data_1B4G
# 
_entry.id   1B4G 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1B4G         
WWPDB D_1000171472 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1B4G 
_pdbx_database_status.recvd_initial_deposition_date   1998-12-22 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    ? 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Antz, C.'          1 
'Bauer, T.'         2 
'Kalbacher, H.'     3 
'Frank, R.'         4 
'Covarrubias, M.'   5 
'Kalbitzer, H.R.'   6 
'Ruppersberg, J.P.' 7 
'Baukrowitz, T.'    8 
'Fakler, B.'        9 
# 
_citation.id                        primary 
_citation.title                     
'Control of K+ channel gating by protein phosphorylation: structural switches of the inactivation gate.' 
_citation.journal_abbrev            Nat.Struct.Biol. 
_citation.journal_volume            6 
_citation.page_first                146 
_citation.page_last                 150 
_citation.year                      1999 
_citation.journal_id_ASTM           NSBIEW 
_citation.country                   US 
_citation.journal_id_ISSN           1072-8368 
_citation.journal_id_CSD            2024 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   10048926 
_citation.pdbx_database_id_DOI      10.1038/5833 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Antz, C.'          1 
primary 'Bauer, T.'         2 
primary 'Kalbacher, H.'     3 
primary 'Frank, R.'         4 
primary 'Covarrubias, M.'   5 
primary 'Kalbitzer, H.R.'   6 
primary 'Ruppersberg, J.P.' 7 
primary 'Baukrowitz, T.'    8 
primary 'Fakler, B.'        9 
# 
_cell.entry_id           1B4G 
_cell.length_a           1.000 
_cell.length_b           1.000 
_cell.length_c           1.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1B4G 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 syn 
_entity.pdbx_description           'POTASSIUM CHANNEL' 
_entity.formula_weight             3360.841 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              'INACTIVATION DOMAIN' 
_entity.details                    'SER 8 IS PHOSPHORLYATED' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   yes 
_entity_poly.pdbx_seq_one_letter_code       'MISSVCV(SEP)SYRGRKSGNKPPSKTCLKEEMA' 
_entity_poly.pdbx_seq_one_letter_code_can   MISSVCVSSYRGRKSGNKPPSKTCLKEEMA 
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  MET n 
1 2  ILE n 
1 3  SER n 
1 4  SER n 
1 5  VAL n 
1 6  CYS n 
1 7  VAL n 
1 8  SEP n 
1 9  SER n 
1 10 TYR n 
1 11 ARG n 
1 12 GLY n 
1 13 ARG n 
1 14 LYS n 
1 15 SER n 
1 16 GLY n 
1 17 ASN n 
1 18 LYS n 
1 19 PRO n 
1 20 PRO n 
1 21 SER n 
1 22 LYS n 
1 23 THR n 
1 24 CYS n 
1 25 LEU n 
1 26 LYS n 
1 27 GLU n 
1 28 GLU n 
1 29 MET n 
1 30 ALA n 
# 
_pdbx_entity_src_syn.entity_id              1 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    'Homo sapiens' 
_pdbx_entity_src_syn.organism_common_name   human 
_pdbx_entity_src_syn.ncbi_taxonomy_id       9606 
_pdbx_entity_src_syn.details                ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    KCNC4_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          Q03721 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   MISSVCVSSYRGRKSGNKPPSKTCLKEEMA 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1B4G 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 30 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q03721 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  30 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       30 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ?               'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ?               'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ?               'C4 H8 N2 O3'    132.118 
CYS 'L-peptide linking' y CYSTEINE        ?               'C3 H7 N O2 S'   121.158 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?               'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ?               'C2 H5 N O2'     75.067  
ILE 'L-peptide linking' y ISOLEUCINE      ?               'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ?               'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ?               'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ?               'C5 H11 N O2 S'  149.211 
PRO 'L-peptide linking' y PROLINE         ?               'C5 H9 N O2'     115.130 
SEP 'L-peptide linking' n PHOSPHOSERINE   PHOSPHONOSERINE 'C3 H8 N O6 P'   185.072 
SER 'L-peptide linking' y SERINE          ?               'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ?               'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE        ?               'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ?               'C5 H11 N O2'    117.146 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         283 
_pdbx_nmr_exptl_sample_conditions.pressure            ? 
_pdbx_nmr_exptl_sample_conditions.pH                  3.5 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      ? 
_pdbx_nmr_exptl_sample_conditions.pressure_units      . 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
_pdbx_nmr_ensemble.entry_id                             1B4G 
_pdbx_nmr_ensemble.conformers_calculated_total_number   ? 
_pdbx_nmr_ensemble.conformers_submitted_total_number    22 
_pdbx_nmr_ensemble.conformer_selection_criteria         ? 
# 
_pdbx_nmr_software.classification   refinement 
_pdbx_nmr_software.name             X-PLOR 
_pdbx_nmr_software.version          3.8 
_pdbx_nmr_software.authors          BRUNGER 
_pdbx_nmr_software.ordinal          1 
# 
_exptl.entry_id          1B4G 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_struct.entry_id                  1B4G 
_struct.title                     
'CONTROL OF K+ CHANNEL GATING BY PROTEIN PHOSPHORYLATION: STRUCTURAL SWITCHES OF THE INACTIVATION GATE, NMR, 22 STRUCTURES' 
_struct.pdbx_descriptor           'POTASSIUM CHANNEL' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1B4G 
_struct_keywords.pdbx_keywords   'POTASSIUM CHANNEL' 
_struct_keywords.text            'POTASSIUM CHANNEL, INACTIVATION GATE, PHOSPHORYLATION' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   Y 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1 covale ? ? A SEP 8 N ? ? ? 1_555 A VAL 7 C ? ? A SEP 8 A VAL 7 1_555 ? ? ? ? ? ? ? 1.307 ? 
covale2 covale ? ? A SEP 8 C ? ? ? 1_555 A SER 9 N ? ? A SEP 8 A SER 9 1_555 ? ? ? ? ? ? ? 1.315 ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_database_PDB_matrix.entry_id          1B4G 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1B4G 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N    . MET A 1 1  ? -3.846  5.080   8.887   1.00 1.27 ? 1  MET A N    1  
ATOM   2     C CA   . MET A 1 1  ? -2.959  3.941   8.498   1.00 1.48 ? 1  MET A CA   1  
ATOM   3     C C    . MET A 1 1  ? -3.320  2.679   9.298   1.00 1.76 ? 1  MET A C    1  
ATOM   4     O O    . MET A 1 1  ? -3.734  1.686   8.735   1.00 2.11 ? 1  MET A O    1  
ATOM   5     C CB   . MET A 1 1  ? -1.534  4.407   8.823   1.00 1.36 ? 1  MET A CB   1  
ATOM   6     C CG   . MET A 1 1  ? -0.527  3.601   7.997   1.00 1.80 ? 1  MET A CG   1  
ATOM   7     S SD   . MET A 1 1  ? 0.390   4.718   6.907   1.00 2.17 ? 1  MET A SD   1  
ATOM   8     C CE   . MET A 1 1  ? -0.391  4.217   5.353   1.00 2.62 ? 1  MET A CE   1  
ATOM   9     H H1   . MET A 1 1  ? -4.834  4.758   8.923   1.00 1.54 ? 1  MET A H1   1  
ATOM   10    H H2   . MET A 1 1  ? -3.563  5.442   9.824   1.00 1.17 ? 1  MET A H2   1  
ATOM   11    H H3   . MET A 1 1  ? -3.759  5.843   8.182   1.00 1.14 ? 1  MET A H3   1  
ATOM   12    H HA   . MET A 1 1  ? -3.047  3.746   7.440   1.00 1.65 ? 1  MET A HA   1  
ATOM   13    H HB2  . MET A 1 1  ? -1.437  5.457   8.584   1.00 1.13 ? 1  MET A HB2  1  
ATOM   14    H HB3  . MET A 1 1  ? -1.336  4.258   9.873   1.00 1.52 ? 1  MET A HB3  1  
ATOM   15    H HG2  . MET A 1 1  ? 0.163   3.100   8.660   1.00 2.00 ? 1  MET A HG2  1  
ATOM   16    H HG3  . MET A 1 1  ? -1.051  2.867   7.402   1.00 2.26 ? 1  MET A HG3  1  
ATOM   17    H HE1  . MET A 1 1  ? -1.458  4.120   5.502   1.00 3.07 ? 1  MET A HE1  1  
ATOM   18    H HE2  . MET A 1 1  ? -0.203  4.963   4.598   1.00 2.93 ? 1  MET A HE2  1  
ATOM   19    H HE3  . MET A 1 1  ? 0.021   3.271   5.032   1.00 2.95 ? 1  MET A HE3  1  
ATOM   20    N N    . ILE A 1 2  ? -3.168  2.708   10.603  1.00 1.67 ? 2  ILE A N    1  
ATOM   21    C CA   . ILE A 1 2  ? -3.506  1.501   11.424  1.00 1.96 ? 2  ILE A CA   1  
ATOM   22    C C    . ILE A 1 2  ? -3.769  1.887   12.890  1.00 1.79 ? 2  ILE A C    1  
ATOM   23    O O    . ILE A 1 2  ? -3.057  2.687   13.471  1.00 1.52 ? 2  ILE A O    1  
ATOM   24    C CB   . ILE A 1 2  ? -2.282  0.578   11.308  1.00 2.19 ? 2  ILE A CB   1  
ATOM   25    C CG1  . ILE A 1 2  ? -2.600  -0.775  11.954  1.00 2.59 ? 2  ILE A CG1  1  
ATOM   26    C CG2  . ILE A 1 2  ? -1.073  1.205   12.013  1.00 2.06 ? 2  ILE A CG2  1  
ATOM   27    C CD1  . ILE A 1 2  ? -1.740  -1.866  11.311  1.00 3.35 ? 2  ILE A CD1  1  
ATOM   28    H H    . ILE A 1 2  ? -2.833  3.518   11.042  1.00 1.45 ? 2  ILE A H    1  
ATOM   29    H HA   . ILE A 1 2  ? -4.372  1.006   11.013  1.00 2.26 ? 2  ILE A HA   1  
ATOM   30    H HB   . ILE A 1 2  ? -2.047  0.429   10.263  1.00 2.31 ? 2  ILE A HB   1  
ATOM   31    H HG12 . ILE A 1 2  ? -2.388  -0.726  13.013  1.00 2.53 ? 2  ILE A HG12 1  
ATOM   32    H HG13 . ILE A 1 2  ? -3.643  -1.009  11.807  1.00 2.70 ? 2  ILE A HG13 1  
ATOM   33    H HG21 . ILE A 1 2  ? -0.973  2.236   11.709  1.00 2.18 ? 2  ILE A HG21 1  
ATOM   34    H HG22 . ILE A 1 2  ? -1.215  1.157   13.083  1.00 2.10 ? 2  ILE A HG22 1  
ATOM   35    H HG23 . ILE A 1 2  ? -0.179  0.661   11.744  1.00 2.42 ? 2  ILE A HG23 1  
ATOM   36    H HD11 . ILE A 1 2  ? -0.719  -1.522  11.238  1.00 3.90 ? 2  ILE A HD11 1  
ATOM   37    H HD12 . ILE A 1 2  ? -1.777  -2.758  11.919  1.00 3.65 ? 2  ILE A HD12 1  
ATOM   38    H HD13 . ILE A 1 2  ? -2.118  -2.087  10.324  1.00 3.54 ? 2  ILE A HD13 1  
ATOM   39    N N    . SER A 1 3  ? -4.791  1.309   13.485  1.00 2.07 ? 3  SER A N    1  
ATOM   40    C CA   . SER A 1 3  ? -5.135  1.604   14.920  1.00 2.07 ? 3  SER A CA   1  
ATOM   41    C C    . SER A 1 3  ? -5.161  3.117   15.210  1.00 1.83 ? 3  SER A C    1  
ATOM   42    O O    . SER A 1 3  ? -4.879  3.542   16.315  1.00 1.78 ? 3  SER A O    1  
ATOM   43    C CB   . SER A 1 3  ? -4.031  0.919   15.731  1.00 2.07 ? 3  SER A CB   1  
ATOM   44    O OG   . SER A 1 3  ? -4.340  1.004   17.117  1.00 2.14 ? 3  SER A OG   1  
ATOM   45    H H    . SER A 1 3  ? -5.335  0.666   12.985  1.00 2.35 ? 3  SER A H    1  
ATOM   46    H HA   . SER A 1 3  ? -6.088  1.165   15.171  1.00 2.39 ? 3  SER A HA   1  
ATOM   47    H HB2  . SER A 1 3  ? -3.964  -0.118  15.446  1.00 2.34 ? 3  SER A HB2  1  
ATOM   48    H HB3  . SER A 1 3  ? -3.086  1.405   15.529  1.00 1.90 ? 3  SER A HB3  1  
ATOM   49    H HG   . SER A 1 3  ? -4.322  1.932   17.372  1.00 1.96 ? 3  SER A HG   1  
ATOM   50    N N    . SER A 1 4  ? -5.502  3.931   14.233  1.00 1.84 ? 4  SER A N    1  
ATOM   51    C CA   . SER A 1 4  ? -5.550  5.420   14.451  1.00 1.87 ? 4  SER A CA   1  
ATOM   52    C C    . SER A 1 4  ? -4.200  5.966   14.950  1.00 1.61 ? 4  SER A C    1  
ATOM   53    O O    . SER A 1 4  ? -4.124  7.063   15.471  1.00 1.84 ? 4  SER A O    1  
ATOM   54    C CB   . SER A 1 4  ? -6.628  5.627   15.513  1.00 2.26 ? 4  SER A CB   1  
ATOM   55    O OG   . SER A 1 4  ? -7.522  6.647   15.085  1.00 2.69 ? 4  SER A OG   1  
ATOM   56    H H    . SER A 1 4  ? -5.730  3.565   13.353  1.00 1.94 ? 4  SER A H    1  
ATOM   57    H HA   . SER A 1 4  ? -5.837  5.919   13.541  1.00 1.96 ? 4  SER A HA   1  
ATOM   58    H HB2  . SER A 1 4  ? -7.173  4.710   15.654  1.00 2.31 ? 4  SER A HB2  1  
ATOM   59    H HB3  . SER A 1 4  ? -6.158  5.910   16.446  1.00 2.24 ? 4  SER A HB3  1  
ATOM   60    H HG   . SER A 1 4  ? -7.193  7.489   15.412  1.00 2.87 ? 4  SER A HG   1  
ATOM   61    N N    . VAL A 1 5  ? -3.140  5.215   14.796  1.00 1.37 ? 5  VAL A N    1  
ATOM   62    C CA   . VAL A 1 5  ? -1.798  5.689   15.261  1.00 1.40 ? 5  VAL A CA   1  
ATOM   63    C C    . VAL A 1 5  ? -1.150  6.578   14.194  1.00 1.40 ? 5  VAL A C    1  
ATOM   64    O O    . VAL A 1 5  ? -0.608  7.626   14.490  1.00 1.68 ? 5  VAL A O    1  
ATOM   65    C CB   . VAL A 1 5  ? -0.977  4.411   15.482  1.00 1.45 ? 5  VAL A CB   1  
ATOM   66    C CG1  . VAL A 1 5  ? 0.488   4.772   15.738  1.00 1.78 ? 5  VAL A CG1  1  
ATOM   67    C CG2  . VAL A 1 5  ? -1.528  3.653   16.693  1.00 1.55 ? 5  VAL A CG2  1  
ATOM   68    H H    . VAL A 1 5  ? -3.227  4.336   14.375  1.00 1.36 ? 5  VAL A H    1  
ATOM   69    H HA   . VAL A 1 5  ? -1.892  6.228   16.185  1.00 1.62 ? 5  VAL A HA   1  
ATOM   70    H HB   . VAL A 1 5  ? -1.043  3.784   14.604  1.00 1.43 ? 5  VAL A HB   1  
ATOM   71    H HG11 . VAL A 1 5  ? 0.538   5.631   16.391  1.00 2.07 ? 5  VAL A HG11 1  
ATOM   72    H HG12 . VAL A 1 5  ? 0.989   3.936   16.203  1.00 2.10 ? 5  VAL A HG12 1  
ATOM   73    H HG13 . VAL A 1 5  ? 0.971   5.005   14.800  1.00 2.18 ? 5  VAL A HG13 1  
ATOM   74    H HG21 . VAL A 1 5  ? -1.488  4.290   17.564  1.00 1.65 ? 5  VAL A HG21 1  
ATOM   75    H HG22 . VAL A 1 5  ? -2.552  3.368   16.503  1.00 1.88 ? 5  VAL A HG22 1  
ATOM   76    H HG23 . VAL A 1 5  ? -0.934  2.769   16.865  1.00 2.07 ? 5  VAL A HG23 1  
ATOM   77    N N    . CYS A 1 6  ? -1.212  6.164   12.958  1.00 1.20 ? 6  CYS A N    1  
ATOM   78    C CA   . CYS A 1 6  ? -0.613  6.970   11.854  1.00 1.19 ? 6  CYS A CA   1  
ATOM   79    C C    . CYS A 1 6  ? -1.691  7.335   10.826  1.00 1.07 ? 6  CYS A C    1  
ATOM   80    O O    . CYS A 1 6  ? -2.642  6.601   10.622  1.00 1.06 ? 6  CYS A O    1  
ATOM   81    C CB   . CYS A 1 6  ? 0.446   6.061   11.226  1.00 1.30 ? 6  CYS A CB   1  
ATOM   82    S SG   . CYS A 1 6  ? 2.012   6.254   12.114  1.00 1.70 ? 6  CYS A SG   1  
ATOM   83    H H    . CYS A 1 6  ? -1.659  5.321   12.755  1.00 1.16 ? 6  CYS A H    1  
ATOM   84    H HA   . CYS A 1 6  ? -0.149  7.862   12.245  1.00 1.36 ? 6  CYS A HA   1  
ATOM   85    H HB2  . CYS A 1 6  ? 0.122   5.033   11.288  1.00 1.30 ? 6  CYS A HB2  1  
ATOM   86    H HB3  . CYS A 1 6  ? 0.585   6.332   10.189  1.00 1.36 ? 6  CYS A HB3  1  
ATOM   87    H HG   . CYS A 1 6  ? 1.830   6.184   13.054  1.00 1.94 ? 6  CYS A HG   1  
ATOM   88    N N    . VAL A 1 7  ? -1.548  8.464   10.183  1.00 1.15 ? 7  VAL A N    1  
ATOM   89    C CA   . VAL A 1 7  ? -2.559  8.892   9.165   1.00 1.19 ? 7  VAL A CA   1  
ATOM   90    C C    . VAL A 1 7  ? -2.355  8.117   7.855   1.00 1.00 ? 7  VAL A C    1  
ATOM   91    O O    . VAL A 1 7  ? -3.077  7.186   7.558   1.00 0.90 ? 7  VAL A O    1  
ATOM   92    C CB   . VAL A 1 7  ? -2.314  10.397  8.967   1.00 1.52 ? 7  VAL A CB   1  
ATOM   93    C CG1  . VAL A 1 7  ? -3.094  10.900  7.748   1.00 1.71 ? 7  VAL A CG1  1  
ATOM   94    C CG2  . VAL A 1 7  ? -2.780  11.156  10.211  1.00 1.68 ? 7  VAL A CG2  1  
ATOM   95    H H    . VAL A 1 7  ? -0.774  9.032   10.371  1.00 1.30 ? 7  VAL A H    1  
ATOM   96    H HA   . VAL A 1 7  ? -3.553  8.731   9.537   1.00 1.26 ? 7  VAL A HA   1  
ATOM   97    H HB   . VAL A 1 7  ? -1.258  10.572  8.814   1.00 1.62 ? 7  VAL A HB   1  
ATOM   98    H HG11 . VAL A 1 7  ? -3.973  10.288  7.604   1.00 1.80 ? 7  VAL A HG11 1  
ATOM   99    H HG12 . VAL A 1 7  ? -3.392  11.925  7.909   1.00 1.99 ? 7  VAL A HG12 1  
ATOM   100   H HG13 . VAL A 1 7  ? -2.467  10.841  6.870   1.00 2.03 ? 7  VAL A HG13 1  
ATOM   101   H HG21 . VAL A 1 7  ? -3.833  10.980  10.366  1.00 2.03 ? 7  VAL A HG21 1  
ATOM   102   H HG22 . VAL A 1 7  ? -2.225  10.812  11.071  1.00 1.78 ? 7  VAL A HG22 1  
ATOM   103   H HG23 . VAL A 1 7  ? -2.608  12.213  10.071  1.00 2.14 ? 7  VAL A HG23 1  
HETATM 104   N N    . SEP A 1 8  ? -1.377  8.501   7.078   1.00 1.15 ? 8  SEP A N    1  
HETATM 105   C CA   . SEP A 1 8  ? -1.105  7.804   5.780   1.00 1.03 ? 8  SEP A CA   1  
HETATM 106   C CB   . SEP A 1 8  ? -2.256  8.206   4.855   1.00 1.17 ? 8  SEP A CB   1  
HETATM 107   O OG   . SEP A 1 8  ? -2.717  7.053   4.140   1.00 1.14 ? 8  SEP A OG   1  
HETATM 108   C C    . SEP A 1 8  ? 0.234   8.274   5.205   1.00 0.97 ? 8  SEP A C    1  
HETATM 109   O O    . SEP A 1 8  ? 1.055   7.476   4.800   1.00 0.94 ? 8  SEP A O    1  
HETATM 110   P P    . SEP A 1 8  ? -3.988  6.214   4.664   1.00 1.04 ? 8  SEP A P    1  
HETATM 111   O O1P  . SEP A 1 8  ? -3.516  5.235   5.669   1.00 1.14 ? 8  SEP A O1P  1  
HETATM 112   O O2P  . SEP A 1 8  ? -5.063  7.170   5.010   1.00 1.34 ? 8  SEP A O2P  1  
HETATM 113   O O3P  . SEP A 1 8  ? -4.438  5.404   3.349   1.00 1.35 ? 8  SEP A O3P  1  
HETATM 114   H H    . SEP A 1 8  ? -0.816  9.253   7.350   1.00 1.42 ? 8  SEP A H    1  
HETATM 115   H HA   . SEP A 1 8  ? -1.099  6.738   5.920   1.00 0.98 ? 8  SEP A HA   1  
HETATM 116   H HB2  . SEP A 1 8  ? -1.909  8.959   4.159   1.00 1.25 ? 8  SEP A HB2  1  
HETATM 117   H HB3  . SEP A 1 8  ? -3.066  8.611   5.439   1.00 1.30 ? 8  SEP A HB3  1  
HETATM 118   H HOP3 . SEP A 1 8  ? -4.614  6.051   2.663   1.00 1.79 ? 8  SEP A HOP3 1  
ATOM   119   N N    . SER A 1 9  ? 0.444   9.572   5.183   1.00 1.01 ? 9  SER A N    1  
ATOM   120   C CA   . SER A 1 9  ? 1.720   10.166  4.654   1.00 1.05 ? 9  SER A CA   1  
ATOM   121   C C    . SER A 1 9  ? 1.904   9.883   3.159   1.00 0.98 ? 9  SER A C    1  
ATOM   122   O O    . SER A 1 9  ? 2.080   8.756   2.748   1.00 0.90 ? 9  SER A O    1  
ATOM   123   C CB   . SER A 1 9  ? 2.853   9.522   5.450   1.00 1.06 ? 9  SER A CB   1  
ATOM   124   O OG   . SER A 1 9  ? 2.725   9.871   6.824   1.00 1.18 ? 9  SER A OG   1  
ATOM   125   H H    . SER A 1 9  ? -0.248  10.168  5.528   1.00 1.07 ? 9  SER A H    1  
ATOM   126   H HA   . SER A 1 9  ? 1.724   11.230  4.826   1.00 1.16 ? 9  SER A HA   1  
ATOM   127   H HB2  . SER A 1 9  ? 2.805   8.453   5.344   1.00 1.00 ? 9  SER A HB2  1  
ATOM   128   H HB3  . SER A 1 9  ? 3.800   9.876   5.062   1.00 1.14 ? 9  SER A HB3  1  
ATOM   129   H HG   . SER A 1 9  ? 3.588   10.148  7.144   1.00 1.49 ? 9  SER A HG   1  
ATOM   130   N N    . TYR A 1 10 ? 1.901   10.923  2.359   1.00 1.05 ? 10 TYR A N    1  
ATOM   131   C CA   . TYR A 1 10 ? 2.107   10.785  0.881   1.00 1.03 ? 10 TYR A CA   1  
ATOM   132   C C    . TYR A 1 10 ? 1.054   9.860   0.229   1.00 0.93 ? 10 TYR A C    1  
ATOM   133   O O    . TYR A 1 10 ? 0.335   9.136   0.891   1.00 0.90 ? 10 TYR A O    1  
ATOM   134   C CB   . TYR A 1 10 ? 3.550   10.247  0.748   1.00 1.09 ? 10 TYR A CB   1  
ATOM   135   C CG   . TYR A 1 10 ? 3.602   8.973   -0.062  1.00 1.00 ? 10 TYR A CG   1  
ATOM   136   C CD1  . TYR A 1 10 ? 3.663   9.040   -1.454  1.00 1.01 ? 10 TYR A CD1  1  
ATOM   137   C CD2  . TYR A 1 10 ? 3.598   7.732   0.583   1.00 0.96 ? 10 TYR A CD2  1  
ATOM   138   C CE1  . TYR A 1 10 ? 3.715   7.865   -2.211  1.00 0.99 ? 10 TYR A CE1  1  
ATOM   139   C CE2  . TYR A 1 10 ? 3.652   6.554   -0.170  1.00 0.95 ? 10 TYR A CE2  1  
ATOM   140   C CZ   . TYR A 1 10 ? 3.710   6.620   -1.569  1.00 0.97 ? 10 TYR A CZ   1  
ATOM   141   O OH   . TYR A 1 10 ? 3.761   5.459   -2.319  1.00 1.01 ? 10 TYR A OH   1  
ATOM   142   H H    . TYR A 1 10 ? 1.788   11.812  2.740   1.00 1.14 ? 10 TYR A H    1  
ATOM   143   H HA   . TYR A 1 10 ? 2.054   11.759  0.421   1.00 1.11 ? 10 TYR A HA   1  
ATOM   144   H HB2  . TYR A 1 10 ? 4.159   10.992  0.262   1.00 1.15 ? 10 TYR A HB2  1  
ATOM   145   H HB3  . TYR A 1 10 ? 3.947   10.055  1.733   1.00 1.17 ? 10 TYR A HB3  1  
ATOM   146   H HD1  . TYR A 1 10 ? 3.665   10.004  -1.943  1.00 1.06 ? 10 TYR A HD1  1  
ATOM   147   H HD2  . TYR A 1 10 ? 3.550   7.685   1.665   1.00 0.98 ? 10 TYR A HD2  1  
ATOM   148   H HE1  . TYR A 1 10 ? 3.760   7.919   -3.288  1.00 1.03 ? 10 TYR A HE1  1  
ATOM   149   H HE2  . TYR A 1 10 ? 3.649   5.596   0.326   1.00 0.95 ? 10 TYR A HE2  1  
ATOM   150   H HH   . TYR A 1 10 ? 3.751   4.709   -1.716  1.00 1.00 ? 10 TYR A HH   1  
ATOM   151   N N    . ARG A 1 11 ? 0.968   9.901   -1.079  1.00 0.92 ? 11 ARG A N    1  
ATOM   152   C CA   . ARG A 1 11 ? -0.014  9.049   -1.822  1.00 0.87 ? 11 ARG A CA   1  
ATOM   153   C C    . ARG A 1 11 ? 0.433   7.574   -1.792  1.00 0.80 ? 11 ARG A C    1  
ATOM   154   O O    . ARG A 1 11 ? 0.974   7.108   -0.812  1.00 0.82 ? 11 ARG A O    1  
ATOM   155   C CB   . ARG A 1 11 ? 0.006   9.620   -3.249  1.00 0.92 ? 11 ARG A CB   1  
ATOM   156   C CG   . ARG A 1 11 ? -1.394  10.107  -3.625  1.00 1.05 ? 11 ARG A CG   1  
ATOM   157   C CD   . ARG A 1 11 ? -2.114  9.029   -4.441  1.00 1.10 ? 11 ARG A CD   1  
ATOM   158   N NE   . ARG A 1 11 ? -3.075  9.777   -5.302  1.00 1.27 ? 11 ARG A NE   1  
ATOM   159   C CZ   . ARG A 1 11 ? -4.292  9.989   -4.891  1.00 1.42 ? 11 ARG A CZ   1  
ATOM   160   N NH1  . ARG A 1 11 ? -5.209  9.085   -5.086  1.00 1.54 ? 11 ARG A NH1  1  
ATOM   161   N NH2  . ARG A 1 11 ? -4.587  11.102  -4.285  1.00 1.92 ? 11 ARG A NH2  1  
ATOM   162   H H    . ARG A 1 11 ? 1.557   10.503  -1.578  1.00 0.96 ? 11 ARG A H    1  
ATOM   163   H HA   . ARG A 1 11 ? -0.997  9.147   -1.401  1.00 0.93 ? 11 ARG A HA   1  
ATOM   164   H HB2  . ARG A 1 11 ? 0.696   10.450  -3.294  1.00 0.94 ? 11 ARG A HB2  1  
ATOM   165   H HB3  . ARG A 1 11 ? 0.321   8.860   -3.944  1.00 0.94 ? 11 ARG A HB3  1  
ATOM   166   H HG2  . ARG A 1 11 ? -1.955  10.314  -2.725  1.00 1.17 ? 11 ARG A HG2  1  
ATOM   167   H HG3  . ARG A 1 11 ? -1.312  11.008  -4.214  1.00 1.21 ? 11 ARG A HG3  1  
ATOM   168   H HD2  . ARG A 1 11 ? -1.405  8.484   -5.051  1.00 1.32 ? 11 ARG A HD2  1  
ATOM   169   H HD3  . ARG A 1 11 ? -2.647  8.355   -3.788  1.00 1.23 ? 11 ARG A HD3  1  
ATOM   170   H HE   . ARG A 1 11 ? -2.791  10.112  -6.178  1.00 1.62 ? 11 ARG A HE   1  
ATOM   171   H HH11 . ARG A 1 11 ? -4.977  8.231   -5.550  1.00 1.62 ? 11 ARG A HH11 1  
ATOM   172   H HH12 . ARG A 1 11 ? -6.145  9.245   -4.774  1.00 1.86 ? 11 ARG A HH12 1  
ATOM   173   H HH21 . ARG A 1 11 ? -3.879  11.790  -4.136  1.00 2.14 ? 11 ARG A HH21 1  
ATOM   174   H HH22 . ARG A 1 11 ? -5.520  11.269  -3.971  1.00 2.28 ? 11 ARG A HH22 1  
ATOM   175   N N    . GLY A 1 12 ? 0.217   6.837   -2.853  1.00 0.80 ? 12 GLY A N    1  
ATOM   176   C CA   . GLY A 1 12 ? 0.649   5.408   -2.872  1.00 0.81 ? 12 GLY A CA   1  
ATOM   177   C C    . GLY A 1 12 ? 1.503   5.161   -4.117  1.00 0.88 ? 12 GLY A C    1  
ATOM   178   O O    . GLY A 1 12 ? 1.642   4.043   -4.572  1.00 0.98 ? 12 GLY A O    1  
ATOM   179   H H    . GLY A 1 12 ? -0.219  7.221   -3.640  1.00 0.83 ? 12 GLY A H    1  
ATOM   180   H HA2  . GLY A 1 12 ? 1.230   5.193   -1.986  1.00 0.82 ? 12 GLY A HA2  1  
ATOM   181   H HA3  . GLY A 1 12 ? -0.218  4.768   -2.902  1.00 0.85 ? 12 GLY A HA3  1  
ATOM   182   N N    . ARG A 1 13 ? 2.057   6.206   -4.683  1.00 0.90 ? 13 ARG A N    1  
ATOM   183   C CA   . ARG A 1 13 ? 2.884   6.045   -5.912  1.00 1.00 ? 13 ARG A CA   1  
ATOM   184   C C    . ARG A 1 13 ? 4.338   6.515   -5.701  1.00 1.09 ? 13 ARG A C    1  
ATOM   185   O O    . ARG A 1 13 ? 4.873   7.265   -6.495  1.00 1.16 ? 13 ARG A O    1  
ATOM   186   C CB   . ARG A 1 13 ? 2.161   6.900   -6.961  1.00 1.02 ? 13 ARG A CB   1  
ATOM   187   C CG   . ARG A 1 13 ? 2.195   8.385   -6.564  1.00 1.06 ? 13 ARG A CG   1  
ATOM   188   C CD   . ARG A 1 13 ? 2.962   9.191   -7.621  1.00 1.24 ? 13 ARG A CD   1  
ATOM   189   N NE   . ARG A 1 13 ? 2.192   9.016   -8.889  1.00 1.35 ? 13 ARG A NE   1  
ATOM   190   C CZ   . ARG A 1 13 ? 2.817   8.973   -10.031 1.00 1.56 ? 13 ARG A CZ   1  
ATOM   191   N NH1  . ARG A 1 13 ? 3.170   10.078  -10.619 1.00 1.93 ? 13 ARG A NH1  1  
ATOM   192   N NH2  . ARG A 1 13 ? 3.086   7.824   -10.581 1.00 1.65 ? 13 ARG A NH2  1  
ATOM   193   H H    . ARG A 1 13 ? 1.914   7.097   -4.306  1.00 0.89 ? 13 ARG A H    1  
ATOM   194   H HA   . ARG A 1 13 ? 2.878   5.016   -6.222  1.00 1.05 ? 13 ARG A HA   1  
ATOM   195   H HB2  . ARG A 1 13 ? 2.643   6.774   -7.911  1.00 1.11 ? 13 ARG A HB2  1  
ATOM   196   H HB3  . ARG A 1 13 ? 1.133   6.578   -7.035  1.00 1.00 ? 13 ARG A HB3  1  
ATOM   197   H HG2  . ARG A 1 13 ? 1.185   8.759   -6.490  1.00 1.07 ? 13 ARG A HG2  1  
ATOM   198   H HG3  . ARG A 1 13 ? 2.688   8.492   -5.609  1.00 1.08 ? 13 ARG A HG3  1  
ATOM   199   H HD2  . ARG A 1 13 ? 2.996   10.236  -7.341  1.00 1.38 ? 13 ARG A HD2  1  
ATOM   200   H HD3  . ARG A 1 13 ? 3.961   8.801   -7.739  1.00 1.30 ? 13 ARG A HD3  1  
ATOM   201   H HE   . ARG A 1 13 ? 1.216   8.933   -8.863  1.00 1.38 ? 13 ARG A HE   1  
ATOM   202   H HH11 . ARG A 1 13 ? 2.961   10.958  -10.194 1.00 2.10 ? 13 ARG A HH11 1  
ATOM   203   H HH12 . ARG A 1 13 ? 3.652   10.048  -11.494 1.00 2.16 ? 13 ARG A HH12 1  
ATOM   204   H HH21 . ARG A 1 13 ? 2.814   6.977   -10.126 1.00 1.64 ? 13 ARG A HH21 1  
ATOM   205   H HH22 . ARG A 1 13 ? 3.565   7.788   -11.458 1.00 1.90 ? 13 ARG A HH22 1  
ATOM   206   N N    . LYS A 1 14 ? 4.990   6.074   -4.653  1.00 1.15 ? 14 LYS A N    1  
ATOM   207   C CA   . LYS A 1 14 ? 6.411   6.500   -4.419  1.00 1.31 ? 14 LYS A CA   1  
ATOM   208   C C    . LYS A 1 14 ? 7.385   5.659   -5.266  1.00 1.41 ? 14 LYS A C    1  
ATOM   209   O O    . LYS A 1 14 ? 8.354   5.122   -4.762  1.00 1.56 ? 14 LYS A O    1  
ATOM   210   C CB   . LYS A 1 14 ? 6.658   6.284   -2.917  1.00 1.38 ? 14 LYS A CB   1  
ATOM   211   C CG   . LYS A 1 14 ? 6.628   4.787   -2.575  1.00 1.46 ? 14 LYS A CG   1  
ATOM   212   C CD   . LYS A 1 14 ? 6.541   4.614   -1.057  1.00 1.51 ? 14 LYS A CD   1  
ATOM   213   C CE   . LYS A 1 14 ? 7.288   3.343   -0.637  1.00 1.73 ? 14 LYS A CE   1  
ATOM   214   N NZ   . LYS A 1 14 ? 6.415   2.209   -1.067  1.00 1.70 ? 14 LYS A NZ   1  
ATOM   215   H H    . LYS A 1 14 ? 4.553   5.462   -4.023  1.00 1.13 ? 14 LYS A H    1  
ATOM   216   H HA   . LYS A 1 14 ? 6.526   7.545   -4.659  1.00 1.32 ? 14 LYS A HA   1  
ATOM   217   H HB2  . LYS A 1 14 ? 7.621   6.688   -2.657  1.00 1.53 ? 14 LYS A HB2  1  
ATOM   218   H HB3  . LYS A 1 14 ? 5.895   6.794   -2.352  1.00 1.29 ? 14 LYS A HB3  1  
ATOM   219   H HG2  . LYS A 1 14 ? 5.769   4.327   -3.041  1.00 1.41 ? 14 LYS A HG2  1  
ATOM   220   H HG3  . LYS A 1 14 ? 7.529   4.316   -2.938  1.00 1.65 ? 14 LYS A HG3  1  
ATOM   221   H HD2  . LYS A 1 14 ? 6.988   5.470   -0.572  1.00 1.57 ? 14 LYS A HD2  1  
ATOM   222   H HD3  . LYS A 1 14 ? 5.506   4.534   -0.762  1.00 1.44 ? 14 LYS A HD3  1  
ATOM   223   H HE2  . LYS A 1 14 ? 8.247   3.292   -1.135  1.00 1.86 ? 14 LYS A HE2  1  
ATOM   224   H HE3  . LYS A 1 14 ? 7.420   3.322   0.435   1.00 1.83 ? 14 LYS A HE3  1  
ATOM   225   H HZ1  . LYS A 1 14 ? 5.413   2.508   -1.054  1.00 1.58 ? 14 LYS A HZ1  1  
ATOM   226   H HZ2  . LYS A 1 14 ? 6.677   1.915   -2.036  1.00 1.71 ? 14 LYS A HZ2  1  
ATOM   227   H HZ3  . LYS A 1 14 ? 6.545   1.407   -0.420  1.00 1.86 ? 14 LYS A HZ3  1  
ATOM   228   N N    . SER A 1 15 ? 7.138   5.552   -6.553  1.00 1.36 ? 15 SER A N    1  
ATOM   229   C CA   . SER A 1 15 ? 8.040   4.753   -7.450  1.00 1.48 ? 15 SER A CA   1  
ATOM   230   C C    . SER A 1 15 ? 8.346   3.380   -6.825  1.00 1.55 ? 15 SER A C    1  
ATOM   231   O O    . SER A 1 15 ? 9.485   2.955   -6.754  1.00 1.70 ? 15 SER A O    1  
ATOM   232   C CB   . SER A 1 15 ? 9.310   5.594   -7.581  1.00 1.61 ? 15 SER A CB   1  
ATOM   233   O OG   . SER A 1 15 ? 10.186  4.982   -8.520  1.00 1.76 ? 15 SER A OG   1  
ATOM   234   H H    . SER A 1 15 ? 6.359   6.003   -6.934  1.00 1.27 ? 15 SER A H    1  
ATOM   235   H HA   . SER A 1 15 ? 7.584   4.625   -8.418  1.00 1.45 ? 15 SER A HA   1  
ATOM   236   H HB2  . SER A 1 15 ? 9.055   6.583   -7.927  1.00 1.61 ? 15 SER A HB2  1  
ATOM   237   H HB3  . SER A 1 15 ? 9.792   5.668   -6.615  1.00 1.64 ? 15 SER A HB3  1  
ATOM   238   H HG   . SER A 1 15 ? 10.565  4.200   -8.108  1.00 1.79 ? 15 SER A HG   1  
ATOM   239   N N    . GLY A 1 16 ? 7.331   2.692   -6.369  1.00 1.49 ? 16 GLY A N    1  
ATOM   240   C CA   . GLY A 1 16 ? 7.541   1.353   -5.740  1.00 1.60 ? 16 GLY A CA   1  
ATOM   241   C C    . GLY A 1 16 ? 6.549   1.180   -4.588  1.00 1.58 ? 16 GLY A C    1  
ATOM   242   O O    . GLY A 1 16 ? 6.898   1.315   -3.429  1.00 1.68 ? 16 GLY A O    1  
ATOM   243   H H    . GLY A 1 16 ? 6.426   3.062   -6.437  1.00 1.40 ? 16 GLY A H    1  
ATOM   244   H HA2  . GLY A 1 16 ? 7.382   0.578   -6.476  1.00 1.62 ? 16 GLY A HA2  1  
ATOM   245   H HA3  . GLY A 1 16 ? 8.548   1.287   -5.356  1.00 1.72 ? 16 GLY A HA3  1  
ATOM   246   N N    . ASN A 1 17 ? 5.312   0.894   -4.900  1.00 1.48 ? 17 ASN A N    1  
ATOM   247   C CA   . ASN A 1 17 ? 4.282   0.720   -3.831  1.00 1.46 ? 17 ASN A CA   1  
ATOM   248   C C    . ASN A 1 17 ? 3.270   -0.359  -4.239  1.00 1.49 ? 17 ASN A C    1  
ATOM   249   O O    . ASN A 1 17 ? 3.158   -0.707  -5.399  1.00 1.51 ? 17 ASN A O    1  
