415  -4.020  -6.802  1.00 0.00 ? 72 GLU B N    1  
ATOM 2611  C CA   . GLU B 1 73 ? -5.936  -2.718  -7.310  1.00 0.00 ? 72 GLU B CA   1  
ATOM 2612  C C    . GLU B 1 73 ? -6.347  -1.828  -6.130  1.00 0.00 ? 72 GLU B C    1  
ATOM 2613  O O    . GLU B 1 73 ? -6.307  -0.619  -6.210  1.00 0.00 ? 72 GLU B O    1  
ATOM 2614  C CB   . GLU B 1 73 ? -7.142  -2.960  -8.221  1.00 0.00 ? 72 GLU B CB   1  
ATOM 2615  C CG   . GLU B 1 73 ? -6.680  -3.641  -9.511  1.00 0.00 ? 72 GLU B CG   1  
ATOM 2616  C CD   . GLU B 1 73 ? -7.897  -3.973  -10.377 1.00 0.00 ? 72 GLU B CD   1  
ATOM 2617  O OE1  . GLU B 1 73 ? -8.557  -3.045  -10.816 1.00 0.00 ? 72 GLU B OE1  1  
ATOM 2618  O OE2  . GLU B 1 73 ? -8.148  -5.148  -10.587 1.00 0.00 ? 72 GLU B OE2  1  
ATOM 2619  H H    . GLU B 1 73 ? -5.954  -4.833  -6.897  1.00 0.00 ? 72 GLU B H    1  
ATOM 2620  H HA   . GLU B 1 73 ? -5.159  -2.210  -7.859  1.00 0.00 ? 72 GLU B HA   1  
ATOM 2621  H HB2  . GLU B 1 73 ? -7.855  -3.594  -7.714  1.00 0.00 ? 72 GLU B HB2  1  
ATOM 2622  H HB3  . GLU B 1 73 ? -7.606  -2.016  -8.462  1.00 0.00 ? 72 GLU B HB3  1  
ATOM 2623  H HG2  . GLU B 1 73 ? -6.021  -2.978  -10.052 1.00 0.00 ? 72 GLU B HG2  1  
ATOM 2624  H HG3  . GLU B 1 73 ? -6.154  -4.553  -9.269  1.00 0.00 ? 72 GLU B HG3  1  
ATOM 2625  N N    . PHE B 1 74 ? -6.697  -2.423  -5.023  1.00 0.00 ? 73 PHE B N    1  
ATOM 2626  C CA   . PHE B 1 74 ? -7.072  -1.625  -3.816  1.00 0.00 ? 73 PHE B CA   1  
ATOM 2627  C C    . PHE B 1 74 ? -5.805  -1.059  -3.174  1.00 0.00 ? 73 PHE B C    1  
ATOM 2628  O O    . PHE B 1 74 ? -5.788  0.072   -2.734  1.00 0.00 ? 73 PHE B O    1  
ATOM 2629  C CB   . PHE B 1 74 ? -7.837  -2.505  -2.823  1.00 0.00 ? 73 PHE B CB   1  
ATOM 2630  C CG   . PHE B 1 74 ? -8.081  -1.749  -1.535  1.00 0.00 ? 73 PHE B CG   1  
ATOM 2631  C CD1  . PHE B 1 74 ? -9.058  -0.747  -1.484  1.00 0.00 ? 73 PHE B CD1  1  
ATOM 2632  C CD2  . PHE B 1 74 ? -7.337  -2.057  -0.388  1.00 0.00 ? 73 PHE B CD2  1  
ATOM 2633  C CE1  . PHE B 1 74 ? -9.290  -0.054  -0.290  1.00 0.00 ? 73 PHE B CE1  1  
ATOM 2634  C CE2  . PHE B 1 74 ? -7.571  -1.365  0.806   1.00 0.00 ? 73 PHE B CE2  1  
ATOM 2635  C CZ   . PHE B 1 74 ? -8.547  -0.363  0.855   1.00 0.00 ? 73 PHE B CZ   1  
ATOM 2636  H H    . PHE B 1 74 ? -6.666  -3.401  -4.966  1.00 0.00 ? 73 PHE B H    1  
ATOM 2637  H HA   . PHE B 1 74 ? -7.656  -0.755  -4.076  1.00 0.00 ? 73 PHE B HA   1  
ATOM 2638  H HB2  . PHE B 1 74 ? -8.786  -2.789  -3.255  1.00 0.00 ? 73 PHE B HB2  1  
ATOM 2639  H HB3  . PHE B 1 74 ? -7.260  -3.394  -2.615  1.00 0.00 ? 73 PHE B HB3  1  
ATOM 2640  H HD1  . PHE B 1 74 ? -9.631  -0.507  -2.366  1.00 0.00 ? 73 PHE B HD1  1  
ATOM 2641  H HD2  . PHE B 1 74 ? -6.583  -2.830  -0.426  1.00 0.00 ? 73 PHE B HD2  1  
ATOM 2642  H HE1  . PHE B 1 74 ? -10.044 0.719   -0.252  1.00 0.00 ? 73 PHE B HE1  1  
ATOM 2643  H HE2  . PHE B 1 74 ? -6.997  -1.603  1.689   1.00 0.00 ? 73 PHE B HE2  1  
ATOM 2644  H HZ   . PHE B 1 74 ? -8.728  0.171   1.777   1.00 0.00 ? 73 PHE B HZ   1  
ATOM 2645  N N    . MET B 1 75 ? -4.741  -1.801  -3.120  1.00 0.00 ? 74 MET B N    1  
ATOM 2646  C CA   . MET B 1 75 ? -3.510  -1.231  -2.507  1.00 0.00 ? 74 MET B CA   1  
ATOM 2647  C C    . MET B 1 75 ? -2.986  -0.109  -3.413  1.00 0.00 ? 74 MET B C    1  
ATOM 2648  O O    . MET B 1 75 ? -2.379  0.830   -2.936  1.00 0.00 ? 74 MET B O    1  
ATOM 2649  C CB   . MET B 1 75 ? -2.447  -2.325  -2.334  1.00 0.00 ? 74 MET B CB   1  
ATOM 2650  C CG   . MET B 1 75 ? -1.477  -1.935  -1.212  1.00 0.00 ? 74 MET B CG   1  
ATOM 2651  S SD   . MET B 1 75 ? -2.281  -2.197  0.395   1.00 0.00 ? 74 MET B SD   1  
ATOM 2652  C CE   . MET B 1 75 ? -2.263  -0.485  0.993   1.00 0.00 ? 74 MET B CE   1  
ATOM 2653  H H    . MET B 1 75 ? -4.744  -2.710  -3.489  1.00 0.00 ? 74 MET B H    1  
ATOM 2654  H HA   . MET B 1 75 ? -3.758  -0.794  -1.552  1.00 0.00 ? 74 MET B HA   1  
ATOM 2655  H HB2  . MET B 1 75 ? -2.932  -3.257  -2.081  1.00 0.00 ? 74 MET B HB2  1  
ATOM 2656  H HB3  . MET B 1 75 ? -1.898  -2.447  -3.256  1.00 0.00 ? 74 MET B HB3  1  
ATOM 2657  H HG2  . MET B 1 75 ? -0.591  -2.551  -1.276  1.00 0.00 ? 74 MET B HG2  1  
ATOM 2658  H HG3  . MET B 1 75 ? -1.200  -0.898  -1.320  1.00 0.00 ? 74 MET B HG3  1  
ATOM 2659  H HE1  . MET B 1 75 ? -2.590  0.180   0.211   1.00 0.00 ? 74 MET B HE1  1  
ATOM 2660  H HE2  . MET B 1 75 ? -2.930  -0.394  1.840   1.00 0.00 ? 74 MET B HE2  1  
ATOM 2661  H HE3  . MET B 1 75 ? -1.260  -0.219  1.290   1.00 0.00 ? 74 MET B HE3  1  
ATOM 2662  N N    . ALA B 1 76 ? -3.219  -0.160  -4.694  1.00 0.00 ? 75 ALA B N    1  
ATOM 2663  C CA   . ALA B 1 76 ? -2.740  0.943   -5.579  1.00 0.00 ? 75 ALA B CA   1  
ATOM 2664  C C    . ALA B 1 76 ? -3.652  2.170   -5.441  1.00 0.00 ? 75 ALA B C    1  
ATOM 2665  O O    . ALA B 1 76 ? -3.188  3.257   -5.158  1.00 0.00 ? 75 ALA B O    1  
ATOM 2666  C CB   . ALA B 1 76 ? -2.754  0.465   -7.032  1.00 0.00 ? 75 ALA B CB   1  
ATOM 2667  H H    . ALA B 1 76 ? -3.720  -0.894  -5.109  1.00 0.00 ? 75 ALA B H    1  
ATOM 2668  H HA   . ALA B 1 76 ? -1.740  1.259   -5.319  1.00 0.00 ? 75 ALA B HA   1  
ATOM 2669  H HB1  . ALA B 1 76 ? -3.741  0.109   -7.284  1.00 0.00 ? 75 ALA B HB1  1  
ATOM 2670  H HB2  . ALA B 1 76 ? -2.490  1.286   -7.683  1.00 0.00 ? 75 ALA B HB2  1  
ATOM 2671  H HB3  . ALA B 1 76 ? -2.040  -0.335  -7.155  1.00 0.00 ? 75 ALA B HB3  1  
ATOM 2672  N N    . PHE B 1 77 ? -4.937  2.028   -5.640  1.00 0.00 ? 76 PHE B N    1  
ATOM 2673  C CA   . PHE B 1 77 ? -5.829  3.221   -5.514  1.00 0.00 ? 76 PHE B CA   1  
ATOM 2674  C C    . PHE B 1 77 ? -5.663  3.834   -4.121  1.00 0.00 ? 76 PHE B C    1  
ATOM 2675  O O    . PHE B 1 77 ? -5.757  5.033   -3.945  1.00 0.00 ? 76 PHE B O    1  
ATOM 2676  C CB   . PHE B 1 77 ? -7.299  2.823   -5.724  1.00 0.00 ? 76 PHE B CB   1  
ATOM 2677  C CG   . PHE B 1 77 ? -7.573  2.566   -7.196  1.00 0.00 ? 76 PHE B CG   1  
ATOM 2678  C CD1  . PHE B 1 77 ? -7.376  3.585   -8.142  1.00 0.00 ? 76 PHE B CD1  1  
ATOM 2679  C CD2  . PHE B 1 77 ? -8.024  1.306   -7.617  1.00 0.00 ? 76 PHE B CD2  1  
ATOM 2680  C CE1  . PHE B 1 77 ? -7.624  3.339   -9.496  1.00 0.00 ? 76 PHE B CE1  1  
ATOM 2681  C CE2  . PHE B 1 77 ? -8.273  1.065   -8.972  1.00 0.00 ? 76 PHE B CE2  1  
ATOM 2682  C CZ   . PHE B 1 77 ? -8.072  2.081   -9.912  1.00 0.00 ? 76 PHE B CZ   1  
ATOM 2683  H H    . PHE B 1 77 ? -5.309  1.152   -5.873  1.00 0.00 ? 76 PHE B H    1  
ATOM 2684  H HA   . PHE B 1 77 ? -5.541  3.954   -6.249  1.00 0.00 ? 76 PHE B HA   1  
ATOM 2685  H HB2  . PHE B 1 77 ? -7.510  1.929   -5.155  1.00 0.00 ? 76 PHE B HB2  1  
ATOM 2686  H HB3  . PHE B 1 77 ? -7.938  3.622   -5.377  1.00 0.00 ? 76 PHE B HB3  1  
ATOM 2687  H HD1  . PHE B 1 77 ? -7.037  4.560   -7.830  1.00 0.00 ? 76 PHE B HD1  1  
ATOM 2688  H HD2  . PHE B 1 77 ? -8.187  0.523   -6.894  1.00 0.00 ? 76 PHE B HD2  1  
ATOM 2689  H HE1  . PHE B 1 77 ? -7.471  4.123   -10.221 1.00 0.00 ? 76 PHE B HE1  1  
ATOM 2690  H HE2  . PHE B 1 77 ? -8.619  0.094   -9.293  1.00 0.00 ? 76 PHE B HE2  1  
ATOM 2691  H HZ   . PHE B 1 77 ? -8.263  1.894   -10.958 1.00 0.00 ? 76 PHE B HZ   1  
ATOM 2692  N N    . VAL B 1 78 ? -5.410  3.025   -3.135  1.00 0.00 ? 77 VAL B N    1  
ATOM 2693  C CA   . VAL B 1 78 ? -5.232  3.567   -1.759  1.00 0.00 ? 77 VAL B CA   1  
ATOM 2694  C C    . VAL B 1 78 ? -3.930  4.376   -1.704  1.00 0.00 ? 77 VAL B C    1  
ATOM 2695  O O    . VAL B 1 78 ? -3.835  5.369   -1.010  1.00 0.00 ? 77 VAL B O    1  
ATOM 2696  C CB   . VAL B 1 78 ? -5.168  2.405   -0.759  1.00 0.00 ? 77 VAL B CB   1  
ATOM 2697  C CG1  . VAL B 1 78 ? -4.702  2.916   0.610   1.00 0.00 ? 77 VAL B CG1  1  
ATOM 2698  C CG2  . VAL B 1 78 ? -6.558  1.773   -0.619  1.00 0.00 ? 77 VAL B CG2  1  
ATOM 2699  H H    . VAL B 1 78 ? -5.330  2.061   -3.302  1.00 0.00 ? 77 VAL B H    1  
ATOM 2700  H HA   . VAL B 1 78 ? -6.067  4.209   -1.515  1.00 0.00 ? 77 VAL B HA   1  
ATOM 2701  H HB   . VAL B 1 78 ? -4.470  1.663   -1.119  1.00 0.00 ? 77 VAL B HB   1  
ATOM 2702  H HG11 . VAL B 1 78 ? -5.235  3.823   0.855   1.00 0.00 ? 77 VAL B HG11 1  
ATOM 2703  H HG12 . VAL B 1 78 ? -4.902  2.167   1.362   1.00 0.00 ? 77 VAL B HG12 1  
ATOM 2704  H HG13 . VAL B 1 78 ? -3.642  3.119   0.577   1.00 0.00 ? 77 VAL B HG13 1  
ATOM 2705  H HG21 . VAL B 1 78 ? -7.024  1.701   -1.591  1.00 0.00 ? 77 VAL B HG21 1  
ATOM 2706  H HG22 . VAL B 1 78 ? -6.460  0.785   -0.193  1.00 0.00 ? 77 VAL B HG22 1  
ATOM 2707  H HG23 . VAL B 1 78 ? -7.172  2.384   0.028   1.00 0.00 ? 77 VAL B HG23 1  
ATOM 2708  N N    . SER B 1 79 ? -2.927  3.958   -2.427  1.00 0.00 ? 78 SER B N    1  
ATOM 2709  C CA   . SER B 1 79 ? -1.635  4.702   -2.411  1.00 0.00 ? 78 SER B CA   1  
ATOM 2710  C C    . SER B 1 79 ? -1.799  6.047   -3.126  1.00 0.00 ? 78 SER B C    1  
ATOM 2711  O O    . SER B 1 79 ? -1.464  7.086   -2.593  1.00 0.00 ? 78 SER B O    1  
ATOM 2712  C CB   . SER B 1 79 ? -0.563  3.874   -3.123  1.00 0.00 ? 78 SER B CB   1  
ATOM 2713  O OG   . SER B 1 79 ? -0.620  4.135   -4.519  1.00 0.00 ? 78 SER B OG   1  
ATOM 2714  H H    . SER B 1 79 ? -3.023  3.154   -2.978  1.00 0.00 ? 78 SER B H    1  
ATOM 2715  H HA   . SER B 1 79 ? -1.334  4.875   -1.387  1.00 0.00 ? 78 SER B HA   1  
ATOM 2716  H HB2  . SER B 1 79 ? 0.412   4.143   -2.753  1.00 0.00 ? 78 SER B HB2  1  
ATOM 2717  H HB3  . SER B 1 79 ? -0.739  2.822   -2.936  1.00 0.00 ? 78 SER B HB3  1  
ATOM 2718  H HG   . SER B 1 79 ? -1.064  3.395   -4.941  1.00 0.00 ? 78 SER B HG   1  
ATOM 2719  N N    . MET B 1 80 ? -2.293  6.040   -4.333  1.00 0.00 ? 79 MET B N    1  
ATOM 2720  C CA   . MET B 1 80 ? -2.453  7.321   -5.077  1.00 0.00 ? 79 MET B CA   1  
ATOM 2721  C C    . MET B 1 80 ? -3.205  8.330   -4.213  1.00 0.00 ? 79 MET B C    1  
ATOM 2722  O O    . MET B 1 80 ? -2.779  9.453   -4.040  1.00 0.00 ? 79 MET B O    1  
ATOM 2723  C CB   . MET B 1 80 ? -3.242  7.067   -6.363  1.00 0.00 ? 79 MET B CB   1  
ATOM 2724  C CG   . MET B 1 80 ? -2.440  6.141   -7.279  1.00 0.00 ? 79 MET B CG   1  
ATOM 2725  S SD   . MET B 1 80 ? -3.217  6.096   -8.918  1.00 0.00 ? 79 MET B SD   1  
ATOM 2726  C CE   . MET B 1 80 ? -3.243  4.298   -9.137  1.00 0.00 ? 79 MET B CE   1  
ATOM 2727  H H    . MET B 1 80 ? -2.542  5.198   -4.768  1.00 0.00 ? 79 MET B H    1  
ATOM 2728  H HA   . MET B 1 80 ? -1.482  7.717   -5.327  1.00 0.00 ? 79 MET B HA   1  
ATOM 2729  H HB2  . MET B 1 80 ? -4.187  6.604   -6.119  1.00 0.00 ? 79 MET B HB2  1  
ATOM 2730  H HB3  . MET B 1 80 ? -3.420  8.005   -6.867  1.00 0.00 ? 79 MET B HB3  1  
ATOM 2731  H HG2  . MET B 1 80 ? -1.429  6.514   -7.369  1.00 0.00 ? 79 MET B HG2  1  
ATOM 2732  H HG3  . MET B 1 80 ? -2.420  5.149   -6.855  1.00 0.00 ? 79 MET B HG3  1  
ATOM 2733  H HE1  . MET B 1 80 ? -2.261  3.896   -8.928  1.00 0.00 ? 79 MET B HE1  1  
ATOM 2734  H HE2  . MET B 1 80 ? -3.967  3.865   -8.460  1.00 0.00 ? 79 MET B HE2  1  
ATOM 2735  H HE3  . MET B 1 80 ? -3.517  4.062   -10.152 1.00 0.00 ? 79 MET B HE3  1  
ATOM 2736  N N    . VAL B 1 81 ? -4.325  7.942   -3.679  1.00 0.00 ? 80 VAL B N    1  
ATOM 2737  C CA   . VAL B 1 81 ? -5.109  8.889   -2.834  1.00 0.00 ? 80 VAL B CA   1  
ATOM 2738  C C    . VAL B 1 81 ? -4.257  9.340   -1.645  1.00 0.00 ? 80 VAL B C    1  
ATOM 2739  O O    . VAL B 1 81 ? -4.237  10.502  -1.291  1.00 0.00 ? 80 VAL B O    1  
ATOM 2740  C CB   . VAL B 1 81 ? -6.372  8.192   -2.323  1.00 0.00 ? 80 VAL B CB   1  
ATOM 2741  C CG1  . VAL B 1 81 ? -7.109  9.116   -1.351  1.00 0.00 ? 80 VAL B CG1  1  
ATOM 2742  C CG2  . VAL B 1 81 ? -7.288  7.864   -3.504  1.00 0.00 ? 80 VAL B CG2  1  
ATOM 2743  H H    . VAL B 1 81 ? -4.651  7.031   -3.842  1.00 0.00 ? 80 VAL B H    1  
ATOM 2744  H HA   . VAL B 1 81 ? -5.387  9.746   -3.433  1.00 0.00 ? 80 VAL B HA   1  
ATOM 2745  H HB   . VAL B 1 81 ? -6.098  7.280   -1.813  1.00 0.00 ? 80 VAL B HB   1  
ATOM 2746  H HG11 . VAL B 1 81 ? -7.174  10.107  -1.776  1.00 0.00 ? 80 VAL B HG11 1  
ATOM 2747  H HG12 . VAL B 1 81 ? -8.104  8.734   -1.176  1.00 0.00 ? 80 VAL B HG12 1  
ATOM 2748  H HG13 . VAL B 1 81 ? -6.570  9.159   -0.416  1.00 0.00 ? 80 VAL B HG13 1  
ATOM 2749  H HG21 . VAL B 1 81 ? -6.719  7.364   -4.273  1.00 0.00 ? 80 VAL B HG21 1  
ATOM 2750  H HG22 . VAL B 1 81 ? -8.089  7.220   -3.170  1.00 0.00 ? 80 VAL B HG22 1  
ATOM 2751  H HG23 . VAL B 1 81 ? -7.704  8.778   -3.901  1.00 0.00 ? 80 VAL B HG23 1  
ATOM 2752  N N    . THR B 1 82 ? -3.545  8.436   -1.032  1.00 0.00 ? 81 THR B N    1  
ATOM 2753  C CA   . THR B 1 82 ? -2.689  8.828   0.122   1.00 0.00 ? 81 THR B CA   1  
ATOM 2754  C C    . THR B 1 82 ? -1.524  9.676   -0.392  1.00 0.00 ? 81 THR B C    1  
ATOM 2755  O O    . THR B 1 82 ? -1.224  10.728  0.137   1.00 0.00 ? 81 THR B O    1  
ATOM 2756  C CB   . THR B 1 82 ? -2.146  7.571   0.806   1.00 0.00 ? 81 THR B CB   1  
ATOM 2757  O OG1  . THR B 1 82 ? -3.216  6.670   1.055   1.00 0.00 ? 81 THR B OG1  1  
ATOM 2758  C CG2  . THR B 1 82 ? -1.481  7.954   2.130   1.00 0.00 ? 81 THR B CG2  1  
ATOM 2759  H H    . THR B 1 82 ? -3.566  7.505   -1.335  1.00 0.00 ? 81 THR B H    1  
ATOM 2760  H HA   . THR B 1 82 ? -3.272  9.402   0.827   1.00 0.00 ? 81 THR B HA   1  
ATOM 2761  H HB   . THR B 1 82 ? -1.417  7.098   0.166   1.00 0.00 ? 81 THR B HB   1  
ATOM 2762  H HG1  . THR B 1 82 ? -3.482  6.771   1.971   1.00 0.00 ? 81 THR B HG1  1  
ATOM 2763  H HG21 . THR B 1 82 ? -0.747  8.726   1.953   1.00 0.00 ? 81 THR B HG21 1  
ATOM 2764  H HG22 . THR B 1 82 ? -2.231  8.321   2.816   1.00 0.00 ? 81 THR B HG22 1  
ATOM 2765  H HG23 . THR B 1 82 ? -0.998  7.087   2.554   1.00 0.00 ? 81 THR B HG23 1  
ATOM 2766  N N    . THR B 1 83 ? -0.869  9.222   -1.425  1.00 0.00 ? 82 THR B N    1  
ATOM 2767  C CA   . THR B 1 83 ? 0.277   9.988   -1.992  1.00 0.00 ? 82 THR B CA   1  
ATOM 2768  C C    . THR B 1 83 ? -0.241  11.223  -2.735  1.00 0.00 ? 82 THR B C    1  
ATOM 2769  O O    . THR B 1 83 ? 0.501   12.144  -3.013  1.00 0.00 ? 82 THR B O    1  
ATOM 2770  C CB   . THR B 1 83 ? 1.062   9.100   -2.961  1.00 0.00 ? 82 THR B CB   1  
ATOM 2771  O OG1  . THR B 1 83 ? 0.202   8.663   -4.002  1.00 0.00 ? 82 THR B OG1  1  
ATOM 2772  C CG2  . THR B 1 83 ? 1.617   7.889   -2.211  1.00 0.00 ? 82 THR B CG2  1  
ATOM 2773  H H    . THR B 1 83 ? -1.134  8.371   -1.833  1.00 0.00 ? 82 THR B H    1  
ATOM 2774  H HA   . THR B 1 83 ? 0.928   10.302  -1.189  1.00 0.00 ? 82 THR B HA   1  
ATOM 2775  H HB   . THR B 1 83 ? 1.880   9.663   -3.382  1.00 0.00 ? 82 THR B HB   1  
ATOM 2776  H HG1  . THR B 1 83 ? 0.579   7.867   -4.383  1.00 0.00 ? 82 THR B HG1  1  
ATOM 2777  H HG21 . THR B 1 83 ? 2.069   8.214   -1.286  1.00 0.00 ? 82 THR B HG21 1  
ATOM 2778  H HG22 . THR B 1 83 ? 0.815   7.199   -1.997  1.00 0.00 ? 82 THR B HG22 1  
ATOM 2779  H HG23 . THR B 1 83 ? 2.361   7.398   -2.822  1.00 0.00 ? 82 THR B HG23 1  
ATOM 2780  N N    . ALA B 1 84 ? -1.507  11.254  -3.063  1.00 0.00 ? 83 ALA B N    1  
ATOM 2781  C CA   . ALA B 1 84 ? -2.053  12.436  -3.790  1.00 0.00 ? 83 ALA B CA   1  
ATOM 2782  C C    . ALA B 1 84 ? -1.662  13.704  -3.034  1.00 0.00 ? 83 ALA B C    1  
ATOM 2783  O O    . ALA B 1 84 ? -1.288  14.699  -3.621  1.00 0.00 ? 83 ALA B O    1  
ATOM 2784  C CB   . ALA B 1 84 ? -3.579  12.340  -3.866  1.00 0.00 ? 83 ALA B CB   1  
ATOM 2785  H H    . ALA B 1 84 ? -2.094  10.506  -2.827  1.00 0.00 ? 83 ALA B H    1  
ATOM 2786  H HA   . ALA B 1 84 ? -1.642  12.469  -4.788  1.00 0.00 ? 83 ALA B HA   1  
ATOM 2787  H HB1  . ALA B 1 84 ? -3.982  12.219  -2.872  1.00 0.00 ? 83 ALA B HB1  1  
ATOM 2788  H HB2  . ALA B 1 84 ? -3.975  13.244  -4.305  1.00 0.00 ? 83 ALA B HB2  1  
ATOM 2789  H HB3  . ALA B 1 84 ? -3.858  11.493  -4.474  1.00 0.00 ? 83 ALA B HB3  1  
ATOM 2790  N N    . CYS B 1 85 ? -1.729  13.669  -1.733  1.00 0.00 ? 84 CYS B N    1  
ATOM 2791  C CA   . CYS B 1 85 ? -1.342  14.869  -0.941  1.00 0.00 ? 84 CYS B CA   1  
ATOM 2792  C C    . CYS B 1 85 ? 0.181   15.005  -0.978  1.00 0.00 ? 84 CYS B C    1  
ATOM 2793  O O    . CYS B 1 85 ? 0.878   14.537  -0.099  1.00 0.00 ? 84 CYS B O    1  
ATOM 2794  C CB   . CYS B 1 85 ? -1.808  14.703  0.507   1.00 0.00 ? 84 CYS B CB   1  
ATOM 2795  S SG   . CYS B 1 85 ? -1.528  16.245  1.412   1.00 0.00 ? 84 CYS B SG   1  
ATOM 2796  H H    . CYS B 1 85 ? -2.024  12.851  -1.278  1.00 0.00 ? 84 CYS B H    1  
ATOM 2797  H HA   . CYS B 1 85 ? -1.796  15.750  -1.371  1.00 0.00 ? 84 CYS B HA   1  
ATOM 2798  H HB2  . CYS B 1 85 ? -2.862  14.464  0.521   1.00 0.00 ? 84 CYS B HB2  1  
ATOM 2799  H HB3  . CYS B 1 85 ? -1.252  13.904  0.975   1.00 0.00 ? 84 CYS B HB3  1  
ATOM 2800  H HG   . CYS B 1 85 ? -2.334  16.764  1.371   1.00 0.00 ? 84 CYS B HG   1  
ATOM 2801  N N    . HIS B 1 86 ? 0.701   15.628  -2.002  1.00 0.00 ? 85 HIS B N    1  
ATOM 2802  C CA   . HIS B 1 86 ? 2.180   15.786  -2.123  1.00 0.00 ? 85 HIS B CA   1  
ATOM 2803  C C    . HIS B 1 86 ? 2.786   16.192  -0.775  1.00 0.00 ? 85 HIS B C    1  
ATOM 2804  O O    . HIS B 1 86 ? 2.275   17.051  -0.084  1.00 0.00 ? 85 HIS B O    1  
ATOM 2805  C CB   . HIS B 1 86 ? 2.494   16.858  -3.173  1.00 0.00 ? 85 HIS B CB   1  
ATOM 2806  C CG   . HIS B 1 86 ? 2.067   18.210  -2.666  1.00 0.00 ? 85 HIS B CG   1  
ATOM 2807  N ND1  . HIS B 1 86 ? 2.831   19.348  -2.869  1.00 0.00 ? 85 HIS B ND1  1  
ATOM 2808  C CD2  . HIS B 1 86 ? 0.962   18.620  -1.963  1.00 0.00 ? 85 HIS B CD2  1  
ATOM 2809  C CE1  . HIS B 1 86 ? 2.182   20.379  -2.297  1.00 0.00 ? 85 HIS B CE1  1  
ATOM 2810  N NE2  . HIS B 1 86 ? 1.037   19.990  -1.731  1.00 0.00 ? 85 HIS B NE2  1  
ATOM 2811  H H    . HIS B 1 86 ? 0.115   15.984  -2.703  1.00 0.00 ? 85 HIS B H    1  
ATOM 2812  H HA   . HIS B 1 86 ? 2.612   14.847  -2.436  1.00 0.00 ? 85 HIS B HA   1  
ATOM 2813  H HB2  . HIS B 1 86 ? 3.556   16.867  -3.369  1.00 0.00 ? 85 HIS B HB2  1  
ATOM 2814  H HB3  . HIS B 1 86 ? 1.962   16.633  -4.085  1.00 0.00 ? 85 HIS B HB3  1  
ATOM 2815  H HD1  . HIS B 1 86 ? 3.689   19.394  -3.341  1.00 0.00 ? 85 HIS B HD1  1  
ATOM 2816  H HD2  . HIS B 1 86 ? 0.157   17.977  -1.639  1.00 0.00 ? 85 HIS B HD2  1  
ATOM 2817  H HE1  . HIS B 1 86 ? 2.543   21.397  -2.297  1.00 0.00 ? 85 HIS B HE1  1  
ATOM 2818  N N    . GLU B 1 87 ? 3.877   15.581  -0.405  1.00 0.00 ? 86 GLU B N    1  
ATOM 2819  C CA   . GLU B 1 87 ? 4.531   15.925  0.889   1.00 0.00 ? 86 GLU B CA   1  
ATOM 2820  C C    . GLU B 1 87 ? 3.544   15.731  2.041   1.00 0.00 ? 86 GLU B C    1  
ATOM 2821  O O    . GLU B 1 87 ? 3.235   16.656  2.766   1.00 0.00 ? 86 GLU B O    1  
ATOM 2822  C CB   . GLU B 1 87 ? 4.994   17.384  0.854   1.00 0.00 ? 86 GLU B CB   1  
ATOM 2823  C CG   . GLU B 1 87 ? 5.980   17.635  1.996   1.00 0.00 ? 86 GLU B CG   1  
ATOM 2824  C CD   . GLU B 1 87 ? 6.226   19.138  2.138   1.00 0.00 ? 86 GLU B CD   1  
ATOM 2825  O OE1  . GLU B 1 87 ? 5.673   19.886  1.348   1.00 0.00 ? 86 GLU B OE1  1  
ATOM 2826  O OE2  . GLU B 1 87 ? 6.964   19.516  3.033   1.00 0.00 ? 86 GLU B OE2  1  
ATOM 2827  H H    . GLU B 1 87 ? 4.272   14.895  -0.983  1.00 0.00 ? 86 GLU B H    1  
ATOM 2828  H HA   . GLU B 1 87 ? 5.386   15.282  1.039   1.00 0.00 ? 86 GLU B HA   1  
ATOM 2829  H HB2  . GLU B 1 87 ? 5.478   17.585  -0.091  1.00 0.00 ? 86 GLU B HB2  1  
ATOM 2830  H HB3  . GLU B 1 87 ? 4.141   18.036  0.967   1.00 0.00 ? 86 GLU B HB3  1  
ATOM 2831  H HG2  . GLU B 1 87 ? 5.569   17.248  2.918   1.00 0.00 ? 86 GLU B HG2  1  
ATOM 2832  H HG3  . GLU B 1 87 ? 6.914   17.138  1.782   1.00 0.00 ? 86 GLU B HG3  1  
ATOM 2833  N N    . PHE B 1 88 ? 3.052   14.536  2.226   1.00 0.00 ? 87 PHE B N    1  
ATOM 2834  C CA   . PHE B 1 88 ? 2.096   14.296  3.343   1.00 0.00 ? 87 PHE B CA   1  
ATOM 2835  C C    . PHE B 1 88 ? 2.849   14.417  4.670   1.00 0.00 ? 87 PHE B C    1  
ATOM 2836  O O    . PHE B 1 88 ? 2.279   14.739  5.694   1.00 0.00 ? 87 PHE B O    1  
ATOM 2837  C CB   . PHE B 1 88 ? 1.474   12.899  3.211   1.00 0.00 ? 87 PHE B CB   1  
ATOM 2838  C CG   . PHE B 1 88 ? 2.514   11.914  2.730   1.00 0.00 ? 87 PHE B CG   1  
ATOM 2839  C CD1  . PHE B 1 88 ? 2.813   11.822  1.366   1.00 0.00 ? 87 PHE B CD1  1  
ATOM 2840  C CD2  . PHE B 1 88 ? 3.172   11.088  3.649   1.00 0.00 ? 87 PHE B CD2  1  
ATOM 2841  C CE1  . PHE B 1 88 ? 3.772   10.905  0.920   1.00 0.00 ? 87 PHE B CE1  1  
ATOM 2842  C CE2  . PHE B 1 88 ? 4.130   10.170  3.203   1.00 0.00 ? 87 PHE B CE2  1  
ATOM 2843  C CZ   . PHE B 1 88 ? 4.430   10.078  1.838   1.00 0.00 ? 87 PHE B CZ   1  
ATOM 2844  H H    . PHE B 1 88 ? 3.317   13.800  1.637   1.00 0.00 ? 87 PHE B H    1  
ATOM 2845  H HA   . PHE B 1 88 ? 1.314   15.041  3.308   1.00 0.00 ? 87 PHE B HA   1  
ATOM 2846  H HB2  . PHE B 1 88 ? 1.093   12.580  4.170   1.00 0.00 ? 87 PHE B HB2  1  
ATOM 2847  H HB3  . PHE B 1 88 ? 0.663   12.936  2.499   1.00 0.00 ? 87 PHE B HB3  1  
ATOM 2848  H HD1  . PHE B 1 88 ? 2.305   12.459  0.657   1.00 0.00 ? 87 PHE B HD1  1  
ATOM 2849  H HD2  . PHE B 1 88 ? 2.941   11.159  4.702   1.00 0.00 ? 87 PHE B HD2  1  
ATOM 2850  H HE1  . PHE B 1 88 ? 4.004   10.834  -0.133  1.00 0.00 ? 87 PHE B HE1  1  
ATOM 2851  H HE2  . PHE B 1 88 ? 4.636   9.531   3.911   1.00 0.00 ? 87 PHE B HE2  1  
ATOM 2852  H HZ   . PHE B 1 88 ? 5.169   9.370   1.494   1.00 0.00 ? 87 PHE B HZ   1  
ATOM 2853  N N    . PHE B 1 89 ? 4.133   14.173  4.656   1.00 0.00 ? 88 PHE B N    1  
ATOM 2854  C CA   . PHE B 1 89 ? 4.931   14.288  5.911   1.00 0.00 ? 88 PHE B CA   1  
ATOM 2855  C C    . PHE B 1 89 ? 4.688   15.660  6.538   1.00 0.00 ? 88 PHE B C    1  
ATOM 2856  O O    . PHE B 1 89 ? 4.666   15.809  7.743   1.00 0.00 ? 88 PHE B O    1  
ATOM 2857  C CB   . PHE B 1 89 ? 6.418   14.128  5.587   1.00 0.00 ? 88 PHE B CB   1  
ATOM 2858  C CG   . PHE B 1 89 ? 6.631   12.864  4.788   1.00 0.00 ? 88 PHE B CG   1  
ATOM 2859  C CD1  . PHE B 1 89 ? 6.741   11.630  5.442   1.00 0.00 ? 88 PHE B CD1  1  
ATOM 2860  C CD2  . PHE B 1 89 ? 6.720   12.926  3.392   1.00 0.00 ? 88 PHE B CD2  1  
ATOM 2861  C CE1  . PHE B 1 89 ? 6.940   10.459  4.699   1.00 0.00 ? 88 PHE B CE1  1  
ATOM 2862  C CE2  . PHE B 1 89 ? 6.919   11.755  2.650   1.00 0.00 ? 88 PHE B CE2  1  
ATOM 2863  C CZ   . PHE B 1 89 ? 7.029   10.522  3.304   1.00 0.00 ? 88 PHE B CZ   1  
ATOM 2864  H H    . PHE B 1 89 ? 4.573   13.925  3.817   1.00 0.00 ? 88 PHE B H    1  
ATOM 2865  H HA   . PHE B 1 89 ? 4.630   13.524  6.611   1.00 0.00 ? 88 PHE B HA   1  
ATOM 2866  H HB2  . PHE B 1 89 ? 6.754   14.978  5.011   1.00 0.00 ? 88 PHE B HB2  1  
ATOM 2867  H HB3  . PHE B 1 89 ? 6.982   14.071  6.506   1.00 0.00 ? 88 PHE B HB3  1  
ATOM 2868  H HD1  . PHE B 1 89 ? 6.672   11.582  6.519   1.00 0.00 ? 88 PHE B HD1  1  
ATOM 2869  H HD2  . PHE B 1 89 ? 6.636   13.877  2.887   1.00 0.00 ? 88 PHE B HD2  1  
ATOM 2870  H HE1  . PHE B 1 89 ? 7.024   9.507   5.203   1.00 0.00 ? 88 PHE B HE1  1  
ATOM 2871  H HE2  . PHE B 1 89 ? 6.988   11.803  1.573   1.00 0.00 ? 88 PHE B HE2  1  
ATOM 2872  H HZ   . PHE B 1 89 ? 7.182   9.619   2.732   1.00 0.00 ? 88 PHE B HZ   1  
ATOM 2873  N N    . GLU B 1 90 ? 4.505   16.665  5.727   1.00 0.00 ? 89 GLU B N    1  
ATOM 2874  C CA   . GLU B 1 90 ? 4.262   18.029  6.274   1.00 0.00 ? 89 GLU B CA   1  
ATOM 2875  C C    . GLU B 1 90 ? 2.849   18.097  6.856   1.00 0.00 ? 89 GLU B C    1  
ATOM 2876  O O    . GLU B 1 90 ? 2.010   18.842  6.390   1.00 0.00 ? 89 GLU B O    1  
ATOM 2877  C CB   . GLU B 1 90 ? 4.405   19.062  5.154   1.00 0.00 ? 89 GLU B CB   1  
ATOM 2878  C CG   . GLU B 1 90 ? 4.451   20.467  5.757   1.00 0.00 ? 89 GLU B CG   1  
ATOM 2879  C CD   . GLU B 1 90 ? 4.552   21.501  4.634   1.00 0.00 ? 89 GLU B CD   1  
ATOM 2880  O OE1  . GLU B 1 90 ? 5.444   21.369  3.813   1.00 0.00 ? 89 GLU B OE1  1  
ATOM 2881  O OE2  . GLU B 1 90 ? 3.735   22.407  4.615   1.00 0.00 ? 89 GLU B OE2  1  
ATOM 2882  H H    . GLU B 1 90 ? 4.526   16.521  4.758   1.00 0.00 ? 89 GLU B H    1  
ATOM 2883  H HA   . GLU B 1 90 ? 4.982   18.238  7.052   1.00 0.00 ? 89 GLU B HA   1  
ATOM 2884  H HB2  . GLU B 1 90 ? 5.317   18.874  4.606   1.00 0.00 ? 89 GLU B HB2  1  
ATOM 2885  H HB3  . GLU B 1 90 ? 3.561   18.986  4.485   1.00 0.00 ? 89 GLU B HB3  1  
ATOM 2886  H HG2  . GLU B 1 90 ? 3.551   20.642  6.330   1.00 0.00 ? 89 GLU B HG2  1  
ATOM 2887  H HG3  . GLU B 1 90 ? 5.312   20.554  6.402   1.00 0.00 ? 89 GLU B HG3  1  
ATOM 2888  N N    . HIS B 1 91 ? 2.581   17.325  7.873   1.00 0.00 ? 90 HIS B N    1  
ATOM 2889  C CA   . HIS B 1 91 ? 1.224   17.345  8.488   1.00 0.00 ? 90 HIS B CA   1  
ATOM 2890  C C    . HIS B 1 91 ? 1.062   18.620  9.317   1.00 0.00 ? 90 HIS B C    1  
ATOM 2891  O O    . HIS B 1 91 ? 1.773   18.842  10.277  1.00 0.00 ? 90 HIS B O    1  
ATOM 2892  C CB   . HIS B 1 91 ? 1.058   16.123  9.394   1.00 0.00 ? 90 HIS B CB   1  
ATOM 2893  C CG   . HIS B 1 91 ? -0.366  16.038  9.869   1.00 0.00 ? 90 HIS B CG   1  
ATOM 2894  N ND1  . HIS B 1 91 ? -1.154  17.165  10.046  1.00 0.00 ? 90 HIS B ND1  1  
ATOM 2895  C CD2  . HIS B 1 91 ? -1.157  14.970  10.210  1.00 0.00 ? 90 HIS B CD2  1  
ATOM 2896  C CE1  . HIS B 1 91 ? -2.360  16.752  10.475  1.00 0.00 ? 90 HIS B CE1  1  
ATOM 2897  N NE2  . HIS B 1 91 ? -2.417  15.423  10.592  1.00 0.00 ? 90 HIS B NE2  1  
ATOM 2898  H H    . HIS B 1 91 ? 3.273   16.733  8.234   1.00 0.00 ? 90 HIS B H    1  
ATOM 2899  H HA   . HIS B 1 91 ? 0.475   17.322  7.710   1.00 0.00 ? 90 HIS B HA   1  
ATOM 2900  H HB2  . HIS B 1 91 ? 1.307   15.229  8.840   1.00 0.00 ? 90 HIS B HB2  1  
ATOM 2901  H HB3  . HIS B 1 91 ? 1.717   16.213  10.245  1.00 0.00 ? 90 HIS B HB3  1  
ATOM 2902  H HD1  . HIS B 1 91 ? -0.882  18.093  9.887   1.00 0.00 ? 90 HIS B HD1  1  
ATOM 2903  H HD2  . HIS B 1 91 ? -0.849  13.935  10.185  1.00 0.00 ? 90 HIS B HD2  1  
ATOM 2904  H HE1  . HIS B 1 91 ? -3.183  17.415  10.698  1.00 0.00 ? 90 HIS B HE1  1  
ATOM 2905  N N    . GLU B 1 92 ? 0.133   19.463  8.953   1.00 0.00 ? 91 GLU B N    1  
ATOM 2906  C CA   . GLU B 1 92 ? -0.072  20.725  9.720   1.00 0.00 ? 91 GLU B CA   1  
ATOM 2907  C C    . GLU B 1 92 ? -1.493  21.241  9.481   1.00 0.00 ? 91 GLU B C    1  
ATOM 2908  O O    . GLU B 1 92 ? -2.029  21.876  10.374  1.00 0.00 ? 91 GLU B O    1  
ATOM 2909  C CB   . GLU B 1 92 ? 0.937   21.776  9.251   1.00 0.00 ? 91 GLU B CB   1  
ATOM 2910  C CG   . GLU B 1 92 ? 0.933   22.959  10.221  1.00 0.00 ? 91 GLU B CG   1  
ATOM 2911  C CD   . GLU B 1 92 ? 1.661   22.567  11.509  1.00 0.00 ? 91 GLU B CD   1  
ATOM 2912  O OE1  . GLU B 1 92 ? 2.880   22.551  11.495  1.00 0.00 ? 91 GLU B OE1  1  
ATOM 2913  O OE2  . GLU B 1 92 ? 0.985   22.290  12.486  1.00 0.00 ? 91 GLU B OE2  1  
ATOM 2914  O OXT  . GLU B 1 92 ? -2.020  20.992  8.409   1.00 0.00 ? 91 GLU B OXT  1  
ATOM 2915  H H    . GLU B 1 92 ? -0.428  19.266  8.175   1.00 0.00 ? 91 GLU B H    1  
ATOM 2916  H HA   . GLU B 1 92 ? 0.068   20.536  10.774  1.00 0.00 ? 91 GLU B HA   1  
ATOM 2917  H HB2  . GLU B 1 92 ? 1.924   21.337  9.219   1.00 0.00 ? 91 GLU B HB2  1  
ATOM 2918  H HB3  . GLU B 1 92 ? 0.665   22.121  8.265   1.00 0.00 ? 91 GLU B HB3  1  
ATOM 2919  H HG2  . GLU B 1 92 ? 1.435   23.800  9.764   1.00 0.00 ? 91 GLU B HG2  1  
ATOM 2920  H HG3  . GLU B 1 92 ? -0.085  23.231  10.454  1.00 0.00 ? 91 GLU B HG3  1  
ATOM 2921  N N    . MET A 1 1  ? -11.151 7.553   13.274  1.00 0.00 ? 0  MET A N    2  
ATOM 2922  C CA   . MET A 1 1  ? -9.787  6.966   13.396  1.00 0.00 ? 0  MET A CA   2  
ATOM 2923  C C    . MET A 1 1  ? -9.893  5.442   13.482  1.00 0.00 ? 0  MET A C    2  
ATOM 2924  O O    . MET A 1 1  ? -9.575  4.846   14.492  1.00 0.00 ? 0  MET A O    2  
ATOM 2925  C CB   . MET A 1 1  ? -9.113  7.501   14.662  1.00 0.00 ? 0  MET A CB   2  
ATOM 2926  C CG   . MET A 1 1  ? -8.920  9.014   14.541  1.00 0.00 ? 0  MET A CG   2  
ATOM 2927  S SD   . MET A 1 1  ? -7.920  9.606   15.928  1.00 0.00 ? 0  MET A SD   2  
ATOM 2928  C CE   . MET A 1 1  ? -7.680  11.295  15.329  1.00 0.00 ? 0  MET A CE   2  
ATOM 2929  H H1   . MET A 1 1  ? -11.723 6.969   12.628  1.00 0.00 ? 0  MET A H1   2  
ATOM 2930  H H2   . MET A 1 1  ? -11.603 7.580   14.209  1.00 0.00 ? 0  MET A H2   2  
ATOM 2931  H H3   . MET A 1 1  ? -11.080 8.519   12.897  1.00 0.00 ? 0  MET A H3   2  
ATOM 2932  H HA   . MET A 1 1  ? -9.199  7.237   12.532  1.00 0.00 ? 0  MET A HA   2  
ATOM 2933  H HB2  . MET A 1 1  ? -9.733  7.285   15.520  1.00 0.00 ? 0  MET A HB2  2  
ATOM 2934  H HB3  . MET A 1 1  ? -8.151  7.028   14.785  1.00 0.00 ? 0  MET A HB3  2  
ATOM 2935  H HG2  . MET A 1 1  ? -8.418  9.240   13.612  1.00 0.00 ? 0  MET A HG2  2  
ATOM 2936  H HG3  . MET A 1 1  ? -9.884  9.502   14.557  1.00 0.00 ? 0  MET A HG3  2  
ATOM 2937  H HE1  . MET A 1 1  ? -8.609  11.665  14.918  1.00 0.00 ? 0  MET A HE1  2  
ATOM 2938  H HE2  . MET A 1 1  ? -7.373  11.928  16.145  1.00 0.00 ? 0  MET A HE2  2  
ATOM 2939  H HE3  . MET A 1 1  ? -6.915  11.300  14.565  1.00 0.00 ? 0  MET A HE3  2  
ATOM 2940  N N    . SER A 1 2  ? -10.334 4.803   12.434  1.00 0.00 ? 1  SER A N    2  
ATOM 2941  C CA   . SER A 1 2  ? -10.450 3.320   12.472  1.00 0.00 ? 1  SER A CA   2  
ATOM 2942  C C    . SER A 1 2  ? -9.062  2.715   12.676  1.00 0.00 ? 1  SER A C    2  
ATOM 2943  O O    . SER A 1 2  ? -8.064  3.408   12.653  1.00 0.00 ? 1  SER A O    2  
ATOM 2944  C CB   . SER A 1 2  ? -11.044 2.814   11.158  1.00 0.00 ? 1  SER A CB   2  
ATOM 2945  O OG   . SER A 1 2  ? -10.042 2.839   10.151  1.00 0.00 ? 1  SER A OG   2  
ATOM 2946  H H    . SER A 1 2  ? -10.585 5.297   11.625  1.00 0.00 ? 1  SER A H    2  
ATOM 2947  H HA   . SER A 1 2  ? -11.089 3.033   13.294  1.00 0.00 ? 1  SER A HA   2  
ATOM 2948  H HB2  . SER A 1 2  ? -11.395 1.803   11.284  1.00 0.00 ? 1  SER A HB2  2  
ATOM 2949  H HB3  . SER A 1 2  ? -11.874 3.447   10.871  1.00 0.00 ? 1  SER A HB3  2  
ATOM 2950  H HG   . SER A 1 2  ? -9.843  3.757   9.953   1.00 0.00 ? 1  SER A HG   2  
ATOM 2951  N N    . GLU A 1 3  ? -8.987  1.430   12.882  1.00 0.00 ? 2  GLU A N    2  
ATOM 2952  C CA   . GLU A 1 3  ? -7.658  0.792   13.096  1.00 0.00 ? 2  GLU A CA   2  
ATOM 2953  C C    . GLU A 1 3  ? -6.797  0.966   11.844  1.00 0.00 ? 2  GLU A C    2  
ATOM 2954  O O    . GLU A 1 3  ? -5.596  1.136   11.923  1.00 0.00 ? 2  GLU A O    2  
ATOM 2955  C CB   . GLU A 1 3  ? -7.850  -0.699  13.381  1.00 0.00 ? 2  GLU A CB   2  
ATOM 2956  C CG   . GLU A 1 3  ? -8.509  -0.875  14.751  1.00 0.00 ? 2  GLU A CG   2  
ATOM 2957  C CD   . GLU A 1 3  ? -7.486  -0.583  15.851  1.00 0.00 ? 2  GLU A CD   2  
ATOM 2958  O OE1  . GLU A 1 3  ? -6.489  -1.284  15.907  1.00 0.00 ? 2  GLU A OE1  2  
ATOM 2959  O OE2  . GLU A 1 3  ? -7.718  0.336   16.619  1.00 0.00 ? 2  GLU A OE2  2  
ATOM 2960  H H    . GLU A 1 3  ? -9.802  0.886   12.903  1.00 0.00 ? 2  GLU A H    2  
ATOM 2961  H HA   . GLU A 1 3  ? -7.168  1.258   13.938  1.00 0.00 ? 2  GLU A HA   2  
ATOM 2962  H HB2  . GLU A 1 3  ? -8.480  -1.132  12.618  1.00 0.00 ? 2  GLU A HB2  2  
ATOM 2963  H HB3  . GLU A 1 3  ? -6.890  -1.192  13.379  1.00 0.00 ? 2  GLU A HB3  2  
ATOM 2964  H HG2  . GLU A 1 3  ? -9.340  -0.191  14.840  1.00 0.00 ? 2  GLU A HG2  2  
ATOM 2965  H HG3  . GLU A 1 3  ? -8.864  -1.890  14.852  1.00 0.00 ? 2  GLU A HG3  2  
ATOM 2966  N N    . LEU A 1 4  ? -7.401  0.917   10.687  1.00 0.00 ? 3  LEU A N    2  
ATOM 2967  C CA   . LEU A 1 4  ? -6.618  1.070   9.428   1.00 0.00 ? 3  LEU A CA   2  
ATOM 2968  C C    . LEU A 1 4  ? -6.033  2.486   9.355   1.00 0.00 ? 3  LEU A C    2  
ATOM 2969  O O    . LEU A 1 4  ? -4.868  2.669   9.064   1.00 0.00 ? 3  LEU A O    2  
ATOM 2970  C CB   . LEU A 1 4  ? -7.541  0.809   8.219   1.00 0.00 ? 3  LEU A CB   2  
ATOM 2971  C CG   . LEU A 1 4  ? -6.747  0.189   7.062   1.00 0.00 ? 3  LEU A CG   2  
ATOM 2972  C CD1  . LEU A 1 4  ? -7.686  -0.060  5.880   1.00 0.00 ? 3  LEU A CD1  2  
ATOM 2973  C CD2  . LEU A 1 4  ? -5.626  1.143   6.632   1.00 0.00 ? 3  LEU A CD2  2  
ATOM 2974  H H    . LEU A 1 4  ? -8.368  0.766   10.646  1.00 0.00 ? 3  LEU A H    2  
ATOM 2975  H HA   . LEU A 1 4  ? -5.809  0.352   9.429   1.00 0.00 ? 3  LEU A HA   2  
ATOM 2976  H HB2  . LEU A 1 4  ? -8.325  0.127   8.514   1.00 0.00 ? 3  LEU A HB2  2  
ATOM 2977  H HB3  . LEU A 1 4  ? -7.986  1.737   7.889   1.00 0.00 ? 3  LEU A HB3  2  
ATOM 2978  H HG   . LEU A 1 4  ? -6.319  -0.751  7.383   1.00 0.00 ? 3  LEU A HG   2  
ATOM 2979  H HD11 . LEU A 1 4  ? -8.578  -0.558  6.229   1.00 0.00 ? 3  LEU A HD11 2  
ATOM 2980  H HD12 . LEU A 1 4  ? -7.953  0.884   5.428   1.00 0.00 ? 3  LEU A HD12 2  
ATOM 2981  H HD13 . LEU A 1 4  ? -7.189  -0.681  5.150   1.00 0.00 ? 3  LEU A HD13 2  
ATOM 2982  H HD21 . LEU A 1 4  ? -6.003  2.155   6.604   1.00 0.00 ? 3  LEU A HD21 2  
ATOM 2983  H HD22 . LEU A 1 4  ? -4.811  1.081   7.338   1.00 0.00 ? 3  LEU A HD22 2  
ATOM 2984  H HD23 . LEU A 1 4  ? -5.270  0.865   5.651   1.00 0.00 ? 3  LEU A HD23 2  
ATOM 2985  N N    . GLU A 1 5  ? -6.822  3.491   9.628   1.00 0.00 ? 4  GLU A N    2  
ATOM 2986  C CA   . GLU A 1 5  ? -6.286  4.879   9.580   1.00 0.00 ? 4  GLU A CA   2  
ATOM 2987  C C    . GLU A 1 5  ? -5.043  4.956   10.466  1.00 0.00 ? 4  GLU A C    2  
ATOM 2988  O O    . GLU A 1 5  ? -4.012  5.465   10.075  1.00 0.00 ? 4  GLU A O    2  
ATOM 2989  C CB   . GLU A 1 5  ? -7.348  5.857   10.090  1.00 0.00 ? 4  GLU A CB   2  
ATOM 2990  C CG   . GLU A 1 5  ? -8.431  6.033   9.022   1.00 0.00 ? 4  GLU A CG   2  
ATOM 2991  C CD   . GLU A 1 5  ? -9.612  6.807   9.610   1.00 0.00 ? 4  GLU A CD   2  
ATOM 2992  O OE1  . GLU A 1 5  ? -10.218 6.306   10.543  1.00 0.00 ? 4  GLU A OE1  2  
ATOM 2993  O OE2  . GLU A 1 5  ? -9.891  7.887   9.117   1.00 0.00 ? 4  GLU A OE2  2  
ATOM 2994  H H    . GLU A 1 5  ? -7.758  3.339   9.876   1.00 0.00 ? 4  GLU A H    2  
ATOM 2995  H HA   . GLU A 1 5  ? -6.021  5.129   8.563   1.00 0.00 ? 4  GLU A HA   2  
ATOM 2996  H HB2  . GLU A 1 5  ? -7.791  5.467   10.995  1.00 0.00 ? 4  GLU A HB2  2  
ATOM 2997  H HB3  . GLU A 1 5  ? -6.890  6.812   10.295  1.00 0.00 ? 4  GLU A HB3  2  
ATOM 2998  H HG2  . GLU A 1 5  ? -8.024  6.580   8.184   1.00 0.00 ? 4  GLU A HG2  2  
ATOM 2999  H HG3  . GLU A 1 5  ? -8.769  5.063   8.689   1.00 0.00 ? 4  GLU A HG3  2  
ATOM 3000  N N    . LYS A 1 6  ? -5.139  4.433   11.657  1.00 0.00 ? 5  LYS A N    2  
ATOM 3001  C CA   . LYS A 1 6  ? -3.975  4.445   12.584  1.00 0.00 ? 5  LYS A CA   2  
ATOM 3002  C C    . LYS A 1 6  ? -2.737  3.924   11.855  1.00 0.00 ? 5  LYS A C    2  
ATOM 3003  O O    . LYS A 1 6  ? -1.642  4.423   12.017  1.00 0.00 ? 5  LYS A O    2  
ATOM 3004  C CB   . LYS A 1 6  ? -4.270  3.513   13.764  1.00 0.00 ? 5  LYS A CB   2  
ATOM 3005  C CG   . LYS A 1 6  ? -3.221  3.731   14.863  1.00 0.00 ? 5  LYS A CG   2  
ATOM 3006  C CD   . LYS A 1 6  ? -3.213  2.535   15.817  1.00 0.00 ? 5  LYS A CD   2  
ATOM 3007  C CE   . LYS A 1 6  ? -4.616  2.326   16.389  1.00 0.00 ? 5  LYS A CE   2  
ATOM 3008  N NZ   . LYS A 1 6  ? -4.544  1.396   17.551  1.00 0.00 ? 5  LYS A NZ   2  
ATOM 3009  H H    . LYS A 1 6  ? -5.983  4.021   11.940  1.00 0.00 ? 5  LYS A H    2  
ATOM 3010  H HA   . LYS A 1 6  ? -3.814  5.443   12.966  1.00 0.00 ? 5  LYS A HA   2  
ATOM 3011  H HB2  . LYS A 1 6  ? -5.253  3.730   14.156  1.00 0.00 ? 5  LYS A HB2  2  
ATOM 3012  H HB3  . LYS A 1 6  ? -4.234  2.486   13.430  1.00 0.00 ? 5  LYS A HB3  2  
ATOM 3013  H HG2  . LYS A 1 6  ? -2.243  3.837   14.415  1.00 0.00 ? 5  LYS A HG2  2  
ATOM 3014  H HG3  . LYS A 1 6  ? -3.462  4.626   15.415  1.00 0.00 ? 5  LYS A HG3  2  
ATOM 3015  H HD2  . LYS A 1 6  ? -2.907  1.649   15.280  1.00 0.00 ? 5  LYS A HD2  2  
ATOM 3016  H HD3  . LYS A 1 6  ? -2.522  2.724   16.625  1.00 0.00 ? 5  LYS A HD3  2  
ATOM 3017  H HE2  . LYS A 1 6  ? -5.019  3.275   16.712  1.00 0.00 ? 5  LYS A HE2  2  
ATOM 3018  H HE3  . LYS A 1 6  ? -5.256  1.904   15.629  1.00 0.00 ? 5  LYS A HE3  2  
ATOM 3019  H HZ1  . LYS A 1 6  ? -3.859  0.641   17.349  1.00 0.00 ? 5  LYS A HZ1  2  
ATOM 3020  H HZ2  . LYS A 1 6  ? -4.240  1.920   18.396  1.00 0.00 ? 5  LYS A HZ2  2  
ATOM 3021  H HZ3  . LYS A 1 6  ? -5.483  0.979   17.720  1.00 0.00 ? 5  LYS A HZ3  2  
ATOM 3022  N N    . ALA A 1 7  ? -2.921  2.906   11.057  1.00 0.00 ? 6  ALA A N    2  
ATOM 3023  C CA   . ALA A 1 7  ? -1.787  2.303   10.301  1.00 0.00 ? 6  ALA A CA   2  
ATOM 3024  C C    . ALA A 1 7  ? -1.390  3.193   9.120   1.00 0.00 ? 6  ALA A C    2  
ATOM 3025  O O    . ALA A 1 7  ? -0.249  3.193   8.701   1.00 0.00 ? 6  ALA A O    2  
ATOM 3026  C CB   . ALA A 1 7  ? -2.199  0.916   9.789   1.00 0.00 ? 6  ALA A CB   2  
ATOM 3027  H H    . ALA A 1 7  ? -3.821  2.533   10.954  1.00 0.00 ? 6  ALA A H    2  
ATOM 3028  H HA   . ALA A 1 7  ? -0.925  2.208   10.943  1.00 0.00 ? 6  ALA A HA   2  
ATOM 3029  H HB1  . ALA A 1 7  ? -3.216  0.954   9.424   1.00 0.00 ? 6  ALA A HB1  2  
ATOM 3030  H HB2  . ALA A 1 7  ? -1.541  0.611   8.988   1.00 0.00 ? 6  ALA A HB2  2  
ATOM 3031  H HB3  . ALA A 1 7  ? -2.137  0.201   10.597  1.00 0.00 ? 6  ALA A HB3  2  
ATOM 3032  N N    . MET A 1 8  ? -2.289  3.972   8.591   1.00 0.00 ? 7  MET A N    2  
ATOM 3033  C CA   . MET A 1 8  ? -1.896  4.863   7.464   1.00 0.00 ? 7  MET A CA   2  
ATOM 3034  C C    . MET A 1 8  ? -0.931  5.925   8.015   1.00 0.00 ? 7  MET A C    2  
ATOM 3035  O O    . MET A 1 8  ? 0.150   6.134   7.491   1.00 0.00 ? 7  MET A O    2  
ATOM 3036  C CB   . MET A 1 8  ? -3.156  5.537   6.876   1.00 0.00 ? 7  MET A CB   2  
ATOM 3037  C CG   . MET A 1 8  ? -3.702  4.724   5.685   1.00 0.00 ? 7  MET A CG   2  
ATOM 3038  S SD   . MET A 1 8  ? -2.936  5.322   4.150   1.00 0.00 ? 7  MET A SD   2  
ATOM 3039  C CE   . MET A 1 8  ? -2.197  3.763   3.599   1.00 0.00 ? 7  MET A CE   2  
ATOM 3040  H H    . MET A 1 8  ? -3.204  3.988   8.944   1.00 0.00 ? 7  MET A H    2  
ATOM 3041  H HA   . MET A 1 8  ? -1.394  4.283   6.702   1.00 0.00 ? 7  MET A HA   2  
ATOM 3042  H HB2  . MET A 1 8  ? -3.914  5.597   7.645   1.00 0.00 ? 7  MET A HB2  2  
ATOM 3043  H HB3  . MET A 1 8  ? -2.914  6.537   6.541   1.00 0.00 ? 7  MET A HB3  2  
ATOM 3044  H HG2  . MET A 1 8  ? -3.480  3.676   5.823   1.00 0.00 ? 7  MET A HG2  2  
ATOM 3045  H HG3  . MET A 1 8  ? -4.774  4.855   5.621   1.00 0.00 ? 7  MET A HG3  2  
ATOM 3046  H HE1  . MET A 1 8  ? -1.636  3.323   4.408   1.00 0.00 ? 7  MET A HE1  2  
ATOM 3047  H HE2  . MET A 1 8  ? -2.980  3.082   3.294   1.00 0.00 ? 7  MET A HE2  2  
ATOM 3048  H HE3  . MET A 1 8  ? -1.534  3.955   2.766   1.00 0.00 ? 7  MET A HE3  2  
ATOM 3049  N N    . VAL A 1 9  ? -1.307  6.585   9.079   1.00 0.00 ? 8  VAL A N    2  
ATOM 3050  C CA   . VAL A 1 9  ? -0.411  7.621   9.663   1.00 0.00 ? 8  VAL A CA   2  
ATOM 3051  C C    . VAL A 1 9  ? 0.850   6.942   10.207  1.00 0.00 ? 8  VAL A C    2  
ATOM 3052  O O    . VAL A 1 9  ? 1.943   7.459   10.093  1.00 0.00 ? 8  VAL A O    2  
ATOM 3053  C CB   . VAL A 1 9  ? -1.143  8.358   10.796  1.00 0.00 ? 8  VAL A CB   2  
ATOM 3054  C CG1  . VAL A 1 9  ? -0.505  9.734   11.022  1.00 0.00 ? 8  VAL A CG1  2  
ATOM 3055  C CG2  . VAL A 1 9  ? -2.616  8.539   10.414  1.00 0.00 ? 8  VAL A CG2  2  
ATOM 3056  H H    . VAL A 1 9  ? -2.174  6.396   9.493   1.00 0.00 ? 8  VAL A H    2  
ATOM 3057  H HA   . VAL A 1 9  ? -0.134  8.323   8.890   1.00 0.00 ? 8  VAL A HA   2  
ATOM 3058  H HB   . VAL A 1 9  ? -1.078  7.780   11.708  1.00 0.00 ? 8  VAL A HB   2  
ATOM 3059  H HG11 . VAL A 1 9  ? 0.567   9.626   11.091  1.00 0.00 ? 8  VAL A HG11 2  
ATOM 3060  H HG12 . VAL A 1 9  ? -0.749  10.384  10.195  1.00 0.00 ? 8  VAL A HG12 2  
ATOM 3061  H HG13 . VAL A 1 9  ? -0.883  10.160  11.939  1.00 0.00 ? 8  VAL A HG13 2  
ATOM 3062  H HG21 . VAL A 1 9  ? -2.686  8.863   9.386   1.00 0.00 ? 8  VAL A HG21 2  
ATOM 3063  H HG22 . VAL A 1 9  ? -3.135  7.600   10.531  1.00 0.00 ? 8  VAL A HG22 2  
ATOM 3064  H HG23 . VAL A 1 9  ? -3.068  9.281   11.056  1.00 0.00 ? 8  VAL A HG23 2  
ATOM 3065  N N    . ALA A 1 10 ? 0.707   5.781   10.788  1.00 0.00 ? 9  ALA A N    2  
ATOM 3066  C CA   . ALA A 1 10 ? 1.899   5.067   11.324  1.00 0.00 ? 9  ALA A CA   2  
ATOM 3067  C C    . ALA A 1 10 ? 2.889   4.830   10.183  1.00 0.00 ? 9  ALA A C    2  
ATOM 3068  O O    . ALA A 1 10 ? 4.068   5.082   10.309  1.00 0.00 ? 9  ALA A O    2  
ATOM 3069  C CB   . ALA A 1 10 ? 1.465   3.719   11.906  1.00 0.00 ? 9  ALA A CB   2  
ATOM 3070  H H    . ALA A 1 10 ? -0.181  5.373   10.863  1.00 0.00 ? 9  ALA A H    2  
ATOM 3071  H HA   . ALA A 1 10 ? 2.361   5.657   12.101  1.00 0.00 ? 9  ALA A HA   2  
ATOM 3072  H HB1  . ALA A 1 10 ? 0.580   3.855   12.507  1.00 0.00 ? 9  ALA A HB1  2  
ATOM 3073  H HB2  . ALA A 1 10 ? 1.252   3.030   11.102  1.00 0.00 ? 9  ALA A HB2  2  
ATOM 3074  H HB3  . ALA A 1 10 ? 2.259   3.321   12.521  1.00 0.00 ? 9  ALA A HB3  2  
ATOM 3075  N N    . LEU A 1 11 ? 2.417   4.331   9.074   1.00 0.00 ? 10 LEU A N    2  
ATOM 3076  C CA   . LEU A 1 11 ? 3.332   4.058   7.925   1.00 0.00 ? 10 LEU A CA   2  
ATOM 3077  C C    . LEU A 1 11 ? 4.265   5.256   7.729   1.00 0.00 ? 10 LEU A C    2  
ATOM 3078  O O    . LEU A 1 11 ? 5.446   5.104   7.490   1.00 0.00 ? 10 LEU A O    2  
ATOM 3079  C CB   . LEU A 1 11 ? 2.478   3.843   6.652   1.00 0.00 ? 10 LEU A CB   2  
ATOM 3080  C CG   . LEU A 1 11 ? 2.158   2.340   6.469   1.00 0.00 ? 10 LEU A CG   2  
ATOM 3081  C CD1  . LEU A 1 11 ? 0.889   2.173   5.630   1.00 0.00 ? 10 LEU A CD1  2  
ATOM 3082  C CD2  . LEU A 1 11 ? 3.321   1.638   5.753   1.00 0.00 ? 10 LEU A CD2  2  
ATOM 3083  H H    . LEU A 1 11 ? 1.462   4.115   9.005   1.00 0.00 ? 10 LEU A H    2  
ATOM 3084  H HA   . LEU A 1 11 ? 3.900   3.157   8.123   1.00 0.00 ? 10 LEU A HA   2  
ATOM 3085  H HB2  . LEU A 1 11 ? 1.555   4.395   6.755   1.00 0.00 ? 10 LEU A HB2  2  
ATOM 3086  H HB3  . LEU A 1 11 ? 3.011   4.204   5.783   1.00 0.00 ? 10 LEU A HB3  2  
ATOM 3087  H HG   . LEU A 1 11 ? 2.005   1.885   7.437   1.00 0.00 ? 10 LEU A HG   2  
ATOM 3088  H HD11 . LEU A 1 11 ? 0.951   2.799   4.752   1.00 0.00 ? 10 LEU A HD11 2  
ATOM 3089  H HD12 . LEU A 1 11 ? 0.790   1.140   5.329   1.00 0.00 ? 10 LEU A HD12 2  
ATOM 3090  H HD13 . LEU A 1 11 ? 0.030   2.460   6.218   1.00 0.00 ? 10 LEU A HD13 2  
ATOM 3091  H HD21 . LEU A 1 11 ? 3.532   2.144   4.822   1.00 0.00 ? 10 LEU A HD21 2  
ATOM 3092  H HD22 . LEU A 1 11 ? 4.199   1.657   6.380   1.00 0.00 ? 10 LEU A HD22 2  
ATOM 3093  H HD23 . LEU A 1 11 ? 3.049   0.612   5.550   1.00 0.00 ? 10 LEU A HD23 2  
ATOM 3094  N N    . ILE A 1 12 ? 3.747   6.450   7.854   1.00 0.00 ? 11 ILE A N    2  
ATOM 3095  C CA   . ILE A 1 12 ? 4.626   7.643   7.699   1.00 0.00 ? 11 ILE A CA   2  
ATOM 3096  C C    . ILE A 1 12 ? 5.648   7.618   8.844   1.00 0.00 ? 11 ILE A C    2  
ATOM 3097  O O    . ILE A 1 12 ? 6.806   7.941   8.672   1.00 0.00 ? 11 ILE A O    2  
ATOM 3098  C CB   . ILE A 1 12 ? 3.779   8.934   7.760   1.00 0.00 ? 11 ILE A CB   2  
ATOM 3099  C CG1  . ILE A 1 12 ? 3.086   9.170   6.408   1.00 0.00 ? 11 ILE A CG1  2  
ATOM 3100  C CG2  . ILE A 1 12 ? 4.673   10.142  8.070   1.00 0.00 ? 11 ILE A CG2  2  
ATOM 3101  C CD1  . ILE A 1 12 ? 1.968   8.147   6.203   1.00 0.00 ? 11 ILE A CD1  2  
ATOM 3102  H H    . ILE A 1 12 ? 2.795   6.557   8.066   1.00 0.00 ? 11 ILE A H    2  
ATOM 3103  H HA   . ILE A 1 12 ? 5.137   7.584   6.749   1.00 0.00 ? 11 ILE A HA   2  
ATOM 3104  H HB   . ILE A 1 12 ? 3.033   8.837   8.534   1.00 0.00 ? 11 ILE A HB   2  
ATOM 3105  H HG12 . ILE A 1 12 ? 2.664   10.165  6.395   1.00 0.00 ? 11 ILE A HG12 2  
ATOM 3106  H HG13 . ILE A 1 12 ? 3.805   9.079   5.609   1.00 0.00 ? 11 ILE A HG13 2  
ATOM 3107  H HG21 . ILE A 1 12 ? 5.557   10.105  7.451   1.00 0.00 ? 11 ILE A HG21 2  
ATOM 3108  H HG22 . ILE A 1 12 ? 4.131   11.054  7.868   1.00 0.00 ? 11 ILE A HG22 2  
ATOM 3109  H HG23 . ILE A 1 12 ? 4.961   10.120  9.111   1.00 0.00 ? 11 ILE A HG23 2  
ATOM 3110  H HD11 . ILE A 1 12 ? 1.354   8.101   7.089   1.00 0.00 ? 11 ILE A HD11 2  
ATOM 3111  H HD12 . ILE A 1 12 ? 1.360   8.444   5.361   1.00 0.00 ? 11 ILE A HD12 2  
ATOM 3112  H HD13 . ILE A 1 12 ? 2.397   7.175   6.010   1.00 0.00 ? 11 ILE A HD13 2  
ATOM 3113  N N    . ASP A 1 13 ? 5.210   7.228   10.013  1.00 0.00 ? 12 ASP A N    2  
ATOM 3114  C CA   . ASP A 1 13 ? 6.124   7.160   11.188  1.00 0.00 ? 12 ASP A CA   2  
ATOM 3115  C C    . ASP A 1 13 ? 7.376   6.361   10.834  1.00 0.00 ? 12 ASP A C    2  
ATOM 3116  O O    . ASP A 1 13 ? 8.491   6.808   11.017  1.00 0.00 ? 12 ASP A O    2  
ATOM 3117  C CB   . ASP A 1 13 ? 5.400   6.444   12.341  1.00 0.00 ? 12 ASP A CB   2  
ATOM 3118  C CG   . ASP A 1 13 ? 6.113   6.745   13.664  1.00 0.00 ? 12 ASP A CG   2  
ATOM 3119  O OD1  . ASP A 1 13 ? 5.845   7.790   14.233  1.00 0.00 ? 12 ASP A OD1  2  
ATOM 3120  O OD2  . ASP A 1 13 ? 6.914   5.926   14.083  1.00 0.00 ? 12 ASP A OD2  2  
ATOM 3121  H H    . ASP A 1 13 ? 4.271   6.973   10.117  1.00 0.00 ? 12 ASP A H    2  
ATOM 3122  H HA   . ASP A 1 13 ? 6.383   8.156   11.524  1.00 0.00 ? 12 ASP A HA   2  
ATOM 3123  H HB2  . ASP A 1 13 ? 4.380   6.794   12.396  1.00 0.00 ? 12 ASP A HB2  2  
ATOM 3124  H HB3  . ASP A 1 13 ? 5.405   5.377   12.172  1.00 0.00 ? 12 ASP A HB3  2  
ATOM 3125  N N    . VAL A 1 14 ? 7.188   5.159   10.355  1.00 0.00 ? 13 VAL A N    2  
ATOM 3126  C CA   . VAL A 1 14 ? 8.351   4.291   10.016  1.00 0.00 ? 13 VAL A CA   2  
ATOM 3127  C C    . VAL A 1 14 ? 9.030   4.755   8.724   1.00 0.00 ? 13 VAL A C    2  
ATOM 3128  O O    . VAL A 1 14 ? 10.241  4.725   8.627   1.00 0.00 ? 13 VAL A O    2  
ATOM 3129  C CB   . VAL A 1 14 ? 7.887   2.841   9.875   1.00 0.00 ? 13 VAL A CB   2  
ATOM 3130  C CG1  . VAL A 1 14 ? 9.074   1.957   9.484   1.00 0.00 ? 13 VAL A CG1  2  
ATOM 3131  C CG2  . VAL A 1 14 ? 7.309   2.359   11.207  1.00 0.00 ? 13 VAL A CG2  2  
ATOM 3132  H H    . VAL A 1 14 ? 6.273   4.815   10.239  1.00 0.00 ? 13 VAL A H    2  
ATOM 3133  H HA   . VAL A 1 14 ? 9.094   4.370   10.793  1.00 0.00 ? 13 VAL A HA   2  
ATOM 3134  H HB   . VAL A 1 14 ? 7.123   2.781   9.107   1.00 0.00 ? 13 VAL A HB   2  
ATOM 3135  H HG11 . VAL A 1 14 ? 9.926   2.206   10.100  1.00 0.00 ? 13 VAL A HG11 2  
ATOM 3136  H HG12 . VAL A 1 14 ? 8.814   0.919   9.632   1.00 0.00 ? 13 VAL A HG12 2  
ATOM 3137  H HG13 . VAL A 1 14 ? 9.319   2.122   8.446   1.00 0.00 ? 13 VAL A HG13 2  
ATOM 3138  H HG21 . VAL A 1 14 ? 8.042   2.494   11.988  1.00 0.00 ? 13 VAL A HG21 2  
ATOM 3139  H HG22 . VAL A 1 14 ? 6.422   2.930   11.442  1.00 0.00 ? 13 VAL A HG22 2  
ATOM 3140  H HG23 . VAL A 1 14 ? 7.052   1.312   11.131  1.00 0.00 ? 13 VAL A HG23 2  
ATOM 3141  N N    . PHE A 1 15 ? 8.305   5.178   7.730   1.00 0.00 ? 14 PHE A N    2  
ATOM 3142  C CA   . PHE A 1 15 ? 9.007   5.616   6.490   1.00 0.00 ? 14 PHE A CA   2  
ATOM 3143  C C    . PHE A 1 15 ? 9.903   6.807   6.829   1.00 0.00 ? 14 PHE A C    2  
ATOM 3144  O O    . PHE A 1 15 ? 10.964  6.988   6.263   1.00 0.00 ? 14 PHE A O    2  
ATOM 3145  C CB   . PHE A 1 15 ? 8.004   6.023   5.411   1.00 0.00 ? 14 PHE A CB   2  
ATOM 3146  C CG   . PHE A 1 15 ? 8.756   6.362   4.145   1.00 0.00 ? 14 PHE A CG   2  
ATOM 3147  C CD1  . PHE A 1 15 ? 9.028   5.361   3.203   1.00 0.00 ? 14 PHE A CD1  2  
ATOM 3148  C CD2  . PHE A 1 15 ? 9.190   7.675   3.915   1.00 0.00 ? 14 PHE A CD2  2  
ATOM 3149  C CE1  . PHE A 1 15 ? 9.732   5.673   2.033   1.00 0.00 ? 14 PHE A CE1  2  
ATOM 3150  C CE2  . PHE A 1 15 ? 9.893   7.986   2.743   1.00 0.00 ? 14 PHE A CE2  2  
ATOM 3151  C CZ   . PHE A 1 15 ? 10.163  6.984   1.803   1.00 0.00 ? 14 PHE A CZ   2  
ATOM 3152  H H    . PHE A 1 15 ? 7.328   5.205   7.793   1.00 0.00 ? 14 PHE A H    2  
ATOM 3153  H HA   . PHE A 1 15 ? 9.609   4.791   6.135   1.00 0.00 ? 14 PHE A HA   2  
ATOM 3154  H HB2  . PHE A 1 15 ? 7.325   5.205   5.220   1.00 0.00 ? 14 PHE A HB2  2  
ATOM 3155  H HB3  . PHE A 1 15 ? 7.447   6.888   5.741   1.00 0.00 ? 14 PHE A HB3  2  
ATOM 3156  H HD1  . PHE A 1 15 ? 8.694   4.349   3.379   1.00 0.00 ? 14 PHE A HD1  2  
ATOM 3157  H HD2  . PHE A 1 15 ? 8.982   8.447   4.641   1.00 0.00 ? 14 PHE A HD2  2  
ATOM 3158  H HE1  . PHE A 1 15 ? 9.941   4.901   1.307   1.00 0.00 ? 14 PHE A HE1  2  
ATOM 3159  H HE2  . PHE A 1 15 ? 10.227  8.999   2.564   1.00 0.00 ? 14 PHE A HE2  2  
ATOM 3160  H HZ   . PHE A 1 15 ? 10.706  7.224   0.901   1.00 0.00 ? 14 PHE A HZ   2  
ATOM 3161  N N    . HIS A 1 16 ? 9.473   7.625   7.753   1.00 0.00 ? 15 HIS A N    2  
ATOM 3162  C CA   . HIS A 1 16 ? 10.278  8.815   8.143   1.00 0.00 ? 15 HIS A CA   2  
ATOM 3163  C C    . HIS A 1 16 ? 11.389  8.404   9.115   1.00 0.00 ? 15 HIS A C    2  
ATOM 3164  O O    . HIS A 1 16 ? 12.453  8.991   9.142   1.00 0.00 ? 15 HIS A O    2  
ATOM 3165  C CB   . HIS A 1 16 ? 9.367   9.842   8.818   1.00 0.00 ? 15 HIS A CB   2  
ATOM 3166  C CG   . HIS A 1 16 ? 10.133  11.111  9.064   1.00 0.00 ? 15 HIS A CG   2  
ATOM 3167  N ND1  . HIS A 1 16 ? 10.081  11.781  10.276  1.00 0.00 ? 15 HIS A ND1  2  
ATOM 3168  C CD2  . HIS A 1 16 ? 10.971  11.848  8.264   1.00 0.00 ? 15 HIS A CD2  2  
ATOM 3169  C CE1  . HIS A 1 16 ? 10.866  12.868  10.173  1.00 0.00 ? 15 HIS A CE1  2  
ATOM 3170  N NE2  . HIS A 1 16 ? 11.433  12.957  8.967   1.00 0.00 ? 15 HIS A NE2  2  
ATOM 3171  H H    . HIS A 1 16 ? 8.612   7.455   8.190   1.00 0.00 ? 15 HIS A H    2  
ATOM 3172  H HA   . HIS A 1 16 ? 10.719  9.254   7.260   1.00 0.00 ? 15 HIS A HA   2  
ATOM 3173  H HB2  . HIS A 1 16 ? 8.522   10.050  8.178   1.00 0.00 ? 15 HIS A HB2  2  
ATOM 3174  H HB3  . HIS A 1 16 ? 9.015   9.447   9.760   1.00 0.00 ? 15 HIS A HB3  2  
ATOM 3175  H HD1  . HIS A 1 16 ? 9.565   11.511  11.064  1.00 0.00 ? 15 HIS A HD1  2  
ATOM 3176  H HD2  . HIS A 1 16 ? 11.229  11.606  7.243   1.00 0.00 ? 15 HIS A HD2  2  
ATOM 3177  H HE1  . HIS A 1 16 ? 11.016  13.584  10.967  1.00 0.00 ? 15 HIS A HE1  2  
ATOM 3178  N N    . GLN A 1 17 ? 11.137  7.414   9.931   1.00 0.00 ? 16 GLN A N    2  
ATOM 3179  C CA   . GLN A 1 17 ? 12.166  6.981   10.922  1.00 0.00 ? 16 GLN A CA   2  
ATOM 3180  C C    . GLN A 1 17 ? 13.477  6.661   10.205  1.00 0.00 ? 16 GLN A C    2  
ATOM 3181  O O    . GLN A 1 17 ? 14.536  7.086   10.622  1.00 0.00 ? 16 GLN A O    2  
ATOM 3182  C CB   . GLN A 1 17 ? 11.670  5.742   11.670  1.00 0.00 ? 16 GLN A CB   2  
ATOM 3183  C CG   . GLN A 1 17 ? 12.682  5.355   12.751  1.00 0.00 ? 16 GLN A CG   2  
ATOM 3184  C CD   . GLN A 1 17 ? 12.053  4.324   13.689  1.00 0.00 ? 16 GLN A CD   2  
ATOM 3185  O OE1  . GLN A 1 17 ? 12.476  4.174   14.818  1.00 0.00 ? 16 GLN A OE1  2  
ATOM 3186  N NE2  . GLN A 1 17 ? 11.051  3.603   13.265  1.00 0.00 ? 16 GLN A NE2  2  
ATOM 3187  H H    . GLN A 1 17 ? 10.266  6.967   9.905   1.00 0.00 ? 16 GLN A H    2  
ATOM 3188  H HA   . GLN A 1 17 ? 12.338  7.784   11.622  1.00 0.00 ? 16 GLN A HA   2  
ATOM 3189  H HB2  . GLN A 1 17 ? 10.716  5.957   12.130  1.00 0.00 ? 16 GLN A HB2  2  
ATOM 3190  H HB3  . GLN A 1 17 ? 11.559  4.924   10.975  1.00 0.00 ? 16 GLN A HB3  2  
ATOM 3191  H HG2  . GLN A 1 17 ? 13.561  4.931   12.286  1.00 0.00 ? 16 GLN A HG2  2  
ATOM 3192  H HG3  . GLN A 1 17 ? 12.959  6.232   13.316  1.00 0.00 ? 16 GLN A HG3  2  
ATOM 3193  H HE21 . GLN A 1 17 ? 10.711  3.724   12.354  1.00 0.00 ? 16 GLN A HE21 2  
ATOM 3194  H HE22 . GLN A 1 17 ? 10.638  2.940   13.858  1.00 0.00 ? 16 GLN A HE22 2  
ATOM 3195  N N    . TYR A 1 18 ? 13.426  5.923   9.130   1.00 0.00 ? 17 TYR A N    2  
ATOM 3196  C CA   . TYR A 1 18 ? 14.681  5.596   8.403   1.00 0.00 ? 17 TYR A CA   2  
ATOM 3197  C C    . TYR A 1 18 ? 15.204  6.865   7.730   1.00 0.00 ? 17 TYR A C    2  
ATOM 3198  O O    . TYR A 1 18 ? 16.363  7.211   7.847   1.00 0.00 ? 17 TYR A O    2  
ATOM 3199  C CB   . TYR A 1 18 ? 14.398  4.528   7.337   1.00 0.00 ? 17 TYR A CB   2  
ATOM 3200  C CG   . TYR A 1 18 ? 14.308  3.163   7.987   1.00 0.00 ? 17 TYR A CG   2  
ATOM 3201  C CD1  . TYR A 1 18 ? 13.278  2.890   8.896   1.00 0.00 ? 17 TYR A CD1  2  
ATOM 3202  C CD2  . TYR A 1 18 ? 15.249  2.170   7.680   1.00 0.00 ? 17 TYR A CD2  2  
ATOM 3203  C CE1  . TYR A 1 18 ? 13.189  1.628   9.497   1.00 0.00 ? 17 TYR A CE1  2  
ATOM 3204  C CE2  . TYR A 1 18 ? 15.159  0.908   8.280   1.00 0.00 ? 17 TYR A CE2  2  
ATOM 3205  C CZ   . TYR A 1 18 ? 14.129  0.637   9.189   1.00 0.00 ? 17 TYR A CZ   2  
ATOM 3206  O OH   . TYR A 1 18 ? 14.039  -0.606  9.780   1.00 0.00 ? 17 TYR A OH   2  
ATOM 3207  H H    . TYR A 1 18 ? 12.568  5.582   8.805   1.00 0.00 ? 17 TYR A H    2  
ATOM 3208  H HA   . TYR A 1 18 ? 15.420  5.229   9.101   1.00 0.00 ? 17 TYR A HA   2  
ATOM 3209  H HB2  . TYR A 1 18 ? 13.463  4.753   6.846   1.00 0.00 ? 17 TYR A HB2  2  
ATOM 3210  H HB3  . TYR A 1 18 ? 15.195  4.528   6.606   1.00 0.00 ? 17 TYR A HB3  2  
ATOM 3211  H HD1  . TYR A 1 18 ? 12.552  3.653   9.134   1.00 0.00 ? 17 TYR A HD1  2  
ATOM 3212  H HD2  . TYR A 1 18 ? 16.045  2.378   6.979   1.00 0.00 ? 17 TYR A HD2  2  
ATOM 3213  H HE1  . TYR A 1 18 ? 12.394  1.419   10.197  1.00 0.00 ? 17 TYR A HE1  2  
ATOM 3214  H HE2  . TYR A 1 18 ? 15.884  0.143   8.043   1.00 0.00 ? 17 TYR A HE2  2  
ATOM 3215  H HH   . TYR A 1 18 ? 13.560  -1.185  9.182   1.00 0.00 ? 17 TYR A HH   2  
ATOM 3216  N N    . SER A 1 19 ? 14.352  7.562   7.024   1.00 0.00 ? 18 SER A N    2  
ATOM 3217  C CA   . SER A 1 19 ? 14.784  8.813   6.333   1.00 0.00 ? 18 SER A CA   2  
ATOM 3218  C C    . SER A 1 19 ? 14.365  10.037  7.150   1.00 0.00 ? 18 SER A C    2  
ATOM 3219  O O    . SER A 1 19 ? 13.656  10.893  6.660   1.00 0.00 ? 18 SER A O    2  
ATOM 3220  C CB   . SER A 1 19 ? 14.123  8.882   4.956   1.00 0.00 ? 18 SER A CB   2  
ATOM 3221  O OG   . SER A 1 19 ? 12.776  9.314   5.103   1.00 0.00 ? 18 SER A OG   2  
ATOM 3222  H H    . SER A 1 19 ? 13.424  7.260   6.946   1.00 0.00 ? 18 SER A H    2  
ATOM 3223  H HA   . SER A 1 19 ? 15.858  8.817   6.211   1.00 0.00 ? 18 SER A HA   2  
ATOM 3224  H HB2  . SER A 1 19 ? 14.654  9.583   4.334   1.00 0.00 ? 18 SER A HB2  2  
ATOM 3225  H HB3  . SER A 1 19 ? 14.151  7.903   4.496   1.00 0.00 ? 18 SER A HB3  2  
ATOM 3226  H HG   . SER A 1 19 ? 12.673  9.666   5.990   1.00 0.00 ? 18 SER A HG   2  
ATOM 3227  N N    . GLY A 1 20 ? 14.816  10.148  8.382   1.00 0.00 ? 19 GLY A N    2  
ATOM 3228  C CA   . GLY A 1 20 ? 14.465  11.344  9.220   1.00 0.00 ? 19 GLY A CA   2  
ATOM 3229  C C    . GLY A 1 20 ? 15.766  12.033  9.638   1.00 0.00 ? 19 GLY A C    2  
ATOM 3230  O O    . GLY A 1 20 ? 15.778  13.193  9.998   1.00 0.00 ? 19 GLY A O    2  
ATOM 3231  H H    . GLY A 1 20 ? 15.410  9.463   8.756   1.00 0.00 ? 19 GLY A H    2  
ATOM 3232  H HA2  . GLY A 1 20 ? 13.855  12.027  8.646   1.00 0.00 ? 19 GLY A HA2  2  
ATOM 3233  H HA3  . GLY A 1 20 ? 13.938  11.047  10.115  1.00 0.00 ? 19 GLY A HA3  2  
ATOM 3234  N N    . ARG A 1 21 ? 16.867  11.333  9.571   1.00 0.00 ? 20 ARG A N    2  
ATOM 3235  C CA   . ARG A 1 21 ? 18.169  11.956  9.939   1.00 0.00 ? 20 ARG A CA   2  
ATOM 3236  C C    . ARG A 1 21 ? 18.460  13.091  8.960   1.00 0.00 ? 20 ARG A C    2  
ATOM 3237  O O    . ARG A 1 21 ? 19.077  14.073  9.325   1.00 0.00 ? 20 ARG A O    2  
ATOM 3238  C CB   . ARG A 1 21 ? 19.295  10.911  9.926   1.00 0.00 ? 20 ARG A CB   2  
ATOM 3239  C CG   . ARG A 1 21 ? 19.038  9.882   8.822   1.00 0.00 ? 20 ARG A CG   2  
ATOM 3240  C CD   . ARG A 1 21 ? 20.279  9.005   8.643   1.00 0.00 ? 20 ARG A CD   2  
ATOM 3241  N NE   . ARG A 1 21 ? 20.587  8.319   9.929   1.00 0.00 ? 20 ARG A NE   2  
ATOM 3242  C CZ   . ARG A 1 21 ? 21.702  7.654   10.065  1.00 0.00 ? 20 ARG A CZ   2  
ATOM 3243  N NH1  . ARG A 1 21 ? 22.842  8.286   10.086  1.00 0.00 ? 20 ARG A NH1  2  
ATOM 3244  N NH2  . ARG A 1 21 ? 21.676  6.355   10.182  1.00 0.00 ? 20 ARG A NH2  2  
ATOM 3245  H H    . ARG A 1 21 ? 16.843  10.407  9.255   1.00 0.00 ? 20 ARG A H    2  
ATOM 3246  H HA   . ARG A 1 21 ? 18.111  12.430  10.908  1.00 0.00 ? 20 ARG A HA   2  
ATOM 3247  H HB2  . ARG A 1 21 ? 20.243  11.399  9.750   1.00 0.00 ? 20 ARG A HB2  2  
ATOM 3248  H HB3  . ARG A 1 21 ? 19.325  10.407  10.881  1.00 0.00 ? 20 ARG A HB3  2  
ATOM 3249  H HG2  . ARG A 1 21 ? 18.198  9.260   9.098   1.00 0.00 ? 20 ARG A HG2  2  
ATOM 3250  H HG3  . ARG A 1 21 ? 18.822  10.390  7.895   1.00 0.00 ? 20 ARG A HG3  2  
ATOM 3251  H HD2  . ARG A 1 21 ? 20.092  8.267   7.877   1.00 0.00 ? 20 ARG A HD2  2  
ATOM 3252  H HD3  . ARG A 1 21 ? 21.118  9.621   8.353   1.00 0.00 ? 20 ARG A HD3  2  
ATOM 3253  H HE   . ARG A 1 21 ? 19.952  8.367   10.674  1.00 0.00 ? 20 ARG A HE   2  
ATOM 3254  H HH11 . ARG A 1 21 ? 22.863  9.282   9.999   1.00 0.00 ? 20 ARG A HH11 2  
ATOM 3255  H HH12 . ARG A 1 21 ? 23.695  7.775   10.190  1.00 0.00 ? 20 ARG A HH12 2  
ATOM 3256  H HH21 . ARG A 1 21 ? 20.803  5.869   10.168  1.00 0.00 ? 20 ARG A HH21 2  
ATOM 3257  H HH22 . ARG A 1 21 ? 22.531  5.846   10.286  1.00 0.00 ? 20 ARG A HH22 2  
ATOM 3258  N N    . GLU A 1 22 ? 17.985  13.012  7.741   1.00 0.00 ? 21 GLU A N    2  
ATOM 3259  C CA   . GLU A 1 22 ? 18.208  14.150  6.793   1.00 0.00 ? 21 GLU A CA   2  
ATOM 3260  C C    . GLU A 1 22 ? 16.978  14.284  5.894   1.00 0.00 ? 21 GLU A C    2  
ATOM 3261  O O    . GLU A 1 22 ? 16.446  15.363  5.728   1.00 0.00 ? 21 GLU A O    2  
ATOM 3262  C CB   . GLU A 1 22 ? 19.459  13.901  5.936   1.00 0.00 ? 21 GLU A CB   2  
ATOM 3263  C CG   . GLU A 1 22 ? 20.734  14.163  6.752   1.00 0.00 ? 21 GLU A CG   2  
ATOM 3264  C CD   . GLU A 1 22 ? 21.016  12.973  7.671   1.00 0.00 ? 21 GLU A CD   2  
ATOM 3265  O OE1  . GLU A 1 22 ? 20.814  11.851  7.235   1.00 0.00 ? 21 GLU A OE1  2  
ATOM 3266  O OE2  . GLU A 1 22 ? 21.429  13.203  8.796   1.00 0.00 ? 21 GLU A OE2  2  
ATOM 3267  H H    . GLU A 1 22 ? 17.454  12.236  7.466   1.00 0.00 ? 21 GLU A H    2  
ATOM 3268  H HA   . GLU A 1 22 ? 18.315  15.057  7.370   1.00 0.00 ? 21 GLU A HA   2  
ATOM 3269  H HB2  . GLU A 1 22 ? 19.457  12.876  5.593   1.00 0.00 ? 21 GLU A HB2  2  
ATOM 3270  H HB3  . GLU A 1 22 ? 19.442  14.561  5.081   1.00 0.00 ? 21 GLU A HB3  2  
ATOM 3271  H HG2  . GLU A 1 22 ? 21.567  14.298  6.076   1.00 0.00 ? 21 GLU A HG2  2  
ATOM 3272  H HG3  . GLU A 1 22 ? 20.611  15.055  7.348   1.00 0.00 ? 21 GLU A HG3  2  
ATOM 3273  N N    . GLY A 1 23 ? 16.506  13.198  5.333   1.00 0.00 ? 22 GLY A N    2  
ATOM 3274  C CA   . GLY A 1 23 ? 15.294  13.264  4.458   1.00 0.00 ? 22 GLY A CA   2  
ATOM 3275  C C    . GLY A 1 23 ? 15.383  14.476  3.530   1.00 0.00 ? 22 GLY A C    2  
ATOM 3276  O O    . GLY A 1 23 ? 14.396  14.910  2.969   1.00 0.00 ? 22 GLY A O    2  
ATOM 3277  H H    . GLY A 1 23 ? 16.939  12.332  5.490   1.00 0.00 ? 22 GLY A H    2  
ATOM 3278  H HA2  . GLY A 1 23 ? 15.230  12.360  3.869   1.00 0.00 ? 22 GLY A HA2  2  
ATOM 3279  H HA3  . GLY A 1 23 ? 14.411  13.352  5.073   1.00 0.00 ? 22 GLY A HA3  2  
ATOM 3280  N N    . ASP A 1 24 ? 16.552  15.029  3.358   1.00 0.00 ? 23 ASP A N    2  
ATOM 3281  C CA   . ASP A 1 24 ? 16.680  16.210  2.459   1.00 0.00 ? 23 ASP A CA   2  
ATOM 3282  C C    . ASP A 1 24 ? 15.993  15.889  1.131   1.00 0.00 ? 23 ASP A C    2  
ATOM 3283  O O    . ASP A 1 24 ? 15.181  16.648  0.641   1.00 0.00 ? 23 ASP A O    2  
ATOM 3284  C CB   . ASP A 1 24 ? 18.159  16.516  2.215   1.00 0.00 ? 23 ASP A CB   2  
ATOM 3285  C CG   . ASP A 1 24 ? 18.825  16.910  3.534   1.00 0.00 ? 23 ASP A CG   2  
ATOM 3286  O OD1  . ASP A 1 24 ? 18.133  17.432  4.393   1.00 0.00 ? 23 ASP A OD1  2  
ATOM 3287  O OD2  . ASP A 1 24 ? 20.016  16.681  3.665   1.00 0.00 ? 23 ASP A OD2  2  
ATOM 3288  H H    . ASP A 1 24 ? 17.336  14.671  3.825   1.00 0.00 ? 23 ASP A H    2  
ATOM 3289  H HA   . ASP A 1 24 ? 16.202  17.064  2.916   1.00 0.00 ? 23 ASP A HA   2  
ATOM 3290  H HB2  . ASP A 1 24 ? 18.646  15.640  1.812   1.00 0.00 ? 23 ASP A HB2  2  
ATOM 3291  H HB3  . ASP A 1 24 ? 18.245  17.332  1.513   1.00 0.00 ? 23 ASP A HB3  2  
ATOM 3292  N N    . LYS A 1 25 ? 16.296  14.756  0.552   1.00 0.00 ? 24 LYS A N    2  
ATOM 3293  C CA   . LYS A 1 25 ? 15.642  14.373  -0.733  1.00 0.00 ? 24 LYS A CA   2  
ATOM 3294  C C    . LYS A 1 25 ? 14.375  13.571  -0.421  1.00 0.00 ? 24 LYS A C    2  
ATOM 3295  O O    . LYS A 1 25 ? 14.337  12.799  0.515   1.00 0.00 ? 24 LYS A O    2  
ATOM 3296  C CB   . LYS A 1 25 ? 16.601  13.514  -1.561  1.00 0.00 ? 24 LYS A CB   2  
ATOM 3297  C CG   . LYS A 1 25 ? 17.996  14.154  -1.556  1.00 0.00 ? 24 LYS A CG   2  
ATOM 3298  C CD   . LYS A 1 25 ? 18.956  13.348  -2.453  1.00 0.00 ? 24 LYS A CD   2  
ATOM 3299  C CE   . LYS A 1 25 ? 18.863  13.839  -3.904  1.00 0.00 ? 24 LYS A CE   2  
ATOM 3300  N NZ   . LYS A 1 25 ? 19.410  15.223  -3.996  1.00 0.00 ? 24 LYS A NZ   2  
ATOM 3301  H H    . LYS A 1 25 ? 16.942  14.150  0.972   1.00 0.00 ? 24 LYS A H    2  
ATOM 3302  H HA   . LYS A 1 25 ? 15.383  15.266  -1.286  1.00 0.00 ? 24 LYS A HA   2  
ATOM 3303  H HB2  . LYS A 1 25 ? 16.658  12.523  -1.133  1.00 0.00 ? 24 LYS A HB2  2  
ATOM 3304  H HB3  . LYS A 1 25 ? 16.239  13.448  -2.574  1.00 0.00 ? 24 LYS A HB3  2  
ATOM 3305  H HG2  . LYS A 1 25 ? 17.924  15.170  -1.918  1.00 0.00 ? 24 LYS A HG2  2  
ATOM 3306  H HG3  . LYS A 1 25 ? 18.377  14.163  -0.545  1.00 0.00 ? 24 LYS A HG3  2  
ATOM 3307  H HD2  . LYS A 1 25 ? 19.970  13.478  -2.099  1.00 0.00 ? 24 LYS A HD2  2  
ATOM 3308  H HD3  . LYS A 1 25 ? 18.699  12.298  -2.415  1.00 0.00 ? 24 LYS A HD3  2  
ATOM 3309  H HE2  . LYS A 1 25 ? 19.436  13.183  -4.543  1.00 0.00 ? 24 LYS A HE2  2  
ATOM 3310  H HE3  . LYS A 1 25 ? 17.832  13.838  -4.221  1.00 0.00 ? 24 LYS A HE3  2  
ATOM 3311  H HZ1  . LYS A 1 25 ? 18.883  15.848  -3.354  1.00 0.00 ? 24 LYS A HZ1  2  
ATOM 3312  H HZ2  . LYS A 1 25 ? 20.414  15.219  -3.724  1.00 0.00 ? 24 LYS A HZ2  2  
ATOM 3313  H HZ3  . LYS A 1 25 ? 19.316  15.568  -4.973  1.00 0.00 ? 24 LYS A HZ3  2  
ATOM 3314  N N    . HIS A 1 26 ? 13.346  13.726  -1.213  1.00 0.00 ? 25 HIS A N    2  
ATOM 3315  C CA   . HIS A 1 26 ? 12.088  12.950  -0.983  1.00 0.00 ? 25 HIS A CA   2  
ATOM 3316  C C    . HIS A 1 26 ? 12.092  11.759  -1.939  1.00 0.00 ? 25 HIS A C    2  
ATOM 3317  O O    . HIS A 1 26 ? 11.078  11.384  -2.493  1.00 0.00 ? 25 HIS A O    2  
ATOM 3318  C CB   . HIS A 1 26 ? 10.878  13.841  -1.276  1.00 0.00 ? 25 HIS A CB   2  
ATOM 3319  C CG   . HIS A 1 26 ? 10.780  14.910  -0.222  1.00 0.00 ? 25 HIS A CG   2  
ATOM 3320  N ND1  . HIS A 1 26 ? 10.724  16.259  -0.538  1.00 0.00 ? 25 HIS A ND1  2  
ATOM 3321  C CD2  . HIS A 1 26 ? 10.729  14.845  1.149   1.00 0.00 ? 25 HIS A CD2  2  
ATOM 3322  C CE1  . HIS A 1 26 ? 10.644  16.944  0.618   1.00 0.00 ? 25 HIS A CE1  2  
ATOM 3323  N NE2  . HIS A 1 26 ? 10.643  16.130  1.677   1.00 0.00 ? 25 HIS A NE2  2  
ATOM 3324  H H    . HIS A 1 26 ? 13.407  14.337  -1.974  1.00 0.00 ? 25 HIS A H    2  
ATOM 3325  H HA   . HIS A 1 26 ? 12.044  12.599  0.040   1.00 0.00 ? 25 HIS A HA   2  
ATOM 3326  H HB2  . HIS A 1 26 ? 10.996  14.301  -2.247  1.00 0.00 ? 25 HIS A HB2  2  
ATOM 3327  H HB3  . HIS A 1 26 ? 9.980   13.243  -1.268  1.00 0.00 ? 25 HIS A HB3  2  
ATOM 3328  H HD1  . HIS A 1 26 ? 10.742  16.644  -1.439  1.00 0.00 ? 25 HIS A HD1  2  
ATOM 3329  H HD2  . HIS A 1 26 ? 10.756  13.934  1.729   1.00 0.00 ? 25 HIS A HD2  2  
ATOM 3330  H HE1  . HIS A 1 26 ? 10.591  18.021  0.683   1.00 0.00 ? 25 HIS A HE1  2  
ATOM 3331  N N    . LYS A 1 27 ? 13.239  11.157  -2.121  1.00 0.00 ? 26 LYS A N    2  
ATOM 3332  C CA   . LYS A 1 27 ? 13.355  9.974   -3.025  1.00 0.00 ? 26 LYS A CA   2  
ATOM 3333  C C    . LYS A 1 27 ? 14.175  8.889   -2.325  1.00 0.00 ? 26 LYS A C    2  
ATOM 3334  O O    . LYS A 1 27 ? 14.990  9.182   -1.471  1.00 0.00 ? 26 LYS A O    2  
ATOM 3335  C CB   . LYS A 1 27 ? 14.061  10.389  -4.318  1.00 0.00 ? 26 LYS A CB   2  
ATOM 3336  C CG   . LYS A 1 27 ? 13.261  11.498  -5.002  1.00 0.00 ? 26 LYS A CG   2  
ATOM 3337  C CD   . LYS A 1 27 ? 13.763  11.681  -6.437  1.00 0.00 ? 26 LYS A CD   2  
ATOM 3338  C CE   . LYS A 1 27 ? 12.903  12.723  -7.157  1.00 0.00 ? 26 LYS A CE   2  
ATOM 3339  N NZ   . LYS A 1 27 ? 13.636  13.231  -8.351  1.00 0.00 ? 26 LYS A NZ   2  
ATOM 3340  H H    . LYS A 1 27 ? 14.031  11.485  -1.652  1.00 0.00 ? 26 LYS A H    2  
ATOM 3341  H HA   . LYS A 1 27 ? 12.372  9.597   -3.261  1.00 0.00 ? 26 LYS A HA   2  
ATOM 3342  H HB2  . LYS A 1 27 ? 15.053  10.750  -4.086  1.00 0.00 ? 26 LYS A HB2  2  
ATOM 3343  H HB3  . LYS A 1 27 ? 14.132  9.538   -4.979  1.00 0.00 ? 26 LYS A HB3  2  
ATOM 3344  H HG2  . LYS A 1 27 ? 12.215  11.228  -5.018  1.00 0.00 ? 26 LYS A HG2  2  
ATOM 3345  H HG3  . LYS A 1 27 ? 13.387  12.422  -4.459  1.00 0.00 ? 26 LYS A HG3  2  
ATOM 3346  H HD2  . LYS A 1 27 ? 14.791  12.013  -6.418  1.00 0.00 ? 26 LYS A HD2  2  
ATOM 3347  H HD3  . LYS A 1 27 ? 13.699  10.740  -6.962  1.00 0.00 ? 26 LYS A HD3  2  
ATOM 3348  H HE2  . LYS A 1 27 ? 11.976  12.267  -7.473  1.00 0.00 ? 26 LYS A HE2  2  
ATOM 3349  H HE3  . LYS A 1 27 ? 12.691  13.545  -6.489  1.00 0.00 ? 26 LYS A HE3  2  
ATOM 3350  H HZ1  . LYS A 1 27 ? 14.236  12.476  -8.738  1.00 0.00 ? 26 LYS A HZ1  2  
ATOM 3351  H HZ2  . LYS A 1 27 ? 12.952  13.537  -9.073  1.00 0.00 ? 26 LYS A HZ2  2  
ATOM 3352  H HZ3  . LYS A 1 27 ? 14.232  14.037  -8.075  1.00 0.00 ? 26 LYS A HZ3  2  
ATOM 3353  N N    . LEU A 1 28 ? 13.972  7.641   -2.674  1.00 0.00 ? 27 LEU A N    2  
ATOM 3354  C CA   . LEU A 1 28 ? 14.742  6.527   -2.027  1.00 0.00 ? 27 LEU A CA   2  
ATOM 3355  C C    . LEU A 1 28 ? 15.461  5.723   -3.114  1.00 0.00 ? 27 LEU A C    2  
ATOM 3356  O O    . LEU A 1 28 ? 14.927  5.498   -4.182  1.00 0.00 ? 27 LEU A O    2  
ATOM 3357  C CB   . LEU A 1 28 ? 13.763  5.616   -1.262  1.00 0.00 ? 27 LEU A CB   2  
ATOM 3358  C CG   . LEU A 1 28 ? 14.502  4.861   -0.135  1.00 0.00 ? 27 LEU A CG   2  
ATOM 3359  C CD1  . LEU A 1 28 ? 14.599  5.738   1.121   1.00 0.00 ? 27 LEU A CD1  2  
ATOM 3360  C CD2  . LEU A 1 28 ? 13.735  3.581   0.213   1.00 0.00 ? 27 LEU A CD2  2  
ATOM 3361  H H    . LEU A 1 28 ? 13.309  7.433   -3.365  1.00 0.00 ? 27 LEU A H    2  
ATOM 3362  H HA   . LEU A 1 28 ? 15.477  6.928   -1.344  1.00 0.00 ? 27 LEU A HA   2  
ATOM 3363  H HB2  . LEU A 1 28 ? 12.975  6.221   -0.837  1.00 0.00 ? 27 LEU A HB2  2  
ATOM 3364  H HB3  . LEU A 1 28 ? 13.327  4.902   -1.948  1.00 0.00 ? 27 LEU A HB3  2  
ATOM 3365  H HG   . LEU A 1 28 ? 15.498  4.601   -0.467  1.00 0.00 ? 27 LEU A HG   2  
ATOM 3366  H HD11 . LEU A 1 28 ? 13.618  6.103   1.385   1.00 0.00 ? 27 LEU A HD11 2  
ATOM 3367  H HD12 . LEU A 1 28 ? 14.993  5.151   1.937   1.00 0.00 ? 27 LEU A HD12 2  
ATOM 3368  H HD13 . LEU A 1 28 ? 15.256  6.573   0.932   1.00 0.00 ? 27 LEU A HD13 2  
ATOM 3369  H HD21 . LEU A 1 28 ? 12.724  3.833   0.494   1.00 0.00 ? 27 LEU A HD21 2  
ATOM 3370  H HD22 . LEU A 1 28 ? 13.719  2.928   -0.646  1.00 0.00 ? 27 LEU A HD22 2  
ATOM 3371  H HD23 . LEU A 1 28 ? 14.224  3.081   1.036   1.00 0.00 ? 27 LEU A HD23 2  
ATOM 3372  N N    . LYS A 1 29 ? 16.672  5.292   -2.860  1.00 0.00 ? 28 LYS A N    2  
ATOM 3373  C CA   . LYS A 1 29 ? 17.416  4.509   -3.892  1.00 0.00 ? 28 LYS A CA   2  
ATOM 3374  C C    . LYS A 1 29 ? 17.115  3.017   -3.717  1.00 0.00 ? 28 LYS A C    2  
ATOM 3375  O O    . LYS A 1 29 ? 16.874  2.549   -2.621  1.00 0.00 ? 28 LYS A O    2  
ATOM 3376  C CB   . LYS A 1 29 ? 18.919  4.758   -3.740  1.00 0.00 ? 28 LYS A CB   2  
ATOM 3377  C CG   . LYS A 1 29 ? 19.206  6.250   -3.948  1.00 0.00 ? 28 LYS A CG   2  
ATOM 3378  C CD   . LYS A 1 29 ? 20.718  6.488   -4.087  1.00 0.00 ? 28 LYS A CD   2  
ATOM 3379  C CE   . LYS A 1 29 ? 21.399  6.390   -2.717  1.00 0.00 ? 28 LYS A CE   2  
ATOM 3380  N NZ   . LYS A 1 29 ? 20.731  7.314   -1.756  1.00 0.00 ? 28 LYS A NZ   2  
ATOM 3381  H H    . LYS A 1 29 ? 17.091  5.487   -1.995  1.00 0.00 ? 28 LYS A H    2  
ATOM 3382  H HA   . LYS A 1 29 ? 17.093  4.836   -4.872  1.00 0.00 ? 28 LYS A HA   2  
ATOM 3383  H HB2  . LYS A 1 29 ? 19.233  4.461   -2.750  1.00 0.00 ? 28 LYS A HB2  2  
ATOM 3384  H HB3  . LYS A 1 29 ? 19.455  4.181   -4.478  1.00 0.00 ? 28 LYS A HB3  2  
ATOM 3385  H HG2  . LYS A 1 29 ? 18.708  6.585   -4.847  1.00 0.00 ? 28 LYS A HG2  2  
ATOM 3386  H HG3  . LYS A 1 29 ? 18.831  6.807   -3.104  1.00 0.00 ? 28 LYS A HG3  2  
ATOM 3387  H HD2  . LYS A 1 29 ? 21.141  5.748   -4.751  1.00 0.00 ? 28 LYS A HD2  2  
ATOM 3388  H HD3  . LYS A 1 29 ? 20.886  7.472   -4.498  1.00 0.00 ? 28 LYS A HD3  2  
ATOM 3389  H HE2  . LYS A 1 29 ? 21.331  5.378   -2.350  1.00 0.00 ? 28 LYS A HE2  2  
ATOM 3390  H HE3  . LYS A 1 29 ? 22.439  6.666   -2.815  1.00 0.00 ? 28 LYS A HE3  2  
ATOM 3391  H HZ1  . LYS A 1 29 ? 20.690  8.269   -2.168  1.00 0.00 ? 28 LYS A HZ1  2  
ATOM 3392  H HZ2  . LYS A 1 29 ? 19.768  6.977   -1.563  1.00 0.00 ? 28 LYS A HZ2  2  
ATOM 3393  H HZ3  . LYS A 1 29 ? 21.271  7.341   -0.869  1.00 0.00 ? 28 LYS A HZ3  2  
ATOM 3394  N N    . LYS A 1 30 ? 17.120  2.269   -4.785  1.00 0.00 ? 29 LYS A N    2  
ATOM 3395  C CA   . LYS A 1 30 ? 16.828  0.807   -4.687  1.00 0.00 ? 29 LYS A CA   2  
ATOM 3396  C C    . LYS A 1 30 ? 17.781  0.129   -3.694  1.00 0.00 ? 29 LYS A C    2  
ATOM 3397  O O    . LYS A 1 30 ? 17.386  -0.715  -2.913  1.00 0.00 ? 29 LYS A O    2  
ATOM 3398  C CB   . LYS A 1 30 ? 17.021  0.175   -6.071  1.00 0.00 ? 29 LYS A CB   2  
ATOM 3399  C CG   . LYS A 1 30 ? 18.517  0.158   -6.429  1.00 0.00 ? 29 LYS A CG   2  
ATOM 3400  C CD   . LYS A 1 30 ? 18.698  -0.042  -7.939  1.00 0.00 ? 29 LYS A CD   2  
ATOM 3401  C CE   . LYS A 1 30 ? 20.108  -0.565  -8.224  1.00 0.00 ? 29 LYS A CE   2  
ATOM 3402  N NZ   . LYS A 1 30 ? 21.101  0.246   -7.464  1.00 0.00 ? 29 LYS A NZ   2  
ATOM 3403  H H    . LYS A 1 30 ? 17.310  2.666   -5.662  1.00 0.00 ? 29 LYS A H    2  
ATOM 3404  H HA   . LYS A 1 30 ? 15.807  0.659   -4.369  1.00 0.00 ? 29 LYS A HA   2  
ATOM 3405  H HB2  . LYS A 1 30 ? 16.641  -0.836  -6.060  1.00 0.00 ? 29 LYS A HB2  2  
ATOM 3406  H HB3  . LYS A 1 30 ? 16.484  0.754   -6.805  1.00 0.00 ? 29 LYS A HB3  2  
ATOM 3407  H HG2  . LYS A 1 30 ? 18.966  1.098   -6.140  1.00 0.00 ? 29 LYS A HG2  2  
ATOM 3408  H HG3  . LYS A 1 30 ? 18.999  -0.649  -5.898  1.00 0.00 ? 29 LYS A HG3  2  
ATOM 3409  H HD2  . LYS A 1 30 ? 17.971  -0.753  -8.301  1.00 0.00 ? 29 LYS A HD2  2  
ATOM 3410  H HD3  . LYS A 1 30 ? 18.563  0.902   -8.442  1.00 0.00 ? 29 LYS A HD3  2  
ATOM 3411  H HE2  . LYS A 1 30 ? 20.178  -1.598  -7.917  1.00 0.00 ? 29 LYS A HE2  2  
ATOM 3412  H HE3  . LYS A 1 30 ? 20.314  -0.489  -9.281  1.00 0.00 ? 29 LYS A HE3  2  
ATOM 3413  H HZ1  . LYS A 1 30 ? 20.862  0.229   -6.453  1.00 0.00 ? 29 LYS A HZ1  2  
ATOM 3414  H HZ2  . LYS A 1 30 ? 22.051  -0.152  -7.600  1.00 0.00 ? 29 LYS A HZ2  2  
ATOM 3415  H HZ3  . LYS A 1 30 ? 21.083  1.228   -7.809  1.00 0.00 ? 29 LYS A HZ3  2  
ATOM 3416  N N    . SER A 1 31 ? 19.035  0.475   -3.741  1.00 0.00 ? 30 SER A N    2  
ATOM 3417  C CA   . SER A 1 31 ? 20.031  -0.160  -2.831  1.00 0.00 ? 30 SER A CA   2  
ATOM 3418  C C    . SER A 1 31 ? 19.606  -0.003  -1.369  1.00 0.00 ? 30 SER A C    2  
ATOM 3419  O O    . SER A 1 31 ? 19.769  -0.903  -0.562  1.00 0.00 ? 30 SER A O    2  
ATOM 3420  C CB   . SER A 1 31 ? 21.393  0.508   -3.032  1.00 0.00 ? 30 SER A CB   2  
ATOM 3421  O OG   . SER A 1 31 ? 21.358  1.820   -2.486  1.00 0.00 ? 30 SER A OG   2  
ATOM 3422  H H    . SER A 1 31 ? 19.328  1.140   -4.396  1.00 0.00 ? 30 SER A H    2  
ATOM 3423  H HA   . SER A 1 31 ? 20.113  -1.209  -3.069  1.00 0.00 ? 30 SER A HA   2  
ATOM 3424  H HB2  . SER A 1 31 ? 22.154  -0.064  -2.530  1.00 0.00 ? 30 SER A HB2  2  
ATOM 3425  H HB3  . SER A 1 31 ? 21.618  0.552   -4.090  1.00 0.00 ? 30 SER A HB3  2  
ATOM 3426  H HG   . SER A 1 31 ? 22.239  2.033   -2.168  1.00 0.00 ? 30 SER A HG   2  
ATOM 3427  N N    . GLU A 1 32 ? 19.050  1.125   -1.015  1.00 0.00 ? 31 GLU A N    2  
ATOM 3428  C CA   . GLU A 1 32 ? 18.622  1.310   0.403   1.00 0.00 ? 31 GLU A CA   2  
ATOM 3429  C C    . GLU A 1 32 ? 17.262  0.645   0.592   1.00 0.00 ? 31 GLU A C    2  
ATOM 3430  O O    . GLU A 1 32 ? 16.951  0.122   1.644   1.00 0.00 ? 31 GLU A O    2  
ATOM 3431  C CB   . GLU A 1 32 ? 18.544  2.798   0.748   1.00 0.00 ? 31 GLU A CB   2  
ATOM 3432  C CG   . GLU A 1 32 ? 19.916  3.442   0.538   1.00 0.00 ? 31 GLU A CG   2  
ATOM 3433  C CD   . GLU A 1 32 ? 19.853  4.920   0.926   1.00 0.00 ? 31 GLU A CD   2  
ATOM 3434  O OE1  . GLU A 1 32 ? 20.010  5.211   2.101   1.00 0.00 ? 31 GLU A OE1  2  
ATOM 3435  O OE2  . GLU A 1 32 ? 19.649  5.737   0.043   1.00 0.00 ? 31 GLU A OE2  2  
ATOM 3436  H H    . GLU A 1 32 ? 18.904  1.824   -1.686  1.00 0.00 ? 31 GLU A H    2  
ATOM 3437  H HA   . GLU A 1 32 ? 19.359  0.818   1.025   1.00 0.00 ? 31 GLU A HA   2  
ATOM 3438  H HB2  . GLU A 1 32 ? 17.817  3.277   0.108   1.00 0.00 ? 31 GLU A HB2  2  
ATOM 3439  H HB3  . GLU A 1 32 ? 18.248  2.913   1.779   1.00 0.00 ? 31 GLU A HB3  2  
ATOM 3440  H HG2  . GLU A 1 32 ? 20.647  2.938   1.153   1.00 0.00 ? 31 GLU A HG2  2  
ATOM 3441  H HG3  . GLU A 1 32 ? 20.199  3.357   -0.501  1.00 0.00 ? 31 GLU A HG3  2  
ATOM 3442  N N    . LEU A 1 33 ? 16.455  0.641   -0.437  1.00 0.00 ? 32 LEU A N    2  
ATOM 3443  C CA   . LEU A 1 33 ? 15.125  -0.014  -0.334  1.00 0.00 ? 32 LEU A CA   2  
ATOM 3444  C C    . LEU A 1 33 ? 15.351  -1.503  -0.060  1.00 0.00 ? 32 LEU A C    2  
ATOM 3445  O O    . LEU A 1 33 ? 14.723  -2.080  0.804   1.00 0.00 ? 32 LEU A O    2  
ATOM 3446  C CB   . LEU A 1 33 ? 14.346  0.186   -1.647  1.00 0.00 ? 32 LEU A CB   2  
ATOM 3447  C CG   . LEU A 1 33 ? 12.833  0.142   -1.387  1.00 0.00 ? 32 LEU A CG   2  
ATOM 3448  C CD1  . LEU A 1 33 ? 12.090  0.440   -2.693  1.00 0.00 ? 32 LEU A CD1  2  
ATOM 3449  C CD2  . LEU A 1 33 ? 12.428  -1.247  -0.867  1.00 0.00 ? 32 LEU A CD2  2  
ATOM 3450  H H    . LEU A 1 33 ? 16.736  1.053   -1.280  1.00 0.00 ? 32 LEU A H    2  
ATOM 3451  H HA   . LEU A 1 33 ? 14.580  0.407   0.498   1.00 0.00 ? 32 LEU A HA   2  
ATOM 3452  H HB2  . LEU A 1 33 ? 14.604  1.147   -2.068  1.00 0.00 ? 32 LEU A HB2  2  
ATOM 3453  H HB3  . LEU A 1 33 ? 14.610  -0.591  -2.350  1.00 0.00 ? 32 LEU A HB3  2  
ATOM 3454  H HG   . LEU A 1 33 ? 12.575  0.891   -0.652  1.00 0.00 ? 32 LEU A HG   2  
ATOM 3455  H HD11 . LEU A 1 33 ? 12.378  1.416   -3.057  1.00 0.00 ? 32 LEU A HD11 2  
ATOM 3456  H HD12 . LEU A 1 33 ? 12.343  -0.307  -3.431  1.00 0.00 ? 32 LEU A HD12 2  
ATOM 3457  H HD13 . LEU A 1 33 ? 11.025  0.423   -2.514  1.00 0.00 ? 32 LEU A HD13 2  
ATOM 3458  H HD21 . LEU A 1 33 ? 13.007  -2.009  -1.370  1.00 0.00 ? 32 LEU A HD21 2  
ATOM 3459  H HD22 . LEU A 1 33 ? 12.612  -1.298  0.195   1.00 0.00 ? 32 LEU A HD22 2  
ATOM 3460  H HD23 . LEU A 1 33 ? 11.376  -1.414  -1.054  1.00 0.00 ? 32 LEU A HD23 2  
ATOM 3461  N N    . LYS A 1 34 ? 16.228  -2.148  -0.784  1.00 0.00 ? 33 LYS A N    2  
ATOM 3462  C CA   . LYS A 1 34 ? 16.440  -3.598  -0.534  1.00 0.00 ? 33 LYS A CA   2  
ATOM 3463  C C    . LYS A 1 34 ? 16.726  -3.800  0.950   1.00 0.00 ? 33 LYS A C    2  
ATOM 3464  O O    . LYS A 1 34 ? 16.038  -4.531  1.635   1.00 0.00 ? 33 LYS A O    2  
ATOM 3465  C CB   . LYS A 1 34 ? 17.628  -4.096  -1.360  1.00 0.00 ? 33 LYS A CB   2  
ATOM 3466  C CG   . LYS A 1 34 ? 17.735  -5.617  -1.237  1.00 0.00 ? 33 LYS A CG   2  
ATOM 3467  C CD   . LYS A 1 34 ? 18.975  -6.106  -1.991  1.00 0.00 ? 33 LYS A CD   2  
ATOM 3468  C CE   . LYS A 1 34 ? 19.304  -7.536  -1.559  1.00 0.00 ? 33 LYS A CE   2  
ATOM 3469  N NZ   . LYS A 1 34 ? 18.068  -8.368  -1.607  1.00 0.00 ? 33 LYS A NZ   2  
ATOM 3470  H H    . LYS A 1 34 ? 16.726  -1.696  -1.495  1.00 0.00 ? 33 LYS A H    2  
ATOM 3471  H HA   . LYS A 1 34 ? 15.547  -4.131  -0.820  1.00 0.00 ? 33 LYS A HA   2  
ATOM 3472  H HB2  . LYS A 1 34 ? 17.486  -3.826  -2.396  1.00 0.00 ? 33 LYS A HB2  2  
ATOM 3473  H HB3  . LYS A 1 34 ? 18.537  -3.643  -0.992  1.00 0.00 ? 33 LYS A HB3  2  
ATOM 3474  H HG2  . LYS A 1 34 ? 17.815  -5.888  -0.194  1.00 0.00 ? 33 LYS A HG2  2  
ATOM 3475  H HG3  . LYS A 1 34 ? 16.854  -6.076  -1.662  1.00 0.00 ? 33 LYS A HG3  2  
ATOM 3476  H HD2  . LYS A 1 34 ? 18.782  -6.085  -3.054  1.00 0.00 ? 33 LYS A HD2  2  
ATOM 3477  H HD3  . LYS A 1 34 ? 19.812  -5.463  -1.764  1.00 0.00 ? 33 LYS A HD3  2  
ATOM 3478  H HE2  . LYS A 1 34 ? 20.044  -7.953  -2.226  1.00 0.00 ? 33 LYS A HE2  2  
ATOM 3479  H HE3  . LYS A 1 34 ? 19.693  -7.527  -0.551  1.00 0.00 ? 33 LYS A HE3  2  
ATOM 3480  H HZ1  . LYS A 1 34 ? 17.409  -7.970  -2.305  1.00 0.00 ? 33 LYS A HZ1  2  
ATOM 3481  H HZ2  . LYS A 1 34 ? 18.317  -9.341  -1.878  1.00 0.00 ? 33 LYS A HZ2  2  
ATOM 3482  H HZ3  . LYS A 1 34 ? 17.617  -8.372  -0.671  1.00 0.00 ? 33 LYS A HZ3  2  
ATOM 3483  N N    . GLU A 1 35 ? 17.743  -3.155  1.451   1.00 0.00 ? 34 GLU A N    2  
ATOM 3484  C CA   . GLU A 1 35 ? 18.076  -3.311  2.898   1.00 0.00 ? 34 GLU A CA   2  
ATOM 3485  C C    . GLU A 1 35 ? 16.803  -3.116  3.730   1.00 0.00 ? 34 GLU A C    2  
ATOM 3486  O O    . GLU A 1 35 ? 16.601  -3.775  4.731   1.00 0.00 ? 34 GLU A O    2  
ATOM 3487  C CB   . GLU A 1 35 ? 19.116  -2.265  3.300   1.00 0.00 ? 34 GLU A CB   2  
ATOM 3488  C CG   . GLU A 1 35 ? 20.444  -2.572  2.605   1.00 0.00 ? 34 GLU A CG   2  
ATOM 3489  C CD   . GLU A 1 35 ? 21.438  -1.443  2.881   1.00 0.00 ? 34 GLU A CD   2  
ATOM 3490  O OE1  . GLU A 1 35 ? 21.162  -0.325  2.478   1.00 0.00 ? 34 GLU A OE1  2  
ATOM 3491  O OE2  . GLU A 1 35 ? 22.458  -1.716  3.493   1.00 0.00 ? 34 GLU A OE2  2  
ATOM 3492  H H    . GLU A 1 35 ? 18.291  -2.581  0.871   1.00 0.00 ? 34 GLU A H    2  
ATOM 3493  H HA   . GLU A 1 35 ? 18.471  -4.302  3.071   1.00 0.00 ? 34 GLU A HA   2  
ATOM 3494  H HB2  . GLU A 1 35 ? 18.772  -1.284  3.005   1.00 0.00 ? 34 GLU A HB2  2  
ATOM 3495  H HB3  . GLU A 1 35 ? 19.258  -2.290  4.370   1.00 0.00 ? 34 GLU A HB3  2  
ATOM 3496  H HG2  . GLU A 1 35 ? 20.840  -3.503  2.984   1.00 0.00 ? 34 GLU A HG2  2  
ATOM 3497  H HG3  . GLU A 1 35 ? 20.283  -2.655  1.541   1.00 0.00 ? 34 GLU A HG3  2  
ATOM 3498  N N    . LEU A 1 36 ? 15.940  -2.223  3.326   1.00 0.00 ? 35 LEU A N    2  
ATOM 3499  C CA   . LEU A 1 36 ? 14.683  -2.001  4.098   1.00 0.00 ? 35 LEU A CA   2  
ATOM 3500  C C    . LEU A 1 36 ? 13.787  -3.240  3.985   1.00 0.00 ? 35 LEU A C    2  
ATOM 3501  O O    . LEU A 1 36 ? 13.171  -3.651  4.947   1.00 0.00 ? 35 LEU A O    2  
ATOM 3502  C CB   . LEU A 1 36 ? 13.955  -0.762  3.560   1.00 0.00 ? 35 LEU A CB   2  
ATOM 3503  C CG   . LEU A 1 36 ? 12.693  -0.479  4.387   1.00 0.00 ? 35 LEU A CG   2  
ATOM 3504  C CD1  . LEU A 1 36 ? 13.067  -0.169  5.848   1.00 0.00 ? 35 LEU A CD1  2  
ATOM 3505  C CD2  . LEU A 1 36 ? 11.963  0.721   3.774   1.00 0.00 ? 35 LEU A CD2  2  
ATOM 3506  H H    . LEU A 1 36 ? 16.115  -1.706  2.512   1.00 0.00 ? 35 LEU A H    2  
ATOM 3507  H HA   . LEU A 1 36 ? 14.919  -1.860  5.141   1.00 0.00 ? 35 LEU A HA   2  
ATOM 3508  H HB2  . LEU A 1 36 ? 14.616  0.091   3.614   1.00 0.00 ? 35 LEU A HB2  2  
ATOM 3509  H HB3  . LEU A 1 36 ? 13.674  -0.929  2.533   1.00 0.00 ? 35 LEU A HB3  2  
ATOM 3510  H HG   . LEU A 1 36 ? 12.046  -1.343  4.360   1.00 0.00 ? 35 LEU A HG   2  
ATOM 3511  H HD11 . LEU A 1 36 ? 14.013  0.351   5.882   1.00 0.00 ? 35 LEU A HD11 2  
ATOM 3512  H HD12 . LEU A 1 36 ? 12.303  0.450   6.298   1.00 0.00 ? 35 LEU A HD12 2  
ATOM 3513  H HD13 . LEU A 1 36 ? 13.144  -1.094  6.402   1.00 0.00 ? 35 LEU A HD13 2  
ATOM 3514  H HD21 . LEU A 1 36 ? 12.641  1.559   3.708   1.00 0.00 ? 35 LEU A HD21 2  
ATOM 3515  H HD22 . LEU A 1 36 ? 11.613  0.463   2.786   1.00 0.00 ? 35 LEU A HD22 2  
ATOM 3516  H HD23 . LEU A 1 36 ? 11.122  0.987   4.397   1.00 0.00 ? 35 LEU A HD23 2  
ATOM 3517  N N    . ILE A 1 37 ? 13.725  -3.861  2.838   1.00 0.00 ? 36 ILE A N    2  
ATOM 3518  C CA   . ILE A 1 37 ? 12.888  -5.089  2.700   1.00 0.00 ? 36 ILE A CA   2  
ATOM 3519  C C    . ILE A 1 37 ? 13.384  -6.152  3.686   1.00 0.00 ? 36 ILE A C    2  
ATOM 3520  O O    . ILE A 1 37 ? 12.608  -6.849  4.310   1.00 0.00 ? 36 ILE A O    2  
ATOM 3521  C CB   . ILE A 1 37 ? 13.025  -5.623  1.266   1.00 0.00 ? 36 ILE A CB   2  
ATOM 3522  C CG1  . ILE A 1 37 ? 12.274  -4.681  0.315   1.00 0.00 ? 36 ILE A CG1  2  
ATOM 3523  C CG2  . ILE A 1 37 ? 12.421  -7.033  1.176   1.00 0.00 ? 36 ILE A CG2  2  
ATOM 3524  C CD1  . ILE A 1 37 ? 12.538  -5.079  -1.141  1.00 0.00 ? 36 ILE A CD1  2  
ATOM 3525  H H    . ILE A 1 37 ? 14.238  -3.544  2.067   1.00 0.00 ? 36 ILE A H    2  
ATOM 3526  H HA   . ILE A 1 37 ? 11.845  -4.872  2.884   1.00 0.00 ? 36 ILE A HA   2  
ATOM 3527  H HB   . ILE A 1 37 ? 14.069  -5.659  0.993   1.00 0.00 ? 36 ILE A HB   2  
ATOM 3528  H HG12 . ILE A 1 37 ? 11.215  -4.741  0.516   1.00 0.00 ? 36 ILE A HG12 2  
ATOM 3529  H HG13 . ILE A 1 37 ? 12.612  -3.668  0.474   1.00 0.00 ? 36 ILE A HG13 2  
ATOM 3530  H HG21 . ILE A 1 37 ? 11.481  -7.056  1.707   1.00 0.00 ? 36 ILE A HG21 2  
ATOM 3531  H HG22 . ILE A 1 37 ? 12.256  -7.297  0.142   1.00 0.00 ? 36 ILE A HG22 2  
ATOM 3532  H HG23 . ILE A 1 37 ? 13.101  -7.743  1.623   1.00 0.00 ? 36 ILE A HG23 2  
ATOM 3533  H HD11 . ILE A 1 37 ? 13.581  -5.324  -1.268  1.00 0.00 ? 36 ILE A HD11 2  
ATOM 3534  H HD12 . ILE A 1 37 ? 11.933  -5.938  -1.394  1.00 0.00 ? 36 ILE A HD12 2  
ATOM 3535  H HD13 . ILE A 1 37 ? 12.280  -4.255  -1.790  1.00 0.00 ? 36 ILE A HD13 2  
ATOM 3536  N N    . ASN A 1 38 ? 14.675  -6.301  3.798   1.00 0.00 ? 37 ASN A N    2  
ATOM 3537  C CA   . ASN A 1 38 ? 15.241  -7.341  4.704   1.00 0.00 ? 37 ASN A CA   2  
ATOM 3538  C C    . ASN A 1 38 ? 14.789  -7.124  6.153   1.00 0.00 ? 37 ASN A C    2  
ATOM 3539  O O    . ASN A 1 38 ? 14.482  -8.062  6.862   1.00 0.00 ? 37 ASN A O    2  
ATOM 3540  C CB   . ASN A 1 38 ? 16.768  -7.273  4.648   1.00 0.00 ? 37 ASN A CB   2  
ATOM 3541  C CG   . ASN A 1 38 ? 17.241  -7.538  3.217   1.00 0.00 ? 37 ASN A CG   2  
ATOM 3542  O OD1  . ASN A 1 38 ? 17.949  -6.736  2.641   1.00 0.00 ? 37 ASN A OD1  2  
ATOM 3543  N ND2  . ASN A 1 38 ? 16.880  -8.638  2.615   1.00 0.00 ? 37 ASN A ND2  2  
ATOM 3544  H H    . ASN A 1 38 ? 15.277  -5.743  3.263   1.00 0.00 ? 37 ASN A H    2  
ATOM 3545  H HA   . ASN A 1 38 ? 14.923  -8.314  4.358   1.00 0.00 ? 37 ASN A HA   2  
ATOM 3546  H HB2  . ASN A 1 38 ? 17.096  -6.293  4.960   1.00 0.00 ? 37 ASN A HB2  2  
ATOM 3547  H HB3  . ASN A 1 38 ? 17.186  -8.019  5.307   1.00 0.00 ? 37 ASN A HB3  2  
ATOM 3548  H HD21 . ASN A 1 38 ? 16.309  -9.286  3.079   1.00 0.00 ? 37 ASN A HD21 2  
ATOM 3549  H HD22 . ASN A 1 38 ? 17.181  -8.818  1.700   1.00 0.00 ? 37 ASN A HD22 2  
ATOM 3550  N N    . ASN A 1 39 ? 14.779  -5.898  6.611   1.00 0.00 ? 38 ASN A N    2  
ATOM 3551  C CA   . ASN A 1 39 ? 14.388  -5.617  8.030   1.00 0.00 ? 38 ASN A CA   2  
ATOM 3552  C C    . ASN A 1 39 ? 12.940  -5.120  8.123   1.00 0.00 ? 38 ASN A C    2  
ATOM 3553  O O    . ASN A 1 39 ? 12.480  -4.772  9.192   1.00 0.00 ? 38 ASN A O    2  
ATOM 3554  C CB   . ASN A 1 39 ? 15.316  -4.536  8.590   1.00 0.00 ? 38 ASN A CB   2  
ATOM 3555  C CG   . ASN A 1 39 ? 16.767  -5.008  8.493   1.00 0.00 ? 38 ASN A CG   2  
ATOM 3556  O OD1  . ASN A 1 39 ? 17.149  -5.643  7.530   1.00 0.00 ? 38 ASN A OD1  2  
ATOM 3557  N ND2  . ASN A 1 39 ? 17.600  -4.724  9.456   1.00 0.00 ? 38 ASN A ND2  2  
ATOM 3558  H H    . ASN A 1 39 ? 15.057  -5.160  6.028   1.00 0.00 ? 38 ASN A H    2  
ATOM 3559  H HA   . ASN A 1 39 ? 14.496  -6.511  8.628   1.00 0.00 ? 38 ASN A HA   2  
ATOM 3560  H HB2  . ASN A 1 39 ? 15.194  -3.627  8.019   1.00 0.00 ? 38 ASN A HB2  2  
ATOM 3561  H HB3  . ASN A 1 39 ? 15.068  -4.349  9.624   1.00 0.00 ? 38 ASN A HB3  2  
ATOM 3562  H HD21 . ASN A 1 39 ? 17.293  -4.211  10.233  1.00 0.00 ? 38 ASN A HD21 2  
ATOM 3563  H HD22 . ASN A 1 39 ? 18.531  -5.023  9.403   1.00 0.00 ? 38 ASN A HD22 2  
ATOM 3564  N N    . GLU A 1 40 ? 12.218  -5.065  7.027   1.00 0.00 ? 39 GLU A N    2  
ATOM 3565  C CA   . GLU A 1 40 ? 10.799  -4.565  7.079   1.00 0.00 ? 39 GLU A CA   2  
ATOM 3566  C C    . GLU A 1 40 ? 9.818   -5.681  6.709   1.00 0.00 ? 39 GLU A C    2  
ATOM 3567  O O    . GLU A 1 40 ? 8.698   -5.700  7.180   1.00 0.00 ? 39 GLU A O    2  
ATOM 3568  C CB   . GLU A 1 40 ? 10.643  -3.413  6.082   1.00 0.00 ? 39 GLU A CB   2  
ATOM 3569  C CG   . GLU A 1 40 ? 9.297   -2.713  6.301   1.00 0.00 ? 39 GLU A CG   2  
ATOM 3570  C CD   . GLU A 1 40 ? 9.370   -1.846  7.559   1.00 0.00 ? 39 GLU A CD   2  
ATOM 3571  O OE1  . GLU A 1 40 ? 9.894   -0.748  7.469   1.00 0.00 ? 39 GLU A OE1  2  
ATOM 3572  O OE2  . GLU A 1 40 ? 8.902   -2.296  8.593   1.00 0.00 ? 39 GLU A OE2  2  
ATOM 3573  H H    . GLU A 1 40 ? 12.608  -5.339  6.171   1.00 0.00 ? 39 GLU A H    2  
ATOM 3574  H HA   . GLU A 1 40 ? 10.563  -4.204  8.070   1.00 0.00 ? 39 GLU A HA   2  
ATOM 3575  H HB2  . GLU A 1 40 ? 11.444  -2.702  6.227   1.00 0.00 ? 39 GLU A HB2  2  
ATOM 3576  H HB3  . GLU A 1 40 ? 10.684  -3.800  5.075   1.00 0.00 ? 39 GLU A HB3  2  
ATOM 3577  H HG2  . GLU A 1 40 ? 9.074   -2.090  5.447   1.00 0.00 ? 39 GLU A HG2  2  
ATOM 3578  H HG3  . GLU A 1 40 ? 8.519   -3.452  6.420   1.00 0.00 ? 39 GLU A HG3  2  
ATOM 3579  N N    . LEU A 1 41 ? 10.224  -6.612  5.879   1.00 0.00 ? 40 LEU A N    2  
ATOM 3580  C CA   . LEU A 1 41 ? 9.310   -7.736  5.480   1.00 0.00 ? 40 LEU A CA   2  
ATOM 3581  C C    . LEU A 1 41 ? 9.941   -9.076  5.871   1.00 0.00 ? 40 LEU A C    2  
ATOM 3582  O O    . LEU A 1 41 ? 9.902   -10.033 5.124   1.00 0.00 ? 40 LEU A O    2  
ATOM 3583  C CB   . LEU A 1 41 ? 9.090   -7.699  3.964   1.00 0.00 ? 40 LEU A CB   2  
ATOM 3584  C CG   . LEU A 1 41 ? 8.557   -6.320  3.547   1.00 0.00 ? 40 LEU A CG   2  
ATOM 3585  C CD1  . LEU A 1 41 ? 8.362   -6.288  2.026   1.00 0.00 ? 40 LEU A CD1  2  
ATOM 3586  C CD2  . LEU A 1 41 ? 7.213   -6.042  4.242   1.00 0.00 ? 40 LEU A CD2  2  
ATOM 3587  H H    . LEU A 1 41 ? 11.134  -6.576  5.518   1.00 0.00 ? 40 LEU A H    2  
ATOM 3588  H HA   . LEU A 1 41 ? 8.357   -7.642  5.980   1.00 0.00 ? 40 LEU A HA   2  
ATOM 3589  H HB2  . LEU A 1 41 ? 10.028  -7.889  3.462   1.00 0.00 ? 40 LEU A HB2  2  
ATOM 3590  H HB3  . LEU A 1 41 ? 8.374   -8.458  3.687   1.00 0.00 ? 40 LEU A HB3  2  
ATOM 3591  H HG   . LEU A 1 41 ? 9.273   -5.561  3.829   1.00 0.00 ? 40 LEU A HG   2  
ATOM 3592  H HD11 . LEU A 1 41 ? 7.887   -7.202  1.703   1.00 0.00 ? 40 LEU A HD11 2  
ATOM 3593  H HD12 . LEU A 1 41 ? 7.739   -5.446  1.760   1.00 0.00 ? 40 LEU A HD12 2  
ATOM 3594  H HD13 . LEU A 1 41 ? 9.322   -6.190  1.541   1.00 0.00 ? 40 LEU A HD13 2  
ATOM 3595  H HD21 . LEU A 1 41 ? 6.635   -6.953  4.297   1.00 0.00 ? 40 LEU A HD21 2  
ATOM 3596  H HD22 . LEU A 1 41 ? 7.393   -5.670  5.238   1.00 0.00 ? 40 LEU A HD22 2  
ATOM 3597  H HD23 . LEU A 1 41 ? 6.660   -5.300  3.683   1.00 0.00 ? 40 LEU A HD23 2  
ATOM 3598  N N    . SER A 1 42 ? 10.522  -9.148  7.038   1.00 0.00 ? 41 SER A N    2  
ATOM 3599  C CA   . SER A 1 42 ? 11.158  -10.421 7.484   1.00 0.00 ? 41 SER A CA   2  
ATOM 3600  C C    . SER A 1 42 ? 10.082  -11.447 7.849   1.00 0.00 ? 41 SER A C    2  
ATOM 3601  O O    . SER A 1 42 ? 10.268  -12.636 7.683   1.00 0.00 ? 41 SER A O    2  
ATOM 3602  C CB   . SER A 1 42 ? 12.029  -10.151 8.711   1.00 0.00 ? 41 SER A CB   2  
ATOM 3603  O OG   . SER A 1 42 ? 11.198  -9.789  9.806   1.00 0.00 ? 41 SER A OG   2  
ATOM 3604  H H    . SER A 1 42 ? 10.541  -8.362  7.623   1.00 0.00 ? 41 SER A H    2  
ATOM 3605  H HA   . SER A 1 42 ? 11.774  -10.815 6.689   1.00 0.00 ? 41 SER A HA   2  
ATOM 3606  H HB2  . SER A 1 42 ? 12.582  -11.040 8.965   1.00 0.00 ? 41 SER A HB2  2  
ATOM 3607  H HB3  . SER A 1 42 ? 12.722  -9.350  8.491   1.00 0.00 ? 41 SER A HB3  2  
ATOM 3608  H HG   . SER A 1 42 ? 10.296  -9.722  9.485   1.00 0.00 ? 41 SER A HG   2  
ATOM 3609  N N    . HIS A 1 43 ? 8.962   -11.006 8.357   1.00 0.00 ? 42 HIS A N    2  
ATOM 3610  C CA   . HIS A 1 43 ? 7.891   -11.971 8.740   1.00 0.00 ? 42 HIS A CA   2  
ATOM 3611  C C    . HIS A 1 43 ? 7.324   -12.646 7.489   1.00 0.00 ? 42 HIS A C    2  
ATOM 3612  O O    . HIS A 1 43 ? 7.220   -13.855 7.419   1.00 0.00 ? 42 HIS A O    2  
ATOM 3613  C CB   . HIS A 1 43 ? 6.770   -11.224 9.467   1.00 0.00 ? 42 HIS A CB   2  
ATOM 3614  C CG   . HIS A 1 43 ? 5.867   -12.213 10.151  1.00 0.00 ? 42 HIS A CG   2  
ATOM 3615  N ND1  . HIS A 1 43 ? 4.504   -12.263 9.906   1.00 0.00 ? 42 HIS A ND1  2  
ATOM 3616  C CD2  . HIS A 1 43 ? 6.118   -13.197 11.075  1.00 0.00 ? 42 HIS A CD2  2  
ATOM 3617  C CE1  . HIS A 1 43 ? 3.991   -13.245 10.669  1.00 0.00 ? 42 HIS A CE1  2  
ATOM 3618  N NE2  . HIS A 1 43 ? 4.932   -13.847 11.401  1.00 0.00 ? 42 HIS A NE2  2  
ATOM 3619  H H    . HIS A 1 43 ? 8.824   -10.046 8.496   1.00 0.00 ? 42 HIS A H    2  
ATOM 3620  H HA   . HIS A 1 43 ? 8.306   -12.723 9.396   1.00 0.00 ? 42 HIS A HA   2  
ATOM 3621  H HB2  . HIS A 1 43 ? 7.198   -10.560 10.203  1.00 0.00 ? 42 HIS A HB2  2  
ATOM 3622  H HB3  . HIS A 1 43 ? 6.198   -10.650 8.753   1.00 0.00 ? 42 HIS A HB3  2  
ATOM 3623  H HD1  . HIS A 1 43 ? 4.005   -11.687 9.289   1.00 0.00 ? 42 HIS A HD1  2  
ATOM 3624  H HD2  . HIS A 1 43 ? 7.089   -13.430 11.486  1.00 0.00 ? 42 HIS A HD2  2  
ATOM 3625  H HE1  . HIS A 1 43 ? 2.945   -13.514 10.687  1.00 0.00 ? 42 HIS A HE1  2  
ATOM 3626  N N    . PHE A 1 44 ? 6.951   -11.879 6.502   1.00 0.00 ? 43 PHE A N    2  
ATOM 3627  C CA   . PHE A 1 44 ? 6.388   -12.485 5.263   1.00 0.00 ? 43 PHE A CA   2  
ATOM 3628  C C    . PHE A 1 44 ? 7.472   -13.316 4.567   1.00 0.00 ? 43 PHE A C    2  
ATOM 3629  O O    . PHE A 1 44 ? 7.185   -14.282 3.891   1.00 0.00 ? 43 PHE A O    2  
ATOM 3630  C CB   . PHE A 1 44 ? 5.893   -11.368 4.325   1.00 0.00 ? 43 PHE A CB   2  
ATOM 3631  C CG   . PHE A 1 44 ? 4.472   -10.981 4.689   1.00 0.00 ? 43 PHE A CG   2  
ATOM 3632  C CD1  . PHE A 1 44 ? 4.185   -10.500 5.974   1.00 0.00 ? 43 PHE A CD1  2  
ATOM 3633  C CD2  . PHE A 1 44 ? 3.443   -11.107 3.746   1.00 0.00 ? 43 PHE A CD2  2  
ATOM 3634  C CE1  . PHE A 1 44 ? 2.873   -10.147 6.313   1.00 0.00 ? 43 PHE A CE1  2  
ATOM 3635  C CE2  . PHE A 1 44 ? 2.132   -10.753 4.085   1.00 0.00 ? 43 PHE A CE2  2  
ATOM 3636  C CZ   . PHE A 1 44 ? 1.847   -10.274 5.369   1.00 0.00 ? 43 PHE A CZ   2  
ATOM 3637  H H    . PHE A 1 44 ? 7.039   -10.906 6.576   1.00 0.00 ? 43 PHE A H    2  
ATOM 3638  H HA   . PHE A 1 44 ? 5.563   -13.134 5.526   1.00 0.00 ? 43 PHE A HA   2  
ATOM 3639  H HB2  . PHE A 1 44 ? 6.535   -10.506 4.428   1.00 0.00 ? 43 PHE A HB2  2  
ATOM 3640  H HB3  . PHE A 1 44 ? 5.920   -11.713 3.300   1.00 0.00 ? 43 PHE A HB3  2  
ATOM 3641  H HD1  . PHE A 1 44 ? 4.976   -10.402 6.702   1.00 0.00 ? 43 PHE A HD1  2  
ATOM 3642  H HD2  . PHE A 1 44 ? 3.661   -11.478 2.755   1.00 0.00 ? 43 PHE A HD2  2  
ATOM 3643  H HE1  . PHE A 1 44 ? 2.652   -9.776  7.303   1.00 0.00 ? 43 PHE A HE1  2  
ATOM 3644  H HE2  . PHE A 1 44 ? 1.341   -10.851 3.357   1.00 0.00 ? 43 PHE A HE2  2  
ATOM 3645  H HZ   . PHE A 1 44 ? 0.835   -10.001 5.630   1.00 0.00 ? 43 PHE A HZ   2  
ATOM 3646  N N    . LEU A 1 45 ? 8.713   -12.941 4.719   1.00 0.00 ? 44 LEU A N    2  
ATOM 3647  C CA   . LEU A 1 45 ? 9.809   -13.704 4.055   1.00 0.00 ? 44 LEU A CA   2  
ATOM 3648  C C    . LEU A 1 45 ? 9.641   -15.202 4.350   1.00 0.00 ? 44 LEU A C    2  
ATOM 3649  O O    . LEU A 1 45 ? 10.065  -16.046 3.585   1.00 0.00 ? 44 LEU A O    2  
ATOM 3650  C CB   . LEU A 1 45 ? 11.170  -13.197 4.583   1.00 0.00 ? 44 LEU A CB   2  
ATOM 3651  C CG   . LEU A 1 45 ? 12.247  -13.236 3.478   1.00 0.00 ? 44 LEU A CG   2  
ATOM 3652  C CD1  . LEU A 1 45 ? 12.352  -14.654 2.905   1.00 0.00 ? 44 LEU A CD1  2  
ATOM 3653  C CD2  . LEU A 1 45 ? 11.908  -12.236 2.348   1.00 0.00 ? 44 LEU A CD2  2  
ATOM 3654  H H    . LEU A 1 45 ? 8.924   -12.154 5.263   1.00 0.00 ? 44 LEU A H    2  
ATOM 3655  H HA   . LEU A 1 45 ? 9.746   -13.545 2.991   1.00 0.00 ? 44 LEU A HA   2  
ATOM 3656  H HB2  . LEU A 1 45 ? 11.054  -12.180 4.927   1.00 0.00 ? 44 LEU A HB2  2  
ATOM 3657  H HB3  . LEU A 1 45 ? 11.492  -13.812 5.413   1.00 0.00 ? 44 LEU A HB3  2  
ATOM 3658  H HG   . LEU A 1 45 ? 13.199  -12.967 3.914   1.00 0.00 ? 44 LEU A HG   2  
ATOM 3659  H HD11 . LEU A 1 45 ? 12.308  -15.373 3.709   1.00 0.00 ? 44 LEU A HD11 2  
ATOM 3660  H HD12 . LEU A 1 45 ? 11.536  -14.827 2.219   1.00 0.00 ? 44 LEU A HD12 2  
ATOM 3661  H HD13 . LEU A 1 45 ? 13.289  -14.760 2.380   1.00 0.00 ? 44 LEU A HD13 2  
ATOM 3662  H HD21 . LEU A 1 45 ? 11.312  -11.423 2.739   1.00 0.00 ? 44 LEU A HD21 2  
ATOM 3663  H HD22 . LEU A 1 45 ? 12.826  -11.837 1.941   1.00 0.00 ? 44 LEU A HD22 2  
ATOM 3664  H HD23 . LEU A 1 45 ? 11.359  -12.733 1.560   1.00 0.00 ? 44 LEU A HD23 2  
ATOM 3665  N N    . GLU A 1 46 ? 9.023   -15.540 5.448   1.00 0.00 ? 45 GLU A N    2  
ATOM 3666  C CA   . GLU A 1 46 ? 8.831   -16.982 5.778   1.00 0.00 ? 45 GLU A CA   2  
ATOM 3667  C C    . GLU A 1 46 ? 7.602   -17.519 5.043   1.00 0.00 ? 45 GLU A C    2  
ATOM 3668  O O    . GLU A 1 46 ? 7.582   -18.646 4.589   1.00 0.00 ? 45 GLU A O    2  
ATOM 3669  C CB   . GLU A 1 46 ? 8.630   -17.142 7.286   1.00 0.00 ? 45 GLU A CB   2  
ATOM 3670  C CG   . GLU A 1 46 ? 8.768   -18.619 7.663   1.00 0.00 ? 45 GLU A CG   2  
ATOM 3671  C CD   . GLU A 1 46 ? 8.220   -18.841 9.074   1.00 0.00 ? 45 GLU A CD   2  
ATOM 3672  O OE1  . GLU A 1 46 ? 7.124   -18.378 9.343   1.00 0.00 ? 45 GLU A OE1  2  
ATOM 3673  O OE2  . GLU A 1 46 ? 8.906   -19.472 9.862   1.00 0.00 ? 45 GLU A OE2  2  
ATOM 3674  H H    . GLU A 1 46 ? 8.684   -14.849 6.052   1.00 0.00 ? 45 GLU A H    2  
ATOM 3675  H HA   . GLU A 1 46 ? 9.702   -17.539 5.473   1.00 0.00 ? 45 GLU A HA   2  
ATOM 3676  H HB2  . GLU A 1 46 ? 9.376   -16.563 7.812   1.00 0.00 ? 45 GLU A HB2  2  
ATOM 3677  H HB3  . GLU A 1 46 ? 7.645   -16.793 7.558   1.00 0.00 ? 45 GLU A HB3  2  
ATOM 3678  H HG2  . GLU A 1 46 ? 8.211   -19.223 6.961   1.00 0.00 ? 45 GLU A HG2  2  
ATOM 3679  H HG3  . GLU A 1 46 ? 9.809   -18.902 7.635   1.00 0.00 ? 45 GLU A HG3  2  
ATOM 3680  N N    . GLU A 1 47 ? 6.572   -16.725 4.930   1.00 0.00 ? 46 GLU A N    2  
ATOM 3681  C CA   . GLU A 1 47 ? 5.335   -17.191 4.234   1.00 0.00 ? 46 GLU A CA   2  
ATOM 3682  C C    . GLU A 1 47 ? 5.423   -16.885 2.735   1.00 0.00 ? 46 GLU A C    2  
ATOM 3683  O O    . GLU A 1 47 ? 4.575   -16.212 2.182   1.00 0.00 ? 46 GLU A O    2  
ATOM 3684  C CB   . GLU A 1 47 ? 4.122   -16.469 4.826   1.00 0.00 ? 46 GLU A CB   2  
ATOM 3685  C CG   . GLU A 1 47 ? 3.873   -16.970 6.250   1.00 0.00 ? 46 GLU A CG   2  
ATOM 3686  C CD   . GLU A 1 47 ? 2.606   -16.318 6.808   1.00 0.00 ? 46 GLU A CD   2  
ATOM 3687  O OE1  . GLU A 1 47 ? 2.246   -15.257 6.324   1.00 0.00 ? 46 GLU A OE1  2  
ATOM 3688  O OE2  . GLU A 1 47 ? 2.018   -16.890 7.711   1.00 0.00 ? 46 GLU A OE2  2  
ATOM 3689  H H    . GLU A 1 47 ? 6.609   -15.824 5.312   1.00 0.00 ? 46 GLU A H    2  
ATOM 3690  H HA   . GLU A 1 47 ? 5.218   -18.256 4.374   1.00 0.00 ? 46 GLU A HA   2  
ATOM 3691  H HB2  . GLU A 1 47 ? 4.311   -15.406 4.845   1.00 0.00 ? 46 GLU A HB2  2  
ATOM 3692  H HB3  . GLU A 1 47 ? 3.253   -16.670 4.219   1.00 0.00 ? 46 GLU A HB3  2  
ATOM 3693  H HG2  . GLU A 1 47 ? 3.751   -18.044 6.238   1.00 0.00 ? 46 GLU A HG2  2  
ATOM 3694  H HG3  . GLU A 1 47 ? 4.714   -16.710 6.876   1.00 0.00 ? 46 GLU A HG3  2  
ATOM 3695  N N    . ILE A 1 48 ? 6.437   -17.388 2.071   1.00 0.00 ? 47 ILE A N    2  
ATOM 3696  C CA   . ILE A 1 48 ? 6.592   -17.150 0.598   1.00 0.00 ? 47 ILE A CA   2  
ATOM 3697  C C    . ILE A 1 48 ? 6.498   -18.491 -0.131  1.00 0.00 ? 47 ILE A C    2  
ATOM 3698  O O    . ILE A 1 48 ? 7.396   -19.307 -0.061  1.00 0.00 ? 47 ILE A O    2  
ATOM 3699  C CB   . ILE A 1 48 ? 7.965   -16.532 0.318   1.00 0.00 ? 47 ILE A CB   2  
ATOM 3700  C CG1  . ILE A 1 48 ? 8.159   -15.278 1.181   1.00 0.00 ? 47 ILE A CG1  2  
ATOM 3701  C CG2  . ILE A 1 48 ? 8.074   -16.163 -1.163  1.00 0.00 ? 47 ILE A CG2  2  
ATOM 3702  C CD1  . ILE A 1 48 ? 6.992   -14.300 0.990   1.00 0.00 ? 47 ILE A CD1  2  
ATOM 3703  H H    . ILE A 1 48 ? 7.098   -17.936 2.543   1.00 0.00 ? 47 ILE A H    2  
ATOM 3704  H HA   . ILE A 1 48 ? 5.816   -16.490 0.236   1.00 0.00 ? 47 ILE A HA   2  
ATOM 3705  H HB   . ILE A 1 48 ? 8.732   -17.254 0.560   1.00 0.00 ? 47 ILE A HB   2  
ATOM 3706  H HG12 . ILE A 1 48 ? 8.211   -15.569 2.217   1.00 0.00 ? 47 ILE A HG12 2  
ATOM 3707  H HG13 . ILE A 1 48 ? 9.081   -14.790 0.900   1.00 0.00 ? 47 ILE A HG13 2  
ATOM 3708  H HG21 . ILE A 1 48 ? 7.929   -17.047 -1.766  1.00 0.00 ? 47 ILE A HG21 2  
ATOM 3709  H HG22 . ILE A 1 48 ? 7.319   -15.431 -1.410  1.00 0.00 ? 47 ILE A HG22 2  
ATOM 3710  H HG23 . ILE A 1 48 ? 9.053   -15.751 -1.360  1.00 0.00 ? 47 ILE A HG23 2  
ATOM 3711  H HD11 . ILE A 1 48 ? 6.665   -14.312 -0.038  1.00 0.00 ? 47 ILE A HD11 2  
ATOM 3712  H HD12 . ILE A 1 48 ? 6.174   -14.590 1.631   1.00 0.00 ? 47 ILE A HD12 2  
ATOM 3713  H HD13 . ILE A 1 48 ? 7.315   -13.303 1.251   1.00 0.00 ? 47 ILE A HD13 2  
ATOM 3714  N N    . LYS A 1 49 ? 5.420   -18.732 -0.831  1.00 0.00 ? 48 LYS A N    2  
ATOM 3715  C CA   . LYS A 1 49 ? 5.278   -20.027 -1.561  1.00 0.00 ? 48 LYS A CA   2  
ATOM 3716  C C    . LYS A 1 49 ? 5.835   -19.877 -2.980  1.00 0.00 ? 48 LYS A C    2  
ATOM 3717  O O    . LYS A 1 49 ? 6.498   -20.757 -3.492  1.00 0.00 ? 48 LYS A O    2  
ATOM 3718  C CB   . LYS A 1 49 ? 3.800   -20.419 -1.632  1.00 0.00 ? 48 LYS A CB   2  
ATOM 3719  C CG   . LYS A 1 49 ? 3.159   -20.289 -0.246  1.00 0.00 ? 48 LYS A CG   2  
ATOM 3720  C CD   . LYS A 1 49 ? 3.975   -21.080 0.785   1.00 0.00 ? 48 LYS A CD   2  
ATOM 3721  C CE   . LYS A 1 49 ? 3.117   -21.343 2.027   1.00 0.00 ? 48 LYS A CE   2  
ATOM 3722  N NZ   . LYS A 1 49 ? 3.918   -22.094 3.035   1.00 0.00 ? 48 LYS A NZ   2  
ATOM 3723  H H    . LYS A 1 49 ? 4.705   -18.063 -0.876  1.00 0.00 ? 48 LYS A H    2  
ATOM 3724  H HA   . LYS A 1 49 ? 5.830   -20.797 -1.036  1.00 0.00 ? 48 LYS A HA   2  
ATOM 3725  H HB2  . LYS A 1 49 ? 3.290   -19.768 -2.327  1.00 0.00 ? 48 LYS A HB2  2  
ATOM 3726  H HB3  . LYS A 1 49 ? 3.715   -21.441 -1.970  1.00 0.00 ? 48 LYS A HB3  2  
ATOM 3727  H HG2  . LYS A 1 49 ? 3.131   -19.247 0.039   1.00 0.00 ? 48 LYS A HG2  2  
ATOM 3728  H HG3  . LYS A 1 49 ? 2.152   -20.679 -0.282  1.00 0.00 ? 48 LYS A HG3  2  
ATOM 3729  H HD2  . LYS A 1 49 ? 4.285   -22.023 0.356   1.00 0.00 ? 48 LYS A HD2  2  
ATOM 3730  H HD3  . LYS A 1 49 ? 4.846   -20.509 1.068   1.00 0.00 ? 48 LYS A HD3  2  
ATOM 3731  H HE2  . LYS A 1 49 ? 2.798   -20.401 2.450   1.00 0.00 ? 48 LYS A HE2  2  
ATOM 3732  H HE3  . LYS A 1 49 ? 2.251   -21.924 1.749   1.00 0.00 ? 48 LYS A HE3  2  
ATOM 3733  H HZ1  . LYS A 1 49 ? 4.823   -22.385 2.611   1.00 0.00 ? 48 LYS A HZ1  2  
ATOM 3734  H HZ2  . LYS A 1 49 ? 4.099   -21.485 3.857   1.00 0.00 ? 48 LYS A HZ2  2  
ATOM 3735  H HZ3  . LYS A 1 49 ? 3.390   -22.936 3.339   1.00 0.00 ? 48 LYS A HZ3  2  
ATOM 3736  N N    . GLU A 1 50 ? 5.566   -18.769 -3.625  1.00 0.00 ? 49 GLU A N    2  
ATOM 3737  C CA   . GLU A 1 50 ? 6.076   -18.564 -5.016  1.00 0.00 ? 49 GLU A CA   2  
ATOM 3738  C C    . GLU A 1 50 ? 7.451   -17.892 -4.966  1.00 0.00 ? 49 GLU A C    2  
ATOM 3739  O O    . GLU A 1 50 ? 7.611   -16.761 -5.382  1.00 0.00 ? 49 GLU A O    2  
ATOM 3740  C CB   . GLU A 1 50 ? 5.101   -17.673 -5.788  1.00 0.00 ? 49 GLU A CB   2  
ATOM 3741  C CG   . GLU A 1 50 ? 3.669   -18.153 -5.546  1.00 0.00 ? 49 GLU A CG   2  
ATOM 3742  C CD   . GLU A 1 50 ? 3.548   -19.620 -5.962  1.00 0.00 ? 49 GLU A CD   2  
ATOM 3743  O OE1  . GLU A 1 50 ? 3.990   -19.944 -7.053  1.00 0.00 ? 49 GLU A OE1  2  
ATOM 3744  O OE2  . GLU A 1 50 ? 3.016   -20.395 -5.185  1.00 0.00 ? 49 GLU A OE2  2  
ATOM 3745  H H    . GLU A 1 50 ? 5.026   -18.073 -3.195  1.00 0.00 ? 49 GLU A H    2  
ATOM 3746  H HA   . GLU A 1 50 ? 6.159   -19.521 -5.513  1.00 0.00 ? 49 GLU A HA   2  
ATOM 3747  H HB2  . GLU A 1 50 ? 5.202   -16.651 -5.451  1.00 0.00 ? 49 GLU A HB2  2  
ATOM 3748  H HB3  . GLU A 1 50 ? 5.323   -17.728 -6.844  1.00 0.00 ? 49 GLU A HB3  2  
ATOM 3749  H HG2  . GLU A 1 50 ? 3.428   -18.054 -4.497  1.00 0.00 ? 49 GLU A HG2  2  
ATOM 3750  H HG3  . GLU A 1 50 ? 2.985   -17.558 -6.131  1.00 0.00 ? 49 GLU A HG3  2  
ATOM 3751  N N    . GLN A 1 51 ? 8.441   -18.566 -4.450  1.00 0.00 ? 50 GLN A N    2  
ATOM 3752  C CA   . GLN A 1 51 ? 9.798   -17.953 -4.362  1.00 0.00 ? 50 GLN A CA   2  
ATOM 3753  C C    . GLN A 1 51 ? 10.161  -17.280 -5.691  1.00 0.00 ? 50 GLN A C    2  
ATOM 3754  O O    . GLN A 1 51 ? 11.004  -16.406 -5.744  1.00 0.00 ? 50 GLN A O    2  
ATOM 3755  C CB   . GLN A 1 51 ? 10.822  -19.051 -4.047  1.00 0.00 ? 50 GLN A CB   2  
ATOM 3756  C CG   . GLN A 1 51 ? 12.249  -18.489 -4.114  1.00 0.00 ? 50 GLN A CG   2  
ATOM 3757  C CD   . GLN A 1 51 ? 12.358  -17.239 -3.239  1.00 0.00 ? 50 GLN A CD   2  
ATOM 3758  O OE1  . GLN A 1 51 ? 12.185  -17.308 -2.038  1.00 0.00 ? 50 GLN A OE1  2  
ATOM 3759  N NE2  . GLN A 1 51 ? 12.639  -16.091 -3.792  1.00 0.00 ? 50 GLN A NE2  2  
ATOM 3760  H H    . GLN A 1 51 ? 8.291   -19.472 -4.108  1.00 0.00 ? 50 GLN A H    2  
ATOM 3761  H HA   . GLN A 1 51 ? 9.797   -17.227 -3.562  1.00 0.00 ? 50 GLN A HA   2  
ATOM 3762  H HB2  . GLN A 1 51 ? 10.637  -19.437 -3.055  1.00 0.00 ? 50 GLN A HB2  2  
ATOM 3763  H HB3  . GLN A 1 51 ? 10.720  -19.851 -4.765  1.00 0.00 ? 50 GLN A HB3  2  