ATOM   250   C CB   . ASN A 1 17 ? 3.601   2.087   -3.729  1.00 1.31 ? 17 ASN A CB   1  
ATOM   251   C CG   . ASN A 1 17 ? 3.118   2.323   -2.298  1.00 1.28 ? 17 ASN A CG   1  
ATOM   252   O OD1  . ASN A 1 17 ? 3.869   2.785   -1.460  1.00 1.42 ? 17 ASN A OD1  1  
ATOM   253   N ND2  . ASN A 1 17 ? 1.890   2.027   -1.977  1.00 1.22 ? 17 ASN A ND2  1  
ATOM   254   H H    . ASN A 1 17 ? 5.056   0.799   -5.841  1.00 1.45 ? 17 ASN A H    1  
ATOM   255   H HA   . ASN A 1 17 ? 4.748   0.467   -2.891  1.00 1.55 ? 17 ASN A HA   1  
ATOM   256   H HB2  . ASN A 1 17 ? 4.304   2.860   -4.003  1.00 1.32 ? 17 ASN A HB2  1  
ATOM   257   H HB3  . ASN A 1 17 ? 2.756   2.117   -4.401  1.00 1.27 ? 17 ASN A HB3  1  
ATOM   258   H HD21 . ASN A 1 17 ? 1.281   1.656   -2.651  1.00 1.23 ? 17 ASN A HD21 1  
ATOM   259   H HD22 . ASN A 1 17 ? 1.575   2.177   -1.061  1.00 1.24 ? 17 ASN A HD22 1  
ATOM   260   N N    . LYS A 1 18 ? 2.529   -0.885  -3.294  1.00 1.56 ? 18 LYS A N    1  
ATOM   261   C CA   . LYS A 1 18 ? 1.519   -1.938  -3.630  1.00 1.62 ? 18 LYS A CA   1  
ATOM   262   C C    . LYS A 1 18 ? 0.395   -1.336  -4.489  1.00 1.55 ? 18 LYS A C    1  
ATOM   263   O O    . LYS A 1 18 ? -0.288  -0.423  -4.062  1.00 1.69 ? 18 LYS A O    1  
ATOM   264   C CB   . LYS A 1 18 ? 0.970   -2.423  -2.283  1.00 1.87 ? 18 LYS A CB   1  
ATOM   265   C CG   . LYS A 1 18 ? 1.241   -3.923  -2.133  1.00 2.16 ? 18 LYS A CG   1  
ATOM   266   C CD   . LYS A 1 18 ? 0.179   -4.554  -1.225  1.00 2.48 ? 18 LYS A CD   1  
ATOM   267   C CE   . LYS A 1 18 ? -1.131  -4.727  -2.003  1.00 2.49 ? 18 LYS A CE   1  
ATOM   268   N NZ   . LYS A 1 18 ? -1.456  -6.180  -1.903  1.00 2.28 ? 18 LYS A NZ   1  
ATOM   269   H H    . LYS A 1 18 ? 2.634   -0.587  -2.367  1.00 1.62 ? 18 LYS A H    1  
ATOM   270   H HA   . LYS A 1 18 ? 1.991   -2.756  -4.151  1.00 1.66 ? 18 LYS A HA   1  
ATOM   271   H HB2  . LYS A 1 18 ? 1.455   -1.887  -1.480  1.00 1.89 ? 18 LYS A HB2  1  
ATOM   272   H HB3  . LYS A 1 18 ? -0.094  -2.246  -2.242  1.00 1.93 ? 18 LYS A HB3  1  
ATOM   273   H HG2  . LYS A 1 18 ? 1.211   -4.393  -3.106  1.00 2.02 ? 18 LYS A HG2  1  
ATOM   274   H HG3  . LYS A 1 18 ? 2.218   -4.068  -1.694  1.00 2.41 ? 18 LYS A HG3  1  
ATOM   275   H HD2  . LYS A 1 18 ? 0.527   -5.518  -0.884  1.00 2.70 ? 18 LYS A HD2  1  
ATOM   276   H HD3  . LYS A 1 18 ? 0.007   -3.912  -0.374  1.00 2.91 ? 18 LYS A HD3  1  
ATOM   277   H HE2  . LYS A 1 18 ? -1.915  -4.132  -1.553  1.00 3.13 ? 18 LYS A HE2  1  
ATOM   278   H HE3  . LYS A 1 18 ? -0.995  -4.450  -3.038  1.00 2.47 ? 18 LYS A HE3  1  
ATOM   279   H HZ1  . LYS A 1 18 ? -1.441  -6.476  -0.908  1.00 2.67 ? 18 LYS A HZ1  1  
ATOM   280   H HZ2  . LYS A 1 18 ? -2.408  -6.354  -2.302  1.00 2.22 ? 18 LYS A HZ2  1  
ATOM   281   H HZ3  . LYS A 1 18 ? -0.749  -6.735  -2.446  1.00 2.10 ? 18 LYS A HZ3  1  
ATOM   282   N N    . PRO A 1 19 ? 0.246   -1.869  -5.679  1.00 1.43 ? 19 PRO A N    1  
ATOM   283   C CA   . PRO A 1 19 ? -0.820  -1.341  -6.578  1.00 1.53 ? 19 PRO A CA   1  
ATOM   284   C C    . PRO A 1 19 ? -2.181  -1.965  -6.228  1.00 1.91 ? 19 PRO A C    1  
ATOM   285   O O    . PRO A 1 19 ? -2.269  -3.150  -5.961  1.00 1.99 ? 19 PRO A O    1  
ATOM   286   C CB   . PRO A 1 19 ? -0.369  -1.761  -7.974  1.00 1.33 ? 19 PRO A CB   1  
ATOM   287   C CG   . PRO A 1 19 ? 0.498   -2.955  -7.756  1.00 1.14 ? 19 PRO A CG   1  
ATOM   288   C CD   . PRO A 1 19 ? 1.126   -2.806  -6.398  1.00 1.16 ? 19 PRO A CD   1  
ATOM   289   H HA   . PRO A 1 19 ? -0.868  -0.266  -6.515  1.00 1.69 ? 19 PRO A HA   1  
ATOM   290   H HB2  . PRO A 1 19 ? -1.225  -2.020  -8.582  1.00 1.55 ? 19 PRO A HB2  1  
ATOM   291   H HB3  . PRO A 1 19 ? 0.200   -0.972  -8.439  1.00 1.39 ? 19 PRO A HB3  1  
ATOM   292   H HG2  . PRO A 1 19 ? -0.101  -3.855  -7.790  1.00 1.37 ? 19 PRO A HG2  1  
ATOM   293   H HG3  . PRO A 1 19 ? 1.268   -2.996  -8.510  1.00 1.23 ? 19 PRO A HG3  1  
ATOM   294   H HD2  . PRO A 1 19 ? 1.157   -3.763  -5.892  1.00 1.39 ? 19 PRO A HD2  1  
ATOM   295   H HD3  . PRO A 1 19 ? 2.118   -2.391  -6.484  1.00 1.14 ? 19 PRO A HD3  1  
ATOM   296   N N    . PRO A 1 20 ? -3.201  -1.137  -6.242  1.00 2.33 ? 20 PRO A N    1  
ATOM   297   C CA   . PRO A 1 20 ? -4.563  -1.654  -5.912  1.00 2.83 ? 20 PRO A CA   1  
ATOM   298   C C    . PRO A 1 20 ? -5.071  -2.615  -7.001  1.00 2.87 ? 20 PRO A C    1  
ATOM   299   O O    . PRO A 1 20 ? -5.665  -3.633  -6.704  1.00 3.25 ? 20 PRO A O    1  
ATOM   300   C CB   . PRO A 1 20 ? -5.429  -0.398  -5.842  1.00 3.23 ? 20 PRO A CB   1  
ATOM   301   C CG   . PRO A 1 20 ? -4.722  0.604   -6.690  1.00 2.96 ? 20 PRO A CG   1  
ATOM   302   C CD   . PRO A 1 20 ? -3.252  0.294   -6.591  1.00 2.48 ? 20 PRO A CD   1  
ATOM   303   H HA   . PRO A 1 20 ? -4.555  -2.146  -4.953  1.00 3.04 ? 20 PRO A HA   1  
ATOM   304   H HB2  . PRO A 1 20 ? -6.417  -0.600  -6.235  1.00 3.50 ? 20 PRO A HB2  1  
ATOM   305   H HB3  . PRO A 1 20 ? -5.494  -0.042  -4.825  1.00 3.53 ? 20 PRO A HB3  1  
ATOM   306   H HG2  . PRO A 1 20 ? -5.054  0.519   -7.716  1.00 2.95 ? 20 PRO A HG2  1  
ATOM   307   H HG3  . PRO A 1 20 ? -4.909  1.600   -6.321  1.00 3.24 ? 20 PRO A HG3  1  
ATOM   308   H HD2  . PRO A 1 20 ? -2.765  0.473   -7.541  1.00 2.28 ? 20 PRO A HD2  1  
ATOM   309   H HD3  . PRO A 1 20 ? -2.793  0.883   -5.812  1.00 2.62 ? 20 PRO A HD3  1  
ATOM   310   N N    . SER A 1 21 ? -4.841  -2.301  -8.254  1.00 2.67 ? 21 SER A N    1  
ATOM   311   C CA   . SER A 1 21 ? -5.312  -3.203  -9.357  1.00 2.98 ? 21 SER A CA   1  
ATOM   312   C C    . SER A 1 21 ? -4.429  -4.458  -9.460  1.00 2.71 ? 21 SER A C    1  
ATOM   313   O O    . SER A 1 21 ? -4.821  -5.446  -10.051 1.00 2.96 ? 21 SER A O    1  
ATOM   314   C CB   . SER A 1 21 ? -5.219  -2.368  -10.639 1.00 3.24 ? 21 SER A CB   1  
ATOM   315   O OG   . SER A 1 21 ? -3.899  -1.845  -10.780 1.00 2.97 ? 21 SER A OG   1  
ATOM   316   H H    . SER A 1 21 ? -4.359  -1.477  -8.471  1.00 2.47 ? 21 SER A H    1  
ATOM   317   H HA   . SER A 1 21 ? -6.339  -3.489  -9.186  1.00 3.34 ? 21 SER A HA   1  
ATOM   318   H HB2  . SER A 1 21 ? -5.444  -2.989  -11.490 1.00 3.57 ? 21 SER A HB2  1  
ATOM   319   H HB3  . SER A 1 21 ? -5.935  -1.558  -10.591 1.00 3.42 ? 21 SER A HB3  1  
ATOM   320   H HG   . SER A 1 21 ? -3.948  -0.888  -10.682 1.00 3.06 ? 21 SER A HG   1  
ATOM   321   N N    . LYS A 1 22 ? -3.246  -4.432  -8.890  1.00 2.29 ? 22 LYS A N    1  
ATOM   322   C CA   . LYS A 1 22 ? -2.351  -5.629  -8.955  1.00 2.07 ? 22 LYS A CA   1  
ATOM   323   C C    . LYS A 1 22 ? -1.951  -6.061  -7.538  1.00 1.71 ? 22 LYS A C    1  
ATOM   324   O O    . LYS A 1 22 ? -0.818  -5.904  -7.123  1.00 1.33 ? 22 LYS A O    1  
ATOM   325   C CB   . LYS A 1 22 ? -1.129  -5.171  -9.757  1.00 1.90 ? 22 LYS A CB   1  
ATOM   326   C CG   . LYS A 1 22 ? -1.448  -5.227  -11.254 1.00 2.39 ? 22 LYS A CG   1  
ATOM   327   C CD   . LYS A 1 22 ? -0.495  -4.303  -12.019 1.00 2.56 ? 22 LYS A CD   1  
ATOM   328   C CE   . LYS A 1 22 ? -0.847  -2.836  -11.734 1.00 2.55 ? 22 LYS A CE   1  
ATOM   329   N NZ   . LYS A 1 22 ? -2.143  -2.587  -12.436 1.00 3.00 ? 22 LYS A NZ   1  
ATOM   330   H H    . LYS A 1 22 ? -2.948  -3.629  -8.415  1.00 2.18 ? 22 LYS A H    1  
ATOM   331   H HA   . LYS A 1 22 ? -2.845  -6.440  -9.467  1.00 2.37 ? 22 LYS A HA   1  
ATOM   332   H HB2  . LYS A 1 22 ? -0.876  -4.159  -9.479  1.00 1.85 ? 22 LYS A HB2  1  
ATOM   333   H HB3  . LYS A 1 22 ? -0.294  -5.822  -9.545  1.00 1.65 ? 22 LYS A HB3  1  
ATOM   334   H HG2  . LYS A 1 22 ? -1.329  -6.241  -11.608 1.00 2.41 ? 22 LYS A HG2  1  
ATOM   335   H HG3  . LYS A 1 22 ? -2.467  -4.907  -11.417 1.00 2.72 ? 22 LYS A HG3  1  
ATOM   336   H HD2  . LYS A 1 22 ? 0.521   -4.496  -11.705 1.00 2.38 ? 22 LYS A HD2  1  
ATOM   337   H HD3  . LYS A 1 22 ? -0.584  -4.492  -13.078 1.00 2.98 ? 22 LYS A HD3  1  
ATOM   338   H HE2  . LYS A 1 22 ? -0.959  -2.680  -10.669 1.00 2.26 ? 22 LYS A HE2  1  
ATOM   339   H HE3  . LYS A 1 22 ? -0.082  -2.185  -12.129 1.00 2.64 ? 22 LYS A HE3  1  
ATOM   340   H HZ1  . LYS A 1 22 ? -2.421  -3.429  -12.980 1.00 3.15 ? 22 LYS A HZ1  1  
ATOM   341   H HZ2  . LYS A 1 22 ? -2.886  -2.371  -11.728 1.00 2.94 ? 22 LYS A HZ2  1  
ATOM   342   H HZ3  . LYS A 1 22 ? -2.038  -1.780  -13.083 1.00 3.34 ? 22 LYS A HZ3  1  
ATOM   343   N N    . THR A 1 23 ? -2.881  -6.605  -6.795  1.00 1.95 ? 23 THR A N    1  
ATOM   344   C CA   . THR A 1 23 ? -2.572  -7.054  -5.397  1.00 1.77 ? 23 THR A CA   1  
ATOM   345   C C    . THR A 1 23 ? -2.476  -8.589  -5.324  1.00 1.75 ? 23 THR A C    1  
ATOM   346   O O    . THR A 1 23 ? -2.810  -9.191  -4.319  1.00 1.78 ? 23 THR A O    1  
ATOM   347   C CB   . THR A 1 23 ? -3.739  -6.535  -4.539  1.00 2.22 ? 23 THR A CB   1  
ATOM   348   O OG1  . THR A 1 23 ? -3.509  -6.868  -3.174  1.00 2.23 ? 23 THR A OG1  1  
ATOM   349   C CG2  . THR A 1 23 ? -5.059  -7.165  -4.999  1.00 2.66 ? 23 THR A CG2  1  
ATOM   350   H H    . THR A 1 23 ? -3.785  -6.717  -7.157  1.00 2.32 ? 23 THR A H    1  
ATOM   351   H HA   . THR A 1 23 ? -1.649  -6.609  -5.059  1.00 1.47 ? 23 THR A HA   1  
ATOM   352   H HB   . THR A 1 23 ? -3.806  -5.461  -4.639  1.00 2.34 ? 23 THR A HB   1  
ATOM   353   H HG1  . THR A 1 23 ? -3.579  -7.828  -3.087  1.00 2.22 ? 23 THR A HG1  1  
ATOM   354   H HG21 . THR A 1 23 ? -4.869  -8.149  -5.401  1.00 2.82 ? 23 THR A HG21 1  
ATOM   355   H HG22 . THR A 1 23 ? -5.732  -7.244  -4.158  1.00 3.08 ? 23 THR A HG22 1  
ATOM   356   H HG23 . THR A 1 23 ? -5.507  -6.545  -5.761  1.00 2.91 ? 23 THR A HG23 1  
ATOM   357   N N    . CYS A 1 24 ? -2.019  -9.222  -6.377  1.00 1.84 ? 24 CYS A N    1  
ATOM   358   C CA   . CYS A 1 24 ? -1.897  -10.712 -6.369  1.00 1.95 ? 24 CYS A CA   1  
ATOM   359   C C    . CYS A 1 24 ? -0.540  -11.141 -6.949  1.00 1.69 ? 24 CYS A C    1  
ATOM   360   O O    . CYS A 1 24 ? -0.469  -11.810 -7.964  1.00 1.87 ? 24 CYS A O    1  
ATOM   361   C CB   . CYS A 1 24 ? -3.051  -11.209 -7.248  1.00 2.40 ? 24 CYS A CB   1  
ATOM   362   S SG   . CYS A 1 24 ? -4.583  -11.228 -6.283  1.00 2.89 ? 24 CYS A SG   1  
ATOM   363   H H    . CYS A 1 24 ? -1.754  -8.718  -7.171  1.00 1.93 ? 24 CYS A H    1  
ATOM   364   H HA   . CYS A 1 24 ? -2.011  -11.091 -5.366  1.00 2.00 ? 24 CYS A HA   1  
ATOM   365   H HB2  . CYS A 1 24 ? -3.167  -10.550 -8.095  1.00 2.57 ? 24 CYS A HB2  1  
ATOM   366   H HB3  . CYS A 1 24 ? -2.833  -12.208 -7.597  1.00 2.60 ? 24 CYS A HB3  1  
ATOM   367   H HG   . CYS A 1 24 ? -5.193  -11.836 -6.708  1.00 3.17 ? 24 CYS A HG   1  
ATOM   368   N N    . LEU A 1 25 ? 0.536   -10.762 -6.306  1.00 1.61 ? 25 LEU A N    1  
ATOM   369   C CA   . LEU A 1 25 ? 1.894   -11.147 -6.808  1.00 1.58 ? 25 LEU A CA   1  
ATOM   370   C C    . LEU A 1 25 ? 2.752   -11.698 -5.657  1.00 1.44 ? 25 LEU A C    1  
ATOM   371   O O    . LEU A 1 25 ? 3.929   -11.406 -5.549  1.00 1.53 ? 25 LEU A O    1  
ATOM   372   C CB   . LEU A 1 25 ? 2.494   -9.855  -7.386  1.00 1.72 ? 25 LEU A CB   1  
ATOM   373   C CG   . LEU A 1 25 ? 2.631   -8.794  -6.288  1.00 1.74 ? 25 LEU A CG   1  
ATOM   374   C CD1  . LEU A 1 25 ? 4.058   -8.245  -6.281  1.00 1.89 ? 25 LEU A CD1  1  
ATOM   375   C CD2  . LEU A 1 25 ? 1.650   -7.650  -6.557  1.00 1.98 ? 25 LEU A CD2  1  
ATOM   376   H H    . LEU A 1 25 ? 0.453   -10.225 -5.486  1.00 1.83 ? 25 LEU A H    1  
ATOM   377   H HA   . LEU A 1 25 ? 1.804   -11.888 -7.586  1.00 1.75 ? 25 LEU A HA   1  
ATOM   378   H HB2  . LEU A 1 25 ? 3.468   -10.070 -7.801  1.00 1.82 ? 25 LEU A HB2  1  
ATOM   379   H HB3  . LEU A 1 25 ? 1.848   -9.480  -8.167  1.00 1.88 ? 25 LEU A HB3  1  
ATOM   380   H HG   . LEU A 1 25 ? 2.413   -9.238  -5.328  1.00 1.66 ? 25 LEU A HG   1  
ATOM   381   H HD11 . LEU A 1 25 ? 4.758   -9.065  -6.231  1.00 2.10 ? 25 LEU A HD11 1  
ATOM   382   H HD12 . LEU A 1 25 ? 4.230   -7.677  -7.184  1.00 1.99 ? 25 LEU A HD12 1  
ATOM   383   H HD13 . LEU A 1 25 ? 4.192   -7.604  -5.422  1.00 2.42 ? 25 LEU A HD13 1  
ATOM   384   H HD21 . LEU A 1 25 ? 1.749   -7.323  -7.581  1.00 2.31 ? 25 LEU A HD21 1  
ATOM   385   H HD22 . LEU A 1 25 ? 0.641   -7.993  -6.384  1.00 2.13 ? 25 LEU A HD22 1  
ATOM   386   H HD23 . LEU A 1 25 ? 1.868   -6.826  -5.893  1.00 2.39 ? 25 LEU A HD23 1  
ATOM   387   N N    . LYS A 1 26 ? 2.161   -12.504 -4.804  1.00 1.41 ? 26 LYS A N    1  
ATOM   388   C CA   . LYS A 1 26 ? 2.906   -13.102 -3.650  1.00 1.42 ? 26 LYS A CA   1  
ATOM   389   C C    . LYS A 1 26 ? 3.641   -12.020 -2.840  1.00 1.49 ? 26 LYS A C    1  
ATOM   390   O O    . LYS A 1 26 ? 4.831   -12.109 -2.598  1.00 1.68 ? 26 LYS A O    1  
ATOM   391   C CB   . LYS A 1 26 ? 3.891   -14.091 -4.281  1.00 1.68 ? 26 LYS A CB   1  
ATOM   392   C CG   . LYS A 1 26 ? 4.010   -15.327 -3.386  1.00 1.86 ? 26 LYS A CG   1  
ATOM   393   C CD   . LYS A 1 26 ? 2.680   -16.088 -3.375  1.00 1.79 ? 26 LYS A CD   1  
ATOM   394   C CE   . LYS A 1 26 ? 2.895   -17.497 -2.811  1.00 2.02 ? 26 LYS A CE   1  
ATOM   395   N NZ   . LYS A 1 26 ? 2.820   -17.344 -1.329  1.00 1.86 ? 26 LYS A NZ   1  
ATOM   396   H H    . LYS A 1 26 ? 1.216   -12.725 -4.928  1.00 1.49 ? 26 LYS A H    1  
ATOM   397   H HA   . LYS A 1 26 ? 2.223   -13.634 -3.009  1.00 1.40 ? 26 LYS A HA   1  
ATOM   398   H HB2  . LYS A 1 26 ? 3.533   -14.384 -5.257  1.00 1.76 ? 26 LYS A HB2  1  
ATOM   399   H HB3  . LYS A 1 26 ? 4.860   -13.624 -4.378  1.00 1.83 ? 26 LYS A HB3  1  
ATOM   400   H HG2  . LYS A 1 26 ? 4.791   -15.969 -3.765  1.00 2.14 ? 26 LYS A HG2  1  
ATOM   401   H HG3  . LYS A 1 26 ? 4.253   -15.018 -2.381  1.00 1.91 ? 26 LYS A HG3  1  
ATOM   402   H HD2  . LYS A 1 26 ? 1.968   -15.557 -2.759  1.00 1.62 ? 26 LYS A HD2  1  
ATOM   403   H HD3  . LYS A 1 26 ? 2.299   -16.161 -4.383  1.00 1.92 ? 26 LYS A HD3  1  
ATOM   404   H HE2  . LYS A 1 26 ? 2.118   -18.162 -3.164  1.00 2.16 ? 26 LYS A HE2  1  
ATOM   405   H HE3  . LYS A 1 26 ? 3.868   -17.870 -3.095  1.00 2.26 ? 26 LYS A HE3  1  
ATOM   406   H HZ1  . LYS A 1 26 ? 1.993   -16.757 -1.073  1.00 1.68 ? 26 LYS A HZ1  1  
ATOM   407   H HZ2  . LYS A 1 26 ? 2.731   -18.281 -0.887  1.00 2.02 ? 26 LYS A HZ2  1  
ATOM   408   H HZ3  . LYS A 1 26 ? 3.691   -16.878 -0.981  1.00 1.91 ? 26 LYS A HZ3  1  
ATOM   409   N N    . GLU A 1 27 ? 2.932   -11.004 -2.412  1.00 1.50 ? 27 GLU A N    1  
ATOM   410   C CA   . GLU A 1 27 ? 3.573   -9.914  -1.608  1.00 1.78 ? 27 GLU A CA   1  
ATOM   411   C C    . GLU A 1 27 ? 3.947   -10.412 -0.198  1.00 1.91 ? 27 GLU A C    1  
ATOM   412   O O    . GLU A 1 27 ? 4.670   -9.751  0.525   1.00 2.24 ? 27 GLU A O    1  
ATOM   413   C CB   . GLU A 1 27 ? 2.514   -8.811  -1.525  1.00 1.98 ? 27 GLU A CB   1  
ATOM   414   C CG   . GLU A 1 27 ? 2.280   -8.222  -2.921  1.00 1.93 ? 27 GLU A CG   1  
ATOM   415   C CD   . GLU A 1 27 ? 0.865   -8.553  -3.398  1.00 2.09 ? 27 GLU A CD   1  
ATOM   416   O OE1  . GLU A 1 27 ? 0.620   -9.704  -3.720  1.00 2.73 ? 27 GLU A OE1  1  
ATOM   417   O OE2  . GLU A 1 27 ? 0.050   -7.647  -3.439  1.00 2.10 ? 27 GLU A OE2  1  
ATOM   418   H H    . GLU A 1 27 ? 1.973   -10.957 -2.618  1.00 1.46 ? 27 GLU A H    1  
ATOM   419   H HA   . GLU A 1 27 ? 4.449   -9.541  -2.115  1.00 1.85 ? 27 GLU A HA   1  
ATOM   420   H HB2  . GLU A 1 27 ? 1.590   -9.228  -1.148  1.00 2.07 ? 27 GLU A HB2  1  
ATOM   421   H HB3  . GLU A 1 27 ? 2.856   -8.032  -0.860  1.00 2.19 ? 27 GLU A HB3  1  
ATOM   422   H HG2  . GLU A 1 27 ? 2.404   -7.152  -2.882  1.00 1.88 ? 27 GLU A HG2  1  
ATOM   423   H HG3  . GLU A 1 27 ? 2.996   -8.640  -3.613  1.00 2.01 ? 27 GLU A HG3  1  
ATOM   424   N N    . GLU A 1 28 ? 3.463   -11.569 0.198   1.00 1.76 ? 28 GLU A N    1  
ATOM   425   C CA   . GLU A 1 28 ? 3.793   -12.108 1.555   1.00 1.93 ? 28 GLU A CA   1  
ATOM   426   C C    . GLU A 1 28 ? 5.223   -12.685 1.571   1.00 2.09 ? 28 GLU A C    1  
ATOM   427   O O    . GLU A 1 28 ? 6.043   -12.358 0.732   1.00 2.23 ? 28 GLU A O    1  
ATOM   428   C CB   . GLU A 1 28 ? 2.749   -13.210 1.800   1.00 1.76 ? 28 GLU A CB   1  
ATOM   429   C CG   . GLU A 1 28 ? 2.949   -14.355 0.794   1.00 1.56 ? 28 GLU A CG   1  
ATOM   430   C CD   . GLU A 1 28 ? 1.765   -14.417 -0.177  1.00 1.45 ? 28 GLU A CD   1  
ATOM   431   O OE1  . GLU A 1 28 ? 1.472   -13.406 -0.794  1.00 1.74 ? 28 GLU A OE1  1  
ATOM   432   O OE2  . GLU A 1 28 ? 1.180   -15.482 -0.297  1.00 1.56 ? 28 GLU A OE2  1  
ATOM   433   H H    . GLU A 1 28 ? 2.883   -12.087 -0.398  1.00 1.60 ? 28 GLU A H    1  
ATOM   434   H HA   . GLU A 1 28 ? 3.694   -11.335 2.300   1.00 2.17 ? 28 GLU A HA   1  
ATOM   435   H HB2  . GLU A 1 28 ? 2.859   -13.591 2.805   1.00 1.89 ? 28 GLU A HB2  1  
ATOM   436   H HB3  . GLU A 1 28 ? 1.759   -12.797 1.680   1.00 1.80 ? 28 GLU A HB3  1  
ATOM   437   H HG2  . GLU A 1 28 ? 3.858   -14.189 0.236   1.00 1.60 ? 28 GLU A HG2  1  
ATOM   438   H HG3  . GLU A 1 28 ? 3.022   -15.289 1.326   1.00 1.63 ? 28 GLU A HG3  1  
ATOM   439   N N    . MET A 1 29 ? 5.527   -13.541 2.517   1.00 2.18 ? 29 MET A N    1  
ATOM   440   C CA   . MET A 1 29 ? 6.899   -14.136 2.582   1.00 2.49 ? 29 MET A CA   1  
ATOM   441   C C    . MET A 1 29 ? 7.048   -15.245 1.528   1.00 2.46 ? 29 MET A C    1  
ATOM   442   O O    . MET A 1 29 ? 6.986   -16.421 1.838   1.00 2.60 ? 29 MET A O    1  
ATOM   443   C CB   . MET A 1 29 ? 7.021   -14.704 4.001   1.00 2.71 ? 29 MET A CB   1  
ATOM   444   C CG   . MET A 1 29 ? 8.495   -14.951 4.332   1.00 3.35 ? 29 MET A CG   1  
ATOM   445   S SD   . MET A 1 29 ? 8.647   -15.478 6.057   1.00 3.75 ? 29 MET A SD   1  
ATOM   446   C CE   . MET A 1 29 ? 10.252  -16.299 5.903   1.00 4.46 ? 29 MET A CE   1  
ATOM   447   H H    . MET A 1 29 ? 4.853   -13.793 3.183   1.00 2.12 ? 29 MET A H    1  
ATOM   448   H HA   . MET A 1 29 ? 7.645   -13.371 2.428   1.00 2.70 ? 29 MET A HA   1  
ATOM   449   H HB2  . MET A 1 29 ? 6.606   -14.000 4.708   1.00 2.67 ? 29 MET A HB2  1  
ATOM   450   H HB3  . MET A 1 29 ? 6.480   -15.637 4.063   1.00 2.69 ? 29 MET A HB3  1  
ATOM   451   H HG2  . MET A 1 29 ? 8.885   -15.722 3.684   1.00 3.58 ? 29 MET A HG2  1  
ATOM   452   H HG3  . MET A 1 29 ? 9.055   -14.039 4.183   1.00 3.77 ? 29 MET A HG3  1  
ATOM   453   H HE1  . MET A 1 29 ? 10.202  -17.043 5.120   1.00 4.79 ? 29 MET A HE1  1  
ATOM   454   H HE2  . MET A 1 29 ? 11.009  -15.565 5.662   1.00 4.84 ? 29 MET A HE2  1  
ATOM   455   H HE3  . MET A 1 29 ? 10.503  -16.778 6.835   1.00 4.69 ? 29 MET A HE3  1  
ATOM   456   N N    . ALA A 1 30 ? 7.242   -14.867 0.282   1.00 2.43 ? 30 ALA A N    1  
ATOM   457   C CA   . ALA A 1 30 ? 7.398   -15.873 -0.825  1.00 2.56 ? 30 ALA A CA   1  
ATOM   458   C C    . ALA A 1 30 ? 6.124   -16.726 -0.986  1.00 2.30 ? 30 ALA A C    1  
ATOM   459   O O    . ALA A 1 30 ? 6.202   -17.763 -1.628  1.00 2.52 ? 30 ALA A O    1  
ATOM   460   C CB   . ALA A 1 30 ? 8.595   -16.742 -0.417  1.00 3.09 ? 30 ALA A CB   1  
ATOM   461   O OXT  . ALA A 1 30 ? 5.086   -16.324 -0.480  1.00 2.09 ? 30 ALA A OXT  1  
ATOM   462   H H    . ALA A 1 30 ? 7.282   -13.910 0.071   1.00 2.42 ? 30 ALA A H    1  
ATOM   463   H HA   . ALA A 1 30 ? 7.619   -15.367 -1.752  1.00 2.64 ? 30 ALA A HA   1  
ATOM   464   H HB1  . ALA A 1 30 ? 9.328   -16.131 0.089   1.00 3.51 ? 30 ALA A HB1  1  
ATOM   465   H HB2  . ALA A 1 30 ? 8.260   -17.527 0.245   1.00 3.31 ? 30 ALA A HB2  1  
ATOM   466   H HB3  . ALA A 1 30 ? 9.038   -17.180 -1.298  1.00 3.28 ? 30 ALA A HB3  1  
ATOM   467   N N    . MET A 1 1  ? -13.862 7.246   11.982  1.00 2.69 ? 1  MET A N    2  
ATOM   468   C CA   . MET A 1 1  ? -13.135 7.274   13.289  1.00 2.31 ? 1  MET A CA   2  
ATOM   469   C C    . MET A 1 1  ? -11.775 7.966   13.125  1.00 2.03 ? 1  MET A C    2  
ATOM   470   O O    . MET A 1 1  ? -11.204 7.979   12.051  1.00 2.28 ? 1  MET A O    2  
ATOM   471   C CB   . MET A 1 1  ? -12.948 5.801   13.674  1.00 2.63 ? 1  MET A CB   2  
ATOM   472   C CG   . MET A 1 1  ? -12.684 5.689   15.179  1.00 3.07 ? 1  MET A CG   2  
ATOM   473   S SD   . MET A 1 1  ? -14.145 6.246   16.092  1.00 3.51 ? 1  MET A SD   2  
ATOM   474   C CE   . MET A 1 1  ? -14.771 4.609   16.544  1.00 4.30 ? 1  MET A CE   2  
ATOM   475   H H1   . MET A 1 1  ? -13.283 6.751   11.272  1.00 3.06 ? 1  MET A H1   2  
ATOM   476   H H2   . MET A 1 1  ? -14.769 6.749   12.099  1.00 2.84 ? 1  MET A H2   2  
ATOM   477   H H3   . MET A 1 1  ? -14.040 8.219   11.663  1.00 2.93 ? 1  MET A H3   2  
ATOM   478   H HA   . MET A 1 1  ? -13.725 7.778   14.037  1.00 2.47 ? 1  MET A HA   2  
ATOM   479   H HB2  . MET A 1 1  ? -13.842 5.246   13.424  1.00 2.97 ? 1  MET A HB2  2  
ATOM   480   H HB3  . MET A 1 1  ? -12.108 5.390   13.133  1.00 2.69 ? 1  MET A HB3  2  
ATOM   481   H HG2  . MET A 1 1  ? -12.474 4.660   15.431  1.00 3.53 ? 1  MET A HG2  2  
ATOM   482   H HG3  . MET A 1 1  ? -11.838 6.305   15.444  1.00 3.11 ? 1  MET A HG3  2  
ATOM   483   H HE1  . MET A 1 1  ? -14.896 4.013   15.651  1.00 4.55 ? 1  MET A HE1  2  
ATOM   484   H HE2  . MET A 1 1  ? -14.070 4.123   17.204  1.00 4.65 ? 1  MET A HE2  2  
ATOM   485   H HE3  . MET A 1 1  ? -15.722 4.715   17.047  1.00 4.67 ? 1  MET A HE3  2  
ATOM   486   N N    . ILE A 1 2  ? -11.254 8.538   14.183  1.00 1.79 ? 2  ILE A N    2  
ATOM   487   C CA   . ILE A 1 2  ? -9.929  9.230   14.093  1.00 1.62 ? 2  ILE A CA   2  
ATOM   488   C C    . ILE A 1 2  ? -8.791  8.260   14.457  1.00 1.26 ? 2  ILE A C    2  
ATOM   489   O O    . ILE A 1 2  ? -8.993  7.289   15.162  1.00 1.30 ? 2  ILE A O    2  
ATOM   490   C CB   . ILE A 1 2  ? -10.011 10.389  15.099  1.00 1.86 ? 2  ILE A CB   2  
ATOM   491   C CG1  . ILE A 1 2  ? -8.909  11.409  14.795  1.00 2.00 ? 2  ILE A CG1  2  
ATOM   492   C CG2  . ILE A 1 2  ? -9.836  9.866   16.529  1.00 1.88 ? 2  ILE A CG2  2  
ATOM   493   C CD1  . ILE A 1 2  ? -9.303  12.774  15.361  1.00 2.61 ? 2  ILE A CD1  2  
ATOM   494   H H    . ILE A 1 2  ? -11.733 8.512   15.038  1.00 1.94 ? 2  ILE A H    2  
ATOM   495   H HA   . ILE A 1 2  ? -9.779  9.620   13.098  1.00 1.75 ? 2  ILE A HA   2  
ATOM   496   H HB   . ILE A 1 2  ? -10.976 10.869  15.011  1.00 2.16 ? 2  ILE A HB   2  
ATOM   497   H HG12 . ILE A 1 2  ? -7.983  11.084  15.249  1.00 2.10 ? 2  ILE A HG12 2  
ATOM   498   H HG13 . ILE A 1 2  ? -8.776  11.490  13.727  1.00 2.02 ? 2  ILE A HG13 2  
ATOM   499   H HG21 . ILE A 1 2  ? -10.401 8.953   16.652  1.00 1.86 ? 2  ILE A HG21 2  
ATOM   500   H HG22 . ILE A 1 2  ? -8.791  9.671   16.716  1.00 2.17 ? 2  ILE A HG22 2  
ATOM   501   H HG23 . ILE A 1 2  ? -10.194 10.607  17.229  1.00 2.22 ? 2  ILE A HG23 2  
ATOM   502   H HD11 . ILE A 1 2  ? -9.555  12.673  16.405  1.00 2.97 ? 2  ILE A HD11 2  
ATOM   503   H HD12 . ILE A 1 2  ? -8.476  13.461  15.255  1.00 3.00 ? 2  ILE A HD12 2  
ATOM   504   H HD13 . ILE A 1 2  ? -10.158 13.155  14.820  1.00 2.92 ? 2  ILE A HD13 2  
ATOM   505   N N    . SER A 1 3  ? -7.598  8.520   13.978  1.00 1.13 ? 3  SER A N    2  
ATOM   506   C CA   . SER A 1 3  ? -6.445  7.619   14.294  1.00 0.94 ? 3  SER A CA   2  
ATOM   507   C C    . SER A 1 3  ? -5.384  8.372   15.110  1.00 1.06 ? 3  SER A C    2  
ATOM   508   O O    . SER A 1 3  ? -5.156  8.064   16.264  1.00 1.19 ? 3  SER A O    2  
ATOM   509   C CB   . SER A 1 3  ? -5.884  7.192   12.934  1.00 0.82 ? 3  SER A CB   2  
ATOM   510   O OG   . SER A 1 3  ? -4.572  6.667   13.108  1.00 0.87 ? 3  SER A OG   2  
ATOM   511   H H    . SER A 1 3  ? -7.461  9.309   13.413  1.00 1.33 ? 3  SER A H    2  
ATOM   512   H HA   . SER A 1 3  ? -6.785  6.752   14.838  1.00 1.01 ? 3  SER A HA   2  
ATOM   513   H HB2  . SER A 1 3  ? -6.517  6.431   12.506  1.00 0.90 ? 3  SER A HB2  2  
ATOM   514   H HB3  . SER A 1 3  ? -5.857  8.047   12.271  1.00 0.97 ? 3  SER A HB3  2  
ATOM   515   H HG   . SER A 1 3  ? -4.089  6.789   12.281  1.00 0.92 ? 3  SER A HG   2  
ATOM   516   N N    . SER A 1 4  ? -4.732  9.352   14.511  1.00 1.11 ? 4  SER A N    2  
ATOM   517   C CA   . SER A 1 4  ? -3.667  10.151  15.224  1.00 1.33 ? 4  SER A CA   2  
ATOM   518   C C    . SER A 1 4  ? -2.357  9.357   15.375  1.00 1.35 ? 4  SER A C    2  
ATOM   519   O O    . SER A 1 4  ? -1.281  9.920   15.312  1.00 1.57 ? 4  SER A O    2  
ATOM   520   C CB   . SER A 1 4  ? -4.246  10.507  16.598  1.00 1.54 ? 4  SER A CB   2  
ATOM   521   O OG   . SER A 1 4  ? -3.840  11.823  16.950  1.00 1.80 ? 4  SER A OG   2  
ATOM   522   H H    . SER A 1 4  ? -4.939  9.564   13.578  1.00 1.06 ? 4  SER A H    2  
ATOM   523   H HA   . SER A 1 4  ? -3.473  11.056  14.676  1.00 1.40 ? 4  SER A HA   2  
ATOM   524   H HB2  . SER A 1 4  ? -5.322  10.465  16.561  1.00 1.50 ? 4  SER A HB2  2  
ATOM   525   H HB3  . SER A 1 4  ? -3.887  9.798   17.334  1.00 1.63 ? 4  SER A HB3  2  
ATOM   526   H HG   . SER A 1 4  ? -2.952  11.775  17.315  1.00 2.12 ? 4  SER A HG   2  
ATOM   527   N N    . VAL A 1 5  ? -2.434  8.066   15.580  1.00 1.24 ? 5  VAL A N    2  
ATOM   528   C CA   . VAL A 1 5  ? -1.189  7.249   15.740  1.00 1.40 ? 5  VAL A CA   2  
ATOM   529   C C    . VAL A 1 5  ? -0.615  6.865   14.369  1.00 1.35 ? 5  VAL A C    2  
ATOM   530   O O    . VAL A 1 5  ? 0.577   6.946   14.145  1.00 1.56 ? 5  VAL A O    2  
ATOM   531   C CB   . VAL A 1 5  ? -1.628  5.999   16.514  1.00 1.46 ? 5  VAL A CB   2  
ATOM   532   C CG1  . VAL A 1 5  ? -0.456  5.021   16.623  1.00 1.74 ? 5  VAL A CG1  2  
ATOM   533   C CG2  . VAL A 1 5  ? -2.081  6.401   17.920  1.00 1.59 ? 5  VAL A CG2  2  
ATOM   534   H H    . VAL A 1 5  ? -3.307  7.635   15.633  1.00 1.12 ? 5  VAL A H    2  
ATOM   535   H HA   . VAL A 1 5  ? -0.457  7.792   16.307  1.00 1.57 ? 5  VAL A HA   2  
ATOM   536   H HB   . VAL A 1 5  ? -2.447  5.522   15.994  1.00 1.37 ? 5  VAL A HB   2  
ATOM   537   H HG11 . VAL A 1 5  ? 0.411   5.538   17.005  1.00 2.18 ? 5  VAL A HG11 2  
ATOM   538   H HG12 . VAL A 1 5  ? -0.721  4.216   17.293  1.00 2.10 ? 5  VAL A HG12 2  
ATOM   539   H HG13 . VAL A 1 5  ? -0.233  4.616   15.647  1.00 1.84 ? 5  VAL A HG13 2  
ATOM   540   H HG21 . VAL A 1 5  ? -1.325  7.022   18.378  1.00 1.90 ? 5  VAL A HG21 2  
ATOM   541   H HG22 . VAL A 1 5  ? -3.008  6.952   17.855  1.00 2.02 ? 5  VAL A HG22 2  
ATOM   542   H HG23 . VAL A 1 5  ? -2.230  5.515   18.518  1.00 1.79 ? 5  VAL A HG23 2  
ATOM   543   N N    . CYS A 1 6  ? -1.455  6.452   13.459  1.00 1.16 ? 6  CYS A N    2  
ATOM   544   C CA   . CYS A 1 6  ? -0.969  6.063   12.101  1.00 1.20 ? 6  CYS A CA   2  
ATOM   545   C C    . CYS A 1 6  ? -1.762  6.802   11.015  1.00 1.07 ? 6  CYS A C    2  
ATOM   546   O O    . CYS A 1 6  ? -2.962  6.989   11.122  1.00 1.02 ? 6  CYS A O    2  
ATOM   547   C CB   . CYS A 1 6  ? -1.189  4.549   12.009  1.00 1.36 ? 6  CYS A CB   2  
ATOM   548   S SG   . CYS A 1 6  ? -2.955  4.165   12.153  1.00 1.39 ? 6  CYS A SG   2  
ATOM   549   H H    . CYS A 1 6  ? -2.407  6.400   13.669  1.00 1.04 ? 6  CYS A H    2  
ATOM   550   H HA   . CYS A 1 6  ? 0.083   6.284   12.005  1.00 1.31 ? 6  CYS A HA   2  
ATOM   551   H HB2  . CYS A 1 6  ? -0.822  4.191   11.058  1.00 1.48 ? 6  CYS A HB2  2  
ATOM   552   H HB3  . CYS A 1 6  ? -0.650  4.060   12.807  1.00 1.45 ? 6  CYS A HB3  2  
ATOM   553   H HG   . CYS A 1 6  ? -3.211  4.287   13.070  1.00 1.71 ? 6  CYS A HG   2  
ATOM   554   N N    . VAL A 1 7  ? -1.093  7.224   9.974   1.00 1.10 ? 7  VAL A N    2  
ATOM   555   C CA   . VAL A 1 7  ? -1.781  7.956   8.870   1.00 1.09 ? 7  VAL A CA   2  
ATOM   556   C C    . VAL A 1 7  ? -1.424  7.319   7.520   1.00 1.15 ? 7  VAL A C    2  
ATOM   557   O O    . VAL A 1 7  ? -0.500  6.533   7.415   1.00 1.25 ? 7  VAL A O    2  
ATOM   558   C CB   . VAL A 1 7  ? -1.244  9.393   8.937   1.00 1.09 ? 7  VAL A CB   2  
ATOM   559   C CG1  . VAL A 1 7  ? -2.094  10.302  8.048   1.00 1.20 ? 7  VAL A CG1  2  
ATOM   560   C CG2  . VAL A 1 7  ? -1.301  9.906   10.380  1.00 1.15 ? 7  VAL A CG2  2  
ATOM   561   H H    . VAL A 1 7  ? -0.134  7.064   9.917   1.00 1.17 ? 7  VAL A H    2  
ATOM   562   H HA   . VAL A 1 7  ? -2.848  7.951   9.020   1.00 1.14 ? 7  VAL A HA   2  
ATOM   563   H HB   . VAL A 1 7  ? -0.222  9.407   8.588   1.00 1.06 ? 7  VAL A HB   2  
ATOM   564   H HG11 . VAL A 1 7  ? -3.134  10.022  8.133   1.00 1.78 ? 7  VAL A HG11 2  
ATOM   565   H HG12 . VAL A 1 7  ? -1.972  11.328  8.362   1.00 1.20 ? 7  VAL A HG12 2  
ATOM   566   H HG13 . VAL A 1 7  ? -1.777  10.199  7.021   1.00 1.56 ? 7  VAL A HG13 2  
ATOM   567   H HG21 . VAL A 1 7  ? -2.229  9.595   10.836  1.00 1.65 ? 7  VAL A HG21 2  
ATOM   568   H HG22 . VAL A 1 7  ? -0.471  9.501   10.940  1.00 1.71 ? 7  VAL A HG22 2  
ATOM   569   H HG23 . VAL A 1 7  ? -1.244  10.985  10.381  1.00 1.18 ? 7  VAL A HG23 2  
HETATM 570   N N    . SEP A 1 8  ? -2.149  7.668   6.491   1.00 1.17 ? 8  SEP A N    2  
HETATM 571   C CA   . SEP A 1 8  ? -1.866  7.103   5.131   1.00 1.28 ? 8  SEP A CA   2  
HETATM 572   C CB   . SEP A 1 8  ? -2.828  7.826   4.188   1.00 1.44 ? 8  SEP A CB   2  
HETATM 573   O OG   . SEP A 1 8  ? -4.164  7.368   4.429   1.00 1.71 ? 8  SEP A OG   2  
HETATM 574   C C    . SEP A 1 8  ? -0.417  7.385   4.726   1.00 1.13 ? 8  SEP A C    2  
HETATM 575   O O    . SEP A 1 8  ? 0.263   6.524   4.203   1.00 1.19 ? 8  SEP A O    2  
HETATM 576   P P    . SEP A 1 8  ? -5.360  8.422   4.654   1.00 1.88 ? 8  SEP A P    2  
HETATM 577   O O1P  . SEP A 1 8  ? -5.108  9.142   5.922   1.00 1.90 ? 8  SEP A O1P  2  
HETATM 578   O O2P  . SEP A 1 8  ? -5.549  9.182   3.399   1.00 2.27 ? 8  SEP A O2P  2  
HETATM 579   O O3P  . SEP A 1 8  ? -6.637  7.465   4.864   1.00 2.08 ? 8  SEP A O3P  2  
HETATM 580   H H    . SEP A 1 8  ? -2.876  8.308   6.612   1.00 1.15 ? 8  SEP A H    2  
HETATM 581   H HA   . SEP A 1 8  ? -2.060  6.046   5.116   1.00 1.41 ? 8  SEP A HA   2  
HETATM 582   H HB2  . SEP A 1 8  ? -2.546  7.622   3.166   1.00 1.42 ? 8  SEP A HB2  2  
HETATM 583   H HB3  . SEP A 1 8  ? -2.779  8.888   4.366   1.00 1.45 ? 8  SEP A HB3  2  
HETATM 584   H HOP3 . SEP A 1 8  ? -6.460  6.921   5.634   1.00 2.24 ? 8  SEP A HOP3 2  
ATOM   585   N N    . SER A 1 9  ? 0.049   8.588   4.979   1.00 0.99 ? 9  SER A N    2  
ATOM   586   C CA   . SER A 1 9  ? 1.455   8.982   4.637   1.00 0.87 ? 9  SER A CA   2  
ATOM   587   C C    . SER A 1 9  ? 1.681   8.971   3.123   1.00 0.81 ? 9  SER A C    2  
ATOM   588   O O    . SER A 1 9  ? 1.537   7.958   2.476   1.00 0.81 ? 9  SER A O    2  
ATOM   589   C CB   . SER A 1 9  ? 2.362   7.954   5.312   1.00 0.88 ? 9  SER A CB   2  
ATOM   590   O OG   . SER A 1 9  ? 2.045   7.874   6.700   1.00 1.03 ? 9  SER A OG   2  
ATOM   591   H H    . SER A 1 9  ? -0.535  9.241   5.408   1.00 0.99 ? 9  SER A H    2  
ATOM   592   H HA   . SER A 1 9  ? 1.668   9.962   5.033   1.00 0.89 ? 9  SER A HA   2  
ATOM   593   H HB2  . SER A 1 9  ? 2.217   6.990   4.854   1.00 0.94 ? 9  SER A HB2  2  
ATOM   594   H HB3  . SER A 1 9  ? 3.393   8.256   5.183   1.00 0.82 ? 9  SER A HB3  2  
ATOM   595   H HG   . SER A 1 9  ? 1.374   7.193   6.814   1.00 1.26 ? 9  SER A HG   2  
ATOM   596   N N    . TYR A 1 10 ? 2.061   10.099  2.570   1.00 0.80 ? 10 TYR A N    2  
ATOM   597   C CA   . TYR A 1 10 ? 2.336   10.201  1.100   1.00 0.78 ? 10 TYR A CA   2  
ATOM   598   C C    . TYR A 1 10 ? 1.137   9.700   0.254   1.00 0.78 ? 10 TYR A C    2  
ATOM   599   O O    . TYR A 1 10 ? 0.143   9.225   0.773   1.00 0.87 ? 10 TYR A O    2  
ATOM   600   C CB   . TYR A 1 10 ? 3.634   9.379   0.912   1.00 0.69 ? 10 TYR A CB   2  
ATOM   601   C CG   . TYR A 1 10 ? 3.447   8.199   -0.009  1.00 0.57 ? 10 TYR A CG   2  
ATOM   602   C CD1  . TYR A 1 10 ? 3.627   8.362   -1.382  1.00 0.54 ? 10 TYR A CD1  2  
ATOM   603   C CD2  . TYR A 1 10 ? 3.115   6.945   0.512   1.00 0.57 ? 10 TYR A CD2  2  
ATOM   604   C CE1  . TYR A 1 10 ? 3.471   7.272   -2.242  1.00 0.50 ? 10 TYR A CE1  2  
ATOM   605   C CE2  . TYR A 1 10 ? 2.956   5.853   -0.345  1.00 0.56 ? 10 TYR A CE2  2  
ATOM   606   C CZ   . TYR A 1 10 ? 3.134   6.016   -1.724  1.00 0.51 ? 10 TYR A CZ   2  
ATOM   607   O OH   . TYR A 1 10 ? 2.972   4.940   -2.572  1.00 0.57 ? 10 TYR A OH   2  
ATOM   608   H H    . TYR A 1 10 ? 2.185   10.884  3.133   1.00 0.83 ? 10 TYR A H    2  
ATOM   609   H HA   . TYR A 1 10 ? 2.537   11.229  0.848   1.00 0.86 ? 10 TYR A HA   2  
ATOM   610   H HB2  . TYR A 1 10 ? 4.395   10.019  0.499   1.00 0.74 ? 10 TYR A HB2  2  
ATOM   611   H HB3  . TYR A 1 10 ? 3.963   9.021   1.876   1.00 0.72 ? 10 TYR A HB3  2  
ATOM   612   H HD1  . TYR A 1 10 ? 3.883   9.334   -1.776  1.00 0.61 ? 10 TYR A HD1  2  
ATOM   613   H HD2  . TYR A 1 10 ? 2.979   6.822   1.580   1.00 0.64 ? 10 TYR A HD2  2  
ATOM   614   H HE1  . TYR A 1 10 ? 3.613   7.400   -3.303  1.00 0.52 ? 10 TYR A HE1  2  
ATOM   615   H HE2  . TYR A 1 10 ? 2.696   4.886   0.055   1.00 0.64 ? 10 TYR A HE2  2  
ATOM   616   H HH   . TYR A 1 10 ? 2.177   4.470   -2.307  1.00 0.82 ? 10 TYR A HH   2  
ATOM   617   N N    . ARG A 1 11 ? 1.211   9.848   -1.045  1.00 0.73 ? 11 ARG A N    2  
ATOM   618   C CA   . ARG A 1 11 ? 0.080   9.413   -1.927  1.00 0.76 ? 11 ARG A CA   2  
ATOM   619   C C    . ARG A 1 11 ? 0.197   7.914   -2.251  1.00 0.66 ? 11 ARG A C    2  
ATOM   620   O O    . ARG A 1 11 ? 0.509   7.115   -1.391  1.00 0.66 ? 11 ARG A O    2  
ATOM   621   C CB   . ARG A 1 11 ? 0.220   10.282  -3.186  1.00 0.77 ? 11 ARG A CB   2  
ATOM   622   C CG   . ARG A 1 11 ? 0.032   11.760  -2.822  1.00 1.00 ? 11 ARG A CG   2  
ATOM   623   C CD   . ARG A 1 11 ? -1.409  12.002  -2.357  1.00 1.15 ? 11 ARG A CD   2  
ATOM   624   N NE   . ARG A 1 11 ? -1.336  12.050  -0.865  1.00 1.25 ? 11 ARG A NE   2  
ATOM   625   C CZ   . ARG A 1 11 ? -2.343  11.641  -0.148  1.00 1.37 ? 11 ARG A CZ   2  
ATOM   626   N NH1  . ARG A 1 11 ? -3.450  12.330  -0.129  1.00 1.63 ? 11 ARG A NH1  2  
ATOM   627   N NH2  . ARG A 1 11 ? -2.242  10.547  0.554   1.00 1.29 ? 11 ARG A NH2  2  
ATOM   628   H H    . ARG A 1 11 ? 2.004   10.262  -1.442  1.00 0.71 ? 11 ARG A H    2  
ATOM   629   H HA   . ARG A 1 11 ? -0.862  9.612   -1.453  1.00 0.89 ? 11 ARG A HA   2  
ATOM   630   H HB2  . ARG A 1 11 ? 1.202   10.138  -3.613  1.00 0.74 ? 11 ARG A HB2  2  
ATOM   631   H HB3  . ARG A 1 11 ? -0.529  9.996   -3.905  1.00 0.75 ? 11 ARG A HB3  2  
ATOM   632   H HG2  . ARG A 1 11 ? 0.718   12.025  -2.030  1.00 1.06 ? 11 ARG A HG2  2  
ATOM   633   H HG3  . ARG A 1 11 ? 0.234   12.371  -3.689  1.00 1.06 ? 11 ARG A HG3  2  
ATOM   634   H HD2  . ARG A 1 11 ? -1.774  12.943  -2.748  1.00 1.31 ? 11 ARG A HD2  2  
ATOM   635   H HD3  . ARG A 1 11 ? -2.047  11.191  -2.672  1.00 1.10 ? 11 ARG A HD3  2  
ATOM   636   H HE   . ARG A 1 11 ? -0.530  12.390  -0.424  1.00 1.29 ? 11 ARG A HE   2  
ATOM   637   H HH11 . ARG A 1 11 ? -3.522  13.171  -0.666  1.00 1.73 ? 11 ARG A HH11 2  
ATOM   638   H HH12 . ARG A 1 11 ? -4.224  12.020  0.420   1.00 1.76 ? 11 ARG A HH12 2  
ATOM   639   H HH21 . ARG A 1 11 ? -1.389  10.021  0.543   1.00 1.14 ? 11 ARG A HH21 2  
ATOM   640   H HH22 . ARG A 1 11 ? -3.015  10.231  1.102   1.00 1.44 ? 11 ARG A HH22 2  
ATOM   641   N N    . GLY A 1 12 ? -0.041  7.524   -3.481  1.00 0.63 ? 12 GLY A N    2  
ATOM   642   C CA   . GLY A 1 12 ? 0.077   6.080   -3.852  1.00 0.64 ? 12 GLY A CA   2  
ATOM   643   C C    . GLY A 1 12 ? 1.165   5.938   -4.917  1.00 0.56 ? 12 GLY A C    2  
ATOM   644   O O    . GLY A 1 12 ? 1.216   4.967   -5.649  1.00 0.64 ? 12 GLY A O    2  
ATOM   645   H H    . GLY A 1 12 ? -0.282  8.180   -4.167  1.00 0.65 ? 12 GLY A H    2  
ATOM   646   H HA2  . GLY A 1 12 ? 0.343   5.501   -2.980  1.00 0.68 ? 12 GLY A HA2  2  
ATOM   647   H HA3  . GLY A 1 12 ? -0.861  5.730   -4.251  1.00 0.73 ? 12 GLY A HA3  2  
ATOM   648   N N    . ARG A 1 13 ? 2.030   6.916   -5.009  1.00 0.51 ? 13 ARG A N    2  
ATOM   649   C CA   . ARG A 1 13 ? 3.116   6.884   -6.023  1.00 0.55 ? 13 ARG A CA   2  
ATOM   650   C C    . ARG A 1 13 ? 4.488   6.740   -5.344  1.00 0.54 ? 13 ARG A C    2  
ATOM   651   O O    . ARG A 1 13 ? 5.319   7.630   -5.391  1.00 0.61 ? 13 ARG A O    2  
ATOM   652   C CB   . ARG A 1 13 ? 2.979   8.224   -6.762  1.00 0.68 ? 13 ARG A CB   2  
ATOM   653   C CG   . ARG A 1 13 ? 3.090   9.401   -5.779  1.00 0.75 ? 13 ARG A CG   2  
ATOM   654   C CD   . ARG A 1 13 ? 3.364   10.696  -6.552  1.00 0.96 ? 13 ARG A CD   2  
ATOM   655   N NE   . ARG A 1 13 ? 4.770   10.571  -7.039  1.00 1.04 ? 13 ARG A NE   2  
ATOM   656   C CZ   . ARG A 1 13 ? 5.764   10.921  -6.271  1.00 1.13 ? 13 ARG A CZ   2  
ATOM   657   N NH1  . ARG A 1 13 ? 6.199   12.148  -6.290  1.00 1.38 ? 13 ARG A NH1  2  
ATOM   658   N NH2  . ARG A 1 13 ? 6.317   10.043  -5.488  1.00 1.00 ? 13 ARG A NH2  2  
ATOM   659   H H    . ARG A 1 13 ? 1.953   7.685   -4.410  1.00 0.53 ? 13 ARG A H    2  
ATOM   660   H HA   . ARG A 1 13 ? 2.956   6.071   -6.709  1.00 0.59 ? 13 ARG A HA   2  
ATOM   661   H HB2  . ARG A 1 13 ? 3.754   8.302   -7.499  1.00 0.78 ? 13 ARG A HB2  2  
ATOM   662   H HB3  . ARG A 1 13 ? 2.016   8.262   -7.249  1.00 0.70 ? 13 ARG A HB3  2  
ATOM   663   H HG2  . ARG A 1 13 ? 2.163   9.501   -5.233  1.00 0.77 ? 13 ARG A HG2  2  
ATOM   664   H HG3  . ARG A 1 13 ? 3.897   9.222   -5.087  1.00 0.73 ? 13 ARG A HG3  2  
ATOM   665   H HD2  . ARG A 1 13 ? 2.681   10.785  -7.387  1.00 0.99 ? 13 ARG A HD2  2  
ATOM   666   H HD3  . ARG A 1 13 ? 3.272   11.551  -5.899  1.00 1.07 ? 13 ARG A HD3  2  
ATOM   667   H HE   . ARG A 1 13 ? 4.948   10.227  -7.938  1.00 1.10 ? 13 ARG A HE   2  
ATOM   668   H HH11 . ARG A 1 13 ? 5.771   12.820  -6.892  1.00 1.50 ? 13 ARG A HH11 2  
ATOM   669   H HH12 . ARG A 1 13 ? 6.965   12.419  -5.698  1.00 1.47 ? 13 ARG A HH12 2  
ATOM   670   H HH21 . ARG A 1 13 ? 5.978   9.099   -5.475  1.00 0.85 ? 13 ARG A HH21 2  
ATOM   671   H HH22 . ARG A 1 13 ? 7.088   10.307  -4.899  1.00 1.09 ? 13 ARG A HH22 2  
ATOM   672   N N    . LYS A 1 14 ? 4.724   5.618   -4.708  1.00 0.51 ? 14 LYS A N    2  
ATOM   673   C CA   . LYS A 1 14 ? 6.034   5.390   -4.009  1.00 0.52 ? 14 LYS A CA   2  
ATOM   674   C C    . LYS A 1 14 ? 7.180   5.174   -5.015  1.00 0.61 ? 14 LYS A C    2  
ATOM   675   O O    . LYS A 1 14 ? 7.841   4.151   -5.015  1.00 0.69 ? 14 LYS A O    2  
ATOM   676   C CB   . LYS A 1 14 ? 5.846   4.144   -3.108  1.00 0.57 ? 14 LYS A CB   2  
ATOM   677   C CG   . LYS A 1 14 ? 4.960   3.058   -3.761  1.00 0.64 ? 14 LYS A CG   2  
ATOM   678   C CD   . LYS A 1 14 ? 5.453   2.724   -5.173  1.00 0.75 ? 14 LYS A CD   2  
ATOM   679   C CE   . LYS A 1 14 ? 4.605   1.589   -5.756  1.00 1.04 ? 14 LYS A CE   2  
ATOM   680   N NZ   . LYS A 1 14 ? 3.433   2.261   -6.393  1.00 1.51 ? 14 LYS A NZ   2  
ATOM   681   H H    . LYS A 1 14 ? 4.034   4.930   -4.684  1.00 0.53 ? 14 LYS A H    2  
ATOM   682   H HA   . LYS A 1 14 ? 6.261   6.243   -3.388  1.00 0.52 ? 14 LYS A HA   2  
ATOM   683   H HB2  . LYS A 1 14 ? 6.811   3.720   -2.894  1.00 0.63 ? 14 LYS A HB2  2  
ATOM   684   H HB3  . LYS A 1 14 ? 5.389   4.455   -2.179  1.00 0.58 ? 14 LYS A HB3  2  
ATOM   685   H HG2  . LYS A 1 14 ? 4.996   2.165   -3.154  1.00 0.75 ? 14 LYS A HG2  2  
ATOM   686   H HG3  . LYS A 1 14 ? 3.941   3.407   -3.810  1.00 0.65 ? 14 LYS A HG3  2  
ATOM   687   H HD2  . LYS A 1 14 ? 5.369   3.598   -5.802  1.00 0.73 ? 14 LYS A HD2  2  
ATOM   688   H HD3  . LYS A 1 14 ? 6.486   2.410   -5.128  1.00 0.85 ? 14 LYS A HD3  2  
ATOM   689   H HE2  . LYS A 1 14 ? 5.174   1.039   -6.495  1.00 1.58 ? 14 LYS A HE2  2  
ATOM   690   H HE3  . LYS A 1 14 ? 4.270   0.927   -4.971  1.00 1.29 ? 14 LYS A HE3  2  
ATOM   691   H HZ1  . LYS A 1 14 ? 2.954   2.866   -5.695  1.00 1.78 ? 14 LYS A HZ1  2  
ATOM   692   H HZ2  . LYS A 1 14 ? 3.758   2.844   -7.192  1.00 1.99 ? 14 LYS A HZ2  2  
ATOM   693   H HZ3  . LYS A 1 14 ? 2.766   1.542   -6.739  1.00 1.73 ? 14 LYS A HZ3  2  
ATOM   694   N N    . SER A 1 15 ? 7.430   6.139   -5.862  1.00 0.68 ? 15 SER A N    2  
ATOM   695   C CA   . SER A 1 15 ? 8.536   6.007   -6.861  1.00 0.84 ? 15 SER A CA   2  
ATOM   696   C C    . SER A 1 15 ? 9.694   6.943   -6.491  1.00 0.87 ? 15 SER A C    2  
ATOM   697   O O    . SER A 1 15 ? 9.692   8.111   -6.831  1.00 1.08 ? 15 SER A O    2  
ATOM   698   C CB   . SER A 1 15 ? 7.916   6.413   -8.198  1.00 0.96 ? 15 SER A CB   2  
ATOM   699   O OG   . SER A 1 15 ? 8.781   6.016   -9.255  1.00 1.21 ? 15 SER A OG   2  
ATOM   700   H H    . SER A 1 15 ? 6.892   6.960   -5.834  1.00 0.68 ? 15 SER A H    2  
ATOM   701   H HA   . SER A 1 15 ? 8.879   4.985   -6.910  1.00 0.91 ? 15 SER A HA   2  
ATOM   702   H HB2  . SER A 1 15 ? 6.963   5.927   -8.318  1.00 1.00 ? 15 SER A HB2  2  
ATOM   703   H HB3  . SER A 1 15 ? 7.775   7.486   -8.217  1.00 1.04 ? 15 SER A HB3  2  
ATOM   704   H HG   . SER A 1 15 ? 9.364   6.753   -9.458  1.00 1.44 ? 15 SER A HG   2  
ATOM   705   N N    . GLY A 1 16 ? 10.679  6.436   -5.792  1.00 0.82 ? 16 GLY A N    2  
ATOM   706   C CA   . GLY A 1 16 ? 11.839  7.290   -5.390  1.00 0.88 ? 16 GLY A CA   2  
ATOM   707   C C    . GLY A 1 16 ? 11.798  7.524   -3.878  1.00 0.79 ? 16 GLY A C    2  
ATOM   708   O O    . GLY A 1 16 ? 11.180  8.457   -3.403  1.00 0.84 ? 16 GLY A O    2  
ATOM   709   H H    . GLY A 1 16 ? 10.653  5.492   -5.526  1.00 0.88 ? 16 GLY A H    2  
ATOM   710   H HA2  . GLY A 1 16 ? 12.761  6.793   -5.655  1.00 0.97 ? 16 GLY A HA2  2  
ATOM   711   H HA3  . GLY A 1 16 ? 11.783  8.240   -5.899  1.00 0.95 ? 16 GLY A HA3  2  
ATOM   712   N N    . ASN A 1 17 ? 12.448  6.678   -3.120  1.00 0.75 ? 17 ASN A N    2  
ATOM   713   C CA   . ASN A 1 17 ? 12.448  6.842   -1.635  1.00 0.69 ? 17 ASN A CA   2  
ATOM   714   C C    . ASN A 1 17 ? 13.626  6.080   -1.010  1.00 0.65 ? 17 ASN A C    2  
ATOM   715   O O    . ASN A 1 17 ? 14.465  5.536   -1.705  1.00 0.71 ? 17 ASN A O    2  
ATOM   716   C CB   . ASN A 1 17 ? 11.115  6.244   -1.179  1.00 0.70 ? 17 ASN A CB   2  
ATOM   717   C CG   . ASN A 1 17 ? 10.483  7.150   -0.121  1.00 0.77 ? 17 ASN A CG   2  
ATOM   718   O OD1  . ASN A 1 17 ? 10.808  7.058   1.045   1.00 0.83 ? 17 ASN A OD1  2  
ATOM   719   N ND2  . ASN A 1 17 ? 9.589   8.027   -0.479  1.00 1.03 ? 17 ASN A ND2  2  
ATOM   720   H H    . ASN A 1 17 ? 12.933  5.930   -3.526  1.00 0.80 ? 17 ASN A H    2  
ATOM   721   H HA   . ASN A 1 17 ? 12.493  7.886   -1.371  1.00 0.75 ? 17 ASN A HA   2  
ATOM   722   H HB2  . ASN A 1 17 ? 10.449  6.160   -2.025  1.00 0.76 ? 17 ASN A HB2  2  
ATOM   723   H HB3  . ASN A 1 17 ? 11.286  5.265   -0.758  1.00 0.71 ? 17 ASN A HB3  2  
ATOM   724   H HD21 . ASN A 1 17 ? 9.328   8.105   -1.421  1.00 1.22 ? 17 ASN A HD21 2  
ATOM   725   H HD22 . ASN A 1 17 ? 9.178   8.609   0.193   1.00 1.15 ? 17 ASN A HD22 2  
ATOM   726   N N    . LYS A 1 18 ? 13.690  6.037   0.299   1.00 0.65 ? 18 LYS A N    2  
ATOM   727   C CA   . LYS A 1 18 ? 14.805  5.311   0.981   1.00 0.65 ? 18 LYS A CA   2  
ATOM   728   C C    . LYS A 1 18 ? 14.695  3.798   0.723   1.00 0.69 ? 18 LYS A C    2  
ATOM   729   O O    . LYS A 1 18 ? 13.784  3.153   1.210   1.00 0.82 ? 18 LYS A O    2  
ATOM   730   C CB   . LYS A 1 18 ? 14.620  5.623   2.469   1.00 0.74 ? 18 LYS A CB   2  
ATOM   731   C CG   . LYS A 1 18 ? 15.984  5.679   3.154   1.00 0.80 ? 18 LYS A CG   2  
ATOM   732   C CD   . LYS A 1 18 ? 15.911  4.973   4.513   1.00 0.93 ? 18 LYS A CD   2  
ATOM   733   C CE   . LYS A 1 18 ? 16.681  3.649   4.450   1.00 0.94 ? 18 LYS A CE   2  
ATOM   734   N NZ   . LYS A 1 18 ? 15.710  2.645   3.914   1.00 1.07 ? 18 LYS A NZ   2  
ATOM   735   H H    . LYS A 1 18 ? 13.001  6.483   0.835   1.00 0.70 ? 18 LYS A H    2  
ATOM   736   H HA   . LYS A 1 18 ? 15.758  5.684   0.642   1.00 0.64 ? 18 LYS A HA   2  
ATOM   737   H HB2  . LYS A 1 18 ? 14.123  6.578   2.577   1.00 0.77 ? 18 LYS A HB2  2  
ATOM   738   H HB3  . LYS A 1 18 ? 14.017  4.853   2.927   1.00 0.83 ? 18 LYS A HB3  2  
ATOM   739   H HG2  . LYS A 1 18 ? 16.718  5.190   2.531   1.00 0.82 ? 18 LYS A HG2  2  
ATOM   740   H HG3  . LYS A 1 18 ? 16.266  6.711   3.301   1.00 0.88 ? 18 LYS A HG3  2  
ATOM   741   H HD2  . LYS A 1 18 ? 16.349  5.608   5.270   1.00 1.07 ? 18 LYS A HD2  2  
ATOM   742   H HD3  . LYS A 1 18 ? 14.880  4.777   4.763   1.00 1.05 ? 18 LYS A HD3  2  
ATOM   743   H HE2  . LYS A 1 18 ? 17.531  3.744   3.786   1.00 0.88 ? 18 LYS A HE2  2  
ATOM   744   H HE3  . LYS A 1 18 ? 17.007  3.359   5.437   1.00 1.16 ? 18 LYS A HE3  2  
ATOM   745   H HZ1  . LYS A 1 18 ? 14.868  3.127   3.542   1.00 1.19 ? 18 LYS A HZ1  2  
ATOM   746   H HZ2  . LYS A 1 18 ? 16.165  2.103   3.143   1.00 0.98 ? 18 LYS A HZ2  2  
ATOM   747   H HZ3  . LYS A 1 18 ? 15.428  1.995   4.674   1.00 1.36 ? 18 LYS A HZ3  2  
ATOM   748   N N    . PRO A 1 19 ? 15.633  3.282   -0.042  1.00 0.69 ? 19 PRO A N    2  
ATOM   749   C CA   . PRO A 1 19 ? 15.599  1.820   -0.348  1.00 0.78 ? 19 PRO A CA   2  
ATOM   750   C C    . PRO A 1 19 ? 15.932  0.988   0.901   1.00 0.85 ? 19 PRO A C    2  
ATOM   751   O O    . PRO A 1 19 ? 16.553  1.480   1.827   1.00 0.86 ? 19 PRO A O    2  
ATOM   752   C CB   . PRO A 1 19 ? 16.674  1.642   -1.418  1.00 0.79 ? 19 PRO A CB   2  
ATOM   753   C CG   . PRO A 1 19 ? 17.617  2.778   -1.207  1.00 0.73 ? 19 PRO A CG   2  
ATOM   754   C CD   . PRO A 1 19 ? 16.810  3.921   -0.655  1.00 0.65 ? 19 PRO A CD   2  
ATOM   755   H HA   . PRO A 1 19 ? 14.636  1.540   -0.744  1.00 0.85 ? 19 PRO A HA   2  
ATOM   756   H HB2  . PRO A 1 19 ? 17.183  0.697   -1.287  1.00 0.86 ? 19 PRO A HB2  2  
ATOM   757   H HB3  . PRO A 1 19 ? 16.239  1.703   -2.403  1.00 0.83 ? 19 PRO A HB3  2  
ATOM   758   H HG2  . PRO A 1 19 ? 18.387  2.491   -0.502  1.00 0.79 ? 19 PRO A HG2  2  
ATOM   759   H HG3  . PRO A 1 19 ? 18.064  3.069   -2.145  1.00 0.79 ? 19 PRO A HG3  2  
ATOM   760   H HD2  . PRO A 1 19 ? 17.382  4.459   0.089   1.00 0.69 ? 19 PRO A HD2  2  
ATOM   761   H HD3  . PRO A 1 19 ? 16.502  4.582   -1.448  1.00 0.67 ? 19 PRO A HD3  2  
ATOM   762   N N    . PRO A 1 20 ? 15.509  -0.256  0.881   1.00 0.96 ? 20 PRO A N    2  
ATOM   763   C CA   . PRO A 1 20 ? 15.794  -1.138  2.053   1.00 1.07 ? 20 PRO A CA   2  
ATOM   764   C C    . PRO A 1 20 ? 17.297  -1.444  2.153   1.00 1.04 ? 20 PRO A C    2  
ATOM   765   O O    . PRO A 1 20 ? 17.856  -1.480  3.232   1.00 1.25 ? 20 PRO A O    2  
ATOM   766   C CB   . PRO A 1 20 ? 14.991  -2.405  1.766   1.00 1.24 ? 20 PRO A CB   2  
ATOM   767   C CG   . PRO A 1 20 ? 14.830  -2.428  0.284   1.00 1.22 ? 20 PRO A CG   2  
ATOM   768   C CD   . PRO A 1 20 ? 14.782  -0.994  -0.167  1.00 1.11 ? 20 PRO A CD   2  
ATOM   769   H HA   . PRO A 1 20 ? 15.442  -0.679  2.964   1.00 1.13 ? 20 PRO A HA   2  
ATOM   770   H HB2  . PRO A 1 20 ? 15.535  -3.278  2.104   1.00 1.29 ? 20 PRO A HB2  2  
ATOM   771   H HB3  . PRO A 1 20 ? 14.024  -2.355  2.242   1.00 1.35 ? 20 PRO A HB3  2  
ATOM   772   H HG2  . PRO A 1 20 ? 15.672  -2.935  -0.170  1.00 1.22 ? 20 PRO A HG2  2  
ATOM   773   H HG3  . PRO A 1 20 ? 13.910  -2.924  0.019   1.00 1.37 ? 20 PRO A HG3  2  
ATOM   774   H HD2  . PRO A 1 20 ? 15.275  -0.883  -1.124  1.00 1.12 ? 20 PRO A HD2  2  
ATOM   775   H HD3  . PRO A 1 20 ? 13.761  -0.648  -0.223  1.00 1.21 ? 20 PRO A HD3  2  
ATOM   776   N N    . SER A 1 21 ? 17.953  -1.654  1.037   1.00 1.04 ? 21 SER A N    2  
ATOM   777   C CA   . SER A 1 21 ? 19.419  -1.948  1.061   1.00 1.06 ? 21 SER A CA   2  
ATOM   778   C C    . SER A 1 21 ? 20.186  -0.881  0.269   1.00 0.96 ? 21 SER A C    2  
ATOM   779   O O    . SER A 1 21 ? 19.620  -0.178  -0.548  1.00 0.97 ? 21 SER A O    2  
ATOM   780   C CB   . SER A 1 21 ? 19.561  -3.318  0.394   1.00 1.17 ? 21 SER A CB   2  
ATOM   781   O OG   . SER A 1 21 ? 20.941  -3.650  0.292   1.00 1.31 ? 21 SER A OG   2  
ATOM   782   H H    . SER A 1 21 ? 17.480  -1.612  0.179   1.00 1.18 ? 21 SER A H    2  
ATOM   783   H HA   . SER A 1 21 ? 19.780  -1.994  2.077   1.00 1.17 ? 21 SER A HA   2  
ATOM   784   H HB2  . SER A 1 21 ? 19.058  -4.062  0.988   1.00 1.26 ? 21 SER A HB2  2  
ATOM   785   H HB3  . SER A 1 21 ? 19.115  -3.284  -0.591  1.00 1.19 ? 21 SER A HB3  2  
ATOM   786   H HG   . SER A 1 21 ? 21.015  -4.606  0.227   1.00 1.48 ? 21 SER A HG   2  
ATOM   787   N N    . LYS A 1 22 ? 21.471  -0.759  0.497   1.00 1.06 ? 22 LYS A N    2  
ATOM   788   C CA   . LYS A 1 22 ? 22.272  0.263   -0.250  1.00 1.07 ? 22 LYS A CA   2  
ATOM   789   C C    . LYS A 1 22 ? 22.821  -0.334  -1.557  1.00 1.06 ? 22 LYS A C    2  
ATOM   790   O O    . LYS A 1 22 ? 23.988  -0.198  -1.876  1.00 1.22 ? 22 LYS A O    2  
ATOM   791   C CB   . LYS A 1 22 ? 23.412  0.650   0.701   1.00 1.30 ? 22 LYS A CB   2  
ATOM   792   C CG   . LYS A 1 22 ? 23.875  2.077   0.390   1.00 1.25 ? 22 LYS A CG   2  
ATOM   793   C CD   . LYS A 1 22 ? 24.449  2.721   1.657   1.00 1.33 ? 22 LYS A CD   2  
ATOM   794   C CE   . LYS A 1 22 ? 23.312  3.314   2.498   1.00 1.20 ? 22 LYS A CE   2  
ATOM   795   N NZ   . LYS A 1 22 ? 23.601  4.777   2.573   1.00 1.19 ? 22 LYS A NZ   2  
ATOM   796   H H    . LYS A 1 22 ? 21.908  -1.341  1.153   1.00 1.22 ? 22 LYS A H    2  
ATOM   797   H HA   . LYS A 1 22 ? 21.664  1.126   -0.466  1.00 1.00 ? 22 LYS A HA   2  
ATOM   798   H HB2  . LYS A 1 22 ? 23.061  0.598   1.722   1.00 1.43 ? 22 LYS A HB2  2  
ATOM   799   H HB3  . LYS A 1 22 ? 24.239  -0.032  0.569   1.00 1.47 ? 22 LYS A HB3  2  
ATOM   800   H HG2  . LYS A 1 22 ? 24.637  2.048   -0.376  1.00 1.43 ? 22 LYS A HG2  2  
ATOM   801   H HG3  . LYS A 1 22 ? 23.037  2.661   0.040   1.00 1.24 ? 22 LYS A HG3  2  
ATOM   802   H HD2  . LYS A 1 22 ? 24.971  1.972   2.234   1.00 1.77 ? 22 LYS A HD2  2  
ATOM   803   H HD3  . LYS A 1 22 ? 25.137  3.505   1.380   1.00 1.64 ? 22 LYS A HD3  2  
ATOM   804   H HE2  . LYS A 1 22 ? 22.359  3.140   2.015   1.00 1.59 ? 22 LYS A HE2  2  
ATOM   805   H HE3  . LYS A 1 22 ? 23.316  2.885   3.489   1.00 1.68 ? 22 LYS A HE3  2  
ATOM   806   H HZ1  . LYS A 1 22 ? 24.600  4.929   2.817   1.00 1.63 ? 22 LYS A HZ1  2  
ATOM   807   H HZ2  . LYS A 1 22 ? 23.397  5.219   1.653   1.00 1.71 ? 22 LYS A HZ2  2  
ATOM   808   H HZ3  . LYS A 1 22 ? 22.993  5.212   3.305   1.00 0.97 ? 22 LYS A HZ3  2  
ATOM   809   N N    . THR A 1 23 ? 21.977  -0.986  -2.318  1.00 0.94 ? 23 THR A N    2  
ATOM   810   C CA   . THR A 1 23 ? 22.427  -1.591  -3.613  1.00 1.03 ? 23 THR A CA   2  
ATOM   811   C C    . THR A 1 23 ? 21.882  -0.790  -4.811  1.00 0.98 ? 23 THR A C    2  
ATOM   812   O O    . THR A 1 23 ? 22.407  -0.870  -5.906  1.00 1.15 ? 23 THR A O    2  
ATOM   813   C CB   . THR A 1 23 ? 21.865  -3.023  -3.607  1.00 1.07 ? 23 THR A CB   2  
ATOM   814   O OG1  . THR A 1 23 ? 22.491  -3.779  -4.635  1.00 1.35 ? 23 THR A OG1  2  
ATOM   815   C CG2  . THR A 1 23 ? 20.350  -3.001  -3.840  1.00 1.19 ? 23 THR A CG2  2  
ATOM   816   H H    . THR A 1 23 ? 21.043  -1.072  -2.037  1.00 0.87 ? 23 THR A H    2  
ATOM   817   H HA   . THR A 1 23 ? 23.505  -1.626  -3.653  1.00 1.19 ? 23 THR A HA   2  
ATOM   818   H HB   . THR A 1 23 ? 22.069  -3.481  -2.651  1.00 1.07 ? 23 THR A HB   2  
ATOM   819   H HG1  . THR A 1 23 ? 22.317  -3.347  -5.476  1.00 1.67 ? 23 THR A HG1  2  
ATOM   820   H HG21 . THR A 1 23 ? 19.892  -2.282  -3.179  1.00 1.81 ? 23 THR A HG21 2  
ATOM   821   H HG22 . THR A 1 23 ? 20.147  -2.729  -4.866  1.00 1.60 ? 23 THR A HG22 2  
ATOM   822   H HG23 . THR A 1 23 ? 19.944  -3.982  -3.643  1.00 1.40 ? 23 THR A HG23 2  
ATOM   823   N N    . CYS A 1 24 ? 20.838  -0.019  -4.607  1.00 0.85 ? 24 CYS A N    2  
ATOM   824   C CA   . CYS A 1 24 ? 20.259  0.790   -5.720  1.00 0.87 ? 24 CYS A CA   2  
ATOM   825   C C    . CYS A 1 24 ? 19.767  2.137   -5.177  1.00 0.78 ? 24 CYS A C    2  
ATOM   826   O O    . CYS A 1 24 ? 19.066  2.191   -4.182  1.00 0.74 ? 24 CYS A O    2  
ATOM   827   C CB   . CYS A 1 24 ? 19.087  -0.041  -6.249  1.00 0.97 ? 24 CYS A CB   2  
ATOM   828   S SG   . CYS A 1 24 ? 18.522  0.647   -7.825  1.00 1.36 ? 24 CYS A SG   2  
ATOM   829   H H    . CYS A 1 24 ? 20.434  0.030   -3.719  1.00 0.82 ? 24 CYS A H    2  
ATOM   830   H HA   . CYS A 1 24 ? 20.989  0.940   -6.498  1.00 0.97 ? 24 CYS A HA   2  
ATOM   831   H HB2  . CYS A 1 24 ? 19.409  -1.062  -6.396  1.00 1.15 ? 24 CYS A HB2  2  
ATOM   832   H HB3  . CYS A 1 24 ? 18.277  -0.018  -5.535  1.00 1.01 ? 24 CYS A HB3  2  
ATOM   833   H HG   . CYS A 1 24 ? 17.816  0.086   -8.157  1.00 1.88 ? 24 CYS A HG   2  
ATOM   834   N N    . LEU A 1 25 ? 20.137  3.221   -5.822  1.00 0.83 ? 25 LEU A N    2  
ATOM   835   C CA   . LEU A 1 25 ? 19.709  4.584   -5.358  1.00 0.82 ? 25 LEU A CA   2  
ATOM   836   C C    . LEU A 1 25 ? 20.182  4.845   -3.917  1.00 0.72 ? 25 LEU A C    2  
ATOM   837   O O    . LEU A 1 25 ? 20.925  4.069   -3.344  1.00 0.77 ? 25 LEU A O    2  
ATOM   838   C CB   . LEU A 1 25 ? 18.177  4.585   -5.447  1.00 0.88 ? 25 LEU A CB   2  
ATOM   839   C CG   . LEU A 1 25 ? 17.746  5.017   -6.851  1.00 1.10 ? 25 LEU A CG   2  
ATOM   840   C CD1  . LEU A 1 25 ? 16.432  4.325   -7.217  1.00 1.40 ? 25 LEU A CD1  2  
ATOM   841   C CD2  . LEU A 1 25 ? 17.546  6.533   -6.881  1.00 1.23 ? 25 LEU A CD2  2  
ATOM   842   H H    . LEU A 1 25 ? 20.703  3.140   -6.615  1.00 0.94 ? 25 LEU A H    2  
ATOM   843   H HA   . LEU A 1 25 ? 20.110  5.339   -6.016  1.00 0.96 ? 25 LEU A HA   2  
ATOM   844   H HB2  . LEU A 1 25 ? 17.803  3.593   -5.244  1.00 0.91 ? 25 LEU A HB2  2  
ATOM   845   H HB3  . LEU A 1 25 ? 17.774  5.276   -4.722  1.00 0.87 ? 25 LEU A HB3  2  
ATOM   846   H HG   . LEU A 1 25 ? 18.509  4.737   -7.564  1.00 1.20 ? 25 LEU A HG   2  
ATOM   847   H HD11 . LEU A 1 25 ? 16.522  3.264   -7.039  1.00 1.89 ? 25 LEU A HD11 2  
ATOM   848   H HD12 . LEU A 1 25 ? 15.633  4.726   -6.611  1.00 1.76 ? 25 LEU A HD12 2  
ATOM   849   H HD13 . LEU A 1 25 ? 16.214  4.498   -8.261  1.00 1.73 ? 25 LEU A HD13 2  
ATOM   850   H HD21 . LEU A 1 25 ? 16.969  6.838   -6.020  1.00 1.48 ? 25 LEU A HD21 2  
ATOM   851   H HD22 . LEU A 1 25 ? 18.509  7.024   -6.861  1.00 1.68 ? 25 LEU A HD22 2  
ATOM   852   H HD23 . LEU A 1 25 ? 17.020  6.809   -7.783  1.00 1.65 ? 25 LEU A HD23 2  
ATOM   853   N N    . LYS A 1 26 ? 19.765  5.940   -3.334  1.00 0.68 ? 26 LYS A N    2  
ATOM   854   C CA   . LYS A 1 26 ? 20.193  6.263   -1.939  1.00 0.71 ? 26 LYS A CA   2  
ATOM   855   C C    . LYS A 1 26 ? 18.972  6.618   -1.079  1.00 0.61 ? 26 LYS A C    2  
ATOM   856   O O    . LYS A 1 26 ? 17.841  6.512   -1.513  1.00 0.54 ? 26 LYS A O    2  
ATOM   857   C CB   . LYS A 1 26 ? 21.117  7.476   -2.083  1.00 0.92 ? 26 LYS A CB   2  
ATOM   858   C CG   . LYS A 1 26 ? 22.477  7.033   -2.634  1.00 1.12 ? 26 LYS A CG   2  
ATOM   859   C CD   . LYS A 1 26 ? 22.518  7.231   -4.155  1.00 1.27 ? 26 LYS A CD   2  
ATOM   860   C CE   . LYS A 1 26 ? 22.275  8.705   -4.500  1.00 1.40 ? 26 LYS A CE   2  
ATOM   861   N NZ   . LYS A 1 26 ? 21.100  8.701   -5.420  1.00 1.46 ? 26 LYS A NZ   2  
ATOM   862   H H    . LYS A 1 26 ? 19.175  6.559   -3.816  1.00 0.72 ? 26 LYS A H    2  
ATOM   863   H HA   . LYS A 1 26 ? 20.732  5.436   -1.505  1.00 0.75 ? 26 LYS A HA   2  
ATOM   864   H HB2  . LYS A 1 26 ? 20.668  8.191   -2.757  1.00 0.93 ? 26 LYS A HB2  2  
ATOM   865   H HB3  . LYS A 1 26 ? 21.257  7.936   -1.115  1.00 1.02 ? 26 LYS A HB3  2  
ATOM   866   H HG2  . LYS A 1 26 ? 23.259  7.621   -2.175  1.00 1.26 ? 26 LYS A HG2  2  
ATOM   867   H HG3  . LYS A 1 26 ? 22.634  5.989   -2.406  1.00 1.13 ? 26 LYS A HG3  2  
ATOM   868   H HD2  . LYS A 1 26 ? 23.487  6.930   -4.530  1.00 1.51 ? 26 LYS A HD2  2  
ATOM   869   H HD3  . LYS A 1 26 ? 21.753  6.625   -4.616  1.00 1.23 ? 26 LYS A HD3  2  
ATOM   870   H HE2  . LYS A 1 26 ? 22.053  9.270   -3.602  1.00 1.38 ? 26 LYS A HE2  2  
ATOM   871   H HE3  . LYS A 1 26 ? 23.135  9.121   -5.002  1.00 1.62 ? 26 LYS A HE3  2  
ATOM   872   H HZ1  . LYS A 1 26 ? 20.348  8.094   -5.027  1.00 1.59 ? 26 LYS A HZ1  2  
ATOM   873   H HZ2  . LYS A 1 26 ? 20.734  9.672   -5.522  1.00 1.61 ? 26 LYS A HZ2  2  
ATOM   874   H HZ3  . LYS A 1 26 ? 21.385  8.337   -6.350  1.00 1.79 ? 26 LYS A HZ3  2  
ATOM   875   N N    . GLU A 1 27 ? 19.201  7.037   0.138   1.00 0.70 ? 27 GLU A N    2  
ATOM   876   C CA   . GLU A 1 27 ? 18.070  7.406   1.047   1.00 0.73 ? 27 GLU A CA   2  
ATOM   877   C C    . GLU A 1 27 ? 17.456  8.749   0.618   1.00 0.70 ? 27 GLU A C    2  
ATOM   878   O O    . GLU A 1 27 ? 17.510  9.732   1.337   1.00 0.87 ? 27 GLU A O    2  
ATOM   879   C CB   . GLU A 1 27 ? 18.708  7.507   2.438   1.00 0.92 ? 27 GLU A CB   2  
ATOM   880   C CG   . GLU A 1 27 ? 19.242  6.130   2.862   1.00 0.97 ? 27 GLU A CG   2  
ATOM   881   C CD   . GLU A 1 27 ? 20.772  6.108   2.777   1.00 1.03 ? 27 GLU A CD   2  
ATOM   882   O OE1  . GLU A 1 27 ? 21.294  6.215   1.678   1.00 1.07 ? 27 GLU A OE1  2  
ATOM   883   O OE2  . GLU A 1 27 ? 21.402  5.971   3.814   1.00 1.24 ? 27 GLU A OE2  2  
ATOM   884   H H    . GLU A 1 27 ? 20.124  7.109   0.461   1.00 0.80 ? 27 GLU A H    2  
ATOM   885   H HA   . GLU A 1 27 ? 17.319  6.632   1.044   1.00 0.72 ? 27 GLU A HA   2  
ATOM   886   H HB2  . GLU A 1 27 ? 19.523  8.218   2.410   1.00 0.99 ? 27 GLU A HB2  2  
ATOM   887   H HB3  . GLU A 1 27 ? 17.969  7.838   3.152   1.00 1.02 ? 27 GLU A HB3  2  
ATOM   888   H HG2  . GLU A 1 27 ? 18.939  5.926   3.874   1.00 1.09 ? 27 GLU A HG2  2  
ATOM   889   H HG3  . GLU A 1 27 ? 18.839  5.372   2.206   1.00 0.92 ? 27 GLU A HG3  2  
ATOM   890   N N    . GLU A 1 28 ? 16.880  8.792   -0.558  1.00 0.56 ? 28 GLU A N    2  
ATOM   891   C CA   . GLU A 1 28 ? 16.266  10.058  -1.064  1.00 0.57 ? 28 GLU A CA   2  
ATOM   892   C C    . GLU A 1 28 ? 14.737  10.004  -0.931  1.00 0.58 ? 28 GLU A C    2  
ATOM   893   O O    . GLU A 1 28 ? 14.183  9.062   -0.392  1.00 0.84 ? 28 GLU A O    2  
ATOM   894   C CB   . GLU A 1 28 ? 16.672  10.126  -2.542  1.00 0.58 ? 28 GLU A CB   2  
ATOM   895   C CG   . GLU A 1 28 ? 18.184  9.908   -2.680  1.00 0.75 ? 28 GLU A CG   2  