ATOM 3764  H HG2  . GLN A 1 51 ? 12.943  -19.236 -3.757  1.00 0.00 ? 50 GLN A HG2  2  
ATOM 3765  H HG3  . GLN A 1 51 ? 12.493  -18.236 -5.135  1.00 0.00 ? 50 GLN A HG3  2  
ATOM 3766  H HE21 . GLN A 1 51 ? 12.777  -16.034 -4.760  1.00 0.00 ? 50 GLN A HE21 2  
ATOM 3767  H HE22 . GLN A 1 51 ? 12.711  -15.285 -3.238  1.00 0.00 ? 50 GLN A HE22 2  
ATOM 3768  N N    . GLU A 1 52 ? 9.542   -17.687 -6.767  1.00 0.00 ? 51 GLU A N    2  
ATOM 3769  C CA   . GLU A 1 52 ? 9.868   -17.074 -8.089  1.00 0.00 ? 51 GLU A CA   2  
ATOM 3770  C C    . GLU A 1 52 ? 9.277   -15.662 -8.184  1.00 0.00 ? 51 GLU A C    2  
ATOM 3771  O O    . GLU A 1 52 ? 9.778   -14.829 -8.913  1.00 0.00 ? 51 GLU A O    2  
ATOM 3772  C CB   . GLU A 1 52 ? 9.335   -17.948 -9.226  1.00 0.00 ? 51 GLU A CB   2  
ATOM 3773  C CG   . GLU A 1 52 ? 10.206  -19.198 -9.362  1.00 0.00 ? 51 GLU A CG   2  
ATOM 3774  C CD   . GLU A 1 52 ? 11.563  -18.814 -9.955  1.00 0.00 ? 51 GLU A CD   2  
ATOM 3775  O OE1  . GLU A 1 52 ? 11.588  -17.957 -10.823 1.00 0.00 ? 51 GLU A OE1  2  
ATOM 3776  O OE2  . GLU A 1 52 ? 12.555  -19.383 -9.531  1.00 0.00 ? 51 GLU A OE2  2  
ATOM 3777  H H    . GLU A 1 52 ? 8.867   -18.394 -6.705  1.00 0.00 ? 51 GLU A H    2  
ATOM 3778  H HA   . GLU A 1 52 ? 10.939  -16.975 -8.170  1.00 0.00 ? 51 GLU A HA   2  
ATOM 3779  H HB2  . GLU A 1 52 ? 8.317   -18.239 -9.008  1.00 0.00 ? 51 GLU A HB2  2  
ATOM 3780  H HB3  . GLU A 1 52 ? 9.360   -17.392 -10.150 1.00 0.00 ? 51 GLU A HB3  2  
ATOM 3781  H HG2  . GLU A 1 52 ? 10.350  -19.644 -8.388  1.00 0.00 ? 51 GLU A HG2  2  
ATOM 3782  H HG3  . GLU A 1 52 ? 9.719   -19.908 -10.014 1.00 0.00 ? 51 GLU A HG3  2  
ATOM 3783  N N    . VAL A 1 53 ? 8.254   -15.361 -7.435  1.00 0.00 ? 52 VAL A N    2  
ATOM 3784  C CA   . VAL A 1 53 ? 7.697   -13.978 -7.480  1.00 0.00 ? 52 VAL A CA   2  
ATOM 3785  C C    . VAL A 1 53 ? 8.655   -13.058 -6.726  1.00 0.00 ? 52 VAL A C    2  
ATOM 3786  O O    . VAL A 1 53 ? 9.027   -12.009 -7.214  1.00 0.00 ? 52 VAL A O    2  
ATOM 3787  C CB   . VAL A 1 53 ? 6.324   -13.944 -6.802  1.00 0.00 ? 52 VAL A CB   2  
ATOM 3788  C CG1  . VAL A 1 53 ? 5.840   -12.494 -6.695  1.00 0.00 ? 52 VAL A CG1  2  
ATOM 3789  C CG2  . VAL A 1 53 ? 5.324   -14.747 -7.632  1.00 0.00 ? 52 VAL A CG2  2  
ATOM 3790  H H    . VAL A 1 53 ? 7.882   -16.014 -6.804  1.00 0.00 ? 52 VAL A H    2  
ATOM 3791  H HA   . VAL A 1 53 ? 7.609   -13.632 -8.500  1.00 0.00 ? 52 VAL A HA   2  
ATOM 3792  H HB   . VAL A 1 53 ? 6.401   -14.372 -5.813  1.00 0.00 ? 52 VAL A HB   2  
ATOM 3793  H HG11 . VAL A 1 53 ? 5.957   -12.005 -7.650  1.00 0.00 ? 52 VAL A HG11 2  
ATOM 3794  H HG12 . VAL A 1 53 ? 4.798   -12.483 -6.410  1.00 0.00 ? 52 VAL A HG12 2  
ATOM 3795  H HG13 . VAL A 1 53 ? 6.422   -11.973 -5.949  1.00 0.00 ? 52 VAL A HG13 2  
ATOM 3796  H HG21 . VAL A 1 53 ? 5.764   -15.692 -7.912  1.00 0.00 ? 52 VAL A HG21 2  
ATOM 3797  H HG22 . VAL A 1 53 ? 4.433   -14.923 -7.048  1.00 0.00 ? 52 VAL A HG22 2  
ATOM 3798  H HG23 . VAL A 1 53 ? 5.067   -14.192 -8.522  1.00 0.00 ? 52 VAL A HG23 2  
ATOM 3799  N N    . VAL A 1 54 ? 9.070   -13.435 -5.552  1.00 0.00 ? 53 VAL A N    2  
ATOM 3800  C CA   . VAL A 1 54 ? 10.012  -12.566 -4.798  1.00 0.00 ? 53 VAL A CA   2  
ATOM 3801  C C    . VAL A 1 54 ? 11.318  -12.452 -5.583  1.00 0.00 ? 53 VAL A C    2  
ATOM 3802  O O    . VAL A 1 54 ? 11.967  -11.425 -5.583  1.00 0.00 ? 53 VAL A O    2  
ATOM 3803  C CB   . VAL A 1 54 ? 10.288  -13.181 -3.425  1.00 0.00 ? 53 VAL A CB   2  
ATOM 3804  C CG1  . VAL A 1 54 ? 11.370  -12.370 -2.709  1.00 0.00 ? 53 VAL A CG1  2  
ATOM 3805  C CG2  . VAL A 1 54 ? 9.003   -13.160 -2.593  1.00 0.00 ? 53 VAL A CG2  2  
ATOM 3806  H H    . VAL A 1 54 ? 8.772   -14.283 -5.159  1.00 0.00 ? 53 VAL A H    2  
ATOM 3807  H HA   . VAL A 1 54 ? 9.581   -11.583 -4.675  1.00 0.00 ? 53 VAL A HA   2  
ATOM 3808  H HB   . VAL A 1 54 ? 10.624  -14.200 -3.547  1.00 0.00 ? 53 VAL A HB   2  
ATOM 3809  H HG11 . VAL A 1 54 ? 11.144  -11.317 -2.791  1.00 0.00 ? 53 VAL A HG11 2  
ATOM 3810  H HG12 . VAL A 1 54 ? 11.401  -12.652 -1.667  1.00 0.00 ? 53 VAL A HG12 2  
ATOM 3811  H HG13 . VAL A 1 54 ? 12.329  -12.569 -3.165  1.00 0.00 ? 53 VAL A HG13 2  
ATOM 3812  H HG21 . VAL A 1 54 ? 8.569   -12.172 -2.627  1.00 0.00 ? 53 VAL A HG21 2  
ATOM 3813  H HG22 . VAL A 1 54 ? 8.302   -13.875 -2.997  1.00 0.00 ? 53 VAL A HG22 2  
ATOM 3814  H HG23 . VAL A 1 54 ? 9.233   -13.419 -1.570  1.00 0.00 ? 53 VAL A HG23 2  
ATOM 3815  N N    . ASP A 1 55 ? 11.708  -13.500 -6.254  1.00 0.00 ? 54 ASP A N    2  
ATOM 3816  C CA   . ASP A 1 55 ? 12.971  -13.450 -7.040  1.00 0.00 ? 54 ASP A CA   2  
ATOM 3817  C C    . ASP A 1 55 ? 12.893  -12.315 -8.063  1.00 0.00 ? 54 ASP A C    2  
ATOM 3818  O O    . ASP A 1 55 ? 13.838  -11.577 -8.257  1.00 0.00 ? 54 ASP A O    2  
ATOM 3819  C CB   . ASP A 1 55 ? 13.174  -14.780 -7.769  1.00 0.00 ? 54 ASP A CB   2  
ATOM 3820  C CG   . ASP A 1 55 ? 13.541  -15.869 -6.758  1.00 0.00 ? 54 ASP A CG   2  
ATOM 3821  O OD1  . ASP A 1 55 ? 14.117  -15.531 -5.738  1.00 0.00 ? 54 ASP A OD1  2  
ATOM 3822  O OD2  . ASP A 1 55 ? 13.239  -17.021 -7.023  1.00 0.00 ? 54 ASP A OD2  2  
ATOM 3823  H H    . ASP A 1 55 ? 11.170  -14.319 -6.242  1.00 0.00 ? 54 ASP A H    2  
ATOM 3824  H HA   . ASP A 1 55 ? 13.799  -13.282 -6.367  1.00 0.00 ? 54 ASP A HA   2  
ATOM 3825  H HB2  . ASP A 1 55 ? 12.262  -15.052 -8.279  1.00 0.00 ? 54 ASP A HB2  2  
ATOM 3826  H HB3  . ASP A 1 55 ? 13.971  -14.678 -8.490  1.00 0.00 ? 54 ASP A HB3  2  
ATOM 3827  N N    . LYS A 1 56 ? 11.776  -12.177 -8.730  1.00 0.00 ? 55 LYS A N    2  
ATOM 3828  C CA   . LYS A 1 56 ? 11.651  -11.096 -9.749  1.00 0.00 ? 55 LYS A CA   2  
ATOM 3829  C C    . LYS A 1 56 ? 11.603  -9.734  -9.058  1.00 0.00 ? 55 LYS A C    2  
ATOM 3830  O O    . LYS A 1 56 ? 12.001  -8.736  -9.623  1.00 0.00 ? 55 LYS A O    2  
ATOM 3831  C CB   . LYS A 1 56 ? 10.388  -11.299 -10.584 1.00 0.00 ? 55 LYS A CB   2  
ATOM 3832  C CG   . LYS A 1 56 ? 10.555  -12.533 -11.481 1.00 0.00 ? 55 LYS A CG   2  
ATOM 3833  C CD   . LYS A 1 56 ? 9.384   -12.636 -12.477 1.00 0.00 ? 55 LYS A CD   2  
ATOM 3834  C CE   . LYS A 1 56 ? 8.185   -13.331 -11.820 1.00 0.00 ? 55 LYS A CE   2  
ATOM 3835  N NZ   . LYS A 1 56 ? 8.478   -14.784 -11.670 1.00 0.00 ? 55 LYS A NZ   2  
ATOM 3836  H H    . LYS A 1 56 ? 11.026  -12.787 -8.567  1.00 0.00 ? 55 LYS A H    2  
ATOM 3837  H HA   . LYS A 1 56 ? 12.525  -11.115 -10.383 1.00 0.00 ? 55 LYS A HA   2  
ATOM 3838  H HB2  . LYS A 1 56 ? 9.546   -11.440 -9.923  1.00 0.00 ? 55 LYS A HB2  2  
ATOM 3839  H HB3  . LYS A 1 56 ? 10.223  -10.427 -11.198 1.00 0.00 ? 55 LYS A HB3  2  
ATOM 3840  H HG2  . LYS A 1 56 ? 11.483  -12.449 -12.029 1.00 0.00 ? 55 LYS A HG2  2  
ATOM 3841  H HG3  . LYS A 1 56 ? 10.585  -13.421 -10.866 1.00 0.00 ? 55 LYS A HG3  2  
ATOM 3842  H HD2  . LYS A 1 56 ? 9.091   -11.648 -12.802 1.00 0.00 ? 55 LYS A HD2  2  
ATOM 3843  H HD3  . LYS A 1 56 ? 9.698   -13.213 -13.335 1.00 0.00 ? 55 LYS A HD3  2  
ATOM 3844  H HE2  . LYS A 1 56 ? 8.000   -12.899 -10.848 1.00 0.00 ? 55 LYS A HE2  2  
ATOM 3845  H HE3  . LYS A 1 56 ? 7.311   -13.204 -12.441 1.00 0.00 ? 55 LYS A HE3  2  
ATOM 3846  H HZ1  . LYS A 1 56 ? 9.295   -15.035 -12.261 1.00 0.00 ? 55 LYS A HZ1  2  
ATOM 3847  H HZ2  . LYS A 1 56 ? 8.694   -14.994 -10.676 1.00 0.00 ? 55 LYS A HZ2  2  
ATOM 3848  H HZ3  . LYS A 1 56 ? 7.649   -15.337 -11.970 1.00 0.00 ? 55 LYS A HZ3  2  
ATOM 3849  N N    . VAL A 1 57 ? 11.157  -9.674  -7.834  1.00 0.00 ? 56 VAL A N    2  
ATOM 3850  C CA   . VAL A 1 57 ? 11.138  -8.366  -7.124  1.00 0.00 ? 56 VAL A CA   2  
ATOM 3851  C C    . VAL A 1 57 ? 12.583  -7.923  -6.905  1.00 0.00 ? 56 VAL A C    2  
ATOM 3852  O O    . VAL A 1 57 ? 12.991  -6.862  -7.333  1.00 0.00 ? 56 VAL A O    2  
ATOM 3853  C CB   . VAL A 1 57 ? 10.442  -8.537  -5.772  1.00 0.00 ? 56 VAL A CB   2  
ATOM 3854  C CG1  . VAL A 1 57 ? 10.501  -7.220  -4.997  1.00 0.00 ? 56 VAL A CG1  2  
ATOM 3855  C CG2  . VAL A 1 57 ? 8.979   -8.931  -5.999  1.00 0.00 ? 56 VAL A CG2  2  
ATOM 3856  H H    . VAL A 1 57 ? 10.870  -10.480 -7.361  1.00 0.00 ? 56 VAL A H    2  
ATOM 3857  H HA   . VAL A 1 57 ? 10.620  -7.613  -7.701  1.00 0.00 ? 56 VAL A HA   2  
ATOM 3858  H HB   . VAL A 1 57 ? 10.942  -9.310  -5.206  1.00 0.00 ? 56 VAL A HB   2  
ATOM 3859  H HG11 . VAL A 1 57 ? 10.188  -6.409  -5.639  1.00 0.00 ? 56 VAL A HG11 2  
ATOM 3860  H HG12 . VAL A 1 57 ? 9.845   -7.275  -4.141  1.00 0.00 ? 56 VAL A HG12 2  
ATOM 3861  H HG13 . VAL A 1 57 ? 11.513  -7.044  -4.662  1.00 0.00 ? 56 VAL A HG13 2  
ATOM 3862  H HG21 . VAL A 1 57 ? 8.925   -9.697  -6.759  1.00 0.00 ? 56 VAL A HG21 2  
ATOM 3863  H HG22 . VAL A 1 57 ? 8.560   -9.308  -5.079  1.00 0.00 ? 56 VAL A HG22 2  
ATOM 3864  H HG23 . VAL A 1 57 ? 8.418   -8.066  -6.321  1.00 0.00 ? 56 VAL A HG23 2  
ATOM 3865  N N    . MET A 1 58 ? 13.362  -8.731  -6.241  1.00 0.00 ? 57 MET A N    2  
ATOM 3866  C CA   . MET A 1 58 ? 14.781  -8.360  -5.993  1.00 0.00 ? 57 MET A CA   2  
ATOM 3867  C C    . MET A 1 58 ? 15.462  -8.014  -7.323  1.00 0.00 ? 57 MET A C    2  
ATOM 3868  O O    . MET A 1 58 ? 16.405  -7.249  -7.364  1.00 0.00 ? 57 MET A O    2  
ATOM 3869  C CB   . MET A 1 58 ? 15.505  -9.545  -5.331  1.00 0.00 ? 57 MET A CB   2  
ATOM 3870  C CG   . MET A 1 58 ? 15.247  -9.540  -3.819  1.00 0.00 ? 57 MET A CG   2  
ATOM 3871  S SD   . MET A 1 58 ? 13.466  -9.458  -3.504  1.00 0.00 ? 57 MET A SD   2  
ATOM 3872  C CE   . MET A 1 58 ? 13.549  -9.599  -1.700  1.00 0.00 ? 57 MET A CE   2  
ATOM 3873  H H    . MET A 1 58 ? 13.013  -9.576  -5.887  1.00 0.00 ? 57 MET A H    2  
ATOM 3874  H HA   . MET A 1 58 ? 14.821  -7.500  -5.342  1.00 0.00 ? 57 MET A HA   2  
ATOM 3875  H HB2  . MET A 1 58 ? 15.137  -10.468 -5.755  1.00 0.00 ? 57 MET A HB2  2  
ATOM 3876  H HB3  . MET A 1 58 ? 16.568  -9.468  -5.510  1.00 0.00 ? 57 MET A HB3  2  
ATOM 3877  H HG2  . MET A 1 58 ? 15.647  -10.443 -3.384  1.00 0.00 ? 57 MET A HG2  2  
ATOM 3878  H HG3  . MET A 1 58 ? 15.730  -8.682  -3.375  1.00 0.00 ? 57 MET A HG3  2  
ATOM 3879  H HE1  . MET A 1 58 ? 14.194  -8.824  -1.307  1.00 0.00 ? 57 MET A HE1  2  
ATOM 3880  H HE2  . MET A 1 58 ? 12.562  -9.487  -1.282  1.00 0.00 ? 57 MET A HE2  2  
ATOM 3881  H HE3  . MET A 1 58 ? 13.942  -10.571 -1.433  1.00 0.00 ? 57 MET A HE3  2  
ATOM 3882  N N    . GLU A 1 59 ? 14.983  -8.556  -8.418  1.00 0.00 ? 58 GLU A N    2  
ATOM 3883  C CA   . GLU A 1 59 ? 15.593  -8.242  -9.747  1.00 0.00 ? 58 GLU A CA   2  
ATOM 3884  C C    . GLU A 1 59 ? 14.955  -6.979  -10.334 1.00 0.00 ? 58 GLU A C    2  
ATOM 3885  O O    . GLU A 1 59 ? 15.625  -6.179  -10.956 1.00 0.00 ? 58 GLU A O    2  
ATOM 3886  C CB   . GLU A 1 59 ? 15.415  -9.421  -10.707 1.00 0.00 ? 58 GLU A CB   2  
ATOM 3887  C CG   . GLU A 1 59 ? 16.294  -9.214  -11.943 1.00 0.00 ? 58 GLU A CG   2  
ATOM 3888  C CD   . GLU A 1 59 ? 15.835  -10.153 -13.060 1.00 0.00 ? 58 GLU A CD   2  
ATOM 3889  O OE1  . GLU A 1 59 ? 15.198  -11.146 -12.748 1.00 0.00 ? 58 GLU A OE1  2  
ATOM 3890  O OE2  . GLU A 1 59 ? 16.128  -9.863  -14.209 1.00 0.00 ? 58 GLU A OE2  2  
ATOM 3891  H H    . GLU A 1 59 ? 14.206  -9.146  -8.367  1.00 0.00 ? 58 GLU A H    2  
ATOM 3892  H HA   . GLU A 1 59 ? 16.643  -8.021  -9.619  1.00 0.00 ? 58 GLU A HA   2  
ATOM 3893  H HB2  . GLU A 1 59 ? 15.702  -10.336 -10.209 1.00 0.00 ? 58 GLU A HB2  2  
ATOM 3894  H HB3  . GLU A 1 59 ? 14.380  -9.484  -11.008 1.00 0.00 ? 58 GLU A HB3  2  
ATOM 3895  H HG2  . GLU A 1 59 ? 16.212  -8.189  -12.278 1.00 0.00 ? 58 GLU A HG2  2  
ATOM 3896  H HG3  . GLU A 1 59 ? 17.322  -9.430  -11.694 1.00 0.00 ? 58 GLU A HG3  2  
ATOM 3897  N N    . THR A 1 60 ? 13.678  -6.775  -10.150 1.00 0.00 ? 59 THR A N    2  
ATOM 3898  C CA   . THR A 1 60 ? 13.056  -5.543  -10.716 1.00 0.00 ? 59 THR A CA   2  
ATOM 3899  C C    . THR A 1 60 ? 13.617  -4.334  -9.966  1.00 0.00 ? 59 THR A C    2  
ATOM 3900  O O    . THR A 1 60 ? 14.071  -3.385  -10.574 1.00 0.00 ? 59 THR A O    2  
ATOM 3901  C CB   . THR A 1 60 ? 11.530  -5.602  -10.588 1.00 0.00 ? 59 THR A CB   2  
ATOM 3902  O OG1  . THR A 1 60 ? 11.087  -6.927  -10.851 1.00 0.00 ? 59 THR A OG1  2  
ATOM 3903  C CG2  . THR A 1 60 ? 10.892  -4.640  -11.593 1.00 0.00 ? 59 THR A CG2  2  
ATOM 3904  H H    . THR A 1 60 ? 13.140  -7.414  -9.638  1.00 0.00 ? 59 THR A H    2  
ATOM 3905  H HA   . THR A 1 60 ? 13.345  -5.442  -11.752 1.00 0.00 ? 59 THR A HA   2  
ATOM 3906  H HB   . THR A 1 60 ? 11.241  -5.318  -9.588  1.00 0.00 ? 59 THR A HB   2  
ATOM 3907  H HG1  . THR A 1 60 ? 10.487  -7.184  -10.147 1.00 0.00 ? 59 THR A HG1  2  
ATOM 3908  H HG21 . THR A 1 60 ? 11.340  -3.663  -11.490 1.00 0.00 ? 59 THR A HG21 2  
ATOM 3909  H HG22 . THR A 1 60 ? 11.056  -5.006  -12.595 1.00 0.00 ? 59 THR A HG22 2  
ATOM 3910  H HG23 . THR A 1 60 ? 9.831   -4.572  -11.404 1.00 0.00 ? 59 THR A HG23 2  
ATOM 3911  N N    . LEU A 1 61 ? 13.645  -4.364  -8.667  1.00 0.00 ? 60 LEU A N    2  
ATOM 3912  C CA   . LEU A 1 61 ? 14.243  -3.218  -7.933  1.00 0.00 ? 60 LEU A CA   2  
ATOM 3913  C C    . LEU A 1 61 ? 15.683  -3.053  -8.420  1.00 0.00 ? 60 LEU A C    2  
ATOM 3914  O O    . LEU A 1 61 ? 16.071  -1.998  -8.879  1.00 0.00 ? 60 LEU A O    2  
ATOM 3915  C CB   . LEU A 1 61 ? 14.235  -3.509  -6.421  1.00 0.00 ? 60 LEU A CB   2  
ATOM 3916  C CG   . LEU A 1 61 ? 12.904  -3.059  -5.805  1.00 0.00 ? 60 LEU A CG   2  
ATOM 3917  C CD1  . LEU A 1 61 ? 11.765  -3.916  -6.358  1.00 0.00 ? 60 LEU A CD1  2  
ATOM 3918  C CD2  . LEU A 1 61 ? 12.969  -3.218  -4.286  1.00 0.00 ? 60 LEU A CD2  2  
ATOM 3919  H H    . LEU A 1 61 ? 13.316  -5.142  -8.163  1.00 0.00 ? 60 LEU A H    2  
ATOM 3920  H HA   . LEU A 1 61 ? 13.716  -2.294  -8.130  1.00 0.00 ? 60 LEU A HA   2  
ATOM 3921  H HB2  . LEU A 1 61 ? 14.363  -4.569  -6.260  1.00 0.00 ? 60 LEU A HB2  2  
ATOM 3922  H HB3  . LEU A 1 61 ? 15.044  -2.974  -5.942  1.00 0.00 ? 60 LEU A HB3  2  
ATOM 3923  H HG   . LEU A 1 61 ? 12.725  -2.022  -6.051  1.00 0.00 ? 60 LEU A HG   2  
ATOM 3924  H HD11 . LEU A 1 61 ? 12.050  -4.957  -6.330  1.00 0.00 ? 60 LEU A HD11 2  
ATOM 3925  H HD12 . LEU A 1 61 ? 10.881  -3.769  -5.757  1.00 0.00 ? 60 LEU A HD12 2  
ATOM 3926  H HD13 . LEU A 1 61 ? 11.559  -3.627  -7.378  1.00 0.00 ? 60 LEU A HD13 2  
ATOM 3927  H HD21 . LEU A 1 61 ? 13.884  -2.777  -3.916  1.00 0.00 ? 60 LEU A HD21 2  
ATOM 3928  H HD22 . LEU A 1 61 ? 12.123  -2.721  -3.836  1.00 0.00 ? 60 LEU A HD22 2  
ATOM 3929  H HD23 . LEU A 1 61 ? 12.947  -4.268  -4.033  1.00 0.00 ? 60 LEU A HD23 2  
ATOM 3930  N N    . ASP A 1 62 ? 16.476  -4.088  -8.343  1.00 0.00 ? 61 ASP A N    2  
ATOM 3931  C CA   . ASP A 1 62 ? 17.883  -3.976  -8.822  1.00 0.00 ? 61 ASP A CA   2  
ATOM 3932  C C    . ASP A 1 62 ? 17.885  -3.364  -10.225 1.00 0.00 ? 61 ASP A C    2  
ATOM 3933  O O    . ASP A 1 62 ? 18.847  -2.750  -10.644 1.00 0.00 ? 61 ASP A O    2  
ATOM 3934  C CB   . ASP A 1 62 ? 18.519  -5.366  -8.873  1.00 0.00 ? 61 ASP A CB   2  
ATOM 3935  C CG   . ASP A 1 62 ? 18.708  -5.896  -7.451  1.00 0.00 ? 61 ASP A CG   2  
ATOM 3936  O OD1  . ASP A 1 62 ? 18.751  -5.087  -6.539  1.00 0.00 ? 61 ASP A OD1  2  
ATOM 3937  O OD2  . ASP A 1 62 ? 18.806  -7.103  -7.298  1.00 0.00 ? 61 ASP A OD2  2  
ATOM 3938  H H    . ASP A 1 62 ? 16.148  -4.936  -7.979  1.00 0.00 ? 61 ASP A H    2  
ATOM 3939  H HA   . ASP A 1 62 ? 18.445  -3.344  -8.150  1.00 0.00 ? 61 ASP A HA   2  
ATOM 3940  H HB2  . ASP A 1 62 ? 17.876  -6.036  -9.426  1.00 0.00 ? 61 ASP A HB2  2  
ATOM 3941  H HB3  . ASP A 1 62 ? 19.480  -5.305  -9.362  1.00 0.00 ? 61 ASP A HB3  2  
ATOM 3942  N N    . GLU A 1 63 ? 16.806  -3.523  -10.953 1.00 0.00 ? 62 GLU A N    2  
ATOM 3943  C CA   . GLU A 1 63 ? 16.728  -2.950  -12.334 1.00 0.00 ? 62 GLU A CA   2  
ATOM 3944  C C    . GLU A 1 63 ? 15.967  -1.632  -12.280 1.00 0.00 ? 62 GLU A C    2  
ATOM 3945  O O    . GLU A 1 63 ? 15.174  -1.305  -13.140 1.00 0.00 ? 62 GLU A O    2  
ATOM 3946  C CB   . GLU A 1 63 ? 15.987  -3.896  -13.230 1.00 0.00 ? 62 GLU A CB   2  
ATOM 3947  C CG   . GLU A 1 63 ? 16.834  -5.141  -13.503 1.00 0.00 ? 62 GLU A CG   2  
ATOM 3948  C CD   . GLU A 1 63 ? 17.923  -4.805  -14.524 1.00 0.00 ? 62 GLU A CD   2  
ATOM 3949  O OE1  . GLU A 1 63 ? 17.579  -4.308  -15.584 1.00 0.00 ? 62 GLU A OE1  2  
ATOM 3950  O OE2  . GLU A 1 63 ? 19.081  -5.049  -14.230 1.00 0.00 ? 62 GLU A OE2  2  
ATOM 3951  H H    . GLU A 1 63 ? 16.043  -4.017  -10.589 1.00 0.00 ? 62 GLU A H    2  
ATOM 3952  H HA   . GLU A 1 63 ? 17.724  -2.750  -12.701 1.00 0.00 ? 62 GLU A HA   2  
ATOM 3953  H HB2  . GLU A 1 63 ? 15.076  -4.170  -12.730 1.00 0.00 ? 62 GLU A HB2  2  
ATOM 3954  H HB3  . GLU A 1 63 ? 15.758  -3.396  -14.153 1.00 0.00 ? 62 GLU A HB3  2  
ATOM 3955  H HG2  . GLU A 1 63 ? 17.293  -5.476  -12.583 1.00 0.00 ? 62 GLU A HG2  2  
ATOM 3956  H HG3  . GLU A 1 63 ? 16.205  -5.925  -13.897 1.00 0.00 ? 62 GLU A HG3  2  
ATOM 3957  N N    . ASP A 1 64 ? 16.224  -0.893  -11.273 1.00 0.00 ? 63 ASP A N    2  
ATOM 3958  C CA   . ASP A 1 64 ? 15.559  0.429   -11.092 1.00 0.00 ? 63 ASP A CA   2  
ATOM 3959  C C    . ASP A 1 64 ? 15.561  1.197   -12.409 1.00 0.00 ? 63 ASP A C    2  
ATOM 3960  O O    . ASP A 1 64 ? 14.594  1.836   -12.773 1.00 0.00 ? 63 ASP A O    2  
ATOM 3961  C CB   . ASP A 1 64 ? 16.381  1.232   -10.081 1.00 0.00 ? 63 ASP A CB   2  
ATOM 3962  C CG   . ASP A 1 64 ? 15.792  2.638   -9.936  1.00 0.00 ? 63 ASP A CG   2  
ATOM 3963  O OD1  . ASP A 1 64 ? 14.742  2.881   -10.508 1.00 0.00 ? 63 ASP A OD1  2  
ATOM 3964  O OD2  . ASP A 1 64 ? 16.403  3.447   -9.258  1.00 0.00 ? 63 ASP A OD2  2  
ATOM 3965  H H    . ASP A 1 64 ? 16.863  -1.219  -10.626 1.00 0.00 ? 63 ASP A H    2  
ATOM 3966  H HA   . ASP A 1 64 ? 14.562  0.339   -10.691 1.00 0.00 ? 63 ASP A HA   2  
ATOM 3967  H HB2  . ASP A 1 64 ? 16.352  0.733   -9.125  1.00 0.00 ? 63 ASP A HB2  2  
ATOM 3968  H HB3  . ASP A 1 64 ? 17.401  1.305   -10.422 1.00 0.00 ? 63 ASP A HB3  2  
ATOM 3969  N N    . GLY A 1 65 ? 16.635  1.102   -13.138 1.00 0.00 ? 64 GLY A N    2  
ATOM 3970  C CA   . GLY A 1 65 ? 16.727  1.788   -14.461 1.00 0.00 ? 64 GLY A CA   2  
ATOM 3971  C C    . GLY A 1 65 ? 16.357  3.277   -14.357 1.00 0.00 ? 64 GLY A C    2  
ATOM 3972  O O    . GLY A 1 65 ? 16.453  3.996   -15.331 1.00 0.00 ? 64 GLY A O    2  
ATOM 3973  H H    . GLY A 1 65 ? 17.379  0.539   -12.835 1.00 0.00 ? 64 GLY A H    2  
ATOM 3974  H HA2  . GLY A 1 65 ? 17.744  1.708   -14.818 1.00 0.00 ? 64 GLY A HA2  2  
ATOM 3975  H HA3  . GLY A 1 65 ? 16.052  1.283   -15.133 1.00 0.00 ? 64 GLY A HA3  2  
ATOM 3976  N N    . ASP A 1 66 ? 15.925  3.754   -13.202 1.00 0.00 ? 65 ASP A N    2  
ATOM 3977  C CA   . ASP A 1 66 ? 15.537  5.211   -13.066 1.00 0.00 ? 65 ASP A CA   2  
ATOM 3978  C C    . ASP A 1 66 ? 16.540  6.018   -12.197 1.00 0.00 ? 65 ASP A C    2  
ATOM 3979  O O    . ASP A 1 66 ? 16.450  7.227   -12.146 1.00 0.00 ? 65 ASP A O    2  
ATOM 3980  C CB   . ASP A 1 66 ? 14.153  5.291   -12.422 1.00 0.00 ? 65 ASP A CB   2  
ATOM 3981  C CG   . ASP A 1 66 ? 13.585  6.698   -12.610 1.00 0.00 ? 65 ASP A CG   2  
ATOM 3982  O OD1  . ASP A 1 66 ? 13.817  7.273   -13.660 1.00 0.00 ? 65 ASP A OD1  2  
ATOM 3983  O OD2  . ASP A 1 66 ? 12.929  7.178   -11.700 1.00 0.00 ? 65 ASP A OD2  2  
ATOM 3984  H H    . ASP A 1 66 ? 15.830  3.161   -12.429 1.00 0.00 ? 65 ASP A H    2  
ATOM 3985  H HA   . ASP A 1 66 ? 15.482  5.633   -14.060 1.00 0.00 ? 65 ASP A HA   2  
ATOM 3986  H HB2  . ASP A 1 66 ? 13.496  4.570   -12.887 1.00 0.00 ? 65 ASP A HB2  2  
ATOM 3987  H HB3  . ASP A 1 66 ? 14.235  5.075   -11.367 1.00 0.00 ? 65 ASP A HB3  2  
ATOM 3988  N N    . GLY A 1 67 ? 17.497  5.406   -11.526 1.00 0.00 ? 66 GLY A N    2  
ATOM 3989  C CA   . GLY A 1 67 ? 18.462  6.207   -10.710 1.00 0.00 ? 66 GLY A CA   2  
ATOM 3990  C C    . GLY A 1 67 ? 17.854  6.579   -9.351  1.00 0.00 ? 66 GLY A C    2  
ATOM 3991  O O    . GLY A 1 67 ? 18.565  6.740   -8.380  1.00 0.00 ? 66 GLY A O    2  
ATOM 3992  H H    . GLY A 1 67 ? 17.621  4.445   -11.575 1.00 0.00 ? 66 GLY A H    2  
ATOM 3993  H HA2  . GLY A 1 67 ? 19.363  5.630   -10.553 1.00 0.00 ? 66 GLY A HA2  2  
ATOM 3994  H HA3  . GLY A 1 67 ? 18.703  7.101   -11.264 1.00 0.00 ? 66 GLY A HA3  2  
ATOM 3995  N N    . GLU A 1 68 ? 16.552  6.707   -9.260  1.00 0.00 ? 67 GLU A N    2  
ATOM 3996  C CA   . GLU A 1 68 ? 15.929  7.062   -7.940  1.00 0.00 ? 67 GLU A CA   2  
ATOM 3997  C C    . GLU A 1 68 ? 14.526  6.454   -7.835  1.00 0.00 ? 67 GLU A C    2  
ATOM 3998  O O    . GLU A 1 68 ? 13.722  6.578   -8.738  1.00 0.00 ? 67 GLU A O    2  
ATOM 3999  C CB   . GLU A 1 68 ? 15.820  8.587   -7.804  1.00 0.00 ? 67 GLU A CB   2  
ATOM 4000  C CG   . GLU A 1 68 ? 17.218  9.224   -7.692  1.00 0.00 ? 67 GLU A CG   2  
ATOM 4001  C CD   . GLU A 1 68 ? 17.818  9.434   -9.088  1.00 0.00 ? 67 GLU A CD   2  
ATOM 4002  O OE1  . GLU A 1 68 ? 17.071  9.777   -9.989  1.00 0.00 ? 67 GLU A OE1  2  
ATOM 4003  O OE2  . GLU A 1 68 ? 19.016  9.250   -9.228  1.00 0.00 ? 67 GLU A OE2  2  
ATOM 4004  H H    . GLU A 1 68 ? 15.996  6.577   -10.055 1.00 0.00 ? 67 GLU A H    2  
ATOM 4005  H HA   . GLU A 1 68 ? 16.548  6.669   -7.146  1.00 0.00 ? 67 GLU A HA   2  
ATOM 4006  H HB2  . GLU A 1 68 ? 15.306  8.987   -8.666  1.00 0.00 ? 67 GLU A HB2  2  
ATOM 4007  H HB3  . GLU A 1 68 ? 15.252  8.821   -6.915  1.00 0.00 ? 67 GLU A HB3  2  
ATOM 4008  H HG2  . GLU A 1 68 ? 17.134  10.181  -7.196  1.00 0.00 ? 67 GLU A HG2  2  
ATOM 4009  H HG3  . GLU A 1 68 ? 17.867  8.583   -7.116  1.00 0.00 ? 67 GLU A HG3  2  
ATOM 4010  N N    . CYS A 1 69 ? 14.217  5.813   -6.731  1.00 0.00 ? 68 CYS A N    2  
ATOM 4011  C CA   . CYS A 1 69 ? 12.856  5.209   -6.551  1.00 0.00 ? 68 CYS A CA   2  
ATOM 4012  C C    . CYS A 1 69 ? 12.041  6.077   -5.585  1.00 0.00 ? 68 CYS A C    2  
ATOM 4013  O O    . CYS A 1 69 ? 12.487  6.402   -4.502  1.00 0.00 ? 68 CYS A O    2  
ATOM 4014  C CB   . CYS A 1 69 ? 12.995  3.800   -5.970  1.00 0.00 ? 68 CYS A CB   2  
ATOM 4015  S SG   . CYS A 1 69 ? 14.051  2.803   -7.050  1.00 0.00 ? 68 CYS A SG   2  
ATOM 4016  H H    . CYS A 1 69 ? 14.878  5.739   -6.010  1.00 0.00 ? 68 CYS A H    2  
ATOM 4017  H HA   . CYS A 1 69 ? 12.344  5.154   -7.503  1.00 0.00 ? 68 CYS A HA   2  
ATOM 4018  H HB2  . CYS A 1 69 ? 13.439  3.858   -4.987  1.00 0.00 ? 68 CYS A HB2  2  
ATOM 4019  H HB3  . CYS A 1 69 ? 12.020  3.343   -5.897  1.00 0.00 ? 68 CYS A HB3  2  
ATOM 4020  H HG   . CYS A 1 69 ? 13.484  2.336   -7.669  1.00 0.00 ? 68 CYS A HG   2  
ATOM 4021  N N    . ASP A 1 70 ? 10.853  6.464   -5.971  1.00 0.00 ? 69 ASP A N    2  
ATOM 4022  C CA   . ASP A 1 70 ? 10.012  7.322   -5.081  1.00 0.00 ? 69 ASP A CA   2  
ATOM 4023  C C    . ASP A 1 70 ? 9.214   6.449   -4.106  1.00 0.00 ? 69 ASP A C    2  
ATOM 4024  O O    . ASP A 1 70 ? 9.396   5.250   -4.036  1.00 0.00 ? 69 ASP A O    2  
ATOM 4025  C CB   . ASP A 1 70 ? 9.042   8.139   -5.934  1.00 0.00 ? 69 ASP A CB   2  
ATOM 4026  C CG   . ASP A 1 70 ? 9.821   8.887   -7.017  1.00 0.00 ? 69 ASP A CG   2  
ATOM 4027  O OD1  . ASP A 1 70 ? 10.796  8.340   -7.504  1.00 0.00 ? 69 ASP A OD1  2  
ATOM 4028  O OD2  . ASP A 1 70 ? 9.429   9.996   -7.341  1.00 0.00 ? 69 ASP A OD2  2  
ATOM 4029  H H    . ASP A 1 70 ? 10.517  6.200   -6.854  1.00 0.00 ? 69 ASP A H    2  
ATOM 4030  H HA   . ASP A 1 70 ? 10.647  7.994   -4.522  1.00 0.00 ? 69 ASP A HA   2  
ATOM 4031  H HB2  . ASP A 1 70 ? 8.324   7.477   -6.397  1.00 0.00 ? 69 ASP A HB2  2  
ATOM 4032  H HB3  . ASP A 1 70 ? 8.525   8.851   -5.309  1.00 0.00 ? 69 ASP A HB3  2  
ATOM 4033  N N    . PHE A 1 71 ? 8.322   7.047   -3.361  1.00 0.00 ? 70 PHE A N    2  
ATOM 4034  C CA   . PHE A 1 71 ? 7.498   6.260   -2.396  1.00 0.00 ? 70 PHE A CA   2  
ATOM 4035  C C    . PHE A 1 71 ? 6.450   5.463   -3.173  1.00 0.00 ? 70 PHE A C    2  
ATOM 4036  O O    . PHE A 1 71 ? 6.134   4.342   -2.827  1.00 0.00 ? 70 PHE A O    2  
ATOM 4037  C CB   . PHE A 1 71 ? 6.809   7.217   -1.415  1.00 0.00 ? 70 PHE A CB   2  
ATOM 4038  C CG   . PHE A 1 71 ? 6.108   6.439   -0.321  1.00 0.00 ? 70 PHE A CG   2  
ATOM 4039  C CD1  . PHE A 1 71 ? 4.895   5.787   -0.583  1.00 0.00 ? 70 PHE A CD1  2  
ATOM 4040  C CD2  . PHE A 1 71 ? 6.669   6.379   0.961   1.00 0.00 ? 70 PHE A CD2  2  
ATOM 4041  C CE1  . PHE A 1 71 ? 4.247   5.076   0.435   1.00 0.00 ? 70 PHE A CE1  2  
ATOM 4042  C CE2  . PHE A 1 71 ? 6.020   5.668   1.978   1.00 0.00 ? 70 PHE A CE2  2  
ATOM 4043  C CZ   . PHE A 1 71 ? 4.810   5.017   1.715   1.00 0.00 ? 70 PHE A CZ   2  
ATOM 4044  H H    . PHE A 1 71 ? 8.181   8.015   -3.447  1.00 0.00 ? 70 PHE A H    2  
ATOM 4045  H HA   . PHE A 1 71 ? 8.131   5.565   -1.867  1.00 0.00 ? 70 PHE A HA   2  
ATOM 4046  H HB2  . PHE A 1 71 ? 7.549   7.869   -0.975  1.00 0.00 ? 70 PHE A HB2  2  
ATOM 4047  H HB3  . PHE A 1 71 ? 6.083   7.812   -1.950  1.00 0.00 ? 70 PHE A HB3  2  
ATOM 4048  H HD1  . PHE A 1 71 ? 4.457   5.833   -1.569  1.00 0.00 ? 70 PHE A HD1  2  
ATOM 4049  H HD2  . PHE A 1 71 ? 7.601   6.883   1.165   1.00 0.00 ? 70 PHE A HD2  2  
ATOM 4050  H HE1  . PHE A 1 71 ? 3.312   4.573   0.233   1.00 0.00 ? 70 PHE A HE1  2  
ATOM 4051  H HE2  . PHE A 1 71 ? 6.452   5.625   2.966   1.00 0.00 ? 70 PHE A HE2  2  
ATOM 4052  H HZ   . PHE A 1 71 ? 4.311   4.468   2.500   1.00 0.00 ? 70 PHE A HZ   2  
ATOM 4053  N N    . GLN A 1 72 ? 5.909   6.017   -4.220  1.00 0.00 ? 71 GLN A N    2  
ATOM 4054  C CA   . GLN A 1 72 ? 4.890   5.263   -5.001  1.00 0.00 ? 71 GLN A CA   2  
ATOM 4055  C C    . GLN A 1 72 ? 5.485   3.914   -5.413  1.00 0.00 ? 71 GLN A C    2  
ATOM 4056  O O    . GLN A 1 72 ? 4.811   2.903   -5.417  1.00 0.00 ? 71 GLN A O    2  
ATOM 4057  C CB   . GLN A 1 72 ? 4.510   6.062   -6.250  1.00 0.00 ? 71 GLN A CB   2  
ATOM 4058  C CG   . GLN A 1 72 ? 3.298   5.415   -6.924  1.00 0.00 ? 71 GLN A CG   2  
ATOM 4059  C CD   . GLN A 1 72 ? 3.039   6.095   -8.269  1.00 0.00 ? 71 GLN A CD   2  
ATOM 4060  O OE1  . GLN A 1 72 ? 3.964   6.470   -8.961  1.00 0.00 ? 71 GLN A OE1  2  
ATOM 4061  N NE2  . GLN A 1 72 ? 1.810   6.272   -8.671  1.00 0.00 ? 71 GLN A NE2  2  
ATOM 4062  H H    . GLN A 1 72 ? 6.173   6.920   -4.494  1.00 0.00 ? 71 GLN A H    2  
ATOM 4063  H HA   . GLN A 1 72 ? 4.015   5.105   -4.388  1.00 0.00 ? 71 GLN A HA   2  
ATOM 4064  H HB2  . GLN A 1 72 ? 4.266   7.076   -5.967  1.00 0.00 ? 71 GLN A HB2  2  
ATOM 4065  H HB3  . GLN A 1 72 ? 5.341   6.070   -6.939  1.00 0.00 ? 71 GLN A HB3  2  
ATOM 4066  H HG2  . GLN A 1 72 ? 3.493   4.364   -7.082  1.00 0.00 ? 71 GLN A HG2  2  
ATOM 4067  H HG3  . GLN A 1 72 ? 2.430   5.529   -6.292  1.00 0.00 ? 71 GLN A HG3  2  
ATOM 4068  H HE21 . GLN A 1 72 ? 1.064   5.970   -8.113  1.00 0.00 ? 71 GLN A HE21 2  
ATOM 4069  H HE22 . GLN A 1 72 ? 1.634   6.706   -9.532  1.00 0.00 ? 71 GLN A HE22 2  
ATOM 4070  N N    . GLU A 1 73 ? 6.746   3.889   -5.750  1.00 0.00 ? 72 GLU A N    2  
ATOM 4071  C CA   . GLU A 1 73 ? 7.388   2.604   -6.150  1.00 0.00 ? 72 GLU A CA   2  
ATOM 4072  C C    . GLU A 1 73 ? 7.582   1.715   -4.917  1.00 0.00 ? 72 GLU A C    2  
ATOM 4073  O O    . GLU A 1 73 ? 7.599   0.506   -5.006  1.00 0.00 ? 72 GLU A O    2  
ATOM 4074  C CB   . GLU A 1 73 ? 8.739   2.881   -6.812  1.00 0.00 ? 72 GLU A CB   2  
ATOM 4075  C CG   . GLU A 1 73 ? 8.595   4.039   -7.803  1.00 0.00 ? 72 GLU A CG   2  
ATOM 4076  C CD   . GLU A 1 73 ? 9.861   4.143   -8.654  1.00 0.00 ? 72 GLU A CD   2  
ATOM 4077  O OE1  . GLU A 1 73 ? 10.822  3.464   -8.335  1.00 0.00 ? 72 GLU A OE1  2  
ATOM 4078  O OE2  . GLU A 1 73 ? 9.848   4.901   -9.611  1.00 0.00 ? 72 GLU A OE2  2  
ATOM 4079  H H    . GLU A 1 73 ? 7.273   4.714   -5.732  1.00 0.00 ? 72 GLU A H    2  
ATOM 4080  H HA   . GLU A 1 73 ? 6.743   2.082   -6.841  1.00 0.00 ? 72 GLU A HA   2  
ATOM 4081  H HB2  . GLU A 1 73 ? 9.464   3.142   -6.055  1.00 0.00 ? 72 GLU A HB2  2  
ATOM 4082  H HB3  . GLU A 1 73 ? 9.070   1.999   -7.339  1.00 0.00 ? 72 GLU A HB3  2  
ATOM 4083  H HG2  . GLU A 1 73 ? 7.742   3.860   -8.442  1.00 0.00 ? 72 GLU A HG2  2  
ATOM 4084  H HG3  . GLU A 1 73 ? 8.451   4.961   -7.260  1.00 0.00 ? 72 GLU A HG3  2  
ATOM 4085  N N    . PHE A 1 74 ? 7.680   2.306   -3.758  1.00 0.00 ? 73 PHE A N    2  
ATOM 4086  C CA   . PHE A 1 74 ? 7.824   1.499   -2.510  1.00 0.00 ? 73 PHE A CA   2  
ATOM 4087  C C    . PHE A 1 74 ? 6.466   0.883   -2.168  1.00 0.00 ? 73 PHE A C    2  
ATOM 4088  O O    . PHE A 1 74 ? 6.391   -0.252  -1.748  1.00 0.00 ? 73 PHE A O    2  
ATOM 4089  C CB   . PHE A 1 74 ? 8.331   2.385   -1.365  1.00 0.00 ? 73 PHE A CB   2  
ATOM 4090  C CG   . PHE A 1 74 ? 8.231   1.650   -0.046  1.00 0.00 ? 73 PHE A CG   2  
ATOM 4091  C CD1  . PHE A 1 74 ? 9.195   0.694   0.300   1.00 0.00 ? 73 PHE A CD1  2  
ATOM 4092  C CD2  . PHE A 1 74 ? 7.180   1.934   0.836   1.00 0.00 ? 73 PHE A CD2  2  
ATOM 4093  C CE1  . PHE A 1 74 ? 9.105   0.022   1.526   1.00 0.00 ? 73 PHE A CE1  2  
ATOM 4094  C CE2  . PHE A 1 74 ? 7.092   1.262   2.062   1.00 0.00 ? 73 PHE A CE2  2  
ATOM 4095  C CZ   . PHE A 1 74 ? 8.055   0.306   2.407   1.00 0.00 ? 73 PHE A CZ   2  
ATOM 4096  H H    . PHE A 1 74 ? 7.605   3.281   -3.701  1.00 0.00 ? 73 PHE A H    2  
ATOM 4097  H HA   . PHE A 1 74 ? 8.479   0.653   -2.653  1.00 0.00 ? 73 PHE A HA   2  
ATOM 4098  H HB2  . PHE A 1 74 ? 9.363   2.648   -1.548  1.00 0.00 ? 73 PHE A HB2  2  
ATOM 4099  H HB3  . PHE A 1 74 ? 7.737   3.286   -1.319  1.00 0.00 ? 73 PHE A HB3  2  
ATOM 4100  H HD1  . PHE A 1 74 ? 10.005  0.474   -0.379  1.00 0.00 ? 73 PHE A HD1  2  
ATOM 4101  H HD2  . PHE A 1 74 ? 6.437   2.671   0.570   1.00 0.00 ? 73 PHE A HD2  2  
ATOM 4102  H HE1  . PHE A 1 74 ? 9.848   -0.716  1.792   1.00 0.00 ? 73 PHE A HE1  2  
ATOM 4103  H HE2  . PHE A 1 74 ? 6.281   1.482   2.740   1.00 0.00 ? 73 PHE A HE2  2  
ATOM 4104  H HZ   . PHE A 1 74 ? 7.988   -0.211  3.353   1.00 0.00 ? 73 PHE A HZ   2  
ATOM 4105  N N    . MET A 1 75 ? 5.394   1.588   -2.355  1.00 0.00 ? 74 MET A N    2  
ATOM 4106  C CA   . MET A 1 75 ? 4.075   0.971   -2.041  1.00 0.00 ? 74 MET A CA   2  
ATOM 4107  C C    . MET A 1 75 ? 3.794   -0.142  -3.064  1.00 0.00 ? 74 MET A C    2  
ATOM 4108  O O    . MET A 1 75 ? 3.502   -1.261  -2.690  1.00 0.00 ? 74 MET A O    2  
ATOM 4109  C CB   . MET A 1 75 ? 2.969   2.037   -2.085  1.00 0.00 ? 74 MET A CB   2  
ATOM 4110  C CG   . MET A 1 75 ? 1.790   1.608   -1.201  1.00 0.00 ? 74 MET A CG   2  
ATOM 4111  S SD   . MET A 1 75 ? 2.180   1.969   0.535   1.00 0.00 ? 74 MET A SD   2  
ATOM 4112  C CE   . MET A 1 75 ? 2.116   0.275   1.177   1.00 0.00 ? 74 MET A CE   2  
ATOM 4113  H H    . MET A 1 75 ? 5.448   2.500   -2.712  1.00 0.00 ? 74 MET A H    2  
ATOM 4114  H HA   . MET A 1 75 ? 4.117   0.516   -1.062  1.00 0.00 ? 74 MET A HA   2  
ATOM 4115  H HB2  . MET A 1 75 ? 3.364   2.975   -1.723  1.00 0.00 ? 74 MET A HB2  2  
ATOM 4116  H HB3  . MET A 1 75 ? 2.626   2.164   -3.102  1.00 0.00 ? 74 MET A HB3  2  
ATOM 4117  H HG2  . MET A 1 75 ? 0.907   2.158   -1.493  1.00 0.00 ? 74 MET A HG2  2  
ATOM 4118  H HG3  . MET A 1 75 ? 1.611   0.551   -1.326  1.00 0.00 ? 74 MET A HG3  2  
ATOM 4119  H HE1  . MET A 1 75 ? 1.195   -0.195  0.859   1.00 0.00 ? 74 MET A HE1  2  
ATOM 4120  H HE2  . MET A 1 75 ? 2.953   -0.288  0.799   1.00 0.00 ? 74 MET A HE2  2  
ATOM 4121  H HE3  . MET A 1 75 ? 2.160   0.299   2.257   1.00 0.00 ? 74 MET A HE3  2  
ATOM 4122  N N    . ALA A 1 76 ? 3.868   0.126   -4.338  1.00 0.00 ? 75 ALA A N    2  
ATOM 4123  C CA   . ALA A 1 76 ? 3.593   -0.945  -5.342  1.00 0.00 ? 75 ALA A CA   2  
ATOM 4124  C C    . ALA A 1 76 ? 4.526   -2.147  -5.152  1.00 0.00 ? 75 ALA A C    2  
ATOM 4125  O O    . ALA A 1 76 ? 4.074   -3.270  -5.057  1.00 0.00 ? 75 ALA A O    2  
ATOM 4126  C CB   . ALA A 1 76 ? 3.794   -0.375  -6.747  1.00 0.00 ? 75 ALA A CB   2  
ATOM 4127  H H    . ALA A 1 76 ? 4.092   1.022   -4.668  1.00 0.00 ? 75 ALA A H    2  
ATOM 4128  H HA   . ALA A 1 76 ? 2.580   -1.307  -5.254  1.00 0.00 ? 75 ALA A HA   2  
ATOM 4129  H HB1  . ALA A 1 76 ? 3.144   0.476   -6.887  1.00 0.00 ? 75 ALA A HB1  2  
ATOM 4130  H HB2  . ALA A 1 76 ? 4.823   -0.066  -6.866  1.00 0.00 ? 75 ALA A HB2  2  
ATOM 4131  H HB3  . ALA A 1 76 ? 3.559   -1.132  -7.480  1.00 0.00 ? 75 ALA A HB3  2  
ATOM 4132  N N    . PHE A 1 77 ? 5.813   -1.946  -5.118  1.00 0.00 ? 76 PHE A N    2  
ATOM 4133  C CA   . PHE A 1 77 ? 6.724   -3.124  -4.961  1.00 0.00 ? 76 PHE A CA   2  
ATOM 4134  C C    . PHE A 1 77 ? 6.450   -3.815  -3.619  1.00 0.00 ? 76 PHE A C    2  
ATOM 4135  O O    . PHE A 1 77 ? 6.553   -5.020  -3.499  1.00 0.00 ? 76 PHE A O    2  
ATOM 4136  C CB   . PHE A 1 77 ? 8.199   -2.673  -5.037  1.00 0.00 ? 76 PHE A CB   2  
ATOM 4137  C CG   . PHE A 1 77 ? 8.653   -2.622  -6.487  1.00 0.00 ? 76 PHE A CG   2  
ATOM 4138  C CD1  . PHE A 1 77 ? 8.645   -3.789  -7.266  1.00 0.00 ? 76 PHE A CD1  2  
ATOM 4139  C CD2  . PHE A 1 77 ? 9.071   -1.410  -7.055  1.00 0.00 ? 76 PHE A CD2  2  
ATOM 4140  C CE1  . PHE A 1 77 ? 9.053   -3.741  -8.603  1.00 0.00 ? 76 PHE A CE1  2  
ATOM 4141  C CE2  . PHE A 1 77 ? 9.481   -1.366  -8.392  1.00 0.00 ? 76 PHE A CE2  2  
ATOM 4142  C CZ   . PHE A 1 77 ? 9.470   -2.531  -9.167  1.00 0.00 ? 76 PHE A CZ   2  
ATOM 4143  H H    . PHE A 1 77 ? 6.177   -1.039  -5.212  1.00 0.00 ? 76 PHE A H    2  
ATOM 4144  H HA   . PHE A 1 77 ? 6.518   -3.822  -5.758  1.00 0.00 ? 76 PHE A HA   2  
ATOM 4145  H HB2  . PHE A 1 77 ? 8.298   -1.695  -4.592  1.00 0.00 ? 76 PHE A HB2  2  
ATOM 4146  H HB3  . PHE A 1 77 ? 8.822   -3.374  -4.497  1.00 0.00 ? 76 PHE A HB3  2  
ATOM 4147  H HD1  . PHE A 1 77 ? 8.330   -4.727  -6.835  1.00 0.00 ? 76 PHE A HD1  2  
ATOM 4148  H HD2  . PHE A 1 77 ? 9.084   -0.512  -6.461  1.00 0.00 ? 76 PHE A HD2  2  
ATOM 4149  H HE1  . PHE A 1 77 ? 9.044   -4.640  -9.201  1.00 0.00 ? 76 PHE A HE1  2  
ATOM 4150  H HE2  . PHE A 1 77 ? 9.803   -0.432  -8.828  1.00 0.00 ? 76 PHE A HE2  2  
ATOM 4151  H HZ   . PHE A 1 77 ? 9.783   -2.495  -10.199 1.00 0.00 ? 76 PHE A HZ   2  
ATOM 4152  N N    . VAL A 1 78 ? 6.095   -3.066  -2.619  1.00 0.00 ? 77 VAL A N    2  
ATOM 4153  C CA   . VAL A 1 78 ? 5.807   -3.690  -1.295  1.00 0.00 ? 77 VAL A CA   2  
ATOM 4154  C C    . VAL A 1 78 ? 4.527   -4.528  -1.404  1.00 0.00 ? 77 VAL A C    2  
ATOM 4155  O O    . VAL A 1 78 ? 4.390   -5.553  -0.767  1.00 0.00 ? 77 VAL A O    2  
ATOM 4156  C CB   . VAL A 1 78 ? 5.635   -2.585  -0.241  1.00 0.00 ? 77 VAL A CB   2  
ATOM 4157  C CG1  . VAL A 1 78 ? 4.982   -3.158  1.025   1.00 0.00 ? 77 VAL A CG1  2  
ATOM 4158  C CG2  . VAL A 1 78 ? 7.013   -1.999  0.113   1.00 0.00 ? 77 VAL A CG2  2  
ATOM 4159  H H    . VAL A 1 78 ? 6.007   -2.096  -2.742  1.00 0.00 ? 77 VAL A H    2  
ATOM 4160  H HA   . VAL A 1 78 ? 6.630   -4.330  -1.014  1.00 0.00 ? 77 VAL A HA   2  
ATOM 4161  H HB   . VAL A 1 78 ? 5.006   -1.805  -0.643  1.00 0.00 ? 77 VAL A HB   2  
ATOM 4162  H HG11 . VAL A 1 78 ? 5.454   -4.095  1.281   1.00 0.00 ? 77 VAL A HG11 2  
ATOM 4163  H HG12 . VAL A 1 78 ? 5.102   -2.460  1.840   1.00 0.00 ? 77 VAL A HG12 2  
ATOM 4164  H HG13 . VAL A 1 78 ? 3.930   -3.323  0.844   1.00 0.00 ? 77 VAL A HG13 2  
ATOM 4165  H HG21 . VAL A 1 78 ? 7.635   -1.963  -0.771  1.00 0.00 ? 77 VAL A HG21 2  
ATOM 4166  H HG22 . VAL A 1 78 ? 6.886   -1.001  0.500   1.00 0.00 ? 77 VAL A HG22 2  
ATOM 4167  H HG23 . VAL A 1 78 ? 7.492   -2.616  0.862   1.00 0.00 ? 77 VAL A HG23 2  
ATOM 4168  N N    . SER A 1 79 ? 3.591   -4.102  -2.207  1.00 0.00 ? 78 SER A N    2  
ATOM 4169  C CA   . SER A 1 79 ? 2.326   -4.876  -2.354  1.00 0.00 ? 78 SER A CA   2  
ATOM 4170  C C    . SER A 1 79 ? 2.622   -6.235  -2.999  1.00 0.00 ? 78 SER A C    2  
ATOM 4171  O O    . SER A 1 79 ? 2.136   -7.256  -2.556  1.00 0.00 ? 78 SER A O    2  
ATOM 4172  C CB   . SER A 1 79 ? 1.356   -4.095  -3.241  1.00 0.00 ? 78 SER A CB   2  
ATOM 4173  O OG   . SER A 1 79 ? 0.054   -4.653  -3.119  1.00 0.00 ? 78 SER A OG   2  
ATOM 4174  H H    . SER A 1 79 ? 3.720   -3.273  -2.714  1.00 0.00 ? 78 SER A H    2  
ATOM 4175  H HA   . SER A 1 79 ? 1.880   -5.028  -1.382  1.00 0.00 ? 78 SER A HA   2  
ATOM 4176  H HB2  . SER A 1 79 ? 1.330   -3.064  -2.929  1.00 0.00 ? 78 SER A HB2  2  
ATOM 4177  H HB3  . SER A 1 79 ? 1.687   -4.149  -4.270  1.00 0.00 ? 78 SER A HB3  2  
ATOM 4178  H HG   . SER A 1 79 ? -0.388  -4.560  -3.965  1.00 0.00 ? 78 SER A HG   2  
ATOM 4179  N N    . MET A 1 80 ? 3.393   -6.259  -4.051  1.00 0.00 ? 79 MET A N    2  
ATOM 4180  C CA   . MET A 1 80 ? 3.690   -7.555  -4.727  1.00 0.00 ? 79 MET A CA   2  
ATOM 4181  C C    . MET A 1 80 ? 4.277   -8.552  -3.730  1.00 0.00 ? 79 MET A C    2  
ATOM 4182  O O    . MET A 1 80 ? 3.799   -9.658  -3.592  1.00 0.00 ? 79 MET A O    2  
ATOM 4183  C CB   . MET A 1 80 ? 4.699   -7.317  -5.855  1.00 0.00 ? 79 MET A CB   2  
ATOM 4184  C CG   . MET A 1 80 ? 4.010   -6.620  -7.033  1.00 0.00 ? 79 MET A CG   2  
ATOM 4185  S SD   . MET A 1 80 ? 3.110   -7.845  -8.014  1.00 0.00 ? 79 MET A SD   2  
ATOM 4186  C CE   . MET A 1 80 ? 4.480   -8.322  -9.097  1.00 0.00 ? 79 MET A CE   2  
ATOM 4187  H H    . MET A 1 80 ? 3.763   -5.432  -4.421  1.00 0.00 ? 79 MET A H    2  
ATOM 4188  H HA   . MET A 1 80 ? 2.780   -7.960  -5.142  1.00 0.00 ? 79 MET A HA   2  
ATOM 4189  H HB2  . MET A 1 80 ? 5.504   -6.696  -5.491  1.00 0.00 ? 79 MET A HB2  2  
ATOM 4190  H HB3  . MET A 1 80 ? 5.097   -8.265  -6.186  1.00 0.00 ? 79 MET A HB3  2  
ATOM 4191  H HG2  . MET A 1 80 ? 3.319   -5.875  -6.662  1.00 0.00 ? 79 MET A HG2  2  
ATOM 4192  H HG3  . MET A 1 80 ? 4.755   -6.141  -7.651  1.00 0.00 ? 79 MET A HG3  2  
ATOM 4193  H HE1  . MET A 1 80 ? 5.374   -8.466  -8.505  1.00 0.00 ? 79 MET A HE1  2  
ATOM 4194  H HE2  . MET A 1 80 ? 4.236   -9.242  -9.604  1.00 0.00 ? 79 MET A HE2  2  
ATOM 4195  H HE3  . MET A 1 80 ? 4.648   -7.544  -9.829  1.00 0.00 ? 79 MET A HE3  2  
ATOM 4196  N N    . VAL A 1 81 ? 5.321   -8.180  -3.049  1.00 0.00 ? 80 VAL A N    2  
ATOM 4197  C CA   . VAL A 1 81 ? 5.943   -9.130  -2.080  1.00 0.00 ? 80 VAL A CA   2  
ATOM 4198  C C    . VAL A 1 81 ? 4.881   -9.619  -1.092  1.00 0.00 ? 80 VAL A C    2  
ATOM 4199  O O    . VAL A 1 81 ? 4.861   -10.772 -0.711  1.00 0.00 ? 80 VAL A O    2  
ATOM 4200  C CB   . VAL A 1 81 ? 7.063   -8.427  -1.307  1.00 0.00 ? 80 VAL A CB   2  
ATOM 4201  C CG1  . VAL A 1 81 ? 7.627   -9.380  -0.251  1.00 0.00 ? 80 VAL A CG1  2  
ATOM 4202  C CG2  . VAL A 1 81 ? 8.180   -8.025  -2.272  1.00 0.00 ? 80 VAL A CG2  2  
ATOM 4203  H H    . VAL A 1 81 ? 5.703   -7.286  -3.191  1.00 0.00 ? 80 VAL A H    2  
ATOM 4204  H HA   . VAL A 1 81 ? 6.353   -9.968  -2.628  1.00 0.00 ? 80 VAL A HA   2  
ATOM 4205  H HB   . VAL A 1 81 ? 6.668   -7.546  -0.822  1.00 0.00 ? 80 VAL A HB   2  
ATOM 4206  H HG11 . VAL A 1 81 ? 7.824   -10.341 -0.703  1.00 0.00 ? 80 VAL A HG11 2  
ATOM 4207  H HG12 . VAL A 1 81 ? 8.546   -8.974  0.146   1.00 0.00 ? 80 VAL A HG12 2  
ATOM 4208  H HG13 . VAL A 1 81 ? 6.910   -9.498  0.548   1.00 0.00 ? 80 VAL A HG13 2  
ATOM 4209  H HG21 . VAL A 1 81 ? 8.554   -8.904  -2.774  1.00 0.00 ? 80 VAL A HG21 2  
ATOM 4210  H HG22 . VAL A 1 81 ? 7.794   -7.329  -3.001  1.00 0.00 ? 80 VAL A HG22 2  
ATOM 4211  H HG23 . VAL A 1 81 ? 8.983   -7.558  -1.718  1.00 0.00 ? 80 VAL A HG23 2  
ATOM 4212  N N    . THR A 1 82 ? 3.991   -8.758  -0.686  1.00 0.00 ? 81 THR A N    2  
ATOM 4213  C CA   . THR A 1 82 ? 2.926   -9.185  0.263   1.00 0.00 ? 81 THR A CA   2  
ATOM 4214  C C    . THR A 1 82 ? 1.976   -10.146 -0.457  1.00 0.00 ? 81 THR A C    2  
ATOM 4215  O O    . THR A 1 82 ? 1.685   -11.225 0.019   1.00 0.00 ? 81 THR A O    2  
ATOM 4216  C CB   . THR A 1 82 ? 2.148   -7.956  0.743   1.00 0.00 ? 81 THR A CB   2  
ATOM 4217  O OG1  . THR A 1 82 ? 3.063   -6.927  1.094   1.00 0.00 ? 81 THR A OG1  2  
ATOM 4218  C CG2  . THR A 1 82 ? 1.303   -8.327  1.961   1.00 0.00 ? 81 THR A CG2  2  
ATOM 4219  H H    . THR A 1 82 ? 4.016   -7.834  -1.011  1.00 0.00 ? 81 THR A H    2  
ATOM 4220  H HA   . THR A 1 82 ? 3.373   -9.684  1.110   1.00 0.00 ? 81 THR A HA   2  
ATOM 4221  H HB   . THR A 1 82 ? 1.501   -7.608  -0.047  1.00 0.00 ? 81 THR A HB   2  
ATOM 4222  H HG1  . THR A 1 82 ? 2.555   -6.158  1.362   1.00 0.00 ? 81 THR A HG1  2  
ATOM 4223  H HG21 . THR A 1 82 ? 0.756   -9.235  1.757   1.00 0.00 ? 81 THR A HG21 2  
ATOM 4224  H HG22 . THR A 1 82 ? 1.948   -8.479  2.813   1.00 0.00 ? 81 THR A HG22 2  
ATOM 4225  H HG23 . THR A 1 82 ? 0.609   -7.527  2.174   1.00 0.00 ? 81 THR A HG23 2  
ATOM 4226  N N    . THR A 1 83 ? 1.498   -9.758  -1.608  1.00 0.00 ? 82 THR A N    2  
ATOM 4227  C CA   . THR A 1 83 ? 0.572   -10.638 -2.377  1.00 0.00 ? 82 THR A CA   2  
ATOM 4228  C C    . THR A 1 83 ? 1.351   -11.818 -2.965  1.00 0.00 ? 82 THR A C    2  
ATOM 4229  O O    . THR A 1 83 ? 0.783   -12.827 -3.332  1.00 0.00 ? 82 THR A O    2  
ATOM 4230  C CB   . THR A 1 83 ? -0.071  -9.837  -3.512  1.00 0.00 ? 82 THR A CB   2  
ATOM 4231  O OG1  . THR A 1 83 ? 0.947   -9.231  -4.295  1.00 0.00 ? 82 THR A OG1  2  
ATOM 4232  C CG2  . THR A 1 83 ? -0.981  -8.756  -2.924  1.00 0.00 ? 82 THR A CG2  2  
ATOM 4233  H H    . THR A 1 83 ? 1.754   -8.884  -1.971  1.00 0.00 ? 82 THR A H    2  
ATOM 4234  H HA   . THR A 1 83 ? -0.199  -11.009 -1.719  1.00 0.00 ? 82 THR A HA   2  
ATOM 4235  H HB   . THR A 1 83 ? -0.658  -10.497 -4.131  1.00 0.00 ? 82 THR A HB   2  
ATOM 4236  H HG1  . THR A 1 83 ? 1.477   -9.931  -4.684  1.00 0.00 ? 82 THR A HG1  2  
ATOM 4237  H HG21 . THR A 1 83 ? -1.644  -9.200  -2.198  1.00 0.00 ? 82 THR A HG21 2  
ATOM 4238  H HG22 . THR A 1 83 ? -0.378  -7.998  -2.446  1.00 0.00 ? 82 THR A HG22 2  
ATOM 4239  H HG23 . THR A 1 83 ? -1.563  -8.306  -3.716  1.00 0.00 ? 82 THR A HG23 2  
ATOM 4240  N N    . ALA A 1 84 ? 2.648   -11.700 -3.056  1.00 0.00 ? 83 ALA A N    2  
ATOM 4241  C CA   . ALA A 1 84 ? 3.459   -12.816 -3.618  1.00 0.00 ? 83 ALA A CA   2  
ATOM 4242  C C    . ALA A 1 84 ? 3.161   -14.094 -2.835  1.00 0.00 ? 83 ALA A C    2  
ATOM 4243  O O    . ALA A 1 84 ? 3.288   -15.191 -3.342  1.00 0.00 ? 83 ALA A O    2  
ATOM 4244  C CB   . ALA A 1 84 ? 4.947   -12.478 -3.500  1.00 0.00 ? 83 ALA A CB   2  
ATOM 4245  H H    . ALA A 1 84 ? 3.087   -10.881 -2.744  1.00 0.00 ? 83 ALA A H    2  
ATOM 4246  H HA   . ALA A 1 84 ? 3.203   -12.961 -4.658  1.00 0.00 ? 83 ALA A HA   2  
ATOM 4247  H HB1  . ALA A 1 84 ? 5.149   -11.557 -4.026  1.00 0.00 ? 83 ALA A HB1  2  
ATOM 4248  H HB2  . ALA A 1 84 ? 5.208   -12.363 -2.458  1.00 0.00 ? 83 ALA A HB2  2  
ATOM 4249  H HB3  . ALA A 1 84 ? 5.533   -13.276 -3.931  1.00 0.00 ? 83 ALA A HB3  2  
ATOM 4250  N N    . CYS A 1 85 ? 2.758   -13.958 -1.603  1.00 0.00 ? 84 CYS A N    2  
ATOM 4251  C CA   . CYS A 1 85 ? 2.440   -15.162 -0.786  1.00 0.00 ? 84 CYS A CA   2  
ATOM 4252  C C    . CYS A 1 85 ? 1.097   -15.733 -1.241  1.00 0.00 ? 84 CYS A C    2  
ATOM 4253  O O    . CYS A 1 85 ? 0.245   -15.017 -1.730  1.00 0.00 ? 84 CYS A O    2  
ATOM 4254  C CB   . CYS A 1 85 ? 2.354   -14.767 0.689   1.00 0.00 ? 84 CYS A CB   2  
ATOM 4255  S SG   . CYS A 1 85 ? 1.917   -16.219 1.678   1.00 0.00 ? 84 CYS A SG   2  
ATOM 4256  H H    . CYS A 1 85 ? 2.658   -13.062 -1.217  1.00 0.00 ? 84 CYS A H    2  
ATOM 4257  H HA   . CYS A 1 85 ? 3.214   -15.904 -0.918  1.00 0.00 ? 84 CYS A HA   2  
ATOM 4258  H HB2  . CYS A 1 85 ? 3.308   -14.383 1.016   1.00 0.00 ? 84 CYS A HB2  2  
ATOM 4259  H HB3  . CYS A 1 85 ? 1.597   -14.006 0.814   1.00 0.00 ? 84 CYS A HB3  2  
ATOM 4260  H HG   . CYS A 1 85 ? 2.618   -16.866 1.581   1.00 0.00 ? 84 CYS A HG   2  
ATOM 4261  N N    . HIS A 1 86 ? 0.897   -17.014 -1.090  1.00 0.00 ? 85 HIS A N    2  
ATOM 4262  C CA   . HIS A 1 86 ? -0.397  -17.616 -1.519  1.00 0.00 ? 85 HIS A CA   2  
ATOM 4263  C C    . HIS A 1 86 ? -1.553  -16.799 -0.937  1.00 0.00 ? 85 HIS A C    2  
ATOM 4264  O O    . HIS A 1 86 ? -1.346  -15.848 -0.210  1.00 0.00 ? 85 HIS A O    2  
ATOM 4265  C CB   . HIS A 1 86 ? -0.483  -19.062 -1.023  1.00 0.00 ? 85 HIS A CB   2  
ATOM 4266  C CG   . HIS A 1 86 ? -0.507  -19.083 0.481   1.00 0.00 ? 85 HIS A CG   2  
ATOM 4267  N ND1  . HIS A 1 86 ? 0.582   -18.691 1.245   1.00 0.00 ? 85 HIS A ND1  2  
ATOM 4268  C CD2  . HIS A 1 86 ? -1.480  -19.451 1.377   1.00 0.00 ? 85 HIS A CD2  2  
ATOM 4269  C CE1  . HIS A 1 86 ? 0.242   -18.832 2.539   1.00 0.00 ? 85 HIS A CE1  2  
ATOM 4270  N NE2  . HIS A 1 86 ? -1.005  -19.292 2.676   1.00 0.00 ? 85 HIS A NE2  2  
ATOM 4271  H H    . HIS A 1 86 ? 1.595   -17.578 -0.696  1.00 0.00 ? 85 HIS A H    2  
ATOM 4272  H HA   . HIS A 1 86 ? -0.458  -17.602 -2.598  1.00 0.00 ? 85 HIS A HA   2  
ATOM 4273  H HB2  . HIS A 1 86 ? -1.385  -19.519 -1.404  1.00 0.00 ? 85 HIS A HB2  2  
ATOM 4274  H HB3  . HIS A 1 86 ? 0.375   -19.613 -1.377  1.00 0.00 ? 85 HIS A HB3  2  
ATOM 4275  H HD1  . HIS A 1 86 ? 1.443   -18.371 0.904   1.00 0.00 ? 85 HIS A HD1  2  
ATOM 4276  H HD2  . HIS A 1 86 ? -2.464  -19.808 1.114   1.00 0.00 ? 85 HIS A HD2  2  
ATOM 4277  H HE1  . HIS A 1 86 ? 0.896   -18.600 3.366   1.00 0.00 ? 85 HIS A HE1  2  
ATOM 4278  N N    . GLU A 1 87 ? -2.768  -17.159 -1.254  1.00 0.00 ? 86 GLU A N    2  
ATOM 4279  C CA   . GLU A 1 87 ? -3.939  -16.399 -0.724  1.00 0.00 ? 86 GLU A CA   2  
ATOM 4280  C C    . GLU A 1 87 ? -3.747  -16.127 0.771   1.00 0.00 ? 86 GLU A C    2  
ATOM 4281  O O    . GLU A 1 87 ? -3.973  -16.984 1.602   1.00 0.00 ? 86 GLU A O    2  
ATOM 4282  C CB   . GLU A 1 87 ? -5.214  -17.219 -0.936  1.00 0.00 ? 86 GLU A CB   2  
ATOM 4283  C CG   . GLU A 1 87 ? -5.361  -17.561 -2.421  1.00 0.00 ? 86 GLU A CG   2  
ATOM 4284  C CD   . GLU A 1 87 ? -5.582  -16.277 -3.221  1.00 0.00 ? 86 GLU A CD   2  
ATOM 4285  O OE1  . GLU A 1 87 ? -6.274  -15.404 -2.723  1.00 0.00 ? 86 GLU A OE1  2  
ATOM 4286  O OE2  . GLU A 1 87 ? -5.056  -16.187 -4.318  1.00 0.00 ? 86 GLU A OE2  2  
ATOM 4287  H H    . GLU A 1 87 ? -2.911  -17.927 -1.845  1.00 0.00 ? 86 GLU A H    2  
ATOM 4288  H HA   . GLU A 1 87 ? -4.025  -15.460 -1.251  1.00 0.00 ? 86 GLU A HA   2  
ATOM 4289  H HB2  . GLU A 1 87 ? -5.155  -18.131 -0.359  1.00 0.00 ? 86 GLU A HB2  2  
ATOM 4290  H HB3  . GLU A 1 87 ? -6.069  -16.645 -0.615  1.00 0.00 ? 86 GLU A HB3  2  
ATOM 4291  H HG2  . GLU A 1 87 ? -4.463  -18.053 -2.768  1.00 0.00 ? 86 GLU A HG2  2  
ATOM 4292  H HG3  . GLU A 1 87 ? -6.206  -18.218 -2.557  1.00 0.00 ? 86 GLU A HG3  2  
ATOM 4293  N N    . PHE A 1 88 ? -3.324  -14.941 1.118   1.00 0.00 ? 87 PHE A N    2  
ATOM 4294  C CA   . PHE A 1 88 ? -3.111  -14.620 2.557   1.00 0.00 ? 87 PHE A CA   2  
ATOM 4295  C C    . PHE A 1 88 ? -4.435  -14.742 3.314   1.00 0.00 ? 87 PHE A C    2  
ATOM 4296  O O    . PHE A 1 88 ? -4.456  -14.971 4.507   1.00 0.00 ? 87 PHE A O    2  
ATOM 4297  C CB   . PHE A 1 88 ? -2.556  -13.200 2.700   1.00 0.00 ? 87 PHE A CB   2  
ATOM 4298  C CG   . PHE A 1 88 ? -3.397  -12.230 1.904   1.00 0.00 ? 87 PHE A CG   2  
ATOM 4299  C CD1  . PHE A 1 88 ? -3.175  -12.076 0.530   1.00 0.00 ? 87 PHE A CD1  2  
ATOM 4300  C CD2  . PHE A 1 88 ? -4.390  -11.478 2.542   1.00 0.00 ? 87 PHE A CD2  2  
ATOM 4301  C CE1  . PHE A 1 88 ? -3.948  -11.170 -0.206  1.00 0.00 ? 87 PHE A CE1  2  
ATOM 4302  C CE2  . PHE A 1 88 ? -5.161  -10.570 1.806   1.00 0.00 ? 87 PHE A CE2  2  
ATOM 4303  C CZ   . PHE A 1 88 ? -4.940  -10.416 0.432   1.00 0.00 ? 87 PHE A CZ   2  
ATOM 4304  H H    . PHE A 1 88 ? -3.142  -14.265 0.433   1.00 0.00 ? 87 PHE A H    2  
ATOM 4305  H HA   . PHE A 1 88 ? -2.402  -15.321 2.973   1.00 0.00 ? 87 PHE A HA   2  
ATOM 4306  H HB2  . PHE A 1 88 ? -2.568  -12.914 3.741   1.00 0.00 ? 87 PHE A HB2  2  
ATOM 4307  H HB3  . PHE A 1 88 ? -1.540  -13.176 2.334   1.00 0.00 ? 87 PHE A HB3  2  
ATOM 4308  H HD1  . PHE A 1 88 ? -2.409  -12.657 0.038   1.00 0.00 ? 87 PHE A HD1  2  
ATOM 4309  H HD2  . PHE A 1 88 ? -4.561  -11.597 3.601   1.00 0.00 ? 87 PHE A HD2  2  
ATOM 4310  H HE1  . PHE A 1 88 ? -3.777  -11.051 -1.266  1.00 0.00 ? 87 PHE A HE1  2  
ATOM 4311  H HE2  . PHE A 1 88 ? -5.927  -9.989  2.298   1.00 0.00 ? 87 PHE A HE2  2  
ATOM 4312  H HZ   . PHE A 1 88 ? -5.534  -9.715  -0.135  1.00 0.00 ? 87 PHE A HZ   2  
ATOM 4313  N N    . PHE A 1 89 ? -5.541  -14.601 2.635   1.00 0.00 ? 88 PHE A N    2  
ATOM 4314  C CA   . PHE A 1 89 ? -6.856  -14.721 3.326   1.00 0.00 ? 88 PHE A CA   2  
ATOM 4315  C C    . PHE A 1 89 ? -6.876  -16.018 4.138   1.00 0.00 ? 88 PHE A C    2  
ATOM 4316  O O    . PHE A 1 89 ? -7.388  -16.067 5.240   1.00 0.00 ? 88 PHE A O    2  
ATOM 4317  C CB   . PHE A 1 89 ? -7.983  -14.749 2.293   1.00 0.00 ? 88 PHE A CB   2  
ATOM 4318  C CG   . PHE A 1 89 ? -7.876  -13.537 1.394   1.00 0.00 ? 88 PHE A CG   2  
ATOM 4319  C CD1  . PHE A 1 89 ? -8.092  -12.256 1.919   1.00 0.00 ? 88 PHE A CD1  2  
ATOM 4320  C CD2  . PHE A 1 89 ? -7.567  -13.692 0.036   1.00 0.00 ? 88 PHE A CD2  2  
ATOM 4321  C CE1  . PHE A 1 89 ? -7.999  -11.133 1.088   1.00 0.00 ? 88 PHE A CE1  2  
ATOM 4322  C CE2  . PHE A 1 89 ? -7.473  -12.569 -0.794  1.00 0.00 ? 88 PHE A CE2  2  
ATOM 4323  C CZ   . PHE A 1 89 ? -7.690  -11.290 -0.269  1.00 0.00 ? 88 PHE A CZ   2  
ATOM 4324  H H    . PHE A 1 89 ? -5.507  -14.423 1.672   1.00 0.00 ? 88 PHE A H    2  
ATOM 4325  H HA   . PHE A 1 89 ? -7.000  -13.891 4.000   1.00 0.00 ? 88 PHE A HA   2  
ATOM 4326  H HB2  . PHE A 1 89 ? -7.905  -15.650 1.701   1.00 0.00 ? 88 PHE A HB2  2  
ATOM 4327  H HB3  . PHE A 1 89 ? -8.936  -14.735 2.801   1.00 0.00 ? 88 PHE A HB3  2  
ATOM 4328  H HD1  . PHE A 1 89 ? -8.331  -12.136 2.966   1.00 0.00 ? 88 PHE A HD1  2  
ATOM 4329  H HD2  . PHE A 1 89 ? -7.399  -14.678 -0.370  1.00 0.00 ? 88 PHE A HD2  2  
ATOM 4330  H HE1  . PHE A 1 89 ? -8.165  -10.144 1.493   1.00 0.00 ? 88 PHE A HE1  2  
ATOM 4331  H HE2  . PHE A 1 89 ? -7.233  -12.689 -1.840  1.00 0.00 ? 88 PHE A HE2  2  
ATOM 4332  H HZ   . PHE A 1 89 ? -7.620  -10.424 -0.911  1.00 0.00 ? 88 PHE A HZ   2  
ATOM 4333  N N    . GLU A 1 90 ? -6.316  -17.066 3.602   1.00 0.00 ? 89 GLU A N    2  
ATOM 4334  C CA   . GLU A 1 90 ? -6.290  -18.362 4.336   1.00 0.00 ? 89 GLU A CA   2  
ATOM 4335  C C    . GLU A 1 90 ? -5.086  -18.379 5.279   1.00 0.00 ? 89 GLU A C    2  
ATOM 4336  O O    . GLU A 1 90 ? -4.153  -19.136 5.098   1.00 0.00 ? 89 GLU A O    2  
ATOM 4337  C CB   . GLU A 1 90 ? -6.173  -19.514 3.335   1.00 0.00 ? 89 GLU A CB   2  
ATOM 4338  C CG   . GLU A 1 90 ? -7.524  -19.738 2.652   1.00 0.00 ? 89 GLU A CG   2  
ATOM 4339  C CD   . GLU A 1 90 ? -7.902  -18.493 1.849   1.00 0.00 ? 89 GLU A CD   2  
ATOM 4340  O OE1  . GLU A 1 90 ? -7.229  -18.215 0.871   1.00 0.00 ? 89 GLU A OE1  2  
ATOM 4341  O OE2  . GLU A 1 90 ? -8.859  -17.837 2.227   1.00 0.00 ? 89 GLU A OE2  2  
ATOM 4342  H H    . GLU A 1 90 ? -5.907  -16.998 2.716   1.00 0.00 ? 89 GLU A H    2  
ATOM 4343  H HA   . GLU A 1 90 ? -7.199  -18.472 4.909   1.00 0.00 ? 89 GLU A HA   2  
ATOM 4344  H HB2  . GLU A 1 90 ? -5.428  -19.270 2.591   1.00 0.00 ? 89 GLU A HB2  2  
ATOM 4345  H HB3  . GLU A 1 90 ? -5.881  -20.415 3.854   1.00 0.00 ? 89 GLU A HB3  2  
ATOM 4346  H HG2  . GLU A 1 90 ? -7.455  -20.589 1.989   1.00 0.00 ? 89 GLU A HG2  2  
ATOM 4347  H HG3  . GLU A 1 90 ? -8.279  -19.925 3.400   1.00 0.00 ? 89 GLU A HG3  2  
ATOM 4348  N N    . HIS A 1 91 ? -5.101  -17.549 6.286   1.00 0.00 ? 90 HIS A N    2  
ATOM 4349  C CA   . HIS A 1 91 ? -3.958  -17.516 7.241   1.00 0.00 ? 90 HIS A CA   2  
ATOM 4350  C C    . HIS A 1 91 ? -4.024  -18.735 8.164   1.00 0.00 ? 90 HIS A C    2  
ATOM 4351  O O    . HIS A 1 91 ? -3.681  -18.662 9.327   1.00 0.00 ? 90 HIS A O    2  
ATOM 4352  C CB   . HIS A 1 91 ? -4.029  -16.238 8.079   1.00 0.00 ? 90 HIS A CB   2  
ATOM 4353  C CG   . HIS A 1 91 ? -2.734  -16.053 8.820   1.00 0.00 ? 90 HIS A CG   2  
ATOM 4354  N ND1  . HIS A 1 91 ? -2.689  -15.854 10.191  1.00 0.00 ? 90 HIS A ND1  2  
ATOM 4355  C CD2  . HIS A 1 91 ? -1.428  -16.038 8.395   1.00 0.00 ? 90 HIS A CD2  2  
ATOM 4356  C CE1  . HIS A 1 91 ? -1.395  -15.728 10.539  1.00 0.00 ? 90 HIS A CE1  2  
ATOM 4357  N NE2  . HIS A 1 91 ? -0.584  -15.833 9.483   1.00 0.00 ? 90 HIS A NE2  2  
ATOM 4358  H H    . HIS A 1 91 ? -5.864  -16.946 6.413   1.00 0.00 ? 90 HIS A H    2  
ATOM 4359  H HA   . HIS A 1 91 ? -3.030  -17.534 6.689   1.00 0.00 ? 90 HIS A HA   2  
ATOM 4360  H HB2  . HIS A 1 91 ? -4.196  -15.391 7.430   1.00 0.00 ? 90 HIS A HB2  2  
ATOM 4361  H HB3  . HIS A 1 91 ? -4.840  -16.315 8.787   1.00 0.00 ? 90 HIS A HB3  2  
ATOM 4362  H HD1  . HIS A 1 91 ? -3.458  -15.811 10.795  1.00 0.00 ? 90 HIS A HD1  2  
ATOM 4363  H HD2  . HIS A 1 91 ? -1.105  -16.164 7.372   1.00 0.00 ? 90 HIS A HD2  2  
ATOM 4364  H HE1  . HIS A 1 91 ? -1.054  -15.561 11.550  1.00 0.00 ? 90 HIS A HE1  2  
ATOM 4365  N N    . GLU A 1 92 ? -4.459  -19.857 7.657   1.00 0.00 ? 91 GLU A N    2  
ATOM 4366  C CA   . GLU A 1 92 ? -4.542  -21.076 8.512   1.00 0.00 ? 91 GLU A CA   2  
ATOM 4367  C C    . GLU A 1 92 ? -3.156  -21.717 8.616   1.00 0.00 ? 91 GLU A C    2  
ATOM 4368  O O    . GLU A 1 92 ? -2.691  -21.898 9.729   1.00 0.00 ? 91 GLU A O    2  
ATOM 4369  C CB   . GLU A 1 92 ? -5.520  -22.076 7.889   1.00 0.00 ? 91 GLU A CB   2  
ATOM 4370  C CG   . GLU A 1 92 ? -6.937  -21.498 7.920   1.00 0.00 ? 91 GLU A CG   2  
ATOM 4371  C CD   . GLU A 1 92 ? -7.072  -20.415 6.848   1.00 0.00 ? 91 GLU A CD   2  
ATOM 4372  O OE1  . GLU A 1 92 ? -7.382  -20.762 5.720   1.00 0.00 ? 91 GLU A OE1  2  
ATOM 4373  O OE2  . GLU A 1 92 ? -6.864  -19.258 7.173   1.00 0.00 ? 91 GLU A OE2  2  
ATOM 4374  O OXT  . GLU A 1 92 ? -2.584  -22.016 7.581   1.00 0.00 ? 91 GLU A OXT  2  
ATOM 4375  H H    . GLU A 1 92 ? -4.730  -19.897 6.716   1.00 0.00 ? 91 GLU A H    2  
ATOM 4376  H HA   . GLU A 1 92 ? -4.885  -20.802 9.499   1.00 0.00 ? 91 GLU A HA   2  
ATOM 4377  H HB2  . GLU A 1 92 ? -5.232  -22.271 6.866   1.00 0.00 ? 91 GLU A HB2  2  
ATOM 4378  H HB3  . GLU A 1 92 ? -5.498  -22.998 8.451   1.00 0.00 ? 91 GLU A HB3  2  
ATOM 4379  H HG2  . GLU A 1 92 ? -7.651  -22.287 7.728   1.00 0.00 ? 91 GLU A HG2  2  
ATOM 4380  H HG3  . GLU A 1 92 ? -7.130  -21.067 8.890   1.00 0.00 ? 91 GLU A HG3  2  
ATOM 4381  N N    . MET B 1 1  ? 8.770   -8.196  14.802  1.00 0.00 ? 0  MET B N    2  
ATOM 4382  C CA   . MET B 1 1  ? 7.404   -7.608  14.704  1.00 0.00 ? 0  MET B CA   2  
ATOM 4383  C C    . MET B 1 1  ? 7.492   -6.087  14.844  1.00 0.00 ? 0  MET B C    2  
ATOM 4384  O O    . MET B 1 1  ? 7.006   -5.514  15.798  1.00 0.00 ? 0  MET B O    2  
ATOM 4385  C CB   . MET B 1 1  ? 6.524   -8.172  15.823  1.00 0.00 ? 0  MET B CB   2  
ATOM 4386  C CG   . MET B 1 1  ? 6.357   -9.680  15.635  1.00 0.00 ? 0  MET B CG   2  
ATOM 4387  S SD   . MET B 1 1  ? 5.135   -10.302 16.816  1.00 0.00 ? 0  MET B SD   2  
ATOM 4388  C CE   . MET B 1 1  ? 5.003   -11.976 16.144  1.00 0.00 ? 0  MET B CE   2  
ATOM 4389  H H1   . MET B 1 1  ? 9.443   -7.599  14.278  1.00 0.00 ? 0  MET B H1   2  
ATOM 4390  H H2   . MET B 1 1  ? 9.055   -8.247  15.801  1.00 0.00 ? 0  MET B H2   2  
ATOM 4391  H H3   . MET B 1 1  ? 8.765   -9.153  14.396  1.00 0.00 ? 0  MET B H3   2  
ATOM 4392  H HA   . MET B 1 1  ? 6.973   -7.857  13.746  1.00 0.00 ? 0  MET B HA   2  
ATOM 4393  H HB2  . MET B 1 1  ? 6.989   -7.977  16.779  1.00 0.00 ? 0  MET B HB2  2  
ATOM 4394  H HB3  . MET B 1 1  ? 5.555   -7.698  15.792  1.00 0.00 ? 0  MET B HB3  2  
ATOM 4395  H HG2  . MET B 1 1  ? 6.021   -9.883  14.629  1.00 0.00 ? 0  MET B HG2  2  
ATOM 4396  H HG3  . MET B 1 1  ? 7.304   -10.172 15.803  1.00 0.00 ? 0  MET B HG3  2  
ATOM 4397  H HE1  . MET B 1 1  ? 5.989   -12.339 15.889  1.00 0.00 ? 0  MET B HE1  2  
ATOM 4398  H HE2  . MET B 1 1  ? 4.562   -12.628 16.881  1.00 0.00 ? 0  MET B HE2  2  
ATOM 4399  H HE3  . MET B 1 1  ? 4.380   -11.960 15.261  1.00 0.00 ? 0  MET B HE3  2  
ATOM 4400  N N    . SER B 1 2  ? 8.105   -5.424  13.901  1.00 0.00 ? 1  SER B N    2  
ATOM 4401  C CA   . SER B 1 2  ? 8.212   -3.942  13.994  1.00 0.00 ? 1  SER B CA   2  
ATOM 4402  C C    . SER B 1 2  ? 6.808   -3.339  13.972  1.00 0.00 ? 1  SER B C    2  
ATOM 4403  O O    . SER B 1 2  ? 5.830   -4.028  13.764  1.00 0.00 ? 1  SER B O    2  
ATOM 4404  C CB   . SER B 1 2  ? 9.021   -3.407  12.814  1.00 0.00 ? 1  SER B CB   2  
ATOM 4405  O OG   . SER B 1 2  ? 8.205   -3.406  11.650  1.00 0.00 ? 1  SER B OG   2  
ATOM 4406  H H    . SER B 1 2  ? 8.491   -5.899  13.136  1.00 0.00 ? 1  SER B H    2  
ATOM 4407  H HA   . SER B 1 2  ? 8.699   -3.681  14.922  1.00 0.00 ? 1  SER B HA   2  
ATOM 4408  H HB2  . SER B 1 2  ? 9.343   -2.401  13.023  1.00 0.00 ? 1  SER B HB2  2  
ATOM 4409  H HB3  . SER B 1 2  ? 9.888   -4.036  12.658  1.00 0.00 ? 1  SER B HB3  2  
ATOM 4410  H HG   . SER B 1 2  ? 8.045   -4.318  11.400  1.00 0.00 ? 1  SER B HG   2  
ATOM 4411  N N    . GLU B 1 3  ? 6.697   -2.059  14.194  1.00 0.00 ? 2  GLU B N    2  
ATOM 4412  C CA   . GLU B 1 3  ? 5.351   -1.423  14.194  1.00 0.00 ? 2  GLU B CA   2  
ATOM 4413  C C    . GLU B 1 3  ? 4.716   -1.564  12.809  1.00 0.00 ? 2  GLU B C    2  
ATOM 4414  O O    . GLU B 1 3  ? 3.520   -1.732  12.678  1.00 0.00 ? 2  GLU B O    2  
ATOM 4415  C CB   . GLU B 1 3  ? 5.490   0.061   14.543  1.00 0.00 ? 2  GLU B CB   2  
ATOM 4416  C CG   . GLU B 1 3  ? 5.905   0.202   16.009  1.00 0.00 ? 2  GLU B CG   2  
ATOM 4417  C CD   . GLU B 1 3  ? 4.710   -0.113  16.911  1.00 0.00 ? 2  GLU B CD   2  
ATOM 4418  O OE1  . GLU B 1 3  ? 3.717   0.589   16.812  1.00 0.00 ? 2  GLU B OE1  2  
ATOM 4419  O OE2  . GLU B 1 3  ? 4.808   -1.051  17.685  1.00 0.00 ? 2  GLU B OE2  2  
ATOM 4420  H H    . GLU B 1 3  ? 7.497   -1.519  14.367  1.00 0.00 ? 2  GLU B H    2  
ATOM 4421  H HA   . GLU B 1 3  ? 4.725   -1.907  14.928  1.00 0.00 ? 2  GLU B HA   2  
ATOM 4422  H HB2  . GLU B 1 3  ? 6.241   0.510   13.910  1.00 0.00 ? 2  GLU B HB2  2  
ATOM 4423  H HB3  . GLU B 1 3  ? 4.544   0.557   14.389  1.00 0.00 ? 2  GLU B HB3  2  
ATOM 4424  H HG2  . GLU B 1 3  ? 6.710   -0.486  16.223  1.00 0.00 ? 2  GLU B HG2  2  
ATOM 4425  H HG3  . GLU B 1 3  ? 6.236   1.213   16.194  1.00 0.00 ? 2  GLU B HG3  2  
ATOM 4426  N N    . LEU B 1 4  ? 5.509   -1.489  11.774  1.00 0.00 ? 3  LEU B N    2  
ATOM 4427  C CA   . LEU B 1 4  ? 4.953   -1.609  10.396  1.00 0.00 ? 3  LEU B CA   2  
ATOM 4428  C C    . LEU B 1 4  ? 4.391   -3.022  10.190  1.00 0.00 ? 3  LEU B C    2  
ATOM 4429  O O    . LEU B 1 4  ? 3.293   -3.194  9.701   1.00 0.00 ? 3  LEU B O    2  
ATOM 4430  C CB   . LEU B 1 4  ? 6.069   -1.323  9.370   1.00 0.00 ? 3  LEU B CB   2  
ATOM 4431  C CG   . LEU B 1 4  ? 5.483   -0.673  8.108   1.00 0.00 ? 3  LEU B CG   2  
ATOM 4432  C CD1  . LEU B 1 4  ? 6.610   -0.399  7.111   1.00 0.00 ? 3  LEU B CD1  2  
ATOM 4433  C CD2  . LEU B 1 4  ? 4.453   -1.613  7.471   1.00 0.00 ? 3  LEU B CD2  2  
ATOM 4434  H H    . LEU B 1 4  ? 6.469   -1.340  11.902  1.00 0.00 ? 3  LEU B H    2  
ATOM 4435  H HA   . LEU B 1 4  ? 4.155   -0.890  10.276  1.00 0.00 ? 3  LEU B HA   2  
ATOM 4436  H HB2  . LEU B 1 4  ? 6.790   -0.650  9.810   1.00 0.00 ? 3  LEU B HB2  2  
ATOM 4437  H HB3  . LEU B 1 4  ? 6.565   -2.244  9.098   1.00 0.00 ? 3  LEU B HB3  2  
ATOM 4438  H HG   . LEU B 1 4  ? 5.006   0.260   8.375   1.00 0.00 ? 3  LEU B HG   2  
ATOM 4439  H HD11 . LEU B 1 4  ? 7.429   0.089   7.619   1.00 0.00 ? 3  LEU B HD11 2  
ATOM 4440  H HD12 . LEU B 1 4  ? 6.952   -1.332  6.689   1.00 0.00 ? 3  LEU B HD12 2  
ATOM 4441  H HD13 . LEU B 1 4  ? 6.244   0.241   6.322   1.00 0.00 ? 3  LEU B HD13 2  
ATOM 4442  H HD21 . LEU B 1 4  ? 4.830   -2.625  7.484   1.00 0.00 ? 3  LEU B HD21 2  
ATOM 4443  H HD22 . LEU B 1 4  ? 3.530   -1.565  8.029   1.00 0.00 ? 3  LEU B HD22 2  
ATOM 4444  H HD23 . LEU B 1 4  ? 4.270   -1.310  6.450   1.00 0.00 ? 3  LEU B HD23 2  
ATOM 4445  N N    . GLU B 1 5  ? 5.123   -4.035  10.570  1.00 0.00 ? 4  GLU B N    2  
ATOM 4446  C CA   . GLU B 1 5  ? 4.604   -5.420  10.397  1.00 0.00 ? 4  GLU B CA   2  
ATOM 4447  C C    . GLU B 1 5  ? 3.228   -5.514  11.056  1.00 0.00 ? 4  GLU B C    2  
ATOM 4448  O O    . GLU B 1 5  ? 2.280   -6.011  10.483  1.00 0.00 ? 4  GLU B O    2  
ATOM 4449  C CB   . GLU B 1 5  ? 5.565   -6.413  11.057  1.00 0.00 ? 4  GLU B CB   2  
ATOM 4450  C CG   . GLU B 1 5  ? 6.814   -6.567  10.187  1.00 0.00 ? 4  GLU B CG   2  
ATOM 4451  C CD   . GLU B 1 5  ? 7.879   -7.358  10.949  1.00 0.00 ? 4  GLU B CD   2  
ATOM 4452  O OE1  . GLU B 1 5  ? 8.316   -6.882  11.984  1.00 0.00 ? 4  GLU B OE1  2  
ATOM 4453  O OE2  . GLU B 1 5  ? 8.239   -8.426  10.485  1.00 0.00 ? 4  GLU B OE2  2  
ATOM 4454  H H    . GLU B 1 5  ? 6.002   -3.892  10.977  1.00 0.00 ? 4  GLU B H    2  
ATOM 4455  H HA   . GLU B 1 5  ? 4.517   -5.645  9.345   1.00 0.00 ? 4  GLU B HA   2  
ATOM 4456  H HB2  . GLU B 1 5  ? 5.847   -6.046  12.034  1.00 0.00 ? 4  GLU B HB2  2  
ATOM 4457  H HB3  . GLU B 1 5  ? 5.079   -7.371  11.159  1.00 0.00 ? 4  GLU B HB3  2  
ATOM 4458  H HG2  . GLU B 1 5  ? 6.557   -7.092  9.278   1.00 0.00 ? 4  GLU B HG2  2  
ATOM 4459  H HG3  . GLU B 1 5  ? 7.203   -5.590  9.939   1.00 0.00 ? 4  GLU B HG3  2  
ATOM 4460  N N    . LYS B 1 6  ? 3.119   -5.020  12.258  1.00 0.00 ? 5  LYS B N    2  
ATOM 4461  C CA   . LYS B 1 6  ? 1.814   -5.051  12.973  1.00 0.00 ? 5  LYS B CA   2  
ATOM 4462  C C    . LYS B 1 6  ? 0.718   -4.509  12.055  1.00 0.00 ? 5  LYS B C    2  
ATOM 4463  O O    . LYS B 1 6  ? -0.388  -5.009  12.016  1.00 0.00 ? 5  LYS B O    2  
ATOM 4464  C CB   . LYS B 1 6  ? 1.902   -4.148  14.208  1.00 0.00 ? 5  LYS B CB   2  
ATOM 4465  C CG   . LYS B 1 6  ? 0.681   -4.389  15.105  1.00 0.00 ? 5  LYS B CG   2  
ATOM 4466  C CD   . LYS B 1 6  ? 0.509   -3.216  16.073  1.00 0.00 ? 5  LYS B CD   2  
ATOM 4467  C CE   . LYS B 1 6  ? 1.793   -3.026  16.881  1.00 0.00 ? 5  LYS B CE   2  
ATOM 4468  N NZ   . LYS B 1 6  ? 1.523   -2.123  18.036  1.00 0.00 ? 5  LYS B NZ   2  
ATOM 4469  H H    . LYS B 1 6  ? 3.901   -4.618  12.691  1.00 0.00 ? 5  LYS B H    2  
ATOM 4470  H HA   . LYS B 1 6  ? 1.591   -6.058  13.298  1.00 0.00 ? 5  LYS B HA   2  
ATOM 4471  H HB2  . LYS B 1 6  ? 2.804   -4.377  14.756  1.00 0.00 ? 5  LYS B HB2  2  
ATOM 4472  H HB3  . LYS B 1 6  ? 1.922   -3.114  13.897  1.00 0.00 ? 5  LYS B HB3  2  
ATOM 4473  H HG2  . LYS B 1 6  ? -0.206  -4.482  14.495  1.00 0.00 ? 5  LYS B HG2  2  
ATOM 4474  H HG3  . LYS B 1 6  ? 0.825   -5.298  15.669  1.00 0.00 ? 5  LYS B HG3  2  
ATOM 4475  H HD2  . LYS B 1 6  ? 0.297   -2.317  15.513  1.00 0.00 ? 5  LYS B HD2  2  
ATOM 4476  H HD3  . LYS B 1 6  ? -0.310  -3.422  16.746  1.00 0.00 ? 5  LYS B HD3  2  
ATOM 4477  H HE2  . LYS B 1 6  ? 2.136   -3.983  17.245  1.00 0.00 ? 5  LYS B HE2  2  
ATOM 4478  H HE3  . LYS B 1 6  ? 2.553   -2.587  16.252  1.00 0.00 ? 5  LYS B HE3  2  
ATOM 4479  H HZ1  . LYS B 1 6  ? 0.882   -1.361  17.738  1.00 0.00 ? 5  LYS B HZ1  2  
ATOM 4480  H HZ2  . LYS B 1 6  ? 1.079   -2.666  18.803  1.00 0.00 ? 5  LYS B HZ2  2  
ATOM 4481  H HZ3  . LYS B 1 6  ? 2.418   -1.713  18.372  1.00 0.00 ? 5  LYS B HZ3  2  
ATOM 4482  N N    . ALA B 1 7  ? 1.034   -3.473  11.325  1.00 0.00 ? 6  ALA B N    2  
ATOM 4483  C CA   . ALA B 1 7  ? 0.045   -2.848  10.401  1.00 0.00 ? 6  ALA B CA   2  
ATOM 4484  C C    . ALA B 1 7  ? -0.143  -3.709  9.149   1.00 0.00 ? 6  ALA B C    2  
ATOM 4485  O O    . ALA B 1 7  ? -1.195  -3.695  8.541   1.00 0.00 ? 6  ALA B O    2  
ATOM 4486  C CB   . ALA B 1 7  ? 0.537   -1.451  10.001  1.00 0.00 ? 6  ALA B CB   2  
ATOM 4487  H H    . ALA B 1 7  ? 1.938   -3.100  11.387  1.00 0.00 ? 6  ALA B H    2  
ATOM 4488  H HA   . ALA B 1 7  ? -0.913  -2.766  10.889  1.00 0.00 ? 6  ALA B HA   2  
ATOM 4489  H HB1  . ALA B 1 7  ? 1.601   -1.483  9.813   1.00 0.00 ? 6  ALA B HB1  2  
ATOM 4490  H HB2  . ALA B 1 7  ? 0.025   -1.125  9.107   1.00 0.00 ? 6  ALA B HB2  2  
ATOM 4491  H HB3  . ALA B 1 7  ? 0.337   -0.755  10.803  1.00 0.00 ? 6  ALA B HB3  2  
ATOM 4492  N N    . MET B 1 8  ? 0.834   -4.477  8.763   1.00 0.00 ? 7  MET B N    2  
ATOM 4493  C CA   . MET B 1 8  ? 0.640   -5.340  7.564   1.00 0.00 ? 7  MET B CA   2  
ATOM 4494  C C    . MET B 1 8  ? -0.404  -6.412  7.916   1.00 0.00 ? 7  MET B C    2  
ATOM 4495  O O    . MET B 1 8  ? -1.379  -6.606  7.210   1.00 0.00 ? 7  MET B O    2  
ATOM 4496  C CB   . MET B 1 8  ? 1.983   -6.004  7.184   1.00 0.00 ? 7  MET B CB   2  
ATOM 4497  C CG   . MET B 1 8  ? 2.723   -5.164  6.123   1.00 0.00 ? 7  MET B CG   2  
ATOM 4498  S SD   . MET B 1 8  ? 2.232   -5.723  4.466   1.00 0.00 ? 7  MET B SD   2  
ATOM 4499  C CE   . MET B 1 8  ? 1.596   -4.149  3.835   1.00 0.00 ? 7  MET B CE   2  
ATOM 4500  H H    . MET B 1 8  ? 1.675   -4.504  9.266   1.00 0.00 ? 7  MET B H    2  
ATOM 4501  H HA   . MET B 1 8  ? 0.275   -4.741  6.742   1.00 0.00 ? 7  MET B HA   2  
ATOM 4502  H HB2  . MET B 1 8  ? 2.598   -6.085  8.069   1.00 0.00 ? 7  MET B HB2  2  
ATOM 4503  H HB3  . MET B 1 8  ? 1.803   -6.994  6.788   1.00 0.00 ? 7  MET B HB3  2  
ATOM 4504  H HG2  . MET B 1 8  ? 2.480   -4.119  6.247   1.00 0.00 ? 7  MET B HG2  2  
ATOM 4505  H HG3  . MET B 1 8  ? 3.790   -5.297  6.241   1.00 0.00 ? 7  MET B HG3  2  
ATOM 4506  H HE1  . MET B 1 8  ? 0.905   -3.727  4.546   1.00 0.00 ? 7  MET B HE1  2  
ATOM 4507  H HE2  . MET B 1 8  ? 2.418   -3.463  3.684   1.00 0.00 ? 7  MET B HE2  2  
ATOM 4508  H HE3  . MET B 1 8  ? 1.085   -4.319  2.896   1.00 0.00 ? 7  MET B HE3  2  
ATOM 4509  N N    . VAL B 1 9  ? -0.214  -7.099  9.013   1.00 0.00 ? 8  VAL B N    2  
ATOM 4510  C CA   . VAL B 1 9  ? -1.196  -8.146  9.411   1.00 0.00 ? 8  VAL B CA   2  
ATOM 4511  C C    . VAL B 1 9  ? -2.532  -7.476  9.747   1.00 0.00 ? 8  VAL B C    2  
ATOM 4512  O O    . VAL B 1 9  ? -3.589  -7.986  9.435   1.00 0.00 ? 8  VAL B O    2  
ATOM 4513  C CB   . VAL B 1 9  ? -0.667  -8.912  10.634  1.00 0.00 ? 8  VAL B CB   2  
ATOM 4514  C CG1  . VAL B 1 9  ? -1.333  -10.290 10.714  1.00 0.00 ? 8  VAL B CG1  2  
ATOM 4515  C CG2  . VAL B 1 9  ? 0.850   -9.088  10.504  1.00 0.00 ? 8  VAL B CG2  2  
ATOM 4516  H H    . VAL B 1 9  ? 0.569   -6.922  9.573   1.00 0.00 ? 8  VAL B H    2  
ATOM 4517  H HA   . VAL B 1 9  ? -1.335  -8.827  8.584   1.00 0.00 ? 8  VAL B HA   2  
ATOM 4518  H HB   . VAL B 1 9  ? -0.887  -8.356  11.534  1.00 0.00 ? 8  VAL B HB   2  
ATOM 4519  H HG11 . VAL B 1 9  ? -2.401  -10.182 10.601  1.00 0.00 ? 8  VAL B HG11 2  
ATOM 4520  H HG12 . VAL B 1 9  ? -0.950  -10.922 9.925   1.00 0.00 ? 8  VAL B HG12 2  
ATOM 4521  H HG13 . VAL B 1 9  ? -1.116  -10.740 11.672  1.00 0.00 ? 8  VAL B HG13 2  
ATOM 4522  H HG21 . VAL B 1 9  ? 1.094   -9.387  9.496   1.00 0.00 ? 8  VAL B HG21 2  
ATOM 4523  H HG22 . VAL B 1 9  ? 1.340   -8.153  10.731  1.00 0.00 ? 8  VAL B HG22 2  
ATOM 4524  H HG23 . VAL B 1 9  ? 1.187   -9.847  11.196  1.00 0.00 ? 8  VAL B HG23 2  
ATOM 4525  N N    . ALA B 1 10 ? -2.491  -6.330  10.371  1.00 0.00 ? 9  ALA B N    2  
ATOM 4526  C CA   . ALA B 1 10 ? -3.758  -5.625  10.713  1.00 0.00 ? 9  ALA B CA   2  
ATOM 4527  C C    . ALA B 1 10 ? -4.539  -5.358  9.426   1.00 0.00 ? 9  ALA B C    2  
ATOM 4528  O O    . ALA B 1 10 ? -5.722  -5.609  9.343   1.00 0.00 ? 9  ALA B O    2  
ATOM 4529  C CB   . ALA B 1 10 ? -3.431  -4.293  11.393  1.00 0.00 ? 9  ALA B CB   2  
ATOM 4530  H H    . ALA B 1 10 ? -1.630  -5.927  10.607  1.00 0.00 ? 9  ALA B H    2  
ATOM 4531  H HA   . ALA B 1 10 ? -4.345  -6.233  11.385  1.00 0.00 ? 9  ALA B HA   2  
ATOM 4532  H HB1  . ALA B 1 10 ? -2.662  -4.446  12.133  1.00 0.00 ? 9  ALA B HB1  2  
ATOM 4533  H HB2  . ALA B 1 10 ? -3.086  -3.585  10.654  1.00 0.00 ? 9  ALA B HB2  2  
ATOM 4534  H HB3  . ALA B 1 10 ? -4.319  -3.907  11.872  1.00 0.00 ? 9  ALA B HB3  2  
ATOM 4535  N N    . LEU B 1 11 ? -3.885  -4.834  8.426   1.00 0.00 ? 10 LEU B N    2  
ATOM 4536  C CA   . LEU B 1 11 ? -4.591  -4.531  7.144   1.00 0.00 ? 10 LEU B CA   2  
ATOM 4537  C C    . LEU B 1 11 ? -5.475  -5.721  6.763   1.00 0.00 ? 10 LEU B C    2  
ATOM 4538  O O    . LEU B 1 11 ? -6.598  -5.560  6.330   1.00 0.00 ? 10 LEU B O    2  
ATOM 4539  C CB   . LEU B 1 11 ? -3.532  -4.288  6.042   1.00 0.00 ? 10 LEU B CB   2  
ATOM 4540  C CG   . LEU B 1 11 ? -3.187  -2.782  5.952   1.00 0.00 ? 10 LEU B CG   2  
ATOM 4541  C CD1  . LEU B 1 11 ? -1.793  -2.599  5.347   1.00 0.00 ? 10 LEU B CD1  2  
ATOM 4542  C CD2  . LEU B 1 11 ? -4.212  -2.059  5.066   1.00 0.00 ? 10 LEU B CD2  2  
ATOM 4543  H H    . LEU B 1 11 ? -2.933  -4.619  8.526   1.00 0.00 ? 10 LEU B H    2  
ATOM 4544  H HA   . LEU B 1 11 ? -5.185  -3.633  7.265   1.00 0.00 ? 10 LEU B HA   2  
ATOM 4545  H HB2  . LEU B 1 11 ? -2.639  -4.845  6.287   1.00 0.00 ? 10 LEU B HB2  2  
ATOM 4546  H HB3  . LEU B 1 11 ? -3.909  -4.627  5.086   1.00 0.00 ? 10 LEU B HB3  2  
ATOM 4547  H HG   . LEU B 1 11 ? -3.202  -2.350  6.943   1.00 0.00 ? 10 LEU B HG   2  
ATOM 4548  H HD11 . LEU B 1 11 ? -1.704  -3.204  4.456   1.00 0.00 ? 10 LEU B HD11 2  
ATOM 4549  H HD12 . LEU B 1 11 ? -1.646  -1.559  5.092   1.00 0.00 ? 10 LEU B HD12 2  
ATOM 4550  H HD13 . LEU B 1 11 ? -1.047  -2.903  6.065   1.00 0.00 ? 10 LEU B HD13 2  
ATOM 4551  H HD21 . LEU B 1 11 ? -4.260  -2.542  4.100   1.00 0.00 ? 10 LEU B HD21 2  
ATOM 4552  H HD22 . LEU B 1 11 ? -5.184  -2.091  5.533   1.00 0.00 ? 10 LEU B HD22 2  
ATOM 4553  H HD23 . LEU B 1 11 ? -3.910  -1.031  4.936   1.00 0.00 ? 10 LEU B HD23 2  
ATOM 4554  N N    . ILE B 1 12 ? -4.985  -6.919  6.946   1.00 0.00 ? 11 ILE B N    2  
ATOM 4555  C CA   . ILE B 1 12 ? -5.823  -8.106  6.615   1.00 0.00 ? 11 ILE B CA   2  
ATOM 4556  C C    . ILE B 1 12 ? -7.025  -8.105  7.569   1.00 0.00 ? 11 ILE B C    2  
ATOM 4557  O O    . ILE B 1 12 ? -8.137  -8.420  7.194   1.00 0.00 ? 11 ILE B O    2  
ATOM 4558  C CB   . ILE B 1 12 ? -4.998  -9.400  6.788   1.00 0.00 ? 11 ILE B CB   2  
ATOM 4559  C CG1  . ILE B 1 12 ? -4.083  -9.606  5.570   1.00 0.00 ? 11 ILE B CG1  2  
ATOM 4560  C CG2  . ILE B 1 12 ? -5.930  -10.613 6.912   1.00 0.00 ? 11 ILE B CG2  2  
ATOM 4561  C CD1  . ILE B 1 12 ? -2.948  -8.581  5.583   1.00 0.00 ? 11 ILE B CD1  2  
ATOM 4562  H H    . ILE B 1 12 ? -4.083  -7.034  7.315   1.00 0.00 ? 11 ILE B H    2  
ATOM 4563  H HA   . ILE B 1 12 ? -6.164  -8.023  5.593   1.00 0.00 ? 11 ILE B HA   2  
ATOM 4564  H HB   . ILE B 1 12 ? -4.395  -9.323  7.681   1.00 0.00 ? 11 ILE B HB   2  
ATOM 4565  H HG12 . ILE B 1 12 ? -3.664  -10.601 5.605   1.00 0.00 ? 11 ILE B HG12 2  
ATOM 4566  H HG13 . ILE B 1 12 ? -4.656  -9.494  4.662   1.00 0.00 ? 11 ILE B HG13 2  
ATOM 4567  H HG21 . ILE B 1 12 ? -6.695  -10.558 6.153   1.00 0.00 ? 11 ILE B HG21 2  
ATOM 4568  H HG22 . ILE B 1 12 ? -5.360  -11.521 6.784   1.00 0.00 ? 11 ILE B HG22 2  
ATOM 4569  H HG23 . ILE B 1 12 ? -6.392  -10.614 7.889   1.00 0.00 ? 11 ILE B HG23 2  
ATOM 4570  H HD11 . ILE B 1 12 ? -2.495  -8.559  6.562   1.00 0.00 ? 11 ILE B HD11 2  
ATOM 4571  H HD12 . ILE B 1 12 ? -2.204  -8.860  4.850   1.00 0.00 ? 11 ILE B HD12 2  
ATOM 4572  H HD13 . ILE B 1 12 ? -3.339  -7.604  5.343   1.00 0.00 ? 11 ILE B HD13 2  
ATOM 4573  N N    . ASP B 1 13 ? -6.794  -7.744  8.804   1.00 0.00 ? 12 ASP B N    2  
ATOM 4574  C CA   . ASP B 1 13 ? -7.895  -7.702  9.808   1.00 0.00 ? 12 ASP B CA   2  
ATOM 4575  C C    . ASP B 1 13 ? -9.070  -6.890  9.264   1.00 0.00 ? 12 ASP B C    2  
ATOM 4576  O O    . ASP B 1 13 ? -10.199 -7.338  9.243   1.00 0.00 ? 12 ASP B O    2  
ATOM 4577  C CB   . ASP B 1 13 ? -7.380  -7.015  11.084  1.00 0.00 ? 12 ASP B CB   2  
ATOM 4578  C CG   . ASP B 1 13 ? -8.308  -7.346  12.258  1.00 0.00 ? 12 ASP B CG   2  
ATOM 4579  O OD1  . ASP B 1 13 ? -8.140  -8.405  12.840  1.00 0.00 ? 12 ASP B OD1  2  
ATOM 4580  O OD2  . ASP B 1 13 ? -9.170  -6.535  12.553  1.00 0.00 ? 12 ASP B OD2  2  
ATOM 4581  H H    . ASP B 1 13 ? -5.887  -7.494  9.074   1.00 0.00 ? 12 ASP B H    2  
ATOM 4582  H HA   . ASP B 1 13 ? -8.208  -8.704  10.070  1.00 0.00 ? 12 ASP B HA   2  
ATOM 4583  H HB2  . ASP B 1 13 ? -6.385  -7.370  11.304  1.00 0.00 ? 12 ASP B HB2  2  
ATOM 4584  H HB3  . ASP B 1 13 ? -7.358  -5.945  10.942  1.00 0.00 ? 12 ASP B HB3  2  
ATOM 4585  N N    . VAL B 1 14 ? -8.804  -5.678  8.854   1.00 0.00 ? 13 VAL B N    2  
ATOM 4586  C CA   . VAL B 1 14 ? -9.893  -4.799  8.341   1.00 0.00 ? 13 VAL B CA   2  
ATOM 4587  C C    . VAL B 1 14 ? -10.341 -5.229  6.942   1.00 0.00 ? 13 VAL B C    2  
ATOM 4588  O O    . VAL B 1 14 ? -11.517 -5.193  6.640   1.00 0.00 ? 13 VAL B O    2  
ATOM 4589  C CB   . VAL B 1 14 ? -9.413  -3.346  8.316   1.00 0.00 ? 13 VAL B CB   2  
ATOM 4590  C CG1  . VAL B 1 14 ? -10.516 -2.450  7.751   1.00 0.00 ? 13 VAL B CG1  2  
ATOM 4591  C CG2  . VAL B 1 14 ? -9.071  -2.898  9.739   1.00 0.00 ? 13 VAL B CG2  2  
ATOM 4592  H H    . VAL B 1 14 ? -7.883  -5.334  8.904   1.00 0.00 ? 13 VAL B H    2  
ATOM 4593  H HA   . VAL B 1 14 ? -10.758 -4.893  8.978   1.00 0.00 ? 13 VAL B HA   2  
ATOM 4594  H HB   . VAL B 1 14 ? -8.529  -3.271  7.693   1.00 0.00 ? 13 VAL B HB   2  
ATOM 4595  H HG11 . VAL B 1 14 ? -11.461 -2.711  8.205   1.00 0.00 ? 13 VAL B HG11 2  
ATOM 4596  H HG12 . VAL B 1 14 ? -10.287 -1.417  7.965   1.00 0.00 ? 13 VAL B HG12 2  
ATOM 4597  H HG13 . VAL B 1 14 ? -10.581 -2.590  6.682   1.00 0.00 ? 13 VAL B HG13 2  
ATOM 4598  H HG21 . VAL B 1 14 ? -9.927  -3.050  10.380  1.00 0.00 ? 13 VAL B HG21 2  
ATOM 4599  H HG22 . VAL B 1 14 ? -8.237  -3.478  10.109  1.00 0.00 ? 13 VAL B HG22 2  
ATOM 4600  H HG23 . VAL B 1 14 ? -8.806  -1.851  9.733   1.00 0.00 ? 13 VAL B HG23 2  
ATOM 4601  N N    . PHE B 1 15 ? -9.456  -5.631  6.076   1.00 0.00 ? 14 PHE B N    2  
ATOM 4602  C CA   . PHE B 1 15 ? -9.936  -6.037  4.724   1.00 0.00 ? 14 PHE B CA   2  
ATOM 4603  C C    . PHE B 1 15 ? -10.875 -7.233  4.877   1.00 0.00 ? 14 PHE B C    2  
ATOM 4604  O O    . PHE B 1 15 ? -11.823 -7.397  4.134   1.00 0.00 ? 14 PHE B O    2  
ATOM 4605  C CB   . PHE B 1 15 ? -8.762  -6.421  3.823   1.00 0.00 ? 14 PHE B CB   2  
ATOM 4606  C CG   . PHE B 1 15 ? -9.287  -6.727  2.439   1.00 0.00 ? 14 PHE B CG   2  
ATOM 4607  C CD1  . PHE B 1 15 ? -9.395  -5.704  1.489   1.00 0.00 ? 14 PHE B CD1  2  
ATOM 4608  C CD2  . PHE B 1 15 ? -9.674  -8.033  2.107   1.00 0.00 ? 14 PHE B CD2  2  
ATOM 4609  C CE1  . PHE B 1 15 ? -9.888  -5.985  0.209   1.00 0.00 ? 14 PHE B CE1  2  
ATOM 4610  C CE2  . PHE B 1 15 ? -10.166 -8.314  0.826   1.00 0.00 ? 14 PHE B CE2  2  
ATOM 4611  C CZ   . PHE B 1 15 ? -10.273 -7.289  -0.122  1.00 0.00 ? 14 PHE B CZ   2  
ATOM 4612  H H    . PHE B 1 15 ? -8.504  -5.662  6.305   1.00 0.00 ? 14 PHE B H    2  
ATOM 4613  H HA   . PHE B 1 15 ? -10.469 -5.202  4.291   1.00 0.00 ? 14 PHE B HA   2  
ATOM 4614  H HB2  . PHE B 1 15 ? -8.062  -5.601  3.771   1.00 0.00 ? 14 PHE B HB2  2  
ATOM 4615  H HB3  . PHE B 1 15 ? -8.269  -7.295  4.222   1.00 0.00 ? 14 PHE B HB3  2  
ATOM 4616  H HD1  . PHE B 1 15 ? -9.097  -4.697  1.744   1.00 0.00 ? 14 PHE B HD1  2  
ATOM 4617  H HD2  . PHE B 1 15 ? -9.591  -8.823  2.840   1.00 0.00 ? 14 PHE B HD2  2  
ATOM 4618  H HE1  . PHE B 1 15 ? -9.971  -5.196  -0.523  1.00 0.00 ? 14 PHE B HE1  2  
ATOM 4619  H HE2  . PHE B 1 15 ? -10.464 -9.321  0.568   1.00 0.00 ? 14 PHE B HE2  2  
ATOM 4620  H HZ   . PHE B 1 15 ? -10.653 -7.506  -1.110  1.00 0.00 ? 14 PHE B HZ   2  
ATOM 4621  N N    . HIS B 1 16 ? -10.608 -8.074  5.841   1.00 0.00 ? 15 HIS B N    2  
ATOM 4622  C CA   . HIS B 1 16 ? -11.467 -9.271  6.059   1.00 0.00 ? 15 HIS B CA   2  
ATOM 4623  C C    . HIS B 1 16 ? -12.727 -8.880  6.836   1.00 0.00 ? 15 HIS B C    2  
ATOM 4624  O O    . HIS B 1 16 ? -13.780 -9.464  6.667   1.00 0.00 ? 15 HIS B O    2  
ATOM 4625  C CB   . HIS B 1 16 ? -10.683 -10.316 6.855   1.00 0.00 ? 15 HIS B CB   2  
ATOM 4626  C CG   . HIS B 1 16 ? -11.478 -11.589 6.935   1.00 0.00 ? 15 HIS B CG   2  
ATOM 4627  N ND1  . HIS B 1 16 ? -11.633 -12.287 8.122   1.00 0.00 ? 15 HIS B ND1  2  
ATOM 4628  C CD2  . HIS B 1 16 ? -12.167 -12.303 5.986   1.00 0.00 ? 15 HIS B CD2  2  
ATOM 4629  C CE1  . HIS B 1 16 ? -12.388 -13.369 7.860   1.00 0.00 ? 15 HIS B CE1  2  
ATOM 4630  N NE2  . HIS B 1 16 ? -12.741 -13.427 6.573   1.00 0.00 ? 15 HIS B NE2  2  
ATOM 4631  H H    . HIS B 1 16 ? -9.835  -7.917  6.423   1.00 0.00 ? 15 HIS B H    2  
ATOM 4632  H HA   . HIS B 1 16 ? -11.749 -9.688  5.103   1.00 0.00 ? 15 HIS B HA   2  
ATOM 4633  H HB2  . HIS B 1 16 ? -9.741  -10.511 6.363   1.00 0.00 ? 15 HIS B HB2  2  
ATOM 4634  H HB3  . HIS B 1 16 ? -10.498 -9.945  7.851   1.00 0.00 ? 15 HIS B HB3  2  
ATOM 4635  H HD1  . HIS B 1 16 ? -11.260 -12.038 8.993   1.00 0.00 ? 15 HIS B HD1  2  
ATOM 4636  H HD2  . HIS B 1 16 ? -12.246 -12.036 4.943   1.00 0.00 ? 15 HIS B HD2  2  
ATOM 4637  H HE1  . HIS B 1 16 ? -12.671 -14.103 8.599   1.00 0.00 ? 15 HIS B HE1  2  
ATOM 4638  N N    . GLN B 1 17 ? -12.620 -7.910  7.707   1.00 0.00 ? 16 GLN B N    2  
ATOM 4639  C CA   . GLN B 1 17 ? -13.803 -7.497  8.518   1.00 0.00 ? 16 GLN B CA   2  
ATOM 4640  C C    . GLN B 1 17 ? -14.973 -7.157  7.595   1.00 0.00 ? 16 GLN B C    2  
ATOM 4641  O O    . GLN B 1 17 ? -16.087 -7.588  7.815   1.00 0.00 ? 16 GLN B O    2  
ATOM 4642  C CB   . GLN B 1 17 ? -13.444 -6.279  9.369   1.00 0.00 ? 16 GLN B CB   2  
ATOM 4643  C CG   . GLN B 1 17 ? -14.626 -5.915  10.270  1.00 0.00 ? 16 GLN B CG   2  
ATOM 4644  C CD   . GLN B 1 17 ? -14.167 -4.909  11.327  1.00 0.00 ? 16 GLN B CD   2  
ATOM 4645  O OE1  . GLN B 1 17 ? -14.777 -4.784  12.370  1.00 0.00 ? 16 GLN B OE1  2  
ATOM 4646  N NE2  . GLN B 1 17 ? -13.109 -4.180  11.098  1.00 0.00 ? 16 GLN B NE2  2  
ATOM 4647  H H    . GLN B 1 17 ? -11.758 -7.465  7.841   1.00 0.00 ? 16 GLN B H    2  
ATOM 4648  H HA   . GLN B 1 17 ? -14.092 -8.318  9.157   1.00 0.00 ? 16 GLN B HA   2  
ATOM 4649  H HB2  . GLN B 1 17 ? -12.583 -6.508  9.980   1.00 0.00 ? 16 GLN B HB2  2  
ATOM 4650  H HB3  . GLN B 1 17 ? -13.217 -5.444  8.724   1.00 0.00 ? 16 GLN B HB3  2  
ATOM 4651  H HG2  . GLN B 1 17 ? -15.413 -5.477  9.673   1.00 0.00 ? 16 GLN B HG2  2  
ATOM 4652  H HG3  . GLN B 1 17 ? -14.995 -6.804  10.758  1.00 0.00 ? 16 GLN B HG3  2  
ATOM 4653  H HE21 . GLN B 1 17 ? -12.618 -4.280  10.255  1.00 0.00 ? 16 GLN B HE21 2  
ATOM 4654  H HE22 . GLN B 1 17 ? -12.804 -3.533  11.768  1.00 0.00 ? 16 GLN B HE22 2  
ATOM 4655  N N    . TYR B 1 18 ? -14.740 -6.394  6.563   1.00 0.00 ? 17 TYR B N    2  
ATOM 4656  C CA   . TYR B 1 18 ? -15.853 -6.046  5.640   1.00 0.00 ? 17 TYR B CA   2  
ATOM 4657  C C    . TYR B 1 18 ? -16.252 -7.297  4.858   1.00 0.00 ? 17 TYR B C    2  
ATOM 4658  O O    . TYR B 1 18 ? -17.413 -7.642  4.767   1.00 0.00 ? 17 TYR B O    2  
ATOM 4659  C CB   . TYR B 1 18 ? -15.393 -4.953  4.664   1.00 0.00 ? 17 TYR B CB   2  
ATOM 4660  C CG   . TYR B 1 18 ? -15.417 -3.604  5.353   1.00 0.00 ? 17 TYR B CG   2  
ATOM 4661  C CD1  . TYR B 1 18 ? -14.557 -3.356  6.431   1.00 0.00 ? 17 TYR B CD1  2  
ATOM 4662  C CD2  . TYR B 1 18 ? -16.293 -2.601  4.913   1.00 0.00 ? 17 TYR B CD2  2  
ATOM 4663  C CE1  . TYR B 1 18 ? -14.574 -2.109  7.068   1.00 0.00 ? 17 TYR B CE1  2  
ATOM 4664  C CE2  . TYR B 1 18 ? -16.308 -1.354  5.551   1.00 0.00 ? 17 TYR B CE2  2  
ATOM 4665  C CZ   . TYR B 1 18 ? -15.448 -1.109  6.628   1.00 0.00 ? 17 TYR B CZ   2  
ATOM 4666  O OH   . TYR B 1 18 ? -15.462 0.120   7.255   1.00 0.00 ? 17 TYR B OH   2  
ATOM 4667  H H    . TYR B 1 18 ? -13.840 -6.047  6.398   1.00 0.00 ? 17 TYR B H    2  
ATOM 4668  H HA   . TYR B 1 18 ? -16.700 -5.692  6.210   1.00 0.00 ? 17 TYR B HA   2  
ATOM 4669  H HB2  . TYR B 1 18 ? -14.387 -5.169  4.335   1.00 0.00 ? 17 TYR B HB2  2  
ATOM 4670  H HB3  . TYR B 1 18 ? -16.053 -4.933  3.808   1.00 0.00 ? 17 TYR B HB3  2  
ATOM 4671  H HD1  . TYR B 1 18 ? -13.883 -4.128  6.771   1.00 0.00 ? 17 TYR B HD1  2  
ATOM 4672  H HD2  . TYR B 1 18 ? -16.957 -2.790  4.082   1.00 0.00 ? 17 TYR B HD2  2  
ATOM 4673  H HE1  . TYR B 1 18 ? -13.911 -1.919  7.899   1.00 0.00 ? 17 TYR B HE1  2  
ATOM 4674  H HE2  . TYR B 1 18 ? -16.983 -0.582  5.212   1.00 0.00 ? 17 TYR B HE2  2  
ATOM 4675  H HH   . TYR B 1 18 ? -14.889 0.712   6.763   1.00 0.00 ? 17 TYR B HH   2  
ATOM 4676  N N    . SER B 1 19 ? -15.291 -7.979  4.291   1.00 0.00 ? 18 SER B N    2  
ATOM 4677  C CA   . SER B 1 19 ? -15.597 -9.212  3.506   1.00 0.00 ? 18 SER B CA   2  
ATOM 4678  C C    . SER B 1 19 ? -15.322 -10.456 4.354   1.00 0.00 ? 18 SER B C    2  
ATOM 4679  O O    . SER B 1 19 ? -14.539 -11.303 3.971   1.00 0.00 ? 18 SER B O    2  
ATOM 4680  C CB   . SER B 1 19 ? -14.711 -9.250  2.261   1.00 0.00 ? 18 SER B CB   2  
ATOM 4681  O OG   . SER B 1 19 ? -13.409 -9.689  2.626   1.00 0.00 ? 18 SER B OG   2  
ATOM 4682  H H    . SER B 1 19 ? -14.363 -7.678  4.380   1.00 0.00 ? 18 SER B H    2  
ATOM 4683  H HA   . SER B 1 19 ? -16.636 -9.210  3.202   1.00 0.00 ? 18 SER B HA   2  
ATOM 4684  H HB2  . SER B 1 19 ? -15.127 -9.934  1.541   1.00 0.00 ? 18 SER B HB2  2  
ATOM 4685  H HB3  . SER B 1 19 ? -14.660 -8.260  1.827   1.00 0.00 ? 18 SER B HB3  2  
ATOM 4686  H HG   . SER B 1 19 ? -13.458 -10.062 3.509   1.00 0.00 ? 18 SER B HG   2  
ATOM 4687  N N    . GLY B 1 20 ? -15.978 -10.595 5.488   1.00 0.00 ? 19 GLY B N    2  
ATOM 4688  C CA   . GLY B 1 20 ? -15.773 -11.812 6.344   1.00 0.00 ? 19 GLY B CA   2  
ATOM 4689  C C    . GLY B 1 20 ? -17.126 -12.507 6.516   1.00 0.00 ? 19 GLY B C    2  
ATOM 4690  O O    . GLY B 1 20 ? -17.197 -13.675 6.841   1.00 0.00 ? 19 GLY B O    2  
ATOM 4691  H H    . GLY B 1 20 ? -16.627 -9.917  5.770   1.00 0.00 ? 19 GLY B H    2  
ATOM 4692  H HA2  . GLY B 1 20 ? -15.074 -12.482 5.865   1.00 0.00 ? 19 GLY B HA2  2  
ATOM 4693  H HA3  . GLY B 1 20 ? -15.408 -11.539 7.323   1.00 0.00 ? 19 GLY B HA3  2  
ATOM 4694  N N    . ARG B 1 21 ? -18.200 -11.802 6.280   1.00 0.00 ? 20 ARG B N    2  
ATOM 4695  C CA   . ARG B 1 21 ? -19.545 -12.429 6.405   1.00 0.00 ? 20 ARG B CA   2  
ATOM 4696  C C    . ARG B 1 21 ? -19.663 -13.540 5.363   1.00 0.00 ? 20 ARG B C    2  
ATOM 4697  O O    . ARG B 1 21 ? -20.332 -14.529 5.593   1.00 0.00 ? 20 ARG B O    2  
ATOM 4698  C CB   . ARG B 1 21 ? -20.653 -11.381 6.225   1.00 0.00 ? 20 ARG B CB   2  
ATOM 4699  C CG   . ARG B 1 21 ? -20.212 -10.326 5.206   1.00 0.00 ? 20 ARG B CG   2  
ATOM 4700  C CD   . ARG B 1 21 ? -21.406 -9.443  4.839   1.00 0.00 ? 20 ARG B CD   2  
ATOM 4701  N NE   . ARG B 1 21 ? -21.930 -8.786  6.069   1.00 0.00 ? 20 ARG B NE   2  
ATOM 4702  C CZ   . ARG B 1 21 ? -23.052 -8.121  6.029   1.00 0.00 ? 20 ARG B CZ   2  
ATOM 4703  N NH1  . ARG B 1 21 ? -24.178 -8.751  5.840   1.00 0.00 ? 20 ARG B NH1  2  
ATOM 4704  N NH2  . ARG B 1 21 ? -23.048 -6.826  6.179   1.00 0.00 ? 20 ARG B NH2  2  
ATOM 4705  H H    . ARG B 1 21 ? -18.123 -10.869 5.994   1.00 0.00 ? 20 ARG B H    2  
ATOM 4706  H HA   . ARG B 1 21 ? -19.653 -12.928 7.357   1.00 0.00 ? 20 ARG B HA   2  
ATOM 4707  H HB2  . ARG B 1 21 ? -21.557 -11.862 5.878   1.00 0.00 ? 20 ARG B HB2  2  
ATOM 4708  H HB3  . ARG B 1 21 ? -20.847 -10.900 7.172   1.00 0.00 ? 20 ARG B HB3  2  
ATOM 4709  H HG2  . ARG B 1 21 ? -19.433 -9.715  5.636   1.00 0.00 ? 20 ARG B HG2  2  
ATOM 4710  H HG3  . ARG B 1 21 ? -19.841 -10.814 4.317   1.00 0.00 ? 20 ARG B HG3  2  
ATOM 4711  H HD2  . ARG B 1 21 ? -21.091 -8.687  4.134   1.00 0.00 ? 20 ARG B HD2  2  
ATOM 4712  H HD3  . ARG B 1 21 ? -22.182 -10.049 4.395   1.00 0.00 ? 20 ARG B HD3  2  
ATOM 4713  H HE   . ARG B 1 21 ? -21.432 -8.854  6.910   1.00 0.00 ? 20 ARG B HE   2  
ATOM 4714  H HH11 . ARG B 1 21 ? -24.184 -9.744  5.726   1.00 0.00 ? 20 ARG B HH11 2  
ATOM 4715  H HH12 . ARG B 1 21 ? -25.037 -8.239  5.809   1.00 0.00 ? 20 ARG B HH12 2  
ATOM 4716  H HH21 . ARG B 1 21 ? -22.186 -6.342  6.327   1.00 0.00 ? 20 ARG B HH21 2  
ATOM 4717  H HH22 . ARG B 1 21 ? -23.908 -6.317  6.148   1.00 0.00 ? 20 ARG B HH22 2  
ATOM 4718  N N    . GLU B 1 22 ? -18.988 -13.433 4.246   1.00 0.00 ? 21 GLU B N    2  
ATOM 4719  C CA   . GLU B 1 22 ? -19.044 -14.548 3.247   1.00 0.00 ? 21 GLU B CA   2  
ATOM 4720  C C    . GLU B 1 22 ? -17.678 -14.664 2.568   1.00 0.00 ? 21 GLU B C    2  
ATOM 4721  O O    . GLU B 1 22 ? -17.124 -15.741 2.469   1.00 0.00 ? 21 GLU B O    2  
ATOM 4722  C CB   . GLU B 1 22 ? -20.130 -14.275 2.194   1.00 0.00 ? 21 GLU B CB   2  
ATOM 4723  C CG   . GLU B 1 22 ? -21.525 -14.553 2.774   1.00 0.00 ? 21 GLU B CG   2  
ATOM 4724  C CD   . GLU B 1 22 ? -21.962 -13.383 3.660   1.00 0.00 ? 21 GLU B CD   2  
ATOM 4725  O OE1  . GLU B 1 22 ? -21.689 -12.253 3.292   1.00 0.00 ? 21 GLU B OE1  2  
ATOM 4726  O OE2  . GLU B 1 22 ? -22.561 -13.639 4.692   1.00 0.00 ? 21 GLU B OE2  2  
ATOM 4727  H H    . GLU B 1 22 ? -18.417 -12.652 4.085   1.00 0.00 ? 21 GLU B H    2  
ATOM 4728  H HA   . GLU B 1 22 ? -19.247 -15.469 3.774   1.00 0.00 ? 21 GLU B HA   2  
ATOM 4729  H HB2  . GLU B 1 22 ? -20.071 -13.242 1.882   1.00 0.00 ? 21 GLU B HB2  2  
ATOM 4730  H HB3  . GLU B 1 22 ? -19.967 -14.915 1.340   1.00 0.00 ? 21 GLU B HB3  2  
ATOM 4731  H HG2  . GLU B 1 22 ? -22.230 -14.669 1.963   1.00 0.00 ? 21 GLU B HG2  2  
ATOM 4732  H HG3  . GLU B 1 22 ? -21.505 -15.459 3.360   1.00 0.00 ? 21 GLU B HG3  2  
ATOM 4733  N N    . GLY B 1 23 ? -17.118 -13.567 2.122   1.00 0.00 ? 22 GLY B N    2  
ATOM 4734  C CA   . GLY B 1 23 ? -15.775 -13.615 1.465   1.00 0.00 ? 22 GLY B CA   2  
ATOM 4735  C C    . GLY B 1 23 ? -15.703 -14.805 0.507   1.00 0.00 ? 22 GLY B C    2  
ATOM 4736  O O    . GLY B 1 23 ? -14.634 -15.227 0.113   1.00 0.00 ? 22 GLY B O    2  
ATOM 4737  H H    . GLY B 1 23 ? -17.572 -12.703 2.224   1.00 0.00 ? 22 GLY B H    2  
ATOM 4738  H HA2  . GLY B 1 23 ? -15.611 -12.697 0.919   1.00 0.00 ? 22 GLY B HA2  2  
ATOM 4739  H HA3  . GLY B 1 23 ? -15.009 -13.721 2.219   1.00 0.00 ? 22 GLY B HA3  2  
ATOM 4740  N N    . ASP B 1 24 ? -16.824 -15.349 0.124   1.00 0.00 ? 23 ASP B N    2  
ATOM 4741  C CA   . ASP B 1 24 ? -16.795 -16.508 -0.811  1.00 0.00 ? 23 ASP B CA   2  
ATOM 4742  C C    . ASP B 1 24 ? -15.892 -16.158 -1.995  1.00 0.00 ? 23 ASP B C    2  
ATOM 4743  O O    . ASP B 1 24 ? -15.007 -16.908 -2.356  1.00 0.00 ? 23 ASP B O    2  
ATOM 4744  C CB   . ASP B 1 24 ? -18.210 -16.804 -1.312  1.00 0.00 ? 23 ASP B CB   2  
ATOM 4745  C CG   . ASP B 1 24 ? -19.092 -17.227 -0.135  1.00 0.00 ? 23 ASP B CG   2  
ATOM 4746  O OD1  . ASP B 1 24 ? -18.556 -17.772 0.816   1.00 0.00 ? 23 ASP B OD1  2  
ATOM 4747  O OD2  . ASP B 1 24 ? -20.288 -16.998 -0.205  1.00 0.00 ? 23 ASP B OD2  2  
ATOM 4748  H H    . ASP B 1 24 ? -17.677 -15.000 0.459   1.00 0.00 ? 23 ASP B H    2  
ATOM 4749  H HA   . ASP B 1 24 ? -16.402 -17.375 -0.300  1.00 0.00 ? 23 ASP B HA   2  
ATOM 4750  H HB2  . ASP B 1 24 ? -18.622 -15.917 -1.771  1.00 0.00 ? 23 ASP B HB2  2  
ATOM 4751  H HB3  . ASP B 1 24 ? -18.175 -17.603 -2.038  1.00 0.00 ? 23 ASP B HB3  2  
ATOM 4752  N N    . LYS B 1 25 ? -16.093 -15.011 -2.589  1.00 0.00 ? 24 LYS B N    2  
ATOM 4753  C CA   . LYS B 1 25 ? -15.230 -14.598 -3.734  1.00 0.00 ? 24 LYS B CA   2  
ATOM 4754  C C    . LYS B 1 25 ? -14.035 -13.809 -3.191  1.00 0.00 ? 24 LYS B C    2  
ATOM 4755  O O    . LYS B 1 25 ? -14.158 -13.059 -2.244  1.00 0.00 ? 24 LYS B O    2  
ATOM 4756  C CB   . LYS B 1 25 ? -16.034 -13.717 -4.693  1.00 0.00 ? 24 LYS B CB   2  
ATOM 4757  C CG   . LYS B 1 25 ? -17.408 -14.353 -4.941  1.00 0.00 ? 24 LYS B CG   2  
ATOM 4758  C CD   . LYS B 1 25 ? -18.202 -13.523 -5.970  1.00 0.00 ? 24 LYS B CD   2  
ATOM 4759  C CE   . LYS B 1 25 ? -17.863 -13.979 -7.395  1.00 0.00 ? 24 LYS B CE   2  
ATOM 4760  N NZ   . LYS B 1 25 ? -18.384 -15.359 -7.612  1.00 0.00 ? 24 LYS B NZ   2  
ATOM 4761  H H    . LYS B 1 25 ? -16.801 -14.413 -2.271  1.00 0.00 ? 24 LYS B H    2  
ATOM 4762  H HA   . LYS B 1 25 ? -14.879 -15.479 -4.256  1.00 0.00 ? 24 LYS B HA   2  
ATOM 4763  H HB2  . LYS B 1 25 ? -16.164 -12.736 -4.256  1.00 0.00 ? 24 LYS B HB2  2  
ATOM 4764  H HB3  . LYS B 1 25 ? -15.504 -13.628 -5.628  1.00 0.00 ? 24 LYS B HB3  2  
ATOM 4765  H HG2  . LYS B 1 25 ? -17.275 -15.361 -5.310  1.00 0.00 ? 24 LYS B HG2  2  
ATOM 4766  H HG3  . LYS B 1 25 ? -17.956 -14.386 -4.011  1.00 0.00 ? 24 LYS B HG3  2  
ATOM 4767  H HD2  . LYS B 1 25 ? -19.261 -13.658 -5.797  1.00 0.00 ? 24 LYS B HD2  2  
ATOM 4768  H HD3  . LYS B 1 25 ? -17.956 -12.475 -5.863  1.00 0.00 ? 24 LYS B HD3  2  
ATOM 4769  H HE2  . LYS B 1 25 ? -18.319 -13.307 -8.106  1.00 0.00 ? 24 LYS B HE2  2  
ATOM 4770  H HE3  . LYS B 1 25 ? -16.792 -13.974 -7.531  1.00 0.00 ? 24 LYS B HE3  2  
ATOM 4771  H HZ1  . LYS B 1 25 ? -17.974 -16.002 -6.905  1.00 0.00 ? 24 LYS B HZ1  2  
ATOM 4772  H HZ2  . LYS B 1 25 ? -19.419 -15.359 -7.516  1.00 0.00 ? 24 LYS B HZ2  2  
ATOM 4773  H HZ3  . LYS B 1 25 ? -18.124 -15.682 -8.567  1.00 0.00 ? 24 LYS B HZ3  2  
ATOM 4774  N N    . HIS B 1 26 ? -12.886 -13.947 -3.799  1.00 0.00 ? 25 HIS B N    2  
ATOM 4775  C CA   . HIS B 1 26 ? -11.686 -13.181 -3.339  1.00 0.00 ? 25 HIS B CA   2  
ATOM 4776  C C    . HIS B 1 26 ? -11.529 -11.967 -4.253  1.00 0.00 ? 25 HIS B C    2  
ATOM 4777  O O    . HIS B 1 26 ? -10.435 -11.582 -4.617  1.00 0.00 ? 25 HIS B O    2  
ATOM 4778  C CB   . HIS B 1 26 ? -10.444 -14.069 -3.443  1.00 0.00 ? 25 HIS B CB   2  
ATOM 4779  C CG   . HIS B 1 26 ? -10.525 -15.163 -2.413  1.00 0.00 ? 25 HIS B CG   2  
ATOM 4780  N ND1  . HIS B 1 26 ? -10.415 -16.504 -2.747  1.00 0.00 ? 25 HIS B ND1  2  
ATOM 4781  C CD2  . HIS B 1 26 ? -10.709 -15.130 -1.053  1.00 0.00 ? 25 HIS B CD2  2  
ATOM 4782  C CE1  . HIS B 1 26 ? -10.533 -17.216 -1.611  1.00 0.00 ? 25 HIS B CE1  2  
ATOM 4783  N NE2  . HIS B 1 26 ? -10.714 -16.428 -0.549  1.00 0.00 ? 25 HIS B NE2  2  
ATOM 4784  H H    . HIS B 1 26 ? -12.816 -14.540 -4.574  1.00 0.00 ? 25 HIS B H    2  
ATOM 4785  H HA   . HIS B 1 26 ? -11.819 -12.854 -2.316  1.00 0.00 ? 25 HIS B HA   2  
ATOM 4786  H HB2  . HIS B 1 26 ? -10.394 -14.504 -4.430  1.00 0.00 ? 25 HIS B HB2  2  
ATOM 4787  H HB3  . HIS B 1 26 ? -9.560  -13.474 -3.266  1.00 0.00 ? 25 HIS B HB3  2  
ATOM 4788  H HD1  . HIS B 1 26 ? -10.279 -16.867 -3.647  1.00 0.00 ? 25 HIS B HD1  2  
ATOM 4789  H HD2  . HIS B 1 26 ? -10.836 -14.234 -0.463  1.00 0.00 ? 25 HIS B HD2  2  
ATOM 4790  H HE1  . HIS B 1 26 ? -10.490 -18.294 -1.565  1.00 0.00 ? 25 HIS B HE1  2  
ATOM 4791  N N    . LYS B 1 27 ? -12.628 -11.358 -4.614  1.00 0.00 ? 26 LYS B N    2  
ATOM 4792  C CA   . LYS B 1 27 ? -12.589 -10.153 -5.496  1.00 0.00 ? 26 LYS B CA   2  
ATOM 4793  C C    . LYS B 1 27 ? -13.519 -9.083  -4.919  1.00 0.00 ? 26 LYS B C    2  
ATOM 4794  O O    . LYS B 1 27 ? -14.466 -9.393  -4.225  1.00 0.00 ? 26 LYS B O    2  
ATOM 4795  C CB   . LYS B 1 27 ? -13.064 -10.535 -6.899  1.00 0.00 ? 26 LYS B CB   2  
ATOM 4796  C CG   . LYS B 1 27 ? -12.157 -11.630 -7.463  1.00 0.00 ? 26 LYS B CG   2  
ATOM 4797  C CD   . LYS B 1 27 ? -12.407 -11.776 -8.967  1.00 0.00 ? 26 LYS B CD   2  
ATOM 4798  C CE   . LYS B 1 27 ? -11.435 -12.804 -9.555  1.00 0.00 ? 26 LYS B CE   2  
ATOM 4799  N NZ   . LYS B 1 27 ? -11.953 -13.282 -10.868 1.00 0.00 ? 26 LYS B NZ   2  
ATOM 4800  H H    . LYS B 1 27 ? -13.489 -11.695 -4.295  1.00 0.00 ? 26 LYS B H    2  
ATOM 4801  H HA   . LYS B 1 27 ? -11.581 -9.773  -5.551  1.00 0.00 ? 26 LYS B HA   2  
ATOM 4802  H HB2  . LYS B 1 27 ? -14.080 -10.898 -6.849  1.00 0.00 ? 26 LYS B HB2  2  
ATOM 4803  H HB3  . LYS B 1 27 ? -13.022 -9.669  -7.542  1.00 0.00 ? 26 LYS B HB3  2  
ATOM 4804  H HG2  . LYS B 1 27 ? -11.124 -11.363 -7.294  1.00 0.00 ? 26 LYS B HG2  2  
ATOM 4805  H HG3  . LYS B 1 27 ? -12.373 -12.566 -6.972  1.00 0.00 ? 26 LYS B HG3  2  
ATOM 4806  H HD2  . LYS B 1 27 ? -13.422 -12.106 -9.132  1.00 0.00 ? 26 LYS B HD2  2  
ATOM 4807  H HD3  . LYS B 1 27 ? -12.255 -10.823 -9.451  1.00 0.00 ? 26 LYS B HD3  2  
ATOM 4808  H HE2  . LYS B 1 27 ? -10.468 -12.344 -9.696  1.00 0.00 ? 26 LYS B HE2  2  
ATOM 4809  H HE3  . LYS B 1 27 ? -11.339 -13.642 -8.880  1.00 0.00 ? 26 LYS B HE3  2  
ATOM 4810  H HZ1  . LYS B 1 27 ? -12.479 -12.515 -11.333 1.00 0.00 ? 26 LYS B HZ1  2  
ATOM 4811  H HZ2  . LYS B 1 27 ? -11.155 -13.571 -11.470 1.00 0.00 ? 26 LYS B HZ2  2  
ATOM 4812  H HZ3  . LYS B 1 27 ? -12.586 -14.092 -10.717 1.00 0.00 ? 26 LYS B HZ3  2  
ATOM 4813  N N    . LEU B 1 28 ? -13.259 -7.828  -5.199  1.00 0.00 ? 27 LEU B N    2  
ATOM 4814  C CA   . LEU B 1 28 ? -14.130 -6.726  -4.666  1.00 0.00 ? 27 LEU B CA   2  
ATOM 4815  C C    . LEU B 1 28 ? -14.653 -5.895  -5.841  1.00 0.00 ? 27 LEU B C    2  
ATOM 4816  O O    . LEU B 1 28 ? -13.945 -5.646  -6.796  1.00 0.00 ? 27 LEU B O    2  
ATOM 4817  C CB   . LEU B 1 28 ? -13.298 -5.837  -3.723  1.00 0.00 ? 27 LEU B CB   2  
ATOM 4818  C CG   . LEU B 1 28 ? -14.219 -5.107  -2.722  1.00 0.00 ? 27 LEU B CG   2  
ATOM 4819  C CD1  . LEU B 1 28 ? -14.528 -6.013  -1.522  1.00 0.00 ? 27 LEU B CD1  2  
ATOM 4820  C CD2  . LEU B 1 28 ? -13.525 -3.838  -2.217  1.00 0.00 ? 27 LEU B CD2  2  
ATOM 4821  H H    . LEU B 1 28 ? -12.488 -7.605  -5.761  1.00 0.00 ? 27 LEU B H    2  
ATOM 4822  H HA   . LEU B 1 28 ? -14.971 -7.143  -4.129  1.00 0.00 ? 27 LEU B HA   2  
ATOM 4823  H HB2  . LEU B 1 28 ? -12.593 -6.455  -3.185  1.00 0.00 ? 27 LEU B HB2  2  
ATOM 4824  H HB3  . LEU B 1 28 ? -12.751 -5.109  -4.308  1.00 0.00 ? 27 LEU B HB3  2  
ATOM 4825  H HG   . LEU B 1 28 ? -15.144 -4.837  -3.213  1.00 0.00 ? 27 LEU B HG   2  
ATOM 4826  H HD11 . LEU B 1 28 ? -13.606 -6.388  -1.103  1.00 0.00 ? 27 LEU B HD11 2  
ATOM 4827  H HD12 . LEU B 1 28 ? -15.057 -5.445  -0.771  1.00 0.00 ? 27 LEU B HD12 2  
ATOM 4828  H HD13 . LEU B 1 28 ? -15.142 -6.842  -1.840  1.00 0.00 ? 27 LEU B HD13 2  
ATOM 4829  H HD21 . LEU B 1 28 ? -12.575 -4.099  -1.774  1.00 0.00 ? 27 LEU B HD21 2  
ATOM 4830  H HD22 . LEU B 1 28 ? -13.362 -3.165  -3.045  1.00 0.00 ? 27 LEU B HD22 2  
ATOM 4831  H HD23 . LEU B 1 28 ? -14.147 -3.356  -1.477  1.00 0.00 ? 27 LEU B HD23 2  
ATOM 4832  N N    . LYS B 1 29 ? -15.891 -5.467  -5.786  1.00 0.00 ? 28 LYS B N    2  
ATOM 4833  C CA   . LYS B 1 29 ? -16.449 -4.657  -6.912  1.00 0.00 ? 28 LYS B CA   2  
ATOM 4834  C C    . LYS B 1 29 ? -16.184 -3.170  -6.651  1.00 0.00 ? 28 LYS B C    2  
ATOM 4835  O O    . LYS B 1 29 ? -16.134 -2.729  -5.520  1.00 0.00 ? 28 LYS B O    2  
ATOM 4836  C CB   . LYS B 1 29 ? -17.955 -4.905  -7.024  1.00 0.00 ? 28 LYS B CB   2  
ATOM 4837  C CG   . LYS B 1 29 ? -18.201 -6.390  -7.314  1.00 0.00 ? 28 LYS B CG   2  
ATOM 4838  C CD   . LYS B 1 29 ? -19.666 -6.620  -7.715  1.00 0.00 ? 28 LYS B CD   2  
ATOM 4839  C CE   . LYS B 1 29 ? -20.571 -6.553  -6.479  1.00 0.00 ? 28 LYS B CE   2  
ATOM 4840  N NZ   . LYS B 1 29 ? -20.077 -7.502  -5.442  1.00 0.00 ? 28 LYS B NZ   2  
ATOM 4841  H H    . LYS B 1 29 ? -16.451 -5.681  -5.011  1.00 0.00 ? 28 LYS B H    2  
ATOM 4842  H HA   . LYS B 1 29 ? -15.963 -4.961  -7.830  1.00 0.00 ? 28 LYS B HA   2  
ATOM 4843  H HB2  . LYS B 1 29 ? -18.434 -4.631  -6.096  1.00 0.00 ? 28 LYS B HB2  2  
ATOM 4844  H HB3  . LYS B 1 29 ? -18.358 -4.308  -7.829  1.00 0.00 ? 28 LYS B HB3  2  
ATOM 4845  H HG2  . LYS B 1 29 ? -17.557 -6.705  -8.123  1.00 0.00 ? 28 LYS B HG2  2  
ATOM 4846  H HG3  . LYS B 1 29 ? -17.975 -6.969  -6.433  1.00 0.00 ? 28 LYS B HG3  2  
ATOM 4847  H HD2  . LYS B 1 29 ? -19.971 -5.864  -8.423  1.00 0.00 ? 28 LYS B HD2  2  
ATOM 4848  H HD3  . LYS B 1 29 ? -19.761 -7.594  -8.172  1.00 0.00 ? 28 LYS B HD3  2  
ATOM 4849  H HE2  . LYS B 1 29 ? -20.568 -5.550  -6.082  1.00 0.00 ? 28 LYS B HE2  2  
ATOM 4850  H HE3  . LYS B 1 29 ? -21.579 -6.823  -6.760  1.00 0.00 ? 28 LYS B HE3  2  
ATOM 4851  H HZ1  . LYS B 1 29 ? -19.964 -8.447  -5.863  1.00 0.00 ? 28 LYS B HZ1  2  
ATOM 4852  H HZ2  . LYS B 1 29 ? -19.161 -7.172  -5.078  1.00 0.00 ? 28 LYS B HZ2  2  
ATOM 4853  H HZ3  . LYS B 1 29 ? -20.761 -7.549  -4.660  1.00 0.00 ? 28 LYS B HZ3  2  
ATOM 4854  N N    . LYS B 1 30 ? -16.007 -2.397  -7.686  1.00 0.00 ? 29 LYS B N    2  
ATOM 4855  C CA   . LYS B 1 30 ? -15.738 -0.938  -7.505  1.00 0.00 ? 29 LYS B CA   2  
ATOM 4856  C C    . LYS B 1 30 ? -16.847 -0.281  -6.673  1.00 0.00 ? 29 LYS B C    2  
ATOM 4857  O O    . LYS B 1 30 ? -16.593 0.542   -5.816  1.00 0.00 ? 29 LYS B O    2  
ATOM 4858  C CB   . LYS B 1 30 ? -15.692 -0.274  -8.886  1.00 0.00 ? 29 LYS B CB   2  
ATOM 4859  C CG   . LYS B 1 30 ? -17.105 -0.244  -9.494  1.00 0.00 ? 29 LYS B CG   2  
ATOM 4860  C CD   . LYS B 1 30 ? -17.026 -0.007  -11.007 1.00 0.00 ? 29 LYS B CD   2  
ATOM 4861  C CE   . LYS B 1 30 ? -18.367 0.528   -11.516 1.00 0.00 ? 29 LYS B CE   2  
ATOM 4862  N NZ   . LYS B 1 30 ? -19.474 -0.299  -10.957 1.00 0.00 ? 29 LYS B NZ   2  
ATOM 4863  H H    . LYS B 1 30 ? -16.044 -2.772  -8.593  1.00 0.00 ? 29 LYS B H    2  
ATOM 4864  H HA   . LYS B 1 30 ? -14.787 -0.802  -7.014  1.00 0.00 ? 29 LYS B HA   2  
ATOM 4865  H HB2  . LYS B 1 30 ? -15.321 0.736   -8.786  1.00 0.00 ? 29 LYS B HB2  2  
ATOM 4866  H HB3  . LYS B 1 30 ? -15.037 -0.836  -9.531  1.00 0.00 ? 29 LYS B HB3  2  
ATOM 4867  H HG2  . LYS B 1 30 ? -17.595 -1.188  -9.308  1.00 0.00 ? 29 LYS B HG2  2  
ATOM 4868  H HG3  . LYS B 1 30 ? -17.672 0.552   -9.033  1.00 0.00 ? 29 LYS B HG3  2  
ATOM 4869  H HD2  . LYS B 1 30 ? -16.248 0.710   -11.223 1.00 0.00 ? 29 LYS B HD2  2  
ATOM 4870  H HD3  . LYS B 1 30 ? -16.806 -0.939  -11.502 1.00 0.00 ? 29 LYS B HD3  2  
ATOM 4871  H HE2  . LYS B 1 30 ? -18.489 1.553   -11.201 1.00 0.00 ? 29 LYS B HE2  2  
ATOM 4872  H HE3  . LYS B 1 30 ? -18.389 0.477   -12.595 1.00 0.00 ? 29 LYS B HE3  2  
ATOM 4873  H HZ1  . LYS B 1 30 ? -19.411 -0.307  -9.919  1.00 0.00 ? 29 LYS B HZ1  2  
ATOM 4874  H HZ2  . LYS B 1 30 ? -20.388 0.105   -11.243 1.00 0.00 ? 29 LYS B HZ2  2  
ATOM 4875  H HZ3  . LYS B 1 30 ? -19.396 -1.272  -11.317 1.00 0.00 ? 29 LYS B HZ3  2  
ATOM 4876  N N    . SER B 1 31 ? -18.074 -0.623  -6.942  1.00 0.00 ? 30 SER B N    2  
ATOM 4877  C CA   . SER B 1 31 ? -19.212 -0.007  -6.200  1.00 0.00 ? 30 SER B CA   2  
ATOM 4878  C C    . SER B 1 31 ? -19.042 -0.200  -4.692  1.00 0.00 ? 30 SER B C    2  
ATOM 4879  O O    . SER B 1 31 ? -19.342 0.681   -3.903  1.00 0.00 ? 30 SER B O    2  
ATOM 4880  C CB   . SER B 1 31 ? -20.518 -0.665  -6.647  1.00 0.00 ? 30 SER B CB   2  
ATOM 4881  O OG   . SER B 1 31 ? -20.576 -1.990  -6.134  1.00 0.00 ? 30 SER B OG   2  
ATOM 4882  H H    . SER B 1 31 ? -18.250 -1.270  -7.654  1.00 0.00 ? 30 SER B H    2  
ATOM 4883  H HA   . SER B 1 31 ? -19.253 1.048   -6.423  1.00 0.00 ? 30 SER B HA   2  
ATOM 4884  H HB2  . SER B 1 31 ? -21.355 -0.103  -6.269  1.00 0.00 ? 30 SER B HB2  2  
ATOM 4885  H HB3  . SER B 1 31 ? -20.559 -0.684  -7.729  1.00 0.00 ? 30 SER B HB3  2  
ATOM 4886  H HG   . SER B 1 31 ? -21.498 -2.208  -5.978  1.00 0.00 ? 30 SER B HG   2  
ATOM 4887  N N    . GLU B 1 32 ? -18.554 -1.338  -4.275  1.00 0.00 ? 31 GLU B N    2  
ATOM 4888  C CA   . GLU B 1 32 ? -18.374 -1.558  -2.810  1.00 0.00 ? 31 GLU B CA   2  
ATOM 4889  C C    . GLU B 1 32 ? -17.067 -0.901  -2.375  1.00 0.00 ? 31 GLU B C    2  
ATOM 4890  O O    . GLU B 1 32 ? -16.941 -0.404  -1.274  1.00 0.00 ? 31 GLU B O    2  
ATOM 4891  C CB   . GLU B 1 32 ? -18.354 -3.054  -2.493  1.00 0.00 ? 31 GLU B CB   2  
ATOM 4892  C CG   . GLU B 1 32 ? -19.669 -3.689  -2.950  1.00 0.00 ? 31 GLU B CG   2  
ATOM 4893  C CD   . GLU B 1 32 ? -19.672 -5.176  -2.591  1.00 0.00 ? 31 GLU B CD   2  
ATOM 4894  O OE1  . GLU B 1 32 ? -20.028 -5.494  -1.469  1.00 0.00 ? 31 GLU B OE1  2  
ATOM 4895  O OE2  . GLU B 1 32 ? -19.319 -5.972  -3.446  1.00 0.00 ? 31 GLU B OE2  2  
ATOM 4896  H H    . GLU B 1 32 ? -18.294 -2.021  -4.928  1.00 0.00 ? 31 GLU B H    2  
ATOM 4897  H HA   . GLU B 1 32 ? -19.207 -1.079  -2.311  1.00 0.00 ? 31 GLU B HA   2  
ATOM 4898  H HB2  . GLU B 1 32 ? -17.528 -3.520  -3.010  1.00 0.00 ? 31 GLU B HB2  2  
ATOM 4899  H HB3  . GLU B 1 32 ? -18.239 -3.195  -1.429  1.00 0.00 ? 31 GLU B HB3  2  
ATOM 4900  H HG2  . GLU B 1 32 ? -20.496 -3.198  -2.456  1.00 0.00 ? 31 GLU B HG2  2  
ATOM 4901  H HG3  . GLU B 1 32 ? -19.772 -3.578  -4.018  1.00 0.00 ? 31 GLU B HG3  2  
ATOM 4902  N N    . LEU B 1 33 ? -16.097 -0.875  -3.251  1.00 0.00 ? 32 LEU B N    2  
ATOM 4903  C CA   . LEU B 1 33 ? -14.804 -0.227  -2.907  1.00 0.00 ? 32 LEU B CA   2  
ATOM 4904  C C    . LEU B 1 33 ? -15.075 1.256   -2.639  1.00 0.00 ? 32 LEU B C    2  
ATOM 4905  O O    . LEU B 1 33 ? -14.605 1.810   -1.668  1.00 0.00 ? 32 LEU B O    2  
ATOM 4906  C CB   . LEU B 1 33 ? -13.812 -0.398  -4.072  1.00 0.00 ? 32 LEU B CB   2  
ATOM 4907  C CG   . LEU B 1 33 ? -12.366 -0.365  -3.556  1.00 0.00 ? 32 LEU B CG   2  
ATOM 4908  C CD1  . LEU B 1 33 ? -11.410 -0.634  -4.723  1.00 0.00 ? 32 LEU B CD1  2  
ATOM 4909  C CD2  . LEU B 1 33 ? -12.057 1.010   -2.942  1.00 0.00 ? 32 LEU B CD2  2  
ATOM 4910  H H    . LEU B 1 33 ? -16.228 -1.267  -4.139  1.00 0.00 ? 32 LEU B H    2  
ATOM 4911  H HA   . LEU B 1 33 ? -14.408 -0.670  -2.004  1.00 0.00 ? 32 LEU B HA   2  
ATOM 4912  H HB2  . LEU B 1 33 ? -13.993 -1.348  -4.554  1.00 0.00 ? 32 LEU B HB2  2  
ATOM 4913  H HB3  . LEU B 1 33 ? -13.953 0.397   -4.791  1.00 0.00 ? 32 LEU B HB3  2  
ATOM 4914  H HG   . LEU B 1 33 ? -12.236 -1.131  -2.807  1.00 0.00 ? 32 LEU B HG   2  
ATOM 4915  H HD11 . LEU B 1 33 ? -11.631 -1.600  -5.154  1.00 0.00 ? 32 LEU B HD11 2  
ATOM 4916  H HD12 . LEU B 1 33 ? -11.534 0.132   -5.475  1.00 0.00 ? 32 LEU B HD12 2  