ATOM   896   C CD   . GLU A 1 28 ? 18.510  9.427   -4.093  1.00 0.94 ? 28 GLU A CD   2  
ATOM   897   O OE1  . GLU A 1 28 ? 18.703  10.267  -4.956  1.00 1.17 ? 28 GLU A OE1  2  
ATOM   898   O OE2  . GLU A 1 28 ? 18.579  8.224   -4.288  1.00 1.57 ? 28 GLU A OE2  2  
ATOM   899   H H    . GLU A 1 28 ? 16.860  7.988   -1.117  1.00 0.52 ? 28 GLU A H    2  
ATOM   900   H HA   . GLU A 1 28 ? 16.661  10.910  -0.534  1.00 0.72 ? 28 GLU A HA   2  
ATOM   901   H HB2  . GLU A 1 28 ? 16.146  9.359   -3.093  1.00 0.56 ? 28 GLU A HB2  2  
ATOM   902   H HB3  . GLU A 1 28 ? 16.414  11.095  -2.941  1.00 0.66 ? 28 GLU A HB3  2  
ATOM   903   H HG2  . GLU A 1 28 ? 18.698  10.835  -2.487  1.00 0.85 ? 28 GLU A HG2  2  
ATOM   904   H HG3  . GLU A 1 28 ? 18.508  9.164   -1.968  1.00 0.79 ? 28 GLU A HG3  2  
ATOM   905   N N    . MET A 1 29 ? 14.053  11.008  -1.421  1.00 0.72 ? 29 MET A N    2  
ATOM   906   C CA   . MET A 1 29 ? 12.560  11.022  -1.330  1.00 0.92 ? 29 MET A CA   2  
ATOM   907   C C    . MET A 1 29 ? 11.963  11.806  -2.506  1.00 1.04 ? 29 MET A C    2  
ATOM   908   O O    . MET A 1 29 ? 12.238  12.979  -2.682  1.00 1.18 ? 29 MET A O    2  
ATOM   909   C CB   . MET A 1 29 ? 12.248  11.717  -0.001  1.00 1.15 ? 29 MET A CB   2  
ATOM   910   C CG   . MET A 1 29 ? 11.043  11.045  0.662   1.00 1.53 ? 29 MET A CG   2  
ATOM   911   S SD   . MET A 1 29 ? 9.600   12.132  0.536   1.00 2.25 ? 29 MET A SD   2  
ATOM   912   C CE   . MET A 1 29 ? 8.844   11.350  -0.911  1.00 3.42 ? 29 MET A CE   2  
ATOM   913   H H    . MET A 1 29 ? 14.521  11.755  -1.850  1.00 0.91 ? 29 MET A H    2  
ATOM   914   H HA   . MET A 1 29 ? 12.176  10.014  -1.317  1.00 0.90 ? 29 MET A HA   2  
ATOM   915   H HB2  . MET A 1 29 ? 13.105  11.645  0.653   1.00 1.25 ? 29 MET A HB2  2  
ATOM   916   H HB3  . MET A 1 29 ? 12.022  12.758  -0.183  1.00 1.22 ? 29 MET A HB3  2  
ATOM   917   H HG2  . MET A 1 29 ? 10.833  10.109  0.167   1.00 1.77 ? 29 MET A HG2  2  
ATOM   918   H HG3  . MET A 1 29 ? 11.262  10.859  1.702   1.00 1.66 ? 29 MET A HG3  2  
ATOM   919   H HE1  . MET A 1 29 ? 9.538   10.650  -1.347  1.00 3.87 ? 29 MET A HE1  2  
ATOM   920   H HE2  . MET A 1 29 ? 7.948   10.825  -0.608  1.00 3.78 ? 29 MET A HE2  2  
ATOM   921   H HE3  . MET A 1 29 ? 8.594   12.108  -1.640  1.00 3.85 ? 29 MET A HE3  2  
ATOM   922   N N    . ALA A 1 30 ? 11.153  11.166  -3.311  1.00 1.07 ? 30 ALA A N    2  
ATOM   923   C CA   . ALA A 1 30 ? 10.533  11.863  -4.479  1.00 1.27 ? 30 ALA A CA   2  
ATOM   924   C C    . ALA A 1 30 ? 9.002   11.755  -4.420  1.00 1.34 ? 30 ALA A C    2  
ATOM   925   O O    . ALA A 1 30 ? 8.509   10.694  -4.065  1.00 1.16 ? 30 ALA A O    2  
ATOM   926   C CB   . ALA A 1 30 ? 11.079  11.134  -5.708  1.00 1.31 ? 30 ALA A CB   2  
ATOM   927   O OXT  . ALA A 1 30 ? 8.345   12.734  -4.738  1.00 1.62 ? 30 ALA A OXT  2  
ATOM   928   H H    . ALA A 1 30 ? 10.950  10.218  -3.147  1.00 1.02 ? 30 ALA A H    2  
ATOM   929   H HA   . ALA A 1 30 ? 10.835  12.899  -4.503  1.00 1.39 ? 30 ALA A HA   2  
ATOM   930   H HB1  . ALA A 1 30 ? 12.155  11.082  -5.648  1.00 1.65 ? 30 ALA A HB1  2  
ATOM   931   H HB2  . ALA A 1 30 ? 10.671  10.134  -5.742  1.00 1.69 ? 30 ALA A HB2  2  
ATOM   932   H HB3  . ALA A 1 30 ? 10.793  11.671  -6.600  1.00 1.65 ? 30 ALA A HB3  2  
ATOM   933   N N    . MET A 1 1  ? -3.457  -6.777  14.722  1.00 3.88 ? 1  MET A N    3  
ATOM   934   C CA   . MET A 1 1  ? -3.983  -5.405  14.445  1.00 3.17 ? 1  MET A CA   3  
ATOM   935   C C    . MET A 1 1  ? -2.837  -4.470  14.030  1.00 2.71 ? 1  MET A C    3  
ATOM   936   O O    . MET A 1 1  ? -1.722  -4.601  14.497  1.00 3.17 ? 1  MET A O    3  
ATOM   937   C CB   . MET A 1 1  ? -4.610  -4.943  15.767  1.00 3.59 ? 1  MET A CB   3  
ATOM   938   C CG   . MET A 1 1  ? -5.230  -3.552  15.593  1.00 3.43 ? 1  MET A CG   3  
ATOM   939   S SD   . MET A 1 1  ? -6.478  -3.603  14.282  1.00 3.77 ? 1  MET A SD   3  
ATOM   940   C CE   . MET A 1 1  ? -6.304  -1.886  13.735  1.00 4.44 ? 1  MET A CE   3  
ATOM   941   H H1   . MET A 1 1  ? -2.675  -6.719  15.406  1.00 4.28 ? 1  MET A H1   3  
ATOM   942   H H2   . MET A 1 1  ? -4.218  -7.368  15.115  1.00 4.25 ? 1  MET A H2   3  
ATOM   943   H H3   . MET A 1 1  ? -3.109  -7.201  13.839  1.00 3.82 ? 1  MET A H3   3  
ATOM   944   H HA   . MET A 1 1  ? -4.737  -5.440  13.674  1.00 3.02 ? 1  MET A HA   3  
ATOM   945   H HB2  . MET A 1 1  ? -5.376  -5.643  16.065  1.00 4.20 ? 1  MET A HB2  3  
ATOM   946   H HB3  . MET A 1 1  ? -3.846  -4.898  16.531  1.00 3.71 ? 1  MET A HB3  3  
ATOM   947   H HG2  . MET A 1 1  ? -5.697  -3.249  16.519  1.00 3.94 ? 1  MET A HG2  3  
ATOM   948   H HG3  . MET A 1 1  ? -4.460  -2.843  15.330  1.00 2.98 ? 1  MET A HG3  3  
ATOM   949   H HE1  . MET A 1 1  ? -5.257  -1.620  13.713  1.00 4.58 ? 1  MET A HE1  3  
ATOM   950   H HE2  . MET A 1 1  ? -6.721  -1.777  12.747  1.00 4.85 ? 1  MET A HE2  3  
ATOM   951   H HE3  . MET A 1 1  ? -6.833  -1.237  14.420  1.00 4.77 ? 1  MET A HE3  3  
ATOM   952   N N    . ILE A 1 2  ? -3.109  -3.529  13.161  1.00 2.12 ? 2  ILE A N    3  
ATOM   953   C CA   . ILE A 1 2  ? -2.040  -2.581  12.716  1.00 2.00 ? 2  ILE A CA   3  
ATOM   954   C C    . ILE A 1 2  ? -1.965  -1.387  13.679  1.00 1.65 ? 2  ILE A C    3  
ATOM   955   O O    . ILE A 1 2  ? -2.961  -0.748  13.965  1.00 1.56 ? 2  ILE A O    3  
ATOM   956   C CB   . ILE A 1 2  ? -2.463  -2.125  11.312  1.00 2.21 ? 2  ILE A CB   3  
ATOM   957   C CG1  . ILE A 1 2  ? -2.449  -3.321  10.355  1.00 2.79 ? 2  ILE A CG1  3  
ATOM   958   C CG2  . ILE A 1 2  ? -1.489  -1.061  10.800  1.00 2.60 ? 2  ILE A CG2  3  
ATOM   959   C CD1  . ILE A 1 2  ? -3.849  -3.529  9.772   1.00 3.18 ? 2  ILE A CD1  3  
ATOM   960   H H    . ILE A 1 2  ? -4.018  -3.443  12.802  1.00 2.11 ? 2  ILE A H    3  
ATOM   961   H HA   . ILE A 1 2  ? -1.087  -3.085  12.667  1.00 2.50 ? 2  ILE A HA   3  
ATOM   962   H HB   . ILE A 1 2  ? -3.459  -1.706  11.356  1.00 2.16 ? 2  ILE A HB   3  
ATOM   963   H HG12 . ILE A 1 2  ? -1.750  -3.134  9.554   1.00 3.32 ? 2  ILE A HG12 3  
ATOM   964   H HG13 . ILE A 1 2  ? -2.151  -4.210  10.892  1.00 2.75 ? 2  ILE A HG13 3  
ATOM   965   H HG21 . ILE A 1 2  ? -0.474  -1.385  10.978  1.00 3.04 ? 2  ILE A HG21 3  
ATOM   966   H HG22 . ILE A 1 2  ? -1.640  -0.915  9.740   1.00 2.93 ? 2  ILE A HG22 3  
ATOM   967   H HG23 . ILE A 1 2  ? -1.665  -0.130  11.319  1.00 2.53 ? 2  ILE A HG23 3  
ATOM   968   H HD11 . ILE A 1 2  ? -4.558  -3.663  10.574  1.00 3.41 ? 2  ILE A HD11 3  
ATOM   969   H HD12 . ILE A 1 2  ? -4.126  -2.663  9.187   1.00 3.45 ? 2  ILE A HD12 3  
ATOM   970   H HD13 . ILE A 1 2  ? -3.849  -4.405  9.140   1.00 3.54 ? 2  ILE A HD13 3  
ATOM   971   N N    . SER A 1 3  ? -0.790  -1.088  14.179  1.00 1.90 ? 3  SER A N    3  
ATOM   972   C CA   . SER A 1 3  ? -0.641  0.064   15.129  1.00 1.82 ? 3  SER A CA   3  
ATOM   973   C C    . SER A 1 3  ? -1.091  1.372   14.466  1.00 1.44 ? 3  SER A C    3  
ATOM   974   O O    . SER A 1 3  ? -1.816  2.148   15.057  1.00 1.35 ? 3  SER A O    3  
ATOM   975   C CB   . SER A 1 3  ? 0.851   0.119   15.465  1.00 2.31 ? 3  SER A CB   3  
ATOM   976   O OG   . SER A 1 3  ? 1.045   0.953   16.600  1.00 2.62 ? 3  SER A OG   3  
ATOM   977   H H    . SER A 1 3  ? -0.006  -1.623  13.932  1.00 2.34 ? 3  SER A H    3  
ATOM   978   H HA   . SER A 1 3  ? -1.211  -0.116  16.027  1.00 1.94 ? 3  SER A HA   3  
ATOM   979   H HB2  . SER A 1 3  ? 1.209   -0.871  15.689  1.00 2.53 ? 3  SER A HB2  3  
ATOM   980   H HB3  . SER A 1 3  ? 1.397   0.514   14.617  1.00 2.39 ? 3  SER A HB3  3  
ATOM   981   H HG   . SER A 1 3  ? 0.962   1.869   16.318  1.00 2.72 ? 3  SER A HG   3  
ATOM   982   N N    . SER A 1 4  ? -0.665  1.614   13.244  1.00 1.40 ? 4  SER A N    3  
ATOM   983   C CA   . SER A 1 4  ? -1.052  2.866   12.512  1.00 1.17 ? 4  SER A CA   3  
ATOM   984   C C    . SER A 1 4  ? -0.501  4.105   13.227  1.00 1.22 ? 4  SER A C    3  
ATOM   985   O O    . SER A 1 4  ? -1.056  4.583   14.198  1.00 1.27 ? 4  SER A O    3  
ATOM   986   C CB   . SER A 1 4  ? -2.582  2.897   12.488  1.00 1.09 ? 4  SER A CB   3  
ATOM   987   O OG   . SER A 1 4  ? -3.083  1.624   12.094  1.00 1.24 ? 4  SER A OG   3  
ATOM   988   H H    . SER A 1 4  ? -0.081  0.963   12.801  1.00 1.66 ? 4  SER A H    3  
ATOM   989   H HA   . SER A 1 4  ? -0.678  2.831   11.501  1.00 1.33 ? 4  SER A HA   3  
ATOM   990   H HB2  . SER A 1 4  ? -2.950  3.139   13.469  1.00 1.15 ? 4  SER A HB2  3  
ATOM   991   H HB3  . SER A 1 4  ? -2.908  3.658   11.790  1.00 1.16 ? 4  SER A HB3  3  
ATOM   992   H HG   . SER A 1 4  ? -3.298  1.128   12.888  1.00 1.33 ? 4  SER A HG   3  
ATOM   993   N N    . VAL A 1 5  ? 0.589   4.625   12.741  1.00 1.43 ? 5  VAL A N    3  
ATOM   994   C CA   . VAL A 1 5  ? 1.202   5.838   13.372  1.00 1.68 ? 5  VAL A CA   3  
ATOM   995   C C    . VAL A 1 5  ? 0.532   7.124   12.857  1.00 1.64 ? 5  VAL A C    3  
ATOM   996   O O    . VAL A 1 5  ? 0.573   8.153   13.502  1.00 1.88 ? 5  VAL A O    3  
ATOM   997   C CB   . VAL A 1 5  ? 2.685   5.786   12.979  1.00 2.05 ? 5  VAL A CB   3  
ATOM   998   C CG1  . VAL A 1 5  ? 2.870   6.254   11.530  1.00 2.08 ? 5  VAL A CG1  3  
ATOM   999   C CG2  . VAL A 1 5  ? 3.492   6.694   13.910  1.00 2.43 ? 5  VAL A CG2  3  
ATOM   1000  H H    . VAL A 1 5  ? 1.005   4.217   11.957  1.00 1.52 ? 5  VAL A H    3  
ATOM   1001  H HA   . VAL A 1 5  ? 1.108   5.782   14.442  1.00 1.77 ? 5  VAL A HA   3  
ATOM   1002  H HB   . VAL A 1 5  ? 3.040   4.771   13.071  1.00 2.13 ? 5  VAL A HB   3  
ATOM   1003  H HG11 . VAL A 1 5  ? 2.135   5.777   10.900  1.00 2.12 ? 5  VAL A HG11 3  
ATOM   1004  H HG12 . VAL A 1 5  ? 2.748   7.325   11.479  1.00 2.52 ? 5  VAL A HG12 3  
ATOM   1005  H HG13 . VAL A 1 5  ? 3.860   5.989   11.191  1.00 2.17 ? 5  VAL A HG13 3  
ATOM   1006  H HG21 . VAL A 1 5  ? 3.076   7.690   13.891  1.00 2.38 ? 5  VAL A HG21 3  
ATOM   1007  H HG22 . VAL A 1 5  ? 3.451   6.305   14.917  1.00 2.91 ? 5  VAL A HG22 3  
ATOM   1008  H HG23 . VAL A 1 5  ? 4.520   6.728   13.578  1.00 2.82 ? 5  VAL A HG23 3  
ATOM   1009  N N    . CYS A 1 6  ? -0.082  7.066   11.704  1.00 1.46 ? 6  CYS A N    3  
ATOM   1010  C CA   . CYS A 1 6  ? -0.757  8.272   11.140  1.00 1.58 ? 6  CYS A CA   3  
ATOM   1011  C C    . CYS A 1 6  ? -1.922  7.851   10.231  1.00 1.49 ? 6  CYS A C    3  
ATOM   1012  O O    . CYS A 1 6  ? -2.370  6.720   10.265  1.00 1.37 ? 6  CYS A O    3  
ATOM   1013  C CB   . CYS A 1 6  ? 0.331   8.991   10.333  1.00 1.75 ? 6  CYS A CB   3  
ATOM   1014  S SG   . CYS A 1 6  ? 0.257   10.768  10.667  1.00 2.25 ? 6  CYS A SG   3  
ATOM   1015  H H    . CYS A 1 6  ? -0.099  6.223   11.209  1.00 1.34 ? 6  CYS A H    3  
ATOM   1016  H HA   . CYS A 1 6  ? -1.112  8.912   11.932  1.00 1.71 ? 6  CYS A HA   3  
ATOM   1017  H HB2  . CYS A 1 6  ? 1.301   8.611   10.619  1.00 1.80 ? 6  CYS A HB2  3  
ATOM   1018  H HB3  . CYS A 1 6  ? 0.174   8.815   9.278   1.00 1.68 ? 6  CYS A HB3  3  
ATOM   1019  H HG   . CYS A 1 6  ? 0.526   10.911  11.577  1.00 2.43 ? 6  CYS A HG   3  
ATOM   1020  N N    . VAL A 1 7  ? -2.408  8.753   9.418   1.00 1.66 ? 7  VAL A N    3  
ATOM   1021  C CA   . VAL A 1 7  ? -3.535  8.422   8.498   1.00 1.75 ? 7  VAL A CA   3  
ATOM   1022  C C    . VAL A 1 7  ? -2.976  7.832   7.191   1.00 1.69 ? 7  VAL A C    3  
ATOM   1023  O O    . VAL A 1 7  ? -2.067  7.024   7.213   1.00 1.56 ? 7  VAL A O    3  
ATOM   1024  C CB   . VAL A 1 7  ? -4.263  9.761   8.264   1.00 2.05 ? 7  VAL A CB   3  
ATOM   1025  C CG1  . VAL A 1 7  ? -4.763  10.317  9.600   1.00 2.18 ? 7  VAL A CG1  3  
ATOM   1026  C CG2  . VAL A 1 7  ? -3.312  10.779  7.618   1.00 2.14 ? 7  VAL A CG2  3  
ATOM   1027  H H    . VAL A 1 7  ? -2.028  9.651   9.408   1.00 1.78 ? 7  VAL A H    3  
ATOM   1028  H HA   . VAL A 1 7  ? -4.206  7.719   8.963   1.00 1.72 ? 7  VAL A HA   3  
ATOM   1029  H HB   . VAL A 1 7  ? -5.108  9.596   7.615   1.00 2.18 ? 7  VAL A HB   3  
ATOM   1030  H HG11 . VAL A 1 7  ? -5.255  9.532   10.155  1.00 2.36 ? 7  VAL A HG11 3  
ATOM   1031  H HG12 . VAL A 1 7  ? -3.927  10.691  10.170  1.00 2.25 ? 7  VAL A HG12 3  
ATOM   1032  H HG13 . VAL A 1 7  ? -5.463  11.120  9.416   1.00 2.62 ? 7  VAL A HG13 3  
ATOM   1033  H HG21 . VAL A 1 7  ? -2.381  10.295  7.366   1.00 1.97 ? 7  VAL A HG21 3  
ATOM   1034  H HG22 . VAL A 1 7  ? -3.765  11.177  6.722   1.00 2.31 ? 7  VAL A HG22 3  
ATOM   1035  H HG23 . VAL A 1 7  ? -3.120  11.584  8.313   1.00 2.28 ? 7  VAL A HG23 3  
HETATM 1036  N N    . SEP A 1 8  ? -3.504  8.231   6.059   1.00 1.86 ? 8  SEP A N    3  
HETATM 1037  C CA   . SEP A 1 8  ? -2.998  7.698   4.751   1.00 1.88 ? 8  SEP A CA   3  
HETATM 1038  C CB   . SEP A 1 8  ? -3.653  8.571   3.678   1.00 2.08 ? 8  SEP A CB   3  
HETATM 1039  O OG   . SEP A 1 8  ? -4.898  7.982   3.286   1.00 2.37 ? 8  SEP A OG   3  
HETATM 1040  C C    . SEP A 1 8  ? -1.470  7.812   4.678   1.00 1.59 ? 8  SEP A C    3  
HETATM 1041  O O    . SEP A 1 8  ? -0.802  6.915   4.202   1.00 1.58 ? 8  SEP A O    3  
HETATM 1042  P P    . SEP A 1 8  ? -4.954  6.908   2.088   1.00 2.58 ? 8  SEP A P    3  
HETATM 1043  O O1P  . SEP A 1 8  ? -4.610  7.602   0.827   1.00 2.71 ? 8  SEP A O1P  3  
HETATM 1044  O O2P  . SEP A 1 8  ? -4.188  5.711   2.505   1.00 2.82 ? 8  SEP A O2P  3  
HETATM 1045  O O3P  . SEP A 1 8  ? -6.513  6.514   2.038   1.00 2.84 ? 8  SEP A O3P  3  
HETATM 1046  H H    . SEP A 1 8  ? -4.230  8.882   6.069   1.00 2.00 ? 8  SEP A H    3  
HETATM 1047  H HA   . SEP A 1 8  ? -3.299  6.674   4.624   1.00 2.03 ? 8  SEP A HA   3  
HETATM 1048  H HB2  . SEP A 1 8  ? -2.993  8.647   2.826   1.00 2.02 ? 8  SEP A HB2  3  
HETATM 1049  H HB3  . SEP A 1 8  ? -3.836  9.557   4.074   1.00 2.12 ? 8  SEP A HB3  3  
HETATM 1050  H HOP3 . SEP A 1 8  ? -6.620  5.866   1.339   1.00 3.13 ? 8  SEP A HOP3 3  
ATOM   1051  N N    . SER A 1 9  ? -0.927  8.907   5.167   1.00 1.40 ? 9  SER A N    3  
ATOM   1052  C CA   . SER A 1 9  ? 0.559   9.125   5.169   1.00 1.15 ? 9  SER A CA   3  
ATOM   1053  C C    . SER A 1 9  ? 1.120   9.193   3.747   1.00 1.03 ? 9  SER A C    3  
ATOM   1054  O O    . SER A 1 9  ? 1.005   8.261   2.983   1.00 1.11 ? 9  SER A O    3  
ATOM   1055  C CB   . SER A 1 9  ? 1.159   7.933   5.914   1.00 1.19 ? 9  SER A CB   3  
ATOM   1056  O OG   . SER A 1 9  ? 0.588   7.846   7.217   1.00 1.38 ? 9  SER A OG   3  
ATOM   1057  H H    . SER A 1 9  ? -1.505  9.591   5.550   1.00 1.47 ? 9  SER A H    3  
ATOM   1058  H HA   . SER A 1 9  ? 0.794   10.034  5.700   1.00 1.14 ? 9  SER A HA   3  
ATOM   1059  H HB2  . SER A 1 9  ? 0.950   7.027   5.370   1.00 1.28 ? 9  SER A HB2  3  
ATOM   1060  H HB3  . SER A 1 9  ? 2.231   8.066   5.985   1.00 1.13 ? 9  SER A HB3  3  
ATOM   1061  H HG   . SER A 1 9  ? -0.250  7.376   7.147   1.00 1.62 ? 9  SER A HG   3  
ATOM   1062  N N    . TYR A 1 10 ? 1.750   10.293  3.411   1.00 0.93 ? 10 TYR A N    3  
ATOM   1063  C CA   . TYR A 1 10 ? 2.368   10.468  2.054   1.00 0.88 ? 10 TYR A CA   3  
ATOM   1064  C C    . TYR A 1 10 ? 1.359   10.174  0.918   1.00 0.99 ? 10 TYR A C    3  
ATOM   1065  O O    . TYR A 1 10 ? 0.227   9.791   1.148   1.00 1.19 ? 10 TYR A O    3  
ATOM   1066  C CB   . TYR A 1 10 ? 3.584   9.507   2.068   1.00 0.78 ? 10 TYR A CB   3  
ATOM   1067  C CG   . TYR A 1 10 ? 3.456   8.402   1.043   1.00 0.71 ? 10 TYR A CG   3  
ATOM   1068  C CD1  . TYR A 1 10 ? 3.928   8.604   -0.255  1.00 0.66 ? 10 TYR A CD1  3  
ATOM   1069  C CD2  . TYR A 1 10 ? 2.875   7.180   1.397   1.00 0.86 ? 10 TYR A CD2  3  
ATOM   1070  C CE1  . TYR A 1 10 ? 3.814   7.586   -1.207  1.00 0.71 ? 10 TYR A CE1  3  
ATOM   1071  C CE2  . TYR A 1 10 ? 2.761   6.161   0.447   1.00 0.97 ? 10 TYR A CE2  3  
ATOM   1072  C CZ   . TYR A 1 10 ? 3.228   6.365   -0.856  1.00 0.89 ? 10 TYR A CZ   3  
ATOM   1073  O OH   . TYR A 1 10 ? 3.107   5.365   -1.793  1.00 1.07 ? 10 TYR A OH   3  
ATOM   1074  H H    . TYR A 1 10 ? 1.838   11.007  4.067   1.00 0.96 ? 10 TYR A H    3  
ATOM   1075  H HA   . TYR A 1 10 ? 2.725   11.480  1.955   1.00 0.98 ? 10 TYR A HA   3  
ATOM   1076  H HB2  . TYR A 1 10 ? 4.478   10.071  1.857   1.00 0.84 ? 10 TYR A HB2  3  
ATOM   1077  H HB3  . TYR A 1 10 ? 3.671   9.066   3.050   1.00 0.85 ? 10 TYR A HB3  3  
ATOM   1078  H HD1  . TYR A 1 10 ? 4.374   9.550   -0.521  1.00 0.72 ? 10 TYR A HD1  3  
ATOM   1079  H HD2  . TYR A 1 10 ? 2.515   7.024   2.406   1.00 0.97 ? 10 TYR A HD2  3  
ATOM   1080  H HE1  . TYR A 1 10 ? 4.178   7.742   -2.212  1.00 0.73 ? 10 TYR A HE1  3  
ATOM   1081  H HE2  . TYR A 1 10 ? 2.306   5.220   0.716   1.00 1.19 ? 10 TYR A HE2  3  
ATOM   1082  H HH   . TYR A 1 10 ? 2.174   5.161   -1.891  1.00 1.21 ? 10 TYR A HH   3  
ATOM   1083  N N    . ARG A 1 11 ? 1.767   10.379  -0.310  1.00 0.96 ? 11 ARG A N    3  
ATOM   1084  C CA   . ARG A 1 11 ? 0.861   10.130  -1.477  1.00 1.16 ? 11 ARG A CA   3  
ATOM   1085  C C    . ARG A 1 11 ? 0.579   8.625   -1.637  1.00 1.18 ? 11 ARG A C    3  
ATOM   1086  O O    . ARG A 1 11 ? 0.726   7.854   -0.711  1.00 1.12 ? 11 ARG A O    3  
ATOM   1087  C CB   . ARG A 1 11 ? 1.642   10.667  -2.684  1.00 1.17 ? 11 ARG A CB   3  
ATOM   1088  C CG   . ARG A 1 11 ? 0.900   11.857  -3.290  1.00 1.39 ? 11 ARG A CG   3  
ATOM   1089  C CD   . ARG A 1 11 ? 0.234   11.433  -4.602  1.00 1.78 ? 11 ARG A CD   3  
ATOM   1090  N NE   . ARG A 1 11 ? 0.012   12.704  -5.346  1.00 2.33 ? 11 ARG A NE   3  
ATOM   1091  C CZ   . ARG A 1 11 ? -1.077  13.392  -5.155  1.00 3.05 ? 11 ARG A CZ   3  
ATOM   1092  N NH1  . ARG A 1 11 ? -2.161  13.088  -5.809  1.00 3.44 ? 11 ARG A NH1  3  
ATOM   1093  N NH2  . ARG A 1 11 ? -1.077  14.382  -4.311  1.00 3.78 ? 11 ARG A NH2  3  
ATOM   1094  H H    . ARG A 1 11 ? 2.675   10.708  -0.466  1.00 0.87 ? 11 ARG A H    3  
ATOM   1095  H HA   . ARG A 1 11 ? -0.060  10.671  -1.365  1.00 1.35 ? 11 ARG A HA   3  
ATOM   1096  H HB2  . ARG A 1 11 ? 2.626   10.981  -2.365  1.00 1.06 ? 11 ARG A HB2  3  
ATOM   1097  H HB3  . ARG A 1 11 ? 1.739   9.890   -3.425  1.00 1.23 ? 11 ARG A HB3  3  
ATOM   1098  H HG2  . ARG A 1 11 ? 0.147   12.204  -2.595  1.00 1.54 ? 11 ARG A HG2  3  
ATOM   1099  H HG3  . ARG A 1 11 ? 1.602   12.654  -3.486  1.00 1.51 ? 11 ARG A HG3  3  
ATOM   1100  H HD2  . ARG A 1 11 ? 0.888   10.776  -5.159  1.00 1.91 ? 11 ARG A HD2  3  
ATOM   1101  H HD3  . ARG A 1 11 ? -0.710  10.949  -4.405  1.00 2.11 ? 11 ARG A HD3  3  
ATOM   1102  H HE   . ARG A 1 11 ? 0.685   13.024  -5.982  1.00 2.55 ? 11 ARG A HE   3  
ATOM   1103  H HH11 . ARG A 1 11 ? -2.155  12.327  -6.456  1.00 3.26 ? 11 ARG A HH11 3  
ATOM   1104  H HH12 . ARG A 1 11 ? -2.998  13.615  -5.666  1.00 4.16 ? 11 ARG A HH12 3  
ATOM   1105  H HH21 . ARG A 1 11 ? -0.242  14.611  -3.811  1.00 3.78 ? 11 ARG A HH21 3  
ATOM   1106  H HH22 . ARG A 1 11 ? -1.910  14.912  -4.161  1.00 4.53 ? 11 ARG A HH22 3  
ATOM   1107  N N    . GLY A 1 12 ? 0.196   8.200   -2.815  1.00 1.35 ? 12 GLY A N    3  
ATOM   1108  C CA   . GLY A 1 12 ? -0.068  6.747   -3.043  1.00 1.46 ? 12 GLY A CA   3  
ATOM   1109  C C    . GLY A 1 12 ? 0.933   6.237   -4.076  1.00 1.36 ? 12 GLY A C    3  
ATOM   1110  O O    . GLY A 1 12 ? 0.662   5.320   -4.825  1.00 1.53 ? 12 GLY A O    3  
ATOM   1111  H H    . GLY A 1 12 ? 0.101   8.831   -3.559  1.00 1.43 ? 12 GLY A H    3  
ATOM   1112  H HA2  . GLY A 1 12 ? 0.056   6.204   -2.115  1.00 1.40 ? 12 GLY A HA2  3  
ATOM   1113  H HA3  . GLY A 1 12 ? -1.069  6.611   -3.415  1.00 1.70 ? 12 GLY A HA3  3  
ATOM   1114  N N    . ARG A 1 13 ? 2.086   6.851   -4.121  1.00 1.13 ? 13 ARG A N    3  
ATOM   1115  C CA   . ARG A 1 13 ? 3.129   6.453   -5.103  1.00 1.08 ? 13 ARG A CA   3  
ATOM   1116  C C    . ARG A 1 13 ? 4.398   5.964   -4.385  1.00 0.89 ? 13 ARG A C    3  
ATOM   1117  O O    . ARG A 1 13 ? 5.262   6.741   -4.020  1.00 0.86 ? 13 ARG A O    3  
ATOM   1118  C CB   . ARG A 1 13 ? 3.391   7.727   -5.923  1.00 1.17 ? 13 ARG A CB   3  
ATOM   1119  C CG   . ARG A 1 13 ? 3.639   8.933   -5.004  1.00 1.11 ? 13 ARG A CG   3  
ATOM   1120  C CD   . ARG A 1 13 ? 4.862   9.712   -5.495  1.00 1.20 ? 13 ARG A CD   3  
ATOM   1121  N NE   . ARG A 1 13 ? 6.008   9.124   -4.745  1.00 1.08 ? 13 ARG A NE   3  
ATOM   1122  C CZ   . ARG A 1 13 ? 7.127   9.781   -4.632  1.00 1.23 ? 13 ARG A CZ   3  
ATOM   1123  N NH1  . ARG A 1 13 ? 7.168   10.886  -3.943  1.00 1.42 ? 13 ARG A NH1  3  
ATOM   1124  N NH2  . ARG A 1 13 ? 8.203   9.326   -5.205  1.00 1.30 ? 13 ARG A NH2  3  
ATOM   1125  H H    . ARG A 1 13 ? 2.262   7.590   -3.510  1.00 1.05 ? 13 ARG A H    3  
ATOM   1126  H HA   . ARG A 1 13 ? 2.750   5.678   -5.747  1.00 1.22 ? 13 ARG A HA   3  
ATOM   1127  H HB2  . ARG A 1 13 ? 4.249   7.574   -6.546  1.00 1.18 ? 13 ARG A HB2  3  
ATOM   1128  H HB3  . ARG A 1 13 ? 2.532   7.928   -6.542  1.00 1.38 ? 13 ARG A HB3  3  
ATOM   1129  H HG2  . ARG A 1 13 ? 2.773   9.579   -5.019  1.00 1.26 ? 13 ARG A HG2  3  
ATOM   1130  H HG3  . ARG A 1 13 ? 3.814   8.591   -3.996  1.00 0.97 ? 13 ARG A HG3  3  
ATOM   1131  H HD2  . ARG A 1 13 ? 4.993   9.574   -6.561  1.00 1.37 ? 13 ARG A HD2  3  
ATOM   1132  H HD3  . ARG A 1 13 ? 4.762   10.761  -5.259  1.00 1.31 ? 13 ARG A HD3  3  
ATOM   1133  H HE   . ARG A 1 13 ? 5.923   8.231   -4.342  1.00 0.98 ? 13 ARG A HE   3  
ATOM   1134  H HH11 . ARG A 1 13 ? 6.340   11.229  -3.501  1.00 1.45 ? 13 ARG A HH11 3  
ATOM   1135  H HH12 . ARG A 1 13 ? 8.025   11.392  -3.858  1.00 1.61 ? 13 ARG A HH12 3  
ATOM   1136  H HH21 . ARG A 1 13 ? 8.164   8.469   -5.730  1.00 1.24 ? 13 ARG A HH21 3  
ATOM   1137  H HH22 . ARG A 1 13 ? 9.064   9.824   -5.124  1.00 1.49 ? 13 ARG A HH22 3  
ATOM   1138  N N    . LYS A 1 14 ? 4.512   4.676   -4.180  1.00 0.94 ? 14 LYS A N    3  
ATOM   1139  C CA   . LYS A 1 14 ? 5.715   4.117   -3.486  1.00 0.96 ? 14 LYS A CA   3  
ATOM   1140  C C    . LYS A 1 14 ? 6.915   4.030   -4.446  1.00 1.06 ? 14 LYS A C    3  
ATOM   1141  O O    . LYS A 1 14 ? 7.526   2.986   -4.596  1.00 1.22 ? 14 LYS A O    3  
ATOM   1142  C CB   . LYS A 1 14 ? 5.286   2.716   -3.027  1.00 1.14 ? 14 LYS A CB   3  
ATOM   1143  C CG   . LYS A 1 14 ? 4.614   2.786   -1.650  1.00 1.13 ? 14 LYS A CG   3  
ATOM   1144  C CD   . LYS A 1 14 ? 5.477   3.608   -0.688  1.00 1.00 ? 14 LYS A CD   3  
ATOM   1145  C CE   . LYS A 1 14 ? 5.154   3.221   0.758   1.00 1.15 ? 14 LYS A CE   3  
ATOM   1146  N NZ   . LYS A 1 14 ? 6.017   4.104   1.597   1.00 1.24 ? 14 LYS A NZ   3  
ATOM   1147  H H    . LYS A 1 14 ? 3.803   4.072   -4.475  1.00 1.07 ? 14 LYS A H    3  
ATOM   1148  H HA   . LYS A 1 14 ? 5.967   4.723   -2.631  1.00 0.90 ? 14 LYS A HA   3  
ATOM   1149  H HB2  . LYS A 1 14 ? 4.590   2.303   -3.743  1.00 1.22 ? 14 LYS A HB2  3  
ATOM   1150  H HB3  . LYS A 1 14 ? 6.153   2.081   -2.969  1.00 1.27 ? 14 LYS A HB3  3  
ATOM   1151  H HG2  . LYS A 1 14 ? 3.643   3.250   -1.750  1.00 1.13 ? 14 LYS A HG2  3  
ATOM   1152  H HG3  . LYS A 1 14 ? 4.495   1.787   -1.259  1.00 1.34 ? 14 LYS A HG3  3  
ATOM   1153  H HD2  . LYS A 1 14 ? 6.521   3.416   -0.890  1.00 1.08 ? 14 LYS A HD2  3  
ATOM   1154  H HD3  . LYS A 1 14 ? 5.271   4.658   -0.833  1.00 0.85 ? 14 LYS A HD3  3  
ATOM   1155  H HE2  . LYS A 1 14 ? 4.108   3.402   0.968   1.00 1.21 ? 14 LYS A HE2  3  
ATOM   1156  H HE3  . LYS A 1 14 ? 5.401   2.185   0.934   1.00 1.28 ? 14 LYS A HE3  3  
ATOM   1157  H HZ1  . LYS A 1 14 ? 5.878   5.096   1.316   1.00 1.28 ? 14 LYS A HZ1  3  
ATOM   1158  H HZ2  . LYS A 1 14 ? 5.761   3.990   2.597   1.00 1.41 ? 14 LYS A HZ2  3  
ATOM   1159  H HZ3  . LYS A 1 14 ? 7.022   3.840   1.461   1.00 1.27 ? 14 LYS A HZ3  3  
ATOM   1160  N N    . SER A 1 15 ? 7.269   5.119   -5.080  1.00 1.03 ? 15 SER A N    3  
ATOM   1161  C CA   . SER A 1 15 ? 8.437   5.100   -6.013  1.00 1.18 ? 15 SER A CA   3  
ATOM   1162  C C    . SER A 1 15 ? 9.717   5.448   -5.244  1.00 1.26 ? 15 SER A C    3  
ATOM   1163  O O    . SER A 1 15 ? 10.024  6.603   -5.013  1.00 1.37 ? 15 SER A O    3  
ATOM   1164  C CB   . SER A 1 15 ? 8.135   6.158   -7.082  1.00 1.22 ? 15 SER A CB   3  
ATOM   1165  O OG   . SER A 1 15 ? 7.440   7.256   -6.497  1.00 1.10 ? 15 SER A OG   3  
ATOM   1166  H H    . SER A 1 15 ? 6.775   5.953   -4.936  1.00 0.95 ? 15 SER A H    3  
ATOM   1167  H HA   . SER A 1 15 ? 8.532   4.129   -6.475  1.00 1.25 ? 15 SER A HA   3  
ATOM   1168  H HB2  . SER A 1 15 ? 9.059   6.514   -7.505  1.00 1.28 ? 15 SER A HB2  3  
ATOM   1169  H HB3  . SER A 1 15 ? 7.533   5.714   -7.865  1.00 1.42 ? 15 SER A HB3  3  
ATOM   1170  H HG   . SER A 1 15 ? 6.695   7.472   -7.066  1.00 1.22 ? 15 SER A HG   3  
ATOM   1171  N N    . GLY A 1 16 ? 10.455  4.447   -4.832  1.00 1.37 ? 16 GLY A N    3  
ATOM   1172  C CA   . GLY A 1 16 ? 11.710  4.695   -4.060  1.00 1.48 ? 16 GLY A CA   3  
ATOM   1173  C C    . GLY A 1 16 ? 11.491  4.286   -2.600  1.00 1.42 ? 16 GLY A C    3  
ATOM   1174  O O    . GLY A 1 16 ? 11.689  5.067   -1.691  1.00 1.52 ? 16 GLY A O    3  
ATOM   1175  H H    . GLY A 1 16 ? 10.175  3.527   -5.024  1.00 1.48 ? 16 GLY A H    3  
ATOM   1176  H HA2  . GLY A 1 16 ? 12.516  4.112   -4.483  1.00 1.56 ? 16 GLY A HA2  3  
ATOM   1177  H HA3  . GLY A 1 16 ? 11.962  5.743   -4.102  1.00 1.55 ? 16 GLY A HA3  3  
ATOM   1178  N N    . ASN A 1 17 ? 11.076  3.063   -2.376  1.00 1.31 ? 17 ASN A N    3  
ATOM   1179  C CA   . ASN A 1 17 ? 10.830  2.585   -0.980  1.00 1.28 ? 17 ASN A CA   3  
ATOM   1180  C C    . ASN A 1 17 ? 11.560  1.259   -0.734  1.00 1.22 ? 17 ASN A C    3  
ATOM   1181  O O    . ASN A 1 17 ? 11.820  0.505   -1.652  1.00 1.18 ? 17 ASN A O    3  
ATOM   1182  C CB   . ASN A 1 17 ? 9.312   2.384   -0.903  1.00 1.22 ? 17 ASN A CB   3  
ATOM   1183  C CG   . ASN A 1 17 ? 8.870   2.292   0.560   1.00 1.28 ? 17 ASN A CG   3  
ATOM   1184  O OD1  . ASN A 1 17 ? 8.431   3.267   1.137   1.00 1.35 ? 17 ASN A OD1  3  
ATOM   1185  N ND2  . ASN A 1 17 ? 8.956   1.151   1.189   1.00 1.35 ? 17 ASN A ND2  3  
ATOM   1186  H H    . ASN A 1 17 ? 10.922  2.458   -3.130  1.00 1.30 ? 17 ASN A H    3  
ATOM   1187  H HA   . ASN A 1 17 ? 11.141  3.329   -0.264  1.00 1.39 ? 17 ASN A HA   3  
ATOM   1188  H HB2  . ASN A 1 17 ? 8.814   3.218   -1.376  1.00 1.25 ? 17 ASN A HB2  3  
ATOM   1189  H HB3  . ASN A 1 17 ? 9.046   1.471   -1.412  1.00 1.17 ? 17 ASN A HB3  3  
ATOM   1190  H HD21 . ASN A 1 17 ? 9.302   0.359   0.726   1.00 1.37 ? 17 ASN A HD21 3  
ATOM   1191  H HD22 . ASN A 1 17 ? 8.676   1.088   2.125   1.00 1.44 ? 17 ASN A HD22 3  
ATOM   1192  N N    . LYS A 1 18 ? 11.877  0.967   0.503   1.00 1.25 ? 18 LYS A N    3  
ATOM   1193  C CA   . LYS A 1 18 ? 12.579  -0.315  0.824   1.00 1.22 ? 18 LYS A CA   3  
ATOM   1194  C C    . LYS A 1 18 ? 11.618  -1.501  0.624   1.00 1.07 ? 18 LYS A C    3  
ATOM   1195  O O    . LYS A 1 18 ? 10.543  -1.525  1.194   1.00 1.13 ? 18 LYS A O    3  
ATOM   1196  C CB   . LYS A 1 18 ? 12.988  -0.190  2.297   1.00 1.40 ? 18 LYS A CB   3  
ATOM   1197  C CG   . LYS A 1 18 ? 14.515  -0.191  2.409   1.00 1.59 ? 18 LYS A CG   3  
ATOM   1198  C CD   . LYS A 1 18 ? 14.983  -1.489  3.077   1.00 1.60 ? 18 LYS A CD   3  
ATOM   1199  C CE   . LYS A 1 18 ? 14.946  -2.637  2.060   1.00 1.41 ? 18 LYS A CE   3  
ATOM   1200  N NZ   . LYS A 1 18 ? 13.871  -3.552  2.544   1.00 1.33 ? 18 LYS A NZ   3  
ATOM   1201  H H    . LYS A 1 18 ? 11.645  1.590   1.223   1.00 1.32 ? 18 LYS A H    3  
ATOM   1202  H HA   . LYS A 1 18 ? 13.454  -0.430  0.205   1.00 1.29 ? 18 LYS A HA   3  
ATOM   1203  H HB2  . LYS A 1 18 ? 12.599  0.734   2.702   1.00 1.49 ? 18 LYS A HB2  3  
ATOM   1204  H HB3  . LYS A 1 18 ? 12.586  -1.022  2.855   1.00 1.37 ? 18 LYS A HB3  3  
ATOM   1205  H HG2  . LYS A 1 18 ? 14.949  -0.116  1.422   1.00 1.60 ? 18 LYS A HG2  3  
ATOM   1206  H HG3  . LYS A 1 18 ? 14.831  0.651   3.006   1.00 1.79 ? 18 LYS A HG3  3  
ATOM   1207  H HD2  . LYS A 1 18 ? 15.993  -1.362  3.439   1.00 1.84 ? 18 LYS A HD2  3  
ATOM   1208  H HD3  . LYS A 1 18 ? 14.333  -1.722  3.907   1.00 1.67 ? 18 LYS A HD3  3  
ATOM   1209  H HE2  . LYS A 1 18 ? 14.707  -2.257  1.076   1.00 1.38 ? 18 LYS A HE2  3  
ATOM   1210  H HE3  . LYS A 1 18 ? 15.893  -3.155  2.044   1.00 1.59 ? 18 LYS A HE3  3  
ATOM   1211  H HZ1  . LYS A 1 18 ? 13.027  -2.998  2.797   1.00 1.45 ? 18 LYS A HZ1  3  
ATOM   1212  H HZ2  . LYS A 1 18 ? 13.624  -4.230  1.788   1.00 1.18 ? 18 LYS A HZ2  3  
ATOM   1213  H HZ3  . LYS A 1 18 ? 14.206  -4.075  3.377   1.00 1.66 ? 18 LYS A HZ3  3  
ATOM   1214  N N    . PRO A 1 19 ? 12.036  -2.444  -0.191  1.00 1.02 ? 19 PRO A N    3  
ATOM   1215  C CA   . PRO A 1 19 ? 11.152  -3.611  -0.435  1.00 1.04 ? 19 PRO A CA   3  
ATOM   1216  C C    . PRO A 1 19 ? 11.729  -4.891  0.192   1.00 1.03 ? 19 PRO A C    3  
ATOM   1217  O O    . PRO A 1 19 ? 12.880  -4.923  0.597   1.00 1.05 ? 19 PRO A O    3  