ATOM 4917  H HD13 . LEU B 1 33 ? -10.392 -0.624  -4.364  1.00 0.00 ? 32 LEU B HD13 2  
ATOM 4918  H HD21 . LEU B 1 33 ? -12.542 1.785   -3.518  1.00 0.00 ? 32 LEU B HD21 2  
ATOM 4919  H HD22 . LEU B 1 33 ? -12.419 1.037   -1.926  1.00 0.00 ? 32 LEU B HD22 2  
ATOM 4920  H HD23 . LEU B 1 33 ? -10.989 1.179   -2.942  1.00 0.00 ? 32 LEU B HD23 2  
ATOM 4921  N N    . LYS B 1 34 ? -15.816 1.920   -3.487  1.00 0.00 ? 33 LYS B N    2  
ATOM 4922  C CA   . LYS B 1 34 ? -16.070 3.364   -3.242  1.00 0.00 ? 33 LYS B CA   2  
ATOM 4923  C C    . LYS B 1 34 ? -16.605 3.532   -1.824  1.00 0.00 ? 33 LYS B C    2  
ATOM 4924  O O    . LYS B 1 34 ? -16.045 4.244   -1.015  1.00 0.00 ? 33 LYS B O    2  
ATOM 4925  C CB   . LYS B 1 34 ? -17.100 3.886   -4.247  1.00 0.00 ? 33 LYS B CB   2  
ATOM 4926  C CG   . LYS B 1 34 ? -17.228 5.404   -4.107  1.00 0.00 ? 33 LYS B CG   2  
ATOM 4927  C CD   . LYS B 1 34 ? -18.321 5.915   -5.049  1.00 0.00 ? 33 LYS B CD   2  
ATOM 4928  C CE   . LYS B 1 34 ? -18.721 7.335   -4.646  1.00 0.00 ? 33 LYS B CE   2  
ATOM 4929  N NZ   . LYS B 1 34 ? -17.496 8.163   -4.462  1.00 0.00 ? 33 LYS B NZ   2  
ATOM 4930  H H    . LYS B 1 34 ? -16.185 1.487   -4.283  1.00 0.00 ? 33 LYS B H    2  
ATOM 4931  H HA   . LYS B 1 34 ? -15.141 3.902   -3.359  1.00 0.00 ? 33 LYS B HA   2  
ATOM 4932  H HB2  . LYS B 1 34 ? -16.782 3.640   -5.250  1.00 0.00 ? 33 LYS B HB2  2  
ATOM 4933  H HB3  . LYS B 1 34 ? -18.057 3.427   -4.050  1.00 0.00 ? 33 LYS B HB3  2  
ATOM 4934  H HG2  . LYS B 1 34 ? -17.485 5.650   -3.087  1.00 0.00 ? 33 LYS B HG2  2  
ATOM 4935  H HG3  . LYS B 1 34 ? -16.288 5.869   -4.364  1.00 0.00 ? 33 LYS B HG3  2  
ATOM 4936  H HD2  . LYS B 1 34 ? -17.950 5.918   -6.064  1.00 0.00 ? 33 LYS B HD2  2  
ATOM 4937  H HD3  . LYS B 1 34 ? -19.184 5.269   -4.984  1.00 0.00 ? 33 LYS B HD3  2  
ATOM 4938  H HE2  . LYS B 1 34 ? -19.337 7.769   -5.420  1.00 0.00 ? 33 LYS B HE2  2  
ATOM 4939  H HE3  . LYS B 1 34 ? -19.276 7.302   -3.720  1.00 0.00 ? 33 LYS B HE3  2  
ATOM 4940  H HZ1  . LYS B 1 34 ? -16.727 7.781   -5.047  1.00 0.00 ? 33 LYS B HZ1  2  
ATOM 4941  H HZ2  . LYS B 1 34 ? -17.696 9.144   -4.748  1.00 0.00 ? 33 LYS B HZ2  2  
ATOM 4942  H HZ3  . LYS B 1 34 ? -17.211 8.144   -3.463  1.00 0.00 ? 33 LYS B HZ3  2  
ATOM 4943  N N    . GLU B 1 35 ? -17.692 2.878   -1.520  1.00 0.00 ? 34 GLU B N    2  
ATOM 4944  C CA   . GLU B 1 35 ? -18.267 3.001   -0.148  1.00 0.00 ? 34 GLU B CA   2  
ATOM 4945  C C    . GLU B 1 35 ? -17.155 2.782   0.885   1.00 0.00 ? 34 GLU B C    2  
ATOM 4946  O O    . GLU B 1 35 ? -17.128 3.416   1.921   1.00 0.00 ? 34 GLU B O    2  
ATOM 4947  C CB   . GLU B 1 35 ? -19.360 1.948   0.045   1.00 0.00 ? 34 GLU B CB   2  
ATOM 4948  C CG   . GLU B 1 35 ? -20.549 2.276   -0.859  1.00 0.00 ? 34 GLU B CG   2  
ATOM 4949  C CD   . GLU B 1 35 ? -21.575 1.144   -0.783  1.00 0.00 ? 34 GLU B CD   2  
ATOM 4950  O OE1  . GLU B 1 35 ? -21.233 0.035   -1.160  1.00 0.00 ? 34 GLU B OE1  2  
ATOM 4951  O OE2  . GLU B 1 35 ? -22.685 1.405   -0.349  1.00 0.00 ? 34 GLU B OE2  2  
ATOM 4952  H H    . GLU B 1 35 ? -18.132 2.321   -2.199  1.00 0.00 ? 34 GLU B H    2  
ATOM 4953  H HA   . GLU B 1 35 ? -18.687 3.988   -0.021  1.00 0.00 ? 34 GLU B HA   2  
ATOM 4954  H HB2  . GLU B 1 35 ? -18.970 0.973   -0.210  1.00 0.00 ? 34 GLU B HB2  2  
ATOM 4955  H HB3  . GLU B 1 35 ? -19.683 1.948   1.076   1.00 0.00 ? 34 GLU B HB3  2  
ATOM 4956  H HG2  . GLU B 1 35 ? -21.006 3.199   -0.531  1.00 0.00 ? 34 GLU B HG2  2  
ATOM 4957  H HG3  . GLU B 1 35 ? -20.209 2.384   -1.877  1.00 0.00 ? 34 GLU B HG3  2  
ATOM 4958  N N    . LEU B 1 36 ? -16.235 1.896   0.612   1.00 0.00 ? 35 LEU B N    2  
ATOM 4959  C CA   . LEU B 1 36 ? -15.128 1.652   1.583   1.00 0.00 ? 35 LEU B CA   2  
ATOM 4960  C C    . LEU B 1 36 ? -14.227 2.891   1.653   1.00 0.00 ? 35 LEU B C    2  
ATOM 4961  O O    . LEU B 1 36 ? -13.785 3.277   2.716   1.00 0.00 ? 35 LEU B O    2  
ATOM 4962  C CB   . LEU B 1 36 ? -14.317 0.424   1.147   1.00 0.00 ? 35 LEU B CB   2  
ATOM 4963  C CG   . LEU B 1 36 ? -13.215 0.118   2.170   1.00 0.00 ? 35 LEU B CG   2  
ATOM 4964  C CD1  . LEU B 1 36 ? -13.832 -0.226  3.538   1.00 0.00 ? 35 LEU B CD1  2  
ATOM 4965  C CD2  . LEU B 1 36 ? -12.390 -1.070  1.663   1.00 0.00 ? 35 LEU B CD2  2  
ATOM 4966  H H    . LEU B 1 36 ? -16.267 1.400   -0.232  1.00 0.00 ? 35 LEU B H    2  
ATOM 4967  H HA   . LEU B 1 36 ? -15.539 1.486   2.566   1.00 0.00 ? 35 LEU B HA   2  
ATOM 4968  H HB2  . LEU B 1 36 ? -14.976 -0.428  1.067   1.00 0.00 ? 35 LEU B HB2  2  
ATOM 4969  H HB3  . LEU B 1 36 ? -13.865 0.615   0.187   1.00 0.00 ? 35 LEU B HB3  2  
ATOM 4970  H HG   . LEU B 1 36 ? -12.573 0.980   2.274   1.00 0.00 ? 35 LEU B HG   2  
ATOM 4971  H HD11 . LEU B 1 36 ? -14.770 -0.743  3.397   1.00 0.00 ? 35 LEU B HD11 2  
ATOM 4972  H HD12 . LEU B 1 36 ? -13.156 -0.858  4.097   1.00 0.00 ? 35 LEU B HD12 2  
ATOM 4973  H HD13 . LEU B 1 36 ? -14.004 0.685   4.093   1.00 0.00 ? 35 LEU B HD13 2  
ATOM 4974  H HD21 . LEU B 1 36 ? -13.046 -1.904  1.461   1.00 0.00 ? 35 LEU B HD21 2  
ATOM 4975  H HD22 . LEU B 1 36 ? -11.876 -0.789  0.755   1.00 0.00 ? 35 LEU B HD22 2  
ATOM 4976  H HD23 . LEU B 1 36 ? -11.667 -1.353  2.413   1.00 0.00 ? 35 LEU B HD23 2  
ATOM 4977  N N    . ILE B 1 37 ? -13.971 3.539   0.550   1.00 0.00 ? 36 ILE B N    2  
ATOM 4978  C CA   . ILE B 1 37 ? -13.124 4.767   0.586   1.00 0.00 ? 36 ILE B CA   2  
ATOM 4979  C C    . ILE B 1 37 ? -13.782 5.808   1.498   1.00 0.00 ? 36 ILE B C    2  
ATOM 4980  O O    . ILE B 1 37 ? -13.125 6.488   2.262   1.00 0.00 ? 36 ILE B O    2  
ATOM 4981  C CB   . ILE B 1 37 ? -13.014 5.336   -0.838  1.00 0.00 ? 36 ILE B CB   2  
ATOM 4982  C CG1  . ILE B 1 37 ? -12.111 4.415   -1.669  1.00 0.00 ? 36 ILE B CG1  2  
ATOM 4983  C CG2  . ILE B 1 37 ? -12.405 6.746   -0.789  1.00 0.00 ? 36 ILE B CG2  2  
ATOM 4984  C CD1  . ILE B 1 37 ? -12.123 4.848   -3.138  1.00 0.00 ? 36 ILE B CD1  2  
ATOM 4985  H H    . ILE B 1 37 ? -14.344 3.242   -0.306  1.00 0.00 ? 36 ILE B H    2  
ATOM 4986  H HA   . ILE B 1 37 ? -12.128 4.543   0.941   1.00 0.00 ? 36 ILE B HA   2  
ATOM 4987  H HB   . ILE B 1 37 ? -13.997 5.382   -1.284  1.00 0.00 ? 36 ILE B HB   2  
ATOM 4988  H HG12 . ILE B 1 37 ? -11.102 4.467   -1.288  1.00 0.00 ? 36 ILE B HG12 2  
ATOM 4989  H HG13 . ILE B 1 37 ? -12.470 3.399   -1.594  1.00 0.00 ? 36 ILE B HG13 2  
ATOM 4990  H HG21 . ILE B 1 37 ? -11.571 6.753   -0.104  1.00 0.00 ? 36 ILE B HG21 2  
ATOM 4991  H HG22 . ILE B 1 37 ? -12.066 7.034   -1.772  1.00 0.00 ? 36 ILE B HG22 2  
ATOM 4992  H HG23 . ILE B 1 37 ? -13.152 7.447   -0.448  1.00 0.00 ? 36 ILE B HG23 2  
ATOM 4993  H HD11 . ILE B 1 37 ? -13.130 5.099   -3.435  1.00 0.00 ? 36 ILE B HD11 2  
ATOM 4994  H HD12 . ILE B 1 37 ? -11.484 5.711   -3.263  1.00 0.00 ? 36 ILE B HD12 2  
ATOM 4995  H HD13 . ILE B 1 37 ? -11.757 4.039   -3.753  1.00 0.00 ? 36 ILE B HD13 2  
ATOM 4996  N N    . ASN B 1 38 ? -15.073 5.958   1.392   1.00 0.00 ? 37 ASN B N    2  
ATOM 4997  C CA   . ASN B 1 38 ? -15.787 6.978   2.213   1.00 0.00 ? 37 ASN B CA   2  
ATOM 4998  C C    . ASN B 1 38 ? -15.589 6.725   3.712   1.00 0.00 ? 37 ASN B C    2  
ATOM 4999  O O    . ASN B 1 38 ? -15.409 7.645   4.485   1.00 0.00 ? 37 ASN B O    2  
ATOM 5000  C CB   . ASN B 1 38 ? -17.282 6.916   1.894   1.00 0.00 ? 37 ASN B CB   2  
ATOM 5001  C CG   . ASN B 1 38 ? -17.504 7.217   0.411   1.00 0.00 ? 37 ASN B CG   2  
ATOM 5002  O OD1  . ASN B 1 38 ? -18.102 6.430   -0.297  1.00 0.00 ? 37 ASN B OD1  2  
ATOM 5003  N ND2  . ASN B 1 38 ? -17.047 8.330   -0.094  1.00 0.00 ? 37 ASN B ND2  2  
ATOM 5004  H H    . ASN B 1 38 ? -15.575 5.415   0.748   1.00 0.00 ? 37 ASN B H    2  
ATOM 5005  H HA   . ASN B 1 38 ? -15.416 7.958   1.949   1.00 0.00 ? 37 ASN B HA   2  
ATOM 5006  H HB2  . ASN B 1 38 ? -17.657 5.929   2.123   1.00 0.00 ? 37 ASN B HB2  2  
ATOM 5007  H HB3  . ASN B 1 38 ? -17.807 7.648   2.490   1.00 0.00 ? 37 ASN B HB3  2  
ATOM 5008  H HD21 . ASN B 1 38 ? -16.565 8.965   0.476   1.00 0.00 ? 37 ASN B HD21 2  
ATOM 5009  H HD22 . ASN B 1 38 ? -17.187 8.532   -1.043  1.00 0.00 ? 37 ASN B HD22 2  
ATOM 5010  N N    . ASN B 1 39 ? -15.656 5.488   4.134   1.00 0.00 ? 38 ASN B N    2  
ATOM 5011  C CA   . ASN B 1 39 ? -15.512 5.172   5.593   1.00 0.00 ? 38 ASN B CA   2  
ATOM 5012  C C    . ASN B 1 39 ? -14.101 4.669   5.919   1.00 0.00 ? 38 ASN B C    2  
ATOM 5013  O O    . ASN B 1 39 ? -13.830 4.294   7.043   1.00 0.00 ? 38 ASN B O    2  
ATOM 5014  C CB   . ASN B 1 39 ? -16.521 4.081   5.960   1.00 0.00 ? 38 ASN B CB   2  
ATOM 5015  C CG   . ASN B 1 39 ? -17.936 4.560   5.627   1.00 0.00 ? 38 ASN B CG   2  
ATOM 5016  O OD1  . ASN B 1 39 ? -18.148 5.219   4.629   1.00 0.00 ? 38 ASN B OD1  2  
ATOM 5017  N ND2  . ASN B 1 39 ? -18.920 4.255   6.428   1.00 0.00 ? 38 ASN B ND2  2  
ATOM 5018  H H    . ASN B 1 39 ? -15.829 4.765   3.496   1.00 0.00 ? 38 ASN B H    2  
ATOM 5019  H HA   . ASN B 1 39 ? -15.723 6.051   6.185   1.00 0.00 ? 38 ASN B HA   2  
ATOM 5020  H HB2  . ASN B 1 39 ? -16.302 3.186   5.396   1.00 0.00 ? 38 ASN B HB2  2  
ATOM 5021  H HB3  . ASN B 1 39 ? -16.454 3.868   7.016   1.00 0.00 ? 38 ASN B HB3  2  
ATOM 5022  H HD21 . ASN B 1 39 ? -18.749 3.723   7.233   1.00 0.00 ? 38 ASN B HD21 2  
ATOM 5023  H HD22 . ASN B 1 39 ? -19.829 4.558   6.224   1.00 0.00 ? 38 ASN B HD22 2  
ATOM 5024  N N    . GLU B 1 40 ? -13.203 4.638   4.962   1.00 0.00 ? 39 GLU B N    2  
ATOM 5025  C CA   . GLU B 1 40 ? -11.813 4.132   5.243   1.00 0.00 ? 39 GLU B CA   2  
ATOM 5026  C C    . GLU B 1 40 ? -10.784 5.254   5.073   1.00 0.00 ? 39 GLU B C    2  
ATOM 5027  O O    . GLU B 1 40 ? -9.761  5.258   5.729   1.00 0.00 ? 39 GLU B O    2  
ATOM 5028  C CB   . GLU B 1 40 ? -11.487 3.004   4.260   1.00 0.00 ? 39 GLU B CB   2  
ATOM 5029  C CG   . GLU B 1 40 ? -10.198 2.295   4.689   1.00 0.00 ? 39 GLU B CG   2  
ATOM 5030  C CD   . GLU B 1 40 ? -10.484 1.399   5.895   1.00 0.00 ? 39 GLU B CD   2  
ATOM 5031  O OE1  . GLU B 1 40 ? -10.983 0.305   5.690   1.00 0.00 ? 39 GLU B OE1  2  
ATOM 5032  O OE2  . GLU B 1 40 ? -10.200 1.822   7.004   1.00 0.00 ? 39 GLU B OE2  2  
ATOM 5033  H H    . GLU B 1 40 ? -13.442 4.933   4.058   1.00 0.00 ? 39 GLU B H    2  
ATOM 5034  H HA   . GLU B 1 40 ? -11.749 3.747   6.251   1.00 0.00 ? 39 GLU B HA   2  
ATOM 5035  H HB2  . GLU B 1 40 ? -12.300 2.292   4.249   1.00 0.00 ? 39 GLU B HB2  2  
ATOM 5036  H HB3  . GLU B 1 40 ? -11.357 3.415   3.271   1.00 0.00 ? 39 GLU B HB3  2  
ATOM 5037  H HG2  . GLU B 1 40 ? -9.832  1.692   3.871   1.00 0.00 ? 39 GLU B HG2  2  
ATOM 5038  H HG3  . GLU B 1 40 ? -9.453  3.028   4.957   1.00 0.00 ? 39 GLU B HG3  2  
ATOM 5039  N N    . LEU B 1 41 ? -11.044 6.206   4.209   1.00 0.00 ? 40 LEU B N    2  
ATOM 5040  C CA   . LEU B 1 41 ? -10.076 7.336   3.999   1.00 0.00 ? 40 LEU B CA   2  
ATOM 5041  C C    . LEU B 1 41 ? -10.766 8.668   4.308   1.00 0.00 ? 40 LEU B C    2  
ATOM 5042  O O    . LEU B 1 41 ? -10.602 9.643   3.602   1.00 0.00 ? 40 LEU B O    2  
ATOM 5043  C CB   . LEU B 1 41 ? -9.601  7.335   2.542   1.00 0.00 ? 40 LEU B CB   2  
ATOM 5044  C CG   . LEU B 1 41 ? -9.003  5.965   2.189   1.00 0.00 ? 40 LEU B CG   2  
ATOM 5045  C CD1  . LEU B 1 41 ? -8.551  5.968   0.724   1.00 0.00 ? 40 LEU B CD1  2  
ATOM 5046  C CD2  . LEU B 1 41 ? -7.797  5.666   3.097   1.00 0.00 ? 40 LEU B CD2  2  
ATOM 5047  H H    . LEU B 1 41 ? -11.879 6.181   3.697   1.00 0.00 ? 40 LEU B H    2  
ATOM 5048  H HA   . LEU B 1 41 ? -9.222  7.227   4.652   1.00 0.00 ? 40 LEU B HA   2  
ATOM 5049  H HB2  . LEU B 1 41 ? -10.439 7.539   1.892   1.00 0.00 ? 40 LEU B HB2  2  
ATOM 5050  H HB3  . LEU B 1 41 ? -8.849  8.098   2.410   1.00 0.00 ? 40 LEU B HB3  2  
ATOM 5051  H HG   . LEU B 1 41 ? -9.756  5.201   2.327   1.00 0.00 ? 40 LEU B HG   2  
ATOM 5052  H HD11 . LEU B 1 41 ? -8.029  6.889   0.509   1.00 0.00 ? 40 LEU B HD11 2  
ATOM 5053  H HD12 . LEU B 1 41 ? -7.891  5.131   0.548   1.00 0.00 ? 40 LEU B HD12 2  
ATOM 5054  H HD13 . LEU B 1 41 ? -9.413  5.885   0.080   1.00 0.00 ? 40 LEU B HD13 2  
ATOM 5055  H HD21 . LEU B 1 41 ? -7.238  6.574   3.272   1.00 0.00 ? 40 LEU B HD21 2  
ATOM 5056  H HD22 . LEU B 1 41 ? -8.144  5.270   4.039   1.00 0.00 ? 40 LEU B HD22 2  
ATOM 5057  H HD23 . LEU B 1 41 ? -7.156  4.936   2.622   1.00 0.00 ? 40 LEU B HD23 2  
ATOM 5058  N N    . SER B 1 42 ? -11.538 8.714   5.360   1.00 0.00 ? 41 SER B N    2  
ATOM 5059  C CA   . SER B 1 42 ? -12.242 9.979   5.722   1.00 0.00 ? 41 SER B CA   2  
ATOM 5060  C C    . SER B 1 42 ? -11.245 10.992  6.290   1.00 0.00 ? 41 SER B C    2  
ATOM 5061  O O    . SER B 1 42 ? -11.401 12.185  6.123   1.00 0.00 ? 41 SER B O    2  
ATOM 5062  C CB   . SER B 1 42 ? -13.310 9.682   6.775   1.00 0.00 ? 41 SER B CB   2  
ATOM 5063  O OG   . SER B 1 42 ? -12.677 9.291   7.987   1.00 0.00 ? 41 SER B OG   2  
ATOM 5064  H H    . SER B 1 42 ? -11.656 7.915   5.915   1.00 0.00 ? 41 SER B H    2  
ATOM 5065  H HA   . SER B 1 42 ? -12.714 10.393  4.843   1.00 0.00 ? 41 SER B HA   2  
ATOM 5066  H HB2  . SER B 1 42 ? -13.899 10.566  6.952   1.00 0.00 ? 41 SER B HB2  2  
ATOM 5067  H HB3  . SER B 1 42 ? -13.954 8.888   6.421   1.00 0.00 ? 41 SER B HB3  2  
ATOM 5068  H HG   . SER B 1 42 ? -11.734 9.229   7.823   1.00 0.00 ? 41 SER B HG   2  
ATOM 5069  N N    . HIS B 1 43 ? -10.228 10.536  6.971   1.00 0.00 ? 42 HIS B N    2  
ATOM 5070  C CA   . HIS B 1 43 ? -9.240  11.488  7.554   1.00 0.00 ? 42 HIS B CA   2  
ATOM 5071  C C    . HIS B 1 43 ? -8.468  12.191  6.435   1.00 0.00 ? 42 HIS B C    2  
ATOM 5072  O O    . HIS B 1 43 ? -8.355  13.401  6.413   1.00 0.00 ? 42 HIS B O    2  
ATOM 5073  C CB   . HIS B 1 43 ? -8.258  10.720  8.443   1.00 0.00 ? 42 HIS B CB   2  
ATOM 5074  C CG   . HIS B 1 43 ? -7.487  11.690  9.295   1.00 0.00 ? 42 HIS B CG   2  
ATOM 5075  N ND1  . HIS B 1 43 ? -6.102  11.741  9.288   1.00 0.00 ? 42 HIS B ND1  2  
ATOM 5076  C CD2  . HIS B 1 43 ? -7.893  12.652  10.186  1.00 0.00 ? 42 HIS B CD2  2  
ATOM 5077  C CE1  . HIS B 1 43 ? -5.727  12.704  10.151  1.00 0.00 ? 42 HIS B CE1  2  
ATOM 5078  N NE2  . HIS B 1 43 ? -6.781  13.291  10.725  1.00 0.00 ? 42 HIS B NE2  2  
ATOM 5079  H H    . HIS B 1 43 ? -10.115 9.572   7.108   1.00 0.00 ? 42 HIS B H    2  
ATOM 5080  H HA   . HIS B 1 43 ? -9.761  12.225  8.147   1.00 0.00 ? 42 HIS B HA   2  
ATOM 5081  H HB2  . HIS B 1 43 ? -8.806  10.040  9.079   1.00 0.00 ? 42 HIS B HB2  2  
ATOM 5082  H HB3  . HIS B 1 43 ? -7.573  10.162  7.824   1.00 0.00 ? 42 HIS B HB3  2  
ATOM 5083  H HD1  . HIS B 1 43 ? -5.504  11.180  8.752   1.00 0.00 ? 42 HIS B HD1  2  
ATOM 5084  H HD2  . HIS B 1 43 ? -8.920  12.879  10.431  1.00 0.00 ? 42 HIS B HD2  2  
ATOM 5085  H HE1  . HIS B 1 43 ? -4.701  12.969  10.354  1.00 0.00 ? 42 HIS B HE1  2  
ATOM 5086  N N    . PHE B 1 44 ? -7.931  11.446  5.508   1.00 0.00 ? 43 PHE B N    2  
ATOM 5087  C CA   . PHE B 1 44 ? -7.165  12.081  4.398   1.00 0.00 ? 43 PHE B CA   2  
ATOM 5088  C C    . PHE B 1 44 ? -8.116  12.931  3.548   1.00 0.00 ? 43 PHE B C    2  
ATOM 5089  O O    . PHE B 1 44 ? -7.718  13.912  2.954   1.00 0.00 ? 43 PHE B O    2  
ATOM 5090  C CB   . PHE B 1 44 ? -6.516  10.985  3.532   1.00 0.00 ? 43 PHE B CB   2  
ATOM 5091  C CG   . PHE B 1 44 ? -5.178  10.584  4.124   1.00 0.00 ? 43 PHE B CG   2  
ATOM 5092  C CD1  . PHE B 1 44 ? -5.114  10.072  5.427   1.00 0.00 ? 43 PHE B CD1  2  
ATOM 5093  C CD2  . PHE B 1 44 ? -4.002  10.730  3.374   1.00 0.00 ? 43 PHE B CD2  2  
ATOM 5094  C CE1  . PHE B 1 44 ? -3.879  9.707   5.976   1.00 0.00 ? 43 PHE B CE1  2  
ATOM 5095  C CE2  . PHE B 1 44 ? -2.769  10.364  3.924   1.00 0.00 ? 43 PHE B CE2  2  
ATOM 5096  C CZ   . PHE B 1 44 ? -2.707  9.853   5.225   1.00 0.00 ? 43 PHE B CZ   2  
ATOM 5097  H H    . PHE B 1 44 ? -8.029  10.472  5.542   1.00 0.00 ? 43 PHE B H    2  
ATOM 5098  H HA   . PHE B 1 44 ? -6.398  12.720  4.814   1.00 0.00 ? 43 PHE B HA   2  
ATOM 5099  H HB2  . PHE B 1 44 ? -7.165  10.122  3.503   1.00 0.00 ? 43 PHE B HB2  2  
ATOM 5100  H HB3  . PHE B 1 44 ? -6.368  11.354  2.527   1.00 0.00 ? 43 PHE B HB3  2  
ATOM 5101  H HD1  . PHE B 1 44 ? -6.017  9.959   6.007   1.00 0.00 ? 43 PHE B HD1  2  
ATOM 5102  H HD2  . PHE B 1 44 ? -4.049  11.125  2.369   1.00 0.00 ? 43 PHE B HD2  2  
ATOM 5103  H HE1  . PHE B 1 44 ? -3.830  9.312   6.981   1.00 0.00 ? 43 PHE B HE1  2  
ATOM 5104  H HE2  . PHE B 1 44 ? -1.865  10.477  3.344   1.00 0.00 ? 43 PHE B HE2  2  
ATOM 5105  H HZ   . PHE B 1 44 ? -1.754  9.572   5.649   1.00 0.00 ? 43 PHE B HZ   2  
ATOM 5106  N N    . LEU B 1 45 ? -9.364  12.557  3.476   1.00 0.00 ? 44 LEU B N    2  
ATOM 5107  C CA   . LEU B 1 45 ? -10.331 13.338  2.654   1.00 0.00 ? 44 LEU B CA   2  
ATOM 5108  C C    . LEU B 1 45 ? -10.218 14.828  3.009   1.00 0.00 ? 44 LEU B C    2  
ATOM 5109  O O    . LEU B 1 45 ? -10.505 15.691  2.204   1.00 0.00 ? 44 LEU B O    2  
ATOM 5110  C CB   . LEU B 1 45 ? -11.761 12.822  2.929   1.00 0.00 ? 44 LEU B CB   2  
ATOM 5111  C CG   . LEU B 1 45 ? -12.634 12.892  1.658   1.00 0.00 ? 44 LEU B CG   2  
ATOM 5112  C CD1  . LEU B 1 45 ? -12.641 14.323  1.109   1.00 0.00 ? 44 LEU B CD1  2  
ATOM 5113  C CD2  . LEU B 1 45 ? -12.106 11.917  0.578   1.00 0.00 ? 44 LEU B CD2  2  
ATOM 5114  H H    . LEU B 1 45 ? -9.664  11.757  3.957   1.00 0.00 ? 44 LEU B H    2  
ATOM 5115  H HA   . LEU B 1 45 ? -10.087 13.205  1.613   1.00 0.00 ? 44 LEU B HA   2  
ATOM 5116  H HB2  . LEU B 1 45 ? -11.706 11.797  3.263   1.00 0.00 ? 44 LEU B HB2  2  
ATOM 5117  H HB3  . LEU B 1 45 ? -12.221 13.418  3.707   1.00 0.00 ? 44 LEU B HB3  2  
ATOM 5118  H HG   . LEU B 1 45 ? -13.647 12.615  1.918   1.00 0.00 ? 44 LEU B HG   2  
ATOM 5119  H HD11 . LEU B 1 45 ? -12.736 15.023  1.926   1.00 0.00 ? 44 LEU B HD11 2  
ATOM 5120  H HD12 . LEU B 1 45 ? -11.721 14.510  0.577   1.00 0.00 ? 44 LEU B HD12 2  
ATOM 5121  H HD13 . LEU B 1 45 ? -13.475 14.444  0.434   1.00 0.00 ? 44 LEU B HD13 2  
ATOM 5122  H HD21 . LEU B 1 45 ? -11.585 11.094  1.046   1.00 0.00 ? 44 LEU B HD21 2  
ATOM 5123  H HD22 . LEU B 1 45 ? -12.941 11.532  0.012   1.00 0.00 ? 44 LEU B HD22 2  
ATOM 5124  H HD23 . LEU B 1 45 ? -11.431 12.432  -0.092  1.00 0.00 ? 44 LEU B HD23 2  
ATOM 5125  N N    . GLU B 1 46 ? -9.796  15.138  4.204   1.00 0.00 ? 45 GLU B N    2  
ATOM 5126  C CA   . GLU B 1 46 ? -9.665  16.571  4.596   1.00 0.00 ? 45 GLU B CA   2  
ATOM 5127  C C    . GLU B 1 46 ? -8.330  17.122  4.095   1.00 0.00 ? 45 GLU B C    2  
ATOM 5128  O O    . GLU B 1 46 ? -8.233  18.259  3.679   1.00 0.00 ? 45 GLU B O    2  
ATOM 5129  C CB   . GLU B 1 46 ? -9.725  16.694  6.120   1.00 0.00 ? 45 GLU B CB   2  
ATOM 5130  C CG   . GLU B 1 46 ? -9.927  18.162  6.504   1.00 0.00 ? 45 GLU B CG   2  
ATOM 5131  C CD   . GLU B 1 46 ? -9.628  18.349  7.993   1.00 0.00 ? 45 GLU B CD   2  
ATOM 5132  O OE1  . GLU B 1 46 ? -8.594  17.876  8.433   1.00 0.00 ? 45 GLU B OE1  2  
ATOM 5133  O OE2  . GLU B 1 46 ? -10.439 18.963  8.666   1.00 0.00 ? 45 GLU B OE2  2  
ATOM 5134  H H    . GLU B 1 46 ? -9.565  14.431  4.840   1.00 0.00 ? 45 GLU B H    2  
ATOM 5135  H HA   . GLU B 1 46 ? -10.472 17.137  4.161   1.00 0.00 ? 45 GLU B HA   2  
ATOM 5136  H HB2  . GLU B 1 46 ? -10.549 16.105  6.497   1.00 0.00 ? 45 GLU B HB2  2  
ATOM 5137  H HB3  . GLU B 1 46 ? -8.800  16.336  6.547   1.00 0.00 ? 45 GLU B HB3  2  
ATOM 5138  H HG2  . GLU B 1 46 ? -9.259  18.781  5.922   1.00 0.00 ? 45 GLU B HG2  2  
ATOM 5139  H HG3  . GLU B 1 46 ? -10.949 18.449  6.305   1.00 0.00 ? 45 GLU B HG3  2  
ATOM 5140  N N    . GLU B 1 47 ? -7.295  16.328  4.141   1.00 0.00 ? 46 GLU B N    2  
ATOM 5141  C CA   . GLU B 1 47 ? -5.957  16.806  3.678   1.00 0.00 ? 46 GLU B CA   2  
ATOM 5142  C C    . GLU B 1 47 ? -5.788  16.536  2.179   1.00 0.00 ? 46 GLU B C    2  
ATOM 5143  O O    . GLU B 1 47 ? -4.857  15.874  1.763   1.00 0.00 ? 46 GLU B O    2  
ATOM 5144  C CB   . GLU B 1 47 ? -4.862  16.067  4.450   1.00 0.00 ? 46 GLU B CB   2  
ATOM 5145  C CG   . GLU B 1 47 ? -4.861  16.533  5.908   1.00 0.00 ? 46 GLU B CG   2  
ATOM 5146  C CD   . GLU B 1 47 ? -3.707  15.863  6.659   1.00 0.00 ? 46 GLU B CD   2  
ATOM 5147  O OE1  . GLU B 1 47 ? -3.269  14.814  6.218   1.00 0.00 ? 46 GLU B OE1  2  
ATOM 5148  O OE2  . GLU B 1 47 ? -3.282  16.412  7.662   1.00 0.00 ? 46 GLU B OE2  2  
ATOM 5149  H H    . GLU B 1 47 ? -7.395  15.418  4.489   1.00 0.00 ? 46 GLU B H    2  
ATOM 5150  H HA   . GLU B 1 47 ? -5.867  17.868  3.862   1.00 0.00 ? 46 GLU B HA   2  
ATOM 5151  H HB2  . GLU B 1 47 ? -5.051  15.004  4.411   1.00 0.00 ? 46 GLU B HB2  2  
ATOM 5152  H HB3  . GLU B 1 47 ? -3.902  16.280  4.006   1.00 0.00 ? 46 GLU B HB3  2  
ATOM 5153  H HG2  . GLU B 1 47 ? -4.740  17.606  5.943   1.00 0.00 ? 46 GLU B HG2  2  
ATOM 5154  H HG3  . GLU B 1 47 ? -5.796  16.261  6.374   1.00 0.00 ? 46 GLU B HG3  2  
ATOM 5155  N N    . ILE B 1 48 ? -6.674  17.058  1.364   1.00 0.00 ? 47 ILE B N    2  
ATOM 5156  C CA   . ILE B 1 48 ? -6.574  16.856  -0.119  1.00 0.00 ? 47 ILE B CA   2  
ATOM 5157  C C    . ILE B 1 48 ? -6.359  18.213  -0.789  1.00 0.00 ? 47 ILE B C    2  
ATOM 5158  O O    . ILE B 1 48 ? -7.256  19.030  -0.854  1.00 0.00 ? 47 ILE B O    2  
ATOM 5159  C CB   . ILE B 1 48 ? -7.879  16.249  -0.644  1.00 0.00 ? 47 ILE B CB   2  
ATOM 5160  C CG1  . ILE B 1 48 ? -8.216  14.975  0.142   1.00 0.00 ? 47 ILE B CG1  2  
ATOM 5161  C CG2  . ILE B 1 48 ? -7.733  15.916  -2.131  1.00 0.00 ? 47 ILE B CG2  2  
ATOM 5162  C CD1  . ILE B 1 48 ? -7.033  13.999  0.130   1.00 0.00 ? 47 ILE B CD1  2  
ATOM 5163  H H    . ILE B 1 48 ? -7.406  17.597  1.729   1.00 0.00 ? 47 ILE B H    2  
ATOM 5164  H HA   . ILE B 1 48 ? -5.747  16.203  -0.359  1.00 0.00 ? 47 ILE B HA   2  
ATOM 5165  H HB   . ILE B 1 48 ? -8.677  16.967  -0.520  1.00 0.00 ? 47 ILE B HB   2  
ATOM 5166  H HG12 . ILE B 1 48 ? -8.445  15.242  1.161   1.00 0.00 ? 47 ILE B HG12 2  
ATOM 5167  H HG13 . ILE B 1 48 ? -9.076  14.497  -0.304  1.00 0.00 ? 47 ILE B HG13 2  
ATOM 5168  H HG21 . ILE B 1 48 ? -7.488  16.814  -2.679  1.00 0.00 ? 47 ILE B HG21 2  
ATOM 5169  H HG22 . ILE B 1 48 ? -6.946  15.188  -2.262  1.00 0.00 ? 47 ILE B HG22 2  
ATOM 5170  H HG23 . ILE B 1 48 ? -8.663  15.511  -2.502  1.00 0.00 ? 47 ILE B HG23 2  
ATOM 5171  H HD11 . ILE B 1 48 ? -6.535  14.035  -0.827  1.00 0.00 ? 47 ILE B HD11 2  
ATOM 5172  H HD12 . ILE B 1 48 ? -6.336  14.270  0.908   1.00 0.00 ? 47 ILE B HD12 2  
ATOM 5173  H HD13 . ILE B 1 48 ? -7.394  12.997  0.308   1.00 0.00 ? 47 ILE B HD13 2  
ATOM 5174  N N    . LYS B 1 49 ? -5.177  18.468  -1.288  1.00 0.00 ? 48 LYS B N    2  
ATOM 5175  C CA   . LYS B 1 49 ? -4.915  19.780  -1.952  1.00 0.00 ? 48 LYS B CA   2  
ATOM 5176  C C    . LYS B 1 49 ? -5.220  19.666  -3.449  1.00 0.00 ? 48 LYS B C    2  
ATOM 5177  O O    . LYS B 1 49 ? -5.788  20.560  -4.045  1.00 0.00 ? 48 LYS B O    2  
ATOM 5178  C CB   . LYS B 1 49 ? -3.446  20.169  -1.761  1.00 0.00 ? 48 LYS B CB   2  
ATOM 5179  C CG   . LYS B 1 49 ? -3.051  20.004  -0.289  1.00 0.00 ? 48 LYS B CG   2  
ATOM 5180  C CD   . LYS B 1 49 ? -4.032  20.773  0.606   1.00 0.00 ? 48 LYS B CD   2  
ATOM 5181  C CE   . LYS B 1 49 ? -3.400  21.003  1.982   1.00 0.00 ? 48 LYS B CE   2  
ATOM 5182  N NZ   . LYS B 1 49 ? -4.361  21.732  2.856   1.00 0.00 ? 48 LYS B NZ   2  
ATOM 5183  H H    . LYS B 1 49 ? -4.465  17.798  -1.227  1.00 0.00 ? 48 LYS B H    2  
ATOM 5184  H HA   . LYS B 1 49 ? -5.549  20.538  -1.511  1.00 0.00 ? 48 LYS B HA   2  
ATOM 5185  H HB2  . LYS B 1 49 ? -2.824  19.533  -2.373  1.00 0.00 ? 48 LYS B HB2  2  
ATOM 5186  H HB3  . LYS B 1 49 ? -3.306  21.199  -2.055  1.00 0.00 ? 48 LYS B HB3  2  
ATOM 5187  H HG2  . LYS B 1 49 ? -3.071  18.956  -0.028  1.00 0.00 ? 48 LYS B HG2  2  
ATOM 5188  H HG3  . LYS B 1 49 ? -2.053  20.391  -0.143  1.00 0.00 ? 48 LYS B HG3  2  
ATOM 5189  H HD2  . LYS B 1 49 ? -4.265  21.726  0.153   1.00 0.00 ? 48 LYS B HD2  2  
ATOM 5190  H HD3  . LYS B 1 49 ? -4.938  20.198  0.722   1.00 0.00 ? 48 LYS B HD3  2  
ATOM 5191  H HE2  . LYS B 1 49 ? -3.157  20.050  2.431   1.00 0.00 ? 48 LYS B HE2  2  
ATOM 5192  H HE3  . LYS B 1 49 ? -2.499  21.588  1.871   1.00 0.00 ? 48 LYS B HE3  2  
ATOM 5193  H HZ1  . LYS B 1 49 ? -5.181  22.036  2.291   1.00 0.00 ? 48 LYS B HZ1  2  
ATOM 5194  H HZ2  . LYS B 1 49 ? -4.680  21.105  3.621   1.00 0.00 ? 48 LYS B HZ2  2  
ATOM 5195  H HZ3  . LYS B 1 49 ? -3.894  22.565  3.266   1.00 0.00 ? 48 LYS B HZ3  2  
ATOM 5196  N N    . GLU B 1 50 ? -4.844  18.572  -4.065  1.00 0.00 ? 49 GLU B N    2  
ATOM 5197  C CA   . GLU B 1 50 ? -5.109  18.402  -5.527  1.00 0.00 ? 49 GLU B CA   2  
ATOM 5198  C C    . GLU B 1 50 ? -6.472  17.733  -5.729  1.00 0.00 ? 49 GLU B C    2  
ATOM 5199  O O    . GLU B 1 50 ? -6.557  16.613  -6.193  1.00 0.00 ? 49 GLU B O    2  
ATOM 5200  C CB   . GLU B 1 50 ? -4.015  17.527  -6.143  1.00 0.00 ? 49 GLU B CB   2  
ATOM 5201  C CG   . GLU B 1 50 ? -2.646  17.997  -5.648  1.00 0.00 ? 49 GLU B CG   2  
ATOM 5202  C CD   . GLU B 1 50 ? -2.457  19.473  -6.002  1.00 0.00 ? 49 GLU B CD   2  
ATOM 5203  O OE1  . GLU B 1 50 ? -2.707  19.824  -7.144  1.00 0.00 ? 49 GLU B OE1  2  
ATOM 5204  O OE2  . GLU B 1 50 ? -2.067  20.227  -5.127  1.00 0.00 ? 49 GLU B OE2  2  
ATOM 5205  H H    . GLU B 1 50 ? -4.385  17.864  -3.566  1.00 0.00 ? 49 GLU B H    2  
ATOM 5206  H HA   . GLU B 1 50 ? -5.106  19.371  -6.007  1.00 0.00 ? 49 GLU B HA   2  
ATOM 5207  H HB2  . GLU B 1 50 ? -4.171  16.498  -5.852  1.00 0.00 ? 49 GLU B HB2  2  
ATOM 5208  H HB3  . GLU B 1 50 ? -4.054  17.608  -7.219  1.00 0.00 ? 49 GLU B HB3  2  
ATOM 5209  H HG2  . GLU B 1 50 ? -2.588  17.872  -4.576  1.00 0.00 ? 49 GLU B HG2  2  
ATOM 5210  H HG3  . GLU B 1 50 ? -1.872  17.413  -6.121  1.00 0.00 ? 49 GLU B HG3  2  
ATOM 5211  N N    . GLN B 1 51 ? -7.535  18.398  -5.374  1.00 0.00 ? 50 GLN B N    2  
ATOM 5212  C CA   . GLN B 1 51 ? -8.887  17.787  -5.533  1.00 0.00 ? 50 GLN B CA   2  
ATOM 5213  C C    . GLN B 1 51 ? -9.017  17.147  -6.921  1.00 0.00 ? 50 GLN B C    2  
ATOM 5214  O O    . GLN B 1 51 ? -9.838  16.277  -7.137  1.00 0.00 ? 50 GLN B O    2  
ATOM 5215  C CB   . GLN B 1 51 ? -9.951  18.880  -5.371  1.00 0.00 ? 50 GLN B CB   2  
ATOM 5216  C CG   . GLN B 1 51 ? -11.345 18.324  -5.695  1.00 0.00 ? 50 GLN B CG   2  
ATOM 5217  C CD   . GLN B 1 51 ? -11.601 17.054  -4.881  1.00 0.00 ? 50 GLN B CD   2  
ATOM 5218  O OE1  . GLN B 1 51 ? -11.636 17.094  -3.668  1.00 0.00 ? 50 GLN B OE1  2  
ATOM 5219  N NE2  . GLN B 1 51 ? -11.781 15.920  -5.502  1.00 0.00 ? 50 GLN B NE2  2  
ATOM 5220  H H    . GLN B 1 51 ? -7.448  19.295  -4.989  1.00 0.00 ? 50 GLN B H    2  
ATOM 5221  H HA   . GLN B 1 51 ? -9.022  17.042  -4.763  1.00 0.00 ? 50 GLN B HA   2  
ATOM 5222  H HB2  . GLN B 1 51 ? -9.939  19.242  -4.353  1.00 0.00 ? 50 GLN B HB2  2  
ATOM 5223  H HB3  . GLN B 1 51 ? -9.729  19.696  -6.042  1.00 0.00 ? 50 GLN B HB3  2  
ATOM 5224  H HG2  . GLN B 1 51 ? -12.091 19.065  -5.444  1.00 0.00 ? 50 GLN B HG2  2  
ATOM 5225  H HG3  . GLN B 1 51 ? -11.411 18.096  -6.748  1.00 0.00 ? 50 GLN B HG3  2  
ATOM 5226  H HE21 . GLN B 1 51 ? -11.752 15.887  -6.480  1.00 0.00 ? 50 GLN B HE21 2  
ATOM 5227  H HE22 . GLN B 1 51 ? -11.947 15.102  -4.988  1.00 0.00 ? 50 GLN B HE22 2  
ATOM 5228  N N    . GLU B 1 52 ? -8.224  17.577  -7.865  1.00 0.00 ? 51 GLU B N    2  
ATOM 5229  C CA   . GLU B 1 52 ? -8.318  16.997  -9.237  1.00 0.00 ? 51 GLU B CA   2  
ATOM 5230  C C    . GLU B 1 52 ? -7.719  15.586  -9.264  1.00 0.00 ? 51 GLU B C    2  
ATOM 5231  O O    . GLU B 1 52 ? -8.087  14.773  -10.088 1.00 0.00 ? 51 GLU B O    2  
ATOM 5232  C CB   . GLU B 1 52 ? -7.600  17.897  -10.245 1.00 0.00 ? 51 GLU B CB   2  
ATOM 5233  C CG   . GLU B 1 52 ? -8.437  19.152  -10.498 1.00 0.00 ? 51 GLU B CG   2  
ATOM 5234  C CD   . GLU B 1 52 ? -9.672  18.786  -11.323 1.00 0.00 ? 51 GLU B CD   2  
ATOM 5235  O OE1  . GLU B 1 52 ? -9.547  17.950  -12.203 1.00 0.00 ? 51 GLU B OE1  2  
ATOM 5236  O OE2  . GLU B 1 52 ? -10.723 19.348  -11.061 1.00 0.00 ? 51 GLU B OE2  2  
ATOM 5237  H H    . GLU B 1 52 ? -7.570  18.281  -7.671  1.00 0.00 ? 51 GLU B H    2  
ATOM 5238  H HA   . GLU B 1 52 ? -9.360  16.904  -9.502  1.00 0.00 ? 51 GLU B HA   2  
ATOM 5239  H HB2  . GLU B 1 52 ? -6.635  18.180  -9.850  1.00 0.00 ? 51 GLU B HB2  2  
ATOM 5240  H HB3  . GLU B 1 52 ? -7.467  17.362  -11.173 1.00 0.00 ? 51 GLU B HB3  2  
ATOM 5241  H HG2  . GLU B 1 52 ? -8.746  19.575  -9.553  1.00 0.00 ? 51 GLU B HG2  2  
ATOM 5242  H HG3  . GLU B 1 52 ? -7.846  19.876  -11.040 1.00 0.00 ? 51 GLU B HG3  2  
ATOM 5243  N N    . VAL B 1 53 ? -6.838  15.265  -8.359  1.00 0.00 ? 52 VAL B N    2  
ATOM 5244  C CA   . VAL B 1 53 ? -6.280  13.881  -8.342  1.00 0.00 ? 52 VAL B CA   2  
ATOM 5245  C C    . VAL B 1 53 ? -7.352  12.946  -7.785  1.00 0.00 ? 52 VAL B C    2  
ATOM 5246  O O    . VAL B 1 53 ? -7.634  11.910  -8.353  1.00 0.00 ? 52 VAL B O    2  
ATOM 5247  C CB   . VAL B 1 53 ? -5.043  13.826  -7.440  1.00 0.00 ? 52 VAL B CB   2  
ATOM 5248  C CG1  . VAL B 1 53 ? -4.583  12.374  -7.286  1.00 0.00 ? 52 VAL B CG1  2  
ATOM 5249  C CG2  . VAL B 1 53 ? -3.916  14.646  -8.067  1.00 0.00 ? 52 VAL B CG2  2  
ATOM 5250  H H    . VAL B 1 53 ? -6.581  15.901  -7.658  1.00 0.00 ? 52 VAL B H    2  
ATOM 5251  H HA   . VAL B 1 53 ? -6.019  13.560  -9.340  1.00 0.00 ? 52 VAL B HA   2  
ATOM 5252  H HB   . VAL B 1 53 ? -5.288  14.231  -6.469  1.00 0.00 ? 52 VAL B HB   2  
ATOM 5253  H HG11 . VAL B 1 53 ? -4.535  11.907  -8.259  1.00 0.00 ? 52 VAL B HG11 2  
ATOM 5254  H HG12 . VAL B 1 53 ? -3.605  12.352  -6.828  1.00 0.00 ? 52 VAL B HG12 2  
ATOM 5255  H HG13 . VAL B 1 53 ? -5.283  11.836  -6.664  1.00 0.00 ? 52 VAL B HG13 2  
ATOM 5256  H HG21 . VAL B 1 53 ? -4.304  15.599  -8.395  1.00 0.00 ? 52 VAL B HG21 2  
ATOM 5257  H HG22 . VAL B 1 53 ? -3.139  14.806  -7.335  1.00 0.00 ? 52 VAL B HG22 2  
ATOM 5258  H HG23 . VAL B 1 53 ? -3.511  14.112  -8.913  1.00 0.00 ? 52 VAL B HG23 2  
ATOM 5259  N N    . VAL B 1 54 ? -7.962  13.296  -6.690  1.00 0.00 ? 53 VAL B N    2  
ATOM 5260  C CA   . VAL B 1 54 ? -9.018  12.412  -6.129  1.00 0.00 ? 53 VAL B CA   2  
ATOM 5261  C C    . VAL B 1 54 ? -10.171 12.321  -7.128  1.00 0.00 ? 53 VAL B C    2  
ATOM 5262  O O    . VAL B 1 54 ? -10.809 11.296  -7.263  1.00 0.00 ? 53 VAL B O    2  
ATOM 5263  C CB   . VAL B 1 54 ? -9.525  12.995  -4.808  1.00 0.00 ? 53 VAL B CB   2  
ATOM 5264  C CG1  . VAL B 1 54 ? -10.712 12.171  -4.308  1.00 0.00 ? 53 VAL B CG1  2  
ATOM 5265  C CG2  . VAL B 1 54 ? -8.401  12.951  -3.770  1.00 0.00 ? 53 VAL B CG2  2  
ATOM 5266  H H    . VAL B 1 54 ? -7.736  14.133  -6.230  1.00 0.00 ? 53 VAL B H    2  
ATOM 5267  H HA   . VAL B 1 54 ? -8.613  11.426  -5.958  1.00 0.00 ? 53 VAL B HA   2  
ATOM 5268  H HB   . VAL B 1 54 ? -9.836  14.018  -4.962  1.00 0.00 ? 53 VAL B HB   2  
ATOM 5269  H HG11 . VAL B 1 54 ? -10.474 11.119  -4.375  1.00 0.00 ? 53 VAL B HG11 2  
ATOM 5270  H HG12 . VAL B 1 54 ? -10.921 12.428  -3.280  1.00 0.00 ? 53 VAL B HG12 2  
ATOM 5271  H HG13 . VAL B 1 54 ? -11.579 12.383  -4.916  1.00 0.00 ? 53 VAL B HG13 2  
ATOM 5272  H HG21 . VAL B 1 54 ? -7.966  11.962  -3.753  1.00 0.00 ? 53 VAL B HG21 2  
ATOM 5273  H HG22 . VAL B 1 54 ? -7.642  13.673  -4.031  1.00 0.00 ? 53 VAL B HG22 2  
ATOM 5274  H HG23 . VAL B 1 54 ? -8.802  13.185  -2.795  1.00 0.00 ? 53 VAL B HG23 2  
ATOM 5275  N N    . ASP B 1 55 ? -10.442 13.386  -7.831  1.00 0.00 ? 54 ASP B N    2  
ATOM 5276  C CA   . ASP B 1 55 ? -11.552 13.359  -8.821  1.00 0.00 ? 54 ASP B CA   2  
ATOM 5277  C C    . ASP B 1 55 ? -11.299 12.249  -9.843  1.00 0.00 ? 54 ASP B C    2  
ATOM 5278  O O    . ASP B 1 55 ? -12.195 11.518  -10.214 1.00 0.00 ? 54 ASP B O    2  
ATOM 5279  C CB   . ASP B 1 55 ? -11.628 14.706  -9.542  1.00 0.00 ? 54 ASP B CB   2  
ATOM 5280  C CG   . ASP B 1 55 ? -12.163 15.771  -8.583  1.00 0.00 ? 54 ASP B CG   2  
ATOM 5281  O OD1  . ASP B 1 55 ? -12.906 15.412  -7.684  1.00 0.00 ? 54 ASP B OD1  2  
ATOM 5282  O OD2  . ASP B 1 55 ? -11.822 16.929  -8.764  1.00 0.00 ? 54 ASP B OD2  2  
ATOM 5283  H H    . ASP B 1 55 ? -9.914  14.203  -7.707  1.00 0.00 ? 54 ASP B H    2  
ATOM 5284  H HA   . ASP B 1 55 ? -12.482 13.177  -8.304  1.00 0.00 ? 54 ASP B HA   2  
ATOM 5285  H HB2  . ASP B 1 55 ? -10.642 14.988  -9.882  1.00 0.00 ? 54 ASP B HB2  2  
ATOM 5286  H HB3  . ASP B 1 55 ? -12.291 14.624  -10.390 1.00 0.00 ? 54 ASP B HB3  2  
ATOM 5287  N N    . LYS B 1 56 ? -10.084 12.123  -10.313 1.00 0.00 ? 55 LYS B N    2  
ATOM 5288  C CA   . LYS B 1 56 ? -9.786  11.066  -11.321 1.00 0.00 ? 55 LYS B CA   2  
ATOM 5289  C C    . LYS B 1 56 ? -9.854  9.688   -10.665 1.00 0.00 ? 55 LYS B C    2  
ATOM 5290  O O    . LYS B 1 56 ? -10.149 8.705   -11.314 1.00 0.00 ? 55 LYS B O    2  
ATOM 5291  C CB   . LYS B 1 56 ? -8.398  11.286  -11.923 1.00 0.00 ? 55 LYS B CB   2  
ATOM 5292  C CG   . LYS B 1 56 ? -8.411  12.541  -12.805 1.00 0.00 ? 55 LYS B CG   2  
ATOM 5293  C CD   . LYS B 1 56 ? -7.087  12.664  -13.584 1.00 0.00 ? 55 LYS B CD   2  
ATOM 5294  C CE   . LYS B 1 56 ? -6.019  13.340  -12.715 1.00 0.00 ? 55 LYS B CE   2  
ATOM 5295  N NZ   . LYS B 1 56 ? -6.335  14.789  -12.583 1.00 0.00 ? 55 LYS B NZ   2  
ATOM 5296  H H    . LYS B 1 56 ? -9.373  12.727  -10.009 1.00 0.00 ? 55 LYS B H    2  
ATOM 5297  H HA   . LYS B 1 56 ? -10.538 11.102  -12.094 1.00 0.00 ? 55 LYS B HA   2  
ATOM 5298  H HB2  . LYS B 1 56 ? -7.682  11.408  -11.125 1.00 0.00 ? 55 LYS B HB2  2  
ATOM 5299  H HB3  . LYS B 1 56 ? -8.130  10.428  -12.520 1.00 0.00 ? 55 LYS B HB3  2  
ATOM 5300  H HG2  . LYS B 1 56 ? -9.232  12.472  -13.505 1.00 0.00 ? 55 LYS B HG2  2  
ATOM 5301  H HG3  . LYS B 1 56 ? -8.547  13.414  -12.184 1.00 0.00 ? 55 LYS B HG3  2  
ATOM 5302  H HD2  . LYS B 1 56 ? -6.742  11.683  -13.878 1.00 0.00 ? 55 LYS B HD2  2  
ATOM 5303  H HD3  . LYS B 1 56 ? -7.251  13.262  -14.469 1.00 0.00 ? 55 LYS B HD3  2  
ATOM 5304  H HE2  . LYS B 1 56 ? -6.003  12.884  -11.737 1.00 0.00 ? 55 LYS B HE2  2  
ATOM 5305  H HE3  . LYS B 1 56 ? -5.051  13.224  -13.181 1.00 0.00 ? 55 LYS B HE3  2  
ATOM 5306  H HZ1  . LYS B 1 56 ? -7.040  15.057  -13.298 1.00 0.00 ? 55 LYS B HZ1  2  
ATOM 5307  H HZ2  . LYS B 1 56 ? -6.718  14.976  -11.635 1.00 0.00 ? 55 LYS B HZ2  2  
ATOM 5308  H HZ3  . LYS B 1 56 ? -5.467  15.347  -12.723 1.00 0.00 ? 55 LYS B HZ3  2  
ATOM 5309  N N    . VAL B 1 57 ? -9.624  9.597   -9.384  1.00 0.00 ? 56 VAL B N    2  
ATOM 5310  C CA   . VAL B 1 57 ? -9.725  8.273   -8.713  1.00 0.00 ? 56 VAL B CA   2  
ATOM 5311  C C    . VAL B 1 57 ? -11.186 7.829   -8.755  1.00 0.00 ? 56 VAL B C    2  
ATOM 5312  O O    . VAL B 1 57 ? -11.514 6.780   -9.272  1.00 0.00 ? 56 VAL B O    2  
ATOM 5313  C CB   . VAL B 1 57 ? -9.271  8.409   -7.259  1.00 0.00 ? 56 VAL B CB   2  
ATOM 5314  C CG1  . VAL B 1 57 ? -9.460  7.074   -6.537  1.00 0.00 ? 56 VAL B CG1  2  
ATOM 5315  C CG2  . VAL B 1 57 ? -7.790  8.804   -7.223  1.00 0.00 ? 56 VAL B CG2  2  
ATOM 5316  H H    . VAL B 1 57 ? -9.423  10.391  -8.849  1.00 0.00 ? 56 VAL B H    2  
ATOM 5317  H HA   . VAL B 1 57 ? -9.115  7.533   -9.211  1.00 0.00 ? 56 VAL B HA   2  
ATOM 5318  H HB   . VAL B 1 57 ? -9.861  9.170   -6.768  1.00 0.00 ? 56 VAL B HB   2  
ATOM 5319  H HG11 . VAL B 1 57 ? -9.041  6.278   -7.135  1.00 0.00 ? 56 VAL B HG11 2  
ATOM 5320  H HG12 . VAL B 1 57 ? -8.959  7.107   -5.581  1.00 0.00 ? 56 VAL B HG12 2  
ATOM 5321  H HG13 . VAL B 1 57 ? -10.514 6.893   -6.384  1.00 0.00 ? 56 VAL B HG13 2  
ATOM 5322  H HG21 . VAL B 1 57 ? -7.609  9.588   -7.944  1.00 0.00 ? 56 VAL B HG21 2  
ATOM 5323  H HG22 . VAL B 1 57 ? -7.536  9.158   -6.236  1.00 0.00 ? 56 VAL B HG22 2  
ATOM 5324  H HG23 . VAL B 1 57 ? -7.181  7.945   -7.465  1.00 0.00 ? 56 VAL B HG23 2  
ATOM 5325  N N    . MET B 1 58 ? -12.067 8.623   -8.214  1.00 0.00 ? 57 MET B N    2  
ATOM 5326  C CA   . MET B 1 58 ? -13.508 8.251   -8.222  1.00 0.00 ? 57 MET B CA   2  
ATOM 5327  C C    . MET B 1 58 ? -13.951 7.939   -9.656  1.00 0.00 ? 57 MET B C    2  
ATOM 5328  O O    . MET B 1 58 ? -14.873 7.178   -9.876  1.00 0.00 ? 57 MET B O    2  
ATOM 5329  C CB   . MET B 1 58 ? -14.336 9.421   -7.665  1.00 0.00 ? 57 MET B CB   2  
ATOM 5330  C CG   . MET B 1 58 ? -14.339 9.380   -6.131  1.00 0.00 ? 57 MET B CG   2  
ATOM 5331  S SD   . MET B 1 58 ? -12.639 9.285   -5.518  1.00 0.00 ? 57 MET B SD   2  
ATOM 5332  C CE   . MET B 1 58 ? -13.029 9.383   -3.752  1.00 0.00 ? 57 MET B CE   2  
ATOM 5333  H H    . MET B 1 58 ? -11.786 9.459   -7.785  1.00 0.00 ? 57 MET B H    2  
ATOM 5334  H HA   . MET B 1 58 ? -13.658 7.375   -7.608  1.00 0.00 ? 57 MET B HA   2  
ATOM 5335  H HB2  . MET B 1 58 ? -13.901 10.353  -7.997  1.00 0.00 ? 57 MET B HB2  2  
ATOM 5336  H HB3  . MET B 1 58 ? -15.353 9.352   -8.024  1.00 0.00 ? 57 MET B HB3  2  
ATOM 5337  H HG2  . MET B 1 58 ? -14.809 10.274  -5.749  1.00 0.00 ? 57 MET B HG2  2  
ATOM 5338  H HG3  . MET B 1 58 ? -14.891 8.513   -5.797  1.00 0.00 ? 57 MET B HG3  2  
ATOM 5339  H HE1  . MET B 1 58 ? -13.730 8.601   -3.495  1.00 0.00 ? 57 MET B HE1  2  
ATOM 5340  H HE2  . MET B 1 58 ? -12.127 9.258   -3.175  1.00 0.00 ? 57 MET B HE2  2  
ATOM 5341  H HE3  . MET B 1 58 ? -13.463 10.349  -3.533  1.00 0.00 ? 57 MET B HE3  2  
ATOM 5342  N N    . GLU B 1 59 ? -13.293 8.506   -10.640 1.00 0.00 ? 58 GLU B N    2  
ATOM 5343  C CA   . GLU B 1 59 ? -13.667 8.225   -12.061 1.00 0.00 ? 58 GLU B CA   2  
ATOM 5344  C C    . GLU B 1 59 ? -12.936 6.974   -12.560 1.00 0.00 ? 58 GLU B C    2  
ATOM 5345  O O    . GLU B 1 59 ? -13.489 6.191   -13.306 1.00 0.00 ? 58 GLU B O    2  
ATOM 5346  C CB   . GLU B 1 59 ? -13.329 9.425   -12.947 1.00 0.00 ? 58 GLU B CB   2  
ATOM 5347  C CG   . GLU B 1 59 ? -13.983 9.251   -14.321 1.00 0.00 ? 58 GLU B CG   2  
ATOM 5348  C CD   . GLU B 1 59 ? -13.342 10.215  -15.320 1.00 0.00 ? 58 GLU B CD   2  
ATOM 5349  O OE1  . GLU B 1 59 ? -12.768 11.198  -14.880 1.00 0.00 ? 58 GLU B OE1  2  
ATOM 5350  O OE2  . GLU B 1 59 ? -13.433 9.953   -16.508 1.00 0.00 ? 58 GLU B OE2  2  
ATOM 5351  H H    . GLU B 1 59 ? -12.537 9.091   -10.443 1.00 0.00 ? 58 GLU B H    2  
ATOM 5352  H HA   . GLU B 1 59 ? -14.723 8.004   -12.120 1.00 0.00 ? 58 GLU B HA   2  
ATOM 5353  H HB2  . GLU B 1 59 ? -13.698 10.329  -12.484 1.00 0.00 ? 58 GLU B HB2  2  
ATOM 5354  H HB3  . GLU B 1 59 ? -12.257 9.493   -13.066 1.00 0.00 ? 58 GLU B HB3  2  
ATOM 5355  H HG2  . GLU B 1 59 ? -13.844 8.234   -14.661 1.00 0.00 ? 58 GLU B HG2  2  
ATOM 5356  H HG3  . GLU B 1 59 ? -15.039 9.464   -14.246 1.00 0.00 ? 58 GLU B HG3  2  
ATOM 5357  N N    . THR B 1 60 ? -11.710 6.762   -12.166 1.00 0.00 ? 59 THR B N    2  
ATOM 5358  C CA   . THR B 1 60 ? -10.999 5.542   -12.647 1.00 0.00 ? 59 THR B CA   2  
ATOM 5359  C C    . THR B 1 60 ? -11.678 4.318   -12.033 1.00 0.00 ? 59 THR B C    2  
ATOM 5360  O O    . THR B 1 60 ? -12.020 3.385   -12.732 1.00 0.00 ? 59 THR B O    2  
ATOM 5361  C CB   . THR B 1 60 ? -9.517  5.594   -12.259 1.00 0.00 ? 59 THR B CB   2  
ATOM 5362  O OG1  . THR B 1 60 ? -9.037  6.922   -12.410 1.00 0.00 ? 59 THR B OG1  2  
ATOM 5363  C CG2  . THR B 1 60 ? -8.715  4.653   -13.162 1.00 0.00 ? 59 THR B CG2  2  
ATOM 5364  H H    . THR B 1 60 ? -11.267 7.387   -11.555 1.00 0.00 ? 59 THR B H    2  
ATOM 5365  H HA   . THR B 1 60 ? -11.106 5.467   -13.720 1.00 0.00 ? 59 THR B HA   2  
ATOM 5366  H HB   . THR B 1 60 ? -9.402  5.285   -11.231 1.00 0.00 ? 59 THR B HB   2  
ATOM 5367  H HG1  . THR B 1 60 ? -8.566  7.161   -11.608 1.00 0.00 ? 59 THR B HG1  2  
ATOM 5368  H HG21 . THR B 1 60 ? -9.173  3.676   -13.161 1.00 0.00 ? 59 THR B HG21 2  
ATOM 5369  H HG22 . THR B 1 60 ? -8.706  5.044   -14.169 1.00 0.00 ? 59 THR B HG22 2  
ATOM 5370  H HG23 . THR B 1 60 ? -7.702  4.578   -12.798 1.00 0.00 ? 59 THR B HG23 2  
ATOM 5371  N N    . LEU B 1 61 ? -11.927 4.317   -10.757 1.00 0.00 ? 60 LEU B N    2  
ATOM 5372  C CA   . LEU B 1 61 ? -12.640 3.154   -10.164 1.00 0.00 ? 60 LEU B CA   2  
ATOM 5373  C C    . LEU B 1 61 ? -13.976 3.006   -10.895 1.00 0.00 ? 60 LEU B C    2  
ATOM 5374  O O    . LEU B 1 61 ? -14.279 1.963   -11.438 1.00 0.00 ? 60 LEU B O    2  
ATOM 5375  C CB   . LEU B 1 61 ? -12.892 3.410   -8.666  1.00 0.00 ? 60 LEU B CB   2  
ATOM 5376  C CG   . LEU B 1 61 ? -11.685 2.941   -7.844  1.00 0.00 ? 60 LEU B CG   2  
ATOM 5377  C CD1  . LEU B 1 61 ? -10.469 3.808   -8.173  1.00 0.00 ? 60 LEU B CD1  2  
ATOM 5378  C CD2  . LEU B 1 61 ? -12.009 3.064   -6.354  1.00 0.00 ? 60 LEU B CD2  2  
ATOM 5379  H H    . LEU B 1 61 ? -11.690 5.080   -10.186 1.00 0.00 ? 60 LEU B H    2  
ATOM 5380  H HA   . LEU B 1 61 ? -12.086 2.234   -10.290 1.00 0.00 ? 60 LEU B HA   2  
ATOM 5381  H HB2  . LEU B 1 61 ? -13.046 4.466   -8.505  1.00 0.00 ? 60 LEU B HB2  2  
ATOM 5382  H HB3  . LEU B 1 61 ? -13.770 2.866   -8.345  1.00 0.00 ? 60 LEU B HB3  2  
ATOM 5383  H HG   . LEU B 1 61 ? -11.465 1.910   -8.079  1.00 0.00 ? 60 LEU B HG   2  
ATOM 5384  H HD11 . LEU B 1 61 ? -10.756 4.848   -8.169  1.00 0.00 ? 60 LEU B HD11 2  
ATOM 5385  H HD12 . LEU B 1 61 ? -9.700  3.644   -7.433  1.00 0.00 ? 60 LEU B HD12 2  
ATOM 5386  H HD13 . LEU B 1 61 ? -10.091 3.542   -9.149  1.00 0.00 ? 60 LEU B HD13 2  
ATOM 5387  H HD21 . LEU B 1 61 ? -12.973 2.617   -6.157  1.00 0.00 ? 60 LEU B HD21 2  
ATOM 5388  H HD22 . LEU B 1 61 ? -11.251 2.553   -5.778  1.00 0.00 ? 60 LEU B HD22 2  
ATOM 5389  H HD23 . LEU B 1 61 ? -12.031 4.107   -6.076  1.00 0.00 ? 60 LEU B HD23 2  
ATOM 5390  N N    . ASP B 1 62 ? -14.772 4.041   -10.929 1.00 0.00 ? 61 ASP B N    2  
ATOM 5391  C CA   . ASP B 1 62 ? -16.076 3.945   -11.643 1.00 0.00 ? 61 ASP B CA   2  
ATOM 5392  C C    . ASP B 1 62 ? -15.838 3.366   -13.040 1.00 0.00 ? 61 ASP B C    2  
ATOM 5393  O O    . ASP B 1 62 ? -16.713 2.765   -13.632 1.00 0.00 ? 61 ASP B O    2  
ATOM 5394  C CB   . ASP B 1 62 ? -16.696 5.338   -11.769 1.00 0.00 ? 61 ASP B CB   2  
ATOM 5395  C CG   . ASP B 1 62 ? -17.125 5.834   -10.387 1.00 0.00 ? 61 ASP B CG   2  
ATOM 5396  O OD1  . ASP B 1 62 ? -17.322 5.004   -9.516  1.00 0.00 ? 61 ASP B OD1  2  
ATOM 5397  O OD2  . ASP B 1 62 ? -17.249 7.037   -10.224 1.00 0.00 ? 61 ASP B OD2  2  
ATOM 5398  H H    . ASP B 1 62 ? -14.512 4.879   -10.493 1.00 0.00 ? 61 ASP B H    2  
ATOM 5399  H HA   . ASP B 1 62 ? -16.744 3.299   -11.093 1.00 0.00 ? 61 ASP B HA   2  
ATOM 5400  H HB2  . ASP B 1 62 ? -15.969 6.018   -12.187 1.00 0.00 ? 61 ASP B HB2  2  
ATOM 5401  H HB3  . ASP B 1 62 ? -17.559 5.291   -12.416 1.00 0.00 ? 61 ASP B HB3  2  
ATOM 5402  N N    . GLU B 1 63 ? -14.652 3.538   -13.568 1.00 0.00 ? 62 GLU B N    2  
ATOM 5403  C CA   . GLU B 1 63 ? -14.339 2.994   -14.926 1.00 0.00 ? 62 GLU B CA   2  
ATOM 5404  C C    . GLU B 1 63 ? -13.597 1.676   -14.779 1.00 0.00 ? 62 GLU B C    2  
ATOM 5405  O O    . GLU B 1 63 ? -12.667 1.369   -15.498 1.00 0.00 ? 62 GLU B O    2  
ATOM 5406  C CB   . GLU B 1 63 ? -13.454 3.963   -15.661 1.00 0.00 ? 62 GLU B CB   2  
ATOM 5407  C CG   . GLU B 1 63 ? -14.245 5.218   -16.047 1.00 0.00 ? 62 GLU B CG   2  
ATOM 5408  C CD   . GLU B 1 63 ? -15.142 4.909   -17.247 1.00 0.00 ? 62 GLU B CD   2  
ATOM 5409  O OE1  . GLU B 1 63 ? -14.622 4.437   -18.244 1.00 0.00 ? 62 GLU B OE1  2  
ATOM 5410  O OE2  . GLU B 1 63 ? -16.334 5.150   -17.149 1.00 0.00 ? 62 GLU B OE2  2  
ATOM 5411  H H    . GLU B 1 63 ? -13.962 4.022   -13.068 1.00 0.00 ? 62 GLU B H    2  
ATOM 5412  H HA   . GLU B 1 63 ? -15.253 2.825   -15.477 1.00 0.00 ? 62 GLU B HA   2  
ATOM 5413  H HB2  . GLU B 1 63 ? -12.643 4.224   -15.008 1.00 0.00 ? 62 GLU B HB2  2  
ATOM 5414  H HB3  . GLU B 1 63 ? -13.071 3.486   -16.544 1.00 0.00 ? 62 GLU B HB3  2  
ATOM 5415  H HG2  . GLU B 1 63 ? -14.854 5.532   -15.211 1.00 0.00 ? 62 GLU B HG2  2  
ATOM 5416  H HG3  . GLU B 1 63 ? -13.558 6.009   -16.308 1.00 0.00 ? 62 GLU B HG3  2  
ATOM 5417  N N    . ASP B 1 64 ? -14.022 0.913   -13.848 1.00 0.00 ? 63 ASP B N    2  
ATOM 5418  C CA   . ASP B 1 64 ? -13.397 -0.419  -13.582 1.00 0.00 ? 63 ASP B CA   2  
ATOM 5419  C C    . ASP B 1 64 ? -13.172 -1.149  -14.903 1.00 0.00 ? 63 ASP B C    2  
ATOM 5420  O O    . ASP B 1 64 ? -12.155 -1.782  -15.112 1.00 0.00 ? 63 ASP B O    2  
ATOM 5421  C CB   . ASP B 1 64 ? -14.374 -1.238  -12.748 1.00 0.00 ? 63 ASP B CB   2  
ATOM 5422  C CG   . ASP B 1 64 ? -13.819 -2.647  -12.542 1.00 0.00 ? 63 ASP B CG   2  
ATOM 5423  O OD1  . ASP B 1 64 ? -12.686 -2.879  -12.932 1.00 0.00 ? 63 ASP B OD1  2  
ATOM 5424  O OD2  . ASP B 1 64 ? -14.535 -3.471  -11.998 1.00 0.00 ? 63 ASP B OD2  2  
ATOM 5425  H H    . ASP B 1 64 ? -14.761 1.228   -13.313 1.00 0.00 ? 63 ASP B H    2  
ATOM 5426  H HA   . ASP B 1 64 ? -12.472 -0.317  -13.037 1.00 0.00 ? 63 ASP B HA   2  
ATOM 5427  H HB2  . ASP B 1 64 ? -14.511 -0.760  -11.792 1.00 0.00 ? 63 ASP B HB2  2  
ATOM 5428  H HB3  . ASP B 1 64 ? -15.322 -1.298  -13.263 1.00 0.00 ? 63 ASP B HB3  2  
ATOM 5429  N N    . GLY B 1 65 ? -14.104 -1.031  -15.802 1.00 0.00 ? 64 GLY B N    2  
ATOM 5430  C CA   . GLY B 1 65 ? -13.968 -1.684  -17.133 1.00 0.00 ? 64 GLY B CA   2  
ATOM 5431  C C    . GLY B 1 65 ? -13.620 -3.178  -17.007 1.00 0.00 ? 64 GLY B C    2  
ATOM 5432  O O    . GLY B 1 65 ? -13.547 -3.873  -18.002 1.00 0.00 ? 64 GLY B O    2  
ATOM 5433  H H    . GLY B 1 65 ? -14.890 -0.475  -15.618 1.00 0.00 ? 64 GLY B H    2  
ATOM 5434  H HA2  . GLY B 1 65 ? -14.905 -1.589  -17.666 1.00 0.00 ? 64 GLY B HA2  2  
ATOM 5435  H HA3  . GLY B 1 65 ? -13.189 -1.177  -17.683 1.00 0.00 ? 64 GLY B HA3  2  
ATOM 5436  N N    . ASP B 1 66 ? -13.390 -3.683  -15.811 1.00 0.00 ? 65 ASP B N    2  
ATOM 5437  C CA   . ASP B 1 66 ? -13.030 -5.139  -15.646 1.00 0.00 ? 65 ASP B CA   2  
ATOM 5438  C C    . ASP B 1 66 ? -14.165 -5.967  -14.979 1.00 0.00 ? 65 ASP B C    2  
ATOM 5439  O O    . ASP B 1 66 ? -14.084 -7.180  -14.942 1.00 0.00 ? 65 ASP B O    2  
ATOM 5440  C CB   . ASP B 1 66 ? -11.776 -5.243  -14.775 1.00 0.00 ? 65 ASP B CB   2  
ATOM 5441  C CG   . ASP B 1 66 ? -11.183 -6.649  -14.897 1.00 0.00 ? 65 ASP B CG   2  
ATOM 5442  O OD1  . ASP B 1 66 ? -11.231 -7.198  -15.985 1.00 0.00 ? 65 ASP B OD1  2  
ATOM 5443  O OD2  . ASP B 1 66 ? -10.691 -7.152  -13.900 1.00 0.00 ? 65 ASP B OD2  2  
ATOM 5444  H H    . ASP B 1 66 ? -13.429 -3.110  -15.018 1.00 0.00 ? 65 ASP B H    2  
ATOM 5445  H HA   . ASP B 1 66 ? -12.807 -5.558  -16.618 1.00 0.00 ? 65 ASP B HA   2  
ATOM 5446  H HB2  . ASP B 1 66 ? -11.049 -4.514  -15.104 1.00 0.00 ? 65 ASP B HB2  2  
ATOM 5447  H HB3  . ASP B 1 66 ? -12.037 -5.054  -13.745 1.00 0.00 ? 65 ASP B HB3  2  
ATOM 5448  N N    . GLY B 1 67 ? -15.223 -5.371  -14.468 1.00 0.00 ? 66 GLY B N    2  
ATOM 5449  C CA   . GLY B 1 67 ? -16.311 -6.187  -13.850 1.00 0.00 ? 66 GLY B CA   2  
ATOM 5450  C C    . GLY B 1 67 ? -15.945 -6.593  -12.414 1.00 0.00 ? 66 GLY B C    2  
ATOM 5451  O O    . GLY B 1 67 ? -16.812 -6.777  -11.582 1.00 0.00 ? 66 GLY B O    2  
ATOM 5452  H H    . GLY B 1 67 ? -15.339 -4.408  -14.513 1.00 0.00 ? 66 GLY B H    2  
ATOM 5453  H HA2  . GLY B 1 67 ? -17.226 -5.610  -13.834 1.00 0.00 ? 66 GLY B HA2  2  
ATOM 5454  H HA3  . GLY B 1 67 ? -16.460 -7.073  -14.447 1.00 0.00 ? 66 GLY B HA3  2  
ATOM 5455  N N    . GLU B 1 68 ? -14.678 -6.728  -12.104 1.00 0.00 ? 67 GLU B N    2  
ATOM 5456  C CA   . GLU B 1 68 ? -14.289 -7.117  -10.706 1.00 0.00 ? 67 GLU B CA   2  
ATOM 5457  C C    . GLU B 1 68 ? -12.925 -6.516  -10.348 1.00 0.00 ? 67 GLU B C    2  
ATOM 5458  O O    . GLU B 1 68 ? -11.979 -6.621  -11.103 1.00 0.00 ? 67 GLU B O    2  
ATOM 5459  C CB   . GLU B 1 68 ? -14.204 -8.645  -10.590 1.00 0.00 ? 67 GLU B CB   2  
ATOM 5460  C CG   . GLU B 1 68 ? -15.599 -9.281  -10.734 1.00 0.00 ? 67 GLU B CG   2  
ATOM 5461  C CD   . GLU B 1 68 ? -15.952 -9.454  -12.216 1.00 0.00 ? 67 GLU B CD   2  
ATOM 5462  O OE1  . GLU B 1 68 ? -15.061 -9.779  -12.985 1.00 0.00 ? 67 GLU B OE1  2  
ATOM 5463  O OE2  . GLU B 1 68 ? -17.108 -9.265  -12.555 1.00 0.00 ? 67 GLU B OE2  2  
ATOM 5464  H H    . GLU B 1 68 ? -13.995 -6.581  -12.789 1.00 0.00 ? 67 GLU B H    2  
ATOM 5465  H HA   . GLU B 1 68 ? -15.035 -6.741  -10.020 1.00 0.00 ? 67 GLU B HA   2  
ATOM 5466  H HB2  . GLU B 1 68 ? -13.549 -9.025  -11.362 1.00 0.00 ? 67 GLU B HB2  2  
ATOM 5467  H HB3  . GLU B 1 68 ? -13.796 -8.902  -9.624  1.00 0.00 ? 67 GLU B HB3  2  
ATOM 5468  H HG2  . GLU B 1 68 ? -15.600 -10.249 -10.254 1.00 0.00 ? 67 GLU B HG2  2  
ATOM 5469  H HG3  . GLU B 1 68 ? -16.338 -8.651  -10.262 1.00 0.00 ? 67 GLU B HG3  2  
ATOM 5470  N N    . CYS B 1 69 ? -12.810 -5.903  -9.193  1.00 0.00 ? 68 CYS B N    2  
ATOM 5471  C CA   . CYS B 1 69 ? -11.500 -5.307  -8.769  1.00 0.00 ? 68 CYS B CA   2  
ATOM 5472  C C    . CYS B 1 69 ? -10.862 -6.200  -7.699  1.00 0.00 ? 68 CYS B C    2  
ATOM 5473  O O    . CYS B 1 69 ? -11.485 -6.550  -6.716  1.00 0.00 ? 68 CYS B O    2  
ATOM 5474  C CB   . CYS B 1 69 ? -11.739 -3.912  -8.186  1.00 0.00 ? 68 CYS B CB   2  
ATOM 5475  S SG   . CYS B 1 69 ? -12.595 -2.886  -9.406  1.00 0.00 ? 68 CYS B SG   2  
ATOM 5476  H H    . CYS B 1 69 ? -13.585 -5.843  -8.594  1.00 0.00 ? 68 CYS B H    2  
ATOM 5477  H HA   . CYS B 1 69 ? -10.834 -5.231  -9.617  1.00 0.00 ? 68 CYS B HA   2  
ATOM 5478  H HB2  . CYS B 1 69 ? -12.343 -3.992  -7.295  1.00 0.00 ? 68 CYS B HB2  2  
ATOM 5479  H HB3  . CYS B 1 69 ? -10.790 -3.459  -7.937  1.00 0.00 ? 68 CYS B HB3  2  
ATOM 5480  H HG   . CYS B 1 69 ? -11.932 -2.406  -9.908  1.00 0.00 ? 68 CYS B HG   2  
ATOM 5481  N N    . ASP B 1 70 ? -9.625  -6.582  -7.886  1.00 0.00 ? 69 ASP B N    2  
ATOM 5482  C CA   . ASP B 1 70 ? -8.947  -7.463  -6.885  1.00 0.00 ? 69 ASP B CA   2  
ATOM 5483  C C    . ASP B 1 70 ? -8.329  -6.616  -5.768  1.00 0.00 ? 69 ASP B C    2  
ATOM 5484  O O    . ASP B 1 70 ? -8.521  -5.418  -5.701  1.00 0.00 ? 69 ASP B O    2  
ATOM 5485  C CB   . ASP B 1 70 ? -7.845  -8.262  -7.580  1.00 0.00 ? 69 ASP B CB   2  
ATOM 5486  C CG   . ASP B 1 70 ? -8.427  -8.982  -8.798  1.00 0.00 ? 69 ASP B CG   2  
ATOM 5487  O OD1  . ASP B 1 70 ? -9.305  -8.420  -9.431  1.00 0.00 ? 69 ASP B OD1  2  
ATOM 5488  O OD2  . ASP B 1 70 ? -7.984  -10.084 -9.077  1.00 0.00 ? 69 ASP B OD2  2  
ATOM 5489  H H    . ASP B 1 70 ? -9.143  -6.297  -8.691  1.00 0.00 ? 69 ASP B H    2  
ATOM 5490  H HA   . ASP B 1 70 ? -9.668  -8.146  -6.460  1.00 0.00 ? 69 ASP B HA   2  
ATOM 5491  H HB2  . ASP B 1 70 ? -7.059  -7.592  -7.897  1.00 0.00 ? 69 ASP B HB2  2  
ATOM 5492  H HB3  . ASP B 1 70 ? -7.441  -8.991  -6.893  1.00 0.00 ? 69 ASP B HB3  2  
ATOM 5493  N N    . PHE B 1 71 ? -7.576  -7.235  -4.896  1.00 0.00 ? 70 PHE B N    2  
ATOM 5494  C CA   . PHE B 1 71 ? -6.930  -6.473  -3.786  1.00 0.00 ? 70 PHE B CA   2  
ATOM 5495  C C    . PHE B 1 71 ? -5.765  -5.660  -4.354  1.00 0.00 ? 70 PHE B C    2  
ATOM 5496  O O    . PHE B 1 71 ? -5.515  -4.549  -3.932  1.00 0.00 ? 70 PHE B O    2  
ATOM 5497  C CB   . PHE B 1 71 ? -6.418  -7.455  -2.725  1.00 0.00 ? 70 PHE B CB   2  
ATOM 5498  C CG   . PHE B 1 71 ? -5.915  -6.706  -1.509  1.00 0.00 ? 70 PHE B CG   2  
ATOM 5499  C CD1  . PHE B 1 71 ? -4.675  -6.051  -1.545  1.00 0.00 ? 70 PHE B CD1  2  
ATOM 5500  C CD2  . PHE B 1 71 ? -6.686  -6.675  -0.340  1.00 0.00 ? 70 PHE B CD2  2  
ATOM 5501  C CE1  . PHE B 1 71 ? -4.212  -5.366  -0.414  1.00 0.00 ? 70 PHE B CE1  2  
ATOM 5502  C CE2  . PHE B 1 71 ? -6.222  -5.991  0.789   1.00 0.00 ? 70 PHE B CE2  2  
ATOM 5503  C CZ   . PHE B 1 71 ? -4.985  -5.336  0.752   1.00 0.00 ? 70 PHE B CZ   2  
ATOM 5504  H H    . PHE B 1 71 ? -7.422  -8.200  -4.980  1.00 0.00 ? 70 PHE B H    2  
ATOM 5505  H HA   . PHE B 1 71 ? -7.645  -5.789  -3.356  1.00 0.00 ? 70 PHE B HA   2  
ATOM 5506  H HB2  . PHE B 1 71 ? -7.221  -8.115  -2.434  1.00 0.00 ? 70 PHE B HB2  2  
ATOM 5507  H HB3  . PHE B 1 71 ? -5.611  -8.040  -3.142  1.00 0.00 ? 70 PHE B HB3  2  
ATOM 5508  H HD1  . PHE B 1 71 ? -4.075  -6.075  -2.442  1.00 0.00 ? 70 PHE B HD1  2  
ATOM 5509  H HD2  . PHE B 1 71 ? -7.639  -7.181  -0.311  1.00 0.00 ? 70 PHE B HD2  2  
ATOM 5510  H HE1  . PHE B 1 71 ? -3.257  -4.862  -0.441  1.00 0.00 ? 70 PHE B HE1  2  
ATOM 5511  H HE2  . PHE B 1 71 ? -6.816  -5.969  1.689   1.00 0.00 ? 70 PHE B HE2  2  
ATOM 5512  H HZ   . PHE B 1 71 ? -4.628  -4.808  1.624   1.00 0.00 ? 70 PHE B HZ   2  
ATOM 5513  N N    . GLN B 1 72 ? -5.053  -6.191  -5.306  1.00 0.00 ? 71 GLN B N    2  
ATOM 5514  C CA   . GLN B 1 72 ? -3.917  -5.422  -5.883  1.00 0.00 ? 71 GLN B CA   2  
ATOM 5515  C C    . GLN B 1 72 ? -4.434  -4.062  -6.358  1.00 0.00 ? 71 GLN B C    2  
ATOM 5516  O O    . GLN B 1 72 ? -3.770  -3.053  -6.223  1.00 0.00 ? 71 GLN B O    2  
ATOM 5517  C CB   . GLN B 1 72 ? -3.327  -6.192  -7.067  1.00 0.00 ? 71 GLN B CB   2  
ATOM 5518  C CG   . GLN B 1 72 ? -2.019  -5.533  -7.508  1.00 0.00 ? 71 GLN B CG   2  
ATOM 5519  C CD   . GLN B 1 72 ? -1.533  -6.182  -8.806  1.00 0.00 ? 71 GLN B CD   2  
ATOM 5520  O OE1  . GLN B 1 72 ? -2.326  -6.537  -9.655  1.00 0.00 ? 71 GLN B OE1  2  
ATOM 5521  N NE2  . GLN B 1 72 ? -0.254  -6.352  -8.996  1.00 0.00 ? 71 GLN B NE2  2  
ATOM 5522  H H    . GLN B 1 72 ? -5.265  -7.087  -5.642  1.00 0.00 ? 71 GLN B H    2  
ATOM 5523  H HA   . GLN B 1 72 ? -3.159  -5.281  -5.125  1.00 0.00 ? 71 GLN B HA   2  
ATOM 5524  H HB2  . GLN B 1 72 ? -3.135  -7.213  -6.771  1.00 0.00 ? 71 GLN B HB2  2  
ATOM 5525  H HB3  . GLN B 1 72 ? -4.029  -6.181  -7.888  1.00 0.00 ? 71 GLN B HB3  2  
ATOM 5526  H HG2  . GLN B 1 72 ? -2.186  -4.478  -7.672  1.00 0.00 ? 71 GLN B HG2  2  
ATOM 5527  H HG3  . GLN B 1 72 ? -1.272  -5.665  -6.741  1.00 0.00 ? 71 GLN B HG3  2  
ATOM 5528  H HE21 . GLN B 1 72 ? 0.386   -6.066  -8.312  1.00 0.00 ? 71 GLN B HE21 2  
ATOM 5529  H HE22 . GLN B 1 72 ? 0.067   -6.767  -9.824  1.00 0.00 ? 71 GLN B HE22 2  
ATOM 5530  N N    . GLU B 1 73 ? -5.619  -4.025  -6.904  1.00 0.00 ? 72 GLU B N    2  
ATOM 5531  C CA   . GLU B 1 73 ? -6.184  -2.729  -7.378  1.00 0.00 ? 72 GLU B CA   2  
ATOM 5532  C C    . GLU B 1 73 ? -6.588  -1.869  -6.174  1.00 0.00 ? 72 GLU B C    2  
ATOM 5533  O O    . GLU B 1 73 ? -6.590  -0.659  -6.236  1.00 0.00 ? 72 GLU B O    2  
ATOM 5534  C CB   . GLU B 1 73 ? -7.402  -2.986  -8.267  1.00 0.00 ? 72 GLU B CB   2  
ATOM 5535  C CG   . GLU B 1 73 ? -7.089  -4.120  -9.246  1.00 0.00 ? 72 GLU B CG   2  
ATOM 5536  C CD   . GLU B 1 73 ? -8.192  -4.200  -10.303 1.00 0.00 ? 72 GLU B CD   2  
ATOM 5537  O OE1  . GLU B 1 73 ? -9.194  -3.526  -10.137 1.00 0.00 ? 72 GLU B OE1  2  
ATOM 5538  O OE2  . GLU B 1 73 ? -8.014  -4.935  -11.261 1.00 0.00 ? 72 GLU B OE2  2  
ATOM 5539  H H    . GLU B 1 73 ? -6.140  -4.849  -6.997  1.00 0.00 ? 72 GLU B H    2  
ATOM 5540  H HA   . GLU B 1 73 ? -5.432  -2.191  -7.935  1.00 0.00 ? 72 GLU B HA   2  
ATOM 5541  H HB2  . GLU B 1 73 ? -8.245  -3.263  -7.651  1.00 0.00 ? 72 GLU B HB2  2  
ATOM 5542  H HB3  . GLU B 1 73 ? -7.639  -2.091  -8.821  1.00 0.00 ? 72 GLU B HB3  2  
ATOM 5543  H HG2  . GLU B 1 73 ? -6.141  -3.929  -9.726  1.00 0.00 ? 72 GLU B HG2  2  
ATOM 5544  H HG3  . GLU B 1 73 ? -7.040  -5.056  -8.709  1.00 0.00 ? 72 GLU B HG3  2  
ATOM 5545  N N    . PHE B 1 74 ? -6.881  -2.487  -5.064  1.00 0.00 ? 73 PHE B N    2  
ATOM 5546  C CA   . PHE B 1 74 ? -7.237  -1.710  -3.840  1.00 0.00 ? 73 PHE B CA   2  
ATOM 5547  C C    . PHE B 1 74 ? -5.959  -1.106  -3.256  1.00 0.00 ? 73 PHE B C    2  
ATOM 5548  O O    . PHE B 1 74 ? -5.958  0.018   -2.802  1.00 0.00 ? 73 PHE B O    2  
ATOM 5549  C CB   . PHE B 1 74 ? -7.932  -2.622  -2.820  1.00 0.00 ? 73 PHE B CB   2  
ATOM 5550  C CG   . PHE B 1 74 ? -8.059  -1.918  -1.486  1.00 0.00 ? 73 PHE B CG   2  
ATOM 5551  C CD1  . PHE B 1 74 ? -9.068  -0.968  -1.286  1.00 0.00 ? 73 PHE B CD1  2  
ATOM 5552  C CD2  . PHE B 1 74 ? -7.174  -2.226  -0.444  1.00 0.00 ? 73 PHE B CD2  2  
ATOM 5553  C CE1  . PHE B 1 74 ? -9.191  -0.325  -0.048  1.00 0.00 ? 73 PHE B CE1  2  
ATOM 5554  C CE2  . PHE B 1 74 ? -7.298  -1.585  0.794   1.00 0.00 ? 73 PHE B CE2  2  
ATOM 5555  C CZ   . PHE B 1 74 ? -8.306  -0.634  0.993   1.00 0.00 ? 73 PHE B CZ   2  
ATOM 5556  H H    . PHE B 1 74 ? -6.816  -3.464  -5.018  1.00 0.00 ? 73 PHE B H    2  
ATOM 5557  H HA   . PHE B 1 74 ? -7.859  -0.859  -4.072  1.00 0.00 ? 73 PHE B HA   2  
ATOM 5558  H HB2  . PHE B 1 74 ? -8.917  -2.876  -3.183  1.00 0.00 ? 73 PHE B HB2  2  
ATOM 5559  H HB3  . PHE B 1 74 ? -7.353  -3.525  -2.695  1.00 0.00 ? 73 PHE B HB3  2  
ATOM 5560  H HD1  . PHE B 1 74 ? -9.751  -0.729  -2.088  1.00 0.00 ? 73 PHE B HD1  2  
ATOM 5561  H HD2  . PHE B 1 74 ? -6.395  -2.959  -0.597  1.00 0.00 ? 73 PHE B HD2  2  
ATOM 5562  H HE1  . PHE B 1 74 ? -9.968  0.408   0.105   1.00 0.00 ? 73 PHE B HE1  2  
ATOM 5563  H HE2  . PHE B 1 74 ? -6.614  -1.822  1.596   1.00 0.00 ? 73 PHE B HE2  2  
ATOM 5564  H HZ   . PHE B 1 74 ? -8.402  -0.140  1.949   1.00 0.00 ? 73 PHE B HZ   2  
ATOM 5565  N N    . MET B 1 75 ? -4.869  -1.809  -3.274  1.00 0.00 ? 74 MET B N    2  
ATOM 5566  C CA   . MET B 1 75 ? -3.624  -1.203  -2.725  1.00 0.00 ? 74 MET B CA   2  
ATOM 5567  C C    . MET B 1 75 ? -3.173  -0.068  -3.658  1.00 0.00 ? 74 MET B C    2  
ATOM 5568  O O    . MET B 1 75 ? -2.951  1.040   -3.212  1.00 0.00 ? 74 MET B O    2  
ATOM 5569  C CB   . MET B 1 75 ? -2.525  -2.272  -2.605  1.00 0.00 ? 74 MET B CB   2  
ATOM 5570  C CG   . MET B 1 75 ? -1.516  -1.868  -1.523  1.00 0.00 ? 74 MET B CG   2  
ATOM 5571  S SD   . MET B 1 75 ? -2.195  -2.269  0.113   1.00 0.00 ? 74 MET B SD   2  
ATOM 5572  C CE   . MET B 1 75 ? -2.244  -0.591  0.796   1.00 0.00 ? 74 MET B CE   2  
ATOM 5573  H H    . MET B 1 75 ? -4.861  -2.713  -3.657  1.00 0.00 ? 74 MET B H    2  
ATOM 5574  H HA   . MET B 1 75 ? -3.833  -0.773  -1.756  1.00 0.00 ? 74 MET B HA   2  
ATOM 5575  H HB2  . MET B 1 75 ? -2.976  -3.217  -2.338  1.00 0.00 ? 74 MET B HB2  2  
ATOM 5576  H HB3  . MET B 1 75 ? -2.014  -2.376  -3.551  1.00 0.00 ? 74 MET B HB3  2  
ATOM 5577  H HG2  . MET B 1 75 ? -0.595  -2.414  -1.672  1.00 0.00 ? 74 MET B HG2  2  
ATOM 5578  H HG3  . MET B 1 75 ? -1.318  -0.809  -1.589  1.00 0.00 ? 74 MET B HG3  2  
ATOM 5579  H HE1  . MET B 1 75 ? -1.283  -0.116  0.652   1.00 0.00 ? 74 MET B HE1  2  
ATOM 5580  H HE2  . MET B 1 75 ? -3.005  -0.017  0.294   1.00 0.00 ? 74 MET B HE2  2  
ATOM 5581  H HE3  . MET B 1 75 ? -2.472  -0.641  1.852   1.00 0.00 ? 74 MET B HE3  2  
ATOM 5582  N N    . ALA B 1 76 ? -3.029  -0.306  -4.931  1.00 0.00 ? 75 ALA B N    2  
ATOM 5583  C CA   . ALA B 1 76 ? -2.587  0.788   -5.848  1.00 0.00 ? 75 ALA B CA   2  
ATOM 5584  C C    . ALA B 1 76 ? -3.540  1.988   -5.791  1.00 0.00 ? 75 ALA B C    2  
ATOM 5585  O O    . ALA B 1 76 ? -3.112  3.108   -5.593  1.00 0.00 ? 75 ALA B O    2  
ATOM 5586  C CB   . ALA B 1 76 ? -2.545  0.253   -7.280  1.00 0.00 ? 75 ALA B CB   2  
ATOM 5587  H H    . ALA B 1 76 ? -3.192  -1.192  -5.316  1.00 0.00 ? 75 ALA B H    2  
ATOM 5588  H HA   . ALA B 1 76 ? -1.604  1.145   -5.580  1.00 0.00 ? 75 ALA B HA   2  
ATOM 5589  H HB1  . ALA B 1 76 ? -1.880  -0.597  -7.327  1.00 0.00 ? 75 ALA B HB1  2  
ATOM 5590  H HB2  . ALA B 1 76 ? -3.538  -0.050  -7.580  1.00 0.00 ? 75 ALA B HB2  2  
ATOM 5591  H HB3  . ALA B 1 76 ? -2.189  1.026   -7.944  1.00 0.00 ? 75 ALA B HB3  2  
ATOM 5592  N N    . PHE B 1 77 ? -4.814  1.791   -5.983  1.00 0.00 ? 76 PHE B N    2  
ATOM 5593  C CA   . PHE B 1 77 ? -5.740  2.967   -5.955  1.00 0.00 ? 76 PHE B CA   2  
ATOM 5594  C C    . PHE B 1 77 ? -5.700  3.625   -4.570  1.00 0.00 ? 76 PHE B C    2  
ATOM 5595  O O    . PHE B 1 77 ? -5.824  4.827   -4.440  1.00 0.00 ? 76 PHE B O    2  
ATOM 5596  C CB   . PHE B 1 77 ? -7.180  2.523   -6.293  1.00 0.00 ? 76 PHE B CB   2  
ATOM 5597  C CG   . PHE B 1 77 ? -7.379  2.507   -7.800  1.00 0.00 ? 76 PHE B CG   2  
ATOM 5598  C CD1  . PHE B 1 77 ? -7.240  3.693   -8.537  1.00 0.00 ? 76 PHE B CD1  2  
ATOM 5599  C CD2  . PHE B 1 77 ? -7.693  1.311   -8.459  1.00 0.00 ? 76 PHE B CD2  2  
ATOM 5600  C CE1  . PHE B 1 77 ? -7.413  3.678   -9.925  1.00 0.00 ? 76 PHE B CE1  2  
ATOM 5601  C CE2  . PHE B 1 77 ? -7.868  1.300   -9.848  1.00 0.00 ? 76 PHE B CE2  2  
ATOM 5602  C CZ   . PHE B 1 77 ? -7.726  2.483   -10.580 1.00 0.00 ? 76 PHE B CZ   2  
ATOM 5603  H H    . PHE B 1 77 ? -5.155  0.887   -6.159  1.00 0.00 ? 76 PHE B H    2  
ATOM 5604  H HA   . PHE B 1 77 ? -5.402  3.684   -6.687  1.00 0.00 ? 76 PHE B HA   2  
ATOM 5605  H HB2  . PHE B 1 77 ? -7.352  1.534   -5.895  1.00 0.00 ? 76 PHE B HB2  2  
ATOM 5606  H HB3  . PHE B 1 77 ? -7.886  3.212   -5.850  1.00 0.00 ? 76 PHE B HB3  2  
ATOM 5607  H HD1  . PHE B 1 77 ? -7.004  4.619   -8.036  1.00 0.00 ? 76 PHE B HD1  2  
ATOM 5608  H HD2  . PHE B 1 77 ? -7.806  0.399   -7.898  1.00 0.00 ? 76 PHE B HD2  2  
ATOM 5609  H HE1  . PHE B 1 77 ? -7.303  4.591   -10.491 1.00 0.00 ? 76 PHE B HE1  2  
ATOM 5610  H HE2  . PHE B 1 77 ? -8.110  0.377   -10.354 1.00 0.00 ? 76 PHE B HE2  2  
ATOM 5611  H HZ   . PHE B 1 77 ? -7.858  2.472   -11.651 1.00 0.00 ? 76 PHE B HZ   2  
ATOM 5612  N N    . VAL B 1 78 ? -5.520  2.851   -3.542  1.00 0.00 ? 77 VAL B N    2  
ATOM 5613  C CA   . VAL B 1 78 ? -5.463  3.442   -2.174  1.00 0.00 ? 77 VAL B CA   2  
ATOM 5614  C C    . VAL B 1 78 ? -4.184  4.279   -2.042  1.00 0.00 ? 77 VAL B C    2  
ATOM 5615  O O    . VAL B 1 78 ? -4.159  5.288   -1.366  1.00 0.00 ? 77 VAL B O    2  
ATOM 5616  C CB   . VAL B 1 78 ? -5.473  2.313   -1.133  1.00 0.00 ? 77 VAL B CB   2  
ATOM 5617  C CG1  . VAL B 1 78 ? -5.046  2.853   0.240   1.00 0.00 ? 77 VAL B CG1  2  
ATOM 5618  C CG2  . VAL B 1 78 ? -6.890  1.722   -1.033  1.00 0.00 ? 77 VAL B CG2  2  
ATOM 5619  H H    . VAL B 1 78 ? -5.411  1.884   -3.671  1.00 0.00 ? 77 VAL B H    2  
ATOM 5620  H HA   . VAL B 1 78 ? -6.323  4.078   -2.022  1.00 0.00 ? 77 VAL B HA   2  
ATOM 5621  H HB   . VAL B 1 78 ? -4.783  1.540   -1.440  1.00 0.00 ? 77 VAL B HB   2  
ATOM 5622  H HG11 . VAL B 1 78 ? -5.556  3.785   0.434   1.00 0.00 ? 77 VAL B HG11 2  
ATOM 5623  H HG12 . VAL B 1 78 ? -5.302  2.136   1.005   1.00 0.00 ? 77 VAL B HG12 2  
ATOM 5624  H HG13 . VAL B 1 78 ? -3.979  3.019   0.245   1.00 0.00 ? 77 VAL B HG13 2  
ATOM 5625  H HG21 . VAL B 1 78 ? -7.352  1.710   -2.011  1.00 0.00 ? 77 VAL B HG21 2  
ATOM 5626  H HG22 . VAL B 1 78 ? -6.830  0.715   -0.655  1.00 0.00 ? 77 VAL B HG22 2  
ATOM 5627  H HG23 . VAL B 1 78 ? -7.490  2.323   -0.363  1.00 0.00 ? 77 VAL B HG23 2  
ATOM 5628  N N    . SER B 1 79 ? -3.124  3.869   -2.683  1.00 0.00 ? 78 SER B N    2  
ATOM 5629  C CA   . SER B 1 79 ? -1.853  4.643   -2.594  1.00 0.00 ? 78 SER B CA   2  
ATOM 5630  C C    . SER B 1 79 ? -2.036  6.018   -3.247  1.00 0.00 ? 78 SER B C    2  
ATOM 5631  O O    . SER B 1 79 ? -1.634  7.027   -2.703  1.00 0.00 ? 78 SER B O    2  
ATOM 5632  C CB   . SER B 1 79 ? -0.745  3.881   -3.320  1.00 0.00 ? 78 SER B CB   2  
ATOM 5633  O OG   . SER B 1 79 ? 0.516   4.432   -2.965  1.00 0.00 ? 78 SER B OG   2  
ATOM 5634  H H    . SER B 1 79 ? -3.164  3.054   -3.224  1.00 0.00 ? 78 SER B H    2  
ATOM 5635  H HA   . SER B 1 79 ? -1.581  4.771   -1.557  1.00 0.00 ? 78 SER B HA   2  
ATOM 5636  H HB2  . SER B 1 79 ? -0.772  2.843   -3.034  1.00 0.00 ? 78 SER B HB2  2  
ATOM 5637  H HB3  . SER B 1 79 ? -0.896  3.960   -4.389  1.00 0.00 ? 78 SER B HB3  2  
ATOM 5638  H HG   . SER B 1 79 ? 1.097   4.357   -3.725  1.00 0.00 ? 78 SER B HG   2  
ATOM 5639  N N    . MET B 1 80 ? -2.617  6.070   -4.414  1.00 0.00 ? 79 MET B N    2  
ATOM 5640  C CA   . MET B 1 80 ? -2.795  7.382   -5.100  1.00 0.00 ? 79 MET B CA   2  
ATOM 5641  C C    . MET B 1 80 ? -3.545  8.356   -4.194  1.00 0.00 ? 79 MET B C    2  
ATOM 5642  O O    . MET B 1 80 ? -3.099  9.457   -3.949  1.00 0.00 ? 79 MET B O    2  
ATOM 5643  C CB   . MET B 1 80 ? -3.596  7.174   -6.389  1.00 0.00 ? 79 MET B CB   2  
ATOM 5644  C CG   . MET B 1 80 ? -2.716  6.503   -7.448  1.00 0.00 ? 79 MET B CG   2  
ATOM 5645  S SD   . MET B 1 80 ? -1.663  7.749   -8.232  1.00 0.00 ? 79 MET B SD   2  
ATOM 5646  C CE   . MET B 1 80 ? -2.828  8.256   -9.521  1.00 0.00 ? 79 MET B CE   2  
ATOM 5647  H H    . MET B 1 80 ? -2.917  5.252   -4.862  1.00 0.00 ? 79 MET B H    2  
ATOM 5648  H HA   . MET B 1 80 ? -1.828  7.795   -5.343  1.00 0.00 ? 79 MET B HA   2  
ATOM 5649  H HB2  . MET B 1 80 ? -4.451  6.547   -6.182  1.00 0.00 ? 79 MET B HB2  2  
ATOM 5650  H HB3  . MET B 1 80 ? -3.933  8.131   -6.760  1.00 0.00 ? 79 MET B HB3  2  
ATOM 5651  H HG2  . MET B 1 80 ? -2.097  5.748   -6.983  1.00 0.00 ? 79 MET B HG2  2  
ATOM 5652  H HG3  . MET B 1 80 ? -3.344  6.041   -8.196  1.00 0.00 ? 79 MET B HG3  2  
ATOM 5653  H HE1  . MET B 1 80 ? -3.810  8.388   -9.087  1.00 0.00 ? 79 MET B HE1  2  
ATOM 5654  H HE2  . MET B 1 80 ? -2.502  9.187   -9.957  1.00 0.00 ? 79 MET B HE2  2  
ATOM 5655  H HE3  . MET B 1 80 ? -2.867  7.496   -10.289 1.00 0.00 ? 79 MET B HE3  2  
ATOM 5656  N N    . VAL B 1 81 ? -4.690  7.972   -3.711  1.00 0.00 ? 80 VAL B N    2  
ATOM 5657  C CA   . VAL B 1 81 ? -5.469  8.900   -2.839  1.00 0.00 ? 80 VAL B CA   2  
ATOM 5658  C C    . VAL B 1 81 ? -4.592  9.362   -1.673  1.00 0.00 ? 80 VAL B C    2  
ATOM 5659  O O    . VAL B 1 81 ? -4.638  10.506  -1.266  1.00 0.00 ? 80 VAL B O    2  
ATOM 5660  C CB   . VAL B 1 81 ? -6.703  8.183   -2.286  1.00 0.00 ? 80 VAL B CB   2  
ATOM 5661  C CG1  . VAL B 1 81 ? -7.441  9.112   -1.319  1.00 0.00 ? 80 VAL B CG1  2  
ATOM 5662  C CG2  . VAL B 1 81 ? -7.639  7.807   -3.437  1.00 0.00 ? 80 VAL B CG2  2  
ATOM 5663  H H    . VAL B 1 81 ? -5.040  7.083   -3.937  1.00 0.00 ? 80 VAL B H    2  
ATOM 5664  H HA   . VAL B 1 81 ? -5.781  9.753   -3.428  1.00 0.00 ? 80 VAL B HA   2  
ATOM 5665  H HB   . VAL B 1 81 ? -6.396  7.289   -1.762  1.00 0.00 ? 80 VAL B HB   2  
ATOM 5666  H HG11 . VAL B 1 81 ? -7.559  10.084  -1.775  1.00 0.00 ? 80 VAL B HG11 2  
ATOM 5667  H HG12 . VAL B 1 81 ? -8.413  8.699   -1.095  1.00 0.00 ? 80 VAL B HG12 2  
ATOM 5668  H HG13 . VAL B 1 81 ? -6.871  9.208   -0.407  1.00 0.00 ? 80 VAL B HG13 2  
ATOM 5669  H HG21 . VAL B 1 81 ? -7.923  8.699   -3.974  1.00 0.00 ? 80 VAL B HG21 2  
ATOM 5670  H HG22 . VAL B 1 81 ? -7.133  7.128   -4.106  1.00 0.00 ? 80 VAL B HG22 2  
ATOM 5671  H HG23 . VAL B 1 81 ? -8.524  7.330   -3.039  1.00 0.00 ? 80 VAL B HG23 2  
ATOM 5672  N N    . THR B 1 82 ? -3.783  8.489   -1.141  1.00 0.00 ? 81 THR B N    2  
ATOM 5673  C CA   . THR B 1 82 ? -2.896  8.890   -0.014  1.00 0.00 ? 81 THR B CA   2  
ATOM 5674  C C    . THR B 1 82 ? -1.839  9.865   -0.539  1.00 0.00 ? 81 THR B C    2  
ATOM 5675  O O    . THR B 1 82 ? -1.634  10.931  0.006   1.00 0.00 ? 81 THR B O    2  
ATOM 5676  C CB   . THR B 1 82 ? -2.211  7.648   0.561   1.00 0.00 ? 81 THR B CB   2  
ATOM 5677  O OG1  . THR B 1 82 ? -3.171  6.614   0.726   1.00 0.00 ? 81 THR B OG1  2  
ATOM 5678  C CG2  . THR B 1 82 ? -1.587  7.987   1.914   1.00 0.00 ? 81 THR B CG2  2  
ATOM 5679  H H    . THR B 1 82 ? -3.752  7.573   -1.489  1.00 0.00 ? 81 THR B H    2  
ATOM 5680  H HA   . THR B 1 82 ? -3.483  9.371   0.755   1.00 0.00 ? 81 THR B HA   2  
ATOM 5681  H HB   . THR B 1 82 ? -1.437  7.317   -0.115  1.00 0.00 ? 81 THR B HB   2  
ATOM 5682  H HG1  . THR B 1 82 ? -2.716  5.836   1.058   1.00 0.00 ? 81 THR B HG1  2  
ATOM 5683  H HG21 . THR B 1 82 ? -1.013  8.898   1.828   1.00 0.00 ? 81 THR B HG21 2  
ATOM 5684  H HG22 . THR B 1 82 ? -2.368  8.121   2.647   1.00 0.00 ? 81 THR B HG22 2  
ATOM 5685  H HG23 . THR B 1 82 ? -0.938  7.180   2.223   1.00 0.00 ? 81 THR B HG23 2  
ATOM 5686  N N    . THR B 1 83 ? -1.171  9.503   -1.600  1.00 0.00 ? 82 THR B N    2  
ATOM 5687  C CA   . THR B 1 83 ? -0.128  10.398  -2.179  1.00 0.00 ? 82 THR B CA   2  
ATOM 5688  C C    . THR B 1 83 ? -0.796  11.594  -2.862  1.00 0.00 ? 82 THR B C    2  
ATOM 5689  O O    . THR B 1 83 ? -0.175  12.610  -3.102  1.00 0.00 ? 82 THR B O    2  
ATOM 5690  C CB   . THR B 1 83 ? 0.700   9.623   -3.205  1.00 0.00 ? 82 THR B CB   2  
ATOM 5691  O OG1  . THR B 1 83 ? -0.168  9.039   -4.165  1.00 0.00 ? 82 THR B OG1  2  
ATOM 5692  C CG2  . THR B 1 83 ? 1.498   8.525   -2.498  1.00 0.00 ? 82 THR B CG2  2  
ATOM 5693  H H    . THR B 1 83 ? -1.359  8.639   -2.023  1.00 0.00 ? 82 THR B H    2  
ATOM 5694  H HA   . THR B 1 83 ? 0.519   10.752  -1.389  1.00 0.00 ? 82 THR B HA   2  
ATOM 5695  H HB   . THR B 1 83 ? 1.384   10.296  -3.699  1.00 0.00 ? 82 THR B HB   2  
ATOM 5696  H HG1  . THR B 1 83 ? -0.625  9.749   -4.622  1.00 0.00 ? 82 THR B HG1  2  
ATOM 5697  H HG21 . THR B 1 83 ? 2.027   8.950   -1.658  1.00 0.00 ? 82 THR B HG21 2  
ATOM 5698  H HG22 . THR B 1 83 ? 0.823   7.758   -2.147  1.00 0.00 ? 82 THR B HG22 2  
ATOM 5699  H HG23 . THR B 1 83 ? 2.207   8.093   -3.188  1.00 0.00 ? 82 THR B HG23 2  
ATOM 5700  N N    . ALA B 1 84 ? -2.058  11.483  -3.176  1.00 0.00 ? 83 ALA B N    2  
ATOM 5701  C CA   . ALA B 1 84 ? -2.763  12.614  -3.842  1.00 0.00 ? 83 ALA B CA   2  
ATOM 5702  C C    . ALA B 1 84 ? -2.605  13.872  -2.989  1.00 0.00 ? 83 ALA B C    2  
ATOM 5703  O O    . ALA B 1 84 ? -2.644  14.981  -3.483  1.00 0.00 ? 83 ALA B O    2  
ATOM 5704  C CB   . ALA B 1 84 ? -4.248  12.278  -3.987  1.00 0.00 ? 83 ALA B CB   2  
ATOM 5705  H H    . ALA B 1 84 ? -2.544  10.658  -2.964  1.00 0.00 ? 83 ALA B H    2  
ATOM 5706  H HA   . ALA B 1 84 ? -2.333  12.784  -4.818  1.00 0.00 ? 83 ALA B HA   2  
ATOM 5707  H HB1  . ALA B 1 84 ? -4.357  11.371  -4.562  1.00 0.00 ? 83 ALA B HB1  2  
ATOM 5708  H HB2  . ALA B 1 84 ? -4.683  12.139  -3.008  1.00 0.00 ? 83 ALA B HB2  2  
ATOM 5709  H HB3  . ALA B 1 84 ? -4.753  13.088  -4.493  1.00 0.00 ? 83 ALA B HB3  2  
ATOM 5710  N N    . CYS B 1 85 ? -2.417  13.706  -1.710  1.00 0.00 ? 84 CYS B N    2  
ATOM 5711  C CA   . CYS B 1 85 ? -2.246  14.889  -0.822  1.00 0.00 ? 84 CYS B CA   2  
ATOM 5712  C C    . CYS B 1 85 ? -0.845  15.466  -1.026  1.00 0.00 ? 84 CYS B C    2  
ATOM 5713  O O    . CYS B 1 85 ? 0.079   14.760  -1.380  1.00 0.00 ? 84 CYS B O    2  
ATOM 5714  C CB   . CYS B 1 85 ? -2.411  14.459  0.637   1.00 0.00 ? 84 CYS B CB   2  
ATOM 5715  S SG   . CYS B 1 85 ? -2.151  15.885  1.721   1.00 0.00 ? 84 CYS B SG   2  
ATOM 5716  H H    . CYS B 1 85 ? -2.383  12.801  -1.334  1.00 0.00 ? 84 CYS B H    2  
ATOM 5717  H HA   . CYS B 1 85 ? -2.986  15.636  -1.066  1.00 0.00 ? 84 CYS B HA   2  
ATOM 5718  H HB2  . CYS B 1 85 ? -3.408  14.070  0.787   1.00 0.00 ? 84 CYS B HB2  2  
ATOM 5719  H HB3  . CYS B 1 85 ? -1.687  13.693  0.871   1.00 0.00 ? 84 CYS B HB3  2  
ATOM 5720  H HG   . CYS B 1 85 ? -2.827  16.537  1.520   1.00 0.00 ? 84 CYS B HG   2  
ATOM 5721  N N    . HIS B 1 86 ? -0.675  16.743  -0.812  1.00 0.00 ? 85 HIS B N    2  
ATOM 5722  C CA   . HIS B 1 86 ? 0.673   17.351  -1.000  1.00 0.00 ? 85 HIS B CA   2  
ATOM 5723  C C    . HIS B 1 86 ? 1.713   16.517  -0.249  1.00 0.00 ? 85 HIS B C    2  
ATOM 5724  O O    . HIS B 1 86 ? 1.387   15.549  0.410   1.00 0.00 ? 85 HIS B O    2  
ATOM 5725  C CB   . HIS B 1 86 ? 0.671   18.784  -0.462  1.00 0.00 ? 85 HIS B CB   2  
ATOM 5726  C CG   . HIS B 1 86 ? 0.438   18.769  1.024   1.00 0.00 ? 85 HIS B CG   2  
ATOM 5727  N ND1  . HIS B 1 86 ? -0.765  18.363  1.581   1.00 0.00 ? 85 HIS B ND1  2  
ATOM 5728  C CD2  . HIS B 1 86 ? 1.243   19.113  2.082   1.00 0.00 ? 85 HIS B CD2  2  
ATOM 5729  C CE1  . HIS B 1 86 ? -0.651  18.472  2.917   1.00 0.00 ? 85 HIS B CE1  2  
ATOM 5730  N NE2  . HIS B 1 86 ? 0.553   18.925  3.276   1.00 0.00 ? 85 HIS B NE2  2  
ATOM 5731  H H    . HIS B 1 86 ? -1.430  17.299  -0.530  1.00 0.00 ? 85 HIS B H    2  
ATOM 5732  H HA   . HIS B 1 86 ? 0.917   17.363  -2.052  1.00 0.00 ? 85 HIS B HA   2  
ATOM 5733  H HB2  . HIS B 1 86 ? 1.624   19.248  -0.672  1.00 0.00 ? 85 HIS B HB2  2  
ATOM 5734  H HB3  . HIS B 1 86 ? -0.115  19.347  -0.944  1.00 0.00 ? 85 HIS B HB3  2  
ATOM 5735  H HD1  . HIS B 1 86 ? -1.555  18.053  1.091   1.00 0.00 ? 85 HIS B HD1  2  
ATOM 5736  H HD2  . HIS B 1 86 ? 2.257   19.474  2.000   1.00 0.00 ? 85 HIS B HD2  2  
ATOM 5737  H HE1  . HIS B 1 86 ? -1.436  18.222  3.615   1.00 0.00 ? 85 HIS B HE1  2  
ATOM 5738  N N    . GLU B 1 87 ? 2.964   16.881  -0.345  1.00 0.00 ? 86 GLU B N    2  
ATOM 5739  C CA   . GLU B 1 87 ? 4.028   16.105  0.359   1.00 0.00 ? 86 GLU B CA   2  
ATOM 5740  C C    . GLU B 1 87 ? 3.584   15.798  1.792   1.00 0.00 ? 86 GLU B C    2  
ATOM 5741  O O    . GLU B 1 87 ? 3.664   16.634  2.670   1.00 0.00 ? 86 GLU B O    2  
ATOM 5742  C CB   . GLU B 1 87 ? 5.319   16.926  0.387   1.00 0.00 ? 86 GLU B CB   2  
ATOM 5743  C CG   . GLU B 1 87 ? 5.717   17.303  -1.042  1.00 0.00 ? 86 GLU B CG   2  
ATOM 5744  C CD   . GLU B 1 87 ? 6.074   16.037  -1.823  1.00 0.00 ? 86 GLU B CD   2  
ATOM 5745  O OE1  . GLU B 1 87 ? 6.671   15.151  -1.235  1.00 0.00 ? 86 GLU B OE1  2  
ATOM 5746  O OE2  . GLU B 1 87 ? 5.743   15.975  -2.996  1.00 0.00 ? 86 GLU B OE2  2  
ATOM 5747  H H    . GLU B 1 87 ? 3.205   17.662  -0.884  1.00 0.00 ? 86 GLU B H    2  
ATOM 5748  H HA   . GLU B 1 87 ? 4.204   15.179  -0.169  1.00 0.00 ? 86 GLU B HA   2  
ATOM 5749  H HB2  . GLU B 1 87 ? 5.162   17.824  0.967   1.00 0.00 ? 86 GLU B HB2  2  
ATOM 5750  H HB3  . GLU B 1 87 ? 6.108   16.341  0.836   1.00 0.00 ? 86 GLU B HB3  2  
ATOM 5751  H HG2  . GLU B 1 87 ? 4.892   17.805  -1.525  1.00 0.00 ? 86 GLU B HG2  2  
ATOM 5752  H HG3  . GLU B 1 87 ? 6.573   17.960  -1.016  1.00 0.00 ? 86 GLU B HG3  2  
ATOM 5753  N N    . PHE B 1 88 ? 3.109   14.605  2.033   1.00 0.00 ? 87 PHE B N    2  
ATOM 5754  C CA   . PHE B 1 88 ? 2.654   14.251  3.407   1.00 0.00 ? 87 PHE B CA   2  
ATOM 5755  C C    . PHE B 1 88 ? 3.829   14.351  4.382   1.00 0.00 ? 87 PHE B C    2  
ATOM 5756  O O    . PHE B 1 88 ? 3.646   14.551  5.566   1.00 0.00 ? 87 PHE B O    2  
ATOM 5757  C CB   . PHE B 1 88 ? 2.084   12.829  3.418   1.00 0.00 ? 87 PHE B CB   2  
ATOM 5758  C CG   . PHE B 1 88 ? 3.049   11.877  2.755   1.00 0.00 ? 87 PHE B CG   2  
ATOM 5759  C CD1  . PHE B 1 88 ? 3.066   11.755  1.360   1.00 0.00 ? 87 PHE B CD1  2  
ATOM 5760  C CD2  . PHE B 1 88 ? 3.920   11.106  3.534   1.00 0.00 ? 87 PHE B CD2  2  
ATOM 5761  C CE1  . PHE B 1 88 ? 3.954   10.865  0.745   1.00 0.00 ? 87 PHE B CE1  2  
ATOM 5762  C CE2  . PHE B 1 88 ? 4.807   10.213  2.919   1.00 0.00 ? 87 PHE B CE2  2  
ATOM 5763  C CZ   . PHE B 1 88 ? 4.824   10.093  1.525   1.00 0.00 ? 87 PHE B CZ   2  
ATOM 5764  H H    . PHE B 1 88 ? 3.048   13.946  1.311   1.00 0.00 ? 87 PHE B H    2  
ATOM 5765  H HA   . PHE B 1 88 ? 1.884   14.944  3.712   1.00 0.00 ? 87 PHE B HA   2  
ATOM 5766  H HB2  . PHE B 1 88 ? 1.918   12.519  4.439   1.00 0.00 ? 87 PHE B HB2  2  
ATOM 5767  H HB3  . PHE B 1 88 ? 1.145   12.817  2.884   1.00 0.00 ? 87 PHE B HB3  2  
ATOM 5768  H HD1  . PHE B 1 88 ? 2.395   12.350  0.758   1.00 0.00 ? 87 PHE B HD1  2  
ATOM 5769  H HD2  . PHE B 1 88 ? 3.908   11.199  4.610   1.00 0.00 ? 87 PHE B HD2  2  
ATOM 5770  H HE1  . PHE B 1 88 ? 3.967   10.772  -0.331  1.00 0.00 ? 87 PHE B HE1  2  
ATOM 5771  H HE2  . PHE B 1 88 ? 5.478   9.619   3.521   1.00 0.00 ? 87 PHE B HE2  2  
ATOM 5772  H HZ   . PHE B 1 88 ? 5.506   9.404   1.051   1.00 0.00 ? 87 PHE B HZ   2  
ATOM 5773  N N    . PHE B 1 89 ? 5.035   14.223  3.898   1.00 0.00 ? 88 PHE B N    2  
ATOM 5774  C CA   . PHE B 1 89 ? 6.213   14.323  4.809   1.00 0.00 ? 88 PHE B CA   2  
ATOM 5775  C C    . PHE B 1 89 ? 6.092   15.599  5.642   1.00 0.00 ? 88 PHE B C    2  
ATOM 5776  O O    . PHE B 1 89 ? 6.408   15.621  6.815   1.00 0.00 ? 88 PHE B O    2  
ATOM 5777  C CB   . PHE B 1 89 ? 7.499   14.371  3.982   1.00 0.00 ? 88 PHE B CB   2  
ATOM 5778  C CG   . PHE B 1 89 ? 7.549   13.181  3.049   1.00 0.00 ? 88 PHE B CG   2  
ATOM 5779  C CD1  . PHE B 1 89 ? 7.673   11.888  3.572   1.00 0.00 ? 88 PHE B CD1  2  
ATOM 5780  C CD2  . PHE B 1 89 ? 7.476   13.369  1.662   1.00 0.00 ? 88 PHE B CD2  2  
ATOM 5781  C CE1  . PHE B 1 89 ? 7.725   10.785  2.710   1.00 0.00 ? 88 PHE B CE1  2  
ATOM 5782  C CE2  . PHE B 1 89 ? 7.526   12.267  0.801   1.00 0.00 ? 88 PHE B CE2  2  
ATOM 5783  C CZ   . PHE B 1 89 ? 7.652   10.975  1.325   1.00 0.00 ? 88 PHE B CZ   2  
ATOM 5784  H H    . PHE B 1 89 ? 5.167   14.068  2.939   1.00 0.00 ? 88 PHE B H    2  
ATOM 5785  H HA   . PHE B 1 89 ? 6.238   13.472  5.470   1.00 0.00 ? 88 PHE B HA   2  
ATOM 5786  H HB2  . PHE B 1 89 ? 7.523   15.286  3.408   1.00 0.00 ? 88 PHE B HB2  2  
ATOM 5787  H HB3  . PHE B 1 89 ? 8.351   14.342  4.645   1.00 0.00 ? 88 PHE B HB3  2  
ATOM 5788  H HD1  . PHE B 1 89 ? 7.730   11.742  4.641   1.00 0.00 ? 88 PHE B HD1  2  
ATOM 5789  H HD2  . PHE B 1 89 ? 7.378   14.366  1.257   1.00 0.00 ? 88 PHE B HD2  2  
ATOM 5790  H HE1  . PHE B 1 89 ? 7.821   9.787   3.114   1.00 0.00 ? 88 PHE B HE1  2  
ATOM 5791  H HE2  . PHE B 1 89 ? 7.469   12.413  -0.267  1.00 0.00 ? 88 PHE B HE2  2  
ATOM 5792  H HZ   . PHE B 1 89 ? 7.694   10.125  0.660   1.00 0.00 ? 88 PHE B HZ   2  
ATOM 5793  N N    . GLU B 1 90 ? 5.630   16.661  5.042   1.00 0.00 ? 89 GLU B N    2  
ATOM 5794  C CA   . GLU B 1 90 ? 5.479   17.939  5.792   1.00 0.00 ? 89 GLU B CA   2  
ATOM 5795  C C    . GLU B 1 90 ? 4.131   17.938  6.516   1.00 0.00 ? 89 GLU B C    2  
ATOM 5796  O O    . GLU B 1 90 ? 3.242   18.701  6.196   1.00 0.00 ? 89 GLU B O    2  
ATOM 5797  C CB   . GLU B 1 90 ? 5.532   19.116  4.814   1.00 0.00 ? 89 GLU B CB   2  
ATOM 5798  C CG   . GLU B 1 90 ? 6.980   19.352  4.377   1.00 0.00 ? 89 GLU B CG   2  
ATOM 5799  C CD   . GLU B 1 90 ? 7.491   18.125  3.621   1.00 0.00 ? 89 GLU B CD   2  
ATOM 5800  O OE1  . GLU B 1 90 ? 6.995   17.873  2.535   1.00 0.00 ? 89 GLU B OE1  2  
ATOM 5801  O OE2  . GLU B 1 90 ? 8.371   17.457  4.141   1.00 0.00 ? 89 GLU B OE2  2  
ATOM 5802  H H    . GLU B 1 90 ? 5.379   16.616  4.098   1.00 0.00 ? 89 GLU B H    2  
ATOM 5803  H HA   . GLU B 1 90 ? 6.276   18.033  6.514   1.00 0.00 ? 89 GLU B HA   2  
ATOM 5804  H HB2  . GLU B 1 90 ? 4.926   18.891  3.948   1.00 0.00 ? 89 GLU B HB2  2  
ATOM 5805  H HB3  . GLU B 1 90 ? 5.155   20.005  5.297   1.00 0.00 ? 89 GLU B HB3  2  
ATOM 5806  H HG2  . GLU B 1 90 ? 7.024   20.218  3.732   1.00 0.00 ? 89 GLU B HG2  2  
ATOM 5807  H HG3  . GLU B 1 90 ? 7.596   19.519  5.247   1.00 0.00 ? 89 GLU B HG3  2  
ATOM 5808  N N    . HIS B 1 91 ? 3.975   17.084  7.490   1.00 0.00 ? 90 HIS B N    2  
ATOM 5809  C CA   . HIS B 1 91 ? 2.685   17.031  8.234   1.00 0.00 ? 90 HIS B CA   2  
ATOM 5810  C C    . HIS B 1 91 ? 2.591   18.228  9.184   1.00 0.00 ? 90 HIS B C    2  
ATOM 5811  O O    . HIS B 1 91 ? 2.055   18.128  10.270  1.00 0.00 ? 90 HIS B O    2  
ATOM 5812  C CB   . HIS B 1 91 ? 2.613   15.733  9.041   1.00 0.00 ? 90 HIS B CB   2  
ATOM 5813  C CG   . HIS B 1 91 ? 1.211   15.535  9.546   1.00 0.00 ? 90 HIS B CG   2  
ATOM 5814  N ND1  . HIS B 1 91 ? 0.932   15.303  10.883  1.00 0.00 ? 90 HIS B ND1  2  
ATOM 5815  C CD2  . HIS B 1 91 ? -0.003  15.534  8.904   1.00 0.00 ? 90 HIS B CD2  2  
ATOM 5816  C CE1  . HIS B 1 91 ? -0.401  15.173  11.003  1.00 0.00 ? 90 HIS B CE1  2  
ATOM 5817  N NE2  . HIS B 1 91 ? -1.020  15.305  9.826   1.00 0.00 ? 90 HIS B NE2  2  
ATOM 5818  H H    . HIS B 1 91 ? 4.705   16.476  7.730   1.00 0.00 ? 90 HIS B H    2  
ATOM 5819  H HA   . HIS B 1 91 ? 1.865   17.065  7.533   1.00 0.00 ? 90 HIS B HA   2  
ATOM 5820  H HB2  . HIS B 1 91 ? 2.890   14.901  8.410   1.00 0.00 ? 90 HIS B HB2  2  
ATOM 5821  H HB3  . HIS B 1 91 ? 3.292   15.792  9.879   1.00 0.00 ? 90 HIS B HB3  2  
ATOM 5822  H HD1  . HIS B 1 91 ? 1.588   15.244  11.610  1.00 0.00 ? 90 HIS B HD1  2  
ATOM 5823  H HD2  . HIS B 1 91 ? -0.146  15.685  7.844   1.00 0.00 ? 90 HIS B HD2  2  
ATOM 5824  H HE1  . HIS B 1 91 ? -0.910  14.983  11.936  1.00 0.00 ? 90 HIS B HE1  2  
ATOM 5825  N N    . GLU B 1 92 ? 3.106   19.360  8.787   1.00 0.00 ? 91 GLU B N    2  
ATOM 5826  C CA   . GLU B 1 92 ? 3.039   20.558  9.672   1.00 0.00 ? 91 GLU B CA   2  
ATOM 5827  C C    . GLU B 1 92 ? 1.656   21.201  9.553   1.00 0.00 ? 91 GLU B C    2  
ATOM 5828  O O    . GLU B 1 92 ? 1.007   21.357  10.575  1.00 0.00 ? 91 GLU B O    2  
ATOM 5829  C CB   . GLU B 1 92 ? 4.108   21.570  9.250   1.00 0.00 ? 91 GLU B CB   2  
ATOM 5830  C CG   . GLU B 1 92 ? 5.500   20.987  9.508   1.00 0.00 ? 91 GLU B CG   2  
ATOM 5831  C CD   . GLU B 1 92 ? 5.818   19.930  8.449   1.00 0.00 ? 91 GLU B CD   2  
ATOM 5832  O OE1  . GLU B 1 92 ? 6.315   20.302  7.399   1.00 0.00 ? 91 GLU B OE1  2  
ATOM 5833  O OE2  . GLU B 1 92 ? 5.558   18.766  8.706   1.00 0.00 ? 91 GLU B OE2  2  
ATOM 5834  O OXT  . GLU B 1 92 ? 1.268   21.526  8.443   1.00 0.00 ? 91 GLU B OXT  2  
ATOM 5835  H H    . GLU B 1 92 ? 3.533   19.422  7.907   1.00 0.00 ? 91 GLU B H    2  
ATOM 5836  H HA   . GLU B 1 92 ? 3.210   20.260  10.696  1.00 0.00 ? 91 GLU B HA   2  
ATOM 5837  H HB2  . GLU B 1 92 ? 3.999   21.790  8.198   1.00 0.00 ? 91 GLU B HB2  2  
ATOM 5838  H HB3  . GLU B 1 92 ? 3.990   22.478  9.821   1.00 0.00 ? 91 GLU B HB3  2  
ATOM 5839  H HG2  . GLU B 1 92 ? 6.235   21.778  9.459   1.00 0.00 ? 91 GLU B HG2  2  
ATOM 5840  H HG3  . GLU B 1 92 ? 5.525   20.532  10.487  1.00 0.00 ? 91 GLU B HG3  2  
ATOM 5841  N N    . MET A 1 1  ? -11.560 7.203   14.479  1.00 0.00 ? 0  MET A N    3  
ATOM 5842  C CA   . MET A 1 1  ? -10.230 6.632   14.132  1.00 0.00 ? 0  MET A CA   3  
ATOM 5843  C C    . MET A 1 1  ? -10.287 5.106   14.248  1.00 0.00 ? 0  MET A C    3  
ATOM 5844  O O    . MET A 1 1  ? -10.263 4.555   15.331  1.00 0.00 ? 0  MET A O    3  
ATOM 5845  C CB   . MET A 1 1  ? -9.174  7.189   15.090  1.00 0.00 ? 0  MET A CB   3  
ATOM 5846  C CG   . MET A 1 1  ? -8.965  8.679   14.804  1.00 0.00 ? 0  MET A CG   3  
ATOM 5847  S SD   . MET A 1 1  ? -8.100  9.452   16.197  1.00 0.00 ? 0  MET A SD   3  
ATOM 5848  C CE   . MET A 1 1  ? -6.415  8.951   15.758  1.00 0.00 ? 0  MET A CE   3  
ATOM 5849  H H1   . MET A 1 1  ? -12.295 6.738   13.911  1.00 0.00 ? 0  MET A H1   3  
ATOM 5850  H H2   . MET A 1 1  ? -11.750 7.047   15.489  1.00 0.00 ? 0  MET A H2   3  
ATOM 5851  H H3   . MET A 1 1  ? -11.563 8.223   14.277  1.00 0.00 ? 0  MET A H3   3  
ATOM 5852  H HA   . MET A 1 1  ? -9.975  6.905   13.118  1.00 0.00 ? 0  MET A HA   3  
ATOM 5853  H HB2  . MET A 1 1  ? -9.511  7.060   16.110  1.00 0.00 ? 0  MET A HB2  3  
ATOM 5854  H HB3  . MET A 1 1  ? -8.243  6.662   14.949  1.00 0.00 ? 0  MET A HB3  3  
ATOM 5855  H HG2  . MET A 1 1  ? -8.379  8.794   13.905  1.00 0.00 ? 0  MET A HG2  3  
ATOM 5856  H HG3  . MET A 1 1  ? -9.924  9.158   14.671  1.00 0.00 ? 0  MET A HG3  3  
ATOM 5857  H HE1  . MET A 1 1  ? -6.234  9.169   14.714  1.00 0.00 ? 0  MET A HE1  3  
ATOM 5858  H HE2  . MET A 1 1  ? -5.707  9.494   16.364  1.00 0.00 ? 0  MET A HE2  3  
ATOM 5859  H HE3  . MET A 1 1  ? -6.298  7.891   15.936  1.00 0.00 ? 0  MET A HE3  3  
ATOM 5860  N N    . SER A 1 2  ? -10.364 4.420   13.138  1.00 0.00 ? 1  SER A N    3  
ATOM 5861  C CA   . SER A 1 2  ? -10.423 2.930   13.178  1.00 0.00 ? 1  SER A CA   3  
ATOM 5862  C C    . SER A 1 2  ? -9.003  2.371   13.277  1.00 0.00 ? 1  SER A C    3  
ATOM 5863  O O    . SER A 1 2  ? -8.034  3.100   13.210  1.00 0.00 ? 1  SER A O    3  
ATOM 5864  C CB   . SER A 1 2  ? -11.085 2.409   11.902  1.00 0.00 ? 1  SER A CB   3  
ATOM 5865  O OG   . SER A 1 2  ? -10.223 2.643   10.796  1.00 0.00 ? 1  SER A OG   3  
ATOM 5866  H H    . SER A 1 2  ? -10.382 4.886   12.276  1.00 0.00 ? 1  SER A H    3  
ATOM 5867  H HA   . SER A 1 2  ? -10.997 2.612   14.038  1.00 0.00 ? 1  SER A HA   3  
ATOM 5868  H HB2  . SER A 1 2  ? -11.263 1.351   11.993  1.00 0.00 ? 1  SER A HB2  3  
ATOM 5869  H HB3  . SER A 1 2  ? -12.028 2.920   11.753  1.00 0.00 ? 1  SER A HB3  3  
ATOM 5870  H HG   . SER A 1 2  ? -10.218 3.586   10.617  1.00 0.00 ? 1  SER A HG   3  
ATOM 5871  N N    . GLU A 1 3  ? -8.869  1.083   13.438  1.00 0.00 ? 2  GLU A N    3  
ATOM 5872  C CA   . GLU A 1 3  ? -7.508  0.486   13.541  1.00 0.00 ? 2  GLU A CA   3  
ATOM 5873  C C    . GLU A 1 3  ? -6.741  0.739   12.240  1.00 0.00 ? 2  GLU A C    3  
ATOM 5874  O O    . GLU A 1 3  ? -5.538  0.911   12.241  1.00 0.00 ? 2  GLU A O    3  
ATOM 5875  C CB   . GLU A 1 3  ? -7.629  -1.022  13.787  1.00 0.00 ? 2  GLU A CB   3  
ATOM 5876  C CG   . GLU A 1 3  ? -8.608  -1.280  14.939  1.00 0.00 ? 2  GLU A CG   3  
ATOM 5877  C CD   . GLU A 1 3  ? -8.166  -0.495  16.176  1.00 0.00 ? 2  GLU A CD   3  
ATOM 5878  O OE1  . GLU A 1 3  ? -7.048  -0.703  16.617  1.00 0.00 ? 2  GLU A OE1  3  
ATOM 5879  O OE2  . GLU A 1 3  ? -8.953  0.302   16.660  1.00 0.00 ? 2  GLU A OE2  3  
ATOM 5880  H H    . GLU A 1 3  ? -9.662  0.509   13.491  1.00 0.00 ? 2  GLU A H    3  
ATOM 5881  H HA   . GLU A 1 3  ? -6.977  0.943   14.363  1.00 0.00 ? 2  GLU A HA   3  
ATOM 5882  H HB2  . GLU A 1 3  ? -7.992  -1.503  12.890  1.00 0.00 ? 2  GLU A HB2  3  
ATOM 5883  H HB3  . GLU A 1 3  ? -6.660  -1.424  14.045  1.00 0.00 ? 2  GLU A HB3  3  
ATOM 5884  H HG2  . GLU A 1 3  ? -9.598  -0.964  14.646  1.00 0.00 ? 2  GLU A HG2  3  
ATOM 5885  H HG3  . GLU A 1 3  ? -8.621  -2.335  15.172  1.00 0.00 ? 2  GLU A HG3  3  
ATOM 5886  N N    . LEU A 1 4  ? -7.429  0.756   11.129  1.00 0.00 ? 3  LEU A N    3  
ATOM 5887  C CA   . LEU A 1 4  ? -6.742  0.989   9.824   1.00 0.00 ? 3  LEU A CA   3  
ATOM 5888  C C    . LEU A 1 4  ? -6.115  2.390   9.812   1.00 0.00 ? 3  LEU A C    3  
ATOM 5889  O O    . LEU A 1 4  ? -4.940  2.551   9.548   1.00 0.00 ? 3  LEU A O    3  
ATOM 5890  C CB   . LEU A 1 4  ? -7.770  0.862   8.681   1.00 0.00 ? 3  LEU A CB   3  
ATOM 5891  C CG   . LEU A 1 4  ? -7.083  0.394   7.391   1.00 0.00 ? 3  LEU A CG   3  
ATOM 5892  C CD1  . LEU A 1 4  ? -8.123  0.271   6.275   1.00 0.00 ? 3  LEU A CD1  3  
ATOM 5893  C CD2  . LEU A 1 4  ? -6.010  1.406   6.975   1.00 0.00 ? 3  LEU A CD2  3  
ATOM 5894  H H    . LEU A 1 4  ? -8.397  0.602   11.149  1.00 0.00 ? 3  LEU A H    3  
ATOM 5895  H HA   . LEU A 1 4  ? -5.965  0.249   9.697   1.00 0.00 ? 3  LEU A HA   3  
ATOM 5896  H HB2  . LEU A 1 4  ? -8.524  0.141   8.962   1.00 0.00 ? 3  LEU A HB2  3  
ATOM 5897  H HB3  . LEU A 1 4  ? -8.244  1.819   8.507   1.00 0.00 ? 3  LEU A HB3  3  
ATOM 5898  H HG   . LEU A 1 4  ? -6.625  -0.569  7.560   1.00 0.00 ? 3  LEU A HG   3  
ATOM 5899  H HD11 . LEU A 1 4  ? -8.940  -0.350  6.611   1.00 0.00 ? 3  LEU A HD11 3  
ATOM 5900  H HD12 . LEU A 1 4  ? -8.497  1.251   6.021   1.00 0.00 ? 3  LEU A HD12 3  
ATOM 5901  H HD13 . LEU A 1 4  ? -7.664  -0.176  5.404   1.00 0.00 ? 3  LEU A HD13 3  
ATOM 5902  H HD21 . LEU A 1 4  ? -6.398  2.408   7.078   1.00 0.00 ? 3  LEU A HD21 3  
ATOM 5903  H HD22 . LEU A 1 4  ? -5.141  1.288   7.604   1.00 0.00 ? 3  LEU A HD22 3  
ATOM 5904  H HD23 . LEU A 1 4  ? -5.731  1.233   5.945   1.00 0.00 ? 3  LEU A HD23 3  
ATOM 5905  N N    . GLU A 1 5  ? -6.885  3.405   10.097  1.00 0.00 ? 4  GLU A N    3  
ATOM 5906  C CA   . GLU A 1 5  ? -6.324  4.786   10.096  1.00 0.00 ? 4  GLU A CA   3  
ATOM 5907  C C    . GLU A 1 5  ? -5.071  4.833   10.972  1.00 0.00 ? 4  GLU A C    3  
ATOM 5908  O O    . GLU A 1 5  ? -4.041  5.346   10.582  1.00 0.00 ? 4  GLU A O    3  
ATOM 5909  C CB   . GLU A 1 5  ? -7.371  5.758   10.644  1.00 0.00 ? 4  GLU A CB   3  
ATOM 5910  C CG   . GLU A 1 5  ? -8.640  5.667   9.794   1.00 0.00 ? 4  GLU A CG   3  
ATOM 5911  C CD   . GLU A 1 5  ? -9.709  6.601   10.361  1.00 0.00 ? 4  GLU A CD   3  
ATOM 5912  O OE1  . GLU A 1 5  ? -9.358  7.700   10.757  1.00 0.00 ? 4  GLU A OE1  3  
ATOM 5913  O OE2  . GLU A 1 5  ? -10.862 6.202   10.389  1.00 0.00 ? 4  GLU A OE2  3  
ATOM 5914  H H    . GLU A 1 5  ? -7.831  3.267   10.314  1.00 0.00 ? 4  GLU A H    3  
ATOM 5915  H HA   . GLU A 1 5  ? -6.069  5.064   9.084   1.00 0.00 ? 4  GLU A HA   3  
ATOM 5916  H HB2  . GLU A 1 5  ? -7.600  5.500   11.668  1.00 0.00 ? 4  GLU A HB2  3  
ATOM 5917  H HB3  . GLU A 1 5  ? -6.985  6.765   10.604  1.00 0.00 ? 4  GLU A HB3  3  
ATOM 5918  H HG2  . GLU A 1 5  ? -8.413  5.954   8.778   1.00 0.00 ? 4  GLU A HG2  3  
ATOM 5919  H HG3  . GLU A 1 5  ? -9.007  4.652   9.807   1.00 0.00 ? 4  GLU A HG3  3  
ATOM 5920  N N    . LYS A 1 6  ? -5.158  4.289   12.154  1.00 0.00 ? 5  LYS A N    3  
ATOM 5921  C CA   . LYS A 1 6  ? -3.984  4.281   13.070  1.00 0.00 ? 5  LYS A CA   3  
ATOM 5922  C C    . LYS A 1 6  ? -2.757  3.759   12.324  1.00 0.00 ? 5  LYS A C    3  
ATOM 5923  O O    . LYS A 1 6  ? -1.657  4.246   12.483  1.00 0.00 ? 5  LYS A O    3  
ATOM 5924  C CB   . LYS A 1 6  ? -4.279  3.342   14.241  1.00 0.00 ? 5  LYS A CB   3  
ATOM 5925  C CG   . LYS A 1 6  ? -3.125  3.402   15.244  1.00 0.00 ? 5  LYS A CG   3  
ATOM 5926  C CD   . LYS A 1 6  ? -3.454  2.528   16.455  1.00 0.00 ? 5  LYS A CD   3  
ATOM 5927  C CE   . LYS A 1 6  ? -2.196  2.331   17.302  1.00 0.00 ? 5  LYS A CE   3  
ATOM 5928  N NZ   . LYS A 1 6  ? -1.222  1.489   16.554  1.00 0.00 ? 5  LYS A NZ   3  
ATOM 5929  H H    . LYS A 1 6  ? -6.000  3.878   12.441  1.00 0.00 ? 5  LYS A H    3  
ATOM 5930  H HA   . LYS A 1 6  ? -3.810  5.274   13.460  1.00 0.00 ? 5  LYS A HA   3  
ATOM 5931  H HB2  . LYS A 1 6  ? -5.195  3.647   14.725  1.00 0.00 ? 5  LYS A HB2  3  
ATOM 5932  H HB3  . LYS A 1 6  ? -4.384  2.331   13.875  1.00 0.00 ? 5  LYS A HB3  3  
ATOM 5933  H HG2  . LYS A 1 6  ? -2.221  3.042   14.774  1.00 0.00 ? 5  LYS A HG2  3  
ATOM 5934  H HG3  . LYS A 1 6  ? -2.980  4.423   15.568  1.00 0.00 ? 5  LYS A HG3  3  
ATOM 5935  H HD2  . LYS A 1 6  ? -4.218  3.009   17.049  1.00 0.00 ? 5  LYS A HD2  3  
ATOM 5936  H HD3  . LYS A 1 6  ? -3.813  1.567   16.116  1.00 0.00 ? 5  LYS A HD3  3  
ATOM 5937  H HE2  . LYS A 1 6  ? -1.751  3.291   17.515  1.00 0.00 ? 5  LYS A HE2  3  
ATOM 5938  H HE3  . LYS A 1 6  ? -2.459  1.841   18.227  1.00 0.00 ? 5  LYS A HE3  3  
ATOM 5939  H HZ1  . LYS A 1 6  ? -1.032  1.921   15.627  1.00 0.00 ? 5  LYS A HZ1  3  
ATOM 5940  H HZ2  . LYS A 1 6  ? -0.336  1.421   17.094  1.00 0.00 ? 5  LYS A HZ2  3  
ATOM 5941  H HZ3  . LYS A 1 6  ? -1.616  0.537   16.419  1.00 0.00 ? 5  LYS A HZ3  3  
ATOM 5942  N N    . ALA A 1 7  ? -2.955  2.754   11.517  1.00 0.00 ? 6  ALA A N    3  
ATOM 5943  C CA   . ALA A 1 7  ? -1.832  2.151   10.747  1.00 0.00 ? 6  ALA A CA   3  
ATOM 5944  C C    . ALA A 1 7  ? -1.459  3.029   9.546   1.00 0.00 ? 6  ALA A C    3  
ATOM 5945  O O    . ALA A 1 7  ? -0.324  3.033   9.112   1.00 0.00 ? 6  ALA A O    3  
ATOM 5946  C CB   . ALA A 1 7  ? -2.257  0.757   10.260  1.00 0.00 ? 6  ALA A CB   3  
ATOM 5947  H H    . ALA A 1 7  ? -3.858  2.386   11.418  1.00 0.00 ? 6  ALA A H    3  
ATOM 5948  H HA   . ALA A 1 7  ? -0.962  2.064   11.377  1.00 0.00 ? 6  ALA A HA   3  
ATOM 5949  H HB1  . ALA A 1 7  ? -3.312  0.766   10.027  1.00 0.00 ? 6  ALA A HB1  3  
ATOM 5950  H HB2  . ALA A 1 7  ? -1.698  0.489   9.376   1.00 0.00 ? 6  ALA A HB2  3  
ATOM 5951  H HB3  . ALA A 1 7  ? -2.068  0.031   11.037  1.00 0.00 ? 6  ALA A HB3  3  
ATOM 5952  N N    . MET A 1 8  ? -2.379  3.779   9.010   1.00 0.00 ? 7  MET A N    3  
ATOM 5953  C CA   . MET A 1 8  ? -2.020  4.646   7.852   1.00 0.00 ? 7  MET A CA   3  
ATOM 5954  C C    . MET A 1 8  ? -0.967  5.662   8.311   1.00 0.00 ? 7  MET A C    3  
ATOM 5955  O O    . MET A 1 8  ? 0.028   5.884   7.650   1.00 0.00 ? 7  MET A O    3  
ATOM 5956  C CB   . MET A 1 8  ? -3.270  5.379   7.344   1.00 0.00 ? 7  MET A CB   3  
ATOM 5957  C CG   . MET A 1 8  ? -3.053  5.819   5.892   1.00 0.00 ? 7  MET A CG   3  
ATOM 5958  S SD   . MET A 1 8  ? -3.219  4.380   4.804   1.00 0.00 ? 7  MET A SD   3  
ATOM 5959  C CE   . MET A 1 8  ? -2.011  4.887   3.556   1.00 0.00 ? 7  MET A CE   3  
ATOM 5960  H H    . MET A 1 8  ? -3.290  3.782   9.367   1.00 0.00 ? 7  MET A H    3  
ATOM 5961  H HA   . MET A 1 8  ? -1.608  4.036   7.063   1.00 0.00 ? 7  MET A HA   3  
ATOM 5962  H HB2  . MET A 1 8  ? -4.118  4.711   7.393   1.00 0.00 ? 7  MET A HB2  3  
ATOM 5963  H HB3  . MET A 1 8  ? -3.461  6.247   7.958   1.00 0.00 ? 7  MET A HB3  3  
ATOM 5964  H HG2  . MET A 1 8  ? -3.791  6.561   5.625   1.00 0.00 ? 7  MET A HG2  3  
ATOM 5965  H HG3  . MET A 1 8  ? -2.063  6.240   5.784   1.00 0.00 ? 7  MET A HG3  3  
ATOM 5966  H HE1  . MET A 1 8  ? -1.043  5.009   4.022   1.00 0.00 ? 7  MET A HE1  3  
ATOM 5967  H HE2  . MET A 1 8  ? -1.947  4.131   2.790   1.00 0.00 ? 7  MET A HE2  3  
ATOM 5968  H HE3  . MET A 1 8  ? -2.325  5.821   3.112   1.00 0.00 ? 7  MET A HE3  3  
ATOM 5969  N N    . VAL A 1 9  ? -1.186  6.277   9.442   1.00 0.00 ? 8  VAL A N    3  
ATOM 5970  C CA   . VAL A 1 9  ? -0.210  7.282   9.958   1.00 0.00 ? 8  VAL A CA   3  
ATOM 5971  C C    . VAL A 1 9  ? 1.083   6.580   10.400  1.00 0.00 ? 8  VAL A C    3  
ATOM 5972  O O    . VAL A 1 9  ? 2.166   7.109   10.248  1.00 0.00 ? 8  VAL A O    3  
ATOM 5973  C CB   . VAL A 1 9  ? -0.830  8.020   11.152  1.00 0.00 ? 8  VAL A CB   3  
ATOM 5974  C CG1  . VAL A 1 9  ? -0.069  9.324   11.402  1.00 0.00 ? 8  VAL A CG1  3  
ATOM 5975  C CG2  . VAL A 1 9  ? -2.295  8.344   10.844  1.00 0.00 ? 8  VAL A CG2  3  
ATOM 5976  H H    . VAL A 1 9  ? -1.998  6.079   9.954   1.00 0.00 ? 8  VAL A H    3  
ATOM 5977  H HA   . VAL A 1 9  ? 0.019   7.996   9.180   1.00 0.00 ? 8  VAL A HA   3  
ATOM 5978  H HB   . VAL A 1 9  ? -0.774  7.395   12.032  1.00 0.00 ? 8  VAL A HB   3  
ATOM 5979  H HG11 . VAL A 1 9  ? 0.980   9.108   11.539  1.00 0.00 ? 8  VAL A HG11 3  
ATOM 5980  H HG12 . VAL A 1 9  ? -0.193  9.980   10.553  1.00 0.00 ? 8  VAL A HG12 3  
ATOM 5981  H HG13 . VAL A 1 9  ? -0.456  9.805   12.288  1.00 0.00 ? 8  VAL A HG13 3  
ATOM 5982  H HG21 . VAL A 1 9  ? -2.358  8.860   9.897   1.00 0.00 ? 8  VAL A HG21 3  
ATOM 5983  H HG22 . VAL A 1 9  ? -2.863  7.427   10.793  1.00 0.00 ? 8  VAL A HG22 3  
ATOM 5984  H HG23 . VAL A 1 9  ? -2.696  8.973   11.625  1.00 0.00 ? 8  VAL A HG23 3  
ATOM 5985  N N    . ALA A 1 10 ? 0.981   5.398   10.945  1.00 0.00 ? 9  ALA A N    3  
ATOM 5986  C CA   . ALA A 1 10 ? 2.205   4.669   11.393  1.00 0.00 ? 9  ALA A CA   3  
ATOM 5987  C C    . ALA A 1 10 ? 3.128   4.431   10.195  1.00 0.00 ? 9  ALA A C    3  
ATOM 5988  O O    . ALA A 1 10 ? 4.314   4.689   10.246  1.00 0.00 ? 9  ALA A O    3  
ATOM 5989  C CB   . ALA A 1 10 ? 1.793   3.313   11.966  1.00 0.00 ? 9  ALA A CB   3  
ATOM 5990  H H    . ALA A 1 10 ? 0.100   4.984   11.061  1.00 0.00 ? 9  ALA A H    3  
ATOM 5991  H HA   . ALA A 1 10 ? 2.714   5.233   12.160  1.00 0.00 ? 9  ALA A HA   3  
ATOM 5992  H HB1  . ALA A 1 10 ? 1.251   2.758   11.216  1.00 0.00 ? 9  ALA A HB1  3  
ATOM 5993  H HB2  . ALA A 1 10 ? 2.675   2.761   12.254  1.00 0.00 ? 9  ALA A HB2  3  
ATOM 5994  H HB3  . ALA A 1 10 ? 1.163   3.461   12.832  1.00 0.00 ? 9  ALA A HB3  3  
ATOM 5995  N N    . LEU A 1 11 ? 2.587   3.916   9.127   1.00 0.00 ? 10 LEU A N    3  
ATOM 5996  C CA   . LEU A 1 11 ? 3.414   3.627   7.923   1.00 0.00 ? 10 LEU A CA   3  
ATOM 5997  C C    . LEU A 1 11 ? 4.217   4.859   7.531   1.00 0.00 ? 10 LEU A C    3  
ATOM 5998  O O    . LEU A 1 11 ? 5.428   4.835   7.436   1.00 0.00 ? 10 LEU A O    3  
ATOM 5999  C CB   . LEU A 1 11 ? 2.467   3.285   6.759   1.00 0.00 ? 10 LEU A CB   3  
ATOM 6000  C CG   . LEU A 1 11 ? 1.944   1.839   6.901   1.00 0.00 ? 10 LEU A CG   3  
ATOM 6001  C CD1  . LEU A 1 11 ? 0.598   1.703   6.182   1.00 0.00 ? 10 LEU A CD1  3  
ATOM 6002  C CD2  . LEU A 1 11 ? 2.939   0.850   6.274   1.00 0.00 ? 10 LEU A CD2  3  
ATOM 6003  H H    . LEU A 1 11 ? 1.632   3.699   9.124   1.00 0.00 ? 10 LEU A H    3  
ATOM 6004  H HA   . LEU A 1 11 ? 4.047   2.774   8.105   1.00 0.00 ? 10 LEU A HA   3  
ATOM 6005  H HB2  . LEU A 1 11 ? 1.634   3.975   6.772   1.00 0.00 ? 10 LEU A HB2  3  
ATOM 6006  H HB3  . LEU A 1 11 ? 2.994   3.385   5.820   1.00 0.00 ? 10 LEU A HB3  3  
ATOM 6007  H HG   . LEU A 1 11 ? 1.812   1.604   7.947   1.00 0.00 ? 10 LEU A HG   3  
ATOM 6008  H HD11 . LEU A 1 11 ? 0.688   2.084   5.175   1.00 0.00 ? 10 LEU A HD11 3  
ATOM 6009  H HD12 . LEU A 1 11 ? 0.311   0.663   6.149   1.00 0.00 ? 10 LEU A HD12 3  
ATOM 6010  H HD13 . LEU A 1 11 ? -0.151  2.265   6.715   1.00 0.00 ? 10 LEU A HD13 3  
ATOM 6011  H HD21 . LEU A 1 11 ? 3.893   0.924   6.769   1.00 0.00 ? 10 LEU A HD21 3  
ATOM 6012  H HD22 . LEU A 1 11 ? 2.558   -0.156  6.379   1.00 0.00 ? 10 LEU A HD22 3  
ATOM 6013  H HD23 . LEU A 1 11 ? 3.061   1.078   5.226   1.00 0.00 ? 10 LEU A HD23 3  
ATOM 6014  N N    . ILE A 1 12 ? 3.527   5.931   7.282   1.00 0.00 ? 11 ILE A N    3  
ATOM 6015  C CA   . ILE A 1 12 ? 4.204   7.183   6.863   1.00 0.00 ? 11 ILE A CA   3  
ATOM 6016  C C    . ILE A 1 12 ? 5.292   7.564   7.863   1.00 0.00 ? 11 ILE A C    3  
ATOM 6017  O O    . ILE A 1 12 ? 6.349   8.030   7.484   1.00 0.00 ? 11 ILE A O    3  
ATOM 6018  C CB   . ILE A 1 12 ? 3.174   8.312   6.789   1.00 0.00 ? 11 ILE A CB   3  
ATOM 6019  C CG1  . ILE A 1 12 ? 2.140   7.984   5.710   1.00 0.00 ? 11 ILE A CG1  3  
ATOM 6020  C CG2  . ILE A 1 12 ? 3.876   9.623   6.430   1.00 0.00 ? 11 ILE A CG2  3  
ATOM 6021  C CD1  . ILE A 1 12 ? 0.950   8.941   5.829   1.00 0.00 ? 11 ILE A CD1  3  
ATOM 6022  H H    . ILE A 1 12 ? 2.549   5.904   7.355   1.00 0.00 ? 11 ILE A H    3  
ATOM 6023  H HA   . ILE A 1 12 ? 4.644   7.043   5.887   1.00 0.00 ? 11 ILE A HA   3  
ATOM 6024  H HB   . ILE A 1 12 ? 2.680   8.414   7.745   1.00 0.00 ? 11 ILE A HB   3  
ATOM 6025  H HG12 . ILE A 1 12 ? 2.592   8.092   4.734   1.00 0.00 ? 11 ILE A HG12 3  
ATOM 6026  H HG13 . ILE A 1 12 ? 1.796   6.969   5.839   1.00 0.00 ? 11 ILE A HG13 3  
ATOM 6027  H HG21 . ILE A 1 12 ? 4.512   9.464   5.573   1.00 0.00 ? 11 ILE A HG21 3  
ATOM 6028  H HG22 . ILE A 1 12 ? 3.136   10.375  6.198   1.00 0.00 ? 11 ILE A HG22 3  
ATOM 6029  H HG23 . ILE A 1 12 ? 4.475   9.954   7.266   1.00 0.00 ? 11 ILE A HG23 3  
ATOM 6030  H HD11 . ILE A 1 12 ? 1.304   9.941   6.036   1.00 0.00 ? 11 ILE A HD11 3  
ATOM 6031  H HD12 . ILE A 1 12 ? 0.397   8.942   4.901   1.00 0.00 ? 11 ILE A HD12 3  
ATOM 6032  H HD13 . ILE A 1 12 ? 0.305   8.612   6.630   1.00 0.00 ? 11 ILE A HD13 3  
ATOM 6033  N N    . ASP A 1 13 ? 5.047   7.403   9.137   1.00 0.00 ? 12 ASP A N    3  
ATOM 6034  C CA   . ASP A 1 13 ? 6.086   7.800   10.126  1.00 0.00 ? 12 ASP A CA   3  
ATOM 6035  C C    . ASP A 1 13 ? 7.276   6.841   10.045  1.00 0.00 ? 12 ASP A C    3  
ATOM 6036  O O    . ASP A 1 13 ? 8.412   7.252   10.166  1.00 0.00 ? 12 ASP A O    3  
ATOM 6037  C CB   . ASP A 1 13 ? 5.501   7.807   11.540  1.00 0.00 ? 12 ASP A CB   3  
ATOM 6038  C CG   . ASP A 1 13 ? 4.528   8.978   11.686  1.00 0.00 ? 12 ASP A CG   3  
ATOM 6039  O OD1  . ASP A 1 13 ? 4.562   9.860   10.843  1.00 0.00 ? 12 ASP A OD1  3  
ATOM 6040  O OD2  . ASP A 1 13 ? 3.762   8.973   12.636  1.00 0.00 ? 12 ASP A OD2  3  
ATOM 6041  H H    . ASP A 1 13 ? 4.186   7.046   9.437   1.00 0.00 ? 12 ASP A H    3  
ATOM 6042  H HA   . ASP A 1 13 ? 6.417   8.792   9.854   1.00 0.00 ? 12 ASP A HA   3  
ATOM 6043  H HB2  . ASP A 1 13 ? 4.978   6.878   11.717  1.00 0.00 ? 12 ASP A HB2  3  
ATOM 6044  H HB3  . ASP A 1 13 ? 6.299   7.913   12.260  1.00 0.00 ? 12 ASP A HB3  3  
ATOM 6045  N N    . VAL A 1 14 ? 7.044   5.569   9.833   1.00 0.00 ? 13 VAL A N    3  
ATOM 6046  C CA   . VAL A 1 14 ? 8.200   4.635   9.742   1.00 0.00 ? 13 VAL A CA   3  
ATOM 6047  C C    . VAL A 1 14 ? 8.969   4.938   8.459   1.00 0.00 ? 13 VAL A C    3  
ATOM 6048  O O    . VAL A 1 14 ? 10.183  4.969   8.455   1.00 0.00 ? 13 VAL A O    3  
ATOM 6049  C CB   . VAL A 1 14 ? 7.724   3.180   9.752   1.00 0.00 ? 13 VAL A CB   3  
ATOM 6050  C CG1  . VAL A 1 14 ? 8.929   2.245   9.641   1.00 0.00 ? 13 VAL A CG1  3  
ATOM 6051  C CG2  . VAL A 1 14 ? 6.975   2.897   11.056  1.00 0.00 ? 13 VAL A CG2  3  
ATOM 6052  H H    . VAL A 1 14 ? 6.127   5.234   9.726   1.00 0.00 ? 13 VAL A H    3  
ATOM 6053  H HA   . VAL A 1 14 ? 8.877   4.826   10.560  1.00 0.00 ? 13 VAL A HA   3  
ATOM 6054  H HB   . VAL A 1 14 ? 7.064   3.014   8.913   1.00 0.00 ? 13 VAL A HB   3  
ATOM 6055  H HG11 . VAL A 1 14 ? 9.658   2.507   10.393  1.00 0.00 ? 13 VAL A HG11 3  
ATOM 6056  H HG12 . VAL A 1 14 ? 8.608   1.225   9.790   1.00 0.00 ? 13 VAL A HG12 3  
ATOM 6057  H HG13 . VAL A 1 14 ? 9.371   2.344   8.660   1.00 0.00 ? 13 VAL A HG13 3  
ATOM 6058  H HG21 . VAL A 1 14 ? 6.228   3.661   11.215  1.00 0.00 ? 13 VAL A HG21 3  
ATOM 6059  H HG22 . VAL A 1 14 ? 6.495   1.931   10.991  1.00 0.00 ? 13 VAL A HG22 3  
ATOM 6060  H HG23 . VAL A 1 14 ? 7.672   2.898   11.880  1.00 0.00 ? 13 VAL A HG23 3  
ATOM 6061  N N    . PHE A 1 15 ? 8.292   5.190   7.377   1.00 0.00 ? 14 PHE A N    3  
ATOM 6062  C CA   . PHE A 1 15 ? 9.027   5.516   6.128   1.00 0.00 ? 14 PHE A CA   3  
ATOM 6063  C C    . PHE A 1 15 ? 9.854   6.782   6.370   1.00 0.00 ? 14 PHE A C    3  
ATOM 6064  O O    . PHE A 1 15 ? 10.944  6.941   5.850   1.00 0.00 ? 14 PHE A O    3  
ATOM 6065  C CB   . PHE A 1 15 ? 8.038   5.762   4.988   1.00 0.00 ? 14 PHE A CB   3  
ATOM 6066  C CG   . PHE A 1 15 ? 8.807   6.045   3.719   1.00 0.00 ? 14 PHE A CG   3  
ATOM 6067  C CD1  . PHE A 1 15 ? 9.340   7.321   3.494   1.00 0.00 ? 14 PHE A CD1  3  
ATOM 6068  C CD2  . PHE A 1 15 ? 8.994   5.032   2.771   1.00 0.00 ? 14 PHE A CD2  3  
ATOM 6069  C CE1  . PHE A 1 15 ? 10.058  7.584   2.321   1.00 0.00 ? 14 PHE A CE1  3  
ATOM 6070  C CE2  . PHE A 1 15 ? 9.712   5.294   1.600   1.00 0.00 ? 14 PHE A CE2  3  
ATOM 6071  C CZ   . PHE A 1 15 ? 10.245  6.569   1.374   1.00 0.00 ? 14 PHE A CZ   3  
ATOM 6072  H H    . PHE A 1 15 ? 7.312   5.182   7.390   1.00 0.00 ? 14 PHE A H    3  
ATOM 6073  H HA   . PHE A 1 15 ? 9.684   4.698   5.872   1.00 0.00 ? 14 PHE A HA   3  
ATOM 6074  H HB2  . PHE A 1 15 ? 7.421   4.886   4.850   1.00 0.00 ? 14 PHE A HB2  3  
ATOM 6075  H HB3  . PHE A 1 15 ? 7.414   6.610   5.228   1.00 0.00 ? 14 PHE A HB3  3  
ATOM 6076  H HD1  . PHE A 1 15 ? 9.195   8.103   4.224   1.00 0.00 ? 14 PHE A HD1  3  
ATOM 6077  H HD2  . PHE A 1 15 ? 8.584   4.048   2.944   1.00 0.00 ? 14 PHE A HD2  3  
ATOM 6078  H HE1  . PHE A 1 15 ? 10.469  8.568   2.147   1.00 0.00 ? 14 PHE A HE1  3  
ATOM 6079  H HE2  . PHE A 1 15 ? 9.856   4.513   0.868   1.00 0.00 ? 14 PHE A HE2  3  
ATOM 6080  H HZ   . PHE A 1 15 ? 10.799  6.770   0.470   1.00 0.00 ? 14 PHE A HZ   3  
ATOM 6081  N N    . HIS A 1 16 ? 9.338   7.685   7.162   1.00 0.00 ? 15 HIS A N    3  
ATOM 6082  C CA   . HIS A 1 16 ? 10.081  8.945   7.446   1.00 0.00 ? 15 HIS A CA   3  
ATOM 6083  C C    . HIS A 1 16 ? 11.209  8.674   8.446   1.00 0.00 ? 15 HIS A C    3  
ATOM 6084  O O    . HIS A 1 16 ? 12.242  9.315   8.425   1.00 0.00 ? 15 HIS A O    3  
ATOM 6085  C CB   . HIS A 1 16 ? 9.119   9.982   8.032   1.00 0.00 ? 15 HIS A CB   3  
ATOM 6086  C CG   . HIS A 1 16 ? 9.813   11.313  8.120   1.00 0.00 ? 15 HIS A CG   3  
ATOM 6087  N ND1  . HIS A 1 16 ? 10.180  11.878  9.332   1.00 0.00 ? 15 HIS A ND1  3  
ATOM 6088  C CD2  . HIS A 1 16 ? 10.218  12.200  7.154   1.00 0.00 ? 15 HIS A CD2  3  
ATOM 6089  C CE1  . HIS A 1 16 ? 10.777  13.054  9.066   1.00 0.00 ? 15 HIS A CE1  3  
ATOM 6090  N NE2  . HIS A 1 16 ? 10.828  13.299  7.754   1.00 0.00 ? 15 HIS A NE2  3  
ATOM 6091  H H    . HIS A 1 16 ? 8.459   7.533   7.570   1.00 0.00 ? 15 HIS A H    3  
ATOM 6092  H HA   . HIS A 1 16 ? 10.501  9.327   6.528   1.00 0.00 ? 15 HIS A HA   3  
ATOM 6093  H HB2  . HIS A 1 16 ? 8.252   10.070  7.394   1.00 0.00 ? 15 HIS A HB2  3  
ATOM 6094  H HB3  . HIS A 1 16 ? 8.810   9.669   9.019   1.00 0.00 ? 15 HIS A HB3  3  
ATOM 6095  H HD1  . HIS A 1 16 ? 10.031  11.492  10.220  1.00 0.00 ? 15 HIS A HD1  3  
ATOM 6096  H HD2  . HIS A 1 16 ? 10.077  12.069  6.091   1.00 0.00 ? 15 HIS A HD2  3  
ATOM 6097  H HE1  . HIS A 1 16 ? 11.166  13.720  9.821   1.00 0.00 ? 15 HIS A HE1  3  
ATOM 6098  N N    . GLN A 1 17 ? 11.007  7.733   9.330   1.00 0.00 ? 16 GLN A N    3  
ATOM 6099  C CA   . GLN A 1 17 ? 12.049  7.417   10.349  1.00 0.00 ? 16 GLN A CA   3  
ATOM 6100  C C    . GLN A 1 17 ? 13.384  7.148   9.657   1.00 0.00 ? 16 GLN A C    3  
ATOM 6101  O O    . GLN A 1 17 ? 14.420  7.610   10.090  1.00 0.00 ? 16 GLN A O    3  
ATOM 6102  C CB   . GLN A 1 17 ? 11.624  6.177   11.142  1.00 0.00 ? 16 GLN A CB   3  
ATOM 6103  C CG   . GLN A 1 17 ? 12.575  5.968   12.324  1.00 0.00 ? 16 GLN A CG   3  
ATOM 6104  C CD   . GLN A 1 17 ? 12.372  7.080   13.355  1.00 0.00 ? 16 GLN A CD   3  
ATOM 6105  O OE1  . GLN A 1 17 ? 13.326  7.647   13.849  1.00 0.00 ? 16 GLN A OE1  3  
ATOM 6106  N NE2  . GLN A 1 17 ? 11.162  7.419   13.705  1.00 0.00 ? 16 GLN A NE2  3  
ATOM 6107  H H    . GLN A 1 17 ? 10.161  7.238   9.330   1.00 0.00 ? 16 GLN A H    3  
ATOM 6108  H HA   . GLN A 1 17 ? 12.156  8.253   11.025  1.00 0.00 ? 16 GLN A HA   3  
ATOM 6109  H HB2  . GLN A 1 17 ? 10.618  6.315   11.510  1.00 0.00 ? 16 GLN A HB2  3  
ATOM 6110  H HB3  . GLN A 1 17 ? 11.657  5.310   10.498  1.00 0.00 ? 16 GLN A HB3  3  
ATOM 6111  H HG2  . GLN A 1 17 ? 12.371  5.011   12.784  1.00 0.00 ? 16 GLN A HG2  3  
ATOM 6112  H HG3  . GLN A 1 17 ? 13.596  5.987   11.973  1.00 0.00 ? 16 GLN A HG3  3  
ATOM 6113  H HE21 . GLN A 1 17 ? 10.390  6.963   13.309  1.00 0.00 ? 16 GLN A HE21 3  
ATOM 6114  H HE22 . GLN A 1 17 ? 11.024  8.130   14.365  1.00 0.00 ? 16 GLN A HE22 3  
ATOM 6115  N N    . TYR A 1 18 ? 13.374  6.407   8.584   1.00 0.00 ? 17 TYR A N    3  
ATOM 6116  C CA   . TYR A 1 18 ? 14.650  6.120   7.876   1.00 0.00 ? 17 TYR A CA   3  
ATOM 6117  C C    . TYR A 1 18 ? 15.135  7.392   7.182   1.00 0.00 ? 17 TYR A C    3  
ATOM 6118  O O    . TYR A 1 18 ? 16.300  7.733   7.236   1.00 0.00 ? 17 TYR A O    3  
ATOM 6119  C CB   . TYR A 1 18 ? 14.421  5.026   6.830   1.00 0.00 ? 17 TYR A CB   3  
ATOM 6120  C CG   . TYR A 1 18 ? 14.284  3.686   7.519   1.00 0.00 ? 17 TYR A CG   3  
ATOM 6121  C CD1  . TYR A 1 18 ? 13.160  3.423   8.311   1.00 0.00 ? 17 TYR A CD1  3  
ATOM 6122  C CD2  . TYR A 1 18 ? 15.275  2.706   7.364   1.00 0.00 ? 17 TYR A CD2  3  
ATOM 6123  C CE1  . TYR A 1 18 ? 13.026  2.185   8.949   1.00 0.00 ? 17 TYR A CE1  3  
ATOM 6124  C CE2  . TYR A 1 18 ? 15.140  1.467   8.003   1.00 0.00 ? 17 TYR A CE2  3  
ATOM 6125  C CZ   . TYR A 1 18 ? 14.015  1.207   8.796   1.00 0.00 ? 17 TYR A CZ   3  
ATOM 6126  O OH   . TYR A 1 18 ? 13.881  -0.013  9.426   1.00 0.00 ? 17 TYR A OH   3  
ATOM 6127  H H    . TYR A 1 18 ? 12.534  6.038   8.248   1.00 0.00 ? 17 TYR A H    3  
ATOM 6128  H HA   . TYR A 1 18 ? 15.392  5.791   8.589   1.00 0.00 ? 17 TYR A HA   3  
ATOM 6129  H HB2  . TYR A 1 18 ? 13.516  5.240   6.280   1.00 0.00 ? 17 TYR A HB2  3  
ATOM 6130  H HB3  . TYR A 1 18 ? 15.258  4.999   6.148   1.00 0.00 ? 17 TYR A HB3  3  
ATOM 6131  H HD1  . TYR A 1 18 ? 12.396  4.177   8.430   1.00 0.00 ? 17 TYR A HD1  3  
ATOM 6132  H HD2  . TYR A 1 18 ? 16.142  2.908   6.754   1.00 0.00 ? 17 TYR A HD2  3  
ATOM 6133  H HE1  . TYR A 1 18 ? 12.158  1.984   9.561   1.00 0.00 ? 17 TYR A HE1  3  
ATOM 6134  H HE2  . TYR A 1 18 ? 15.903  0.712   7.884   1.00 0.00 ? 17 TYR A HE2  3  
ATOM 6135  H HH   . TYR A 1 18 ? 14.336  -0.672  8.898   1.00 0.00 ? 17 TYR A HH   3  
ATOM 6136  N N    . SER A 1 19 ? 14.249  8.097   6.524   1.00 0.00 ? 18 SER A N    3  
ATOM 6137  C CA   . SER A 1 19 ? 14.656  9.349   5.816   1.00 0.00 ? 18 SER A CA   3  
ATOM 6138  C C    . SER A 1 19 ? 14.352  10.572  6.689   1.00 0.00 ? 18 SER A C    3  
ATOM 6139  O O    . SER A 1 19 ? 13.635  11.462  6.277   1.00 0.00 ? 18 SER A O    3  
ATOM 6140  C CB   . SER A 1 19 ? 13.872  9.465   4.507   1.00 0.00 ? 18 SER A CB   3  
ATOM 6141  O OG   . SER A 1 19 ? 14.449  10.484  3.703   1.00 0.00 ? 18 SER A OG   3  
ATOM 6142  H H    . SER A 1 19 ? 13.315  7.800   6.492   1.00 0.00 ? 18 SER A H    3  
ATOM 6143  H HA   . SER A 1 19 ? 15.714  9.321   5.595   1.00 0.00 ? 18 SER A HA   3  
ATOM 6144  H HB2  . SER A 1 19 ? 13.912  8.528   3.975   1.00 0.00 ? 18 SER A HB2  3  
ATOM 6145  H HB3  . SER A 1 19 ? 12.840  9.706   4.726   1.00 0.00 ? 18 SER A HB3  3  
ATOM 6146  H HG   . SER A 1 19 ? 13.743  11.064  3.409   1.00 0.00 ? 18 SER A HG   3  
ATOM 6147  N N    . GLY A 1 20 ? 14.908  10.643  7.881   1.00 0.00 ? 19 GLY A N    3  
ATOM 6148  C CA   . GLY A 1 20 ? 14.671  11.830  8.772   1.00 0.00 ? 19 GLY A CA   3  
ATOM 6149  C C    . GLY A 1 20 ? 16.018  12.517  9.016   1.00 0.00 ? 19 GLY A C    3  
ATOM 6150  O O    . GLY A 1 20 ? 16.083  13.652  9.446   1.00 0.00 ? 19 GLY A O    3  
ATOM 6151  H H    . GLY A 1 20 ? 15.509  9.934   8.195   1.00 0.00 ? 19 GLY A H    3  
ATOM 6152  H HA2  . GLY A 1 20 ? 13.986  12.522  8.300   1.00 0.00 ? 19 GLY A HA2  3  
ATOM 6153  H HA3  . GLY A 1 20 ? 14.266  11.509  9.720   1.00 0.00 ? 19 GLY A HA3  3  
ATOM 6154  N N    . ARG A 1 21 ? 17.090  11.842  8.713   1.00 0.00 ? 20 ARG A N    3  
ATOM 6155  C CA   . ARG A 1 21 ? 18.445  12.444  8.882   1.00 0.00 ? 20 ARG A CA   3  
ATOM 6156  C C    . ARG A 1 21 ? 18.574  13.650  7.953   1.00 0.00 ? 20 ARG A C    3  
ATOM 6157  O O    . ARG A 1 21 ? 19.225  14.621  8.290   1.00 0.00 ? 20 ARG A O    3  
ATOM 6158  C CB   . ARG A 1 21 ? 19.514  11.404  8.539   1.00 0.00 ? 20 ARG A CB   3  
ATOM 6159  C CG   . ARG A 1 21 ? 20.867  11.847  9.092   1.00 0.00 ? 20 ARG A CG   3  
ATOM 6160  C CD   . ARG A 1 21 ? 21.949  10.869  8.633   1.00 0.00 ? 20 ARG A CD   3  
ATOM 6161  N NE   . ARG A 1 21 ? 23.282  11.345  9.100   1.00 0.00 ? 20 ARG A NE   3  
ATOM 6162  C CZ   . ARG A 1 21 ? 23.443  11.713  10.341  1.00 0.00 ? 20 ARG A CZ   3  
ATOM 6163  N NH1  . ARG A 1 21 ? 23.168  10.881  11.307  1.00 0.00 ? 20 ARG A NH1  3  
ATOM 6164  N NH2  . ARG A 1 21 ? 23.874  12.914  10.613  1.00 0.00 ? 20 ARG A NH2  3  
ATOM 6165  H H    . ARG A 1 21 ? 17.008  10.941  8.340   1.00 0.00 ? 20 ARG A H    3  
ATOM 6166  H HA   . ARG A 1 21 ? 18.605  12.826  9.879   1.00 0.00 ? 20 ARG A HA   3  
ATOM 6167  H HB2  . ARG A 1 21 ? 19.242  10.453  8.973   1.00 0.00 ? 20 ARG A HB2  3  
ATOM 6168  H HB3  . ARG A 1 21 ? 19.583  11.301  7.466   1.00 0.00 ? 20 ARG A HB3  3  
ATOM 6169  H HG2  . ARG A 1 21 ? 21.097  12.839  8.730   1.00 0.00 ? 20 ARG A HG2  3  
ATOM 6170  H HG3  . ARG A 1 21 ? 20.828  11.857  10.171  1.00 0.00 ? 20 ARG A HG3  3  
ATOM 6171  H HD2  . ARG A 1 21 ? 21.749  9.891   9.047   1.00 0.00 ? 20 ARG A HD2  3  
ATOM 6172  H HD3  . ARG A 1 21 ? 21.946  10.810  7.554   1.00 0.00 ? 20 ARG A HD3  3  
ATOM 6173  H HE   . ARG A 1 21 ? 24.036  11.385  8.475   1.00 0.00 ? 20 ARG A HE   3  
ATOM 6174  H HH11 . ARG A 1 21 ? 22.834  9.962   11.095  1.00 0.00 ? 20 ARG A HH11 3  
ATOM 6175  H HH12 . ARG A 1 21 ? 23.287  11.162  12.260  1.00 0.00 ? 20 ARG A HH12 3  
ATOM 6176  H HH21 . ARG A 1 21 ? 24.077  13.551  9.871   1.00 0.00 ? 20 ARG A HH21 3  
ATOM 6177  H HH22 . ARG A 1 21 ? 24.001  13.196  11.564  1.00 0.00 ? 20 ARG A HH22 3  
ATOM 6178  N N    . GLU A 1 22 ? 17.943  13.635  6.810   1.00 0.00 ? 21 GLU A N    3  
ATOM 6179  C CA   . GLU A 1 22 ? 18.025  14.826  5.910   1.00 0.00 ? 21 GLU A CA   3  
ATOM 6180  C C    . GLU A 1 22 ? 16.711  14.964  5.147   1.00 0.00 ? 21 GLU A C    3  
ATOM 6181  O O    . GLU A 1 22 ? 16.165  16.043  5.032   1.00 0.00 ? 21 GLU A O    3  
ATOM 6182  C CB   . GLU A 1 22 ? 19.178  14.655  4.914   1.00 0.00 ? 21 GLU A CB   3  
ATOM 6183  C CG   . GLU A 1 22 ? 20.517  14.918  5.607   1.00 0.00 ? 21 GLU A CG   3  
ATOM 6184  C CD   . GLU A 1 22 ? 21.631  14.948  4.558   1.00 0.00 ? 21 GLU A CD   3  
ATOM 6185  O OE1  . GLU A 1 22 ? 21.351  15.341  3.437   1.00 0.00 ? 21 GLU A OE1  3  
ATOM 6186  O OE2  . GLU A 1 22 ? 22.744  14.574  4.891   1.00 0.00 ? 21 GLU A OE2  3  
ATOM 6187  H H    . GLU A 1 22 ? 17.397  12.861  6.557   1.00 0.00 ? 21 GLU A H    3  
ATOM 6188  H HA   . GLU A 1 22 ? 18.180  15.713  6.510   1.00 0.00 ? 21 GLU A HA   3  
ATOM 6189  H HB2  . GLU A 1 22 ? 19.166  13.647  4.527   1.00 0.00 ? 21 GLU A HB2  3  
ATOM 6190  H HB3  . GLU A 1 22 ? 19.056  15.354  4.097   1.00 0.00 ? 21 GLU A HB3  3  
ATOM 6191  H HG2  . GLU A 1 22 ? 20.479  15.869  6.118   1.00 0.00 ? 21 GLU A HG2  3  
ATOM 6192  H HG3  . GLU A 1 22 ? 20.716  14.131  6.318   1.00 0.00 ? 21 GLU A HG3  3  
ATOM 6193  N N    . GLY A 1 23 ? 16.196  13.879  4.627   1.00 0.00 ? 22 GLY A N    3  
ATOM 6194  C CA   . GLY A 1 23 ? 14.912  13.946  3.872   1.00 0.00 ? 22 GLY A CA   3  
ATOM 6195  C C    . GLY A 1 23 ? 14.940  15.141  2.921   1.00 0.00 ? 22 GLY A C    3  
ATOM 6196  O O    . GLY A 1 23 ? 13.915  15.581  2.440   1.00 0.00 ? 22 GLY A O    3  
ATOM 6197  H H    . GLY A 1 23 ? 16.650  13.017  4.732   1.00 0.00 ? 22 GLY A H    3  
ATOM 6198  H HA2  . GLY A 1 23 ? 14.775  13.031  3.315   1.00 0.00 ? 22 GLY A HA2  3  
ATOM 6199  H HA3  . GLY A 1 23 ? 14.089  14.063  4.561   1.00 0.00 ? 22 GLY A HA3  3  
ATOM 6200  N N    . ASP A 1 24 ? 16.103  15.671  2.644   1.00 0.00 ? 23 ASP A N    3  
ATOM 6201  C CA   . ASP A 1 24 ? 16.178  16.839  1.720   1.00 0.00 ? 23 ASP A CA   3  
ATOM 6202  C C    . ASP A 1 24 ? 15.345  16.518  0.476   1.00 0.00 ? 23 ASP A C    3  
ATOM 6203  O O    . ASP A 1 24 ? 14.400  17.211  0.156   1.00 0.00 ? 23 ASP A O    3  
ATOM 6204  C CB   . ASP A 1 24 ? 17.637  17.090  1.330   1.00 0.00 ? 23 ASP A CB   3  
ATOM 6205  C CG   . ASP A 1 24 ? 18.404  17.612  2.548   1.00 0.00 ? 23 ASP A CG   3  
ATOM 6206  O OD1  . ASP A 1 24 ? 17.777  17.813  3.576   1.00 0.00 ? 23 ASP A OD1  3  
ATOM 6207  O OD2  . ASP A 1 24 ? 19.604  17.799  2.433   1.00 0.00 ? 23 ASP A OD2  3  
ATOM 6208  H H    . ASP A 1 24 ? 16.914  15.306  3.055   1.00 0.00 ? 23 ASP A H    3  
ATOM 6209  H HA   . ASP A 1 24 ? 15.775  17.714  2.210   1.00 0.00 ? 23 ASP A HA   3  
ATOM 6210  H HB2  . ASP A 1 24 ? 18.084  16.167  0.990   1.00 0.00 ? 23 ASP A HB2  3  
ATOM 6211  H HB3  . ASP A 1 24 ? 17.678  17.824  0.540   1.00 0.00 ? 23 ASP A HB3  3  
ATOM 6212  N N    . LYS A 1 25 ? 15.657  15.443  -0.199  1.00 0.00 ? 24 LYS A N    3  
ATOM 6213  C CA   . LYS A 1 25 ? 14.847  15.045  -1.387  1.00 0.00 ? 24 LYS A CA   3  
ATOM 6214  C C    . LYS A 1 25 ? 13.756  14.086  -0.899  1.00 0.00 ? 24 LYS A C    3  
ATOM 6215  O O    . LYS A 1 25 ? 13.725  13.711  0.257   1.00 0.00 ? 24 LYS A O    3  
ATOM 6216  C CB   . LYS A 1 25 ? 15.740  14.337  -2.410  1.00 0.00 ? 24 LYS A CB   3  
ATOM 6217  C CG   . LYS A 1 25 ? 16.589  15.373  -3.158  1.00 0.00 ? 24 LYS A CG   3  
ATOM 6218  C CD   . LYS A 1 25 ? 17.450  16.166  -2.158  1.00 0.00 ? 24 LYS A CD   3  
ATOM 6219  C CE   . LYS A 1 25 ? 18.671  16.753  -2.877  1.00 0.00 ? 24 LYS A CE   3  
ATOM 6220  N NZ   . LYS A 1 25 ? 19.394  17.684  -1.963  1.00 0.00 ? 24 LYS A NZ   3  
ATOM 6221  H H    . LYS A 1 25 ? 16.400  14.877  0.098   1.00 0.00 ? 24 LYS A H    3  
ATOM 6222  H HA   . LYS A 1 25 ? 14.394  15.921  -1.834  1.00 0.00 ? 24 LYS A HA   3  
ATOM 6223  H HB2  . LYS A 1 25 ? 16.388  13.641  -1.900  1.00 0.00 ? 24 LYS A HB2  3  
ATOM 6224  H HB3  . LYS A 1 25 ? 15.123  13.803  -3.117  1.00 0.00 ? 24 LYS A HB3  3  
ATOM 6225  H HG2  . LYS A 1 25 ? 17.229  14.863  -3.867  1.00 0.00 ? 24 LYS A HG2  3  
ATOM 6226  H HG3  . LYS A 1 25 ? 15.939  16.053  -3.687  1.00 0.00 ? 24 LYS A HG3  3  
ATOM 6227  H HD2  . LYS A 1 25 ? 16.861  16.968  -1.736  1.00 0.00 ? 24 LYS A HD2  3  
ATOM 6228  H HD3  . LYS A 1 25 ? 17.784  15.510  -1.366  1.00 0.00 ? 24 LYS A HD3  3  
ATOM 6229  H HE2  . LYS A 1 25 ? 19.334  15.953  -3.171  1.00 0.00 ? 24 LYS A HE2  3  
ATOM 6230  H HE3  . LYS A 1 25 ? 18.346  17.290  -3.755  1.00 0.00 ? 24 LYS A HE3  3  
ATOM 6231  H HZ1  . LYS A 1 25 ? 19.136  17.477  -0.978  1.00 0.00 ? 24 LYS A HZ1  3  
ATOM 6232  H HZ2  . LYS A 1 25 ? 20.420  17.561  -2.087  1.00 0.00 ? 24 LYS A HZ2  3  
ATOM 6233  H HZ3  . LYS A 1 25 ? 19.132  18.665  -2.189  1.00 0.00 ? 24 LYS A HZ3  3  
ATOM 6234  N N    . HIS A 1 26 ? 12.882  13.664  -1.776  1.00 0.00 ? 25 HIS A N    3  
ATOM 6235  C CA   . HIS A 1 26 ? 11.802  12.700  -1.390  1.00 0.00 ? 25 HIS A CA   3  
ATOM 6236  C C    . HIS A 1 26 ? 11.893  11.505  -2.338  1.00 0.00 ? 25 HIS A C    3  
ATOM 6237  O O    . HIS A 1 26 ? 10.918  11.091  -2.932  1.00 0.00 ? 25 HIS A O    3  
ATOM 6238  C CB   . HIS A 1 26 ? 10.435  13.380  -1.525  1.00 0.00 ? 25 HIS A CB   3  
ATOM 6239  C CG   . HIS A 1 26 ? 10.130  13.643  -2.975  1.00 0.00 ? 25 HIS A CG   3  
ATOM 6240  N ND1  . HIS A 1 26 ? 10.817  14.590  -3.719  1.00 0.00 ? 25 HIS A ND1  3  
ATOM 6241  C CD2  . HIS A 1 26 ? 9.218   13.083  -3.833  1.00 0.00 ? 25 HIS A CD2  3  
ATOM 6242  C CE1  . HIS A 1 26 ? 10.311  14.571  -4.966  1.00 0.00 ? 25 HIS A CE1  3  
ATOM 6243  N NE2  . HIS A 1 26 ? 9.334   13.670  -5.089  1.00 0.00 ? 25 HIS A NE2  3  
ATOM 6244  H H    . HIS A 1 26 ? 12.946  13.968  -2.704  1.00 0.00 ? 25 HIS A H    3  
ATOM 6245  H HA   . HIS A 1 26 ? 11.943  12.360  -0.372  1.00 0.00 ? 25 HIS A HA   3  
ATOM 6246  H HB2  . HIS A 1 26 ? 9.674   12.738  -1.108  1.00 0.00 ? 25 HIS A HB2  3  
ATOM 6247  H HB3  . HIS A 1 26 ? 10.449  14.317  -0.988  1.00 0.00 ? 25 HIS A HB3  3  
ATOM 6248  H HD1  . HIS A 1 26 ? 11.540  15.168  -3.395  1.00 0.00 ? 25 HIS A HD1  3  
ATOM 6249  H HD2  . HIS A 1 26 ? 8.518   12.303  -3.573  1.00 0.00 ? 25 HIS A HD2  3  
ATOM 6250  H HE1  . HIS A 1 26 ? 10.656  15.205  -5.769  1.00 0.00 ? 25 HIS A HE1  3  
ATOM 6251  N N    . LYS A 1 27 ? 13.073  10.958  -2.482  1.00 0.00 ? 26 LYS A N    3  
ATOM 6252  C CA   . LYS A 1 27 ? 13.274  9.790   -3.388  1.00 0.00 ? 26 LYS A CA   3  
ATOM 6253  C C    . LYS A 1 27 ? 14.060  8.701   -2.655  1.00 0.00 ? 26 LYS A C    3  
ATOM 6254  O O    . LYS A 1 27 ? 14.918  8.986   -1.844  1.00 0.00 ? 26 LYS A O    3  
ATOM 6255  C CB   . LYS A 1 27 ? 14.066  10.238  -4.619  1.00 0.00 ? 26 LYS A CB   3  
ATOM 6256  C CG   . LYS A 1 27 ? 13.201  11.161  -5.479  1.00 0.00 ? 26 LYS A CG   3  
ATOM 6257  C CD   . LYS A 1 27 ? 14.013  11.642  -6.683  1.00 0.00 ? 26 LYS A CD   3  
ATOM 6258  C CE   . LYS A 1 27 ? 13.269  12.780  -7.381  1.00 0.00 ? 26 LYS A CE   3  
ATOM 6259  N NZ   . LYS A 1 27 ? 11.838  12.401  -7.562  1.00 0.00 ? 26 LYS A NZ   3  
ATOM 6260  H H    . LYS A 1 27 ? 13.835  11.322  -1.990  1.00 0.00 ? 26 LYS A H    3  
ATOM 6261  H HA   . LYS A 1 27 ? 12.321  9.395   -3.700  1.00 0.00 ? 26 LYS A HA   3  
ATOM 6262  H HB2  . LYS A 1 27 ? 14.952  10.767  -4.302  1.00 0.00 ? 26 LYS A HB2  3  
ATOM 6263  H HB3  . LYS A 1 27 ? 14.351  9.373   -5.198  1.00 0.00 ? 26 LYS A HB3  3  
ATOM 6264  H HG2  . LYS A 1 27 ? 12.329  10.623  -5.822  1.00 0.00 ? 26 LYS A HG2  3  
ATOM 6265  H HG3  . LYS A 1 27 ? 12.892  12.014  -4.892  1.00 0.00 ? 26 LYS A HG3  3  
ATOM 6266  H HD2  . LYS A 1 27 ? 14.978  11.993  -6.347  1.00 0.00 ? 26 LYS A HD2  3  
ATOM 6267  H HD3  . LYS A 1 27 ? 14.147  10.824  -7.376  1.00 0.00 ? 26 LYS A HD3  3  
ATOM 6268  H HE2  . LYS A 1 27 ? 13.331  13.674  -6.779  1.00 0.00 ? 26 LYS A HE2  3  
ATOM 6269  H HE3  . LYS A 1 27 ? 13.717  12.965  -8.346  1.00 0.00 ? 26 LYS A HE3  3  
ATOM 6270  H HZ1  . LYS A 1 27 ? 11.721  11.387  -7.359  1.00 0.00 ? 26 LYS A HZ1  3  
ATOM 6271  H HZ2  . LYS A 1 27 ? 11.246  12.955  -6.912  1.00 0.00 ? 26 LYS A HZ2  3  
ATOM 6272  H HZ3  . LYS A 1 27 ? 11.550  12.595  -8.542  1.00 0.00 ? 26 LYS A HZ3  3  
ATOM 6273  N N    . LEU A 1 28 ? 13.778  7.455   -2.942  1.00 0.00 ? 27 LEU A N    3  
ATOM 6274  C CA   . LEU A 1 28 ? 14.506  6.326   -2.278  1.00 0.00 ? 27 LEU A CA   3  
ATOM 6275  C C    . LEU A 1 28 ? 15.147  5.464   -3.362  1.00 0.00 ? 27 LEU A C    3  
ATOM 6276  O O    . LEU A 1 28 ? 14.599  5.298   -4.433  1.00 0.00 ? 27 LEU A O    3  
ATOM 6277  C CB   . LEU A 1 28 ? 13.512  5.485   -1.473  1.00 0.00 ? 27 LEU A CB   3  
ATOM 6278  C CG   . LEU A 1 28 ? 14.272  4.519   -0.546  1.00 0.00 ? 27 LEU A CG   3  
ATOM 6279  C CD1  . LEU A 1 28 ? 14.878  5.276   0.655   1.00 0.00 ? 27 LEU A CD1  3  
ATOM 6280  C CD2  . LEU A 1 28 ? 13.301  3.451   -0.033  1.00 0.00 ? 27 LEU A CD2  3  
ATOM 6281  H H    . LEU A 1 28 ? 13.087  7.258   -3.609  1.00 0.00 ? 27 LEU A H    3  
ATOM 6282  H HA   . LEU A 1 28 ? 15.272  6.704   -1.619  1.00 0.00 ? 27 LEU A HA   3  
ATOM 6283  H HB2  . LEU A 1 28 ? 12.881  6.137   -0.888  1.00 0.00 ? 27 LEU A HB2  3  
ATOM 6284  H HB3  . LEU A 1 28 ? 12.899  4.916   -2.155  1.00 0.00 ? 27 LEU A HB3  3  
ATOM 6285  H HG   . LEU A 1 28 ? 15.067  4.044   -1.103  1.00 0.00 ? 27 LEU A HG   3  
ATOM 6286  H HD11 . LEU A 1 28 ? 14.200  6.051   0.982   1.00 0.00 ? 27 LEU A HD11 3  
ATOM 6287  H HD12 . LEU A 1 28 ? 15.049  4.587   1.469   1.00 0.00 ? 27 LEU A HD12 3  
ATOM 6288  H HD13 . LEU A 1 28 ? 15.820  5.719   0.369   1.00 0.00 ? 27 LEU A HD13 3  
ATOM 6289  H HD21 . LEU A 1 28 ? 12.788  2.995   -0.866  1.00 0.00 ? 27 LEU A HD21 3  
ATOM 6290  H HD22 . LEU A 1 28 ? 13.851  2.694   0.507   1.00 0.00 ? 27 LEU A HD22 3  
ATOM 6291  H HD23 . LEU A 1 28 ? 12.579  3.911   0.626   1.00 0.00 ? 27 LEU A HD23 3  
ATOM 6292  N N    . LYS A 1 29 ? 16.314  4.925   -3.108  1.00 0.00 ? 28 LYS A N    3  
ATOM 6293  C CA   . LYS A 1 29 ? 16.991  4.087   -4.145  1.00 0.00 ? 28 LYS A CA   3  
ATOM 6294  C C    . LYS A 1 29 ? 16.655  2.607   -3.925  1.00 0.00 ? 28 LYS A C    3  
ATOM 6295  O O    . LYS A 1 29 ? 16.398  2.175   -2.820  1.00 0.00 ? 28 LYS A O    3  
ATOM 6296  C CB   . LYS A 1 29 ? 18.503  4.295   -4.044  1.00 0.00 ? 28 LYS A CB   3  
ATOM 6297  C CG   . LYS A 1 29 ? 18.839  5.736   -4.432  1.00 0.00 ? 28 LYS A CG   3  
ATOM 6298  C CD   . LYS A 1 29 ? 20.278  6.056   -4.026  1.00 0.00 ? 28 LYS A CD   3  
ATOM 6299  C CE   . LYS A 1 29 ? 20.563  7.537   -4.287  1.00 0.00 ? 28 LYS A CE   3  
ATOM 6300  N NZ   . LYS A 1 29 ? 21.831  7.928   -3.605  1.00 0.00 ? 28 LYS A NZ   3  
ATOM 6301  H H    . LYS A 1 29 ? 16.751  5.082   -2.246  1.00 0.00 ? 28 LYS A H    3  
ATOM 6302  H HA   . LYS A 1 29 ? 16.649  4.397   -5.124  1.00 0.00 ? 28 LYS A HA   3  
ATOM 6303  H HB2  . LYS A 1 29 ? 18.825  4.109   -3.029  1.00 0.00 ? 28 LYS A HB2  3  
ATOM 6304  H HB3  . LYS A 1 29 ? 19.008  3.615   -4.713  1.00 0.00 ? 28 LYS A HB3  3  
ATOM 6305  H HG2  . LYS A 1 29 ? 18.729  5.855   -5.500  1.00 0.00 ? 28 LYS A HG2  3  
ATOM 6306  H HG3  . LYS A 1 29 ? 18.166  6.410   -3.924  1.00 0.00 ? 28 LYS A HG3  3  
ATOM 6307  H HD2  . LYS A 1 29 ? 20.413  5.841   -2.975  1.00 0.00 ? 28 LYS A HD2  3  
ATOM 6308  H HD3  . LYS A 1 29 ? 20.959  5.453   -4.608  1.00 0.00 ? 28 LYS A HD3  3  
ATOM 6309  H HE2  . LYS A 1 29 ? 20.659  7.702   -5.349  1.00 0.00 ? 28 LYS A HE2  3  
ATOM 6310  H HE3  . LYS A 1 29 ? 19.749  8.134   -3.903  1.00 0.00 ? 28 LYS A HE3  3  
ATOM 6311  H HZ1  . LYS A 1 29 ? 22.583  7.254   -3.857  1.00 0.00 ? 28 LYS A HZ1  3  
ATOM 6312  H HZ2  . LYS A 1 29 ? 22.106  8.883   -3.906  1.00 0.00 ? 28 LYS A HZ2  3  
ATOM 6313  H HZ3  . LYS A 1 29 ? 21.687  7.920   -2.575  1.00 0.00 ? 28 LYS A HZ3  3  
ATOM 6314  N N    . LYS A 1 30 ? 16.668  1.828   -4.971  1.00 0.00 ? 29 LYS A N    3  
ATOM 6315  C CA   . LYS A 1 30 ? 16.365  0.375   -4.833  1.00 0.00 ? 29 LYS A CA   3  
ATOM 6316  C C    . LYS A 1 30 ? 17.334  -0.277  -3.835  1.00 0.00 ? 29 LYS A C    3  
ATOM 6317  O O    . LYS A 1 30 ? 16.962  -1.142  -3.066  1.00 0.00 ? 29 LYS A O    3  
ATOM 6318  C CB   . LYS A 1 30 ? 16.491  -0.310  -6.211  1.00 0.00 ? 29 LYS A CB   3  
ATOM 6319  C CG   . LYS A 1 30 ? 17.941  -0.311  -6.734  1.00 0.00 ? 29 LYS A CG   3  
ATOM 6320  C CD   . LYS A 1 30 ? 18.425  1.126   -6.989  1.00 0.00 ? 29 LYS A CD   3  
ATOM 6321  C CE   . LYS A 1 30 ? 19.624  1.110   -7.944  1.00 0.00 ? 29 LYS A CE   3  
ATOM 6322  N NZ   . LYS A 1 30 ? 20.391  2.377   -7.787  1.00 0.00 ? 29 LYS A NZ   3  
ATOM 6323  H H    . LYS A 1 30 ? 16.887  2.196   -5.852  1.00 0.00 ? 29 LYS A H    3  
ATOM 6324  H HA   . LYS A 1 30 ? 15.350  0.239   -4.488  1.00 0.00 ? 29 LYS A HA   3  
ATOM 6325  H HB2  . LYS A 1 30 ? 16.152  -1.331  -6.125  1.00 0.00 ? 29 LYS A HB2  3  
ATOM 6326  H HB3  . LYS A 1 30 ? 15.862  0.209   -6.919  1.00 0.00 ? 29 LYS A HB3  3  
ATOM 6327  H HG2  . LYS A 1 30 ? 18.590  -0.792  -6.023  1.00 0.00 ? 29 LYS A HG2  3  
ATOM 6328  H HG3  . LYS A 1 30 ? 17.973  -0.862  -7.662  1.00 0.00 ? 29 LYS A HG3  3  
ATOM 6329  H HD2  . LYS A 1 30 ? 17.625  1.703   -7.428  1.00 0.00 ? 29 LYS A HD2  3  
ATOM 6330  H HD3  . LYS A 1 30 ? 18.726  1.578   -6.059  1.00 0.00 ? 29 LYS A HD3  3  
ATOM 6331  H HE2  . LYS A 1 30 ? 20.265  0.272   -7.709  1.00 0.00 ? 29 LYS A HE2  3  
ATOM 6332  H HE3  . LYS A 1 30 ? 19.274  1.024   -8.961  1.00 0.00 ? 29 LYS A HE3  3  
ATOM 6333  H HZ1  . LYS A 1 30 ? 19.752  3.129   -7.456  1.00 0.00 ? 29 LYS A HZ1  3  
ATOM 6334  H HZ2  . LYS A 1 30 ? 21.150  2.240   -7.091  1.00 0.00 ? 29 LYS A HZ2  3  
ATOM 6335  H HZ3  . LYS A 1 30 ? 20.804  2.648   -8.702  1.00 0.00 ? 29 LYS A HZ3  3  
ATOM 6336  N N    . SER A 1 31 ? 18.576  0.119   -3.862  1.00 0.00 ? 30 SER A N    3  
ATOM 6337  C CA   . SER A 1 31 ? 19.590  -0.478  -2.948  1.00 0.00 ? 30 SER A CA   3  
ATOM 6338  C C    . SER A 1 31 ? 19.207  -0.255  -1.483  1.00 0.00 ? 30 SER A C    3  
ATOM 6339  O O    . SER A 1 31 ? 19.358  -1.132  -0.647  1.00 0.00 ? 30 SER A O    3  
ATOM 6340  C CB   . SER A 1 31 ? 20.944  0.182   -3.213  1.00 0.00 ? 30 SER A CB   3  
ATOM 6341  O OG   . SER A 1 31 ? 20.783  1.593   -3.238  1.00 0.00 ? 30 SER A OG   3  
ATOM 6342  H H    . SER A 1 31 ? 18.848  0.796   -4.511  1.00 0.00 ? 30 SER A H    3  
ATOM 6343  H HA   . SER A 1 31 ? 19.678  -1.536  -3.149  1.00 0.00 ? 30 SER A HA   3  
ATOM 6344  H HB2  . SER A 1 31 ? 21.636  -0.082  -2.431  1.00 0.00 ? 30 SER A HB2  3  
ATOM 6345  H HB3  . SER A 1 31 ? 21.332  -0.164  -4.163  1.00 0.00 ? 30 SER A HB3  3  
ATOM 6346  H HG   . SER A 1 31 ? 21.626  1.983   -3.480  1.00 0.00 ? 30 SER A HG   3  
ATOM 6347  N N    . GLU A 1 32 ? 18.713  0.912   -1.155  1.00 0.00 ? 31 GLU A N    3  
ATOM 6348  C CA   . GLU A 1 32 ? 18.342  1.172   0.265   1.00 0.00 ? 31 GLU A CA   3  
ATOM 6349  C C    . GLU A 1 32 ? 16.992  0.520   0.546   1.00 0.00 ? 31 GLU A C    3  
ATOM 6350  O O    . GLU A 1 32 ? 16.739  0.026   1.626   1.00 0.00 ? 31 GLU A O    3  
ATOM 6351  C CB   . GLU A 1 32 ? 18.282  2.679   0.527   1.00 0.00 ? 31 GLU A CB   3  
ATOM 6352  C CG   . GLU A 1 32 ? 19.702  3.247   0.501   1.00 0.00 ? 31 GLU A CG   3  
ATOM 6353  C CD   . GLU A 1 32 ? 19.666  4.736   0.849   1.00 0.00 ? 31 GLU A CD   3  
ATOM 6354  O OE1  . GLU A 1 32 ? 19.523  5.533   -0.062  1.00 0.00 ? 31 GLU A OE1  3  
ATOM 6355  O OE2  . GLU A 1 32 ? 19.783  5.053   2.022   1.00 0.00 ? 31 GLU A OE2  3  
ATOM 6356  H H    . GLU A 1 32 ? 18.588  1.598   -1.845  1.00 0.00 ? 31 GLU A H    3  
ATOM 6357  H HA   . GLU A 1 32 ? 19.107  0.721   0.882   1.00 0.00 ? 31 GLU A HA   3  
ATOM 6358  H HB2  . GLU A 1 32 ? 17.686  3.155   -0.239  1.00 0.00 ? 31 GLU A HB2  3  
ATOM 6359  H HB3  . GLU A 1 32 ? 17.841  2.861   1.495   1.00 0.00 ? 31 GLU A HB3  3  
ATOM 6360  H HG2  . GLU A 1 32 ? 20.312  2.722   1.221   1.00 0.00 ? 31 GLU A HG2  3  
ATOM 6361  H HG3  . GLU A 1 32 ? 20.121  3.121   -0.486  1.00 0.00 ? 31 GLU A HG3  3  
ATOM 6362  N N    . LEU A 1 33 ? 16.133  0.490   -0.436  1.00 0.00 ? 32 LEU A N    3  
ATOM 6363  C CA   . LEU A 1 33 ? 14.811  -0.160  -0.246  1.00 0.00 ? 32 LEU A CA   3  
ATOM 6364  C C    . LEU A 1 33 ? 15.053  -1.632  0.078   1.00 0.00 ? 32 LEU A C    3  
ATOM 6365  O O    . LEU A 1 33 ? 14.407  -2.192  0.939   1.00 0.00 ? 32 LEU A O    3  
ATOM 6366  C CB   . LEU A 1 33 ? 13.979  -0.024  -1.528  1.00 0.00 ? 32 LEU A CB   3  
ATOM 6367  C CG   . LEU A 1 33 ? 12.706  -0.878  -1.443  1.00 0.00 ? 32 LEU A CG   3  
ATOM 6368  C CD1  . LEU A 1 33 ? 11.930  -0.542  -0.165  1.00 0.00 ? 32 LEU A CD1  3  
ATOM 6369  C CD2  . LEU A 1 33 ? 11.827  -0.585  -2.664  1.00 0.00 ? 32 LEU A CD2  3  
ATOM 6370  H H    . LEU A 1 33 ? 16.368  0.877   -1.306  1.00 0.00 ? 32 LEU A H    3  
ATOM 6371  H HA   . LEU A 1 33 ? 14.296  0.288   0.590   1.00 0.00 ? 32 LEU A HA   3  
ATOM 6372  H HB2  . LEU A 1 33 ? 13.704  1.010   -1.668  1.00 0.00 ? 32 LEU A HB2  3  
ATOM 6373  H HB3  . LEU A 1 33 ? 14.570  -0.353  -2.370  1.00 0.00 ? 32 LEU A HB3  3  
ATOM 6374  H HG   . LEU A 1 33 ? 12.973  -1.925  -1.437  1.00 0.00 ? 32 LEU A HG   3  
ATOM 6375  H HD11 . LEU A 1 33 ? 11.948  0.525   0.000   1.00 0.00 ? 32 LEU A HD11 3  
ATOM 6376  H HD12 . LEU A 1 33 ? 10.906  -0.874  -0.265  1.00 0.00 ? 32 LEU A HD12 3  
ATOM 6377  H HD13 . LEU A 1 33 ? 12.384  -1.043  0.673   1.00 0.00 ? 32 LEU A HD13 3  
ATOM 6378  H HD21 . LEU A 1 33 ? 12.394  -0.758  -3.567  1.00 0.00 ? 32 LEU A HD21 3  
ATOM 6379  H HD22 . LEU A 1 33 ? 10.965  -1.234  -2.651  1.00 0.00 ? 32 LEU A HD22 3  
ATOM 6380  H HD23 . LEU A 1 33 ? 11.501  0.445   -2.633  1.00 0.00 ? 32 LEU A HD23 3  
ATOM 6381  N N    . LYS A 1 34 ? 15.959  -2.282  -0.605  1.00 0.00 ? 33 LYS A N    3  
ATOM 6382  C CA   . LYS A 1 34 ? 16.185  -3.721  -0.314  1.00 0.00 ? 33 LYS A CA   3  
ATOM 6383  C C    . LYS A 1 34 ? 16.453  -3.883  1.179   1.00 0.00 ? 33 LYS A C    3  
ATOM 6384  O O    . LYS A 1 34 ? 15.753  -4.591  1.876   1.00 0.00 ? 33 LYS A O    3  
ATOM 6385  C CB   . LYS A 1 34 ? 17.384  -4.232  -1.115  1.00 0.00 ? 33 LYS A CB   3  
ATOM 6386  C CG   . LYS A 1 34 ? 17.488  -5.750  -0.956  1.00 0.00 ? 33 LYS A CG   3  
ATOM 6387  C CD   . LYS A 1 34 ? 18.533  -6.301  -1.928  1.00 0.00 ? 33 LYS A CD   3  
ATOM 6388  C CE   . LYS A 1 34 ? 18.710  -7.802  -1.692  1.00 0.00 ? 33 LYS A CE   3  
ATOM 6389  N NZ   . LYS A 1 34 ? 19.288  -8.030  -0.337  1.00 0.00 ? 33 LYS A NZ   3  
ATOM 6390  H H    . LYS A 1 34 ? 16.467  -1.841  -1.316  1.00 0.00 ? 33 LYS A H    3  
ATOM 6391  H HA   . LYS A 1 34 ? 15.297  -4.263  -0.599  1.00 0.00 ? 33 LYS A HA   3  
ATOM 6392  H HB2  . LYS A 1 34 ? 17.251  -3.985  -2.159  1.00 0.00 ? 33 LYS A HB2  3  
ATOM 6393  H HB3  . LYS A 1 34 ? 18.287  -3.770  -0.746  1.00 0.00 ? 33 LYS A HB3  3  
ATOM 6394  H HG2  . LYS A 1 34 ? 17.780  -5.985  0.058   1.00 0.00 ? 33 LYS A HG2  3  
ATOM 6395  H HG3  . LYS A 1 34 ? 16.530  -6.199  -1.168  1.00 0.00 ? 33 LYS A HG3  3  
ATOM 6396  H HD2  . LYS A 1 34 ? 18.204  -6.132  -2.944  1.00 0.00 ? 33 LYS A HD2  3  
ATOM 6397  H HD3  . LYS A 1 34 ? 19.476  -5.799  -1.767  1.00 0.00 ? 33 LYS A HD3  3  
ATOM 6398  H HE2  . LYS A 1 34 ? 17.749  -8.291  -1.759  1.00 0.00 ? 33 LYS A HE2  3  
ATOM 6399  H HE3  . LYS A 1 34 ? 19.373  -8.211  -2.440  1.00 0.00 ? 33 LYS A HE3  3  
ATOM 6400  H HZ1  . LYS A 1 34 ? 20.126  -7.427  -0.210  1.00 0.00 ? 33 LYS A HZ1  3  
ATOM 6401  H HZ2  . LYS A 1 34 ? 18.581  -7.792  0.386   1.00 0.00 ? 33 LYS A HZ2  3  
ATOM 6402  H HZ3  . LYS A 1 34 ? 19.562  -9.030  -0.241  1.00 0.00 ? 33 LYS A HZ3  3  
ATOM 6403  N N    . GLU A 1 35 ? 17.463  -3.224  1.676   1.00 0.00 ? 34 GLU A N    3  
ATOM 6404  C CA   . GLU A 1 35 ? 17.770  -3.337  3.132   1.00 0.00 ? 34 GLU A CA   3  
ATOM 6405  C C    . GLU A 1 35 ? 16.497  -3.051  3.932   1.00 0.00 ? 34 GLU A C    3  
ATOM 6406  O O    . GLU A 1 35 ? 16.237  -3.676  4.939   1.00 0.00 ? 34 GLU A O    3  
ATOM 6407  C CB   . GLU A 1 35 ? 18.847  -2.320  3.514   1.00 0.00 ? 34 GLU A CB   3  
ATOM 6408  C CG   . GLU A 1 35 ? 20.133  -2.629  2.744   1.00 0.00 ? 34 GLU A CG   3  
ATOM 6409  C CD   . GLU A 1 35 ? 21.146  -1.505  2.969   1.00 0.00 ? 34 GLU A CD   3  
ATOM 6410  O OE1  . GLU A 1 35 ? 21.668  -1.415  4.068   1.00 0.00 ? 34 GLU A OE1  3  
ATOM 6411  O OE2  . GLU A 1 35 ? 21.382  -0.752  2.038   1.00 0.00 ? 34 GLU A OE2  3  
ATOM 6412  H H    . GLU A 1 35 ? 18.018  -2.661  1.091   1.00 0.00 ? 34 GLU A H    3  
ATOM 6413  H HA   . GLU A 1 35 ? 18.122  -4.334  3.357   1.00 0.00 ? 34 GLU A HA   3  
ATOM 6414  H HB2  . GLU A 1 35 ? 18.506  -1.325  3.267   1.00 0.00 ? 34 GLU A HB2  3  
ATOM 6415  H HB3  . GLU A 1 35 ? 19.040  -2.383  4.574   1.00 0.00 ? 34 GLU A HB3  3  
ATOM 6416  H HG2  . GLU A 1 35 ? 20.546  -3.563  3.095   1.00 0.00 ? 34 GLU A HG2  3  
ATOM 6417  H HG3  . GLU A 1 35 ? 19.911  -2.706  1.691   1.00 0.00 ? 34 GLU A HG3  3  
ATOM 6418  N N    . LEU A 1 36 ? 15.704  -2.109  3.499   1.00 0.00 ? 35 LEU A N    3  
ATOM 6419  C CA   . LEU A 1 36 ? 14.453  -1.791  4.247   1.00 0.00 ? 35 LEU A CA   3  
ATOM 6420  C C    . LEU A 1 36 ? 13.467  -2.961  4.123   1.00 0.00 ? 35 LEU A C    3  
ATOM 6421  O O    . LEU A 1 36 ? 12.788  -3.303  5.070   1.00 0.00 ? 35 LEU A O    3  
ATOM 6422  C CB   . LEU A 1 36 ? 13.834  -0.503  3.691   1.00 0.00 ? 35 LEU A CB   3  
ATOM 6423  C CG   . LEU A 1 36 ? 12.634  -0.060  4.552   1.00 0.00 ? 35 LEU A CG   3  
ATOM 6424  C CD1  . LEU A 1 36 ? 13.114  0.652   5.826   1.00 0.00 ? 35 LEU A CD1  3  
ATOM 6425  C CD2  . LEU A 1 36 ? 11.763  0.905   3.742   1.00 0.00 ? 35 LEU A CD2  3  
ATOM 6426  H H    . LEU A 1 36 ? 15.931  -1.614  2.684   1.00 0.00 ? 35 LEU A H    3  
ATOM 6427  H HA   . LEU A 1 36 ? 14.687  -1.659  5.292   1.00 0.00 ? 35 LEU A HA   3  
ATOM 6428  H HB2  . LEU A 1 36 ? 14.582  0.277   3.685   1.00 0.00 ? 35 LEU A HB2  3  
ATOM 6429  H HB3  . LEU A 1 36 ? 13.503  -0.682  2.681   1.00 0.00 ? 35 LEU A HB3  3  
ATOM 6430  H HG   . LEU A 1 36 ? 12.046  -0.923  4.827   1.00 0.00 ? 35 LEU A HG   3  
ATOM 6431  H HD11 . LEU A 1 36 ? 13.856  1.394   5.573   1.00 0.00 ? 35 LEU A HD11 3  
ATOM 6432  H HD12 . LEU A 1 36 ? 12.274  1.138   6.300   1.00 0.00 ? 35 LEU A HD12 3  
ATOM 6433  H HD13 . LEU A 1 36 ? 13.541  -0.068  6.508   1.00 0.00 ? 35 LEU A HD13 3  
ATOM 6434  H HD21 . LEU A 1 36 ? 11.437  0.420   2.833   1.00 0.00 ? 35 LEU A HD21 3  
ATOM 6435  H HD22 . LEU A 1 36 ? 10.902  1.191   4.326   1.00 0.00 ? 35 LEU A HD22 3  
ATOM 6436  H HD23 . LEU A 1 36 ? 12.339  1.784   3.494   1.00 0.00 ? 35 LEU A HD23 3  
ATOM 6437  N N    . ILE A 1 37 ? 13.391  -3.598  2.983   1.00 0.00 ? 36 ILE A N    3  
ATOM 6438  C CA   . ILE A 1 37 ? 12.461  -4.759  2.841   1.00 0.00 ? 36 ILE A CA   3  
ATOM 6439  C C    . ILE A 1 37 ? 12.840  -5.819  3.878   1.00 0.00 ? 36 ILE A C    3  
ATOM 6440  O O    . ILE A 1 37 ? 12.004  -6.545  4.379   1.00 0.00 ? 36 ILE A O    3  
ATOM 6441  C CB   . ILE A 1 37 ? 12.604  -5.346  1.421   1.00 0.00 ? 36 ILE A CB   3  
ATOM 6442  C CG1  . ILE A 1 37 ? 11.970  -4.368  0.421   1.00 0.00 ? 36 ILE A CG1  3  
ATOM 6443  C CG2  . ILE A 1 37 ? 11.889  -6.710  1.330   1.00 0.00 ? 36 ILE A CG2  3  
ATOM 6444  C CD1  . ILE A 1 37 ? 12.177  -4.866  -1.011  1.00 0.00 ? 36 ILE A CD1  3  
ATOM 6445  H H    . ILE A 1 37 ? 13.951  -3.337  2.224   1.00 0.00 ? 36 ILE A H    3  
ATOM 6446  H HA   . ILE A 1 37 ? 11.436  -4.447  2.982   1.00 0.00 ? 36 ILE A HA   3  
ATOM 6447  H HB   . ILE A 1 37 ? 13.651  -5.473  1.188   1.00 0.00 ? 36 ILE A HB   3  
ATOM 6448  H HG12 . ILE A 1 37 ? 10.911  -4.286  0.622   1.00 0.00 ? 36 ILE A HG12 3  
ATOM 6449  H HG13 . ILE A 1 37 ? 12.429  -3.398  0.531   1.00 0.00 ? 36 ILE A HG13 3  
ATOM 6450  H HG21 . ILE A 1 37 ? 10.875  -6.612  1.687   1.00 0.00 ? 36 ILE A HG21 3  
ATOM 6451  H HG22 . ILE A 1 37 ? 11.873  -7.047  0.304   1.00 0.00 ? 36 ILE A HG22 3  
ATOM 6452  H HG23 . ILE A 1 37 ? 12.414  -7.437  1.931   1.00 0.00 ? 36 ILE A HG23 3  
ATOM 6453  H HD11 . ILE A 1 37 ? 13.209  -5.151  -1.148  1.00 0.00 ? 36 ILE A HD11 3  
ATOM 6454  H HD12 . ILE A 1 37 ? 11.542  -5.722  -1.188  1.00 0.00 ? 36 ILE A HD12 3  
ATOM 6455  H HD13 . ILE A 1 37 ? 11.925  -4.080  -1.706  1.00 0.00 ? 36 ILE A HD13 3  
ATOM 6456  N N    . ASN A 1 38 ? 14.106  -5.934  4.169   1.00 0.00 ? 37 ASN A N    3  
ATOM 6457  C CA   . ASN A 1 38 ? 14.570  -6.970  5.133   1.00 0.00 ? 37 ASN A CA   3  
ATOM 6458  C C    . ASN A 1 38 ? 14.023  -6.718  6.541   1.00 0.00 ? 37 ASN A C    3  
ATOM 6459  O O    . ASN A 1 38 ? 13.422  -7.582  7.144   1.00 0.00 ? 37 ASN A O    3  
ATOM 6460  C CB   . ASN A 1 38 ? 16.099  -6.953  5.187   1.00 0.00 ? 37 ASN A CB   3  
ATOM 6461  C CG   . ASN A 1 38 ? 16.666  -7.355  3.825   1.00 0.00 ? 37 ASN A CG   3  
ATOM 6462  O OD1  . ASN A 1 38 ? 16.270  -6.820  2.808   1.00 0.00 ? 37 ASN A OD1  3  
ATOM 6463  N ND2  . ASN A 1 38 ? 17.581  -8.283  3.760   1.00 0.00 ? 37 ASN A ND2  3  
ATOM 6464  H H    . ASN A 1 38 ? 14.762  -5.354  3.727   1.00 0.00 ? 37 ASN A H    3  
ATOM 6465  H HA   . ASN A 1 38 ? 14.248  -7.939  4.781   1.00 0.00 ? 37 ASN A HA   3  
ATOM 6466  H HB2  . ASN A 1 38 ? 16.439  -5.959  5.440   1.00 0.00 ? 37 ASN A HB2  3  
ATOM 6467  H HB3  . ASN A 1 38 ? 16.442  -7.651  5.937   1.00 0.00 ? 37 ASN A HB3  3  
ATOM 6468  H HD21 . ASN A 1 38 ? 17.899  -8.717  4.581   1.00 0.00 ? 37 ASN A HD21 3  
ATOM 6469  H HD22 . ASN A 1 38 ? 17.953  -8.545  2.892   1.00 0.00 ? 37 ASN A HD22 3  
ATOM 6470  N N    . ASN A 1 39 ? 14.261  -5.557  7.091   1.00 0.00 ? 38 ASN A N    3  
ATOM 6471  C CA   . ASN A 1 39 ? 13.793  -5.283  8.485   1.00 0.00 ? 38 ASN A CA   3  
ATOM 6472  C C    . ASN A 1 39 ? 12.301  -4.925  8.521   1.00 0.00 ? 38 ASN A C    3  
ATOM 6473  O O    . ASN A 1 39 ? 11.785  -4.561  9.559   1.00 0.00 ? 38 ASN A O    3  
ATOM 6474  C CB   . ASN A 1 39 ? 14.608  -4.132  9.076   1.00 0.00 ? 38 ASN A CB   3  
ATOM 6475  C CG   . ASN A 1 39 ? 16.089  -4.517  9.111   1.00 0.00 ? 38 ASN A CG   3  
ATOM 6476  O OD1  . ASN A 1 39 ? 16.736  -4.588  8.085   1.00 0.00 ? 38 ASN A OD1  3  
ATOM 6477  N ND2  . ASN A 1 39 ? 16.657  -4.767  10.258  1.00 0.00 ? 38 ASN A ND2  3  
ATOM 6478  H H    . ASN A 1 39 ? 14.775  -4.880  6.603   1.00 0.00 ? 38 ASN A H    3  
ATOM 6479  H HA   . ASN A 1 39 ? 13.949  -6.172  9.077   1.00 0.00 ? 38 ASN A HA   3  
ATOM 6480  H HB2  . ASN A 1 39 ? 14.480  -3.250  8.466   1.00 0.00 ? 38 ASN A HB2  3  
ATOM 6481  H HB3  . ASN A 1 39 ? 14.269  -3.928  10.080  1.00 0.00 ? 38 ASN A HB3  3  
ATOM 6482  H HD21 . ASN A 1 39 ? 16.136  -4.707  11.086  1.00 0.00 ? 38 ASN A HD21 3  
ATOM 6483  H HD22 . ASN A 1 39 ? 17.603  -5.015  10.292  1.00 0.00 ? 38 ASN A HD22 3  
ATOM 6484  N N    . GLU A 1 40 ? 11.602  -5.013  7.413   1.00 0.00 ? 39 GLU A N    3  
ATOM 6485  C CA   . GLU A 1 40 ? 10.138  -4.665  7.409   1.00 0.00 ? 39 GLU A CA   3  
ATOM 6486  C C    . GLU A 1 40 ? 9.307   -5.856  6.921   1.00 0.00 ? 39 GLU A C    3  
ATOM 6487  O O    . GLU A 1 40 ? 8.154   -5.993  7.281   1.00 0.00 ? 39 GLU A O    3  
ATOM 6488  C CB   . GLU A 1 40 ? 9.903   -3.476  6.468   1.00 0.00 ? 39 GLU A CB   3  
ATOM 6489  C CG   . GLU A 1 40 ? 10.459  -2.189  7.092   1.00 0.00 ? 39 GLU A CG   3  
ATOM 6490  C CD   . GLU A 1 40 ? 9.888   -0.977  6.352   1.00 0.00 ? 39 GLU A CD   3  
ATOM 6491  O OE1  . GLU A 1 40 ? 9.249   -1.179  5.332   1.00 0.00 ? 39 GLU A OE1  3  
ATOM 6492  O OE2  . GLU A 1 40 ? 10.098  0.130   6.818   1.00 0.00 ? 39 GLU A OE2  3  
ATOM 6493  H H    . GLU A 1 40 ? 12.037  -5.302  6.584   1.00 0.00 ? 39 GLU A H    3  
ATOM 6494  H HA   . GLU A 1 40 ? 9.810   -4.399  8.405   1.00 0.00 ? 39 GLU A HA   3  
ATOM 6495  H HB2  . GLU A 1 40 ? 10.401  -3.662  5.527   1.00 0.00 ? 39 GLU A HB2  3  
ATOM 6496  H HB3  . GLU A 1 40 ? 8.843   -3.361  6.295   1.00 0.00 ? 39 GLU A HB3  3  
ATOM 6497  H HG2  . GLU A 1 40 ? 10.178  -2.137  8.134   1.00 0.00 ? 39 GLU A HG2  3  
ATOM 6498  H HG3  . GLU A 1 40 ? 11.536  -2.183  7.009   1.00 0.00 ? 39 GLU A HG3  3  
ATOM 6499  N N    . LEU A 1 41 ? 9.873   -6.722  6.113   1.00 0.00 ? 40 LEU A N    3  
ATOM 6500  C CA   . LEU A 1 41 ? 9.104   -7.912  5.608   1.00 0.00 ? 40 LEU A CA   3  
ATOM 6501  C C    . LEU A 1 41 ? 9.822   -9.207  6.012   1.00 0.00 ? 40 LEU A C    3  
ATOM 6502  O O    . LEU A 1 41 ? 9.663   -10.237 5.387   1.00 0.00 ? 40 LEU A O    3  
ATOM 6503  C CB   . LEU A 1 41 ? 8.996   -7.836  4.075   1.00 0.00 ? 40 LEU A CB   3  
ATOM 6504  C CG   . LEU A 1 41 ? 7.879   -6.847  3.668   1.00 0.00 ? 40 LEU A CG   3  
ATOM 6505  C CD1  . LEU A 1 41 ? 8.163   -6.293  2.264   1.00 0.00 ? 40 LEU A CD1  3  
ATOM 6506  C CD2  . LEU A 1 41 ? 6.515   -7.559  3.659   1.00 0.00 ? 40 LEU A CD2  3  
ATOM 6507  H H    . LEU A 1 41 ? 10.804  -6.593  5.838   1.00 0.00 ? 40 LEU A H    3  
ATOM 6508  H HA   . LEU A 1 41 ? 8.111   -7.921  6.034   1.00 0.00 ? 40 LEU A HA   3  
ATOM 6509  H HB2  . LEU A 1 41 ? 9.942   -7.501  3.673   1.00 0.00 ? 40 LEU A HB2  3  
ATOM 6510  H HB3  . LEU A 1 41 ? 8.770   -8.817  3.681   1.00 0.00 ? 40 LEU A HB3  3  
ATOM 6511  H HG   . LEU A 1 41 ? 7.851   -6.025  4.371   1.00 0.00 ? 40 LEU A HG   3  
ATOM 6512  H HD11 . LEU A 1 41 ? 8.516   -7.089  1.626   1.00 0.00 ? 40 LEU A HD11 3  
ATOM 6513  H HD12 . LEU A 1 41 ? 7.258   -5.872  1.848   1.00 0.00 ? 40 LEU A HD12 3  
ATOM 6514  H HD13 . LEU A 1 41 ? 8.918   -5.524  2.330   1.00 0.00 ? 40 LEU A HD13 3  
ATOM 6515  H HD21 . LEU A 1 41 ? 6.566   -8.429  3.021   1.00 0.00 ? 40 LEU A HD21 3  
ATOM 6516  H HD22 . LEU A 1 41 ? 6.254   -7.861  4.661   1.00 0.00 ? 40 LEU A HD22 3  
ATOM 6517  H HD23 . LEU A 1 41 ? 5.760   -6.884  3.281   1.00 0.00 ? 40 LEU A HD23 3  
ATOM 6518  N N    . SER A 1 42 ? 10.608  -9.163  7.055   1.00 0.00 ? 41 SER A N    3  
ATOM 6519  C CA   . SER A 1 42 ? 11.331  -10.391 7.502   1.00 0.00 ? 41 SER A CA   3  
ATOM 6520  C C    . SER A 1 42 ? 10.347  -11.363 8.155   1.00 0.00 ? 41 SER A C    3  
ATOM 6521  O O    . SER A 1 42 ? 10.565  -12.559 8.173   1.00 0.00 ? 41 SER A O    3  
ATOM 6522  C CB   . SER A 1 42 ? 12.409  -10.013 8.521   1.00 0.00 ? 41 SER A CB   3  
ATOM 6523  O OG   . SER A 1 42 ? 12.658  -11.125 9.372   1.00 0.00 ? 41 SER A OG   3  
ATOM 6524  H H    . SER A 1 42 ? 10.720  -8.323  7.548   1.00 0.00 ? 41 SER A H    3  
ATOM 6525  H HA   . SER A 1 42 ? 11.792  -10.873 6.652   1.00 0.00 ? 41 SER A HA   3  
ATOM 6526  H HB2  . SER A 1 42 ? 13.319  -9.752  8.008   1.00 0.00 ? 41 SER A HB2  3  
ATOM 6527  H HB3  . SER A 1 42 ? 12.071  -9.168  9.106   1.00 0.00 ? 41 SER A HB3  3  
ATOM 6528  H HG   . SER A 1 42 ? 12.770  -10.795 10.267  1.00 0.00 ? 41 SER A HG   3  
ATOM 6529  N N    . HIS A 1 43 ? 9.269   -10.869 8.698   1.00 0.00 ? 42 HIS A N    3  
ATOM 6530  C CA   . HIS A 1 43 ? 8.289   -11.779 9.350   1.00 0.00 ? 42 HIS A CA   3  
ATOM 6531  C C    . HIS A 1 43 ? 7.522   -12.561 8.284   1.00 0.00 ? 42 HIS A C    3  
ATOM 6532  O O    . HIS A 1 43 ? 7.418   -13.770 8.341   1.00 0.00 ? 42 HIS A O    3  
ATOM 6533  C CB   . HIS A 1 43 ? 7.300   -10.958 10.176  1.00 0.00 ? 42 HIS A CB   3  
ATOM 6534  C CG   . HIS A 1 43 ? 6.303   -11.884 10.812  1.00 0.00 ? 42 HIS A CG   3  
ATOM 6535  N ND1  . HIS A 1 43 ? 5.315   -12.520 10.077  1.00 0.00 ? 42 HIS A ND1  3  
ATOM 6536  C CD2  . HIS A 1 43 ? 6.135   -12.303 12.108  1.00 0.00 ? 42 HIS A CD2  3  
ATOM 6537  C CE1  . HIS A 1 43 ? 4.605   -13.282 10.927  1.00 0.00 ? 42 HIS A CE1  3  
ATOM 6538  N NE2  . HIS A 1 43 ? 5.062   -13.186 12.179  1.00 0.00 ? 42 HIS A NE2  3  
ATOM 6539  H H    . HIS A 1 43 ? 9.102   -9.904  8.679   1.00 0.00 ? 42 HIS A H    3  
ATOM 6540  H HA   . HIS A 1 43 ? 8.811   -12.468 9.996   1.00 0.00 ? 42 HIS A HA   3  
ATOM 6541  H HB2  . HIS A 1 43 ? 7.832   -10.414 10.943  1.00 0.00 ? 42 HIS A HB2  3  
ATOM 6542  H HB3  . HIS A 1 43 ? 6.784   -10.262 9.531   1.00 0.00 ? 42 HIS A HB3  3  
ATOM 6543  H HD1  . HIS A 1 43 ? 5.162   -12.430 9.113   1.00 0.00 ? 42 HIS A HD1  3  
ATOM 6544  H HD2  . HIS A 1 43 ? 6.743   -11.995 12.945  1.00 0.00 ? 42 HIS A HD2  3  
ATOM 6545  H HE1  . HIS A 1 43 ? 3.768   -13.899 10.633  1.00 0.00 ? 42 HIS A HE1  3  
ATOM 6546  N N    . PHE A 1 44 ? 6.980   -11.880 7.314   1.00 0.00 ? 43 PHE A N    3  
ATOM 6547  C CA   . PHE A 1 44 ? 6.214   -12.582 6.249   1.00 0.00 ? 43 PHE A CA   3  
ATOM 6548  C C    . PHE A 1 44 ? 7.148   -13.528 5.493   1.00 0.00 ? 43 PHE A C    3  
ATOM 6549  O O    . PHE A 1 44 ? 6.711   -14.418 4.792   1.00 0.00 ? 43 PHE A O    3  
ATOM 6550  C CB   . PHE A 1 44 ? 5.621   -11.551 5.288   1.00 0.00 ? 43 PHE A CB   3  
ATOM 6551  C CG   . PHE A 1 44 ? 4.504   -10.807 5.984   1.00 0.00 ? 43 PHE A CG   3  
ATOM 6552  C CD1  . PHE A 1 44 ? 4.792   -9.675  6.757   1.00 0.00 ? 43 PHE A CD1  3  
ATOM 6553  C CD2  . PHE A 1 44 ? 3.181   -11.253 5.861   1.00 0.00 ? 43 PHE A CD2  3  
ATOM 6554  C CE1  . PHE A 1 44 ? 3.758   -8.988  7.405   1.00 0.00 ? 43 PHE A CE1  3  
ATOM 6555  C CE2  . PHE A 1 44 ? 2.147   -10.565 6.509   1.00 0.00 ? 43 PHE A CE2  3  
ATOM 6556  C CZ   . PHE A 1 44 ? 2.436   -9.433  7.281   1.00 0.00 ? 43 PHE A CZ   3  
ATOM 6557  H H    . PHE A 1 44 ? 7.073   -10.904 7.288   1.00 0.00 ? 43 PHE A H    3  
ATOM 6558  H HA   . PHE A 1 44 ? 5.417   -13.153 6.701   1.00 0.00 ? 43 PHE A HA   3  
ATOM 6559  H HB2  . PHE A 1 44 ? 6.389   -10.853 4.990   1.00 0.00 ? 43 PHE A HB2  3  
ATOM 6560  H HB3  . PHE A 1 44 ? 5.230   -12.052 4.416   1.00 0.00 ? 43 PHE A HB3  3  
ATOM 6561  H HD1  . PHE A 1 44 ? 5.812   -9.332  6.852   1.00 0.00 ? 43 PHE A HD1  3  
ATOM 6562  H HD2  . PHE A 1 44 ? 2.958   -12.126 5.266   1.00 0.00 ? 43 PHE A HD2  3  
ATOM 6563  H HE1  . PHE A 1 44 ? 3.981   -8.115  8.001   1.00 0.00 ? 43 PHE A HE1  3  
ATOM 6564  H HE2  . PHE A 1 44 ? 1.127   -10.908 6.414   1.00 0.00 ? 43 PHE A HE2  3  
ATOM 6565  H HZ   . PHE A 1 44 ? 1.638   -8.903  7.781   1.00 0.00 ? 43 PHE A HZ   3  
ATOM 6566  N N    . LEU A 1 45 ? 8.433   -13.333 5.626   1.00 0.00 ? 44 LEU A N    3  
ATOM 6567  C CA   . LEU A 1 45 ? 9.409   -14.207 4.912   1.00 0.00 ? 44 LEU A CA   3  
ATOM 6568  C C    . LEU A 1 45 ? 9.058   -15.685 5.153   1.00 0.00 ? 44 LEU A C    3  
ATOM 6569  O O    . LEU A 1 45 ? 9.229   -16.521 4.289   1.00 0.00 ? 44 LEU A O    3  
ATOM 6570  C CB   . LEU A 1 45 ? 10.828  -13.899 5.436   1.00 0.00 ? 44 LEU A CB   3  
ATOM 6571  C CG   . LEU A 1 45 ? 11.888  -14.113 4.335   1.00 0.00 ? 44 LEU A CG   3  
ATOM 6572  C CD1  . LEU A 1 45 ? 11.759  -15.527 3.754   1.00 0.00 ? 44 LEU A CD1  3  
ATOM 6573  C CD2  . LEU A 1 45 ? 11.725  -13.064 3.209   1.00 0.00 ? 44 LEU A CD2  3  
ATOM 6574  H H    . LEU A 1 45 ? 8.758   -12.603 6.193   1.00 0.00 ? 44 LEU A H    3  
ATOM 6575  H HA   . LEU A 1 45 ? 9.358   -13.999 3.855   1.00 0.00 ? 44 LEU A HA   3  
ATOM 6576  H HB2  . LEU A 1 45 ? 10.865  -12.872 5.769   1.00 0.00 ? 44 LEU A HB2  3  
ATOM 6577  H HB3  . LEU A 1 45 ? 11.054  -14.545 6.274   1.00 0.00 ? 44 LEU A HB3  3  
ATOM 6578  H HG   . LEU A 1 45 ? 12.870  -14.008 4.775   1.00 0.00 ? 44 LEU A HG   3  
ATOM 6579  H HD11 . LEU A 1 45 ? 11.559  -16.229 4.551   1.00 0.00 ? 44 LEU A HD11 3  
ATOM 6580  H HD12 . LEU A 1 45 ? 10.950  -15.551 3.040   1.00 0.00 ? 44 LEU A HD12 3  
ATOM 6581  H HD13 . LEU A 1 45 ? 12.681  -15.797 3.260   1.00 0.00 ? 44 LEU A HD13 3  
ATOM 6582  H HD21 . LEU A 1 45 ? 11.289  -12.159 3.604   1.00 0.00 ? 44 LEU A HD21 3  
ATOM 6583  H HD22 . LEU A 1 45 ? 12.697  -12.836 2.796   1.00 0.00 ? 44 LEU A HD22 3  
ATOM 6584  H HD23 . LEU A 1 45 ? 11.090  -13.453 2.425   1.00 0.00 ? 44 LEU A HD23 3  
ATOM 6585  N N    . GLU A 1 46 ? 8.573   -16.016 6.318   1.00 0.00 ? 45 GLU A N    3  
ATOM 6586  C CA   . GLU A 1 46 ? 8.226   -17.441 6.595   1.00 0.00 ? 45 GLU A CA   3  
ATOM 6587  C C    . GLU A 1 46 ? 6.961   -17.830 5.825   1.00 0.00 ? 45 GLU A C    3  
ATOM 6588  O O    . GLU A 1 46 ? 6.841   -18.932 5.328   1.00 0.00 ? 45 GLU A O    3  
ATOM 6589  C CB   . GLU A 1 46 ? 7.988   -17.635 8.094   1.00 0.00 ? 45 GLU A CB   3  
ATOM 6590  C CG   . GLU A 1 46 ? 7.879   -19.130 8.402   1.00 0.00 ? 45 GLU A CG   3  
ATOM 6591  C CD   . GLU A 1 46 ? 7.601   -19.327 9.893   1.00 0.00 ? 45 GLU A CD   3  
ATOM 6592  O OE1  . GLU A 1 46 ? 8.520   -19.149 10.676  1.00 0.00 ? 45 GLU A OE1  3  
ATOM 6593  O OE2  . GLU A 1 46 ? 6.474   -19.652 10.227  1.00 0.00 ? 45 GLU A OE2  3  
ATOM 6594  H H    . GLU A 1 46 ? 8.443   -15.333 7.008   1.00 0.00 ? 45 GLU A H    3  
ATOM 6595  H HA   . GLU A 1 46 ? 9.040   -18.072 6.279   1.00 0.00 ? 45 GLU A HA   3  
ATOM 6596  H HB2  . GLU A 1 46 ? 8.814   -17.212 8.647   1.00 0.00 ? 45 GLU A HB2  3  
ATOM 6597  H HB3  . GLU A 1 46 ? 7.072   -17.142 8.382   1.00 0.00 ? 45 GLU A HB3  3  
ATOM 6598  H HG2  . GLU A 1 46 ? 7.073   -19.558 7.825   1.00 0.00 ? 45 GLU A HG2  3  
ATOM 6599  H HG3  . GLU A 1 46 ? 8.806   -19.620 8.144   1.00 0.00 ? 45 GLU A HG3  3  
ATOM 6600  N N    . GLU A 1 47 ? 6.015   -16.939 5.727   1.00 0.00 ? 46 GLU A N    3  
ATOM 6601  C CA   . GLU A 1 47 ? 4.753   -17.262 4.995   1.00 0.00 ? 46 GLU A CA   3  
ATOM 6602  C C    . GLU A 1 47 ? 4.927   -16.994 3.496   1.00 0.00 ? 46 GLU A C    3  
ATOM 6603  O O    . GLU A 1 47 ? 4.208   -16.204 2.919   1.00 0.00 ? 46 GLU A O    3  
ATOM 6604  C CB   . GLU A 1 47 ? 3.621   -16.380 5.527   1.00 0.00 ? 46 GLU A CB   3  
ATOM 6605  C CG   . GLU A 1 47 ? 3.220   -16.840 6.931   1.00 0.00 ? 46 GLU A CG   3  
ATOM 6606  C CD   . GLU A 1 47 ? 1.997   -16.047 7.396   1.00 0.00 ? 46 GLU A CD   3  
ATOM 6607  O OE1  . GLU A 1 47 ? 1.446   -15.319 6.587   1.00 0.00 ? 46 GLU A OE1  3  
ATOM 6608  O OE2  . GLU A 1 47 ? 1.633   -16.180 8.553   1.00 0.00 ? 46 GLU A OE2  3  
ATOM 6609  H H    . GLU A 1 47 ? 6.130   -16.059 6.141   1.00 0.00 ? 46 GLU A H    3  
ATOM 6610  H HA   . GLU A 1 47 ? 4.499   -18.300 5.149   1.00 0.00 ? 46 GLU A HA   3  
ATOM 6611  H HB2  . GLU A 1 47 ? 3.956   -15.354 5.567   1.00 0.00 ? 46 GLU A HB2  3  
ATOM 6612  H HB3  . GLU A 1 47 ? 2.769   -16.455 4.869   1.00 0.00 ? 46 GLU A HB3  3  
ATOM 6613  H HG2  . GLU A 1 47 ? 2.982   -17.894 6.910   1.00 0.00 ? 46 GLU A HG2  3  
ATOM 6614  H HG3  . GLU A 1 47 ? 4.038   -16.669 7.614   1.00 0.00 ? 46 GLU A HG3  3  
ATOM 6615  N N    . ILE A 1 48 ? 5.871   -17.648 2.859   1.00 0.00 ? 47 ILE A N    3  
ATOM 6616  C CA   . ILE A 1 48 ? 6.091   -17.436 1.387   1.00 0.00 ? 47 ILE A CA   3  
ATOM 6617  C C    . ILE A 1 48 ? 5.992   -18.779 0.663   1.00 0.00 ? 47 ILE A C    3  
ATOM 6618  O O    . ILE A 1 48 ? 6.858   -19.622 0.784   1.00 0.00 ? 47 ILE A O    3  
ATOM 6619  C CB   . ILE A 1 48 ? 7.488   -16.849 1.148   1.00 0.00 ? 47 ILE A CB   3  
ATOM 6620  C CG1  . ILE A 1 48 ? 7.719   -15.609 2.040   1.00 0.00 ? 47 ILE A CG1  3  
ATOM 6621  C CG2  . ILE A 1 48 ? 7.637   -16.478 -0.330  1.00 0.00 ? 47 ILE A CG2  3  
ATOM 6622  C CD1  . ILE A 1 48 ? 6.979   -14.375 1.499   1.00 0.00 ? 47 ILE A CD1  3  
ATOM 6623  H H    . ILE A 1 48 ? 6.436   -18.283 3.347   1.00 0.00 ? 47 ILE A H    3  
ATOM 6624  H HA   . ILE A 1 48 ? 5.344   -16.769 0.985   1.00 0.00 ? 47 ILE A HA   3  
ATOM 6625  H HB   . ILE A 1 48 ? 8.226   -17.602 1.392   1.00 0.00 ? 47 ILE A HB   3  
ATOM 6626  H HG12 . ILE A 1 48 ? 7.371   -15.818 3.038   1.00 0.00 ? 47 ILE A HG12 3  
ATOM 6627  H HG13 . ILE A 1 48 ? 8.778   -15.397 2.074   1.00 0.00 ? 47 ILE A HG13 3  
ATOM 6628  H HG21 . ILE A 1 48 ? 6.819   -15.839 -0.629  1.00 0.00 ? 47 ILE A HG21 3  
ATOM 6629  H HG22 . ILE A 1 48 ? 8.572   -15.960 -0.477  1.00 0.00 ? 47 ILE A HG22 3  
ATOM 6630  H HG23 . ILE A 1 48 ? 7.626   -17.376 -0.929  1.00 0.00 ? 47 ILE A HG23 3  
ATOM 6631  H HD11 . ILE A 1 48 ? 5.937   -14.606 1.353   1.00 0.00 ? 47 ILE A HD11 3  
ATOM 6632  H HD12 . ILE A 1 48 ? 7.068   -13.567 2.210   1.00 0.00 ? 47 ILE A HD12 3  
ATOM 6633  H HD13 . ILE A 1 48 ? 7.415   -14.070 0.560   1.00 0.00 ? 47 ILE A HD13 3  
ATOM 6634  N N    . LYS A 1 49 ? 4.948   -18.985 -0.099  1.00 0.00 ? 48 LYS A N    3  
ATOM 6635  C CA   . LYS A 1 49 ? 4.805   -20.276 -0.835  1.00 0.00 ? 48 LYS A CA   3  
ATOM 6636  C C    . LYS A 1 49 ? 5.462   -20.147 -2.212  1.00 0.00 ? 48 LYS A C    3  
ATOM 6637  O O    . LYS A 1 49 ? 6.185   -21.019 -2.650  1.00 0.00 ? 48 LYS A O    3  
ATOM 6638  C CB   . LYS A 1 49 ? 3.320   -20.605 -1.013  1.00 0.00 ? 48 LYS A CB   3  
ATOM 6639  C CG   . LYS A 1 49 ? 2.617   -20.619 0.351   1.00 0.00 ? 48 LYS A CG   3  
ATOM 6640  C CD   . LYS A 1 49 ? 3.034   -21.859 1.154   1.00 0.00 ? 48 LYS A CD   3  
ATOM 6641  C CE   . LYS A 1 49 ? 2.038   -22.087 2.295   1.00 0.00 ? 48 LYS A CE   3  
ATOM 6642  N NZ   . LYS A 1 49 ? 2.520   -23.200 3.159   1.00 0.00 ? 48 LYS A NZ   3  
ATOM 6643  H H    . LYS A 1 49 ? 4.263   -18.291 -0.189  1.00 0.00 ? 48 LYS A H    3  
ATOM 6644  H HA   . LYS A 1 49 ? 5.288   -21.064 -0.274  1.00 0.00 ? 48 LYS A HA   3  
ATOM 6645  H HB2  . LYS A 1 49 ? 2.864   -19.853 -1.641  1.00 0.00 ? 48 LYS A HB2  3  
ATOM 6646  H HB3  . LYS A 1 49 ? 3.218   -21.571 -1.483  1.00 0.00 ? 48 LYS A HB3  3  
ATOM 6647  H HG2  . LYS A 1 49 ? 2.887   -19.729 0.901   1.00 0.00 ? 48 LYS A HG2  3  
ATOM 6648  H HG3  . LYS A 1 49 ? 1.547   -20.634 0.199   1.00 0.00 ? 48 LYS A HG3  3  
ATOM 6649  H HD2  . LYS A 1 49 ? 3.044   -22.725 0.509   1.00 0.00 ? 48 LYS A HD2  3  
ATOM 6650  H HD3  . LYS A 1 49 ? 4.018   -21.706 1.569   1.00 0.00 ? 48 LYS A HD3  3  
ATOM 6651  H HE2  . LYS A 1 49 ? 1.950   -21.185 2.883   1.00 0.00 ? 48 LYS A HE2  3  
ATOM 6652  H HE3  . LYS A 1 49 ? 1.072   -22.344 1.883   1.00 0.00 ? 48 LYS A HE3  3  
ATOM 6653  H HZ1  . LYS A 1 49 ? 3.351   -23.644 2.721   1.00 0.00 ? 48 LYS A HZ1  3  
ATOM 6654  H HZ2  . LYS A 1 49 ? 2.782   -22.825 4.093   1.00 0.00 ? 48 LYS A HZ2  3  
ATOM 6655  H HZ3  . LYS A 1 49 ? 1.764   -23.907 3.268   1.00 0.00 ? 48 LYS A HZ3  3  
ATOM 6656  N N    . GLU A 1 50 ? 5.214   -19.060 -2.898  1.00 0.00 ? 49 GLU A N    3  
ATOM 6657  C CA   . GLU A 1 50 ? 5.823   -18.871 -4.248  1.00 0.00 ? 49 GLU A CA   3  
ATOM 6658  C C    . GLU A 1 50 ? 7.212   -18.245 -4.092  1.00 0.00 ? 49 GLU A C    3  
ATOM 6659  O O    . GLU A 1 50 ? 7.342   -17.062 -3.847  1.00 0.00 ? 49 GLU A O    3  
ATOM 6660  C CB   . GLU A 1 50 ? 4.935   -17.942 -5.084  1.00 0.00 ? 49 GLU A CB   3  
ATOM 6661  C CG   . GLU A 1 50 ? 3.652   -18.675 -5.492  1.00 0.00 ? 49 GLU A CG   3  
ATOM 6662  C CD   . GLU A 1 50 ? 2.753   -18.863 -4.269  1.00 0.00 ? 49 GLU A CD   3  
ATOM 6663  O OE1  . GLU A 1 50 ? 2.907   -18.108 -3.323  1.00 0.00 ? 49 GLU A OE1  3  
ATOM 6664  O OE2  . GLU A 1 50 ? 1.923   -19.757 -4.300  1.00 0.00 ? 49 GLU A OE2  3  
ATOM 6665  H H    . GLU A 1 50 ? 4.628   -18.369 -2.525  1.00 0.00 ? 49 GLU A H    3  
ATOM 6666  H HA   . GLU A 1 50 ? 5.910   -19.829 -4.740  1.00 0.00 ? 49 GLU A HA   3  
ATOM 6667  H HB2  . GLU A 1 50 ? 4.680   -17.069 -4.501  1.00 0.00 ? 49 GLU A HB2  3  
ATOM 6668  H HB3  . GLU A 1 50 ? 5.469   -17.638 -5.971  1.00 0.00 ? 49 GLU A HB3  3  
ATOM 6669  H HG2  . GLU A 1 50 ? 3.127   -18.093 -6.235  1.00 0.00 ? 49 GLU A HG2  3  
ATOM 6670  H HG3  . GLU A 1 50 ? 3.901   -19.641 -5.904  1.00 0.00 ? 49 GLU A HG3  3  
ATOM 6671  N N    . GLN A 1 51 ? 8.253   -19.019 -4.238  1.00 0.00 ? 50 GLN A N    3  
ATOM 6672  C CA   . GLN A 1 51 ? 9.624   -18.449 -4.103  1.00 0.00 ? 50 GLN A CA   3  
ATOM 6673  C C    . GLN A 1 51 ? 10.021  -17.754 -5.411  1.00 0.00 ? 50 GLN A C    3  
ATOM 6674  O O    . GLN A 1 51 ? 10.861  -16.875 -5.426  1.00 0.00 ? 50 GLN A O    3  
ATOM 6675  C CB   . GLN A 1 51 ? 10.616  -19.578 -3.802  1.00 0.00 ? 50 GLN A CB   3  
ATOM 6676  C CG   . GLN A 1 51 ? 10.184  -20.314 -2.531  1.00 0.00 ? 50 GLN A CG   3  
ATOM 6677  C CD   . GLN A 1 51 ? 11.111  -21.508 -2.292  1.00 0.00 ? 50 GLN A CD   3  
ATOM 6678  O OE1  . GLN A 1 51 ? 12.100  -21.670 -2.978  1.00 0.00 ? 50 GLN A OE1  3  
ATOM 6679  N NE2  . GLN A 1 51 ? 10.830  -22.356 -1.340  1.00 0.00 ? 50 GLN A NE2  3  
ATOM 6680  H H    . GLN A 1 51 ? 8.139   -19.969 -4.451  1.00 0.00 ? 50 GLN A H    3  
ATOM 6681  H HA   . GLN A 1 51 ? 9.638   -17.736 -3.292  1.00 0.00 ? 50 GLN A HA   3  
ATOM 6682  H HB2  . GLN A 1 51 ? 10.635  -20.270 -4.632  1.00 0.00 ? 50 GLN A HB2  3  
ATOM 6683  H HB3  . GLN A 1 51 ? 11.601  -19.162 -3.657  1.00 0.00 ? 50 GLN A HB3  3  
ATOM 6684  H HG2  . GLN A 1 51 ? 10.240  -19.640 -1.689  1.00 0.00 ? 50 GLN A HG2  3  
ATOM 6685  H HG3  . GLN A 1 51 ? 9.170   -20.666 -2.645  1.00 0.00 ? 50 GLN A HG3  3  
ATOM 6686  H HE21 . GLN A 1 51 ? 10.031  -22.225 -0.788  1.00 0.00 ? 50 GLN A HE21 3  
ATOM 6687  H HE22 . GLN A 1 51 ? 11.418  -23.122 -1.177  1.00 0.00 ? 50 GLN A HE22 3  
ATOM 6688  N N    . GLU A 1 52 ? 9.429   -18.142 -6.510  1.00 0.00 ? 51 GLU A N    3  
ATOM 6689  C CA   . GLU A 1 52 ? 9.782   -17.506 -7.814  1.00 0.00 ? 51 GLU A CA   3  
ATOM 6690  C C    . GLU A 1 52 ? 9.182   -16.097 -7.914  1.00 0.00 ? 51 GLU A C    3  
ATOM 6691  O O    . GLU A 1 52 ? 9.690   -15.260 -8.633  1.00 0.00 ? 51 GLU A O    3  
ATOM 6692  C CB   . GLU A 1 52 ? 9.290   -18.368 -8.978  1.00 0.00 ? 51 GLU A CB   3  
ATOM 6693  C CG   . GLU A 1 52 ? 9.794   -19.803 -8.808  1.00 0.00 ? 51 GLU A CG   3  
ATOM 6694  C CD   . GLU A 1 52 ? 11.324  -19.813 -8.811  1.00 0.00 ? 51 GLU A CD   3  
ATOM 6695  O OE1  . GLU A 1 52 ? 11.902  -18.953 -9.456  1.00 0.00 ? 51 GLU A OE1  3  
ATOM 6696  O OE2  . GLU A 1 52 ? 11.893  -20.681 -8.169  1.00 0.00 ? 51 GLU A OE2  3  
ATOM 6697  H H    . GLU A 1 52 ? 8.754   -18.852 -6.476  1.00 0.00 ? 51 GLU A H    3  
ATOM 6698  H HA   . GLU A 1 52 ? 10.855  -17.398 -7.869  1.00 0.00 ? 51 GLU A HA   3  
ATOM 6699  H HB2  . GLU A 1 52 ? 8.209   -18.364 -8.996  1.00 0.00 ? 51 GLU A HB2  3  
ATOM 6700  H HB3  . GLU A 1 52 ? 9.666   -17.965 -9.907  1.00 0.00 ? 51 GLU A HB3  3  
ATOM 6701  H HG2  . GLU A 1 52 ? 9.432   -20.203 -7.872  1.00 0.00 ? 51 GLU A HG2  3  
ATOM 6702  H HG3  . GLU A 1 52 ? 9.431   -20.409 -9.624  1.00 0.00 ? 51 GLU A HG3  3  
ATOM 6703  N N    . VAL A 1 53 ? 8.144   -15.797 -7.182  1.00 0.00 ? 52 VAL A N    3  
ATOM 6704  C CA   . VAL A 1 53 ? 7.588   -14.411 -7.240  1.00 0.00 ? 52 VAL A CA   3  
ATOM 6705  C C    . VAL A 1 53 ? 8.562   -13.488 -6.509  1.00 0.00 ? 52 VAL A C    3  
ATOM 6706  O O    . VAL A 1 53 ? 8.931   -12.447 -7.013  1.00 0.00 ? 52 VAL A O    3  
ATOM 6707  C CB   . VAL A 1 53 ? 6.217   -14.361 -6.550  1.00 0.00 ? 52 VAL A CB   3  
ATOM 6708  C CG1  . VAL A 1 53 ? 5.795   -12.902 -6.340  1.00 0.00 ? 52 VAL A CG1  3  
ATOM 6709  C CG2  . VAL A 1 53 ? 5.178   -15.059 -7.428  1.00 0.00 ? 52 VAL A CG2  3  
ATOM 6710  H H    . VAL A 1 53 ? 7.765   -16.447 -6.552  1.00 0.00 ? 52 VAL A H    3  
ATOM 6711  H HA   . VAL A 1 53 ? 7.494   -14.075 -8.264  1.00 0.00 ? 52 VAL A HA   3  
ATOM 6712  H HB   . VAL A 1 53 ? 6.277   -14.860 -5.593  1.00 0.00 ? 52 VAL A HB   3  
ATOM 6713  H HG11 . VAL A 1 53 ? 5.985   -12.339 -7.242  1.00 0.00 ? 52 VAL A HG11 3  
ATOM 6714  H HG12 . VAL A 1 53 ? 4.741   -12.859 -6.105  1.00 0.00 ? 52 VAL A HG12 3  
ATOM 6715  H HG13 . VAL A 1 53 ? 6.363   -12.476 -5.526  1.00 0.00 ? 52 VAL A HG13 3  
ATOM 6716  H HG21 . VAL A 1 53 ? 5.537   -16.038 -7.704  1.00 0.00 ? 52 VAL A HG21 3  
ATOM 6717  H HG22 . VAL A 1 53 ? 4.253   -15.155 -6.879  1.00 0.00 ? 52 VAL A HG22 3  
ATOM 6718  H HG23 . VAL A 1 53 ? 5.010   -14.471 -8.319  1.00 0.00 ? 52 VAL A HG23 3  
ATOM 6719  N N    . VAL A 1 54 ? 8.994   -13.854 -5.339  1.00 0.00 ? 53 VAL A N    3  
ATOM 6720  C CA   . VAL A 1 54 ? 9.951   -12.981 -4.609  1.00 0.00 ? 53 VAL A CA   3  
ATOM 6721  C C    . VAL A 1 54 ? 11.246  -12.882 -5.415  1.00 0.00 ? 53 VAL A C    3  
ATOM 6722  O O    . VAL A 1 54 ? 11.921  -11.871 -5.407  1.00 0.00 ? 53 VAL A O    3  
ATOM 6723  C CB   . VAL A 1 54 ? 10.244  -13.577 -3.230  1.00 0.00 ? 53 VAL A CB   3  
ATOM 6724  C CG1  . VAL A 1 54 ? 11.316  -12.741 -2.527  1.00 0.00 ? 53 VAL A CG1  3  
ATOM 6725  C CG2  . VAL A 1 54 ? 8.963   -13.567 -2.393  1.00 0.00 ? 53 VAL A CG2  3  
ATOM 6726  H H    . VAL A 1 54 ? 8.698   -14.698 -4.936  1.00 0.00 ? 53 VAL A H    3  
ATOM 6727  H HA   . VAL A 1 54 ? 9.524   -11.995 -4.492  1.00 0.00 ? 53 VAL A HA   3  
ATOM 6728  H HB   . VAL A 1 54 ? 10.595  -14.593 -3.344  1.00 0.00 ? 53 VAL A HB   3  
ATOM 6729  H HG11 . VAL A 1 54 ? 11.042  -11.697 -2.565  1.00 0.00 ? 53 VAL A HG11 3  
ATOM 6730  H HG12 . VAL A 1 54 ? 11.396  -13.053 -1.496  1.00 0.00 ? 53 VAL A HG12 3  
ATOM 6731  H HG13 . VAL A 1 54 ? 12.267  -12.882 -3.020  1.00 0.00 ? 53 VAL A HG13 3  
ATOM 6732  H HG21 . VAL A 1 54 ? 8.566   -12.563 -2.357  1.00 0.00 ? 53 VAL A HG21 3  
ATOM 6733  H HG22 . VAL A 1 54 ? 8.235   -14.227 -2.841  1.00 0.00 ? 53 VAL A HG22 3  
ATOM 6734  H HG23 . VAL A 1 54 ? 9.185   -13.902 -1.392  1.00 0.00 ? 53 VAL A HG23 3  
ATOM 6735  N N    . ASP A 1 55 ? 11.598  -13.929 -6.111  1.00 0.00 ? 54 ASP A N    3  
ATOM 6736  C CA   . ASP A 1 55 ? 12.848  -13.903 -6.919  1.00 0.00 ? 54 ASP A CA   3  
ATOM 6737  C C    . ASP A 1 55 ? 12.767  -12.777 -7.950  1.00 0.00 ? 54 ASP A C    3  
ATOM 6738  O O    . ASP A 1 55 ? 13.702  -12.024 -8.141  1.00 0.00 ? 54 ASP A O    3  
ATOM 6739  C CB   . ASP A 1 55 ? 13.013  -15.238 -7.647  1.00 0.00 ? 54 ASP A CB   3  
ATOM 6740  C CG   . ASP A 1 55 ? 13.261  -16.350 -6.627  1.00 0.00 ? 54 ASP A CG   3  
ATOM 6741  O OD1  . ASP A 1 55 ? 13.451  -16.029 -5.466  1.00 0.00 ? 54 ASP A OD1  3  
ATOM 6742  O OD2  . ASP A 1 55 ? 13.258  -17.504 -7.024  1.00 0.00 ? 54 ASP A OD2  3  
ATOM 6743  H H    . ASP A 1 55 ? 11.038  -14.734 -6.101  1.00 0.00 ? 54 ASP A H    3  
ATOM 6744  H HA   . ASP A 1 55 ? 13.690  -13.748 -6.261  1.00 0.00 ? 54 ASP A HA   3  
ATOM 6745  H HB2  . ASP A 1 55 ? 12.115  -15.455 -8.208  1.00 0.00 ? 54 ASP A HB2  3  
ATOM 6746  H HB3  . ASP A 1 55 ? 13.853  -15.178 -8.323  1.00 0.00 ? 54 ASP A HB3  3  
ATOM 6747  N N    . LYS A 1 56 ? 11.655  -12.671 -8.631  1.00 0.00 ? 55 LYS A N    3  
ATOM 6748  C CA   . LYS A 1 56 ? 11.513  -11.609 -9.667  1.00 0.00 ? 55 LYS A CA   3  
ATOM 6749  C C    . LYS A 1 56 ? 11.441  -10.236 -8.998  1.00 0.00 ? 55 LYS A C    3  
ATOM 6750  O O    . LYS A 1 56 ? 11.837  -9.244  -9.575  1.00 0.00 ? 55 LYS A O    3  
ATOM 6751  C CB   . LYS A 1 56 ? 10.254  -11.861 -10.503 1.00 0.00 ? 55 LYS A CB   3  
ATOM 6752  C CG   . LYS A 1 56 ? 10.309  -13.268 -11.119 1.00 0.00 ? 55 LYS A CG   3  
ATOM 6753  C CD   . LYS A 1 56 ? 11.297  -13.299 -12.293 1.00 0.00 ? 55 LYS A CD   3  
ATOM 6754  C CE   . LYS A 1 56 ? 11.100  -14.589 -13.094 1.00 0.00 ? 55 LYS A CE   3  
ATOM 6755  N NZ   . LYS A 1 56 ? 11.949  -14.544 -14.318 1.00 0.00 ? 55 LYS A NZ   3  
ATOM 6756  H H    . LYS A 1 56 ? 10.919  -13.298 -8.469  1.00 0.00 ? 55 LYS A H    3  
ATOM 6757  H HA   . LYS A 1 56 ? 12.386  -11.622 -10.298 1.00 0.00 ? 55 LYS A HA   3  
ATOM 6758  H HB2  . LYS A 1 56 ? 9.384   -11.784 -9.865  1.00 0.00 ? 55 LYS A HB2  3  
ATOM 6759  H HB3  . LYS A 1 56 ? 10.188  -11.125 -11.288 1.00 0.00 ? 55 LYS A HB3  3  
ATOM 6760  H HG2  . LYS A 1 56 ? 10.626  -13.976 -10.367 1.00 0.00 ? 55 LYS A HG2  3  
ATOM 6761  H HG3  . LYS A 1 56 ? 9.326   -13.541 -11.474 1.00 0.00 ? 55 LYS A HG3  3  
ATOM 6762  H HD2  . LYS A 1 56 ? 11.127  -12.449 -12.937 1.00 0.00 ? 55 LYS A HD2  3  
ATOM 6763  H HD3  . LYS A 1 56 ? 12.308  -13.269 -11.917 1.00 0.00 ? 55 LYS A HD3  3  
ATOM 6764  H HE2  . LYS A 1 56 ? 11.386  -15.437 -12.489 1.00 0.00 ? 55 LYS A HE2  3  
ATOM 6765  H HE3  . LYS A 1 56 ? 10.063  -14.683 -13.379 1.00 0.00 ? 55 LYS A HE3  3  
ATOM 6766  H HZ1  . LYS A 1 56 ? 12.105  -13.554 -14.595 1.00 0.00 ? 55 LYS A HZ1  3  
ATOM 6767  H HZ2  . LYS A 1 56 ? 12.865  -14.995 -14.122 1.00 0.00 ? 55 LYS A HZ2  3  
ATOM 6768  H HZ3  . LYS A 1 56 ? 11.470  -15.050 -15.090 1.00 0.00 ? 55 LYS A HZ3  3  
ATOM 6769  N N    . VAL A 1 57 ? 10.985  -10.160 -7.779  1.00 0.00 ? 56 VAL A N    3  
ATOM 6770  C CA   . VAL A 1 57 ? 10.949  -8.842  -7.086  1.00 0.00 ? 56 VAL A CA   3  
ATOM 6771  C C    . VAL A 1 57 ? 12.387  -8.376  -6.859  1.00 0.00 ? 56 VAL A C    3  
ATOM 6772  O O    . VAL A 1 57 ? 12.776  -7.303  -7.276  1.00 0.00 ? 56 VAL A O    3  
ATOM 6773  C CB   . VAL A 1 57 ? 10.255  -9.002  -5.731  1.00 0.00 ? 56 VAL A CB   3  
ATOM 6774  C CG1  . VAL A 1 57 ? 10.317  -7.676  -4.969  1.00 0.00 ? 56 VAL A CG1  3  
ATOM 6775  C CG2  . VAL A 1 57 ? 8.789   -9.395  -5.947  1.00 0.00 ? 56 VAL A CG2  3  
ATOM 6776  H H    . VAL A 1 57 ? 10.705  -10.963 -7.295  1.00 0.00 ? 56 VAL A H    3  
ATOM 6777  H HA   . VAL A 1 57 ? 10.424  -8.098  -7.668  1.00 0.00 ? 56 VAL A HA   3  
ATOM 6778  H HB   . VAL A 1 57 ? 10.756  -9.770  -5.159  1.00 0.00 ? 56 VAL A HB   3  
ATOM 6779  H HG11 . VAL A 1 57 ? 10.011  -6.872  -5.622  1.00 0.00 ? 56 VAL A HG11 3  
ATOM 6780  H HG12 . VAL A 1 57 ? 9.656   -7.720  -4.116  1.00 0.00 ? 56 VAL A HG12 3  
ATOM 6781  H HG13 . VAL A 1 57 ? 11.328  -7.500  -4.632  1.00 0.00 ? 56 VAL A HG13 3  
ATOM 6782  H HG21 . VAL A 1 57 ? 8.723   -10.131 -6.734  1.00 0.00 ? 56 VAL A HG21 3  
ATOM 6783  H HG22 . VAL A 1 57 ? 8.391   -9.810  -5.033  1.00 0.00 ? 56 VAL A HG22 3  
ATOM 6784  H HG23 . VAL A 1 57 ? 8.216   -8.521  -6.225  1.00 0.00 ? 56 VAL A HG23 3  
ATOM 6785  N N    . MET A 1 58 ? 13.174  -9.171  -6.190  1.00 0.00 ? 57 MET A N    3  
ATOM 6786  C CA   . MET A 1 58 ? 14.584  -8.775  -5.919  1.00 0.00 ? 57 MET A CA   3  
ATOM 6787  C C    . MET A 1 58 ? 15.306  -8.447  -7.229  1.00 0.00 ? 57 MET A C    3  
ATOM 6788  O O    . MET A 1 58 ? 16.236  -7.666  -7.250  1.00 0.00 ? 57 MET A O    3  
ATOM 6789  C CB   . MET A 1 58 ? 15.308  -9.923  -5.212  1.00 0.00 ? 57 MET A CB   3  
ATOM 6790  C CG   . MET A 1 58 ? 14.652  -10.185 -3.854  1.00 0.00 ? 57 MET A CG   3  
ATOM 6791  S SD   . MET A 1 58 ? 15.003  -8.805  -2.736  1.00 0.00 ? 57 MET A SD   3  
ATOM 6792  C CE   . MET A 1 58 ? 13.779  -9.219  -1.469  1.00 0.00 ? 57 MET A CE   3  
ATOM 6793  H H    . MET A 1 58 ? 12.836  -10.021 -5.836  1.00 0.00 ? 57 MET A H    3  
ATOM 6794  H HA   . MET A 1 58 ? 14.593  -7.903  -5.282  1.00 0.00 ? 57 MET A HA   3  
ATOM 6795  H HB2  . MET A 1 58 ? 15.247  -10.814 -5.820  1.00 0.00 ? 57 MET A HB2  3  
ATOM 6796  H HB3  . MET A 1 58 ? 16.344  -9.659  -5.064  1.00 0.00 ? 57 MET A HB3  3  
ATOM 6797  H HG2  . MET A 1 58 ? 13.585  -10.281 -3.983  1.00 0.00 ? 57 MET A HG2  3  
ATOM 6798  H HG3  . MET A 1 58 ? 15.048  -11.097 -3.434  1.00 0.00 ? 57 MET A HG3  3  
ATOM 6799  H HE1  . MET A 1 58 ? 13.907  -10.245 -1.165  1.00 0.00 ? 57 MET A HE1  3  
ATOM 6800  H HE2  . MET A 1 58 ? 13.916  -8.572  -0.612  1.00 0.00 ? 57 MET A HE2  3  
ATOM 6801  H HE3  . MET A 1 58 ? 12.786  -9.085  -1.873  1.00 0.00 ? 57 MET A HE3  3  
ATOM 6802  N N    . GLU A 1 59 ? 14.877  -9.013  -8.332  1.00 0.00 ? 58 GLU A N    3  
ATOM 6803  C CA   . GLU A 1 59 ? 15.532  -8.700  -9.638  1.00 0.00 ? 58 GLU A CA   3  
ATOM 6804  C C    . GLU A 1 59 ? 14.900  -7.440  -10.232 1.00 0.00 ? 58 GLU A C    3  
ATOM 6805  O O    . GLU A 1 59 ? 15.573  -6.642  -10.850 1.00 0.00 ? 58 GLU A O    3  
ATOM 6806  C CB   . GLU A 1 59 ? 15.392  -9.879  -10.606 1.00 0.00 ? 58 GLU A CB   3  
ATOM 6807  C CG   . GLU A 1 59 ? 16.335  -9.682  -11.800 1.00 0.00 ? 58 GLU A CG   3  
ATOM 6808  C CD   . GLU A 1 59 ? 15.896  -10.583 -12.957 1.00 0.00 ? 58 GLU A CD   3  
ATOM 6809  O OE1  . GLU A 1 59 ? 14.707  -10.627 -13.227 1.00 0.00 ? 58 GLU A OE1  3  
ATOM 6810  O OE2  . GLU A 1 59 ? 16.755  -11.211 -13.552 1.00 0.00 ? 58 GLU A OE2  3  
ATOM 6811  H H    . GLU A 1 59 ? 14.104  -9.609  -8.305  1.00 0.00 ? 58 GLU A H    3  
ATOM 6812  H HA   . GLU A 1 59 ? 16.577  -8.472  -9.476  1.00 0.00 ? 58 GLU A HA   3  
ATOM 6813  H HB2  . GLU A 1 59 ? 15.648  -10.796 -10.094 1.00 0.00 ? 58 GLU A HB2  3  
ATOM 6814  H HB3  . GLU A 1 59 ? 14.373  -9.935  -10.958 1.00 0.00 ? 58 GLU A HB3  3  
ATOM 6815  H HG2  . GLU A 1 59 ? 16.306  -8.650  -12.118 1.00 0.00 ? 58 GLU A HG2  3  
ATOM 6816  H HG3  . GLU A 1 59 ? 17.343  -9.940  -11.510 1.00 0.00 ? 58 GLU A HG3  3  
ATOM 6817  N N    . THR A 1 60 ? 13.624  -7.233  -10.046 1.00 0.00 ? 59 THR A N    3  
ATOM 6818  C CA   . THR A 1 60 ? 13.005  -5.999  -10.609 1.00 0.00 ? 59 THR A CA   3  
ATOM 6819  C C    . THR A 1 60 ? 13.550  -4.794  -9.838  1.00 0.00 ? 59 THR A C    3  
ATOM 6820  O O    . THR A 1 60 ? 13.934  -3.803  -10.427 1.00 0.00 ? 59 THR A O    3  
ATOM 6821  C CB   . THR A 1 60 ? 11.478  -6.065  -10.500 1.00 0.00 ? 59 THR A CB   3  
ATOM 6822  O OG1  . THR A 1 60 ? 11.041  -7.385  -10.789 1.00 0.00 ? 59 THR A OG1  3  
ATOM 6823  C CG2  . THR A 1 60 ? 10.848  -5.091  -11.499 1.00 0.00 ? 59 THR A CG2  3  
ATOM 6824  H H    . THR A 1 60 ? 13.086  -7.869  -9.529  1.00 0.00 ? 59 THR A H    3  
ATOM 6825  H HA   . THR A 1 60 ? 13.305  -5.888  -11.641 1.00 0.00 ? 59 THR A HA   3  
ATOM 6826  H HB   . THR A 1 60 ? 11.176  -5.796  -9.500  1.00 0.00 ? 59 THR A HB   3  
ATOM 6827  H HG1  . THR A 1 60 ? 11.755  -7.841  -11.241 1.00 0.00 ? 59 THR A HG1  3  
ATOM 6828  H HG21 . THR A 1 60 ? 11.360  -4.141  -11.447 1.00 0.00 ? 59 THR A HG21 3  
ATOM 6829  H HG22 . THR A 1 60 ? 10.936  -5.493  -12.497 1.00 0.00 ? 59 THR A HG22 3  
ATOM 6830  H HG23 . THR A 1 60 ? 9.805   -4.952  -11.259 1.00 0.00 ? 59 THR A HG23 3  
ATOM 6831  N N    . LEU A 1 61 ? 13.634  -4.873  -8.541  1.00 0.00 ? 60 LEU A N    3  
ATOM 6832  C CA   . LEU A 1 61 ? 14.211  -3.737  -7.773  1.00 0.00 ? 60 LEU A CA   3  
ATOM 6833  C C    . LEU A 1 61 ? 15.653  -3.529  -8.236  1.00 0.00 ? 60 LEU A C    3  
ATOM 6834  O O    . LEU A 1 61 ? 16.019  -2.462  -8.687  1.00 0.00 ? 60 LEU A O    3  
ATOM 6835  C CB   . LEU A 1 61 ? 14.193  -4.070  -6.277  1.00 0.00 ? 60 LEU A CB   3  
ATOM 6836  C CG   . LEU A 1 61 ? 12.750  -4.324  -5.818  1.00 0.00 ? 60 LEU A CG   3  
ATOM 6837  C CD1  . LEU A 1 61 ? 12.755  -4.748  -4.346  1.00 0.00 ? 60 LEU A CD1  3  
ATOM 6838  C CD2  . LEU A 1 61 ? 11.914  -3.043  -5.983  1.00 0.00 ? 60 LEU A CD2  3  
ATOM 6839  H H    . LEU A 1 61 ? 13.359  -5.680  -8.053  1.00 0.00 ? 60 LEU A H    3  
ATOM 6840  H HA   . LEU A 1 61 ? 13.672  -2.818  -7.945  1.00 0.00 ? 60 LEU A HA   3  
ATOM 6841  H HB2  . LEU A 1 61 ? 14.787  -4.955  -6.100  1.00 0.00 ? 60 LEU A HB2  3  
ATOM 6842  H HB3  . LEU A 1 61 ? 14.605  -3.244  -5.719  1.00 0.00 ? 60 LEU A HB3  3  
ATOM 6843  H HG   . LEU A 1 61 ? 12.319  -5.115  -6.416  1.00 0.00 ? 60 LEU A HG   3  
ATOM 6844  H HD11 . LEU A 1 61 ? 13.274  -4.005  -3.758  1.00 0.00 ? 60 LEU A HD11 3  
ATOM 6845  H HD12 . LEU A 1 61 ? 11.737  -4.838  -3.994  1.00 0.00 ? 60 LEU A HD12 3  
ATOM 6846  H HD13 . LEU A 1 61 ? 13.255  -5.699  -4.246  1.00 0.00 ? 60 LEU A HD13 3  
ATOM 6847  H HD21 . LEU A 1 61 ? 12.514  -2.179  -5.736  1.00 0.00 ? 60 LEU A HD21 3  
ATOM 6848  H HD22 . LEU A 1 61 ? 11.574  -2.964  -7.005  1.00 0.00 ? 60 LEU A HD22 3  
ATOM 6849  H HD23 . LEU A 1 61 ? 11.055  -3.081  -5.327  1.00 0.00 ? 60 LEU A HD23 3  
ATOM 6850  N N    . ASP A 1 62 ? 16.476  -4.538  -8.146  1.00 0.00 ? 61 ASP A N    3  
ATOM 6851  C CA   . ASP A 1 62 ? 17.884  -4.381  -8.603  1.00 0.00 ? 61 ASP A CA   3  
ATOM 6852  C C    . ASP A 1 62 ? 17.888  -3.793  -10.019 1.00 0.00 ? 61 ASP A C    3  
ATOM 6853  O O    . ASP A 1 62 ? 18.869  -3.232  -10.466 1.00 0.00 ? 61 ASP A O    3  
ATOM 6854  C CB   . ASP A 1 62 ? 18.572  -5.749  -8.620  1.00 0.00 ? 61 ASP A CB   3  
ATOM 6855  C CG   . ASP A 1 62 ? 20.070  -5.568  -8.869  1.00 0.00 ? 61 ASP A CG   3  
ATOM 6856  O OD1  . ASP A 1 62 ? 20.440  -5.362  -10.013 1.00 0.00 ? 61 ASP A OD1  3  
ATOM 6857  O OD2  . ASP A 1 62 ? 20.823  -5.639  -7.911  1.00 0.00 ? 61 ASP A OD2  3  
ATOM 6858  H H    . ASP A 1 62 ? 16.167  -5.396  -7.786  1.00 0.00 ? 61 ASP A H    3  
ATOM 6859  H HA   . ASP A 1 62 ? 18.411  -3.717  -7.933  1.00 0.00 ? 61 ASP A HA   3  
ATOM 6860  H HB2  . ASP A 1 62 ? 18.420  -6.240  -7.670  1.00 0.00 ? 61 ASP A HB2  3  
ATOM 6861  H HB3  . ASP A 1 62 ? 18.150  -6.353  -9.409  1.00 0.00 ? 61 ASP A HB3  3  
ATOM 6862  N N    . GLU A 1 63 ? 16.790  -3.921  -10.729 1.00 0.00 ? 62 GLU A N    3  
ATOM 6863  C CA   . GLU A 1 63 ? 16.709  -3.379  -12.126 1.00 0.00 ? 62 GLU A CA   3  
ATOM 6864  C C    . GLU A 1 63 ? 15.925  -2.071  -12.116 1.00 0.00 ? 62 GLU A C    3  
ATOM 6865  O O    . GLU A 1 63 ? 15.112  -1.799  -12.975 1.00 0.00 ? 62 GLU A O    3  
ATOM 6866  C CB   . GLU A 1 63 ? 15.990  -4.357  -13.006 1.00 0.00 ? 62 GLU A CB   3  
ATOM 6867  C CG   . GLU A 1 63 ? 16.852  -5.600  -13.236 1.00 0.00 ? 62 GLU A CG   3  
ATOM 6868  C CD   . GLU A 1 63 ? 15.992  -6.712  -13.839 1.00 0.00 ? 62 GLU A CD   3  
ATOM 6869  O OE1  . GLU A 1 63 ? 14.906  -6.938  -13.328 1.00 0.00 ? 62 GLU A OE1  3  
ATOM 6870  O OE2  . GLU A 1 63 ? 16.432  -7.320  -14.801 1.00 0.00 ? 62 GLU A OE2  3  
ATOM 6871  H H    . GLU A 1 63 ? 16.015  -4.377  -10.343 1.00 0.00 ? 62 GLU A H    3  
ATOM 6872  H HA   . GLU A 1 63 ? 17.704  -3.176  -12.494 1.00 0.00 ? 62 GLU A HA   3  
ATOM 6873  H HB2  . GLU A 1 63 ? 15.076  -4.627  -12.511 1.00 0.00 ? 62 GLU A HB2  3  
ATOM 6874  H HB3  . GLU A 1 63 ? 15.768  -3.886  -13.945 1.00 0.00 ? 62 GLU A HB3  3  
ATOM 6875  H HG2  . GLU A 1 63 ? 17.658  -5.359  -13.914 1.00 0.00 ? 62 GLU A HG2  3  
ATOM 6876  H HG3  . GLU A 1 63 ? 17.263  -5.935  -12.296 1.00 0.00 ? 62 GLU A HG3  3  
ATOM 6877  N N    . ASP A 1 64 ? 16.185  -1.282  -11.149 1.00 0.00 ? 63 ASP A N    3  
ATOM 6878  C CA   . ASP A 1 64 ? 15.498  0.038   -11.010 1.00 0.00 ? 63 ASP A CA   3  
ATOM 6879  C C    . ASP A 1 64 ? 15.424  0.731   -12.373 1.00 0.00 ? 63 ASP A C    3  
ATOM 6880  O O    . ASP A 1 64 ? 14.475  1.421   -12.687 1.00 0.00 ? 63 ASP A O    3  
ATOM 6881  C CB   . ASP A 1 64 ? 16.341  0.910   -10.066 1.00 0.00 ? 63 ASP A CB   3  
ATOM 6882  C CG   . ASP A 1 64 ? 15.532  2.134   -9.627  1.00 0.00 ? 63 ASP A CG   3  
ATOM 6883  O OD1  . ASP A 1 64 ? 14.321  2.021   -9.535  1.00 0.00 ? 63 ASP A OD1  3  
ATOM 6884  O OD2  . ASP A 1 64 ? 16.140  3.165   -9.388  1.00 0.00 ? 63 ASP A OD2  3  
ATOM 6885  H H    . ASP A 1 64 ? 16.839  -1.569  -10.502 1.00 0.00 ? 63 ASP A H    3  
ATOM 6886  H HA   . ASP A 1 64 ? 14.516  -0.067  -10.571 1.00 0.00 ? 63 ASP A HA   3  
ATOM 6887  H HB2  . ASP A 1 64 ? 16.617  0.331   -9.196  1.00 0.00 ? 63 ASP A HB2  3  
ATOM 6888  H HB3  . ASP A 1 64 ? 17.235  1.236   -10.577 1.00 0.00 ? 63 ASP A HB3  3  
ATOM 6889  N N    . GLY A 1 65 ? 16.411  0.501   -13.191 1.00 0.00 ? 64 GLY A N    3  
ATOM 6890  C CA   . GLY A 1 65 ? 16.437  1.085   -14.570 1.00 0.00 ? 64 GLY A CA   3  
ATOM 6891  C C    . GLY A 1 65 ? 16.214  2.608   -14.569 1.00 0.00 ? 64 GLY A C    3  
ATOM 6892  O O    . GLY A 1 65 ? 16.398  3.247   -15.586 1.00 0.00 ? 64 GLY A O    3  
ATOM 6893  H H    . GLY A 1 65 ? 17.132  -0.105  -12.916 1.00 0.00 ? 64 GLY A H    3  
ATOM 6894  H HA2  . GLY A 1 65 ? 17.405  0.878   -15.003 1.00 0.00 ? 64 GLY A HA2  3  
ATOM 6895  H HA3  . GLY A 1 65 ? 15.665  0.596   -15.144 1.00 0.00 ? 64 GLY A HA3  3  
ATOM 6896  N N    . ASP A 1 66 ? 15.827  3.205   -13.460 1.00 0.00 ? 65 ASP A N    3  
ATOM 6897  C CA   . ASP A 1 66 ? 15.605  4.704   -13.440 1.00 0.00 ? 65 ASP A CA   3  
ATOM 6898  C C    . ASP A 1 66 ? 16.701  5.452   -12.634 1.00 0.00 ? 65 ASP A C    3  
ATOM 6899  O O    . ASP A 1 66 ? 17.020  6.575   -12.969 1.00 0.00 ? 65 ASP A O    3  
ATOM 6900  C CB   . ASP A 1 66 ? 14.247  4.993   -12.802 1.00 0.00 ? 65 ASP A CB   3  
ATOM 6901  C CG   . ASP A 1 66 ? 14.151  4.275   -11.456 1.00 0.00 ? 65 ASP A CG   3  
ATOM 6902  O OD1  . ASP A 1 66 ? 14.709  4.782   -10.497 1.00 0.00 ? 65 ASP A OD1  3  
ATOM 6903  O OD2  . ASP A 1 66 ? 13.520  3.233   -11.406 1.00 0.00 ? 65 ASP A OD2  3  
ATOM 6904  H H    . ASP A 1 66 ? 15.669  2.678   -12.656 1.00 0.00 ? 65 ASP A H    3  
ATOM 6905  H HA   . ASP A 1 66 ? 15.594  5.075   -14.455 1.00 0.00 ? 65 ASP A HA   3  
ATOM 6906  H HB2  . ASP A 1 66 ? 14.142  6.056   -12.651 1.00 0.00 ? 65 ASP A HB2  3  
ATOM 6907  H HB3  . ASP A 1 66 ? 13.461  4.641   -13.452 1.00 0.00 ? 65 ASP A HB3  3  
ATOM 6908  N N    . GLY A 1 67 ? 17.288  4.885   -11.593 1.00 0.00 ? 66 GLY A N    3  
ATOM 6909  C CA   . GLY A 1 67 ? 18.347  5.622   -10.822 1.00 0.00 ? 66 GLY A CA   3  
ATOM 6910  C C    . GLY A 1 67 ? 17.773  6.098   -9.485  1.00 0.00 ? 66 GLY A C    3  
ATOM 6911  O O    . GLY A 1 67 ? 18.492  6.266   -8.521  1.00 0.00 ? 66 GLY A O    3  
ATOM 6912  H H    . GLY A 1 67 ? 17.044  3.996   -11.284 1.00 0.00 ? 66 GLY A H    3  
ATOM 6913  H HA2  . GLY A 1 67 ? 19.182  4.960   -10.634 1.00 0.00 ? 66 GLY A HA2  3  
ATOM 6914  H HA3  . GLY A 1 67 ? 18.689  6.466   -11.402 1.00 0.00 ? 66 GLY A HA3  3  
ATOM 6915  N N    . GLU A 1 68 ? 16.480  6.295   -9.408  1.00 0.00 ? 67 GLU A N    3  
ATOM 6916  C CA   . GLU A 1 68 ? 15.864  6.736   -8.114  1.00 0.00 ? 67 GLU A CA   3  
ATOM 6917  C C    . GLU A 1 68 ? 14.456  6.147   -7.991  1.00 0.00 ? 67 GLU A C    3  
ATOM 6918  O O    . GLU A 1 68 ? 13.664  6.233   -8.908  1.00 0.00 ? 67 GLU A O    3  
ATOM 6919  C CB   . GLU A 1 68 ? 15.784  8.264   -8.071  1.00 0.00 ? 67 GLU A CB   3  
ATOM 6920  C CG   . GLU A 1 68 ? 17.182  8.848   -7.860  1.00 0.00 ? 67 GLU A CG   3  
ATOM 6921  C CD   . GLU A 1 68 ? 17.078  10.365  -7.692  1.00 0.00 ? 67 GLU A CD   3  
ATOM 6922  O OE1  . GLU A 1 68 ? 16.735  11.026  -8.659  1.00 0.00 ? 67 GLU A OE1  3  
ATOM 6923  O OE2  . GLU A 1 68 ? 17.340  10.839  -6.600  1.00 0.00 ? 67 GLU A OE2  3  
ATOM 6924  H H    . GLU A 1 68 ? 15.921  6.153   -10.201 1.00 0.00 ? 67 GLU A H    3  
ATOM 6925  H HA   . GLU A 1 68 ? 16.480  6.381   -7.298  1.00 0.00 ? 67 GLU A HA   3  
ATOM 6926  H HB2  . GLU A 1 68 ? 15.378  8.629   -9.004  1.00 0.00 ? 67 GLU A HB2  3  
ATOM 6927  H HB3  . GLU A 1 68 ? 15.143  8.567   -7.256  1.00 0.00 ? 67 GLU A HB3  3  
ATOM 6928  H HG2  . GLU A 1 68 ? 17.624  8.415   -6.974  1.00 0.00 ? 67 GLU A HG2  3  
ATOM 6929  H HG3  . GLU A 1 68 ? 17.800  8.626   -8.717  1.00 0.00 ? 67 GLU A HG3  3  
ATOM 6930  N N    . CYS A 1 69 ? 14.133  5.549   -6.867  1.00 0.00 ? 68 CYS A N    3  
ATOM 6931  C CA   . CYS A 1 69 ? 12.769  4.955   -6.683  1.00 0.00 ? 68 CYS A CA   3  
ATOM 6932  C C    . CYS A 1 69 ? 11.945  5.861   -5.761  1.00 0.00 ? 68 CYS A C    3  
ATOM 6933  O O    . CYS A 1 69 ? 12.367  6.207   -4.675  1.00 0.00 ? 68 CYS A O    3  
ATOM 6934  C CB   . CYS A 1 69 ? 12.903  3.559   -6.060  1.00 0.00 ? 68 CYS A CB   3  
ATOM 6935  S SG   . CYS A 1 69 ? 14.341  2.722   -6.773  1.00 0.00 ? 68 CYS A SG   3  
ATOM 6936  H H    . CYS A 1 69 ? 14.788  5.495   -6.140  1.00 0.00 ? 68 CYS A H    3  
ATOM 6937  H HA   . CYS A 1 69 ? 12.270  4.872   -7.640  1.00 0.00 ? 68 CYS A HA   3  
ATOM 6938  H HB2  . CYS A 1 69 ? 13.031  3.645   -4.991  1.00 0.00 ? 68 CYS A HB2  3  
ATOM 6939  H HB3  . CYS A 1 69 ? 12.013  2.985   -6.271  1.00 0.00 ? 68 CYS A HB3  3  
ATOM 6940  H HG   . CYS A 1 69 ? 15.086  2.859   -6.183  1.00 0.00 ? 68 CYS A HG   3  
ATOM 6941  N N    . ASP A 1 70 ? 10.776  6.255   -6.190  1.00 0.00 ? 69 ASP A N    3  
ATOM 6942  C CA   . ASP A 1 70 ? 9.926   7.149   -5.349  1.00 0.00 ? 69 ASP A CA   3  
ATOM 6943  C C    . ASP A 1 70 ? 9.133   6.315   -4.338  1.00 0.00 ? 69 ASP A C    3  
ATOM 6944  O O    . ASP A 1 70 ? 9.307   5.118   -4.234  1.00 0.00 ? 69 ASP A O    3  
ATOM 6945  C CB   . ASP A 1 70 ? 8.957   7.911   -6.255  1.00 0.00 ? 69 ASP A CB   3  
ATOM 6946  C CG   . ASP A 1 70 ? 9.744   8.638   -7.346  1.00 0.00 ? 69 ASP A CG   3  
ATOM 6947  O OD1  . ASP A 1 70 ? 10.067  8.004   -8.338  1.00 0.00 ? 69 ASP A OD1  3  
ATOM 6948  O OD2  . ASP A 1 70 ? 10.012  9.815   -7.172  1.00 0.00 ? 69 ASP A OD2  3  
ATOM 6949  H H    . ASP A 1 70 ? 10.460  5.971   -7.072  1.00 0.00 ? 69 ASP A H    3  
ATOM 6950  H HA   . ASP A 1 70 ? 10.553  7.853   -4.821  1.00 0.00 ? 69 ASP A HA   3  
ATOM 6951  H HB2  . ASP A 1 70 ? 8.268   7.215   -6.710  1.00 0.00 ? 69 ASP A HB2  3  
ATOM 6952  H HB3  . ASP A 1 70 ? 8.407   8.633   -5.670  1.00 0.00 ? 69 ASP A HB3  3  
ATOM 6953  N N    . PHE A 1 71 ? 8.252   6.938   -3.598  1.00 0.00 ? 70 PHE A N    3  
ATOM 6954  C CA   . PHE A 1 71 ? 7.443   6.170   -2.607  1.00 0.00 ? 70 PHE A CA   3  
ATOM 6955  C C    . PHE A 1 71 ? 6.380   5.365   -3.357  1.00 0.00 ? 70 PHE A C    3  
ATOM 6956  O O    . PHE A 1 71 ? 6.012   4.281   -2.950  1.00 0.00 ? 70 PHE A O    3  
ATOM 6957  C CB   . PHE A 1 71 ? 6.775   7.133   -1.621  1.00 0.00 ? 70 PHE A CB   3  
ATOM 6958  C CG   . PHE A 1 71 ? 6.013   6.353   -0.572  1.00 0.00 ? 70 PHE A CG   3  
ATOM 6959  C CD1  . PHE A 1 71 ? 4.764   5.796   -0.878  1.00 0.00 ? 70 PHE A CD1  3  
ATOM 6960  C CD2  . PHE A 1 71 ? 6.555   6.190   0.708   1.00 0.00 ? 70 PHE A CD2  3  
ATOM 6961  C CE1  . PHE A 1 71 ? 4.061   5.078   0.097   1.00 0.00 ? 70 PHE A CE1  3  
ATOM 6962  C CE2  . PHE A 1 71 ? 5.852   5.473   1.682   1.00 0.00 ? 70 PHE A CE2  3  
ATOM 6963  C CZ   . PHE A 1 71 ? 4.604   4.917   1.377   1.00 0.00 ? 70 PHE A CZ   3  
ATOM 6964  H H    . PHE A 1 71 ? 8.111   7.902   -3.705  1.00 0.00 ? 70 PHE A H    3  
ATOM 6965  H HA   . PHE A 1 71 ? 8.087   5.482   -2.084  1.00 0.00 ? 70 PHE A HA   3  
ATOM 6966  H HB2  . PHE A 1 71 ? 7.532   7.736   -1.142  1.00 0.00 ? 70 PHE A HB2  3  
ATOM 6967  H HB3  . PHE A 1 71 ? 6.091   7.775   -2.156  1.00 0.00 ? 70 PHE A HB3  3  
ATOM 6968  H HD1  . PHE A 1 71 ? 4.341   5.920   -1.863  1.00 0.00 ? 70 PHE A HD1  3  
ATOM 6969  H HD2  . PHE A 1 71 ? 7.518   6.619   0.944   1.00 0.00 ? 70 PHE A HD2  3  
ATOM 6970  H HE1  . PHE A 1 71 ? 3.098   4.648   -0.138  1.00 0.00 ? 70 PHE A HE1  3  
ATOM 6971  H HE2  . PHE A 1 71 ? 6.272   5.351   2.670   1.00 0.00 ? 70 PHE A HE2  3  
ATOM 6972  H HZ   . PHE A 1 71 ? 4.062   4.363   2.129   1.00 0.00 ? 70 PHE A HZ   3  
ATOM 6973  N N    . GLN A 1 72 ? 5.888   5.872   -4.449  1.00 0.00 ? 71 GLN A N    3  
ATOM 6974  C CA   . GLN A 1 72 ? 4.859   5.111   -5.211  1.00 0.00 ? 71 GLN A CA   3  
ATOM 6975  C C    . GLN A 1 72 ? 5.432   3.744   -5.595  1.00 0.00 ? 71 GLN A C    3  
ATOM 6976  O O    . GLN A 1 72 ? 4.740   2.746   -5.571  1.00 0.00 ? 71 GLN A O    3  
ATOM 6977  C CB   . GLN A 1 72 ? 4.485   5.886   -6.475  1.00 0.00 ? 71 GLN A CB   3  
ATOM 6978  C CG   . GLN A 1 72 ? 3.661   7.116   -6.091  1.00 0.00 ? 71 GLN A CG   3  
ATOM 6979  C CD   . GLN A 1 72 ? 3.269   7.884   -7.354  1.00 0.00 ? 71 GLN A CD   3  
ATOM 6980  O OE1  . GLN A 1 72 ? 3.882   8.878   -7.689  1.00 0.00 ? 71 GLN A OE1  3  
ATOM 6981  N NE2  . GLN A 1 72 ? 2.266   7.462   -8.074  1.00 0.00 ? 71 GLN A NE2  3  
ATOM 6982  H H    . GLN A 1 72 ? 6.197   6.744   -4.772  1.00 0.00 ? 71 GLN A H    3  
ATOM 6983  H HA   . GLN A 1 72 ? 3.980   4.972   -4.599  1.00 0.00 ? 71 GLN A HA   3  
ATOM 6984  H HB2  . GLN A 1 72 ? 5.385   6.198   -6.987  1.00 0.00 ? 71 GLN A HB2  3  
ATOM 6985  H HB3  . GLN A 1 72 ? 3.901   5.253   -7.126  1.00 0.00 ? 71 GLN A HB3  3  
ATOM 6986  H HG2  . GLN A 1 72 ? 2.768   6.802   -5.569  1.00 0.00 ? 71 GLN A HG2  3  
ATOM 6987  H HG3  . GLN A 1 72 ? 4.247   7.757   -5.449  1.00 0.00 ? 71 GLN A HG3  3  
ATOM 6988  H HE21 . GLN A 1 72 ? 1.772   6.659   -7.803  1.00 0.00 ? 71 GLN A HE21 3  
ATOM 6989  H HE22 . GLN A 1 72 ? 2.008   7.946   -8.886  1.00 0.00 ? 71 GLN A HE22 3  
ATOM 6990  N N    . GLU A 1 73 ? 6.689   3.682   -5.937  1.00 0.00 ? 72 GLU A N    3  
ATOM 6991  C CA   . GLU A 1 73 ? 7.288   2.368   -6.305  1.00 0.00 ? 72 GLU A CA   3  
ATOM 6992  C C    . GLU A 1 73 ? 7.439   1.501   -5.047  1.00 0.00 ? 72 GLU A C    3  
ATOM 6993  O O    . GLU A 1 73 ? 7.454   0.293   -5.111  1.00 0.00 ? 72 GLU A O    3  
ATOM 6994  C CB   . GLU A 1 73 ? 8.656   2.574   -6.964  1.00 0.00 ? 72 GLU A CB   3  
ATOM 6995  C CG   . GLU A 1 73 ? 8.494   3.374   -8.259  1.00 0.00 ? 72 GLU A CG   3  
ATOM 6996  C CD   . GLU A 1 73 ? 7.714   2.544   -9.280  1.00 0.00 ? 72 GLU A CD   3  
ATOM 6997  O OE1  . GLU A 1 73 ? 7.798   1.328   -9.215  1.00 0.00 ? 72 GLU A OE1  3  
ATOM 6998  O OE2  . GLU A 1 73 ? 7.047   3.137   -10.112 1.00 0.00 ? 72 GLU A OE2  3  
ATOM 6999  H H    . GLU A 1 73 ? 7.239   4.493   -5.944  1.00 0.00 ? 72 GLU A H    3  
ATOM 7000  H HA   . GLU A 1 73 ? 6.629   1.854   -6.989  1.00 0.00 ? 72 GLU A HA   3  
ATOM 7001  H HB2  . GLU A 1 73 ? 9.304   3.111   -6.287  1.00 0.00 ? 72 GLU A HB2  3  
ATOM 7002  H HB3  . GLU A 1 73 ? 9.091   1.612   -7.192  1.00 0.00 ? 72 GLU A HB3  3  
ATOM 7003  H HG2  . GLU A 1 73 ? 7.958   4.290   -8.054  1.00 0.00 ? 72 GLU A HG2  3  
ATOM 7004  H HG3  . GLU A 1 73 ? 9.468   3.609   -8.661  1.00 0.00 ? 72 GLU A HG3  3  
ATOM 7005  N N    . PHE A 1 74 ? 7.507   2.115   -3.898  1.00 0.00 ? 73 PHE A N    3  
ATOM 7006  C CA   . PHE A 1 74 ? 7.616   1.334   -2.629  1.00 0.00 ? 73 PHE A CA   3  
ATOM 7007  C C    . PHE A 1 74 ? 6.262   0.677   -2.327  1.00 0.00 ? 73 PHE A C    3  
ATOM 7008  O O    . PHE A 1 74 ? 6.213   -0.461  -1.908  1.00 0.00 ? 73 PHE A O    3  
ATOM 7009  C CB   . PHE A 1 74 ? 8.070   2.264   -1.484  1.00 0.00 ? 73 PHE A CB   3  
ATOM 7010  C CG   . PHE A 1 74 ? 7.594   1.755   -0.139  1.00 0.00 ? 73 PHE A CG   3  
ATOM 7011  C CD1  . PHE A 1 74 ? 6.281   2.004   0.275   1.00 0.00 ? 73 PHE A CD1  3  
ATOM 7012  C CD2  . PHE A 1 74 ? 8.465   1.041   0.691   1.00 0.00 ? 73 PHE A CD2  3  
ATOM 7013  C CE1  . PHE A 1 74 ? 5.837   1.538   1.517   1.00 0.00 ? 73 PHE A CE1  3  
ATOM 7014  C CE2  . PHE A 1 74 ? 8.021   0.574   1.934   1.00 0.00 ? 73 PHE A CE2  3  
ATOM 7015  C CZ   . PHE A 1 74 ? 6.707   0.822   2.347   1.00 0.00 ? 73 PHE A CZ   3  
ATOM 7016  H H    . PHE A 1 74 ? 7.436   3.091   -3.863  1.00 0.00 ? 73 PHE A H    3  
ATOM 7017  H HA   . PHE A 1 74 ? 8.297   0.503   -2.732  1.00 0.00 ? 73 PHE A HA   3  
ATOM 7018  H HB2  . PHE A 1 74 ? 9.148   2.322   -1.479  1.00 0.00 ? 73 PHE A HB2  3  
ATOM 7019  H HB3  . PHE A 1 74 ? 7.665   3.249   -1.649  1.00 0.00 ? 73 PHE A HB3  3  
ATOM 7020  H HD1  . PHE A 1 74 ? 5.609   2.557   -0.366  1.00 0.00 ? 73 PHE A HD1  3  
ATOM 7021  H HD2  . PHE A 1 74 ? 9.478   0.851   0.373   1.00 0.00 ? 73 PHE A HD2  3  
ATOM 7022  H HE1  . PHE A 1 74 ? 4.823   1.731   1.835   1.00 0.00 ? 73 PHE A HE1  3  
ATOM 7023  H HE2  . PHE A 1 74 ? 8.693   0.021   2.574   1.00 0.00 ? 73 PHE A HE2  3  
ATOM 7024  H HZ   . PHE A 1 74 ? 6.365   0.462   3.306   1.00 0.00 ? 73 PHE A HZ   3  
ATOM 7025  N N    . MET A 1 75 ? 5.170   1.344   -2.531  1.00 0.00 ? 74 MET A N    3  
ATOM 7026  C CA   . MET A 1 75 ? 3.872   0.673   -2.236  1.00 0.00 ? 74 MET A CA   3  
ATOM 7027  C C    . MET A 1 75 ? 3.627   -0.441  -3.265  1.00 0.00 ? 74 MET A C    3  
ATOM 7028  O O    . MET A 1 75 ? 3.387   -1.574  -2.896  1.00 0.00 ? 74 MET A O    3  
ATOM 7029  C CB   . MET A 1 75 ? 2.727   1.688   -2.272  1.00 0.00 ? 74 MET A CB   3  
ATOM 7030  C CG   . MET A 1 75 ? 1.517   1.110   -1.535  1.00 0.00 ? 74 MET A CG   3  
ATOM 7031  S SD   . MET A 1 75 ? 1.861   1.068   0.248   1.00 0.00 ? 74 MET A SD   3  
ATOM 7032  C CE   . MET A 1 75 ? 1.743   -0.724  0.497   1.00 0.00 ? 74 MET A CE   3  
ATOM 7033  H H    . MET A 1 75 ? 5.197   2.263   -2.876  1.00 0.00 ? 74 MET A H    3  
ATOM 7034  H HA   . MET A 1 75 ? 3.924   0.215   -1.258  1.00 0.00 ? 74 MET A HA   3  
ATOM 7035  H HB2  . MET A 1 75 ? 3.041   2.603   -1.790  1.00 0.00 ? 74 MET A HB2  3  
ATOM 7036  H HB3  . MET A 1 75 ? 2.458   1.893   -3.297  1.00 0.00 ? 74 MET A HB3  3  
ATOM 7037  H HG2  . MET A 1 75 ? 0.653   1.731   -1.721  1.00 0.00 ? 74 MET A HG2  3  
ATOM 7038  H HG3  . MET A 1 75 ? 1.326   0.111   -1.895  1.00 0.00 ? 74 MET A HG3  3  
ATOM 7039  H HE1  . MET A 1 75 ? 0.831   -1.090  0.049   1.00 0.00 ? 74 MET A HE1  3  
ATOM 7040  H HE2  . MET A 1 75 ? 2.595   -1.207  0.039   1.00 0.00 ? 74 MET A HE2  3  
ATOM 7041  H HE3  . MET A 1 75 ? 1.733   -0.941  1.552   1.00 0.00 ? 74 MET A HE3  3  
ATOM 7042  N N    . ALA A 1 76 ? 3.671   -0.162  -4.537  1.00 0.00 ? 75 ALA A N    3  
ATOM 7043  C CA   . ALA A 1 76 ? 3.423   -1.243  -5.539  1.00 0.00 ? 75 ALA A CA   3  
ATOM 7044  C C    . ALA A 1 76 ? 4.347   -2.441  -5.302  1.00 0.00 ? 75 ALA A C    3  
ATOM 7045  O O    . ALA A 1 76 ? 3.899   -3.570  -5.258  1.00 0.00 ? 75 ALA A O    3  
ATOM 7046  C CB   . ALA A 1 76 ? 3.668   -0.692  -6.945  1.00 0.00 ? 75 ALA A CB   3  
ATOM 7047  H H    . ALA A 1 76 ? 3.849   0.744   -4.864  1.00 0.00 ? 75 ALA A H    3  
ATOM 7048  H HA   . ALA A 1 76 ? 2.406   -1.600  -5.474  1.00 0.00 ? 75 ALA A HA   3  
ATOM 7049  H HB1  . ALA A 1 76 ? 4.648   -0.240  -6.989  1.00 0.00 ? 75 ALA A HB1  3  
ATOM 7050  H HB2  . ALA A 1 76 ? 3.610   -1.497  -7.661  1.00 0.00 ? 75 ALA A HB2  3  
ATOM 7051  H HB3  . ALA A 1 76 ? 2.918   0.051   -7.176  1.00 0.00 ? 75 ALA A HB3  3  
ATOM 7052  N N    . PHE A 1 77 ? 5.624   -2.228  -5.168  1.00 0.00 ? 76 PHE A N    3  
ATOM 7053  C CA   . PHE A 1 77 ? 6.538   -3.393  -4.958  1.00 0.00 ? 76 PHE A CA   3  
ATOM 7054  C C    . PHE A 1 77 ? 6.235   -4.056  -3.607  1.00 0.00 ? 76 PHE A C    3  
ATOM 7055  O O    . PHE A 1 77 ? 6.337   -5.257  -3.460  1.00 0.00 ? 76 PHE A O    3  
ATOM 7056  C CB   . PHE A 1 77 ? 8.008   -2.923  -5.001  1.00 0.00 ? 76 PHE A CB   3  
ATOM 7057  C CG   . PHE A 1 77 ? 8.514   -2.912  -6.435  1.00 0.00 ? 76 PHE A CG   3  
ATOM 7058  C CD1  . PHE A 1 77 ? 8.551   -4.102  -7.173  1.00 0.00 ? 76 PHE A CD1  3  
ATOM 7059  C CD2  . PHE A 1 77 ? 8.939   -1.713  -7.027  1.00 0.00 ? 76 PHE A CD2  3  
ATOM 7060  C CE1  . PHE A 1 77 ? 9.009   -4.093  -8.494  1.00 0.00 ? 76 PHE A CE1  3  
ATOM 7061  C CE2  . PHE A 1 77 ? 9.398   -1.706  -8.348  1.00 0.00 ? 76 PHE A CE2  3  
ATOM 7062  C CZ   . PHE A 1 77 ? 9.432   -2.895  -9.083  1.00 0.00 ? 76 PHE A CZ   3  
ATOM 7063  H H    . PHE A 1 77 ? 5.980   -1.315  -5.218  1.00 0.00 ? 76 PHE A H    3  
ATOM 7064  H HA   . PHE A 1 77 ? 6.365   -4.109  -5.748  1.00 0.00 ? 76 PHE A HA   3  
ATOM 7065  H HB2  . PHE A 1 77 ? 8.076   -1.928  -4.587  1.00 0.00 ? 76 PHE A HB2  3  
ATOM 7066  H HB3  . PHE A 1 77 ? 8.622   -3.594  -4.415  1.00 0.00 ? 76 PHE A HB3  3  
ATOM 7067  H HD1  . PHE A 1 77 ? 8.232   -5.030  -6.723  1.00 0.00 ? 76 PHE A HD1  3  
ATOM 7068  H HD2  . PHE A 1 77 ? 8.920   -0.797  -6.465  1.00 0.00 ? 76 PHE A HD2  3  
ATOM 7069  H HE1  . PHE A 1 77 ? 9.034   -5.011  -9.060  1.00 0.00 ? 76 PHE A HE1  3  
ATOM 7070  H HE2  . PHE A 1 77 ? 9.723   -0.781  -8.801  1.00 0.00 ? 76 PHE A HE2  3  
ATOM 7071  H HZ   . PHE A 1 77 ? 9.786   -2.890  -10.103 1.00 0.00 ? 76 PHE A HZ   3  
ATOM 7072  N N    . VAL A 1 78 ? 5.862   -3.287  -2.625  1.00 0.00 ? 77 VAL A N    3  
ATOM 7073  C CA   . VAL A 1 78 ? 5.555   -3.891  -1.296  1.00 0.00 ? 77 VAL A CA   3  
ATOM 7074  C C    . VAL A 1 78 ? 4.295   -4.757  -1.424  1.00 0.00 ? 77 VAL A C    3  
ATOM 7075  O O    . VAL A 1 78 ? 4.183   -5.797  -0.805  1.00 0.00 ? 77 VAL A O    3  
ATOM 7076  C CB   . VAL A 1 78 ? 5.343   -2.773  -0.259  1.00 0.00 ? 77 VAL A CB   3  
ATOM 7077  C CG1  . VAL A 1 78 ? 4.618   -3.323  0.977   1.00 0.00 ? 77 VAL A CG1  3  
ATOM 7078  C CG2  . VAL A 1 78 ? 6.707   -2.211  0.169   1.00 0.00 ? 77 VAL A CG2  3  
ATOM 7079  H H    . VAL A 1 78 ? 5.778   -2.319  -2.764  1.00 0.00 ? 77 VAL A H    3  
ATOM 7080  H HA   . VAL A 1 78 ? 6.383   -4.515  -0.990  1.00 0.00 ? 77 VAL A HA   3  
ATOM 7081  H HB   . VAL A 1 78 ? 4.751   -1.984  -0.699  1.00 0.00 ? 77 VAL A HB   3  
ATOM 7082  H HG11 . VAL A 1 78 ? 5.064   -4.263  1.267   1.00 0.00 ? 77 VAL A HG11 3  
ATOM 7083  H HG12 . VAL A 1 78 ? 4.704   -2.617  1.790   1.00 0.00 ? 77 VAL A HG12 3  
ATOM 7084  H HG13 . VAL A 1 78 ? 3.575   -3.477  0.743   1.00 0.00 ? 77 VAL A HG13 3  
ATOM 7085  H HG21 . VAL A 1 78 ? 7.343   -2.104  -0.697  1.00 0.00 ? 77 VAL A HG21 3  
ATOM 7086  H HG22 . VAL A 1 78 ? 6.568   -1.247  0.635   1.00 0.00 ? 77 VAL A HG22 3  
ATOM 7087  H HG23 . VAL A 1 78 ? 7.171   -2.887  0.874   1.00 0.00 ? 77 VAL A HG23 3  
ATOM 7088  N N    . SER A 1 79 ? 3.352   -4.345  -2.225  1.00 0.00 ? 78 SER A N    3  
ATOM 7089  C CA   . SER A 1 79 ? 2.114   -5.158  -2.389  1.00 0.00 ? 78 SER A CA   3  
ATOM 7090  C C    . SER A 1 79 ? 2.469   -6.492  -3.054  1.00 0.00 ? 78 SER A C    3  
ATOM 7091  O O    . SER A 1 79 ? 2.082   -7.548  -2.593  1.00 0.00 ? 78 SER A O    3  
ATOM 7092  C CB   . SER A 1 79 ? 1.118   -4.402  -3.269  1.00 0.00 ? 78 SER A CB   3  
ATOM 7093  O OG   . SER A 1 79 ? 1.452   -4.604  -4.636  1.00 0.00 ? 78 SER A OG   3  
ATOM 7094  H H    . SER A 1 79 ? 3.459   -3.507  -2.722  1.00 0.00 ? 78 SER A H    3  
ATOM 7095  H HA   . SER A 1 79 ? 1.672   -5.343  -1.420  1.00 0.00 ? 78 SER A HA   3  
ATOM 7096  H HB2  . SER A 1 79 ? 0.122   -4.772  -3.090  1.00 0.00 ? 78 SER A HB2  3  
ATOM 7097  H HB3  . SER A 1 79 ? 1.156   -3.348  -3.030  1.00 0.00 ? 78 SER A HB3  3  
ATOM 7098  H HG   . SER A 1 79 ? 0.635   -4.720  -5.127  1.00 0.00 ? 78 SER A HG   3  
ATOM 7099  N N    . MET A 1 80 ? 3.184   -6.449  -4.144  1.00 0.00 ? 79 MET A N    3  
ATOM 7100  C CA   . MET A 1 80 ? 3.545   -7.711  -4.856  1.00 0.00 ? 79 MET A CA   3  
ATOM 7101  C C    . MET A 1 80 ? 4.157   -8.723  -3.881  1.00 0.00 ? 79 MET A C    3  
ATOM 7102  O O    . MET A 1 80 ? 3.908   -9.907  -3.977  1.00 0.00 ? 79 MET A O    3  
ATOM 7103  C CB   . MET A 1 80 ? 4.558   -7.402  -5.963  1.00 0.00 ? 79 MET A CB   3  
ATOM 7104  C CG   . MET A 1 80 ? 3.958   -6.405  -6.958  1.00 0.00 ? 79 MET A CG   3  
ATOM 7105  S SD   . MET A 1 80 ? 5.276   -5.725  -7.999  1.00 0.00 ? 79 MET A SD   3  
ATOM 7106  C CE   . MET A 1 80 ? 5.804   -7.282  -8.759  1.00 0.00 ? 79 MET A CE   3  
ATOM 7107  H H    . MET A 1 80 ? 3.466   -5.588  -4.519  1.00 0.00 ? 79 MET A H    3  
ATOM 7108  H HA   . MET A 1 80 ? 2.656   -8.138  -5.296  1.00 0.00 ? 79 MET A HA   3  
ATOM 7109  H HB2  . MET A 1 80 ? 5.450   -6.978  -5.524  1.00 0.00 ? 79 MET A HB2  3  
ATOM 7110  H HB3  . MET A 1 80 ? 4.812   -8.314  -6.481  1.00 0.00 ? 79 MET A HB3  3  
ATOM 7111  H HG2  . MET A 1 80 ? 3.231   -6.907  -7.580  1.00 0.00 ? 79 MET A HG2  3  
ATOM 7112  H HG3  . MET A 1 80 ? 3.476   -5.602  -6.419  1.00 0.00 ? 79 MET A HG3  3  
ATOM 7113  H HE1  . MET A 1 80 ? 4.948   -7.930  -8.884  1.00 0.00 ? 79 MET A HE1  3  
ATOM 7114  H HE2  . MET A 1 80 ? 6.253   -7.078  -9.722  1.00 0.00 ? 79 MET A HE2  3  
ATOM 7115  H HE3  . MET A 1 80 ? 6.529   -7.767  -8.124  1.00 0.00 ? 79 MET A HE3  3  
ATOM 7116  N N    . VAL A 1 81 ? 4.956   -8.278  -2.951  1.00 0.00 ? 80 VAL A N    3  
ATOM 7117  C CA   . VAL A 1 81 ? 5.576   -9.241  -1.990  1.00 0.00 ? 80 VAL A CA   3  
ATOM 7118  C C    . VAL A 1 81 ? 4.516   -9.753  -1.014  1.00 0.00 ? 80 VAL A C    3  
ATOM 7119  O O    . VAL A 1 81 ? 4.497   -10.917 -0.668  1.00 0.00 ? 80 VAL A O    3  
ATOM 7120  C CB   . VAL A 1 81 ? 6.691   -8.540  -1.203  1.00 0.00 ? 80 VAL A CB   3  
ATOM 7121  C CG1  . VAL A 1 81 ? 7.301   -9.514  -0.191  1.00 0.00 ? 80 VAL A CG1  3  
ATOM 7122  C CG2  . VAL A 1 81 ? 7.784   -8.070  -2.165  1.00 0.00 ? 80 VAL A CG2  3  
ATOM 7123  H H    . VAL A 1 81 ? 5.147   -7.319  -2.885  1.00 0.00 ? 80 VAL A H    3  
ATOM 7124  H HA   . VAL A 1 81 ? 5.990   -10.077 -2.539  1.00 0.00 ? 80 VAL A HA   3  
ATOM 7125  H HB   . VAL A 1 81 ? 6.280   -7.690  -0.678  1.00 0.00 ? 80 VAL A HB   3  
ATOM 7126  H HG11 . VAL A 1 81 ? 7.584   -10.427 -0.695  1.00 0.00 ? 80 VAL A HG11 3  
ATOM 7127  H HG12 . VAL A 1 81 ? 8.176   -9.064  0.258   1.00 0.00 ? 80 VAL A HG12 3  
ATOM 7128  H HG13 . VAL A 1 81 ? 6.577   -9.737  0.578   1.00 0.00 ? 80 VAL A HG13 3  
ATOM 7129  H HG21 . VAL A 1 81 ? 7.344   -7.464  -2.943  1.00 0.00 ? 80 VAL A HG21 3  
ATOM 7130  H HG22 . VAL A 1 81 ? 8.514   -7.484  -1.622  1.00 0.00 ? 80 VAL A HG22 3  
ATOM 7131  H HG23 . VAL A 1 81 ? 8.269   -8.928  -2.606  1.00 0.00 ? 80 VAL A HG23 3  
ATOM 7132  N N    . THR A 1 82 ? 3.626   -8.908  -0.577  1.00 0.00 ? 81 THR A N    3  
ATOM 7133  C CA   . THR A 1 82 ? 2.570   -9.380  0.362   1.00 0.00 ? 81 THR A CA   3  
ATOM 7134  C C    . THR A 1 82 ? 1.644   -10.340 -0.388  1.00 0.00 ? 81 THR A C    3  
ATOM 7135  O O    . THR A 1 82 ? 1.303   -11.400 0.097   1.00 0.00 ? 81 THR A O    3  
ATOM 7136  C CB   . THR A 1 82 ? 1.766   -8.183  0.878   1.00 0.00 ? 81 THR A CB   3  
ATOM 7137  O OG1  . THR A 1 82 ? 2.659   -7.193  1.366   1.00 0.00 ? 81 THR A OG1  3  
ATOM 7138  C CG2  . THR A 1 82 ? 0.835   -8.635  2.006   1.00 0.00 ? 81 THR A CG2  3  
ATOM 7139  H H    . THR A 1 82 ? 3.645   -7.973  -0.871  1.00 0.00 ? 81 THR A H    3  
ATOM 7140  H HA   . THR A 1 82 ? 3.029   -9.895  1.193   1.00 0.00 ? 81 THR A HA   3  
ATOM 7141  H HB   . THR A 1 82 ? 1.176   -7.772  0.074   1.00 0.00 ? 81 THR A HB   3  
ATOM 7142  H HG1  . THR A 1 82 ? 3.393   -7.126  0.750   1.00 0.00 ? 81 THR A HG1  3  
ATOM 7143  H HG21 . THR A 1 82 ? 0.160   -9.392  1.634   1.00 0.00 ? 81 THR A HG21 3  
ATOM 7144  H HG22 . THR A 1 82 ? 1.421   -9.043  2.816   1.00 0.00 ? 81 THR A HG22 3  
ATOM 7145  H HG23 . THR A 1 82 ? 0.266   -7.790  2.364   1.00 0.00 ? 81 THR A HG23 3  
ATOM 7146  N N    . THR A 1 83 ? 1.243   -9.973  -1.576  1.00 0.00 ? 82 THR A N    3  
ATOM 7147  C CA   . THR A 1 83 ? 0.346   -10.852 -2.378  1.00 0.00 ? 82 THR A CA   3  
ATOM 7148  C C    . THR A 1 83 ? 1.136   -12.054 -2.905  1.00 0.00 ? 82 THR A C    3  
ATOM 7149  O O    . THR A 1 83 ? 0.568   -13.053 -3.300  1.00 0.00 ? 82 THR A O    3  
ATOM 7150  C CB   . THR A 1 83 ? -0.227  -10.063 -3.558  1.00 0.00 ? 82 THR A CB   3  
ATOM 7151  O OG1  . THR A 1 83 ? 0.816   -9.344  -4.199  1.00 0.00 ? 82 THR A OG1  3  
ATOM 7152  C CG2  . THR A 1 83 ? -1.287  -9.083  -3.052  1.00 0.00 ? 82 THR A CG2  3  
ATOM 7153  H H    . THR A 1 83 ? 1.539   -9.115  -1.945  1.00 0.00 ? 82 THR A H    3  
ATOM 7154  H HA   . THR A 1 83 ? -0.464  -11.202 -1.754  1.00 0.00 ? 82 THR A HA   3  
ATOM 7155  H HB   . THR A 1 83 ? -0.681  -10.745 -4.261  1.00 0.00 ? 82 THR A HB   3  
ATOM 7156  H HG1  . THR A 1 83 ? 0.414   -8.702  -4.788  1.00 0.00 ? 82 THR A HG1  3  
ATOM 7157  H HG21 . THR A 1 83 ? -0.844  -8.418  -2.325  1.00 0.00 ? 82 THR A HG21 3  
ATOM 7158  H HG22 . THR A 1 83 ? -1.669  -8.507  -3.881  1.00 0.00 ? 82 THR A HG22 3  
ATOM 7159  H HG23 . THR A 1 83 ? -2.095  -9.632  -2.592  1.00 0.00 ? 82 THR A HG23 3  
ATOM 7160  N N    . ALA A 1 84 ? 2.440   -11.967 -2.917  1.00 0.00 ? 83 ALA A N    3  
ATOM 7161  C CA   . ALA A 1 84 ? 3.256   -13.110 -3.423  1.00 0.00 ? 83 ALA A CA   3  
ATOM 7162  C C    . ALA A 1 84 ? 2.843   -14.382 -2.686  1.00 0.00 ? 83 ALA A C    3  
ATOM 7163  O O    . ALA A 1 84 ? 2.890   -15.470 -3.225  1.00 0.00 ? 83 ALA A O    3  
ATOM 7164  C CB   . ALA A 1 84 ? 4.742   -12.839 -3.172  1.00 0.00 ? 83 ALA A CB   3  
ATOM 7165  H H    . ALA A 1 84 ? 2.881   -11.156 -2.586  1.00 0.00 ? 83 ALA A H    3  
ATOM 7166  H HA   . ALA A 1 84 ? 3.085   -13.235 -4.482  1.00 0.00 ? 83 ALA A HA   3  
ATOM 7167  H HB1  . ALA A 1 84 ? 5.032   -11.927 -3.671  1.00 0.00 ? 83 ALA A HB1  3  
ATOM 7168  H HB2  . ALA A 1 84 ? 4.916   -12.740 -2.111  1.00 0.00 ? 83 ALA A HB2  3  
ATOM 7169  H HB3  . ALA A 1 84 ? 5.327   -13.660 -3.557  1.00 0.00 ? 83 ALA A HB3  3  
ATOM 7170  N N    . CYS A 1 85 ? 2.430   -14.249 -1.457  1.00 0.00 ? 84 CYS A N    3  
ATOM 7171  C CA   . CYS A 1 85 ? 2.003   -15.448 -0.680  1.00 0.00 ? 84 CYS A CA   3  
ATOM 7172  C C    . CYS A 1 85 ? 0.650   -15.932 -1.207  1.00 0.00 ? 84 CYS A C    3  
ATOM 7173  O O    . CYS A 1 85 ? -0.152  -15.152 -1.682  1.00 0.00 ? 84 CYS A O    3  
ATOM 7174  C CB   . CYS A 1 85 ? 1.866   -15.074 0.798   1.00 0.00 ? 84 CYS A CB   3  
ATOM 7175  S SG   . CYS A 1 85 ? 1.681   -16.578 1.789   1.00 0.00 ? 84 CYS A SG   3  
ATOM 7176  H H    . CYS A 1 85 ? 2.399   -13.358 -1.046  1.00 0.00 ? 84 CYS A H    3  
ATOM 7177  H HA   . CYS A 1 85 ? 2.737   -16.233 -0.789  1.00 0.00 ? 84 CYS A HA   3  
ATOM 7178  H HB2  . CYS A 1 85 ? 2.748   -14.539 1.117   1.00 0.00 ? 84 CYS A HB2  3  
ATOM 7179  H HB3  . CYS A 1 85 ? 0.997   -14.446 0.931   1.00 0.00 ? 84 CYS A HB3  3  
ATOM 7180  H HG   . CYS A 1 85 ? 0.804   -16.935 1.628   1.00 0.00 ? 84 CYS A HG   3  
ATOM 7181  N N    . HIS A 1 86 ? 0.386   -17.210 -1.128  1.00 0.00 ? 85 HIS A N    3  
ATOM 7182  C CA   . HIS A 1 86 ? -0.920  -17.730 -1.626  1.00 0.00 ? 85 HIS A CA   3  
ATOM 7183  C C    . HIS A 1 86 ? -2.051  -16.874 -1.052  1.00 0.00 ? 85 HIS A C    3  
ATOM 7184  O O    . HIS A 1 86 ? -1.823  -15.992 -0.249  1.00 0.00 ? 85 HIS A O    3  
ATOM 7185  C CB   . HIS A 1 86 ? -1.104  -19.184 -1.179  1.00 0.00 ? 85 HIS A CB   3  
ATOM 7186  C CG   . HIS A 1 86 ? -0.993  -19.269 0.318   1.00 0.00 ? 85 HIS A CG   3  
ATOM 7187  N ND1  . HIS A 1 86 ? -0.580  -18.195 1.089   1.00 0.00 ? 85 HIS A ND1  3  
ATOM 7188  C CD2  . HIS A 1 86 ? -1.238  -20.293 1.201   1.00 0.00 ? 85 HIS A CD2  3  
ATOM 7189  C CE1  . HIS A 1 86 ? -0.588  -18.592 2.374   1.00 0.00 ? 85 HIS A CE1  3  
ATOM 7190  N NE2  . HIS A 1 86 ? -0.982  -19.862 2.499   1.00 0.00 ? 85 HIS A NE2  3  
ATOM 7191  H H    . HIS A 1 86 ? 1.045   -17.825 -0.743  1.00 0.00 ? 85 HIS A H    3  
ATOM 7192  H HA   . HIS A 1 86 ? -0.941  -17.679 -2.704  1.00 0.00 ? 85 HIS A HA   3  
ATOM 7193  H HB2  . HIS A 1 86 ? -2.078  -19.534 -1.487  1.00 0.00 ? 85 HIS A HB2  3  
ATOM 7194  H HB3  . HIS A 1 86 ? -0.341  -19.800 -1.632  1.00 0.00 ? 85 HIS A HB3  3  
ATOM 7195  H HD1  . HIS A 1 86 ? -0.328  -17.308 0.758   1.00 0.00 ? 85 HIS A HD1  3  
ATOM 7196  H HD2  . HIS A 1 86 ? -1.578  -21.281 0.929   1.00 0.00 ? 85 HIS A HD2  3  
ATOM 7197  H HE1  . HIS A 1 86 ? -0.310  -17.960 3.204   1.00 0.00 ? 85 HIS A HE1  3  
ATOM 7198  N N    . GLU A 1 87 ? -3.267  -17.125 -1.458  1.00 0.00 ? 86 GLU A N    3  
ATOM 7199  C CA   . GLU A 1 87 ? -4.418  -16.325 -0.938  1.00 0.00 ? 86 GLU A CA   3  
ATOM 7200  C C    . GLU A 1 87 ? -4.283  -16.141 0.576   1.00 0.00 ? 86 GLU A C    3  
ATOM 7201  O O    . GLU A 1 87 ? -4.576  -17.032 1.348   1.00 0.00 ? 86 GLU A O    3  
ATOM 7202  C CB   . GLU A 1 87 ? -5.724  -17.062 -1.246  1.00 0.00 ? 86 GLU A CB   3  
ATOM 7203  C CG   . GLU A 1 87 ? -6.041  -16.941 -2.738  1.00 0.00 ? 86 GLU A CG   3  
ATOM 7204  C CD   . GLU A 1 87 ? -7.117  -17.962 -3.119  1.00 0.00 ? 86 GLU A CD   3  
ATOM 7205  O OE1  . GLU A 1 87 ? -6.795  -19.137 -3.183  1.00 0.00 ? 86 GLU A OE1  3  
ATOM 7206  O OE2  . GLU A 1 87 ? -8.244  -17.550 -3.341  1.00 0.00 ? 86 GLU A OE2  3  
ATOM 7207  H H    . GLU A 1 87 ? -3.425  -17.841 -2.108  1.00 0.00 ? 86 GLU A H    3  
ATOM 7208  H HA   . GLU A 1 87 ? -4.430  -15.358 -1.418  1.00 0.00 ? 86 GLU A HA   3  
ATOM 7209  H HB2  . GLU A 1 87 ? -5.617  -18.105 -0.982  1.00 0.00 ? 86 GLU A HB2  3  
ATOM 7210  H HB3  . GLU A 1 87 ? -6.528  -16.626 -0.672  1.00 0.00 ? 86 GLU A HB3  3  
ATOM 7211  H HG2  . GLU A 1 87 ? -6.398  -15.944 -2.950  1.00 0.00 ? 86 GLU A HG2  3  
ATOM 7212  H HG3  . GLU A 1 87 ? -5.147  -17.133 -3.313  1.00 0.00 ? 86 GLU A HG3  3  
ATOM 7213  N N    . PHE A 1 88 ? -3.838  -14.991 1.009   1.00 0.00 ? 87 PHE A N    3  
ATOM 7214  C CA   . PHE A 1 88 ? -3.687  -14.760 2.471   1.00 0.00 ? 87 PHE A CA   3  
ATOM 7215  C C    . PHE A 1 88 ? -5.067  -14.758 3.126   1.00 0.00 ? 87 PHE A C    3  
ATOM 7216  O O    . PHE A 1 88 ? -5.207  -15.036 4.300   1.00 0.00 ? 87 PHE A O    3  
ATOM 7217  C CB   . PHE A 1 88 ? -2.985  -13.423 2.725   1.00 0.00 ? 87 PHE A CB   3  
ATOM 7218  C CG   . PHE A 1 88 ? -3.673  -12.319 1.960   1.00 0.00 ? 87 PHE A CG   3  
ATOM 7219  C CD1  . PHE A 1 88 ? -4.740  -11.628 2.544   1.00 0.00 ? 87 PHE A CD1  3  
ATOM 7220  C CD2  . PHE A 1 88 ? -3.235  -11.974 0.675   1.00 0.00 ? 87 PHE A CD2  3  
ATOM 7221  C CE1  . PHE A 1 88 ? -5.370  -10.591 1.846   1.00 0.00 ? 87 PHE A CE1  3  
ATOM 7222  C CE2  . PHE A 1 88 ? -3.868  -10.940 -0.026  1.00 0.00 ? 87 PHE A CE2  3  