ATOM   1218  C CB   . PRO A 1 19 ? 11.130  -3.725  -1.956  1.00 1.13 ? 19 PRO A CB   3  
ATOM   1219  C CG   . PRO A 1 19 ? 12.403  -3.095  -2.433  1.00 1.19 ? 19 PRO A CG   3  
ATOM   1220  C CD   . PRO A 1 19 ? 12.999  -2.303  -1.292  1.00 1.12 ? 19 PRO A CD   3  
ATOM   1221  H HA   . PRO A 1 19 ? 10.158  -3.421  -0.068  1.00 1.12 ? 19 PRO A HA   3  
ATOM   1222  H HB2  . PRO A 1 19 ? 11.091  -4.765  -2.251  1.00 1.22 ? 19 PRO A HB2  3  
ATOM   1223  H HB3  . PRO A 1 19 ? 10.283  -3.190  -2.357  1.00 1.21 ? 19 PRO A HB3  3  
ATOM   1224  H HG2  . PRO A 1 19 ? 13.096  -3.864  -2.746  1.00 1.29 ? 19 PRO A HG2  3  
ATOM   1225  H HG3  . PRO A 1 19 ? 12.196  -2.433  -3.260  1.00 1.34 ? 19 PRO A HG3  3  
ATOM   1226  H HD2  . PRO A 1 19 ? 13.958  -2.717  -1.011  1.00 1.20 ? 19 PRO A HD2  3  
ATOM   1227  H HD3  . PRO A 1 19 ? 13.101  -1.266  -1.566  1.00 1.22 ? 19 PRO A HD3  3  
ATOM   1228  N N    . PRO A 1 20 ? 10.905  -5.913  0.238   1.00 1.14 ? 20 PRO A N    3  
ATOM   1229  C CA   . PRO A 1 20 ? 11.376  -7.204  0.813   1.00 1.24 ? 20 PRO A CA   3  
ATOM   1230  C C    . PRO A 1 20 ? 11.782  -8.160  -0.321  1.00 1.19 ? 20 PRO A C    3  
ATOM   1231  O O    . PRO A 1 20 ? 11.109  -9.138  -0.593  1.00 1.27 ? 20 PRO A O    3  
ATOM   1232  C CB   . PRO A 1 20 ? 10.167  -7.735  1.579   1.00 1.41 ? 20 PRO A CB   3  
ATOM   1233  C CG   . PRO A 1 20 ? 8.986   -7.109  0.917   1.00 1.39 ? 20 PRO A CG   3  
ATOM   1234  C CD   . PRO A 1 20 ? 9.440   -5.787  0.358   1.00 1.25 ? 20 PRO A CD   3  
ATOM   1235  H HA   . PRO A 1 20 ? 12.203  -7.042  1.488   1.00 1.29 ? 20 PRO A HA   3  
ATOM   1236  H HB2  . PRO A 1 20 ? 10.118  -8.813  1.501   1.00 1.48 ? 20 PRO A HB2  3  
ATOM   1237  H HB3  . PRO A 1 20 ? 10.214  -7.433  2.613   1.00 1.51 ? 20 PRO A HB3  3  
ATOM   1238  H HG2  . PRO A 1 20 ? 8.631   -7.748  0.119   1.00 1.39 ? 20 PRO A HG2  3  
ATOM   1239  H HG3  . PRO A 1 20 ? 8.200   -6.948  1.638   1.00 1.54 ? 20 PRO A HG3  3  
ATOM   1240  H HD2  . PRO A 1 20 ? 8.993   -5.618  -0.613  1.00 1.25 ? 20 PRO A HD2  3  
ATOM   1241  H HD3  . PRO A 1 20 ? 9.191   -4.986  1.035   1.00 1.33 ? 20 PRO A HD3  3  
ATOM   1242  N N    . SER A 1 21 ? 12.877  -7.871  -0.988  1.00 1.23 ? 21 SER A N    3  
ATOM   1243  C CA   . SER A 1 21 ? 13.347  -8.740  -2.118  1.00 1.28 ? 21 SER A CA   3  
ATOM   1244  C C    . SER A 1 21 ? 12.257  -8.853  -3.201  1.00 1.00 ? 21 SER A C    3  
ATOM   1245  O O    . SER A 1 21 ? 11.482  -7.937  -3.409  1.00 0.95 ? 21 SER A O    3  
ATOM   1246  C CB   . SER A 1 21 ? 13.641  -10.104 -1.481  1.00 1.62 ? 21 SER A CB   3  
ATOM   1247  O OG   . SER A 1 21 ? 14.283  -10.938 -2.439  1.00 1.78 ? 21 SER A OG   3  
ATOM   1248  H H    . SER A 1 21 ? 13.392  -7.072  -0.748  1.00 1.33 ? 21 SER A H    3  
ATOM   1249  H HA   . SER A 1 21 ? 14.250  -8.336  -2.546  1.00 1.46 ? 21 SER A HA   3  
ATOM   1250  H HB2  . SER A 1 21 ? 14.289  -9.975  -0.630  1.00 1.86 ? 21 SER A HB2  3  
ATOM   1251  H HB3  . SER A 1 21 ? 12.712  -10.558 -1.158  1.00 1.65 ? 21 SER A HB3  3  
ATOM   1252  H HG   . SER A 1 21 ? 14.672  -11.683 -1.973  1.00 2.09 ? 21 SER A HG   3  
ATOM   1253  N N    . LYS A 1 22 ? 12.195  -9.966  -3.890  1.00 1.06 ? 22 LYS A N    3  
ATOM   1254  C CA   . LYS A 1 22 ? 11.159  -10.139 -4.957  1.00 0.99 ? 22 LYS A CA   3  
ATOM   1255  C C    . LYS A 1 22 ? 10.218  -11.300 -4.599  1.00 1.20 ? 22 LYS A C    3  
ATOM   1256  O O    . LYS A 1 22 ? 10.156  -12.303 -5.284  1.00 1.37 ? 22 LYS A O    3  
ATOM   1257  C CB   . LYS A 1 22 ? 11.947  -10.435 -6.244  1.00 1.02 ? 22 LYS A CB   3  
ATOM   1258  C CG   . LYS A 1 22 ? 12.868  -11.648 -6.037  1.00 1.19 ? 22 LYS A CG   3  
ATOM   1259  C CD   . LYS A 1 22 ? 12.889  -12.502 -7.309  1.00 1.34 ? 22 LYS A CD   3  
ATOM   1260  C CE   . LYS A 1 22 ? 11.797  -13.577 -7.232  1.00 1.42 ? 22 LYS A CE   3  
ATOM   1261  N NZ   . LYS A 1 22 ? 10.570  -12.946 -7.808  1.00 1.67 ? 22 LYS A NZ   3  
ATOM   1262  H H    . LYS A 1 22 ? 12.832  -10.690 -3.706  1.00 1.29 ? 22 LYS A H    3  
ATOM   1263  H HA   . LYS A 1 22 ? 10.592  -9.229  -5.076  1.00 0.99 ? 22 LYS A HA   3  
ATOM   1264  H HB2  . LYS A 1 22 ? 11.255  -10.641 -7.046  1.00 1.12 ? 22 LYS A HB2  3  
ATOM   1265  H HB3  . LYS A 1 22 ? 12.546  -9.573  -6.502  1.00 1.08 ? 22 LYS A HB3  3  
ATOM   1266  H HG2  . LYS A 1 22 ? 13.868  -11.305 -5.818  1.00 1.28 ? 22 LYS A HG2  3  
ATOM   1267  H HG3  . LYS A 1 22 ? 12.503  -12.241 -5.212  1.00 1.31 ? 22 LYS A HG3  3  
ATOM   1268  H HD2  . LYS A 1 22 ? 12.717  -11.873 -8.169  1.00 1.39 ? 22 LYS A HD2  3  
ATOM   1269  H HD3  . LYS A 1 22 ? 13.852  -12.981 -7.402  1.00 1.48 ? 22 LYS A HD3  3  
ATOM   1270  H HE2  . LYS A 1 22 ? 12.085  -14.442 -7.815  1.00 1.57 ? 22 LYS A HE2  3  
ATOM   1271  H HE3  . LYS A 1 22 ? 11.621  -13.860 -6.206  1.00 1.39 ? 22 LYS A HE3  3  
ATOM   1272  H HZ1  . LYS A 1 22 ? 10.839  -12.206 -8.495  1.00 1.60 ? 22 LYS A HZ1  3  
ATOM   1273  H HZ2  . LYS A 1 22 ? 10.004  -13.673 -8.291  1.00 2.09 ? 22 LYS A HZ2  3  
ATOM   1274  H HZ3  . LYS A 1 22 ? 10.003  -12.520 -7.041  1.00 1.71 ? 22 LYS A HZ3  3  
ATOM   1275  N N    . THR A 1 23 ? 9.483   -11.170 -3.523  1.00 1.33 ? 23 THR A N    3  
ATOM   1276  C CA   . THR A 1 23 ? 8.544   -12.267 -3.118  1.00 1.73 ? 23 THR A CA   3  
ATOM   1277  C C    . THR A 1 23 ? 7.351   -11.706 -2.324  1.00 1.98 ? 23 THR A C    3  
ATOM   1278  O O    . THR A 1 23 ? 6.813   -12.364 -1.451  1.00 2.36 ? 23 THR A O    3  
ATOM   1279  C CB   . THR A 1 23 ? 9.389   -13.208 -2.248  1.00 1.73 ? 23 THR A CB   3  
ATOM   1280  O OG1  . THR A 1 23 ? 8.641   -14.378 -1.950  1.00 2.25 ? 23 THR A OG1  3  
ATOM   1281  C CG2  . THR A 1 23 ? 9.782   -12.507 -0.943  1.00 1.51 ? 23 THR A CG2  3  
ATOM   1282  H H    . THR A 1 23 ? 9.550   -10.354 -2.984  1.00 1.24 ? 23 THR A H    3  
ATOM   1283  H HA   . THR A 1 23 ? 8.193   -12.796 -3.989  1.00 2.01 ? 23 THR A HA   3  
ATOM   1284  H HB   . THR A 1 23 ? 10.284  -13.483 -2.784  1.00 1.73 ? 23 THR A HB   3  
ATOM   1285  H HG1  . THR A 1 23 ? 7.848   -14.115 -1.473  1.00 2.39 ? 23 THR A HG1  3  
ATOM   1286  H HG21 . THR A 1 23 ? 10.072  -11.488 -1.154  1.00 1.79 ? 23 THR A HG21 3  
ATOM   1287  H HG22 . THR A 1 23 ? 8.940   -12.508 -0.266  1.00 1.79 ? 23 THR A HG22 3  
ATOM   1288  H HG23 . THR A 1 23 ? 10.610  -13.029 -0.490  1.00 1.77 ? 23 THR A HG23 3  
ATOM   1289  N N    . CYS A 1 24 ? 6.929   -10.501 -2.624  1.00 1.90 ? 24 CYS A N    3  
ATOM   1290  C CA   . CYS A 1 24 ? 5.771   -9.900  -1.892  1.00 2.32 ? 24 CYS A CA   3  
ATOM   1291  C C    . CYS A 1 24 ? 5.152   -8.762  -2.717  1.00 2.33 ? 24 CYS A C    3  
ATOM   1292  O O    . CYS A 1 24 ? 4.016   -8.843  -3.144  1.00 2.66 ? 24 CYS A O    3  
ATOM   1293  C CB   . CYS A 1 24 ? 6.361   -9.368  -0.581  1.00 2.40 ? 24 CYS A CB   3  
ATOM   1294  S SG   . CYS A 1 24 ? 5.075   -8.513  0.365   1.00 2.92 ? 24 CYS A SG   3  
ATOM   1295  H H    . CYS A 1 24 ? 7.372   -9.994  -3.336  1.00 1.63 ? 24 CYS A H    3  
ATOM   1296  H HA   . CYS A 1 24 ? 5.030   -10.654 -1.682  1.00 2.64 ? 24 CYS A HA   3  
ATOM   1297  H HB2  . CYS A 1 24 ? 6.746   -10.192 0.000   1.00 2.43 ? 24 CYS A HB2  3  
ATOM   1298  H HB3  . CYS A 1 24 ? 7.163   -8.679  -0.801  1.00 2.28 ? 24 CYS A HB3  3  
ATOM   1299  H HG   . CYS A 1 24 ? 4.331   -9.113  0.464   1.00 3.29 ? 24 CYS A HG   3  
ATOM   1300  N N    . LEU A 1 25 ? 5.895   -7.708  -2.945  1.00 2.08 ? 25 LEU A N    3  
ATOM   1301  C CA   . LEU A 1 25 ? 5.362   -6.562  -3.746  1.00 2.19 ? 25 LEU A CA   3  
ATOM   1302  C C    . LEU A 1 25 ? 6.275   -6.295  -4.948  1.00 1.83 ? 25 LEU A C    3  
ATOM   1303  O O    . LEU A 1 25 ? 7.300   -6.931  -5.092  1.00 1.61 ? 25 LEU A O    3  
ATOM   1304  C CB   . LEU A 1 25 ? 5.365   -5.371  -2.784  1.00 2.37 ? 25 LEU A CB   3  
ATOM   1305  C CG   . LEU A 1 25 ? 4.089   -5.392  -1.939  1.00 2.79 ? 25 LEU A CG   3  
ATOM   1306  C CD1  . LEU A 1 25 ? 4.329   -4.637  -0.632  1.00 2.98 ? 25 LEU A CD1  3  
ATOM   1307  C CD2  . LEU A 1 25 ? 2.954   -4.718  -2.713  1.00 3.16 ? 25 LEU A CD2  3  
ATOM   1308  H H    . LEU A 1 25 ? 6.807   -7.669  -2.593  1.00 1.90 ? 25 LEU A H    3  
ATOM   1309  H HA   . LEU A 1 25 ? 4.355   -6.768  -4.077  1.00 2.48 ? 25 LEU A HA   3  
ATOM   1310  H HB2  . LEU A 1 25 ? 6.227   -5.435  -2.137  1.00 2.21 ? 25 LEU A HB2  3  
ATOM   1311  H HB3  . LEU A 1 25 ? 5.404   -4.451  -3.348  1.00 2.46 ? 25 LEU A HB3  3  
ATOM   1312  H HG   . LEU A 1 25 ? 3.820   -6.415  -1.719  1.00 2.84 ? 25 LEU A HG   3  
ATOM   1313  H HD11 . LEU A 1 25 ? 4.828   -3.702  -0.841  1.00 3.28 ? 25 LEU A HD11 3  
ATOM   1314  H HD12 . LEU A 1 25 ? 3.382   -4.439  -0.152  1.00 3.19 ? 25 LEU A HD12 3  
ATOM   1315  H HD13 . LEU A 1 25 ? 4.946   -5.236  0.022   1.00 3.12 ? 25 LEU A HD13 3  
ATOM   1316  H HD21 . LEU A 1 25 ? 3.291   -3.763  -3.087  1.00 3.34 ? 25 LEU A HD21 3  
ATOM   1317  H HD22 . LEU A 1 25 ? 2.662   -5.346  -3.542  1.00 3.42 ? 25 LEU A HD22 3  
ATOM   1318  H HD23 . LEU A 1 25 ? 2.109   -4.570  -2.057  1.00 3.48 ? 25 LEU A HD23 3  
ATOM   1319  N N    . LYS A 1 26 ? 5.897   -5.355  -5.799  1.00 1.82 ? 26 LYS A N    3  
ATOM   1320  C CA   . LYS A 1 26 ? 6.709   -4.995  -7.025  1.00 1.53 ? 26 LYS A CA   3  
ATOM   1321  C C    . LYS A 1 26 ? 7.717   -6.096  -7.395  1.00 1.23 ? 26 LYS A C    3  
ATOM   1322  O O    . LYS A 1 26 ? 8.895   -6.007  -7.092  1.00 1.11 ? 26 LYS A O    3  
ATOM   1323  C CB   . LYS A 1 26 ? 7.436   -3.664  -6.709  1.00 1.65 ? 26 LYS A CB   3  
ATOM   1324  C CG   . LYS A 1 26 ? 7.552   -3.413  -5.195  1.00 1.92 ? 26 LYS A CG   3  
ATOM   1325  C CD   . LYS A 1 26 ? 8.684   -4.260  -4.604  1.00 1.80 ? 26 LYS A CD   3  
ATOM   1326  C CE   . LYS A 1 26 ? 10.034  -3.767  -5.136  1.00 1.75 ? 26 LYS A CE   3  
ATOM   1327  N NZ   . LYS A 1 26 ? 10.729  -4.995  -5.620  1.00 1.59 ? 26 LYS A NZ   3  
ATOM   1328  H H    . LYS A 1 26 ? 5.062   -4.874  -5.630  1.00 2.03 ? 26 LYS A H    3  
ATOM   1329  H HA   . LYS A 1 26 ? 6.039   -4.837  -7.858  1.00 1.54 ? 26 LYS A HA   3  
ATOM   1330  H HB2  . LYS A 1 26 ? 8.426   -3.695  -7.137  1.00 1.49 ? 26 LYS A HB2  3  
ATOM   1331  H HB3  . LYS A 1 26 ? 6.885   -2.851  -7.160  1.00 1.79 ? 26 LYS A HB3  3  
ATOM   1332  H HG2  . LYS A 1 26 ? 7.762   -2.367  -5.024  1.00 2.09 ? 26 LYS A HG2  3  
ATOM   1333  H HG3  . LYS A 1 26 ? 6.623   -3.671  -4.712  1.00 2.09 ? 26 LYS A HG3  3  
ATOM   1334  H HD2  . LYS A 1 26 ? 8.669   -4.177  -3.528  1.00 1.97 ? 26 LYS A HD2  3  
ATOM   1335  H HD3  . LYS A 1 26 ? 8.545   -5.291  -4.886  1.00 1.64 ? 26 LYS A HD3  3  
ATOM   1336  H HE2  . LYS A 1 26 ? 9.886   -3.070  -5.949  1.00 1.85 ? 26 LYS A HE2  3  
ATOM   1337  H HE3  . LYS A 1 26 ? 10.605  -3.307  -4.345  1.00 1.81 ? 26 LYS A HE3  3  
ATOM   1338  H HZ1  . LYS A 1 26 ? 10.082  -5.544  -6.233  1.00 1.34 ? 26 LYS A HZ1  3  
ATOM   1339  H HZ2  . LYS A 1 26 ? 11.573  -4.720  -6.173  1.00 1.71 ? 26 LYS A HZ2  3  
ATOM   1340  H HZ3  . LYS A 1 26 ? 11.018  -5.578  -4.808  1.00 1.78 ? 26 LYS A HZ3  3  
ATOM   1341  N N    . GLU A 1 27 ? 7.254   -7.137  -8.044  1.00 1.18 ? 27 GLU A N    3  
ATOM   1342  C CA   . GLU A 1 27 ? 8.167   -8.256  -8.433  1.00 1.01 ? 27 GLU A CA   3  
ATOM   1343  C C    . GLU A 1 27 ? 9.104   -7.821  -9.570  1.00 0.79 ? 27 GLU A C    3  
ATOM   1344  O O    . GLU A 1 27 ? 8.938   -8.211  -10.712 1.00 0.84 ? 27 GLU A O    3  
ATOM   1345  C CB   . GLU A 1 27 ? 7.241   -9.390  -8.895  1.00 1.25 ? 27 GLU A CB   3  
ATOM   1346  C CG   . GLU A 1 27 ? 6.486   -9.971  -7.691  1.00 1.49 ? 27 GLU A CG   3  
ATOM   1347  C CD   . GLU A 1 27 ? 7.473   -10.630 -6.724  1.00 1.43 ? 27 GLU A CD   3  
ATOM   1348  O OE1  . GLU A 1 27 ? 8.130   -11.578 -7.127  1.00 1.77 ? 27 GLU A OE1  3  
ATOM   1349  O OE2  . GLU A 1 27 ? 7.552   -10.178 -5.594  1.00 1.56 ? 27 GLU A OE2  3  
ATOM   1350  H H    . GLU A 1 27 ? 6.302   -7.184  -8.270  1.00 1.35 ? 27 GLU A H    3  
ATOM   1351  H HA   . GLU A 1 27 ? 8.743   -8.581  -7.580  1.00 1.02 ? 27 GLU A HA   3  
ATOM   1352  H HB2  . GLU A 1 27 ? 6.531   -9.002  -9.612  1.00 1.34 ? 27 GLU A HB2  3  
ATOM   1353  H HB3  . GLU A 1 27 ? 7.830   -10.168 -9.358  1.00 1.27 ? 27 GLU A HB3  3  
ATOM   1354  H HG2  . GLU A 1 27 ? 5.959   -9.178  -7.181  1.00 1.60 ? 27 GLU A HG2  3  
ATOM   1355  H HG3  . GLU A 1 27 ? 5.778   -10.709 -8.035  1.00 1.80 ? 27 GLU A HG3  3  
ATOM   1356  N N    . GLU A 1 28 ? 10.091  -7.016  -9.259  1.00 0.72 ? 28 GLU A N    3  
ATOM   1357  C CA   . GLU A 1 28 ? 11.053  -6.552  -10.308 1.00 0.75 ? 28 GLU A CA   3  
ATOM   1358  C C    . GLU A 1 28 ? 11.793  -7.755  -10.908 1.00 0.67 ? 28 GLU A C    3  
ATOM   1359  O O    . GLU A 1 28 ? 11.985  -7.841  -12.106 1.00 0.98 ? 28 GLU A O    3  
ATOM   1360  C CB   . GLU A 1 28 ? 12.036  -5.632  -9.578  1.00 1.07 ? 28 GLU A CB   3  
ATOM   1361  C CG   . GLU A 1 28 ? 11.305  -4.378  -9.085  1.00 1.32 ? 28 GLU A CG   3  
ATOM   1362  C CD   . GLU A 1 28 ? 12.278  -3.495  -8.304  1.00 1.79 ? 28 GLU A CD   3  
ATOM   1363  O OE1  . GLU A 1 28 ? 12.512  -3.788  -7.142  1.00 1.93 ? 28 GLU A OE1  3  
ATOM   1364  O OE2  . GLU A 1 28 ? 12.771  -2.539  -8.878  1.00 2.12 ? 28 GLU A OE2  3  
ATOM   1365  H H    . GLU A 1 28 ? 10.201  -6.719  -8.331  1.00 0.82 ? 28 GLU A H    3  
ATOM   1366  H HA   . GLU A 1 28 ? 10.536  -6.005  -11.081 1.00 0.88 ? 28 GLU A HA   3  
ATOM   1367  H HB2  . GLU A 1 28 ? 12.462  -6.156  -8.735  1.00 1.11 ? 28 GLU A HB2  3  
ATOM   1368  H HB3  . GLU A 1 28 ? 12.826  -5.340  -10.255 1.00 1.24 ? 28 GLU A HB3  3  
ATOM   1369  H HG2  . GLU A 1 28 ? 10.919  -3.831  -9.931  1.00 1.38 ? 28 GLU A HG2  3  
ATOM   1370  H HG3  . GLU A 1 28 ? 10.489  -4.665  -8.441  1.00 1.21 ? 28 GLU A HG3  3  
ATOM   1371  N N    . MET A 1 29 ? 12.196  -8.686  -10.079 1.00 0.71 ? 29 MET A N    3  
ATOM   1372  C CA   . MET A 1 29 ? 12.912  -9.894  -10.587 1.00 0.87 ? 29 MET A CA   3  
ATOM   1373  C C    . MET A 1 29 ? 11.975  -11.108 -10.547 1.00 1.03 ? 29 MET A C    3  
ATOM   1374  O O    . MET A 1 29 ? 11.169  -11.251 -9.643  1.00 1.10 ? 29 MET A O    3  
ATOM   1375  C CB   . MET A 1 29 ? 14.094  -10.086 -9.631  1.00 1.05 ? 29 MET A CB   3  
ATOM   1376  C CG   . MET A 1 29 ? 14.951  -11.266 -10.096 1.00 1.35 ? 29 MET A CG   3  
ATOM   1377  S SD   . MET A 1 29 ? 16.174  -11.663 -8.823  1.00 2.11 ? 29 MET A SD   3  
ATOM   1378  C CE   . MET A 1 29 ? 16.050  -13.465 -8.939  1.00 2.78 ? 29 MET A CE   3  
ATOM   1379  H H    . MET A 1 29 ? 12.019  -8.594  -9.119  1.00 0.93 ? 29 MET A H    3  
ATOM   1380  H HA   . MET A 1 29 ? 13.271  -9.727  -11.591 1.00 1.01 ? 29 MET A HA   3  
ATOM   1381  H HB2  . MET A 1 29 ? 14.695  -9.186  -9.620  1.00 1.17 ? 29 MET A HB2  3  
ATOM   1382  H HB3  . MET A 1 29 ? 13.725  -10.282 -8.635  1.00 1.19 ? 29 MET A HB3  3  
ATOM   1383  H HG2  . MET A 1 29 ? 14.319  -12.125 -10.268 1.00 1.81 ? 29 MET A HG2  3  
ATOM   1384  H HG3  . MET A 1 29 ? 15.458  -11.004 -11.013 1.00 1.69 ? 29 MET A HG3  3  
ATOM   1385  H HE1  . MET A 1 29 ? 15.073  -13.737 -9.304  1.00 3.21 ? 29 MET A HE1  3  
ATOM   1386  H HE2  . MET A 1 29 ? 16.803  -13.833 -9.622  1.00 3.15 ? 29 MET A HE2  3  
ATOM   1387  H HE3  . MET A 1 29 ? 16.201  -13.898 -7.960  1.00 3.18 ? 29 MET A HE3  3  
ATOM   1388  N N    . ALA A 1 30 ? 12.076  -11.980 -11.518 1.00 1.46 ? 30 ALA A N    3  
ATOM   1389  C CA   . ALA A 1 30 ? 11.193  -13.192 -11.544 1.00 1.75 ? 30 ALA A CA   3  
ATOM   1390  C C    . ALA A 1 30 ? 11.586  -14.173 -10.429 1.00 1.74 ? 30 ALA A C    3  
ATOM   1391  O O    . ALA A 1 30 ? 12.765  -14.256 -10.116 1.00 1.79 ? 30 ALA A O    3  
ATOM   1392  C CB   . ALA A 1 30 ? 11.418  -13.825 -12.920 1.00 2.14 ? 30 ALA A CB   3  
ATOM   1393  O OXT  . ALA A 1 30 ? 10.697  -14.823 -9.903  1.00 1.91 ? 30 ALA A OXT  3  
ATOM   1394  H H    . ALA A 1 30 ? 12.734  -11.840 -12.229 1.00 1.73 ? 30 ALA A H    3  
ATOM   1395  H HA   . ALA A 1 30 ? 10.160  -12.903 -11.439 1.00 1.90 ? 30 ALA A HA   3  
ATOM   1396  H HB1  . ALA A 1 30 ? 11.197  -13.102 -13.690 1.00 2.45 ? 30 ALA A HB1  3  
ATOM   1397  H HB2  . ALA A 1 30 ? 12.447  -14.142 -13.008 1.00 2.50 ? 30 ALA A HB2  3  
ATOM   1398  H HB3  . ALA A 1 30 ? 10.768  -14.681 -13.032 1.00 2.47 ? 30 ALA A HB3  3  
ATOM   1399  N N    . MET A 1 1  ? 8.719   13.589  17.000  1.00 6.21 ? 1  MET A N    4  
ATOM   1400  C CA   . MET A 1 1  ? 7.703   12.579  17.425  1.00 6.11 ? 1  MET A CA   4  
ATOM   1401  C C    . MET A 1 1  ? 7.491   11.536  16.318  1.00 5.61 ? 1  MET A C    4  
ATOM   1402  O O    . MET A 1 1  ? 7.675   11.818  15.149  1.00 5.29 ? 1  MET A O    4  
ATOM   1403  C CB   . MET A 1 1  ? 6.417   13.378  17.666  1.00 5.91 ? 1  MET A CB   4  
ATOM   1404  C CG   . MET A 1 1  ? 5.719   12.862  18.928  1.00 6.48 ? 1  MET A CG   4  
ATOM   1405  S SD   . MET A 1 1  ? 6.703   13.298  20.382  1.00 6.99 ? 1  MET A SD   4  
ATOM   1406  C CE   . MET A 1 1  ? 5.508   12.766  21.633  1.00 7.61 ? 1  MET A CE   4  
ATOM   1407  H H1   . MET A 1 1  ? 8.395   14.066  16.133  1.00 6.37 ? 1  MET A H1   4  
ATOM   1408  H H2   . MET A 1 1  ? 8.848   14.293  17.755  1.00 6.47 ? 1  MET A H2   4  
ATOM   1409  H H3   . MET A 1 1  ? 9.626   13.114  16.815  1.00 6.14 ? 1  MET A H3   4  
ATOM   1410  H HA   . MET A 1 1  ? 8.013   12.096  18.339  1.00 6.71 ? 1  MET A HA   4  
ATOM   1411  H HB2  . MET A 1 1  ? 6.659   14.424  17.792  1.00 5.95 ? 1  MET A HB2  4  
ATOM   1412  H HB3  . MET A 1 1  ? 5.755   13.262  16.819  1.00 5.57 ? 1  MET A HB3  4  
ATOM   1413  H HG2  . MET A 1 1  ? 4.740   13.312  19.007  1.00 6.54 ? 1  MET A HG2  4  
ATOM   1414  H HG3  . MET A 1 1  ? 5.617   11.788  18.870  1.00 6.77 ? 1  MET A HG3  4  
ATOM   1415  H HE1  . MET A 1 1  ? 5.275   11.720  21.486  1.00 7.87 ? 1  MET A HE1  4  
ATOM   1416  H HE2  . MET A 1 1  ? 5.929   12.911  22.618  1.00 7.83 ? 1  MET A HE2  4  
ATOM   1417  H HE3  . MET A 1 1  ? 4.605   13.348  21.543  1.00 7.78 ? 1  MET A HE3  4  
ATOM   1418  N N    . ILE A 1 2  ? 7.107   10.338  16.679  1.00 5.66 ? 2  ILE A N    4  
ATOM   1419  C CA   . ILE A 1 2  ? 6.882   9.272   15.651  1.00 5.30 ? 2  ILE A CA   4  
ATOM   1420  C C    . ILE A 1 2  ? 5.451   8.725   15.761  1.00 4.77 ? 2  ILE A C    4  
ATOM   1421  O O    . ILE A 1 2  ? 4.905   8.608   16.842  1.00 4.93 ? 2  ILE A O    4  
ATOM   1422  C CB   . ILE A 1 2  ? 7.909   8.179   15.977  1.00 5.88 ? 2  ILE A CB   4  
ATOM   1423  C CG1  . ILE A 1 2  ? 9.327   8.732   15.789  1.00 6.52 ? 2  ILE A CG1  4  
ATOM   1424  C CG2  . ILE A 1 2  ? 7.709   6.984   15.041  1.00 5.74 ? 2  ILE A CG2  4  
ATOM   1425  C CD1  . ILE A 1 2  ? 10.011  8.866   17.151  1.00 7.22 ? 2  ILE A CD1  4  
ATOM   1426  H H    . ILE A 1 2  ? 6.965   10.134  17.628  1.00 6.02 ? 2  ILE A H    4  
ATOM   1427  H HA   . ILE A 1 2  ? 7.060   9.661   14.661  1.00 5.19 ? 2  ILE A HA   4  
ATOM   1428  H HB   . ILE A 1 2  ? 7.779   7.858   17.000  1.00 6.08 ? 2  ILE A HB   4  
ATOM   1429  H HG12 . ILE A 1 2  ? 9.897   8.055   15.166  1.00 6.62 ? 2  ILE A HG12 4  
ATOM   1430  H HG13 . ILE A 1 2  ? 9.278   9.700   15.315  1.00 6.51 ? 2  ILE A HG13 4  
ATOM   1431  H HG21 . ILE A 1 2  ? 7.728   7.321   14.015  1.00 5.65 ? 2  ILE A HG21 4  
ATOM   1432  H HG22 . ILE A 1 2  ? 8.503   6.267   15.197  1.00 5.58 ? 2  ILE A HG22 4  
ATOM   1433  H HG23 . ILE A 1 2  ? 6.757   6.517   15.249  1.00 6.15 ? 2  ILE A HG23 4  
ATOM   1434  H HD11 . ILE A 1 2  ? 9.376   9.430   17.819  1.00 7.41 ? 2  ILE A HD11 4  
ATOM   1435  H HD12 . ILE A 1 2  ? 10.185  7.884   17.565  1.00 7.45 ? 2  ILE A HD12 4  
ATOM   1436  H HD13 . ILE A 1 2  ? 10.954  9.378   17.032  1.00 7.56 ? 2  ILE A HD13 4  
ATOM   1437  N N    . SER A 1 3  ? 4.846   8.385   14.648  1.00 4.30 ? 3  SER A N    4  
ATOM   1438  C CA   . SER A 1 3  ? 3.451   7.841   14.684  1.00 3.96 ? 3  SER A CA   4  
ATOM   1439  C C    . SER A 1 3  ? 3.464   6.318   14.472  1.00 4.15 ? 3  SER A C    4  
ATOM   1440  O O    . SER A 1 3  ? 4.496   5.729   14.212  1.00 4.58 ? 3  SER A O    4  
ATOM   1441  C CB   . SER A 1 3  ? 2.721   8.537   13.533  1.00 3.42 ? 3  SER A CB   4  
ATOM   1442  O OG   . SER A 1 3  ? 1.339   8.198   13.579  1.00 3.30 ? 3  SER A OG   4  
ATOM   1443  H H    . SER A 1 3  ? 5.309   8.486   13.791  1.00 4.30 ? 3  SER A H    4  
ATOM   1444  H HA   . SER A 1 3  ? 2.977   8.087   15.622  1.00 4.16 ? 3  SER A HA   4  
ATOM   1445  H HB2  . SER A 1 3  ? 2.829   9.604   13.628  1.00 3.47 ? 3  SER A HB2  4  
ATOM   1446  H HB3  . SER A 1 3  ? 3.150   8.216   12.592  1.00 3.33 ? 3  SER A HB3  4  
ATOM   1447  H HG   . SER A 1 3  ? 0.874   8.899   14.044  1.00 3.32 ? 3  SER A HG   4  
ATOM   1448  N N    . SER A 1 4  ? 2.323   5.681   14.576  1.00 3.99 ? 4  SER A N    4  
ATOM   1449  C CA   . SER A 1 4  ? 2.261   4.199   14.377  1.00 4.41 ? 4  SER A CA   4  
ATOM   1450  C C    . SER A 1 4  ? 1.500   3.874   13.087  1.00 4.13 ? 4  SER A C    4  
ATOM   1451  O O    . SER A 1 4  ? 2.081   3.457   12.103  1.00 4.01 ? 4  SER A O    4  
ATOM   1452  C CB   . SER A 1 4  ? 1.514   3.662   15.604  1.00 5.00 ? 4  SER A CB   4  
ATOM   1453  O OG   . SER A 1 4  ? 0.263   4.333   15.730  1.00 4.88 ? 4  SER A OG   4  
ATOM   1454  H H    . SER A 1 4  ? 1.503   6.178   14.781  1.00 3.71 ? 4  SER A H    4  
ATOM   1455  H HA   . SER A 1 4  ? 3.251   3.783   14.340  1.00 4.64 ? 4  SER A HA   4  
ATOM   1456  H HB2  . SER A 1 4  ? 1.340   2.606   15.487  1.00 5.43 ? 4  SER A HB2  4  
ATOM   1457  H HB3  . SER A 1 4  ? 2.115   3.829   16.489  1.00 5.18 ? 4  SER A HB3  4  
ATOM   1458  H HG   . SER A 1 4  ? -0.096  4.133   16.599  1.00 5.20 ? 4  SER A HG   4  
ATOM   1459  N N    . VAL A 1 5  ? 0.208   4.068   13.088  1.00 4.13 ? 5  VAL A N    4  
ATOM   1460  C CA   . VAL A 1 5  ? -0.605  3.783   11.864  1.00 3.95 ? 5  VAL A CA   4  
ATOM   1461  C C    . VAL A 1 5  ? -0.586  4.985   10.909  1.00 3.38 ? 5  VAL A C    4  
ATOM   1462  O O    . VAL A 1 5  ? -0.761  4.835   9.716   1.00 3.15 ? 5  VAL A O    4  
ATOM   1463  C CB   . VAL A 1 5  ? -2.025  3.506   12.379  1.00 4.43 ? 5  VAL A CB   4  
ATOM   1464  C CG1  . VAL A 1 5  ? -2.706  4.815   12.796  1.00 4.38 ? 5  VAL A CG1  4  
ATOM   1465  C CG2  . VAL A 1 5  ? -2.847  2.839   11.274  1.00 4.54 ? 5  VAL A CG2  4  
ATOM   1466  H H    . VAL A 1 5  ? -0.227  4.408   13.898  1.00 4.33 ? 5  VAL A H    4  
ATOM   1467  H HA   . VAL A 1 5  ? -0.223  2.911   11.364  1.00 4.00 ? 5  VAL A HA   4  
ATOM   1468  H HB   . VAL A 1 5  ? -1.971  2.847   13.234  1.00 4.82 ? 5  VAL A HB   4  
ATOM   1469  H HG11 . VAL A 1 5  ? -2.057  5.363   13.463  1.00 4.08 ? 5  VAL A HG11 4  
ATOM   1470  H HG12 . VAL A 1 5  ? -2.908  5.411   11.918  1.00 4.59 ? 5  VAL A HG12 4  
ATOM   1471  H HG13 . VAL A 1 5  ? -3.635  4.592   13.301  1.00 4.74 ? 5  VAL A HG13 4  
ATOM   1472  H HG21 . VAL A 1 5  ? -2.312  1.982   10.894  1.00 4.70 ? 5  VAL A HG21 4  
ATOM   1473  H HG22 . VAL A 1 5  ? -3.799  2.522   11.675  1.00 4.42 ? 5  VAL A HG22 4  
ATOM   1474  H HG23 . VAL A 1 5  ? -3.012  3.546   10.473  1.00 4.90 ? 5  VAL A HG23 4  
ATOM   1475  N N    . CYS A 1 6  ? -0.373  6.171   11.439  1.00 3.21 ? 6  CYS A N    4  
ATOM   1476  C CA   . CYS A 1 6  ? -0.335  7.416   10.602  1.00 2.76 ? 6  CYS A CA   4  
ATOM   1477  C C    . CYS A 1 6  ? -1.715  7.718   9.997   1.00 2.87 ? 6  CYS A C    4  
ATOM   1478  O O    . CYS A 1 6  ? -2.534  6.839   9.803   1.00 3.16 ? 6  CYS A O    4  
ATOM   1479  C CB   . CYS A 1 6  ? 0.724   7.157   9.514   1.00 2.39 ? 6  CYS A CB   4  
ATOM   1480  S SG   . CYS A 1 6  ? -0.056  7.006   7.884   1.00 2.24 ? 6  CYS A SG   4  
ATOM   1481  H H    . CYS A 1 6  ? -0.238  6.243   12.403  1.00 3.45 ? 6  CYS A H    4  
ATOM   1482  H HA   . CYS A 1 6  ? -0.020  8.249   11.212  1.00 2.73 ? 6  CYS A HA   4  
ATOM   1483  H HB2  . CYS A 1 6  ? 1.424   7.978   9.496   1.00 2.19 ? 6  CYS A HB2  4  
ATOM   1484  H HB3  . CYS A 1 6  ? 1.254   6.243   9.742   1.00 2.58 ? 6  CYS A HB3  4  
ATOM   1485  H HG   . CYS A 1 6  ? -0.553  6.184   7.866   1.00 2.44 ? 6  CYS A HG   4  
ATOM   1486  N N    . VAL A 1 7  ? -1.975  8.966   9.704   1.00 2.79 ? 7  VAL A N    4  
ATOM   1487  C CA   . VAL A 1 7  ? -3.297  9.346   9.112   1.00 3.10 ? 7  VAL A CA   4  
ATOM   1488  C C    . VAL A 1 7  ? -3.327  9.019   7.614   1.00 3.00 ? 7  VAL A C    4  
ATOM   1489  O O    . VAL A 1 7  ? -4.325  8.568   7.086   1.00 3.32 ? 7  VAL A O    4  
ATOM   1490  C CB   . VAL A 1 7  ? -3.434  10.858  9.356   1.00 3.16 ? 7  VAL A CB   4  
ATOM   1491  C CG1  . VAL A 1 7  ? -2.432  11.640  8.498   1.00 2.93 ? 7  VAL A CG1  4  
ATOM   1492  C CG2  . VAL A 1 7  ? -4.854  11.303  9.001   1.00 3.65 ? 7  VAL A CG2  4  
ATOM   1493  H H    . VAL A 1 7  ? -1.299  9.654   9.876   1.00 2.62 ? 7  VAL A H    4  
ATOM   1494  H HA   . VAL A 1 7  ? -4.089  8.822   9.615   1.00 3.43 ? 7  VAL A HA   4  
ATOM   1495  H HB   . VAL A 1 7  ? -3.244  11.065  10.398  1.00 3.14 ? 7  VAL A HB   4  
ATOM   1496  H HG11 . VAL A 1 7  ? -1.446  11.217  8.617   1.00 2.64 ? 7  VAL A HG11 4  
ATOM   1497  H HG12 . VAL A 1 7  ? -2.726  11.583  7.460   1.00 3.02 ? 7  VAL A HG12 4  
ATOM   1498  H HG13 . VAL A 1 7  ? -2.420  12.673  8.812   1.00 3.10 ? 7  VAL A HG13 4  
ATOM   1499  H HG21 . VAL A 1 7  ? -5.071  11.035  7.978   1.00 3.82 ? 7  VAL A HG21 4  
ATOM   1500  H HG22 . VAL A 1 7  ? -5.560  10.817  9.657   1.00 3.98 ? 7  VAL A HG22 4  
ATOM   1501  H HG23 . VAL A 1 7  ? -4.935  12.374  9.116   1.00 3.78 ? 7  VAL A HG23 4  
HETATM 1502  N N    . SEP A 1 8  ? -2.236  9.247   6.935   1.00 2.62 ? 8  SEP A N    4  
HETATM 1503  C CA   . SEP A 1 8  ? -2.164  8.960   5.468   1.00 2.52 ? 8  SEP A CA   4  
HETATM 1504  C CB   . SEP A 1 8  ? -3.033  10.032  4.803   1.00 2.98 ? 8  SEP A CB   4  
HETATM 1505  O OG   . SEP A 1 8  ? -3.774  9.443   3.726   1.00 3.23 ? 8  SEP A OG   4  
HETATM 1506  C C    . SEP A 1 8  ? -0.712  9.064   4.992   1.00 2.10 ? 8  SEP A C    4  
HETATM 1507  O O    . SEP A 1 8  ? -0.144  8.107   4.506   1.00 1.81 ? 8  SEP A O    4  
HETATM 1508  P P    . SEP A 1 8  ? -5.307  8.991   3.930   1.00 3.75 ? 8  SEP A P    4  
HETATM 1509  O O1P  . SEP A 1 8  ? -5.935  9.908   4.908   1.00 4.08 ? 8  SEP A O1P  4  
HETATM 1510  O O2P  . SEP A 1 8  ? -5.917  8.809   2.594   1.00 4.01 ? 8  SEP A O2P  4  
HETATM 1511  O O3P  . SEP A 1 8  ? -5.161  7.544   4.618   1.00 3.72 ? 8  SEP A O3P  4  
HETATM 1512  H H    . SEP A 1 8  ? -1.454  9.609   7.399   1.00 2.44 ? 8  SEP A H    4  
HETATM 1513  H HA   . SEP A 1 8  ? -2.557  7.982   5.257   1.00 2.57 ? 8  SEP A HA   4  
HETATM 1514  H HB2  . SEP A 1 8  ? -2.401  10.823  4.425   1.00 2.93 ? 8  SEP A HB2  4  
HETATM 1515  H HB3  . SEP A 1 8  ? -3.720  10.441  5.525   1.00 3.23 ? 8  SEP A HB3  4  
HETATM 1516  H HOP3 . SEP A 1 8  ? -4.744  7.675   5.471   1.00 3.68 ? 8  SEP A HOP3 4  
ATOM   1517  N N    . SER A 1 9  ? -0.119  10.225  5.157   1.00 2.16 ? 9  SER A N    4  
ATOM   1518  C CA   . SER A 1 9  ? 1.309   10.455  4.748   1.00 2.00 ? 9  SER A CA   4  
ATOM   1519  C C    . SER A 1 9  ? 1.513   10.239  3.244   1.00 2.10 ? 9  SER A C    4  
ATOM   1520  O O    . SER A 1 9  ? 1.423   9.135   2.754   1.00 1.95 ? 9  SER A O    4  
ATOM   1521  C CB   . SER A 1 9  ? 2.138   9.448   5.542   1.00 1.65 ? 9  SER A CB   4  
ATOM   1522  O OG   . SER A 1 9  ? 1.936   9.661   6.936   1.00 1.86 ? 9  SER A OG   4  
ATOM   1523  H H    . SER A 1 9  ? -0.617  10.956  5.570   1.00 2.39 ? 9  SER A H    4  
ATOM   1524  H HA   . SER A 1 9  ? 1.609   11.455  5.018   1.00 2.22 ? 9  SER A HA   4  
ATOM   1525  H HB2  . SER A 1 9  ? 1.833   8.449   5.282   1.00 1.47 ? 9  SER A HB2  4  
ATOM   1526  H HB3  . SER A 1 9  ? 3.183   9.579   5.292   1.00 1.69 ? 9  SER A HB3  4  
ATOM   1527  H HG   . SER A 1 9  ? 2.332   8.924   7.410   1.00 2.00 ? 9  SER A HG   4  
ATOM   1528  N N    . TYR A 1 10 ? 1.821   11.297  2.531   1.00 2.45 ? 10 TYR A N    4  
ATOM   1529  C CA   . TYR A 1 10 ? 2.077   11.221  1.051   1.00 2.78 ? 10 TYR A CA   4  
ATOM   1530  C C    . TYR A 1 10 ? 0.979   10.428  0.301   1.00 2.80 ? 10 TYR A C    4  
ATOM   1531  O O    . TYR A 1 10 ? 0.019   9.958   0.882   1.00 2.75 ? 10 TYR A O    4  
ATOM   1532  C CB   . TYR A 1 10 ? 3.490   10.591  0.947   1.00 2.64 ? 10 TYR A CB   4  
ATOM   1533  C CG   . TYR A 1 10 ? 3.463   9.189   0.378   1.00 2.26 ? 10 TYR A CG   4  
ATOM   1534  C CD1  . TYR A 1 10 ? 3.324   8.087   1.229   1.00 1.77 ? 10 TYR A CD1  4  
ATOM   1535  C CD2  . TYR A 1 10 ? 3.598   8.997   -0.998  1.00 2.47 ? 10 TYR A CD2  4  
ATOM   1536  C CE1  . TYR A 1 10 ? 3.316   6.793   0.698   1.00 1.48 ? 10 TYR A CE1  4  
ATOM   1537  C CE2  . TYR A 1 10 ? 3.587   7.704   -1.530  1.00 2.23 ? 10 TYR A CE2  4  
ATOM   1538  C CZ   . TYR A 1 10 ? 3.445   6.600   -0.680  1.00 1.73 ? 10 TYR A CZ   4  
ATOM   1539  O OH   . TYR A 1 10 ? 3.433   5.325   -1.201  1.00 1.59 ? 10 TYR A OH   4  
ATOM   1540  H H    . TYR A 1 10 ? 1.907   12.157  2.980   1.00 2.55 ? 10 TYR A H    4  