ATOM 7223  C CZ   . PHE A 1 88 ? -4.936  -10.247 0.560   1.00 0.00 ? 87 PHE A CZ   3  
ATOM 7224  H H    . PHE A 1 88 ? -3.605  -14.282 0.373   1.00 0.00 ? 87 PHE A H    3  
ATOM 7225  H HA   . PHE A 1 88 ? -3.095  -15.559 2.896   1.00 0.00 ? 87 PHE A HA   3  
ATOM 7226  H HB2  . PHE A 1 88 ? -3.018  -13.198 3.781   1.00 0.00 ? 87 PHE A HB2  3  
ATOM 7227  H HB3  . PHE A 1 88 ? -1.956  -13.492 2.406   1.00 0.00 ? 87 PHE A HB3  3  
ATOM 7228  H HD1  . PHE A 1 88 ? -5.078  -11.897 3.533   1.00 0.00 ? 87 PHE A HD1  3  
ATOM 7229  H HD2  . PHE A 1 88 ? -2.412  -12.508 0.224   1.00 0.00 ? 87 PHE A HD2  3  
ATOM 7230  H HE1  . PHE A 1 88 ? -6.192  -10.057 2.300   1.00 0.00 ? 87 PHE A HE1  3  
ATOM 7231  H HE2  . PHE A 1 88 ? -3.532  -10.675 -1.018  1.00 0.00 ? 87 PHE A HE2  3  
ATOM 7232  H HZ   . PHE A 1 88 ? -5.421  -9.447  0.022   1.00 0.00 ? 87 PHE A HZ   3  
ATOM 7233  N N    . PHE A 1 89 ? -6.094  -14.457 2.376   1.00 0.00 ? 88 PHE A N    3  
ATOM 7234  C CA   . PHE A 1 89 ? -7.462  -14.453 2.966   1.00 0.00 ? 88 PHE A CA   3  
ATOM 7235  C C    . PHE A 1 89 ? -7.687  -15.779 3.691   1.00 0.00 ? 88 PHE A C    3  
ATOM 7236  O O    . PHE A 1 89 ? -8.227  -15.831 4.778   1.00 0.00 ? 88 PHE A O    3  
ATOM 7237  C CB   . PHE A 1 89 ? -8.502  -14.303 1.856   1.00 0.00 ? 88 PHE A CB   3  
ATOM 7238  C CG   . PHE A 1 89 ? -8.148  -13.123 0.980   1.00 0.00 ? 88 PHE A CG   3  
ATOM 7239  C CD1  . PHE A 1 89 ? -8.378  -11.818 1.435   1.00 0.00 ? 88 PHE A CD1  3  
ATOM 7240  C CD2  . PHE A 1 89 ? -7.596  -13.334 -0.290  1.00 0.00 ? 88 PHE A CD2  3  
ATOM 7241  C CE1  . PHE A 1 89 ? -8.054  -10.726 0.619   1.00 0.00 ? 88 PHE A CE1  3  
ATOM 7242  C CE2  . PHE A 1 89 ? -7.273  -12.242 -1.104  1.00 0.00 ? 88 PHE A CE2  3  
ATOM 7243  C CZ   . PHE A 1 89 ? -7.503  -10.939 -0.650  1.00 0.00 ? 88 PHE A CZ   3  
ATOM 7244  H H    . PHE A 1 89 ? -5.966  -14.242 1.428   1.00 0.00 ? 88 PHE A H    3  
ATOM 7245  H HA   . PHE A 1 89 ? -7.555  -13.638 3.667   1.00 0.00 ? 88 PHE A HA   3  
ATOM 7246  H HB2  . PHE A 1 89 ? -8.519  -15.205 1.259   1.00 0.00 ? 88 PHE A HB2  3  
ATOM 7247  H HB3  . PHE A 1 89 ? -9.476  -14.146 2.294   1.00 0.00 ? 88 PHE A HB3  3  
ATOM 7248  H HD1  . PHE A 1 89 ? -8.803  -11.654 2.414   1.00 0.00 ? 88 PHE A HD1  3  
ATOM 7249  H HD2  . PHE A 1 89 ? -7.419  -14.339 -0.641  1.00 0.00 ? 88 PHE A HD2  3  
ATOM 7250  H HE1  . PHE A 1 89 ? -8.230  -9.718  0.969   1.00 0.00 ? 88 PHE A HE1  3  
ATOM 7251  H HE2  . PHE A 1 89 ? -6.846  -12.405 -2.082  1.00 0.00 ? 88 PHE A HE2  3  
ATOM 7252  H HZ   . PHE A 1 89 ? -7.255  -10.097 -1.279  1.00 0.00 ? 88 PHE A HZ   3  
ATOM 7253  N N    . GLU A 1 90 ? -7.261  -16.854 3.083   1.00 0.00 ? 89 GLU A N    3  
ATOM 7254  C CA   . GLU A 1 90 ? -7.423  -18.197 3.707   1.00 0.00 ? 89 GLU A CA   3  
ATOM 7255  C C    . GLU A 1 90 ? -6.146  -18.533 4.474   1.00 0.00 ? 89 GLU A C    3  
ATOM 7256  O O    . GLU A 1 90 ? -5.582  -19.600 4.330   1.00 0.00 ? 89 GLU A O    3  
ATOM 7257  C CB   . GLU A 1 90 ? -7.661  -19.241 2.609   1.00 0.00 ? 89 GLU A CB   3  
ATOM 7258  C CG   . GLU A 1 90 ? -8.254  -20.512 3.223   1.00 0.00 ? 89 GLU A CG   3  
ATOM 7259  C CD   . GLU A 1 90 ? -8.365  -21.595 2.148   1.00 0.00 ? 89 GLU A CD   3  
ATOM 7260  O OE1  . GLU A 1 90 ? -8.497  -21.240 0.989   1.00 0.00 ? 89 GLU A OE1  3  
ATOM 7261  O OE2  . GLU A 1 90 ? -8.316  -22.761 2.504   1.00 0.00 ? 89 GLU A OE2  3  
ATOM 7262  H H    . GLU A 1 90 ? -6.827  -16.776 2.212   1.00 0.00 ? 89 GLU A H    3  
ATOM 7263  H HA   . GLU A 1 90 ? -8.262  -18.187 4.386   1.00 0.00 ? 89 GLU A HA   3  
ATOM 7264  H HB2  . GLU A 1 90 ? -8.348  -18.841 1.878   1.00 0.00 ? 89 GLU A HB2  3  
ATOM 7265  H HB3  . GLU A 1 90 ? -6.724  -19.480 2.127   1.00 0.00 ? 89 GLU A HB3  3  
ATOM 7266  H HG2  . GLU A 1 90 ? -7.614  -20.859 4.021   1.00 0.00 ? 89 GLU A HG2  3  
ATOM 7267  H HG3  . GLU A 1 90 ? -9.236  -20.297 3.616   1.00 0.00 ? 89 GLU A HG3  3  
ATOM 7268  N N    . HIS A 1 91 ? -5.684  -17.624 5.286   1.00 0.00 ? 90 HIS A N    3  
ATOM 7269  C CA   . HIS A 1 91 ? -4.442  -17.877 6.062   1.00 0.00 ? 90 HIS A CA   3  
ATOM 7270  C C    . HIS A 1 91 ? -4.633  -19.114 6.939   1.00 0.00 ? 90 HIS A C    3  
ATOM 7271  O O    . HIS A 1 91 ? -4.925  -19.014 8.115   1.00 0.00 ? 90 HIS A O    3  
ATOM 7272  C CB   . HIS A 1 91 ? -4.142  -16.667 6.946   1.00 0.00 ? 90 HIS A CB   3  
ATOM 7273  C CG   . HIS A 1 91 ? -2.807  -16.858 7.608   1.00 0.00 ? 90 HIS A CG   3  
ATOM 7274  N ND1  . HIS A 1 91 ? -2.686  -17.375 8.887   1.00 0.00 ? 90 HIS A ND1  3  
ATOM 7275  C CD2  . HIS A 1 91 ? -1.527  -16.612 7.178   1.00 0.00 ? 90 HIS A CD2  3  
ATOM 7276  C CE1  . HIS A 1 91 ? -1.374  -17.426 9.180   1.00 0.00 ? 90 HIS A CE1  3  
ATOM 7277  N NE2  . HIS A 1 91 ? -0.623  -16.973 8.173   1.00 0.00 ? 90 HIS A NE2  3  
ATOM 7278  H H    . HIS A 1 91 ? -6.155  -16.770 5.382   1.00 0.00 ? 90 HIS A H    3  
ATOM 7279  H HA   . HIS A 1 91 ? -3.619  -18.041 5.383   1.00 0.00 ? 90 HIS A HA   3  
ATOM 7280  H HB2  . HIS A 1 91 ? -4.120  -15.774 6.339   1.00 0.00 ? 90 HIS A HB2  3  
ATOM 7281  H HB3  . HIS A 1 91 ? -4.908  -16.573 7.701   1.00 0.00 ? 90 HIS A HB3  3  
ATOM 7282  H HD1  . HIS A 1 91 ? -3.422  -17.653 9.471   1.00 0.00 ? 90 HIS A HD1  3  
ATOM 7283  H HD2  . HIS A 1 91 ? -1.262  -16.202 6.215   1.00 0.00 ? 90 HIS A HD2  3  
ATOM 7284  H HE1  . HIS A 1 91 ? -0.977  -17.791 10.115  1.00 0.00 ? 90 HIS A HE1  3  
ATOM 7285  N N    . GLU A 1 92 ? -4.471  -20.280 6.378   1.00 0.00 ? 91 GLU A N    3  
ATOM 7286  C CA   . GLU A 1 92 ? -4.642  -21.521 7.183   1.00 0.00 ? 91 GLU A CA   3  
ATOM 7287  C C    . GLU A 1 92 ? -3.787  -21.428 8.448   1.00 0.00 ? 91 GLU A C    3  
ATOM 7288  O O    . GLU A 1 92 ? -2.760  -20.771 8.399   1.00 0.00 ? 91 GLU A O    3  
ATOM 7289  C CB   . GLU A 1 92 ? -4.203  -22.731 6.355   1.00 0.00 ? 91 GLU A CB   3  
ATOM 7290  C CG   . GLU A 1 92 ? -5.147  -22.908 5.162   1.00 0.00 ? 91 GLU A CG   3  
ATOM 7291  C CD   . GLU A 1 92 ? -6.476  -23.496 5.641   1.00 0.00 ? 91 GLU A CD   3  
ATOM 7292  O OE1  . GLU A 1 92 ? -6.447  -24.323 6.537   1.00 0.00 ? 91 GLU A OE1  3  
ATOM 7293  O OE2  . GLU A 1 92 ? -7.500  -23.111 5.100   1.00 0.00 ? 91 GLU A OE2  3  
ATOM 7294  O OXT  . GLU A 1 92 ? -4.175  -22.013 9.446   1.00 0.00 ? 91 GLU A OXT  3  
ATOM 7295  H H    . GLU A 1 92 ? -4.235  -20.339 5.429   1.00 0.00 ? 91 GLU A H    3  
ATOM 7296  H HA   . GLU A 1 92 ? -5.681  -21.629 7.458   1.00 0.00 ? 91 GLU A HA   3  
ATOM 7297  H HB2  . GLU A 1 92 ? -3.195  -22.574 5.997   1.00 0.00 ? 91 GLU A HB2  3  
ATOM 7298  H HB3  . GLU A 1 92 ? -4.233  -23.617 6.970   1.00 0.00 ? 91 GLU A HB3  3  
ATOM 7299  H HG2  . GLU A 1 92 ? -5.324  -21.948 4.697   1.00 0.00 ? 91 GLU A HG2  3  
ATOM 7300  H HG3  . GLU A 1 92 ? -4.697  -23.577 4.444   1.00 0.00 ? 91 GLU A HG3  3  
ATOM 7301  N N    . MET B 1 1  ? 8.981   -7.769  16.086  1.00 0.00 ? 0  MET B N    3  
ATOM 7302  C CA   . MET B 1 1  ? 7.729   -7.189  15.529  1.00 0.00 ? 0  MET B CA   3  
ATOM 7303  C C    . MET B 1 1  ? 7.764   -5.666  15.683  1.00 0.00 ? 0  MET B C    3  
ATOM 7304  O O    . MET B 1 1  ? 7.556   -5.135  16.756  1.00 0.00 ? 0  MET B O    3  
ATOM 7305  C CB   . MET B 1 1  ? 6.526   -7.761  16.284  1.00 0.00 ? 0  MET B CB   3  
ATOM 7306  C CG   . MET B 1 1  ? 6.370   -9.245  15.938  1.00 0.00 ? 0  MET B CG   3  
ATOM 7307  S SD   . MET B 1 1  ? 5.283   -10.042 17.149  1.00 0.00 ? 0  MET B SD   3  
ATOM 7308  C CE   . MET B 1 1  ? 3.696   -9.529  16.440  1.00 0.00 ? 0  MET B CE   3  
ATOM 7309  H H1   . MET B 1 1  ? 9.802   -7.295  15.660  1.00 0.00 ? 0  MET B H1   3  
ATOM 7310  H H2   . MET B 1 1  ? 8.997   -7.632  17.117  1.00 0.00 ? 0  MET B H2   3  
ATOM 7311  H H3   . MET B 1 1  ? 9.020   -8.786  15.868  1.00 0.00 ? 0  MET B H3   3  
ATOM 7312  H HA   . MET B 1 1  ? 7.649   -7.442  14.482  1.00 0.00 ? 0  MET B HA   3  
ATOM 7313  H HB2  . MET B 1 1  ? 6.685   -7.653  17.348  1.00 0.00 ? 0  MET B HB2  3  
ATOM 7314  H HB3  . MET B 1 1  ? 5.632   -7.230  15.996  1.00 0.00 ? 0  MET B HB3  3  
ATOM 7315  H HG2  . MET B 1 1  ? 5.945   -9.342  14.951  1.00 0.00 ? 0  MET B HG2  3  
ATOM 7316  H HG3  . MET B 1 1  ? 7.339   -9.723  15.961  1.00 0.00 ? 0  MET B HG3  3  
ATOM 7317  H HE1  . MET B 1 1  ? 3.695   -9.728  15.378  1.00 0.00 ? 0  MET B HE1  3  
ATOM 7318  H HE2  . MET B 1 1  ? 2.896   -10.082 16.907  1.00 0.00 ? 0  MET B HE2  3  
ATOM 7319  H HE3  . MET B 1 1  ? 3.549   -8.473  16.617  1.00 0.00 ? 0  MET B HE3  3  
ATOM 7320  N N    . SER B 1 2  ? 8.027   -4.959  14.614  1.00 0.00 ? 1  SER B N    3  
ATOM 7321  C CA   . SER B 1 2  ? 8.076   -3.469  14.693  1.00 0.00 ? 1  SER B CA   3  
ATOM 7322  C C    . SER B 1 2  ? 6.660   -2.909  14.560  1.00 0.00 ? 1  SER B C    3  
ATOM 7323  O O    . SER B 1 2  ? 5.717   -3.636  14.316  1.00 0.00 ? 1  SER B O    3  
ATOM 7324  C CB   . SER B 1 2  ? 8.945   -2.927  13.557  1.00 0.00 ? 1  SER B CB   3  
ATOM 7325  O OG   . SER B 1 2  ? 8.283   -3.138  12.317  1.00 0.00 ? 1  SER B OG   3  
ATOM 7326  H H    . SER B 1 2  ? 8.191   -5.408  13.760  1.00 0.00 ? 1  SER B H    3  
ATOM 7327  H HA   . SER B 1 2  ? 8.496   -3.170  15.643  1.00 0.00 ? 1  SER B HA   3  
ATOM 7328  H HB2  . SER B 1 2  ? 9.104   -1.871  13.697  1.00 0.00 ? 1  SER B HB2  3  
ATOM 7329  H HB3  . SER B 1 2  ? 9.900   -3.436  13.560  1.00 0.00 ? 1  SER B HB3  3  
ATOM 7330  H HG   . SER B 1 2  ? 8.310   -4.077  12.122  1.00 0.00 ? 1  SER B HG   3  
ATOM 7331  N N    . GLU B 1 3  ? 6.499   -1.625  14.720  1.00 0.00 ? 2  GLU B N    3  
ATOM 7332  C CA   . GLU B 1 3  ? 5.140   -1.027  14.603  1.00 0.00 ? 2  GLU B CA   3  
ATOM 7333  C C    . GLU B 1 3  ? 4.605   -1.254  13.186  1.00 0.00 ? 2  GLU B C    3  
ATOM 7334  O O    . GLU B 1 3  ? 3.419   -1.422  12.980  1.00 0.00 ? 2  GLU B O    3  
ATOM 7335  C CB   . GLU B 1 3  ? 5.215   0.476   14.894  1.00 0.00 ? 2  GLU B CB   3  
ATOM 7336  C CG   . GLU B 1 3  ? 5.985   0.710   16.199  1.00 0.00 ? 2  GLU B CG   3  
ATOM 7337  C CD   . GLU B 1 3  ? 5.341   -0.097  17.329  1.00 0.00 ? 2  GLU B CD   3  
ATOM 7338  O OE1  . GLU B 1 3  ? 4.163   0.105   17.578  1.00 0.00 ? 2  GLU B OE1  3  
ATOM 7339  O OE2  . GLU B 1 3  ? 6.035   -0.904  17.924  1.00 0.00 ? 2  GLU B OE2  3  
ATOM 7340  H H    . GLU B 1 3  ? 7.271   -1.054  14.918  1.00 0.00 ? 2  GLU B H    3  
ATOM 7341  H HA   . GLU B 1 3  ? 4.478   -1.499  15.313  1.00 0.00 ? 2  GLU B HA   3  
ATOM 7342  H HB2  . GLU B 1 3  ? 5.725   0.974   14.081  1.00 0.00 ? 2  GLU B HB2  3  
ATOM 7343  H HB3  . GLU B 1 3  ? 4.216   0.875   14.991  1.00 0.00 ? 2  GLU B HB3  3  
ATOM 7344  H HG2  . GLU B 1 3  ? 7.011   0.398   16.073  1.00 0.00 ? 2  GLU B HG2  3  
ATOM 7345  H HG3  . GLU B 1 3  ? 5.957   1.761   16.451  1.00 0.00 ? 2  GLU B HG3  3  
ATOM 7346  N N    . LEU B 1 4  ? 5.471   -1.251  12.207  1.00 0.00 ? 3  LEU B N    3  
ATOM 7347  C CA   . LEU B 1 4  ? 5.015   -1.458  10.801  1.00 0.00 ? 3  LEU B CA   3  
ATOM 7348  C C    . LEU B 1 4  ? 4.401   -2.857  10.656  1.00 0.00 ? 3  LEU B C    3  
ATOM 7349  O O    . LEU B 1 4  ? 3.288   -3.010  10.194  1.00 0.00 ? 3  LEU B O    3  
ATOM 7350  C CB   . LEU B 1 4  ? 6.223   -1.312  9.851   1.00 0.00 ? 3  LEU B CB   3  
ATOM 7351  C CG   . LEU B 1 4  ? 5.763   -0.818  8.472   1.00 0.00 ? 3  LEU B CG   3  
ATOM 7352  C CD1  . LEU B 1 4  ? 6.977   -0.675  7.551   1.00 0.00 ? 3  LEU B CD1  3  
ATOM 7353  C CD2  . LEU B 1 4  ? 4.777   -1.819  7.861   1.00 0.00 ? 3  LEU B CD2  3  
ATOM 7354  H H    . LEU B 1 4  ? 6.422   -1.099  12.394  1.00 0.00 ? 3  LEU B H    3  
ATOM 7355  H HA   . LEU B 1 4  ? 4.270   -0.714  10.557  1.00 0.00 ? 3  LEU B HA   3  
ATOM 7356  H HB2  . LEU B 1 4  ? 6.917   -0.598  10.270  1.00 0.00 ? 3  LEU B HB2  3  
ATOM 7357  H HB3  . LEU B 1 4  ? 6.720   -2.266  9.742   1.00 0.00 ? 3  LEU B HB3  3  
ATOM 7358  H HG   . LEU B 1 4  ? 5.282   0.144   8.580   1.00 0.00 ? 3  LEU B HG   3  
ATOM 7359  H HD11 . LEU B 1 4  ? 7.726   -0.062  8.032   1.00 0.00 ? 3  LEU B HD11 3  
ATOM 7360  H HD12 . LEU B 1 4  ? 7.390   -1.651  7.345   1.00 0.00 ? 3  LEU B HD12 3  
ATOM 7361  H HD13 . LEU B 1 4  ? 6.673   -0.211  6.624   1.00 0.00 ? 3  LEU B HD13 3  
ATOM 7362  H HD21 . LEU B 1 4  ? 5.143   -2.824  8.010   1.00 0.00 ? 3  LEU B HD21 3  
ATOM 7363  H HD22 . LEU B 1 4  ? 3.815   -1.711  8.335   1.00 0.00 ? 3  LEU B HD22 3  
ATOM 7364  H HD23 . LEU B 1 4  ? 4.677   -1.626  6.802   1.00 0.00 ? 3  LEU B HD23 3  
ATOM 7365  N N    . GLU B 1 5  ? 5.113   -3.879  11.048  1.00 0.00 ? 4  GLU B N    3  
ATOM 7366  C CA   . GLU B 1 5  ? 4.562   -5.259  10.925  1.00 0.00 ? 4  GLU B CA   3  
ATOM 7367  C C    . GLU B 1 5  ? 3.179   -5.319  11.575  1.00 0.00 ? 4  GLU B C    3  
ATOM 7368  O O    . GLU B 1 5  ? 2.230   -5.822  11.006  1.00 0.00 ? 4  GLU B O    3  
ATOM 7369  C CB   . GLU B 1 5  ? 5.501   -6.243  11.624  1.00 0.00 ? 4  GLU B CB   3  
ATOM 7370  C CG   . GLU B 1 5  ? 6.896   -6.138  11.003  1.00 0.00 ? 4  GLU B CG   3  
ATOM 7371  C CD   . GLU B 1 5  ? 7.855   -7.085  11.727  1.00 0.00 ? 4  GLU B CD   3  
ATOM 7372  O OE1  . GLU B 1 5  ? 7.443   -8.191  12.036  1.00 0.00 ? 4  GLU B OE1  3  
ATOM 7373  O OE2  . GLU B 1 5  ? 8.986   -6.689  11.957  1.00 0.00 ? 4  GLU B OE2  3  
ATOM 7374  H H    . GLU B 1 5  ? 6.008   -3.747  11.424  1.00 0.00 ? 4  GLU B H    3  
ATOM 7375  H HA   . GLU B 1 5  ? 4.482   -5.516  9.880   1.00 0.00 ? 4  GLU B HA   3  
ATOM 7376  H HB2  . GLU B 1 5  ? 5.554   -6.004  12.677  1.00 0.00 ? 4  GLU B HB2  3  
ATOM 7377  H HB3  . GLU B 1 5  ? 5.129   -7.248  11.501  1.00 0.00 ? 4  GLU B HB3  3  
ATOM 7378  H HG2  . GLU B 1 5  ? 6.845   -6.406  9.958   1.00 0.00 ? 4  GLU B HG2  3  
ATOM 7379  H HG3  . GLU B 1 5  ? 7.255   -5.125  11.098  1.00 0.00 ? 4  GLU B HG3  3  
ATOM 7380  N N    . LYS B 1 6  ? 3.063   -4.798  12.765  1.00 0.00 ? 5  LYS B N    3  
ATOM 7381  C CA   . LYS B 1 6  ? 1.751   -4.804  13.468  1.00 0.00 ? 5  LYS B CA   3  
ATOM 7382  C C    . LYS B 1 6  ? 0.668   -4.266  12.535  1.00 0.00 ? 5  LYS B C    3  
ATOM 7383  O O    . LYS B 1 6  ? -0.444  -4.753  12.497  1.00 0.00 ? 5  LYS B O    3  
ATOM 7384  C CB   . LYS B 1 6  ? 1.842   -3.888  14.690  1.00 0.00 ? 5  LYS B CB   3  
ATOM 7385  C CG   . LYS B 1 6  ? 0.534   -3.965  15.482  1.00 0.00 ? 5  LYS B CG   3  
ATOM 7386  C CD   . LYS B 1 6  ? 0.653   -3.115  16.747  1.00 0.00 ? 5  LYS B CD   3  
ATOM 7387  C CE   . LYS B 1 6  ? -0.731  -2.931  17.372  1.00 0.00 ? 5  LYS B CE   3  
ATOM 7388  N NZ   . LYS B 1 6  ? -1.565  -2.073  16.486  1.00 0.00 ? 5  LYS B NZ   3  
ATOM 7389  H H    . LYS B 1 6  ? 3.844   -4.394  13.198  1.00 0.00 ? 5  LYS B H    3  
ATOM 7390  H HA   . LYS B 1 6  ? 1.515   -5.803  13.804  1.00 0.00 ? 5  LYS B HA   3  
ATOM 7391  H HB2  . LYS B 1 6  ? 2.663   -4.205  15.317  1.00 0.00 ? 5  LYS B HB2  3  
ATOM 7392  H HB3  . LYS B 1 6  ? 2.007   -2.871  14.366  1.00 0.00 ? 5  LYS B HB3  3  
ATOM 7393  H HG2  . LYS B 1 6  ? -0.277  -3.594  14.872  1.00 0.00 ? 5  LYS B HG2  3  
ATOM 7394  H HG3  . LYS B 1 6  ? 0.337   -4.991  15.757  1.00 0.00 ? 5  LYS B HG3  3  
ATOM 7395  H HD2  . LYS B 1 6  ? 1.305   -3.609  17.454  1.00 0.00 ? 5  LYS B HD2  3  
ATOM 7396  H HD3  . LYS B 1 6  ? 1.062   -2.148  16.493  1.00 0.00 ? 5  LYS B HD3  3  
ATOM 7397  H HE2  . LYS B 1 6  ? -1.205  -3.894  17.489  1.00 0.00 ? 5  LYS B HE2  3  
ATOM 7398  H HE3  . LYS B 1 6  ? -0.629  -2.459  18.338  1.00 0.00 ? 5  LYS B HE3  3  
ATOM 7399  H HZ1  . LYS B 1 6  ? -1.594  -2.488  15.532  1.00 0.00 ? 5  LYS B HZ1  3  
ATOM 7400  H HZ2  . LYS B 1 6  ? -2.530  -2.013  16.870  1.00 0.00 ? 5  LYS B HZ2  3  
ATOM 7401  H HZ3  . LYS B 1 6  ? -1.154  -1.120  16.438  1.00 0.00 ? 5  LYS B HZ3  3  
ATOM 7402  N N    . ALA B 1 7  ? 0.999   -3.246  11.793  1.00 0.00 ? 6  ALA B N    3  
ATOM 7403  C CA   . ALA B 1 7  ? 0.022   -2.626  10.855  1.00 0.00 ? 6  ALA B CA   3  
ATOM 7404  C C    . ALA B 1 7  ? -0.141  -3.481  9.592   1.00 0.00 ? 6  ALA B C    3  
ATOM 7405  O O    . ALA B 1 7  ? -1.186  -3.473  8.972   1.00 0.00 ? 6  ALA B O    3  
ATOM 7406  C CB   . ALA B 1 7  ? 0.521   -1.224  10.474  1.00 0.00 ? 6  ALA B CB   3  
ATOM 7407  H H    . ALA B 1 7  ? 1.904   -2.878  11.855  1.00 0.00 ? 6  ALA B H    3  
ATOM 7408  H HA   . ALA B 1 7  ? -0.943  -2.549  11.330  1.00 0.00 ? 6  ALA B HA   3  
ATOM 7409  H HB1  . ALA B 1 7  ? 1.601   -1.231  10.423  1.00 0.00 ? 6  ALA B HB1  3  
ATOM 7410  H HB2  . ALA B 1 7  ? 0.119   -0.939  9.514   1.00 0.00 ? 6  ALA B HB2  3  
ATOM 7411  H HB3  . ALA B 1 7  ? 0.203   -0.512  11.221  1.00 0.00 ? 6  ALA B HB3  3  
ATOM 7412  N N    . MET B 1 8  ? 0.857   -4.223  9.205   1.00 0.00 ? 7  MET B N    3  
ATOM 7413  C CA   . MET B 1 8  ? 0.700   -5.067  7.988   1.00 0.00 ? 7  MET B CA   3  
ATOM 7414  C C    . MET B 1 8  ? -0.414  -6.088  8.242   1.00 0.00 ? 7  MET B C    3  
ATOM 7415  O O    . MET B 1 8  ? -1.283  -6.296  7.417   1.00 0.00 ? 7  MET B O    3  
ATOM 7416  C CB   . MET B 1 8  ? 2.019   -5.792  7.684   1.00 0.00 ? 7  MET B CB   3  
ATOM 7417  C CG   . MET B 1 8  ? 2.052   -6.204  6.208   1.00 0.00 ? 7  MET B CG   3  
ATOM 7418  S SD   . MET B 1 8  ? 2.399   -4.745  5.192   1.00 0.00 ? 7  MET B SD   3  
ATOM 7419  C CE   . MET B 1 8  ? 1.420   -5.226  3.748   1.00 0.00 ? 7  MET B CE   3  
ATOM 7420  H H    . MET B 1 8  ? 1.695   -4.234  9.712   1.00 0.00 ? 7  MET B H    3  
ATOM 7421  H HA   . MET B 1 8  ? 0.428   -4.440  7.152   1.00 0.00 ? 7  MET B HA   3  
ATOM 7422  H HB2  . MET B 1 8  ? 2.846   -5.128  7.889   1.00 0.00 ? 7  MET B HB2  3  
ATOM 7423  H HB3  . MET B 1 8  ? 2.105   -6.672  8.305   1.00 0.00 ? 7  MET B HB3  3  
ATOM 7424  H HG2  . MET B 1 8  ? 2.825   -6.943  6.057   1.00 0.00 ? 7  MET B HG2  3  
ATOM 7425  H HG3  . MET B 1 8  ? 1.095   -6.620  5.926   1.00 0.00 ? 7  MET B HG3  3  
ATOM 7426  H HE1  . MET B 1 8  ? 0.387   -5.355  4.041   1.00 0.00 ? 7  MET B HE1  3  
ATOM 7427  H HE2  . MET B 1 8  ? 1.485   -4.455  2.997   1.00 0.00 ? 7  MET B HE2  3  
ATOM 7428  H HE3  . MET B 1 8  ? 1.805   -6.153  3.346   1.00 0.00 ? 7  MET B HE3  3  
ATOM 7429  N N    . VAL B 1 9  ? -0.389  -6.726  9.382   1.00 0.00 ? 8  VAL B N    3  
ATOM 7430  C CA   . VAL B 1 9  ? -1.437  -7.737  9.705   1.00 0.00 ? 8  VAL B CA   3  
ATOM 7431  C C    . VAL B 1 9  ? -2.788  -7.042  9.935   1.00 0.00 ? 8  VAL B C    3  
ATOM 7432  O O    . VAL B 1 9  ? -3.829  -7.565  9.592   1.00 0.00 ? 8  VAL B O    3  
ATOM 7433  C CB   . VAL B 1 9  ? -1.029  -8.500  10.973  1.00 0.00 ? 8  VAL B CB   3  
ATOM 7434  C CG1  . VAL B 1 9  ? -1.820  -9.806  11.065  1.00 0.00 ? 8  VAL B CG1  3  
ATOM 7435  C CG2  . VAL B 1 9  ? 0.467   -8.820  10.912  1.00 0.00 ? 8  VAL B CG2  3  
ATOM 7436  H H    . VAL B 1 9  ? 0.324   -6.538  10.027  1.00 0.00 ? 8  VAL B H    3  
ATOM 7437  H HA   . VAL B 1 9  ? -1.531  -8.436  8.886   1.00 0.00 ? 8  VAL B HA   3  
ATOM 7438  H HB   . VAL B 1 9  ? -1.233  -7.892  11.842  1.00 0.00 ? 8  VAL B HB   3  
ATOM 7439  H HG11 . VAL B 1 9  ? -2.878  -9.591  11.027  1.00 0.00 ? 8  VAL B HG11 3  
ATOM 7440  H HG12 . VAL B 1 9  ? -1.552  -10.447 10.238  1.00 0.00 ? 8  VAL B HG12 3  
ATOM 7441  H HG13 . VAL B 1 9  ? -1.588  -10.304 11.995  1.00 0.00 ? 8  VAL B HG13 3  
ATOM 7442  H HG21 . VAL B 1 9  ? 0.691   -9.319  9.980   1.00 0.00 ? 8  VAL B HG21 3  
ATOM 7443  H HG22 . VAL B 1 9  ? 1.036   -7.904  10.975  1.00 0.00 ? 8  VAL B HG22 3  
ATOM 7444  H HG23 . VAL B 1 9  ? 0.731   -9.465  11.737  1.00 0.00 ? 8  VAL B HG23 3  
ATOM 7445  N N    . ALA B 1 10 ? -2.780  -5.870  10.512  1.00 0.00 ? 9  ALA B N    3  
ATOM 7446  C CA   . ALA B 1 10 ? -4.064  -5.147  10.760  1.00 0.00 ? 9  ALA B CA   3  
ATOM 7447  C C    . ALA B 1 10 ? -4.771  -4.885  9.428   1.00 0.00 ? 9  ALA B C    3  
ATOM 7448  O O    . ALA B 1 10 ? -5.947  -5.140  9.272   1.00 0.00 ? 9  ALA B O    3  
ATOM 7449  C CB   . ALA B 1 10 ? -3.756  -3.803  11.420  1.00 0.00 ? 9  ALA B CB   3  
ATOM 7450  H H    . ALA B 1 10 ? -1.933  -5.460  10.783  1.00 0.00 ? 9  ALA B H    3  
ATOM 7451  H HA   . ALA B 1 10 ? -4.695  -5.725  11.418  1.00 0.00 ? 9  ALA B HA   3  
ATOM 7452  H HB1  . ALA B 1 10 ? -3.096  -3.235  10.783  1.00 0.00 ? 9  ALA B HB1  3  
ATOM 7453  H HB2  . ALA B 1 10 ? -4.674  -3.255  11.564  1.00 0.00 ? 9  ALA B HB2  3  
ATOM 7454  H HB3  . ALA B 1 10 ? -3.282  -3.969  12.377  1.00 0.00 ? 9  ALA B HB3  3  
ATOM 7455  N N    . LEU B 1 11 ? -4.057  -4.351  8.477   1.00 0.00 ? 10 LEU B N    3  
ATOM 7456  C CA   . LEU B 1 11 ? -4.668  -4.037  7.155   1.00 0.00 ? 10 LEU B CA   3  
ATOM 7457  C C    . LEU B 1 11 ? -5.392  -5.259  6.609   1.00 0.00 ? 10 LEU B C    3  
ATOM 7458  O O    . LEU B 1 11 ? -6.569  -5.232  6.311   1.00 0.00 ? 10 LEU B O    3  
ATOM 7459  C CB   . LEU B 1 11 ? -3.538  -3.675  6.175   1.00 0.00 ? 10 LEU B CB   3  
ATOM 7460  C CG   . LEU B 1 11 ? -3.048  -2.233  6.431   1.00 0.00 ? 10 LEU B CG   3  
ATOM 7461  C CD1  . LEU B 1 11 ? -1.600  -2.087  5.954   1.00 0.00 ? 10 LEU B CD1  3  
ATOM 7462  C CD2  . LEU B 1 11 ? -3.923  -1.230  5.663   1.00 0.00 ? 10 LEU B CD2  3  
ATOM 7463  H H    . LEU B 1 11 ? -3.115  -4.135  8.640   1.00 0.00 ? 10 LEU B H    3  
ATOM 7464  H HA   . LEU B 1 11 ? -5.324  -3.186  7.244   1.00 0.00 ? 10 LEU B HA   3  
ATOM 7465  H HB2  . LEU B 1 11 ? -2.718  -4.367  6.316   1.00 0.00 ? 10 LEU B HB2  3  
ATOM 7466  H HB3  . LEU B 1 11 ? -3.899  -3.756  5.159   1.00 0.00 ? 10 LEU B HB3  3  
ATOM 7467  H HG   . LEU B 1 11 ? -3.095  -2.018  7.490   1.00 0.00 ? 10 LEU B HG   3  
ATOM 7468  H HD11 . LEU B 1 11 ? -1.518  -2.448  4.939   1.00 0.00 ? 10 LEU B HD11 3  
ATOM 7469  H HD12 . LEU B 1 11 ? -1.312  -1.047  5.990   1.00 0.00 ? 10 LEU B HD12 3  
ATOM 7470  H HD13 . LEU B 1 11 ? -0.951  -2.661  6.595   1.00 0.00 ? 10 LEU B HD13 3  
ATOM 7471  H HD21 . LEU B 1 11 ? -4.948  -1.312  5.988   1.00 0.00 ? 10 LEU B HD21 3  
ATOM 7472  H HD22 . LEU B 1 11 ? -3.567  -0.227  5.850   1.00 0.00 ? 10 LEU B HD22 3  
ATOM 7473  H HD23 . LEU B 1 11 ? -3.866  -1.439  4.606   1.00 0.00 ? 10 LEU B HD23 3  
ATOM 7474  N N    . ILE B 1 12 ? -4.669  -6.328  6.461   1.00 0.00 ? 11 ILE B N    3  
ATOM 7475  C CA   . ILE B 1 12 ? -5.263  -7.571  5.909   1.00 0.00 ? 11 ILE B CA   3  
ATOM 7476  C C    . ILE B 1 12 ? -6.505  -7.968  6.703   1.00 0.00 ? 11 ILE B C    3  
ATOM 7477  O O    . ILE B 1 12 ? -7.481  -8.424  6.142   1.00 0.00 ? 11 ILE B O    3  
ATOM 7478  C CB   . ILE B 1 12 ? -4.234  -8.700  5.990   1.00 0.00 ? 11 ILE B CB   3  
ATOM 7479  C CG1  . ILE B 1 12 ? -3.033  -8.355  5.108   1.00 0.00 ? 11 ILE B CG1  3  
ATOM 7480  C CG2  . ILE B 1 12 ? -4.864  -10.002 5.493   1.00 0.00 ? 11 ILE B CG2  3  
ATOM 7481  C CD1  . ILE B 1 12 ? -1.879  -9.315  5.408   1.00 0.00 ? 11 ILE B CD1  3  
ATOM 7482  H H    . ILE B 1 12 ? -3.717  -6.305  6.699   1.00 0.00 ? 11 ILE B H    3  
ATOM 7483  H HA   . ILE B 1 12 ? -5.531  -7.411  4.875   1.00 0.00 ? 11 ILE B HA   3  
ATOM 7484  H HB   . ILE B 1 12 ? -3.910  -8.822  7.014   1.00 0.00 ? 11 ILE B HB   3  
ATOM 7485  H HG12 . ILE B 1 12 ? -3.313  -8.442  4.068   1.00 0.00 ? 11 ILE B HG12 3  
ATOM 7486  H HG13 . ILE B 1 12 ? -2.717  -7.343  5.313   1.00 0.00 ? 11 ILE B HG13 3  
ATOM 7487  H HG21 . ILE B 1 12 ? -5.346  -9.826  4.543   1.00 0.00 ? 11 ILE B HG21 3  
ATOM 7488  H HG22 . ILE B 1 12 ? -4.094  -10.752 5.374   1.00 0.00 ? 11 ILE B HG22 3  
ATOM 7489  H HG23 . ILE B 1 12 ? -5.595  -10.348 6.208   1.00 0.00 ? 11 ILE B HG23 3  
ATOM 7490  H HD11 . ILE B 1 12 ? -2.262  -10.318 5.534   1.00 0.00 ? 11 ILE B HD11 3  
ATOM 7491  H HD12 . ILE B 1 12 ? -1.177  -9.300  4.588   1.00 0.00 ? 11 ILE B HD12 3  
ATOM 7492  H HD13 . ILE B 1 12 ? -1.380  -9.004  6.313   1.00 0.00 ? 11 ILE B HD13 3  
ATOM 7493  N N    . ASP B 1 13 ? -6.480  -7.832  8.003   1.00 0.00 ? 12 ASP B N    3  
ATOM 7494  C CA   . ASP B 1 13 ? -7.671  -8.245  8.794   1.00 0.00 ? 12 ASP B CA   3  
ATOM 7495  C C    . ASP B 1 13 ? -8.831  -7.282  8.531   1.00 0.00 ? 12 ASP B C    3  
ATOM 7496  O O    . ASP B 1 13 ? -9.970  -7.694  8.450   1.00 0.00 ? 12 ASP B O    3  
ATOM 7497  C CB   . ASP B 1 13 ? -7.334  -8.280  10.286  1.00 0.00 ? 12 ASP B CB   3  
ATOM 7498  C CG   . ASP B 1 13 ? -6.398  -9.456  10.572  1.00 0.00 ? 12 ASP B CG   3  
ATOM 7499  O OD1  . ASP B 1 13 ? -6.288  -10.321 9.719   1.00 0.00 ? 12 ASP B OD1  3  
ATOM 7500  O OD2  . ASP B 1 13 ? -5.805  -9.471  11.639  1.00 0.00 ? 12 ASP B OD2  3  
ATOM 7501  H H    . ASP B 1 13 ? -5.681  -7.483  8.451   1.00 0.00 ? 12 ASP B H    3  
ATOM 7502  H HA   . ASP B 1 13 ? -7.950  -9.231  8.450   1.00 0.00 ? 12 ASP B HA   3  
ATOM 7503  H HB2  . ASP B 1 13 ? -6.849  -7.355  10.567  1.00 0.00 ? 12 ASP B HB2  3  
ATOM 7504  H HB3  . ASP B 1 13 ? -8.242  -8.398  10.858  1.00 0.00 ? 12 ASP B HB3  3  
ATOM 7505  N N    . VAL B 1 14 ? -8.568  -6.007  8.385   1.00 0.00 ? 13 VAL B N    3  
ATOM 7506  C CA   . VAL B 1 14 ? -9.693  -5.068  8.117   1.00 0.00 ? 13 VAL B CA   3  
ATOM 7507  C C    . VAL B 1 14 ? -10.233 -5.346  6.717   1.00 0.00 ? 13 VAL B C    3  
ATOM 7508  O O    . VAL B 1 14 ? -11.428 -5.375  6.506   1.00 0.00 ? 13 VAL B O    3  
ATOM 7509  C CB   . VAL B 1 14 ? -9.227  -3.616  8.235   1.00 0.00 ? 13 VAL B CB   3  
ATOM 7510  C CG1  . VAL B 1 14 ? -10.396 -2.676  7.939   1.00 0.00 ? 13 VAL B CG1  3  
ATOM 7511  C CG2  . VAL B 1 14 ? -8.710  -3.359  9.652   1.00 0.00 ? 13 VAL B CG2  3  
ATOM 7512  H H    . VAL B 1 14 ? -7.645  -5.672  8.441   1.00 0.00 ? 13 VAL B H    3  
ATOM 7513  H HA   . VAL B 1 14 ? -10.498 -5.273  8.804   1.00 0.00 ? 13 VAL B HA   3  
ATOM 7514  H HB   . VAL B 1 14 ? -8.433  -3.435  7.524   1.00 0.00 ? 13 VAL B HB   3  
ATOM 7515  H HG11 . VAL B 1 14 ? -11.241 -2.951  8.552   1.00 0.00 ? 13 VAL B HG11 3  
ATOM 7516  H HG12 . VAL B 1 14 ? -10.106 -1.660  8.160   1.00 0.00 ? 13 VAL B HG12 3  
ATOM 7517  H HG13 . VAL B 1 14 ? -10.665 -2.755  6.896   1.00 0.00 ? 13 VAL B HG13 3  
ATOM 7518  H HG21 . VAL B 1 14 ? -8.000  -4.127  9.921   1.00 0.00 ? 13 VAL B HG21 3  
ATOM 7519  H HG22 . VAL B 1 14 ? -8.227  -2.393  9.689   1.00 0.00 ? 13 VAL B HG22 3  
ATOM 7520  H HG23 . VAL B 1 14 ? -9.535  -3.375  10.346  1.00 0.00 ? 13 VAL B HG23 3  
ATOM 7521  N N    . PHE B 1 15 ? -9.382  -5.579  5.761   1.00 0.00 ? 14 PHE B N    3  
ATOM 7522  C CA   . PHE B 1 15 ? -9.894  -5.880  4.399   1.00 0.00 ? 14 PHE B CA   3  
ATOM 7523  C C    . PHE B 1 15 ? -10.748 -7.148  4.474   1.00 0.00 ? 14 PHE B C    3  
ATOM 7524  O O    . PHE B 1 15 ? -11.734 -7.295  3.774   1.00 0.00 ? 14 PHE B O    3  
ATOM 7525  C CB   . PHE B 1 15 ? -8.726  -6.106  3.438   1.00 0.00 ? 14 PHE B CB   3  
ATOM 7526  C CG   . PHE B 1 15 ? -9.268  -6.364  2.052   1.00 0.00 ? 14 PHE B CG   3  
ATOM 7527  C CD1  . PHE B 1 15 ? -9.753  -7.634  1.716   1.00 0.00 ? 14 PHE B CD1  3  
ATOM 7528  C CD2  . PHE B 1 15 ? -9.293  -5.332  1.106   1.00 0.00 ? 14 PHE B CD2  3  
ATOM 7529  C CE1  . PHE B 1 15 ? -10.262 -7.873  0.433   1.00 0.00 ? 14 PHE B CE1  3  
ATOM 7530  C CE2  . PHE B 1 15 ? -9.802  -5.571  -0.175  1.00 0.00 ? 14 PHE B CE2  3  
ATOM 7531  C CZ   . PHE B 1 15 ? -10.287 -6.840  -0.511  1.00 0.00 ? 14 PHE B CZ   3  
ATOM 7532  H H    . PHE B 1 15 ? -8.418  -5.574  5.940   1.00 0.00 ? 14 PHE B H    3  
ATOM 7533  H HA   . PHE B 1 15 ? -10.499 -5.055  4.051   1.00 0.00 ? 14 PHE B HA   3  
ATOM 7534  H HB2  . PHE B 1 15 ? -8.095  -5.229  3.424   1.00 0.00 ? 14 PHE B HB2  3  
ATOM 7535  H HB3  . PHE B 1 15 ? -8.150  -6.960  3.764   1.00 0.00 ? 14 PHE B HB3  3  
ATOM 7536  H HD1  . PHE B 1 15 ? -9.733  -8.430  2.445   1.00 0.00 ? 14 PHE B HD1  3  
ATOM 7537  H HD2  . PHE B 1 15 ? -8.919  -4.352  1.365   1.00 0.00 ? 14 PHE B HD2  3  
ATOM 7538  H HE1  . PHE B 1 15 ? -10.637 -8.852  0.174   1.00 0.00 ? 14 PHE B HE1  3  
ATOM 7539  H HE2  . PHE B 1 15 ? -9.820  -4.775  -0.905  1.00 0.00 ? 14 PHE B HE2  3  
ATOM 7540  H HZ   . PHE B 1 15 ? -10.680 -7.023  -1.500  1.00 0.00 ? 14 PHE B HZ   3  
ATOM 7541  N N    . HIS B 1 16 ? -10.373 -8.067  5.324   1.00 0.00 ? 15 HIS B N    3  
ATOM 7542  C CA   . HIS B 1 16 ? -11.152 -9.331  5.454   1.00 0.00 ? 15 HIS B CA   3  
ATOM 7543  C C    . HIS B 1 16 ? -12.434 -9.076  6.253   1.00 0.00 ? 15 HIS B C    3  
ATOM 7544  O O    . HIS B 1 16 ? -13.447 -9.714  6.046   1.00 0.00 ? 15 HIS B O    3  
ATOM 7545  C CB   . HIS B 1 16 ? -10.303 -10.380 6.175   1.00 0.00 ? 15 HIS B CB   3  
ATOM 7546  C CG   . HIS B 1 16 ? -11.000 -11.711 6.119   1.00 0.00 ? 15 HIS B CG   3  
ATOM 7547  N ND1  . HIS B 1 16 ? -11.566 -12.299 7.239   1.00 0.00 ? 15 HIS B ND1  3  
ATOM 7548  C CD2  . HIS B 1 16 ? -11.234 -12.579 5.082   1.00 0.00 ? 15 HIS B CD2  3  
ATOM 7549  C CE1  . HIS B 1 16 ? -12.108 -13.468 6.854   1.00 0.00 ? 15 HIS B CE1  3  
ATOM 7550  N NE2  . HIS B 1 16 ? -11.935 -13.688 5.548   1.00 0.00 ? 15 HIS B NE2  3  
ATOM 7551  H H    . HIS B 1 16 ? -9.576  -7.925  5.877   1.00 0.00 ? 15 HIS B H    3  
ATOM 7552  H HA   . HIS B 1 16 ? -11.410 -9.694  4.471   1.00 0.00 ? 15 HIS B HA   3  
ATOM 7553  H HB2  . HIS B 1 16 ? -9.340  -10.459 5.691   1.00 0.00 ? 15 HIS B HB2  3  
ATOM 7554  H HB3  . HIS B 1 16 ? -10.166 -10.087 7.206   1.00 0.00 ? 15 HIS B HB3  3  
ATOM 7555  H HD1  . HIS B 1 16 ? -11.570 -11.930 8.147   1.00 0.00 ? 15 HIS B HD1  3  
ATOM 7556  H HD2  . HIS B 1 16 ? -10.916 -12.428 4.060   1.00 0.00 ? 15 HIS B HD2  3  
ATOM 7557  H HE1  . HIS B 1 16 ? -12.619 -14.147 7.520   1.00 0.00 ? 15 HIS B HE1  3  
ATOM 7558  N N    . GLN B 1 17 ? -12.385 -8.152  7.176   1.00 0.00 ? 16 GLN B N    3  
ATOM 7559  C CA   . GLN B 1 17 ? -13.586 -7.854  8.010   1.00 0.00 ? 16 GLN B CA   3  
ATOM 7560  C C    . GLN B 1 17 ? -14.784 -7.568  7.107   1.00 0.00 ? 16 GLN B C    3  
ATOM 7561  O O    . GLN B 1 17 ? -15.878 -8.037  7.349   1.00 0.00 ? 16 GLN B O    3  
ATOM 7562  C CB   . GLN B 1 17 ? -13.303 -6.630  8.887   1.00 0.00 ? 16 GLN B CB   3  
ATOM 7563  C CG   . GLN B 1 17 ? -14.441 -6.441  9.894   1.00 0.00 ? 16 GLN B CG   3  
ATOM 7564  C CD   . GLN B 1 17 ? -14.414 -7.573  10.924  1.00 0.00 ? 16 GLN B CD   3  
ATOM 7565  O OE1  . GLN B 1 17 ? -15.437 -8.147  11.238  1.00 0.00 ? 16 GLN B OE1  3  
ATOM 7566  N NE2  . GLN B 1 17 ? -13.280 -7.921  11.468  1.00 0.00 ? 16 GLN B NE2  3  
ATOM 7567  H H    . GLN B 1 17 ? -11.552 -7.659  7.329   1.00 0.00 ? 16 GLN B H    3  
ATOM 7568  H HA   . GLN B 1 17 ? -13.805 -8.703  8.641   1.00 0.00 ? 16 GLN B HA   3  
ATOM 7569  H HB2  . GLN B 1 17 ? -12.374 -6.777  9.417   1.00 0.00 ? 16 GLN B HB2  3  
ATOM 7570  H HB3  . GLN B 1 17 ? -13.227 -5.751  8.264   1.00 0.00 ? 16 GLN B HB3  3  
ATOM 7571  H HG2  . GLN B 1 17 ? -14.319 -5.494  10.400  1.00 0.00 ? 16 GLN B HG2  3  
ATOM 7572  H HG3  . GLN B 1 17 ? -15.387 -6.451  9.375   1.00 0.00 ? 16 GLN B HG3  3  
ATOM 7573  H HE21 . GLN B 1 17 ? -12.453 -7.459  11.216  1.00 0.00 ? 16 GLN B HE21 3  
ATOM 7574  H HE22 . GLN B 1 17 ? -13.256 -8.644  12.128  1.00 0.00 ? 16 GLN B HE22 3  
ATOM 7575  N N    . TYR B 1 18 ? -14.594 -6.808  6.066   1.00 0.00 ? 17 TYR B N    3  
ATOM 7576  C CA   . TYR B 1 18 ? -15.730 -6.504  5.157   1.00 0.00 ? 17 TYR B CA   3  
ATOM 7577  C C    . TYR B 1 18 ? -16.090 -7.762  4.367   1.00 0.00 ? 17 TYR B C    3  
ATOM 7578  O O    . TYR B 1 18 ? -17.247 -8.101  4.215   1.00 0.00 ? 17 TYR B O    3  
ATOM 7579  C CB   . TYR B 1 18 ? -15.329 -5.391  4.186   1.00 0.00 ? 17 TYR B CB   3  
ATOM 7580  C CG   . TYR B 1 18 ? -15.312 -4.065  4.913   1.00 0.00 ? 17 TYR B CG   3  
ATOM 7581  C CD1  . TYR B 1 18 ? -14.340 -3.820  5.889   1.00 0.00 ? 17 TYR B CD1  3  
ATOM 7582  C CD2  . TYR B 1 18 ? -16.264 -3.080  4.612   1.00 0.00 ? 17 TYR B CD2  3  
ATOM 7583  C CE1  . TYR B 1 18 ? -14.317 -2.594  6.565   1.00 0.00 ? 17 TYR B CE1  3  
ATOM 7584  C CE2  . TYR B 1 18 ? -16.240 -1.854  5.287   1.00 0.00 ? 17 TYR B CE2  3  
ATOM 7585  C CZ   . TYR B 1 18 ? -15.266 -1.611  6.264   1.00 0.00 ? 17 TYR B CZ   3  
ATOM 7586  O OH   . TYR B 1 18 ? -15.242 -0.403  6.931   1.00 0.00 ? 17 TYR B OH   3  
ATOM 7587  H H    . TYR B 1 18 ? -13.708 -6.434  5.883   1.00 0.00 ? 17 TYR B H    3  
ATOM 7588  H HA   . TYR B 1 18 ? -16.584 -6.187  5.740   1.00 0.00 ? 17 TYR B HA   3  
ATOM 7589  H HB2  . TYR B 1 18 ? -14.343 -5.597  3.793   1.00 0.00 ? 17 TYR B HB2  3  
ATOM 7590  H HB3  . TYR B 1 18 ? -16.038 -5.349  3.372   1.00 0.00 ? 17 TYR B HB3  3  
ATOM 7591  H HD1  . TYR B 1 18 ? -13.606 -4.578  6.122   1.00 0.00 ? 17 TYR B HD1  3  
ATOM 7592  H HD2  . TYR B 1 18 ? -17.016 -3.268  3.859   1.00 0.00 ? 17 TYR B HD2  3  
ATOM 7593  H HE1  . TYR B 1 18 ? -13.565 -2.407  7.318   1.00 0.00 ? 17 TYR B HE1  3  
ATOM 7594  H HE2  . TYR B 1 18 ? -16.973 -1.095  5.055   1.00 0.00 ? 17 TYR B HE2  3  
ATOM 7595  H HH   . TYR B 1 18 ? -15.603 0.267   6.346   1.00 0.00 ? 17 TYR B HH   3  
ATOM 7596  N N    . SER B 1 19 ? -15.105 -8.456  3.855   1.00 0.00 ? 18 SER B N    3  
ATOM 7597  C CA   . SER B 1 19 ? -15.384 -9.694  3.065   1.00 0.00 ? 18 SER B CA   3  
ATOM 7598  C C    . SER B 1 19 ? -15.231 -10.933 3.953   1.00 0.00 ? 18 SER B C    3  
ATOM 7599  O O    . SER B 1 19 ? -14.453 -11.818 3.652   1.00 0.00 ? 18 SER B O    3  
ATOM 7600  C CB   . SER B 1 19 ? -14.389 -9.786  1.906   1.00 0.00 ? 18 SER B CB   3  
ATOM 7601  O OG   . SER B 1 19 ? -14.820 -10.789 0.996   1.00 0.00 ? 18 SER B OG   3  
ATOM 7602  H H    . SER B 1 19 ? -14.179 -8.161  3.987   1.00 0.00 ? 18 SER B H    3  
ATOM 7603  H HA   . SER B 1 19 ? -16.390 -9.659  2.668   1.00 0.00 ? 18 SER B HA   3  
ATOM 7604  H HB2  . SER B 1 19 ? -14.340 -8.840  1.393   1.00 0.00 ? 18 SER B HB2  3  
ATOM 7605  H HB3  . SER B 1 19 ? -13.409 -10.035 2.292   1.00 0.00 ? 18 SER B HB3  3  
ATOM 7606  H HG   . SER B 1 19 ? -14.074 -11.365 0.815   1.00 0.00 ? 18 SER B HG   3  
ATOM 7607  N N    . GLY B 1 20 ? -15.982 -11.026 5.032   1.00 0.00 ? 19 GLY B N    3  
ATOM 7608  C CA   . GLY B 1 20 ? -15.898 -12.231 5.927   1.00 0.00 ? 19 GLY B CA   3  
ATOM 7609  C C    . GLY B 1 20 ? -17.265 -12.919 5.927   1.00 0.00 ? 19 GLY B C    3  
ATOM 7610  O O    . GLY B 1 20 ? -17.402 -14.061 6.317   1.00 0.00 ? 19 GLY B O    3  
ATOM 7611  H H    . GLY B 1 20 ? -16.627 -10.322 5.253   1.00 0.00 ? 19 GLY B H    3  
ATOM 7612  H HA2  . GLY B 1 20 ? -15.141 -12.914 5.564   1.00 0.00 ? 19 GLY B HA2  3  
ATOM 7613  H HA3  . GLY B 1 20 ? -15.661 -11.929 6.936   1.00 0.00 ? 19 GLY B HA3  3  
ATOM 7614  N N    . ARG B 1 21 ? -18.272 -12.236 5.459   1.00 0.00 ? 20 ARG B N    3  
ATOM 7615  C CA   . ARG B 1 21 ? -19.634 -12.838 5.385   1.00 0.00 ? 20 ARG B CA   3  
ATOM 7616  C C    . ARG B 1 21 ? -19.603 -14.026 4.424   1.00 0.00 ? 20 ARG B C    3  
ATOM 7617  O O    . ARG B 1 21 ? -20.301 -15.001 4.627   1.00 0.00 ? 20 ARG B O    3  
ATOM 7618  C CB   . ARG B 1 21 ? -20.631 -11.789 4.885   1.00 0.00 ? 20 ARG B CB   3  
ATOM 7619  C CG   . ARG B 1 21 ? -22.058 -12.241 5.192   1.00 0.00 ? 20 ARG B CG   3  
ATOM 7620  C CD   . ARG B 1 21 ? -23.048 -11.251 4.574   1.00 0.00 ? 20 ARG B CD   3  
ATOM 7621  N NE   . ARG B 1 21 ? -24.439 -11.733 4.800   1.00 0.00 ? 20 ARG B NE   3  
ATOM 7622  C CZ   . ARG B 1 21 ? -24.810 -12.123 5.989   1.00 0.00 ? 20 ARG B CZ   3  
ATOM 7623  N NH1  . ARG B 1 21 ? -24.702 -11.310 7.004   1.00 0.00 ? 20 ARG B NH1  3  
ATOM 7624  N NH2  . ARG B 1 21 ? -25.278 -13.328 6.162   1.00 0.00 ? 20 ARG B NH2  3  
ATOM 7625  H H    . ARG B 1 21 ? -18.129 -11.328 5.123   1.00 0.00 ? 20 ARG B H    3  
ATOM 7626  H HA   . ARG B 1 21 ? -19.961 -13.240 6.332   1.00 0.00 ? 20 ARG B HA   3  
ATOM 7627  H HB2  . ARG B 1 21 ? -20.438 -10.847 5.377   1.00 0.00 ? 20 ARG B HB2  3  
ATOM 7628  H HB3  . ARG B 1 21 ? -20.517 -11.667 3.818   1.00 0.00 ? 20 ARG B HB3  3  
ATOM 7629  H HG2  . ARG B 1 21 ? -22.222 -13.225 4.777   1.00 0.00 ? 20 ARG B HG2  3  
ATOM 7630  H HG3  . ARG B 1 21 ? -22.202 -12.271 6.262   1.00 0.00 ? 20 ARG B HG3  3  
ATOM 7631  H HD2  . ARG B 1 21 ? -22.922 -10.281 5.035   1.00 0.00 ? 20 ARG B HD2  3  
ATOM 7632  H HD3  . ARG B 1 21 ? -22.862 -11.172 3.513   1.00 0.00 ? 20 ARG B HD3  3  
ATOM 7633  H HE   . ARG B 1 21 ? -25.077 -11.760 4.055   1.00 0.00 ? 20 ARG B HE   3  
ATOM 7634  H HH11 . ARG B 1 21 ? -24.338 -10.389 6.869   1.00 0.00 ? 20 ARG B HH11 3  
ATOM 7635  H HH12 . ARG B 1 21 ? -24.982 -11.610 7.916   1.00 0.00 ? 20 ARG B HH12 3  
ATOM 7636  H HH21 . ARG B 1 21 ? -25.352 -13.952 5.383   1.00 0.00 ? 20 ARG B HH21 3  
ATOM 7637  H HH22 . ARG B 1 21 ? -25.564 -13.629 7.071   1.00 0.00 ? 20 ARG B HH22 3  
ATOM 7638  N N    . GLU B 1 22 ? -18.787 -13.990 3.406   1.00 0.00 ? 21 GLU B N    3  
ATOM 7639  C CA   . GLU B 1 22 ? -18.715 -15.164 2.483   1.00 0.00 ? 21 GLU B CA   3  
ATOM 7640  C C    . GLU B 1 22 ? -17.291 -15.290 1.950   1.00 0.00 ? 21 GLU B C    3  
ATOM 7641  O O    . GLU B 1 22 ? -16.731 -16.368 1.909   1.00 0.00 ? 21 GLU B O    3  
ATOM 7642  C CB   . GLU B 1 22 ? -19.682 -14.972 1.308   1.00 0.00 ? 21 GLU B CB   3  
ATOM 7643  C CG   . GLU B 1 22 ? -21.119 -15.245 1.759   1.00 0.00 ? 21 GLU B CG   3  
ATOM 7644  C CD   . GLU B 1 22 ? -22.039 -15.253 0.536   1.00 0.00 ? 21 GLU B CD   3  
ATOM 7645  O OE1  . GLU B 1 22 ? -21.573 -15.625 -0.529  1.00 0.00 ? 21 GLU B OE1  3  
ATOM 7646  O OE2  . GLU B 1 22 ? -23.192 -14.883 0.683   1.00 0.00 ? 21 GLU B OE2  3  
ATOM 7647  H H    . GLU B 1 22 ? -18.207 -13.213 3.264   1.00 0.00 ? 21 GLU B H    3  
ATOM 7648  H HA   . GLU B 1 22 ? -18.968 -16.062 3.029   1.00 0.00 ? 21 GLU B HA   3  
ATOM 7649  H HB2  . GLU B 1 22 ? -19.606 -13.956 0.948   1.00 0.00 ? 21 GLU B HB2  3  
ATOM 7650  H HB3  . GLU B 1 22 ? -19.423 -15.655 0.511   1.00 0.00 ? 21 GLU B HB3  3  
ATOM 7651  H HG2  . GLU B 1 22 ? -21.167 -16.206 2.251   1.00 0.00 ? 21 GLU B HG2  3  
ATOM 7652  H HG3  . GLU B 1 22 ? -21.437 -14.471 2.442   1.00 0.00 ? 21 GLU B HG3  3  
ATOM 7653  N N    . GLY B 1 23 ? -16.695 -14.198 1.546   1.00 0.00 ? 22 GLY B N    3  
ATOM 7654  C CA   . GLY B 1 23 ? -15.301 -14.253 1.018   1.00 0.00 ? 22 GLY B CA   3  
ATOM 7655  C C    . GLY B 1 23 ? -15.167 -15.430 0.054   1.00 0.00 ? 22 GLY B C    3  
ATOM 7656  O O    . GLY B 1 23 ? -14.075 -15.863 -0.254  1.00 0.00 ? 22 GLY B O    3  
ATOM 7657  H H    . GLY B 1 23 ? -17.161 -13.336 1.588   1.00 0.00 ? 22 GLY B H    3  
ATOM 7658  H HA2  . GLY B 1 23 ? -15.073 -13.327 0.510   1.00 0.00 ? 22 GLY B HA2  3  
ATOM 7659  H HA3  . GLY B 1 23 ? -14.608 -14.385 1.834   1.00 0.00 ? 22 GLY B HA3  3  
ATOM 7660  N N    . ASP B 1 24 ? -16.265 -15.952 -0.426  1.00 0.00 ? 23 ASP B N    3  
ATOM 7661  C CA   . ASP B 1 24 ? -16.182 -17.102 -1.372  1.00 0.00 ? 23 ASP B CA   3  
ATOM 7662  C C    . ASP B 1 24 ? -15.150 -16.759 -2.450  1.00 0.00 ? 23 ASP B C    3  
ATOM 7663  O O    . ASP B 1 24 ? -14.164 -17.448 -2.618  1.00 0.00 ? 23 ASP B O    3  
ATOM 7664  C CB   . ASP B 1 24 ? -17.553 -17.342 -2.008  1.00 0.00 ? 23 ASP B CB   3  
ATOM 7665  C CG   . ASP B 1 24 ? -18.515 -17.885 -0.948  1.00 0.00 ? 23 ASP B CG   3  
ATOM 7666  O OD1  . ASP B 1 24 ? -18.072 -18.108 0.167   1.00 0.00 ? 23 ASP B OD1  3  
ATOM 7667  O OD2  . ASP B 1 24 ? -19.678 -18.068 -1.268  1.00 0.00 ? 23 ASP B OD2  3  
ATOM 7668  H H    . ASP B 1 24 ? -17.135 -15.593 -0.152  1.00 0.00 ? 23 ASP B H    3  
ATOM 7669  H HA   . ASP B 1 24 ? -15.867 -17.986 -0.837  1.00 0.00 ? 23 ASP B HA   3  
ATOM 7670  H HB2  . ASP B 1 24 ? -17.937 -16.411 -2.401  1.00 0.00 ? 23 ASP B HB2  3  
ATOM 7671  H HB3  . ASP B 1 24 ? -17.460 -18.061 -2.808  1.00 0.00 ? 23 ASP B HB3  3  
ATOM 7672  N N    . LYS B 1 25 ? -15.344 -15.671 -3.148  1.00 0.00 ? 24 LYS B N    3  
ATOM 7673  C CA   . LYS B 1 25 ? -14.345 -15.252 -4.173  1.00 0.00 ? 24 LYS B CA   3  
ATOM 7674  C C    . LYS B 1 25 ? -13.354 -14.305 -3.489  1.00 0.00 ? 24 LYS B C    3  
ATOM 7675  O O    . LYS B 1 25 ? -13.519 -13.952 -2.338  1.00 0.00 ? 24 LYS B O    3  
ATOM 7676  C CB   . LYS B 1 25 ? -15.052 -14.523 -5.320  1.00 0.00 ? 24 LYS B CB   3  
ATOM 7677  C CG   . LYS B 1 25 ? -15.762 -15.542 -6.220  1.00 0.00 ? 24 LYS B CG   3  
ATOM 7678  C CD   . LYS B 1 25 ? -16.778 -16.352 -5.396  1.00 0.00 ? 24 LYS B CD   3  
ATOM 7679  C CE   . LYS B 1 25 ? -17.859 -16.923 -6.322  1.00 0.00 ? 24 LYS B CE   3  
ATOM 7680  N NZ   . LYS B 1 25 ? -18.725 -17.870 -5.562  1.00 0.00 ? 24 LYS B NZ   3  
ATOM 7681  H H    . LYS B 1 25 ? -16.127 -15.109 -2.970  1.00 0.00 ? 24 LYS B H    3  
ATOM 7682  H HA   . LYS B 1 25 ? -13.822 -16.120 -4.554  1.00 0.00 ? 24 LYS B HA   3  
ATOM 7683  H HB2  . LYS B 1 25 ? -15.779 -13.835 -4.914  1.00 0.00 ? 24 LYS B HB2  3  
ATOM 7684  H HB3  . LYS B 1 25 ? -14.326 -13.976 -5.901  1.00 0.00 ? 24 LYS B HB3  3  
ATOM 7685  H HG2  . LYS B 1 25 ? -16.273 -15.018 -7.017  1.00 0.00 ? 24 LYS B HG2  3  
ATOM 7686  H HG3  . LYS B 1 25 ? -15.030 -16.214 -6.645  1.00 0.00 ? 24 LYS B HG3  3  
ATOM 7687  H HD2  . LYS B 1 25 ? -16.268 -17.164 -4.895  1.00 0.00 ? 24 LYS B HD2  3  
ATOM 7688  H HD3  . LYS B 1 25 ? -17.243 -15.711 -4.660  1.00 0.00 ? 24 LYS B HD3  3  
ATOM 7689  H HE2  . LYS B 1 25 ? -18.464 -16.116 -6.709  1.00 0.00 ? 24 LYS B HE2  3  
ATOM 7690  H HE3  . LYS B 1 25 ? -17.390 -17.445 -7.143  1.00 0.00 ? 24 LYS B HE3  3  
ATOM 7691  H HZ1  . LYS B 1 25 ? -18.638 -17.682 -4.544  1.00 0.00 ? 24 LYS B HZ1  3  
ATOM 7692  H HZ2  . LYS B 1 25 ? -19.716 -17.743 -5.856  1.00 0.00 ? 24 LYS B HZ2  3  
ATOM 7693  H HZ3  . LYS B 1 25 ? -18.429 -18.847 -5.759  1.00 0.00 ? 24 LYS B HZ3  3  
ATOM 7694  N N    . HIS B 1 26 ? -12.344 -13.869 -4.197  1.00 0.00 ? 25 HIS B N    3  
ATOM 7695  C CA   . HIS B 1 26 ? -11.347 -12.914 -3.616  1.00 0.00 ? 25 HIS B CA   3  
ATOM 7696  C C    . HIS B 1 26 ? -11.276 -11.701 -4.543  1.00 0.00 ? 25 HIS B C    3  
ATOM 7697  O O    . HIS B 1 26 ? -10.215 -11.279 -4.956  1.00 0.00 ? 25 HIS B O    3  
ATOM 7698  C CB   . HIS B 1 26 ? -9.976  -13.595 -3.530  1.00 0.00 ? 25 HIS B CB   3  
ATOM 7699  C CG   . HIS B 1 26 ? -9.429  -13.830 -4.913  1.00 0.00 ? 25 HIS B CG   3  
ATOM 7700  N ND1  . HIS B 1 26 ? -9.979  -14.762 -5.779  1.00 0.00 ? 25 HIS B ND1  3  
ATOM 7701  C CD2  . HIS B 1 26 ? -8.386  -13.256 -5.593  1.00 0.00 ? 25 HIS B CD2  3  
ATOM 7702  C CE1  . HIS B 1 26 ? -9.269  -14.720 -6.922  1.00 0.00 ? 25 HIS B CE1  3  
ATOM 7703  N NE2  . HIS B 1 26 ? -8.286  -13.819 -6.861  1.00 0.00 ? 25 HIS B NE2  3  
ATOM 7704  H H    . HIS B 1 26 ? -12.249 -14.155 -5.128  1.00 0.00 ? 25 HIS B H    3  
ATOM 7705  H HA   . HIS B 1 26 ? -11.659 -12.593 -2.630  1.00 0.00 ? 25 HIS B HA   3  
ATOM 7706  H HB2  . HIS B 1 26 ? -9.296  -12.962 -2.978  1.00 0.00 ? 25 HIS B HB2  3  
ATOM 7707  H HB3  . HIS B 1 26 ? -10.080 -14.541 -3.021  1.00 0.00 ? 25 HIS B HB3  3  
ATOM 7708  H HD1  . HIS B 1 26 ? -10.745 -15.345 -5.594  1.00 0.00 ? 25 HIS B HD1  3  
ATOM 7709  H HD2  . HIS B 1 26 ? -7.740  -12.482 -5.202  1.00 0.00 ? 25 HIS B HD2  3  
ATOM 7710  H HE1  . HIS B 1 26 ? -9.471  -15.337 -7.784  1.00 0.00 ? 25 HIS B HE1  3  
ATOM 7711  N N    . LYS B 1 27 ? -12.416 -11.149 -4.873  1.00 0.00 ? 26 LYS B N    3  
ATOM 7712  C CA   . LYS B 1 27 ? -12.461 -9.963  -5.779  1.00 0.00 ? 26 LYS B CA   3  
ATOM 7713  C C    . LYS B 1 27 ? -13.362 -8.887  -5.169  1.00 0.00 ? 26 LYS B C    3  
ATOM 7714  O O    . LYS B 1 27 ? -14.344 -9.186  -4.520  1.00 0.00 ? 26 LYS B O    3  
ATOM 7715  C CB   . LYS B 1 27 ? -13.032 -10.386 -7.134  1.00 0.00 ? 26 LYS B CB   3  
ATOM 7716  C CG   . LYS B 1 27 ? -12.033 -11.295 -7.852  1.00 0.00 ? 26 LYS B CG   3  
ATOM 7717  C CD   . LYS B 1 27 ? -12.629 -11.751 -9.186  1.00 0.00 ? 26 LYS B CD   3  
ATOM 7718  C CE   . LYS B 1 27 ? -11.776 -12.878 -9.769  1.00 0.00 ? 26 LYS B CE   3  
ATOM 7719  N NZ   . LYS B 1 27 ? -10.336 -12.498 -9.698  1.00 0.00 ? 26 LYS B NZ   3  
ATOM 7720  H H    . LYS B 1 27 ? -13.250 -11.521 -4.525  1.00 0.00 ? 26 LYS B H    3  
ATOM 7721  H HA   . LYS B 1 27 ? -11.470 -9.565  -5.917  1.00 0.00 ? 26 LYS B HA   3  
ATOM 7722  H HB2  . LYS B 1 27 ? -13.959 -10.919 -6.982  1.00 0.00 ? 26 LYS B HB2  3  
ATOM 7723  H HB3  . LYS B 1 27 ? -13.216 -9.510  -7.737  1.00 0.00 ? 26 LYS B HB3  3  
ATOM 7724  H HG2  . LYS B 1 27 ? -11.117 -10.753 -8.033  1.00 0.00 ? 26 LYS B HG2  3  
ATOM 7725  H HG3  . LYS B 1 27 ? -11.827 -12.160 -7.238  1.00 0.00 ? 26 LYS B HG3  3  
ATOM 7726  H HD2  . LYS B 1 27 ? -13.637 -12.107 -9.025  1.00 0.00 ? 26 LYS B HD2  3  
ATOM 7727  H HD3  . LYS B 1 27 ? -12.645 -10.920 -9.876  1.00 0.00 ? 26 LYS B HD3  3  
ATOM 7728  H HE2  . LYS B 1 27 ? -11.939 -13.783 -9.204  1.00 0.00 ? 26 LYS B HE2  3  
ATOM 7729  H HE3  . LYS B 1 27 ? -12.054 -13.043 -10.800 1.00 0.00 ? 26 LYS B HE3  3  
ATOM 7730  H HZ1  . LYS B 1 27 ? -10.256 -11.488 -9.458  1.00 0.00 ? 26 LYS B HZ1  3  
ATOM 7731  H HZ2  . LYS B 1 27 ? -9.862  -13.066 -8.968  1.00 0.00 ? 26 LYS B HZ2  3  
ATOM 7732  H HZ3  . LYS B 1 27 ? -9.885  -12.674 -10.618 1.00 0.00 ? 26 LYS B HZ3  3  
ATOM 7733  N N    . LEU B 1 28 ? -13.036 -7.636  -5.381  1.00 0.00 ? 27 LEU B N    3  
ATOM 7734  C CA   . LEU B 1 28 ? -13.867 -6.519  -4.828  1.00 0.00 ? 27 LEU B CA   3  
ATOM 7735  C C    . LEU B 1 28 ? -14.316 -5.634  -5.987  1.00 0.00 ? 27 LEU B C    3  
ATOM 7736  O O    . LEU B 1 28 ? -13.595 -5.450  -6.947  1.00 0.00 ? 27 LEU B O    3  
ATOM 7737  C CB   . LEU B 1 28 ? -13.025 -5.695  -3.851  1.00 0.00 ? 27 LEU B CB   3  
ATOM 7738  C CG   . LEU B 1 28 ? -13.932 -4.745  -3.047  1.00 0.00 ? 27 LEU B CG   3  
ATOM 7739  C CD1  . LEU B 1 28 ? -14.732 -5.524  -1.981  1.00 0.00 ? 27 LEU B CD1  3  
ATOM 7740  C CD2  . LEU B 1 28 ? -13.063 -3.689  -2.357  1.00 0.00 ? 27 LEU B CD2  3  
ATOM 7741  H H    . LEU B 1 28 ? -12.242 -7.428  -5.916  1.00 0.00 ? 27 LEU B H    3  
ATOM 7742  H HA   . LEU B 1 28 ? -14.734 -6.907  -4.315  1.00 0.00 ? 27 LEU B HA   3  
ATOM 7743  H HB2  . LEU B 1 28 ? -12.502 -6.359  -3.179  1.00 0.00 ? 27 LEU B HB2  3  
ATOM 7744  H HB3  . LEU B 1 28 ? -12.305 -5.115  -4.407  1.00 0.00 ? 27 LEU B HB3  3  
ATOM 7745  H HG   . LEU B 1 28 ? -14.621 -4.257  -3.721  1.00 0.00 ? 27 LEU B HG   3  
ATOM 7746  H HD11 . LEU B 1 28 ? -14.118 -6.307  -1.559  1.00 0.00 ? 27 LEU B HD11 3  
ATOM 7747  H HD12 . LEU B 1 28 ? -15.039 -4.849  -1.195  1.00 0.00 ? 27 LEU B HD12 3  
ATOM 7748  H HD13 . LEU B 1 28 ? -15.611 -5.959  -2.431  1.00 0.00 ? 27 LEU B HD13 3  
ATOM 7749  H HD21 . LEU B 1 28 ? -12.418 -3.218  -3.082  1.00 0.00 ? 27 LEU B HD21 3  
ATOM 7750  H HD22 . LEU B 1 28 ? -13.697 -2.941  -1.903  1.00 0.00 ? 27 LEU B HD22 3  
ATOM 7751  H HD23 . LEU B 1 28 ? -12.463 -4.163  -1.594  1.00 0.00 ? 27 LEU B HD23 3  
ATOM 7752  N N    . LYS B 1 29 ? -15.510 -5.098  -5.926  1.00 0.00 ? 28 LYS B N    3  
ATOM 7753  C CA   . LYS B 1 29 ? -16.002 -4.239  -7.046  1.00 0.00 ? 28 LYS B CA   3  
ATOM 7754  C C    . LYS B 1 29 ? -15.710 -2.765  -6.745  1.00 0.00 ? 28 LYS B C    3  
ATOM 7755  O O    . LYS B 1 29 ? -15.645 -2.354  -5.604  1.00 0.00 ? 28 LYS B O    3  
ATOM 7756  C CB   . LYS B 1 29 ? -17.509 -4.446  -7.207  1.00 0.00 ? 28 LYS B CB   3  
ATOM 7757  C CG   . LYS B 1 29 ? -17.773 -5.878  -7.674  1.00 0.00 ? 28 LYS B CG   3  
ATOM 7758  C CD   . LYS B 1 29 ? -19.260 -6.203  -7.524  1.00 0.00 ? 28 LYS B CD   3  
ATOM 7759  C CE   . LYS B 1 29 ? -19.495 -7.678  -7.857  1.00 0.00 ? 28 LYS B CE   3  
ATOM 7760  N NZ   . LYS B 1 29 ? -20.859 -8.079  -7.408  1.00 0.00 ? 28 LYS B NZ   3  
ATOM 7761  H H    . LYS B 1 29 ? -16.086 -5.271  -5.153  1.00 0.00 ? 28 LYS B H    3  
ATOM 7762  H HA   . LYS B 1 29 ? -15.499 -4.532  -7.958  1.00 0.00 ? 28 LYS B HA   3  
ATOM 7763  H HB2  . LYS B 1 29 ? -17.999 -4.278  -6.258  1.00 0.00 ? 28 LYS B HB2  3  
ATOM 7764  H HB3  . LYS B 1 29 ? -17.894 -3.753  -7.939  1.00 0.00 ? 28 LYS B HB3  3  
ATOM 7765  H HG2  . LYS B 1 29 ? -17.484 -5.978  -8.710  1.00 0.00 ? 28 LYS B HG2  3  
ATOM 7766  H HG3  . LYS B 1 29 ? -17.195 -6.563  -7.072  1.00 0.00 ? 28 LYS B HG3  3  
ATOM 7767  H HD2  . LYS B 1 29 ? -19.571 -6.008  -6.507  1.00 0.00 ? 28 LYS B HD2  3  
ATOM 7768  H HD3  . LYS B 1 29 ? -19.833 -5.588  -8.201  1.00 0.00 ? 28 LYS B HD3  3  
ATOM 7769  H HE2  . LYS B 1 29 ? -19.409 -7.823  -8.924  1.00 0.00 ? 28 LYS B HE2  3  
ATOM 7770  H HE3  . LYS B 1 29 ? -18.757 -8.284  -7.352  1.00 0.00 ? 28 LYS B HE3  3  
ATOM 7771  H HZ1  . LYS B 1 29 ? -21.559 -7.399  -7.771  1.00 0.00 ? 28 LYS B HZ1  3  
ATOM 7772  H HZ2  . LYS B 1 29 ? -21.079 -9.028  -7.769  1.00 0.00 ? 28 LYS B HZ2  3  
ATOM 7773  H HZ3  . LYS B 1 29 ? -20.892 -8.091  -6.368  1.00 0.00 ? 28 LYS B HZ3  3  
ATOM 7774  N N    . LYS B 1 30 ? -15.546 -1.966  -7.763  1.00 0.00 ? 29 LYS B N    3  
ATOM 7775  C CA   . LYS B 1 30 ? -15.273 -0.516  -7.548  1.00 0.00 ? 29 LYS B CA   3  
ATOM 7776  C C    . LYS B 1 30 ? -16.397 0.119   -6.715  1.00 0.00 ? 29 LYS B C    3  
ATOM 7777  O O    . LYS B 1 30 ? -16.162 0.969   -5.879  1.00 0.00 ? 29 LYS B O    3  
ATOM 7778  C CB   . LYS B 1 30 ? -15.164 0.195   -8.914  1.00 0.00 ? 29 LYS B CB   3  
ATOM 7779  C CG   . LYS B 1 30 ? -16.504 0.209   -9.675  1.00 0.00 ? 29 LYS B CG   3  
ATOM 7780  C CD   . LYS B 1 30 ? -16.936 -1.221  -10.035 1.00 0.00 ? 29 LYS B CD   3  
ATOM 7781  C CE   . LYS B 1 30 ? -17.957 -1.185  -11.179 1.00 0.00 ? 29 LYS B CE   3  
ATOM 7782  N NZ   . LYS B 1 30 ? -18.737 -2.454  -11.179 1.00 0.00 ? 29 LYS B NZ   3  
ATOM 7783  H H    . LYS B 1 30 ? -15.612 -2.316  -8.675  1.00 0.00 ? 29 LYS B H    3  
ATOM 7784  H HA   . LYS B 1 30 ? -14.331 -0.389  -7.033  1.00 0.00 ? 29 LYS B HA   3  
ATOM 7785  H HB2  . LYS B 1 30 ? -14.845 1.213   -8.752  1.00 0.00 ? 29 LYS B HB2  3  
ATOM 7786  H HB3  . LYS B 1 30 ? -14.423 -0.313  -9.514  1.00 0.00 ? 29 LYS B HB3  3  
ATOM 7787  H HG2  . LYS B 1 30 ? -17.265 0.678   -9.075  1.00 0.00 ? 29 LYS B HG2  3  
ATOM 7788  H HG3  . LYS B 1 30 ? -16.379 0.778   -10.584 1.00 0.00 ? 29 LYS B HG3  3  
ATOM 7789  H HD2  . LYS B 1 30 ? -16.073 -1.792  -10.343 1.00 0.00 ? 29 LYS B HD2  3  
ATOM 7790  H HD3  . LYS B 1 30 ? -17.391 -1.691  -9.179  1.00 0.00 ? 29 LYS B HD3  3  
ATOM 7791  H HE2  . LYS B 1 30 ? -18.629 -0.350  -11.041 1.00 0.00 ? 29 LYS B HE2  3  
ATOM 7792  H HE3  . LYS B 1 30 ? -17.439 -1.080  -12.120 1.00 0.00 ? 29 LYS B HE3  3  
ATOM 7793  H HZ1  . LYS B 1 30 ? -18.163 -3.213  -10.759 1.00 0.00 ? 29 LYS B HZ1  3  
ATOM 7794  H HZ2  . LYS B 1 30 ? -19.604 -2.328  -10.619 1.00 0.00 ? 29 LYS B HZ2  3  
ATOM 7795  H HZ3  . LYS B 1 30 ? -18.989 -2.706  -12.156 1.00 0.00 ? 29 LYS B HZ3  3  
ATOM 7796  N N    . SER B 1 31 ? -17.617 -0.274  -6.961  1.00 0.00 ? 30 SER B N    3  
ATOM 7797  C CA   . SER B 1 31 ? -18.772 0.308   -6.221  1.00 0.00 ? 30 SER B CA   3  
ATOM 7798  C C    . SER B 1 31 ? -18.642 0.057   -4.716  1.00 0.00 ? 30 SER B C    3  
ATOM 7799  O O    . SER B 1 31 ? -18.934 0.918   -3.901  1.00 0.00 ? 30 SER B O    3  
ATOM 7800  C CB   . SER B 1 31 ? -20.061 -0.343  -6.724  1.00 0.00 ? 30 SER B CB   3  
ATOM 7801  O OG   . SER B 1 31 ? -19.896 -1.754  -6.748  1.00 0.00 ? 30 SER B OG   3  
ATOM 7802  H H    . SER B 1 31 ? -17.774 -0.938  -7.659  1.00 0.00 ? 30 SER B H    3  
ATOM 7803  H HA   . SER B 1 31 ? -18.825 1.369   -6.413  1.00 0.00 ? 30 SER B HA   3  
ATOM 7804  H HB2  . SER B 1 31 ? -20.875 -0.093  -6.065  1.00 0.00 ? 30 SER B HB2  3  
ATOM 7805  H HB3  . SER B 1 31 ? -20.281 0.020   -7.719  1.00 0.00 ? 30 SER B HB3  3  
ATOM 7806  H HG   . SER B 1 31 ? -20.686 -2.138  -7.137  1.00 0.00 ? 30 SER B HG   3  
ATOM 7807  N N    . GLU B 1 32 ? -18.210 -1.117  -4.332  1.00 0.00 ? 31 GLU B N    3  
ATOM 7808  C CA   . GLU B 1 32 ? -18.084 -1.406  -2.874  1.00 0.00 ? 31 GLU B CA   3  
ATOM 7809  C C    . GLU B 1 32 ? -16.803 -0.762  -2.356  1.00 0.00 ? 31 GLU B C    3  
ATOM 7810  O O    . GLU B 1 32 ? -16.737 -0.289  -1.240  1.00 0.00 ? 31 GLU B O    3  
ATOM 7811  C CB   . GLU B 1 32 ? -18.068 -2.917  -2.635  1.00 0.00 ? 31 GLU B CB   3  
ATOM 7812  C CG   . GLU B 1 32 ? -19.462 -3.482  -2.912  1.00 0.00 ? 31 GLU B CG   3  
ATOM 7813  C CD   . GLU B 1 32 ? -19.484 -4.977  -2.591  1.00 0.00 ? 31 GLU B CD   3  
ATOM 7814  O OE1  . GLU B 1 32 ? -19.188 -5.758  -3.480  1.00 0.00 ? 31 GLU B OE1  3  
ATOM 7815  O OE2  . GLU B 1 32 ? -19.798 -5.316  -1.462  1.00 0.00 ? 31 GLU B OE2  3  
ATOM 7816  H H    . GLU B 1 32 ? -17.969 -1.790  -5.003  1.00 0.00 ? 31 GLU B H    3  
ATOM 7817  H HA   . GLU B 1 32 ? -18.943 -0.964  -2.388  1.00 0.00 ? 31 GLU B HA   3  
ATOM 7818  H HB2  . GLU B 1 32 ? -17.351 -3.380  -3.297  1.00 0.00 ? 31 GLU B HB2  3  
ATOM 7819  H HB3  . GLU B 1 32 ? -17.797 -3.119  -1.610  1.00 0.00 ? 31 GLU B HB3  3  
ATOM 7820  H HG2  . GLU B 1 32 ? -20.187 -2.969  -2.296  1.00 0.00 ? 31 GLU B HG2  3  
ATOM 7821  H HG3  . GLU B 1 32 ? -19.709 -3.336  -3.953  1.00 0.00 ? 31 GLU B HG3  3  
ATOM 7822  N N    . LEU B 1 33 ? -15.789 -0.715  -3.178  1.00 0.00 ? 32 LEU B N    3  
ATOM 7823  C CA   . LEU B 1 33 ? -14.519 -0.072  -2.754  1.00 0.00 ? 32 LEU B CA   3  
ATOM 7824  C C    . LEU B 1 33 ? -14.814 1.395   -2.448  1.00 0.00 ? 32 LEU B C    3  
ATOM 7825  O O    . LEU B 1 33 ? -14.324 1.937   -1.479  1.00 0.00 ? 32 LEU B O    3  
ATOM 7826  C CB   . LEU B 1 33 ? -13.481 -0.185  -3.879  1.00 0.00 ? 32 LEU B CB   3  
ATOM 7827  C CG   . LEU B 1 33 ? -12.242 0.665   -3.563  1.00 0.00 ? 32 LEU B CG   3  
ATOM 7828  C CD1  . LEU B 1 33 ? -11.694 0.303   -2.179  1.00 0.00 ? 32 LEU B CD1  3  
ATOM 7829  C CD2  . LEU B 1 33 ? -11.169 0.392   -4.622  1.00 0.00 ? 32 LEU B CD2  3  
ATOM 7830  H H    . LEU B 1 33 ? -15.873 -1.085  -4.082  1.00 0.00 ? 32 LEU B H    3  
ATOM 7831  H HA   . LEU B 1 33 ? -14.154 -0.537  -1.851  1.00 0.00 ? 32 LEU B HA   3  
ATOM 7832  H HB2  . LEU B 1 33 ? -13.186 -1.217  -3.989  1.00 0.00 ? 32 LEU B HB2  3  
ATOM 7833  H HB3  . LEU B 1 33 ? -13.921 0.161   -4.802  1.00 0.00 ? 32 LEU B HB3  3  
ATOM 7834  H HG   . LEU B 1 33 ? -12.507 1.711   -3.583  1.00 0.00 ? 32 LEU B HG   3  
ATOM 7835  H HD11 . LEU B 1 33 ? -11.739 -0.767  -2.039  1.00 0.00 ? 32 LEU B HD11 3  
ATOM 7836  H HD12 . LEU B 1 33 ? -10.669 0.635   -2.097  1.00 0.00 ? 32 LEU B HD12 3  
ATOM 7837  H HD13 . LEU B 1 33 ? -12.284 0.789   -1.419  1.00 0.00 ? 32 LEU B HD13 3  
ATOM 7838  H HD21 . LEU B 1 33 ? -11.575 0.584   -5.605  1.00 0.00 ? 32 LEU B HD21 3  
ATOM 7839  H HD22 . LEU B 1 33 ? -10.323 1.039   -4.451  1.00 0.00 ? 32 LEU B HD22 3  
ATOM 7840  H HD23 . LEU B 1 33 ? -10.852 -0.639  -4.557  1.00 0.00 ? 32 LEU B HD23 3  
ATOM 7841  N N    . LYS B 1 34 ? -15.592 2.060   -3.262  1.00 0.00 ? 33 LYS B N    3  
ATOM 7842  C CA   . LYS B 1 34 ? -15.865 3.493   -2.986  1.00 0.00 ? 33 LYS B CA   3  
ATOM 7843  C C    . LYS B 1 34 ? -16.383 3.627   -1.558  1.00 0.00 ? 33 LYS B C    3  
ATOM 7844  O O    . LYS B 1 34 ? -15.812 4.321   -0.739  1.00 0.00 ? 33 LYS B O    3  
ATOM 7845  C CB   . LYS B 1 34 ? -16.912 4.021   -3.969  1.00 0.00 ? 33 LYS B CB   3  
ATOM 7846  C CG   . LYS B 1 34 ? -17.043 5.536   -3.801  1.00 0.00 ? 33 LYS B CG   3  
ATOM 7847  C CD   . LYS B 1 34 ? -17.909 6.108   -4.926  1.00 0.00 ? 33 LYS B CD   3  
ATOM 7848  C CE   . LYS B 1 34 ? -18.125 7.605   -4.694  1.00 0.00 ? 33 LYS B CE   3  
ATOM 7849  N NZ   . LYS B 1 34 ? -18.925 7.808   -3.453  1.00 0.00 ? 33 LYS B NZ   3  
ATOM 7850  H H    . LYS B 1 34 ? -15.972 1.634   -4.057  1.00 0.00 ? 33 LYS B H    3  
ATOM 7851  H HA   . LYS B 1 34 ? -14.943 4.039   -3.106  1.00 0.00 ? 33 LYS B HA   3  
ATOM 7852  H HB2  . LYS B 1 34 ? -16.604 3.794   -4.980  1.00 0.00 ? 33 LYS B HB2  3  
ATOM 7853  H HB3  . LYS B 1 34 ? -17.864 3.554   -3.768  1.00 0.00 ? 33 LYS B HB3  3  
ATOM 7854  H HG2  . LYS B 1 34 ? -17.503 5.753   -2.847  1.00 0.00 ? 33 LYS B HG2  3  
ATOM 7855  H HG3  . LYS B 1 34 ? -16.063 5.988   -3.839  1.00 0.00 ? 33 LYS B HG3  3  
ATOM 7856  H HD2  . LYS B 1 34 ? -17.412 5.957   -5.874  1.00 0.00 ? 33 LYS B HD2  3  
ATOM 7857  H HD3  . LYS B 1 34 ? -18.864 5.605   -4.936  1.00 0.00 ? 33 LYS B HD3  3  
ATOM 7858  H HE2  . LYS B 1 34 ? -17.168 8.093   -4.588  1.00 0.00 ? 33 LYS B HE2  3  
ATOM 7859  H HE3  . LYS B 1 34 ? -18.652 8.029   -5.536  1.00 0.00 ? 33 LYS B HE3  3  
ATOM 7860  H HZ1  . LYS B 1 34 ? -19.771 7.205   -3.482  1.00 0.00 ? 33 LYS B HZ1  3  
ATOM 7861  H HZ2  . LYS B 1 34 ? -18.350 7.555   -2.625  1.00 0.00 ? 33 LYS B HZ2  3  
ATOM 7862  H HZ3  . LYS B 1 34 ? -19.212 8.807   -3.386  1.00 0.00 ? 33 LYS B HZ3  3  
ATOM 7863  N N    . GLU B 1 35 ? -17.462 2.961   -1.252  1.00 0.00 ? 34 GLU B N    3  
ATOM 7864  C CA   . GLU B 1 35 ? -18.011 3.048   0.133   1.00 0.00 ? 34 GLU B CA   3  
ATOM 7865  C C    . GLU B 1 35 ? -16.893 2.743   1.132   1.00 0.00 ? 34 GLU B C    3  
ATOM 7866  O O    . GLU B 1 35 ? -16.807 3.349   2.180   1.00 0.00 ? 34 GLU B O    3  
ATOM 7867  C CB   . GLU B 1 35 ? -19.136 2.026   0.307   1.00 0.00 ? 34 GLU B CB   3  
ATOM 7868  C CG   . GLU B 1 35 ? -20.274 2.352   -0.663  1.00 0.00 ? 34 GLU B CG   3  
ATOM 7869  C CD   . GLU B 1 35 ? -21.309 1.226   -0.635  1.00 0.00 ? 34 GLU B CD   3  
ATOM 7870  O OE1  . GLU B 1 35 ? -22.010 1.116   0.358   1.00 0.00 ? 34 GLU B OE1  3  
ATOM 7871  O OE2  . GLU B 1 35 ? -21.383 0.492   -1.606  1.00 0.00 ? 34 GLU B OE2  3  
ATOM 7872  H H    . GLU B 1 35 ? -17.909 2.411   -1.933  1.00 0.00 ? 34 GLU B H    3  
ATOM 7873  H HA   . GLU B 1 35 ? -18.398 4.041   0.315   1.00 0.00 ? 34 GLU B HA   3  
ATOM 7874  H HB2  . GLU B 1 35 ? -18.758 1.035   0.103   1.00 0.00 ? 34 GLU B HB2  3  
ATOM 7875  H HB3  . GLU B 1 35 ? -19.507 2.069   1.321   1.00 0.00 ? 34 GLU B HB3  3  
ATOM 7876  H HG2  . GLU B 1 35 ? -20.742 3.280   -0.369  1.00 0.00 ? 34 GLU B HG2  3  
ATOM 7877  H HG3  . GLU B 1 35 ? -19.877 2.448   -1.662  1.00 0.00 ? 34 GLU B HG3  3  
ATOM 7878  N N    . LEU B 1 36 ? -16.037 1.808   0.822   1.00 0.00 ? 35 LEU B N    3  
ATOM 7879  C CA   . LEU B 1 36 ? -14.930 1.474   1.765   1.00 0.00 ? 35 LEU B CA   3  
ATOM 7880  C C    . LEU B 1 36 ? -13.938 2.643   1.832   1.00 0.00 ? 35 LEU B C    3  
ATOM 7881  O O    . LEU B 1 36 ? -13.430 2.966   2.887   1.00 0.00 ? 35 LEU B O    3  
ATOM 7882  C CB   . LEU B 1 36 ? -14.224 0.195   1.297   1.00 0.00 ? 35 LEU B CB   3  
ATOM 7883  C CG   . LEU B 1 36 ? -13.187 -0.267  2.341   1.00 0.00 ? 35 LEU B CG   3  
ATOM 7884  C CD1  . LEU B 1 36 ? -13.875 -1.002  3.501   1.00 0.00 ? 35 LEU B CD1  3  
ATOM 7885  C CD2  . LEU B 1 36 ? -12.191 -1.218  1.672   1.00 0.00 ? 35 LEU B CD2  3  
ATOM 7886  H H    . LEU B 1 36 ? -16.121 1.329   -0.029  1.00 0.00 ? 35 LEU B H    3  
ATOM 7887  H HA   . LEU B 1 36 ? -15.337 1.322   2.752   1.00 0.00 ? 35 LEU B HA   3  
ATOM 7888  H HB2  . LEU B 1 36 ? -14.959 -0.583  1.150   1.00 0.00 ? 35 LEU B HB2  3  
ATOM 7889  H HB3  . LEU B 1 36 ? -13.727 0.392   0.362   1.00 0.00 ? 35 LEU B HB3  3  
ATOM 7890  H HG   . LEU B 1 36 ? -12.656 0.589   2.728   1.00 0.00 ? 35 LEU B HG   3  
ATOM 7891  H HD11 . LEU B 1 36 ? -14.563 -1.737  3.112   1.00 0.00 ? 35 LEU B HD11 3  
ATOM 7892  H HD12 . LEU B 1 36 ? -13.127 -1.498  4.102   1.00 0.00 ? 35 LEU B HD12 3  
ATOM 7893  H HD13 . LEU B 1 36 ? -14.413 -0.294  4.115   1.00 0.00 ? 35 LEU B HD13 3  
ATOM 7894  H HD21 . LEU B 1 36 ? -11.716 -0.717  0.841   1.00 0.00 ? 35 LEU B HD21 3  
ATOM 7895  H HD22 . LEU B 1 36 ? -11.441 -1.518  2.388   1.00 0.00 ? 35 LEU B HD22 3  
ATOM 7896  H HD23 . LEU B 1 36 ? -12.715 -2.091  1.313   1.00 0.00 ? 35 LEU B HD23 3  
ATOM 7897  N N    . ILE B 1 37 ? -13.670 3.302   0.734   1.00 0.00 ? 36 ILE B N    3  
ATOM 7898  C CA   . ILE B 1 37 ? -12.732 4.463   0.773   1.00 0.00 ? 36 ILE B CA   3  
ATOM 7899  C C    . ILE B 1 37 ? -13.282 5.504   1.751   1.00 0.00 ? 36 ILE B C    3  
ATOM 7900  O O    . ILE B 1 37 ? -12.544 6.219   2.400   1.00 0.00 ? 36 ILE B O    3  
ATOM 7901  C CB   . ILE B 1 37 ? -12.632 5.077   -0.638  1.00 0.00 ? 36 ILE B CB   3  
ATOM 7902  C CG1  . ILE B 1 37 ? -11.837 4.117   -1.535  1.00 0.00 ? 36 ILE B CG1  3  
ATOM 7903  C CG2  . ILE B 1 37 ? -11.914 6.441   -0.582  1.00 0.00 ? 36 ILE B CG2  3  
ATOM 7904  C CD1  . ILE B 1 37 ? -11.799 4.643   -2.972  1.00 0.00 ? 36 ILE B CD1  3  
ATOM 7905  H H    . ILE B 1 37 ? -14.094 3.057   -0.115  1.00 0.00 ? 36 ILE B H    3  
ATOM 7906  H HA   . ILE B 1 37 ? -11.745 4.146   1.080   1.00 0.00 ? 36 ILE B HA   3  
ATOM 7907  H HB   . ILE B 1 37 ? -13.625 5.211   -1.043  1.00 0.00 ? 36 ILE B HB   3  
ATOM 7908  H HG12 . ILE B 1 37 ? -10.827 4.029   -1.159  1.00 0.00 ? 36 ILE B HG12 3  
ATOM 7909  H HG13 . ILE B 1 37 ? -12.306 3.146   -1.524  1.00 0.00 ? 36 ILE B HG13 3  
ATOM 7910  H HG21 . ILE B 1 37 ? -10.975 6.335   -0.060  1.00 0.00 ? 36 ILE B HG21 3  
ATOM 7911  H HG22 . ILE B 1 37 ? -11.724 6.797   -1.584  1.00 0.00 ? 36 ILE B HG22 3  
ATOM 7912  H HG23 . ILE B 1 37 ? -12.534 7.157   -0.064  1.00 0.00 ? 36 ILE B HG23 3  
ATOM 7913  H HD11 . ILE B 1 37 ? -12.793 4.932   -3.276  1.00 0.00 ? 36 ILE B HD11 3  
ATOM 7914  H HD12 . ILE B 1 37 ? -11.144 5.500   -3.023  1.00 0.00 ? 36 ILE B HD12 3  
ATOM 7915  H HD13 . ILE B 1 37 ? -11.431 3.869   -3.629  1.00 0.00 ? 36 ILE B HD13 3  
ATOM 7916  N N    . ASN B 1 38 ? -14.580 5.616   1.825   1.00 0.00 ? 37 ASN B N    3  
ATOM 7917  C CA   . ASN B 1 38 ? -15.201 6.635   2.716   1.00 0.00 ? 37 ASN B CA   3  
ATOM 7918  C C    . ASN B 1 38 ? -14.900 6.355   4.192   1.00 0.00 ? 37 ASN B C    3  
ATOM 7919  O O    . ASN B 1 38 ? -14.412 7.207   4.904   1.00 0.00 ? 37 ASN B O    3  
ATOM 7920  C CB   . ASN B 1 38 ? -16.717 6.620   2.511   1.00 0.00 ? 37 ASN B CB   3  
ATOM 7921  C CG   . ASN B 1 38 ? -17.045 7.049   1.080   1.00 0.00 ? 37 ASN B CG   3  
ATOM 7922  O OD1  . ASN B 1 38 ? -16.482 6.533   0.135   1.00 0.00 ? 37 ASN B OD1  3  
ATOM 7923  N ND2  . ASN B 1 38 ? -17.937 7.981   0.878   1.00 0.00 ? 37 ASN B ND2  3  
ATOM 7924  H H    . ASN B 1 38 ? -15.150 5.046   1.267   1.00 0.00 ? 37 ASN B H    3  
ATOM 7925  H HA   . ASN B 1 38 ? -14.825 7.610   2.443   1.00 0.00 ? 37 ASN B HA   3  
ATOM 7926  H HB2  . ASN B 1 38 ? -17.094 5.623   2.683   1.00 0.00 ? 37 ASN B HB2  3  
ATOM 7927  H HB3  . ASN B 1 38 ? -17.183 7.305   3.204   1.00 0.00 ? 37 ASN B HB3  3  
ATOM 7928  H HD21 . ASN B 1 38 ? -18.390 8.399   1.641   1.00 0.00 ? 37 ASN B HD21 3  
ATOM 7929  H HD22 . ASN B 1 38 ? -18.157 8.260   -0.036  1.00 0.00 ? 37 ASN B HD22 3  
ATOM 7930  N N    . ASN B 1 39 ? -15.227 5.185   4.671   1.00 0.00 ? 38 ASN B N    3  
ATOM 7931  C CA   . ASN B 1 39 ? -15.001 4.883   6.119   1.00 0.00 ? 38 ASN B CA   3  
ATOM 7932  C C    . ASN B 1 39 ? -13.537 4.521   6.401   1.00 0.00 ? 38 ASN B C    3  
ATOM 7933  O O    . ASN B 1 39 ? -13.204 4.137   7.504   1.00 0.00 ? 38 ASN B O    3  
ATOM 7934  C CB   . ASN B 1 39 ? -15.904 3.723   6.541   1.00 0.00 ? 38 ASN B CB   3  
ATOM 7935  C CG   . ASN B 1 39 ? -17.369 4.110   6.332   1.00 0.00 ? 38 ASN B CG   3  
ATOM 7936  O OD1  . ASN B 1 39 ? -17.833 4.202   5.212   1.00 0.00 ? 38 ASN B OD1  3  
ATOM 7937  N ND2  . ASN B 1 39 ? -18.124 4.340   7.371   1.00 0.00 ? 38 ASN B ND2  3  
ATOM 7938  H H    . ASN B 1 39 ? -15.650 4.518   4.091   1.00 0.00 ? 38 ASN B H    3  
ATOM 7939  H HA   . ASN B 1 39 ? -15.257 5.761   6.694   1.00 0.00 ? 38 ASN B HA   3  
ATOM 7940  H HB2  . ASN B 1 39 ? -15.673 2.853   5.945   1.00 0.00 ? 38 ASN B HB2  3  
ATOM 7941  H HB3  . ASN B 1 39 ? -15.740 3.500   7.584   1.00 0.00 ? 38 ASN B HB3  3  
ATOM 7942  H HD21 . ASN B 1 39 ? -17.751 4.263   8.274   1.00 0.00 ? 38 ASN B HD21 3  
ATOM 7943  H HD22 . ASN B 1 39 ? -19.063 4.589   7.248   1.00 0.00 ? 38 ASN B HD22 3  
ATOM 7944  N N    . GLU B 1 40 ? -12.661 4.629   5.429   1.00 0.00 ? 39 GLU B N    3  
ATOM 7945  C CA   . GLU B 1 40 ? -11.217 4.277   5.667   1.00 0.00 ? 39 GLU B CA   3  
ATOM 7946  C C    . GLU B 1 40 ? -10.316 5.476   5.349   1.00 0.00 ? 39 GLU B C    3  
ATOM 7947  O O    . GLU B 1 40 ? -9.241  5.604   5.902   1.00 0.00 ? 39 GLU B O    3  
ATOM 7948  C CB   . GLU B 1 40 ? -10.824 3.107   4.756   1.00 0.00 ? 39 GLU B CB   3  
ATOM 7949  C CG   . GLU B 1 40 ? -11.477 1.809   5.253   1.00 0.00 ? 39 GLU B CG   3  
ATOM 7950  C CD   . GLU B 1 40 ? -10.787 0.610   4.597   1.00 0.00 ? 39 GLU B CD   3  
ATOM 7951  O OE1  . GLU B 1 40 ? -9.984  0.829   3.705   1.00 0.00 ? 39 GLU B OE1  3  
ATOM 7952  O OE2  . GLU B 1 40 ? -11.072 -0.505  5.000   1.00 0.00 ? 39 GLU B OE2  3  
ATOM 7953  H H    . GLU B 1 40 ? -12.949 4.934   4.544   1.00 0.00 ? 39 GLU B H    3  
ATOM 7954  H HA   . GLU B 1 40 ? -11.062 3.992   6.698   1.00 0.00 ? 39 GLU B HA   3  
ATOM 7955  H HB2  . GLU B 1 40 ? -11.156 3.311   3.749   1.00 0.00 ? 39 GLU B HB2  3  
ATOM 7956  H HB3  . GLU B 1 40 ? -9.750  2.992   4.764   1.00 0.00 ? 39 GLU B HB3  3  
ATOM 7957  H HG2  . GLU B 1 40 ? -11.376 1.737   6.326   1.00 0.00 ? 39 GLU B HG2  3  
ATOM 7958  H HG3  . GLU B 1 40 ? -12.524 1.807   4.988   1.00 0.00 ? 39 GLU B HG3  3  
ATOM 7959  N N    . LEU B 1 41 ? -10.738 6.358   4.473   1.00 0.00 ? 40 LEU B N    3  
ATOM 7960  C CA   . LEU B 1 41 ? -9.896  7.556   4.129   1.00 0.00 ? 40 LEU B CA   3  
ATOM 7961  C C    . LEU B 1 41 ? -10.673 8.844   4.430   1.00 0.00 ? 40 LEU B C    3  
ATOM 7962  O O    . LEU B 1 41 ? -10.411 9.886   3.860   1.00 0.00 ? 40 LEU B O    3  
ATOM 7963  C CB   . LEU B 1 41 ? -9.529  7.509   2.636   1.00 0.00 ? 40 LEU B CB   3  
ATOM 7964  C CG   . LEU B 1 41 ? -8.358  6.525   2.404   1.00 0.00 ? 40 LEU B CG   3  
ATOM 7965  C CD1  . LEU B 1 41 ? -8.400  5.998   0.963   1.00 0.00 ? 40 LEU B CD1  3  
ATOM 7966  C CD2  . LEU B 1 41 ? -7.013  7.234   2.641   1.00 0.00 ? 40 LEU B CD2  3  
ATOM 7967  H H    . LEU B 1 41 ? -11.609 6.236   4.042   1.00 0.00 ? 40 LEU B H    3  
ATOM 7968  H HA   . LEU B 1 41 ? -8.990  7.555   4.717   1.00 0.00 ? 40 LEU B HA   3  
ATOM 7969  H HB2  . LEU B 1 41 ? -10.393 7.184   2.072   1.00 0.00 ? 40 LEU B HB2  3  
ATOM 7970  H HB3  . LEU B 1 41 ? -9.241  8.496   2.305   1.00 0.00 ? 40 LEU B HB3  3  
ATOM 7971  H HG   . LEU B 1 41 ? -8.449  5.690   3.086   1.00 0.00 ? 40 LEU B HG   3  
ATOM 7972  H HD11 . LEU B 1 41 ? -8.640  6.808   0.290   1.00 0.00 ? 40 LEU B HD11 3  
ATOM 7973  H HD12 . LEU B 1 41 ? -7.437  5.584   0.698   1.00 0.00 ? 40 LEU B HD12 3  
ATOM 7974  H HD13 . LEU B 1 41 ? -9.154  5.230   0.885   1.00 0.00 ? 40 LEU B HD13 3  
ATOM 7975  H HD21 . LEU B 1 41 ? -6.956  8.116   2.020   1.00 0.00 ? 40 LEU B HD21 3  
ATOM 7976  H HD22 . LEU B 1 41 ? -6.926  7.516   3.678   1.00 0.00 ? 40 LEU B HD22 3  
ATOM 7977  H HD23 . LEU B 1 41 ? -6.205  6.565   2.384   1.00 0.00 ? 40 LEU B HD23 3  
ATOM 7978  N N    . SER B 1 42 ? -11.624 8.782   5.324   1.00 0.00 ? 41 SER B N    3  
ATOM 7979  C CA   . SER B 1 42 ? -12.414 10.003  5.665   1.00 0.00 ? 41 SER B CA   3  
ATOM 7980  C C    . SER B 1 42 ? -11.556 10.961  6.494   1.00 0.00 ? 41 SER B C    3  
ATOM 7981  O O    . SER B 1 42 ? -11.775 12.156  6.497   1.00 0.00 ? 41 SER B O    3  
ATOM 7982  C CB   . SER B 1 42 ? -13.649 9.609   6.479   1.00 0.00 ? 41 SER B CB   3  
ATOM 7983  O OG   . SER B 1 42 ? -14.040 10.705  7.296   1.00 0.00 ? 41 SER B OG   3  
ATOM 7984  H H    . SER B 1 42 ? -11.818 7.933   5.774   1.00 0.00 ? 41 SER B H    3  
ATOM 7985  H HA   . SER B 1 42 ? -12.725 10.503  4.758   1.00 0.00 ? 41 SER B HA   3  
ATOM 7986  H HB2  . SER B 1 42 ? -14.459 9.359   5.815   1.00 0.00 ? 41 SER B HB2  3  
ATOM 7987  H HB3  . SER B 1 42 ? -13.414 8.752   7.097   1.00 0.00 ? 41 SER B HB3  3  
ATOM 7988  H HG   . SER B 1 42 ? -14.301 10.358  8.153   1.00 0.00 ? 41 SER B HG   3  
ATOM 7989  N N    . HIS B 1 43 ? -10.586 10.454  7.202   1.00 0.00 ? 42 HIS B N    3  
ATOM 7990  C CA   . HIS B 1 43 ? -9.731  11.349  8.028   1.00 0.00 ? 42 HIS B CA   3  
ATOM 7991  C C    . HIS B 1 43 ? -8.795  12.150  7.122   1.00 0.00 ? 42 HIS B C    3  
ATOM 7992  O O    . HIS B 1 43 ? -8.703  13.357  7.219   1.00 0.00 ? 42 HIS B O    3  
ATOM 7993  C CB   . HIS B 1 43 ? -8.896  10.511  8.994   1.00 0.00 ? 42 HIS B CB   3  
ATOM 7994  C CG   . HIS B 1 43 ? -8.022  11.423  9.807   1.00 0.00 ? 42 HIS B CG   3  
ATOM 7995  N ND1  . HIS B 1 43 ? -6.925  12.071  9.262   1.00 0.00 ? 42 HIS B ND1  3  
ATOM 7996  C CD2  . HIS B 1 43 ? -8.076  11.817  11.120  1.00 0.00 ? 42 HIS B CD2  3  
ATOM 7997  C CE1  . HIS B 1 43 ? -6.369  12.814  10.235  1.00 0.00 ? 42 HIS B CE1  3  
ATOM 7998  N NE2  . HIS B 1 43 ? -7.032  12.696  11.389  1.00 0.00 ? 42 HIS B NE2  3  
ATOM 7999  H H    . HIS B 1 43 ? -10.416 9.489   7.193   1.00 0.00 ? 42 HIS B H    3  
ATOM 8000  H HA   . HIS B 1 43 ? -10.356 12.027  8.589   1.00 0.00 ? 42 HIS B HA   3  
ATOM 8001  H HB2  . HIS B 1 43 ? -9.549  9.954   9.649   1.00 0.00 ? 42 HIS B HB2  3  
ATOM 8002  H HB3  . HIS B 1 43 ? -8.277  9.826   8.433   1.00 0.00 ? 42 HIS B HB3  3  
ATOM 8003  H HD1  . HIS B 1 43 ? -6.610  11.999  8.337   1.00 0.00 ? 42 HIS B HD1  3  
ATOM 8004  H HD2  . HIS B 1 43 ? -8.817  11.494  11.836  1.00 0.00 ? 42 HIS B HD2  3  
ATOM 8005  H HE1  . HIS B 1 43 ? -5.495  13.435  10.099  1.00 0.00 ? 42 HIS B HE1  3  
ATOM 8006  N N    . PHE B 1 44 ? -8.096  11.486  6.245   1.00 0.00 ? 43 PHE B N    3  
ATOM 8007  C CA   . PHE B 1 44 ? -7.162  12.207  5.340   1.00 0.00 ? 43 PHE B CA   3  
ATOM 8008  C C    . PHE B 1 44 ? -7.955  13.169  4.454   1.00 0.00 ? 43 PHE B C    3  
ATOM 8009  O O    . PHE B 1 44 ? -7.406  14.071  3.854   1.00 0.00 ? 43 PHE B O    3  
ATOM 8010  C CB   . PHE B 1 44 ? -6.413  11.193  4.474   1.00 0.00 ? 43 PHE B CB   3  
ATOM 8011  C CG   . PHE B 1 44 ? -5.429  10.434  5.335   1.00 0.00 ? 43 PHE B CG   3  
ATOM 8012  C CD1  . PHE B 1 44 ? -5.843  9.287   6.025   1.00 0.00 ? 43 PHE B CD1  3  
ATOM 8013  C CD2  . PHE B 1 44 ? -4.105  10.878  5.446   1.00 0.00 ? 43 PHE B CD2  3  
ATOM 8014  C CE1  . PHE B 1 44 ? -4.933  8.586   6.827   1.00 0.00 ? 43 PHE B CE1  3  
ATOM 8015  C CE2  . PHE B 1 44 ? -3.196  10.176  6.247   1.00 0.00 ? 43 PHE B CE2  3  
ATOM 8016  C CZ   . PHE B 1 44 ? -3.610  9.030   6.937   1.00 0.00 ? 43 PHE B CZ   3  
ATOM 8017  H H    . PHE B 1 44 ? -8.182  10.511  6.186   1.00 0.00 ? 43 PHE B H    3  
ATOM 8018  H HA   . PHE B 1 44 ? -6.453  12.767  5.931   1.00 0.00 ? 43 PHE B HA   3  
ATOM 8019  H HB2  . PHE B 1 44 ? -7.119  10.502  4.036   1.00 0.00 ? 43 PHE B HB2  3  
ATOM 8020  H HB3  . PHE B 1 44 ? -5.880  11.709  3.690   1.00 0.00 ? 43 PHE B HB3  3  
ATOM 8021  H HD1  . PHE B 1 44 ? -6.863  8.945   5.940   1.00 0.00 ? 43 PHE B HD1  3  
ATOM 8022  H HD2  . PHE B 1 44 ? -3.786  11.762  4.914   1.00 0.00 ? 43 PHE B HD2  3  
ATOM 8023  H HE1  . PHE B 1 44 ? -5.253  7.702   7.359   1.00 0.00 ? 43 PHE B HE1  3  
ATOM 8024  H HE2  . PHE B 1 44 ? -2.175  10.519  6.333   1.00 0.00 ? 43 PHE B HE2  3  
ATOM 8025  H HZ   . PHE B 1 44 ? -2.908  8.489   7.555   1.00 0.00 ? 43 PHE B HZ   3  
ATOM 8026  N N    . LEU B 1 45 ? -9.243  12.975  4.364   1.00 0.00 ? 44 LEU B N    3  
ATOM 8027  C CA   . LEU B 1 45 ? -10.085 13.864  3.511   1.00 0.00 ? 44 LEU B CA   3  
ATOM 8028  C C    . LEU B 1 45 ? -9.781  15.336  3.836   1.00 0.00 ? 44 LEU B C    3  
ATOM 8029  O O    . LEU B 1 45 ? -9.804  16.189  2.972   1.00 0.00 ? 44 LEU B O    3  
ATOM 8030  C CB   . LEU B 1 45 ? -11.572 13.549  3.781   1.00 0.00 ? 44 LEU B CB   3  
ATOM 8031  C CG   . LEU B 1 45 ? -12.430 13.786  2.520   1.00 0.00 ? 44 LEU B CG   3  
ATOM 8032  C CD1  . LEU B 1 45 ? -12.206 15.210  1.997   1.00 0.00 ? 44 LEU B CD1  3  
ATOM 8033  C CD2  . LEU B 1 45 ? -12.078 12.758  1.418   1.00 0.00 ? 44 LEU B CD2  3  
ATOM 8034  H H    . LEU B 1 45 ? -9.659  12.234  4.854   1.00 0.00 ? 44 LEU B H    3  
ATOM 8035  H HA   . LEU B 1 45 ? -9.856  13.676  2.475   1.00 0.00 ? 44 LEU B HA   3  
ATOM 8036  H HB2  . LEU B 1 45 ? -11.664 12.516  4.083   1.00 0.00 ? 44 LEU B HB2  3  
ATOM 8037  H HB3  . LEU B 1 45 ? -11.937 14.179  4.581   1.00 0.00 ? 44 LEU B HB3  3  
ATOM 8038  H HG   . LEU B 1 45 ? -13.473 13.675  2.786   1.00 0.00 ? 44 LEU B HG   3  
ATOM 8039  H HD11 . LEU B 1 45 ? -12.145 15.897  2.830   1.00 0.00 ? 44 LEU B HD11 3  
ATOM 8040  H HD12 . LEU B 1 45 ? -11.288 15.246  1.431   1.00 0.00 ? 44 LEU B HD12 3  
ATOM 8041  H HD13 . LEU B 1 45 ? -13.031 15.492  1.359   1.00 0.00 ? 44 LEU B HD13 3  
ATOM 8042  H HD21 . LEU B 1 45 ? -11.713 11.844  1.865   1.00 0.00 ? 44 LEU B HD21 3  
ATOM 8043  H HD22 . LEU B 1 45 ? -12.966 12.540  0.843   1.00 0.00 ? 44 LEU B HD22 3  
ATOM 8044  H HD23 . LEU B 1 45 ? -11.319 13.161  0.761   1.00 0.00 ? 44 LEU B HD23 3  
ATOM 8045  N N    . GLU B 1 46 ? -9.502  15.644  5.073   1.00 0.00 ? 45 GLU B N    3  
ATOM 8046  C CA   . GLU B 1 46 ? -9.208  17.062  5.431   1.00 0.00 ? 45 GLU B CA   3  
ATOM 8047  C C    . GLU B 1 46 ? -7.831  17.464  4.894   1.00 0.00 ? 45 GLU B C    3  
ATOM 8048  O O    . GLU B 1 46 ? -7.630  18.575  4.446   1.00 0.00 ? 45 GLU B O    3  
ATOM 8049  C CB   . GLU B 1 46 ? -9.228  17.227  6.953   1.00 0.00 ? 45 GLU B CB   3  
ATOM 8050  C CG   . GLU B 1 46 ? -9.174  18.717  7.303   1.00 0.00 ? 45 GLU B CG   3  
ATOM 8051  C CD   . GLU B 1 46 ? -9.153  18.884  8.823   1.00 0.00 ? 45 GLU B CD   3  
ATOM 8052  O OE1  . GLU B 1 46 ? -10.191 18.694  9.435   1.00 0.00 ? 45 GLU B OE1  3  
ATOM 8053  O OE2  . GLU B 1 46 ? -8.099  19.201  9.350   1.00 0.00 ? 45 GLU B OE2  3  
ATOM 8054  H H    . GLU B 1 46 ? -9.490  14.947  5.762   1.00 0.00 ? 45 GLU B H    3  
ATOM 8055  H HA   . GLU B 1 46 ? -9.957  17.701  4.994   1.00 0.00 ? 45 GLU B HA   3  
ATOM 8056  H HB2  . GLU B 1 46 ? -10.135 16.796  7.349   1.00 0.00 ? 45 GLU B HB2  3  
ATOM 8057  H HB3  . GLU B 1 46 ? -8.373  16.727  7.382   1.00 0.00 ? 45 GLU B HB3  3  
ATOM 8058  H HG2  . GLU B 1 46 ? -8.282  19.154  6.879   1.00 0.00 ? 45 GLU B HG2  3  
ATOM 8059  H HG3  . GLU B 1 46 ? -10.045 19.213  6.901   1.00 0.00 ? 45 GLU B HG3  3  
ATOM 8060  N N    . GLU B 1 47 ? -6.881  16.572  4.941   1.00 0.00 ? 46 GLU B N    3  
ATOM 8061  C CA   . GLU B 1 47 ? -5.514  16.906  4.441   1.00 0.00 ? 46 GLU B CA   3  
ATOM 8062  C C    . GLU B 1 47 ? -5.431  16.668  2.929   1.00 0.00 ? 46 GLU B C    3  
ATOM 8063  O O    . GLU B 1 47 ? -4.623  15.886  2.467   1.00 0.00 ? 46 GLU B O    3  
ATOM 8064  C CB   . GLU B 1 47 ? -4.488  16.012  5.140   1.00 0.00 ? 46 GLU B CB   3  
ATOM 8065  C CG   . GLU B 1 47 ? -4.331  16.444  6.599   1.00 0.00 ? 46 GLU B CG   3  
ATOM 8066  C CD   . GLU B 1 47 ? -3.203  15.640  7.250   1.00 0.00 ? 46 GLU B CD   3  
ATOM 8067  O OE1  . GLU B 1 47 ? -2.522  14.927  6.533   1.00 0.00 ? 46 GLU B OE1  3  
ATOM 8068  O OE2  . GLU B 1 47 ? -3.041  15.751  8.454   1.00 0.00 ? 46 GLU B OE2  3  
ATOM 8069  H H    . GLU B 1 47 ? -7.064  15.685  5.314   1.00 0.00 ? 46 GLU B H    3  
ATOM 8070  H HA   . GLU B 1 47 ? -5.291  17.941  4.655   1.00 0.00 ? 46 GLU B HA   3  
ATOM 8071  H HB2  . GLU B 1 47 ? -4.823  14.986  5.103   1.00 0.00 ? 46 GLU B HB2  3  
ATOM 8072  H HB3  . GLU B 1 47 ? -3.536  16.097  4.637   1.00 0.00 ? 46 GLU B HB3  3  
ATOM 8073  H HG2  . GLU B 1 47 ? -4.093  17.498  6.639   1.00 0.00 ? 46 GLU B HG2  3  
ATOM 8074  H HG3  . GLU B 1 47 ? -5.252  16.262  7.131   1.00 0.00 ? 46 GLU B HG3  3  
ATOM 8075  N N    . ILE B 1 48 ? -6.253  17.335  2.153   1.00 0.00 ? 47 ILE B N    3  
ATOM 8076  C CA   . ILE B 1 48 ? -6.221  17.151  0.662   1.00 0.00 ? 47 ILE B CA   3  
ATOM 8077  C C    . ILE B 1 48 ? -6.002  18.507  -0.010  1.00 0.00 ? 47 ILE B C    3  
ATOM 8078  O O    . ILE B 1 48 ? -6.877  19.350  -0.021  1.00 0.00 ? 47 ILE B O    3  
ATOM 8079  C CB   . ILE B 1 48 ? -7.556  16.572  0.178   1.00 0.00 ? 47 ILE B CB   3  
ATOM 8080  C CG1  . ILE B 1 48 ? -7.934  15.316  0.994   1.00 0.00 ? 47 ILE B CG1  3  
ATOM 8081  C CG2  . ILE B 1 48 ? -7.452  16.229  -1.311  1.00 0.00 ? 47 ILE B CG2  3  
ATOM 8082  C CD1  . ILE B 1 48 ? -7.111  14.091  0.563   1.00 0.00 ? 47 ILE B CD1  3  
ATOM 8083  H H    . ILE B 1 48 ? -6.894  17.962  2.551   1.00 0.00 ? 47 ILE B H    3  
ATOM 8084  H HA   . ILE B 1 48 ? -5.416  16.491  0.380   1.00 0.00 ? 47 ILE B HA   3  
ATOM 8085  H HB   . ILE B 1 48 ? -8.326  17.322  0.308   1.00 0.00 ? 47 ILE B HB   3  
ATOM 8086  H HG12 . ILE B 1 48 ? -7.760  15.506  2.041   1.00 0.00 ? 47 ILE B HG12 3  
ATOM 8087  H HG13 . ILE B 1 48 ? -8.983  15.105  0.845   1.00 0.00 ? 47 ILE B HG13 3  
ATOM 8088  H HG21 . ILE B 1 48 ? -6.595  15.595  -1.479  1.00 0.00 ? 47 ILE B HG21 3  
ATOM 8089  H HG22 . ILE B 1 48 ? -8.348  15.716  -1.624  1.00 0.00 ? 47 ILE B HG22 3  
ATOM 8090  H HG23 . ILE B 1 48 ? -7.341  17.139  -1.882  1.00 0.00 ? 47 ILE B HG23 3  
ATOM 8091  H HD11 . ILE B 1 48 ? -6.060  14.323  0.600   1.00 0.00 ? 47 ILE B HD11 3  
ATOM 8092  H HD12 . ILE B 1 48 ? -7.319  13.270  1.233   1.00 0.00 ? 47 ILE B HD12 3  
ATOM 8093  H HD13 . ILE B 1 48 ? -7.382  13.804  -0.442  1.00 0.00 ? 47 ILE B HD13 3  
ATOM 8094  N N    . LYS B 1 49 ? -4.845  18.726  -0.579  1.00 0.00 ? 48 LYS B N    3  
ATOM 8095  C CA   . LYS B 1 49 ? -4.580  20.031  -1.256  1.00 0.00 ? 48 LYS B CA   3  
ATOM 8096  C C    . LYS B 1 49 ? -4.994  19.928  -2.726  1.00 0.00 ? 48 LYS B C    3  
ATOM 8097  O O    . LYS B 1 49 ? -5.633  20.810  -3.264  1.00 0.00 ? 48 LYS B O    3  
ATOM 8098  C CB   . LYS B 1 49 ? -3.086  20.359  -1.173  1.00 0.00 ? 48 LYS B CB   3  
ATOM 8099  C CG   . LYS B 1 49 ? -2.625  20.346  0.290   1.00 0.00 ? 48 LYS B CG   3  
ATOM 8100  C CD   . LYS B 1 49 ? -3.173  21.571  1.035   1.00 0.00 ? 48 LYS B CD   3  
ATOM 8101  C CE   . LYS B 1 49 ? -2.385  21.776  2.332   1.00 0.00 ? 48 LYS B CE   3  
ATOM 8102  N NZ   . LYS B 1 49 ? -3.008  22.873  3.123   1.00 0.00 ? 48 LYS B NZ   3  
ATOM 8103  H H    . LYS B 1 49 ? -4.152  18.032  -0.565  1.00 0.00 ? 48 LYS B H    3  
ATOM 8104  H HA   . LYS B 1 49 ? -5.152  20.808  -0.769  1.00 0.00 ? 48 LYS B HA   3  
ATOM 8105  H HB2  . LYS B 1 49 ? -2.529  19.618  -1.729  1.00 0.00 ? 48 LYS B HB2  3  
ATOM 8106  H HB3  . LYS B 1 49 ? -2.907  21.333  -1.600  1.00 0.00 ? 48 LYS B HB3  3  
ATOM 8107  H HG2  . LYS B 1 49 ? -2.984  19.446  0.770   1.00 0.00 ? 48 LYS B HG2  3  
ATOM 8108  H HG3  . LYS B 1 49 ? -1.545  20.362  0.322   1.00 0.00 ? 48 LYS B HG3  3  
ATOM 8109  H HD2  . LYS B 1 49 ? -3.075  22.450  0.414   1.00 0.00 ? 48 LYS B HD2  3  
ATOM 8110  H HD3  . LYS B 1 49 ? -4.213  21.412  1.273   1.00 0.00 ? 48 LYS B HD3  3  
ATOM 8111  H HE2  . LYS B 1 49 ? -2.397  20.863  2.909   1.00 0.00 ? 48 LYS B HE2  3  
ATOM 8112  H HE3  . LYS B 1 49 ? -1.364  22.038  2.095   1.00 0.00 ? 48 LYS B HE3  3  
ATOM 8113  H HZ1  . LYS B 1 49 ? -3.753  23.327  2.559   1.00 0.00 ? 48 LYS B HZ1  3  
ATOM 8114  H HZ2  . LYS B 1 49 ? -3.424  22.482  3.991   1.00 0.00 ? 48 LYS B HZ2  3  
ATOM 8115  H HZ3  . LYS B 1 49 ? -2.282  23.576  3.372   1.00 0.00 ? 48 LYS B HZ3  3  
ATOM 8116  N N    . GLU B 1 50 ? -4.632  18.855  -3.381  1.00 0.00 ? 49 GLU B N    3  
ATOM 8117  C CA   . GLU B 1 50 ? -5.003  18.692  -4.818  1.00 0.00 ? 49 GLU B CA   3  
ATOM 8118  C C    . GLU B 1 50 ? -6.398  18.067  -4.911  1.00 0.00 ? 49 GLU B C    3  
ATOM 8119  O O    . GLU B 1 50 ? -6.567  16.879  -4.714  1.00 0.00 ? 49 GLU B O    3  
ATOM 8120  C CB   . GLU B 1 50 ? -3.985  17.777  -5.509  1.00 0.00 ? 49 GLU B CB   3  
ATOM 8121  C CG   . GLU B 1 50 ? -2.652  18.515  -5.679  1.00 0.00 ? 49 GLU B CG   3  
ATOM 8122  C CD   . GLU B 1 50 ? -1.973  18.678  -4.318  1.00 0.00 ? 49 GLU B CD   3  
ATOM 8123  O OE1  . GLU B 1 50 ? -2.285  17.906  -3.426  1.00 0.00 ? 49 GLU B OE1  3  
ATOM 8124  O OE2  . GLU B 1 50 ? -1.151  19.570  -4.191  1.00 0.00 ? 49 GLU B OE2  3  
ATOM 8125  H H    . GLU B 1 50 ? -4.117  18.155  -2.927  1.00 0.00 ? 49 GLU B H    3  
ATOM 8126  H HA   . GLU B 1 50 ? -5.006  19.660  -5.299  1.00 0.00 ? 49 GLU B HA   3  
ATOM 8127  H HB2  . GLU B 1 50 ? -3.832  16.893  -4.908  1.00 0.00 ? 49 GLU B HB2  3  
ATOM 8128  H HB3  . GLU B 1 50 ? -4.360  17.491  -6.479  1.00 0.00 ? 49 GLU B HB3  3  
ATOM 8129  H HG2  . GLU B 1 50 ? -2.008  17.946  -6.334  1.00 0.00 ? 49 GLU B HG2  3  
ATOM 8130  H HG3  . GLU B 1 50 ? -2.829  19.490  -6.109  1.00 0.00 ? 49 GLU B HG3  3  
ATOM 8131  N N    . GLN B 1 51 ? -7.399  18.845  -5.218  1.00 0.00 ? 50 GLN B N    3  
ATOM 8132  C CA   . GLN B 1 51 ? -8.773  18.276  -5.328  1.00 0.00 ? 50 GLN B CA   3  
ATOM 8133  C C    . GLN B 1 51 ? -8.942  17.606  -6.697  1.00 0.00 ? 50 GLN B C    3  
ATOM 8134  O O    . GLN B 1 51 ? -9.766  16.730  -6.871  1.00 0.00 ? 50 GLN B O    3  
ATOM 8135  C CB   . GLN B 1 51 ? -9.802  19.401  -5.178  1.00 0.00 ? 50 GLN B CB   3  
ATOM 8136  C CG   . GLN B 1 51 ? -9.594  20.112  -3.838  1.00 0.00 ? 50 GLN B CG   3  
ATOM 8137  C CD   . GLN B 1 51 ? -10.549 21.303  -3.737  1.00 0.00 ? 50 GLN B CD   3  
ATOM 8138  O OE1  . GLN B 1 51 ? -11.408 21.480  -4.578  1.00 0.00 ? 50 GLN B OE1  3  
ATOM 8139  N NE2  . GLN B 1 51 ? -10.434 22.132  -2.736  1.00 0.00 ? 50 GLN B NE2  3  
ATOM 8140  H H    . GLN B 1 51 ? -7.252  19.798  -5.390  1.00 0.00 ? 50 GLN B H    3  
ATOM 8141  H HA   . GLN B 1 51 ? -8.924  17.547  -4.544  1.00 0.00 ? 50 GLN B HA   3  
ATOM 8142  H HB2  . GLN B 1 51 ? -9.682  20.109  -5.985  1.00 0.00 ? 50 GLN B HB2  3  
ATOM 8143  H HB3  . GLN B 1 51 ? -10.798 18.984  -5.210  1.00 0.00 ? 50 GLN B HB3  3  
ATOM 8144  H HG2  . GLN B 1 51 ? -9.791  19.423  -3.031  1.00 0.00 ? 50 GLN B HG2  3  
ATOM 8145  H HG3  . GLN B 1 51 ? -8.575  20.464  -3.771  1.00 0.00 ? 50 GLN B HG3  3  
ATOM 8146  H HE21 . GLN B 1 51 ? -9.740  21.989  -2.058  1.00 0.00 ? 50 GLN B HE21 3  
ATOM 8147  H HE22 . GLN B 1 51 ? -11.042 22.897  -2.659  1.00 0.00 ? 50 GLN B HE22 3  
ATOM 8148  N N    . GLU B 1 52 ? -8.173  18.014  -7.672  1.00 0.00 ? 51 GLU B N    3  
ATOM 8149  C CA   . GLU B 1 52 ? -8.299  17.404  -9.030  1.00 0.00 ? 51 GLU B CA   3  
ATOM 8150  C C    . GLU B 1 52 ? -7.688  15.995  -9.053  1.00 0.00 ? 51 GLU B C    3  
ATOM 8151  O O    . GLU B 1 52 ? -8.066  15.173  -9.863  1.00 0.00 ? 51 GLU B O    3  
ATOM 8152  C CB   . GLU B 1 52 ? -7.617  18.286  -10.076 1.00 0.00 ? 51 GLU B CB   3  
ATOM 8153  C CG   . GLU B 1 52 ? -8.144  19.718  -9.966  1.00 0.00 ? 51 GLU B CG   3  
ATOM 8154  C CD   . GLU B 1 52 ? -9.652  19.732  -10.229 1.00 0.00 ? 51 GLU B CD   3  
ATOM 8155  O OE1  . GLU B 1 52 ? -10.111 18.886  -10.979 1.00 0.00 ? 51 GLU B OE1  3  
ATOM 8156  O OE2  . GLU B 1 52 ? -10.322 20.589  -9.676  1.00 0.00 ? 51 GLU B OE2  3  
ATOM 8157  H H    . GLU B 1 52 ? -7.514  18.722  -7.511  1.00 0.00 ? 51 GLU B H    3  
ATOM 8158  H HA   . GLU B 1 52 ? -9.347  17.299  -9.267  1.00 0.00 ? 51 GLU B HA   3  
ATOM 8159  H HB2  . GLU B 1 52 ? -6.549  18.280  -9.911  1.00 0.00 ? 51 GLU B HB2  3  
ATOM 8160  H HB3  . GLU B 1 52 ? -7.830  17.902  -11.063 1.00 0.00 ? 51 GLU B HB3  3  
ATOM 8161  H HG2  . GLU B 1 52 ? -7.947  20.100  -8.975  1.00 0.00 ? 51 GLU B HG2  3  
ATOM 8162  H HG3  . GLU B 1 52 ? -7.649  20.340  -10.697 1.00 0.00 ? 51 GLU B HG3  3  
ATOM 8163  N N    . VAL B 1 53 ? -6.789  15.679  -8.161  1.00 0.00 ? 52 VAL B N    3  
ATOM 8164  C CA   . VAL B 1 53 ? -6.231  14.294  -8.150  1.00 0.00 ? 52 VAL B CA   3  
ATOM 8165  C C    . VAL B 1 53 ? -7.313  13.358  -7.612  1.00 0.00 ? 52 VAL B C    3  
ATOM 8166  O O    . VAL B 1 53 ? -7.590  12.328  -8.191  1.00 0.00 ? 52 VAL B O    3  
ATOM 8167  C CB   . VAL B 1 53 ? -4.997  14.228  -7.239  1.00 0.00 ? 52 VAL B CB   3  
ATOM 8168  C CG1  . VAL B 1 53 ? -4.614  12.764  -6.988  1.00 0.00 ? 52 VAL B CG1  3  
ATOM 8169  C CG2  . VAL B 1 53 ? -3.824  14.939  -7.915  1.00 0.00 ? 52 VAL B CG2  3  
ATOM 8170  H H    . VAL B 1 53 ? -6.523  16.316  -7.463  1.00 0.00 ? 52 VAL B H    3  
ATOM 8171  H HA   . VAL B 1 53 ? -5.964  13.977  -9.150  1.00 0.00 ? 52 VAL B HA   3  
ATOM 8172  H HB   . VAL B 1 53 ? -5.218  14.708  -6.297  1.00 0.00 ? 52 VAL B HB   3  
ATOM 8173  H HG11 . VAL B 1 53 ? -4.648  12.219  -7.920  1.00 0.00 ? 52 VAL B HG11 3  
ATOM 8174  H HG12 . VAL B 1 53 ? -3.616  12.715  -6.578  1.00 0.00 ? 52 VAL B HG12 3  
ATOM 8175  H HG13 . VAL B 1 53 ? -5.312  12.324  -6.290  1.00 0.00 ? 52 VAL B HG13 3  
ATOM 8176  H HG21 . VAL B 1 53 ? -4.132  15.924  -8.229  1.00 0.00 ? 52 VAL B HG21 3  
ATOM 8177  H HG22 . VAL B 1 53 ? -3.005  15.023  -7.215  1.00 0.00 ? 52 VAL B HG22 3  
ATOM 8178  H HG23 . VAL B 1 53 ? -3.506  14.369  -8.775  1.00 0.00 ? 52 VAL B HG23 3  
ATOM 8179  N N    . VAL B 1 54 ? -7.937  13.704  -6.526  1.00 0.00 ? 53 VAL B N    3  
ATOM 8180  C CA   . VAL B 1 54 ? -9.004  12.819  -5.985  1.00 0.00 ? 53 VAL B CA   3  
ATOM 8181  C C    . VAL B 1 54 ? -10.143 12.738  -7.001  1.00 0.00 ? 53 VAL B C    3  
ATOM 8182  O O    . VAL B 1 54 ? -10.809 11.729  -7.127  1.00 0.00 ? 53 VAL B O    3  
ATOM 8183  C CB   . VAL B 1 54 ? -9.527  13.390  -4.666  1.00 0.00 ? 53 VAL B CB   3  
ATOM 8184  C CG1  . VAL B 1 54 ? -10.702 12.543  -4.170  1.00 0.00 ? 53 VAL B CG1  3  
ATOM 8185  C CG2  . VAL B 1 54 ? -8.407  13.361  -3.624  1.00 0.00 ? 53 VAL B CG2  3  
ATOM 8186  H H    . VAL B 1 54 ? -7.716  14.540  -6.062  1.00 0.00 ? 53 VAL B H    3  
ATOM 8187  H HA   . VAL B 1 54 ? -8.601  11.831  -5.817  1.00 0.00 ? 53 VAL B HA   3  
ATOM 8188  H HB   . VAL B 1 54 ? -9.854  14.408  -4.818  1.00 0.00 ? 53 VAL B HB   3  
ATOM 8189  H HG11 . VAL B 1 54 ? -10.424 11.499  -4.181  1.00 0.00 ? 53 VAL B HG11 3  
ATOM 8190  H HG12 . VAL B 1 54 ? -10.956 12.836  -3.162  1.00 0.00 ? 53 VAL B HG12 3  
ATOM 8191  H HG13 . VAL B 1 54 ? -11.555 12.695  -4.814  1.00 0.00 ? 53 VAL B HG13 3  
ATOM 8192  H HG21 . VAL B 1 54 ? -8.020  12.356  -3.540  1.00 0.00 ? 53 VAL B HG21 3  
ATOM 8193  H HG22 . VAL B 1 54 ? -7.614  14.028  -3.929  1.00 0.00 ? 53 VAL B HG22 3  
ATOM 8194  H HG23 . VAL B 1 54 ? -8.795  13.677  -2.669  1.00 0.00 ? 53 VAL B HG23 3  
ATOM 8195  N N    . ASP B 1 55 ? -10.373 13.799  -7.727  1.00 0.00 ? 54 ASP B N    3  
ATOM 8196  C CA   . ASP B 1 55 ? -11.468 13.791  -8.735  1.00 0.00 ? 54 ASP B CA   3  
ATOM 8197  C C    . ASP B 1 55 ? -11.212 12.685  -9.759  1.00 0.00 ? 54 ASP B C    3  
ATOM 8198  O O    . ASP B 1 55 ? -12.100 11.938  -10.119 1.00 0.00 ? 54 ASP B O    3  
ATOM 8199  C CB   . ASP B 1 55 ? -11.508 15.140  -9.455  1.00 0.00 ? 54 ASP B CB   3  
ATOM 8200  C CG   . ASP B 1 55 ? -11.927 16.233  -8.471  1.00 0.00 ? 54 ASP B CG   3  
ATOM 8201  O OD1  . ASP B 1 55 ? -12.311 15.891  -7.365  1.00 0.00 ? 54 ASP B OD1  3  
ATOM 8202  O OD2  . ASP B 1 55 ? -11.858 17.394  -8.840  1.00 0.00 ? 54 ASP B OD2  3  
ATOM 8203  H H    . ASP B 1 55 ? -9.824  14.602  -7.607  1.00 0.00 ? 54 ASP B H    3  
ATOM 8204  H HA   . ASP B 1 55 ? -12.409 13.625  -8.233  1.00 0.00 ? 54 ASP B HA   3  
ATOM 8205  H HB2  . ASP B 1 55 ? -10.529 15.365  -9.851  1.00 0.00 ? 54 ASP B HB2  3  
ATOM 8206  H HB3  . ASP B 1 55 ? -12.222 15.095  -10.265 1.00 0.00 ? 54 ASP B HB3  3  
ATOM 8207  N N    . LYS B 1 56 ? -10.001 12.588  -10.243 1.00 0.00 ? 55 LYS B N    3  
ATOM 8208  C CA   . LYS B 1 56 ? -9.684  11.547  -11.260 1.00 0.00 ? 55 LYS B CA   3  
ATOM 8209  C C    . LYS B 1 56 ? -9.725  10.161  -10.615 1.00 0.00 ? 55 LYS B C    3  
ATOM 8210  O O    . LYS B 1 56 ? -10.016 9.181   -11.270 1.00 0.00 ? 55 LYS B O    3  
ATOM 8211  C CB   . LYS B 1 56 ? -8.302  11.812  -11.866 1.00 0.00 ? 55 LYS B CB   3  
ATOM 8212  C CG   . LYS B 1 56 ? -8.253  13.230  -12.456 1.00 0.00 ? 55 LYS B CG   3  
ATOM 8213  C CD   . LYS B 1 56 ? -9.028  13.286  -13.779 1.00 0.00 ? 55 LYS B CD   3  
ATOM 8214  C CE   . LYS B 1 56 ? -8.699  14.590  -14.510 1.00 0.00 ? 55 LYS B CE   3  
ATOM 8215  N NZ   . LYS B 1 56 ? -9.328  14.570  -15.861 1.00 0.00 ? 55 LYS B NZ   3  
ATOM 8216  H H    . LYS B 1 56 ? -9.304  13.211  -9.947  1.00 0.00 ? 55 LYS B H    3  
ATOM 8217  H HA   . LYS B 1 56 ? -10.438 11.574  -12.030 1.00 0.00 ? 55 LYS B HA   3  
ATOM 8218  H HB2  . LYS B 1 56 ? -7.552  11.721  -11.091 1.00 0.00 ? 55 LYS B HB2  3  
ATOM 8219  H HB3  . LYS B 1 56 ? -8.103  11.090  -12.642 1.00 0.00 ? 55 LYS B HB3  3  
ATOM 8220  H HG2  . LYS B 1 56 ? -8.694  13.924  -11.755 1.00 0.00 ? 55 LYS B HG2  3  
ATOM 8221  H HG3  . LYS B 1 56 ? -7.225  13.507  -12.633 1.00 0.00 ? 55 LYS B HG3  3  
ATOM 8222  H HD2  . LYS B 1 56 ? -8.750  12.447  -14.401 1.00 0.00 ? 55 LYS B HD2  3  
ATOM 8223  H HD3  . LYS B 1 56 ? -10.088 13.251  -13.580 1.00 0.00 ? 55 LYS B HD3  3  
ATOM 8224  H HE2  . LYS B 1 56 ? -9.084  15.426  -13.947 1.00 0.00 ? 55 LYS B HE2  3  
ATOM 8225  H HE3  . LYS B 1 56 ? -7.629  14.687  -14.614 1.00 0.00 ? 55 LYS B HE3  3  
ATOM 8226  H HZ1  . LYS B 1 56 ? -9.434  13.586  -16.179 1.00 0.00 ? 55 LYS B HZ1  3  
ATOM 8227  H HZ2  . LYS B 1 56 ? -10.265 15.019  -15.814 1.00 0.00 ? 55 LYS B HZ2  3  
ATOM 8228  H HZ3  . LYS B 1 56 ? -8.725  15.089  -16.531 1.00 0.00 ? 55 LYS B HZ3  3  
ATOM 8229  N N    . VAL B 1 57 ? -9.483  10.061  -9.338  1.00 0.00 ? 56 VAL B N    3  
ATOM 8230  C CA   . VAL B 1 57 ? -9.563  8.730   -8.674  1.00 0.00 ? 56 VAL B CA   3  
ATOM 8231  C C    . VAL B 1 57 ? -11.018 8.262   -8.703  1.00 0.00 ? 56 VAL B C    3  
ATOM 8232  O O    . VAL B 1 57 ? -11.330 7.198   -9.200  1.00 0.00 ? 56 VAL B O    3  
ATOM 8233  C CB   . VAL B 1 57 ? -9.109  8.862   -7.218  1.00 0.00 ? 56 VAL B CB   3  
ATOM 8234  C CG1  . VAL B 1 57 ? -9.298  7.523   -6.503  1.00 0.00 ? 56 VAL B CG1  3  
ATOM 8235  C CG2  . VAL B 1 57 ? -7.627  9.256   -7.175  1.00 0.00 ? 56 VAL B CG2  3  
ATOM 8236  H H    . VAL B 1 57 ? -9.289  10.854  -8.799  1.00 0.00 ? 56 VAL B H    3  
ATOM 8237  H HA   . VAL B 1 57 ? -8.946  7.996   -9.173  1.00 0.00 ? 56 VAL B HA   3  
ATOM 8238  H HB   . VAL B 1 57 ? -9.700  9.621   -6.725  1.00 0.00 ? 56 VAL B HB   3  
ATOM 8239  H HG11 . VAL B 1 57 ? -8.884  6.730   -7.109  1.00 0.00 ? 56 VAL B HG11 3  
ATOM 8240  H HG12 . VAL B 1 57 ? -8.790  7.549   -5.550  1.00 0.00 ? 56 VAL B HG12 3  
ATOM 8241  H HG13 . VAL B 1 57 ? -10.351 7.343   -6.345  1.00 0.00 ? 56 VAL B HG13 3  
ATOM 8242  H HG21 . VAL B 1 57 ? -7.430  10.007  -7.925  1.00 0.00 ? 56 VAL B HG21 3  
ATOM 8243  H HG22 . VAL B 1 57 ? -7.390  9.654   -6.199  1.00 0.00 ? 56 VAL B HG22 3  
ATOM 8244  H HG23 . VAL B 1 57 ? -7.015  8.387   -7.368  1.00 0.00 ? 56 VAL B HG23 3  
ATOM 8245  N N    . MET B 1 58 ? -11.908 9.047   -8.162  1.00 0.00 ? 57 MET B N    3  
ATOM 8246  C CA   . MET B 1 58 ? -13.343 8.649   -8.141  1.00 0.00 ? 57 MET B CA   3  
ATOM 8247  C C    . MET B 1 58 ? -13.832 8.347   -9.561  1.00 0.00 ? 57 MET B C    3  
ATOM 8248  O O    . MET B 1 58 ? -14.744 7.569   -9.754  1.00 0.00 ? 57 MET B O    3  
ATOM 8249  C CB   . MET B 1 58 ? -14.178 9.785   -7.546  1.00 0.00 ? 57 MET B CB   3  
ATOM 8250  C CG   . MET B 1 58 ? -13.762 10.019  -6.092  1.00 0.00 ? 57 MET B CG   3  
ATOM 8251  S SD   . MET B 1 58 ? -14.296 8.619   -5.076  1.00 0.00 ? 57 MET B SD   3  
ATOM 8252  C CE   . MET B 1 58 ? -13.305 9.006   -3.612  1.00 0.00 ? 57 MET B CE   3  
ATOM 8253  H H    . MET B 1 58 ? -11.635 9.889   -7.740  1.00 0.00 ? 57 MET B H    3  
ATOM 8254  H HA   . MET B 1 58 ? -13.459 7.764   -7.533  1.00 0.00 ? 57 MET B HA   3  
ATOM 8255  H HB2  . MET B 1 58 ? -14.015 10.687  -8.118  1.00 0.00 ? 57 MET B HB2  3  
ATOM 8256  H HB3  . MET B 1 58 ? -15.223 9.520   -7.581  1.00 0.00 ? 57 MET B HB3  3  
ATOM 8257  H HG2  . MET B 1 58 ? -12.688 10.115  -6.036  1.00 0.00 ? 57 MET B HG2  3  
ATOM 8258  H HG3  . MET B 1 58 ? -14.224 10.925  -5.728  1.00 0.00 ? 57 MET B HG3  3  
ATOM 8259  H HE1  . MET B 1 58 ? -13.483 10.027  -3.315  1.00 0.00 ? 57 MET B HE1  3  
ATOM 8260  H HE2  . MET B 1 58 ? -13.584 8.344   -2.803  1.00 0.00 ? 57 MET B HE2  3  
ATOM 8261  H HE3  . MET B 1 58 ? -12.257 8.878   -3.844  1.00 0.00 ? 57 MET B HE3  3  
ATOM 8262  N N    . GLU B 1 59 ? -13.223 8.933   -10.564 1.00 0.00 ? 58 GLU B N    3  
ATOM 8263  C CA   . GLU B 1 59 ? -13.647 8.647   -11.968 1.00 0.00 ? 58 GLU B CA   3  
ATOM 8264  C C    . GLU B 1 59 ? -12.922 7.396   -12.470 1.00 0.00 ? 58 GLU B C    3  
ATOM 8265  O O    . GLU B 1 59 ? -13.479 6.611   -13.209 1.00 0.00 ? 58 GLU B O    3  
ATOM 8266  C CB   . GLU B 1 59 ? -13.346 9.843   -12.876 1.00 0.00 ? 58 GLU B CB   3  
ATOM 8267  C CG   . GLU B 1 59 ? -14.073 9.671   -14.216 1.00 0.00 ? 58 GLU B CG   3  
ATOM 8268  C CD   . GLU B 1 59 ? -13.444 10.592  -15.264 1.00 0.00 ? 58 GLU B CD   3  
ATOM 8269  O OE1  . GLU B 1 59 ? -12.227 10.639  -15.329 1.00 0.00 ? 58 GLU B OE1  3  
ATOM 8270  O OE2  . GLU B 1 59 ? -14.191 11.233  -15.985 1.00 0.00 ? 58 GLU B OE2  3  
ATOM 8271  H H    . GLU B 1 59 ? -12.467 9.526   -10.395 1.00 0.00 ? 58 GLU B H    3  
ATOM 8272  H HA   . GLU B 1 59 ? -14.704 8.417   -11.990 1.00 0.00 ? 58 GLU B HA   3  
ATOM 8273  H HB2  . GLU B 1 59 ? -13.686 10.750  -12.397 1.00 0.00 ? 58 GLU B HB2  3  
ATOM 8274  H HB3  . GLU B 1 59 ? -12.282 9.904   -13.048 1.00 0.00 ? 58 GLU B HB3  3  
ATOM 8275  H HG2  . GLU B 1 59 ? -13.989 8.644   -14.544 1.00 0.00 ? 58 GLU B HG2  3  
ATOM 8276  H HG3  . GLU B 1 59 ? -15.115 9.926   -14.096 1.00 0.00 ? 58 GLU B HG3  3  
ATOM 8277  N N    . THR B 1 60 ? -11.696 7.183   -12.075 1.00 0.00 ? 59 THR B N    3  
ATOM 8278  C CA   . THR B 1 60 ? -10.989 5.958   -12.548 1.00 0.00 ? 59 THR B CA   3  
ATOM 8279  C C    . THR B 1 60 ? -11.655 4.741   -11.904 1.00 0.00 ? 59 THR B C    3  
ATOM 8280  O O    . THR B 1 60 ? -11.933 3.762   -12.568 1.00 0.00 ? 59 THR B O    3  
ATOM 8281  C CB   . THR B 1 60 ? -9.503  6.019   -12.181 1.00 0.00 ? 59 THR B CB   3  
ATOM 8282  O OG1  . THR B 1 60 ? -9.025  7.344   -12.366 1.00 0.00 ? 59 THR B OG1  3  
ATOM 8283  C CG2  . THR B 1 60 ? -8.711  5.062   -13.076 1.00 0.00 ? 59 THR B CG2  3  
ATOM 8284  H H    . THR B 1 60 ? -11.254 7.808   -11.462 1.00 0.00 ? 59 THR B H    3  
ATOM 8285  H HA   . THR B 1 60 ? -11.110 5.868   -13.618 1.00 0.00 ? 59 THR B HA   3  
ATOM 8286  H HB   . THR B 1 60 ? -9.374  5.731   -11.149 1.00 0.00 ? 59 THR B HB   3  
ATOM 8287  H HG1  . THR B 1 60 ? -9.651  7.810   -12.923 1.00 0.00 ? 59 THR B HG1  3  
ATOM 8288  H HG21 . THR B 1 60 ? -9.224  4.113   -13.130 1.00 0.00 ? 59 THR B HG21 3  
ATOM 8289  H HG22 . THR B 1 60 ? -8.629  5.484   -14.067 1.00 0.00 ? 59 THR B HG22 3  
ATOM 8290  H HG23 . THR B 1 60 ? -7.724  4.917   -12.666 1.00 0.00 ? 59 THR B HG23 3  
ATOM 8291  N N    . LEU B 1 61 ? -11.959 4.795   -10.638 1.00 0.00 ? 60 LEU B N    3  
ATOM 8292  C CA   . LEU B 1 61 ? -12.656 3.645   -10.001 1.00 0.00 ? 60 LEU B CA   3  
ATOM 8293  C C    . LEU B 1 61 ? -13.999 3.449   -10.706 1.00 0.00 ? 60 LEU B C    3  
ATOM 8294  O O    . LEU B 1 61 ? -14.281 2.392   -11.233 1.00 0.00 ? 60 LEU B O    3  
ATOM 8295  C CB   . LEU B 1 61 ? -12.892 3.951   -8.518  1.00 0.00 ? 60 LEU B CB   3  
ATOM 8296  C CG   . LEU B 1 61 ? -11.548 4.192   -7.816  1.00 0.00 ? 60 LEU B CG   3  
ATOM 8297  C CD1  . LEU B 1 61 ? -11.803 4.588   -6.358  1.00 0.00 ? 60 LEU B CD1  3  
ATOM 8298  C CD2  . LEU B 1 61 ? -10.694 2.913   -7.861  1.00 0.00 ? 60 LEU B CD2  3  
ATOM 8299  H H    . LEU B 1 61 ? -11.771 5.592   -10.096 1.00 0.00 ? 60 LEU B H    3  
ATOM 8300  H HA   . LEU B 1 61 ? -12.094 2.729   -10.097 1.00 0.00 ? 60 LEU B HA   3  
ATOM 8301  H HB2  . LEU B 1 61 ? -13.508 4.834   -8.427  1.00 0.00 ? 60 LEU B HB2  3  
ATOM 8302  H HB3  . LEU B 1 61 ? -13.392 3.115   -8.053  1.00 0.00 ? 60 LEU B HB3  3  
ATOM 8303  H HG   . LEU B 1 61 ? -11.023 4.994   -8.317  1.00 0.00 ? 60 LEU B HG   3  
ATOM 8304  H HD11 . LEU B 1 61 ? -12.414 3.835   -5.881  1.00 0.00 ? 60 LEU B HD11 3  
ATOM 8305  H HD12 . LEU B 1 61 ? -10.860 4.670   -5.837  1.00 0.00 ? 60 LEU B HD12 3  
ATOM 8306  H HD13 . LEU B 1 61 ? -12.314 5.539   -6.327  1.00 0.00 ? 60 LEU B HD13 3  
ATOM 8307  H HD21 . LEU B 1 61 ? -11.328 2.046   -7.735  1.00 0.00 ? 60 LEU B HD21 3  
ATOM 8308  H HD22 . LEU B 1 61 ? -10.186 2.853   -8.812  1.00 0.00 ? 60 LEU B HD22 3  
ATOM 8309  H HD23 . LEU B 1 61 ? -9.960  2.937   -7.068  1.00 0.00 ? 60 LEU B HD23 3  
ATOM 8310  N N    . ASP B 1 62 ? -14.825 4.459   -10.737 1.00 0.00 ? 61 ASP B N    3  
ATOM 8311  C CA   . ASP B 1 62 ? -16.136 4.314   -11.430 1.00 0.00 ? 61 ASP B CA   3  
ATOM 8312  C C    . ASP B 1 62 ? -15.898 3.752   -12.837 1.00 0.00 ? 61 ASP B C    3  
ATOM 8313  O O    . ASP B 1 62 ? -16.789 3.202   -13.454 1.00 0.00 ? 61 ASP B O    3  
ATOM 8314  C CB   . ASP B 1 62 ? -16.812 5.683   -11.537 1.00 0.00 ? 61 ASP B CB   3  
ATOM 8315  C CG   . ASP B 1 62 ? -18.246 5.510   -12.039 1.00 0.00 ? 61 ASP B CG   3  
ATOM 8316  O OD1  . ASP B 1 62 ? -18.417 5.326   -13.233 1.00 0.00 ? 61 ASP B OD1  3  
ATOM 8317  O OD2  . ASP B 1 62 ? -19.150 5.565   -11.222 1.00 0.00 ? 61 ASP B OD2  3  
ATOM 8318  H H    . ASP B 1 62 ? -14.583 5.309   -10.313 1.00 0.00 ? 61 ASP B H    3  
ATOM 8319  H HA   . ASP B 1 62 ? -16.768 3.639   -10.872 1.00 0.00 ? 61 ASP B HA   3  
ATOM 8320  H HB2  . ASP B 1 62 ? -16.824 6.156   -10.566 1.00 0.00 ? 61 ASP B HB2  3  
ATOM 8321  H HB3  . ASP B 1 62 ? -16.263 6.301   -12.232 1.00 0.00 ? 61 ASP B HB3  3  
ATOM 8322  N N    . GLU B 1 63 ? -14.697 3.890   -13.347 1.00 0.00 ? 62 GLU B N    3  
ATOM 8323  C CA   . GLU B 1 63 ? -14.381 3.371   -14.717 1.00 0.00 ? 62 GLU B CA   3  
ATOM 8324  C C    . GLU B 1 63 ? -13.609 2.064   -14.603 1.00 0.00 ? 62 GLU B C    3  
ATOM 8325  O O    . GLU B 1 63 ? -12.660 1.808   -15.316 1.00 0.00 ? 62 GLU B O    3  
ATOM 8326  C CB   . GLU B 1 63 ? -13.521 4.368   -15.445 1.00 0.00 ? 62 GLU B CB   3  
ATOM 8327  C CG   . GLU B 1 63 ? -14.335 5.617   -15.795 1.00 0.00 ? 62 GLU B CG   3  
ATOM 8328  C CD   . GLU B 1 63 ? -13.385 6.739   -16.223 1.00 0.00 ? 62 GLU B CD   3  
ATOM 8329  O OE1  . GLU B 1 63 ? -12.403 6.952   -15.532 1.00 0.00 ? 62 GLU B OE1  3  
ATOM 8330  O OE2  . GLU B 1 63 ? -13.657 7.366   -17.234 1.00 0.00 ? 62 GLU B OE2  3  
ATOM 8331  H H    . GLU B 1 63 ? -13.999 4.338   -12.827 1.00 0.00 ? 62 GLU B H    3  
ATOM 8332  H HA   . GLU B 1 63 ? -15.295 3.192   -15.264 1.00 0.00 ? 62 GLU B HA   3  
ATOM 8333  H HB2  . GLU B 1 63 ? -12.705 4.627   -14.800 1.00 0.00 ? 62 GLU B HB2  3  
ATOM 8334  H HB3  . GLU B 1 63 ? -13.144 3.914   -16.343 1.00 0.00 ? 62 GLU B HB3  3  
ATOM 8335  H HG2  . GLU B 1 63 ? -15.013 5.391   -16.605 1.00 0.00 ? 62 GLU B HG2  3  
ATOM 8336  H HG3  . GLU B 1 63 ? -14.900 5.936   -14.933 1.00 0.00 ? 62 GLU B HG3  3  
ATOM 8337  N N    . ASP B 1 64 ? -14.027 1.258   -13.708 1.00 0.00 ? 63 ASP B N    3  
ATOM 8338  C CA   . ASP B 1 64 ? -13.374 -0.070  -13.475 1.00 0.00 ? 63 ASP B CA   3  
ATOM 8339  C C    . ASP B 1 64 ? -13.067 -0.732  -14.824 1.00 0.00 ? 63 ASP B C    3  
ATOM 8340  O O    . ASP B 1 64 ? -12.078 -1.419  -14.986 1.00 0.00 ? 63 ASP B O    3  
ATOM 8341  C CB   . ASP B 1 64 ? -14.361 -0.953  -12.708 1.00 0.00 ? 63 ASP B CB   3  
ATOM 8342  C CG   . ASP B 1 64 ? -13.637 -2.186  -12.163 1.00 0.00 ? 63 ASP B CG   3  
ATOM 8343  O OD1  . ASP B 1 64 ? -12.459 -2.077  -11.866 1.00 0.00 ? 63 ASP B OD1  3  
ATOM 8344  O OD2  . ASP B 1 64 ? -14.275 -3.220  -12.050 1.00 0.00 ? 63 ASP B OD2  3  
ATOM 8345  H H    . ASP B 1 64 ? -14.782 1.536   -13.176 1.00 0.00 ? 63 ASP B H    3  
ATOM 8346  H HA   . ASP B 1 64 ? -12.473 0.041   -12.890 1.00 0.00 ? 63 ASP B HA   3  
ATOM 8347  H HB2  . ASP B 1 64 ? -14.781 -0.390  -11.888 1.00 0.00 ? 63 ASP B HB2  3  
ATOM 8348  H HB3  . ASP B 1 64 ? -15.155 -1.267  -13.371 1.00 0.00 ? 63 ASP B HB3  3  
ATOM 8349  N N    . GLY B 1 65 ? -13.901 -0.483  -15.792 1.00 0.00 ? 64 GLY B N    3  
ATOM 8350  C CA   . GLY B 1 65 ? -13.694 -1.039  -17.162 1.00 0.00 ? 64 GLY B CA   3  
ATOM 8351  C C    . GLY B 1 65 ? -13.472 -2.564  -17.156 1.00 0.00 ? 64 GLY B C    3  
ATOM 8352  O O    . GLY B 1 65 ? -13.479 -3.184  -18.203 1.00 0.00 ? 64 GLY B O    3  
ATOM 8353  H H    . GLY B 1 65 ? -14.659 0.118   -15.632 1.00 0.00 ? 64 GLY B H    3  
ATOM 8354  H HA2  . GLY B 1 65 ? -14.569 -0.821  -17.757 1.00 0.00 ? 64 GLY B HA2  3  
ATOM 8355  H HA3  . GLY B 1 65 ? -12.834 -0.551  -17.600 1.00 0.00 ? 64 GLY B HA3  3  
ATOM 8356  N N    . ASP B 1 66 ? -13.277 -3.183  -16.011 1.00 0.00 ? 65 ASP B N    3  
ATOM 8357  C CA   . ASP B 1 66 ? -13.059 -4.681  -15.982 1.00 0.00 ? 65 ASP B CA   3  
ATOM 8358  C C    . ASP B 1 66 ? -14.276 -5.443  -15.388 1.00 0.00 ? 65 ASP B C    3  
ATOM 8359  O O    . ASP B 1 66 ? -14.532 -6.560  -15.794 1.00 0.00 ? 65 ASP B O    3  
ATOM 8360  C CB   . ASP B 1 66 ? -11.829 -4.986  -15.128 1.00 0.00 ? 65 ASP B CB   3  
ATOM 8361  C CG   . ASP B 1 66 ? -11.964 -4.295  -13.772 1.00 0.00 ? 65 ASP B CG   3  
ATOM 8362  O OD1  . ASP B 1 66 ? -12.676 -4.819  -12.931 1.00 0.00 ? 65 ASP B OD1  3  
ATOM 8363  O OD2  . ASP B 1 66 ? -11.351 -3.255  -13.596 1.00 0.00 ? 65 ASP B OD2  3  
ATOM 8364  H H    . ASP B 1 66 ? -13.258 -2.673  -15.181 1.00 0.00 ? 65 ASP B H    3  
ATOM 8365  H HA   . ASP B 1 66 ? -12.877 -5.039  -16.985 1.00 0.00 ? 65 ASP B HA   3  
ATOM 8366  H HB2  . ASP B 1 66 ? -11.751 -6.053  -14.982 1.00 0.00 ? 65 ASP B HB2  3  
ATOM 8367  H HB3  . ASP B 1 66 ? -10.945 -4.625  -15.629 1.00 0.00 ? 65 ASP B HB3  3  
ATOM 8368  N N    . GLY B 1 67 ? -15.031 -4.896  -14.451 1.00 0.00 ? 66 GLY B N    3  
ATOM 8369  C CA   . GLY B 1 67 ? -16.204 -5.644  -13.887 1.00 0.00 ? 66 GLY B CA   3  
ATOM 8370  C C    . GLY B 1 67 ? -15.865 -6.146  -12.479 1.00 0.00 ? 66 GLY B C    3  
ATOM 8371  O O    . GLY B 1 67 ? -16.738 -6.331  -11.654 1.00 0.00 ? 66 GLY B O    3  
ATOM 8372  H H    . GLY B 1 67 ? -14.845 -4.013  -14.089 1.00 0.00 ? 66 GLY B H    3  
ATOM 8373  H HA2  . GLY B 1 67 ? -17.058 -4.982  -13.830 1.00 0.00 ? 66 GLY B HA2  3  
ATOM 8374  H HA3  . GLY B 1 67 ? -16.446 -6.481  -14.523 1.00 0.00 ? 66 GLY B HA3  3  
ATOM 8375  N N    . GLU B 1 68 ? -14.604 -6.348  -12.187 1.00 0.00 ? 67 GLU B N    3  