ATOM   1541  H HA   . TYR A 1 10 ? 2.116   12.221  0.651   1.00 3.20 ? 10 TYR A HA   4  
ATOM   1542  H HB2  . TYR A 1 10 ? 4.101   11.208  0.308   1.00 3.03 ? 10 TYR A HB2  4  
ATOM   1543  H HB3  . TYR A 1 10 ? 3.933   10.561  1.931   1.00 2.54 ? 10 TYR A HB3  4  
ATOM   1544  H HD1  . TYR A 1 10 ? 3.221   8.237   2.296   1.00 1.71 ? 10 TYR A HD1  4  
ATOM   1545  H HD2  . TYR A 1 10 ? 3.706   9.851   -1.649  1.00 2.89 ? 10 TYR A HD2  4  
ATOM   1546  H HE1  . TYR A 1 10 ? 3.207   5.942   1.353   1.00 1.18 ? 10 TYR A HE1  4  
ATOM   1547  H HE2  . TYR A 1 10 ? 3.687   7.558   -2.594  1.00 2.49 ? 10 TYR A HE2  4  
ATOM   1548  H HH   . TYR A 1 10 ? 2.560   4.953   -1.053  1.00 1.36 ? 10 TYR A HH   4  
ATOM   1549  N N    . ARG A 1 11 ? 1.106   10.308  -0.998  1.00 3.01 ? 11 ARG A N    4  
ATOM   1550  C CA   . ARG A 1 11 ? 0.083   9.568   -1.803  1.00 3.13 ? 11 ARG A CA   4  
ATOM   1551  C C    . ARG A 1 11 ? 0.213   8.052   -1.566  1.00 2.57 ? 11 ARG A C    4  
ATOM   1552  O O    . ARG A 1 11 ? 0.681   7.618   -0.532  1.00 2.11 ? 11 ARG A O    4  
ATOM   1553  C CB   . ARG A 1 11 ? 0.404   9.935   -3.258  1.00 3.57 ? 11 ARG A CB   4  
ATOM   1554  C CG   . ARG A 1 11 ? -0.154  11.327  -3.573  1.00 4.25 ? 11 ARG A CG   4  
ATOM   1555  C CD   . ARG A 1 11 ? -0.898  11.291  -4.912  1.00 4.58 ? 11 ARG A CD   4  
ATOM   1556  N NE   . ARG A 1 11 ? -2.192  11.986  -4.653  1.00 4.90 ? 11 ARG A NE   4  
ATOM   1557  C CZ   . ARG A 1 11 ? -2.524  13.032  -5.352  1.00 5.46 ? 11 ARG A CZ   4  
ATOM   1558  N NH1  . ARG A 1 11 ? -2.094  14.210  -5.001  1.00 5.82 ? 11 ARG A NH1  4  
ATOM   1559  N NH2  . ARG A 1 11 ? -3.285  12.899  -6.399  1.00 5.83 ? 11 ARG A NH2  4  
ATOM   1560  H H    . ARG A 1 11 ? 1.874   10.716  -1.448  1.00 3.14 ? 11 ARG A H    4  
ATOM   1561  H HA   . ARG A 1 11 ? -0.908  9.899   -1.551  1.00 3.39 ? 11 ARG A HA   4  
ATOM   1562  H HB2  . ARG A 1 11 ? 1.476   9.937   -3.400  1.00 3.55 ? 11 ARG A HB2  4  
ATOM   1563  H HB3  . ARG A 1 11 ? -0.041  9.214   -3.921  1.00 3.51 ? 11 ARG A HB3  4  
ATOM   1564  H HG2  . ARG A 1 11 ? -0.834  11.627  -2.789  1.00 4.36 ? 11 ARG A HG2  4  
ATOM   1565  H HG3  . ARG A 1 11 ? 0.659   12.035  -3.635  1.00 4.49 ? 11 ARG A HG3  4  
ATOM   1566  H HD2  . ARG A 1 11 ? -0.329  11.816  -5.669  1.00 4.87 ? 11 ARG A HD2  4  
ATOM   1567  H HD3  . ARG A 1 11 ? -1.079  10.272  -5.216  1.00 4.48 ? 11 ARG A HD3  4  
ATOM   1568  H HE   . ARG A 1 11 ? -2.796  11.654  -3.955  1.00 4.80 ? 11 ARG A HE   4  
ATOM   1569  H HH11 . ARG A 1 11 ? -1.512  14.308  -4.195  1.00 5.72 ? 11 ARG A HH11 4  
ATOM   1570  H HH12 . ARG A 1 11 ? -2.346  15.015  -5.536  1.00 6.31 ? 11 ARG A HH12 4  
ATOM   1571  H HH21 . ARG A 1 11 ? -3.614  11.993  -6.664  1.00 5.75 ? 11 ARG A HH21 4  
ATOM   1572  H HH22 . ARG A 1 11 ? -3.541  13.700  -6.938  1.00 6.29 ? 11 ARG A HH22 4  
ATOM   1573  N N    . GLY A 1 12 ? -0.185  7.241   -2.514  1.00 2.65 ? 12 GLY A N    4  
ATOM   1574  C CA   . GLY A 1 12 ? -0.060  5.763   -2.339  1.00 2.18 ? 12 GLY A CA   4  
ATOM   1575  C C    . GLY A 1 12 ? 0.935   5.234   -3.366  1.00 2.24 ? 12 GLY A C    4  
ATOM   1576  O O    . GLY A 1 12 ? 0.864   4.098   -3.793  1.00 2.17 ? 12 GLY A O    4  
ATOM   1577  H H    . GLY A 1 12 ? -0.550  7.601   -3.350  1.00 3.05 ? 12 GLY A H    4  
ATOM   1578  H HA2  . GLY A 1 12 ? 0.294   5.544   -1.341  1.00 1.79 ? 12 GLY A HA2  4  
ATOM   1579  H HA3  . GLY A 1 12 ? -1.019  5.296   -2.496  1.00 2.33 ? 12 GLY A HA3  4  
ATOM   1580  N N    . ARG A 1 13 ? 1.856   6.069   -3.776  1.00 2.53 ? 13 ARG A N    4  
ATOM   1581  C CA   . ARG A 1 13 ? 2.859   5.657   -4.791  1.00 2.80 ? 13 ARG A CA   4  
ATOM   1582  C C    . ARG A 1 13 ? 4.286   5.709   -4.213  1.00 2.77 ? 13 ARG A C    4  
ATOM   1583  O O    . ARG A 1 13 ? 5.001   6.683   -4.364  1.00 3.12 ? 13 ARG A O    4  
ATOM   1584  C CB   . ARG A 1 13 ? 2.665   6.660   -5.941  1.00 3.36 ? 13 ARG A CB   4  
ATOM   1585  C CG   . ARG A 1 13 ? 2.854   8.106   -5.449  1.00 3.58 ? 13 ARG A CG   4  
ATOM   1586  C CD   . ARG A 1 13 ? 3.374   8.983   -6.596  1.00 4.02 ? 13 ARG A CD   4  
ATOM   1587  N NE   . ARG A 1 13 ? 4.747   8.472   -6.897  1.00 4.02 ? 13 ARG A NE   4  
ATOM   1588  C CZ   . ARG A 1 13 ? 5.795   9.070   -6.406  1.00 4.27 ? 13 ARG A CZ   4  
ATOM   1589  N NH1  . ARG A 1 13 ? 6.205   8.779   -5.207  1.00 4.53 ? 13 ARG A NH1  4  
ATOM   1590  N NH2  . ARG A 1 13 ? 6.435   9.948   -7.120  1.00 4.43 ? 13 ARG A NH2  4  
ATOM   1591  H H    . ARG A 1 13 ? 1.875   6.978   -3.422  1.00 2.65 ? 13 ARG A H    4  
ATOM   1592  H HA   . ARG A 1 13 ? 2.642   4.662   -5.141  1.00 2.76 ? 13 ARG A HA   4  
ATOM   1593  H HB2  . ARG A 1 13 ? 3.377   6.452   -6.714  1.00 3.59 ? 13 ARG A HB2  4  
ATOM   1594  H HB3  . ARG A 1 13 ? 1.666   6.552   -6.337  1.00 3.43 ? 13 ARG A HB3  4  
ATOM   1595  H HG2  . ARG A 1 13 ? 1.906   8.492   -5.105  1.00 3.64 ? 13 ARG A HG2  4  
ATOM   1596  H HG3  . ARG A 1 13 ? 3.563   8.124   -4.636  1.00 3.47 ? 13 ARG A HG3  4  
ATOM   1597  H HD2  . ARG A 1 13 ? 2.734   8.881   -7.463  1.00 4.14 ? 13 ARG A HD2  4  
ATOM   1598  H HD3  . ARG A 1 13 ? 3.423   10.016  -6.285  1.00 4.30 ? 13 ARG A HD3  4  
ATOM   1599  H HE   . ARG A 1 13 ? 4.860   7.683   -7.467  1.00 3.95 ? 13 ARG A HE   4  
ATOM   1600  H HH11 . ARG A 1 13 ? 5.712   8.096   -4.662  1.00 4.51 ? 13 ARG A HH11 4  
ATOM   1601  H HH12 . ARG A 1 13 ? 7.012   9.234   -4.830  1.00 4.85 ? 13 ARG A HH12 4  
ATOM   1602  H HH21 . ARG A 1 13 ? 6.123   10.166  -8.043  1.00 4.41 ? 13 ARG A HH21 4  
ATOM   1603  H HH22 . ARG A 1 13 ? 7.248   10.401  -6.746  1.00 4.68 ? 13 ARG A HH22 4  
ATOM   1604  N N    . LYS A 1 14 ? 4.703   4.661   -3.548  1.00 2.44 ? 14 LYS A N    4  
ATOM   1605  C CA   . LYS A 1 14 ? 6.075   4.632   -2.956  1.00 2.60 ? 14 LYS A CA   4  
ATOM   1606  C C    . LYS A 1 14 ? 7.131   4.397   -4.050  1.00 3.08 ? 14 LYS A C    4  
ATOM   1607  O O    . LYS A 1 14 ? 7.868   3.426   -4.025  1.00 3.24 ? 14 LYS A O    4  
ATOM   1608  C CB   . LYS A 1 14 ? 6.042   3.466   -1.963  1.00 2.31 ? 14 LYS A CB   4  
ATOM   1609  C CG   . LYS A 1 14 ? 6.103   4.009   -0.537  1.00 2.12 ? 14 LYS A CG   4  
ATOM   1610  C CD   . LYS A 1 14 ? 5.418   3.024   0.413   1.00 1.82 ? 14 LYS A CD   4  
ATOM   1611  C CE   . LYS A 1 14 ? 6.239   2.898   1.701   1.00 2.17 ? 14 LYS A CE   4  
ATOM   1612  N NZ   . LYS A 1 14 ? 5.688   1.697   2.395   1.00 2.25 ? 14 LYS A NZ   4  
ATOM   1613  H H    . LYS A 1 14 ? 4.111   3.891   -3.433  1.00 2.17 ? 14 LYS A H    4  
ATOM   1614  H HA   . LYS A 1 14 ? 6.278   5.553   -2.433  1.00 2.66 ? 14 LYS A HA   4  
ATOM   1615  H HB2  . LYS A 1 14 ? 5.129   2.905   -2.097  1.00 2.07 ? 14 LYS A HB2  4  
ATOM   1616  H HB3  . LYS A 1 14 ? 6.887   2.820   -2.137  1.00 2.59 ? 14 LYS A HB3  4  
ATOM   1617  H HG2  . LYS A 1 14 ? 7.134   4.139   -0.246  1.00 2.42 ? 14 LYS A HG2  4  
ATOM   1618  H HG3  . LYS A 1 14 ? 5.592   4.960   -0.494  1.00 2.02 ? 14 LYS A HG3  4  
ATOM   1619  H HD2  . LYS A 1 14 ? 4.427   3.383   0.648   1.00 1.59 ? 14 LYS A HD2  4  
ATOM   1620  H HD3  . LYS A 1 14 ? 5.347   2.057   -0.063  1.00 1.84 ? 14 LYS A HD3  4  
ATOM   1621  H HE2  . LYS A 1 14 ? 7.286   2.754   1.465   1.00 2.64 ? 14 LYS A HE2  4  
ATOM   1622  H HE3  . LYS A 1 14 ? 6.107   3.775   2.317   1.00 2.25 ? 14 LYS A HE3  4  
ATOM   1623  H HZ1  . LYS A 1 14 ? 4.674   1.837   2.584   1.00 2.41 ? 14 LYS A HZ1  4  
ATOM   1624  H HZ2  . LYS A 1 14 ? 5.817   0.858   1.792   1.00 2.64 ? 14 LYS A HZ2  4  
ATOM   1625  H HZ3  . LYS A 1 14 ? 6.188   1.556   3.296   1.00 2.37 ? 14 LYS A HZ3  4  
ATOM   1626  N N    . SER A 1 15 ? 7.207   5.285   -5.008  1.00 3.38 ? 15 SER A N    4  
ATOM   1627  C CA   . SER A 1 15 ? 8.206   5.133   -6.109  1.00 3.86 ? 15 SER A CA   4  
ATOM   1628  C C    . SER A 1 15 ? 8.557   6.509   -6.690  1.00 4.28 ? 15 SER A C    4  
ATOM   1629  O O    . SER A 1 15 ? 7.790   7.093   -7.433  1.00 4.38 ? 15 SER A O    4  
ATOM   1630  C CB   . SER A 1 15 ? 7.514   4.261   -7.158  1.00 3.79 ? 15 SER A CB   4  
ATOM   1631  O OG   . SER A 1 15 ? 8.411   3.244   -7.585  1.00 4.21 ? 15 SER A OG   4  
ATOM   1632  H H    . SER A 1 15 ? 6.603   6.056   -5.003  1.00 3.35 ? 15 SER A H    4  
ATOM   1633  H HA   . SER A 1 15 ? 9.096   4.640   -5.748  1.00 4.02 ? 15 SER A HA   4  
ATOM   1634  H HB2  . SER A 1 15 ? 6.637   3.805   -6.730  1.00 3.44 ? 15 SER A HB2  4  
ATOM   1635  H HB3  . SER A 1 15 ? 7.222   4.876   -7.999  1.00 3.85 ? 15 SER A HB3  4  
ATOM   1636  H HG   . SER A 1 15 ? 8.264   2.468   -7.037  1.00 4.27 ? 15 SER A HG   4  
ATOM   1637  N N    . GLY A 1 16 ? 9.707   7.033   -6.349  1.00 4.65 ? 16 GLY A N    4  
ATOM   1638  C CA   . GLY A 1 16 ? 10.111  8.375   -6.870  1.00 5.10 ? 16 GLY A CA   4  
ATOM   1639  C C    . GLY A 1 16 ? 9.803   9.444   -5.818  1.00 5.01 ? 16 GLY A C    4  
ATOM   1640  O O    . GLY A 1 16 ? 8.813   10.148  -5.907  1.00 4.98 ? 16 GLY A O    4  
ATOM   1641  H H    . GLY A 1 16 ? 10.305  6.546   -5.744  1.00 4.70 ? 16 GLY A H    4  
ATOM   1642  H HA2  . GLY A 1 16 ? 11.170  8.374   -7.086  1.00 5.45 ? 16 GLY A HA2  4  
ATOM   1643  H HA3  . GLY A 1 16 ? 9.559   8.594   -7.773  1.00 5.19 ? 16 GLY A HA3  4  
ATOM   1644  N N    . ASN A 1 17 ? 10.643  9.568   -4.822  1.00 4.99 ? 17 ASN A N    4  
ATOM   1645  C CA   . ASN A 1 17 ? 10.407  10.589  -3.754  1.00 4.94 ? 17 ASN A CA   4  
ATOM   1646  C C    . ASN A 1 17 ? 11.456  11.711  -3.831  1.00 4.63 ? 17 ASN A C    4  
ATOM   1647  O O    . ASN A 1 17 ? 11.790  12.328  -2.836  1.00 4.55 ? 17 ASN A O    4  
ATOM   1648  C CB   . ASN A 1 17 ? 10.544  9.816   -2.441  1.00 5.21 ? 17 ASN A CB   4  
ATOM   1649  C CG   . ASN A 1 17 ? 9.620   10.425  -1.385  1.00 5.35 ? 17 ASN A CG   4  
ATOM   1650  O OD1  . ASN A 1 17 ? 8.615   9.842   -1.033  1.00 5.65 ? 17 ASN A OD1  4  
ATOM   1651  N ND2  . ASN A 1 17 ? 9.917   11.582  -0.862  1.00 5.23 ? 17 ASN A ND2  4  
ATOM   1652  H H    . ASN A 1 17 ? 11.431  8.986   -4.775  1.00 5.04 ? 17 ASN A H    4  
ATOM   1653  H HA   . ASN A 1 17 ? 9.413   10.999  -3.837  1.00 4.99 ? 17 ASN A HA   4  
ATOM   1654  H HB2  . ASN A 1 17 ? 10.276  8.782   -2.601  1.00 5.40 ? 17 ASN A HB2  4  
ATOM   1655  H HB3  . ASN A 1 17 ? 11.566  9.874   -2.098  1.00 5.16 ? 17 ASN A HB3  4  
ATOM   1656  H HD21 . ASN A 1 17 ? 10.727  12.055  -1.147  1.00 5.06 ? 17 ASN A HD21 4  
ATOM   1657  H HD22 . ASN A 1 17 ? 9.330   11.978  -0.186  1.00 5.35 ? 17 ASN A HD22 4  
ATOM   1658  N N    . LYS A 1 18 ? 11.975  11.978  -5.002  1.00 4.50 ? 18 LYS A N    4  
ATOM   1659  C CA   . LYS A 1 18 ? 13.000  13.054  -5.155  1.00 4.24 ? 18 LYS A CA   4  
ATOM   1660  C C    . LYS A 1 18 ? 12.333  14.373  -5.579  1.00 4.11 ? 18 LYS A C    4  
ATOM   1661  O O    . LYS A 1 18 ? 11.940  14.526  -6.723  1.00 3.91 ? 18 LYS A O    4  
ATOM   1662  C CB   . LYS A 1 18 ? 13.935  12.545  -6.258  1.00 3.93 ? 18 LYS A CB   4  
ATOM   1663  C CG   . LYS A 1 18 ? 15.389  12.686  -5.808  1.00 3.97 ? 18 LYS A CG   4  
ATOM   1664  C CD   . LYS A 1 18 ? 16.044  13.859  -6.548  1.00 3.58 ? 18 LYS A CD   4  
ATOM   1665  C CE   . LYS A 1 18 ? 16.424  13.428  -7.970  1.00 3.27 ? 18 LYS A CE   4  
ATOM   1666  N NZ   . LYS A 1 18 ? 15.829  14.466  -8.861  1.00 2.91 ? 18 LYS A NZ   4  
ATOM   1667  H H    . LYS A 1 18 ? 11.691  11.466  -5.785  1.00 4.60 ? 18 LYS A H    4  
ATOM   1668  H HA   . LYS A 1 18 ? 13.550  13.185  -4.237  1.00 4.42 ? 18 LYS A HA   4  
ATOM   1669  H HB2  . LYS A 1 18 ? 13.721  11.504  -6.458  1.00 4.05 ? 18 LYS A HB2  4  
ATOM   1670  H HB3  . LYS A 1 18 ? 13.779  13.121  -7.158  1.00 3.62 ? 18 LYS A HB3  4  
ATOM   1671  H HG2  . LYS A 1 18 ? 15.418  12.868  -4.743  1.00 4.29 ? 18 LYS A HG2  4  
ATOM   1672  H HG3  . LYS A 1 18 ? 15.923  11.776  -6.033  1.00 4.04 ? 18 LYS A HG3  4  
ATOM   1673  H HD2  . LYS A 1 18 ? 15.350  14.686  -6.594  1.00 3.45 ? 18 LYS A HD2  4  
ATOM   1674  H HD3  . LYS A 1 18 ? 16.934  14.165  -6.018  1.00 3.74 ? 18 LYS A HD3  4  
ATOM   1675  H HE2  . LYS A 1 18 ? 17.501  13.407  -8.079  1.00 3.34 ? 18 LYS A HE2  4  
ATOM   1676  H HE3  . LYS A 1 18 ? 16.004  12.461  -8.197  1.00 3.32 ? 18 LYS A HE3  4  
ATOM   1677  H HZ1  . LYS A 1 18 ? 16.113  15.415  -8.535  1.00 2.97 ? 18 LYS A HZ1  4  
ATOM   1678  H HZ2  . LYS A 1 18 ? 16.168  14.322  -9.843  1.00 2.70 ? 18 LYS A HZ2  4  
ATOM   1679  H HZ3  . LYS A 1 18 ? 14.785  14.392  -8.840  1.00 2.90 ? 18 LYS A HZ3  4  
ATOM   1680  N N    . PRO A 1 19 ? 12.233  15.291  -4.642  1.00 4.30 ? 19 PRO A N    4  
ATOM   1681  C CA   . PRO A 1 19 ? 11.602  16.597  -4.990  1.00 4.22 ? 19 PRO A CA   4  
ATOM   1682  C C    . PRO A 1 19 ? 12.505  17.465  -5.899  1.00 3.81 ? 19 PRO A C    4  
ATOM   1683  O O    . PRO A 1 19 ? 11.988  18.194  -6.725  1.00 3.68 ? 19 PRO A O    4  
ATOM   1684  C CB   . PRO A 1 19 ? 11.326  17.259  -3.639  1.00 4.60 ? 19 PRO A CB   4  
ATOM   1685  C CG   . PRO A 1 19 ? 12.281  16.622  -2.692  1.00 4.79 ? 19 PRO A CG   4  
ATOM   1686  C CD   . PRO A 1 19 ? 12.509  15.217  -3.192  1.00 4.70 ? 19 PRO A CD   4  
ATOM   1687  H HA   . PRO A 1 19 ? 10.662  16.418  -5.490  1.00 4.26 ? 19 PRO A HA   4  
ATOM   1688  H HB2  . PRO A 1 19 ? 11.507  18.324  -3.700  1.00 4.52 ? 19 PRO A HB2  4  
ATOM   1689  H HB3  . PRO A 1 19 ? 10.312  17.067  -3.327  1.00 4.87 ? 19 PRO A HB3  4  
ATOM   1690  H HG2  . PRO A 1 19 ? 13.210  17.171  -2.674  1.00 4.68 ? 19 PRO A HG2  4  
ATOM   1691  H HG3  . PRO A 1 19 ? 11.852  16.587  -1.703  1.00 5.15 ? 19 PRO A HG3  4  
ATOM   1692  H HD2  . PRO A 1 19 ? 13.531  14.914  -3.012  1.00 4.68 ? 19 PRO A HD2  4  
ATOM   1693  H HD3  . PRO A 1 19 ? 11.821  14.533  -2.720  1.00 4.98 ? 19 PRO A HD3  4  
ATOM   1694  N N    . PRO A 1 20 ? 13.816  17.359  -5.752  1.00 3.70 ? 20 PRO A N    4  
ATOM   1695  C CA   . PRO A 1 20 ? 14.673  18.185  -6.659  1.00 3.37 ? 20 PRO A CA   4  
ATOM   1696  C C    . PRO A 1 20 ? 14.818  17.478  -8.015  1.00 2.95 ? 20 PRO A C    4  
ATOM   1697  O O    . PRO A 1 20 ? 15.889  17.028  -8.386  1.00 2.93 ? 20 PRO A O    4  
ATOM   1698  C CB   . PRO A 1 20 ? 16.018  18.271  -5.940  1.00 3.62 ? 20 PRO A CB   4  
ATOM   1699  C CG   . PRO A 1 20 ? 16.063  17.062  -5.076  1.00 3.95 ? 20 PRO A CG   4  
ATOM   1700  C CD   . PRO A 1 20 ? 14.645  16.748  -4.693  1.00 4.05 ? 20 PRO A CD   4  
ATOM   1701  H HA   . PRO A 1 20 ? 14.253  19.170  -6.785  1.00 3.36 ? 20 PRO A HA   4  
ATOM   1702  H HB2  . PRO A 1 20 ? 16.828  18.259  -6.657  1.00 3.46 ? 20 PRO A HB2  4  
ATOM   1703  H HB3  . PRO A 1 20 ? 16.063  19.162  -5.333  1.00 3.80 ? 20 PRO A HB3  4  
ATOM   1704  H HG2  . PRO A 1 20 ? 16.494  16.235  -5.623  1.00 3.86 ? 20 PRO A HG2  4  
ATOM   1705  H HG3  . PRO A 1 20 ? 16.644  17.264  -4.189  1.00 4.27 ? 20 PRO A HG3  4  
ATOM   1706  H HD2  . PRO A 1 20 ? 14.495  15.678  -4.661  1.00 4.11 ? 20 PRO A HD2  4  
ATOM   1707  H HD3  . PRO A 1 20 ? 14.411  17.191  -3.741  1.00 4.39 ? 20 PRO A HD3  4  
ATOM   1708  N N    . SER A 1 21 ? 13.741  17.362  -8.751  1.00 2.75 ? 21 SER A N    4  
ATOM   1709  C CA   . SER A 1 21 ? 13.798  16.672  -10.076 1.00 2.39 ? 21 SER A CA   4  
ATOM   1710  C C    . SER A 1 21 ? 13.386  17.631  -11.198 1.00 2.15 ? 21 SER A C    4  
ATOM   1711  O O    . SER A 1 21 ? 12.547  18.493  -11.015 1.00 2.43 ? 21 SER A O    4  
ATOM   1712  C CB   . SER A 1 21 ? 12.808  15.511  -9.962  1.00 2.69 ? 21 SER A CB   4  
ATOM   1713  O OG   . SER A 1 21 ? 13.281  14.589  -8.981  1.00 2.95 ? 21 SER A OG   4  
ATOM   1714  H H    . SER A 1 21 ? 12.888  17.721  -8.425  1.00 2.92 ? 21 SER A H    4  
ATOM   1715  H HA   . SER A 1 21 ? 14.790  16.289  -10.258 1.00 2.28 ? 21 SER A HA   4  
ATOM   1716  H HB2  . SER A 1 21 ? 11.843  15.887  -9.662  1.00 2.89 ? 21 SER A HB2  4  
ATOM   1717  H HB3  . SER A 1 21 ? 12.720  15.019  -10.921 1.00 2.67 ? 21 SER A HB3  4  
ATOM   1718  H HG   . SER A 1 21 ? 12.665  14.605  -8.236  1.00 3.32 ? 21 SER A HG   4  
ATOM   1719  N N    . LYS A 1 22 ? 13.981  17.491  -12.356 1.00 1.86 ? 22 LYS A N    4  
ATOM   1720  C CA   . LYS A 1 22 ? 13.645  18.393  -13.497 1.00 1.92 ? 22 LYS A CA   4  
ATOM   1721  C C    . LYS A 1 22 ? 13.378  17.567  -14.762 1.00 1.96 ? 22 LYS A C    4  
ATOM   1722  O O    . LYS A 1 22 ? 14.292  17.102  -15.415 1.00 1.86 ? 22 LYS A O    4  
ATOM   1723  C CB   . LYS A 1 22 ? 14.885  19.277  -13.676 1.00 1.81 ? 22 LYS A CB   4  
ATOM   1724  C CG   . LYS A 1 22 ? 14.793  20.496  -12.750 1.00 1.74 ? 22 LYS A CG   4  
ATOM   1725  C CD   . LYS A 1 22 ? 15.397  20.158  -11.381 1.00 1.35 ? 22 LYS A CD   4  
ATOM   1726  C CE   . LYS A 1 22 ? 16.924  20.232  -11.456 1.00 1.34 ? 22 LYS A CE   4  
ATOM   1727  N NZ   . LYS A 1 22 ? 17.410  19.218  -10.475 1.00 1.62 ? 22 LYS A NZ   4  
ATOM   1728  H H    . LYS A 1 22 ? 14.654  16.793  -12.475 1.00 1.79 ? 22 LYS A H    4  
ATOM   1729  H HA   . LYS A 1 22 ? 12.788  19.003  -13.257 1.00 2.23 ? 22 LYS A HA   4  
ATOM   1730  H HB2  . LYS A 1 22 ? 15.770  18.706  -13.434 1.00 1.72 ? 22 LYS A HB2  4  
ATOM   1731  H HB3  . LYS A 1 22 ? 14.944  19.611  -14.701 1.00 2.16 ? 22 LYS A HB3  4  
ATOM   1732  H HG2  . LYS A 1 22 ? 15.334  21.322  -13.188 1.00 2.02 ? 22 LYS A HG2  4  
ATOM   1733  H HG3  . LYS A 1 22 ? 13.756  20.774  -12.624 1.00 2.07 ? 22 LYS A HG3  4  
ATOM   1734  H HD2  . LYS A 1 22 ? 15.039  20.864  -10.645 1.00 1.71 ? 22 LYS A HD2  4  
ATOM   1735  H HD3  . LYS A 1 22 ? 15.102  19.162  -11.093 1.00 1.50 ? 22 LYS A HD3  4  
ATOM   1736  H HE2  . LYS A 1 22 ? 17.262  19.988  -12.454 1.00 1.68 ? 22 LYS A HE2  4  
ATOM   1737  H HE3  . LYS A 1 22 ? 17.265  21.215  -11.172 1.00 1.58 ? 22 LYS A HE3  4  
ATOM   1738  H HZ1  . LYS A 1 22 ? 16.942  19.367  -9.554  1.00 1.75 ? 22 LYS A HZ1  4  
ATOM   1739  H HZ2  . LYS A 1 22 ? 17.191  18.255  -10.824 1.00 1.77 ? 22 LYS A HZ2  4  
ATOM   1740  H HZ3  . LYS A 1 22 ? 18.443  19.321  -10.357 1.00 2.10 ? 22 LYS A HZ3  4  
ATOM   1741  N N    . THR A 1 23 ? 12.129  17.387  -15.107 1.00 2.36 ? 23 THR A N    4  
ATOM   1742  C CA   . THR A 1 23 ? 11.788  16.589  -16.333 1.00 2.50 ? 23 THR A CA   4  
ATOM   1743  C C    . THR A 1 23 ? 11.883  17.459  -17.600 1.00 3.17 ? 23 THR A C    4  
ATOM   1744  O O    . THR A 1 23 ? 11.980  16.949  -18.699 1.00 3.50 ? 23 THR A O    4  
ATOM   1745  C CB   . THR A 1 23 ? 10.348  16.096  -16.118 1.00 2.90 ? 23 THR A CB   4  
ATOM   1746  O OG1  . THR A 1 23 ? 10.042  15.098  -17.082 1.00 2.87 ? 23 THR A OG1  4  
ATOM   1747  C CG2  . THR A 1 23 ? 9.360   17.259  -16.260 1.00 3.76 ? 23 THR A CG2  4  
ATOM   1748  H H    . THR A 1 23 ? 11.415  17.771  -14.559 1.00 2.67 ? 23 THR A H    4  
ATOM   1749  H HA   . THR A 1 23 ? 12.451  15.742  -16.420 1.00 2.06 ? 23 THR A HA   4  
ATOM   1750  H HB   . THR A 1 23 ? 10.259  15.676  -15.128 1.00 2.78 ? 23 THR A HB   4  
ATOM   1751  H HG1  . THR A 1 23 ? 10.169  15.475  -17.958 1.00 3.28 ? 23 THR A HG1  4  
ATOM   1752  H HG21 . THR A 1 23 ? 9.683   18.086  -15.646 1.00 4.16 ? 23 THR A HG21 4  
ATOM   1753  H HG22 . THR A 1 23 ? 9.318   17.572  -17.293 1.00 4.10 ? 23 THR A HG22 4  
ATOM   1754  H HG23 . THR A 1 23 ? 8.379   16.937  -15.943 1.00 4.04 ? 23 THR A HG23 4  
ATOM   1755  N N    . CYS A 1 24 ? 11.862  18.763  -17.454 1.00 3.47 ? 24 CYS A N    4  
ATOM   1756  C CA   . CYS A 1 24 ? 11.961  19.657  -18.650 1.00 4.26 ? 24 CYS A CA   4  
ATOM   1757  C C    . CYS A 1 24 ? 13.435  19.851  -19.041 1.00 4.29 ? 24 CYS A C    4  
ATOM   1758  O O    . CYS A 1 24 ? 13.758  20.043  -20.198 1.00 4.87 ? 24 CYS A O    4  
ATOM   1759  C CB   . CYS A 1 24 ? 11.337  20.984  -18.210 1.00 4.79 ? 24 CYS A CB   4  
ATOM   1760  S SG   . CYS A 1 24 ? 11.036  22.021  -19.662 1.00 6.02 ? 24 CYS A SG   4  
ATOM   1761  H H    . CYS A 1 24 ? 11.788  19.155  -16.560 1.00 3.23 ? 24 CYS A H    4  
ATOM   1762  H HA   . CYS A 1 24 ? 11.405  19.243  -19.475 1.00 4.55 ? 24 CYS A HA   4  
ATOM   1763  H HB2  . CYS A 1 24 ? 10.401  20.792  -17.705 1.00 4.50 ? 24 CYS A HB2  4  
ATOM   1764  H HB3  . CYS A 1 24 ? 12.011  21.493  -17.537 1.00 4.95 ? 24 CYS A HB3  4  
ATOM   1765  H HG   . CYS A 1 24 ? 10.387  21.579  -20.214 1.00 6.29 ? 24 CYS A HG   4  
ATOM   1766  N N    . LEU A 1 25 ? 14.328  19.791  -18.080 1.00 3.83 ? 25 LEU A N    4  
ATOM   1767  C CA   . LEU A 1 25 ? 15.783  19.960  -18.381 1.00 4.14 ? 25 LEU A CA   4  
ATOM   1768  C C    . LEU A 1 25 ? 16.529  18.641  -18.132 1.00 3.67 ? 25 LEU A C    4  
ATOM   1769  O O    . LEU A 1 25 ? 15.922  17.605  -17.935 1.00 3.02 ? 25 LEU A O    4  
ATOM   1770  C CB   . LEU A 1 25 ? 16.260  21.046  -17.412 1.00 4.22 ? 25 LEU A CB   4  
ATOM   1771  C CG   . LEU A 1 25 ? 15.839  22.423  -17.928 1.00 4.90 ? 25 LEU A CG   4  
ATOM   1772  C CD1  . LEU A 1 25 ? 15.902  23.436  -16.784 1.00 4.71 ? 25 LEU A CD1  4  
ATOM   1773  C CD2  . LEU A 1 25 ? 16.790  22.862  -19.044 1.00 5.66 ? 25 LEU A CD2  4  
ATOM   1774  H H    . LEU A 1 25 ? 14.041  19.628  -17.158 1.00 3.40 ? 25 LEU A H    4  
ATOM   1775  H HA   . LEU A 1 25 ? 15.925  20.286  -19.399 1.00 4.77 ? 25 LEU A HA   4  
ATOM   1776  H HB2  . LEU A 1 25 ? 15.822  20.877  -16.439 1.00 3.67 ? 25 LEU A HB2  4  
ATOM   1777  H HB3  . LEU A 1 25 ? 17.335  21.008  -17.331 1.00 4.44 ? 25 LEU A HB3  4  
ATOM   1778  H HG   . LEU A 1 25 ? 14.830  22.373  -18.311 1.00 5.15 ? 25 LEU A HG   4  
ATOM   1779  H HD11 . LEU A 1 25 ? 16.848  23.341  -16.272 1.00 4.83 ? 25 LEU A HD11 4  
ATOM   1780  H HD12 . LEU A 1 25 ? 15.806  24.435  -17.183 1.00 4.71 ? 25 LEU A HD12 4  
ATOM   1781  H HD13 . LEU A 1 25 ? 15.096  23.246  -16.092 1.00 4.81 ? 25 LEU A HD13 4  
ATOM   1782  H HD21 . LEU A 1 25 ? 17.802  22.889  -18.666 1.00 5.91 ? 25 LEU A HD21 4  
ATOM   1783  H HD22 . LEU A 1 25 ? 16.731  22.161  -19.864 1.00 6.12 ? 25 LEU A HD22 4  
ATOM   1784  H HD23 . LEU A 1 25 ? 16.509  23.846  -19.390 1.00 5.79 ? 25 LEU A HD23 4  
ATOM   1785  N N    . LYS A 1 26 ? 17.838  18.668  -18.140 1.00 4.20 ? 26 LYS A N    4  
ATOM   1786  C CA   . LYS A 1 26 ? 18.618  17.408  -17.903 1.00 4.15 ? 26 LYS A CA   4  
ATOM   1787  C C    . LYS A 1 26 ? 19.096  17.326  -16.441 1.00 3.79 ? 26 LYS A C    4  
ATOM   1788  O O    . LYS A 1 26 ? 20.222  16.954  -16.168 1.00 4.35 ? 26 LYS A O    4  
ATOM   1789  C CB   . LYS A 1 26 ? 19.806  17.479  -18.876 1.00 5.16 ? 26 LYS A CB   4  
ATOM   1790  C CG   . LYS A 1 26 ? 20.756  18.617  -18.482 1.00 5.67 ? 26 LYS A CG   4  
ATOM   1791  C CD   . LYS A 1 26 ? 21.115  19.435  -19.725 1.00 6.45 ? 26 LYS A CD   4  
ATOM   1792  C CE   . LYS A 1 26 ? 22.137  20.516  -19.357 1.00 7.12 ? 26 LYS A CE   4  
ATOM   1793  N NZ   . LYS A 1 26 ? 21.380  21.799  -19.412 1.00 7.05 ? 26 LYS A NZ   4  
ATOM   1794  H H    . LYS A 1 26 ? 18.308  19.514  -18.301 1.00 4.76 ? 26 LYS A H    4  
ATOM   1795  H HA   . LYS A 1 26 ? 18.009  16.549  -18.137 1.00 3.83 ? 26 LYS A HA   4  
ATOM   1796  H HB2  . LYS A 1 26 ? 20.343  16.541  -18.851 1.00 5.31 ? 26 LYS A HB2  4  
ATOM   1797  H HB3  . LYS A 1 26 ? 19.438  17.652  -19.876 1.00 5.46 ? 26 LYS A HB3  4  
ATOM   1798  H HG2  . LYS A 1 26 ? 20.274  19.256  -17.755 1.00 5.21 ? 26 LYS A HG2  4  
ATOM   1799  H HG3  . LYS A 1 26 ? 21.658  18.202  -18.055 1.00 6.03 ? 26 LYS A HG3  4  
ATOM   1800  H HD2  . LYS A 1 26 ? 21.536  18.781  -20.475 1.00 6.81 ? 26 LYS A HD2  4  
ATOM   1801  H HD3  . LYS A 1 26 ? 20.224  19.904  -20.117 1.00 6.30 ? 26 LYS A HD3  4  
ATOM   1802  H HE2  . LYS A 1 26 ? 22.521  20.343  -18.359 1.00 7.01 ? 26 LYS A HE2  4  
ATOM   1803  H HE3  . LYS A 1 26 ? 22.944  20.530  -20.073 1.00 7.83 ? 26 LYS A HE3  4  
ATOM   1804  H HZ1  . LYS A 1 26 ? 20.961  21.919  -20.355 1.00 6.57 ? 26 LYS A HZ1  4  
ATOM   1805  H HZ2  . LYS A 1 26 ? 20.617  21.786  -18.693 1.00 7.48 ? 26 LYS A HZ2  4  
ATOM   1806  H HZ3  . LYS A 1 26 ? 22.026  22.591  -19.214 1.00 7.19 ? 26 LYS A HZ3  4  
ATOM   1807  N N    . GLU A 1 27 ? 18.233  17.657  -15.503 1.00 2.98 ? 27 GLU A N    4  
ATOM   1808  C CA   . GLU A 1 27 ? 18.600  17.598  -14.047 1.00 2.72 ? 27 GLU A CA   4  
ATOM   1809  C C    . GLU A 1 27 ? 19.992  18.205  -13.797 1.00 3.52 ? 27 GLU A C    4  
ATOM   1810  O O    . GLU A 1 27 ? 20.813  17.638  -13.099 1.00 3.95 ? 27 GLU A O    4  
ATOM   1811  C CB   . GLU A 1 27 ? 18.575  16.109  -13.698 1.00 2.71 ? 27 GLU A CB   4  
ATOM   1812  C CG   . GLU A 1 27 ? 17.128  15.670  -13.449 1.00 1.95 ? 27 GLU A CG   4  
ATOM   1813  C CD   . GLU A 1 27 ? 16.826  15.709  -11.950 1.00 2.13 ? 27 GLU A CD   4  
ATOM   1814  O OE1  . GLU A 1 27 ? 16.794  16.798  -11.398 1.00 2.03 ? 27 GLU A OE1  4  
ATOM   1815  O OE2  . GLU A 1 27 ? 16.621  14.650  -11.378 1.00 2.65 ? 27 GLU A OE2  4  
ATOM   1816  H H    . GLU A 1 27 ? 17.330  17.936  -15.757 1.00 2.66 ? 27 GLU A H    4  
ATOM   1817  H HA   . GLU A 1 27 ? 17.861  18.119  -13.460 1.00 2.17 ? 27 GLU A HA   4  
ATOM   1818  H HB2  . GLU A 1 27 ? 18.989  15.539  -14.519 1.00 3.10 ? 27 GLU A HB2  4  
ATOM   1819  H HB3  . GLU A 1 27 ? 19.161  15.937  -12.808 1.00 3.10 ? 27 GLU A HB3  4  
ATOM   1820  H HG2  . GLU A 1 27 ? 16.456  16.339  -13.968 1.00 1.54 ? 27 GLU A HG2  4  
ATOM   1821  H HG3  . GLU A 1 27 ? 16.990  14.666  -13.817 1.00 2.06 ? 27 GLU A HG3  4  
ATOM   1822  N N    . GLU A 1 28 ? 20.256  19.359  -14.356 1.00 3.88 ? 28 GLU A N    4  
ATOM   1823  C CA   . GLU A 1 28 ? 21.585  20.015  -14.155 1.00 4.67 ? 28 GLU A CA   4  
ATOM   1824  C C    . GLU A 1 28 ? 21.532  20.995  -12.968 1.00 4.39 ? 28 GLU A C    4  
ATOM   1825  O O    . GLU A 1 28 ? 22.540  21.281  -12.350 1.00 4.93 ? 28 GLU A O    4  
ATOM   1826  C CB   . GLU A 1 28 ? 21.879  20.747  -15.477 1.00 5.24 ? 28 GLU A CB   4  
ATOM   1827  C CG   . GLU A 1 28 ? 21.017  22.015  -15.608 1.00 4.84 ? 28 GLU A CG   4  
ATOM   1828  C CD   . GLU A 1 28 ? 19.678  21.674  -16.266 1.00 5.09 ? 28 GLU A CD   4  
ATOM   1829  O OE1  . GLU A 1 28 ? 19.617  21.687  -17.485 1.00 5.75 ? 28 GLU A OE1  4  
ATOM   1830  O OE2  . GLU A 1 28 ? 18.738  21.400  -15.537 1.00 4.70 ? 28 GLU A OE2  4  
ATOM   1831  H H    . GLU A 1 28 ? 19.575  19.797  -14.908 1.00 3.75 ? 28 GLU A H    4  
ATOM   1832  H HA   . GLU A 1 28 ? 22.343  19.268  -13.979 1.00 5.12 ? 28 GLU A HA   4  
ATOM   1833  H HB2  . GLU A 1 28 ? 22.923  21.023  -15.504 1.00 5.76 ? 28 GLU A HB2  4  
ATOM   1834  H HB3  . GLU A 1 28 ? 21.666  20.085  -16.303 1.00 5.55 ? 28 GLU A HB3  4  
ATOM   1835  H HG2  . GLU A 1 28 ? 20.840  22.436  -14.631 1.00 4.22 ? 28 GLU A HG2  4  
ATOM   1836  H HG3  . GLU A 1 28 ? 21.536  22.736  -16.217 1.00 5.12 ? 28 GLU A HG3  4  
ATOM   1837  N N    . MET A 1 29 ? 20.368  21.506  -12.646 1.00 3.61 ? 29 MET A N    4  
ATOM   1838  C CA   . MET A 1 29 ? 20.250  22.459  -11.499 1.00 3.33 ? 29 MET A CA   4  
ATOM   1839  C C    . MET A 1 29 ? 19.656  21.744  -10.275 1.00 2.79 ? 29 MET A C    4  
ATOM   1840  O O    . MET A 1 29 ? 19.663  20.528  -10.195 1.00 2.75 ? 29 MET A O    4  
ATOM   1841  C CB   . MET A 1 29 ? 19.310  23.562  -12.004 1.00 3.11 ? 29 MET A CB   4  
ATOM   1842  C CG   . MET A 1 29 ? 19.921  24.933  -11.705 1.00 3.52 ? 29 MET A CG   4  
ATOM   1843  S SD   . MET A 1 29 ? 18.714  26.227  -12.090 1.00 4.05 ? 29 MET A SD   4  
ATOM   1844  C CE   . MET A 1 29 ? 19.547  27.580  -11.225 1.00 4.88 ? 29 MET A CE   4  
ATOM   1845  H H    . MET A 1 29 ? 19.569  21.259  -13.156 1.00 3.26 ? 29 MET A H    4  
ATOM   1846  H HA   . MET A 1 29 ? 21.214  22.879  -11.258 1.00 3.85 ? 29 MET A HA   4  
ATOM   1847  H HB2  . MET A 1 29 ? 19.169  23.455  -13.070 1.00 3.36 ? 29 MET A HB2  4  
ATOM   1848  H HB3  . MET A 1 29 ? 18.356  23.479  -11.504 1.00 2.60 ? 29 MET A HB3  4  
ATOM   1849  H HG2  . MET A 1 29 ? 20.189  24.990  -10.661 1.00 3.89 ? 29 MET A HG2  4  
ATOM   1850  H HG3  . MET A 1 29 ? 20.804  25.074  -12.312 1.00 3.52 ? 29 MET A HG3  4  
ATOM   1851  H HE1  . MET A 1 29 ? 19.701  27.310  -10.193 1.00 5.18 ? 29 MET A HE1  4  
ATOM   1852  H HE2  . MET A 1 29 ? 20.505  27.768  -11.693 1.00 5.25 ? 29 MET A HE2  4  
ATOM   1853  H HE3  . MET A 1 29 ? 18.934  28.469  -11.276 1.00 5.17 ? 29 MET A HE3  4  
ATOM   1854  N N    . ALA A 1 30 ? 19.139  22.486  -9.325  1.00 2.58 ? 30 ALA A N    4  
ATOM   1855  C CA   . ALA A 1 30 ? 18.542  21.845  -8.111  1.00 2.48 ? 30 ALA A CA   4  
ATOM   1856  C C    . ALA A 1 30 ? 17.060  21.522  -8.353  1.00 1.83 ? 30 ALA A C    4  
ATOM   1857  O O    . ALA A 1 30 ? 16.678  20.385  -8.123  1.00 1.85 ? 30 ALA A O    4  
ATOM   1858  C CB   . ALA A 1 30 ? 18.694  22.881  -6.994  1.00 2.94 ? 30 ALA A CB   4  
ATOM   1859  O OXT  . ALA A 1 30 ? 16.334  22.409  -8.773  1.00 1.69 ? 30 ALA A OXT  4  
ATOM   1860  H H    . ALA A 1 30 ? 19.141  23.462  -9.412  1.00 2.68 ? 30 ALA A H    4  
ATOM   1861  H HA   . ALA A 1 30 ? 19.083  20.948  -7.856  1.00 2.84 ? 30 ALA A HA   4  
ATOM   1862  H HB1  . ALA A 1 30 ? 19.717  23.225  -6.958  1.00 3.37 ? 30 ALA A HB1  4  
ATOM   1863  H HB2  . ALA A 1 30 ? 18.040  23.718  -7.186  1.00 3.23 ? 30 ALA A HB2  4  