ATOM 8376  C CA   . GLU B 1 68 ? -14.216 -6.816  -10.816 1.00 0.00 ? 67 GLU B CA   3  
ATOM 8377  C C    . GLU B 1 68 ? -12.850 -6.231  -10.445 1.00 0.00 ? 67 GLU B C    3  
ATOM 8378  O O    . GLU B 1 68 ? -11.914 -6.302  -11.217 1.00 0.00 ? 67 GLU B O    3  
ATOM 8379  C CB   . GLU B 1 68 ? -14.143 -8.344  -10.790 1.00 0.00 ? 67 GLU B CB   3  
ATOM 8380  C CG   . GLU B 1 68 ? -15.556 -8.929  -10.830 1.00 0.00 ? 67 GLU B CG   3  
ATOM 8381  C CD   . GLU B 1 68 ? -15.480 -10.449 -10.675 1.00 0.00 ? 67 GLU B CD   3  
ATOM 8382  O OE1  . GLU B 1 68 ? -14.978 -11.092 -11.583 1.00 0.00 ? 67 GLU B OE1  3  
ATOM 8383  O OE2  . GLU B 1 68 ? -15.922 -10.943 -9.652  1.00 0.00 ? 67 GLU B OE2  3  
ATOM 8384  H H    . GLU B 1 68 ? -13.919 -6.193  -12.871 1.00 0.00 ? 67 GLU B H    3  
ATOM 8385  H HA   . GLU B 1 68 ? -14.962 -6.474  -10.110 1.00 0.00 ? 67 GLU B HA   3  
ATOM 8386  H HB2  . GLU B 1 68 ? -13.584 -8.693  -11.647 1.00 0.00 ? 67 GLU B HB2  3  
ATOM 8387  H HB3  . GLU B 1 68 ? -13.649 -8.664  -9.884  1.00 0.00 ? 67 GLU B HB3  3  
ATOM 8388  H HG2  . GLU B 1 68 ? -16.142 -8.512  -10.023 1.00 0.00 ? 67 GLU B HG2  3  
ATOM 8389  H HG3  . GLU B 1 68 ? -16.019 -8.689  -11.775 1.00 0.00 ? 67 GLU B HG3  3  
ATOM 8390  N N    . CYS B 1 69 ? -12.723 -5.656  -9.272  1.00 0.00 ? 68 CYS B N    3  
ATOM 8391  C CA   . CYS B 1 69 ? -11.410 -5.068  -8.848  1.00 0.00 ? 68 CYS B CA   3  
ATOM 8392  C C    . CYS B 1 69 ? -10.753 -5.994  -7.816  1.00 0.00 ? 68 CYS B C    3  
ATOM 8393  O O    . CYS B 1 69 ? -11.353 -6.359  -6.825  1.00 0.00 ? 68 CYS B O    3  
ATOM 8394  C CB   . CYS B 1 69 ? -11.649 -3.684  -8.231  1.00 0.00 ? 68 CYS B CB   3  
ATOM 8395  S SG   . CYS B 1 69 ? -12.947 -2.830  -9.161  1.00 0.00 ? 68 CYS B SG   3  
ATOM 8396  H H    . CYS B 1 69 ? -13.491 -5.614  -8.665  1.00 0.00 ? 68 CYS B H    3  
ATOM 8397  H HA   . CYS B 1 69 ? -10.756 -4.968  -9.704  1.00 0.00 ? 68 CYS B HA   3  
ATOM 8398  H HB2  . CYS B 1 69 ? -11.956 -3.790  -7.200  1.00 0.00 ? 68 CYS B HB2  3  
ATOM 8399  H HB3  . CYS B 1 69 ? -10.736 -3.108  -8.276  1.00 0.00 ? 68 CYS B HB3  3  
ATOM 8400  H HG   . CYS B 1 69 ? -13.781 -2.977  -8.708  1.00 0.00 ? 68 CYS B HG   3  
ATOM 8401  N N    . ASP B 1 70 ? -9.529  -6.382  -8.049  1.00 0.00 ? 69 ASP B N    3  
ATOM 8402  C CA   . ASP B 1 70 ? -8.832  -7.293  -7.093  1.00 0.00 ? 69 ASP B CA   3  
ATOM 8403  C C    . ASP B 1 70 ? -8.223  -6.480  -5.946  1.00 0.00 ? 69 ASP B C    3  
ATOM 8404  O O    . ASP B 1 70 ? -8.413  -5.285  -5.851  1.00 0.00 ? 69 ASP B O    3  
ATOM 8405  C CB   . ASP B 1 70 ? -7.723  -8.040  -7.836  1.00 0.00 ? 69 ASP B CB   3  
ATOM 8406  C CG   . ASP B 1 70 ? -8.312  -8.745  -9.059  1.00 0.00 ? 69 ASP B CG   3  
ATOM 8407  O OD1  . ASP B 1 70 ? -8.463  -8.092  -10.078 1.00 0.00 ? 69 ASP B OD1  3  
ATOM 8408  O OD2  . ASP B 1 70 ? -8.605  -9.924  -8.955  1.00 0.00 ? 69 ASP B OD2  3  
ATOM 8409  H H    . ASP B 1 70 ? -9.067  -6.081  -8.859  1.00 0.00 ? 69 ASP B H    3  
ATOM 8410  H HA   . ASP B 1 70 ? -9.539  -8.005  -6.692  1.00 0.00 ? 69 ASP B HA   3  
ATOM 8411  H HB2  . ASP B 1 70 ? -6.967  -7.336  -8.155  1.00 0.00 ? 69 ASP B HB2  3  
ATOM 8412  H HB3  . ASP B 1 70 ? -7.279  -8.774  -7.180  1.00 0.00 ? 69 ASP B HB3  3  
ATOM 8413  N N    . PHE B 1 71 ? -7.480  -7.119  -5.080  1.00 0.00 ? 70 PHE B N    3  
ATOM 8414  C CA   . PHE B 1 71 ? -6.851  -6.371  -3.952  1.00 0.00 ? 70 PHE B CA   3  
ATOM 8415  C C    . PHE B 1 71 ? -5.677  -5.555  -4.495  1.00 0.00 ? 70 PHE B C    3  
ATOM 8416  O O    . PHE B 1 71 ? -5.384  -4.480  -4.011  1.00 0.00 ? 70 PHE B O    3  
ATOM 8417  C CB   . PHE B 1 71 ? -6.359  -7.354  -2.885  1.00 0.00 ? 70 PHE B CB   3  
ATOM 8418  C CG   . PHE B 1 71 ? -5.787  -6.596  -1.708  1.00 0.00 ? 70 PHE B CG   3  
ATOM 8419  C CD1  . PHE B 1 71 ? -4.504  -6.036  -1.786  1.00 0.00 ? 70 PHE B CD1  3  
ATOM 8420  C CD2  . PHE B 1 71 ? -6.538  -6.457  -0.535  1.00 0.00 ? 70 PHE B CD2  3  
ATOM 8421  C CE1  . PHE B 1 71 ? -3.977  -5.338  -0.693  1.00 0.00 ? 70 PHE B CE1  3  
ATOM 8422  C CE2  . PHE B 1 71 ? -6.011  -5.760  0.558   1.00 0.00 ? 70 PHE B CE2  3  
ATOM 8423  C CZ   . PHE B 1 71 ? -4.730  -5.201  0.479   1.00 0.00 ? 70 PHE B CZ   3  
ATOM 8424  H H    . PHE B 1 71 ? -7.322  -8.081  -5.180  1.00 0.00 ? 70 PHE B H    3  
ATOM 8425  H HA   . PHE B 1 71 ? -7.575  -5.692  -3.532  1.00 0.00 ? 70 PHE B HA   3  
ATOM 8426  H HB2  . PHE B 1 71 ? -7.186  -7.965  -2.553  1.00 0.00 ? 70 PHE B HB2  3  
ATOM 8427  H HB3  . PHE B 1 71 ? -5.593  -7.988  -3.309  1.00 0.00 ? 70 PHE B HB3  3  
ATOM 8428  H HD1  . PHE B 1 71 ? -3.920  -6.143  -2.688  1.00 0.00 ? 70 PHE B HD1  3  
ATOM 8429  H HD2  . PHE B 1 71 ? -7.526  -6.888  -0.474  1.00 0.00 ? 70 PHE B HD2  3  
ATOM 8430  H HE1  . PHE B 1 71 ? -2.989  -4.906  -0.753  1.00 0.00 ? 70 PHE B HE1  3  
ATOM 8431  H HE2  . PHE B 1 71 ? -6.592  -5.655  1.462   1.00 0.00 ? 70 PHE B HE2  3  
ATOM 8432  H HZ   . PHE B 1 71 ? -4.323  -4.662  1.322   1.00 0.00 ? 70 PHE B HZ   3  
ATOM 8433  N N    . GLN B 1 72 ? -5.006  -6.042  -5.498  1.00 0.00 ? 71 GLN B N    3  
ATOM 8434  C CA   . GLN B 1 72 ? -3.864  -5.269  -6.060  1.00 0.00 ? 71 GLN B CA   3  
ATOM 8435  C C    . GLN B 1 72 ? -4.365  -3.894  -6.509  1.00 0.00 ? 71 GLN B C    3  
ATOM 8436  O O    . GLN B 1 72 ? -3.688  -2.898  -6.349  1.00 0.00 ? 71 GLN B O    3  
ATOM 8437  C CB   . GLN B 1 72 ? -3.280  -6.021  -7.256  1.00 0.00 ? 71 GLN B CB   3  
ATOM 8438  C CG   . GLN B 1 72 ? -2.532  -7.260  -6.761  1.00 0.00 ? 71 GLN B CG   3  
ATOM 8439  C CD   . GLN B 1 72 ? -1.931  -8.004  -7.954  1.00 0.00 ? 71 GLN B CD   3  
ATOM 8440  O OE1  . GLN B 1 72 ? -2.477  -8.991  -8.407  1.00 0.00 ? 71 GLN B OE1  3  
ATOM 8441  N NE2  . GLN B 1 72 ? -0.821  -7.571  -8.486  1.00 0.00 ? 71 GLN B NE2  3  
ATOM 8442  H H    . GLN B 1 72 ? -5.255  -6.907  -5.884  1.00 0.00 ? 71 GLN B H    3  
ATOM 8443  H HA   . GLN B 1 72 ? -3.101  -5.144  -5.305  1.00 0.00 ? 71 GLN B HA   3  
ATOM 8444  H HB2  . GLN B 1 72 ? -4.080  -6.321  -7.919  1.00 0.00 ? 71 GLN B HB2  3  
ATOM 8445  H HB3  . GLN B 1 72 ? -2.595  -5.377  -7.787  1.00 0.00 ? 71 GLN B HB3  3  
ATOM 8446  H HG2  . GLN B 1 72 ? -1.741  -6.958  -6.090  1.00 0.00 ? 71 GLN B HG2  3  
ATOM 8447  H HG3  . GLN B 1 72 ? -3.217  -7.912  -6.241  1.00 0.00 ? 71 GLN B HG3  3  
ATOM 8448  H HE21 . GLN B 1 72 ? -0.380  -6.775  -8.120  1.00 0.00 ? 71 GLN B HE21 3  
ATOM 8449  H HE22 . GLN B 1 72 ? -0.428  -8.040  -9.252  1.00 0.00 ? 71 GLN B HE22 3  
ATOM 8450  N N    . GLU B 1 73 ? -5.546  -3.823  -7.058  1.00 0.00 ? 72 GLU B N    3  
ATOM 8451  C CA   . GLU B 1 73 ? -6.076  -2.501  -7.498  1.00 0.00 ? 72 GLU B CA   3  
ATOM 8452  C C    . GLU B 1 73 ? -6.439  -1.658  -6.267  1.00 0.00 ? 72 GLU B C    3  
ATOM 8453  O O    . GLU B 1 73 ? -6.444  -0.448  -6.309  1.00 0.00 ? 72 GLU B O    3  
ATOM 8454  C CB   . GLU B 1 73 ? -7.312  -2.691  -8.382  1.00 0.00 ? 72 GLU B CB   3  
ATOM 8455  C CG   . GLU B 1 73 ? -6.931  -3.467  -9.646  1.00 0.00 ? 72 GLU B CG   3  
ATOM 8456  C CD   . GLU B 1 73 ? -5.990  -2.619  -10.504 1.00 0.00 ? 72 GLU B CD   3  
ATOM 8457  O OE1  . GLU B 1 73 ? -6.086  -1.405  -10.431 1.00 0.00 ? 72 GLU B OE1  3  
ATOM 8458  O OE2  . GLU B 1 73 ? -5.192  -3.199  -11.222 1.00 0.00 ? 72 GLU B OE2  3  
ATOM 8459  H H    . GLU B 1 73 ? -6.086  -4.632  -7.174  1.00 0.00 ? 72 GLU B H    3  
ATOM 8460  H HA   . GLU B 1 73 ? -5.311  -1.975  -8.049  1.00 0.00 ? 72 GLU B HA   3  
ATOM 8461  H HB2  . GLU B 1 73 ? -8.065  -3.240  -7.835  1.00 0.00 ? 72 GLU B HB2  3  
ATOM 8462  H HB3  . GLU B 1 73 ? -7.703  -1.724  -8.662  1.00 0.00 ? 72 GLU B HB3  3  
ATOM 8463  H HG2  . GLU B 1 73 ? -6.437  -4.387  -9.370  1.00 0.00 ? 72 GLU B HG2  3  
ATOM 8464  H HG3  . GLU B 1 73 ? -7.823  -3.692  -10.211 1.00 0.00 ? 72 GLU B HG3  3  
ATOM 8465  N N    . PHE B 1 74 ? -6.699  -2.293  -5.158  1.00 0.00 ? 73 PHE B N    3  
ATOM 8466  C CA   . PHE B 1 74 ? -7.023  -1.536  -3.911  1.00 0.00 ? 73 PHE B CA   3  
ATOM 8467  C C    . PHE B 1 74 ? -5.740  -0.887  -3.371  1.00 0.00 ? 73 PHE B C    3  
ATOM 8468  O O    . PHE B 1 74 ? -5.764  0.243   -2.928  1.00 0.00 ? 73 PHE B O    3  
ATOM 8469  C CB   . PHE B 1 74 ? -7.663  -2.487  -2.877  1.00 0.00 ? 73 PHE B CB   3  
ATOM 8470  C CG   . PHE B 1 74 ? -7.423  -2.004  -1.461  1.00 0.00 ? 73 PHE B CG   3  
ATOM 8471  C CD1  . PHE B 1 74 ? -6.198  -2.264  -0.836  1.00 0.00 ? 73 PHE B CD1  3  
ATOM 8472  C CD2  . PHE B 1 74 ? -8.423  -1.304  -0.778  1.00 0.00 ? 73 PHE B CD2  3  
ATOM 8473  C CE1  . PHE B 1 74 ? -5.972  -1.822  0.472   1.00 0.00 ? 73 PHE B CE1  3  
ATOM 8474  C CE2  . PHE B 1 74 ? -8.197  -0.861  0.531   1.00 0.00 ? 73 PHE B CE2  3  
ATOM 8475  C CZ   . PHE B 1 74 ? -6.972  -1.120  1.156   1.00 0.00 ? 73 PHE B CZ   3  
ATOM 8476  H H    . PHE B 1 74 ? -6.634  -3.270  -5.130  1.00 0.00 ? 73 PHE B H    3  
ATOM 8477  H HA   . PHE B 1 74 ? -7.677  -0.701  -4.112  1.00 0.00 ? 73 PHE B HA   3  
ATOM 8478  H HB2  . PHE B 1 74 ? -8.726  -2.543  -3.056  1.00 0.00 ? 73 PHE B HB2  3  
ATOM 8479  H HB3  . PHE B 1 74 ? -7.235  -3.469  -2.991  1.00 0.00 ? 73 PHE B HB3  3  
ATOM 8480  H HD1  . PHE B 1 74 ? -5.427  -2.805  -1.365  1.00 0.00 ? 73 PHE B HD1  3  
ATOM 8481  H HD2  . PHE B 1 74 ? -9.368  -1.105  -1.259  1.00 0.00 ? 73 PHE B HD2  3  
ATOM 8482  H HE1  . PHE B 1 74 ? -5.027  -2.023  0.954   1.00 0.00 ? 73 PHE B HE1  3  
ATOM 8483  H HE2  . PHE B 1 74 ? -8.968  -0.320  1.058   1.00 0.00 ? 73 PHE B HE2  3  
ATOM 8484  H HZ   . PHE B 1 74 ? -6.797  -0.779  2.165   1.00 0.00 ? 73 PHE B HZ   3  
ATOM 8485  N N    . MET B 1 75 ? -4.629  -1.553  -3.399  1.00 0.00 ? 74 MET B N    3  
ATOM 8486  C CA   . MET B 1 75 ? -3.401  -0.890  -2.876  1.00 0.00 ? 74 MET B CA   3  
ATOM 8487  C C    . MET B 1 75 ? -2.986  0.243   -3.827  1.00 0.00 ? 74 MET B C    3  
ATOM 8488  O O    . MET B 1 75 ? -2.813  1.367   -3.402  1.00 0.00 ? 74 MET B O    3  
ATOM 8489  C CB   . MET B 1 75 ? -2.265  -1.907  -2.737  1.00 0.00 ? 74 MET B CB   3  
ATOM 8490  C CG   . MET B 1 75 ? -1.198  -1.346  -1.795  1.00 0.00 ? 74 MET B CG   3  
ATOM 8491  S SD   . MET B 1 75 ? -1.839  -1.337  -0.096  1.00 0.00 ? 74 MET B SD   3  
ATOM 8492  C CE   . MET B 1 75 ? -1.767  0.450   0.204   1.00 0.00 ? 74 MET B CE   3  
ATOM 8493  H H    . MET B 1 75 ? -4.596  -2.465  -3.762  1.00 0.00 ? 74 MET B H    3  
ATOM 8494  H HA   . MET B 1 75 ? -3.618  -0.452  -1.912  1.00 0.00 ? 74 MET B HA   3  
ATOM 8495  H HB2  . MET B 1 75 ? -2.655  -2.830  -2.333  1.00 0.00 ? 74 MET B HB2  3  
ATOM 8496  H HB3  . MET B 1 75 ? -1.826  -2.094  -3.705  1.00 0.00 ? 74 MET B HB3  3  
ATOM 8497  H HG2  . MET B 1 75 ? -0.314  -1.965  -1.843  1.00 0.00 ? 74 MET B HG2  3  
ATOM 8498  H HG3  . MET B 1 75 ? -0.950  -0.341  -2.098  1.00 0.00 ? 74 MET B HG3  3  
ATOM 8499  H HE1  . MET B 1 75 ? -0.793  0.823   -0.076  1.00 0.00 ? 74 MET B HE1  3  
ATOM 8500  H HE2  . MET B 1 75 ? -2.529  0.944   -0.382  1.00 0.00 ? 74 MET B HE2  3  
ATOM 8501  H HE3  . MET B 1 75 ? -1.936  0.647   1.250   1.00 0.00 ? 74 MET B HE3  3  
ATOM 8502  N N    . ALA B 1 76 ? -2.813  -0.012  -5.093  1.00 0.00 ? 75 ALA B N    3  
ATOM 8503  C CA   . ALA B 1 76 ? -2.400  1.086   -6.019  1.00 0.00 ? 75 ALA B CA   3  
ATOM 8504  C C    . ALA B 1 76 ? -3.352  2.282   -5.919  1.00 0.00 ? 75 ALA B C    3  
ATOM 8505  O O    . ALA B 1 76 ? -2.920  3.409   -5.778  1.00 0.00 ? 75 ALA B O    3  
ATOM 8506  C CB   . ALA B 1 76 ? -2.402  0.563   -7.455  1.00 0.00 ? 75 ALA B CB   3  
ATOM 8507  H H    . ALA B 1 76 ? -2.931  -0.912  -5.464  1.00 0.00 ? 75 ALA B H    3  
ATOM 8508  H HA   . ALA B 1 76 ? -1.409  1.440   -5.775  1.00 0.00 ? 75 ALA B HA   3  
ATOM 8509  H HB1  . ALA B 1 76 ? -3.360  0.114   -7.674  1.00 0.00 ? 75 ALA B HB1  3  
ATOM 8510  H HB2  . ALA B 1 76 ? -2.225  1.382   -8.136  1.00 0.00 ? 75 ALA B HB2  3  
ATOM 8511  H HB3  . ALA B 1 76 ? -1.624  -0.177  -7.571  1.00 0.00 ? 75 ALA B HB3  3  
ATOM 8512  N N    . PHE B 1 77 ? -4.633  2.069   -6.007  1.00 0.00 ? 76 PHE B N    3  
ATOM 8513  C CA   . PHE B 1 77 ? -5.570  3.231   -5.934  1.00 0.00 ? 76 PHE B CA   3  
ATOM 8514  C C    . PHE B 1 77 ? -5.502  3.868   -4.538  1.00 0.00 ? 76 PHE B C    3  
ATOM 8515  O O    . PHE B 1 77 ? -5.629  5.067   -4.388  1.00 0.00 ? 76 PHE B O    3  
ATOM 8516  C CB   . PHE B 1 77 ? -7.012  2.766   -6.233  1.00 0.00 ? 76 PHE B CB   3  
ATOM 8517  C CG   . PHE B 1 77 ? -7.267  2.783   -7.732  1.00 0.00 ? 76 PHE B CG   3  
ATOM 8518  C CD1  . PHE B 1 77 ? -7.180  3.988   -8.443  1.00 0.00 ? 76 PHE B CD1  3  
ATOM 8519  C CD2  . PHE B 1 77 ? -7.584  1.597   -8.411  1.00 0.00 ? 76 PHE B CD2  3  
ATOM 8520  C CE1  . PHE B 1 77 ? -7.407  4.004   -9.823  1.00 0.00 ? 76 PHE B CE1  3  
ATOM 8521  C CE2  . PHE B 1 77 ? -7.813  1.616   -9.790  1.00 0.00 ? 76 PHE B CE2  3  
ATOM 8522  C CZ   . PHE B 1 77 ? -7.723  2.819   -10.497 1.00 0.00 ? 76 PHE B CZ   3  
ATOM 8523  H H    . PHE B 1 77 ? -4.975  1.158   -6.134  1.00 0.00 ? 76 PHE B H    3  
ATOM 8524  H HA   . PHE B 1 77 ? -5.267  3.963   -6.667  1.00 0.00 ? 76 PHE B HA   3  
ATOM 8525  H HB2  . PHE B 1 77 ? -7.147  1.763   -5.856  1.00 0.00 ? 76 PHE B HB2  3  
ATOM 8526  H HB3  . PHE B 1 77 ? -7.717  3.427   -5.748  1.00 0.00 ? 76 PHE B HB3  3  
ATOM 8527  H HD1  . PHE B 1 77 ? -6.943  4.906   -7.928  1.00 0.00 ? 76 PHE B HD1  3  
ATOM 8528  H HD2  . PHE B 1 77 ? -7.660  0.671   -7.871  1.00 0.00 ? 76 PHE B HD2  3  
ATOM 8529  H HE1  . PHE B 1 77 ? -7.337  4.933   -10.367 1.00 0.00 ? 76 PHE B HE1  3  
ATOM 8530  H HE2  . PHE B 1 77 ? -8.056  0.701   -10.310 1.00 0.00 ? 76 PHE B HE2  3  
ATOM 8531  H HZ   . PHE B 1 77 ? -7.899  2.833   -11.563 1.00 0.00 ? 76 PHE B HZ   3  
ATOM 8532  N N    . VAL B 1 78 ? -5.300  3.081   -3.522  1.00 0.00 ? 77 VAL B N    3  
ATOM 8533  C CA   . VAL B 1 78 ? -5.223  3.659   -2.149  1.00 0.00 ? 77 VAL B CA   3  
ATOM 8534  C C    . VAL B 1 78 ? -3.961  4.524   -2.044  1.00 0.00 ? 77 VAL B C    3  
ATOM 8535  O O    . VAL B 1 78 ? -3.956  5.552   -1.396  1.00 0.00 ? 77 VAL B O    3  
ATOM 8536  C CB   . VAL B 1 78 ? -5.189  2.521   -1.112  1.00 0.00 ? 77 VAL B CB   3  
ATOM 8537  C CG1  . VAL B 1 78 ? -4.684  3.046   0.239   1.00 0.00 ? 77 VAL B CG1  3  
ATOM 8538  C CG2  . VAL B 1 78 ? -6.605  1.954   -0.932  1.00 0.00 ? 77 VAL B CG2  3  
ATOM 8539  H H    . VAL B 1 78 ? -5.193  2.115   -3.663  1.00 0.00 ? 77 VAL B H    3  
ATOM 8540  H HA   . VAL B 1 78 ? -6.092  4.278   -1.976  1.00 0.00 ? 77 VAL B HA   3  
ATOM 8541  H HB   . VAL B 1 78 ? -4.530  1.739   -1.460  1.00 0.00 ? 77 VAL B HB   3  
ATOM 8542  H HG11 . VAL B 1 78 ? -5.174  3.981   0.467   1.00 0.00 ? 77 VAL B HG11 3  
ATOM 8543  H HG12 . VAL B 1 78 ? -4.907  2.325   1.012   1.00 0.00 ? 77 VAL B HG12 3  
ATOM 8544  H HG13 . VAL B 1 78 ? -3.617  3.202   0.188   1.00 0.00 ? 77 VAL B HG13 3  
ATOM 8545  H HG21 . VAL B 1 78 ? -7.085  1.864   -1.895  1.00 0.00 ? 77 VAL B HG21 3  
ATOM 8546  H HG22 . VAL B 1 78 ? -6.546  0.981   -0.468  1.00 0.00 ? 77 VAL B HG22 3  
ATOM 8547  H HG23 . VAL B 1 78 ? -7.183  2.617   -0.304  1.00 0.00 ? 77 VAL B HG23 3  
ATOM 8548  N N    . SER B 1 79 ? -2.895  4.125   -2.682  1.00 0.00 ? 78 SER B N    3  
ATOM 8549  C CA   . SER B 1 79 ? -1.648  4.939   -2.618  1.00 0.00 ? 78 SER B CA   3  
ATOM 8550  C C    . SER B 1 79 ? -1.886  6.286   -3.308  1.00 0.00 ? 78 SER B C    3  
ATOM 8551  O O    . SER B 1 79 ? -1.585  7.332   -2.769  1.00 0.00 ? 78 SER B O    3  
ATOM 8552  C CB   . SER B 1 79 ? -0.516  4.197   -3.331  1.00 0.00 ? 78 SER B CB   3  
ATOM 8553  O OG   . SER B 1 79 ? -0.614  4.426   -4.731  1.00 0.00 ? 78 SER B OG   3  
ATOM 8554  H H    . SER B 1 79 ? -2.916  3.297   -3.205  1.00 0.00 ? 78 SER B H    3  
ATOM 8555  H HA   . SER B 1 79 ? -1.377  5.104   -1.585  1.00 0.00 ? 78 SER B HA   3  
ATOM 8556  H HB2  . SER B 1 79 ? 0.434   4.561   -2.978  1.00 0.00 ? 78 SER B HB2  3  
ATOM 8557  H HB3  . SER B 1 79 ? -0.594  3.139   -3.122  1.00 0.00 ? 78 SER B HB3  3  
ATOM 8558  H HG   . SER B 1 79 ? 0.274   4.549   -5.074  1.00 0.00 ? 78 SER B HG   3  
ATOM 8559  N N    . MET B 1 80 ? -2.406  6.265   -4.504  1.00 0.00 ? 79 MET B N    3  
ATOM 8560  C CA   . MET B 1 80 ? -2.642  7.540   -5.243  1.00 0.00 ? 79 MET B CA   3  
ATOM 8561  C C    . MET B 1 80 ? -3.412  8.535   -4.367  1.00 0.00 ? 79 MET B C    3  
ATOM 8562  O O    . MET B 1 80 ? -3.152  9.720   -4.397  1.00 0.00 ? 79 MET B O    3  
ATOM 8563  C CB   . MET B 1 80 ? -3.454  7.255   -6.511  1.00 0.00 ? 79 MET B CB   3  
ATOM 8564  C CG   . MET B 1 80 ? -2.692  6.275   -7.409  1.00 0.00 ? 79 MET B CG   3  
ATOM 8565  S SD   . MET B 1 80 ? -3.814  5.619   -8.671  1.00 0.00 ? 79 MET B SD   3  
ATOM 8566  C CE   . MET B 1 80 ? -4.207  7.191   -9.480  1.00 0.00 ? 79 MET B CE   3  
ATOM 8567  H H    . MET B 1 80 ? -2.620  5.411   -4.938  1.00 0.00 ? 79 MET B H    3  
ATOM 8568  H HA   . MET B 1 80 ? -1.693  7.974   -5.518  1.00 0.00 ? 79 MET B HA   3  
ATOM 8569  H HB2  . MET B 1 80 ? -4.406  6.825   -6.239  1.00 0.00 ? 79 MET B HB2  3  
ATOM 8570  H HB3  . MET B 1 80 ? -3.616  8.177   -7.048  1.00 0.00 ? 79 MET B HB3  3  
ATOM 8571  H HG2  . MET B 1 80 ? -1.871  6.788   -7.889  1.00 0.00 ? 79 MET B HG2  3  
ATOM 8572  H HG3  . MET B 1 80 ? -2.308  5.461   -6.812  1.00 0.00 ? 79 MET B HG3  3  
ATOM 8573  H HE1  . MET B 1 80 ? -3.343  7.839   -9.446  1.00 0.00 ? 79 MET B HE1  3  
ATOM 8574  H HE2  . MET B 1 80 ? -4.486  7.006   -10.509 1.00 0.00 ? 79 MET B HE2  3  
ATOM 8575  H HE3  . MET B 1 80 ? -5.030  7.665   -8.968  1.00 0.00 ? 79 MET B HE3  3  
ATOM 8576  N N    . VAL B 1 81 ? -4.357  8.075   -3.595  1.00 0.00 ? 80 VAL B N    3  
ATOM 8577  C CA   . VAL B 1 81 ? -5.132  9.020   -2.734  1.00 0.00 ? 80 VAL B CA   3  
ATOM 8578  C C    . VAL B 1 81 ? -4.253  9.512   -1.584  1.00 0.00 ? 80 VAL B C    3  
ATOM 8579  O O    . VAL B 1 81 ? -4.294  10.669  -1.217  1.00 0.00 ? 80 VAL B O    3  
ATOM 8580  C CB   . VAL B 1 81 ? -6.364  8.308   -2.161  1.00 0.00 ? 80 VAL B CB   3  
ATOM 8581  C CG1  . VAL B 1 81 ? -7.137  9.263   -1.249  1.00 0.00 ? 80 VAL B CG1  3  
ATOM 8582  C CG2  . VAL B 1 81 ? -7.278  7.858   -3.303  1.00 0.00 ? 80 VAL B CG2  3  
ATOM 8583  H H    . VAL B 1 81 ? -4.556  7.115   -3.580  1.00 0.00 ? 80 VAL B H    3  
ATOM 8584  H HA   . VAL B 1 81 ? -5.448  9.868   -3.329  1.00 0.00 ? 80 VAL B HA   3  
ATOM 8585  H HB   . VAL B 1 81 ? -6.047  7.447   -1.591  1.00 0.00 ? 80 VAL B HB   3  
ATOM 8586  H HG11 . VAL B 1 81 ? -7.332  10.186  -1.776  1.00 0.00 ? 80 VAL B HG11 3  
ATOM 8587  H HG12 . VAL B 1 81 ? -8.075  8.807   -0.964  1.00 0.00 ? 80 VAL B HG12 3  
ATOM 8588  H HG13 . VAL B 1 81 ? -6.554  9.470   -0.364  1.00 0.00 ? 80 VAL B HG13 3  
ATOM 8589  H HG21 . VAL B 1 81 ? -6.711  7.266   -4.007  1.00 0.00 ? 80 VAL B HG21 3  
ATOM 8590  H HG22 . VAL B 1 81 ? -8.088  7.264   -2.903  1.00 0.00 ? 80 VAL B HG22 3  
ATOM 8591  H HG23 . VAL B 1 81 ? -7.681  8.725   -3.804  1.00 0.00 ? 80 VAL B HG23 3  
ATOM 8592  N N    . THR B 1 82 ? -3.449  8.657   -1.017  1.00 0.00 ? 81 THR B N    3  
ATOM 8593  C CA   . THR B 1 82 ? -2.569  9.109   0.095   1.00 0.00 ? 81 THR B CA   3  
ATOM 8594  C C    . THR B 1 82 ? -1.530  10.081  -0.469  1.00 0.00 ? 81 THR B C    3  
ATOM 8595  O O    . THR B 1 82 ? -1.277  11.130  0.088   1.00 0.00 ? 81 THR B O    3  
ATOM 8596  C CB   . THR B 1 82 ? -1.862  7.901   0.717   1.00 0.00 ? 81 THR B CB   3  
ATOM 8597  O OG1  . THR B 1 82 ? -2.824  6.903   1.028   1.00 0.00 ? 81 THR B OG1  3  
ATOM 8598  C CG2  . THR B 1 82 ? -1.136  8.329   1.995   1.00 0.00 ? 81 THR B CG2  3  
ATOM 8599  H H    . THR B 1 82 ? -3.417  7.727   -1.328  1.00 0.00 ? 81 THR B H    3  
ATOM 8600  H HA   . THR B 1 82 ? -3.163  9.609   0.846   1.00 0.00 ? 81 THR B HA   3  
ATOM 8601  H HB   . THR B 1 82 ? -1.144  7.503   0.017   1.00 0.00 ? 81 THR B HB   3  
ATOM 8602  H HG1  . THR B 1 82 ? -3.442  6.850   0.295   1.00 0.00 ? 81 THR B HG1  3  
ATOM 8603  H HG21 . THR B 1 82 ? -0.409  9.091   1.758   1.00 0.00 ? 81 THR B HG21 3  
ATOM 8604  H HG22 . THR B 1 82 ? -1.852  8.723   2.702   1.00 0.00 ? 81 THR B HG22 3  
ATOM 8605  H HG23 . THR B 1 82 ? -0.636  7.476   2.429   1.00 0.00 ? 81 THR B HG23 3  
ATOM 8606  N N    . THR B 1 83 ? -0.933  9.735   -1.577  1.00 0.00 ? 82 THR B N    3  
ATOM 8607  C CA   . THR B 1 83 ? 0.086   10.628  -2.199  1.00 0.00 ? 82 THR B CA   3  
ATOM 8608  C C    . THR B 1 83 ? -0.604  11.841  -2.830  1.00 0.00 ? 82 THR B C    3  
ATOM 8609  O O    . THR B 1 83 ? 0.022   12.846  -3.104  1.00 0.00 ? 82 THR B O    3  
ATOM 8610  C CB   . THR B 1 83 ? 0.852   9.860   -3.279  1.00 0.00 ? 82 THR B CB   3  
ATOM 8611  O OG1  . THR B 1 83 ? -0.067  9.155   -4.102  1.00 0.00 ? 82 THR B OG1  3  
ATOM 8612  C CG2  . THR B 1 83 ? 1.812   8.868   -2.620  1.00 0.00 ? 82 THR B CG2  3  
ATOM 8613  H H    . THR B 1 83 ? -1.161  8.885   -2.007  1.00 0.00 ? 82 THR B H    3  
ATOM 8614  H HA   . THR B 1 83 ? 0.778   10.964  -1.441  1.00 0.00 ? 82 THR B HA   3  
ATOM 8615  H HB   . THR B 1 83 ? 1.418   10.554  -3.882  1.00 0.00 ? 82 THR B HB   3  
ATOM 8616  H HG1  . THR B 1 83 ? 0.431   8.524   -4.627  1.00 0.00 ? 82 THR B HG1  3  
ATOM 8617  H HG21 . THR B 1 83 ? 1.253   8.191   -1.992  1.00 0.00 ? 82 THR B HG21 3  
ATOM 8618  H HG22 . THR B 1 83 ? 2.329   8.307   -3.384  1.00 0.00 ? 82 THR B HG22 3  
ATOM 8619  H HG23 . THR B 1 83 ? 2.530   9.407   -2.020  1.00 0.00 ? 82 THR B HG23 3  
ATOM 8620  N N    . ALA B 1 84 ? -1.888  11.757  -3.064  1.00 0.00 ? 83 ALA B N    3  
ATOM 8621  C CA   . ALA B 1 84 ? -2.607  12.911  -3.679  1.00 0.00 ? 83 ALA B CA   3  
ATOM 8622  C C    . ALA B 1 84 ? -2.326  14.168  -2.859  1.00 0.00 ? 83 ALA B C    3  
ATOM 8623  O O    . ALA B 1 84 ? -2.283  15.267  -3.377  1.00 0.00 ? 83 ALA B O    3  
ATOM 8624  C CB   . ALA B 1 84 ? -4.113  12.638  -3.689  1.00 0.00 ? 83 ALA B CB   3  
ATOM 8625  H H    . ALA B 1 84 ? -2.377  10.941  -2.828  1.00 0.00 ? 83 ALA B H    3  
ATOM 8626  H HA   . ALA B 1 84 ? -2.259  13.055  -4.691  1.00 0.00 ? 83 ALA B HA   3  
ATOM 8627  H HB1  . ALA B 1 84 ? -4.313  11.737  -4.248  1.00 0.00 ? 83 ALA B HB1  3  
ATOM 8628  H HB2  . ALA B 1 84 ? -4.465  12.519  -2.675  1.00 0.00 ? 83 ALA B HB2  3  
ATOM 8629  H HB3  . ALA B 1 84 ? -4.625  13.468  -4.152  1.00 0.00 ? 83 ALA B HB3  3  
ATOM 8630  N N    . CYS B 1 85 ? -2.127  14.011  -1.581  1.00 0.00 ? 84 CYS B N    3  
ATOM 8631  C CA   . CYS B 1 85 ? -1.839  15.194  -0.720  1.00 0.00 ? 84 CYS B CA   3  
ATOM 8632  C C    . CYS B 1 85 ? -0.417  15.685  -1.000  1.00 0.00 ? 84 CYS B C    3  
ATOM 8633  O O    . CYS B 1 85 ? 0.455   14.913  -1.348  1.00 0.00 ? 84 CYS B O    3  
ATOM 8634  C CB   . CYS B 1 85 ? -1.955  14.792  0.752   1.00 0.00 ? 84 CYS B CB   3  
ATOM 8635  S SG   . CYS B 1 85 ? -1.942  16.277  1.789   1.00 0.00 ? 84 CYS B SG   3  
ATOM 8636  H H    . CYS B 1 85 ? -2.165  13.112  -1.188  1.00 0.00 ? 84 CYS B H    3  
ATOM 8637  H HA   . CYS B 1 85 ? -2.545  15.983  -0.937  1.00 0.00 ? 84 CYS B HA   3  
ATOM 8638  H HB2  . CYS B 1 85 ? -2.877  14.253  0.907   1.00 0.00 ? 84 CYS B HB2  3  
ATOM 8639  H HB3  . CYS B 1 85 ? -1.120  14.160  1.019   1.00 0.00 ? 84 CYS B HB3  3  
ATOM 8640  H HG   . CYS B 1 85 ? -1.051  16.635  1.786   1.00 0.00 ? 84 CYS B HG   3  
ATOM 8641  N N    . HIS B 1 86 ? -0.172  16.961  -0.854  1.00 0.00 ? 85 HIS B N    3  
ATOM 8642  C CA   . HIS B 1 86 ? 1.200   17.487  -1.112  1.00 0.00 ? 85 HIS B CA   3  
ATOM 8643  C C    . HIS B 1 86 ? 2.218   16.618  -0.372  1.00 0.00 ? 85 HIS B C    3  
ATOM 8644  O O    . HIS B 1 86 ? 1.858   15.721  0.364   1.00 0.00 ? 85 HIS B O    3  
ATOM 8645  C CB   . HIS B 1 86 ? 1.303   18.932  -0.614  1.00 0.00 ? 85 HIS B CB   3  
ATOM 8646  C CG   . HIS B 1 86 ? 0.940   18.989  0.844   1.00 0.00 ? 85 HIS B CG   3  
ATOM 8647  N ND1  . HIS B 1 86 ? 0.403   17.902  1.513   1.00 0.00 ? 85 HIS B ND1  3  
ATOM 8648  C CD2  . HIS B 1 86 ? 1.031   19.995  1.775   1.00 0.00 ? 85 HIS B CD2  3  
ATOM 8649  C CE1  . HIS B 1 86 ? 0.193   18.274  2.789   1.00 0.00 ? 85 HIS B CE1  3  
ATOM 8650  N NE2  . HIS B 1 86 ? 0.558   19.541  3.002   1.00 0.00 ? 85 HIS B NE2  3  
ATOM 8651  H H    . HIS B 1 86 ? -0.887  17.570  -0.574  1.00 0.00 ? 85 HIS B H    3  
ATOM 8652  H HA   . HIS B 1 86 ? 1.403   17.456  -2.173  1.00 0.00 ? 85 HIS B HA   3  
ATOM 8653  H HB2  . HIS B 1 86 ? 2.315   19.286  -0.746  1.00 0.00 ? 85 HIS B HB2  3  
ATOM 8654  H HB3  . HIS B 1 86 ? 0.627   19.558  -1.178  1.00 0.00 ? 85 HIS B HB3  3  
ATOM 8655  H HD1  . HIS B 1 86 ? 0.212   17.022  1.128   1.00 0.00 ? 85 HIS B HD1  3  
ATOM 8656  H HD2  . HIS B 1 86 ? 1.411   20.988  1.584   1.00 0.00 ? 85 HIS B HD2  3  
ATOM 8657  H HE1  . HIS B 1 86 ? -0.221  17.627  3.548   1.00 0.00 ? 85 HIS B HE1  3  
ATOM 8658  N N    . GLU B 1 87 ? 3.484   16.874  -0.561  1.00 0.00 ? 86 GLU B N    3  
ATOM 8659  C CA   . GLU B 1 87 ? 4.531   16.062  0.131   1.00 0.00 ? 86 GLU B CA   3  
ATOM 8660  C C    . GLU B 1 87 ? 4.141   15.849  1.597   1.00 0.00 ? 86 GLU B C    3  
ATOM 8661  O O    . GLU B 1 87 ? 4.299   16.725  2.424   1.00 0.00 ? 86 GLU B O    3  
ATOM 8662  C CB   . GLU B 1 87 ? 5.869   16.802  0.064   1.00 0.00 ? 86 GLU B CB   3  
ATOM 8663  C CG   . GLU B 1 87 ? 6.435   16.709  -1.356  1.00 0.00 ? 86 GLU B CG   3  
ATOM 8664  C CD   . GLU B 1 87 ? 7.559   17.734  -1.529  1.00 0.00 ? 86 GLU B CD   3  
ATOM 8665  O OE1  . GLU B 1 87 ? 7.251   18.910  -1.625  1.00 0.00 ? 86 GLU B OE1  3  
ATOM 8666  O OE2  . GLU B 1 87 ? 8.708   17.324  -1.565  1.00 0.00 ? 86 GLU B OE2  3  
ATOM 8667  H H    . GLU B 1 87 ? 3.749   17.602  -1.161  1.00 0.00 ? 86 GLU B H    3  
ATOM 8668  H HA   . GLU B 1 87 ? 4.626   15.104  -0.358  1.00 0.00 ? 86 GLU B HA   3  
ATOM 8669  H HB2  . GLU B 1 87 ? 5.719   17.840  0.325   1.00 0.00 ? 86 GLU B HB2  3  
ATOM 8670  H HB3  . GLU B 1 87 ? 6.565   16.353  0.757   1.00 0.00 ? 86 GLU B HB3  3  
ATOM 8671  H HG2  . GLU B 1 87 ? 6.825   15.715  -1.523  1.00 0.00 ? 86 GLU B HG2  3  
ATOM 8672  H HG3  . GLU B 1 87 ? 5.652   16.913  -2.070  1.00 0.00 ? 86 GLU B HG3  3  
ATOM 8673  N N    . PHE B 1 88 ? 3.631   14.692  1.926   1.00 0.00 ? 87 PHE B N    3  
ATOM 8674  C CA   . PHE B 1 88 ? 3.234   14.435  3.337   1.00 0.00 ? 87 PHE B CA   3  
ATOM 8675  C C    . PHE B 1 88 ? 4.484   14.417  4.216   1.00 0.00 ? 87 PHE B C    3  
ATOM 8676  O O    . PHE B 1 88 ? 4.422   14.673  5.402   1.00 0.00 ? 87 PHE B O    3  
ATOM 8677  C CB   . PHE B 1 88 ? 2.501   13.094  3.443   1.00 0.00 ? 87 PHE B CB   3  
ATOM 8678  C CG   . PHE B 1 88 ? 3.311   12.003  2.784   1.00 0.00 ? 87 PHE B CG   3  
ATOM 8679  C CD1  . PHE B 1 88 ? 4.263   11.299  3.527   1.00 0.00 ? 87 PHE B CD1  3  
ATOM 8680  C CD2  . PHE B 1 88 ? 3.097   11.684  1.437   1.00 0.00 ? 87 PHE B CD2  3  
ATOM 8681  C CE1  . PHE B 1 88 ? 5.004   10.275  2.927   1.00 0.00 ? 87 PHE B CE1  3  
ATOM 8682  C CE2  . PHE B 1 88 ? 3.840   10.661  0.834   1.00 0.00 ? 87 PHE B CE2  3  
ATOM 8683  C CZ   . PHE B 1 88 ? 4.794   9.956   1.580   1.00 0.00 ? 87 PHE B CZ   3  
ATOM 8684  H H    . PHE B 1 88 ? 3.510   13.996  1.246   1.00 0.00 ? 87 PHE B H    3  
ATOM 8685  H HA   . PHE B 1 88 ? 2.579   15.226  3.670   1.00 0.00 ? 87 PHE B HA   3  
ATOM 8686  H HB2  . PHE B 1 88 ? 2.355   12.850  4.485   1.00 0.00 ? 87 PHE B HB2  3  
ATOM 8687  H HB3  . PHE B 1 88 ? 1.541   13.171  2.955   1.00 0.00 ? 87 PHE B HB3  3  
ATOM 8688  H HD1  . PHE B 1 88 ? 4.428   11.549  4.564   1.00 0.00 ? 87 PHE B HD1  3  
ATOM 8689  H HD2  . PHE B 1 88 ? 2.361   12.228  0.863   1.00 0.00 ? 87 PHE B HD2  3  
ATOM 8690  H HE1  . PHE B 1 88 ? 5.737   9.730   3.503   1.00 0.00 ? 87 PHE B HE1  3  
ATOM 8691  H HE2  . PHE B 1 88 ? 3.678   10.416  -0.205  1.00 0.00 ? 87 PHE B HE2  3  
ATOM 8692  H HZ   . PHE B 1 88 ? 5.365   9.165   1.116   1.00 0.00 ? 87 PHE B HZ   3  
ATOM 8693  N N    . PHE B 1 89 ? 5.624   14.128  3.645   1.00 0.00 ? 88 PHE B N    3  
ATOM 8694  C CA   . PHE B 1 89 ? 6.872   14.110  4.459   1.00 0.00 ? 88 PHE B CA   3  
ATOM 8695  C C    . PHE B 1 89 ? 6.968   15.421  5.236   1.00 0.00 ? 88 PHE B C    3  
ATOM 8696  O O    . PHE B 1 89 ? 7.316   15.451  6.400   1.00 0.00 ? 88 PHE B O    3  
ATOM 8697  C CB   . PHE B 1 89 ? 8.085   13.979  3.538   1.00 0.00 ? 88 PHE B CB   3  
ATOM 8698  C CG   . PHE B 1 89 ? 7.886   12.816  2.593   1.00 0.00 ? 88 PHE B CG   3  
ATOM 8699  C CD1  . PHE B 1 89 ? 8.036   11.502  3.055   1.00 0.00 ? 88 PHE B CD1  3  
ATOM 8700  C CD2  . PHE B 1 89 ? 7.556   13.052  1.252   1.00 0.00 ? 88 PHE B CD2  3  
ATOM 8701  C CE1  . PHE B 1 89 ? 7.857   10.426  2.176   1.00 0.00 ? 88 PHE B CE1  3  
ATOM 8702  C CE2  . PHE B 1 89 ? 7.378   11.977  0.375   1.00 0.00 ? 88 PHE B CE2  3  
ATOM 8703  C CZ   . PHE B 1 89 ? 7.528   10.664  0.836   1.00 0.00 ? 88 PHE B CZ   3  
ATOM 8704  H H    . PHE B 1 89 ? 5.658   13.931  2.686   1.00 0.00 ? 88 PHE B H    3  
ATOM 8705  H HA   . PHE B 1 89 ? 6.845   13.280  5.149   1.00 0.00 ? 88 PHE B HA   3  
ATOM 8706  H HB2  . PHE B 1 89 ? 8.202   14.891  2.970   1.00 0.00 ? 88 PHE B HB2  3  
ATOM 8707  H HB3  . PHE B 1 89 ? 8.970   13.811  4.133   1.00 0.00 ? 88 PHE B HB3  3  
ATOM 8708  H HD1  . PHE B 1 89 ? 8.289   11.319  4.089   1.00 0.00 ? 88 PHE B HD1  3  
ATOM 8709  H HD2  . PHE B 1 89 ? 7.441   14.064  0.895   1.00 0.00 ? 88 PHE B HD2  3  
ATOM 8710  H HE1  . PHE B 1 89 ? 7.972   9.411   2.531   1.00 0.00 ? 88 PHE B HE1  3  
ATOM 8711  H HE2  . PHE B 1 89 ? 7.123   12.159  -0.659  1.00 0.00 ? 88 PHE B HE2  3  
ATOM 8712  H HZ   . PHE B 1 89 ? 7.392   9.835   0.158   1.00 0.00 ? 88 PHE B HZ   3  
ATOM 8713  N N    . GLU B 1 90 ? 6.651   16.509  4.586   1.00 0.00 ? 89 GLU B N    3  
ATOM 8714  C CA   . GLU B 1 90 ? 6.703   17.839  5.253   1.00 0.00 ? 89 GLU B CA   3  
ATOM 8715  C C    . GLU B 1 90 ? 5.314   18.164  5.799   1.00 0.00 ? 89 GLU B C    3  
ATOM 8716  O O    . GLU B 1 90 ? 4.782   19.234  5.581   1.00 0.00 ? 89 GLU B O    3  
ATOM 8717  C CB   . GLU B 1 90 ? 7.123   18.903  4.232   1.00 0.00 ? 89 GLU B CB   3  
ATOM 8718  C CG   . GLU B 1 90 ? 7.602   20.161  4.961   1.00 0.00 ? 89 GLU B CG   3  
ATOM 8719  C CD   . GLU B 1 90 ? 7.892   21.264  3.942   1.00 0.00 ? 89 GLU B CD   3  
ATOM 8720  O OE1  . GLU B 1 90 ? 8.219   20.930  2.815   1.00 0.00 ? 89 GLU B OE1  3  
ATOM 8721  O OE2  . GLU B 1 90 ? 7.782   22.423  4.306   1.00 0.00 ? 89 GLU B OE2  3  
ATOM 8722  H H    . GLU B 1 90 ? 6.371   16.448  3.652   1.00 0.00 ? 89 GLU B H    3  
ATOM 8723  H HA   . GLU B 1 90 ? 7.415   17.814  6.065   1.00 0.00 ? 89 GLU B HA   3  
ATOM 8724  H HB2  . GLU B 1 90 ? 7.924   18.515  3.620   1.00 0.00 ? 89 GLU B HB2  3  
ATOM 8725  H HB3  . GLU B 1 90 ? 6.281   19.153  3.603   1.00 0.00 ? 89 GLU B HB3  3  
ATOM 8726  H HG2  . GLU B 1 90 ? 6.835   20.495  5.645   1.00 0.00 ? 89 GLU B HG2  3  
ATOM 8727  H HG3  . GLU B 1 90 ? 8.503   19.936  5.511   1.00 0.00 ? 89 GLU B HG3  3  
ATOM 8728  N N    . HIS B 1 91 ? 4.723   17.240  6.503   1.00 0.00 ? 90 HIS B N    3  
ATOM 8729  C CA   . HIS B 1 91 ? 3.367   17.481  7.062   1.00 0.00 ? 90 HIS B CA   3  
ATOM 8730  C C    . HIS B 1 91 ? 3.405   18.701  7.983   1.00 0.00 ? 90 HIS B C    3  
ATOM 8731  O O    . HIS B 1 91 ? 3.493   18.578  9.189   1.00 0.00 ? 90 HIS B O    3  
ATOM 8732  C CB   . HIS B 1 91 ? 2.922   16.256  7.859   1.00 0.00 ? 90 HIS B CB   3  
ATOM 8733  C CG   . HIS B 1 91 ? 1.495   16.436  8.289   1.00 0.00 ? 90 HIS B CG   3  
ATOM 8734  N ND1  . HIS B 1 91 ? 1.158   16.930  9.538   1.00 0.00 ? 90 HIS B ND1  3  
ATOM 8735  C CD2  . HIS B 1 91 ? 0.306   16.202  7.644   1.00 0.00 ? 90 HIS B CD2  3  
ATOM 8736  C CE1  . HIS B 1 91 ? -0.185  16.978  9.606   1.00 0.00 ? 90 HIS B CE1  3  
ATOM 8737  N NE2  . HIS B 1 91 ? -0.754  16.545  8.477   1.00 0.00 ? 90 HIS B NE2  3  
ATOM 8738  H H    . HIS B 1 91 ? 5.172   16.384  6.662   1.00 0.00 ? 90 HIS B H    3  
ATOM 8739  H HA   . HIS B 1 91 ? 2.671   17.660  6.256   1.00 0.00 ? 90 HIS B HA   3  
ATOM 8740  H HB2  . HIS B 1 91 ? 3.005   15.374  7.241   1.00 0.00 ? 90 HIS B HB2  3  
ATOM 8741  H HB3  . HIS B 1 91 ? 3.549   16.145  8.731   1.00 0.00 ? 90 HIS B HB3  3  
ATOM 8742  H HD1  . HIS B 1 91 ? 1.784   17.194  10.244  1.00 0.00 ? 90 HIS B HD1  3  
ATOM 8743  H HD2  . HIS B 1 91 ? 0.209   15.810  6.642   1.00 0.00 ? 90 HIS B HD2  3  
ATOM 8744  H HE1  . HIS B 1 91 ? -0.735  17.326  10.467  1.00 0.00 ? 90 HIS B HE1  3  
ATOM 8745  N N    . GLU B 1 92 ? 3.338   19.877  7.424   1.00 0.00 ? 91 GLU B N    3  
ATOM 8746  C CA   . GLU B 1 92 ? 3.370   21.102  8.270   1.00 0.00 ? 91 GLU B CA   3  
ATOM 8747  C C    . GLU B 1 92 ? 2.313   20.988  9.370   1.00 0.00 ? 91 GLU B C    3  
ATOM 8748  O O    . GLU B 1 92 ? 1.309   20.334  9.134   1.00 0.00 ? 91 GLU B O    3  
ATOM 8749  C CB   . GLU B 1 92 ? 3.076   22.329  7.403   1.00 0.00 ? 91 GLU B CB   3  
ATOM 8750  C CG   . GLU B 1 92 ? 4.208   22.526  6.390   1.00 0.00 ? 91 GLU B CG   3  
ATOM 8751  C CD   . GLU B 1 92 ? 5.436   23.103  7.098   1.00 0.00 ? 91 GLU B CD   3  
ATOM 8752  O OE1  . GLU B 1 92 ? 5.255   23.913  7.993   1.00 0.00 ? 91 GLU B OE1  3  
ATOM 8753  O OE2  . GLU B 1 92 ? 6.538   22.726  6.733   1.00 0.00 ? 91 GLU B OE2  3  
ATOM 8754  O OXT  . GLU B 1 92 ? 2.526   21.553  10.430  1.00 0.00 ? 91 GLU B OXT  3  
ATOM 8755  H H    . GLU B 1 92 ? 3.267   19.955  6.450   1.00 0.00 ? 91 GLU B H    3  
ATOM 8756  H HA   . GLU B 1 92 ? 4.347   21.204  8.719   1.00 0.00 ? 91 GLU B HA   3  
ATOM 8757  H HB2  . GLU B 1 92 ? 2.143   22.181  6.876   1.00 0.00 ? 91 GLU B HB2  3  
ATOM 8758  H HB3  . GLU B 1 92 ? 3.001   23.203  8.031   1.00 0.00 ? 91 GLU B HB3  3  
ATOM 8759  H HG2  . GLU B 1 92 ? 4.462   21.575  5.945   1.00 0.00 ? 91 GLU B HG2  3  
ATOM 8760  H HG3  . GLU B 1 92 ? 3.886   23.210  5.620   1.00 0.00 ? 91 GLU B HG3  3  
ATOM 8761  N N    . MET A 1 1  ? -11.535 7.169   12.675  1.00 0.00 ? 0  MET A N    4  
ATOM 8762  C CA   . MET A 1 1  ? -10.337 6.709   13.432  1.00 0.00 ? 0  MET A CA   4  
ATOM 8763  C C    . MET A 1 1  ? -10.404 5.192   13.626  1.00 0.00 ? 0  MET A C    4  
ATOM 8764  O O    . MET A 1 1  ? -10.198 4.686   14.712  1.00 0.00 ? 0  MET A O    4  
ATOM 8765  C CB   . MET A 1 1  ? -10.300 7.399   14.798  1.00 0.00 ? 0  MET A CB   4  
ATOM 8766  C CG   . MET A 1 1  ? -11.688 7.343   15.438  1.00 0.00 ? 0  MET A CG   4  
ATOM 8767  S SD   . MET A 1 1  ? -11.560 7.770   17.193  1.00 0.00 ? 0  MET A SD   4  
ATOM 8768  C CE   . MET A 1 1  ? -13.138 7.055   17.715  1.00 0.00 ? 0  MET A CE   4  
ATOM 8769  H H1   . MET A 1 1  ? -11.588 6.665   11.767  1.00 0.00 ? 0  MET A H1   4  
ATOM 8770  H H2   . MET A 1 1  ? -12.393 6.972   13.228  1.00 0.00 ? 0  MET A H2   4  
ATOM 8771  H H3   . MET A 1 1  ? -11.461 8.192   12.500  1.00 0.00 ? 0  MET A H3   4  
ATOM 8772  H HA   . MET A 1 1  ? -9.444  6.960   12.879  1.00 0.00 ? 0  MET A HA   4  
ATOM 8773  H HB2  . MET A 1 1  ? -9.587  6.896   15.435  1.00 0.00 ? 0  MET A HB2  4  
ATOM 8774  H HB3  . MET A 1 1  ? -10.005 8.430   14.671  1.00 0.00 ? 0  MET A HB3  4  
ATOM 8775  H HG2  . MET A 1 1  ? -12.342 8.045   14.943  1.00 0.00 ? 0  MET A HG2  4  
ATOM 8776  H HG3  . MET A 1 1  ? -12.090 6.345   15.339  1.00 0.00 ? 0  MET A HG3  4  
ATOM 8777  H HE1  . MET A 1 1  ? -13.900 7.298   16.988  1.00 0.00 ? 0  MET A HE1  4  
ATOM 8778  H HE2  . MET A 1 1  ? -13.038 5.982   17.795  1.00 0.00 ? 0  MET A HE2  4  
ATOM 8779  H HE3  . MET A 1 1  ? -13.417 7.460   18.675  1.00 0.00 ? 0  MET A HE3  4  
ATOM 8780  N N    . SER A 1 2  ? -10.687 4.460   12.582  1.00 0.00 ? 1  SER A N    4  
ATOM 8781  C CA   . SER A 1 2  ? -10.760 2.977   12.713  1.00 0.00 ? 1  SER A CA   4  
ATOM 8782  C C    . SER A 1 2  ? -9.359  2.423   12.973  1.00 0.00 ? 1  SER A C    4  
ATOM 8783  O O    . SER A 1 2  ? -8.375  3.126   12.866  1.00 0.00 ? 1  SER A O    4  
ATOM 8784  C CB   . SER A 1 2  ? -11.315 2.376   11.421  1.00 0.00 ? 1  SER A CB   4  
ATOM 8785  O OG   . SER A 1 2  ? -10.308 2.409   10.417  1.00 0.00 ? 1  SER A OG   4  
ATOM 8786  H H    . SER A 1 2  ? -10.847 4.884   11.714  1.00 0.00 ? 1  SER A H    4  
ATOM 8787  H HA   . SER A 1 2  ? -11.408 2.721   13.538  1.00 0.00 ? 1  SER A HA   4  
ATOM 8788  H HB2  . SER A 1 2  ? -11.610 1.354   11.594  1.00 0.00 ? 1  SER A HB2  4  
ATOM 8789  H HB3  . SER A 1 2  ? -12.177 2.947   11.100  1.00 0.00 ? 1  SER A HB3  4  
ATOM 8790  H HG   . SER A 1 2  ? -9.711  1.674   10.572  1.00 0.00 ? 1  SER A HG   4  
ATOM 8791  N N    . GLU A 1 3  ? -9.260  1.167   13.317  1.00 0.00 ? 2  GLU A N    4  
ATOM 8792  C CA   . GLU A 1 3  ? -7.919  0.574   13.587  1.00 0.00 ? 2  GLU A CA   4  
ATOM 8793  C C    . GLU A 1 3  ? -7.027  0.743   12.354  1.00 0.00 ? 2  GLU A C    4  
ATOM 8794  O O    . GLU A 1 3  ? -5.832  0.936   12.460  1.00 0.00 ? 2  GLU A O    4  
ATOM 8795  C CB   . GLU A 1 3  ? -8.078  -0.916  13.899  1.00 0.00 ? 2  GLU A CB   4  
ATOM 8796  C CG   . GLU A 1 3  ? -6.772  -1.462  14.482  1.00 0.00 ? 2  GLU A CG   4  
ATOM 8797  C CD   . GLU A 1 3  ? -6.608  -0.979  15.926  1.00 0.00 ? 2  GLU A CD   4  
ATOM 8798  O OE1  . GLU A 1 3  ? -7.580  -0.503  16.487  1.00 0.00 ? 2  GLU A OE1  4  
ATOM 8799  O OE2  . GLU A 1 3  ? -5.510  -1.096  16.445  1.00 0.00 ? 2  GLU A OE2  4  
ATOM 8800  H H    . GLU A 1 3  ? -10.066 0.616   13.400  1.00 0.00 ? 2  GLU A H    4  
ATOM 8801  H HA   . GLU A 1 3  ? -7.466  1.074   14.431  1.00 0.00 ? 2  GLU A HA   4  
ATOM 8802  H HB2  . GLU A 1 3  ? -8.878  -1.052  14.613  1.00 0.00 ? 2  GLU A HB2  4  
ATOM 8803  H HB3  . GLU A 1 3  ? -8.313  -1.450  12.991  1.00 0.00 ? 2  GLU A HB3  4  
ATOM 8804  H HG2  . GLU A 1 3  ? -6.796  -2.542  14.465  1.00 0.00 ? 2  GLU A HG2  4  
ATOM 8805  H HG3  . GLU A 1 3  ? -5.941  -1.110  13.891  1.00 0.00 ? 2  GLU A HG3  4  
ATOM 8806  N N    . LEU A 1 4  ? -7.600  0.663   11.184  1.00 0.00 ? 3  LEU A N    4  
ATOM 8807  C CA   . LEU A 1 4  ? -6.791  0.808   9.940   1.00 0.00 ? 3  LEU A CA   4  
ATOM 8808  C C    . LEU A 1 4  ? -6.149  2.201   9.899   1.00 0.00 ? 3  LEU A C    4  
ATOM 8809  O O    . LEU A 1 4  ? -4.967  2.339   9.659   1.00 0.00 ? 3  LEU A O    4  
ATOM 8810  C CB   . LEU A 1 4  ? -7.707  0.610   8.717   1.00 0.00 ? 3  LEU A CB   4  
ATOM 8811  C CG   . LEU A 1 4  ? -6.901  0.070   7.526   1.00 0.00 ? 3  LEU A CG   4  
ATOM 8812  C CD1  . LEU A 1 4  ? -7.835  -0.125  6.329   1.00 0.00 ? 3  LEU A CD1  4  
ATOM 8813  C CD2  . LEU A 1 4  ? -5.786  1.060   7.155   1.00 0.00 ? 3  LEU A CD2  4  
ATOM 8814  H H    . LEU A 1 4  ? -8.563  0.494   11.123  1.00 0.00 ? 3  LEU A H    4  
ATOM 8815  H HA   . LEU A 1 4  ? -6.014  0.057   9.936   1.00 0.00 ? 3  LEU A HA   4  
ATOM 8816  H HB2  . LEU A 1 4  ? -8.484  -0.096  8.968   1.00 0.00 ? 3  LEU A HB2  4  
ATOM 8817  H HB3  . LEU A 1 4  ? -8.160  1.553   8.443   1.00 0.00 ? 3  LEU A HB3  4  
ATOM 8818  H HG   . LEU A 1 4  ? -6.463  -0.882  7.795   1.00 0.00 ? 3  LEU A HG   4  
ATOM 8819  H HD11 . LEU A 1 4  ? -8.746  -0.605  6.656   1.00 0.00 ? 3  LEU A HD11 4  
ATOM 8820  H HD12 . LEU A 1 4  ? -8.069  0.836   5.896   1.00 0.00 ? 3  LEU A HD12 4  
ATOM 8821  H HD13 . LEU A 1 4  ? -7.347  -0.744  5.590   1.00 0.00 ? 3  LEU A HD13 4  
ATOM 8822  H HD21 . LEU A 1 4  ? -6.151  2.073   7.252   1.00 0.00 ? 3  LEU A HD21 4  
ATOM 8823  H HD22 . LEU A 1 4  ? -4.946  0.916   7.815   1.00 0.00 ? 3  LEU A HD22 4  
ATOM 8824  H HD23 . LEU A 1 4  ? -5.471  0.888   6.135   1.00 0.00 ? 3  LEU A HD23 4  
ATOM 8825  N N    . GLU A 1 5  ? -6.911  3.236   10.139  1.00 0.00 ? 4  GLU A N    4  
ATOM 8826  C CA   . GLU A 1 5  ? -6.324  4.606   10.112  1.00 0.00 ? 4  GLU A CA   4  
ATOM 8827  C C    . GLU A 1 5  ? -5.060  4.630   10.973  1.00 0.00 ? 4  GLU A C    4  
ATOM 8828  O O    . GLU A 1 5  ? -4.027  5.129   10.575  1.00 0.00 ? 4  GLU A O    4  
ATOM 8829  C CB   . GLU A 1 5  ? -7.340  5.608   10.664  1.00 0.00 ? 4  GLU A CB   4  
ATOM 8830  C CG   . GLU A 1 5  ? -8.658  5.469   9.899   1.00 0.00 ? 4  GLU A CG   4  
ATOM 8831  C CD   . GLU A 1 5  ? -9.604  6.602   10.299  1.00 0.00 ? 4  GLU A CD   4  
ATOM 8832  O OE1  . GLU A 1 5  ? -9.144  7.729   10.383  1.00 0.00 ? 4  GLU A OE1  4  
ATOM 8833  O OE2  . GLU A 1 5  ? -10.772 6.324   10.513  1.00 0.00 ? 4  GLU A OE2  4  
ATOM 8834  H H    . GLU A 1 5  ? -7.862  3.118   10.343  1.00 0.00 ? 4  GLU A H    4  
ATOM 8835  H HA   . GLU A 1 5  ? -6.073  4.870   9.095   1.00 0.00 ? 4  GLU A HA   4  
ATOM 8836  H HB2  . GLU A 1 5  ? -7.508  5.408   11.713  1.00 0.00 ? 4  GLU A HB2  4  
ATOM 8837  H HB3  . GLU A 1 5  ? -6.959  6.611   10.545  1.00 0.00 ? 4  GLU A HB3  4  
ATOM 8838  H HG2  . GLU A 1 5  ? -8.463  5.519   8.836   1.00 0.00 ? 4  GLU A HG2  4  
ATOM 8839  H HG3  . GLU A 1 5  ? -9.115  4.521   10.137  1.00 0.00 ? 4  GLU A HG3  4  
ATOM 8840  N N    . LYS A 1 6  ? -5.142  4.073   12.149  1.00 0.00 ? 5  LYS A N    4  
ATOM 8841  C CA   . LYS A 1 6  ? -3.957  4.034   13.050  1.00 0.00 ? 5  LYS A CA   4  
ATOM 8842  C C    . LYS A 1 6  ? -2.747  3.517   12.270  1.00 0.00 ? 5  LYS A C    4  
ATOM 8843  O O    . LYS A 1 6  ? -1.640  3.998   12.410  1.00 0.00 ? 5  LYS A O    4  
ATOM 8844  C CB   . LYS A 1 6  ? -4.243  3.066   14.204  1.00 0.00 ? 5  LYS A CB   4  
ATOM 8845  C CG   . LYS A 1 6  ? -5.598  3.395   14.841  1.00 0.00 ? 5  LYS A CG   4  
ATOM 8846  C CD   . LYS A 1 6  ? -5.636  4.870   15.266  1.00 0.00 ? 5  LYS A CD   4  
ATOM 8847  C CE   . LYS A 1 6  ? -6.740  5.077   16.307  1.00 0.00 ? 5  LYS A CE   4  
ATOM 8848  N NZ   . LYS A 1 6  ? -6.975  6.535   16.504  1.00 0.00 ? 5  LYS A NZ   4  
ATOM 8849  H H    . LYS A 1 6  ? -5.986  3.670   12.439  1.00 0.00 ? 5  LYS A H    4  
ATOM 8850  H HA   . LYS A 1 6  ? -3.762  5.015   13.458  1.00 0.00 ? 5  LYS A HA   4  
ATOM 8851  H HB2  . LYS A 1 6  ? -4.263  2.054   13.825  1.00 0.00 ? 5  LYS A HB2  4  
ATOM 8852  H HB3  . LYS A 1 6  ? -3.467  3.155   14.949  1.00 0.00 ? 5  LYS A HB3  4  
ATOM 8853  H HG2  . LYS A 1 6  ? -6.385  3.207   14.127  1.00 0.00 ? 5  LYS A HG2  4  
ATOM 8854  H HG3  . LYS A 1 6  ? -5.744  2.768   15.708  1.00 0.00 ? 5  LYS A HG3  4  
ATOM 8855  H HD2  . LYS A 1 6  ? -4.683  5.150   15.693  1.00 0.00 ? 5  LYS A HD2  4  
ATOM 8856  H HD3  . LYS A 1 6  ? -5.840  5.489   14.405  1.00 0.00 ? 5  LYS A HD3  4  
ATOM 8857  H HE2  . LYS A 1 6  ? -7.651  4.609   15.962  1.00 0.00 ? 5  LYS A HE2  4  
ATOM 8858  H HE3  . LYS A 1 6  ? -6.440  4.631   17.244  1.00 0.00 ? 5  LYS A HE3  4  
ATOM 8859  H HZ1  . LYS A 1 6  ? -7.054  7.002   15.580  1.00 0.00 ? 5  LYS A HZ1  4  
ATOM 8860  H HZ2  . LYS A 1 6  ? -7.856  6.676   17.038  1.00 0.00 ? 5  LYS A HZ2  4  
ATOM 8861  H HZ3  . LYS A 1 6  ? -6.178  6.945   17.034  1.00 0.00 ? 5  LYS A HZ3  4  
ATOM 8862  N N    . ALA A 1 7  ? -2.967  2.521   11.455  1.00 0.00 ? 6  ALA A N    4  
ATOM 8863  C CA   . ALA A 1 7  ? -1.864  1.924   10.651  1.00 0.00 ? 6  ALA A CA   4  
ATOM 8864  C C    . ALA A 1 7  ? -1.556  2.788   9.420   1.00 0.00 ? 6  ALA A C    4  
ATOM 8865  O O    . ALA A 1 7  ? -0.425  2.865   8.984   1.00 0.00 ? 6  ALA A O    4  
ATOM 8866  C CB   . ALA A 1 7  ? -2.289  0.514   10.210  1.00 0.00 ? 6  ALA A CB   4  
ATOM 8867  H H    . ALA A 1 7  ? -3.873  2.157   11.372  1.00 0.00 ? 6  ALA A H    4  
ATOM 8868  H HA   . ALA A 1 7  ? -0.970  1.859   11.253  1.00 0.00 ? 6  ALA A HA   4  
ATOM 8869  H HB1  . ALA A 1 7  ? -3.356  0.498   10.047  1.00 0.00 ? 6  ALA A HB1  4  
ATOM 8870  H HB2  . ALA A 1 7  ? -1.785  0.245   9.294   1.00 0.00 ? 6  ALA A HB2  4  
ATOM 8871  H HB3  . ALA A 1 7  ? -2.035  -0.198  10.982  1.00 0.00 ? 6  ALA A HB3  4  
ATOM 8872  N N    . MET A 1 8  ? -2.533  3.442   8.857   1.00 0.00 ? 7  MET A N    4  
ATOM 8873  C CA   . MET A 1 8  ? -2.245  4.290   7.664   1.00 0.00 ? 7  MET A CA   4  
ATOM 8874  C C    . MET A 1 8  ? -1.255  5.389   8.081   1.00 0.00 ? 7  MET A C    4  
ATOM 8875  O O    . MET A 1 8  ? -0.268  5.642   7.417   1.00 0.00 ? 7  MET A O    4  
ATOM 8876  C CB   . MET A 1 8  ? -3.562  4.910   7.145   1.00 0.00 ? 7  MET A CB   4  
ATOM 8877  C CG   . MET A 1 8  ? -3.541  5.020   5.613   1.00 0.00 ? 7  MET A CG   4  
ATOM 8878  S SD   . MET A 1 8  ? -1.925  5.626   5.058   1.00 0.00 ? 7  MET A SD   4  
ATOM 8879  C CE   . MET A 1 8  ? -1.824  4.661   3.527   1.00 0.00 ? 7  MET A CE   4  
ATOM 8880  H H    . MET A 1 8  ? -3.443  3.381   9.214   1.00 0.00 ? 7  MET A H    4  
ATOM 8881  H HA   . MET A 1 8  ? -1.796  3.676   6.896   1.00 0.00 ? 7  MET A HA   4  
ATOM 8882  H HB2  . MET A 1 8  ? -4.387  4.279   7.442   1.00 0.00 ? 7  MET A HB2  4  
ATOM 8883  H HB3  . MET A 1 8  ? -3.699  5.894   7.572   1.00 0.00 ? 7  MET A HB3  4  
ATOM 8884  H HG2  . MET A 1 8  ? -3.730  4.048   5.182   1.00 0.00 ? 7  MET A HG2  4  
ATOM 8885  H HG3  . MET A 1 8  ? -4.311  5.708   5.294   1.00 0.00 ? 7  MET A HG3  4  
ATOM 8886  H HE1  . MET A 1 8  ? -2.762  4.719   2.999   1.00 0.00 ? 7  MET A HE1  4  
ATOM 8887  H HE2  . MET A 1 8  ? -1.037  5.061   2.902   1.00 0.00 ? 7  MET A HE2  4  
ATOM 8888  H HE3  . MET A 1 8  ? -1.611  3.628   3.765   1.00 0.00 ? 7  MET A HE3  4  
ATOM 8889  N N    . VAL A 1 9  ? -1.515  6.027   9.189   1.00 0.00 ? 8  VAL A N    4  
ATOM 8890  C CA   . VAL A 1 9  ? -0.604  7.099   9.682   1.00 0.00 ? 8  VAL A CA   4  
ATOM 8891  C C    . VAL A 1 9  ? 0.715   6.476   10.149  1.00 0.00 ? 8  VAL A C    4  
ATOM 8892  O O    . VAL A 1 9  ? 1.778   7.036   9.965   1.00 0.00 ? 8  VAL A O    4  
ATOM 8893  C CB   . VAL A 1 9  ? -1.271  7.815   10.856  1.00 0.00 ? 8  VAL A CB   4  
ATOM 8894  C CG1  . VAL A 1 9  ? -0.443  9.042   11.243  1.00 0.00 ? 8  VAL A CG1  4  
ATOM 8895  C CG2  . VAL A 1 9  ? -2.678  8.260   10.444  1.00 0.00 ? 8  VAL A CG2  4  
ATOM 8896  H H    . VAL A 1 9  ? -2.313  5.793   9.708   1.00 0.00 ? 8  VAL A H    4  
ATOM 8897  H HA   . VAL A 1 9  ? -0.405  7.818   8.900   1.00 0.00 ? 8  VAL A HA   4  
ATOM 8898  H HB   . VAL A 1 9  ? -1.335  7.143   11.699  1.00 0.00 ? 8  VAL A HB   4  
ATOM 8899  H HG11 . VAL A 1 9  ? -0.279  9.655   10.369  1.00 0.00 ? 8  VAL A HG11 4  
ATOM 8900  H HG12 . VAL A 1 9  ? -0.974  9.614   11.989  1.00 0.00 ? 8  VAL A HG12 4  
ATOM 8901  H HG13 . VAL A 1 9  ? 0.508   8.723   11.643  1.00 0.00 ? 8  VAL A HG13 4  
ATOM 8902  H HG21 . VAL A 1 9  ? -3.256  7.398   10.144  1.00 0.00 ? 8  VAL A HG21 4  
ATOM 8903  H HG22 . VAL A 1 9  ? -3.162  8.744   11.279  1.00 0.00 ? 8  VAL A HG22 4  
ATOM 8904  H HG23 . VAL A 1 9  ? -2.609  8.953   9.617   1.00 0.00 ? 8  VAL A HG23 4  
ATOM 8905  N N    . ALA A 1 10 ? 0.654   5.316   10.746  1.00 0.00 ? 9  ALA A N    4  
ATOM 8906  C CA   . ALA A 1 10 ? 1.900   4.646   11.221  1.00 0.00 ? 9  ALA A CA   4  
ATOM 8907  C C    . ALA A 1 10 ? 2.847   4.442   10.037  1.00 0.00 ? 9  ALA A C    4  
ATOM 8908  O O    . ALA A 1 10 ? 4.022   4.743   10.102  1.00 0.00 ? 9  ALA A O    4  
ATOM 8909  C CB   . ALA A 1 10 ? 1.534   3.279   11.804  1.00 0.00 ? 9  ALA A CB   4  
ATOM 8910  H H    . ALA A 1 10 ? -0.213  4.880   10.878  1.00 0.00 ? 9  ALA A H    4  
ATOM 8911  H HA   . ALA A 1 10 ? 2.373   5.240   11.990  1.00 0.00 ? 9  ALA A HA   4  
ATOM 8912  H HB1  . ALA A 1 10 ? 0.700   3.389   12.482  1.00 0.00 ? 9  ALA A HB1  4  
ATOM 8913  H HB2  . ALA A 1 10 ? 1.260   2.608   11.003  1.00 0.00 ? 9  ALA A HB2  4  
ATOM 8914  H HB3  . ALA A 1 10 ? 2.381   2.877   12.338  1.00 0.00 ? 9  ALA A HB3  4  
ATOM 8915  N N    . LEU A 1 11 ? 2.335   3.915   8.963   1.00 0.00 ? 10 LEU A N    4  
ATOM 8916  C CA   . LEU A 1 11 ? 3.182   3.661   7.766   1.00 0.00 ? 10 LEU A CA   4  
ATOM 8917  C C    . LEU A 1 11 ? 3.954   4.922   7.399   1.00 0.00 ? 10 LEU A C    4  
ATOM 8918  O O    . LEU A 1 11 ? 5.162   4.924   7.273   1.00 0.00 ? 10 LEU A O    4  
ATOM 8919  C CB   . LEU A 1 11 ? 2.254   3.304   6.586   1.00 0.00 ? 10 LEU A CB   4  
ATOM 8920  C CG   . LEU A 1 11 ? 1.860   1.814   6.640   1.00 0.00 ? 10 LEU A CG   4  
ATOM 8921  C CD1  . LEU A 1 11 ? 0.559   1.600   5.860   1.00 0.00 ? 10 LEU A CD1  4  
ATOM 8922  C CD2  . LEU A 1 11 ? 2.965   0.944   6.014   1.00 0.00 ? 10 LEU A CD2  4  
ATOM 8923  H H    . LEU A 1 11 ? 1.387   3.669   8.948   1.00 0.00 ? 10 LEU A H    4  
ATOM 8924  H HA   . LEU A 1 11 ? 3.839   2.827   7.948   1.00 0.00 ? 10 LEU A HA   4  
ATOM 8925  H HB2  . LEU A 1 11 ? 1.363   3.914   6.647   1.00 0.00 ? 10 LEU A HB2  4  
ATOM 8926  H HB3  . LEU A 1 11 ? 2.757   3.508   5.650   1.00 0.00 ? 10 LEU A HB3  4  
ATOM 8927  H HG   . LEU A 1 11 ? 1.710   1.519   7.670   1.00 0.00 ? 10 LEU A HG   4  
ATOM 8928  H HD11 . LEU A 1 11 ? 0.597   2.156   4.934   1.00 0.00 ? 10 LEU A HD11 4  
ATOM 8929  H HD12 . LEU A 1 11 ? 0.438   0.551   5.643   1.00 0.00 ? 10 LEU A HD12 4  
ATOM 8930  H HD13 . LEU A 1 11 ? -0.276  1.943   6.452   1.00 0.00 ? 10 LEU A HD13 4  
ATOM 8931  H HD21 . LEU A 1 11 ? 3.226   1.331   5.041   1.00 0.00 ? 10 LEU A HD21 4  
ATOM 8932  H HD22 . LEU A 1 11 ? 3.837   0.946   6.648   1.00 0.00 ? 10 LEU A HD22 4  
ATOM 8933  H HD23 . LEU A 1 11 ? 2.605   -0.069  5.910   1.00 0.00 ? 10 LEU A HD23 4  
ATOM 8934  N N    . ILE A 1 12 ? 3.238   5.989   7.198   1.00 0.00 ? 11 ILE A N    4  
ATOM 8935  C CA   . ILE A 1 12 ? 3.881   7.266   6.803   1.00 0.00 ? 11 ILE A CA   4  
ATOM 8936  C C    . ILE A 1 12 ? 4.969   7.653   7.802   1.00 0.00 ? 11 ILE A C    4  
ATOM 8937  O O    . ILE A 1 12 ? 6.017   8.139   7.425   1.00 0.00 ? 11 ILE A O    4  
ATOM 8938  C CB   . ILE A 1 12 ? 2.822   8.369   6.761   1.00 0.00 ? 11 ILE A CB   4  
ATOM 8939  C CG1  . ILE A 1 12 ? 1.789   8.039   5.678   1.00 0.00 ? 11 ILE A CG1  4  
ATOM 8940  C CG2  . ILE A 1 12 ? 3.489   9.710   6.442   1.00 0.00 ? 11 ILE A CG2  4  
ATOM 8941  C CD1  . ILE A 1 12 ? 0.580   8.966   5.822   1.00 0.00 ? 11 ILE A CD1  4  
ATOM 8942  H H    . ILE A 1 12 ? 2.263   5.942   7.290   1.00 0.00 ? 11 ILE A H    4  
ATOM 8943  H HA   . ILE A 1 12 ? 4.318   7.158   5.822   1.00 0.00 ? 11 ILE A HA   4  
ATOM 8944  H HB   . ILE A 1 12 ? 2.332   8.432   7.722   1.00 0.00 ? 11 ILE A HB   4  
ATOM 8945  H HG12 . ILE A 1 12 ? 2.235   8.176   4.703   1.00 0.00 ? 11 ILE A HG12 4  
ATOM 8946  H HG13 . ILE A 1 12 ? 1.469   7.014   5.786   1.00 0.00 ? 11 ILE A HG13 4  
ATOM 8947  H HG21 . ILE A 1 12 ? 4.206   9.575   5.646   1.00 0.00 ? 11 ILE A HG21 4  
ATOM 8948  H HG22 . ILE A 1 12 ? 2.739   10.423  6.133   1.00 0.00 ? 11 ILE A HG22 4  
ATOM 8949  H HG23 . ILE A 1 12 ? 3.995   10.078  7.322   1.00 0.00 ? 11 ILE A HG23 4  
ATOM 8950  H HD11 . ILE A 1 12 ? 0.228   8.945   6.842   1.00 0.00 ? 11 ILE A HD11 4  
ATOM 8951  H HD12 . ILE A 1 12 ? 0.866   9.974   5.560   1.00 0.00 ? 11 ILE A HD12 4  
ATOM 8952  H HD13 . ILE A 1 12 ? -0.208  8.634   5.163   1.00 0.00 ? 11 ILE A HD13 4  
ATOM 8953  N N    . ASP A 1 13 ? 4.731   7.482   9.075   1.00 0.00 ? 12 ASP A N    4  
ATOM 8954  C CA   . ASP A 1 13 ? 5.765   7.893   10.064  1.00 0.00 ? 12 ASP A CA   4  
ATOM 8955  C C    . ASP A 1 13 ? 6.970   6.946   10.013  1.00 0.00 ? 12 ASP A C    4  
ATOM 8956  O O    . ASP A 1 13 ? 8.096   7.377   10.165  1.00 0.00 ? 12 ASP A O    4  
ATOM 8957  C CB   . ASP A 1 13 ? 5.172   7.920   11.473  1.00 0.00 ? 12 ASP A CB   4  
ATOM 8958  C CG   . ASP A 1 13 ? 6.230   8.411   12.463  1.00 0.00 ? 12 ASP A CG   4  
ATOM 8959  O OD1  . ASP A 1 13 ? 6.515   9.597   12.455  1.00 0.00 ? 12 ASP A OD1  4  
ATOM 8960  O OD2  . ASP A 1 13 ? 6.737   7.592   13.212  1.00 0.00 ? 12 ASP A OD2  4  
ATOM 8961  H H    . ASP A 1 13 ? 3.873   7.117   9.376   1.00 0.00 ? 12 ASP A H    4  
ATOM 8962  H HA   . ASP A 1 13 ? 6.091   8.884   9.783   1.00 0.00 ? 12 ASP A HA   4  
ATOM 8963  H HB2  . ASP A 1 13 ? 4.321   8.586   11.493  1.00 0.00 ? 12 ASP A HB2  4  
ATOM 8964  H HB3  . ASP A 1 13 ? 4.857   6.925   11.751  1.00 0.00 ? 12 ASP A HB3  4  
ATOM 8965  N N    . VAL A 1 14 ? 6.772   5.667   9.801   1.00 0.00 ? 13 VAL A N    4  
ATOM 8966  C CA   . VAL A 1 14 ? 7.958   4.762   9.754   1.00 0.00 ? 13 VAL A CA   4  
ATOM 8967  C C    . VAL A 1 14 ? 8.752   5.053   8.481   1.00 0.00 ? 13 VAL A C    4  
ATOM 8968  O O    . VAL A 1 14 ? 9.964   5.140   8.511   1.00 0.00 ? 13 VAL A O    4  
ATOM 8969  C CB   . VAL A 1 14 ? 7.532   3.294   9.798   1.00 0.00 ? 13 VAL A CB   4  
ATOM 8970  C CG1  . VAL A 1 14 ? 8.769   2.399   9.674   1.00 0.00 ? 13 VAL A CG1  4  
ATOM 8971  C CG2  . VAL A 1 14 ? 6.824   3.008   11.125  1.00 0.00 ? 13 VAL A CG2  4  
ATOM 8972  H H    . VAL A 1 14 ? 5.863   5.308   9.673   1.00 0.00 ? 13 VAL A H    4  
ATOM 8973  H HA   . VAL A 1 14 ? 8.611   4.997   10.580  1.00 0.00 ? 13 VAL A HA   4  
ATOM 8974  H HB   . VAL A 1 14 ? 6.859   3.092   8.977   1.00 0.00 ? 13 VAL A HB   4  
ATOM 8975  H HG11 . VAL A 1 14 ? 9.549   2.771   10.322  1.00 0.00 ? 13 VAL A HG11 4  
ATOM 8976  H HG12 . VAL A 1 14 ? 8.514   1.390   9.960   1.00 0.00 ? 13 VAL A HG12 4  
ATOM 8977  H HG13 . VAL A 1 14 ? 9.119   2.406   8.651   1.00 0.00 ? 13 VAL A HG13 4  
ATOM 8978  H HG21 . VAL A 1 14 ? 6.064   3.756   11.296  1.00 0.00 ? 13 VAL A HG21 4  
ATOM 8979  H HG22 . VAL A 1 14 ? 6.365   2.031   11.084  1.00 0.00 ? 13 VAL A HG22 4  
ATOM 8980  H HG23 . VAL A 1 14 ? 7.543   3.034   11.930  1.00 0.00 ? 13 VAL A HG23 4  
ATOM 8981  N N    . PHE A 1 15 ? 8.100   5.241   7.370   1.00 0.00 ? 14 PHE A N    4  
ATOM 8982  C CA   . PHE A 1 15 ? 8.863   5.563   6.133   1.00 0.00 ? 14 PHE A CA   4  
ATOM 8983  C C    . PHE A 1 15 ? 9.718   6.799   6.417   1.00 0.00 ? 14 PHE A C    4  
ATOM 8984  O O    . PHE A 1 15 ? 10.800  6.961   5.886   1.00 0.00 ? 14 PHE A O    4  
ATOM 8985  C CB   . PHE A 1 15 ? 7.900   5.858   4.981   1.00 0.00 ? 14 PHE A CB   4  
ATOM 8986  C CG   . PHE A 1 15 ? 8.697   6.186   3.740   1.00 0.00 ? 14 PHE A CG   4  
ATOM 8987  C CD1  . PHE A 1 15 ? 9.180   7.486   3.539   1.00 0.00 ? 14 PHE A CD1  4  
ATOM 8988  C CD2  . PHE A 1 15 ? 8.955   5.190   2.789   1.00 0.00 ? 14 PHE A CD2  4  
ATOM 8989  C CE1  . PHE A 1 15 ? 9.921   7.789   2.389   1.00 0.00 ? 14 PHE A CE1  4  
ATOM 8990  C CE2  . PHE A 1 15 ? 9.695   5.494   1.640   1.00 0.00 ? 14 PHE A CE2  4  
ATOM 8991  C CZ   . PHE A 1 15 ? 10.178  6.793   1.440   1.00 0.00 ? 14 PHE A CZ   4  
ATOM 8992  H H    . PHE A 1 15 ? 7.121   5.195   7.353   1.00 0.00 ? 14 PHE A H    4  
ATOM 8993  H HA   . PHE A 1 15 ? 9.506   4.736   5.869   1.00 0.00 ? 14 PHE A HA   4  
ATOM 8994  H HB2  . PHE A 1 15 ? 7.282   4.991   4.797   1.00 0.00 ? 14 PHE A HB2  4  
ATOM 8995  H HB3  . PHE A 1 15 ? 7.274   6.699   5.240   1.00 0.00 ? 14 PHE A HB3  4  
ATOM 8996  H HD1  . PHE A 1 15 ? 8.981   8.254   4.272   1.00 0.00 ? 14 PHE A HD1  4  
ATOM 8997  H HD2  . PHE A 1 15 ? 8.584   4.188   2.943   1.00 0.00 ? 14 PHE A HD2  4  
ATOM 8998  H HE1  . PHE A 1 15 ? 10.294  8.791   2.235   1.00 0.00 ? 14 PHE A HE1  4  
ATOM 8999  H HE2  . PHE A 1 15 ? 9.894   4.726   0.907   1.00 0.00 ? 14 PHE A HE2  4  
ATOM 9000  H HZ   . PHE A 1 15 ? 10.749  7.026   0.553   1.00 0.00 ? 14 PHE A HZ   4  
ATOM 9001  N N    . HIS A 1 16 ? 9.234   7.672   7.259   1.00 0.00 ? 15 HIS A N    4  
ATOM 9002  C CA   . HIS A 1 16 ? 10.003  8.903   7.594   1.00 0.00 ? 15 HIS A CA   4  
ATOM 9003  C C    . HIS A 1 16 ? 11.121  8.565   8.587   1.00 0.00 ? 15 HIS A C    4  
ATOM 9004  O O    . HIS A 1 16 ? 12.173  9.174   8.588   1.00 0.00 ? 15 HIS A O    4  
ATOM 9005  C CB   . HIS A 1 16 ? 9.063   9.934   8.221   1.00 0.00 ? 15 HIS A CB   4  
ATOM 9006  C CG   . HIS A 1 16 ? 9.825   11.201  8.499   1.00 0.00 ? 15 HIS A CG   4  
ATOM 9007  N ND1  . HIS A 1 16 ? 9.660   11.921  9.672   1.00 0.00 ? 15 HIS A ND1  4  
ATOM 9008  C CD2  . HIS A 1 16 ? 10.762  11.886  7.767   1.00 0.00 ? 15 HIS A CD2  4  
ATOM 9009  C CE1  . HIS A 1 16 ? 10.480  12.987  9.611   1.00 0.00 ? 15 HIS A CE1  4  
ATOM 9010  N NE2  . HIS A 1 16 ? 11.175  13.014  8.471   1.00 0.00 ? 15 HIS A NE2  4  
ATOM 9011  H H    . HIS A 1 16 ? 8.360   7.516   7.675   1.00 0.00 ? 15 HIS A H    4  
ATOM 9012  H HA   . HIS A 1 16 ? 10.434  9.313   6.693   1.00 0.00 ? 15 HIS A HA   4  
ATOM 9013  H HB2  . HIS A 1 16 ? 8.251   10.144  7.539   1.00 0.00 ? 15 HIS A HB2  4  
ATOM 9014  H HB3  . HIS A 1 16 ? 8.664   9.544   9.146   1.00 0.00 ? 15 HIS A HB3  4  
ATOM 9015  H HD1  . HIS A 1 16 ? 9.057   11.696  10.410  1.00 0.00 ? 15 HIS A HD1  4  
ATOM 9016  H HD2  . HIS A 1 16 ? 11.125  11.595  6.792   1.00 0.00 ? 15 HIS A HD2  4  
ATOM 9017  H HE1  . HIS A 1 16 ? 10.566  13.730  10.390  1.00 0.00 ? 15 HIS A HE1  4  
ATOM 9018  N N    . GLN A 1 17 ? 10.886  7.609   9.447   1.00 0.00 ? 16 GLN A N    4  
ATOM 9019  C CA   . GLN A 1 17 ? 11.913  7.236   10.465  1.00 0.00 ? 16 GLN A CA   4  
ATOM 9020  C C    . GLN A 1 17 ? 13.244  6.929   9.780   1.00 0.00 ? 16 GLN A C    4  
ATOM 9021  O O    . GLN A 1 17 ? 14.288  7.371   10.217  1.00 0.00 ? 16 GLN A O    4  
ATOM 9022  C CB   . GLN A 1 17 ? 11.437  6.003   11.241  1.00 0.00 ? 16 GLN A CB   4  
ATOM 9023  C CG   . GLN A 1 17 ? 12.429  5.674   12.368  1.00 0.00 ? 16 GLN A CG   4  
ATOM 9024  C CD   . GLN A 1 17 ? 13.624  4.897   11.803  1.00 0.00 ? 16 GLN A CD   4  
ATOM 9025  O OE1  . GLN A 1 17 ? 14.671  5.462   11.559  1.00 0.00 ? 16 GLN A OE1  4  
ATOM 9026  N NE2  . GLN A 1 17 ? 13.509  3.614   11.586  1.00 0.00 ? 16 GLN A NE2  4  
ATOM 9027  H H    . GLN A 1 17 ? 10.023  7.145   9.434   1.00 0.00 ? 16 GLN A H    4  
ATOM 9028  H HA   . GLN A 1 17 ? 12.048  8.060   11.149  1.00 0.00 ? 16 GLN A HA   4  
ATOM 9029  H HB2  . GLN A 1 17 ? 10.465  6.204   11.668  1.00 0.00 ? 16 GLN A HB2  4  
ATOM 9030  H HB3  . GLN A 1 17 ? 11.364  5.161   10.568  1.00 0.00 ? 16 GLN A HB3  4  
ATOM 9031  H HG2  . GLN A 1 17 ? 12.779  6.590   12.823  1.00 0.00 ? 16 GLN A HG2  4  
ATOM 9032  H HG3  . GLN A 1 17 ? 11.935  5.071   13.114  1.00 0.00 ? 16 GLN A HG3  4  
ATOM 9033  H HE21 . GLN A 1 17 ? 12.666  3.157   11.784  1.00 0.00 ? 16 GLN A HE21 4  
ATOM 9034  H HE22 . GLN A 1 17 ? 14.268  3.108   11.225  1.00 0.00 ? 16 GLN A HE22 4  
ATOM 9035  N N    . TYR A 1 18 ? 13.227  6.173   8.716   1.00 0.00 ? 17 TYR A N    4  
ATOM 9036  C CA   . TYR A 1 18 ? 14.503  5.844   8.024   1.00 0.00 ? 17 TYR A CA   4  
ATOM 9037  C C    . TYR A 1 18 ? 15.019  7.081   7.291   1.00 0.00 ? 17 TYR A C    4  
ATOM 9038  O O    . TYR A 1 18 ? 16.179  7.427   7.383   1.00 0.00 ? 17 TYR A O    4  
ATOM 9039  C CB   . TYR A 1 18 ? 14.264  4.712   7.021   1.00 0.00 ? 17 TYR A CB   4  
ATOM 9040  C CG   . TYR A 1 18 ? 14.056  3.417   7.772   1.00 0.00 ? 17 TYR A CG   4  
ATOM 9041  C CD1  . TYR A 1 18 ? 12.873  3.212   8.494   1.00 0.00 ? 17 TYR A CD1  4  
ATOM 9042  C CD2  . TYR A 1 18 ? 15.045  2.424   7.753   1.00 0.00 ? 17 TYR A CD2  4  
ATOM 9043  C CE1  . TYR A 1 18 ? 12.679  2.015   9.196   1.00 0.00 ? 17 TYR A CE1  4  
ATOM 9044  C CE2  . TYR A 1 18 ? 14.850  1.228   8.455   1.00 0.00 ? 17 TYR A CE2  4  
ATOM 9045  C CZ   . TYR A 1 18 ? 13.668  1.024   9.176   1.00 0.00 ? 17 TYR A CZ   4  
ATOM 9046  O OH   . TYR A 1 18 ? 13.477  -0.156  9.867   1.00 0.00 ? 17 TYR A OH   4  
ATOM 9047  H H    . TYR A 1 18 ? 12.381  5.813   8.381   1.00 0.00 ? 17 TYR A H    4  
ATOM 9048  H HA   . TYR A 1 18 ? 15.235  5.529   8.752   1.00 0.00 ? 17 TYR A HA   4  
ATOM 9049  H HB2  . TYR A 1 18 ? 13.386  4.933   6.431   1.00 0.00 ? 17 TYR A HB2  4  
ATOM 9050  H HB3  . TYR A 1 18 ? 15.122  4.619   6.371   1.00 0.00 ? 17 TYR A HB3  4  
ATOM 9051  H HD1  . TYR A 1 18 ? 12.111  3.976   8.509   1.00 0.00 ? 17 TYR A HD1  4  
ATOM 9052  H HD2  . TYR A 1 18 ? 15.956  2.580   7.195   1.00 0.00 ? 17 TYR A HD2  4  
ATOM 9053  H HE1  . TYR A 1 18 ? 11.767  1.858   9.752   1.00 0.00 ? 17 TYR A HE1  4  
ATOM 9054  H HE2  . TYR A 1 18 ? 15.612  0.463   8.439   1.00 0.00 ? 17 TYR A HE2  4  
ATOM 9055  H HH   . TYR A 1 18 ? 14.046  -0.143  10.641  1.00 0.00 ? 17 TYR A HH   4  
ATOM 9056  N N    . SER A 1 19 ? 14.164  7.750   6.563   1.00 0.00 ? 18 SER A N    4  
ATOM 9057  C CA   . SER A 1 19 ? 14.597  8.970   5.818   1.00 0.00 ? 18 SER A CA   4  
ATOM 9058  C C    . SER A 1 19 ? 14.207  10.227  6.603   1.00 0.00 ? 18 SER A C    4  
ATOM 9059  O O    . SER A 1 19 ? 13.479  11.066  6.110   1.00 0.00 ? 18 SER A O    4  
ATOM 9060  C CB   . SER A 1 19 ? 13.907  8.996   4.453   1.00 0.00 ? 18 SER A CB   4  
ATOM 9061  O OG   . SER A 1 19 ? 14.248  7.817   3.734   1.00 0.00 ? 18 SER A OG   4  
ATOM 9062  H H    . SER A 1 19 ? 13.233  7.449   6.504   1.00 0.00 ? 18 SER A H    4  
ATOM 9063  H HA   . SER A 1 19 ? 15.669  8.956   5.674   1.00 0.00 ? 18 SER A HA   4  
ATOM 9064  H HB2  . SER A 1 19 ? 12.839  9.033   4.587   1.00 0.00 ? 18 SER A HB2  4  
ATOM 9065  H HB3  . SER A 1 19 ? 14.230  9.871   3.904   1.00 0.00 ? 18 SER A HB3  4  
ATOM 9066  H HG   . SER A 1 19 ? 14.868  8.060   3.042   1.00 0.00 ? 18 SER A HG   4  
ATOM 9067  N N    . GLY A 1 20 ? 14.700  10.375  7.814   1.00 0.00 ? 19 GLY A N    4  
ATOM 9068  C CA   . GLY A 1 20 ? 14.379  11.592  8.633   1.00 0.00 ? 19 GLY A CA   4  
ATOM 9069  C C    . GLY A 1 20 ? 15.691  12.284  9.012   1.00 0.00 ? 19 GLY A C    4  
ATOM 9070  O O    . GLY A 1 20 ? 15.704  13.426  9.429   1.00 0.00 ? 19 GLY A O    4  
ATOM 9071  H H    . GLY A 1 20 ? 15.302  9.697   8.188   1.00 0.00 ? 19 GLY A H    4  
ATOM 9072  H HA2  . GLY A 1 20 ? 13.760  12.272  8.063   1.00 0.00 ? 19 GLY A HA2  4  
ATOM 9073  H HA3  . GLY A 1 20 ? 13.864  11.305  9.538   1.00 0.00 ? 19 GLY A HA3  4  
ATOM 9074  N N    . ARG A 1 21 ? 16.796  11.612  8.844   1.00 0.00 ? 20 ARG A N    4  
ATOM 9075  C CA   . ARG A 1 21 ? 18.111  12.238  9.165   1.00 0.00 ? 20 ARG A CA   4  
ATOM 9076  C C    . ARG A 1 21 ? 18.360  13.396  8.199   1.00 0.00 ? 20 ARG A C    4  
ATOM 9077  O O    . ARG A 1 21 ? 19.021  14.354  8.552   1.00 0.00 ? 20 ARG A O    4  
ATOM 9078  C CB   . ARG A 1 21 ? 19.235  11.202  9.064   1.00 0.00 ? 20 ARG A CB   4  
ATOM 9079  C CG   . ARG A 1 21 ? 20.479  11.715  9.796   1.00 0.00 ? 20 ARG A CG   4  
ATOM 9080  C CD   . ARG A 1 21 ? 21.572  10.644  9.762   1.00 0.00 ? 20 ARG A CD   4  
ATOM 9081  N NE   . ARG A 1 21 ? 22.620  10.972  10.770  1.00 0.00 ? 20 ARG A NE   4  
ATOM 9082  C CZ   . ARG A 1 21 ? 23.777  10.369  10.730  1.00 0.00 ? 20 ARG A CZ   4  
ATOM 9083  N NH1  . ARG A 1 21 ? 23.855  9.087   10.968  1.00 0.00 ? 20 ARG A NH1  4  
ATOM 9084  N NH2  . ARG A 1 21 ? 24.856  11.047  10.451  1.00 0.00 ? 20 ARG A NH2  4  
ATOM 9085  H H    . ARG A 1 21 ? 16.767  10.703  8.482   1.00 0.00 ? 20 ARG A H    4  
ATOM 9086  H HA   . ARG A 1 21 ? 18.105  12.694  10.144  1.00 0.00 ? 20 ARG A HA   4  
ATOM 9087  H HB2  . ARG A 1 21 ? 18.910  10.275  9.515   1.00 0.00 ? 20 ARG A HB2  4  
ATOM 9088  H HB3  . ARG A 1 21 ? 19.475  11.032  8.026   1.00 0.00 ? 20 ARG A HB3  4  
ATOM 9089  H HG2  . ARG A 1 21 ? 20.837  12.611  9.311   1.00 0.00 ? 20 ARG A HG2  4  
ATOM 9090  H HG3  . ARG A 1 21 ? 20.227  11.936  10.822  1.00 0.00 ? 20 ARG A HG3  4  
ATOM 9091  H HD2  . ARG A 1 21 ? 21.141  9.680   9.992   1.00 0.00 ? 20 ARG A HD2  4  
ATOM 9092  H HD3  . ARG A 1 21 ? 22.017  10.613  8.779   1.00 0.00 ? 20 ARG A HD3  4  
ATOM 9093  H HE   . ARG A 1 21 ? 22.439  11.641  11.464  1.00 0.00 ? 20 ARG A HE   4  
ATOM 9094  H HH11 . ARG A 1 21 ? 23.028  8.567   11.182  1.00 0.00 ? 20 ARG A HH11 4  
ATOM 9095  H HH12 . ARG A 1 21 ? 24.741  8.626   10.934  1.00 0.00 ? 20 ARG A HH12 4  
ATOM 9096  H HH21 . ARG A 1 21 ? 24.796  12.029  10.268  1.00 0.00 ? 20 ARG A HH21 4  
ATOM 9097  H HH22 . ARG A 1 21 ? 25.743  10.586  10.422  1.00 0.00 ? 20 ARG A HH22 4  
ATOM 9098  N N    . GLU A 1 22 ? 17.815  13.365  7.009   1.00 0.00 ? 21 GLU A N    4  
ATOM 9099  C CA   . GLU A 1 22 ? 18.013  14.528  6.085   1.00 0.00 ? 21 GLU A CA   4  
ATOM 9100  C C    . GLU A 1 22 ? 16.758  14.711  5.230   1.00 0.00 ? 21 GLU A C    4  
ATOM 9101  O O    . GLU A 1 22 ? 16.258  15.809  5.080   1.00 0.00 ? 21 GLU A O    4  
ATOM 9102  C CB   . GLU A 1 22 ? 19.234  14.287  5.187   1.00 0.00 ? 21 GLU A CB   4  
ATOM 9103  C CG   . GLU A 1 22 ? 19.745  15.624  4.634   1.00 0.00 ? 21 GLU A CG   4  
ATOM 9104  C CD   . GLU A 1 22 ? 20.616  15.377  3.400   1.00 0.00 ? 21 GLU A CD   4  
ATOM 9105  O OE1  . GLU A 1 22 ? 21.092  14.264  3.249   1.00 0.00 ? 21 GLU A OE1  4  
ATOM 9106  O OE2  . GLU A 1 22 ? 20.791  16.305  2.626   1.00 0.00 ? 21 GLU A OE2  4  
ATOM 9107  H H    . GLU A 1 22 ? 17.253  12.608  6.741   1.00 0.00 ? 21 GLU A H    4  
ATOM 9108  H HA   . GLU A 1 22 ? 18.161  15.421  6.680   1.00 0.00 ? 21 GLU A HA   4  
ATOM 9109  H HB2  . GLU A 1 22 ? 20.016  13.816  5.767   1.00 0.00 ? 21 GLU A HB2  4  
ATOM 9110  H HB3  . GLU A 1 22 ? 18.957  13.639  4.367   1.00 0.00 ? 21 GLU A HB3  4  
ATOM 9111  H HG2  . GLU A 1 22 ? 18.904  16.247  4.362   1.00 0.00 ? 21 GLU A HG2  4  
ATOM 9112  H HG3  . GLU A 1 22 ? 20.331  16.125  5.390   1.00 0.00 ? 21 GLU A HG3  4  
ATOM 9113  N N    . GLY A 1 23 ? 16.235  13.647  4.681   1.00 0.00 ? 22 GLY A N    4  
ATOM 9114  C CA   . GLY A 1 23 ? 15.002  13.760  3.846   1.00 0.00 ? 22 GLY A CA   4  
ATOM 9115  C C    . GLY A 1 23 ? 15.114  14.958  2.901   1.00 0.00 ? 22 GLY A C    4  
ATOM 9116  O O    . GLY A 1 23 ? 14.125  15.439  2.385   1.00 0.00 ? 22 GLY A O    4  
ATOM 9117  H H    . GLY A 1 23 ? 16.649  12.770  4.819   1.00 0.00 ? 22 GLY A H    4  
ATOM 9118  H HA2  . GLY A 1 23 ? 14.877  12.855  3.268   1.00 0.00 ? 22 GLY A HA2  4  
ATOM 9119  H HA3  . GLY A 1 23 ? 14.145  13.894  4.489   1.00 0.00 ? 22 GLY A HA3  4  
ATOM 9120  N N    . ASP A 1 24 ? 16.305  15.441  2.658   1.00 0.00 ? 23 ASP A N    4  
ATOM 9121  C CA   . ASP A 1 24 ? 16.451  16.601  1.730   1.00 0.00 ? 23 ASP A CA   4  
ATOM 9122  C C    . ASP A 1 24 ? 15.666  16.292  0.452   1.00 0.00 ? 23 ASP A C    4  
ATOM 9123  O O    . ASP A 1 24 ? 14.788  17.032  0.056   1.00 0.00 ? 23 ASP A O    4  
ATOM 9124  C CB   . ASP A 1 24 ? 17.932  16.810  1.392   1.00 0.00 ? 23 ASP A CB   4  
ATOM 9125  C CG   . ASP A 1 24 ? 18.067  17.842  0.269   1.00 0.00 ? 23 ASP A CG   4  
ATOM 9126  O OD1  . ASP A 1 24 ? 17.984  19.023  0.562   1.00 0.00 ? 23 ASP A OD1  4  
ATOM 9127  O OD2  . ASP A 1 24 ? 18.251  17.432  -0.865  1.00 0.00 ? 23 ASP A OD2  4  
ATOM 9128  H H    . ASP A 1 24 ? 17.091  15.044  3.087   1.00 0.00 ? 23 ASP A H    4  
ATOM 9129  H HA   . ASP A 1 24 ? 16.053  17.491  2.195   1.00 0.00 ? 23 ASP A HA   4  
ATOM 9130  H HB2  . ASP A 1 24 ? 18.453  17.165  2.268   1.00 0.00 ? 23 ASP A HB2  4  
ATOM 9131  H HB3  . ASP A 1 24 ? 18.363  15.874  1.071   1.00 0.00 ? 23 ASP A HB3  4  
ATOM 9132  N N    . LYS A 1 25 ? 15.953  15.182  -0.175  1.00 0.00 ? 24 LYS A N    4  
ATOM 9133  C CA   . LYS A 1 25 ? 15.199  14.797  -1.404  1.00 0.00 ? 24 LYS A CA   4  
ATOM 9134  C C    . LYS A 1 25 ? 14.000  13.942  -0.981  1.00 0.00 ? 24 LYS A C    4  
ATOM 9135  O O    . LYS A 1 25 ? 13.964  13.406  0.109   1.00 0.00 ? 24 LYS A O    4  
ATOM 9136  C CB   . LYS A 1 25 ? 16.107  13.982  -2.336  1.00 0.00 ? 24 LYS A CB   4  
ATOM 9137  C CG   . LYS A 1 25 ? 17.039  14.921  -3.116  1.00 0.00 ? 24 LYS A CG   4  
ATOM 9138  C CD   . LYS A 1 25 ? 17.780  14.137  -4.210  1.00 0.00 ? 24 LYS A CD   4  
ATOM 9139  C CE   . LYS A 1 25 ? 18.904  13.300  -3.590  1.00 0.00 ? 24 LYS A CE   4  
ATOM 9140  N NZ   . LYS A 1 25 ? 19.743  12.720  -4.677  1.00 0.00 ? 24 LYS A NZ   4  
ATOM 9141  H H    . LYS A 1 25 ? 16.648  14.587  0.177   1.00 0.00 ? 24 LYS A H    4  
ATOM 9142  H HA   . LYS A 1 25 ? 14.851  15.686  -1.912  1.00 0.00 ? 24 LYS A HA   4  
ATOM 9143  H HB2  . LYS A 1 25 ? 16.698  13.298  -1.745  1.00 0.00 ? 24 LYS A HB2  4  
ATOM 9144  H HB3  . LYS A 1 25 ? 15.499  13.421  -3.031  1.00 0.00 ? 24 LYS A HB3  4  
ATOM 9145  H HG2  . LYS A 1 25 ? 16.456  15.706  -3.576  1.00 0.00 ? 24 LYS A HG2  4  
ATOM 9146  H HG3  . LYS A 1 25 ? 17.757  15.358  -2.440  1.00 0.00 ? 24 LYS A HG3  4  
ATOM 9147  H HD2  . LYS A 1 25 ? 17.087  13.485  -4.720  1.00 0.00 ? 24 LYS A HD2  4  
ATOM 9148  H HD3  . LYS A 1 25 ? 18.204  14.831  -4.920  1.00 0.00 ? 24 LYS A HD3  4  
ATOM 9149  H HE2  . LYS A 1 25 ? 19.517  13.926  -2.959  1.00 0.00 ? 24 LYS A HE2  4  
ATOM 9150  H HE3  . LYS A 1 25 ? 18.479  12.502  -3.002  1.00 0.00 ? 24 LYS A HE3  4  
ATOM 9151  H HZ1  . LYS A 1 25 ? 19.293  12.906  -5.598  1.00 0.00 ? 24 LYS A HZ1  4  
ATOM 9152  H HZ2  . LYS A 1 25 ? 20.687  13.155  -4.656  1.00 0.00 ? 24 LYS A HZ2  4  
ATOM 9153  H HZ3  . LYS A 1 25 ? 19.833  11.695  -4.536  1.00 0.00 ? 24 LYS A HZ3  4  
ATOM 9154  N N    . HIS A 1 26 ? 13.035  13.788  -1.849  1.00 0.00 ? 25 HIS A N    4  
ATOM 9155  C CA   . HIS A 1 26 ? 11.841  12.941  -1.536  1.00 0.00 ? 25 HIS A CA   4  
ATOM 9156  C C    . HIS A 1 26 ? 11.904  11.711  -2.438  1.00 0.00 ? 25 HIS A C    4  
ATOM 9157  O O    . HIS A 1 26 ? 10.923  11.307  -3.030  1.00 0.00 ? 25 HIS A O    4  
ATOM 9158  C CB   . HIS A 1 26 ? 10.564  13.729  -1.833  1.00 0.00 ? 25 HIS A CB   4  
ATOM 9159  C CG   . HIS A 1 26 ? 10.576  14.181  -3.268  1.00 0.00 ? 25 HIS A CG   4  
ATOM 9160  N ND1  . HIS A 1 26 ? 11.419  15.184  -3.720  1.00 0.00 ? 25 HIS A ND1  4  
ATOM 9161  C CD2  . HIS A 1 26 ? 9.855   13.776  -4.364  1.00 0.00 ? 25 HIS A CD2  4  
ATOM 9162  C CE1  . HIS A 1 26 ? 11.187  15.348  -5.035  1.00 0.00 ? 25 HIS A CE1  4  
ATOM 9163  N NE2  . HIS A 1 26 ? 10.242  14.514  -5.478  1.00 0.00 ? 25 HIS A NE2  4  
ATOM 9164  H H    . HIS A 1 26 ? 13.105  14.214  -2.728  1.00 0.00 ? 25 HIS A H    4  
ATOM 9165  H HA   . HIS A 1 26 ? 11.851  12.634  -0.498  1.00 0.00 ? 25 HIS A HA   4  
ATOM 9166  H HB2  . HIS A 1 26 ? 9.703   13.100  -1.660  1.00 0.00 ? 25 HIS A HB2  4  
ATOM 9167  H HB3  . HIS A 1 26 ? 10.516  14.592  -1.186  1.00 0.00 ? 25 HIS A HB3  4  
ATOM 9168  H HD1  . HIS A 1 26 ? 12.066  15.684  -3.180  1.00 0.00 ? 25 HIS A HD1  4  
ATOM 9169  H HD2  . HIS A 1 26 ? 9.103   13.001  -4.362  1.00 0.00 ? 25 HIS A HD2  4  
ATOM 9170  H HE1  . HIS A 1 26 ? 11.702  16.065  -5.657  1.00 0.00 ? 25 HIS A HE1  4  
ATOM 9171  N N    . LYS A 1 27 ? 13.065  11.115  -2.541  1.00 0.00 ? 26 LYS A N    4  
ATOM 9172  C CA   . LYS A 1 27 ? 13.233  9.903   -3.396  1.00 0.00 ? 26 LYS A CA   4  
ATOM 9173  C C    . LYS A 1 27 ? 14.025  8.839   -2.628  1.00 0.00 ? 26 LYS A C    4  
ATOM 9174  O O    . LYS A 1 27 ? 14.826  9.159   -1.771  1.00 0.00 ? 26 LYS A O    4  
ATOM 9175  C CB   . LYS A 1 27 ? 14.000  10.286  -4.662  1.00 0.00 ? 26 LYS A CB   4  
ATOM 9176  C CG   . LYS A 1 27 ? 13.170  11.282  -5.475  1.00 0.00 ? 26 LYS A CG   4  
ATOM 9177  C CD   . LYS A 1 27 ? 13.949  11.704  -6.721  1.00 0.00 ? 26 LYS A CD   4  
ATOM 9178  C CE   . LYS A 1 27 ? 13.053  12.564  -7.614  1.00 0.00 ? 26 LYS A CE   4  
ATOM 9179  N NZ   . LYS A 1 27 ? 13.731  12.802  -8.919  1.00 0.00 ? 26 LYS A NZ   4  
ATOM 9180  H H    . LYS A 1 27 ? 13.833  11.470  -2.052  1.00 0.00 ? 26 LYS A H    4  
ATOM 9181  H HA   . LYS A 1 27 ? 12.267  9.512   -3.671  1.00 0.00 ? 26 LYS A HA   4  
ATOM 9182  H HB2  . LYS A 1 27 ? 14.943  10.738  -4.389  1.00 0.00 ? 26 LYS A HB2  4  
ATOM 9183  H HB3  . LYS A 1 27 ? 14.181  9.403   -5.253  1.00 0.00 ? 26 LYS A HB3  4  
ATOM 9184  H HG2  . LYS A 1 27 ? 12.240  10.817  -5.772  1.00 0.00 ? 26 LYS A HG2  4  
ATOM 9185  H HG3  . LYS A 1 27 ? 12.960  12.152  -4.872  1.00 0.00 ? 26 LYS A HG3  4  
ATOM 9186  H HD2  . LYS A 1 27 ? 14.818  12.275  -6.425  1.00 0.00 ? 26 LYS A HD2  4  
ATOM 9187  H HD3  . LYS A 1 27 ? 14.262  10.827  -7.266  1.00 0.00 ? 26 LYS A HD3  4  
ATOM 9188  H HE2  . LYS A 1 27 ? 12.117  12.052  -7.783  1.00 0.00 ? 26 LYS A HE2  4  
ATOM 9189  H HE3  . LYS A 1 27 ? 12.863  13.510  -7.129  1.00 0.00 ? 26 LYS A HE3  4  
ATOM 9190  H HZ1  . LYS A 1 27 ? 14.571  12.194  -8.990  1.00 0.00 ? 26 LYS A HZ1  4  
ATOM 9191  H HZ2  . LYS A 1 27 ? 13.077  12.580  -9.696  1.00 0.00 ? 26 LYS A HZ2  4  
ATOM 9192  H HZ3  . LYS A 1 27 ? 14.019  13.801  -8.982  1.00 0.00 ? 26 LYS A HZ3  4  
ATOM 9193  N N    . LEU A 1 28 ? 13.813  7.580   -2.928  1.00 0.00 ? 27 LEU A N    4  
ATOM 9194  C CA   . LEU A 1 28 ? 14.557  6.484   -2.221  1.00 0.00 ? 27 LEU A CA   4  
ATOM 9195  C C    . LEU A 1 28 ? 15.286  5.645   -3.269  1.00 0.00 ? 27 LEU A C    4  
ATOM 9196  O O    . LEU A 1 28 ? 14.771  5.401   -4.342  1.00 0.00 ? 27 LEU A O    4  
ATOM 9197  C CB   . LEU A 1 28 ? 13.561  5.610   -1.451  1.00 0.00 ? 27 LEU A CB   4  
ATOM 9198  C CG   . LEU A 1 28 ? 14.306  4.543   -0.636  1.00 0.00 ? 27 LEU A CG   4  
ATOM 9199  C CD1  . LEU A 1 28 ? 15.180  5.204   0.448   1.00 0.00 ? 27 LEU A CD1  4  
ATOM 9200  C CD2  . LEU A 1 28 ? 13.275  3.619   0.024   1.00 0.00 ? 27 LEU A CD2  4  
ATOM 9201  H H    . LEU A 1 28 ? 13.164  7.349   -3.628  1.00 0.00 ? 27 LEU A H    4  
ATOM 9202  H HA   . LEU A 1 28 ? 15.279  6.904   -1.536  1.00 0.00 ? 27 LEU A HA   4  
ATOM 9203  H HB2  . LEU A 1 28 ? 12.983  6.232   -0.784  1.00 0.00 ? 27 LEU A HB2  4  
ATOM 9204  H HB3  . LEU A 1 28 ? 12.898  5.124   -2.151  1.00 0.00 ? 27 LEU A HB3  4  
ATOM 9205  H HG   . LEU A 1 28 ? 14.935  3.964   -1.297  1.00 0.00 ? 27 LEU A HG   4  
ATOM 9206  H HD11 . LEU A 1 28 ? 14.703  6.105   0.806   1.00 0.00 ? 27 LEU A HD11 4  
ATOM 9207  H HD12 . LEU A 1 28 ? 15.316  4.520   1.276   1.00 0.00 ? 27 LEU A HD12 4  
ATOM 9208  H HD13 . LEU A 1 28 ? 16.146  5.450   0.032   1.00 0.00 ? 27 LEU A HD13 4  
ATOM 9209  H HD21 . LEU A 1 28 ? 12.637  3.191   -0.734  1.00 0.00 ? 27 LEU A HD21 4  
ATOM 9210  H HD22 . LEU A 1 28 ? 13.787  2.829   0.552   1.00 0.00 ? 27 LEU A HD22 4  
ATOM 9211  H HD23 . LEU A 1 28 ? 12.676  4.188   0.720   1.00 0.00 ? 27 LEU A HD23 4  
ATOM 9212  N N    . LYS A 1 29 ? 16.489  5.212   -2.985  1.00 0.00 ? 28 LYS A N    4  
ATOM 9213  C CA   . LYS A 1 29 ? 17.245  4.403   -3.990  1.00 0.00 ? 28 LYS A CA   4  
ATOM 9214  C C    . LYS A 1 29 ? 16.927  2.915   -3.795  1.00 0.00 ? 28 LYS A C    4  
ATOM 9215  O O    . LYS A 1 29 ? 16.594  2.483   -2.710  1.00 0.00 ? 28 LYS A O    4  
ATOM 9216  C CB   . LYS A 1 29 ? 18.745  4.643   -3.803  1.00 0.00 ? 28 LYS A CB   4  
ATOM 9217  C CG   . LYS A 1 29 ? 19.513  4.083   -5.000  1.00 0.00 ? 28 LYS A CG   4  
ATOM 9218  C CD   . LYS A 1 29 ? 20.982  4.500   -4.901  1.00 0.00 ? 28 LYS A CD   4  
ATOM 9219  C CE   . LYS A 1 29 ? 21.804  3.738   -5.942  1.00 0.00 ? 28 LYS A CE   4  
ATOM 9220  N NZ   . LYS A 1 29 ? 21.448  4.220   -7.306  1.00 0.00 ? 28 LYS A NZ   4  
ATOM 9221  H H    . LYS A 1 29 ? 16.897  5.427   -2.121  1.00 0.00 ? 28 LYS A H    4  
ATOM 9222  H HA   . LYS A 1 29 ? 16.944  4.724   -4.978  1.00 0.00 ? 28 LYS A HA   4  
ATOM 9223  H HB2  . LYS A 1 29 ? 18.930  5.704   -3.721  1.00 0.00 ? 28 LYS A HB2  4  
ATOM 9224  H HB3  . LYS A 1 29 ? 19.078  4.150   -2.902  1.00 0.00 ? 28 LYS A HB3  4  
ATOM 9225  H HG2  . LYS A 1 29 ? 19.443  3.006   -4.997  1.00 0.00 ? 28 LYS A HG2  4  
ATOM 9226  H HG3  . LYS A 1 29 ? 19.090  4.471   -5.914  1.00 0.00 ? 28 LYS A HG3  4  
ATOM 9227  H HD2  . LYS A 1 29 ? 21.068  5.562   -5.081  1.00 0.00 ? 28 LYS A HD2  4  
ATOM 9228  H HD3  . LYS A 1 29 ? 21.355  4.271   -3.914  1.00 0.00 ? 28 LYS A HD3  4  
ATOM 9229  H HE2  . LYS A 1 29 ? 22.856  3.908   -5.764  1.00 0.00 ? 28 LYS A HE2  4  
ATOM 9230  H HE3  . LYS A 1 29 ? 21.593  2.682   -5.867  1.00 0.00 ? 28 LYS A HE3  4  
ATOM 9231  H HZ1  . LYS A 1 29 ? 20.788  5.021   -7.228  1.00 0.00 ? 28 LYS A HZ1  4  
ATOM 9232  H HZ2  . LYS A 1 29 ? 22.309  4.525   -7.802  1.00 0.00 ? 28 LYS A HZ2  4  
ATOM 9233  H HZ3  . LYS A 1 29 ? 20.998  3.450   -7.839  1.00 0.00 ? 28 LYS A HZ3  4  
ATOM 9234  N N    . LYS A 1 30 ? 17.031  2.128   -4.831  1.00 0.00 ? 29 LYS A N    4  
ATOM 9235  C CA   . LYS A 1 30 ? 16.738  0.669   -4.699  1.00 0.00 ? 29 LYS A CA   4  
ATOM 9236  C C    . LYS A 1 30 ? 17.714  0.024   -3.708  1.00 0.00 ? 29 LYS A C    4  
ATOM 9237  O O    . LYS A 1 30 ? 17.350  -0.837  -2.932  1.00 0.00 ? 29 LYS A O    4  
ATOM 9238  C CB   . LYS A 1 30 ? 16.902  0.004   -6.077  1.00 0.00 ? 29 LYS A CB   4  
ATOM 9239  C CG   . LYS A 1 30 ? 18.325  0.260   -6.645  1.00 0.00 ? 29 LYS A CG   4  
ATOM 9240  C CD   . LYS A 1 30 ? 19.205  -0.988  -6.484  1.00 0.00 ? 29 LYS A CD   4  
ATOM 9241  C CE   . LYS A 1 30 ? 20.588  -0.713  -7.079  1.00 0.00 ? 29 LYS A CE   4  
ATOM 9242  N NZ   . LYS A 1 30 ? 21.460  -1.906  -6.883  1.00 0.00 ? 29 LYS A NZ   4  
ATOM 9243  H H    . LYS A 1 30 ? 17.300  2.489   -5.701  1.00 0.00 ? 29 LYS A H    4  
ATOM 9244  H HA   . LYS A 1 30 ? 15.723  0.523   -4.361  1.00 0.00 ? 29 LYS A HA   4  
ATOM 9245  H HB2  . LYS A 1 30 ? 16.727  -1.059  -5.979  1.00 0.00 ? 29 LYS A HB2  4  
ATOM 9246  H HB3  . LYS A 1 30 ? 16.167  0.419   -6.754  1.00 0.00 ? 29 LYS A HB3  4  
ATOM 9247  H HG2  . LYS A 1 30 ? 18.256  0.501   -7.696  1.00 0.00 ? 29 LYS A HG2  4  
ATOM 9248  H HG3  . LYS A 1 30 ? 18.787  1.087   -6.129  1.00 0.00 ? 29 LYS A HG3  4  
ATOM 9249  H HD2  . LYS A 1 30 ? 19.304  -1.231  -5.436  1.00 0.00 ? 29 LYS A HD2  4  
ATOM 9250  H HD3  . LYS A 1 30 ? 18.751  -1.817  -7.004  1.00 0.00 ? 29 LYS A HD3  4  
ATOM 9251  H HE2  . LYS A 1 30 ? 20.490  -0.507  -8.134  1.00 0.00 ? 29 LYS A HE2  4  
ATOM 9252  H HE3  . LYS A 1 30 ? 21.029  0.141   -6.585  1.00 0.00 ? 29 LYS A HE3  4  
ATOM 9253  H HZ1  . LYS A 1 30 ? 20.925  -2.767  -7.111  1.00 0.00 ? 29 LYS A HZ1  4  
ATOM 9254  H HZ2  . LYS A 1 30 ? 22.286  -1.837  -7.509  1.00 0.00 ? 29 LYS A HZ2  4  
ATOM 9255  H HZ3  . LYS A 1 30 ? 21.776  -1.945  -5.892  1.00 0.00 ? 29 LYS A HZ3  4  
ATOM 9256  N N    . SER A 1 31 ? 18.954  0.420   -3.750  1.00 0.00 ? 30 SER A N    4  
ATOM 9257  C CA   . SER A 1 31 ? 19.974  -0.176  -2.839  1.00 0.00 ? 30 SER A CA   4  
ATOM 9258  C C    . SER A 1 31 ? 19.593  0.033   -1.368  1.00 0.00 ? 30 SER A C    4  
ATOM 9259  O O    . SER A 1 31 ? 19.744  -0.853  -0.542  1.00 0.00 ? 30 SER A O    4  
ATOM 9260  C CB   . SER A 1 31 ? 21.323  0.495   -3.100  1.00 0.00 ? 30 SER A CB   4  
ATOM 9261  O OG   . SER A 1 31 ? 21.199  1.896   -2.895  1.00 0.00 ? 30 SER A OG   4  
ATOM 9262  H H    . SER A 1 31 ? 19.220  1.096   -4.405  1.00 0.00 ? 30 SER A H    4  
ATOM 9263  H HA   . SER A 1 31 ? 20.066  -1.232  -3.044  1.00 0.00 ? 30 SER A HA   4  
ATOM 9264  H HB2  . SER A 1 31 ? 22.061  0.102   -2.421  1.00 0.00 ? 30 SER A HB2  4  
ATOM 9265  H HB3  . SER A 1 31 ? 21.632  0.295   -4.118  1.00 0.00 ? 30 SER A HB3  4  
ATOM 9266  H HG   . SER A 1 31 ? 21.573  2.342   -3.658  1.00 0.00 ? 30 SER A HG   4  
ATOM 9267  N N    . GLU A 1 32 ? 19.099  1.195   -1.027  1.00 0.00 ? 31 GLU A N    4  
ATOM 9268  C CA   . GLU A 1 32 ? 18.729  1.440   0.399   1.00 0.00 ? 31 GLU A CA   4  
ATOM 9269  C C    . GLU A 1 32 ? 17.364  0.813   0.676   1.00 0.00 ? 31 GLU A C    4  
ATOM 9270  O O    . GLU A 1 32 ? 17.107  0.304   1.749   1.00 0.00 ? 31 GLU A O    4  
ATOM 9271  C CB   . GLU A 1 32 ? 18.689  2.942   0.688   1.00 0.00 ? 31 GLU A CB   4  
ATOM 9272  C CG   . GLU A 1 32 ? 20.084  3.540   0.486   1.00 0.00 ? 31 GLU A CG   4  
ATOM 9273  C CD   . GLU A 1 32 ? 19.991  5.067   0.491   1.00 0.00 ? 31 GLU A CD   4  
ATOM 9274  O OE1  . GLU A 1 32 ? 18.888  5.574   0.366   1.00 0.00 ? 31 GLU A OE1  4  
ATOM 9275  O OE2  . GLU A 1 32 ? 21.024  5.702   0.621   1.00 0.00 ? 31 GLU A OE2  4  
ATOM 9276  H H    . GLU A 1 32 ? 18.971  1.886   -1.711  1.00 0.00 ? 31 GLU A H    4  
ATOM 9277  H HA   . GLU A 1 32 ? 19.483  0.964   1.011   1.00 0.00 ? 31 GLU A HA   4  
ATOM 9278  H HB2  . GLU A 1 32 ? 17.991  3.420   0.015   1.00 0.00 ? 31 GLU A HB2  4  
ATOM 9279  H HB3  . GLU A 1 32 ? 18.375  3.105   1.708   1.00 0.00 ? 31 GLU A HB3  4  
ATOM 9280  H HG2  . GLU A 1 32 ? 20.733  3.215   1.286   1.00 0.00 ? 31 GLU A HG2  4  
ATOM 9281  H HG3  . GLU A 1 32 ? 20.484  3.208   -0.460  1.00 0.00 ? 31 GLU A HG3  4  
ATOM 9282  N N    . LEU A 1 33 ? 16.492  0.833   -0.295  1.00 0.00 ? 32 LEU A N    4  
ATOM 9283  C CA   . LEU A 1 33 ? 15.150  0.224   -0.099  1.00 0.00 ? 32 LEU A CA   4  
ATOM 9284  C C    . LEU A 1 33 ? 15.333  -1.267  0.182   1.00 0.00 ? 32 LEU A C    4  
ATOM 9285  O O    . LEU A 1 33 ? 14.702  -1.820  1.060   1.00 0.00 ? 32 LEU A O    4  
ATOM 9286  C CB   . LEU A 1 33 ? 14.302  0.433   -1.361  1.00 0.00 ? 32 LEU A CB   4  
ATOM 9287  C CG   . LEU A 1 33 ? 12.998  -0.370  -1.275  1.00 0.00 ? 32 LEU A CG   4  
ATOM 9288  C CD1  . LEU A 1 33 ? 12.266  -0.044  0.032   1.00 0.00 ? 32 LEU A CD1  4  
ATOM 9289  C CD2  . LEU A 1 33 ? 12.104  -0.003  -2.464  1.00 0.00 ? 32 LEU A CD2  4  
ATOM 9290  H H    . LEU A 1 33 ? 16.726  1.238   -1.156  1.00 0.00 ? 32 LEU A H    4  
ATOM 9291  H HA   . LEU A 1 33 ? 14.669  0.674   0.754   1.00 0.00 ? 32 LEU A HA   4  
ATOM 9292  H HB2  . LEU A 1 33 ? 14.069  1.482   -1.463  1.00 0.00 ? 32 LEU A HB2  4  
ATOM 9293  H HB3  . LEU A 1 33 ? 14.863  0.107   -2.224  1.00 0.00 ? 32 LEU A HB3  4  
ATOM 9294  H HG   . LEU A 1 33 ? 13.221  -1.427  -1.308  1.00 0.00 ? 32 LEU A HG   4  
ATOM 9295  H HD11 . LEU A 1 33 ? 12.326  1.017   0.226   1.00 0.00 ? 32 LEU A HD11 4  
ATOM 9296  H HD12 . LEU A 1 33 ? 11.232  -0.337  -0.047  1.00 0.00 ? 32 LEU A HD12 4  
ATOM 9297  H HD13 . LEU A 1 33 ? 12.723  -0.583  0.843   1.00 0.00 ? 32 LEU A HD13 4  
ATOM 9298  H HD21 . LEU A 1 33 ? 12.660  -0.122  -3.382  1.00 0.00 ? 32 LEU A HD21 4  
ATOM 9299  H HD22 . LEU A 1 33 ? 11.241  -0.651  -2.479  1.00 0.00 ? 32 LEU A HD22 4  
ATOM 9300  H HD23 . LEU A 1 33 ? 11.783  1.024   -2.368  1.00 0.00 ? 32 LEU A HD23 4  
ATOM 9301  N N    . LYS A 1 34 ? 16.177  -1.935  -0.554  1.00 0.00 ? 33 LYS A N    4  
ATOM 9302  C CA   . LYS A 1 34 ? 16.359  -3.388  -0.309  1.00 0.00 ? 33 LYS A CA   4  
ATOM 9303  C C    . LYS A 1 34 ? 16.686  -3.609  1.167   1.00 0.00 ? 33 LYS A C    4  
ATOM 9304  O O    . LYS A 1 34 ? 16.029  -4.369  1.851   1.00 0.00 ? 33 LYS A O    4  
ATOM 9305  C CB   . LYS A 1 34 ? 17.503  -3.914  -1.182  1.00 0.00 ? 33 LYS A CB   4  
ATOM 9306  C CG   . LYS A 1 34 ? 17.017  -4.069  -2.627  1.00 0.00 ? 33 LYS A CG   4  
ATOM 9307  C CD   . LYS A 1 34 ? 18.215  -4.269  -3.559  1.00 0.00 ? 33 LYS A CD   4  
ATOM 9308  C CE   . LYS A 1 34 ? 19.080  -5.427  -3.052  1.00 0.00 ? 33 LYS A CE   4  
ATOM 9309  N NZ   . LYS A 1 34 ? 19.961  -5.906  -4.155  1.00 0.00 ? 33 LYS A NZ   4  
ATOM 9310  H H    . LYS A 1 34 ? 16.675  -1.494  -1.271  1.00 0.00 ? 33 LYS A H    4  
ATOM 9311  H HA   . LYS A 1 34 ? 15.443  -3.902  -0.562  1.00 0.00 ? 33 LYS A HA   4  
ATOM 9312  H HB2  . LYS A 1 34 ? 18.327  -3.215  -1.153  1.00 0.00 ? 33 LYS A HB2  4  
ATOM 9313  H HB3  . LYS A 1 34 ? 17.831  -4.873  -0.810  1.00 0.00 ? 33 LYS A HB3  4  
ATOM 9314  H HG2  . LYS A 1 34 ? 16.362  -4.926  -2.694  1.00 0.00 ? 33 LYS A HG2  4  
ATOM 9315  H HG3  . LYS A 1 34 ? 16.478  -3.181  -2.923  1.00 0.00 ? 33 LYS A HG3  4  
ATOM 9316  H HD2  . LYS A 1 34 ? 17.861  -4.495  -4.554  1.00 0.00 ? 33 LYS A HD2  4  
ATOM 9317  H HD3  . LYS A 1 34 ? 18.806  -3.366  -3.584  1.00 0.00 ? 33 LYS A HD3  4  
ATOM 9318  H HE2  . LYS A 1 34 ? 19.689  -5.087  -2.227  1.00 0.00 ? 33 LYS A HE2  4  
ATOM 9319  H HE3  . LYS A 1 34 ? 18.446  -6.237  -2.721  1.00 0.00 ? 33 LYS A HE3  4  
ATOM 9320  H HZ1  . LYS A 1 34 ? 20.354  -5.090  -4.665  1.00 0.00 ? 33 LYS A HZ1  4  
ATOM 9321  H HZ2  . LYS A 1 34 ? 20.738  -6.471  -3.758  1.00 0.00 ? 33 LYS A HZ2  4  
ATOM 9322  H HZ3  . LYS A 1 34 ? 19.404  -6.492  -4.812  1.00 0.00 ? 33 LYS A HZ3  4  
ATOM 9323  N N    . GLU A 1 35 ? 17.710  -2.965  1.659   1.00 0.00 ? 34 GLU A N    4  
ATOM 9324  C CA   . GLU A 1 35 ? 18.085  -3.162  3.093   1.00 0.00 ? 34 GLU A CA   4  
ATOM 9325  C C    . GLU A 1 35 ? 16.830  -3.060  3.976   1.00 0.00 ? 34 GLU A C    4  
ATOM 9326  O O    . GLU A 1 35 ? 16.711  -3.748  4.971   1.00 0.00 ? 34 GLU A O    4  
ATOM 9327  C CB   . GLU A 1 35 ? 19.102  -2.100  3.512   1.00 0.00 ? 34 GLU A CB   4  
ATOM 9328  C CG   . GLU A 1 35 ? 20.336  -2.191  2.611   1.00 0.00 ? 34 GLU A CG   4  
ATOM 9329  C CD   . GLU A 1 35 ? 21.059  -3.514  2.870   1.00 0.00 ? 34 GLU A CD   4  
ATOM 9330  O OE1  . GLU A 1 35 ? 21.696  -3.626  3.904   1.00 0.00 ? 34 GLU A OE1  4  
ATOM 9331  O OE2  . GLU A 1 35 ? 20.966  -4.392  2.028   1.00 0.00 ? 34 GLU A OE2  4  
ATOM 9332  H H    . GLU A 1 35 ? 18.241  -2.379  1.077   1.00 0.00 ? 34 GLU A H    4  
ATOM 9333  H HA   . GLU A 1 35 ? 18.515  -4.146  3.209   1.00 0.00 ? 34 GLU A HA   4  
ATOM 9334  H HB2  . GLU A 1 35 ? 18.658  -1.119  3.419   1.00 0.00 ? 34 GLU A HB2  4  
ATOM 9335  H HB3  . GLU A 1 35 ? 19.396  -2.266  4.538   1.00 0.00 ? 34 GLU A HB3  4  
ATOM 9336  H HG2  . GLU A 1 35 ? 20.029  -2.144  1.576   1.00 0.00 ? 34 GLU A HG2  4  
ATOM 9337  H HG3  . GLU A 1 35 ? 21.002  -1.370  2.827   1.00 0.00 ? 34 GLU A HG3  4  
ATOM 9338  N N    . LEU A 1 36 ? 15.889  -2.225  3.623   1.00 0.00 ? 35 LEU A N    4  
ATOM 9339  C CA   . LEU A 1 36 ? 14.649  -2.111  4.452   1.00 0.00 ? 35 LEU A CA   4  
ATOM 9340  C C    . LEU A 1 36 ? 13.837  -3.408  4.339   1.00 0.00 ? 35 LEU A C    4  
ATOM 9341  O O    . LEU A 1 36 ? 13.362  -3.930  5.328   1.00 0.00 ? 35 LEU A O    4  
ATOM 9342  C CB   . LEU A 1 36 ? 13.810  -0.920  3.973   1.00 0.00 ? 35 LEU A CB   4  
ATOM 9343  C CG   . LEU A 1 36 ? 12.550  -0.760  4.840   1.00 0.00 ? 35 LEU A CG   4  
ATOM 9344  C CD1  . LEU A 1 36 ? 12.937  -0.456  6.298   1.00 0.00 ? 35 LEU A CD1  4  
ATOM 9345  C CD2  . LEU A 1 36 ? 11.708  0.393   4.282   1.00 0.00 ? 35 LEU A CD2  4  
ATOM 9346  H H    . LEU A 1 36 ? 15.991  -1.686  2.811   1.00 0.00 ? 35 LEU A H    4  
ATOM 9347  H HA   . LEU A 1 36 ? 14.910  -1.977  5.490   1.00 0.00 ? 35 LEU A HA   4  
ATOM 9348  H HB2  . LEU A 1 36 ? 14.402  -0.019  4.036   1.00 0.00 ? 35 LEU A HB2  4  
ATOM 9349  H HB3  . LEU A 1 36 ? 13.518  -1.083  2.951   1.00 0.00 ? 35 LEU A HB3  4  
ATOM 9350  H HG   . LEU A 1 36 ? 11.972  -1.672  4.806   1.00 0.00 ? 35 LEU A HG   4  
ATOM 9351  H HD11 . LEU A 1 36 ? 13.827  0.154   6.318   1.00 0.00 ? 35 LEU A HD11 4  
ATOM 9352  H HD12 . LEU A 1 36 ? 12.130  0.073   6.789   1.00 0.00 ? 35 LEU A HD12 4  
ATOM 9353  H HD13 . LEU A 1 36 ? 13.122  -1.381  6.823   1.00 0.00 ? 35 LEU A HD13 4  
ATOM 9354  H HD21 . LEU A 1 36 ? 12.327  1.271   4.175   1.00 0.00 ? 35 LEU A HD21 4  
ATOM 9355  H HD22 . LEU A 1 36 ? 11.309  0.114   3.318   1.00 0.00 ? 35 LEU A HD22 4  
ATOM 9356  H HD23 . LEU A 1 36 ? 10.894  0.606   4.960   1.00 0.00 ? 35 LEU A HD23 4  
ATOM 9357  N N    . ILE A 1 37 ? 13.689  -3.952  3.161   1.00 0.00 ? 36 ILE A N    4  
ATOM 9358  C CA   . ILE A 1 37 ? 12.929  -5.230  3.018   1.00 0.00 ? 36 ILE A CA   4  
ATOM 9359  C C    . ILE A 1 37 ? 13.536  -6.288  3.943   1.00 0.00 ? 36 ILE A C    4  
ATOM 9360  O O    . ILE A 1 37 ? 12.841  -7.105  4.513   1.00 0.00 ? 36 ILE A O    4  
ATOM 9361  C CB   . ILE A 1 37 ? 13.041  -5.711  1.567   1.00 0.00 ? 36 ILE A CB   4  
ATOM 9362  C CG1  . ILE A 1 37 ? 12.686  -4.553  0.626   1.00 0.00 ? 36 ILE A CG1  4  
ATOM 9363  C CG2  . ILE A 1 37 ? 12.069  -6.875  1.336   1.00 0.00 ? 36 ILE A CG2  4  
ATOM 9364  C CD1  . ILE A 1 37 ? 12.591  -5.063  -0.814  1.00 0.00 ? 36 ILE A CD1  4  
ATOM 9365  H H    . ILE A 1 37 ? 14.087  -3.544  2.365   1.00 0.00 ? 36 ILE A H    4  
ATOM 9366  H HA   . ILE A 1 37 ? 11.883  -5.092  3.252   1.00 0.00 ? 36 ILE A HA   4  
ATOM 9367  H HB   . ILE A 1 37 ? 14.052  -6.040  1.373   1.00 0.00 ? 36 ILE A HB   4  
ATOM 9368  H HG12 . ILE A 1 37 ? 11.737  -4.131  0.921   1.00 0.00 ? 36 ILE A HG12 4  
ATOM 9369  H HG13 . ILE A 1 37 ? 13.451  -3.794  0.687   1.00 0.00 ? 36 ILE A HG13 4  
ATOM 9370  H HG21 . ILE A 1 37 ? 12.154  -7.583  2.146   1.00 0.00 ? 36 ILE A HG21 4  
ATOM 9371  H HG22 . ILE A 1 37 ? 11.057  -6.497  1.292   1.00 0.00 ? 36 ILE A HG22 4  
ATOM 9372  H HG23 . ILE A 1 37 ? 12.309  -7.365  0.403   1.00 0.00 ? 36 ILE A HG23 4  
ATOM 9373  H HD11 . ILE A 1 37 ? 13.443  -5.689  -1.032  1.00 0.00 ? 36 ILE A HD11 4  
ATOM 9374  H HD12 . ILE A 1 37 ? 11.683  -5.637  -0.934  1.00 0.00 ? 36 ILE A HD12 4  
ATOM 9375  H HD13 . ILE A 1 37 ? 12.578  -4.223  -1.493  1.00 0.00 ? 36 ILE A HD13 4  
ATOM 9376  N N    . ASN A 1 38 ? 14.834  -6.296  4.065   1.00 0.00 ? 37 ASN A N    4  
ATOM 9377  C CA   . ASN A 1 38 ? 15.511  -7.317  4.917   1.00 0.00 ? 37 ASN A CA   4  
ATOM 9378  C C    . ASN A 1 38 ? 15.143  -7.140  6.395   1.00 0.00 ? 37 ASN A C    4  
ATOM 9379  O O    . ASN A 1 38 ? 15.197  -8.079  7.164   1.00 0.00 ? 37 ASN A O    4  
ATOM 9380  C CB   . ASN A 1 38 ? 17.026  -7.167  4.757   1.00 0.00 ? 37 ASN A CB   4  
ATOM 9381  C CG   . ASN A 1 38 ? 17.743  -8.140  5.695   1.00 0.00 ? 37 ASN A CG   4  
ATOM 9382  O OD1  . ASN A 1 38 ? 18.538  -7.733  6.518   1.00 0.00 ? 37 ASN A OD1  4  
ATOM 9383  N ND2  . ASN A 1 38 ? 17.495  -9.418  5.605   1.00 0.00 ? 37 ASN A ND2  4  
ATOM 9384  H H    . ASN A 1 38 ? 15.372  -5.641  3.574   1.00 0.00 ? 37 ASN A H    4  
ATOM 9385  H HA   . ASN A 1 38 ? 15.222  -8.302  4.580   1.00 0.00 ? 37 ASN A HA   4  
ATOM 9386  H HB2  . ASN A 1 38 ? 17.303  -7.382  3.735   1.00 0.00 ? 37 ASN A HB2  4  
ATOM 9387  H HB3  . ASN A 1 38 ? 17.315  -6.156  5.002   1.00 0.00 ? 37 ASN A HB3  4  
ATOM 9388  H HD21 . ASN A 1 38 ? 16.854  -9.748  4.942   1.00 0.00 ? 37 ASN A HD21 4  
ATOM 9389  H HD22 . ASN A 1 38 ? 17.949  -10.049 6.203   1.00 0.00 ? 37 ASN A HD22 4  
ATOM 9390  N N    . ASN A 1 39 ? 14.801  -5.942  6.807   1.00 0.00 ? 38 ASN A N    4  
ATOM 9391  C CA   . ASN A 1 39 ? 14.463  -5.694  8.250   1.00 0.00 ? 38 ASN A CA   4  
ATOM 9392  C C    . ASN A 1 39 ? 13.000  -5.266  8.408   1.00 0.00 ? 38 ASN A C    4  
ATOM 9393  O O    . ASN A 1 39 ? 12.574  -4.930  9.495   1.00 0.00 ? 38 ASN A O    4  
ATOM 9394  C CB   . ASN A 1 39 ? 15.367  -4.581  8.785   1.00 0.00 ? 38 ASN A CB   4  
ATOM 9395  C CG   . ASN A 1 39 ? 16.831  -4.947  8.531   1.00 0.00 ? 38 ASN A CG   4  
ATOM 9396  O OD1  . ASN A 1 39 ? 17.126  -6.032  8.071   1.00 0.00 ? 38 ASN A OD1  4  
ATOM 9397  N ND2  . ASN A 1 39 ? 17.766  -4.081  8.812   1.00 0.00 ? 38 ASN A ND2  4  
ATOM 9398  H H    . ASN A 1 39 ? 14.787  -5.196  6.171   1.00 0.00 ? 38 ASN A H    4  
ATOM 9399  H HA   . ASN A 1 39 ? 14.631  -6.589  8.833   1.00 0.00 ? 38 ASN A HA   4  
ATOM 9400  H HB2  . ASN A 1 39 ? 15.133  -3.653  8.281   1.00 0.00 ? 38 ASN A HB2  4  
ATOM 9401  H HB3  . ASN A 1 39 ? 15.207  -4.465  9.846   1.00 0.00 ? 38 ASN A HB3  4  
ATOM 9402  H HD21 . ASN A 1 39 ? 17.529  -3.206  9.182   1.00 0.00 ? 38 ASN A HD21 4  
ATOM 9403  H HD22 . ASN A 1 39 ? 18.707  -4.307  8.652   1.00 0.00 ? 38 ASN A HD22 4  
ATOM 9404  N N    . GLU A 1 40 ? 12.227  -5.261  7.346   1.00 0.00 ? 39 GLU A N    4  
ATOM 9405  C CA   . GLU A 1 40 ? 10.789  -4.836  7.457   1.00 0.00 ? 39 GLU A CA   4  
ATOM 9406  C C    . GLU A 1 40 ? 9.859   -5.971  7.021   1.00 0.00 ? 39 GLU A C    4  
ATOM 9407  O O    . GLU A 1 40 ? 8.745   -6.075  7.495   1.00 0.00 ? 39 GLU A O    4  
ATOM 9408  C CB   . GLU A 1 40 ? 10.554  -3.626  6.550   1.00 0.00 ? 39 GLU A CB   4  
ATOM 9409  C CG   . GLU A 1 40 ? 9.219   -2.970  6.906   1.00 0.00 ? 39 GLU A CG   4  
ATOM 9410  C CD   . GLU A 1 40 ? 9.343   -2.258  8.255   1.00 0.00 ? 39 GLU A CD   4  
ATOM 9411  O OE1  . GLU A 1 40 ? 9.700   -1.092  8.256   1.00 0.00 ? 39 GLU A OE1  4  
ATOM 9412  O OE2  . GLU A 1 40 ? 9.081   -2.893  9.263   1.00 0.00 ? 39 GLU A OE2  4  
ATOM 9413  H H    . GLU A 1 40 ? 12.592  -5.529  6.476   1.00 0.00 ? 39 GLU A H    4  
ATOM 9414  H HA   . GLU A 1 40 ? 10.554  -4.563  8.476   1.00 0.00 ? 39 GLU A HA   4  
ATOM 9415  H HB2  . GLU A 1 40 ? 11.354  -2.913  6.690   1.00 0.00 ? 39 GLU A HB2  4  
ATOM 9416  H HB3  . GLU A 1 40 ? 10.533  -3.946  5.519   1.00 0.00 ? 39 GLU A HB3  4  
ATOM 9417  H HG2  . GLU A 1 40 ? 8.956   -2.253  6.142   1.00 0.00 ? 39 GLU A HG2  4  
ATOM 9418  H HG3  . GLU A 1 40 ? 8.451   -3.726  6.970   1.00 0.00 ? 39 GLU A HG3  4  
ATOM 9419  N N    . LEU A 1 41 ? 10.307  -6.829  6.137   1.00 0.00 ? 40 LEU A N    4  
ATOM 9420  C CA   . LEU A 1 41 ? 9.451   -7.973  5.673   1.00 0.00 ? 40 LEU A CA   4  
ATOM 9421  C C    . LEU A 1 41 ? 10.137  -9.291  6.055   1.00 0.00 ? 40 LEU A C    4  
ATOM 9422  O O    . LEU A 1 41 ? 9.900   -10.324 5.462   1.00 0.00 ? 40 LEU A O    4  
ATOM 9423  C CB   . LEU A 1 41 ? 9.276   -7.886  4.139   1.00 0.00 ? 40 LEU A CB   4  
ATOM 9424  C CG   . LEU A 1 41 ? 7.958   -7.174  3.789   1.00 0.00 ? 40 LEU A CG   4  
ATOM 9425  C CD1  . LEU A 1 41 ? 7.920   -5.783  4.438   1.00 0.00 ? 40 LEU A CD1  4  
ATOM 9426  C CD2  . LEU A 1 41 ? 7.846   -7.038  2.268   1.00 0.00 ? 40 LEU A CD2  4  
ATOM 9427  H H    . LEU A 1 41 ? 11.213  -6.727  5.779   1.00 0.00 ? 40 LEU A H    4  
ATOM 9428  H HA   . LEU A 1 41 ? 8.482   -7.935  6.154   1.00 0.00 ? 40 LEU A HA   4  
ATOM 9429  H HB2  . LEU A 1 41 ? 10.101  -7.331  3.718   1.00 0.00 ? 40 LEU A HB2  4  
ATOM 9430  H HB3  . LEU A 1 41 ? 9.262   -8.880  3.711   1.00 0.00 ? 40 LEU A HB3  4  
ATOM 9431  H HG   . LEU A 1 41 ? 7.129   -7.761  4.158   1.00 0.00 ? 40 LEU A HG   4  
ATOM 9432  H HD11 . LEU A 1 41 ? 8.904   -5.337  4.400   1.00 0.00 ? 40 LEU A HD11 4  
ATOM 9433  H HD12 . LEU A 1 41 ? 7.219   -5.153  3.908   1.00 0.00 ? 40 LEU A HD12 4  
ATOM 9434  H HD13 . LEU A 1 41 ? 7.606   -5.876  5.465   1.00 0.00 ? 40 LEU A HD13 4  
ATOM 9435  H HD21 . LEU A 1 41 ? 7.897   -8.016  1.814   1.00 0.00 ? 40 LEU A HD21 4  
ATOM 9436  H HD22 . LEU A 1 41 ? 6.904   -6.573  2.016   1.00 0.00 ? 40 LEU A HD22 4  
ATOM 9437  H HD23 . LEU A 1 41 ? 8.658   -6.428  1.900   1.00 0.00 ? 40 LEU A HD23 4  
ATOM 9438  N N    . SER A 1 42 ? 10.982  -9.255  7.049   1.00 0.00 ? 41 SER A N    4  
ATOM 9439  C CA   . SER A 1 42 ? 11.685  -10.495 7.484   1.00 0.00 ? 41 SER A CA   4  
ATOM 9440  C C    . SER A 1 42 ? 10.688  -11.441 8.154   1.00 0.00 ? 41 SER A C    4  
ATOM 9441  O O    . SER A 1 42 ? 10.873  -12.641 8.173   1.00 0.00 ? 41 SER A O    4  
ATOM 9442  C CB   . SER A 1 42 ? 12.786  -10.131 8.480   1.00 0.00 ? 41 SER A CB   4  
ATOM 9443  O OG   . SER A 1 42 ? 13.415  -11.320 8.939   1.00 0.00 ? 41 SER A OG   4  
ATOM 9444  H H    . SER A 1 42 ? 11.153  -8.410  7.513   1.00 0.00 ? 41 SER A H    4  
ATOM 9445  H HA   . SER A 1 42 ? 12.124  -10.984 6.627   1.00 0.00 ? 41 SER A HA   4  
ATOM 9446  H HB2  . SER A 1 42 ? 13.518  -9.506  7.999   1.00 0.00 ? 41 SER A HB2  4  
ATOM 9447  H HB3  . SER A 1 42 ? 12.351  -9.596  9.314   1.00 0.00 ? 41 SER A HB3  4  
ATOM 9448  H HG   . SER A 1 42 ? 12.730  -11.970 9.114   1.00 0.00 ? 41 SER A HG   4  
ATOM 9449  N N    . HIS A 1 43 ? 9.628   -10.912 8.703   1.00 0.00 ? 42 HIS A N    4  
ATOM 9450  C CA   . HIS A 1 43 ? 8.621   -11.785 9.367   1.00 0.00 ? 42 HIS A CA   4  
ATOM 9451  C C    . HIS A 1 43 ? 7.819   -12.536 8.302   1.00 0.00 ? 42 HIS A C    4  
ATOM 9452  O O    . HIS A 1 43 ? 7.552   -13.715 8.427   1.00 0.00 ? 42 HIS A O    4  
ATOM 9453  C CB   . HIS A 1 43 ? 7.677   -10.923 10.207  1.00 0.00 ? 42 HIS A CB   4  
ATOM 9454  C CG   . HIS A 1 43 ? 6.735   -11.807 10.975  1.00 0.00 ? 42 HIS A CG   4  
ATOM 9455  N ND1  . HIS A 1 43 ? 7.174   -12.670 11.967  1.00 0.00 ? 42 HIS A ND1  4  
ATOM 9456  C CD2  . HIS A 1 43 ? 5.373   -11.973 10.910  1.00 0.00 ? 42 HIS A CD2  4  
ATOM 9457  C CE1  . HIS A 1 43 ? 6.095   -13.310 12.454  1.00 0.00 ? 42 HIS A CE1  4  
ATOM 9458  N NE2  . HIS A 1 43 ? 4.972   -12.923 11.845  1.00 0.00 ? 42 HIS A NE2  4  
ATOM 9459  H H    . HIS A 1 43 ? 9.487   -9.943  8.674   1.00 0.00 ? 42 HIS A H    4  
ATOM 9460  H HA   . HIS A 1 43 ? 9.125   -12.495 10.006  1.00 0.00 ? 42 HIS A HA   4  
ATOM 9461  H HB2  . HIS A 1 43 ? 8.255   -10.327 10.898  1.00 0.00 ? 42 HIS A HB2  4  
ATOM 9462  H HB3  . HIS A 1 43 ? 7.110   -10.272 9.558   1.00 0.00 ? 42 HIS A HB3  4  
ATOM 9463  H HD1  . HIS A 1 43 ? 8.101   -12.792 12.260  1.00 0.00 ? 42 HIS A HD1  4  
ATOM 9464  H HD2  . HIS A 1 43 ? 4.714   -11.447 10.235  1.00 0.00 ? 42 HIS A HD2  4  
ATOM 9465  H HE1  . HIS A 1 43 ? 6.134   -14.049 13.241  1.00 0.00 ? 42 HIS A HE1  4  
ATOM 9466  N N    . PHE A 1 44 ? 7.432   -11.860 7.255   1.00 0.00 ? 43 PHE A N    4  
ATOM 9467  C CA   . PHE A 1 44 ? 6.647   -12.532 6.181   1.00 0.00 ? 43 PHE A CA   4  
ATOM 9468  C C    . PHE A 1 44 ? 7.547   -13.516 5.429   1.00 0.00 ? 43 PHE A C    4  
ATOM 9469  O O    . PHE A 1 44 ? 7.081   -14.452 4.809   1.00 0.00 ? 43 PHE A O    4  
ATOM 9470  C CB   . PHE A 1 44 ? 6.111   -11.479 5.207   1.00 0.00 ? 43 PHE A CB   4  
ATOM 9471  C CG   . PHE A 1 44 ? 5.004   -10.691 5.871   1.00 0.00 ? 43 PHE A CG   4  
ATOM 9472  C CD1  . PHE A 1 44 ? 3.735   -11.263 6.027   1.00 0.00 ? 43 PHE A CD1  4  
ATOM 9473  C CD2  . PHE A 1 44 ? 5.246   -9.390  6.329   1.00 0.00 ? 43 PHE A CD2  4  
ATOM 9474  C CE1  . PHE A 1 44 ? 2.709   -10.534 6.640   1.00 0.00 ? 43 PHE A CE1  4  
ATOM 9475  C CE2  . PHE A 1 44 ? 4.219   -8.661  6.942   1.00 0.00 ? 43 PHE A CE2  4  
ATOM 9476  C CZ   . PHE A 1 44 ? 2.951   -9.233  7.098   1.00 0.00 ? 43 PHE A CZ   4  
ATOM 9477  H H    . PHE A 1 44 ? 7.658   -10.910 7.175   1.00 0.00 ? 43 PHE A H    4  
ATOM 9478  H HA   . PHE A 1 44 ? 5.819   -13.067 6.623   1.00 0.00 ? 43 PHE A HA   4  
ATOM 9479  H HB2  . PHE A 1 44 ? 6.912   -10.811 4.925   1.00 0.00 ? 43 PHE A HB2  4  
ATOM 9480  H HB3  . PHE A 1 44 ? 5.724   -11.969 4.326   1.00 0.00 ? 43 PHE A HB3  4  
ATOM 9481  H HD1  . PHE A 1 44 ? 3.547   -12.266 5.675   1.00 0.00 ? 43 PHE A HD1  4  
ATOM 9482  H HD2  . PHE A 1 44 ? 6.223   -8.948  6.209   1.00 0.00 ? 43 PHE A HD2  4  
ATOM 9483  H HE1  . PHE A 1 44 ? 1.730   -10.975 6.760   1.00 0.00 ? 43 PHE A HE1  4  
ATOM 9484  H HE2  . PHE A 1 44 ? 4.406   -7.658  7.295   1.00 0.00 ? 43 PHE A HE2  4  
ATOM 9485  H HZ   . PHE A 1 44 ? 2.159   -8.671  7.570   1.00 0.00 ? 43 PHE A HZ   4  
ATOM 9486  N N    . LEU A 1 45 ? 8.833   -13.300 5.468   1.00 0.00 ? 44 LEU A N    4  
ATOM 9487  C CA   . LEU A 1 45 ? 9.772   -14.207 4.746   1.00 0.00 ? 44 LEU A CA   4  
ATOM 9488  C C    . LEU A 1 45 ? 9.425   -15.668 5.063   1.00 0.00 ? 44 LEU A C    4  
ATOM 9489  O O    . LEU A 1 45 ? 9.646   -16.556 4.264   1.00 0.00 ? 44 LEU A O    4  
ATOM 9490  C CB   . LEU A 1 45 ? 11.216  -13.888 5.190   1.00 0.00 ? 44 LEU A CB   4  
ATOM 9491  C CG   . LEU A 1 45 ? 12.216  -14.097 4.034   1.00 0.00 ? 44 LEU A CG   4  
ATOM 9492  C CD1  . LEU A 1 45 ? 12.083  -15.520 3.479   1.00 0.00 ? 44 LEU A CD1  4  
ATOM 9493  C CD2  . LEU A 1 45 ? 11.969  -13.068 2.906   1.00 0.00 ? 44 LEU A CD2  4  
ATOM 9494  H H    . LEU A 1 45 ? 9.184   -12.532 5.966   1.00 0.00 ? 44 LEU A H    4  
ATOM 9495  H HA   . LEU A 1 45 ? 9.670   -14.042 3.685   1.00 0.00 ? 44 LEU A HA   4  
ATOM 9496  H HB2  . LEU A 1 45 ? 11.264  -12.860 5.516   1.00 0.00 ? 44 LEU A HB2  4  
ATOM 9497  H HB3  . LEU A 1 45 ? 11.494  -14.528 6.017   1.00 0.00 ? 44 LEU A HB3  4  
ATOM 9498  H HG   . LEU A 1 45 ? 13.220  -13.967 4.416   1.00 0.00 ? 44 LEU A HG   4  
ATOM 9499  H HD11 . LEU A 1 45 ? 11.967  -16.217 4.297   1.00 0.00 ? 44 LEU A HD11 4  
ATOM 9500  H HD12 . LEU A 1 45 ? 11.221  -15.576 2.831   1.00 0.00 ? 44 LEU A HD12 4  
ATOM 9501  H HD13 . LEU A 1 45 ? 12.971  -15.771 2.918   1.00 0.00 ? 44 LEU A HD13 4  
ATOM 9502  H HD21 . LEU A 1 45 ? 11.538  -12.165 3.317   1.00 0.00 ? 44 LEU A HD21 4  
ATOM 9503  H HD22 . LEU A 1 45 ? 12.909  -12.827 2.435   1.00 0.00 ? 44 LEU A HD22 4  
ATOM 9504  H HD23 . LEU A 1 45 ? 11.298  -13.480 2.164   1.00 0.00 ? 44 LEU A HD23 4  
ATOM 9505  N N    . GLU A 1 46 ? 8.887   -15.929 6.221   1.00 0.00 ? 45 GLU A N    4  
ATOM 9506  C CA   . GLU A 1 46 ? 8.539   -17.333 6.576   1.00 0.00 ? 45 GLU A CA   4  
ATOM 9507  C C    . GLU A 1 46 ? 7.308   -17.782 5.785   1.00 0.00 ? 45 GLU A C    4  
ATOM 9508  O O    . GLU A 1 46 ? 7.237   -18.897 5.309   1.00 0.00 ? 45 GLU A O    4  
ATOM 9509  C CB   . GLU A 1 46 ? 8.241   -17.418 8.075   1.00 0.00 ? 45 GLU A CB   4  
ATOM 9510  C CG   . GLU A 1 46 ? 8.248   -18.883 8.515   1.00 0.00 ? 45 GLU A CG   4  
ATOM 9511  C CD   . GLU A 1 46 ? 7.800   -18.979 9.975   1.00 0.00 ? 45 GLU A CD   4  
ATOM 9512  O OE1  . GLU A 1 46 ? 6.633   -18.737 10.232  1.00 0.00 ? 45 GLU A OE1  4  
ATOM 9513  O OE2  . GLU A 1 46 ? 8.632   -19.294 10.810  1.00 0.00 ? 45 GLU A OE2  4  
ATOM 9514  H H    . GLU A 1 46 ? 8.715   -15.205 6.860   1.00 0.00 ? 45 GLU A H    4  
ATOM 9515  H HA   . GLU A 1 46 ? 9.369   -17.977 6.339   1.00 0.00 ? 45 GLU A HA   4  
ATOM 9516  H HB2  . GLU A 1 46 ? 8.995   -16.872 8.623   1.00 0.00 ? 45 GLU A HB2  4  
ATOM 9517  H HB3  . GLU A 1 46 ? 7.270   -16.989 8.274   1.00 0.00 ? 45 GLU A HB3  4  
ATOM 9518  H HG2  . GLU A 1 46 ? 7.571   -19.449 7.892   1.00 0.00 ? 45 GLU A HG2  4  
ATOM 9519  H HG3  . GLU A 1 46 ? 9.246   -19.283 8.420   1.00 0.00 ? 45 GLU A HG3  4  
ATOM 9520  N N    . GLU A 1 47 ? 6.335   -16.924 5.648   1.00 0.00 ? 46 GLU A N    4  
ATOM 9521  C CA   . GLU A 1 47 ? 5.100   -17.300 4.895   1.00 0.00 ? 46 GLU A CA   4  
ATOM 9522  C C    . GLU A 1 47 ? 5.289   -17.014 3.403   1.00 0.00 ? 46 GLU A C    4  
ATOM 9523  O O    . GLU A 1 47 ? 4.547   -16.255 2.812   1.00 0.00 ? 46 GLU A O    4  
ATOM 9524  C CB   . GLU A 1 47 ? 3.919   -16.483 5.422   1.00 0.00 ? 46 GLU A CB   4  
ATOM 9525  C CG   . GLU A 1 47 ? 3.821   -16.648 6.940   1.00 0.00 ? 46 GLU A CG   4  
ATOM 9526  C CD   . GLU A 1 47 ? 2.464   -16.132 7.423   1.00 0.00 ? 46 GLU A CD   4  
ATOM 9527  O OE1  . GLU A 1 47 ? 1.484   -16.369 6.736   1.00 0.00 ? 46 GLU A OE1  4  
ATOM 9528  O OE2  . GLU A 1 47 ? 2.428   -15.510 8.471   1.00 0.00 ? 46 GLU A OE2  4  