ATOM   1864  H HB3  . ALA A 1 30 ? 18.432  22.431  -6.047  1.00 3.04 ? 30 ALA A HB3  4  
ATOM   1865  N N    . MET A 1 1  ? 5.344   11.698  20.997  1.00 2.06 ? 1  MET A N    5  
ATOM   1866  C CA   . MET A 1 1  ? 6.504   10.759  20.886  1.00 1.73 ? 1  MET A CA   5  
ATOM   1867  C C    . MET A 1 1  ? 6.145   9.570   19.982  1.00 1.58 ? 1  MET A C    5  
ATOM   1868  O O    . MET A 1 1  ? 6.709   9.405   18.918  1.00 1.79 ? 1  MET A O    5  
ATOM   1869  C CB   . MET A 1 1  ? 6.784   10.288  22.320  1.00 2.05 ? 1  MET A CB   5  
ATOM   1870  C CG   . MET A 1 1  ? 7.899   11.140  22.934  1.00 2.97 ? 1  MET A CG   5  
ATOM   1871  S SD   . MET A 1 1  ? 9.466   10.765  22.111  1.00 3.84 ? 1  MET A SD   5  
ATOM   1872  C CE   . MET A 1 1  ? 10.488  11.951  23.019  1.00 4.90 ? 1  MET A CE   5  
ATOM   1873  H H1   . MET A 1 1  ? 5.060   12.012  20.047  1.00 2.55 ? 1  MET A H1   5  
ATOM   1874  H H2   . MET A 1 1  ? 4.545   11.214  21.453  1.00 2.30 ? 1  MET A H2   5  
ATOM   1875  H H3   . MET A 1 1  ? 5.621   12.525  21.566  1.00 2.35 ? 1  MET A H3   5  
ATOM   1876  H HA   . MET A 1 1  ? 7.368   11.275  20.496  1.00 2.33 ? 1  MET A HA   5  
ATOM   1877  H HB2  . MET A 1 1  ? 5.887   10.386  22.914  1.00 2.29 ? 1  MET A HB2  5  
ATOM   1878  H HB3  . MET A 1 1  ? 7.094   9.253   22.305  1.00 2.19 ? 1  MET A HB3  5  
ATOM   1879  H HG2  . MET A 1 1  ? 7.666   12.187  22.806  1.00 3.33 ? 1  MET A HG2  5  
ATOM   1880  H HG3  . MET A 1 1  ? 7.983   10.917  23.988  1.00 3.35 ? 1  MET A HG3  5  
ATOM   1881  H HE1  . MET A 1 1  ? 10.373  11.792  24.080  1.00 5.20 ? 1  MET A HE1  5  
ATOM   1882  H HE2  . MET A 1 1  ? 11.526  11.814  22.747  1.00 5.16 ? 1  MET A HE2  5  
ATOM   1883  H HE3  . MET A 1 1  ? 10.176  12.957  22.772  1.00 5.35 ? 1  MET A HE3  5  
ATOM   1884  N N    . ILE A 1 2  ? 5.212   8.747   20.395  1.00 1.50 ? 2  ILE A N    5  
ATOM   1885  C CA   . ILE A 1 2  ? 4.816   7.572   19.556  1.00 1.64 ? 2  ILE A CA   5  
ATOM   1886  C C    . ILE A 1 2  ? 3.466   7.842   18.877  1.00 1.45 ? 2  ILE A C    5  
ATOM   1887  O O    . ILE A 1 2  ? 2.592   8.471   19.443  1.00 1.43 ? 2  ILE A O    5  
ATOM   1888  C CB   . ILE A 1 2  ? 4.706   6.394   20.535  1.00 2.05 ? 2  ILE A CB   5  
ATOM   1889  C CG1  . ILE A 1 2  ? 6.062   6.151   21.217  1.00 2.29 ? 2  ILE A CG1  5  
ATOM   1890  C CG2  . ILE A 1 2  ? 4.285   5.129   19.780  1.00 2.40 ? 2  ILE A CG2  5  
ATOM   1891  C CD1  . ILE A 1 2  ? 7.145   5.902   20.162  1.00 2.48 ? 2  ILE A CD1  5  
ATOM   1892  H H    . ILE A 1 2  ? 4.769   8.902   21.255  1.00 1.56 ? 2  ILE A H    5  
ATOM   1893  H HA   . ILE A 1 2  ? 5.573   7.366   18.816  1.00 1.82 ? 2  ILE A HA   5  
ATOM   1894  H HB   . ILE A 1 2  ? 3.962   6.624   21.287  1.00 2.10 ? 2  ILE A HB   5  
ATOM   1895  H HG12 . ILE A 1 2  ? 6.327   7.016   21.806  1.00 2.16 ? 2  ILE A HG12 5  
ATOM   1896  H HG13 . ILE A 1 2  ? 5.988   5.287   21.862  1.00 2.64 ? 2  ILE A HG13 5  
ATOM   1897  H HG21 . ILE A 1 2  ? 4.842   5.057   18.859  1.00 2.96 ? 2  ILE A HG21 5  
ATOM   1898  H HG22 . ILE A 1 2  ? 4.486   4.262   20.391  1.00 2.64 ? 2  ILE A HG22 5  
ATOM   1899  H HG23 . ILE A 1 2  ? 3.228   5.176   19.560  1.00 2.28 ? 2  ILE A HG23 5  
ATOM   1900  H HD11 . ILE A 1 2  ? 6.767   5.226   19.409  1.00 2.73 ? 2  ILE A HD11 5  
ATOM   1901  H HD12 . ILE A 1 2  ? 7.421   6.839   19.700  1.00 2.65 ? 2  ILE A HD12 5  
ATOM   1902  H HD13 . ILE A 1 2  ? 8.013   5.464   20.634  1.00 2.87 ? 2  ILE A HD13 5  
ATOM   1903  N N    . SER A 1 3  ? 3.292   7.370   17.667  1.00 1.45 ? 3  SER A N    5  
ATOM   1904  C CA   . SER A 1 3  ? 1.999   7.597   16.947  1.00 1.31 ? 3  SER A CA   5  
ATOM   1905  C C    . SER A 1 3  ? 1.014   6.460   17.247  1.00 1.23 ? 3  SER A C    5  
ATOM   1906  O O    . SER A 1 3  ? -0.045  6.682   17.805  1.00 1.31 ? 3  SER A O    5  
ATOM   1907  C CB   . SER A 1 3  ? 2.364   7.621   15.458  1.00 1.34 ? 3  SER A CB   5  
ATOM   1908  O OG   . SER A 1 3  ? 1.191   7.408   14.676  1.00 1.29 ? 3  SER A OG   5  
ATOM   1909  H H    . SER A 1 3  ? 4.012   6.865   17.232  1.00 1.61 ? 3  SER A H    5  
ATOM   1910  H HA   . SER A 1 3  ? 1.571   8.546   17.234  1.00 1.37 ? 3  SER A HA   5  
ATOM   1911  H HB2  . SER A 1 3  ? 2.789   8.578   15.206  1.00 1.46 ? 3  SER A HB2  5  
ATOM   1912  H HB3  . SER A 1 3  ? 3.090   6.845   15.254  1.00 1.41 ? 3  SER A HB3  5  
ATOM   1913  H HG   . SER A 1 3  ? 1.032   8.200   14.156  1.00 1.45 ? 3  SER A HG   5  
ATOM   1914  N N    . SER A 1 4  ? 1.355   5.243   16.872  1.00 1.19 ? 4  SER A N    5  
ATOM   1915  C CA   . SER A 1 4  ? 0.450   4.065   17.118  1.00 1.24 ? 4  SER A CA   5  
ATOM   1916  C C    . SER A 1 4  ? -0.866  4.177   16.325  1.00 1.18 ? 4  SER A C    5  
ATOM   1917  O O    . SER A 1 4  ? -1.745  3.346   16.459  1.00 1.28 ? 4  SER A O    5  
ATOM   1918  C CB   . SER A 1 4  ? 0.170   4.072   18.622  1.00 1.43 ? 4  SER A CB   5  
ATOM   1919  O OG   . SER A 1 4  ? 0.659   2.867   19.197  1.00 1.58 ? 4  SER A OG   5  
ATOM   1920  H H    . SER A 1 4  ? 2.213   5.102   16.419  1.00 1.20 ? 4  SER A H    5  
ATOM   1921  H HA   . SER A 1 4  ? 0.957   3.153   16.852  1.00 1.28 ? 4  SER A HA   5  
ATOM   1922  H HB2  . SER A 1 4  ? 0.667   4.911   19.078  1.00 1.46 ? 4  SER A HB2  5  
ATOM   1923  H HB3  . SER A 1 4  ? -0.896  4.158   18.786  1.00 1.48 ? 4  SER A HB3  5  
ATOM   1924  H HG   . SER A 1 4  ? -0.055  2.223   19.191  1.00 1.85 ? 4  SER A HG   5  
ATOM   1925  N N    . VAL A 1 5  ? -1.012  5.191   15.508  1.00 1.08 ? 5  VAL A N    5  
ATOM   1926  C CA   . VAL A 1 5  ? -2.273  5.352   14.715  1.00 1.08 ? 5  VAL A CA   5  
ATOM   1927  C C    . VAL A 1 5  ? -1.977  5.416   13.205  1.00 0.97 ? 5  VAL A C    5  
ATOM   1928  O O    . VAL A 1 5  ? -2.798  5.028   12.396  1.00 1.01 ? 5  VAL A O    5  
ATOM   1929  C CB   . VAL A 1 5  ? -2.893  6.664   15.215  1.00 1.13 ? 5  VAL A CB   5  
ATOM   1930  C CG1  . VAL A 1 5  ? -2.079  7.865   14.720  1.00 1.07 ? 5  VAL A CG1  5  
ATOM   1931  C CG2  . VAL A 1 5  ? -4.329  6.780   14.698  1.00 1.24 ? 5  VAL A CG2  5  
ATOM   1932  H H    . VAL A 1 5  ? -0.297  5.847   15.420  1.00 1.07 ? 5  VAL A H    5  
ATOM   1933  H HA   . VAL A 1 5  ? -2.942  4.536   14.918  1.00 1.18 ? 5  VAL A HA   5  
ATOM   1934  H HB   . VAL A 1 5  ? -2.900  6.663   16.295  1.00 1.22 ? 5  VAL A HB   5  
ATOM   1935  H HG11 . VAL A 1 5  ? -1.049  7.753   15.023  1.00 1.36 ? 5  VAL A HG11 5  
ATOM   1936  H HG12 . VAL A 1 5  ? -2.134  7.917   13.642  1.00 1.35 ? 5  VAL A HG12 5  
ATOM   1937  H HG13 . VAL A 1 5  ? -2.482  8.772   15.144  1.00 1.44 ? 5  VAL A HG13 5  
ATOM   1938  H HG21 . VAL A 1 5  ? -4.906  5.937   15.049  1.00 1.62 ? 5  VAL A HG21 5  
ATOM   1939  H HG22 . VAL A 1 5  ? -4.770  7.696   15.062  1.00 1.60 ? 5  VAL A HG22 5  
ATOM   1940  H HG23 . VAL A 1 5  ? -4.322  6.787   13.618  1.00 1.65 ? 5  VAL A HG23 5  
ATOM   1941  N N    . CYS A 1 6  ? -0.814  5.907   12.832  1.00 0.93 ? 6  CYS A N    5  
ATOM   1942  C CA   . CYS A 1 6  ? -0.435  6.016   11.383  1.00 0.91 ? 6  CYS A CA   5  
ATOM   1943  C C    . CYS A 1 6  ? -1.285  7.082   10.675  1.00 0.90 ? 6  CYS A C    5  
ATOM   1944  O O    . CYS A 1 6  ? -2.372  7.419   11.102  1.00 0.96 ? 6  CYS A O    5  
ATOM   1945  C CB   . CYS A 1 6  ? -0.682  4.630   10.777  1.00 0.95 ? 6  CYS A CB   5  
ATOM   1946  S SG   . CYS A 1 6  ? 0.466   4.357   9.403   1.00 1.08 ? 6  CYS A SG   5  
ATOM   1947  H H    . CYS A 1 6  ? -0.186  6.212   13.511  1.00 0.96 ? 6  CYS A H    5  
ATOM   1948  H HA   . CYS A 1 6  ? 0.610   6.266   11.298  1.00 0.96 ? 6  CYS A HA   5  
ATOM   1949  H HB2  . CYS A 1 6  ? -0.524  3.874   11.533  1.00 1.02 ? 6  CYS A HB2  5  
ATOM   1950  H HB3  . CYS A 1 6  ? -1.697  4.571   10.415  1.00 0.95 ? 6  CYS A HB3  5  
ATOM   1951  H HG   . CYS A 1 6  ? 0.129   4.828   8.639   1.00 1.36 ? 6  CYS A HG   5  
ATOM   1952  N N    . VAL A 1 7  ? -0.782  7.616   9.592   1.00 0.91 ? 7  VAL A N    5  
ATOM   1953  C CA   . VAL A 1 7  ? -1.534  8.663   8.839   1.00 0.98 ? 7  VAL A CA   5  
ATOM   1954  C C    . VAL A 1 7  ? -1.611  8.285   7.354   1.00 0.94 ? 7  VAL A C    5  
ATOM   1955  O O    . VAL A 1 7  ? -0.972  7.352   6.904   1.00 0.92 ? 7  VAL A O    5  
ATOM   1956  C CB   . VAL A 1 7  ? -0.724  9.958   9.026   1.00 1.05 ? 7  VAL A CB   5  
ATOM   1957  C CG1  . VAL A 1 7  ? -1.579  11.161  8.623   1.00 1.21 ? 7  VAL A CG1  5  
ATOM   1958  C CG2  . VAL A 1 7  ? -0.309  10.111  10.493  1.00 1.14 ? 7  VAL A CG2  5  
ATOM   1959  H H    . VAL A 1 7  ? 0.094   7.332   9.274   1.00 0.92 ? 7  VAL A H    5  
ATOM   1960  H HA   . VAL A 1 7  ? -2.524  8.785   9.248   1.00 1.08 ? 7  VAL A HA   5  
ATOM   1961  H HB   . VAL A 1 7  ? 0.156   9.921   8.402   1.00 1.01 ? 7  VAL A HB   5  
ATOM   1962  H HG11 . VAL A 1 7  ? -2.610  10.977  8.890   1.00 1.89 ? 7  VAL A HG11 5  
ATOM   1963  H HG12 . VAL A 1 7  ? -1.226  12.042  9.140   1.00 1.51 ? 7  VAL A HG12 5  
ATOM   1964  H HG13 . VAL A 1 7  ? -1.505  11.315  7.557   1.00 1.29 ? 7  VAL A HG13 5  
ATOM   1965  H HG21 . VAL A 1 7  ? -1.129  9.821   11.133  1.00 1.22 ? 7  VAL A HG21 5  
ATOM   1966  H HG22 . VAL A 1 7  ? 0.543   9.479   10.694  1.00 1.18 ? 7  VAL A HG22 5  
ATOM   1967  H HG23 . VAL A 1 7  ? -0.047  11.140  10.687  1.00 1.27 ? 7  VAL A HG23 5  
HETATM 1968  N N    . SEP A 1 8  ? -2.387  9.010   6.595   1.00 0.99 ? 8  SEP A N    5  
HETATM 1969  C CA   . SEP A 1 8  ? -2.521  8.711   5.131   1.00 1.04 ? 8  SEP A CA   5  
HETATM 1970  C CB   . SEP A 1 8  ? -3.599  9.670   4.626   1.00 1.21 ? 8  SEP A CB   5  
HETATM 1971  O OG   . SEP A 1 8  ? -4.889  9.155   4.974   1.00 1.40 ? 8  SEP A OG   5  
HETATM 1972  C C    . SEP A 1 8  ? -1.198  8.966   4.396   1.00 0.99 ? 8  SEP A C    5  
HETATM 1973  O O    . SEP A 1 8  ? -0.875  8.291   3.438   1.00 1.03 ? 8  SEP A O    5  
HETATM 1974  P P    . SEP A 1 8  ? -5.924  10.050  5.823   1.00 1.48 ? 8  SEP A P    5  
HETATM 1975  O O1P  . SEP A 1 8  ? -5.341  10.285  7.162   1.00 1.74 ? 8  SEP A O1P  5  
HETATM 1976  O O2P  . SEP A 1 8  ? -6.336  11.198  4.985   1.00 2.16 ? 8  SEP A O2P  5  
HETATM 1977  O O3P  . SEP A 1 8  ? -7.186  9.066   5.988   1.00 1.93 ? 8  SEP A O3P  5  
HETATM 1978  H H    . SEP A 1 8  ? -2.885  9.752   6.989   1.00 1.05 ? 8  SEP A H    5  
HETATM 1979  H HA   . SEP A 1 8  ? -2.838  7.695   4.983   1.00 1.08 ? 8  SEP A HA   5  
HETATM 1980  H HB2  . SEP A 1 8  ? -3.515  9.768   3.554   1.00 1.23 ? 8  SEP A HB2  5  
HETATM 1981  H HB3  . SEP A 1 8  ? -3.465  10.638  5.083   1.00 1.27 ? 8  SEP A HB3  5  
HETATM 1982  H HOP3 . SEP A 1 8  ? -6.874  8.276   6.434   1.00 2.18 ? 8  SEP A HOP3 5  
ATOM   1983  N N    . SER A 1 9  ? -0.440  9.940   4.841   1.00 1.00 ? 9  SER A N    5  
ATOM   1984  C CA   . SER A 1 9  ? 0.868   10.268  4.189   1.00 1.06 ? 9  SER A CA   5  
ATOM   1985  C C    . SER A 1 9  ? 0.659   10.716  2.739   1.00 1.16 ? 9  SER A C    5  
ATOM   1986  O O    . SER A 1 9  ? -0.424  11.106  2.341   1.00 1.26 ? 9  SER A O    5  
ATOM   1987  C CB   . SER A 1 9  ? 1.686   8.974   4.240   1.00 0.97 ? 9  SER A CB   5  
ATOM   1988  O OG   . SER A 1 9  ? 3.022   9.281   4.623   1.00 1.29 ? 9  SER A OG   5  
ATOM   1989  H H    . SER A 1 9  ? -0.733  10.462  5.607   1.00 1.03 ? 9  SER A H    5  
ATOM   1990  H HA   . SER A 1 9  ? 1.377   11.039  4.743   1.00 1.18 ? 9  SER A HA   5  
ATOM   1991  H HB2  . SER A 1 9  ? 1.256   8.299   4.960   1.00 1.03 ? 9  SER A HB2  5  
ATOM   1992  H HB3  . SER A 1 9  ? 1.680   8.507   3.263   1.00 0.93 ? 9  SER A HB3  5  
ATOM   1993  H HG   . SER A 1 9  ? 3.308   8.623   5.261   1.00 1.58 ? 9  SER A HG   5  
ATOM   1994  N N    . TYR A 1 10 ? 1.702   10.671  1.958   1.00 1.17 ? 10 TYR A N    5  
ATOM   1995  C CA   . TYR A 1 10 ? 1.613   11.092  0.522   1.00 1.29 ? 10 TYR A CA   5  
ATOM   1996  C C    . TYR A 1 10 ? 0.615   10.215  -0.263  1.00 1.28 ? 10 TYR A C    5  
ATOM   1997  O O    . TYR A 1 10 ? 0.045   9.278   0.265   1.00 1.25 ? 10 TYR A O    5  
ATOM   1998  C CB   . TYR A 1 10 ? 3.046   10.953  -0.023  1.00 1.25 ? 10 TYR A CB   5  
ATOM   1999  C CG   . TYR A 1 10 ? 3.392   9.510   -0.330  1.00 0.99 ? 10 TYR A CG   5  
ATOM   2000  C CD1  . TYR A 1 10 ? 3.021   8.475   0.543   1.00 0.93 ? 10 TYR A CD1  5  
ATOM   2001  C CD2  . TYR A 1 10 ? 4.108   9.215   -1.493  1.00 0.88 ? 10 TYR A CD2  5  
ATOM   2002  C CE1  . TYR A 1 10 ? 3.368   7.153   0.245   1.00 0.80 ? 10 TYR A CE1  5  
ATOM   2003  C CE2  . TYR A 1 10 ? 4.452   7.894   -1.792  1.00 0.75 ? 10 TYR A CE2  5  
ATOM   2004  C CZ   . TYR A 1 10 ? 4.083   6.862   -0.922  1.00 0.73 ? 10 TYR A CZ   5  
ATOM   2005  O OH   . TYR A 1 10 ? 4.425   5.558   -1.214  1.00 0.79 ? 10 TYR A OH   5  
ATOM   2006  H H    . TYR A 1 10 ? 2.557   10.365  2.323   1.00 1.12 ? 10 TYR A H    5  
ATOM   2007  H HA   . TYR A 1 10 ? 1.310   12.123  0.464   1.00 1.46 ? 10 TYR A HA   5  
ATOM   2008  H HB2  . TYR A 1 10 ? 3.137   11.533  -0.927  1.00 1.39 ? 10 TYR A HB2  5  
ATOM   2009  H HB3  . TYR A 1 10 ? 3.741   11.333  0.712   1.00 1.33 ? 10 TYR A HB3  5  
ATOM   2010  H HD1  . TYR A 1 10 ? 2.466   8.696   1.443   1.00 1.06 ? 10 TYR A HD1  5  
ATOM   2011  H HD2  . TYR A 1 10 ? 4.392   10.011  -2.163  1.00 0.96 ? 10 TYR A HD2  5  
ATOM   2012  H HE1  . TYR A 1 10 ? 3.081   6.358   0.915   1.00 0.83 ? 10 TYR A HE1  5  
ATOM   2013  H HE2  . TYR A 1 10 ? 5.003   7.669   -2.694  1.00 0.76 ? 10 TYR A HE2  5  
ATOM   2014  H HH   . TYR A 1 10 ? 4.983   5.231   -0.504  1.00 1.16 ? 10 TYR A HH   5  
ATOM   2015  N N    . ARG A 1 11 ? 0.396   10.532  -1.518  1.00 1.40 ? 11 ARG A N    5  
ATOM   2016  C CA   . ARG A 1 11 ? -0.571  9.752   -2.362  1.00 1.51 ? 11 ARG A CA   5  
ATOM   2017  C C    . ARG A 1 11 ? -0.364  8.237   -2.232  1.00 1.39 ? 11 ARG A C    5  
ATOM   2018  O O    . ARG A 1 11 ? -1.314  7.475   -2.233  1.00 1.53 ? 11 ARG A O    5  
ATOM   2019  C CB   . ARG A 1 11 ? -0.295  10.205  -3.799  1.00 1.68 ? 11 ARG A CB   5  
ATOM   2020  C CG   . ARG A 1 11 ? -1.565  10.814  -4.395  1.00 1.94 ? 11 ARG A CG   5  
ATOM   2021  C CD   . ARG A 1 11 ? -2.023  9.984   -5.601  1.00 2.11 ? 11 ARG A CD   5  
ATOM   2022  N NE   . ARG A 1 11 ? -2.484  8.681   -5.032  1.00 2.12 ? 11 ARG A NE   5  
ATOM   2023  C CZ   . ARG A 1 11 ? -3.632  8.597   -4.418  1.00 2.24 ? 11 ARG A CZ   5  
ATOM   2024  N NH1  . ARG A 1 11 ? -4.723  8.975   -5.019  1.00 2.37 ? 11 ARG A NH1  5  
ATOM   2025  N NH2  . ARG A 1 11 ? -3.685  8.125   -3.206  1.00 2.44 ? 11 ARG A NH2  5  
ATOM   2026  H H    . ARG A 1 11 ? 0.863   11.300  -1.909  1.00 1.46 ? 11 ARG A H    5  
ATOM   2027  H HA   . ARG A 1 11 ? -1.576  10.004  -2.094  1.00 1.62 ? 11 ARG A HA   5  
ATOM   2028  H HB2  . ARG A 1 11 ? 0.494   10.944  -3.799  1.00 1.66 ? 11 ARG A HB2  5  
ATOM   2029  H HB3  . ARG A 1 11 ? 0.009   9.356   -4.392  1.00 1.72 ? 11 ARG A HB3  5  
ATOM   2030  H HG2  . ARG A 1 11 ? -2.345  10.824  -3.647  1.00 1.97 ? 11 ARG A HG2  5  
ATOM   2031  H HG3  . ARG A 1 11 ? -1.362  11.825  -4.714  1.00 2.04 ? 11 ARG A HG3  5  
ATOM   2032  H HD2  . ARG A 1 11 ? -2.835  10.485  -6.112  1.00 2.32 ? 11 ARG A HD2  5  
ATOM   2033  H HD3  . ARG A 1 11 ? -1.198  9.821   -6.278  1.00 2.11 ? 11 ARG A HD3  5  
ATOM   2034  H HE   . ARG A 1 11 ? -1.922  7.883   -5.120  1.00 2.12 ? 11 ARG A HE   5  
ATOM   2035  H HH11 . ARG A 1 11 ? -4.680  9.329   -5.953  1.00 2.45 ? 11 ARG A HH11 5  
ATOM   2036  H HH12 . ARG A 1 11 ? -5.603  8.912   -4.550  1.00 2.51 ? 11 ARG A HH12 5  
ATOM   2037  H HH21 . ARG A 1 11 ? -2.843  7.825   -2.748  1.00 2.55 ? 11 ARG A HH21 5  
ATOM   2038  H HH22 . ARG A 1 11 ? -4.562  8.060   -2.731  1.00 2.60 ? 11 ARG A HH22 5  
ATOM   2039  N N    . GLY A 1 12 ? 0.859   7.804   -2.142  1.00 1.19 ? 12 GLY A N    5  
ATOM   2040  C CA   . GLY A 1 12 ? 1.142   6.339   -2.034  1.00 1.11 ? 12 GLY A CA   5  
ATOM   2041  C C    . GLY A 1 12 ? 1.953   5.893   -3.252  1.00 1.05 ? 12 GLY A C    5  
ATOM   2042  O O    . GLY A 1 12 ? 2.080   4.716   -3.531  1.00 1.09 ? 12 GLY A O    5  
ATOM   2043  H H    . GLY A 1 12 ? 1.599   8.443   -2.163  1.00 1.13 ? 12 GLY A H    5  
ATOM   2044  H HA2  . GLY A 1 12 ? 1.705   6.147   -1.133  1.00 1.02 ? 12 GLY A HA2  5  
ATOM   2045  H HA3  . GLY A 1 12 ? 0.214   5.792   -2.004  1.00 1.26 ? 12 GLY A HA3  5  
ATOM   2046  N N    . ARG A 1 13 ? 2.494   6.834   -3.984  1.00 1.02 ? 13 ARG A N    5  
ATOM   2047  C CA   . ARG A 1 13 ? 3.290   6.500   -5.192  1.00 0.98 ? 13 ARG A CA   5  
ATOM   2048  C C    . ARG A 1 13 ? 4.725   6.095   -4.806  1.00 0.81 ? 13 ARG A C    5  
ATOM   2049  O O    . ARG A 1 13 ? 5.680   6.815   -5.037  1.00 0.75 ? 13 ARG A O    5  
ATOM   2050  C CB   . ARG A 1 13 ? 3.248   7.788   -6.032  1.00 1.09 ? 13 ARG A CB   5  
ATOM   2051  C CG   . ARG A 1 13 ? 3.987   8.936   -5.322  1.00 1.03 ? 13 ARG A CG   5  
ATOM   2052  C CD   . ARG A 1 13 ? 4.874   9.688   -6.326  1.00 1.08 ? 13 ARG A CD   5  
ATOM   2053  N NE   . ARG A 1 13 ? 5.679   8.629   -7.010  1.00 0.86 ? 13 ARG A NE   5  
ATOM   2054  C CZ   . ARG A 1 13 ? 5.899   8.688   -8.296  1.00 0.83 ? 13 ARG A CZ   5  
ATOM   2055  N NH1  . ARG A 1 13 ? 4.936   9.004   -9.115  1.00 1.18 ? 13 ARG A NH1  5  
ATOM   2056  N NH2  . ARG A 1 13 ? 7.081   8.415   -8.763  1.00 0.92 ? 13 ARG A NH2  5  
ATOM   2057  H H    . ARG A 1 13 ? 2.368   7.769   -3.741  1.00 1.09 ? 13 ARG A H    5  
ATOM   2058  H HA   . ARG A 1 13 ? 2.816   5.700   -5.731  1.00 1.09 ? 13 ARG A HA   5  
ATOM   2059  H HB2  . ARG A 1 13 ? 3.706   7.603   -6.984  1.00 1.15 ? 13 ARG A HB2  5  
ATOM   2060  H HB3  . ARG A 1 13 ? 2.218   8.074   -6.182  1.00 1.26 ? 13 ARG A HB3  5  
ATOM   2061  H HG2  . ARG A 1 13 ? 3.264   9.620   -4.903  1.00 1.18 ? 13 ARG A HG2  5  
ATOM   2062  H HG3  . ARG A 1 13 ? 4.603   8.538   -4.530  1.00 0.90 ? 13 ARG A HG3  5  
ATOM   2063  H HD2  . ARG A 1 13 ? 4.261   10.223  -7.040  1.00 1.26 ? 13 ARG A HD2  5  
ATOM   2064  H HD3  . ARG A 1 13 ? 5.530   10.372  -5.808  1.00 1.16 ? 13 ARG A HD3  5  
ATOM   2065  H HE   . ARG A 1 13 ? 6.041   7.882   -6.487  1.00 0.81 ? 13 ARG A HE   5  
ATOM   2066  H HH11 . ARG A 1 13 ? 4.023   9.202   -8.763  1.00 1.59 ? 13 ARG A HH11 5  
ATOM   2067  H HH12 . ARG A 1 13 ? 5.113   9.051   -10.100 1.00 1.19 ? 13 ARG A HH12 5  
ATOM   2068  H HH21 . ARG A 1 13 ? 7.823   8.159   -8.138  1.00 1.25 ? 13 ARG A HH21 5  
ATOM   2069  H HH22 . ARG A 1 13 ? 7.251   8.453   -9.751  1.00 0.95 ? 13 ARG A HH22 5  
ATOM   2070  N N    . LYS A 1 14 ? 4.874   4.935   -4.214  1.00 0.82 ? 14 LYS A N    5  
ATOM   2071  C CA   . LYS A 1 14 ? 6.233   4.447   -3.796  1.00 0.80 ? 14 LYS A CA   5  
ATOM   2072  C C    . LYS A 1 14 ? 7.119   4.116   -5.015  1.00 0.78 ? 14 LYS A C    5  
ATOM   2073  O O    . LYS A 1 14 ? 7.646   3.024   -5.138  1.00 0.89 ? 14 LYS A O    5  
ATOM   2074  C CB   . LYS A 1 14 ? 5.970   3.189   -2.946  1.00 0.96 ? 14 LYS A CB   5  
ATOM   2075  C CG   . LYS A 1 14 ? 5.025   2.210   -3.675  1.00 1.13 ? 14 LYS A CG   5  
ATOM   2076  C CD   . LYS A 1 14 ? 5.807   1.022   -4.257  1.00 1.33 ? 14 LYS A CD   5  
ATOM   2077  C CE   . LYS A 1 14 ? 6.799   0.468   -3.224  1.00 1.26 ? 14 LYS A CE   5  
ATOM   2078  N NZ   . LYS A 1 14 ? 8.151   0.826   -3.751  1.00 1.58 ? 14 LYS A NZ   5  
ATOM   2079  H H    . LYS A 1 14 ? 4.085   4.384   -4.038  1.00 0.92 ? 14 LYS A H    5  
ATOM   2080  H HA   . LYS A 1 14 ? 6.718   5.195   -3.188  1.00 0.78 ? 14 LYS A HA   5  
ATOM   2081  H HB2  . LYS A 1 14 ? 6.907   2.700   -2.747  1.00 1.06 ? 14 LYS A HB2  5  
ATOM   2082  H HB3  . LYS A 1 14 ? 5.519   3.484   -2.010  1.00 0.96 ? 14 LYS A HB3  5  
ATOM   2083  H HG2  . LYS A 1 14 ? 4.289   1.840   -2.977  1.00 1.21 ? 14 LYS A HG2  5  
ATOM   2084  H HG3  . LYS A 1 14 ? 4.523   2.725   -4.478  1.00 1.13 ? 14 LYS A HG3  5  
ATOM   2085  H HD2  . LYS A 1 14 ? 5.111   0.243   -4.534  1.00 1.44 ? 14 LYS A HD2  5  
ATOM   2086  H HD3  . LYS A 1 14 ? 6.345   1.344   -5.135  1.00 1.64 ? 14 LYS A HD3  5  
ATOM   2087  H HE2  . LYS A 1 14 ? 6.632   0.928   -2.260  1.00 1.38 ? 14 LYS A HE2  5  
ATOM   2088  H HE3  . LYS A 1 14 ? 6.703   -0.605  -3.150  1.00 1.32 ? 14 LYS A HE3  5  
ATOM   2089  H HZ1  . LYS A 1 14 ? 8.096   1.728   -4.278  1.00 2.17 ? 14 LYS A HZ1  5  
ATOM   2090  H HZ2  . LYS A 1 14 ? 8.816   0.928   -2.958  1.00 1.47 ? 14 LYS A HZ2  5  
ATOM   2091  H HZ3  . LYS A 1 14 ? 8.487   0.074   -4.385  1.00 1.95 ? 14 LYS A HZ3  5  
ATOM   2092  N N    . SER A 1 15 ? 7.301   5.061   -5.903  1.00 0.71 ? 15 SER A N    5  
ATOM   2093  C CA   . SER A 1 15 ? 8.157   4.827   -7.106  1.00 0.70 ? 15 SER A CA   5  
ATOM   2094  C C    . SER A 1 15 ? 9.197   5.948   -7.235  1.00 0.80 ? 15 SER A C    5  
ATOM   2095  O O    . SER A 1 15 ? 8.857   7.112   -7.354  1.00 1.12 ? 15 SER A O    5  
ATOM   2096  C CB   . SER A 1 15 ? 7.188   4.847   -8.292  1.00 0.97 ? 15 SER A CB   5  
ATOM   2097  O OG   . SER A 1 15 ? 7.915   4.639   -9.500  1.00 0.90 ? 15 SER A OG   5  
ATOM   2098  H H    . SER A 1 15 ? 6.880   5.937   -5.771  1.00 0.70 ? 15 SER A H    5  
ATOM   2099  H HA   . SER A 1 15 ? 8.644   3.867   -7.044  1.00 0.71 ? 15 SER A HA   5  
ATOM   2100  H HB2  . SER A 1 15 ? 6.460   4.062   -8.177  1.00 1.18 ? 15 SER A HB2  5  
ATOM   2101  H HB3  . SER A 1 15 ? 6.682   5.803   -8.325  1.00 1.23 ? 15 SER A HB3  5  
ATOM   2102  H HG   . SER A 1 15 ? 7.583   3.836   -9.914  1.00 1.30 ? 15 SER A HG   5  
ATOM   2103  N N    . GLY A 1 16 ? 10.460  5.603   -7.209  1.00 0.97 ? 16 GLY A N    5  
ATOM   2104  C CA   . GLY A 1 16 ? 11.534  6.639   -7.324  1.00 1.32 ? 16 GLY A CA   5  
ATOM   2105  C C    . GLY A 1 16 ? 12.871  5.951   -7.605  1.00 1.22 ? 16 GLY A C    5  
ATOM   2106  O O    . GLY A 1 16 ? 13.609  5.620   -6.699  1.00 1.62 ? 16 GLY A O    5  
ATOM   2107  H H    . GLY A 1 16 ? 10.704  4.659   -7.110  1.00 1.10 ? 16 GLY A H    5  
ATOM   2108  H HA2  . GLY A 1 16 ? 11.296  7.316   -8.134  1.00 1.46 ? 16 GLY A HA2  5  
ATOM   2109  H HA3  . GLY A 1 16 ? 11.605  7.192   -6.401  1.00 1.72 ? 16 GLY A HA3  5  
ATOM   2110  N N    . ASN A 1 17 ? 13.179  5.725   -8.857  1.00 0.91 ? 17 ASN A N    5  
ATOM   2111  C CA   . ASN A 1 17 ? 14.463  5.046   -9.212  1.00 1.09 ? 17 ASN A CA   5  
ATOM   2112  C C    . ASN A 1 17 ? 15.382  5.985   -10.012 1.00 0.97 ? 17 ASN A C    5  
ATOM   2113  O O    . ASN A 1 17 ? 15.071  7.141   -10.227 1.00 0.89 ? 17 ASN A O    5  
ATOM   2114  C CB   . ASN A 1 17 ? 14.047  3.830   -10.053 1.00 1.27 ? 17 ASN A CB   5  
ATOM   2115  C CG   . ASN A 1 17 ? 13.294  4.270   -11.319 1.00 1.22 ? 17 ASN A CG   5  
ATOM   2116  O OD1  . ASN A 1 17 ? 12.586  5.258   -11.320 1.00 1.26 ? 17 ASN A OD1  5  
ATOM   2117  N ND2  . ASN A 1 17 ? 13.412  3.563   -12.406 1.00 1.65 ? 17 ASN A ND2  5  
ATOM   2118  H H    . ASN A 1 17 ? 12.559  5.995   -9.567  1.00 0.83 ? 17 ASN A H    5  
ATOM   2119  H HA   . ASN A 1 17 ? 14.967  4.712   -8.318  1.00 1.44 ? 17 ASN A HA   5  
ATOM   2120  H HB2  . ASN A 1 17 ? 14.928  3.277   -10.339 1.00 1.55 ? 17 ASN A HB2  5  
ATOM   2121  H HB3  . ASN A 1 17 ? 13.405  3.194   -9.463  1.00 1.46 ? 17 ASN A HB3  5  
ATOM   2122  H HD21 . ASN A 1 17 ? 13.972  2.759   -12.411 1.00 1.96 ? 17 ASN A HD21 5  
ATOM   2123  H HD22 . ASN A 1 17 ? 12.944  3.840   -13.222 1.00 1.85 ? 17 ASN A HD22 5  
ATOM   2124  N N    . LYS A 1 18 ? 16.519  5.493   -10.444 1.00 1.14 ? 18 LYS A N    5  
ATOM   2125  C CA   . LYS A 1 18 ? 17.470  6.351   -11.221 1.00 1.09 ? 18 LYS A CA   5  
ATOM   2126  C C    . LYS A 1 18 ? 16.893  6.723   -12.601 1.00 0.87 ? 18 LYS A C    5  
ATOM   2127  O O    . LYS A 1 18 ? 17.122  7.824   -13.072 1.00 0.88 ? 18 LYS A O    5  
ATOM   2128  C CB   . LYS A 1 18 ? 18.747  5.515   -11.374 1.00 1.33 ? 18 LYS A CB   5  
ATOM   2129  C CG   . LYS A 1 18 ? 19.933  6.284   -10.789 1.00 1.56 ? 18 LYS A CG   5  
ATOM   2130  C CD   . LYS A 1 18 ? 20.407  7.341   -11.795 1.00 1.50 ? 18 LYS A CD   5  
ATOM   2131  C CE   . LYS A 1 18 ? 19.893  8.724   -11.378 1.00 1.58 ? 18 LYS A CE   5  
ATOM   2132  N NZ   . LYS A 1 18 ? 19.255  9.290   -12.603 1.00 1.48 ? 18 LYS A NZ   5  
ATOM   2133  H H    . LYS A 1 18 ? 16.750  4.560   -10.249 1.00 1.37 ? 18 LYS A H    5  
ATOM   2134  H HA   . LYS A 1 18 ? 17.692  7.247   -10.664 1.00 1.14 ? 18 LYS A HA   5  
ATOM   2135  H HB2  . LYS A 1 18 ? 18.632  4.578   -10.849 1.00 1.52 ? 18 LYS A HB2  5  
ATOM   2136  H HB3  . LYS A 1 18 ? 18.929  5.321   -12.420 1.00 1.27 ? 18 LYS A HB3  5  
ATOM   2137  H HG2  . LYS A 1 18 ? 19.630  6.767   -9.871  1.00 1.66 ? 18 LYS A HG2  5  
ATOM   2138  H HG3  . LYS A 1 18 ? 20.740  5.598   -10.585 1.00 1.79 ? 18 LYS A HG3  5  
ATOM   2139  H HD2  . LYS A 1 18 ? 21.487  7.352   -11.820 1.00 1.71 ? 18 LYS A HD2  5  
ATOM   2140  H HD3  . LYS A 1 18 ? 20.029  7.099   -12.777 1.00 1.40 ? 18 LYS A HD3  5  
ATOM   2141  H HE2  . LYS A 1 18 ? 19.165  8.628   -10.582 1.00 1.65 ? 18 LYS A HE2  5  
ATOM   2142  H HE3  . LYS A 1 18 ? 20.713  9.351   -11.064 1.00 1.82 ? 18 LYS A HE3  5  
ATOM   2143  H HZ1  . LYS A 1 18 ? 19.926  9.253   -13.396 1.00 1.77 ? 18 LYS A HZ1  5  
ATOM   2144  H HZ2  . LYS A 1 18 ? 18.404  8.733   -12.844 1.00 1.23 ? 18 LYS A HZ2  5  
ATOM   2145  H HZ3  . LYS A 1 18 ? 18.981  10.278  -12.426 1.00 1.75 ? 18 LYS A HZ3  5  
ATOM   2146  N N    . PRO A 1 19 ? 16.161  5.806   -13.204 1.00 0.90 ? 19 PRO A N    5  
ATOM   2147  C CA   . PRO A 1 19 ? 15.572  6.129   -14.536 1.00 0.90 ? 19 PRO A CA   5  
ATOM   2148  C C    . PRO A 1 19 ? 14.059  6.375   -14.404 1.00 0.87 ? 19 PRO A C    5  
ATOM   2149  O O    . PRO A 1 19 ? 13.274  5.442   -14.414 1.00 1.00 ? 19 PRO A O    5  
ATOM   2150  C CB   . PRO A 1 19 ? 15.853  4.891   -15.383 1.00 1.19 ? 19 PRO A CB   5  
ATOM   2151  C CG   . PRO A 1 19 ? 15.986  3.775   -14.405 1.00 1.33 ? 19 PRO A CG   5  
ATOM   2152  C CD   . PRO A 1 19 ? 16.488  4.368   -13.116 1.00 1.18 ? 19 PRO A CD   5  
ATOM   2153  H HA   . PRO A 1 19 ? 16.059  6.989   -14.967 1.00 0.88 ? 19 PRO A HA   5  
ATOM   2154  H HB2  . PRO A 1 19 ? 15.029  4.707   -16.060 1.00 1.32 ? 19 PRO A HB2  5  
ATOM   2155  H HB3  . PRO A 1 19 ? 16.773  5.012   -15.933 1.00 1.24 ? 19 PRO A HB3  5  
ATOM   2156  H HG2  . PRO A 1 19 ? 15.023  3.308   -14.249 1.00 1.45 ? 19 PRO A HG2  5  
ATOM   2157  H HG3  . PRO A 1 19 ? 16.694  3.047   -14.770 1.00 1.52 ? 19 PRO A HG3  5  
ATOM   2158  H HD2  . PRO A 1 19 ? 15.983  3.914   -12.274 1.00 1.28 ? 19 PRO A HD2  5  
ATOM   2159  H HD3  . PRO A 1 19 ? 17.555  4.234   -13.033 1.00 1.30 ? 19 PRO A HD3  5  
ATOM   2160  N N    . PRO A 1 20 ? 13.697  7.633   -14.284 1.00 0.89 ? 20 PRO A N    5  
ATOM   2161  C CA   . PRO A 1 20 ? 12.247  7.957   -14.150 1.00 0.96 ? 20 PRO A CA   5  
ATOM   2162  C C    . PRO A 1 20 ? 11.536  7.843   -15.509 1.00 0.88 ? 20 PRO A C    5  
ATOM   2163  O O    . PRO A 1 20 ? 11.102  8.825   -16.081 1.00 1.06 ? 20 PRO A O    5  
ATOM   2164  C CB   . PRO A 1 20 ? 12.237  9.398   -13.639 1.00 1.22 ? 20 PRO A CB   5  
ATOM   2165  C CG   . PRO A 1 20 ? 13.534  9.972   -14.094 1.00 1.26 ? 20 PRO A CG   5  
ATOM   2166  C CD   . PRO A 1 20 ? 14.524  8.841   -14.115 1.00 1.06 ? 20 PRO A CD   5  
ATOM   2167  H HA   . PRO A 1 20 ? 11.781  7.307   -13.426 1.00 1.02 ? 20 PRO A HA   5  
ATOM   2168  H HB2  . PRO A 1 20 ? 11.408  9.943   -14.070 1.00 1.29 ? 20 PRO A HB2  5  
ATOM   2169  H HB3  . PRO A 1 20 ? 12.181  9.415   -12.562 1.00 1.36 ? 20 PRO A HB3  5  
ATOM   2170  H HG2  . PRO A 1 20 ? 13.425  10.391  -15.085 1.00 1.30 ? 20 PRO A HG2  5  
ATOM   2171  H HG3  . PRO A 1 20 ? 13.865  10.733  -13.404 1.00 1.49 ? 20 PRO A HG3  5  
ATOM   2172  H HD2  . PRO A 1 20 ? 15.208  8.954   -14.946 1.00 1.10 ? 20 PRO A HD2  5  
ATOM   2173  H HD3  . PRO A 1 20 ? 15.063  8.792   -13.183 1.00 1.15 ? 20 PRO A HD3  5  
ATOM   2174  N N    . SER A 1 21 ? 11.411  6.645   -16.023 1.00 0.81 ? 21 SER A N    5  
ATOM   2175  C CA   . SER A 1 21 ? 10.725  6.454   -17.340 1.00 0.87 ? 21 SER A CA   5  
ATOM   2176  C C    . SER A 1 21 ? 9.217   6.293   -17.120 1.00 0.72 ? 21 SER A C    5  
ATOM   2177  O O    . SER A 1 21 ? 8.419   7.020   -17.681 1.00 0.90 ? 21 SER A O    5  
ATOM   2178  C CB   . SER A 1 21 ? 11.330  5.176   -17.931 1.00 1.02 ? 21 SER A CB   5  
ATOM   2179  O OG   . SER A 1 21 ? 11.152  4.098   -17.017 1.00 1.02 ? 21 SER A OG   5  
ATOM   2180  H H    . SER A 1 21 ? 11.766  5.867   -15.540 1.00 0.88 ? 21 SER A H    5  
ATOM   2181  H HA   . SER A 1 21 ? 10.921  7.291   -17.991 1.00 1.05 ? 21 SER A HA   5  
ATOM   2182  H HB2  . SER A 1 21 ? 10.836  4.939   -18.859 1.00 1.13 ? 21 SER A HB2  5  
ATOM   2183  H HB3  . SER A 1 21 ? 12.384  5.334   -18.118 1.00 1.17 ? 21 SER A HB3  5  
ATOM   2184  H HG   . SER A 1 21 ? 11.080  3.285   -17.524 1.00 1.18 ? 21 SER A HG   5  
ATOM   2185  N N    . LYS A 1 22 ? 8.823   5.349   -16.301 1.00 0.59 ? 22 LYS A N    5  
ATOM   2186  C CA   . LYS A 1 22 ? 7.369   5.140   -16.030 1.00 0.56 ? 22 LYS A CA   5  