ATOM 9529  H H    . GLU A 1 47 ? 6.412   -16.034 6.047   1.00 0.00 ? 46 GLU A H    4  
ATOM 9530  H HA   . GLU A 1 47 ? 4.897   -18.353 5.036   1.00 0.00 ? 46 GLU A HA   4  
ATOM 9531  H HB2  . GLU A 1 47 ? 4.067   -15.441 5.181   1.00 0.00 ? 46 GLU A HB2  4  
ATOM 9532  H HB3  . GLU A 1 47 ? 3.006   -16.834 4.965   1.00 0.00 ? 46 GLU A HB3  4  
ATOM 9533  H HG2  . GLU A 1 47 ? 3.922   -17.693 7.197   1.00 0.00 ? 46 GLU A HG2  4  
ATOM 9534  H HG3  . GLU A 1 47 ? 4.608   -16.082 7.416   1.00 0.00 ? 46 GLU A HG3  4  
ATOM 9535  N N    . ILE A 1 48 ? 6.273   -17.626 2.788   1.00 0.00 ? 47 ILE A N    4  
ATOM 9536  C CA   . ILE A 1 48 ? 6.525   -17.410 1.325   1.00 0.00 ? 47 ILE A CA   4  
ATOM 9537  C C    . ILE A 1 48 ? 6.443   -18.754 0.600   1.00 0.00 ? 47 ILE A C    4  
ATOM 9538  O O    . ILE A 1 48 ? 7.362   -19.548 0.639   1.00 0.00 ? 47 ILE A O    4  
ATOM 9539  C CB   . ILE A 1 48 ? 7.927   -16.823 1.131   1.00 0.00 ? 47 ILE A CB   4  
ATOM 9540  C CG1  . ILE A 1 48 ? 8.046   -15.471 1.858   1.00 0.00 ? 47 ILE A CG1  4  
ATOM 9541  C CG2  . ILE A 1 48 ? 8.208   -16.638 -0.362  1.00 0.00 ? 47 ILE A CG2  4  
ATOM 9542  C CD1  . ILE A 1 48 ? 6.955   -14.495 1.391   1.00 0.00 ? 47 ILE A CD1  4  
ATOM 9543  H H    . ILE A 1 48 ? 6.850   -18.237 3.292   1.00 0.00 ? 47 ILE A H    4  
ATOM 9544  H HA   . ILE A 1 48 ? 5.788   -16.739 0.908   1.00 0.00 ? 47 ILE A HA   4  
ATOM 9545  H HB   . ILE A 1 48 ? 8.654   -17.511 1.540   1.00 0.00 ? 47 ILE A HB   4  
ATOM 9546  H HG12 . ILE A 1 48 ? 7.944   -15.632 2.920   1.00 0.00 ? 47 ILE A HG12 4  
ATOM 9547  H HG13 . ILE A 1 48 ? 9.016   -15.043 1.654   1.00 0.00 ? 47 ILE A HG13 4  
ATOM 9548  H HG21 . ILE A 1 48 ? 7.377   -16.125 -0.824  1.00 0.00 ? 47 ILE A HG21 4  
ATOM 9549  H HG22 . ILE A 1 48 ? 9.107   -16.054 -0.489  1.00 0.00 ? 47 ILE A HG22 4  
ATOM 9550  H HG23 . ILE A 1 48 ? 8.338   -17.604 -0.826  1.00 0.00 ? 47 ILE A HG23 4  
ATOM 9551  H HD11 . ILE A 1 48 ? 6.750   -14.643 0.342   1.00 0.00 ? 47 ILE A HD11 4  
ATOM 9552  H HD12 . ILE A 1 48 ? 6.055   -14.664 1.962   1.00 0.00 ? 47 ILE A HD12 4  
ATOM 9553  H HD13 . ILE A 1 48 ? 7.292   -13.482 1.550   1.00 0.00 ? 47 ILE A HD13 4  
ATOM 9554  N N    . LYS A 1 49 ? 5.349   -19.019 -0.065  1.00 0.00 ? 48 LYS A N    4  
ATOM 9555  C CA   . LYS A 1 49 ? 5.211   -20.315 -0.793  1.00 0.00 ? 48 LYS A CA   4  
ATOM 9556  C C    . LYS A 1 49 ? 5.803   -20.173 -2.198  1.00 0.00 ? 48 LYS A C    4  
ATOM 9557  O O    . LYS A 1 49 ? 6.470   -21.059 -2.693  1.00 0.00 ? 48 LYS A O    4  
ATOM 9558  C CB   . LYS A 1 49 ? 3.728   -20.689 -0.891  1.00 0.00 ? 48 LYS A CB   4  
ATOM 9559  C CG   . LYS A 1 49 ? 3.040   -20.415 0.450   1.00 0.00 ? 48 LYS A CG   4  
ATOM 9560  C CD   . LYS A 1 49 ? 3.799   -21.127 1.573   1.00 0.00 ? 48 LYS A CD   4  
ATOM 9561  C CE   . LYS A 1 49 ? 2.929   -21.174 2.831   1.00 0.00 ? 48 LYS A CE   4  
ATOM 9562  N NZ   . LYS A 1 49 ? 2.311   -19.837 3.059   1.00 0.00 ? 48 LYS A NZ   4  
ATOM 9563  H H    . LYS A 1 49 ? 4.619   -18.365 -0.085  1.00 0.00 ? 48 LYS A H    4  
ATOM 9564  H HA   . LYS A 1 49 ? 5.742   -21.087 -0.253  1.00 0.00 ? 48 LYS A HA   4  
ATOM 9565  H HB2  . LYS A 1 49 ? 3.257   -20.098 -1.664  1.00 0.00 ? 48 LYS A HB2  4  
ATOM 9566  H HB3  . LYS A 1 49 ? 3.636   -21.737 -1.132  1.00 0.00 ? 48 LYS A HB3  4  
ATOM 9567  H HG2  . LYS A 1 49 ? 3.033   -19.351 0.638   1.00 0.00 ? 48 LYS A HG2  4  
ATOM 9568  H HG3  . LYS A 1 49 ? 2.025   -20.781 0.415   1.00 0.00 ? 48 LYS A HG3  4  
ATOM 9569  H HD2  . LYS A 1 49 ? 4.039   -22.134 1.263   1.00 0.00 ? 48 LYS A HD2  4  
ATOM 9570  H HD3  . LYS A 1 49 ? 4.710   -20.590 1.789   1.00 0.00 ? 48 LYS A HD3  4  
ATOM 9571  H HE2  . LYS A 1 49 ? 2.152   -21.913 2.704   1.00 0.00 ? 48 LYS A HE2  4  
ATOM 9572  H HE3  . LYS A 1 49 ? 3.541   -21.438 3.681   1.00 0.00 ? 48 LYS A HE3  4  
ATOM 9573  H HZ1  . LYS A 1 49 ? 2.014   -19.433 2.149   1.00 0.00 ? 48 LYS A HZ1  4  
ATOM 9574  H HZ2  . LYS A 1 49 ? 1.482   -19.940 3.678   1.00 0.00 ? 48 LYS A HZ2  4  
ATOM 9575  H HZ3  . LYS A 1 49 ? 3.006   -19.207 3.510   1.00 0.00 ? 48 LYS A HZ3  4  
ATOM 9576  N N    . GLU A 1 50 ? 5.567   -19.060 -2.842  1.00 0.00 ? 49 GLU A N    4  
ATOM 9577  C CA   . GLU A 1 50 ? 6.120   -18.856 -4.214  1.00 0.00 ? 49 GLU A CA   4  
ATOM 9578  C C    . GLU A 1 50 ? 7.544   -18.307 -4.106  1.00 0.00 ? 49 GLU A C    4  
ATOM 9579  O O    . GLU A 1 50 ? 7.748   -17.152 -3.793  1.00 0.00 ? 49 GLU A O    4  
ATOM 9580  C CB   . GLU A 1 50 ? 5.244   -17.856 -4.972  1.00 0.00 ? 49 GLU A CB   4  
ATOM 9581  C CG   . GLU A 1 50 ? 3.939   -18.533 -5.392  1.00 0.00 ? 49 GLU A CG   4  
ATOM 9582  C CD   . GLU A 1 50 ? 3.228   -19.083 -4.154  1.00 0.00 ? 49 GLU A CD   4  
ATOM 9583  O OE1  . GLU A 1 50 ? 2.955   -18.303 -3.256  1.00 0.00 ? 49 GLU A OE1  4  
ATOM 9584  O OE2  . GLU A 1 50 ? 2.971   -20.275 -4.124  1.00 0.00 ? 49 GLU A OE2  4  
ATOM 9585  H H    . GLU A 1 50 ? 5.029   -18.357 -2.423  1.00 0.00 ? 49 GLU A H    4  
ATOM 9586  H HA   . GLU A 1 50 ? 6.133   -19.799 -4.743  1.00 0.00 ? 49 GLU A HA   4  
ATOM 9587  H HB2  . GLU A 1 50 ? 5.024   -17.014 -4.332  1.00 0.00 ? 49 GLU A HB2  4  
ATOM 9588  H HB3  . GLU A 1 50 ? 5.768   -17.514 -5.851  1.00 0.00 ? 49 GLU A HB3  4  
ATOM 9589  H HG2  . GLU A 1 50 ? 3.301   -17.812 -5.883  1.00 0.00 ? 49 GLU A HG2  4  
ATOM 9590  H HG3  . GLU A 1 50 ? 4.155   -19.344 -6.070  1.00 0.00 ? 49 GLU A HG3  4  
ATOM 9591  N N    . GLN A 1 51 ? 8.532   -19.119 -4.370  1.00 0.00 ? 50 GLN A N    4  
ATOM 9592  C CA   . GLN A 1 51 ? 9.939   -18.631 -4.290  1.00 0.00 ? 50 GLN A CA   4  
ATOM 9593  C C    . GLN A 1 51 ? 10.310  -17.921 -5.594  1.00 0.00 ? 50 GLN A C    4  
ATOM 9594  O O    . GLN A 1 51 ? 11.145  -17.039 -5.616  1.00 0.00 ? 50 GLN A O    4  
ATOM 9595  C CB   . GLN A 1 51 ? 10.876  -19.822 -4.078  1.00 0.00 ? 50 GLN A CB   4  
ATOM 9596  C CG   . GLN A 1 51 ? 10.663  -20.398 -2.677  1.00 0.00 ? 50 GLN A CG   4  
ATOM 9597  C CD   . GLN A 1 51 ? 9.270   -21.025 -2.590  1.00 0.00 ? 50 GLN A CD   4  
ATOM 9598  O OE1  . GLN A 1 51 ? 8.727   -21.469 -3.582  1.00 0.00 ? 50 GLN A OE1  4  
ATOM 9599  N NE2  . GLN A 1 51 ? 8.665   -21.081 -1.435  1.00 0.00 ? 50 GLN A NE2  4  
ATOM 9600  H H    . GLN A 1 51 ? 8.353   -20.045 -4.637  1.00 0.00 ? 50 GLN A H    4  
ATOM 9601  H HA   . GLN A 1 51 ? 10.037  -17.947 -3.460  1.00 0.00 ? 50 GLN A HA   4  
ATOM 9602  H HB2  . GLN A 1 51 ? 10.665  -20.581 -4.817  1.00 0.00 ? 50 GLN A HB2  4  
ATOM 9603  H HB3  . GLN A 1 51 ? 11.901  -19.496 -4.179  1.00 0.00 ? 50 GLN A HB3  4  
ATOM 9604  H HG2  . GLN A 1 51 ? 11.411  -21.151 -2.480  1.00 0.00 ? 50 GLN A HG2  4  
ATOM 9605  H HG3  . GLN A 1 51 ? 10.746  -19.608 -1.947  1.00 0.00 ? 50 GLN A HG3  4  
ATOM 9606  H HE21 . GLN A 1 51 ? 9.103   -20.724 -0.634  1.00 0.00 ? 50 GLN A HE21 4  
ATOM 9607  H HE22 . GLN A 1 51 ? 7.773   -21.481 -1.368  1.00 0.00 ? 50 GLN A HE22 4  
ATOM 9608  N N    . GLU A 1 52 ? 9.702   -18.305 -6.683  1.00 0.00 ? 51 GLU A N    4  
ATOM 9609  C CA   . GLU A 1 52 ? 10.026  -17.658 -7.987  1.00 0.00 ? 51 GLU A CA   4  
ATOM 9610  C C    . GLU A 1 52 ? 9.428   -16.248 -8.048  1.00 0.00 ? 51 GLU A C    4  
ATOM 9611  O O    . GLU A 1 52 ? 9.903   -15.405 -8.783  1.00 0.00 ? 51 GLU A O    4  
ATOM 9612  C CB   . GLU A 1 52 ? 9.498   -18.507 -9.144  1.00 0.00 ? 51 GLU A CB   4  
ATOM 9613  C CG   . GLU A 1 52 ? 10.072  -19.922 -9.044  1.00 0.00 ? 51 GLU A CG   4  
ATOM 9614  C CD   . GLU A 1 52 ? 11.578  -19.882 -9.308  1.00 0.00 ? 51 GLU A CD   4  
ATOM 9615  O OE1  . GLU A 1 52 ? 12.029  -18.921 -9.908  1.00 0.00 ? 51 GLU A OE1  4  
ATOM 9616  O OE2  . GLU A 1 52 ? 12.254  -20.814 -8.905  1.00 0.00 ? 51 GLU A OE2  4  
ATOM 9617  H H    . GLU A 1 52 ? 9.031   -19.018 -6.642  1.00 0.00 ? 51 GLU A H    4  
ATOM 9618  H HA   . GLU A 1 52 ? 11.097  -17.552 -8.066  1.00 0.00 ? 51 GLU A HA   4  
ATOM 9619  H HB2  . GLU A 1 52 ? 8.420   -18.551 -9.095  1.00 0.00 ? 51 GLU A HB2  4  
ATOM 9620  H HB3  . GLU A 1 52 ? 9.799   -18.065 -10.082 1.00 0.00 ? 51 GLU A HB3  4  
ATOM 9621  H HG2  . GLU A 1 52 ? 9.888   -20.315 -8.055  1.00 0.00 ? 51 GLU A HG2  4  
ATOM 9622  H HG3  . GLU A 1 52 ? 9.597   -20.555 -9.778  1.00 0.00 ? 51 GLU A HG3  4  
ATOM 9623  N N    . VAL A 1 53 ? 8.421   -15.962 -7.270  1.00 0.00 ? 52 VAL A N    4  
ATOM 9624  C CA   . VAL A 1 53 ? 7.854   -14.582 -7.288  1.00 0.00 ? 52 VAL A CA   4  
ATOM 9625  C C    . VAL A 1 53 ? 8.815   -13.660 -6.537  1.00 0.00 ? 52 VAL A C    4  
ATOM 9626  O O    . VAL A 1 53 ? 9.199   -12.619 -7.033  1.00 0.00 ? 52 VAL A O    4  
ATOM 9627  C CB   . VAL A 1 53 ? 6.488   -14.571 -6.591  1.00 0.00 ? 52 VAL A CB   4  
ATOM 9628  C CG1  . VAL A 1 53 ? 6.017   -13.127 -6.390  1.00 0.00 ? 52 VAL A CG1  4  
ATOM 9629  C CG2  . VAL A 1 53 ? 5.468   -15.314 -7.453  1.00 0.00 ? 52 VAL A CG2  4  
ATOM 9630  H H    . VAL A 1 53 ? 8.068   -16.623 -6.637  1.00 0.00 ? 52 VAL A H    4  
ATOM 9631  H HA   . VAL A 1 53 ? 7.749   -14.230 -8.304  1.00 0.00 ? 52 VAL A HA   4  
ATOM 9632  H HB   . VAL A 1 53 ? 6.572   -15.058 -5.630  1.00 0.00 ? 52 VAL A HB   4  
ATOM 9633  H HG11 . VAL A 1 53 ? 6.152   -12.574 -7.308  1.00 0.00 ? 52 VAL A HG11 4  
ATOM 9634  H HG12 . VAL A 1 53 ? 4.972   -13.123 -6.118  1.00 0.00 ? 52 VAL A HG12 4  
ATOM 9635  H HG13 . VAL A 1 53 ? 6.595   -12.665 -5.604  1.00 0.00 ? 52 VAL A HG13 4  
ATOM 9636  H HG21 . VAL A 1 53 ? 5.900   -16.237 -7.809  1.00 0.00 ? 52 VAL A HG21 4  
ATOM 9637  H HG22 . VAL A 1 53 ? 4.591   -15.531 -6.862  1.00 0.00 ? 52 VAL A HG22 4  
ATOM 9638  H HG23 . VAL A 1 53 ? 5.191   -14.698 -8.295  1.00 0.00 ? 52 VAL A HG23 4  
ATOM 9639  N N    . VAL A 1 54 ? 9.216   -14.024 -5.354  1.00 0.00 ? 53 VAL A N    4  
ATOM 9640  C CA   . VAL A 1 54 ? 10.156  -13.150 -4.602  1.00 0.00 ? 53 VAL A CA   4  
ATOM 9641  C C    . VAL A 1 54 ? 11.473  -13.055 -5.373  1.00 0.00 ? 53 VAL A C    4  
ATOM 9642  O O    . VAL A 1 54 ? 12.137  -12.038 -5.367  1.00 0.00 ? 53 VAL A O    4  
ATOM 9643  C CB   . VAL A 1 54 ? 10.409  -13.742 -3.213  1.00 0.00 ? 53 VAL A CB   4  
ATOM 9644  C CG1  . VAL A 1 54 ? 11.511  -12.947 -2.508  1.00 0.00 ? 53 VAL A CG1  4  
ATOM 9645  C CG2  . VAL A 1 54 ? 9.122   -13.668 -2.387  1.00 0.00 ? 53 VAL A CG2  4  
ATOM 9646  H H    . VAL A 1 54 ? 8.905   -14.864 -4.951  1.00 0.00 ? 53 VAL A H    4  
ATOM 9647  H HA   . VAL A 1 54 ? 9.727   -12.164 -4.502  1.00 0.00 ? 53 VAL A HA   4  
ATOM 9648  H HB   . VAL A 1 54 ? 10.717  -14.773 -3.312  1.00 0.00 ? 53 VAL A HB   4  
ATOM 9649  H HG11 . VAL A 1 54 ? 11.325  -11.890 -2.627  1.00 0.00 ? 53 VAL A HG11 4  
ATOM 9650  H HG12 . VAL A 1 54 ? 11.518  -13.195 -1.457  1.00 0.00 ? 53 VAL A HG12 4  
ATOM 9651  H HG13 . VAL A 1 54 ? 12.468  -13.195 -2.943  1.00 0.00 ? 53 VAL A HG13 4  
ATOM 9652  H HG21 . VAL A 1 54 ? 8.705   -12.674 -2.458  1.00 0.00 ? 53 VAL A HG21 4  
ATOM 9653  H HG22 . VAL A 1 54 ? 8.410   -14.385 -2.766  1.00 0.00 ? 53 VAL A HG22 4  
ATOM 9654  H HG23 . VAL A 1 54 ? 9.344   -13.891 -1.355  1.00 0.00 ? 53 VAL A HG23 4  
ATOM 9655  N N    . ASP A 1 55 ? 11.858  -14.109 -6.038  1.00 0.00 ? 54 ASP A N    4  
ATOM 9656  C CA   . ASP A 1 55 ? 13.131  -14.076 -6.808  1.00 0.00 ? 54 ASP A CA   4  
ATOM 9657  C C    . ASP A 1 55 ? 13.069  -12.962 -7.855  1.00 0.00 ? 54 ASP A C    4  
ATOM 9658  O O    . ASP A 1 55 ? 14.022  -12.239 -8.063  1.00 0.00 ? 54 ASP A O    4  
ATOM 9659  C CB   . ASP A 1 55 ? 13.343  -15.419 -7.508  1.00 0.00 ? 54 ASP A CB   4  
ATOM 9660  C CG   . ASP A 1 55 ? 13.572  -16.511 -6.461  1.00 0.00 ? 54 ASP A CG   4  
ATOM 9661  O OD1  . ASP A 1 55 ? 13.985  -16.175 -5.363  1.00 0.00 ? 54 ASP A OD1  4  
ATOM 9662  O OD2  . ASP A 1 55 ? 13.331  -17.665 -6.775  1.00 0.00 ? 54 ASP A OD2  4  
ATOM 9663  H H    . ASP A 1 55 ? 11.310  -14.921 -6.031  1.00 0.00 ? 54 ASP A H    4  
ATOM 9664  H HA   . ASP A 1 55 ? 13.952  -13.891 -6.130  1.00 0.00 ? 54 ASP A HA   4  
ATOM 9665  H HB2  . ASP A 1 55 ? 12.469  -15.659 -8.096  1.00 0.00 ? 54 ASP A HB2  4  
ATOM 9666  H HB3  . ASP A 1 55 ? 14.205  -15.356 -8.154  1.00 0.00 ? 54 ASP A HB3  4  
ATOM 9667  N N    . LYS A 1 56 ? 11.956  -12.828 -8.530  1.00 0.00 ? 55 LYS A N    4  
ATOM 9668  C CA   . LYS A 1 56 ? 11.847  -11.770 -9.576  1.00 0.00 ? 55 LYS A CA   4  
ATOM 9669  C C    . LYS A 1 56 ? 11.808  -10.391 -8.916  1.00 0.00 ? 55 LYS A C    4  
ATOM 9670  O O    . LYS A 1 56 ? 12.231  -9.412  -9.499  1.00 0.00 ? 55 LYS A O    4  
ATOM 9671  C CB   . LYS A 1 56 ? 10.582  -11.987 -10.413 1.00 0.00 ? 55 LYS A CB   4  
ATOM 9672  C CG   . LYS A 1 56 ? 10.712  -13.272 -11.255 1.00 0.00 ? 55 LYS A CG   4  
ATOM 9673  C CD   . LYS A 1 56 ? 11.429  -12.976 -12.588 1.00 0.00 ? 55 LYS A CD   4  
ATOM 9674  C CE   . LYS A 1 56 ? 10.421  -12.474 -13.630 1.00 0.00 ? 55 LYS A CE   4  
ATOM 9675  N NZ   . LYS A 1 56 ? 11.116  -12.265 -14.932 1.00 0.00 ? 55 LYS A NZ   4  
ATOM 9676  H H    . LYS A 1 56 ? 11.198  -13.428 -8.358  1.00 0.00 ? 55 LYS A H    4  
ATOM 9677  H HA   . LYS A 1 56 ? 12.723  -11.815 -10.203 1.00 0.00 ? 55 LYS A HA   4  
ATOM 9678  H HB2  . LYS A 1 56 ? 9.733   -12.076 -9.750  1.00 0.00 ? 55 LYS A HB2  4  
ATOM 9679  H HB3  . LYS A 1 56 ? 10.437  -11.139 -11.064 1.00 0.00 ? 55 LYS A HB3  4  
ATOM 9680  H HG2  . LYS A 1 56 ? 11.279  -14.010 -10.702 1.00 0.00 ? 55 LYS A HG2  4  
ATOM 9681  H HG3  . LYS A 1 56 ? 9.726   -13.667 -11.458 1.00 0.00 ? 55 LYS A HG3  4  
ATOM 9682  H HD2  . LYS A 1 56 ? 12.188  -12.223 -12.434 1.00 0.00 ? 55 LYS A HD2  4  
ATOM 9683  H HD3  . LYS A 1 56 ? 11.893  -13.880 -12.953 1.00 0.00 ? 55 LYS A HD3  4  
ATOM 9684  H HE2  . LYS A 1 56 ? 9.637   -13.207 -13.756 1.00 0.00 ? 55 LYS A HE2  4  
ATOM 9685  H HE3  . LYS A 1 56 ? 9.990   -11.541 -13.300 1.00 0.00 ? 55 LYS A HE3  4  
ATOM 9686  H HZ1  . LYS A 1 56 ? 11.948  -11.658 -14.787 1.00 0.00 ? 55 LYS A HZ1  4  
ATOM 9687  H HZ2  . LYS A 1 56 ? 11.421  -13.182 -15.314 1.00 0.00 ? 55 LYS A HZ2  4  
ATOM 9688  H HZ3  . LYS A 1 56 ? 10.464  -11.807 -15.602 1.00 0.00 ? 55 LYS A HZ3  4  
ATOM 9689  N N    . VAL A 1 57 ? 11.348  -10.294 -7.700  1.00 0.00 ? 56 VAL A N    4  
ATOM 9690  C CA   . VAL A 1 57 ? 11.339  -8.970  -7.019  1.00 0.00 ? 56 VAL A CA   4  
ATOM 9691  C C    . VAL A 1 57 ? 12.784  -8.490  -6.882  1.00 0.00 ? 56 VAL A C    4  
ATOM 9692  O O    . VAL A 1 57 ? 13.136  -7.412  -7.317  1.00 0.00 ? 56 VAL A O    4  
ATOM 9693  C CB   . VAL A 1 57 ? 10.721  -9.124  -5.628  1.00 0.00 ? 56 VAL A CB   4  
ATOM 9694  C CG1  . VAL A 1 57 ? 10.820  -7.795  -4.874  1.00 0.00 ? 56 VAL A CG1  4  
ATOM 9695  C CG2  . VAL A 1 57 ? 9.248   -9.523  -5.770  1.00 0.00 ? 56 VAL A CG2  4  
ATOM 9696  H H    . VAL A 1 57 ? 11.042  -11.086 -7.213  1.00 0.00 ? 56 VAL A H    4  
ATOM 9697  H HA   . VAL A 1 57 ? 10.774  -8.239  -7.578  1.00 0.00 ? 56 VAL A HA   4  
ATOM 9698  H HB   . VAL A 1 57 ? 11.252  -9.887  -5.080  1.00 0.00 ? 56 VAL A HB   4  
ATOM 9699  H HG11 . VAL A 1 57 ? 10.464  -6.995  -5.506  1.00 0.00 ? 56 VAL A HG11 4  
ATOM 9700  H HG12 . VAL A 1 57 ? 10.216  -7.843  -3.980  1.00 0.00 ? 56 VAL A HG12 4  
ATOM 9701  H HG13 . VAL A 1 57 ? 11.849  -7.610  -4.605  1.00 0.00 ? 56 VAL A HG13 4  
ATOM 9702  H HG21 . VAL A 1 57 ? 9.152   -10.289 -6.526  1.00 0.00 ? 56 VAL A HG21 4  
ATOM 9703  H HG22 . VAL A 1 57 ? 8.886   -9.905  -4.827  1.00 0.00 ? 56 VAL A HG22 4  
ATOM 9704  H HG23 . VAL A 1 57 ? 8.665   -8.660  -6.056  1.00 0.00 ? 56 VAL A HG23 4  
ATOM 9705  N N    . MET A 1 58 ? 13.621  -9.284  -6.277  1.00 0.00 ? 57 MET A N    4  
ATOM 9706  C CA   . MET A 1 58 ? 15.043  -8.880  -6.103  1.00 0.00 ? 57 MET A CA   4  
ATOM 9707  C C    . MET A 1 58 ? 15.652  -8.495  -7.453  1.00 0.00 ? 57 MET A C    4  
ATOM 9708  O O    . MET A 1 58 ? 16.582  -7.715  -7.518  1.00 0.00 ? 57 MET A O    4  
ATOM 9709  C CB   . MET A 1 58 ? 15.831  -10.046 -5.503  1.00 0.00 ? 57 MET A CB   4  
ATOM 9710  C CG   . MET A 1 58 ? 15.478  -10.196 -4.022  1.00 0.00 ? 57 MET A CG   4  
ATOM 9711  S SD   . MET A 1 58 ? 16.296  -8.889  -3.074  1.00 0.00 ? 57 MET A SD   4  
ATOM 9712  C CE   . MET A 1 58 ? 15.137  -8.859  -1.684  1.00 0.00 ? 57 MET A CE   4  
ATOM 9713  H H    . MET A 1 58 ? 13.314  -10.142 -5.914  1.00 0.00 ? 57 MET A H    4  
ATOM 9714  H HA   . MET A 1 58 ? 15.102  -8.028  -5.444  1.00 0.00 ? 57 MET A HA   4  
ATOM 9715  H HB2  . MET A 1 58 ? 15.578  -10.956 -6.029  1.00 0.00 ? 57 MET A HB2  4  
ATOM 9716  H HB3  . MET A 1 58 ? 16.889  -9.855  -5.602  1.00 0.00 ? 57 MET A HB3  4  
ATOM 9717  H HG2  . MET A 1 58 ? 14.408  -10.117 -3.896  1.00 0.00 ? 57 MET A HG2  4  
ATOM 9718  H HG3  . MET A 1 58 ? 15.812  -11.160 -3.669  1.00 0.00 ? 57 MET A HG3  4  
ATOM 9719  H HE1  . MET A 1 58 ? 14.716  -9.845  -1.547  1.00 0.00 ? 57 MET A HE1  4  
ATOM 9720  H HE2  . MET A 1 58 ? 15.658  -8.565  -0.787  1.00 0.00 ? 57 MET A HE2  4  
ATOM 9721  H HE3  . MET A 1 58 ? 14.348  -8.149  -1.890  1.00 0.00 ? 57 MET A HE3  4  
ATOM 9722  N N    . GLU A 1 59 ? 15.131  -9.012  -8.538  1.00 0.00 ? 58 GLU A N    4  
ATOM 9723  C CA   . GLU A 1 59 ? 15.678  -8.643  -9.879  1.00 0.00 ? 58 GLU A CA   4  
ATOM 9724  C C    . GLU A 1 59 ? 15.008  -7.355  -10.363 1.00 0.00 ? 58 GLU A C    4  
ATOM 9725  O O    . GLU A 1 59 ? 15.633  -6.530  -10.997 1.00 0.00 ? 58 GLU A O    4  
ATOM 9726  C CB   . GLU A 1 59 ? 15.452  -9.779  -10.881 1.00 0.00 ? 58 GLU A CB   4  
ATOM 9727  C CG   . GLU A 1 59 ? 16.395  -9.610  -12.074 1.00 0.00 ? 58 GLU A CG   4  
ATOM 9728  C CD   . GLU A 1 59 ? 15.941  -10.520 -13.217 1.00 0.00 ? 58 GLU A CD   4  
ATOM 9729  O OE1  . GLU A 1 59 ? 14.903  -11.144 -13.074 1.00 0.00 ? 58 GLU A OE1  4  
ATOM 9730  O OE2  . GLU A 1 59 ? 16.640  -10.576 -14.216 1.00 0.00 ? 58 GLU A OE2  4  
ATOM 9731  H H    . GLU A 1 59 ? 14.363  -9.610  -8.472  1.00 0.00 ? 58 GLU A H    4  
ATOM 9732  H HA   . GLU A 1 59 ? 16.733  -8.423  -9.790  1.00 0.00 ? 58 GLU A HA   4  
ATOM 9733  H HB2  . GLU A 1 59 ? 15.646  -10.726 -10.400 1.00 0.00 ? 58 GLU A HB2  4  
ATOM 9734  H HB3  . GLU A 1 59 ? 14.429  -9.754  -11.228 1.00 0.00 ? 58 GLU A HB3  4  
ATOM 9735  H HG2  . GLU A 1 59 ? 16.380  -8.581  -12.403 1.00 0.00 ? 58 GLU A HG2  4  
ATOM 9736  H HG3  . GLU A 1 59 ? 17.399  -9.880  -11.780 1.00 0.00 ? 58 GLU A HG3  4  
ATOM 9737  N N    . THR A 1 60 ? 13.757  -7.152  -10.059 1.00 0.00 ? 59 THR A N    4  
ATOM 9738  C CA   . THR A 1 60 ? 13.100  -5.895  -10.497 1.00 0.00 ? 59 THR A CA   4  
ATOM 9739  C C    . THR A 1 60 ? 13.743  -4.734  -9.741  1.00 0.00 ? 59 THR A C    4  
ATOM 9740  O O    . THR A 1 60 ? 14.155  -3.760  -10.339 1.00 0.00 ? 59 THR A O    4  
ATOM 9741  C CB   . THR A 1 60 ? 11.604  -5.957  -10.206 1.00 0.00 ? 59 THR A CB   4  
ATOM 9742  O OG1  . THR A 1 60 ? 11.402  -6.373  -8.863  1.00 0.00 ? 59 THR A OG1  4  
ATOM 9743  C CG2  . THR A 1 60 ? 10.936  -6.949  -11.159 1.00 0.00 ? 59 THR A CG2  4  
ATOM 9744  H H    . THR A 1 60 ? 13.259  -7.806  -9.527  1.00 0.00 ? 59 THR A H    4  
ATOM 9745  H HA   . THR A 1 60 ? 13.270  -5.729  -11.551 1.00 0.00 ? 59 THR A HA   4  
ATOM 9746  H HB   . THR A 1 60 ? 11.175  -4.985  -10.350 1.00 0.00 ? 59 THR A HB   4  
ATOM 9747  H HG1  . THR A 1 60 ? 12.261  -6.448  -8.443  1.00 0.00 ? 59 THR A HG1  4  
ATOM 9748  H HG21 . THR A 1 60 ? 11.465  -7.890  -11.128 1.00 0.00 ? 59 THR A HG21 4  
ATOM 9749  H HG22 . THR A 1 60 ? 9.910   -7.102  -10.858 1.00 0.00 ? 59 THR A HG22 4  
ATOM 9750  H HG23 . THR A 1 60 ? 10.961  -6.555  -12.164 1.00 0.00 ? 59 THR A HG23 4  
ATOM 9751  N N    . LEU A 1 61 ? 13.877  -4.825  -8.450  1.00 0.00 ? 60 LEU A N    4  
ATOM 9752  C CA   . LEU A 1 61 ? 14.544  -3.717  -7.715  1.00 0.00 ? 60 LEU A CA   4  
ATOM 9753  C C    . LEU A 1 61 ? 15.950  -3.543  -8.285  1.00 0.00 ? 60 LEU A C    4  
ATOM 9754  O O    . LEU A 1 61 ? 16.317  -2.480  -8.742  1.00 0.00 ? 60 LEU A O    4  
ATOM 9755  C CB   . LEU A 1 61 ? 14.643  -4.069  -6.228  1.00 0.00 ? 60 LEU A CB   4  
ATOM 9756  C CG   . LEU A 1 61 ? 13.257  -4.423  -5.680  1.00 0.00 ? 60 LEU A CG   4  
ATOM 9757  C CD1  . LEU A 1 61 ? 13.402  -4.970  -4.258  1.00 0.00 ? 60 LEU A CD1  4  
ATOM 9758  C CD2  . LEU A 1 61 ? 12.365  -3.173  -5.659  1.00 0.00 ? 60 LEU A CD2  4  
ATOM 9759  H H    . LEU A 1 61 ? 13.575  -5.615  -7.951  1.00 0.00 ? 60 LEU A H    4  
ATOM 9760  H HA   . LEU A 1 61 ? 14.005  -2.789  -7.835  1.00 0.00 ? 60 LEU A HA   4  
ATOM 9761  H HB2  . LEU A 1 61 ? 15.303  -4.916  -6.106  1.00 0.00 ? 60 LEU A HB2  4  
ATOM 9762  H HB3  . LEU A 1 61 ? 15.040  -3.225  -5.685  1.00 0.00 ? 60 LEU A HB3  4  
ATOM 9763  H HG   . LEU A 1 61 ? 12.806  -5.179  -6.308  1.00 0.00 ? 60 LEU A HG   4  
ATOM 9764  H HD11 . LEU A 1 61 ? 14.056  -4.324  -3.689  1.00 0.00 ? 60 LEU A HD11 4  
ATOM 9765  H HD12 . LEU A 1 61 ? 12.431  -5.005  -3.784  1.00 0.00 ? 60 LEU A HD12 4  
ATOM 9766  H HD13 . LEU A 1 61 ? 13.821  -5.964  -4.295  1.00 0.00 ? 60 LEU A HD13 4  
ATOM 9767  H HD21 . LEU A 1 61 ? 12.934  -2.327  -5.302  1.00 0.00 ? 60 LEU A HD21 4  
ATOM 9768  H HD22 . LEU A 1 61 ? 12.005  -2.970  -6.656  1.00 0.00 ? 60 LEU A HD22 4  
ATOM 9769  H HD23 . LEU A 1 61 ? 11.522  -3.341  -5.004  1.00 0.00 ? 60 LEU A HD23 4  
ATOM 9770  N N    . ASP A 1 62 ? 16.740  -4.584  -8.272  1.00 0.00 ? 61 ASP A N    4  
ATOM 9771  C CA   . ASP A 1 62 ? 18.116  -4.474  -8.825  1.00 0.00 ? 61 ASP A CA   4  
ATOM 9772  C C    . ASP A 1 62 ? 18.046  -3.884  -10.234 1.00 0.00 ? 61 ASP A C    4  
ATOM 9773  O O    . ASP A 1 62 ? 18.994  -3.295  -10.716 1.00 0.00 ? 61 ASP A O    4  
ATOM 9774  C CB   . ASP A 1 62 ? 18.754  -5.864  -8.887  1.00 0.00 ? 61 ASP A CB   4  
ATOM 9775  C CG   . ASP A 1 62 ? 18.895  -6.423  -7.471  1.00 0.00 ? 61 ASP A CG   4  
ATOM 9776  O OD1  . ASP A 1 62 ? 18.113  -6.033  -6.620  1.00 0.00 ? 61 ASP A OD1  4  
ATOM 9777  O OD2  . ASP A 1 62 ? 19.785  -7.231  -7.260  1.00 0.00 ? 61 ASP A OD2  4  
ATOM 9778  H H    . ASP A 1 62 ? 16.427  -5.437  -7.903  1.00 0.00 ? 61 ASP A H    4  
ATOM 9779  H HA   . ASP A 1 62 ? 18.710  -3.832  -8.193  1.00 0.00 ? 61 ASP A HA   4  
ATOM 9780  H HB2  . ASP A 1 62 ? 18.129  -6.521  -9.474  1.00 0.00 ? 61 ASP A HB2  4  
ATOM 9781  H HB3  . ASP A 1 62 ? 19.730  -5.792  -9.343  1.00 0.00 ? 61 ASP A HB3  4  
ATOM 9782  N N    . GLU A 1 63 ? 16.925  -4.039  -10.902 1.00 0.00 ? 62 GLU A N    4  
ATOM 9783  C CA   . GLU A 1 63 ? 16.782  -3.490  -12.290 1.00 0.00 ? 62 GLU A CA   4  
ATOM 9784  C C    . GLU A 1 63 ? 15.996  -2.186  -12.234 1.00 0.00 ? 62 GLU A C    4  
ATOM 9785  O O    . GLU A 1 63 ? 15.175  -1.887  -13.078 1.00 0.00 ? 62 GLU A O    4  
ATOM 9786  C CB   . GLU A 1 63 ? 16.037  -4.470  -13.146 1.00 0.00 ? 62 GLU A CB   4  
ATOM 9787  C CG   . GLU A 1 63 ? 16.932  -5.663  -13.482 1.00 0.00 ? 62 GLU A CG   4  
ATOM 9788  C CD   . GLU A 1 63 ? 16.116  -6.716  -14.233 1.00 0.00 ? 62 GLU A CD   4  
ATOM 9789  O OE1  . GLU A 1 63 ? 14.912  -6.757  -14.035 1.00 0.00 ? 62 GLU A OE1  4  
ATOM 9790  O OE2  . GLU A 1 63 ? 16.707  -7.463  -14.995 1.00 0.00 ? 62 GLU A OE2  4  
ATOM 9791  H H    . GLU A 1 63 ? 16.177  -4.518  -10.490 1.00 0.00 ? 62 GLU A H    4  
ATOM 9792  H HA   . GLU A 1 63 ? 17.761  -3.267  -12.689 1.00 0.00 ? 62 GLU A HA   4  
ATOM 9793  H HB2  . GLU A 1 63 ? 15.175  -4.797  -12.592 1.00 0.00 ? 62 GLU A HB2  4  
ATOM 9794  H HB3  . GLU A 1 63 ? 15.723  -3.981  -14.049 1.00 0.00 ? 62 GLU A HB3  4  
ATOM 9795  H HG2  . GLU A 1 63 ? 17.752  -5.332  -14.102 1.00 0.00 ? 62 GLU A HG2  4  
ATOM 9796  H HG3  . GLU A 1 63 ? 17.319  -6.092  -12.571 1.00 0.00 ? 62 GLU A HG3  4  
ATOM 9797  N N    . ASP A 1 64 ? 16.271  -1.421  -11.252 1.00 0.00 ? 63 ASP A N    4  
ATOM 9798  C CA   . ASP A 1 64 ? 15.592  -0.103  -11.079 1.00 0.00 ? 63 ASP A CA   4  
ATOM 9799  C C    . ASP A 1 64 ? 15.552  0.633   -12.419 1.00 0.00 ? 63 ASP A C    4  
ATOM 9800  O O    . ASP A 1 64 ? 14.591  1.296   -12.752 1.00 0.00 ? 63 ASP A O    4  
ATOM 9801  C CB   . ASP A 1 64 ? 16.426  0.727   -10.099 1.00 0.00 ? 63 ASP A CB   4  
ATOM 9802  C CG   . ASP A 1 64 ? 15.760  2.086   -9.879  1.00 0.00 ? 63 ASP A CG   4  
ATOM 9803  O OD1  . ASP A 1 64 ? 14.679  2.111   -9.314  1.00 0.00 ? 63 ASP A OD1  4  
ATOM 9804  O OD2  . ASP A 1 64 ? 16.345  3.080   -10.277 1.00 0.00 ? 63 ASP A OD2  4  
ATOM 9805  H H    . ASP A 1 64 ? 16.939  -1.720  -10.621 1.00 0.00 ? 63 ASP A H    4  
ATOM 9806  H HA   . ASP A 1 64 ? 14.605  -0.199  -10.651 1.00 0.00 ? 63 ASP A HA   4  
ATOM 9807  H HB2  . ASP A 1 64 ? 16.487  0.204   -9.157  1.00 0.00 ? 63 ASP A HB2  4  
ATOM 9808  H HB3  . ASP A 1 64 ? 17.418  0.872   -10.497 1.00 0.00 ? 63 ASP A HB3  4  
ATOM 9809  N N    . GLY A 1 65 ? 16.584  0.468   -13.199 1.00 0.00 ? 64 GLY A N    4  
ATOM 9810  C CA   . GLY A 1 65 ? 16.651  1.096   -14.556 1.00 0.00 ? 64 GLY A CA   4  
ATOM 9811  C C    . GLY A 1 65 ? 16.344  2.605   -14.527 1.00 0.00 ? 64 GLY A C    4  
ATOM 9812  O O    . GLY A 1 65 ? 16.521  3.276   -15.525 1.00 0.00 ? 64 GLY A O    4  
ATOM 9813  H H    . GLY A 1 65 ? 17.314  -0.123  -12.912 1.00 0.00 ? 64 GLY A H    4  
ATOM 9814  H HA2  . GLY A 1 65 ? 17.649  0.956   -14.945 1.00 0.00 ? 64 GLY A HA2  4  
ATOM 9815  H HA3  . GLY A 1 65 ? 15.935  0.585   -15.181 1.00 0.00 ? 64 GLY A HA3  4  
ATOM 9816  N N    . ASP A 1 66 ? 15.894  3.158   -13.418 1.00 0.00 ? 65 ASP A N    4  
ATOM 9817  C CA   . ASP A 1 66 ? 15.588  4.641   -13.382 1.00 0.00 ? 65 ASP A CA   4  
ATOM 9818  C C    . ASP A 1 66 ? 16.652  5.443   -12.588 1.00 0.00 ? 65 ASP A C    4  
ATOM 9819  O O    . ASP A 1 66 ? 16.900  6.588   -12.916 1.00 0.00 ? 65 ASP A O    4  
ATOM 9820  C CB   . ASP A 1 66 ? 14.226  4.847   -12.719 1.00 0.00 ? 65 ASP A CB   4  
ATOM 9821  C CG   . ASP A 1 66 ? 14.217  4.179   -11.344 1.00 0.00 ? 65 ASP A CG   4  
ATOM 9822  O OD1  . ASP A 1 66 ? 14.715  4.785   -10.410 1.00 0.00 ? 65 ASP A OD1  4  
ATOM 9823  O OD2  . ASP A 1 66 ? 13.711  3.073   -11.248 1.00 0.00 ? 65 ASP A OD2  4  
ATOM 9824  H H    . ASP A 1 66 ? 15.743  2.611   -12.625 1.00 0.00 ? 65 ASP A H    4  
ATOM 9825  H HA   . ASP A 1 66 ? 15.539  5.015   -14.395 1.00 0.00 ? 65 ASP A HA   4  
ATOM 9826  H HB2  . ASP A 1 66 ? 14.039  5.904   -12.607 1.00 0.00 ? 65 ASP A HB2  4  
ATOM 9827  H HB3  . ASP A 1 66 ? 13.457  4.407   -13.335 1.00 0.00 ? 65 ASP A HB3  4  
ATOM 9828  N N    . GLY A 1 67 ? 17.287  4.899   -11.567 1.00 0.00 ? 66 GLY A N    4  
ATOM 9829  C CA   . GLY A 1 67 ? 18.315  5.683   -10.804 1.00 0.00 ? 66 GLY A CA   4  
ATOM 9830  C C    . GLY A 1 67 ? 17.727  6.132   -9.463  1.00 0.00 ? 66 GLY A C    4  
ATOM 9831  O O    . GLY A 1 67 ? 18.441  6.326   -8.501  1.00 0.00 ? 66 GLY A O    4  
ATOM 9832  H H    . GLY A 1 67 ? 17.101  3.993   -11.268 1.00 0.00 ? 66 GLY A H    4  
ATOM 9833  H HA2  . GLY A 1 67 ? 19.180  5.059   -10.624 1.00 0.00 ? 66 GLY A HA2  4  
ATOM 9834  H HA3  . GLY A 1 67 ? 18.614  6.544   -11.383 1.00 0.00 ? 66 GLY A HA3  4  
ATOM 9835  N N    . GLU A 1 68 ? 16.427  6.283   -9.382  1.00 0.00 ? 67 GLU A N    4  
ATOM 9836  C CA   . GLU A 1 68 ? 15.803  6.703   -8.085  1.00 0.00 ? 67 GLU A CA   4  
ATOM 9837  C C    . GLU A 1 68 ? 14.400  6.097   -7.964  1.00 0.00 ? 67 GLU A C    4  
ATOM 9838  O O    . GLU A 1 68 ? 13.599  6.191   -8.873  1.00 0.00 ? 67 GLU A O    4  
ATOM 9839  C CB   . GLU A 1 68 ? 15.711  8.230   -8.032  1.00 0.00 ? 67 GLU A CB   4  
ATOM 9840  C CG   . GLU A 1 68 ? 17.097  8.821   -7.762  1.00 0.00 ? 67 GLU A CG   4  
ATOM 9841  C CD   . GLU A 1 68 ? 16.979  10.334  -7.571  1.00 0.00 ? 67 GLU A CD   4  
ATOM 9842  O OE1  . GLU A 1 68 ? 16.464  10.985  -8.465  1.00 0.00 ? 67 GLU A OE1  4  
ATOM 9843  O OE2  . GLU A 1 68 ? 17.405  10.816  -6.535  1.00 0.00 ? 67 GLU A OE2  4  
ATOM 9844  H H    . GLU A 1 68 ? 15.872  6.124   -10.174 1.00 0.00 ? 67 GLU A H    4  
ATOM 9845  H HA   . GLU A 1 68 ? 16.422  6.346   -7.273  1.00 0.00 ? 67 GLU A HA   4  
ATOM 9846  H HB2  . GLU A 1 68 ? 15.340  8.600   -8.977  1.00 0.00 ? 67 GLU A HB2  4  
ATOM 9847  H HB3  . GLU A 1 68 ? 15.037  8.523   -7.242  1.00 0.00 ? 67 GLU A HB3  4  
ATOM 9848  H HG2  . GLU A 1 68 ? 17.511  8.377   -6.868  1.00 0.00 ? 67 GLU A HG2  4  
ATOM 9849  H HG3  . GLU A 1 68 ? 17.746  8.615   -8.600  1.00 0.00 ? 67 GLU A HG3  4  
ATOM 9850  N N    . CYS A 1 69 ? 14.089  5.481   -6.847  1.00 0.00 ? 68 CYS A N    4  
ATOM 9851  C CA   . CYS A 1 69 ? 12.731  4.873   -6.665  1.00 0.00 ? 68 CYS A CA   4  
ATOM 9852  C C    . CYS A 1 69 ? 11.882  5.788   -5.778  1.00 0.00 ? 68 CYS A C    4  
ATOM 9853  O O    . CYS A 1 69 ? 12.276  6.152   -4.687  1.00 0.00 ? 68 CYS A O    4  
ATOM 9854  C CB   . CYS A 1 69 ? 12.875  3.501   -5.998  1.00 0.00 ? 68 CYS A CB   4  
ATOM 9855  S SG   . CYS A 1 69 ? 11.251  2.918   -5.452  1.00 0.00 ? 68 CYS A SG   4  
ATOM 9856  H H    . CYS A 1 69 ? 14.748  5.423   -6.123  1.00 0.00 ? 68 CYS A H    4  
ATOM 9857  H HA   . CYS A 1 69 ? 12.248  4.755   -7.625  1.00 0.00 ? 68 CYS A HA   4  
ATOM 9858  H HB2  . CYS A 1 69 ? 13.289  2.799   -6.707  1.00 0.00 ? 68 CYS A HB2  4  
ATOM 9859  H HB3  . CYS A 1 69 ? 13.533  3.581   -5.147  1.00 0.00 ? 68 CYS A HB3  4  
ATOM 9860  H HG   . CYS A 1 69 ? 10.934  2.280   -6.096  1.00 0.00 ? 68 CYS A HG   4  
ATOM 9861  N N    . ASP A 1 70 ? 10.721  6.168   -6.241  1.00 0.00 ? 69 ASP A N    4  
ATOM 9862  C CA   . ASP A 1 70 ? 9.846   7.066   -5.432  1.00 0.00 ? 69 ASP A CA   4  
ATOM 9863  C C    . ASP A 1 70 ? 9.031   6.237   -4.436  1.00 0.00 ? 69 ASP A C    4  
ATOM 9864  O O    . ASP A 1 70 ? 9.208   5.040   -4.317  1.00 0.00 ? 69 ASP A O    4  
ATOM 9865  C CB   . ASP A 1 70 ? 8.894   7.819   -6.364  1.00 0.00 ? 69 ASP A CB   4  
ATOM 9866  C CG   . ASP A 1 70 ? 8.202   8.943   -5.591  1.00 0.00 ? 69 ASP A CG   4  
ATOM 9867  O OD1  . ASP A 1 70 ? 8.899   9.698   -4.932  1.00 0.00 ? 69 ASP A OD1  4  
ATOM 9868  O OD2  . ASP A 1 70 ? 6.988   9.032   -5.672  1.00 0.00 ? 69 ASP A OD2  4  
ATOM 9869  H H    . ASP A 1 70 ? 10.426  5.866   -7.125  1.00 0.00 ? 69 ASP A H    4  
ATOM 9870  H HA   . ASP A 1 70 ? 10.457  7.776   -4.893  1.00 0.00 ? 69 ASP A HA   4  
ATOM 9871  H HB2  . ASP A 1 70 ? 9.454   8.238   -7.187  1.00 0.00 ? 69 ASP A HB2  4  
ATOM 9872  H HB3  . ASP A 1 70 ? 8.149   7.136   -6.745  1.00 0.00 ? 69 ASP A HB3  4  
ATOM 9873  N N    . PHE A 1 71 ? 8.134   6.865   -3.724  1.00 0.00 ? 70 PHE A N    4  
ATOM 9874  C CA   . PHE A 1 71 ? 7.300   6.116   -2.740  1.00 0.00 ? 70 PHE A CA   4  
ATOM 9875  C C    . PHE A 1 71 ? 6.217   5.333   -3.489  1.00 0.00 ? 70 PHE A C    4  
ATOM 9876  O O    . PHE A 1 71 ? 5.843   4.248   -3.089  1.00 0.00 ? 70 PHE A O    4  
ATOM 9877  C CB   . PHE A 1 71 ? 6.659   7.103   -1.760  1.00 0.00 ? 70 PHE A CB   4  
ATOM 9878  C CG   . PHE A 1 71 ? 5.901   6.353   -0.691  1.00 0.00 ? 70 PHE A CG   4  
ATOM 9879  C CD1  . PHE A 1 71 ? 4.635   5.826   -0.971  1.00 0.00 ? 70 PHE A CD1  4  
ATOM 9880  C CD2  . PHE A 1 71 ? 6.460   6.191   0.583   1.00 0.00 ? 70 PHE A CD2  4  
ATOM 9881  C CE1  . PHE A 1 71 ? 3.929   5.136   0.021   1.00 0.00 ? 70 PHE A CE1  4  
ATOM 9882  C CE2  . PHE A 1 71 ? 5.754   5.501   1.575   1.00 0.00 ? 70 PHE A CE2  4  
ATOM 9883  C CZ   . PHE A 1 71 ? 4.488   4.973   1.294   1.00 0.00 ? 70 PHE A CZ   4  
ATOM 9884  H H    . PHE A 1 71 ? 8.000   7.829   -3.845  1.00 0.00 ? 70 PHE A H    4  
ATOM 9885  H HA   . PHE A 1 71 ? 7.923   5.413   -2.209  1.00 0.00 ? 70 PHE A HA   4  
ATOM 9886  H HB2  . PHE A 1 71 ? 7.431   7.703   -1.300  1.00 0.00 ? 70 PHE A HB2  4  
ATOM 9887  H HB3  . PHE A 1 71 ? 5.978   7.747   -2.296  1.00 0.00 ? 70 PHE A HB3  4  
ATOM 9888  H HD1  . PHE A 1 71 ? 4.202   5.951   -1.952  1.00 0.00 ? 70 PHE A HD1  4  
ATOM 9889  H HD2  . PHE A 1 71 ? 7.436   6.598   0.800   1.00 0.00 ? 70 PHE A HD2  4  
ATOM 9890  H HE1  . PHE A 1 71 ? 2.952   4.729   -0.195  1.00 0.00 ? 70 PHE A HE1  4  
ATOM 9891  H HE2  . PHE A 1 71 ? 6.185   5.376   2.557   1.00 0.00 ? 70 PHE A HE2  4  
ATOM 9892  H HZ   . PHE A 1 71 ? 3.943   4.441   2.059   1.00 0.00 ? 70 PHE A HZ   4  
ATOM 9893  N N    . GLN A 1 72 ? 5.715   5.857   -4.572  1.00 0.00 ? 71 GLN A N    4  
ATOM 9894  C CA   . GLN A 1 72 ? 4.668   5.115   -5.333  1.00 0.00 ? 71 GLN A CA   4  
ATOM 9895  C C    . GLN A 1 72 ? 5.231   3.760   -5.766  1.00 0.00 ? 71 GLN A C    4  
ATOM 9896  O O    . GLN A 1 72 ? 4.549   2.755   -5.732  1.00 0.00 ? 71 GLN A O    4  
ATOM 9897  C CB   . GLN A 1 72 ? 4.265   5.920   -6.571  1.00 0.00 ? 71 GLN A CB   4  
ATOM 9898  C CG   . GLN A 1 72 ? 2.979   5.337   -7.161  1.00 0.00 ? 71 GLN A CG   4  
ATOM 9899  C CD   . GLN A 1 72 ? 2.523   6.195   -8.343  1.00 0.00 ? 71 GLN A CD   4  
ATOM 9900  O OE1  . GLN A 1 72 ? 3.336   6.724   -9.075  1.00 0.00 ? 71 GLN A OE1  4  
ATOM 9901  N NE2  . GLN A 1 72 ? 1.247   6.354   -8.563  1.00 0.00 ? 71 GLN A NE2  4  
ATOM 9902  H H    . GLN A 1 72 ? 6.031   6.728   -4.890  1.00 0.00 ? 71 GLN A H    4  
ATOM 9903  H HA   . GLN A 1 72 ? 3.801   4.959   -4.707  1.00 0.00 ? 71 GLN A HA   4  
ATOM 9904  H HB2  . GLN A 1 72 ? 4.100   6.951   -6.293  1.00 0.00 ? 71 GLN A HB2  4  
ATOM 9905  H HB3  . GLN A 1 72 ? 5.053   5.867   -7.307  1.00 0.00 ? 71 GLN A HB3  4  
ATOM 9906  H HG2  . GLN A 1 72 ? 3.164   4.327   -7.498  1.00 0.00 ? 71 GLN A HG2  4  
ATOM 9907  H HG3  . GLN A 1 72 ? 2.208   5.330   -6.406  1.00 0.00 ? 71 GLN A HG3  4  
ATOM 9908  H HE21 . GLN A 1 72 ? 0.591   5.926   -7.974  1.00 0.00 ? 71 GLN A HE21 4  
ATOM 9909  H HE22 . GLN A 1 72 ? 0.944   6.901   -9.318  1.00 0.00 ? 71 GLN A HE22 4  
ATOM 9910  N N    . GLU A 1 73 ? 6.471   3.719   -6.164  1.00 0.00 ? 72 GLU A N    4  
ATOM 9911  C CA   . GLU A 1 73 ? 7.076   2.425   -6.587  1.00 0.00 ? 72 GLU A CA   4  
ATOM 9912  C C    . GLU A 1 73 ? 7.291   1.533   -5.358  1.00 0.00 ? 72 GLU A C    4  
ATOM 9913  O O    . GLU A 1 73 ? 7.342   0.324   -5.454  1.00 0.00 ? 72 GLU A O    4  
ATOM 9914  C CB   . GLU A 1 73 ? 8.415   2.684   -7.289  1.00 0.00 ? 72 GLU A CB   4  
ATOM 9915  C CG   . GLU A 1 73 ? 8.161   3.152   -8.724  1.00 0.00 ? 72 GLU A CG   4  
ATOM 9916  C CD   . GLU A 1 73 ? 9.462   3.690   -9.323  1.00 0.00 ? 72 GLU A CD   4  
ATOM 9917  O OE1  . GLU A 1 73 ? 9.873   4.768   -8.926  1.00 0.00 ? 72 GLU A OE1  4  
ATOM 9918  O OE2  . GLU A 1 73 ? 10.025  3.016   -10.170 1.00 0.00 ? 72 GLU A OE2  4  
ATOM 9919  H H    . GLU A 1 73 ? 7.009   4.539   -6.178  1.00 0.00 ? 72 GLU A H    4  
ATOM 9920  H HA   . GLU A 1 73 ? 6.402   1.917   -7.261  1.00 0.00 ? 72 GLU A HA   4  
ATOM 9921  H HB2  . GLU A 1 73 ? 8.958   3.447   -6.752  1.00 0.00 ? 72 GLU A HB2  4  
ATOM 9922  H HB3  . GLU A 1 73 ? 8.996   1.773   -7.307  1.00 0.00 ? 72 GLU A HB3  4  
ATOM 9923  H HG2  . GLU A 1 73 ? 7.807   2.321   -9.317  1.00 0.00 ? 72 GLU A HG2  4  
ATOM 9924  H HG3  . GLU A 1 73 ? 7.418   3.935   -8.722  1.00 0.00 ? 72 GLU A HG3  4  
ATOM 9925  N N    . PHE A 1 74 ? 7.386   2.127   -4.199  1.00 0.00 ? 73 PHE A N    4  
ATOM 9926  C CA   . PHE A 1 74 ? 7.566   1.329   -2.949  1.00 0.00 ? 73 PHE A CA   4  
ATOM 9927  C C    . PHE A 1 74 ? 6.225   0.715   -2.529  1.00 0.00 ? 73 PHE A C    4  
ATOM 9928  O O    . PHE A 1 74 ? 6.173   -0.430  -2.130  1.00 0.00 ? 73 PHE A O    4  
ATOM 9929  C CB   . PHE A 1 74 ? 8.136   2.222   -1.837  1.00 0.00 ? 73 PHE A CB   4  
ATOM 9930  C CG   . PHE A 1 74 ? 8.075   1.512   -0.498  1.00 0.00 ? 73 PHE A CG   4  
ATOM 9931  C CD1  . PHE A 1 74 ? 8.697   0.267   -0.332  1.00 0.00 ? 73 PHE A CD1  4  
ATOM 9932  C CD2  . PHE A 1 74 ? 7.404   2.105   0.582   1.00 0.00 ? 73 PHE A CD2  4  
ATOM 9933  C CE1  . PHE A 1 74 ? 8.647   -0.382  0.907   1.00 0.00 ? 73 PHE A CE1  4  
ATOM 9934  C CE2  . PHE A 1 74 ? 7.356   1.455   1.821   1.00 0.00 ? 73 PHE A CE2  4  
ATOM 9935  C CZ   . PHE A 1 74 ? 7.978   0.212   1.984   1.00 0.00 ? 73 PHE A CZ   4  
ATOM 9936  H H    . PHE A 1 74 ? 7.299   3.101   -4.145  1.00 0.00 ? 73 PHE A H    4  
ATOM 9937  H HA   . PHE A 1 74 ? 8.208   0.480   -3.115  1.00 0.00 ? 73 PHE A HA   4  
ATOM 9938  H HB2  . PHE A 1 74 ? 9.164   2.461   -2.067  1.00 0.00 ? 73 PHE A HB2  4  
ATOM 9939  H HB3  . PHE A 1 74 ? 7.561   3.135   -1.788  1.00 0.00 ? 73 PHE A HB3  4  
ATOM 9940  H HD1  . PHE A 1 74 ? 9.212   -0.193  -1.160  1.00 0.00 ? 73 PHE A HD1  4  
ATOM 9941  H HD2  . PHE A 1 74 ? 6.923   3.065   0.459   1.00 0.00 ? 73 PHE A HD2  4  
ATOM 9942  H HE1  . PHE A 1 74 ? 9.127   -1.341  1.034   1.00 0.00 ? 73 PHE A HE1  4  
ATOM 9943  H HE2  . PHE A 1 74 ? 6.840   1.913   2.652   1.00 0.00 ? 73 PHE A HE2  4  
ATOM 9944  H HZ   . PHE A 1 74 ? 7.941   -0.289  2.940   1.00 0.00 ? 73 PHE A HZ   4  
ATOM 9945  N N    . MET A 1 75 ? 5.142   1.427   -2.616  1.00 0.00 ? 74 MET A N    4  
ATOM 9946  C CA   . MET A 1 75 ? 3.848   0.800   -2.216  1.00 0.00 ? 74 MET A CA   4  
ATOM 9947  C C    . MET A 1 75 ? 3.515   -0.318  -3.208  1.00 0.00 ? 74 MET A C    4  
ATOM 9948  O O    . MET A 1 75 ? 2.854   -1.274  -2.854  1.00 0.00 ? 74 MET A O    4  
ATOM 9949  C CB   . MET A 1 75 ? 2.729   1.842   -2.206  1.00 0.00 ? 74 MET A CB   4  
ATOM 9950  C CG   . MET A 1 75 ? 1.514   1.276   -1.466  1.00 0.00 ? 74 MET A CG   4  
ATOM 9951  S SD   . MET A 1 75 ? 1.862   1.211   0.315   1.00 0.00 ? 74 MET A SD   4  
ATOM 9952  C CE   . MET A 1 75 ? 1.764   -0.587  0.542   1.00 0.00 ? 74 MET A CE   4  
ATOM 9953  H H    . MET A 1 75 ? 5.170   2.347   -2.955  1.00 0.00 ? 74 MET A H    4  
ATOM 9954  H HA   . MET A 1 75 ? 3.950   0.354   -1.239  1.00 0.00 ? 74 MET A HA   4  
ATOM 9955  H HB2  . MET A 1 75 ? 3.074   2.736   -1.706  1.00 0.00 ? 74 MET A HB2  4  
ATOM 9956  H HB3  . MET A 1 75 ? 2.452   2.080   -3.222  1.00 0.00 ? 74 MET A HB3  4  
ATOM 9957  H HG2  . MET A 1 75 ? 0.660   1.914   -1.641  1.00 0.00 ? 74 MET A HG2  4  
ATOM 9958  H HG3  . MET A 1 75 ? 1.301   0.283   -1.834  1.00 0.00 ? 74 MET A HG3  4  
ATOM 9959  H HE1  . MET A 1 75 ? 0.851   -0.958  0.098   1.00 0.00 ? 74 MET A HE1  4  
ATOM 9960  H HE2  . MET A 1 75 ? 2.616   -1.055  0.070   1.00 0.00 ? 74 MET A HE2  4  
ATOM 9961  H HE3  . MET A 1 75 ? 1.768   -0.819  1.595   1.00 0.00 ? 74 MET A HE3  4  
ATOM 9962  N N    . ALA A 1 76 ? 3.969   -0.248  -4.426  1.00 0.00 ? 75 ALA A N    4  
ATOM 9963  C CA   . ALA A 1 76 ? 3.676   -1.349  -5.392  1.00 0.00 ? 75 ALA A CA   4  
ATOM 9964  C C    . ALA A 1 76 ? 4.580   -2.558  -5.110  1.00 0.00 ? 75 ALA A C    4  
ATOM 9965  O O    . ALA A 1 76 ? 4.105   -3.667  -4.968  1.00 0.00 ? 75 ALA A O    4  
ATOM 9966  C CB   . ALA A 1 76 ? 3.931   -0.850  -6.816  1.00 0.00 ? 75 ALA A CB   4  
ATOM 9967  H H    . ALA A 1 76 ? 4.520   0.501   -4.739  1.00 0.00 ? 75 ALA A H    4  
ATOM 9968  H HA   . ALA A 1 76 ? 2.655   -1.690  -5.313  1.00 0.00 ? 75 ALA A HA   4  
ATOM 9969  H HB1  . ALA A 1 76 ? 4.879   -0.333  -6.852  1.00 0.00 ? 75 ALA A HB1  4  
ATOM 9970  H HB2  . ALA A 1 76 ? 3.953   -1.690  -7.493  1.00 0.00 ? 75 ALA A HB2  4  
ATOM 9971  H HB3  . ALA A 1 76 ? 3.141   -0.173  -7.106  1.00 0.00 ? 75 ALA A HB3  4  
ATOM 9972  N N    . PHE A 1 77 ? 5.871   -2.373  -5.036  1.00 0.00 ? 76 PHE A N    4  
ATOM 9973  C CA   . PHE A 1 77 ? 6.765   -3.543  -4.774  1.00 0.00 ? 76 PHE A CA   4  
ATOM 9974  C C    . PHE A 1 77 ? 6.385   -4.192  -3.437  1.00 0.00 ? 76 PHE A C    4  
ATOM 9975  O O    . PHE A 1 77 ? 6.470   -5.393  -3.275  1.00 0.00 ? 76 PHE A O    4  
ATOM 9976  C CB   . PHE A 1 77 ? 8.237   -3.085  -4.739  1.00 0.00 ? 76 PHE A CB   4  
ATOM 9977  C CG   . PHE A 1 77 ? 8.803   -3.039  -6.147  1.00 0.00 ? 76 PHE A CG   4  
ATOM 9978  C CD1  . PHE A 1 77 ? 8.873   -4.212  -6.912  1.00 0.00 ? 76 PHE A CD1  4  
ATOM 9979  C CD2  . PHE A 1 77 ? 9.253   -1.826  -6.688  1.00 0.00 ? 76 PHE A CD2  4  
ATOM 9980  C CE1  . PHE A 1 77 ? 9.388   -4.171  -8.211  1.00 0.00 ? 76 PHE A CE1  4  
ATOM 9981  C CE2  . PHE A 1 77 ? 9.771   -1.788  -7.988  1.00 0.00 ? 76 PHE A CE2  4  
ATOM 9982  C CZ   . PHE A 1 77 ? 9.838   -2.959  -8.750  1.00 0.00 ? 76 PHE A CZ   4  
ATOM 9983  H H    . PHE A 1 77 ? 6.251   -1.478  -5.159  1.00 0.00 ? 76 PHE A H    4  
ATOM 9984  H HA   . PHE A 1 77 ? 6.627   -4.270  -5.560  1.00 0.00 ? 76 PHE A HA   4  
ATOM 9985  H HB2  . PHE A 1 77 ? 8.293   -2.102  -4.295  1.00 0.00 ? 76 PHE A HB2  4  
ATOM 9986  H HB3  . PHE A 1 77 ? 8.819   -3.777  -4.146  1.00 0.00 ? 76 PHE A HB3  4  
ATOM 9987  H HD1  . PHE A 1 77 ? 8.532   -5.150  -6.500  1.00 0.00 ? 76 PHE A HD1  4  
ATOM 9988  H HD2  . PHE A 1 77 ? 9.206   -0.923  -6.102  1.00 0.00 ? 76 PHE A HD2  4  
ATOM 9989  H HE1  . PHE A 1 77 ? 9.439   -5.075  -8.798  1.00 0.00 ? 76 PHE A HE1  4  
ATOM 9990  H HE2  . PHE A 1 77 ? 10.118  -0.854  -8.404  1.00 0.00 ? 76 PHE A HE2  4  
ATOM 9991  H HZ   . PHE A 1 77 ? 10.235  -2.928  -9.753  1.00 0.00 ? 76 PHE A HZ   4  
ATOM 9992  N N    . VAL A 1 78 ? 5.959   -3.414  -2.485  1.00 0.00 ? 77 VAL A N    4  
ATOM 9993  C CA   . VAL A 1 78 ? 5.567   -4.002  -1.171  1.00 0.00 ? 77 VAL A CA   4  
ATOM 9994  C C    . VAL A 1 78 ? 4.364   -4.931  -1.379  1.00 0.00 ? 77 VAL A C    4  
ATOM 9995  O O    . VAL A 1 78 ? 4.217   -5.931  -0.704  1.00 0.00 ? 77 VAL A O    4  
ATOM 9996  C CB   . VAL A 1 78 ? 5.194   -2.876  -0.197  1.00 0.00 ? 77 VAL A CB   4  
ATOM 9997  C CG1  . VAL A 1 78 ? 4.507   -3.459  1.044   1.00 0.00 ? 77 VAL A CG1  4  
ATOM 9998  C CG2  . VAL A 1 78 ? 6.462   -2.131  0.232   1.00 0.00 ? 77 VAL A CG2  4  
ATOM 9999  H H    . VAL A 1 78 ? 5.886   -2.447  -2.638  1.00 0.00 ? 77 VAL A H    4  
ATOM 10000 H HA   . VAL A 1 78 ? 6.395   -4.569  -0.770  1.00 0.00 ? 77 VAL A HA   4  
ATOM 10001 H HB   . VAL A 1 78 ? 4.521   -2.188  -0.688  1.00 0.00 ? 77 VAL A HB   4  
ATOM 10002 H HG11 . VAL A 1 78 ? 5.063   -4.316  1.394   1.00 0.00 ? 77 VAL A HG11 4  
ATOM 10003 H HG12 . VAL A 1 78 ? 4.472   -2.710  1.822   1.00 0.00 ? 77 VAL A HG12 4  
ATOM 10004 H HG13 . VAL A 1 78 ? 3.502   -3.762  0.790   1.00 0.00 ? 77 VAL A HG13 4  
ATOM 10005 H HG21 . VAL A 1 78 ? 7.096   -1.970  -0.627  1.00 0.00 ? 77 VAL A HG21 4  
ATOM 10006 H HG22 . VAL A 1 78 ? 6.187   -1.179  0.660   1.00 0.00 ? 77 VAL A HG22 4  
ATOM 10007 H HG23 . VAL A 1 78 ? 6.995   -2.716  0.968   1.00 0.00 ? 77 VAL A HG23 4  
ATOM 10008 N N    . SER A 1 79 ? 3.503   -4.606  -2.302  1.00 0.00 ? 78 SER A N    4  
ATOM 10009 C CA   . SER A 1 79 ? 2.308   -5.465  -2.546  1.00 0.00 ? 78 SER A CA   4  
ATOM 10010 C C    . SER A 1 79 ? 2.730   -6.789  -3.194  1.00 0.00 ? 78 SER A C    4  
ATOM 10011 O O    . SER A 1 79 ? 2.367   -7.855  -2.739  1.00 0.00 ? 78 SER A O    4  
ATOM 10012 C CB   . SER A 1 79 ? 1.343   -4.732  -3.478  1.00 0.00 ? 78 SER A CB   4  
ATOM 10013 O OG   . SER A 1 79 ? 1.856   -4.766  -4.804  1.00 0.00 ? 78 SER A OG   4  
ATOM 10014 H H    . SER A 1 79 ? 3.637   -3.793  -2.832  1.00 0.00 ? 78 SER A H    4  
ATOM 10015 H HA   . SER A 1 79 ? 1.813   -5.666  -1.607  1.00 0.00 ? 78 SER A HA   4  
ATOM 10016 H HB2  . SER A 1 79 ? 0.381   -5.216  -3.458  1.00 0.00 ? 78 SER A HB2  4  
ATOM 10017 H HB3  . SER A 1 79 ? 1.235   -3.707  -3.149  1.00 0.00 ? 78 SER A HB3  4  
ATOM 10018 H HG   . SER A 1 79 ? 2.814   -4.803  -4.751  1.00 0.00 ? 78 SER A HG   4  
ATOM 10019 N N    . MET A 1 80 ? 3.467   -6.728  -4.267  1.00 0.00 ? 79 MET A N    4  
ATOM 10020 C CA   . MET A 1 80 ? 3.883   -7.980  -4.965  1.00 0.00 ? 79 MET A CA   4  
ATOM 10021 C C    . MET A 1 80 ? 4.494   -8.978  -3.979  1.00 0.00 ? 79 MET A C    4  
ATOM 10022 O O    . MET A 1 80 ? 4.279   -10.168 -4.085  1.00 0.00 ? 79 MET A O    4  
ATOM 10023 C CB   . MET A 1 80 ? 4.916   -7.640  -6.041  1.00 0.00 ? 79 MET A CB   4  
ATOM 10024 C CG   . MET A 1 80 ? 4.238   -6.872  -7.177  1.00 0.00 ? 79 MET A CG   4  
ATOM 10025 S SD   . MET A 1 80 ? 5.465   -6.454  -8.441  1.00 0.00 ? 79 MET A SD   4  
ATOM 10026 C CE   . MET A 1 80 ? 5.388   -8.012  -9.358  1.00 0.00 ? 79 MET A CE   4  
ATOM 10027 H H    . MET A 1 80 ? 3.726   -5.861  -4.642  1.00 0.00 ? 79 MET A H    4  
ATOM 10028 H HA   . MET A 1 80 ? 3.022   -8.432  -5.432  1.00 0.00 ? 79 MET A HA   4  
ATOM 10029 H HB2  . MET A 1 80 ? 5.698   -7.032  -5.610  1.00 0.00 ? 79 MET A HB2  4  
ATOM 10030 H HB3  . MET A 1 80 ? 5.343   -8.552  -6.431  1.00 0.00 ? 79 MET A HB3  4  
ATOM 10031 H HG2  . MET A 1 80 ? 3.465   -7.485  -7.615  1.00 0.00 ? 79 MET A HG2  4  
ATOM 10032 H HG3  . MET A 1 80 ? 3.801   -5.965  -6.786  1.00 0.00 ? 79 MET A HG3  4  
ATOM 10033 H HE1  . MET A 1 80 ? 4.370   -8.206  -9.656  1.00 0.00 ? 79 MET A HE1  4  
ATOM 10034 H HE2  . MET A 1 80 ? 6.011   -7.941  -10.239 1.00 0.00 ? 79 MET A HE2  4  
ATOM 10035 H HE3  . MET A 1 80 ? 5.736   -8.818  -8.728  1.00 0.00 ? 79 MET A HE3  4  
ATOM 10036 N N    . VAL A 1 81 ? 5.255   -8.517  -3.029  1.00 0.00 ? 80 VAL A N    4  
ATOM 10037 C CA   . VAL A 1 81 ? 5.873   -9.467  -2.056  1.00 0.00 ? 80 VAL A CA   4  
ATOM 10038 C C    . VAL A 1 81 ? 4.807   -9.986  -1.087  1.00 0.00 ? 80 VAL A C    4  
ATOM 10039 O O    . VAL A 1 81 ? 4.674   -11.177 -0.885  1.00 0.00 ? 80 VAL A O    4  
ATOM 10040 C CB   . VAL A 1 81 ? 6.973   -8.755  -1.262  1.00 0.00 ? 80 VAL A CB   4  
ATOM 10041 C CG1  . VAL A 1 81 ? 7.681   -9.761  -0.352  1.00 0.00 ? 80 VAL A CG1  4  
ATOM 10042 C CG2  . VAL A 1 81 ? 7.993   -8.142  -2.226  1.00 0.00 ? 80 VAL A CG2  4  
ATOM 10043 H H    . VAL A 1 81 ? 5.418   -7.553  -2.955  1.00 0.00 ? 80 VAL A H    4  
ATOM 10044 H HA   . VAL A 1 81 ? 6.300   -10.301 -2.598  1.00 0.00 ? 80 VAL A HA   4  
ATOM 10045 H HB   . VAL A 1 81 ? 6.532   -7.975  -0.659  1.00 0.00 ? 80 VAL A HB   4  
ATOM 10046 H HG11 . VAL A 1 81 ? 7.897   -10.661 -0.909  1.00 0.00 ? 80 VAL A HG11 4  
ATOM 10047 H HG12 . VAL A 1 81 ? 8.605   -9.332  0.011   1.00 0.00 ? 80 VAL A HG12 4  
ATOM 10048 H HG13 . VAL A 1 81 ? 7.043   -10.001 0.486   1.00 0.00 ? 80 VAL A HG13 4  
ATOM 10049 H HG21 . VAL A 1 81 ? 7.481   -7.526  -2.950  1.00 0.00 ? 80 VAL A HG21 4  
ATOM 10050 H HG22 . VAL A 1 81 ? 8.697   -7.537  -1.669  1.00 0.00 ? 80 VAL A HG22 4  
ATOM 10051 H HG23 . VAL A 1 81 ? 8.524   -8.931  -2.736  1.00 0.00 ? 80 VAL A HG23 4  
ATOM 10052 N N    . THR A 1 82 ? 4.038   -9.116  -0.495  1.00 0.00 ? 81 THR A N    4  
ATOM 10053 C CA   . THR A 1 82 ? 2.982   -9.591  0.443   1.00 0.00 ? 81 THR A CA   4  
ATOM 10054 C C    . THR A 1 82 ? 2.018   -10.502 -0.322  1.00 0.00 ? 81 THR A C    4  
ATOM 10055 O O    . THR A 1 82 ? 1.594   -11.530 0.167   1.00 0.00 ? 81 THR A O    4  
ATOM 10056 C CB   . THR A 1 82 ? 2.213   -8.393  1.003   1.00 0.00 ? 81 THR A CB   4  
ATOM 10057 O OG1  . THR A 1 82 ? 3.133   -7.448  1.532   1.00 0.00 ? 81 THR A OG1  4  
ATOM 10058 C CG2  . THR A 1 82 ? 1.268   -8.864  2.110   1.00 0.00 ? 81 THR A CG2  4  
ATOM 10059 H H    . THR A 1 82 ? 4.147   -8.159  -0.671  1.00 0.00 ? 81 THR A H    4  
ATOM 10060 H HA   . THR A 1 82 ? 3.436   -10.143 1.252   1.00 0.00 ? 81 THR A HA   4  
ATOM 10061 H HB   . THR A 1 82 ? 1.637   -7.933  0.215   1.00 0.00 ? 81 THR A HB   4  
ATOM 10062 H HG1  . THR A 1 82 ? 3.552   -6.999  0.794   1.00 0.00 ? 81 THR A HG1  4  
ATOM 10063 H HG21 . THR A 1 82 ? 0.633   -9.650  1.730   1.00 0.00 ? 81 THR A HG21 4  
ATOM 10064 H HG22 . THR A 1 82 ? 1.846   -9.238  2.942   1.00 0.00 ? 81 THR A HG22 4  
ATOM 10065 H HG23 . THR A 1 82 ? 0.658   -8.036  2.439   1.00 0.00 ? 81 THR A HG23 4  
ATOM 10066 N N    . THR A 1 83 ? 1.675   -10.125 -1.522  1.00 0.00 ? 82 THR A N    4  
ATOM 10067 C CA   . THR A 1 83 ? 0.744   -10.954 -2.338  1.00 0.00 ? 82 THR A CA   4  
ATOM 10068 C C    . THR A 1 83 ? 1.465   -12.211 -2.832  1.00 0.00 ? 82 THR A C    4  
ATOM 10069 O O    . THR A 1 83 ? 0.844   -13.198 -3.174  1.00 0.00 ? 82 THR A O    4  
ATOM 10070 C CB   . THR A 1 83 ? 0.256   -10.139 -3.537  1.00 0.00 ? 82 THR A CB   4  
ATOM 10071 O OG1  . THR A 1 83 ? 1.375   -9.608  -4.232  1.00 0.00 ? 82 THR A OG1  4  
ATOM 10072 C CG2  . THR A 1 83 ? -0.635  -8.995  -3.048  1.00 0.00 ? 82 THR A CG2  4  
ATOM 10073 H H    . THR A 1 83 ? 2.034   -9.292  -1.891  1.00 0.00 ? 82 THR A H    4  
ATOM 10074 H HA   . THR A 1 83 ? -0.103  -11.242 -1.732  1.00 0.00 ? 82 THR A HA   4  
ATOM 10075 H HB   . THR A 1 83 ? -0.313  -10.774 -4.198  1.00 0.00 ? 82 THR A HB   4  
ATOM 10076 H HG1  . THR A 1 83 ? 1.064   -9.255  -5.069  1.00 0.00 ? 82 THR A HG1  4  
ATOM 10077 H HG21 . THR A 1 83 ? -1.430  -9.394  -2.436  1.00 0.00 ? 82 THR A HG21 4  
ATOM 10078 H HG22 . THR A 1 83 ? -0.045  -8.303  -2.466  1.00 0.00 ? 82 THR A HG22 4  
ATOM 10079 H HG23 . THR A 1 83 ? -1.058  -8.480  -3.898  1.00 0.00 ? 82 THR A HG23 4  
ATOM 10080 N N    . ALA A 1 84 ? 2.772   -12.189 -2.872  1.00 0.00 ? 83 ALA A N    4  
ATOM 10081 C CA   . ALA A 1 84 ? 3.519   -13.392 -3.342  1.00 0.00 ? 83 ALA A CA   4  
ATOM 10082 C C    . ALA A 1 84 ? 3.122   -14.592 -2.485  1.00 0.00 ? 83 ALA A C    4  
ATOM 10083 O O    . ALA A 1 84 ? 3.181   -15.726 -2.916  1.00 0.00 ? 83 ALA A O    4  
ATOM 10084 C CB   . ALA A 1 84 ? 5.025   -13.153 -3.206  1.00 0.00 ? 83 ALA A CB   4  
ATOM 10085 H H    . ALA A 1 84 ? 3.258   -11.390 -2.581  1.00 0.00 ? 83 ALA A H    4  
ATOM 10086 H HA   . ALA A 1 84 ? 3.275   -13.588 -4.376  1.00 0.00 ? 83 ALA A HA   4  
ATOM 10087 H HB1  . ALA A 1 84 ? 5.292   -12.237 -3.707  1.00 0.00 ? 83 ALA A HB1  4  
ATOM 10088 H HB2  . ALA A 1 84 ? 5.284   -13.081 -2.160  1.00 0.00 ? 83 ALA A HB2  4  
ATOM 10089 H HB3  . ALA A 1 84 ? 5.561   -13.977 -3.654  1.00 0.00 ? 83 ALA A HB3  4  
ATOM 10090 N N    . CYS A 1 85 ? 2.717   -14.347 -1.271  1.00 0.00 ? 84 CYS A N    4  
ATOM 10091 C CA   . CYS A 1 85 ? 2.314   -15.470 -0.379  1.00 0.00 ? 84 CYS A CA   4  
ATOM 10092 C C    . CYS A 1 85 ? 0.956   -16.015 -0.829  1.00 0.00 ? 84 CYS A C    4  
ATOM 10093 O O    . CYS A 1 85 ? 0.136   -15.299 -1.369  1.00 0.00 ? 84 CYS A O    4  
ATOM 10094 C CB   . CYS A 1 85 ? 2.208   -14.964 1.061   1.00 0.00 ? 84 CYS A CB   4  
ATOM 10095 S SG   . CYS A 1 85 ? 0.763   -13.885 1.217   1.00 0.00 ? 84 CYS A SG   4  
ATOM 10096 H H    . CYS A 1 85 ? 2.680   -13.422 -0.945  1.00 0.00 ? 84 CYS A H    4  
ATOM 10097 H HA   . CYS A 1 85 ? 3.053   -16.255 -0.432  1.00 0.00 ? 84 CYS A HA   4  
ATOM 10098 H HB2  . CYS A 1 85 ? 2.105   -15.804 1.731   1.00 0.00 ? 84 CYS A HB2  4  
ATOM 10099 H HB3  . CYS A 1 85 ? 3.100   -14.409 1.314   1.00 0.00 ? 84 CYS A HB3  4  
ATOM 10100 H HG   . CYS A 1 85 ? 0.971   -13.049 0.795   1.00 0.00 ? 84 CYS A HG   4  
ATOM 10101 N N    . HIS A 1 86 ? 0.715   -17.280 -0.615  1.00 0.00 ? 85 HIS A N    4  
ATOM 10102 C CA   . HIS A 1 86 ? -0.586  -17.876 -1.032  1.00 0.00 ? 85 HIS A CA   4  
ATOM 10103 C C    . HIS A 1 86 ? -1.737  -16.984 -0.562  1.00 0.00 ? 85 HIS A C    4  
ATOM 10104 O O    . HIS A 1 86 ? -1.538  -16.015 0.143   1.00 0.00 ? 85 HIS A O    4  
ATOM 10105 C CB   . HIS A 1 86 ? -0.733  -19.265 -0.408  1.00 0.00 ? 85 HIS A CB   4  
ATOM 10106 C CG   . HIS A 1 86 ? -0.659  -19.150 1.090   1.00 0.00 ? 85 HIS A CG   4  
ATOM 10107 N ND1  . HIS A 1 86 ? 0.100   -18.176 1.720   1.00 0.00 ? 85 HIS A ND1  4  
ATOM 10108 C CD2  . HIS A 1 86 ? -1.245  -19.877 2.096   1.00 0.00 ? 85 HIS A CD2  4  
ATOM 10109 C CE1  . HIS A 1 86 ? -0.048  -18.342 3.047   1.00 0.00 ? 85 HIS A CE1  4  
ATOM 10110 N NE2  . HIS A 1 86 ? -0.858  -19.365 3.331   1.00 0.00 ? 85 HIS A NE2  4  
ATOM 10111 H H    . HIS A 1 86 ? 1.393   -17.839 -0.181  1.00 0.00 ? 85 HIS A H    4  
ATOM 10112 H HA   . HIS A 1 86 ? -0.614  -17.961 -2.108  1.00 0.00 ? 85 HIS A HA   4  
ATOM 10113 H HB2  . HIS A 1 86 ? -1.686  -19.688 -0.690  1.00 0.00 ? 85 HIS A HB2  4  
ATOM 10114 H HB3  . HIS A 1 86 ? 0.064   -19.904 -0.759  1.00 0.00 ? 85 HIS A HB3  4  
ATOM 10115 H HD1  . HIS A 1 86 ? 0.645   -17.491 1.279   1.00 0.00 ? 85 HIS A HD1  4  
ATOM 10116 H HD2  . HIS A 1 86 ? -1.907  -20.719 1.951   1.00 0.00 ? 85 HIS A HD2  4  
ATOM 10117 H HE1  . HIS A 1 86 ? 0.429   -17.723 3.792   1.00 0.00 ? 85 HIS A HE1  4  
ATOM 10118 N N    . GLU A 1 87 ? -2.943  -17.306 -0.947  1.00 0.00 ? 86 GLU A N    4  
ATOM 10119 C CA   . GLU A 1 87 ? -4.111  -16.481 -0.523  1.00 0.00 ? 86 GLU A CA   4  
ATOM 10120 C C    . GLU A 1 87 ? -4.025  -16.214 0.984   1.00 0.00 ? 86 GLU A C    4  
ATOM 10121 O O    . GLU A 1 87 ? -4.374  -17.051 1.792   1.00 0.00 ? 86 GLU A O    4  
ATOM 10122 C CB   . GLU A 1 87 ? -5.408  -17.236 -0.846  1.00 0.00 ? 86 GLU A CB   4  
ATOM 10123 C CG   . GLU A 1 87 ? -5.208  -18.734 -0.586  1.00 0.00 ? 86 GLU A CG   4  
ATOM 10124 C CD   . GLU A 1 87 ? -6.570  -19.426 -0.495  1.00 0.00 ? 86 GLU A CD   4  
ATOM 10125 O OE1  . GLU A 1 87 ? -7.505  -18.937 -1.107  1.00 0.00 ? 86 GLU A OE1  4  
ATOM 10126 O OE2  . GLU A 1 87 ? -6.655  -20.435 0.187   1.00 0.00 ? 86 GLU A OE2  4  
ATOM 10127 H H    . GLU A 1 87 ? -3.081  -18.093 -1.515  1.00 0.00 ? 86 GLU A H    4  
ATOM 10128 H HA   . GLU A 1 87 ? -4.099  -15.541 -1.056  1.00 0.00 ? 86 GLU A HA   4  
ATOM 10129 H HB2  . GLU A 1 87 ? -6.211  -16.863 -0.225  1.00 0.00 ? 86 GLU A HB2  4  
ATOM 10130 H HB3  . GLU A 1 87 ? -5.659  -17.086 -1.885  1.00 0.00 ? 86 GLU A HB3  4  
ATOM 10131 H HG2  . GLU A 1 87 ? -4.639  -19.166 -1.397  1.00 0.00 ? 86 GLU A HG2  4  
ATOM 10132 H HG3  . GLU A 1 87 ? -4.674  -18.873 0.341   1.00 0.00 ? 86 GLU A HG3  4  
ATOM 10133 N N    . PHE A 1 88 ? -3.562  -15.057 1.369   1.00 0.00 ? 87 PHE A N    4  
ATOM 10134 C CA   . PHE A 1 88 ? -3.456  -14.752 2.822   1.00 0.00 ? 87 PHE A CA   4  
ATOM 10135 C C    . PHE A 1 88 ? -4.856  -14.711 3.440   1.00 0.00 ? 87 PHE A C    4  
ATOM 10136 O O    . PHE A 1 88 ? -5.026  -14.930 4.624   1.00 0.00 ? 87 PHE A O    4  
ATOM 10137 C CB   . PHE A 1 88 ? -2.750  -13.408 3.028   1.00 0.00 ? 87 PHE A CB   4  
ATOM 10138 C CG   . PHE A 1 88 ? -3.500  -12.308 2.311   1.00 0.00 ? 87 PHE A CG   4  
ATOM 10139 C CD1  . PHE A 1 88 ? -4.656  -11.764 2.882   1.00 0.00 ? 87 PHE A CD1  4  
ATOM 10140 C CD2  . PHE A 1 88 ? -3.032  -11.826 1.082   1.00 0.00 ? 87 PHE A CD2  4  
ATOM 10141 C CE1  . PHE A 1 88 ? -5.344  -10.737 2.224   1.00 0.00 ? 87 PHE A CE1  4  
ATOM 10142 C CE2  . PHE A 1 88 ? -3.721  -10.800 0.425   1.00 0.00 ? 87 PHE A CE2  4  
ATOM 10143 C CZ   . PHE A 1 88 ? -4.876  -10.256 0.996   1.00 0.00 ? 87 PHE A CZ   4  
ATOM 10144 H H    . PHE A 1 88 ? -3.282  -14.393 0.705   1.00 0.00 ? 87 PHE A H    4  
ATOM 10145 H HA   . PHE A 1 88 ? -2.882  -15.531 3.304   1.00 0.00 ? 87 PHE A HA   4  
ATOM 10146 H HB2  . PHE A 1 88 ? -2.711  -13.184 4.084   1.00 0.00 ? 87 PHE A HB2  4  
ATOM 10147 H HB3  . PHE A 1 88 ? -1.745  -13.470 2.638   1.00 0.00 ? 87 PHE A HB3  4  
ATOM 10148 H HD1  . PHE A 1 88 ? -5.017  -12.134 3.829   1.00 0.00 ? 87 PHE A HD1  4  
ATOM 10149 H HD2  . PHE A 1 88 ? -2.140  -12.245 0.641   1.00 0.00 ? 87 PHE A HD2  4  
ATOM 10150 H HE1  . PHE A 1 88 ? -6.236  -10.317 2.665   1.00 0.00 ? 87 PHE A HE1  4  
ATOM 10151 H HE2  . PHE A 1 88 ? -3.361  -10.429 -0.523  1.00 0.00 ? 87 PHE A HE2  4  
ATOM 10152 H HZ   . PHE A 1 88 ? -5.408  -9.464  0.489   1.00 0.00 ? 87 PHE A HZ   4  
ATOM 10153 N N    . PHE A 1 89 ? -5.864  -14.444 2.653   1.00 0.00 ? 88 PHE A N    4  
ATOM 10154 C CA   . PHE A 1 89 ? -7.247  -14.405 3.211   1.00 0.00 ? 88 PHE A CA   4  
ATOM 10155 C C    . PHE A 1 89 ? -7.517  -15.709 3.964   1.00 0.00 ? 88 PHE A C    4  
ATOM 10156 O O    . PHE A 1 89 ? -8.098  -15.716 5.031   1.00 0.00 ? 88 PHE A O    4  
ATOM 10157 C CB   . PHE A 1 89 ? -8.265  -14.260 2.077   1.00 0.00 ? 88 PHE A CB   4  
ATOM 10158 C CG   . PHE A 1 89 ? -7.815  -13.187 1.116   1.00 0.00 ? 88 PHE A CG   4  
ATOM 10159 C CD1  . PHE A 1 89 ? -8.072  -11.840 1.399   1.00 0.00 ? 88 PHE A CD1  4  
ATOM 10160 C CD2  . PHE A 1 89 ? -7.149  -13.539 -0.064  1.00 0.00 ? 88 PHE A CD2  4  
ATOM 10161 C CE1  . PHE A 1 89 ? -7.661  -10.846 0.503   1.00 0.00 ? 88 PHE A CE1  4  
ATOM 10162 C CE2  . PHE A 1 89 ? -6.740  -12.546 -0.961  1.00 0.00 ? 88 PHE A CE2  4  
ATOM 10163 C CZ   . PHE A 1 89 ? -6.996  -11.199 -0.678  1.00 0.00 ? 88 PHE A CZ   4  
ATOM 10164 H H    . PHE A 1 89 ? -5.714  -14.278 1.699   1.00 0.00 ? 88 PHE A H    4  
ATOM 10165 H HA   . PHE A 1 89 ? -7.346  -13.583 3.901   1.00 0.00 ? 88 PHE A HA   4  
ATOM 10166 H HB2  . PHE A 1 89 ? -8.352  -15.199 1.549   1.00 0.00 ? 88 PHE A HB2  4  
ATOM 10167 H HB3  . PHE A 1 89 ? -9.226  -13.991 2.490   1.00 0.00 ? 88 PHE A HB3  4  
ATOM 10168 H HD1  . PHE A 1 89 ? -8.584  -11.569 2.311   1.00 0.00 ? 88 PHE A HD1  4  
ATOM 10169 H HD2  . PHE A 1 89 ? -6.951  -14.578 -0.282  1.00 0.00 ? 88 PHE A HD2  4  
ATOM 10170 H HE1  . PHE A 1 89 ? -7.858  -9.806  0.722   1.00 0.00 ? 88 PHE A HE1  4  
ATOM 10171 H HE2  . PHE A 1 89 ? -6.226  -12.818 -1.871  1.00 0.00 ? 88 PHE A HE2  4  
ATOM 10172 H HZ   . PHE A 1 89 ? -6.679  -10.432 -1.369  1.00 0.00 ? 88 PHE A HZ   4  
ATOM 10173 N N    . GLU A 1 90 ? -7.098  -16.812 3.402   1.00 0.00 ? 89 GLU A N    4  
ATOM 10174 C CA   . GLU A 1 90 ? -7.320  -18.136 4.056   1.00 0.00 ? 89 GLU A CA   4  
ATOM 10175 C C    . GLU A 1 90 ? -6.017  -18.615 4.696   1.00 0.00 ? 89 GLU A C    4  
ATOM 10176 O O    . GLU A 1 90 ? -5.541  -19.698 4.423   1.00 0.00 ? 89 GLU A O    4  
ATOM 10177 C CB   . GLU A 1 90 ? -7.767  -19.149 3.000   1.00 0.00 ? 89 GLU A CB   4  
ATOM 10178 C CG   . GLU A 1 90 ? -8.888  -18.542 2.154   1.00 0.00 ? 89 GLU A CG   4  
ATOM 10179 C CD   . GLU A 1 90 ? -9.408  -19.590 1.168   1.00 0.00 ? 89 GLU A CD   4  
ATOM 10180 O OE1  . GLU A 1 90 ? -9.002  -20.735 1.282   1.00 0.00 ? 89 GLU A OE1  4  
ATOM 10181 O OE2  . GLU A 1 90 ? -10.205 -19.230 0.317   1.00 0.00 ? 89 GLU A OE2  4  
ATOM 10182 H H    . GLU A 1 90 ? -6.639  -16.770 2.543   1.00 0.00 ? 89 GLU A H    4  
ATOM 10183 H HA   . GLU A 1 90 ? -8.082  -18.050 4.813   1.00 0.00 ? 89 GLU A HA   4  
ATOM 10184 H HB2  . GLU A 1 90 ? -6.930  -19.400 2.364   1.00 0.00 ? 89 GLU A HB2  4  
ATOM 10185 H HB3  . GLU A 1 90 ? -8.129  -20.042 3.487   1.00 0.00 ? 89 GLU A HB3  4  
ATOM 10186 H HG2  . GLU A 1 90 ? -9.693  -18.222 2.800   1.00 0.00 ? 89 GLU A HG2  4  
ATOM 10187 H HG3  . GLU A 1 90 ? -8.507  -17.694 1.606   1.00 0.00 ? 89 GLU A HG3  4  
ATOM 10188 N N    . HIS A 1 91 ? -5.437  -17.817 5.549   1.00 0.00 ? 90 HIS A N    4  
ATOM 10189 C CA   . HIS A 1 91 ? -4.168  -18.232 6.208   1.00 0.00 ? 90 HIS A CA   4  
ATOM 10190 C C    . HIS A 1 91 ? -4.444  -19.414 7.139   1.00 0.00 ? 90 HIS A C    4  
ATOM 10191 O O    . HIS A 1 91 ? -4.351  -19.301 8.345   1.00 0.00 ? 90 HIS A O    4  
ATOM 10192 C CB   . HIS A 1 91 ? -3.606  -17.062 7.019   1.00 0.00 ? 90 HIS A CB   4  
ATOM 10193 C CG   . HIS A 1 91 ? -2.221  -17.404 7.494   1.00 0.00 ? 90 HIS A CG   4  
ATOM 10194 N ND1  . HIS A 1 91 ? -1.840  -17.266 8.819   1.00 0.00 ? 90 HIS A ND1  4  
ATOM 10195 C CD2  . HIS A 1 91 ? -1.116  -17.881 6.834   1.00 0.00 ? 90 HIS A CD2  4  
ATOM 10196 C CE1  . HIS A 1 91 ? -0.555  -17.653 8.914   1.00 0.00 ? 90 HIS A CE1  4  
ATOM 10197 N NE2  . HIS A 1 91 ? -0.065  -18.037 7.732   1.00 0.00 ? 90 HIS A NE2  4  
ATOM 10198 H H    . HIS A 1 91 ? -5.838  -16.947 5.758   1.00 0.00 ? 90 HIS A H    4  
ATOM 10199 H HA   . HIS A 1 91 ? -3.451  -18.526 5.455   1.00 0.00 ? 90 HIS A HA   4  
ATOM 10200 H HB2  . HIS A 1 91 ? -3.567  -16.179 6.397   1.00 0.00 ? 90 HIS A HB2  4  
ATOM 10201 H HB3  . HIS A 1 91 ? -4.243  -16.875 7.870   1.00 0.00 ? 90 HIS A HB3  4  
ATOM 10202 H HD1  . HIS A 1 91 ? -2.404  -16.945 9.554   1.00 0.00 ? 90 HIS A HD1  4  
ATOM 10203 H HD2  . HIS A 1 91 ? -1.070  -18.101 5.777   1.00 0.00 ? 90 HIS A HD2  4  
ATOM 10204 H HE1  . HIS A 1 91 ? 0.012   -17.652 9.833   1.00 0.00 ? 90 HIS A HE1  4  
ATOM 10205 N N    . GLU A 1 92 ? -4.783  -20.547 6.589   1.00 0.00 ? 91 GLU A N    4  
ATOM 10206 C CA   . GLU A 1 92 ? -5.067  -21.735 7.443   1.00 0.00 ? 91 GLU A CA   4  
ATOM 10207 C C    . GLU A 1 92 ? -3.775  -22.196 8.121   1.00 0.00 ? 91 GLU A C    4  
ATOM 10208 O O    . GLU A 1 92 ? -3.618  -23.393 8.299   1.00 0.00 ? 91 GLU A O    4  
ATOM 10209 C CB   . GLU A 1 92 ? -5.619  -22.866 6.573   1.00 0.00 ? 91 GLU A CB   4  
ATOM 10210 C CG   . GLU A 1 92 ? -6.986  -22.462 6.018   1.00 0.00 ? 91 GLU A CG   4  
ATOM 10211 C CD   . GLU A 1 92 ? -8.011  -22.436 7.153   1.00 0.00 ? 91 GLU A CD   4  
ATOM 10212 O OE1  . GLU A 1 92 ? -8.356  -23.501 7.638   1.00 0.00 ? 91 GLU A OE1  4  
ATOM 10213 O OE2  . GLU A 1 92 ? -8.434  -21.351 7.517   1.00 0.00 ? 91 GLU A OE2  4  
ATOM 10214 O OXT  . GLU A 1 92 ? -2.966  -21.345 8.451   1.00 0.00 ? 91 GLU A OXT  4  
ATOM 10215 H H    . GLU A 1 92 ? -4.854  -20.617 5.614   1.00 0.00 ? 91 GLU A H    4  
ATOM 10216 H HA   . GLU A 1 92 ? -5.795  -21.471 8.196   1.00 0.00 ? 91 GLU A HA   4  
ATOM 10217 H HB2  . GLU A 1 92 ? -4.939  -23.056 5.756   1.00 0.00 ? 91 GLU A HB2  4  
ATOM 10218 H HB3  . GLU A 1 92 ? -5.725  -23.760 7.169   1.00 0.00 ? 91 GLU A HB3  4  
ATOM 10219 H HG2  . GLU A 1 92 ? -6.917  -21.481 5.571   1.00 0.00 ? 91 GLU A HG2  4  
ATOM 10220 H HG3  . GLU A 1 92 ? -7.297  -23.177 5.271   1.00 0.00 ? 91 GLU A HG3  4  
ATOM 10221 N N    . MET B 1 1  ? 9.404   -7.723  14.207  1.00 0.00 ? 0  MET B N    4  
ATOM 10222 C CA   . MET B 1 1  ? 8.101   -7.273  14.773  1.00 0.00 ? 0  MET B CA   4  
ATOM 10223 C C    . MET B 1 1  ? 8.136   -5.760  15.002  1.00 0.00 ? 0  MET B C    4  
ATOM 10224 O O    . MET B 1 1  ? 7.760   -5.274  16.051  1.00 0.00 ? 0  MET B O    4  
ATOM 10225 C CB   . MET B 1 1  ? 7.847   -7.987  16.102  1.00 0.00 ? 0  MET B CB   4  
ATOM 10226 C CG   . MET B 1 1  ? 9.115   -7.947  16.957  1.00 0.00 ? 0  MET B CG   4  
ATOM 10227 S SD   . MET B 1 1  ? 8.709   -8.405  18.660  1.00 0.00 ? 0  MET B SD   4  
ATOM 10228 C CE   . MET B 1 1  ? 10.184  -7.705  19.440  1.00 0.00 ? 0  MET B CE   4  
ATOM 10229 H H1   . MET B 1 1  ? 9.600   -7.202  13.329  1.00 0.00 ? 0  MET B H1   4  
ATOM 10230 H H2   . MET B 1 1  ? 10.163  -7.539  14.894  1.00 0.00 ? 0  MET B H2   4  
ATOM 10231 H H3   . MET B 1 1  ? 9.359   -8.742  14.004  1.00 0.00 ? 0  MET B H3   4  
ATOM 10232 H HA   . MET B 1 1  ? 7.307   -7.511  14.080  1.00 0.00 ? 0  MET B HA   4  
ATOM 10233 H HB2  . MET B 1 1  ? 7.041   -7.494  16.627  1.00 0.00 ? 0  MET B HB2  4  
ATOM 10234 H HB3  . MET B 1 1  ? 7.576   -9.015  15.911  1.00 0.00 ? 0  MET B HB3  4  
ATOM 10235 H HG2  . MET B 1 1  ? 9.839   -8.642  16.560  1.00 0.00 ? 0  MET B HG2  4  
ATOM 10236 H HG3  . MET B 1 1  ? 9.528   -6.949  16.941  1.00 0.00 ? 0  MET B HG3  4  
ATOM 10237 H HE1  . MET B 1 1  ? 11.053  -7.936  18.839  1.00 0.00 ? 0  MET B HE1  4  
ATOM 10238 H HE2  . MET B 1 1  ? 10.072  -6.633  19.523  1.00 0.00 ? 0  MET B HE2  4  
ATOM 10239 H HE3  . MET B 1 1  ? 10.307  -8.128  20.425  1.00 0.00 ? 0  MET B HE3  4  
ATOM 10240 N N    . SER B 1 2  ? 8.581   -5.010  14.030  1.00 0.00 ? 1  SER B N    4  
ATOM 10241 C CA   . SER B 1 2  ? 8.633   -3.530  14.198  1.00 0.00 ? 1  SER B CA   4  
ATOM 10242 C C    . SER B 1 2  ? 7.208   -2.977  14.242  1.00 0.00 ? 1  SER B C    4  
ATOM 10243 O O    . SER B 1 2  ? 6.253   -3.676  13.967  1.00 0.00 ? 1  SER B O    4  
ATOM 10244 C CB   . SER B 1 2  ? 9.387   -2.907  13.023  1.00 0.00 ? 1  SER B CB   4  
ATOM 10245 O OG   . SER B 1 2  ? 8.553   -2.920  11.871  1.00 0.00 ? 1  SER B OG   4  
ATOM 10246 H H    . SER B 1 2  ? 8.877   -5.419  13.191  1.00 0.00 ? 1  SER B H    4  
ATOM 10247 H HA   . SER B 1 2  ? 9.139   -3.293  15.122  1.00 0.00 ? 1  SER B HA   4  
ATOM 10248 H HB2  . SER B 1 2  ? 9.650   -1.890  13.259  1.00 0.00 ? 1  SER B HB2  4  
ATOM 10249 H HB3  . SER B 1 2  ? 10.289  -3.475  12.833  1.00 0.00 ? 1  SER B HB3  4  
ATOM 10250 H HG   . SER B 1 2  ? 7.938   -2.185  11.942  1.00 0.00 ? 1  SER B HG   4  
ATOM 10251 N N    . GLU B 1 3  ? 7.055   -1.727  14.589  1.00 0.00 ? 2  GLU B N    4  
ATOM 10252 C CA   . GLU B 1 3  ? 5.688   -1.135  14.652  1.00 0.00 ? 2  GLU B CA   4  
ATOM 10253 C C    . GLU B 1 3  ? 5.004   -1.279  13.291  1.00 0.00 ? 2  GLU B C    4  
ATOM 10254 O O    . GLU B 1 3  ? 3.807   -1.471  13.201  1.00 0.00 ? 2  GLU B O    4  
ATOM 10255 C CB   . GLU B 1 3  ? 5.796   0.349   15.014  1.00 0.00 ? 2  GLU B CB   4  
ATOM 10256 C CG   . GLU B 1 3  ? 4.414   0.888   15.391  1.00 0.00 ? 2  GLU B CG   4  
ATOM 10257 C CD   . GLU B 1 3  ? 4.021   0.380   16.781  1.00 0.00 ? 2  GLU B CD   4  
ATOM 10258 O OE1  . GLU B 1 3  ? 4.892   -0.110  17.481  1.00 0.00 ? 2  GLU B OE1  4  
ATOM 10259 O OE2  . GLU B 1 3  ? 2.855   0.490   17.122  1.00 0.00 ? 2  GLU B OE2  4  
ATOM 10260 H H    . GLU B 1 3  ? 7.838   -1.180  14.809  1.00 0.00 ? 2  GLU B H    4  
ATOM 10261 H HA   . GLU B 1 3  ? 5.106   -1.649  15.404  1.00 0.00 ? 2  GLU B HA   4  
ATOM 10262 H HB2  . GLU B 1 3  ? 6.472   0.469   15.848  1.00 0.00 ? 2  GLU B HB2  4  
ATOM 10263 H HB3  . GLU B 1 3  ? 6.173   0.899   14.165  1.00 0.00 ? 2  GLU B HB3  4  
ATOM 10264 H HG2  . GLU B 1 3  ? 4.439   1.968   15.397  1.00 0.00 ? 2  GLU B HG2  4  
ATOM 10265 H HG3  . GLU B 1 3  ? 3.687   0.549   14.669  1.00 0.00 ? 2  GLU B HG3  4  
ATOM 10266 N N    . LEU B 1 4  ? 5.756   -1.180  12.229  1.00 0.00 ? 3  LEU B N    4  
ATOM 10267 C CA   . LEU B 1 4  ? 5.156   -1.300  10.870  1.00 0.00 ? 3  LEU B CA   4  
ATOM 10268 C C    . LEU B 1 4  ? 4.528   -2.690  10.702  1.00 0.00 ? 3  LEU B C    4  
ATOM 10269 O O    . LEU B 1 4  ? 3.399   -2.821  10.274  1.00 0.00 ? 3  LEU B O    4  
ATOM 10270 C CB   . LEU B 1 4  ? 6.254   -1.083  9.811   1.00 0.00 ? 3  LEU B CB   4  
ATOM 10271 C CG   . LEU B 1 4  ? 5.648   -0.518  8.518   1.00 0.00 ? 3  LEU B CG   4  
ATOM 10272 C CD1  . LEU B 1 4  ? 6.760   -0.305  7.488   1.00 0.00 ? 3  LEU B CD1  4  
ATOM 10273 C CD2  . LEU B 1 4  ? 4.607   -1.499  7.956   1.00 0.00 ? 3  LEU B CD2  4  
ATOM 10274 H H    . LEU B 1 4  ? 6.717   -1.011  12.325  1.00 0.00 ? 3  LEU B H    4  
ATOM 10275 H HA   . LEU B 1 4  ? 4.388   -0.546  10.755  1.00 0.00 ? 3  LEU B HA   4  
ATOM 10276 H HB2  . LEU B 1 4  ? 6.982   -0.383  10.196  1.00 0.00 ? 3  LEU B HB2  4  
ATOM 10277 H HB3  . LEU B 1 4  ? 6.745   -2.021  9.595   1.00 0.00 ? 3  LEU B HB3  4  
ATOM 10278 H HG   . LEU B 1 4  ? 5.172   0.429   8.730   1.00 0.00 ? 3  LEU B HG   4  
ATOM 10279 H HD11 . LEU B 1 4  ? 7.608   0.166   7.964   1.00 0.00 ? 3  LEU B HD11 4  
ATOM 10280 H HD12 . LEU B 1 4  ? 7.060   -1.258  7.080   1.00 0.00 ? 3  LEU B HD12 4  
ATOM 10281 H HD13 . LEU B 1 4  ? 6.397   0.328   6.692   1.00 0.00 ? 3  LEU B HD13 4  
ATOM 10282 H HD21 . LEU B 1 4  ? 4.952   -2.514  8.091   1.00 0.00 ? 3  LEU B HD21 4  
ATOM 10283 H HD22 . LEU B 1 4  ? 3.672   -1.364  8.477   1.00 0.00 ? 3  LEU B HD22 4  
ATOM 10284 H HD23 . LEU B 1 4  ? 4.457   -1.307  6.903   1.00 0.00 ? 3  LEU B HD23 4  
ATOM 10285 N N    . GLU B 1 5  ? 5.242   -3.731  11.041  1.00 0.00 ? 4  GLU B N    4  
ATOM 10286 C CA   . GLU B 1 5  ? 4.667   -5.100  10.896  1.00 0.00 ? 4  GLU B CA   4  
ATOM 10287 C C    . GLU B 1 5  ? 3.283   -5.135  11.544  1.00 0.00 ? 4  GLU B C    4  
ATOM 10288 O O    . GLU B 1 5  ? 2.326   -5.624  10.977  1.00 0.00 ? 4  GLU B O    4  
ATOM 10289 C CB   . GLU B 1 5  ? 5.582   -6.114  11.584  1.00 0.00 ? 4  GLU B CB   4  
ATOM 10290 C CG   . GLU B 1 5  ? 7.005   -5.965  11.040  1.00 0.00 ? 4  GLU B CG   4  
ATOM 10291 C CD   . GLU B 1 5  ? 7.875   -7.108  11.565  1.00 0.00 ? 4  GLU B CD   4  
ATOM 10292 O OE1  . GLU B 1 5  ? 7.407   -8.234  11.555  1.00 0.00 ? 4  GLU B OE1  4  
ATOM 10293 O OE2  . GLU B 1 5  ? 8.994   -6.837  11.968  1.00 0.00 ? 4  GLU B OE2  4  
ATOM 10294 H H    . GLU B 1 5  ? 6.149   -3.620  11.395  1.00 0.00 ? 4  GLU B H    4  
ATOM 10295 H HA   . GLU B 1 5  ? 4.581   -5.343  9.847   1.00 0.00 ? 4  GLU B HA   4  
ATOM 10296 H HB2  . GLU B 1 5  ? 5.582   -5.934  12.649  1.00 0.00 ? 4  GLU B HB2  4  
ATOM 10297 H HB3  . GLU B 1 5  ? 5.226   -7.114  11.387  1.00 0.00 ? 4  GLU B HB3  4  
ATOM 10298 H HG2  . GLU B 1 5  ? 6.982   -5.995  9.960   1.00 0.00 ? 4  GLU B HG2  4  
ATOM 10299 H HG3  . GLU B 1 5  ? 7.418   -5.022  11.366  1.00 0.00 ? 4  GLU B HG3  4  
ATOM 10300 N N    . LYS B 1 6  ? 3.175   -4.600  12.728  1.00 0.00 ? 5  LYS B N    4  
ATOM 10301 C CA   . LYS B 1 6  ? 1.862   -4.573  13.429  1.00 0.00 ? 5  LYS B CA   4  
ATOM 10302 C C    . LYS B 1 6  ? 0.792   -4.038  12.477  1.00 0.00 ? 5  LYS B C    4  
ATOM 10303 O O    . LYS B 1 6  ? -0.323  -4.520  12.429  1.00 0.00 ? 5  LYS B O    4  
ATOM 10304 C CB   . LYS B 1 6  ? 1.962   -3.627  14.632  1.00 0.00 ? 5  LYS B CB   4  
ATOM 10305 C CG   . LYS B 1 6  ? 3.198   -3.972  15.471  1.00 0.00 ? 5  LYS B CG   4  
ATOM 10306 C CD   . LYS B 1 6  ? 3.168   -5.455  15.869  1.00 0.00 ? 5  LYS B CD   4  
ATOM 10307 C CE   . LYS B 1 6  ? 4.092   -5.683  17.069  1.00 0.00 ? 5  LYS B CE   4  
ATOM 10308 N NZ   . LYS B 1 6  ? 4.292   -7.145  17.274  1.00 0.00 ? 5  LYS B NZ   4  
ATOM 10309 H H    . LYS B 1 6  ? 3.963   -4.204  13.155  1.00 0.00 ? 5  LYS B H    4  
ATOM 10310 H HA   . LYS B 1 6  ? 1.605   -5.560  13.783  1.00 0.00 ? 5  LYS B HA   4  
ATOM 10311 H HB2  . LYS B 1 6  ? 2.041   -2.609  14.280  1.00 0.00 ? 5  LYS B HB2  4  
ATOM 10312 H HB3  . LYS B 1 6  ? 1.077   -3.727  15.242  1.00 0.00 ? 5  LYS B HB3  4  
ATOM 10313 H HG2  . LYS B 1 6  ? 4.089   -3.773  14.894  1.00 0.00 ? 5  LYS B HG2  4  
ATOM 10314 H HG3  . LYS B 1 6  ? 3.203   -3.361  16.361  1.00 0.00 ? 5  LYS B HG3  4  
ATOM 10315 H HD2  . LYS B 1 6  ? 2.159   -5.739  16.133  1.00 0.00 ? 5  LYS B HD2  4  
ATOM 10316 H HD3  . LYS B 1 6  ? 3.507   -6.057  15.040  1.00 0.00 ? 5  LYS B HD3  4  
ATOM 10317 H HE2  . LYS B 1 6  ? 5.046   -5.212  16.881  1.00 0.00 ? 5  LYS B HE2  4  
ATOM 10318 H HE3  . LYS B 1 6  ? 3.646   -5.253  17.953  1.00 0.00 ? 5  LYS B HE3  4  
ATOM 10319 H HZ1  . LYS B 1 6  ? 4.518   -7.595  16.364  1.00 0.00 ? 5  LYS B HZ1  4  
ATOM 10320 H HZ2  . LYS B 1 6  ? 5.077   -7.298  17.938  1.00 0.00 ? 5  LYS B HZ2  4  
ATOM 10321 H HZ3  . LYS B 1 6  ? 3.422   -7.562  17.662  1.00 0.00 ? 5  LYS B HZ3  4  
ATOM 10322 N N    . ALA B 1 7  ? 1.139   -3.029  11.725  1.00 0.00 ? 6  ALA B N    4  
ATOM 10323 C CA   . ALA B 1 7  ? 0.178   -2.414  10.767  1.00 0.00 ? 6  ALA B CA   4  
ATOM 10324 C C    . ALA B 1 7  ? 0.070   -3.255  9.487   1.00 0.00 ? 6  ALA B C    4  
ATOM 10325 O O    . ALA B 1 7  ? -0.977  -3.322  8.875   1.00 0.00 ? 6  ALA B O    4  
ATOM 10326 C CB   . ALA B 1 7  ? 0.668   -0.998  10.425  1.00 0.00 ? 6  ALA B CB   4  
ATOM 10327 H H    . ALA B 1 7  ? 2.046   -2.666  11.794  1.00 0.00 ? 6  ALA B H    4  
ATOM 10328 H HA   . ALA B 1 7  ? -0.801  -2.357  11.220  1.00 0.00 ? 6  ALA B HA   4  
ATOM 10329 H HB1  . ALA B 1 7  ? 1.747   -0.983  10.435  1.00 0.00 ? 6  ALA B HB1  4  
ATOM 10330 H HB2  . ALA B 1 7  ? 0.316   -0.711  9.445   1.00 0.00 ? 6  ALA B HB2  4  
ATOM 10331 H HB3  . ALA B 1 7  ? 0.294   -0.299  11.159  1.00 0.00 ? 6  ALA B HB3  4  
ATOM 10332 N N    . MET B 1 8  ? 1.124   -3.902  9.074   1.00 0.00 ? 7  MET B N    4  
ATOM 10333 C CA   . MET B 1 8  ? 1.030   -4.728  7.836   1.00 0.00 ? 7  MET B CA   4  
ATOM 10334 C C    . MET B 1 8  ? -0.013  -5.831  8.070   1.00 0.00 ? 7  MET B C    4  
ATOM 10335 O O    . MET B 1 8  ? -0.882  -6.069  7.253   1.00 0.00 ? 7  MET B O    4  
ATOM 10336 C CB   . MET B 1 8  ? 2.412   -5.342  7.522   1.00 0.00 ? 7  MET B CB   4  
ATOM 10337 C CG   . MET B 1 8  ? 2.636   -5.424  6.004   1.00 0.00 ? 7  MET B CG   4  
ATOM 10338 S SD   . MET B 1 8  ? 1.129   -6.015  5.187   1.00 0.00 ? 7  MET B SD   4  
ATOM 10339 C CE   . MET B 1 8  ? 1.273   -5.023  3.678   1.00 0.00 ? 7  MET B CE   4  
ATOM 10340 H H    . MET B 1 8  ? 1.966   -3.850  9.574   1.00 0.00 ? 7  MET B H    4  
ATOM 10341 H HA   . MET B 1 8  ? 0.708   -4.098  7.018   1.00 0.00 ? 7  MET B HA   4  
ATOM 10342 H HB2  . MET B 1 8  ? 3.180   -4.719  7.957   1.00 0.00 ? 7  MET B HB2  4  
ATOM 10343 H HB3  . MET B 1 8  ? 2.481   -6.334  7.947   1.00 0.00 ? 7  MET B HB3  4  
ATOM 10344 H HG2  . MET B 1 8  ? 2.891   -4.445  5.627   1.00 0.00 ? 7  MET B HG2  4  
ATOM 10345 H HG3  . MET B 1 8  ? 3.447   -6.108  5.799   1.00 0.00 ? 7  MET B HG3  4  
ATOM 10346 H HE1  . MET B 1 8  ? 2.283   -5.074  3.305   1.00 0.00 ? 7  MET B HE1  4  
ATOM 10347 H HE2  . MET B 1 8  ? 0.595   -5.409  2.929   1.00 0.00 ? 7  MET B HE2  4  
ATOM 10348 H HE3  . MET B 1 8  ? 1.025   -3.993  3.899   1.00 0.00 ? 7  MET B HE3  4  
ATOM 10349 N N    . VAL B 1 9  ? 0.067   -6.490  9.193   1.00 0.00 ? 8  VAL B N    4  
ATOM 10350 C CA   . VAL B 1 9  ? -0.911  -7.568  9.515   1.00 0.00 ? 8  VAL B CA   4  
ATOM 10351 C C    . VAL B 1 9  ? -2.288  -6.949  9.778   1.00 0.00 ? 8  VAL B C    4  
ATOM 10352 O O    . VAL B 1 9  ? -3.308  -7.502  9.416   1.00 0.00 ? 8  VAL B O    4  
ATOM 10353 C CB   . VAL B 1 9  ? -0.439  -8.307  10.767  1.00 0.00 ? 8  VAL B CB   4  
ATOM 10354 C CG1  . VAL B 1 9  ? -1.318  -9.538  10.995  1.00 0.00 ? 8  VAL B CG1  4  
ATOM 10355 C CG2  . VAL B 1 9  ? 1.015   -8.749  10.576  1.00 0.00 ? 8  VAL B CG2  4  
ATOM 10356 H H    . VAL B 1 9  ? 0.772   -6.267  9.836   1.00 0.00 ? 8  VAL B H    4  
ATOM 10357 H HA   . VAL B 1 9  ? -0.983  -8.271  8.698   1.00 0.00 ? 8  VAL B HA   4  
ATOM 10358 H HB   . VAL B 1 9  ? -0.510  -7.650  11.622  1.00 0.00 ? 8  VAL B HB   4  
ATOM 10359 H HG11 . VAL B 1 9  ? -1.341  -10.135 10.094  1.00 0.00 ? 8  VAL B HG11 4  
ATOM 10360 H HG12 . VAL B 1 9  ? -0.913  -10.125 11.806  1.00 0.00 ? 8  VAL B HG12 4  
ATOM 10361 H HG13 . VAL B 1 9  ? -2.321  -9.223  11.244  1.00 0.00 ? 8  VAL B HG13 4  
ATOM 10362 H HG21 . VAL B 1 9  ? 1.634   -7.883  10.387  1.00 0.00 ? 8  VAL B HG21 4  
ATOM 10363 H HG22 . VAL B 1 9  ? 1.360   -9.249  11.469  1.00 0.00 ? 8  VAL B HG22 4  
ATOM 10364 H HG23 . VAL B 1 9  ? 1.079   -9.425  9.737   1.00 0.00 ? 8  VAL B HG23 4  
ATOM 10365 N N    . ALA B 1 10 ? -2.323  -5.801  10.398  1.00 0.00 ? 9  ALA B N    4  
ATOM 10366 C CA   . ALA B 1 10 ? -3.629  -5.136  10.680  1.00 0.00 ? 9  ALA B CA   4  
ATOM 10367 C C    . ALA B 1 10 ? -4.375  -4.907  9.365   1.00 0.00 ? 9  ALA B C    4  
ATOM 10368 O O    . ALA B 1 10 ? -5.546  -5.206  9.236   1.00 0.00 ? 9  ALA B O    4  
ATOM 10369 C CB   . ALA B 1 10 ? -3.360  -3.781  11.339  1.00 0.00 ? 9  ALA B CB   4  
ATOM 10370 H H    . ALA B 1 10 ? -1.488  -5.369  10.674  1.00 0.00 ? 9  ALA B H    4  
ATOM 10371 H HA   . ALA B 1 10 ? -4.218  -5.742  11.353  1.00 0.00 ? 9  ALA B HA   4  
ATOM 10372 H HB1  . ALA B 1 10 ? -2.645  -3.905  12.139  1.00 0.00 ? 9  ALA B HB1  4  
ATOM 10373 H HB2  . ALA B 1 10 ? -2.962  -3.095  10.605  1.00 0.00 ? 9  ALA B HB2  4  
ATOM 10374 H HB3  . ALA B 1 10 ? -4.282  -3.385  11.739  1.00 0.00 ? 9  ALA B HB3  4  
ATOM 10375 N N    . LEU B 1 11 ? -3.699  -4.363  8.396   1.00 0.00 ? 10 LEU B N    4  
ATOM 10376 C CA   . LEU B 1 11 ? -4.344  -4.085  7.084   1.00 0.00 ? 10 LEU B CA   4  
ATOM 10377 C C    . LEU B 1 11 ? -5.048  -5.337  6.575   1.00 0.00 ? 10 LEU B C    4  
ATOM 10378 O O    . LEU B 1 11 ? -6.220  -5.333  6.259   1.00 0.00 ? 10 LEU B O    4  
ATOM 10379 C CB   . LEU B 1 11 ? -3.241  -3.709  6.074   1.00 0.00 ? 10 LEU B CB   4  
ATOM 10380 C CG   . LEU B 1 11 ? -2.860  -2.221  6.217   1.00 0.00 ? 10 LEU B CG   4  
ATOM 10381 C CD1  . LEU B 1 11 ? -1.452  -1.997  5.658   1.00 0.00 ? 10 LEU B CD1  4  
ATOM 10382 C CD2  . LEU B 1 11 ? -3.852  -1.337  5.439   1.00 0.00 ? 10 LEU B CD2  4  
ATOM 10383 H H    . LEU B 1 11 ? -2.760  -4.119  8.537   1.00 0.00 ? 10 LEU B H    4  
ATOM 10384 H HA   . LEU B 1 11 ? -5.022  -3.252  7.175   1.00 0.00 ? 10 LEU B HA   4  
ATOM 10385 H HB2  . LEU B 1 11 ? -2.371  -4.322  6.265   1.00 0.00 ? 10 LEU B HB2  4  
ATOM 10386 H HB3  . LEU B 1 11 ? -3.588  -3.895  5.066   1.00 0.00 ? 10 LEU B HB3  4  
ATOM 10387 H HG   . LEU B 1 11 ? -2.875  -1.946  7.263   1.00 0.00 ? 10 LEU B HG   4  
ATOM 10388 H HD11 . LEU B 1 11 ? -1.342  -2.536  4.729   1.00 0.00 ? 10 LEU B HD11 4  
ATOM 10389 H HD12 . LEU B 1 11 ? -1.298  -0.945  5.481   1.00 0.00 ? 10 LEU B HD12 4  
ATOM 10390 H HD13 . LEU B 1 11 ? -0.721  -2.354  6.369   1.00 0.00 ? 10 LEU B HD13 4  
ATOM 10391 H HD21 . LEU B 1 11 ? -3.954  -1.706  4.430   1.00 0.00 ? 10 LEU B HD21 4  
ATOM 10392 H HD22 . LEU B 1 11 ? -4.813  -1.350  5.926   1.00 0.00 ? 10 LEU B HD22 4  
ATOM 10393 H HD23 . LEU B 1 11 ? -3.479  -0.324  5.412   1.00 0.00 ? 10 LEU B HD23 4  
ATOM 10394 N N    . ILE B 1 12 ? -4.310  -6.402  6.473   1.00 0.00 ? 11 ILE B N    4  
ATOM 10395 C CA   . ILE B 1 12 ? -4.882  -7.670  5.957   1.00 0.00 ? 11 ILE B CA   4  
ATOM 10396 C C    . ILE B 1 12 ? -6.114  -8.072  6.763   1.00 0.00 ? 11 ILE B C    4  
ATOM 10397 O O    . ILE B 1 12 ? -7.088  -8.548  6.214   1.00 0.00 ? 11 ILE B O    4  
ATOM 10398 C CB   . ILE B 1 12 ? -3.829  -8.775  6.063   1.00 0.00 ? 11 ILE B CB   4  
ATOM 10399 C CG1  . ILE B 1 12 ? -2.637  -8.428  5.165   1.00 0.00 ? 11 ILE B CG1  4  
ATOM 10400 C CG2  . ILE B 1 12 ? -4.437  -10.108 5.617   1.00 0.00 ? 11 ILE B CG2  4  
ATOM 10401 C CD1  . ILE B 1 12 ? -1.466  -9.361  5.482   1.00 0.00 ? 11 ILE B CD1  4  
ATOM 10402 H H    . ILE B 1 12 ? -3.361  -6.359  6.719   1.00 0.00 ? 11 ILE B H    4  
ATOM 10403 H HA   . ILE B 1 12 ? -5.156  -7.542  4.921   1.00 0.00 ? 11 ILE B HA   4  
ATOM 10404 H HB   . ILE B 1 12 ? -3.498  -8.856  7.089   1.00 0.00 ? 11 ILE B HB   4  
ATOM 10405 H HG12 . ILE B 1 12 ? -2.921  -8.547  4.129   1.00 0.00 ? 11 ILE B HG12 4  
ATOM 10406 H HG13 . ILE B 1 12 ? -2.338  -7.406  5.342   1.00 0.00 ? 11 ILE B HG13 4  
ATOM 10407 H HG21 . ILE B 1 12 ? -5.019  -9.956  4.720   1.00 0.00 ? 11 ILE B HG21 4  
ATOM 10408 H HG22 . ILE B 1 12 ? -3.647  -10.817 5.418   1.00 0.00 ? 11 ILE B HG22 4  
ATOM 10409 H HG23 . ILE B 1 12 ? -5.076  -10.491 6.400   1.00 0.00 ? 11 ILE B HG23 4  
ATOM 10410 H HD11 . ILE B 1 12 ? -1.281  -9.360  6.547   1.00 0.00 ? 11 ILE B HD11 4  
ATOM 10411 H HD12 . ILE B 1 12 ? -1.707  -10.363 5.161   1.00 0.00 ? 11 ILE B HD12 4  
ATOM 10412 H HD13 . ILE B 1 12 ? -0.583  -9.019  4.963   1.00 0.00 ? 11 ILE B HD13 4  
ATOM 10413 N N    . ASP B 1 13 ? -6.082  -7.924  8.060   1.00 0.00 ? 12 ASP B N    4  
ATOM 10414 C CA   . ASP B 1 13 ? -7.261  -8.349  8.865   1.00 0.00 ? 12 ASP B CA   4  
ATOM 10415 C C    . ASP B 1 13 ? -8.442  -7.399  8.639   1.00 0.00 ? 12 ASP B C    4  
ATOM 10416 O O    . ASP B 1 13 ? -9.578  -7.828  8.603   1.00 0.00 ? 12 ASP B O    4  
ATOM 10417 C CB   . ASP B 1 13 ? -6.898  -8.404  10.349  1.00 0.00 ? 12 ASP B CB   4  
ATOM 10418 C CG   . ASP B 1 13 ? -8.101  -8.910  11.149  1.00 0.00 ? 12 ASP B CG   4  
ATOM 10419 O OD1  . ASP B 1 13 ? -8.381  -10.095 11.074  1.00 0.00 ? 12 ASP B OD1  4  
ATOM 10420 O OD2  . ASP B 1 13 ? -8.721  -8.103  11.822  1.00 0.00 ? 12 ASP B OD2  4  
ATOM 10421 H H    . ASP B 1 13 ? -5.283  -7.567  8.501   1.00 0.00 ? 12 ASP B H    4  
ATOM 10422 H HA   . ASP B 1 13 ? -7.537  -9.334  8.517   1.00 0.00 ? 12 ASP B HA   4  
ATOM 10423 H HB2  . ASP B 1 13 ? -6.062  -9.073  10.492  1.00 0.00 ? 12 ASP B HB2  4  
ATOM 10424 H HB3  . ASP B 1 13 ? -6.631  -7.415  10.692  1.00 0.00 ? 12 ASP B HB3  4  
ATOM 10425 N N    . VAL B 1 14 ? -8.212  -6.116  8.486   1.00 0.00 ? 13 VAL B N    4  
ATOM 10426 C CA   . VAL B 1 14 ? -9.376  -5.208  8.266   1.00 0.00 ? 13 VAL B CA   4  
ATOM 10427 C C    . VAL B 1 14 ? -9.957  -5.474  6.878   1.00 0.00 ? 13 VAL B C    4  
ATOM 10428 O O    . VAL B 1 14 ? -11.158 -5.557  6.714   1.00 0.00 ? 13 VAL B O    4  
ATOM 10429 C CB   . VAL B 1 14 ? -8.963  -3.742  8.404   1.00 0.00 ? 13 VAL B CB   4  
ATOM 10430 C CG1  . VAL B 1 14 ? -10.164 -2.842  8.101   1.00 0.00 ? 13 VAL B CG1  4  
ATOM 10431 C CG2  . VAL B 1 14 ? -8.475  -3.481  9.832   1.00 0.00 ? 13 VAL B CG2  4  
ATOM 10432 H H    . VAL B 1 14 ? -7.295  -5.757  8.511   1.00 0.00 ? 13 VAL B H    4  
ATOM 10433 H HA   . VAL B 1 14 ? -10.153 -5.455  8.974   1.00 0.00 ? 13 VAL B HA   4  
ATOM 10434 H HB   . VAL B 1 14 ? -8.168  -3.526  7.705   1.00 0.00 ? 13 VAL B HB   4  
ATOM 10435 H HG11 . VAL B 1 14 ? -11.037 -3.222  8.610   1.00 0.00 ? 13 VAL B HG11 4  
ATOM 10436 H HG12 . VAL B 1 14 ? -9.958  -1.839  8.443   1.00 0.00 ? 13 VAL B HG12 4  
ATOM 10437 H HG13 . VAL B 1 14 ? -10.346 -2.829  7.036   1.00 0.00 ? 13 VAL B HG13 4  
ATOM 10438 H HG21 . VAL B 1 14 ? -7.752  -4.235  10.108  1.00 0.00 ? 13 VAL B HG21 4  
ATOM 10439 H HG22 . VAL B 1 14 ? -8.015  -2.505  9.882   1.00 0.00 ? 13 VAL B HG22 4  
ATOM 10440 H HG23 . VAL B 1 14 ? -9.313  -3.520  10.512  1.00 0.00 ? 13 VAL B HG23 4  
ATOM 10441 N N    . PHE B 1 15 ? -9.137  -5.643  5.882   1.00 0.00 ? 14 PHE B N    4  
ATOM 10442 C CA   . PHE B 1 15 ? -9.693  -5.941  4.534   1.00 0.00 ? 14 PHE B CA   4  
ATOM 10443 C C    . PHE B 1 15 ? -10.582 -7.180  4.654   1.00 0.00 ? 14 PHE B C    4  
ATOM 10444 O O    . PHE B 1 15 ? -11.566 -7.328  3.956   1.00 0.00 ? 14 PHE B O    4  
ATOM 10445 C CB   . PHE B 1 15 ? -8.559  -6.217  3.545   1.00 0.00 ? 14 PHE B CB   4  
ATOM 10446 C CG   . PHE B 1 15 ? -9.148  -6.521  2.186   1.00 0.00 ? 14 PHE B CG   4  
ATOM 10447 C CD1  . PHE B 1 15 ? -9.593  -7.815  1.888   1.00 0.00 ? 14 PHE B CD1  4  
ATOM 10448 C CD2  . PHE B 1 15 ? -9.252  -5.507  1.225   1.00 0.00 ? 14 PHE B CD2  4  
ATOM 10449 C CE1  . PHE B 1 15 ? -10.141 -8.095  0.629   1.00 0.00 ? 14 PHE B CE1  4  
ATOM 10450 C CE2  . PHE B 1 15 ? -9.799  -5.788  -0.033  1.00 0.00 ? 14 PHE B CE2  4  
ATOM 10451 C CZ   . PHE B 1 15 ? -10.244 -7.082  -0.331  1.00 0.00 ? 14 PHE B CZ   4  
ATOM 10452 H H    . PHE B 1 15 ? -8.168  -5.600  6.022   1.00 0.00 ? 14 PHE B H    4  
ATOM 10453 H HA   . PHE B 1 15 ? -10.285 -5.107  4.186   1.00 0.00 ? 14 PHE B HA   4  
ATOM 10454 H HB2  . PHE B 1 15 ? -7.920  -5.348  3.477   1.00 0.00 ? 14 PHE B HB2  4  
ATOM 10455 H HB3  . PHE B 1 15 ? -7.982  -7.064  3.884   1.00 0.00 ? 14 PHE B HB3  4  
ATOM 10456 H HD1  . PHE B 1 15 ? -9.513  -8.597  2.629   1.00 0.00 ? 14 PHE B HD1  4  
ATOM 10457 H HD2  . PHE B 1 15 ? -8.909  -4.509  1.455   1.00 0.00 ? 14 PHE B HD2  4  
ATOM 10458 H HE1  . PHE B 1 15 ? -10.485 -9.093  0.399   1.00 0.00 ? 14 PHE B HE1  4  
ATOM 10459 H HE2  . PHE B 1 15 ? -9.879  -5.006  -0.774  1.00 0.00 ? 14 PHE B HE2  4  
ATOM 10460 H HZ   . PHE B 1 15 ? -10.666 -7.298  -1.301  1.00 0.00 ? 14 PHE B HZ   4  
ATOM 10461 N N    . HIS B 1 16 ? -10.238 -8.069  5.548   1.00 0.00 ? 15 HIS B N    4  
ATOM 10462 C CA   . HIS B 1 16 ? -11.051 -9.303  5.733   1.00 0.00 ? 15 HIS B CA   4  
ATOM 10463 C C    . HIS B 1 16 ? -12.313 -8.980  6.541   1.00 0.00 ? 15 HIS B C    4  
ATOM 10464 O O    . HIS B 1 16 ? -13.351 -9.586  6.364   1.00 0.00 ? 15 HIS B O    4  
ATOM 10465 C CB   . HIS B 1 16 ? -10.222 -10.348 6.483   1.00 0.00 ? 15 HIS B CB   4  
ATOM 10466 C CG   . HIS B 1 16 ? -11.019 -11.617 6.613   1.00 0.00 ? 15 HIS B CG   4  
ATOM 10467 N ND1  . HIS B 1 16 ? -11.043 -12.359 7.784   1.00 0.00 ? 15 HIS B ND1  4  
ATOM 10468 C CD2  . HIS B 1 16 ? -11.828 -12.287 5.728   1.00 0.00 ? 15 HIS B CD2  4  
ATOM 10469 C CE1  . HIS B 1 16 ? -11.843 -13.421 7.574   1.00 0.00 ? 15 HIS B CE1  4  
ATOM 10470 N NE2  . HIS B 1 16 ? -12.347 -13.426 6.338   1.00 0.00 ? 15 HIS B NE2  4  
ATOM 10471 H H    . HIS B 1 16 ? -9.442  -7.922  6.100   1.00 0.00 ? 15 HIS B H    4  
ATOM 10472 H HA   . HIS B 1 16 ? -11.333 -9.695  4.768   1.00 0.00 ? 15 HIS B HA   4  
ATOM 10473 H HB2  . HIS B 1 16 ? -9.313  -10.547 5.936   1.00 0.00 ? 15 HIS B HB2  4  
ATOM 10474 H HB3  . HIS B 1 16 ? -9.977  -9.975  7.467   1.00 0.00 ? 15 HIS B HB3  4  
ATOM 10475 H HD1  . HIS B 1 16 ? -10.565 -12.149 8.613   1.00 0.00 ? 15 HIS B HD1  4  
ATOM 10476 H HD2  . HIS B 1 16 ? -12.031 -11.976 4.714   1.00 0.00 ? 15 HIS B HD2  4  
ATOM 10477 H HE1  . HIS B 1 16 ? -12.051 -14.178 8.316   1.00 0.00 ? 15 HIS B HE1  4  
ATOM 10478 N N    . GLN B 1 17 ? -12.217 -8.039  7.446   1.00 0.00 ? 16 GLN B N    4  
ATOM 10479 C CA   . GLN B 1 17 ? -13.393 -7.682  8.293   1.00 0.00 ? 16 GLN B CA   4  
ATOM 10480 C C    . GLN B 1 17 ? -14.598 -7.359  7.411   1.00 0.00 ? 16 GLN B C    4  
ATOM 10481 O O    . GLN B 1 17 ? -15.699 -7.806  7.668   1.00 0.00 ? 16 GLN B O    4  
ATOM 10482 C CB   . GLN B 1 17 ? -13.048 -6.465  9.159   1.00 0.00 ? 16 GLN B CB   4  
ATOM 10483 C CG   . GLN B 1 17 ? -14.207 -6.153  10.118  1.00 0.00 ? 16 GLN B CG   4  
ATOM 10484 C CD   . GLN B 1 17 ? -15.296 -5.363  9.384   1.00 0.00 ? 16 GLN B CD   4  
ATOM 10485 O OE1  . GLN B 1 17 ? -16.292 -5.920  8.968   1.00 0.00 ? 16 GLN B OE1  4  
ATOM 10486 N NE2  . GLN B 1 17 ? -15.148 -4.077  9.212   1.00 0.00 ? 16 GLN B NE2  4  
ATOM 10487 H H    . GLN B 1 17 ? -11.364 -7.578  7.579   1.00 0.00 ? 16 GLN B H    4  
ATOM 10488 H HA   . GLN B 1 17 ? -13.636 -8.518  8.932   1.00 0.00 ? 16 GLN B HA   4  
ATOM 10489 H HB2  . GLN B 1 17 ? -12.156 -6.677  9.732   1.00 0.00 ? 16 GLN B HB2  4  
ATOM 10490 H HB3  . GLN B 1 17 ? -12.868 -5.611  8.521   1.00 0.00 ? 16 GLN B HB3  4  
ATOM 10491 H HG2  . GLN B 1 17 ? -14.624 -7.076  10.495  1.00 0.00 ? 16 GLN B HG2  4  
ATOM 10492 H HG3  . GLN B 1 17 ? -13.837 -5.565  10.945  1.00 0.00 ? 16 GLN B HG3  4  
ATOM 10493 H HE21 . GLN B 1 17 ? -14.346 -3.627  9.550   1.00 0.00 ? 16 GLN B HE21 4  
ATOM 10494 H HE22 . GLN B 1 17 ? -15.839 -3.562  8.745   1.00 0.00 ? 16 GLN B HE22 4  
ATOM 10495 N N    . TYR B 1 18 ? -14.412 -6.584  6.378   1.00 0.00 ? 17 TYR B N    4  
ATOM 10496 C CA   . TYR B 1 18 ? -15.562 -6.239  5.497   1.00 0.00 ? 17 TYR B CA   4  
ATOM 10497 C C    . TYR B 1 18 ? -15.954 -7.461  4.670   1.00 0.00 ? 17 TYR B C    4  
ATOM 10498 O O    . TYR B 1 18 ? -17.115 -7.806  4.569   1.00 0.00 ? 17 TYR B O    4  
ATOM 10499 C CB   . TYR B 1 18 ? -15.167 -5.090  4.566   1.00 0.00 ? 17 TYR B CB   4  
ATOM 10500 C CG   . TYR B 1 18 ? -15.080 -3.809  5.365   1.00 0.00 ? 17 TYR B CG   4  
ATOM 10501 C CD1  . TYR B 1 18 ? -14.028 -3.620  6.269   1.00 0.00 ? 17 TYR B CD1  4  
ATOM 10502 C CD2  . TYR B 1 18 ? -16.054 -2.813  5.206   1.00 0.00 ? 17 TYR B CD2  4  
ATOM 10503 C CE1  . TYR B 1 18 ? -13.948 -2.438  7.014   1.00 0.00 ? 17 TYR B CE1  4  
ATOM 10504 C CE2  . TYR B 1 18 ? -15.973 -1.631  5.952   1.00 0.00 ? 17 TYR B CE2  4  
ATOM 10505 C CZ   . TYR B 1 18 ? -14.921 -1.443  6.856   1.00 0.00 ? 17 TYR B CZ   4  
ATOM 10506 O OH   . TYR B 1 18 ? -14.842 -0.276  7.590   1.00 0.00 ? 17 TYR B OH   4  
ATOM 10507 H H    . TYR B 1 18 ? -13.524 -6.220  6.189   1.00 0.00 ? 17 TYR B H    4  
ATOM 10508 H HA   . TYR B 1 18 ? -16.401 -5.935  6.106   1.00 0.00 ? 17 TYR B HA   4  
ATOM 10509 H HB2  . TYR B 1 18 ? -14.206 -5.302  4.119   1.00 0.00 ? 17 TYR B HB2  4  
ATOM 10510 H HB3  . TYR B 1 18 ? -15.910 -4.983  3.790   1.00 0.00 ? 17 TYR B HB3  4  
ATOM 10511 H HD1  . TYR B 1 18 ? -13.278 -4.387  6.391   1.00 0.00 ? 17 TYR B HD1  4  
ATOM 10512 H HD2  . TYR B 1 18 ? -16.865 -2.957  4.507   1.00 0.00 ? 17 TYR B HD2  4  
ATOM 10513 H HE1  . TYR B 1 18 ? -13.136 -2.293  7.712   1.00 0.00 ? 17 TYR B HE1  4  
ATOM 10514 H HE2  . TYR B 1 18 ? -16.723 -0.864  5.829   1.00 0.00 ? 17 TYR B HE2  4  
ATOM 10515 H HH   . TYR B 1 18 ? -15.527 -0.302  8.262   1.00 0.00 ? 17 TYR B HH   4  
ATOM 10516 N N    . SER B 1 19 ? -14.994 -8.120  4.074   1.00 0.00 ? 18 SER B N    4  
ATOM 10517 C CA   . SER B 1 19 ? -15.304 -9.325  3.247   1.00 0.00 ? 18 SER B CA   4  
ATOM 10518 C C    . SER B 1 19 ? -15.044 -10.596 4.062   1.00 0.00 ? 18 SER B C    4  
ATOM 10519 O O    . SER B 1 19 ? -14.246 -11.428 3.676   1.00 0.00 ? 18 SER B O    4  
ATOM 10520 C CB   . SER B 1 19 ? -14.406 -9.328  2.010   1.00 0.00 ? 18 SER B CB   4  
ATOM 10521 O OG   . SER B 1 19 ? -14.627 -8.135  1.267   1.00 0.00 ? 18 SER B OG   4  
ATOM 10522 H H    . SER B 1 19 ? -14.067 -7.820  4.169   1.00 0.00 ? 18 SER B H    4  
ATOM 10523 H HA   . SER B 1 19 ? -16.339 -9.304  2.935   1.00 0.00 ? 18 SER B HA   4  
ATOM 10524 H HB2  . SER B 1 19 ? -13.372 -9.370  2.312   1.00 0.00 ? 18 SER B HB2  4  
ATOM 10525 H HB3  . SER B 1 19 ? -14.637 -10.192 1.401   1.00 0.00 ? 18 SER B HB3  4  
ATOM 10526 H HG   . SER B 1 19 ? -15.129 -8.364  0.482   1.00 0.00 ? 18 SER B HG   4  
ATOM 10527 N N    . GLY B 1 20 ? -15.723 -10.765 5.176   1.00 0.00 ? 19 GLY B N    4  
ATOM 10528 C CA   . GLY B 1 20 ? -15.536 -11.998 6.013   1.00 0.00 ? 19 GLY B CA   4  
ATOM 10529 C C    . GLY B 1 20 ? -16.891 -12.693 6.166   1.00 0.00 ? 19 GLY B C    4  
ATOM 10530 O O    . GLY B 1 20 ? -16.971 -13.841 6.555   1.00 0.00 ? 19 GLY B O    4  
ATOM 10531 H H    . GLY B 1 20 ? -16.377 -10.092 5.461   1.00 0.00 ? 19 GLY B H    4  
ATOM 10532 H HA2  . GLY B 1 20 ? -14.834 -12.668 5.536   1.00 0.00 ? 19 GLY B HA2  4  
ATOM 10533 H HA3  . GLY B 1 20 ? -15.172 -11.729 6.994   1.00 0.00 ? 19 GLY B HA3  4  
ATOM 10534 N N    . ARG B 1 21 ? -17.956 -12.015 5.837   1.00 0.00 ? 20 ARG B N    4  
ATOM 10535 C CA   . ARG B 1 21 ? -19.305 -12.643 5.933   1.00 0.00 ? 20 ARG B CA   4  
ATOM 10536 C C    . ARG B 1 21 ? -19.397 -13.783 4.919   1.00 0.00 ? 20 ARG B C    4  
ATOM 10537 O O    . ARG B 1 21 ? -20.106 -14.744 5.144   1.00 0.00 ? 20 ARG B O    4  
ATOM 10538 C CB   . ARG B 1 21 ? -20.399 -11.601 5.674   1.00 0.00 ? 20 ARG B CB   4  
ATOM 10539 C CG   . ARG B 1 21 ? -21.744 -12.124 6.188   1.00 0.00 ? 20 ARG B CG   4  
ATOM 10540 C CD   . ARG B 1 21 ? -22.818 -11.049 6.000   1.00 0.00 ? 20 ARG B CD   4  
ATOM 10541 N NE   . ARG B 1 21 ? -24.012 -11.392 6.822   1.00 0.00 ? 20 ARG B NE   4  
ATOM 10542 C CZ   . ARG B 1 21 ? -25.148 -10.785 6.610   1.00 0.00 ? 20 ARG B CZ   4  
ATOM 10543 N NH1  . ARG B 1 21 ? -25.263 -9.508  6.855   1.00 0.00 ? 20 ARG B NH1  4  
ATOM 10544 N NH2  . ARG B 1 21 ? -26.169 -11.456 6.150   1.00 0.00 ? 20 ARG B NH2  4  
ATOM 10545 H H    . ARG B 1 21 ? -17.869 -11.099 5.500   1.00 0.00 ? 20 ARG B H    4  
ATOM 10546 H HA   . ARG B 1 21 ? -19.455 -13.117 6.892   1.00 0.00 ? 20 ARG B HA   4  
ATOM 10547 H HB2  . ARG B 1 21 ? -20.150 -10.684 6.187   1.00 0.00 ? 20 ARG B HB2  4  
ATOM 10548 H HB3  . ARG B 1 21 ? -20.471 -11.412 4.613   1.00 0.00 ? 20 ARG B HB3  4  
ATOM 10549 H HG2  . ARG B 1 21 ? -22.020 -13.010 5.636   1.00 0.00 ? 20 ARG B HG2  4  
ATOM 10550 H HG3  . ARG B 1 21 ? -21.659 -12.364 7.237   1.00 0.00 ? 20 ARG B HG3  4  
ATOM 10551 H HD2  . ARG B 1 21 ? -22.429 -10.091 6.313   1.00 0.00 ? 20 ARG B HD2  4  
ATOM 10552 H HD3  . ARG B 1 21 ? -23.100 -11.000 4.958   1.00 0.00 ? 20 ARG B HD3  4  
ATOM 10553 H HE   . ARG B 1 21 ? -23.945 -12.074 7.523   1.00 0.00 ? 20 ARG B HE   4  
ATOM 10554 H HH11 . ARG B 1 21 ? -24.481 -8.994  7.208   1.00 0.00 ? 20 ARG B HH11 4  
ATOM 10555 H HH12 . ARG B 1 21 ? -26.133 -9.043  6.689   1.00 0.00 ? 20 ARG B HH12 4  
ATOM 10556 H HH21 . ARG B 1 21 ? -26.082 -12.434 5.961   1.00 0.00 ? 20 ARG B HH21 4  
ATOM 10557 H HH22 . ARG B 1 21 ? -27.040 -10.991 5.990   1.00 0.00 ? 20 ARG B HH22 4  
ATOM 10558 N N    . GLU B 1 22 ? -18.670 -13.731 3.831   1.00 0.00 ? 21 GLU B N    4  
ATOM 10559 C CA   . GLU B 1 22 ? -18.718 -14.877 2.866   1.00 0.00 ? 21 GLU B CA   4  
ATOM 10560 C C    . GLU B 1 22 ? -17.343 -15.048 2.219   1.00 0.00 ? 21 GLU B C    4  
ATOM 10561 O O    . GLU B 1 22 ? -16.826 -16.144 2.130   1.00 0.00 ? 21 GLU B O    4  
ATOM 10562 C CB   . GLU B 1 22 ? -19.781 -14.615 1.790   1.00 0.00 ? 21 GLU B CB   4  
ATOM 10563 C CG   . GLU B 1 22 ? -20.197 -15.941 1.138   1.00 0.00 ? 21 GLU B CG   4  
ATOM 10564 C CD   . GLU B 1 22 ? -20.861 -15.669 -0.214  1.00 0.00 ? 21 GLU B CD   4  
ATOM 10565 O OE1  . GLU B 1 22 ? -21.308 -14.553 -0.419  1.00 0.00 ? 21 GLU B OE1  4  
ATOM 10566 O OE2  . GLU B 1 22 ? -20.911 -16.582 -1.022  1.00 0.00 ? 21 GLU B OE2  4  
ATOM 10567 H H    . GLU B 1 22 ? -18.072 -12.971 3.670   1.00 0.00 ? 21 GLU B H    4  
ATOM 10568 H HA   . GLU B 1 22 ? -18.959 -15.780 3.413   1.00 0.00 ? 21 GLU B HA   4  
ATOM 10569 H HB2  . GLU B 1 22 ? -20.645 -14.153 2.246   1.00 0.00 ? 21 GLU B HB2  4  
ATOM 10570 H HB3  . GLU B 1 22 ? -19.377 -13.954 1.037   1.00 0.00 ? 21 GLU B HB3  4  
ATOM 10571 H HG2  . GLU B 1 22 ? -19.324 -16.561 0.992   1.00 0.00 ? 21 GLU B HG2  4  
ATOM 10572 H HG3  . GLU B 1 22 ? -20.896 -16.453 1.782   1.00 0.00 ? 21 GLU B HG3  4  
ATOM 10573 N N    . GLY B 1 23 ? -16.739 -13.976 1.779   1.00 0.00 ? 22 GLY B N    4  
ATOM 10574 C CA   . GLY B 1 23 ? -15.389 -14.077 1.149   1.00 0.00 ? 22 GLY B CA   4  
ATOM 10575 C C    . GLY B 1 23 ? -15.349 -15.257 0.177   1.00 0.00 ? 22 GLY B C    4  
ATOM 10576 O O    . GLY B 1 23 ? -14.291 -15.733 -0.184  1.00 0.00 ? 22 GLY B O    4  
ATOM 10577 H H    . GLY B 1 23 ? -17.170 -13.100 1.865   1.00 0.00 ? 22 GLY B H    4  
ATOM 10578 H HA2  . GLY B 1 23 ? -15.174 -13.162 0.615   1.00 0.00 ? 22 GLY B HA2  4  
ATOM 10579 H HA3  . GLY B 1 23 ? -14.646 -14.226 1.918   1.00 0.00 ? 22 GLY B HA3  4  
ATOM 10580 N N    . ASP B 1 24 ? -16.486 -15.732 -0.262  1.00 0.00 ? 23 ASP B N    4  
ATOM 10581 C CA   . ASP B 1 24 ? -16.483 -16.875 -1.222  1.00 0.00 ? 23 ASP B CA   4  
ATOM 10582 C C    . ASP B 1 24 ? -15.504 -16.545 -2.353  1.00 0.00 ? 23 ASP B C    4  
ATOM 10583 O O    . ASP B 1 24 ? -14.575 -17.280 -2.618  1.00 0.00 ? 23 ASP B O    4  
ATOM 10584 C CB   . ASP B 1 24 ? -17.891 -17.074 -1.795  1.00 0.00 ? 23 ASP B CB   4  
ATOM 10585 C CG   . ASP B 1 24 ? -17.846 -18.085 -2.944  1.00 0.00 ? 23 ASP B CG   4  
ATOM 10586 O OD1  . ASP B 1 24 ? -17.811 -19.271 -2.663  1.00 0.00 ? 23 ASP B OD1  4  
ATOM 10587 O OD2  . ASP B 1 24 ? -17.847 -17.654 -4.085  1.00 0.00 ? 23 ASP B OD2  4  
ATOM 10588 H H    . ASP B 1 24 ? -17.331 -15.341 0.044   1.00 0.00 ? 23 ASP B H    4  
ATOM 10589 H HA   . ASP B 1 24 ? -16.164 -17.775 -0.716  1.00 0.00 ? 23 ASP B HA   4  
ATOM 10590 H HB2  . ASP B 1 24 ? -18.545 -17.443 -1.020  1.00 0.00 ? 23 ASP B HB2  4  
ATOM 10591 H HB3  . ASP B 1 24 ? -18.266 -16.131 -2.164  1.00 0.00 ? 23 ASP B HB3  4  
ATOM 10592 N N    . LYS B 1 25 ? -15.688 -15.423 -2.997  1.00 0.00 ? 24 LYS B N    4  
ATOM 10593 C CA   . LYS B 1 25 ? -14.748 -15.019 -4.083  1.00 0.00 ? 24 LYS B CA   4  
ATOM 10594 C C    . LYS B 1 25 ? -13.632 -14.175 -3.459  1.00 0.00 ? 24 LYS B C    4  
ATOM 10595 O O    . LYS B 1 25 ? -13.771 -13.659 -2.368  1.00 0.00 ? 24 LYS B O    4  
ATOM 10596 C CB   . LYS B 1 25 ? -15.497 -14.185 -5.133  1.00 0.00 ? 24 LYS B CB   4  
ATOM 10597 C CG   . LYS B 1 25 ? -16.292 -15.107 -6.069  1.00 0.00 ? 24 LYS B CG   4  
ATOM 10598 C CD   . LYS B 1 25 ? -16.850 -14.301 -7.252  1.00 0.00 ? 24 LYS B CD   4  
ATOM 10599 C CE   . LYS B 1 25 ? -18.058 -13.472 -6.804  1.00 0.00 ? 24 LYS B CE   4  
ATOM 10600 N NZ   . LYS B 1 25 ? -18.713 -12.870 -7.999  1.00 0.00 ? 24 LYS B NZ   4  
ATOM 10601 H H    . LYS B 1 25 ? -16.430 -14.833 -2.749  1.00 0.00 ? 24 LYS B H    4  
ATOM 10602 H HA   . LYS B 1 25 ? -14.323 -15.899 -4.545  1.00 0.00 ? 24 LYS B HA   4  
ATOM 10603 H HB2  . LYS B 1 25 ? -16.174 -13.510 -4.631  1.00 0.00 ? 24 LYS B HB2  4  
ATOM 10604 H HB3  . LYS B 1 25 ? -14.785 -13.614 -5.712  1.00 0.00 ? 24 LYS B HB3  4  
ATOM 10605 H HG2  . LYS B 1 25 ? -15.644 -15.885 -6.444  1.00 0.00 ? 24 LYS B HG2  4  
ATOM 10606 H HG3  . LYS B 1 25 ? -17.109 -15.554 -5.523  1.00 0.00 ? 24 LYS B HG3  4  
ATOM 10607 H HD2  . LYS B 1 25 ? -16.084 -13.641 -7.633  1.00 0.00 ? 24 LYS B HD2  4  
ATOM 10608 H HD3  . LYS B 1 25 ? -17.155 -14.980 -8.033  1.00 0.00 ? 24 LYS B HD3  4  
ATOM 10609 H HE2  . LYS B 1 25 ? -18.764 -14.107 -6.290  1.00 0.00 ? 24 LYS B HE2  4  
ATOM 10610 H HE3  . LYS B 1 25 ? -17.732 -12.685 -6.141  1.00 0.00 ? 24 LYS B HE3  4  
ATOM 10611 H HZ1  . LYS B 1 25 ? -18.124 -13.041 -8.840  1.00 0.00 ? 24 LYS B HZ1  4  
ATOM 10612 H HZ2  . LYS B 1 25 ? -19.649 -13.301 -8.137  1.00 0.00 ? 24 LYS B HZ2  4  
ATOM 10613 H HZ3  . LYS B 1 25 ? -18.825 -11.846 -7.855  1.00 0.00 ? 24 LYS B HZ3  4  
ATOM 10614 N N    . HIS B 1 26 ? -12.541 -14.008 -4.160  1.00 0.00 ? 25 HIS B N    4  
ATOM 10615 C CA   . HIS B 1 26 ? -11.412 -13.170 -3.644  1.00 0.00 ? 25 HIS B CA   4  
ATOM 10616 C C    . HIS B 1 26 ? -11.331 -11.924 -4.523  1.00 0.00 ? 25 HIS B C    4  
ATOM 10617 O O    . HIS B 1 26 ? -10.268 -11.512 -4.944  1.00 0.00 ? 25 HIS B O    4  
ATOM 10618 C CB   . HIS B 1 26 ? -10.104 -13.957 -3.750  1.00 0.00 ? 25 HIS B CB   4  
ATOM 10619 C CG   . HIS B 1 26 ? -9.888  -14.382 -5.176  1.00 0.00 ? 25 HIS B CG   4  
ATOM 10620 N ND1  . HIS B 1 26 ? -10.648 -15.375 -5.775  1.00 0.00 ? 25 HIS B ND1  4  
ATOM 10621 C CD2  . HIS B 1 26 ? -9.002  -13.960 -6.136  1.00 0.00 ? 25 HIS B CD2  4  
ATOM 10622 C CE1  . HIS B 1 26 ? -10.209 -15.515 -7.039  1.00 0.00 ? 25 HIS B CE1  4  
ATOM 10623 N NE2  . HIS B 1 26 ? -9.206  -14.677 -7.311  1.00 0.00 ? 25 HIS B NE2  4  
ATOM 10624 H H    . HIS B 1 26 ? -12.470 -14.418 -5.046  1.00 0.00 ? 25 HIS B H    4  
ATOM 10625 H HA   . HIS B 1 26 ? -11.587 -12.882 -2.616  1.00 0.00 ? 25 HIS B HA   4  
ATOM 10626 H HB2  . HIS B 1 26 ? -9.282  -13.333 -3.431  1.00 0.00 ? 25 HIS B HB2  4  
ATOM 10627 H HB3  . HIS B 1 26 ? -10.159 -14.831 -3.119  1.00 0.00 ? 25 HIS B HB3  4  
ATOM 10628 H HD1  . HIS B 1 26 ? -11.373 -15.882 -5.354  1.00 0.00 ? 25 HIS B HD1  4  
ATOM 10629 H HD2  . HIS B 1 26 ? -8.260  -13.187 -5.999  1.00 0.00 ? 25 HIS B HD2  4  
ATOM 10630 H HE1  . HIS B 1 26 ? -10.619 -16.220 -7.747  1.00 0.00 ? 25 HIS B HE1  4  
ATOM 10631 N N    . LYS B 1 27 ? -12.461 -11.322 -4.798  1.00 0.00 ? 26 LYS B N    4  
ATOM 10632 C CA   . LYS B 1 27 ? -12.491 -10.095 -5.647  1.00 0.00 ? 26 LYS B CA   4  
ATOM 10633 C C    . LYS B 1 27 ? -13.394 -9.043  -4.996  1.00 0.00 ? 26 LYS B C    4  
ATOM 10634 O O    . LYS B 1 27 ? -14.321 -9.376  -4.284  1.00 0.00 ? 26 LYS B O    4  
ATOM 10635 C CB   . LYS B 1 27 ? -13.046 -10.453 -7.026  1.00 0.00 ? 26 LYS B CB   4  
ATOM 10636 C CG   . LYS B 1 27 ? -12.097 -11.436 -7.715  1.00 0.00 ? 26 LYS B CG   4  
ATOM 10637 C CD   . LYS B 1 27 ? -12.668 -11.834 -9.076  1.00 0.00 ? 26 LYS B CD   4  
ATOM 10638 C CE   . LYS B 1 27 ? -11.641 -12.680 -9.830  1.00 0.00 ? 26 LYS B CE   4  
ATOM 10639 N NZ   . LYS B 1 27 ? -12.103 -12.893 -11.231 1.00 0.00 ? 26 LYS B NZ   4  
ATOM 10640 H H    . LYS B 1 27 ? -13.297 -11.685 -4.445  1.00 0.00 ? 26 LYS B H    4  
ATOM 10641 H HA   . LYS B 1 27 ? -11.493 -9.701  -5.758  1.00 0.00 ? 26 LYS B HA   4  
ATOM 10642 H HB2  . LYS B 1 27 ? -14.020 -10.907 -6.915  1.00 0.00 ? 26 LYS B HB2  4  
ATOM 10643 H HB3  . LYS B 1 27 ? -13.130 -9.559  -7.623  1.00 0.00 ? 26 LYS B HB3  4  
ATOM 10644 H HG2  . LYS B 1 27 ? -11.132 -10.969 -7.851  1.00 0.00 ? 26 LYS B HG2  4  
ATOM 10645 H HG3  . LYS B 1 27 ? -11.985 -12.318 -7.102  1.00 0.00 ? 26 LYS B HG3  4  
ATOM 10646 H HD2  . LYS B 1 27 ? -13.573 -12.408 -8.932  1.00 0.00 ? 26 LYS B HD2  4  
ATOM 10647 H HD3  . LYS B 1 27 ? -12.891 -10.946 -9.648  1.00 0.00 ? 26 LYS B HD3  4  
ATOM 10648 H HE2  . LYS B 1 27 ? -10.690 -12.168 -9.839  1.00 0.00 ? 26 LYS B HE2  4  
ATOM 10649 H HE3  . LYS B 1 27 ? -11.530 -13.635 -9.339  1.00 0.00 ? 26 LYS B HE3  4  
ATOM 10650 H HZ1  . LYS B 1 27 ? -12.921 -12.281 -11.424 1.00 0.00 ? 26 LYS B HZ1  4  
ATOM 10651 H HZ2  . LYS B 1 27 ? -11.334 -12.658 -11.890 1.00 0.00 ? 26 LYS B HZ2  4  
ATOM 10652 H HZ3  . LYS B 1 27 ? -12.377 -13.889 -11.357 1.00 0.00 ? 26 LYS B HZ3  4  
ATOM 10653 N N    . LEU B 1 28 ? -13.137 -7.779  -5.236  1.00 0.00 ? 27 LEU B N    4  
ATOM 10654 C CA   . LEU B 1 28 ? -13.985 -6.694  -4.636  1.00 0.00 ? 27 LEU B CA   4  
ATOM 10655 C C    . LEU B 1 28 ? -14.537 -5.834  -5.771  1.00 0.00 ? 27 LEU B C    4  
ATOM 10656 O O    . LEU B 1 28 ? -13.858 -5.572  -6.743  1.00 0.00 ? 27 LEU B O    4  
ATOM 10657 C CB   . LEU B 1 28 ? -13.124 -5.837  -3.701  1.00 0.00 ? 27 LEU B CB   4  
ATOM 10658 C CG   . LEU B 1 28 ? -13.989 -4.782  -2.996  1.00 0.00 ? 27 LEU B CG   4  
ATOM 10659 C CD1  . LEU B 1 28 ? -15.025 -5.461  -2.076  1.00 0.00 ? 27 LEU B CD1  4  
ATOM 10660 C CD2  . LEU B 1 28 ? -13.077 -3.874  -2.163  1.00 0.00 ? 27 LEU B CD2  4  
ATOM 10661 H H    . LEU B 1 28 ? -12.385 -7.538  -5.819  1.00 0.00 ? 27 LEU B H    4  
ATOM 10662 H HA   . LEU B 1 28 ? -14.807 -7.125  -4.083  1.00 0.00 ? 27 LEU B HA   4  
ATOM 10663 H HB2  . LEU B 1 28 ? -12.659 -6.473  -2.962  1.00 0.00 ? 27 LEU B HB2  4  
ATOM 10664 H HB3  . LEU B 1 28 ? -12.357 -5.341  -4.278  1.00 0.00 ? 27 LEU B HB3  4  
ATOM 10665 H HG   . LEU B 1 28 ? -14.505 -4.190  -3.738  1.00 0.00 ? 27 LEU B HG   4  
ATOM 10666 H HD11 . LEU B 1 28 ? -14.611 -6.369  -1.664  1.00 0.00 ? 27 LEU B HD11 4  
ATOM 10667 H HD12 . LEU B 1 28 ? -15.291 -4.791  -1.268  1.00 0.00 ? 27 LEU B HD12 4  
ATOM 10668 H HD13 . LEU B 1 28 ? -15.911 -5.696  -2.646  1.00 0.00 ? 27 LEU B HD13 4  
ATOM 10669 H HD21 . LEU B 1 28 ? -12.326 -3.434  -2.803  1.00 0.00 ? 27 LEU B HD21 4  
ATOM 10670 H HD22 . LEU B 1 28 ? -13.666 -3.092  -1.709  1.00 0.00 ? 27 LEU B HD22 4  
ATOM 10671 H HD23 . LEU B 1 28 ? -12.596 -4.457  -1.391  1.00 0.00 ? 27 LEU B HD23 4  
ATOM 10672 N N    . LYS B 1 29 ? -15.770 -5.403  -5.674  1.00 0.00 ? 28 LYS B N    4  
ATOM 10673 C CA   . LYS B 1 29 ? -16.356 -4.574  -6.771  1.00 0.00 ? 28 LYS B CA   4  
ATOM 10674 C C    . LYS B 1 29 ? -16.074 -3.091  -6.501  1.00 0.00 ? 28 LYS B C    4  
ATOM 10675 O O    . LYS B 1 29 ? -15.918 -2.680  -5.369  1.00 0.00 ? 28 LYS B O    4  
ATOM 10676 C CB   . LYS B 1 29 ? -17.867 -4.813  -6.830  1.00 0.00 ? 28 LYS B CB   4  
ATOM 10677 C CG   . LYS B 1 29 ? -18.435 -4.229  -8.123  1.00 0.00 ? 28 LYS B CG   4  
ATOM 10678 C CD   . LYS B 1 29 ? -19.902 -4.643  -8.267  1.00 0.00 ? 28 LYS B CD   4  
ATOM 10679 C CE   . LYS B 1 29 ? -20.548 -3.860  -9.412  1.00 0.00 ? 28 LYS B CE   4  
ATOM 10680 N NZ   . LYS B 1 29 ? -19.978 -4.318  -10.710 1.00 0.00 ? 28 LYS B NZ   4  
ATOM 10681 H H    . LYS B 1 29 ? -16.310 -5.632  -4.890  1.00 0.00 ? 28 LYS B H    4  
ATOM 10682 H HA   . LYS B 1 29 ? -15.902 -4.878  -7.705  1.00 0.00 ? 28 LYS B HA   4  
ATOM 10683 H HB2  . LYS B 1 29 ? -18.063 -5.875  -6.798  1.00 0.00 ? 28 LYS B HB2  4  
ATOM 10684 H HB3  . LYS B 1 29 ? -18.339 -4.335  -5.985  1.00 0.00 ? 28 LYS B HB3  4  
ATOM 10685 H HG2  . LYS B 1 29 ? -18.366 -3.153  -8.089  1.00 0.00 ? 28 LYS B HG2  4  
ATOM 10686 H HG3  . LYS B 1 29 ? -17.872 -4.601  -8.966  1.00 0.00 ? 28 LYS B HG3  4  
ATOM 10687 H HD2  . LYS B 1 29 ? -19.957 -5.702  -8.478  1.00 0.00 ? 28 LYS B HD2  4  
ATOM 10688 H HD3  . LYS B 1 29 ? -20.427 -4.431  -7.348  1.00 0.00 ? 28 LYS B HD3  4  
ATOM 10689 H HE2  . LYS B 1 29 ? -21.614 -4.031  -9.407  1.00 0.00 ? 28 LYS B HE2  4  
ATOM 10690 H HE3  . LYS B 1 29 ? -20.351 -2.806  -9.284  1.00 0.00 ? 28 LYS B HE3  4  
ATOM 10691 H HZ1  . LYS B 1 29 ? -19.340 -5.123  -10.543 1.00 0.00 ? 28 LYS B HZ1  4  
ATOM 10692 H HZ2  . LYS B 1 29 ? -20.749 -4.612  -11.342 1.00 0.00 ? 28 LYS B HZ2  4  
ATOM 10693 H HZ3  . LYS B 1 29 ? -19.449 -3.540  -11.151 1.00 0.00 ? 28 LYS B HZ3  4  
ATOM 10694 N N    . LYS B 1 30 ? -16.011 -2.284  -7.525  1.00 0.00 ? 29 LYS B N    4  
ATOM 10695 C CA   . LYS B 1 30 ? -15.743 -0.830  -7.323  1.00 0.00 ? 29 LYS B CA   4  
ATOM 10696 C C    . LYS B 1 30 ? -16.865 -0.199  -6.487  1.00 0.00 ? 29 LYS B C    4  
ATOM 10697 O O    . LYS B 1 30 ? -16.630 0.647   -5.648  1.00 0.00 ? 29 LYS B O    4  
ATOM 10698 C CB   . LYS B 1 30 ? -15.686 -0.139  -8.696  1.00 0.00 ? 29 LYS B CB   4  
ATOM 10699 C CG   . LYS B 1 30 ? -17.001 -0.380  -9.489  1.00 0.00 ? 29 LYS B CG   4  
ATOM 10700 C CD   . LYS B 1 30 ? -17.896 0.867   -9.447  1.00 0.00 ? 29 LYS B CD   4  
ATOM 10701 C CE   . LYS B 1 30 ? -19.165 0.606   -10.259 1.00 0.00 ? 29 LYS B CE   4  
ATOM 10702 N NZ   . LYS B 1 30 ? -20.057 1.798   -10.183 1.00 0.00 ? 29 LYS B NZ   4  
ATOM 10703 H H    . LYS B 1 30 ? -16.138 -2.628  -8.434  1.00 0.00 ? 29 LYS B H    4  
ATOM 10704 H HA   . LYS B 1 30 ? -14.795 -0.692  -6.824  1.00 0.00 ? 29 LYS B HA   4  
ATOM 10705 H HB2  . LYS B 1 30 ? -15.528 0.921   -8.553  1.00 0.00 ? 29 LYS B HB2  4  
ATOM 10706 H HB3  . LYS B 1 30 ? -14.853 -0.545  -9.255  1.00 0.00 ? 29 LYS B HB3  4  
ATOM 10707 H HG2  . LYS B 1 30 ? -16.766 -0.603  -10.518 1.00 0.00 ? 29 LYS B HG2  4  
ATOM 10708 H HG3  . LYS B 1 30 ? -17.539 -1.215  -9.068  1.00 0.00 ? 29 LYS B HG3  4  
ATOM 10709 H HD2  . LYS B 1 30 ? -18.160 1.091   -8.424  1.00 0.00 ? 29 LYS B HD2  4  
ATOM 10710 H HD3  . LYS B 1 30 ? -17.365 1.704   -9.873  1.00 0.00 ? 29 LYS B HD3  4  
ATOM 10711 H HE2  . LYS B 1 30 ? -18.901 0.419   -11.289 1.00 0.00 ? 29 LYS B HE2  4  
ATOM 10712 H HE3  . LYS B 1 30 ? -19.679 -0.255  -9.857  1.00 0.00 ? 29 LYS B HE3  4  
ATOM 10713 H HZ1  . LYS B 1 30 ? -19.493 2.662   -10.307 1.00 0.00 ? 29 LYS B HZ1  4  
ATOM 10714 H HZ2  . LYS B 1 30 ? -20.774 1.744   -10.934 1.00 0.00 ? 29 LYS B HZ2  4  
ATOM 10715 H HZ3  . LYS B 1 30 ? -20.528 1.820   -9.254  1.00 0.00 ? 29 LYS B HZ3  4  
ATOM 10716 N N    . SER B 1 31 ? -18.082 -0.591  -6.733  1.00 0.00 ? 30 SER B N    4  
ATOM 10717 C CA   . SER B 1 31 ? -19.235 -0.009  -5.986  1.00 0.00 ? 30 SER B CA   4  
ATOM 10718 C C    . SER B 1 31 ? -19.093 -0.245  -4.477  1.00 0.00 ? 30 SER B C    4  
ATOM 10719 O O    . SER B 1 31 ? -19.373 0.627   -3.669  1.00 0.00 ? 30 SER B O    4  
ATOM 10720 C CB   . SER B 1 31 ? -20.525 -0.671  -6.471  1.00 0.00 ? 30 SER B CB   4  
ATOM 10721 O OG   . SER B 1 31 ? -20.434 -2.075  -6.274  1.00 0.00 ? 30 SER B OG   4  
ATOM 10722 H H    . SER B 1 31 ? -18.241 -1.254  -7.435  1.00 0.00 ? 30 SER B H    4  
ATOM 10723 H HA   . SER B 1 31 ? -19.292 1.051   -6.184  1.00 0.00 ? 30 SER B HA   4  
ATOM 10724 H HB2  . SER B 1 31 ? -21.361 -0.287  -5.910  1.00 0.00 ? 30 SER B HB2  4  
ATOM 10725 H HB3  . SER B 1 31 ? -20.667 -0.452  -7.521  1.00 0.00 ? 30 SER B HB3  4  
ATOM 10726 H HG   . SER B 1 31 ? -20.682 -2.507  -7.095  1.00 0.00 ? 30 SER B HG   4  
ATOM 10727 N N    . GLU B 1 32 ? -18.659 -1.415  -4.083  1.00 0.00 ? 31 GLU B N    4  
ATOM 10728 C CA   . GLU B 1 32 ? -18.520 -1.686  -2.621  1.00 0.00 ? 31 GLU B CA   4  
ATOM 10729 C C    . GLU B 1 32 ? -17.217 -1.068  -2.119  1.00 0.00 ? 31 GLU B C    4  
ATOM 10730 O O    . GLU B 1 32 ? -17.134 -0.579  -1.010  1.00 0.00 ? 31 GLU B O    4  
ATOM 10731 C CB   . GLU B 1 32 ? -18.527 -3.194  -2.357  1.00 0.00 ? 31 GLU B CB   4  
ATOM 10732 C CG   . GLU B 1 32 ? -19.871 -3.783  -2.789  1.00 0.00 ? 31 GLU B CG   4  
ATOM 10733 C CD   . GLU B 1 32 ? -19.781 -5.310  -2.797  1.00 0.00 ? 31 GLU B CD   4  
ATOM 10734 O OE1  . GLU B 1 32 ? -18.673 -5.819  -2.754  1.00 0.00 ? 31 GLU B OE1  4  
ATOM 10735 O OE2  . GLU B 1 32 ? -20.821 -5.945  -2.845  1.00 0.00 ? 31 GLU B OE2  4  
ATOM 10736 H H    . GLU B 1 32 ? -18.424 -2.093  -4.750  1.00 0.00 ? 31 GLU B H    4  
ATOM 10737 H HA   . GLU B 1 32 ? -19.362 -1.219  -2.128  1.00 0.00 ? 31 GLU B HA   4  
ATOM 10738 H HB2  . GLU B 1 32 ? -17.731 -3.661  -2.919  1.00 0.00 ? 31 GLU B HB2  4  
ATOM 10739 H HB3  . GLU B 1 32 ? -18.379 -3.375  -1.303  1.00 0.00 ? 31 GLU B HB3  4  
ATOM 10740 H HG2  . GLU B 1 32 ? -20.640 -3.471  -2.097  1.00 0.00 ? 31 GLU B HG2  4  
ATOM 10741 H HG3  . GLU B 1 32 ? -20.116 -3.434  -3.781  1.00 0.00 ? 31 GLU B HG3  4  
ATOM 10742 N N    . LEU B 1 33 ? -16.202 -1.073  -2.939  1.00 0.00 ? 32 LEU B N    4  
ATOM 10743 C CA   . LEU B 1 33 ? -14.908 -0.471  -2.522  1.00 0.00 ? 32 LEU B CA   4  
ATOM 10744 C C    . LEU B 1 33 ? -15.134 1.015   -2.245  1.00 0.00 ? 32 LEU B C    4  
ATOM 10745 O O    . LEU B 1 33 ? -14.651 1.549   -1.268  1.00 0.00 ? 32 LEU B O    4  
ATOM 10746 C CB   . LEU B 1 33 ? -13.870 -0.660  -3.636  1.00 0.00 ? 32 LEU B CB   4  
ATOM 10747 C CG   . LEU B 1 33 ? -12.596 0.138   -3.328  1.00 0.00 ? 32 LEU B CG   4  
ATOM 10748 C CD1  . LEU B 1 33 ? -12.082 -0.215  -1.928  1.00 0.00 ? 32 LEU B CD1  4  
ATOM 10749 C CD2  . LEU B 1 33 ? -11.525 -0.211  -4.366  1.00 0.00 ? 32 LEU B CD2  4  
ATOM 10750 H H    . LEU B 1 33 ? -16.295 -1.462  -3.833  1.00 0.00 ? 32 LEU B H    4  
ATOM 10751 H HA   . LEU B 1 33 ? -14.569 -0.939  -1.611  1.00 0.00 ? 32 LEU B HA   4  
ATOM 10752 H HB2  . LEU B 1 33 ? -13.624 -1.708  -3.718  1.00 0.00 ? 32 LEU B HB2  4  
ATOM 10753 H HB3  . LEU B 1 33 ? -14.286 -0.317  -4.571  1.00 0.00 ? 32 LEU B HB3  4  
ATOM 10754 H HG   . LEU B 1 33 ? -12.811 1.196   -3.377  1.00 0.00 ? 32 LEU B HG   4  
ATOM 10755 H HD11 . LEU B 1 33 ? -12.171 -1.279  -1.765  1.00 0.00 ? 32 LEU B HD11 4  
ATOM 10756 H HD12 . LEU B 1 33 ? -11.048 0.077   -1.837  1.00 0.00 ? 32 LEU B HD12 4  
ATOM 10757 H HD13 . LEU B 1 33 ? -12.663 0.311   -1.190  1.00 0.00 ? 32 LEU B HD13 4  
ATOM 10758 H HD21 . LEU B 1 33 ? -11.927 -0.074  -5.360  1.00 0.00 ? 32 LEU B HD21 4  
ATOM 10759 H HD22 . LEU B 1 33 ? -10.670 0.434   -4.232  1.00 0.00 ? 32 LEU B HD22 4  
ATOM 10760 H HD23 . LEU B 1 33 ? -11.222 -1.240  -4.239  1.00 0.00 ? 32 LEU B HD23 4  
ATOM 10761 N N    . LYS B 1 34 ? -15.849 1.698   -3.094  1.00 0.00 ? 33 LYS B N    4  
ATOM 10762 C CA   . LYS B 1 34 ? -16.068 3.147   -2.855  1.00 0.00 ? 33 LYS B CA   4  
ATOM 10763 C C    . LYS B 1 34 ? -16.626 3.342   -1.446  1.00 0.00 ? 33 LYS B C    4  
ATOM 10764 O O    . LYS B 1 34 ? -16.087 4.088   -0.652  1.00 0.00 ? 33 LYS B O    4  
ATOM 10765 C CB   . LYS B 1 34 ? -17.059 3.692   -3.890  1.00 0.00 ? 33 LYS B CB   4  
ATOM 10766 C CG   . LYS B 1 34 ? -16.348 3.872   -5.235  1.00 0.00 ? 33 LYS B CG   4  
ATOM 10767 C CD   . LYS B 1 34 ? -17.383 4.092   -6.342  1.00 0.00 ? 33 LYS B CD   4  
ATOM 10768 C CE   . LYS B 1 34 ? -18.318 5.243   -5.958  1.00 0.00 ? 33 LYS B CE   4  
ATOM 10769 N NZ   . LYS B 1 34 ? -19.012 5.745   -7.178  1.00 0.00 ? 33 LYS B NZ   4  
ATOM 10770 H H    . LYS B 1 34 ? -16.227 1.272   -3.889  1.00 0.00 ? 33 LYS B H    4  
ATOM 10771 H HA   . LYS B 1 34 ? -15.124 3.663   -2.949  1.00 0.00 ? 33 LYS B HA   4  
ATOM 10772 H HB2  . LYS B 1 34 ? -17.877 2.995   -4.005  1.00 0.00 ? 33 LYS B HB2  4  
ATOM 10773 H HB3  . LYS B 1 34 ? -17.442 4.644   -3.557  1.00 0.00 ? 33 LYS B HB3  4  
ATOM 10774 H HG2  . LYS B 1 34 ? -15.691 4.728   -5.182  1.00 0.00 ? 33 LYS B HG2  4  
ATOM 10775 H HG3  . LYS B 1 34 ? -15.770 2.988   -5.458  1.00 0.00 ? 33 LYS B HG3  4  
ATOM 10776 H HD2  . LYS B 1 34 ? -16.875 4.335   -7.264  1.00 0.00 ? 33 LYS B HD2  4  
ATOM 10777 H HD3  . LYS B 1 34 ? -17.962 3.191   -6.477  1.00 0.00 ? 33 LYS B HD3  4  
ATOM 10778 H HE2  . LYS B 1 34 ? -19.051 4.890   -5.247  1.00 0.00 ? 33 LYS B HE2  4  
ATOM 10779 H HE3  . LYS B 1 34 ? -17.744 6.045   -5.516  1.00 0.00 ? 33 LYS B HE3  4  
ATOM 10780 H HZ1  . LYS B 1 34 ? -19.318 4.939   -7.759  1.00 0.00 ? 33 LYS B HZ1  4  
ATOM 10781 H HZ2  . LYS B 1 34 ? -19.842 6.304   -6.900  1.00 0.00 ? 33 LYS B HZ2  4  
ATOM 10782 H HZ3  . LYS B 1 34 ? -18.359 6.341   -7.727  1.00 0.00 ? 33 LYS B HZ3  4  
ATOM 10783 N N    . GLU B 1 35 ? -17.715 2.692   -1.135  1.00 0.00 ? 34 GLU B N    4  
ATOM 10784 C CA   . GLU B 1 35 ? -18.314 2.865   0.225   1.00 0.00 ? 34 GLU B CA   4  
ATOM 10785 C C    . GLU B 1 35 ? -17.215 2.743   1.294   1.00 0.00 ? 34 GLU B C    4  
ATOM 10786 O O    . GLU B 1 35 ? -17.256 3.412   2.308   1.00 0.00 ? 34 GLU B O    4  
ATOM 10787 C CB   . GLU B 1 35 ? -19.385 1.798   0.457   1.00 0.00 ? 34 GLU B CB   4  
ATOM 10788 C CG   . GLU B 1 35 ? -20.459 1.909   -0.627  1.00 0.00 ? 34 GLU B CG   4  
ATOM 10789 C CD   . GLU B 1 35 ? -21.215 3.229   -0.463  1.00 0.00 ? 34 GLU B CD   4  
ATOM 10790 O OE1  . GLU B 1 35 ? -22.007 3.324   0.459   1.00 0.00 ? 34 GLU B OE1  4  
ATOM 10791 O OE2  . GLU B 1 35 ? -20.988 4.122   -1.263  1.00 0.00 ? 34 GLU B OE2  4  
ATOM 10792 H H    . GLU B 1 35 ? -18.147 2.119   -1.805  1.00 0.00 ? 34 GLU B H    4  
ATOM 10793 H HA   . GLU B 1 35 ? -18.758 3.847   0.289   1.00 0.00 ? 34 GLU B HA   4  
ATOM 10794 H HB2  . GLU B 1 35 ? -18.931 0.818   0.418   1.00 0.00 ? 34 GLU B HB2  4  
ATOM 10795 H HB3  . GLU B 1 35 ? -19.838 1.947   1.426   1.00 0.00 ? 34 GLU B HB3  4  
ATOM 10796 H HG2  . GLU B 1 35 ? -19.991 1.880   -1.601  1.00 0.00 ? 34 GLU B HG2  4  
ATOM 10797 H HG3  . GLU B 1 35 ? -21.151 1.086   -0.535  1.00 0.00 ? 34 GLU B HG3  4  
ATOM 10798 N N    . LEU B 1 36 ? -16.230 1.912   1.080   1.00 0.00 ? 35 LEU B N    4  
ATOM 10799 C CA   . LEU B 1 36 ? -15.137 1.779   2.094   1.00 0.00 ? 35 LEU B CA   4  
ATOM 10800 C C    . LEU B 1 36 ? -14.319 3.076   2.135   1.00 0.00 ? 35 LEU B C    4  
ATOM 10801 O O    . LEU B 1 36 ? -14.006 3.578   3.196   1.00 0.00 ? 35 LEU B O    4  
ATOM 10802 C CB   . LEU B 1 36 ? -14.233 0.595   1.733   1.00 0.00 ? 35 LEU B CB   4  
ATOM 10803 C CG   . LEU B 1 36 ? -13.127 0.416   2.786   1.00 0.00 ? 35 LEU B CG   4  
ATOM 10804 C CD1  . LEU B 1 36 ? -13.741 0.087   4.159   1.00 0.00 ? 35 LEU B CD1  4  
ATOM 10805 C CD2  . LEU B 1 36 ? -12.207 -0.730  2.348   1.00 0.00 ? 35 LEU B CD2  4  
ATOM 10806 H H    . LEU B 1 36 ? -16.201 1.388   0.252   1.00 0.00 ? 35 LEU B H    4  
ATOM 10807 H HA   . LEU B 1 36 ? -15.561 1.627   3.075   1.00 0.00 ? 35 LEU B HA   4  
ATOM 10808 H HB2  . LEU B 1 36 ? -14.828 -0.306  1.684   1.00 0.00 ? 35 LEU B HB2  4  
ATOM 10809 H HB3  . LEU B 1 36 ? -13.782 0.775   0.773   1.00 0.00 ? 35 LEU B HB3  4  
ATOM 10810 H HG   . LEU B 1 36 ? -12.551 1.327   2.861   1.00 0.00 ? 35 LEU B HG   4  
ATOM 10811 H HD11 . LEU B 1 36 ? -14.624 -0.521  4.025   1.00 0.00 ? 35 LEU B HD11 4  
ATOM 10812 H HD12 . LEU B 1 36 ? -13.023 -0.453  4.762   1.00 0.00 ? 35 LEU B HD12 4  
ATOM 10813 H HD13 . LEU B 1 36 ? -14.008 1.003   4.664   1.00 0.00 ? 35 LEU B HD13 4  
ATOM 10814 H HD21 . LEU B 1 36 ? -12.801 -1.604  2.128   1.00 0.00 ? 35 LEU B HD21 4  
ATOM 10815 H HD22 . LEU B 1 36 ? -11.660 -0.435  1.465   1.00 0.00 ? 35 LEU B HD22 4  
ATOM 10816 H HD23 . LEU B 1 36 ? -11.512 -0.957  3.143   1.00 0.00 ? 35 LEU B HD23 4  
ATOM 10817 N N    . ILE B 1 37 ? -13.985 3.641   1.006   1.00 0.00 ? 36 ILE B N    4  
ATOM 10818 C CA   . ILE B 1 37 ? -13.212 4.918   1.009   1.00 0.00 ? 36 ILE B CA   4  
ATOM 10819 C C    . ILE B 1 37 ? -13.958 5.962   1.845   1.00 0.00 ? 36 ILE B C    4  
ATOM 10820 O O    . ILE B 1 37 ? -13.363 6.766   2.533   1.00 0.00 ? 36 ILE B O    4  
ATOM 10821 C CB   . ILE B 1 37 ? -13.092 5.426   -0.432  1.00 0.00 ? 36 ILE B CB   4  
ATOM 10822 C CG1  . ILE B 1 37 ? -12.591 4.285   -1.326  1.00 0.00 ? 36 ILE B CG1  4  
ATOM 10823 C CG2  . ILE B 1 37 ? -12.095 6.591   -0.485  1.00 0.00 ? 36 ILE B CG2  4  
ATOM 10824 C CD1  . ILE B 1 37 ? -12.268 4.820   -2.723  1.00 0.00 ? 36 ILE B CD1  4  
ATOM 10825 H H    . ILE B 1 37 ? -14.251 3.248   0.149   1.00 0.00 ? 36 ILE B H    4  
ATOM 10826 H HA   . ILE B 1 37 ? -12.216 4.773   1.404   1.00 0.00 ? 36 ILE B HA   4  
ATOM 10827 H HB   . ILE B 1 37 ? -14.058 5.761   -0.779  1.00 0.00 ? 36 ILE B HB   4  
ATOM 10828 H HG12 . ILE B 1 37 ? -11.701 3.854   -0.891  1.00 0.00 ? 36 ILE B HG12 4  
ATOM 10829 H HG13 . ILE B 1 37 ? -13.356 3.526   -1.402  1.00 0.00 ? 36 ILE B HG13 4  
ATOM 10830 H HG21 . ILE B 1 37 ? -12.307 7.284   0.315   1.00 0.00 ? 36 ILE B HG21 4  
ATOM 10831 H HG22 . ILE B 1 37 ? -11.089 6.211   -0.374  1.00 0.00 ? 36 ILE B HG22 4  
ATOM 10832 H HG23 . ILE B 1 37 ? -12.183 7.098   -1.435  1.00 0.00 ? 36 ILE B HG23 4  
ATOM 10833 H HD11 . ILE B 1 37 ? -13.075 5.453   -3.062  1.00 0.00 ? 36 ILE B HD11 4  
ATOM 10834 H HD12 . ILE B 1 37 ? -11.352 5.393   -2.686  1.00 0.00 ? 36 ILE B HD12 4  
ATOM 10835 H HD13 . ILE B 1 37 ? -12.147 3.993   -3.406  1.00 0.00 ? 36 ILE B HD13 4  
ATOM 10836 N N    . ASN B 1 38 ? -15.259 5.971   1.759   1.00 0.00 ? 37 ASN B N    4  
ATOM 10837 C CA   . ASN B 1 38 ? -16.062 6.979   2.511   1.00 0.00 ? 37 ASN B CA   4  
ATOM 10838 C C    . ASN B 1 38 ? -15.935 6.774   4.025   1.00 0.00 ? 37 ASN B C    4  
ATOM 10839 O O    . ASN B 1 38 ? -16.110 7.699   4.792   1.00 0.00 ? 37 ASN B O    4  
ATOM 10840 C CB   . ASN B 1 38 ? -17.533 6.836   2.109   1.00 0.00 ? 37 ASN B CB   4  
ATOM 10841 C CG   . ASN B 1 38 ? -18.390 7.794   2.939   1.00 0.00 ? 37 ASN B CG   4  
ATOM 10842 O OD1  . ASN B 1 38 ? -19.306 7.375   3.617   1.00 0.00 ? 37 ASN B OD1  4  
ATOM 10843 N ND2  . ASN B 1 38 ? -18.131 9.073   2.913   1.00 0.00 ? 37 ASN B ND2  4  
ATOM 10844 H H    . ASN B 1 38 ? -15.712 5.326   1.176   1.00 0.00 ? 37 ASN B H    4  
ATOM 10845 H HA   . ASN B 1 38 ? -15.724 7.968   2.242   1.00 0.00 ? 37 ASN B HA   4  
ATOM 10846 H HB2  . ASN B 1 38 ? -17.644 7.070   1.060   1.00 0.00 ? 37 ASN B HB2  4  
ATOM 10847 H HB3  . ASN B 1 38 ? -17.858 5.822   2.287   1.00 0.00 ? 37 ASN B HB3  4  
ATOM 10848 H HD21 . ASN B 1 38 ? -17.392 9.413   2.366   1.00 0.00 ? 37 ASN B HD21 4  
ATOM 10849 H HD22 . ASN B 1 38 ? -18.675 9.694   3.441   1.00 0.00 ? 37 ASN B HD22 4  
ATOM 10850 N N    . ASN B 1 39 ? -15.662 5.567   4.464   1.00 0.00 ? 38 ASN B N    4  
ATOM 10851 C CA   . ASN B 1 39 ? -15.558 5.293   5.938   1.00 0.00 ? 38 ASN B CA   4  
ATOM 10852 C C    . ASN B 1 39 ? -14.139 4.858   6.319   1.00 0.00 ? 38 ASN B C    4  
ATOM 10853 O O    . ASN B 1 39 ? -13.892 4.501   7.453   1.00 0.00 ? 38 ASN B O    4  
ATOM 10854 C CB   . ASN B 1 39 ? -16.536 4.172   6.301   1.00 0.00 ? 38 ASN B CB   4  
ATOM 10855 C CG   . ASN B 1 39 ? -17.941 4.547   5.824   1.00 0.00 ? 38 ASN B CG   4  
ATOM 10856 O OD1  . ASN B 1 39 ? -18.159 5.642   5.344   1.00 0.00 ? 38 ASN B OD1  4  
ATOM 10857 N ND2  . ASN B 1 39 ? -18.909 3.680   5.937   1.00 0.00 ? 38 ASN B ND2  4  
ATOM 10858 H H    . ASN B 1 39 ? -15.548 4.833   3.824   1.00 0.00 ? 38 ASN B H    4  
ATOM 10859 H HA   . ASN B 1 39 ? -15.818 6.176   6.504   1.00 0.00 ? 38 ASN B HA   4  
ATOM 10860 H HB2  . ASN B 1 39 ? -16.226 3.254   5.824   1.00 0.00 ? 38 ASN B HB2  4  
ATOM 10861 H HB3  . ASN B 1 39 ? -16.547 4.037   7.372   1.00 0.00 ? 38 ASN B HB3  4  
ATOM 10862 H HD21 . ASN B 1 39 ? -18.734 2.797   6.325   1.00 0.00 ? 38 ASN B HD21 4  
ATOM 10863 H HD22 . ASN B 1 39 ? -19.812 3.911   5.634   1.00 0.00 ? 38 ASN B HD22 4  
ATOM 10864 N N    . GLU B 1 40 ? -13.207 4.870   5.393   1.00 0.00 ? 39 GLU B N    4  
ATOM 10865 C CA   . GLU B 1 40 ? -11.805 4.439   5.724   1.00 0.00 ? 39 GLU B CA   4  
ATOM 10866 C C    . GLU B 1 40 ? -10.818 5.579   5.463   1.00 0.00 ? 39 GLU B C    4  
ATOM 10867 O O    . GLU B 1 40 ? -9.793  5.671   6.109   1.00 0.00 ? 39 GLU B O    4  
ATOM 10868 C CB   . GLU B 1 40 ? -11.429 3.244   4.844   1.00 0.00 ? 39 GLU B CB   4  
ATOM 10869 C CG   . GLU B 1 40 ? -10.167 2.578   5.396   1.00 0.00 ? 39 GLU B CG   4  
ATOM 10870 C CD   . GLU B 1 40 ? -10.505 1.843   6.695   1.00 0.00 ? 39 GLU B CD   4  
ATOM 10871 O OE1  . GLU B 1 40 ? -10.858 0.678   6.618   1.00 0.00 ? 39 GLU B OE1  4  
ATOM 10872 O OE2  . GLU B 1 40 ? -10.407 2.458   7.743   1.00 0.00 ? 39 GLU B OE2  4  
ATOM 10873 H H    . GLU B 1 40 ? -13.429 5.154   4.482   1.00 0.00 ? 39 GLU B H    4  
ATOM 10874 H HA   . GLU B 1 40 ? -11.736 4.147   6.763   1.00 0.00 ? 39 GLU B HA   4  
ATOM 10875 H HB2  . GLU B 1 40 ? -12.241 2.532   4.842   1.00 0.00 ? 39 GLU B HB2  4  
ATOM 10876 H HB3  . GLU B 1 40 ? -11.244 3.582   3.836   1.00 0.00 ? 39 GLU B HB3  4  
ATOM 10877 H HG2  . GLU B 1 40 ? -9.786  1.874   4.671   1.00 0.00 ? 39 GLU B HG2  4  
ATOM 10878 H HG3  . GLU B 1 40 ? -9.420  3.331   5.595   1.00 0.00 ? 39 GLU B HG3  4  
ATOM 10879 N N    . LEU B 1 41 ? -11.120 6.454   4.534   1.00 0.00 ? 40 LEU B N    4  
ATOM 10880 C CA   . LEU B 1 41 ? -10.201 7.603   4.233   1.00 0.00 ? 40 LEU B CA   4  
ATOM 10881 C C    . LEU B 1 41 ? -10.939 8.916   4.525   1.00 0.00 ? 40 LEU B C    4  
ATOM 10882 O O    . LEU B 1 41 ? -10.610 9.960   3.996   1.00 0.00 ? 40 LEU B O    4  
ATOM 10883 C CB   . LEU B 1 41 ? -9.783  7.544   2.745   1.00 0.00 ? 40 LEU B CB   4  
ATOM 10884 C CG   . LEU B 1 41 ? -8.426  6.835   2.597   1.00 0.00 ? 40 LEU B CG   4  
ATOM 10885 C CD1  . LEU B 1 41 ? -8.493  5.431   3.217   1.00 0.00 ? 40 LEU B CD1  4  
ATOM 10886 C CD2  . LEU B 1 41 ? -8.074  6.725   1.110   1.00 0.00 ? 40 LEU B CD2  4  
ATOM 10887 H H    . LEU B 1 41 ? -11.957 6.361   4.035   1.00 0.00 ? 40 LEU B H    4  
ATOM 10888 H HA   . LEU B 1 41 ? -9.320  7.554   4.862   1.00 0.00 ? 40 LEU B HA   4  
ATOM 10889 H HB2  . LEU B 1 41 ? -10.531 6.998   2.188   1.00 0.00 ? 40 LEU B HB2  4  
ATOM 10890 H HB3  . LEU B 1 41 ? -9.702  8.545   2.343   1.00 0.00 ? 40 LEU B HB3  4  
ATOM 10891 H HG   . LEU B 1 41 ? -7.666  7.412   3.104   1.00 0.00 ? 40 LEU B HG   4  
ATOM 10892 H HD11 . LEU B 1 41 ? -9.458  4.989   3.016   1.00 0.00 ? 40 LEU B HD11 4  
ATOM 10893 H HD12 . LEU B 1 41 ? -7.716  4.809   2.795   1.00 0.00 ? 40 LEU B HD12 4  
ATOM 10894 H HD13 . LEU B 1 41 ? -8.346  5.505   4.284   1.00 0.00 ? 40 LEU B HD13 4  
ATOM 10895 H HD21 . LEU B 1 41 ? -8.052  7.712   0.672   1.00 0.00 ? 40 LEU B HD21 4  
ATOM 10896 H HD22 . LEU B 1 41 ? -7.104  6.263   1.004   1.00 0.00 ? 40 LEU B HD22 4  
ATOM 10897 H HD23 . LEU B 1 41 ? -8.817  6.124   0.607   1.00 0.00 ? 40 LEU B HD23 4  
ATOM 10898 N N    . SER B 1 42 ? -11.932 8.865   5.371   1.00 0.00 ? 41 SER B N    4  
ATOM 10899 C CA   . SER B 1 42 ? -12.695 10.098  5.711   1.00 0.00 ? 41 SER B CA   4  
ATOM 10900 C C    . SER B 1 42 ? -11.816 11.029  6.549   1.00 0.00 ? 41 SER B C    4  
ATOM 10901 O O    . SER B 1 42 ? -12.003 12.229  6.560   1.00 0.00 ? 41 SER B O    4  
ATOM 10902 C CB   . SER B 1 42 ? -13.940 9.720   6.513   1.00 0.00 ? 41 SER B CB   4  
ATOM 10903 O OG   . SER B 1 42 ? -14.634 10.903  6.887   1.00 0.00 ? 41 SER B OG   4  
ATOM 10904 H H    . SER B 1 42 ? -12.174 8.012   5.787   1.00 0.00 ? 41 SER B H    4  
ATOM 10905 H HA   . SER B 1 42 ? -12.991 10.605  4.804   1.00 0.00 ? 41 SER B HA   4  
ATOM 10906 H HB2  . SER B 1 42 ? -14.586 9.105   5.909   1.00 0.00 ? 41 SER B HB2  4  
ATOM 10907 H HB3  . SER B 1 42 ? -13.643 9.169   7.396   1.00 0.00 ? 41 SER B HB3  4  
ATOM 10908 H HG   . SER B 1 42 ? -13.986 11.547  7.182   1.00 0.00 ? 41 SER B HG   4  
ATOM 10909 N N    . HIS B 1 43 ? -10.858 10.488  7.250   1.00 0.00 ? 42 HIS B N    4  
ATOM 10910 C CA   . HIS B 1 43 ? -9.969  11.346  8.082   1.00 0.00 ? 42 HIS B CA   4  
ATOM 10911 C C    . HIS B 1 43 ? -9.008  12.114  7.172   1.00 0.00 ? 42 HIS B C    4  
ATOM 10912 O O    . HIS B 1 43 ? -8.764  13.289  7.359   1.00 0.00 ? 42 HIS B O    4  
ATOM 10913 C CB   . HIS B 1 43 ? -9.171  10.465  9.045   1.00 0.00 ? 42 HIS B CB   4  
ATOM 10914 C CG   . HIS B 1 43 ? -8.363  11.334  9.969   1.00 0.00 ? 42 HIS B CG   4  
ATOM 10915 N ND1  . HIS B 1 43 ? -8.954  12.179  10.894  1.00 0.00 ? 42 HIS B ND1  4  
ATOM 10916 C CD2  . HIS B 1 43 ? -7.008  11.497  10.125  1.00 0.00 ? 42 HIS B CD2  4  
ATOM 10917 C CE1  . HIS B 1 43 ? -7.967  12.808  11.558  1.00 0.00 ? 42 HIS B CE1  4  
ATOM 10918 N NE2  . HIS B 1 43 ? -6.761  12.428  11.128  1.00 0.00 ? 42 HIS B NE2  4  
ATOM 10919 H H    . HIS B 1 43 ? -10.714 9.518   7.225   1.00 0.00 ? 42 HIS B H    4  
ATOM 10920 H HA   . HIS B 1 43 ? -10.568 12.046  8.645   1.00 0.00 ? 42 HIS B HA   4  
ATOM 10921 H HB2  . HIS B 1 43 ? -9.851  9.858   9.624   1.00 0.00 ? 42 HIS B HB2  4  
ATOM 10922 H HB3  . HIS B 1 43 ? -8.508  9.825   8.482   1.00 0.00 ? 42 HIS B HB3  4  
ATOM 10923 H HD1  . HIS B 1 43 ? -9.916  12.299  11.038  1.00 0.00 ? 42 HIS B HD1  4  
ATOM 10924 H HD2  . HIS B 1 43 ? -6.250  10.981  9.554   1.00 0.00 ? 42 HIS B HD2  4  
ATOM 10925 H HE1  . HIS B 1 43 ? -8.131  13.532  12.343  1.00 0.00 ? 42 HIS B HE1  4  
ATOM 10926 N N    . PHE B 1 44 ? -8.459  11.456  6.187   1.00 0.00 ? 43 PHE B N    4  
ATOM 10927 C CA   . PHE B 1 44 ? -7.513  12.144  5.264   1.00 0.00 ? 43 PHE B CA   4  
ATOM 10928 C C    . PHE B 1 44 ? -8.281  13.144  4.396   1.00 0.00 ? 43 PHE B C    4  
ATOM 10929 O O    . PHE B 1 44 ? -7.723  14.090  3.876   1.00 0.00 ? 43 PHE B O    4  
ATOM 10930 C CB   . PHE B 1 44 ? -6.829  11.108  4.369   1.00 0.00 ? 43 PHE B CB   4  
ATOM 10931 C CG   . PHE B 1 44 ? -5.842  10.305  5.186   1.00 0.00 ? 43 PHE B CG   4  
ATOM 10932 C CD1  . PHE B 1 44 ? -4.614  10.870  5.552   1.00 0.00 ? 43 PHE B CD1  4  
ATOM 10933 C CD2  . PHE B 1 44 ? -6.153  8.996   5.576   1.00 0.00 ? 43 PHE B CD2  4  
ATOM 10934 C CE1  . PHE B 1 44 ? -3.698  10.127  6.308   1.00 0.00 ? 43 PHE B CE1  4  
ATOM 10935 C CE2  . PHE B 1 44 ? -5.237  8.254   6.331   1.00 0.00 ? 43 PHE B CE2  4  
ATOM 10936 C CZ   . PHE B 1 44 ? -4.010  8.819   6.697   1.00 0.00 ? 43 PHE B CZ   4  
ATOM 10937 H H    . PHE B 1 44 ? -8.669  10.508  6.054   1.00 0.00 ? 43 PHE B H    4  
ATOM 10938 H HA   . PHE B 1 44 ? -6.766  12.669  5.842   1.00 0.00 ? 43 PHE B HA   4  
ATOM 10939 H HB2  . PHE B 1 44 ? -7.575  10.447  3.950   1.00 0.00 ? 43 PHE B HB2  4  
ATOM 10940 H HB3  . PHE B 1 44 ? -6.307  11.612  3.569   1.00 0.00 ? 43 PHE B HB3  4  
ATOM 10941 H HD1  . PHE B 1 44 ? -4.373  11.879  5.253   1.00 0.00 ? 43 PHE B HD1  4  
ATOM 10942 H HD2  . PHE B 1 44 ? -7.100  8.559   5.294   1.00 0.00 ? 43 PHE B HD2  4  
ATOM 10943 H HE1  . PHE B 1 44 ? -2.751  10.563  6.589   1.00 0.00 ? 43 PHE B HE1  4  
ATOM 10944 H HE2  . PHE B 1 44 ? -5.478  7.245   6.632   1.00 0.00 ? 43 PHE B HE2  4  
ATOM 10945 H HZ   . PHE B 1 44 ? -3.304  8.246   7.279   1.00 0.00 ? 43 PHE B HZ   4  
ATOM 10946 N N    . LEU B 1 45 ? -9.558  12.932  4.227   1.00 0.00 ? 44 LEU B N    4  
ATOM 10947 C CA   . LEU B 1 45 ? -10.370 13.854  3.381   1.00 0.00 ? 44 LEU B CA   4  
ATOM 10948 C C    . LEU B 1 45 ? -10.078 15.309  3.776   1.00 0.00 ? 44 LEU B C    4  
ATOM 10949 O O    . LEU B 1 45 ? -10.169 16.211  2.968   1.00 0.00 ? 44 LEU B O    4  
ATOM 10950 C CB   . LEU B 1 45 ? -11.867 13.531  3.584   1.00 0.00 ? 44 LEU B CB   4  
ATOM 10951 C CG   . LEU B 1 45 ? -12.670 13.764  2.287   1.00 0.00 ? 44 LEU B CG   4  
ATOM 10952 C CD1  . LEU B 1 45 ? -12.450 15.196  1.787   1.00 0.00 ? 44 LEU B CD1  4  
ATOM 10953 C CD2  . LEU B 1 45 ? -12.246 12.755  1.194   1.00 0.00 ? 44 LEU B CD2  4  
ATOM 10954 H H    . LEU B 1 45 ? -9.984  12.156  4.648   1.00 0.00 ? 44 LEU B H    4  
ATOM 10955 H HA   . LEU B 1 45 ? -10.101 13.707  2.347   1.00 0.00 ? 44 LEU B HA   4  
ATOM 10956 H HB2  . LEU B 1 45 ? -11.966 12.497  3.880   1.00 0.00 ? 44 LEU B HB2  4  
ATOM 10957 H HB3  . LEU B 1 45 ? -12.272 14.157  4.367   1.00 0.00 ? 44 LEU B HB3  4  
ATOM 10958 H HG   . LEU B 1 45 ? -13.721 13.630  2.502   1.00 0.00 ? 44 LEU B HG   4  
ATOM 10959 H HD11 . LEU B 1 45 ? -12.466 15.878  2.625   1.00 0.00 ? 44 LEU B HD11 4  
ATOM 10960 H HD12 . LEU B 1 45 ? -11.496 15.261  1.285   1.00 0.00 ? 44 LEU B HD12 4  
ATOM 10961 H HD13 . LEU B 1 45 ? -13.237 15.460  1.096   1.00 0.00 ? 44 LEU B HD13 4  
ATOM 10962 H HD21 . LEU B 1 45 ? -11.886 11.843  1.652   1.00 0.00 ? 44 LEU B HD21 4  
ATOM 10963 H HD22 . LEU B 1 45 ? -13.100 12.525  0.575   1.00 0.00 ? 44 LEU B HD22 4  
ATOM 10964 H HD23 . LEU B 1 45 ? -11.466 13.178  0.577   1.00 0.00 ? 44 LEU B HD23 4  
ATOM 10965 N N    . GLU B 1 46 ? -9.731  15.546  5.009   1.00 0.00 ? 45 GLU B N    4  
ATOM 10966 C CA   . GLU B 1 46 ? -9.444  16.943  5.441   1.00 0.00 ? 45 GLU B CA   4  
ATOM 10967 C C    . GLU B 1 46 ? -8.103  17.402  4.864   1.00 0.00 ? 45 GLU B C    4  
ATOM 10968 O O    . GLU B 1 46 ? -7.957  18.526  4.426   1.00 0.00 ? 45 GLU B O    4  
ATOM 10969 C CB   . GLU B 1 46 ? -9.388  17.000  6.969   1.00 0.00 ? 45 GLU B CB   4  
ATOM 10970 C CG   . GLU B 1 46 ? -9.465  18.457  7.430   1.00 0.00 ? 45 GLU B CG   4  
ATOM 10971 C CD   . GLU B 1 46 ? -9.255  18.525  8.943   1.00 0.00 ? 45 GLU B CD   4  
ATOM 10972 O OE1  . GLU B 1 46 ? -8.144  18.275  9.379   1.00 0.00 ? 45 GLU B OE1  4  
ATOM 10973 O OE2  . GLU B 1 46 ? -10.209 18.828  9.641   1.00 0.00 ? 45 GLU B OE2  4  
ATOM 10974 H H    . GLU B 1 46 ? -9.663  14.811  5.654   1.00 0.00 ? 45 GLU B H    4  
ATOM 10975 H HA   . GLU B 1 46 ? -10.226 17.593  5.086   1.00 0.00 ? 45 GLU B HA   4  
ATOM 10976 H HB2  . GLU B 1 46 ? -10.221 16.446  7.380   1.00 0.00 ? 45 GLU B HB2  4  
ATOM 10977 H HB3  . GLU B 1 46 ? -8.462  16.565  7.312   1.00 0.00 ? 45 GLU B HB3  4  
ATOM 10978 H HG2  . GLU B 1 46 ? -8.698  19.032  6.932   1.00 0.00 ? 45 GLU B HG2  4  
ATOM 10979 H HG3  . GLU B 1 46 ? -10.436 18.861  7.184   1.00 0.00 ? 45 GLU B HG3  4  
ATOM 10980 N N    . GLU B 1 47 ? -7.120  16.544  4.868   1.00 0.00 ? 46 GLU B N    4  
ATOM 10981 C CA   . GLU B 1 47 ? -5.782  16.931  4.329   1.00 0.00 ? 46 GLU B CA   4  
ATOM 10982 C C    . GLU B 1 47 ? -5.730  16.672  2.820   1.00 0.00 ? 46 GLU B C    4  
ATOM 10983 O O    . GLU B 1 47 ? -4.903  15.921  2.341   1.00 0.00 ? 46 GLU B O    4  
ATOM 10984 C CB   . GLU B 1 47 ? -4.700  16.101  5.022   1.00 0.00 ? 46 GLU B CB   4  
ATOM 10985 C CG   . GLU B 1 47 ? -4.844  16.237  6.539   1.00 0.00 ? 46 GLU B CG   4  
ATOM 10986 C CD   . GLU B 1 47 ? -3.581  15.710  7.222   1.00 0.00 ? 46 GLU B CD   4  
ATOM 10987 O OE1  . GLU B 1 47 ? -2.505  15.956  6.703   1.00 0.00 ? 46 GLU B OE1  4  
ATOM 10988 O OE2  . GLU B 1 47 ? -3.712  15.068  8.251   1.00 0.00 ? 46 GLU B OE2  4  
ATOM 10989 H H    . GLU B 1 47 ? -7.260  15.647  5.234   1.00 0.00 ? 46 GLU B H    4  
ATOM 10990 H HA   . GLU B 1 47 ? -5.603  17.980  4.518   1.00 0.00 ? 46 GLU B HA   4  
ATOM 10991 H HB2  . GLU B 1 47 ? -4.807  15.063  4.740   1.00 0.00 ? 46 GLU B HB2  4  
ATOM 10992 H HB3  . GLU B 1 47 ? -3.726  16.457  4.721   1.00 0.00 ? 46 GLU B HB3  4  
ATOM 10993 H HG2  . GLU B 1 47 ? -4.985  17.278  6.794   1.00 0.00 ? 46 GLU B HG2  4  
ATOM 10994 H HG3  . GLU B 1 47 ? -5.697  15.666  6.872   1.00 0.00 ? 46 GLU B HG3  4  
ATOM 10995 N N    . ILE B 1 48 ? -6.604  17.298  2.068   1.00 0.00 ? 47 ILE B N    4  
ATOM 10996 C CA   . ILE B 1 48 ? -6.619  17.109  0.580   1.00 0.00 ? 47 ILE B CA   4  
ATOM 10997 C C    . ILE B 1 48 ? -6.423  18.465  -0.099  1.00 0.00 ? 47 ILE B C    4  
ATOM 10998 O O    . ILE B 1 48 ? -7.337  19.261  -0.192  1.00 0.00 ? 47 ILE B O    4  
ATOM 10999 C CB   . ILE B 1 48 ? -7.973  16.530  0.154   1.00 0.00 ? 47 ILE B CB   4  
ATOM 11000 C CG1  . ILE B 1 48 ? -8.206  15.165  0.828   1.00 0.00 ? 47 ILE B CG1  4  
ATOM 11001 C CG2  . ILE B 1 48 ? -8.013  16.372  -1.368  1.00 0.00 ? 47 ILE B CG2  4  
ATOM 11002 C CD1  . ILE B 1 48 ? -7.055  14.194  0.523   1.00 0.00 ? 47 ILE B CD1  4  
ATOM 11003 H H    . ILE B 1 48 ? -7.254  17.901  2.484   1.00 0.00 ? 47 ILE B H    4  
ATOM 11004 H HA   . ILE B 1 48 ? -5.825  16.443  0.273   1.00 0.00 ? 47 ILE B HA   4  
ATOM 11005 H HB   . ILE B 1 48 ? -8.756  17.212  0.455   1.00 0.00 ? 47 ILE B HB   4  
ATOM 11006 H HG12 . ILE B 1 48 ? -8.275  15.306  1.895   1.00 0.00 ? 47 ILE B HG12 4  
ATOM 11007 H HG13 . ILE B 1 48 ? -9.131  14.744  0.465   1.00 0.00 ? 47 ILE B HG13 4  
ATOM 11008 H HG21 . ILE B 1 48 ? -7.119  15.865  -1.701  1.00 0.00 ? 47 ILE B HG21 4  
ATOM 11009 H HG22 . ILE B 1 48 ? -8.880  15.793  -1.647  1.00 0.00 ? 47 ILE B HG22 4  
ATOM 11010 H HG23 . ILE B 1 48 ? -8.067  17.347  -1.829  1.00 0.00 ? 47 ILE B HG23 4  
ATOM 11011 H HD11 . ILE B 1 48 ? -6.685  14.360  -0.477  1.00 0.00 ? 47 ILE B HD11 4  
ATOM 11012 H HD12 . ILE B 1 48 ? -6.257  14.351  1.233   1.00 0.00 ? 47 ILE B HD12 4  
ATOM 11013 H HD13 . ILE B 1 48 ? -7.413  13.179  0.607   1.00 0.00 ? 47 ILE B HD13 4  
ATOM 11014 N N    . LYS B 1 49 ? -5.237  18.739  -0.576  1.00 0.00 ? 48 LYS B N    4  
ATOM 11015 C CA   . LYS B 1 49 ? -4.985  20.047  -1.249  1.00 0.00 ? 48 LYS B CA   4  
ATOM 11016 C C    . LYS B 1 49 ? -5.347  19.933  -2.732  1.00 0.00 ? 48 LYS B C    4  
ATOM 11017 O O    . LYS B 1 49 ? -5.927  20.830  -3.311  1.00 0.00 ? 48 LYS B O    4  
ATOM 11018 C CB   . LYS B 1 49 ? -3.506  20.419  -1.103  1.00 0.00 ? 48 LYS B CB   4  
ATOM 11019 C CG   . LYS B 1 49 ? -3.041  20.119  0.325   1.00 0.00 ? 48 LYS B CG   4  
ATOM 11020 C CD   . LYS B 1 49 ? -3.968  20.813  1.326   1.00 0.00 ? 48 LYS B CD   4  
ATOM 11021 C CE   . LYS B 1 49 ? -3.310  20.835  2.707   1.00 0.00 ? 48 LYS B CE   4  
ATOM 11022 N NZ   . LYS B 1 49 ? -2.736  19.492  3.006   1.00 0.00 ? 48 LYS B NZ   4  
ATOM 11023 H H    . LYS B 1 49 ? -4.513  18.084  -0.492  1.00 0.00 ? 48 LYS B H    4  
ATOM 11024 H HA   . LYS B 1 49 ? -5.596  20.811  -0.786  1.00 0.00 ? 48 LYS B HA   4  
ATOM 11025 H HB2  . LYS B 1 49 ? -2.918  19.841  -1.802  1.00 0.00 ? 48 LYS B HB2  4  
ATOM 11026 H HB3  . LYS B 1 49 ? -3.377  21.471  -1.307  1.00 0.00 ? 48 LYS B HB3  4  
ATOM 11027 H HG2  . LYS B 1 49 ? -3.063  19.051  0.493   1.00 0.00 ? 48 LYS B HG2  4  
ATOM 11028 H HG3  . LYS B 1 49 ? -2.033  20.483  0.458   1.00 0.00 ? 48 LYS B HG3  4  
ATOM 11029 H HD2  . LYS B 1 49 ? -4.156  21.826  1.000   1.00 0.00 ? 48 LYS B HD2  4  
ATOM 11030 H HD3  . LYS B 1 49 ? -4.902  20.274  1.384   1.00 0.00 ? 48 LYS B HD3  4  
ATOM 11031 H HE2  . LYS B 1 49 ? -2.522  21.574  2.719   1.00 0.00 ? 48 LYS B HE2  4  
ATOM 11032 H HE3  . LYS B 1 49 ? -4.049  21.085  3.454   1.00 0.00 ? 48 LYS B HE3  4  
ATOM 11033 H HZ1  . LYS B 1 49 ? -2.298  19.103  2.148   1.00 0.00 ? 48 LYS B HZ1  4  
ATOM 11034 H HZ2  . LYS B 1 49 ? -2.016  19.581  3.750   1.00 0.00 ? 48 LYS B HZ2  4  
ATOM 11035 H HZ3  . LYS B 1 49 ? -3.494  18.856  3.329   1.00 0.00 ? 48 LYS B HZ3  4  
ATOM 11036 N N    . GLU B 1 50 ? -5.011  18.831  -3.352  1.00 0.00 ? 49 GLU B N    4  
ATOM 11037 C CA   . GLU B 1 50 ? -5.338  18.654  -4.797  1.00 0.00 ? 49 GLU B CA   4  
ATOM 11038 C C    . GLU B 1 50 ? -6.761  18.107  -4.928  1.00 0.00 ? 49 GLU B C    4  
ATOM 11039 O O    . GLU B 1 50 ? -7.013  16.946  -4.672  1.00 0.00 ? 49 GLU B O    4  
ATOM 11040 C CB   . GLU B 1 50 ? -4.353  17.665  -5.424  1.00 0.00 ? 49 GLU B CB   4  
ATOM 11041 C CG   . GLU B 1 50 ? -2.997  18.345  -5.619  1.00 0.00 ? 49 GLU B CG   4  
ATOM 11042 C CD   . GLU B 1 50 ? -2.493  18.871  -4.274  1.00 0.00 ? 49 GLU B CD   4  
ATOM 11043 O OE1  . GLU B 1 50 ? -2.366  18.074  -3.359  1.00 0.00 ? 49 GLU B OE1  4  
ATOM 11044 O OE2  . GLU B 1 50 ? -2.244  20.061  -4.181  1.00 0.00 ? 49 GLU B OE2  4  
ATOM 11045 H H    . GLU B 1 50 ? -4.546  18.119  -2.865  1.00 0.00 ? 49 GLU B H    4  
ATOM 11046 H HA   . GLU B 1 50 ? -5.267  19.606  -5.304  1.00 0.00 ? 49 GLU B HA   4  
ATOM 11047 H HB2  . GLU B 1 50 ? -4.238  16.810  -4.773  1.00 0.00 ? 49 GLU B HB2  4  
ATOM 11048 H HB3  . GLU B 1 50 ? -4.731  17.340  -6.382  1.00 0.00 ? 49 GLU B HB3  4  
ATOM 11049 H HG2  . GLU B 1 50 ? -2.290  17.631  -6.015  1.00 0.00 ? 49 GLU B HG2  4  
ATOM 11050 H HG3  . GLU B 1 50 ? -3.103  19.169  -6.308  1.00 0.00 ? 49 GLU B HG3  4  
ATOM 11051 N N    . GLN B 1 51 ? -7.695  18.926  -5.330  1.00 0.00 ? 50 GLN B N    4  
ATOM 11052 C CA   . GLN B 1 51 ? -9.097  18.441  -5.484  1.00 0.00 ? 50 GLN B CA   4  
ATOM 11053 C C    . GLN B 1 51 ? -9.255  17.756  -6.844  1.00 0.00 ? 50 GLN B C    4  
ATOM 11054 O O    . GLN B 1 51 ? -10.076 16.877  -7.015  1.00 0.00 ? 50 GLN B O    4  
ATOM 11055 C CB   . GLN B 1 51 ? -10.056 19.630  -5.403  1.00 0.00 ? 50 GLN B CB   4  
ATOM 11056 C CG   . GLN B 1 51 ? -10.068 20.180  -3.975  1.00 0.00 ? 50 GLN B CG   4  
ATOM 11057 C CD   . GLN B 1 51 ? -8.707  20.802  -3.656  1.00 0.00 ? 50 GLN B CD   4  
ATOM 11058 O OE1  . GLN B 1 51 ? -8.014  21.262  -4.540  1.00 0.00 ? 50 GLN B OE1  4  
ATOM 11059 N NE2  . GLN B 1 51 ? -8.294  20.836  -2.418  1.00 0.00 ? 50 GLN B NE2  4  
ATOM 11060 H H    . GLN B 1 51 ? -7.476  19.856  -5.548  1.00 0.00 ? 50 GLN B H    4  
ATOM 11061 H HA   . GLN B 1 51 ? -9.326  17.741  -4.693  1.00 0.00 ? 50 GLN B HA   4  
ATOM 11062 H HB2  . GLN B 1 51 ? -9.730  20.403  -6.085  1.00 0.00 ? 50 GLN B HB2  4  
ATOM 11063 H HB3  . GLN B 1 51 ? -11.051 19.310  -5.671  1.00 0.00 ? 50 GLN B HB3  4  
ATOM 11064 H HG2  . GLN B 1 51 ? -10.838 20.932  -3.886  1.00 0.00 ? 50 GLN B HG2  4  
ATOM 11065 H HG3  . GLN B 1 51 ? -10.266 19.377  -3.282  1.00 0.00 ? 50 GLN B HG3  4  
ATOM 11066 H HE21 . GLN B 1 51 ? -8.853  20.465  -1.704  1.00 0.00 ? 50 GLN B HE21 4  
ATOM 11067 H HE22 . GLN B 1 51 ? -7.423  21.232  -2.203  1.00 0.00 ? 50 GLN B HE22 4  
ATOM 11068 N N    . GLU B 1 52 ? -8.481  18.157  -7.814  1.00 0.00 ? 51 GLU B N    4  
ATOM 11069 C CA   . GLU B 1 52 ? -8.595  17.535  -9.165  1.00 0.00 ? 51 GLU B CA   4  
ATOM 11070 C C    . GLU B 1 52 ? -7.993  16.125  -9.156  1.00 0.00 ? 51 GLU B C    4  
ATOM 11071 O O    . GLU B 1 52 ? -8.346  15.296  -9.972  1.00 0.00 ? 51 GLU B O    4  
ATOM 11072 C CB   . GLU B 1 52 ? -7.889  18.403  -10.208 1.00 0.00 ? 51 GLU B CB   4  
ATOM 11073 C CG   . GLU B 1 52 ? -8.471  19.817  -10.175 1.00 0.00 ? 51 GLU B CG   4  
ATOM 11074 C CD   . GLU B 1 52 ? -9.916  19.787  -10.675 1.00 0.00 ? 51 GLU B CD   4  
ATOM 11075 O OE1  . GLU B 1 52 ? -10.266 18.838  -11.357 1.00 0.00 ? 51 GLU B OE1  4  
ATOM 11076 O OE2  . GLU B 1 52 ? -10.648 20.714  -10.368 1.00 0.00 ? 51 GLU B OE2  4  
ATOM 11077 H H    . GLU B 1 52 ? -7.826  18.868  -7.654  1.00 0.00 ? 51 GLU B H    4  
ATOM 11078 H HA   . GLU B 1 52 ? -9.639  17.434  -9.416  1.00 0.00 ? 51 GLU B HA   4  
ATOM 11079 H HB2  . GLU B 1 52 ? -6.832  18.443  -9.987  1.00 0.00 ? 51 GLU B HB2  4  
ATOM 11080 H HB3  . GLU B 1 52 ? -8.036  17.978  -11.189 1.00 0.00 ? 51 GLU B HB3  4  
ATOM 11081 H HG2  . GLU B 1 52 ? -8.447  20.192  -9.162  1.00 0.00 ? 51 GLU B HG2  4  
ATOM 11082 H HG3  . GLU B 1 52 ? -7.885  20.463  -10.812 1.00 0.00 ? 51 GLU B HG3  4  
ATOM 11083 N N    . VAL B 1 53 ? -7.124  15.821  -8.233  1.00 0.00 ? 52 VAL B N    4  
ATOM 11084 C CA   . VAL B 1 53 ? -6.561  14.440  -8.186  1.00 0.00 ? 52 VAL B CA   4  
ATOM 11085 C C    . VAL B 1 53 ? -7.630  13.508  -7.614  1.00 0.00 ? 52 VAL B C    4  
ATOM 11086 O O    . VAL B 1 53 ? -7.929  12.477  -8.184  1.00 0.00 ? 52 VAL B O    4  
ATOM 11087 C CB   . VAL B 1 53 ? -5.323  14.413  -7.280  1.00 0.00 ? 52 VAL B CB   4  
ATOM 11088 C CG1  . VAL B 1 53 ? -4.891  12.964  -7.034  1.00 0.00 ? 52 VAL B CG1  4  
ATOM 11089 C CG2  . VAL B 1 53 ? -4.179  15.169  -7.955  1.00 0.00 ? 52 VAL B CG2  4  
ATOM 11090 H H    . VAL B 1 53 ? -6.877  16.470  -7.539  1.00 0.00 ? 52 VAL B H    4  
ATOM 11091 H HA   . VAL B 1 53 ? -6.296  14.107  -9.179  1.00 0.00 ? 52 VAL B HA   4  
ATOM 11092 H HB   . VAL B 1 53 ? -5.559  14.883  -6.336  1.00 0.00 ? 52 VAL B HB   4  
ATOM 11093 H HG11 . VAL B 1 53 ? -4.877  12.428  -7.972  1.00 0.00 ? 52 VAL B HG11 4  
ATOM 11094 H HG12 . VAL B 1 53 ? -3.902  12.952  -6.599  1.00 0.00 ? 52 VAL B HG12 4  
ATOM 11095 H HG13 . VAL B 1 53 ? -5.587  12.489  -6.358  1.00 0.00 ? 52 VAL B HG13 4  
ATOM 11096 H HG21 . VAL B 1 53 ? -4.549  16.099  -8.358  1.00 0.00 ? 52 VAL B HG21 4  
ATOM 11097 H HG22 . VAL B 1 53 ? -3.407  15.372  -7.228  1.00 0.00 ? 52 VAL B HG22 4  
ATOM 11098 H HG23 . VAL B 1 53 ? -3.772  14.567  -8.754  1.00 0.00 ? 52 VAL B HG23 4  
ATOM 11099 N N    . VAL B 1 54 ? -8.214  13.852  -6.503  1.00 0.00 ? 53 VAL B N    4  
ATOM 11100 C CA   . VAL B 1 54 ? -9.261  12.967  -5.927  1.00 0.00 ? 53 VAL B CA   4  
ATOM 11101 C C    . VAL B 1 54 ? -10.439 12.889  -6.900  1.00 0.00 ? 53 VAL B C    4  
ATOM 11102 O O    . VAL B 1 54 ? -11.095 11.875  -7.018  1.00 0.00 ? 53 VAL B O    4  
ATOM 11103 C CB   . VAL B 1 54 ? -9.732  13.534  -4.585  1.00 0.00 ? 53 VAL B CB   4  
ATOM 11104 C CG1  . VAL B 1 54 ? -10.932 12.730  -4.079  1.00 0.00 ? 53 VAL B CG1  4  
ATOM 11105 C CG2  . VAL B 1 54 ? -8.593  13.441  -3.567  1.00 0.00 ? 53 VAL B CG2  4  
ATOM 11106 H H    . VAL B 1 54 ? -7.971  14.683  -6.041  1.00 0.00 ? 53 VAL B H    4  
ATOM 11107 H HA   . VAL B 1 54 ? -8.853  11.978  -5.777  1.00 0.00 ? 53 VAL B HA   4  
ATOM 11108 H HB   . VAL B 1 54 ? -10.020 14.567  -4.713  1.00 0.00 ? 53 VAL B HB   4  
ATOM 11109 H HG11 . VAL B 1 54 ? -10.730 11.674  -4.187  1.00 0.00 ? 53 VAL B HG11 4  
ATOM 11110 H HG12 . VAL B 1 54 ? -11.107 12.959  -3.038  1.00 0.00 ? 53 VAL B HG12 4  
ATOM 11111 H HG13 . VAL B 1 54 ? -11.808 12.989  -4.656  1.00 0.00 ? 53 VAL B HG13 4  
ATOM 11112 H HG21 . VAL B 1 54 ? -8.170  12.448  -3.588  1.00 0.00 ? 53 VAL B HG21 4  
ATOM 11113 H HG22 . VAL B 1 54 ? -7.829  14.163  -3.814  1.00 0.00 ? 53 VAL B HG22 4  
ATOM 11114 H HG23 . VAL B 1 54 ? -8.977  13.647  -2.579  1.00 0.00 ? 53 VAL B HG23 4  
ATOM 11115 N N    . ASP B 1 55 ? -10.713 13.956  -7.598  1.00 0.00 ? 54 ASP B N    4  
ATOM 11116 C CA   . ASP B 1 55 ? -11.848 13.941  -8.561  1.00 0.00 ? 54 ASP B CA   4  
ATOM 11117 C C    . ASP B 1 55 ? -11.619 12.847  -9.605  1.00 0.00 ? 54 ASP B C    4  
ATOM 11118 O O    . ASP B 1 55 ? -12.527 12.130  -9.976  1.00 0.00 ? 54 ASP B O    4  
ATOM 11119 C CB   . ASP B 1 55 ? -11.945 15.297  -9.261  1.00 0.00 ? 54 ASP B CB   4  
ATOM 11120 C CG   . ASP B 1 55 ? -12.338 16.371  -8.244  1.00 0.00 ? 54 ASP B CG   4  
ATOM 11121 O OD1  . ASP B 1 55 ? -12.920 16.016  -7.232  1.00 0.00 ? 54 ASP B OD1  4  
ATOM 11122 O OD2  . ASP B 1 55 ? -12.050 17.529  -8.494  1.00 0.00 ? 54 ASP B OD2  4  
ATOM 11123 H H    . ASP B 1 55 ? -10.173 14.767  -7.488  1.00 0.00 ? 54 ASP B H    4  
ATOM 11124 H HA   . ASP B 1 55 ? -12.766 13.746  -8.026  1.00 0.00 ? 54 ASP B HA   4  
ATOM 11125 H HB2  . ASP B 1 55 ? -10.989 15.545  -9.697  1.00 0.00 ? 54 ASP B HB2  4  
ATOM 11126 H HB3  . ASP B 1 55 ? -12.694 15.249  -10.037 1.00 0.00 ? 54 ASP B HB3  4  
ATOM 11127 N N    . LYS B 1 56 ? -10.412 12.721  -10.097 1.00 0.00 ? 55 LYS B N    4  
ATOM 11128 C CA   . LYS B 1 56 ? -10.139 11.682  -11.131 1.00 0.00 ? 55 LYS B CA   4  
ATOM 11129 C C    . LYS B 1 56 ? -10.206 10.291  -10.499 1.00 0.00 ? 55 LYS B C    4  
ATOM 11130 O O    . LYS B 1 56 ? -10.530 9.324   -11.159 1.00 0.00 ? 55 LYS B O    4  
ATOM 11131 C CB   . LYS B 1 56 ? -8.757  11.910  -11.752 1.00 0.00 ? 55 LYS B CB   4  
ATOM 11132 C CG   . LYS B 1 56 ? -8.751  13.211  -12.581 1.00 0.00 ? 55 LYS B CG   4  
ATOM 11133 C CD   . LYS B 1 56 ? -9.246  12.940  -14.016 1.00 0.00 ? 55 LYS B CD   4  
ATOM 11134 C CE   . LYS B 1 56 ? -8.085  12.455  -14.893 1.00 0.00 ? 55 LYS B CE   4  
ATOM 11135 N NZ   . LYS B 1 56 ? -8.565  12.271  -16.292 1.00 0.00 ? 55 LYS B NZ   4  
ATOM 11136 H H    . LYS B 1 56 ? -9.692  13.316  -9.795  1.00 0.00 ? 55 LYS B H    4  
ATOM 11137 H HA   . LYS B 1 56 ? -10.904 11.740  -11.888 1.00 0.00 ? 55 LYS B HA   4  
ATOM 11138 H HB2  . LYS B 1 56 ? -8.024  11.985  -10.961 1.00 0.00 ? 55 LYS B HB2  4  
ATOM 11139 H HB3  . LYS B 1 56 ? -8.510  11.074  -12.386 1.00 0.00 ? 55 LYS B HB3  4  
ATOM 11140 H HG2  . LYS B 1 56 ? -9.399  13.940  -12.111 1.00 0.00 ? 55 LYS B HG2  4  
ATOM 11141 H HG3  . LYS B 1 56 ? -7.746  13.606  -12.616 1.00 0.00 ? 55 LYS B HG3  4  
ATOM 11142 H HD2  . LYS B 1 56 ? -10.020 12.187  -13.998 1.00 0.00 ? 55 LYS B HD2  4  
ATOM 11143 H HD3  . LYS B 1 56 ? -9.647  13.852  -14.433 1.00 0.00 ? 55 LYS B HD3  4  
ATOM 11144 H HE2  . LYS B 1 56 ? -7.292  13.187  -14.879 1.00 0.00 ? 55 LYS B HE2  4  
ATOM 11145 H HE3  . LYS B 1 56 ? -7.713  11.515  -14.516 1.00 0.00 ? 55 LYS B HE3  4  
ATOM 11146 H HZ1  . LYS B 1 56 ? -9.409  11.664  -16.293 1.00 0.00 ? 55 LYS B HZ1  4  
ATOM 11147 H HZ2  . LYS B 1 56 ? -8.805  13.196  -16.701 1.00 0.00 ? 55 LYS B HZ2  4  
ATOM 11148 H HZ3  . LYS B 1 56 ? -7.815  11.824  -16.859 1.00 0.00 ? 55 LYS B HZ3  4  
ATOM 11149 N N    . VAL B 1 57 ? -9.945  10.171  -9.227  1.00 0.00 ? 56 VAL B N    4  
ATOM 11150 C CA   . VAL B 1 57 ? -10.045 8.835   -8.577  1.00 0.00 ? 56 VAL B CA   4  
ATOM 11151 C C    . VAL B 1 57 ? -11.492 8.356   -8.681  1.00 0.00 ? 56 VAL B C    4  
ATOM 11152 O O    . VAL B 1 57 ? -11.771 7.287   -9.186  1.00 0.00 ? 56 VAL B O    4  
ATOM 11153 C CB   . VAL B 1 57 ? -9.655  8.961   -7.103  1.00 0.00 ? 56 VAL B CB   4  
ATOM 11154 C CG1  . VAL B 1 57 ? -9.873  7.620   -6.399  1.00 0.00 ? 56 VAL B CG1  4  
ATOM 11155 C CG2  . VAL B 1 57 ? -8.178  9.359   -7.001  1.00 0.00 ? 56 VAL B CG2  4  
ATOM 11156 H H    . VAL B 1 57 ? -9.720  10.952  -8.683  1.00 0.00 ? 56 VAL B H    4  
ATOM 11157 H HA   . VAL B 1 57 ? -9.398  8.112   -9.053  1.00 0.00 ? 56 VAL B HA   4  
ATOM 11158 H HB   . VAL B 1 57 ? -10.267 9.716   -6.632  1.00 0.00 ? 56 VAL B HB   4  
ATOM 11159 H HG11 . VAL B 1 57 ? -9.421  6.830   -6.981  1.00 0.00 ? 56 VAL B HG11 4  
ATOM 11160 H HG12 . VAL B 1 57 ? -9.420  7.650   -5.419  1.00 0.00 ? 56 VAL B HG12 4  
ATOM 11161 H HG13 . VAL B 1 57 ? -10.932 7.433   -6.300  1.00 0.00 ? 56 VAL B HG13 4  
ATOM 11162 H HG21 . VAL B 1 57 ? -7.963  10.138  -7.719  1.00 0.00 ? 56 VAL B HG21 4  
ATOM 11163 H HG22 . VAL B 1 57 ? -7.971  9.723   -6.006  1.00 0.00 ? 56 VAL B HG22 4  
ATOM 11164 H HG23 . VAL B 1 57 ? -7.557  8.500   -7.207  1.00 0.00 ? 56 VAL B HG23 4  
ATOM 11165 N N    . MET B 1 58 ? -12.415 9.142   -8.202  1.00 0.00 ? 57 MET B N    4  
ATOM 11166 C CA   . MET B 1 58 ? -13.847 8.739   -8.264  1.00 0.00 ? 57 MET B CA   4  
ATOM 11167 C C    . MET B 1 58 ? -14.234 8.381   -9.701  1.00 0.00 ? 57 MET B C    4  
ATOM 11168 O O    . MET B 1 58 ? -15.141 7.604   -9.927  1.00 0.00 ? 57 MET B O    4  
ATOM 11169 C CB   . MET B 1 58 ? -14.721 9.896   -7.776  1.00 0.00 ? 57 MET B CB   4  
ATOM 11170 C CG   . MET B 1 58 ? -14.608 10.018  -6.256  1.00 0.00 ? 57 MET B CG   4  
ATOM 11171 S SD   . MET B 1 58 ? -15.566 8.697   -5.473  1.00 0.00 ? 57 MET B SD   4  
ATOM 11172 C CE   . MET B 1 58 ? -14.644 8.638   -3.918  1.00 0.00 ? 57 MET B CE   4  
ATOM 11173 H H    . MET B 1 58 ? -12.170 9.992   -7.779  1.00 0.00 ? 57 MET B H    4  
ATOM 11174 H HA   . MET B 1 58 ? -14.010 7.875   -7.639  1.00 0.00 ? 57 MET B HA   4  
ATOM 11175 H HB2  . MET B 1 58 ? -14.388 10.815  -8.238  1.00 0.00 ? 57 MET B HB2  4  
ATOM 11176 H HB3  . MET B 1 58 ? -15.750 9.710   -8.045  1.00 0.00 ? 57 MET B HB3  4  
ATOM 11177 H HG2  . MET B 1 58 ? -13.572 9.934   -5.962  1.00 0.00 ? 57 MET B HG2  4  
ATOM 11178 H HG3  . MET B 1 58 ? -14.994 10.977  -5.942  1.00 0.00 ? 57 MET B HG3  4  
ATOM 11179 H HE1  . MET B 1 58 ? -14.249 9.621   -3.697  1.00 0.00 ? 57 MET B HE1  4  
ATOM 11180 H HE2  . MET B 1 58 ? -15.300 8.330   -3.120  1.00 0.00 ? 57 MET B HE2  4  
ATOM 11181 H HE3  . MET B 1 58 ? -13.832 7.930   -4.008  1.00 0.00 ? 57 MET B HE3  4  
ATOM 11182 N N    . GLU B 1 59 ? -13.546 8.915   -10.680 1.00 0.00 ? 58 GLU B N    4  
ATOM 11183 C CA   . GLU B 1 59 ? -13.873 8.571   -12.097 1.00 0.00 ? 58 GLU B CA   4  
ATOM 11184 C C    . GLU B 1 59 ? -13.134 7.291   -12.492 1.00 0.00 ? 58 GLU B C    4  
ATOM 11185 O O    . GLU B 1 59 ? -13.650 6.479   -13.231 1.00 0.00 ? 58 GLU B O    4  
ATOM 11186 C CB   . GLU B 1 59 ? -13.490 9.724   -13.029 1.00 0.00 ? 58 GLU B CB   4  
ATOM 11187 C CG   . GLU B 1 59 ? -14.232 9.580   -14.360 1.00 0.00 ? 58 GLU B CG   4  
ATOM 11188 C CD   . GLU B 1 59 ? -13.601 10.509  -15.400 1.00 0.00 ? 58 GLU B CD   4  
ATOM 11189 O OE1  . GLU B 1 59 ? -12.599 11.128  -15.082 1.00 0.00 ? 58 GLU B OE1  4  
ATOM 11190 O OE2  . GLU B 1 59 ? -14.132 10.585  -16.495 1.00 0.00 ? 58 GLU B OE2  4  
ATOM 11191 H H    . GLU B 1 59 ? -12.798 9.510   -10.481 1.00 0.00 ? 58 GLU B H    4  
ATOM 11192 H HA   . GLU B 1 59 ? -14.929 8.352   -12.181 1.00 0.00 ? 58 GLU B HA   4  
ATOM 11193 H HB2  . GLU B 1 59 ? -13.759 10.664  -12.567 1.00 0.00 ? 58 GLU B HB2  4  
ATOM 11194 H HB3  . GLU B 1 59 ? -12.426 9.704   -13.209 1.00 0.00 ? 58 GLU B HB3  4  
ATOM 11195 H HG2  . GLU B 1 59 ? -14.164 8.557   -14.701 1.00 0.00 ? 58 GLU B HG2  4  
ATOM 11196 H HG3  . GLU B 1 59 ? -15.269 9.847   -14.225 1.00 0.00 ? 58 GLU B HG3  4  
ATOM 11197 N N    . THR B 1 60 ? -11.947 7.079   -11.996 1.00 0.00 ? 59 THR B N    4  
ATOM 11198 C CA   . THR B 1 60 ? -11.229 5.828   -12.347 1.00 0.00 ? 59 THR B CA   4  
ATOM 11199 C C    . THR B 1 60 ? -11.984 4.656   -11.724 1.00 0.00 ? 59 THR B C    4  
ATOM 11200 O O    . THR B 1 60 ? -12.296 3.693   -12.398 1.00 0.00 ? 59 THR B O    4  
ATOM 11201 C CB   . THR B 1 60 ? -9.799  5.881   -11.820 1.00 0.00 ? 59 THR B CB   4  
ATOM 11202 O OG1  . THR B 1 60 ? -9.813  6.272   -10.455 1.00 0.00 ? 59 THR B OG1  4  
ATOM 11203 C CG2  . THR B 1 60 ? -8.988  6.888   -12.636 1.00 0.00 ? 59 THR B CG2  4  
ATOM 11204 H H    . THR B 1 60 ? -11.541 7.721   -11.380 1.00 0.00 ? 59 THR B H    4  
ATOM 11205 H HA   . THR B 1 60 ? -11.229 5.681   -13.417 1.00 0.00 ? 59 THR B HA   4  
ATOM 11206 H HB   . THR B 1 60 ? -9.352  4.910   -11.912 1.00 0.00 ? 59 THR B HB   4  
ATOM 11207 H HG1  . THR B 1 60 ? -10.728 6.342   -10.176 1.00 0.00 ? 59 THR B HG1  4  
ATOM 11208 H HG21 . THR B 1 60 ? -9.514  7.829   -12.673 1.00 0.00 ? 59 THR B HG21 4  
ATOM 11209 H HG22 . THR B 1 60 ? -8.023  7.032   -12.173 1.00 0.00 ? 59 THR B HG22 4  
ATOM 11210 H HG23 . THR B 1 60 ? -8.852  6.512   -13.640 1.00 0.00 ? 59 THR B HG23 4  
ATOM 11211 N N    . LEU B 1 61 ? -12.323 4.723   -10.469 1.00 0.00 ? 60 LEU B N    4  
ATOM 11212 C CA   . LEU B 1 61 ? -13.097 3.604   -9.870  1.00 0.00 ? 60 LEU B CA   4  
ATOM 11213 C C    . LEU B 1 61 ? -14.395 3.445   -10.659 1.00 0.00 ? 60 LEU B C    4  
ATOM 11214 O O    . LEU B 1 61 ? -14.685 2.391   -11.189 1.00 0.00 ? 60 LEU B O    4  
ATOM 11215 C CB   . LEU B 1 61 ? -13.432 3.930   -8.412  1.00 0.00 ? 60 LEU B CB   4  
ATOM 11216 C CG   . LEU B 1 61 ? -12.151 4.270   -7.644  1.00 0.00 ? 60 LEU B CG   4  
ATOM 11217 C CD1  . LEU B 1 61 ? -12.520 4.791   -6.253  1.00 0.00 ? 60 LEU B CD1  4  
ATOM 11218 C CD2  . LEU B 1 61 ? -11.274 3.017   -7.504  1.00 0.00 ? 60 LEU B CD2  4  
ATOM 11219 H H    . LEU B 1 61 ? -12.104 5.503   -9.914  1.00 0.00 ? 60 LEU B H    4  
ATOM 11220 H HA   . LEU B 1 61 ? -12.546 2.677   -9.920  1.00 0.00 ? 60 LEU B HA   4  
ATOM 11221 H HB2  . LEU B 1 61 ? -14.103 4.776   -8.381  1.00 0.00 ? 60 LEU B HB2  4  
ATOM 11222 H HB3  . LEU B 1 61 ? -13.911 3.078   -7.954  1.00 0.00 ? 60 LEU B HB3  4  
ATOM 11223 H HG   . LEU B 1 61 ? -11.606 5.035   -8.179  1.00 0.00 ? 60 LEU B HG   4  
ATOM 11224 H HD11 . LEU B 1 61 ? -13.256 4.137   -5.808  1.00 0.00 ? 60 LEU B HD11 4  
ATOM 11225 H HD12 . LEU B 1 61 ? -11.638 4.815   -5.631  1.00 0.00 ? 60 LEU B HD12 4  
ATOM 11226 H HD13 . LEU B 1 61 ? -12.929 5.787   -6.338  1.00 0.00 ? 60 LEU B HD13 4  
ATOM 11227 H HD21 . LEU B 1 61 ? -11.892 2.166   -7.258  1.00 0.00 ? 60 LEU B HD21 4  
ATOM 11228 H HD22 . LEU B 1 61 ? -10.760 2.831   -8.435  1.00 0.00 ? 60 LEU B HD22 4  
ATOM 11229 H HD23 . LEU B 1 61 ? -10.546 3.171   -6.720  1.00 0.00 ? 60 LEU B HD23 4  
ATOM 11230 N N    . ASP B 1 62 ? -15.177 4.487   -10.754 1.00 0.00 ? 61 ASP B N    4  
ATOM 11231 C CA   . ASP B 1 62 ? -16.448 4.392   -11.521 1.00 0.00 ? 61 ASP B CA   4  
ATOM 11232 C C    . ASP B 1 62 ? -16.155 3.826   -12.912 1.00 0.00 ? 61 ASP B C    4  
ATOM 11233 O O    . ASP B 1 62 ? -17.013 3.248   -13.549 1.00 0.00 ? 61 ASP B O    4  
ATOM 11234 C CB   . ASP B 1 62 ? -17.068 5.784   -11.658 1.00 0.00 ? 61 ASP B CB   4  
ATOM 11235 C CG   . ASP B 1 62 ? -17.433 6.318   -10.272 1.00 0.00 ? 61 ASP B CG   4  
ATOM 11236 O OD1  . ASP B 1 62 ? -16.795 5.911   -9.315  1.00 0.00 ? 61 ASP B OD1  4  
ATOM 11237 O OD2  . ASP B 1 62 ? -18.344 7.125   -10.191 1.00 0.00 ? 61 ASP B OD2  4  
ATOM 11238 H H    . ASP B 1 62 ? -14.927 5.332   -10.324 1.00 0.00 ? 61 ASP B H    4  
ATOM 11239 H HA   . ASP B 1 62 ? -17.135 3.740   -11.003 1.00 0.00 ? 61 ASP B HA   4  
ATOM 11240 H HB2  . ASP B 1 62 ? -16.357 6.450   -12.126 1.00 0.00 ? 61 ASP B HB2  4  
ATOM 11241 H HB3  . ASP B 1 62 ? -17.959 5.723   -12.264 1.00 0.00 ? 61 ASP B HB3  4  
ATOM 11242 N N    . GLU B 1 63 ? -14.944 3.988   -13.389 1.00 0.00 ? 62 GLU B N    4  
ATOM 11243 C CA   . GLU B 1 63 ? -14.583 3.460   -14.743 1.00 0.00 ? 62 GLU B CA   4  
ATOM 11244 C C    . GLU B 1 63 ? -13.820 2.153   -14.593 1.00 0.00 ? 62 GLU B C    4  
ATOM 11245 O O    . GLU B 1 63 ? -12.869 1.872   -15.297 1.00 0.00 ? 62 GLU B O    4  
ATOM 11246 C CB   . GLU B 1 63 ? -13.703 4.457   -15.448 1.00 0.00 ? 62 GLU B CB   4  
ATOM 11247 C CG   . GLU B 1 63 ? -14.535 5.660   -15.905 1.00 0.00 ? 62 GLU B CG   4  
ATOM 11248 C CD   . GLU B 1 63 ? -13.611 6.725   -16.499 1.00 0.00 ? 62 GLU B CD   4  
ATOM 11249 O OE1  . GLU B 1 63 ? -12.454 6.759   -16.112 1.00 0.00 ? 62 GLU B OE1  4  
ATOM 11250 O OE2  . GLU B 1 63 ? -14.075 7.486   -17.331 1.00 0.00 ? 62 GLU B OE2  4  
ATOM 11251 H H    . GLU B 1 63 ? -14.270 4.458   -12.854 1.00 0.00 ? 62 GLU B H    4  
ATOM 11252 H HA   . GLU B 1 63 ? -15.477 3.284   -15.323 1.00 0.00 ? 62 GLU B HA   4  
ATOM 11253 H HB2  . GLU B 1 63 ? -12.943 4.771   -14.759 1.00 0.00 ? 62 GLU B HB2  4  
ATOM 11254 H HB3  . GLU B 1 63 ? -13.250 3.984   -16.300 1.00 0.00 ? 62 GLU B HB3  4  
ATOM 11255 H HG2  . GLU B 1 63 ? -15.246 5.341   -16.654 1.00 0.00 ? 62 GLU B HG2  4  
ATOM 11256 H HG3  . GLU B 1 63 ? -15.064 6.075   -15.061 1.00 0.00 ? 62 GLU B HG3  4  
ATOM 11257 N N    . ASP B 1 64 ? -14.247 1.371   -13.681 1.00 0.00 ? 63 ASP B N    4  
ATOM 11258 C CA   . ASP B 1 64 ? -13.601 0.049   -13.419 1.00 0.00 ? 63 ASP B CA   4  
ATOM 11259 C C    . ASP B 1 64 ? -13.348 -0.658  -14.752 1.00 0.00 ? 63 ASP B C    4  
ATOM 11260 O O    . ASP B 1 64 ? -12.346 -1.319  -14.941 1.00 0.00 ? 63 ASP B O    4  
ATOM 11261 C CB   . ASP B 1 64 ? -14.571 -0.793  -12.595 1.00 0.00 ? 63 ASP B CB   4  
ATOM 11262 C CG   . ASP B 1 64 ? -13.951 -2.157  -12.303 1.00 0.00 ? 63 ASP B CG   4  
ATOM 11263 O OD1  . ASP B 1 64 ? -12.974 -2.197  -11.574 1.00 0.00 ? 63 ASP B OD1  4  
ATOM 11264 O OD2  . ASP B 1 64 ? -14.467 -3.140  -12.809 1.00 0.00 ? 63 ASP B OD2  4  
ATOM 11265 H H    . ASP B 1 64 ? -15.002 1.665   -13.156 1.00 0.00 ? 63 ASP B H    4  
ATOM 11266 H HA   . ASP B 1 64 ? -12.678 0.173   -12.874 1.00 0.00 ? 63 ASP B HA   4  
ATOM 11267 H HB2  . ASP B 1 64 ? -14.782 -0.286  -11.668 1.00 0.00 ? 63 ASP B HB2  4  
ATOM 11268 H HB3  . ASP B 1 64 ? -15.489 -0.928  -13.150 1.00 0.00 ? 63 ASP B HB3  4  
ATOM 11269 N N    . GLY B 1 65 ? -14.240 -0.473  -15.683 1.00 0.00 ? 64 GLY B N    4  
ATOM 11270 C CA   . GLY B 1 65 ? -14.089 -1.077  -17.041 1.00 0.00 ? 64 GLY B CA   4  
ATOM 11271 C C    . GLY B 1 65 ? -13.795 -2.589  -16.994 1.00 0.00 ? 64 GLY B C    4  
ATOM 11272 O O    . GLY B 1 65 ? -13.809 -3.241  -18.020 1.00 0.00 ? 64 GLY B O    4  
ATOM 11273 H H    . GLY B 1 65 ? -15.006 0.113   -15.506 1.00 0.00 ? 64 GLY B H    4  
ATOM 11274 H HA2  . GLY B 1 65 ? -15.006 -0.921  -17.593 1.00 0.00 ? 64 GLY B HA2  4  
ATOM 11275 H HA3  . GLY B 1 65 ? -13.281 -0.575  -17.553 1.00 0.00 ? 64 GLY B HA3  4  
ATOM 11276 N N    . ASP B 1 66 ? -13.524 -3.163  -15.841 1.00 0.00 ? 65 ASP B N    4  
ATOM 11277 C CA   . ASP B 1 66 ? -13.227 -4.645  -15.784 1.00 0.00 ? 65 ASP B CA   4  
ATOM 11278 C C    . ASP B 1 66 ? -14.403 -5.460  -15.183 1.00 0.00 ? 65 ASP B C    4  
ATOM 11279 O O    . ASP B 1 66 ? -14.596 -6.597  -15.567 1.00 0.00 ? 65 ASP B O    4  
ATOM 11280 C CB   . ASP B 1 66 ? -11.988 -4.867  -14.916 1.00 0.00 ? 65 ASP B CB   4  
ATOM 11281 C CG   . ASP B 1 66 ? -12.197 -4.225  -13.545 1.00 0.00 ? 65 ASP B CG   4  
ATOM 11282 O OD1  . ASP B 1 66 ? -12.837 -4.847  -12.713 1.00 0.00 ? 65 ASP B OD1  4  
ATOM 11283 O OD2  . ASP B 1 66 ? -11.713 -3.123  -13.349 1.00 0.00 ? 65 ASP B OD2  4  
ATOM 11284 H H    . ASP B 1 66 ? -13.498 -2.630  -15.024 1.00 0.00 ? 65 ASP B H    4  
ATOM 11285 H HA   . ASP B 1 66 ? -13.019 -5.014  -16.778 1.00 0.00 ? 65 ASP B HA   4  
ATOM 11286 H HB2  . ASP B 1 66 ? -11.821 -5.927  -14.794 1.00 0.00 ? 65 ASP B HB2  4  
ATOM 11287 H HB3  . ASP B 1 66 ? -11.130 -4.420  -15.393 1.00 0.00 ? 65 ASP B HB3  4  
ATOM 11288 N N    . GLY B 1 67 ? -15.192 -4.933  -14.268 1.00 0.00 ? 66 GLY B N    4  
ATOM 11289 C CA   . GLY B 1 67 ? -16.328 -5.726  -13.693 1.00 0.00 ? 66 GLY B CA   4  
ATOM 11290 C C    . GLY B 1 67 ? -15.961 -6.199  -12.282 1.00 0.00 ? 66 GLY B C    4  
ATOM 11291 O O    . GLY B 1 67 ? -16.820 -6.410  -11.449 1.00 0.00 ? 66 GLY B O    4  
ATOM 11292 H H    . GLY B 1 67 ? -15.056 -4.033  -13.927 1.00 0.00 ? 66 GLY B H    4  
ATOM 11293 H HA2  . GLY B 1 67 ? -17.208 -5.100  -13.642 1.00 0.00 ? 66 GLY B HA2  4  
ATOM 11294 H HA3  . GLY B 1 67 ? -16.537 -6.584  -14.316 1.00 0.00 ? 66 GLY B HA3  4  
ATOM 11295 N N    . GLU B 1 68 ? -14.690 -6.357  -11.998 1.00 0.00 ? 67 GLU B N    4  
ATOM 11296 C CA   . GLU B 1 68 ? -14.281 -6.803  -10.626 1.00 0.00 ? 67 GLU B CA   4  
ATOM 11297 C C    . GLU B 1 68 ? -12.915 -6.204  -10.272 1.00 0.00 ? 67 GLU B C    4  
ATOM 11298 O O    . GLU B 1 68 ? -11.980 -6.284  -11.044 1.00 0.00 ? 67 GLU B O    4  
ATOM 11299 C CB   . GLU B 1 68 ? -14.199 -8.331  -10.587 1.00 0.00 ? 67 GLU B CB   4  
ATOM 11300 C CG   . GLU B 1 68 ? -15.611 -8.923  -10.552 1.00 0.00 ? 67 GLU B CG   4  
ATOM 11301 C CD   . GLU B 1 68 ? -15.524 -10.440 -10.373 1.00 0.00 ? 67 GLU B CD   4  
ATOM 11302 O OE1  . GLU B 1 68 ? -14.873 -11.077 -11.185 1.00 0.00 ? 67 GLU B OE1  4  
ATOM 11303 O OE2  . GLU B 1 68 ? -16.110 -10.939 -9.426  1.00 0.00 ? 67 GLU B OE2  4  
ATOM 11304 H H    . GLU B 1 68 ? -14.016 -6.187  -12.689 1.00 0.00 ? 67 GLU B H    4  
ATOM 11305 H HA   . GLU B 1 68 ? -15.022 -6.459  -9.917  1.00 0.00 ? 67 GLU B HA   4  
ATOM 11306 H HB2  . GLU B 1 68 ? -13.682 -8.685  -11.467 1.00 0.00 ? 67 GLU B HB2  4  
ATOM 11307 H HB3  . GLU B 1 68 ? -13.660 -8.641  -9.705  1.00 0.00 ? 67 GLU B HB3  4  
ATOM 11308 H HG2  . GLU B 1 68 ? -16.161 -8.494  -9.727  1.00 0.00 ? 67 GLU B HG2  4  
ATOM 11309 H HG3  . GLU B 1 68 ? -16.118 -8.701  -11.478 1.00 0.00 ? 67 GLU B HG3  4  
ATOM 11310 N N    . CYS B 1 69 ? -12.786 -5.609  -9.109  1.00 0.00 ? 68 CYS B N    4  
ATOM 11311 C CA   . CYS B 1 69 ? -11.475 -5.008  -8.702  1.00 0.00 ? 68 CYS B CA   4  
ATOM 11312 C C    . CYS B 1 69 ? -10.778 -5.941  -7.708  1.00 0.00 ? 68 CYS B C    4  
ATOM 11313 O O    . CYS B 1 69 ? -11.340 -6.324  -6.701  1.00 0.00 ? 68 CYS B O    4  
ATOM 11314 C CB   . CYS B 1 69 ? -11.723 -3.648  -8.042  1.00 0.00 ? 68 CYS B CB   4  
ATOM 11315 S SG   . CYS B 1 69 ? -10.207 -3.080  -7.234  1.00 0.00 ? 68 CYS B SG   4  
ATOM 11316 H H    . CYS B 1 69 ? -13.552 -5.562  -8.498  1.00 0.00 ? 68 CYS B H    4  
ATOM 11317 H HA   . CYS B 1 69 ? -10.844 -4.874  -9.571  1.00 0.00 ? 68 CYS B HA   4  
ATOM 11318 H HB2  . CYS B 1 69 ? -12.019 -2.932  -8.794  1.00 0.00 ? 68 CYS B HB2  4  
ATOM 11319 H HB3  . CYS B 1 69 ? -12.508 -3.742  -7.307  1.00 0.00 ? 68 CYS B HB3  4  
ATOM 11320 H HG   . CYS B 1 69 ? -9.791  -2.432  -7.807  1.00 0.00 ? 68 CYS B HG   4  
ATOM 11321 N N    . ASP B 1 70 ? -9.558  -6.316  -7.987  1.00 0.00 ? 69 ASP B N    4  
ATOM 11322 C CA   . ASP B 1 70 ? -8.822  -7.232  -7.066  1.00 0.00 ? 69 ASP B CA   4  
ATOM 11323 C C    . ASP B 1 70 ? -8.177  -6.423  -5.938  1.00 0.00 ? 69 ASP B C    4  
ATOM 11324 O O    . ASP B 1 70 ? -8.370  -5.228  -5.826  1.00 0.00 ? 69 ASP B O    4  
ATOM 11325 C CB   . ASP B 1 70 ? -7.734  -7.970  -7.848  1.00 0.00 ? 69 ASP B CB   4  
ATOM 11326 C CG   . ASP B 1 70 ? -7.175  -9.111  -6.996  1.00 0.00 ? 69 ASP B CG   4  
ATOM 11327 O OD1  . ASP B 1 70 ? -7.967  -9.875  -6.470  1.00 0.00 ? 69 ASP B OD1  4  
ATOM 11328 O OD2  . ASP B 1 70 ? -5.963  -9.201  -6.884  1.00 0.00 ? 69 ASP B OD2  4  
ATOM 11329 H H    . ASP B 1 70 ? -9.125  -6.000  -8.808  1.00 0.00 ? 69 ASP B H    4  
ATOM 11330 H HA   . ASP B 1 70 ? -9.511  -7.950  -6.645  1.00 0.00 ? 69 ASP B HA   4  
ATOM 11331 H HB2  . ASP B 1 70 ? -8.156  -8.373  -8.758  1.00 0.00 ? 69 ASP B HB2  4  
ATOM 11332 H HB3  . ASP B 1 70 ? -6.938  -7.283  -8.094  1.00 0.00 ? 69 ASP B HB3  4  
ATOM 11333 N N    . PHE B 1 71 ? -7.405  -7.067  -5.104  1.00 0.00 ? 70 PHE B N    4  
ATOM 11334 C CA   . PHE B 1 71 ? -6.738  -6.338  -3.987  1.00 0.00 ? 70 PHE B CA   4  
ATOM 11335 C C    . PHE B 1 71 ? -5.549  -5.544  -4.538  1.00 0.00 ? 70 PHE B C    4  
ATOM 11336 O O    . PHE B 1 71 ? -5.243  -4.469  -4.064  1.00 0.00 ? 70 PHE B O    4  
ATOM 11337 C CB   . PHE B 1 71 ? -6.261  -7.344  -2.935  1.00 0.00 ? 70 PHE B CB   4  
ATOM 11338 C CG   . PHE B 1 71 ? -5.682  -6.616  -1.745  1.00 0.00 ? 70 PHE B CG   4  
ATOM 11339 C CD1  . PHE B 1 71 ? -4.388  -6.087  -1.810  1.00 0.00 ? 70 PHE B CD1  4  
ATOM 11340 C CD2  . PHE B 1 71 ? -6.437  -6.475  -0.574  1.00 0.00 ? 70 PHE B CD2  4  
ATOM 11341 C CE1  . PHE B 1 71 ? -3.849  -5.417  -0.706  1.00 0.00 ? 70 PHE B CE1  4  
ATOM 11342 C CE2  . PHE B 1 71 ? -5.898  -5.805  0.530   1.00 0.00 ? 70 PHE B CE2  4  
ATOM 11343 C CZ   . PHE B 1 71 ? -4.603  -5.276  0.464   1.00 0.00 ? 70 PHE B CZ   4  
ATOM 11344 H H    . PHE B 1 71 ? -7.253  -8.028  -5.220  1.00 0.00 ? 70 PHE B H    4  
ATOM 11345 H HA   . PHE B 1 71 ? -7.437  -5.643  -3.549  1.00 0.00 ? 70 PHE B HA   4  
ATOM 11346 H HB2  . PHE B 1 71 ? -7.095  -7.951  -2.615  1.00 0.00 ? 70 PHE B HB2  4  
ATOM 11347 H HB3  . PHE B 1 71 ? -5.503  -7.980  -3.368  1.00 0.00 ? 70 PHE B HB3  4  
ATOM 11348 H HD1  . PHE B 1 71 ? -3.804  -6.196  -2.713  1.00 0.00 ? 70 PHE B HD1  4  
ATOM 11349 H HD2  . PHE B 1 71 ? -7.436  -6.883  -0.523  1.00 0.00 ? 70 PHE B HD2  4  
ATOM 11350 H HE1  . PHE B 1 71 ? -2.850  -5.010  -0.757  1.00 0.00 ? 70 PHE B HE1  4  
ATOM 11351 H HE2  . PHE B 1 71 ? -6.480  -5.698  1.433   1.00 0.00 ? 70 PHE B HE2  4  
ATOM 11352 H HZ   . PHE B 1 71 ? -4.187  -4.759  1.316   1.00 0.00 ? 70 PHE B HZ   4  
ATOM 11353 N N    . GLN B 1 72 ? -4.881  -6.050  -5.538  1.00 0.00 ? 71 GLN B N    4  
ATOM 11354 C CA   . GLN B 1 72 ? -3.726  -5.298  -6.108  1.00 0.00 ? 71 GLN B CA   4  
ATOM 11355 C C    . GLN B 1 72 ? -4.214  -3.933  -6.601  1.00 0.00 ? 71 GLN B C    4  
ATOM 11356 O O    . GLN B 1 72 ? -3.546  -2.931  -6.441  1.00 0.00 ? 71 GLN B O    4  
ATOM 11357 C CB   . GLN B 1 72 ? -3.132  -6.081  -7.281  1.00 0.00 ? 71 GLN B CB   4  
ATOM 11358 C CG   . GLN B 1 72 ? -1.768  -5.492  -7.649  1.00 0.00 ? 71 GLN B CG   4  
ATOM 11359 C CD   . GLN B 1 72 ? -1.130  -6.329  -8.759  1.00 0.00 ? 71 GLN B CD   4  
ATOM 11360 O OE1  . GLN B 1 72 ? -1.816  -6.842  -9.620  1.00 0.00 ? 71 GLN B OE1  4  
ATOM 11361 N NE2  . GLN B 1 72 ? 0.166   -6.488  -8.775  1.00 0.00 ? 71 GLN B NE2  4  
ATOM 11362 H H    . GLN B 1 72 ? -5.142  -6.915  -5.918  1.00 0.00 ? 71 GLN B H    4  
ATOM 11363 H HA   . GLN B 1 72 ? -2.970  -5.155  -5.350  1.00 0.00 ? 71 GLN B HA   4  
ATOM 11364 H HB2  . GLN B 1 72 ? -3.013  -7.118  -7.000  1.00 0.00 ? 71 GLN B HB2  4  
ATOM 11365 H HB3  . GLN B 1 72 ? -3.792  -6.012  -8.132  1.00 0.00 ? 71 GLN B HB3  4  
ATOM 11366 H HG2  . GLN B 1 72 ? -1.897  -4.476  -7.992  1.00 0.00 ? 71 GLN B HG2  4  
ATOM 11367 H HG3  . GLN B 1 72 ? -1.127  -5.501  -6.780  1.00 0.00 ? 71 GLN B HG3  4  
ATOM 11368 H HE21 . GLN B 1 72 ? 0.719   -6.073  -8.081  1.00 0.00 ? 71 GLN B HE21 4  
ATOM 11369 H HE22 . GLN B 1 72 ? 0.585   -7.022  -9.482  1.00 0.00 ? 71 GLN B HE22 4  
ATOM 11370 N N    . GLU B 1 73 ? -5.375  -3.882  -7.190  1.00 0.00 ? 72 GLU B N    4  
ATOM 11371 C CA   . GLU B 1 73 ? -5.905  -2.579  -7.681  1.00 0.00 ? 72 GLU B CA   4  
ATOM 11372 C C    . GLU B 1 73 ? -6.312  -1.708  -6.485  1.00 0.00 ? 72 GLU B C    4  
ATOM 11373 O O    . GLU B 1 73 ? -6.347  -0.497  -6.566  1.00 0.00 ? 72 GLU B O    4  
ATOM 11374 C CB   . GLU B 1 73 ? -7.114  -2.821  -8.591  1.00 0.00 ? 72 GLU B CB   4  
ATOM 11375 C CG   . GLU B 1 73 ? -6.635  -3.264  -9.976  1.00 0.00 ? 72 GLU B CG   4  
ATOM 11376 C CD   . GLU B 1 73 ? -7.824  -3.787  -10.784 1.00 0.00 ? 72 GLU B CD   4  
ATOM 11377 O OE1  . GLU B 1 73 ? -8.293  -4.871  -10.477 1.00 0.00 ? 72 GLU B OE1  4  
ATOM 11378 O OE2  . GLU B 1 73 ? -8.245  -3.096  -11.697 1.00 0.00 ? 72 GLU B OE2  4  
ATOM 11379 H H    . GLU B 1 73 ? -5.903  -4.700  -7.305  1.00 0.00 ? 72 GLU B H    4  
ATOM 11380 H HA   . GLU B 1 73 ? -5.132  -2.060  -8.229  1.00 0.00 ? 72 GLU B HA   4  
ATOM 11381 H HB2  . GLU B 1 73 ? -7.736  -3.592  -8.162  1.00 0.00 ? 72 GLU B HB2  4  
ATOM 11382 H HB3  . GLU B 1 73 ? -7.685  -1.909  -8.686  1.00 0.00 ? 72 GLU B HB3  4  
ATOM 11383 H HG2  . GLU B 1 73 ? -6.192  -2.423  -10.490 1.00 0.00 ? 72 GLU B HG2  4  
ATOM 11384 H HG3  . GLU B 1 73 ? -5.902  -4.049  -9.869  1.00 0.00 ? 72 GLU B HG3  4  
ATOM 11385 N N    . PHE B 1 74 ? -6.590  -2.322  -5.368  1.00 0.00 ? 73 PHE B N    4  
ATOM 11386 C CA   . PHE B 1 74 ? -6.967  -1.547  -4.147  1.00 0.00 ? 73 PHE B CA   4  
ATOM 11387 C C    . PHE B 1 74 ? -5.710  -0.945  -3.508  1.00 0.00 ? 73 PHE B C    4  
ATOM 11388 O O    . PHE B 1 74 ? -5.722  0.193   -3.086  1.00 0.00 ? 73 PHE B O    4  
ATOM 11389 C CB   . PHE B 1 74 ? -7.706  -2.458  -3.157  1.00 0.00 ? 73 PHE B CB   4  
ATOM 11390 C CG   . PHE B 1 74 ? -7.859  -1.773  -1.813  1.00 0.00 ? 73 PHE B CG   4  
ATOM 11391 C CD1  . PHE B 1 74 ? -8.500  -0.530  -1.725  1.00 0.00 ? 73 PHE B CD1  4  
ATOM 11392 C CD2  . PHE B 1 74 ? -7.369  -2.387  -0.650  1.00 0.00 ? 73 PHE B CD2  4  
ATOM 11393 C CE1  . PHE B 1 74 ? -8.648  0.097   -0.482  1.00 0.00 ? 73 PHE B CE1  4  
ATOM 11394 C CE2  . PHE B 1 74 ? -7.519  -1.760  0.592   1.00 0.00 ? 73 PHE B CE2  4  
ATOM 11395 C CZ   . PHE B 1 74 ? -8.159  -0.518  0.676   1.00 0.00 ? 73 PHE B CZ   4  
ATOM 11396 H H    . PHE B 1 74 ? -6.513  -3.298  -5.318  1.00 0.00 ? 73 PHE B H    4  
ATOM 11397 H HA   . PHE B 1 74 ? -7.574  -0.693  -4.398  1.00 0.00 ? 73 PHE B HA   4  
ATOM 11398 H HB2  . PHE B 1 74 ? -8.685  -2.690  -3.551  1.00 0.00 ? 73 PHE B HB2  4  
ATOM 11399 H HB3  . PHE B 1 74 ? -7.147  -3.374  -3.034  1.00 0.00 ? 73 PHE B HB3  4  
ATOM 11400 H HD1  . PHE B 1 74 ? -8.877  -0.052  -2.615  1.00 0.00 ? 73 PHE B HD1  4  
ATOM 11401 H HD2  . PHE B 1 74 ? -6.875  -3.346  -0.713  1.00 0.00 ? 73 PHE B HD2  4  
ATOM 11402 H HE1  . PHE B 1 74 ? -9.142  1.055   -0.416  1.00 0.00 ? 73 PHE B HE1  4  
ATOM 11403 H HE2  . PHE B 1 74 ? -7.141  -2.234  1.486   1.00 0.00 ? 73 PHE B HE2  4  
ATOM 11404 H HZ   . PHE B 1 74 ? -8.274  -0.034  1.635   1.00 0.00 ? 73 PHE B HZ   4  
ATOM 11405 N N    . MET B 1 75 ? -4.626  -1.658  -3.435  1.00 0.00 ? 74 MET B N    4  
ATOM 11406 C CA   . MET B 1 75 ? -3.413  -1.042  -2.823  1.00 0.00 ? 74 MET B CA   4  
ATOM 11407 C C    . MET B 1 75 ? -2.927  0.093   -3.728  1.00 0.00 ? 74 MET B C    4  
ATOM 11408 O O    . MET B 1 75 ? -2.331  1.041   -3.256  1.00 0.00 ? 74 MET B O    4  
ATOM 11409 C CB   . MET B 1 75 ? -2.310  -2.087  -2.654  1.00 0.00 ? 74 MET B CB   4  
ATOM 11410 C CG   . MET B 1 75 ? -1.228  -1.538  -1.719  1.00 0.00 ? 74 MET B CG   4  
ATOM 11411 S SD   . MET B 1 75 ? -1.855  -1.504  -0.015  1.00 0.00 ? 74 MET B SD   4  
ATOM 11412 C CE   . MET B 1 75 ? -1.795  0.289   0.256   1.00 0.00 ? 74 MET B CE   4  
ATOM 11413 H H    . MET B 1 75 ? -4.600  -2.572  -3.791  1.00 0.00 ? 74 MET B H    4  
ATOM 11414 H HA   . MET B 1 75 ? -3.669  -0.614  -1.866  1.00 0.00 ? 74 MET B HA   4  
ATOM 11415 H HB2  . MET B 1 75 ? -2.730  -2.989  -2.232  1.00 0.00 ? 74 MET B HB2  4  
ATOM 11416 H HB3  . MET B 1 75 ? -1.874  -2.307  -3.616  1.00 0.00 ? 74 MET B HB3  4  
ATOM 11417 H HG2  . MET B 1 75 ? -0.357  -2.175  -1.768  1.00 0.00 ? 74 MET B HG2  4  
ATOM 11418 H HG3  . MET B 1 75 ? -0.959  -0.540  -2.031  1.00 0.00 ? 74 MET B HG3  4  
ATOM 11419 H HE1  . MET B 1 75 ? -0.822  0.665   -0.029  1.00 0.00 ? 74 MET B HE1  4  
ATOM 11420 H HE2  . MET B 1 75 ? -2.560  0.768   -0.336  1.00 0.00 ? 74 MET B HE2  4  
ATOM 11421 H HE3  . MET B 1 75 ? -1.966  0.502   1.299   1.00 0.00 ? 74 MET B HE3  4  
ATOM 11422 N N    . ALA B 1 76 ? -3.181  0.046   -5.005  1.00 0.00 ? 75 ALA B N    4  
ATOM 11423 C CA   . ALA B 1 76 ? -2.738  1.163   -5.891  1.00 0.00 ? 75 ALA B CA   4  
ATOM 11424 C C    . ALA B 1 76 ? -3.675  2.369   -5.735  1.00 0.00 ? 75 ALA B C    4  
ATOM 11425 O O    . ALA B 1 76 ? -3.228  3.474   -5.499  1.00 0.00 ? 75 ALA B O    4  
ATOM 11426 C CB   . ALA B 1 76 ? -2.763  0.691   -7.346  1.00 0.00 ? 75 ALA B CB   4  
ATOM 11427 H H    . ALA B 1 76 ? -3.676  -0.695  -5.414  1.00 0.00 ? 75 ALA B H    4  
ATOM 11428 H HA   . ALA B 1 76 ? -1.743  1.500   -5.644  1.00 0.00 ? 75 ALA B HA   4  
ATOM 11429 H HB1  . ALA B 1 76 ? -3.693  0.178   -7.543  1.00 0.00 ? 75 ALA B HB1  4  
ATOM 11430 H HB2  . ALA B 1 76 ? -2.676  1.544   -8.003  1.00 0.00 ? 75 ALA B HB2  4  
ATOM 11431 H HB3  . ALA B 1 76 ? -1.937  0.017   -7.520  1.00 0.00 ? 75 ALA B HB3  4  
ATOM 11432 N N    . PHE B 1 77 ? -4.962  2.187   -5.870  1.00 0.00 ? 76 PHE B N    4  
ATOM 11433 C CA   . PHE B 1 77 ? -5.886  3.354   -5.733  1.00 0.00 ? 76 PHE B CA   4  
ATOM 11434 C C    . PHE B 1 77 ? -5.723  3.978   -4.340  1.00 0.00 ? 76 PHE B C    4  
ATOM 11435 O O    . PHE B 1 77 ? -5.833  5.176   -4.172  1.00 0.00 ? 76 PHE B O    4  
ATOM 11436 C CB   . PHE B 1 77 ? -7.345  2.900   -5.940  1.00 0.00 ? 76 PHE B CB   4  
ATOM 11437 C CG   . PHE B 1 77 ? -7.679  2.881   -7.421  1.00 0.00 ? 76 PHE B CG   4  
ATOM 11438 C CD1  . PHE B 1 77 ? -7.626  4.068   -8.166  1.00 0.00 ? 76 PHE B CD1  4  
ATOM 11439 C CD2  . PHE B 1 77 ? -8.038  1.680   -8.049  1.00 0.00 ? 76 PHE B CD2  4  
ATOM 11440 C CE1  . PHE B 1 77 ? -7.929  4.052   -9.531  1.00 0.00 ? 76 PHE B CE1  4  
ATOM 11441 C CE2  . PHE B 1 77 ? -8.342  1.667   -9.416  1.00 0.00 ? 76 PHE B CE2  4  
ATOM 11442 C CZ   . PHE B 1 77 ? -8.286  2.852   -10.157 1.00 0.00 ? 76 PHE B CZ   4  
ATOM 11443 H H    . PHE B 1 77 ? -5.317  1.295   -6.068  1.00 0.00 ? 76 PHE B H    4  
ATOM 11444 H HA   . PHE B 1 77 ? -5.625  4.096   -6.472  1.00 0.00 ? 76 PHE B HA   4  
ATOM 11445 H HB2  . PHE B 1 77 ? -7.471  1.910   -5.529  1.00 0.00 ? 76 PHE B HB2  4  
ATOM 11446 H HB3  . PHE B 1 77 ? -8.013  3.584   -5.435  1.00 0.00 ? 76 PHE B HB3  4  
ATOM 11447 H HD1  . PHE B 1 77 ? -7.356  4.997   -7.688  1.00 0.00 ? 76 PHE B HD1  4  
ATOM 11448 H HD2  . PHE B 1 77 ? -8.084  0.766   -7.480  1.00 0.00 ? 76 PHE B HD2  4  
ATOM 11449 H HE1  . PHE B 1 77 ? -7.885  4.967   -10.102 1.00 0.00 ? 76 PHE B HE1  4  
ATOM 11450 H HE2  . PHE B 1 77 ? -8.618  0.741   -9.899  1.00 0.00 ? 76 PHE B HE2  4  
ATOM 11451 H HZ   . PHE B 1 77 ? -8.519  2.840   -11.211 1.00 0.00 ? 76 PHE B HZ   4  
ATOM 11452 N N    . VAL B 1 78 ? -5.454  3.182   -3.347  1.00 0.00 ? 77 VAL B N    4  
ATOM 11453 C CA   . VAL B 1 78 ? -5.277  3.746   -1.977  1.00 0.00 ? 77 VAL B CA   4  
ATOM 11454 C C    . VAL B 1 78 ? -4.056  4.675   -1.974  1.00 0.00 ? 77 VAL B C    4  
ATOM 11455 O O    . VAL B 1 78 ? -4.018  5.661   -1.266  1.00 0.00 ? 77 VAL B O    4  
ATOM 11456 C CB   . VAL B 1 78 ? -5.063  2.601   -0.977  1.00 0.00 ? 77 VAL B CB   4  
ATOM 11457 C CG1  . VAL B 1 78 ? -4.583  3.160   0.368   1.00 0.00 ? 77 VAL B CG1  4  
ATOM 11458 C CG2  . VAL B 1 78 ? -6.383  1.852   -0.768  1.00 0.00 ? 77 VAL B CG2  4  
ATOM 11459 H H    . VAL B 1 78 ? -5.358  2.218   -3.504  1.00 0.00 ? 77 VAL B H    4  
ATOM 11460 H HA   . VAL B 1 78 ? -6.158  4.307   -1.702  1.00 0.00 ? 77 VAL B HA   4  
ATOM 11461 H HB   . VAL B 1 78 ? -4.321  1.920   -1.367  1.00 0.00 ? 77 VAL B HB   4  
ATOM 11462 H HG11 . VAL B 1 78 ? -5.188  4.012   0.641   1.00 0.00 ? 77 VAL B HG11 4  
ATOM 11463 H HG12 . VAL B 1 78 ? -4.672  2.397   1.128   1.00 0.00 ? 77 VAL B HG12 4  
ATOM 11464 H HG13 . VAL B 1 78 ? -3.550  3.464   0.283   1.00 0.00 ? 77 VAL B HG13 4  
ATOM 11465 H HG21 . VAL B 1 78 ? -6.873  1.708   -1.720  1.00 0.00 ? 77 VAL B HG21 4  
ATOM 11466 H HG22 . VAL B 1 78 ? -6.181  0.891   -0.319  1.00 0.00 ? 77 VAL B HG22 4  
ATOM 11467 H HG23 . VAL B 1 78 ? -7.027  2.425   -0.116  1.00 0.00 ? 77 VAL B HG23 4  
ATOM 11468 N N    . SER B 1 79 ? -3.058  4.363   -2.753  1.00 0.00 ? 78 SER B N    4  
ATOM 11469 C CA   . SER B 1 79 ? -1.840  5.223   -2.789  1.00 0.00 ? 78 SER B CA   4  
ATOM 11470 C C    . SER B 1 79 ? -2.154  6.560   -3.471  1.00 0.00 ? 78 SER B C    4  
ATOM 11471 O O    . SER B 1 79 ? -1.869  7.617   -2.944  1.00 0.00 ? 78 SER B O    4  
ATOM 11472 C CB   . SER B 1 79 ? -0.739  4.504   -3.569  1.00 0.00 ? 78 SER B CB   4  
ATOM 11473 O OG   . SER B 1 79 ? -1.034  4.564   -4.958  1.00 0.00 ? 78 SER B OG   4  
ATOM 11474 H H    . SER B 1 79 ? -3.107  3.561   -3.313  1.00 0.00 ? 78 SER B H    4  
ATOM 11475 H HA   . SER B 1 79 ? -1.502  5.406   -1.780  1.00 0.00 ? 78 SER B HA   4  
ATOM 11476 H HB2  . SER B 1 79 ? 0.207   4.985   -3.387  1.00 0.00 ? 78 SER B HB2  4  
ATOM 11477 H HB3  . SER B 1 79 ? -0.685  3.473   -3.245  1.00 0.00 ? 78 SER B HB3  4  
ATOM 11478 H HG   . SER B 1 79 ? -1.988  4.603   -5.058  1.00 0.00 ? 78 SER B HG   4  
ATOM 11479 N N    . MET B 1 80 ? -2.711  6.521   -4.649  1.00 0.00 ? 79 MET B N    4  
ATOM 11480 C CA   . MET B 1 80 ? -3.011  7.787   -5.382  1.00 0.00 ? 79 MET B CA   4  
ATOM 11481 C C    . MET B 1 80 ? -3.771  8.768   -4.487  1.00 0.00 ? 79 MET B C    4  
ATOM 11482 O O    . MET B 1 80 ? -3.541  9.959   -4.536  1.00 0.00 ? 79 MET B O    4  
ATOM 11483 C CB   . MET B 1 80 ? -3.859  7.469   -6.615  1.00 0.00 ? 79 MET B CB   4  
ATOM 11484 C CG   . MET B 1 80 ? -3.009  6.719   -7.641  1.00 0.00 ? 79 MET B CG   4  
ATOM 11485 S SD   . MET B 1 80 ? -4.019  6.327   -9.092  1.00 0.00 ? 79 MET B SD   4  
ATOM 11486 C CE   . MET B 1 80 ? -3.797  7.901   -9.957  1.00 0.00 ? 79 MET B CE   4  
ATOM 11487 H H    . MET B 1 80 ? -2.907  5.661   -5.077  1.00 0.00 ? 79 MET B H    4  
ATOM 11488 H HA   . MET B 1 80 ? -2.086  8.244   -5.696  1.00 0.00 ? 79 MET B HA   4  
ATOM 11489 H HB2  . MET B 1 80 ? -4.700  6.855   -6.324  1.00 0.00 ? 79 MET B HB2  4  
ATOM 11490 H HB3  . MET B 1 80 ? -4.218  8.389   -7.051  1.00 0.00 ? 79 MET B HB3  4  
ATOM 11491 H HG2  . MET B 1 80 ? -2.176  7.337   -7.940  1.00 0.00 ? 79 MET B HG2  4  
ATOM 11492 H HG3  . MET B 1 80 ? -2.639  5.804   -7.203  1.00 0.00 ? 79 MET B HG3  4  
ATOM 11493 H HE1  . MET B 1 80 ? -2.744  8.098   -10.085 1.00 0.00 ? 79 MET B HE1  4  
ATOM 11494 H HE2  . MET B 1 80 ? -4.272  7.848   -10.927 1.00 0.00 ? 79 MET B HE2  4  
ATOM 11495 H HE3  . MET B 1 80 ? -4.241  8.697   -9.375  1.00 0.00 ? 79 MET B HE3  4  
ATOM 11496 N N    . VAL B 1 81 ? -4.673  8.292   -3.679  1.00 0.00 ? 80 VAL B N    4  
ATOM 11497 C CA   . VAL B 1 81 ? -5.438  9.227   -2.799  1.00 0.00 ? 80 VAL B CA   4  
ATOM 11498 C C    . VAL B 1 81 ? -4.540  9.725   -1.664  1.00 0.00 ? 80 VAL B C    4  
ATOM 11499 O O    . VAL B 1 81 ? -4.440  10.911  -1.421  1.00 0.00 ? 80 VAL B O    4  
ATOM 11500 C CB   . VAL B 1 81 ? -6.651  8.503   -2.204  1.00 0.00 ? 80 VAL B CB   4  
ATOM 11501 C CG1  . VAL B 1 81 ? -7.495  9.495   -1.399  1.00 0.00 ? 80 VAL B CG1  4  
ATOM 11502 C CG2  . VAL B 1 81 ? -7.504  7.911   -3.329  1.00 0.00 ? 80 VAL B CG2  4  
ATOM 11503 H H    . VAL B 1 81 ? -4.846  7.327   -3.649  1.00 0.00 ? 80 VAL B H    4  
ATOM 11504 H HA   . VAL B 1 81 ? -5.773  10.072  -3.387  1.00 0.00 ? 80 VAL B HA   4  
ATOM 11505 H HB   . VAL B 1 81 ? -6.311  7.711   -1.552  1.00 0.00 ? 80 VAL B HB   4  
ATOM 11506 H HG11 . VAL B 1 81 ? -7.619  10.405  -1.967  1.00 0.00 ? 80 VAL B HG11 4  
ATOM 11507 H HG12 . VAL B 1 81 ? -8.464  9.062   -1.196  1.00 0.00 ? 80 VAL B HG12 4  
ATOM 11508 H HG13 . VAL B 1 81 ? -6.998  9.717   -0.467  1.00 0.00 ? 80 VAL B HG13 4  
ATOM 11509 H HG21 . VAL B 1 81 ? -6.883  7.306   -3.973  1.00 0.00 ? 80 VAL B HG21 4  
ATOM 11510 H HG22 . VAL B 1 81 ? -8.287  7.298   -2.902  1.00 0.00 ? 80 VAL B HG22 4  
ATOM 11511 H HG23 . VAL B 1 81 ? -7.947  8.710   -3.902  1.00 0.00 ? 80 VAL B HG23 4  
ATOM 11512 N N    . THR B 1 82 ? -3.875  8.842   -0.972  1.00 0.00 ? 81 THR B N    4  
ATOM 11513 C CA   . THR B 1 82 ? -2.981  9.297   0.130   1.00 0.00 ? 81 THR B CA   4  
ATOM 11514 C C    . THR B 1 82 ? -1.908  10.218  -0.455  1.00 0.00 ? 81 THR B C    4  
ATOM 11515 O O    . THR B 1 82 ? -1.567  11.237  0.114   1.00 0.00 ? 81 THR B O    4  
ATOM 11516 C CB   . THR B 1 82 ? -2.312  8.086   0.783   1.00 0.00 ? 81 THR B CB   4  
ATOM 11517 O OG1  . THR B 1 82 ? -3.304  7.135   1.141   1.00 0.00 ? 81 THR B OG1  4  
ATOM 11518 C CG2  . THR B 1 82 ? -1.555  8.535   2.035   1.00 0.00 ? 81 THR B CG2  4  
ATOM 11519 H H    . THR B 1 82 ? -3.955  7.888   -1.182  1.00 0.00 ? 81 THR B H    4  
ATOM 11520 H HA   . THR B 1 82 ? -3.559  9.835   0.867   1.00 0.00 ? 81 THR B HA   4  
ATOM 11521 H HB   . THR B 1 82 ? -1.617  7.640   0.089   1.00 0.00 ? 81 THR B HB   4  
ATOM 11522 H HG1  . THR B 1 82 ? -3.600  6.700   0.338   1.00 0.00 ? 81 THR B HG1  4  
ATOM 11523 H HG21 . THR B 1 82 ? -0.867  9.326   1.775   1.00 0.00 ? 81 THR B HG21 4  
ATOM 11524 H HG22 . THR B 1 82 ? -2.257  8.896   2.771   1.00 0.00 ? 81 THR B HG22 4  
ATOM 11525 H HG23 . THR B 1 82 ? -1.005  7.699   2.441   1.00 0.00 ? 81 THR B HG23 4  
ATOM 11526 N N    . THR B 1 83 ? -1.378  9.862   -1.592  1.00 0.00 ? 82 THR B N    4  
ATOM 11527 C CA   . THR B 1 83 ? -0.329  10.703  -2.234  1.00 0.00 ? 82 THR B CA   4  
ATOM 11528 C C    . THR B 1 83 ? -0.963  11.971  -2.814  1.00 0.00 ? 82 THR B C    4  
ATOM 11529 O O    . THR B 1 83 ? -0.295  12.962  -3.034  1.00 0.00 ? 82 THR B O    4  
ATOM 11530 C CB   . THR B 1 83 ? 0.344   9.908   -3.355  1.00 0.00 ? 82 THR B CB   4  
ATOM 11531 O OG1  . THR B 1 83 ? -0.650  9.394   -4.229  1.00 0.00 ? 82 THR B OG1  4  
ATOM 11532 C CG2  . THR B 1 83 ? 1.145   8.753   -2.752  1.00 0.00 ? 82 THR B CG2  4  
ATOM 11533 H H    . THR B 1 83 ? -1.674  9.037   -2.029  1.00 0.00 ? 82 THR B H    4  
ATOM 11534 H HA   . THR B 1 83 ? 0.411   10.977  -1.496  1.00 0.00 ? 82 THR B HA   4  
ATOM 11535 H HB   . THR B 1 83 ? 1.010   10.554  -3.906  1.00 0.00 ? 82 THR B HB   4  
ATOM 11536 H HG1  . THR B 1 83 ? -0.210  9.055   -5.012  1.00 0.00 ? 82 THR B HG1  4  
ATOM 11537 H HG21 . THR B 1 83 ? 1.833   9.139   -2.014  1.00 0.00 ? 82 THR B HG21 4  
ATOM 11538 H HG22 . THR B 1 83 ? 0.469   8.053   -2.283  1.00 0.00 ? 82 THR B HG22 4  
ATOM 11539 H HG23 . THR B 1 83 ? 1.698   8.253   -3.533  1.00 0.00 ? 82 THR B HG23 4  
ATOM 11540 N N    . ALA B 1 84 ? -2.246  11.954  -3.061  1.00 0.00 ? 83 ALA B N    4  
ATOM 11541 C CA   . ALA B 1 84 ? -2.910  13.167  -3.622  1.00 0.00 ? 83 ALA B CA   4  
ATOM 11542 C C    . ALA B 1 84 ? -2.654  14.350  -2.692  1.00 0.00 ? 83 ALA B C    4  
ATOM 11543 O O    . ALA B 1 84 ? -2.644  15.492  -3.106  1.00 0.00 ? 83 ALA B O    4  
ATOM 11544 C CB   . ALA B 1 84 ? -4.417  12.930  -3.732  1.00 0.00 ? 83 ALA B CB   4  
ATOM 11545 H H    . ALA B 1 84 ? -2.773  11.151  -2.866  1.00 0.00 ? 83 ALA B H    4  
ATOM 11546 H HA   . ALA B 1 84 ? -2.504  13.381  -4.600  1.00 0.00 ? 83 ALA B HA   4  
ATOM 11547 H HB1  . ALA B 1 84 ? -4.602  12.023  -4.286  1.00 0.00 ? 83 ALA B HB1  4  
ATOM 11548 H HB2  . ALA B 1 84 ? -4.840  12.840  -2.742  1.00 0.00 ? 83 ALA B HB2  4  
ATOM 11549 H HB3  . ALA B 1 84 ? -4.876  13.763  -4.244  1.00 0.00 ? 83 ALA B HB3  4  
ATOM 11550 N N    . CYS B 1 85 ? -2.447  14.082  -1.433  1.00 0.00 ? 84 CYS B N    4  
ATOM 11551 C CA   . CYS B 1 85 ? -2.191  15.187  -0.468  1.00 0.00 ? 84 CYS B CA   4  
ATOM 11552 C C    . CYS B 1 85 ? -0.779  15.737  -0.686  1.00 0.00 ? 84 CYS B C    4  
ATOM 11553 O O    . CYS B 1 85 ? 0.116   15.028  -1.101  1.00 0.00 ? 84 CYS B O    4  
ATOM 11554 C CB   . CYS B 1 85 ? -2.316  14.655  0.961   1.00 0.00 ? 84 CYS B CB   4  
ATOM 11555 S SG   . CYS B 1 85 ? -0.914  13.570  1.326   1.00 0.00 ? 84 CYS B SG   4  
ATOM 11556 H H    . CYS B 1 85 ? -2.462  13.151  -1.123  1.00 0.00 ? 84 CYS B H    4  
ATOM 11557 H HA   . CYS B 1 85 ? -2.913  15.976  -0.624  1.00 0.00 ? 84 CYS B HA   4  
ATOM 11558 H HB2  . CYS B 1 85 ? -2.321  15.483  1.655   1.00 0.00 ? 84 CYS B HB2  4  
ATOM 11559 H HB3  . CYS B 1 85 ? -3.237  14.099  1.059   1.00 0.00 ? 84 CYS B HB3  4  
ATOM 11560 H HG   . CYS B 1 85 ? -1.052  12.742  0.860   1.00 0.00 ? 84 CYS B HG   4  
ATOM 11561 N N    . HIS B 1 86 ? -0.576  16.997  -0.413  1.00 0.00 ? 85 HIS B N    4  
ATOM 11562 C CA   . HIS B 1 86 ? 0.776   17.596  -0.607  1.00 0.00 ? 85 HIS B CA   4  
ATOM 11563 C C    . HIS B 1 86 ? 1.837   16.693  0.023   1.00 0.00 ? 85 HIS B C    4  
ATOM 11564 O O    . HIS B 1 86 ? 1.529   15.711  0.670   1.00 0.00 ? 85 HIS B O    4  
ATOM 11565 C CB   . HIS B 1 86 ? 0.821   18.973  0.058   1.00 0.00 ? 85 HIS B CB   4  
ATOM 11566 C CG   . HIS B 1 86 ? 0.510   18.832  1.522   1.00 0.00 ? 85 HIS B CG   4  
ATOM 11567 N ND1  . HIS B 1 86 ? -0.340  17.849  2.006   1.00 0.00 ? 85 HIS B ND1  4  
ATOM 11568 C CD2  . HIS B 1 86 ? 0.929   19.539  2.622   1.00 0.00 ? 85 HIS B CD2  4  
ATOM 11569 C CE1  . HIS B 1 86 ? -0.404  17.991  3.342   1.00 0.00 ? 85 HIS B CE1  4  
ATOM 11570 N NE2  . HIS B 1 86 ? 0.350   19.007  3.770   1.00 0.00 ? 85 HIS B NE2  4  
ATOM 11571 H H    . HIS B 1 86 ? -1.313  17.551  -0.083  1.00 0.00 ? 85 HIS B H    4  
ATOM 11572 H HA   . HIS B 1 86 ? 0.975   17.701  -1.664  1.00 0.00 ? 85 HIS B HA   4  
ATOM 11573 H HB2  . HIS B 1 86 ? 1.807   19.399  -0.061  1.00 0.00 ? 85 HIS B HB2  4  
ATOM 11574 H HB3  . HIS B 1 86 ? 0.091   19.621  -0.404  1.00 0.00 ? 85 HIS B HB3  4  
ATOM 11575 H HD1  . HIS B 1 86 ? -0.808  17.174  1.471   1.00 0.00 ? 85 HIS B HD1  4  
ATOM 11576 H HD2  . HIS B 1 86 ? 1.604   20.381  2.600   1.00 0.00 ? 85 HIS B HD2  4  
ATOM 11577 H HE1  . HIS B 1 86 ? -0.995  17.359  3.990   1.00 0.00 ? 85 HIS B HE1  4  
ATOM 11578 N N    . GLU B 1 87 ? 3.089   17.018  -0.158  1.00 0.00 ? 86 GLU B N    4  
ATOM 11579 C CA   . GLU B 1 87 ? 4.174   16.182  0.431   1.00 0.00 ? 86 GLU B CA   4  
ATOM 11580 C C    . GLU B 1 87 ? 3.850   15.889  1.900   1.00 0.00 ? 86 GLU B C    4  
ATOM 11581 O O    . GLU B 1 87 ? 4.066   16.710  2.769   1.00 0.00 ? 86 GLU B O    4  
ATOM 11582 C CB   . GLU B 1 87 ? 5.506   16.940  0.332   1.00 0.00 ? 86 GLU B CB   4  
ATOM 11583 C CG   . GLU B 1 87 ? 5.268   18.433  0.584   1.00 0.00 ? 86 GLU B CG   4  
ATOM 11584 C CD   . GLU B 1 87 ? 6.598   19.120  0.904   1.00 0.00 ? 86 GLU B CD   4  
ATOM 11585 O OE1  . GLU B 1 87 ? 7.618   18.638  0.440   1.00 0.00 ? 86 GLU B OE1  4  
ATOM 11586 O OE2  . GLU B 1 87 ? 6.573   20.116  1.608   1.00 0.00 ? 86 GLU B OE2  4  
ATOM 11587 H H    . GLU B 1 87 ? 3.315   17.815  -0.682  1.00 0.00 ? 86 GLU B H    4  
ATOM 11588 H HA   . GLU B 1 87 ? 4.248   15.252  -0.114  1.00 0.00 ? 86 GLU B HA   4  
ATOM 11589 H HB2  . GLU B 1 87 ? 6.201   16.553  1.066   1.00 0.00 ? 86 GLU B HB2  4  
ATOM 11590 H HB3  . GLU B 1 87 ? 5.920   16.807  -0.657  1.00 0.00 ? 86 GLU B HB3  4  
ATOM 11591 H HG2  . GLU B 1 87 ? 4.835   18.881  -0.299  1.00 0.00 ? 86 GLU B HG2  4  
ATOM 11592 H HG3  . GLU B 1 87 ? 4.593   18.557  1.417   1.00 0.00 ? 86 GLU B HG3  4  
ATOM 11593 N N    . PHE B 1 88 ? 3.331   14.726  2.185   1.00 0.00 ? 87 PHE B N    4  
ATOM 11594 C CA   . PHE B 1 88 ? 2.996   14.396  3.597   1.00 0.00 ? 87 PHE B CA   4  
ATOM 11595 C C    . PHE B 1 88 ? 4.280   14.340  4.429   1.00 0.00 ? 87 PHE B C    4  
ATOM 11596 O O    . PHE B 1 88 ? 4.258   14.535  5.628   1.00 0.00 ? 87 PHE B O    4  
ATOM 11597 C CB   . PHE B 1 88 ? 2.266   13.050  3.663   1.00 0.00 ? 87 PHE B CB   4  
ATOM 11598 C CG   . PHE B 1 88 ? 3.120   11.962  3.055   1.00 0.00 ? 87 PHE B CG   4  
ATOM 11599 C CD1  . PHE B 1 88 ? 4.171   11.403  3.792   1.00 0.00 ? 87 PHE B CD1  4  
ATOM 11600 C CD2  . PHE B 1 88 ? 2.854   11.502  1.758   1.00 0.00 ? 87 PHE B CD2  4  
ATOM 11601 C CE1  . PHE B 1 88 ? 4.955   10.387  3.234   1.00 0.00 ? 87 PHE B CE1  4  
ATOM 11602 C CE2  . PHE B 1 88 ? 3.639   10.487  1.201   1.00 0.00 ? 87 PHE B CE2  4  
ATOM 11603 C CZ   . PHE B 1 88 ? 4.689   9.929   1.939   1.00 0.00 ? 87 PHE B CZ   4  
ATOM 11604 H H    . PHE B 1 88 ? 3.161   14.075  1.473   1.00 0.00 ? 87 PHE B H    4  
ATOM 11605 H HA   . PHE B 1 88 ? 2.352   15.167  3.995   1.00 0.00 ? 87 PHE B HA   4  
ATOM 11606 H HB2  . PHE B 1 88 ? 2.059   12.807  4.695   1.00 0.00 ? 87 PHE B HB2  4  
ATOM 11607 H HB3  . PHE B 1 88 ? 1.335   13.121  3.120   1.00 0.00 ? 87 PHE B HB3  4  
ATOM 11608 H HD1  . PHE B 1 88 ? 4.376   11.756  4.792   1.00 0.00 ? 87 PHE B HD1  4  
ATOM 11609 H HD2  . PHE B 1 88 ? 2.044   11.933  1.188   1.00 0.00 ? 87 PHE B HD2  4  
ATOM 11610 H HE1  . PHE B 1 88 ? 5.765   9.956   3.803   1.00 0.00 ? 87 PHE B HE1  4  
ATOM 11611 H HE2  . PHE B 1 88 ? 3.434   10.133  0.201   1.00 0.00 ? 87 PHE B HE2  4  
ATOM 11612 H HZ   . PHE B 1 88 ? 5.294   9.145   1.509   1.00 0.00 ? 87 PHE B HZ   4  
ATOM 11613 N N    . PHE B 1 89 ? 5.401   14.085  3.808   1.00 0.00 ? 88 PHE B N    4  
ATOM 11614 C CA   . PHE B 1 89 ? 6.677   14.032  4.579   1.00 0.00 ? 88 PHE B CA   4  
ATOM 11615 C C    . PHE B 1 89 ? 6.823   15.319  5.390   1.00 0.00 ? 88 PHE B C    4  
ATOM 11616 O O    . PHE B 1 89 ? 7.227   15.305  6.535   1.00 0.00 ? 88 PHE B O    4  
ATOM 11617 C CB   . PHE B 1 89 ? 7.862   13.904  3.618   1.00 0.00 ? 88 PHE B CB   4  
ATOM 11618 C CG   . PHE B 1 89 ? 7.571   12.849  2.578   1.00 0.00 ? 88 PHE B CG   4  
ATOM 11619 C CD1  . PHE B 1 89 ? 7.779   11.497  2.874   1.00 0.00 ? 88 PHE B CD1  4  
ATOM 11620 C CD2  . PHE B 1 89 ? 7.101   13.225  1.313   1.00 0.00 ? 88 PHE B CD2  4  
ATOM 11621 C CE1  . PHE B 1 89 ? 7.516   10.520  1.906   1.00 0.00 ? 88 PHE B CE1  4  
ATOM 11622 C CE2  . PHE B 1 89 ? 6.840   12.248  0.345   1.00 0.00 ? 88 PHE B CE2  4  
ATOM 11623 C CZ   . PHE B 1 89 ? 7.047   10.896  0.641   1.00 0.00 ? 88 PHE B CZ   4  
ATOM 11624 H H    . PHE B 1 89 ? 5.404   13.936  2.839   1.00 0.00 ? 88 PHE B H    4  
ATOM 11625 H HA   . PHE B 1 89 ? 6.661   13.188  5.250   1.00 0.00 ? 88 PHE B HA   4  
ATOM 11626 H HB2  . PHE B 1 89 ? 8.032   14.852  3.128   1.00 0.00 ? 88 PHE B HB2  4  
ATOM 11627 H HB3  . PHE B 1 89 ? 8.745   13.625  4.173   1.00 0.00 ? 88 PHE B HB3  4  
ATOM 11628 H HD1  . PHE B 1 89 ? 8.140   11.207  3.850   1.00 0.00 ? 88 PHE B HD1  4  
ATOM 11629 H HD2  . PHE B 1 89 ? 6.940   14.268  1.086   1.00 0.00 ? 88 PHE B HD2  4  
ATOM 11630 H HE1  . PHE B 1 89 ? 7.676   9.476   2.134   1.00 0.00 ? 88 PHE B HE1  4  
ATOM 11631 H HE2  . PHE B 1 89 ? 6.477   12.539  -0.630  1.00 0.00 ? 88 PHE B HE2  4  
ATOM 11632 H HZ   . PHE B 1 89 ? 6.845   10.143  -0.106  1.00 0.00 ? 88 PHE B HZ   4  
ATOM 11633 N N    . GLU B 1 90 ? 6.499   16.434  4.788   1.00 0.00 ? 89 GLU B N    4  
ATOM 11634 C CA   . GLU B 1 90 ? 6.614   17.746  5.491   1.00 0.00 ? 89 GLU B CA   4  
ATOM 11635 C C    . GLU B 1 90 ? 5.226   18.216  5.925   1.00 0.00 ? 89 GLU B C    4  
ATOM 11636 O O    . GLU B 1 90 ? 4.799   19.306  5.599   1.00 0.00 ? 89 GLU B O    4  
ATOM 11637 C CB   . GLU B 1 90 ? 7.223   18.776  4.539   1.00 0.00 ? 89 GLU B CB   4  
ATOM 11638 C CG   . GLU B 1 90 ? 8.465   18.181  3.871   1.00 0.00 ? 89 GLU B CG   4  
ATOM 11639 C CD   . GLU B 1 90 ? 9.135   19.245  3.000   1.00 0.00 ? 89 GLU B CD   4  
ATOM 11640 O OE1  . GLU B 1 90 ? 8.715   20.389  3.068   1.00 0.00 ? 89 GLU B OE1  4  
ATOM 11641 O OE2  . GLU B 1 90 ? 10.057  18.899  2.280   1.00 0.00 ? 89 GLU B OE2  4  
ATOM 11642 H H    . GLU B 1 90 ? 6.183   16.408  3.865   1.00 0.00 ? 89 GLU B H    4  
ATOM 11643 H HA   . GLU B 1 90 ? 7.246   17.644  6.359   1.00 0.00 ? 89 GLU B HA   4  
ATOM 11644 H HB2  . GLU B 1 90 ? 6.498   19.041  3.783   1.00 0.00 ? 89 GLU B HB2  4  
ATOM 11645 H HB3  . GLU B 1 90 ? 7.504   19.659  5.094   1.00 0.00 ? 89 GLU B HB3  4  
ATOM 11646 H HG2  . GLU B 1 90 ? 9.157   17.848  4.631   1.00 0.00 ? 89 GLU B HG2  4  
ATOM 11647 H HG3  . GLU B 1 90 ? 8.176   17.344  3.254   1.00 0.00 ? 89 GLU B HG3  4  
ATOM 11648 N N    . HIS B 1 91 ? 4.517   17.405  6.660   1.00 0.00 ? 90 HIS B N    4  
ATOM 11649 C CA   . HIS B 1 91 ? 3.159   17.811  7.116   1.00 0.00 ? 90 HIS B CA   4  
ATOM 11650 C C    . HIS B 1 91 ? 3.283   18.976  8.101   1.00 0.00 ? 90 HIS B C    4  
ATOM 11651 O O    . HIS B 1 91 ? 3.000   18.841  9.274   1.00 0.00 ? 90 HIS B O    4  
ATOM 11652 C CB   . HIS B 1 91 ? 2.476   16.629  7.805   1.00 0.00 ? 90 HIS B CB   4  
ATOM 11653 C CG   . HIS B 1 91 ? 1.033   16.966  8.061   1.00 0.00 ? 90 HIS B CG   4  
ATOM 11654 N ND1  . HIS B 1 91 ? 0.446   16.806  9.306   1.00 0.00 ? 90 HIS B ND1  4  
ATOM 11655 C CD2  . HIS B 1 91 ? 0.047   17.458  7.241   1.00 0.00 ? 90 HIS B CD2  4  
ATOM 11656 C CE1  . HIS B 1 91 ? -0.838  17.194  9.201   1.00 0.00 ? 90 HIS B CE1  4  
ATOM 11657 N NE2  . HIS B 1 91 ? -1.134  17.601  7.964   1.00 0.00 ? 90 HIS B NE2  4  
ATOM 11658 H H    . HIS B 1 91 ? 4.879   16.530  6.915   1.00 0.00 ? 90 HIS B H    4  
ATOM 11659 H HA   . HIS B 1 91 ? 2.571   18.121  6.264   1.00 0.00 ? 90 HIS B HA   4  
ATOM 11660 H HB2  . HIS B 1 91 ? 2.536   15.758  7.170   1.00 0.00 ? 90 HIS B HB2  4  
ATOM 11661 H HB3  . HIS B 1 91 ? 2.969   16.425  8.744   1.00 0.00 ? 90 HIS B HB3  4  
ATOM 11662 H HD1  . HIS B 1 91 ? 0.885   16.470  10.115  1.00 0.00 ? 90 HIS B HD1  4  
ATOM 11663 H HD2  . HIS B 1 91 ? 0.170   17.697  6.195   1.00 0.00 ? 90 HIS B HD2  4  
ATOM 11664 H HE1  . HIS B 1 91 ? -1.544  17.179  10.018  1.00 0.00 ? 90 HIS B HE1  4  
ATOM 11665 N N    . GLU B 1 92 ? 3.706   20.118  7.632   1.00 0.00 ? 91 GLU B N    4  
ATOM 11666 C CA   . GLU B 1 92 ? 3.850   21.289  8.542   1.00 0.00 ? 91 GLU B CA   4  
ATOM 11667 C C    . GLU B 1 92 ? 2.467   21.742  9.014   1.00 0.00 ? 91 GLU B C    4  
ATOM 11668 O O    . GLU B 1 92 ? 2.284   22.936  9.187   1.00 0.00 ? 91 GLU B O    4  
ATOM 11669 C CB   . GLU B 1 92 ? 4.534   22.434  7.792   1.00 0.00 ? 91 GLU B CB   4  
ATOM 11670 C CG   . GLU B 1 92 ? 5.972   22.037  7.454   1.00 0.00 ? 91 GLU B CG   4  
ATOM 11671 C CD   . GLU B 1 92 ? 6.803   21.987  8.737   1.00 0.00 ? 91 GLU B CD   4  
ATOM 11672 O OE1  . GLU B 1 92 ? 7.066   23.041  9.290   1.00 0.00 ? 91 GLU B OE1  4  
ATOM 11673 O OE2  . GLU B 1 92 ? 7.163   20.894  9.144   1.00 0.00 ? 91 GLU B OE2  4  
ATOM 11674 O OXT  . GLU B 1 92 ? 1.616   20.887  9.196   1.00 0.00 ? 91 GLU B OXT  4  
ATOM 11675 H H    . GLU B 1 92 ? 3.931   20.205  6.683   1.00 0.00 ? 91 GLU B H    4  
ATOM 11676 H HA   . GLU B 1 92 ? 4.449   21.010  9.396   1.00 0.00 ? 91 GLU B HA   4  
ATOM 11677 H HB2  . GLU B 1 92 ? 3.993   22.641  6.880   1.00 0.00 ? 91 GLU B HB2  4  
ATOM 11678 H HB3  . GLU B 1 92 ? 4.544   23.317  8.413   1.00 0.00 ? 91 GLU B HB3  4  
ATOM 11679 H HG2  . GLU B 1 92 ? 5.974   21.064  6.984   1.00 0.00 ? 91 GLU B HG2  4  
ATOM 11680 H HG3  . GLU B 1 92 ? 6.398   22.764  6.780   1.00 0.00 ? 91 GLU B HG3  4  
ATOM 11681 N N    . MET A 1 1  ? -11.288 7.259   13.986  1.00 0.00 ? 0  MET A N    5  
ATOM 11682 C CA   . MET A 1 1  ? -9.921  6.728   14.247  1.00 0.00 ? 0  MET A CA   5  
ATOM 11683 C C    . MET A 1 1  ? -9.969  5.199   14.295  1.00 0.00 ? 0  MET A C    5  
ATOM 11684 O O    . MET A 1 1  ? -9.534  4.586   15.250  1.00 0.00 ? 0  MET A O    5  
ATOM 11685 C CB   . MET A 1 1  ? -9.414  7.263   15.588  1.00 0.00 ? 0  MET A CB   5  
ATOM 11686 C CG   . MET A 1 1  ? -9.110  8.757   15.460  1.00 0.00 ? 0  MET A CG   5  
ATOM 11687 S SD   . MET A 1 1  ? -10.649 9.664   15.168  1.00 0.00 ? 0  MET A SD   5  
ATOM 11688 C CE   . MET A 1 1  ? -10.152 11.215  15.955  1.00 0.00 ? 0  MET A CE   5  
ATOM 11689 H H1   . MET A 1 1  ? -11.845 6.545   13.473  1.00 0.00 ? 0  MET A H1   5  
ATOM 11690 H H2   . MET A 1 1  ? -11.753 7.480   14.889  1.00 0.00 ? 0  MET A H2   5  
ATOM 11691 H H3   . MET A 1 1  ? -11.220 8.124   13.413  1.00 0.00 ? 0  MET A H3   5  
ATOM 11692 H HA   . MET A 1 1  ? -9.254  7.043   13.458  1.00 0.00 ? 0  MET A HA   5  
ATOM 11693 H HB2  . MET A 1 1  ? -10.170 7.112   16.345  1.00 0.00 ? 0  MET A HB2  5  
ATOM 11694 H HB3  . MET A 1 1  ? -8.513  6.737   15.868  1.00 0.00 ? 0  MET A HB3  5  
ATOM 11695 H HG2  . MET A 1 1  ? -8.651  9.110   16.371  1.00 0.00 ? 0  MET A HG2  5  
ATOM 11696 H HG3  . MET A 1 1  ? -8.436  8.917   14.631  1.00 0.00 ? 0  MET A HG3  5  
ATOM 11697 H HE1  . MET A 1 1  ? -9.869  11.027  16.978  1.00 0.00 ? 0  MET A HE1  5  
ATOM 11698 H HE2  . MET A 1 1  ? -9.310  11.635  15.422  1.00 0.00 ? 0  MET A HE2  5  
ATOM 11699 H HE3  . MET A 1 1  ? -10.981 11.910  15.935  1.00 0.00 ? 0  MET A HE3  5  
ATOM 11700 N N    . SER A 1 2  ? -10.491 4.578   13.273  1.00 0.00 ? 1  SER A N    5  
ATOM 11701 C CA   . SER A 1 2  ? -10.561 3.089   13.267  1.00 0.00 ? 1  SER A CA   5  
ATOM 11702 C C    . SER A 1 2  ? -9.145  2.516   13.344  1.00 0.00 ? 1  SER A C    5  
ATOM 11703 O O    . SER A 1 2  ? -8.172  3.218   13.149  1.00 0.00 ? 1  SER A O    5  
ATOM 11704 C CB   . SER A 1 2  ? -11.239 2.611   11.982  1.00 0.00 ? 1  SER A CB   5  
ATOM 11705 O OG   . SER A 1 2  ? -10.415 2.933   10.869  1.00 0.00 ? 1  SER A OG   5  
ATOM 11706 H H    . SER A 1 2  ? -10.835 5.089   12.511  1.00 0.00 ? 1  SER A H    5  
ATOM 11707 H HA   . SER A 1 2  ? -11.130 2.754   14.122  1.00 0.00 ? 1  SER A HA   5  
ATOM 11708 H HB2  . SER A 1 2  ? -11.378 1.544   12.022  1.00 0.00 ? 1  SER A HB2  5  
ATOM 11709 H HB3  . SER A 1 2  ? -12.202 3.094   11.883  1.00 0.00 ? 1  SER A HB3  5  
ATOM 11710 H HG   . SER A 1 2  ? -9.507  2.983   11.177  1.00 0.00 ? 1  SER A HG   5  
ATOM 11711 N N    . GLU A 1 3  ? -9.018  1.249   13.630  1.00 0.00 ? 2  GLU A N    5  
ATOM 11712 C CA   . GLU A 1 3  ? -7.661  0.644   13.722  1.00 0.00 ? 2  GLU A CA   5  
ATOM 11713 C C    . GLU A 1 3  ? -6.916  0.855   12.402  1.00 0.00 ? 2  GLU A C    5  
ATOM 11714 O O    . GLU A 1 3  ? -5.717  1.051   12.378  1.00 0.00 ? 2  GLU A O    5  
ATOM 11715 C CB   . GLU A 1 3  ? -7.789  -0.855  14.002  1.00 0.00 ? 2  GLU A CB   5  
ATOM 11716 C CG   . GLU A 1 3  ? -6.398  -1.463  14.192  1.00 0.00 ? 2  GLU A CG   5  
ATOM 11717 C CD   . GLU A 1 3  ? -6.533  -2.929  14.610  1.00 0.00 ? 2  GLU A CD   5  
ATOM 11718 O OE1  . GLU A 1 3  ? -7.182  -3.671  13.891  1.00 0.00 ? 2  GLU A OE1  5  
ATOM 11719 O OE2  . GLU A 1 3  ? -5.985  -3.283  15.641  1.00 0.00 ? 2  GLU A OE2  5  
ATOM 11720 H H    . GLU A 1 3  ? -9.814  0.699   13.787  1.00 0.00 ? 2  GLU A H    5  
ATOM 11721 H HA   . GLU A 1 3  ? -7.111  1.114   14.524  1.00 0.00 ? 2  GLU A HA   5  
ATOM 11722 H HB2  . GLU A 1 3  ? -8.374  -1.004  14.898  1.00 0.00 ? 2  GLU A HB2  5  
ATOM 11723 H HB3  . GLU A 1 3  ? -8.279  -1.336  13.169  1.00 0.00 ? 2  GLU A HB3  5  
ATOM 11724 H HG2  . GLU A 1 3  ? -5.848  -1.401  13.263  1.00 0.00 ? 2  GLU A HG2  5  
ATOM 11725 H HG3  . GLU A 1 3  ? -5.869  -0.919  14.960  1.00 0.00 ? 2  GLU A HG3  5  
ATOM 11726 N N    . LEU A 1 4  ? -7.618  0.807   11.303  1.00 0.00 ? 3  LEU A N    5  
ATOM 11727 C CA   . LEU A 1 4  ? -6.952  0.995   9.983   1.00 0.00 ? 3  LEU A CA   5  
ATOM 11728 C C    . LEU A 1 4  ? -6.277  2.366   9.938   1.00 0.00 ? 3  LEU A C    5  
ATOM 11729 O O    . LEU A 1 4  ? -5.099  2.477   9.665   1.00 0.00 ? 3  LEU A O    5  
ATOM 11730 C CB   . LEU A 1 4  ? -8.002  0.900   8.867   1.00 0.00 ? 3  LEU A CB   5  
ATOM 11731 C CG   . LEU A 1 4  ? -7.389  1.296   7.516   1.00 0.00 ? 3  LEU A CG   5  
ATOM 11732 C CD1  . LEU A 1 4  ? -6.103  0.498   7.265   1.00 0.00 ? 3  LEU A CD1  5  
ATOM 11733 C CD2  . LEU A 1 4  ? -8.402  0.996   6.409   1.00 0.00 ? 3  LEU A CD2  5  
ATOM 11734 H H    . LEU A 1 4  ? -8.583  0.634   11.343  1.00 0.00 ? 3  LEU A H    5  
ATOM 11735 H HA   . LEU A 1 4  ? -6.211  0.222   9.847   1.00 0.00 ? 3  LEU A HA   5  
ATOM 11736 H HB2  . LEU A 1 4  ? -8.369  -0.114  8.808   1.00 0.00 ? 3  LEU A HB2  5  
ATOM 11737 H HB3  . LEU A 1 4  ? -8.823  1.564   9.093   1.00 0.00 ? 3  LEU A HB3  5  
ATOM 11738 H HG   . LEU A 1 4  ? -7.163  2.352   7.515   1.00 0.00 ? 3  LEU A HG   5  
ATOM 11739 H HD11 . LEU A 1 4  ? -6.245  -0.526  7.578   1.00 0.00 ? 3  LEU A HD11 5  
ATOM 11740 H HD12 . LEU A 1 4  ? -5.862  0.521   6.211   1.00 0.00 ? 3  LEU A HD12 5  
ATOM 11741 H HD13 . LEU A 1 4  ? -5.292  0.938   7.827   1.00 0.00 ? 3  LEU A HD13 5  
ATOM 11742 H HD21 . LEU A 1 4  ? -9.359  1.414   6.679   1.00 0.00 ? 3  LEU A HD21 5  
ATOM 11743 H HD22 . LEU A 1 4  ? -8.065  1.436   5.482   1.00 0.00 ? 3  LEU A HD22 5  
ATOM 11744 H HD23 . LEU A 1 4  ? -8.496  -0.073  6.287   1.00 0.00 ? 3  LEU A HD23 5  
ATOM 11745 N N    . GLU A 1 5  ? -7.013  3.412   10.199  1.00 0.00 ? 4  GLU A N    5  
ATOM 11746 C CA   . GLU A 1 5  ? -6.405  4.770   10.163  1.00 0.00 ? 4  GLU A CA   5  
ATOM 11747 C C    . GLU A 1 5  ? -5.194  4.806   11.093  1.00 0.00 ? 4  GLU A C    5  
ATOM 11748 O O    . GLU A 1 5  ? -4.129  5.262   10.734  1.00 0.00 ? 4  GLU A O    5  
ATOM 11749 C CB   . GLU A 1 5  ? -7.437  5.805   10.619  1.00 0.00 ? 4  GLU A CB   5  
ATOM 11750 C CG   . GLU A 1 5  ? -8.504  5.973   9.535   1.00 0.00 ? 4  GLU A CG   5  
ATOM 11751 C CD   . GLU A 1 5  ? -9.492  7.062   9.957   1.00 0.00 ? 4  GLU A CD   5  
ATOM 11752 O OE1  . GLU A 1 5  ? -9.737  7.182   11.146  1.00 0.00 ? 4  GLU A OE1  5  
ATOM 11753 O OE2  . GLU A 1 5  ? -9.986  7.756   9.085   1.00 0.00 ? 4  GLU A OE2  5  
ATOM 11754 H H    . GLU A 1 5  ? -7.962  3.307   10.416  1.00 0.00 ? 4  GLU A H    5  
ATOM 11755 H HA   . GLU A 1 5  ? -6.092  4.994   9.154   1.00 0.00 ? 4  GLU A HA   5  
ATOM 11756 H HB2  . GLU A 1 5  ? -7.902  5.470   11.534  1.00 0.00 ? 4  GLU A HB2  5  
ATOM 11757 H HB3  . GLU A 1 5  ? -6.946  6.751   10.788  1.00 0.00 ? 4  GLU A HB3  5  
ATOM 11758 H HG2  . GLU A 1 5  ? -8.031  6.255   8.605   1.00 0.00 ? 4  GLU A HG2  5  
ATOM 11759 H HG3  . GLU A 1 5  ? -9.033  5.041   9.402   1.00 0.00 ? 4  GLU A HG3  5  
ATOM 11760 N N    . LYS A 1 6  ? -5.357  4.307   12.287  1.00 0.00 ? 5  LYS A N    5  
ATOM 11761 C CA   . LYS A 1 6  ? -4.232  4.285   13.262  1.00 0.00 ? 5  LYS A CA   5  
ATOM 11762 C C    . LYS A 1 6  ? -2.979  3.723   12.590  1.00 0.00 ? 5  LYS A C    5  
ATOM 11763 O O    . LYS A 1 6  ? -1.884  4.223   12.758  1.00 0.00 ? 5  LYS A O    5  
ATOM 11764 C CB   . LYS A 1 6  ? -4.615  3.369   14.428  1.00 0.00 ? 5  LYS A CB   5  
ATOM 11765 C CG   . LYS A 1 6  ? -3.605  3.537   15.566  1.00 0.00 ? 5  LYS A CG   5  
ATOM 11766 C CD   . LYS A 1 6  ? -4.106  2.794   16.805  1.00 0.00 ? 5  LYS A CD   5  
ATOM 11767 C CE   . LYS A 1 6  ? -3.129  3.014   17.961  1.00 0.00 ? 5  LYS A CE   5  
ATOM 11768 N NZ   . LYS A 1 6  ? -3.159  4.448   18.370  1.00 0.00 ? 5  LYS A NZ   5  
ATOM 11769 H H    . LYS A 1 6  ? -6.228  3.936   12.541  1.00 0.00 ? 5  LYS A H    5  
ATOM 11770 H HA   . LYS A 1 6  ? -4.054  5.278   13.648  1.00 0.00 ? 5  LYS A HA   5  
ATOM 11771 H HB2  . LYS A 1 6  ? -5.602  3.629   14.781  1.00 0.00 ? 5  LYS A HB2  5  
ATOM 11772 H HB3  . LYS A 1 6  ? -4.611  2.342   14.095  1.00 0.00 ? 5  LYS A HB3  5  
ATOM 11773 H HG2  . LYS A 1 6  ? -2.650  3.131   15.263  1.00 0.00 ? 5  LYS A HG2  5  
ATOM 11774 H HG3  . LYS A 1 6  ? -3.493  4.585   15.799  1.00 0.00 ? 5  LYS A HG3  5  
ATOM 11775 H HD2  . LYS A 1 6  ? -5.081  3.172   17.080  1.00 0.00 ? 5  LYS A HD2  5  
ATOM 11776 H HD3  . LYS A 1 6  ? -4.175  1.739   16.590  1.00 0.00 ? 5  LYS A HD3  5  
ATOM 11777 H HE2  . LYS A 1 6  ? -3.415  2.395   18.798  1.00 0.00 ? 5  LYS A HE2  5  
ATOM 11778 H HE3  . LYS A 1 6  ? -2.131  2.752   17.643  1.00 0.00 ? 5  LYS A HE3  5  
ATOM 11779 H HZ1  . LYS A 1 6  ? -3.380  5.040   17.546  1.00 0.00 ? 5  LYS A HZ1  5  
ATOM 11780 H HZ2  . LYS A 1 6  ? -3.887  4.584   19.101  1.00 0.00 ? 5  LYS A HZ2  5  
ATOM 11781 H HZ3  . LYS A 1 6  ? -2.230  4.720   18.750  1.00 0.00 ? 5  LYS A HZ3  5  
ATOM 11782 N N    . ALA A 1 7  ? -3.146  2.669   11.838  1.00 0.00 ? 6  ALA A N    5  
ATOM 11783 C CA   . ALA A 1 7  ? -1.994  2.027   11.145  1.00 0.00 ? 6  ALA A CA   5  
ATOM 11784 C C    . ALA A 1 7  ? -1.616  2.809   9.878   1.00 0.00 ? 6  ALA A C    5  
ATOM 11785 O O    . ALA A 1 7  ? -0.472  2.808   9.469   1.00 0.00 ? 6  ALA A O    5  
ATOM 11786 C CB   . ALA A 1 7  ? -2.375  0.581   10.787  1.00 0.00 ? 6  ALA A CB   5  
ATOM 11787 H H    . ALA A 1 7  ? -4.044  2.294   11.729  1.00 0.00 ? 6  ALA A H    5  
ATOM 11788 H HA   . ALA A 1 7  ? -1.135  2.025   11.798  1.00 0.00 ? 6  ALA A HA   5  
ATOM 11789 H HB1  . ALA A 1 7  ? -3.440  0.525   10.616  1.00 0.00 ? 6  ALA A HB1  5  
ATOM 11790 H HB2  . ALA A 1 7  ? -1.854  0.271   9.895   1.00 0.00 ? 6  ALA A HB2  5  
ATOM 11791 H HB3  . ALA A 1 7  ? -2.111  -0.075  11.603  1.00 0.00 ? 6  ALA A HB3  5  
ATOM 11792 N N    . MET A 1 8  ? -2.542  3.478   9.251   1.00 0.00 ? 7  MET A N    5  
ATOM 11793 C CA   . MET A 1 8  ? -2.173  4.240   8.023   1.00 0.00 ? 7  MET A CA   5  
ATOM 11794 C C    . MET A 1 8  ? -1.089  5.261   8.396   1.00 0.00 ? 7  MET A C    5  
ATOM 11795 O O    . MET A 1 8  ? -0.126  5.453   7.681   1.00 0.00 ? 7  MET A O    5  
ATOM 11796 C CB   . MET A 1 8  ? -3.420  4.956   7.464   1.00 0.00 ? 7  MET A CB   5  
ATOM 11797 C CG   . MET A 1 8  ? -3.327  5.071   5.935   1.00 0.00 ? 7  MET A CG   5  
ATOM 11798 S SD   . MET A 1 8  ? -1.665  5.613   5.463   1.00 0.00 ? 7  MET A SD   5  
ATOM 11799 C CE   . MET A 1 8  ? -1.575  4.732   3.883   1.00 0.00 ? 7  MET A CE   5  
ATOM 11800 H H    . MET A 1 8  ? -3.465  3.482   9.582   1.00 0.00 ? 7  MET A H    5  
ATOM 11801 H HA   . MET A 1 8  ? -1.780  3.553   7.286   1.00 0.00 ? 7  MET A HA   5  
ATOM 11802 H HB2  . MET A 1 8  ? -4.301  4.387   7.723   1.00 0.00 ? 7  MET A HB2  5  
ATOM 11803 H HB3  . MET A 1 8  ? -3.500  5.946   7.891   1.00 0.00 ? 7  MET A HB3  5  
ATOM 11804 H HG2  . MET A 1 8  ? -3.531  4.108   5.490   1.00 0.00 ? 7  MET A HG2  5  
ATOM 11805 H HG3  . MET A 1 8  ? -4.053  5.789   5.584   1.00 0.00 ? 7  MET A HG3  5  
ATOM 11806 H HE1  . MET A 1 8  ? -2.472  4.927   3.312   1.00 0.00 ? 7  MET A HE1  5  
ATOM 11807 H HE2  . MET A 1 8  ? -0.717  5.072   3.327   1.00 0.00 ? 7  MET A HE2  5  
ATOM 11808 H HE3  . MET A 1 8  ? -1.484  3.670   4.068   1.00 0.00 ? 7  MET A HE3  5  
ATOM 11809 N N    . VAL A 1 9  ? -1.240  5.902   9.521   1.00 0.00 ? 8  VAL A N    5  
ATOM 11810 C CA   . VAL A 1 9  ? -0.227  6.901   9.969   1.00 0.00 ? 8  VAL A CA   5  
ATOM 11811 C C    . VAL A 1 9  ? 1.074   6.183   10.352  1.00 0.00 ? 8  VAL A C    5  
ATOM 11812 O O    . VAL A 1 9  ? 2.157   6.703   10.170  1.00 0.00 ? 8  VAL A O    5  
ATOM 11813 C CB   . VAL A 1 9  ? -0.771  7.653   11.188  1.00 0.00 ? 8  VAL A CB   5  
ATOM 11814 C CG1  . VAL A 1 9  ? 0.069   8.909   11.434  1.00 0.00 ? 8  VAL A CG1  5  
ATOM 11815 C CG2  . VAL A 1 9  ? -2.221  8.064   10.923  1.00 0.00 ? 8  VAL A CG2  5  
ATOM 11816 H H    . VAL A 1 9  ? -2.022  5.719   10.084  1.00 0.00 ? 8  VAL A H    5  
ATOM 11817 H HA   . VAL A 1 9  ? -0.024  7.615   9.183   1.00 0.00 ? 8  VAL A HA   5  
ATOM 11818 H HB   . VAL A 1 9  ? -0.727  7.013   12.057  1.00 0.00 ? 8  VAL A HB   5  
ATOM 11819 H HG11 . VAL A 1 9  ? 0.053   9.531   10.550  1.00 0.00 ? 8  VAL A HG11 5  
ATOM 11820 H HG12 . VAL A 1 9  ? -0.343  9.459   12.268  1.00 0.00 ? 8  VAL A HG12 5  
ATOM 11821 H HG13 . VAL A 1 9  ? 1.086   8.625   11.656  1.00 0.00 ? 8  VAL A HG13 5  
ATOM 11822 H HG21 . VAL A 1 9  ? -2.296  8.510   9.941   1.00 0.00 ? 8  VAL A HG21 5  
ATOM 11823 H HG22 . VAL A 1 9  ? -2.856  7.195   10.972  1.00 0.00 ? 8  VAL A HG22 5  
ATOM 11824 H HG23 . VAL A 1 9  ? -2.534  8.781   11.668  1.00 0.00 ? 8  VAL A HG23 5  
ATOM 11825 N N    . ALA A 1 10 ? 0.974   4.991   10.879  1.00 0.00 ? 9  ALA A N    5  
ATOM 11826 C CA   . ALA A 1 10 ? 2.198   4.232   11.276  1.00 0.00 ? 9  ALA A CA   5  
ATOM 11827 C C    . ALA A 1 10 ? 3.077   3.970   10.049  1.00 0.00 ? 9  ALA A C    5  
ATOM 11828 O O    . ALA A 1 10 ? 4.264   4.229   10.051  1.00 0.00 ? 9  ALA A O    5  
ATOM 11829 C CB   . ALA A 1 10 ? 1.768   2.886   11.862  1.00 0.00 ? 9  ALA A CB   5  
ATOM 11830 H H    . ALA A 1 10 ? 0.092   4.585   11.012  1.00 0.00 ? 9  ALA A H    5  
ATOM 11831 H HA   . ALA A 1 10 ? 2.746   4.777   12.031  1.00 0.00 ? 9  ALA A HA   5  
ATOM 11832 H HB1  . ALA A 1 10 ? 1.095   2.393   11.177  1.00 0.00 ? 9  ALA A HB1  5  
ATOM 11833 H HB2  . ALA A 1 10 ? 2.639   2.267   12.019  1.00 0.00 ? 9  ALA A HB2  5  
ATOM 11834 H HB3  . ALA A 1 10 ? 1.267   3.047   12.805  1.00 0.00 ? 9  ALA A HB3  5  
ATOM 11835 N N    . LEU A 1 11 ? 2.496   3.437   9.010   1.00