ATOM   2187  C C    . LYS A 1 22 ? 7.082   5.328   -14.535 1.00 0.54 ? 22 LYS A C    5  
ATOM   2188  O O    . LYS A 1 22 ? 6.525   4.466   -13.878 1.00 0.68 ? 22 LYS A O    5  
ATOM   2189  C CB   . LYS A 1 22 ? 7.080   3.702   -16.474 1.00 0.68 ? 22 LYS A CB   5  
ATOM   2190  C CG   . LYS A 1 22 ? 5.750   3.664   -17.230 1.00 0.75 ? 22 LYS A CG   5  
ATOM   2191  C CD   . LYS A 1 22 ? 6.008   3.558   -18.739 1.00 0.86 ? 22 LYS A CD   5  
ATOM   2192  C CE   . LYS A 1 22 ? 6.802   4.778   -19.228 1.00 0.93 ? 22 LYS A CE   5  
ATOM   2193  N NZ   . LYS A 1 22 ? 5.809   5.887   -19.327 1.00 0.88 ? 22 LYS A NZ   5  
ATOM   2194  H H    . LYS A 1 22 ? 9.490   4.781   -15.858 1.00 0.70 ? 22 LYS A H    5  
ATOM   2195  H HA   . LYS A 1 22 ? 6.779   5.830   -16.609 1.00 0.61 ? 22 LYS A HA   5  
ATOM   2196  H HB2  . LYS A 1 22 ? 7.875   3.358   -17.121 1.00 0.75 ? 22 LYS A HB2  5  
ATOM   2197  H HB3  . LYS A 1 22 ? 7.018   3.061   -15.608 1.00 0.78 ? 22 LYS A HB3  5  
ATOM   2198  H HG2  . LYS A 1 22 ? 5.176   2.808   -16.903 1.00 0.91 ? 22 LYS A HG2  5  
ATOM   2199  H HG3  . LYS A 1 22 ? 5.194   4.566   -17.025 1.00 0.73 ? 22 LYS A HG3  5  
ATOM   2200  H HD2  . LYS A 1 22 ? 6.570   2.658   -18.942 1.00 1.02 ? 22 LYS A HD2  5  
ATOM   2201  H HD3  . LYS A 1 22 ? 5.063   3.514   -19.261 1.00 0.93 ? 22 LYS A HD3  5  
ATOM   2202  H HE2  . LYS A 1 22 ? 7.577   5.027   -18.518 1.00 1.04 ? 22 LYS A HE2  5  
ATOM   2203  H HE3  . LYS A 1 22 ? 7.232   4.578   -20.198 1.00 1.07 ? 22 LYS A HE3  5  
ATOM   2204  H HZ1  . LYS A 1 22 ? 4.933   5.537   -19.785 1.00 0.86 ? 22 LYS A HZ1  5  
ATOM   2205  H HZ2  . LYS A 1 22 ? 5.579   6.245   -18.373 1.00 0.90 ? 22 LYS A HZ2  5  
ATOM   2206  H HZ3  . LYS A 1 22 ? 6.209   6.660   -19.898 1.00 1.03 ? 22 LYS A HZ3  5  
ATOM   2207  N N    . THR A 1 23 ? 7.461   6.460   -13.998 1.00 0.53 ? 23 THR A N    5  
ATOM   2208  C CA   . THR A 1 23 ? 7.221   6.728   -12.546 1.00 0.58 ? 23 THR A CA   5  
ATOM   2209  C C    . THR A 1 23 ? 6.403   8.019   -12.361 1.00 0.62 ? 23 THR A C    5  
ATOM   2210  O O    . THR A 1 23 ? 6.449   8.648   -11.320 1.00 0.73 ? 23 THR A O    5  
ATOM   2211  C CB   . THR A 1 23 ? 8.622   6.865   -11.931 1.00 0.89 ? 23 THR A CB   5  
ATOM   2212  O OG1  . THR A 1 23 ? 8.516   6.901   -10.515 1.00 1.03 ? 23 THR A OG1  5  
ATOM   2213  C CG2  . THR A 1 23 ? 9.293   8.151   -12.421 1.00 1.08 ? 23 THR A CG2  5  
ATOM   2214  H H    . THR A 1 23 ? 7.905   7.135   -14.553 1.00 0.60 ? 23 THR A H    5  
ATOM   2215  H HA   . THR A 1 23 ? 6.705   5.896   -12.093 1.00 0.60 ? 23 THR A HA   5  
ATOM   2216  H HB   . THR A 1 23 ? 9.226   6.018   -12.223 1.00 0.98 ? 23 THR A HB   5  
ATOM   2217  H HG1  . THR A 1 23 ? 8.394   5.995   -10.198 1.00 0.88 ? 23 THR A HG1  5  
ATOM   2218  H HG21 . THR A 1 23 ? 8.691   9.002   -12.139 1.00 1.50 ? 23 THR A HG21 5  
ATOM   2219  H HG22 . THR A 1 23 ? 10.271  8.239   -11.972 1.00 1.48 ? 23 THR A HG22 5  
ATOM   2220  H HG23 . THR A 1 23 ? 9.392   8.120   -13.495 1.00 1.55 ? 23 THR A HG23 5  
ATOM   2221  N N    . CYS A 1 24 ? 5.644   8.413   -13.355 1.00 0.69 ? 24 CYS A N    5  
ATOM   2222  C CA   . CYS A 1 24 ? 4.819   9.650   -13.224 1.00 0.95 ? 24 CYS A CA   5  
ATOM   2223  C C    . CYS A 1 24 ? 3.446   9.297   -12.639 1.00 0.98 ? 24 CYS A C    5  
ATOM   2224  O O    . CYS A 1 24 ? 3.123   9.677   -11.528 1.00 1.07 ? 24 CYS A O    5  
ATOM   2225  C CB   . CYS A 1 24 ? 4.689   10.197  -14.651 1.00 1.15 ? 24 CYS A CB   5  
ATOM   2226  S SG   . CYS A 1 24 ? 3.733   11.734  -14.627 1.00 1.80 ? 24 CYS A SG   5  
ATOM   2227  H H    . CYS A 1 24 ? 5.609   7.889   -14.183 1.00 0.66 ? 24 CYS A H    5  
ATOM   2228  H HA   . CYS A 1 24 ? 5.320   10.371  -12.599 1.00 1.06 ? 24 CYS A HA   5  
ATOM   2229  H HB2  . CYS A 1 24 ? 5.673   10.392  -15.052 1.00 1.27 ? 24 CYS A HB2  5  
ATOM   2230  H HB3  . CYS A 1 24 ? 4.187   9.469   -15.272 1.00 1.39 ? 24 CYS A HB3  5  
ATOM   2231  H HG   . CYS A 1 24 ? 4.191   12.360  -14.062 1.00 2.24 ? 24 CYS A HG   5  
ATOM   2232  N N    . LEU A 1 25 ? 2.646   8.564   -13.373 1.00 0.97 ? 25 LEU A N    5  
ATOM   2233  C CA   . LEU A 1 25 ? 1.297   8.169   -12.865 1.00 1.11 ? 25 LEU A CA   5  
ATOM   2234  C C    . LEU A 1 25 ? 1.018   6.701   -13.216 1.00 1.06 ? 25 LEU A C    5  
ATOM   2235  O O    . LEU A 1 25 ? -0.022  6.367   -13.751 1.00 1.16 ? 25 LEU A O    5  
ATOM   2236  C CB   . LEU A 1 25 ? 0.314   9.101   -13.586 1.00 1.29 ? 25 LEU A CB   5  
ATOM   2237  C CG   . LEU A 1 25 ? 0.281   10.460  -12.881 1.00 1.49 ? 25 LEU A CG   5  
ATOM   2238  C CD1  . LEU A 1 25 ? -0.132  11.542  -13.878 1.00 1.82 ? 25 LEU A CD1  5  
ATOM   2239  C CD2  . LEU A 1 25 ? -0.730  10.416  -11.733 1.00 1.82 ? 25 LEU A CD2  5  
ATOM   2240  H H    . LEU A 1 25 ? 2.938   8.263   -14.260 1.00 0.92 ? 25 LEU A H    5  
ATOM   2241  H HA   . LEU A 1 25 ? 1.235   8.318   -11.799 1.00 1.20 ? 25 LEU A HA   5  
ATOM   2242  H HB2  . LEU A 1 25 ? 0.631   9.234   -14.610 1.00 1.21 ? 25 LEU A HB2  5  
ATOM   2243  H HB3  . LEU A 1 25 ? -0.674  8.666   -13.569 1.00 1.46 ? 25 LEU A HB3  5  
ATOM   2244  H HG   . LEU A 1 25 ? 1.262   10.687  -12.491 1.00 1.41 ? 25 LEU A HG   5  
ATOM   2245  H HD11 . LEU A 1 25 ? -1.057  11.257  -14.357 1.00 2.25 ? 25 LEU A HD11 5  
ATOM   2246  H HD12 . LEU A 1 25 ? -0.271  12.478  -13.357 1.00 2.24 ? 25 LEU A HD12 5  
ATOM   2247  H HD13 . LEU A 1 25 ? 0.639   11.657  -14.625 1.00 1.98 ? 25 LEU A HD13 5  
ATOM   2248  H HD21 . LEU A 1 25 ? -0.627  9.484   -11.197 1.00 2.22 ? 25 LEU A HD21 5  
ATOM   2249  H HD22 . LEU A 1 25 ? -0.547  11.241  -11.060 1.00 2.15 ? 25 LEU A HD22 5  
ATOM   2250  H HD23 . LEU A 1 25 ? -1.730  10.493  -12.132 1.00 2.07 ? 25 LEU A HD23 5  
ATOM   2251  N N    . LYS A 1 26 ? 1.952   5.824   -12.917 1.00 0.99 ? 26 LYS A N    5  
ATOM   2252  C CA   . LYS A 1 26 ? 1.775   4.368   -13.227 1.00 1.03 ? 26 LYS A CA   5  
ATOM   2253  C C    . LYS A 1 26 ? 1.325   4.174   -14.685 1.00 0.98 ? 26 LYS A C    5  
ATOM   2254  O O    . LYS A 1 26 ? 0.256   3.657   -14.953 1.00 1.14 ? 26 LYS A O    5  
ATOM   2255  C CB   . LYS A 1 26 ? 0.705   3.871   -12.246 1.00 1.30 ? 26 LYS A CB   5  
ATOM   2256  C CG   . LYS A 1 26 ? 1.344   3.516   -10.892 1.00 1.37 ? 26 LYS A CG   5  
ATOM   2257  C CD   . LYS A 1 26 ? 2.566   2.605   -11.093 1.00 1.35 ? 26 LYS A CD   5  
ATOM   2258  C CE   . LYS A 1 26 ? 2.170   1.352   -11.885 1.00 1.50 ? 26 LYS A CE   5  
ATOM   2259  N NZ   . LYS A 1 26 ? 3.360   1.028   -12.726 1.00 1.47 ? 26 LYS A NZ   5  
ATOM   2260  H H    . LYS A 1 26 ? 2.777   6.128   -12.488 1.00 1.00 ? 26 LYS A H    5  
ATOM   2261  H HA   . LYS A 1 26 ? 2.699   3.840   -13.059 1.00 0.99 ? 26 LYS A HA   5  
ATOM   2262  H HB2  . LYS A 1 26 ? -0.031  4.649   -12.098 1.00 1.39 ? 26 LYS A HB2  5  
ATOM   2263  H HB3  . LYS A 1 26 ? 0.222   2.997   -12.654 1.00 1.39 ? 26 LYS A HB3  5  
ATOM   2264  H HG2  . LYS A 1 26 ? 1.653   4.423   -10.395 1.00 1.33 ? 26 LYS A HG2  5  
ATOM   2265  H HG3  . LYS A 1 26 ? 0.617   3.003   -10.279 1.00 1.56 ? 26 LYS A HG3  5  
ATOM   2266  H HD2  . LYS A 1 26 ? 3.331   3.147   -11.631 1.00 1.23 ? 26 LYS A HD2  5  
ATOM   2267  H HD3  . LYS A 1 26 ? 2.951   2.310   -10.129 1.00 1.43 ? 26 LYS A HD3  5  
ATOM   2268  H HE2  . LYS A 1 26 ? 1.950   0.537   -11.208 1.00 1.62 ? 26 LYS A HE2  5  
ATOM   2269  H HE3  . LYS A 1 26 ? 1.317   1.556   -12.515 1.00 1.58 ? 26 LYS A HE3  5  
ATOM   2270  H HZ1  . LYS A 1 26 ? 3.763   1.903   -13.116 1.00 1.38 ? 26 LYS A HZ1  5  
ATOM   2271  H HZ2  . LYS A 1 26 ? 4.074   0.542   -12.148 1.00 1.56 ? 26 LYS A HZ2  5  
ATOM   2272  H HZ3  . LYS A 1 26 ? 3.069   0.401   -13.514 1.00 1.59 ? 26 LYS A HZ3  5  
ATOM   2273  N N    . GLU A 1 27 ? 2.138   4.589   -15.623 1.00 0.81 ? 27 GLU A N    5  
ATOM   2274  C CA   . GLU A 1 27 ? 1.768   4.438   -17.067 1.00 0.81 ? 27 GLU A CA   5  
ATOM   2275  C C    . GLU A 1 27 ? 1.993   2.985   -17.514 1.00 0.85 ? 27 GLU A C    5  
ATOM   2276  O O    . GLU A 1 27 ? 2.964   2.669   -18.177 1.00 0.84 ? 27 GLU A O    5  
ATOM   2277  C CB   . GLU A 1 27 ? 2.693   5.393   -17.838 1.00 0.76 ? 27 GLU A CB   5  
ATOM   2278  C CG   . GLU A 1 27 ? 2.727   6.772   -17.159 1.00 0.81 ? 27 GLU A CG   5  
ATOM   2279  C CD   . GLU A 1 27 ? 4.064   6.958   -16.437 1.00 0.74 ? 27 GLU A CD   5  
ATOM   2280  O OE1  . GLU A 1 27 ? 5.045   7.229   -17.109 1.00 0.88 ? 27 GLU A OE1  5  
ATOM   2281  O OE2  . GLU A 1 27 ? 4.084   6.821   -15.225 1.00 0.75 ? 27 GLU A OE2  5  
ATOM   2282  H H    . GLU A 1 27 ? 2.993   5.001   -15.379 1.00 0.74 ? 27 GLU A H    5  
ATOM   2283  H HA   . GLU A 1 27 ? 0.739   4.720   -17.220 1.00 0.95 ? 27 GLU A HA   5  
ATOM   2284  H HB2  . GLU A 1 27 ? 3.691   4.982   -17.863 1.00 0.72 ? 27 GLU A HB2  5  
ATOM   2285  H HB3  . GLU A 1 27 ? 2.328   5.503   -18.848 1.00 0.89 ? 27 GLU A HB3  5  
ATOM   2286  H HG2  . GLU A 1 27 ? 2.613   7.541   -17.907 1.00 0.95 ? 27 GLU A HG2  5  
ATOM   2287  H HG3  . GLU A 1 27 ? 1.921   6.844   -16.446 1.00 0.89 ? 27 GLU A HG3  5  
ATOM   2288  N N    . GLU A 1 28 ? 1.100   2.101   -17.146 1.00 1.08 ? 28 GLU A N    5  
ATOM   2289  C CA   . GLU A 1 28 ? 1.250   0.662   -17.536 1.00 1.25 ? 28 GLU A CA   5  
ATOM   2290  C C    . GLU A 1 28 ? 1.217   0.513   -19.063 1.00 1.25 ? 28 GLU A C    5  
ATOM   2291  O O    . GLU A 1 28 ? 2.044   -0.164  -19.645 1.00 1.37 ? 28 GLU A O    5  
ATOM   2292  C CB   . GLU A 1 28 ? 0.057   -0.059  -16.895 1.00 1.56 ? 28 GLU A CB   5  
ATOM   2293  C CG   . GLU A 1 28 ? 0.135   0.061   -15.367 1.00 1.65 ? 28 GLU A CG   5  
ATOM   2294  C CD   . GLU A 1 28 ? 1.287   -0.794  -14.834 1.00 1.76 ? 28 GLU A CD   5  
ATOM   2295  O OE1  . GLU A 1 28 ? 2.392   -0.282  -14.754 1.00 1.72 ? 28 GLU A OE1  5  
ATOM   2296  O OE2  . GLU A 1 28 ? 1.046   -1.943  -14.508 1.00 2.01 ? 28 GLU A OE2  5  
ATOM   2297  H H    . GLU A 1 28 ? 0.330   2.384   -16.606 1.00 1.19 ? 28 GLU A H    5  
ATOM   2298  H HA   . GLU A 1 28 ? 2.172   0.263   -17.144 1.00 1.26 ? 28 GLU A HA   5  
ATOM   2299  H HB2  . GLU A 1 28 ? -0.863  0.388   -17.244 1.00 1.63 ? 28 GLU A HB2  5  
ATOM   2300  H HB3  . GLU A 1 28 ? 0.077   -1.102  -17.173 1.00 1.72 ? 28 GLU A HB3  5  
ATOM   2301  H HG2  . GLU A 1 28 ? 0.300   1.093   -15.094 1.00 1.50 ? 28 GLU A HG2  5  
ATOM   2302  H HG3  . GLU A 1 28 ? -0.792  -0.280  -14.932 1.00 1.88 ? 28 GLU A HG3  5  
ATOM   2303  N N    . MET A 1 29 ? 0.275   1.148   -19.718 1.00 1.23 ? 29 MET A N    5  
ATOM   2304  C CA   . MET A 1 29 ? 0.196   1.049   -21.209 1.00 1.29 ? 29 MET A CA   5  
ATOM   2305  C C    . MET A 1 29 ? 1.004   2.187   -21.856 1.00 1.10 ? 29 MET A C    5  
ATOM   2306  O O    . MET A 1 29 ? 0.454   3.054   -22.509 1.00 1.25 ? 29 MET A O    5  
ATOM   2307  C CB   . MET A 1 29 ? -1.296  1.175   -21.539 1.00 1.57 ? 29 MET A CB   5  
ATOM   2308  C CG   . MET A 1 29 ? -1.573  0.554   -22.910 1.00 1.78 ? 29 MET A CG   5  
ATOM   2309  S SD   . MET A 1 29 ? -3.213  1.063   -23.482 1.00 2.68 ? 29 MET A SD   5  
ATOM   2310  C CE   . MET A 1 29 ? -2.665  2.309   -24.674 1.00 3.72 ? 29 MET A CE   5  
ATOM   2311  H H    . MET A 1 29 ? -0.376  1.694   -19.230 1.00 1.27 ? 29 MET A H    5  
ATOM   2312  H HA   . MET A 1 29 ? 0.567   0.091   -21.541 1.00 1.40 ? 29 MET A HA   5  
ATOM   2313  H HB2  . MET A 1 29 ? -1.876  0.658   -20.787 1.00 1.73 ? 29 MET A HB2  5  
ATOM   2314  H HB3  . MET A 1 29 ? -1.575  2.219   -21.554 1.00 1.70 ? 29 MET A HB3  5  
ATOM   2315  H HG2  . MET A 1 29 ? -0.826  0.890   -23.615 1.00 1.89 ? 29 MET A HG2  5  
ATOM   2316  H HG3  . MET A 1 29 ? -1.535  -0.522  -22.833 1.00 1.79 ? 29 MET A HG3  5  
ATOM   2317  H HE1  . MET A 1 29 ? -1.900  2.924   -24.227 1.00 4.08 ? 29 MET A HE1  5  
ATOM   2318  H HE2  . MET A 1 29 ? -2.262  1.817   -25.549 1.00 4.05 ? 29 MET A HE2  5  
ATOM   2319  H HE3  . MET A 1 29 ? -3.504  2.930   -24.956 1.00 4.19 ? 29 MET A HE3  5  
ATOM   2320  N N    . ALA A 1 30 ? 2.309   2.175   -21.669 1.00 1.00 ? 30 ALA A N    5  
ATOM   2321  C CA   . ALA A 1 30 ? 3.203   3.234   -22.252 1.00 1.03 ? 30 ALA A CA   5  
ATOM   2322  C C    . ALA A 1 30 ? 2.984   4.587   -21.551 1.00 0.99 ? 30 ALA A C    5  
ATOM   2323  O O    . ALA A 1 30 ? 3.815   4.939   -20.729 1.00 0.99 ? 30 ALA A O    5  
ATOM   2324  C CB   . ALA A 1 30 ? 2.847   3.314   -23.743 1.00 1.30 ? 30 ALA A CB   5  
ATOM   2325  O OXT  . ALA A 1 30 ? 2.001   5.250   -21.844 1.00 1.40 ? 30 ALA A OXT  5  
ATOM   2326  H H    . ALA A 1 30 ? 2.709   1.456   -21.135 1.00 1.09 ? 30 ALA A H    5  
ATOM   2327  H HA   . ALA A 1 30 ? 4.236   2.936   -22.146 1.00 1.13 ? 30 ALA A HA   5  
ATOM   2328  H HB1  . ALA A 1 30 ? 2.588   2.329   -24.105 1.00 1.57 ? 30 ALA A HB1  5  
ATOM   2329  H HB2  . ALA A 1 30 ? 2.006   3.979   -23.878 1.00 1.61 ? 30 ALA A HB2  5  
ATOM   2330  H HB3  . ALA A 1 30 ? 3.695   3.688   -24.297 1.00 1.55 ? 30 ALA A HB3  5  
ATOM   2331  N N    . MET A 1 1  ? -9.041  10.924  13.069  1.00 4.80 ? 1  MET A N    6  
ATOM   2332  C CA   . MET A 1 1  ? -8.066  11.900  12.488  1.00 4.07 ? 1  MET A CA   6  
ATOM   2333  C C    . MET A 1 1  ? -6.710  11.221  12.236  1.00 3.16 ? 1  MET A C    6  
ATOM   2334  O O    . MET A 1 1  ? -6.554  10.034  12.455  1.00 3.19 ? 1  MET A O    6  
ATOM   2335  C CB   . MET A 1 1  ? -7.935  13.020  13.534  1.00 4.21 ? 1  MET A CB   6  
ATOM   2336  C CG   . MET A 1 1  ? -7.219  12.501  14.789  1.00 3.98 ? 1  MET A CG   6  
ATOM   2337  S SD   . MET A 1 1  ? -8.438  12.162  16.083  1.00 4.79 ? 1  MET A SD   6  
ATOM   2338  C CE   . MET A 1 1  ? -7.267  11.917  17.440  1.00 4.68 ? 1  MET A CE   6  
ATOM   2339  H H1   . MET A 1 1  ? -8.638  10.501  13.932  1.00 5.14 ? 1  MET A H1   6  
ATOM   2340  H H2   . MET A 1 1  ? -9.927  11.415  13.305  1.00 5.23 ? 1  MET A H2   6  
ATOM   2341  H H3   . MET A 1 1  ? -9.236  10.175  12.376  1.00 4.86 ? 1  MET A H3   6  
ATOM   2342  H HA   . MET A 1 1  ? -8.452  12.306  11.566  1.00 4.30 ? 1  MET A HA   6  
ATOM   2343  H HB2  . MET A 1 1  ? -7.368  13.838  13.113  1.00 4.04 ? 1  MET A HB2  6  
ATOM   2344  H HB3  . MET A 1 1  ? -8.919  13.372  13.806  1.00 4.88 ? 1  MET A HB3  6  
ATOM   2345  H HG2  . MET A 1 1  ? -6.682  11.594  14.554  1.00 3.76 ? 1  MET A HG2  6  
ATOM   2346  H HG3  . MET A 1 1  ? -6.522  13.249  15.140  1.00 3.81 ? 1  MET A HG3  6  
ATOM   2347  H HE1  . MET A 1 1  ? -6.595  11.106  17.194  1.00 4.64 ? 1  MET A HE1  6  
ATOM   2348  H HE2  . MET A 1 1  ? -6.701  12.826  17.595  1.00 4.80 ? 1  MET A HE2  6  
ATOM   2349  H HE3  . MET A 1 1  ? -7.805  11.674  18.342  1.00 5.03 ? 1  MET A HE3  6  
ATOM   2350  N N    . ILE A 1 2  ? -5.732  11.965  11.782  1.00 2.60 ? 2  ILE A N    6  
ATOM   2351  C CA   . ILE A 1 2  ? -4.387  11.363  11.520  1.00 1.74 ? 2  ILE A CA   6  
ATOM   2352  C C    . ILE A 1 2  ? -3.492  11.505  12.761  1.00 1.57 ? 2  ILE A C    6  
ATOM   2353  O O    . ILE A 1 2  ? -3.469  12.535  13.408  1.00 1.88 ? 2  ILE A O    6  
ATOM   2354  C CB   . ILE A 1 2  ? -3.814  12.155  10.336  1.00 1.76 ? 2  ILE A CB   6  
ATOM   2355  C CG1  . ILE A 1 2  ? -4.553  11.756  9.054   1.00 1.93 ? 2  ILE A CG1  6  
ATOM   2356  C CG2  . ILE A 1 2  ? -2.322  11.845  10.176  1.00 2.25 ? 2  ILE A CG2  6  
ATOM   2357  C CD1  . ILE A 1 2  ? -4.249  12.770  7.949   1.00 2.42 ? 2  ILE A CD1  6  
ATOM   2358  H H    . ILE A 1 2  ? -5.880  12.919  11.616  1.00 2.91 ? 2  ILE A H    6  
ATOM   2359  H HA   . ILE A 1 2  ? -4.488  10.323  11.251  1.00 1.61 ? 2  ILE A HA   6  
ATOM   2360  H HB   . ILE A 1 2  ? -3.944  13.213  10.515  1.00 2.13 ? 2  ILE A HB   6  
ATOM   2361  H HG12 . ILE A 1 2  ? -4.227  10.774  8.742   1.00 2.27 ? 2  ILE A HG12 6  
ATOM   2362  H HG13 . ILE A 1 2  ? -5.616  11.740  9.241   1.00 2.15 ? 2  ILE A HG13 6  
ATOM   2363  H HG21 . ILE A 1 2  ? -2.139  10.810  10.426  1.00 2.53 ? 2  ILE A HG21 6  
ATOM   2364  H HG22 . ILE A 1 2  ? -2.024  12.026  9.154   1.00 2.70 ? 2  ILE A HG22 6  
ATOM   2365  H HG23 . ILE A 1 2  ? -1.749  12.481  10.836  1.00 2.54 ? 2  ILE A HG23 6  
ATOM   2366  H HD11 . ILE A 1 2  ? -3.181  12.914  7.876   1.00 2.94 ? 2  ILE A HD11 6  
ATOM   2367  H HD12 . ILE A 1 2  ? -4.627  12.400  7.007   1.00 2.79 ? 2  ILE A HD12 6  
ATOM   2368  H HD13 . ILE A 1 2  ? -4.725  13.711  8.182   1.00 2.57 ? 2  ILE A HD13 6  
ATOM   2369  N N    . SER A 1 3  ? -2.757  10.473  13.091  1.00 1.28 ? 3  SER A N    6  
ATOM   2370  C CA   . SER A 1 3  ? -1.856  10.527  14.284  1.00 1.34 ? 3  SER A CA   6  
ATOM   2371  C C    . SER A 1 3  ? -0.688  9.543   14.111  1.00 1.20 ? 3  SER A C    6  
ATOM   2372  O O    . SER A 1 3  ? -0.398  9.102   13.014  1.00 1.18 ? 3  SER A O    6  
ATOM   2373  C CB   . SER A 1 3  ? -2.742  10.119  15.464  1.00 1.59 ? 3  SER A CB   6  
ATOM   2374  O OG   . SER A 1 3  ? -2.010  10.271  16.677  1.00 1.79 ? 3  SER A OG   6  
ATOM   2375  H H    . SER A 1 3  ? -2.797  9.654   12.547  1.00 1.22 ? 3  SER A H    6  
ATOM   2376  H HA   . SER A 1 3  ? -1.485  11.530  14.430  1.00 1.59 ? 3  SER A HA   6  
ATOM   2377  H HB2  . SER A 1 3  ? -3.616  10.748  15.495  1.00 1.82 ? 3  SER A HB2  6  
ATOM   2378  H HB3  . SER A 1 3  ? -3.048  9.088   15.343  1.00 1.64 ? 3  SER A HB3  6  
ATOM   2379  H HG   . SER A 1 3  ? -2.439  10.953  17.202  1.00 2.10 ? 3  SER A HG   6  
ATOM   2380  N N    . SER A 1 4  ? -0.018  9.194   15.183  1.00 1.37 ? 4  SER A N    6  
ATOM   2381  C CA   . SER A 1 4  ? 1.131   8.235   15.078  1.00 1.60 ? 4  SER A CA   6  
ATOM   2382  C C    . SER A 1 4  ? 0.633   6.822   14.746  1.00 1.70 ? 4  SER A C    6  
ATOM   2383  O O    . SER A 1 4  ? 1.317   6.054   14.097  1.00 2.04 ? 4  SER A O    6  
ATOM   2384  C CB   . SER A 1 4  ? 1.806   8.258   16.450  1.00 1.84 ? 4  SER A CB   6  
ATOM   2385  O OG   . SER A 1 4  ? 2.796   9.280   16.468  1.00 2.18 ? 4  SER A OG   6  
ATOM   2386  H H    . SER A 1 4  ? -0.271  9.562   16.058  1.00 1.49 ? 4  SER A H    6  
ATOM   2387  H HA   . SER A 1 4  ? 1.824   8.568   14.325  1.00 1.69 ? 4  SER A HA   6  
ATOM   2388  H HB2  . SER A 1 4  ? 1.073   8.461   17.213  1.00 1.76 ? 4  SER A HB2  6  
ATOM   2389  H HB3  . SER A 1 4  ? 2.263   7.295   16.642  1.00 1.97 ? 4  SER A HB3  6  
ATOM   2390  H HG   . SER A 1 4  ? 3.638   8.877   16.694  1.00 2.45 ? 4  SER A HG   6  
ATOM   2391  N N    . VAL A 1 5  ? -0.549  6.476   15.186  1.00 1.62 ? 5  VAL A N    6  
ATOM   2392  C CA   . VAL A 1 5  ? -1.098  5.111   14.898  1.00 1.96 ? 5  VAL A CA   6  
ATOM   2393  C C    . VAL A 1 5  ? -1.752  5.080   13.511  1.00 1.94 ? 5  VAL A C    6  
ATOM   2394  O O    . VAL A 1 5  ? -1.586  4.141   12.758  1.00 2.29 ? 5  VAL A O    6  
ATOM   2395  C CB   . VAL A 1 5  ? -2.138  4.854   15.995  1.00 2.11 ? 5  VAL A CB   6  
ATOM   2396  C CG1  . VAL A 1 5  ? -2.795  3.490   15.772  1.00 2.60 ? 5  VAL A CG1  6  
ATOM   2397  C CG2  . VAL A 1 5  ? -1.453  4.864   17.366  1.00 2.17 ? 5  VAL A CG2  6  
ATOM   2398  H H    . VAL A 1 5  ? -1.078  7.114   15.706  1.00 1.47 ? 5  VAL A H    6  
ATOM   2399  H HA   . VAL A 1 5  ? -0.316  4.377   14.954  1.00 2.24 ? 5  VAL A HA   6  
ATOM   2400  H HB   . VAL A 1 5  ? -2.894  5.625   15.964  1.00 2.00 ? 5  VAL A HB   6  
ATOM   2401  H HG11 . VAL A 1 5  ? -2.041  2.718   15.799  1.00 2.71 ? 5  VAL A HG11 6  
ATOM   2402  H HG12 . VAL A 1 5  ? -3.522  3.311   16.550  1.00 3.13 ? 5  VAL A HG12 6  
ATOM   2403  H HG13 . VAL A 1 5  ? -3.287  3.480   14.811  1.00 2.88 ? 5  VAL A HG13 6  
ATOM   2404  H HG21 . VAL A 1 5  ? -0.493  4.374   17.292  1.00 2.52 ? 5  VAL A HG21 6  
ATOM   2405  H HG22 . VAL A 1 5  ? -1.311  5.885   17.689  1.00 2.32 ? 5  VAL A HG22 6  
ATOM   2406  H HG23 . VAL A 1 5  ? -2.070  4.342   18.081  1.00 2.35 ? 5  VAL A HG23 6  
ATOM   2407  N N    . CYS A 1 6  ? -2.489  6.104   13.173  1.00 1.60 ? 6  CYS A N    6  
ATOM   2408  C CA   . CYS A 1 6  ? -3.157  6.149   11.836  1.00 1.56 ? 6  CYS A CA   6  
ATOM   2409  C C    . CYS A 1 6  ? -2.673  7.370   11.044  1.00 1.14 ? 6  CYS A C    6  
ATOM   2410  O O    . CYS A 1 6  ? -2.981  8.499   11.377  1.00 0.98 ? 6  CYS A O    6  
ATOM   2411  C CB   . CYS A 1 6  ? -4.653  6.263   12.136  1.00 1.82 ? 6  CYS A CB   6  
ATOM   2412  S SG   . CYS A 1 6  ? -5.236  4.735   12.915  1.00 2.50 ? 6  CYS A SG   6  
ATOM   2413  H H    . CYS A 1 6  ? -2.600  6.845   13.798  1.00 1.42 ? 6  CYS A H    6  
ATOM   2414  H HA   . CYS A 1 6  ? -2.962  5.242   11.284  1.00 1.82 ? 6  CYS A HA   6  
ATOM   2415  H HB2  . CYS A 1 6  ? -4.822  7.095   12.803  1.00 1.82 ? 6  CYS A HB2  6  
ATOM   2416  H HB3  . CYS A 1 6  ? -5.192  6.426   11.214  1.00 1.80 ? 6  CYS A HB3  6  
ATOM   2417  H HG   . CYS A 1 6  ? -4.937  4.735   13.827  1.00 2.90 ? 6  CYS A HG   6  
ATOM   2418  N N    . VAL A 1 7  ? -1.917  7.148   10.004  1.00 1.18 ? 7  VAL A N    6  
ATOM   2419  C CA   . VAL A 1 7  ? -1.401  8.281   9.184   1.00 1.05 ? 7  VAL A CA   6  
ATOM   2420  C C    . VAL A 1 7  ? -1.660  8.020   7.692   1.00 1.03 ? 7  VAL A C    6  
ATOM   2421  O O    . VAL A 1 7  ? -2.292  7.049   7.317   1.00 1.04 ? 7  VAL A O    6  
ATOM   2422  C CB   . VAL A 1 7  ? 0.103   8.329   9.499   1.00 1.47 ? 7  VAL A CB   6  
ATOM   2423  C CG1  . VAL A 1 7  ? 0.858   7.293   8.658   1.00 1.86 ? 7  VAL A CG1  6  
ATOM   2424  C CG2  . VAL A 1 7  ? 0.652   9.726   9.201   1.00 1.68 ? 7  VAL A CG2  6  
ATOM   2425  H H    . VAL A 1 7  ? -1.683  6.234   9.760   1.00 1.45 ? 7  VAL A H    6  
ATOM   2426  H HA   . VAL A 1 7  ? -1.868  9.204   9.485   1.00 0.91 ? 7  VAL A HA   6  
ATOM   2427  H HB   . VAL A 1 7  ? 0.249   8.106   10.544  1.00 1.52 ? 7  VAL A HB   6  
ATOM   2428  H HG11 . VAL A 1 7  ? 0.247   6.410   8.538   1.00 2.34 ? 7  VAL A HG11 6  
ATOM   2429  H HG12 . VAL A 1 7  ? 1.081   7.711   7.687   1.00 2.19 ? 7  VAL A HG12 6  
ATOM   2430  H HG13 . VAL A 1 7  ? 1.778   7.027   9.155   1.00 2.11 ? 7  VAL A HG13 6  
ATOM   2431  H HG21 . VAL A 1 7  ? -0.163  10.432  9.155   1.00 1.55 ? 7  VAL A HG21 6  
ATOM   2432  H HG22 . VAL A 1 7  ? 1.336   10.018  9.985   1.00 1.88 ? 7  VAL A HG22 6  
ATOM   2433  H HG23 . VAL A 1 7  ? 1.174   9.714   8.255   1.00 1.96 ? 7  VAL A HG23 6  
HETATM 2434  N N    . SEP A 1 8  ? -1.173  8.883   6.845   1.00 1.17 ? 8  SEP A N    6  
HETATM 2435  C CA   . SEP A 1 8  ? -1.378  8.707   5.373   1.00 1.17 ? 8  SEP A CA   6  
HETATM 2436  C CB   . SEP A 1 8  ? -2.266  9.879   4.948   1.00 1.19 ? 8  SEP A CB   6  
HETATM 2437  O OG   . SEP A 1 8  ? -3.301  9.400   4.080   1.00 1.27 ? 8  SEP A OG   6  
HETATM 2438  C C    . SEP A 1 8  ? -0.035  8.751   4.637   1.00 1.15 ? 8  SEP A C    6  
HETATM 2439  O O    . SEP A 1 8  ? 0.330   7.815   3.955   1.00 1.18 ? 8  SEP A O    6  
HETATM 2440  P P    . SEP A 1 8  ? -4.696  8.866   4.682   1.00 1.41 ? 8  SEP A P    6  
HETATM 2441  O O1P  . SEP A 1 8  ? -5.032  9.684   5.869   1.00 1.75 ? 8  SEP A O1P  6  
HETATM 2442  O O2P  . SEP A 1 8  ? -5.665  8.747   3.570   1.00 1.73 ? 8  SEP A O2P  6  
HETATM 2443  O O3P  . SEP A 1 8  ? -4.320  7.384   5.184   1.00 1.82 ? 8  SEP A O3P  6  
HETATM 2444  H H    . SEP A 1 8  ? -0.671  9.650   7.181   1.00 1.35 ? 8  SEP A H    6  
HETATM 2445  H HA   . SEP A 1 8  ? -1.878  7.777   5.173   1.00 1.22 ? 8  SEP A HA   6  
HETATM 2446  H HB2  . SEP A 1 8  ? -1.664  10.617  4.432   1.00 1.19 ? 8  SEP A HB2  6  
HETATM 2447  H HB3  . SEP A 1 8  ? -2.711  10.330  5.819   1.00 1.24 ? 8  SEP A HB3  6  
HETATM 2448  H HOP3 . SEP A 1 8  ? -3.689  7.478   5.901   1.00 2.03 ? 8  SEP A HOP3 6  
ATOM   2449  N N    . SER A 1 9  ? 0.692   9.836   4.782   1.00 1.14 ? 9  SER A N    6  
ATOM   2450  C CA   . SER A 1 9  ? 2.027   9.992   4.111   1.00 1.16 ? 9  SER A CA   6  
ATOM   2451  C C    . SER A 1 9  ? 1.885   9.977   2.585   1.00 1.09 ? 9  SER A C    6  
ATOM   2452  O O    . SER A 1 9  ? 1.578   8.962   1.997   1.00 1.07 ? 9  SER A O    6  
ATOM   2453  C CB   . SER A 1 9  ? 2.877   8.811   4.577   1.00 1.24 ? 9  SER A CB   6  
ATOM   2454  O OG   . SER A 1 9  ? 2.936   8.799   6.001   1.00 1.41 ? 9  SER A OG   6  
ATOM   2455  H H    . SER A 1 9  ? 0.358   10.559  5.345   1.00 1.15 ? 9  SER A H    6  
ATOM   2456  H HA   . SER A 1 9  ? 2.490   10.913  4.427   1.00 1.22 ? 9  SER A HA   6  
ATOM   2457  H HB2  . SER A 1 9  ? 2.438   7.892   4.230   1.00 1.26 ? 9  SER A HB2  6  
ATOM   2458  H HB3  . SER A 1 9  ? 3.872   8.909   4.165   1.00 1.28 ? 9  SER A HB3  6  
ATOM   2459  H HG   . SER A 1 9  ? 3.393   7.999   6.273   1.00 1.69 ? 9  SER A HG   6  
ATOM   2460  N N    . TYR A 1 10 ? 2.133   11.109  1.958   1.00 1.09 ? 10 TYR A N    6  
ATOM   2461  C CA   . TYR A 1 10 ? 2.053   11.249  0.458   1.00 1.06 ? 10 TYR A CA   6  
ATOM   2462  C C    . TYR A 1 10 ? 0.913   10.402  -0.164  1.00 1.02 ? 10 TYR A C    6  
ATOM   2463  O O    . TYR A 1 10 ? -0.024  10.005  0.504   1.00 1.04 ? 10 TYR A O    6  
ATOM   2464  C CB   . TYR A 1 10 ? 3.468   10.851  -0.040  1.00 1.08 ? 10 TYR A CB   6  
ATOM   2465  C CG   . TYR A 1 10 ? 3.567   9.386   -0.415  1.00 1.03 ? 10 TYR A CG   6  
ATOM   2466  C CD1  . TYR A 1 10 ? 3.697   8.407   0.576   1.00 1.08 ? 10 TYR A CD1  6  
ATOM   2467  C CD2  . TYR A 1 10 ? 3.545   9.015   -1.761  1.00 0.98 ? 10 TYR A CD2  6  
ATOM   2468  C CE1  . TYR A 1 10 ? 3.797   7.058   0.217   1.00 1.10 ? 10 TYR A CE1  6  
ATOM   2469  C CE2  . TYR A 1 10 ? 3.646   7.668   -2.120  1.00 0.97 ? 10 TYR A CE2  6  
ATOM   2470  C CZ   . TYR A 1 10 ? 3.771   6.689   -1.132  1.00 1.04 ? 10 TYR A CZ   6  
ATOM   2471  O OH   . TYR A 1 10 ? 3.866   5.358   -1.485  1.00 1.10 ? 10 TYR A OH   6  
ATOM   2472  H H    . TYR A 1 10 ? 2.394   11.887  2.487   1.00 1.14 ? 10 TYR A H    6  
ATOM   2473  H HA   . TYR A 1 10 ? 1.884   12.283  0.214   1.00 1.11 ? 10 TYR A HA   6  
ATOM   2474  H HB2  . TYR A 1 10 ? 3.712   11.444  -0.906  1.00 1.10 ? 10 TYR A HB2  6  
ATOM   2475  H HB3  . TYR A 1 10 ? 4.184   11.062  0.741   1.00 1.16 ? 10 TYR A HB3  6  
ATOM   2476  H HD1  . TYR A 1 10 ? 3.714   8.692   1.620   1.00 1.13 ? 10 TYR A HD1  6  
ATOM   2477  H HD2  . TYR A 1 10 ? 3.450   9.771   -2.524  1.00 0.98 ? 10 TYR A HD2  6  
ATOM   2478  H HE1  . TYR A 1 10 ? 3.897   6.302   0.980   1.00 1.18 ? 10 TYR A HE1  6  
ATOM   2479  H HE2  . TYR A 1 10 ? 3.626   7.386   -3.161  1.00 0.94 ? 10 TYR A HE2  6  
ATOM   2480  H HH   . TYR A 1 10 ? 3.107   4.899   -1.114  1.00 1.11 ? 10 TYR A HH   6  
ATOM   2481  N N    . ARG A 1 11 ? 0.968   10.156  -1.448  1.00 0.99 ? 11 ARG A N    6  
ATOM   2482  C CA   . ARG A 1 11 ? -0.106  9.353   -2.108  1.00 1.01 ? 11 ARG A CA   6  
ATOM   2483  C C    . ARG A 1 11 ? 0.212   7.855   -1.963  1.00 1.02 ? 11 ARG A C    6  
ATOM   2484  O O    . ARG A 1 11 ? 0.789   7.437   -0.978  1.00 1.05 ? 11 ARG A O    6  
ATOM   2485  C CB   . ARG A 1 11 ? -0.083  9.808   -3.574  1.00 1.01 ? 11 ARG A CB   6  
ATOM   2486  C CG   . ARG A 1 11 ? -0.691  11.212  -3.683  1.00 1.15 ? 11 ARG A CG   6  
ATOM   2487  C CD   . ARG A 1 11 ? -2.175  11.168  -3.292  1.00 1.37 ? 11 ARG A CD   6  
ATOM   2488  N NE   . ARG A 1 11 ? -2.231  11.730  -1.908  1.00 1.48 ? 11 ARG A NE   6  
ATOM   2489  C CZ   . ARG A 1 11 ? -3.071  11.243  -1.037  1.00 1.55 ? 11 ARG A CZ   6  
ATOM   2490  N NH1  . ARG A 1 11 ? -4.349  11.445  -1.185  1.00 1.83 ? 11 ARG A NH1  6  
ATOM   2491  N NH2  . ARG A 1 11 ? -2.631  10.562  -0.017  1.00 1.44 ? 11 ARG A NH2  6  
ATOM   2492  H H    . ARG A 1 11 ? 1.705   10.509  -1.982  1.00 0.99 ? 11 ARG A H    6  
ATOM   2493  H HA   . ARG A 1 11 ? -1.062  9.569   -1.671  1.00 1.07 ? 11 ARG A HA   6  
ATOM   2494  H HB2  . ARG A 1 11 ? 0.936   9.827   -3.930  1.00 0.95 ? 11 ARG A HB2  6  
ATOM   2495  H HB3  . ARG A 1 11 ? -0.659  9.124   -4.174  1.00 1.03 ? 11 ARG A HB3  6  
ATOM   2496  H HG2  . ARG A 1 11 ? -0.163  11.883  -3.022  1.00 1.19 ? 11 ARG A HG2  6  
ATOM   2497  H HG3  . ARG A 1 11 ? -0.601  11.564  -4.700  1.00 1.16 ? 11 ARG A HG3  6  
ATOM   2498  H HD2  . ARG A 1 11 ? -2.758  11.775  -3.972  1.00 1.62 ? 11 ARG A HD2  6  
ATOM   2499  H HD3  . ARG A 1 11 ? -2.536  10.151  -3.294  1.00 1.35 ? 11 ARG A HD3  6  
ATOM   2500  H HE   . ARG A 1 11 ? -1.639  12.469  -1.654  1.00 1.61 ? 11 ARG A HE   6  
ATOM   2501  H HH11 . ARG A 1 11 ? -4.684  11.971  -1.965  1.00 1.99 ? 11 ARG A HH11 6  
ATOM   2502  H HH12 . ARG A 1 11 ? -4.995  11.074  -0.519  1.00 1.93 ? 11 ARG A HH12 6  
ATOM   2503  H HH21 . ARG A 1 11 ? -1.646  10.410  0.099   1.00 1.37 ? 11 ARG A HH21 6  
ATOM   2504  H HH22 . ARG A 1 11 ? -3.273  10.189  0.651   1.00 1.52 ? 11 ARG A HH22 6  
ATOM   2505  N N    . GLY A 1 12 ? -0.140  7.043   -2.929  1.00 1.05 ? 12 GLY A N    6  
ATOM   2506  C CA   . GLY A 1 12 ? 0.169   5.585   -2.827  1.00 1.12 ? 12 GLY A CA   6  
ATOM   2507  C C    . GLY A 1 12 ? 1.160   5.217   -3.928  1.00 1.07 ? 12 GLY A C    6  
ATOM   2508  O O    . GLY A 1 12 ? 1.201   4.096   -4.393  1.00 1.16 ? 12 GLY A O    6  
ATOM   2509  H H    . GLY A 1 12 ? -0.591  7.389   -3.726  1.00 1.06 ? 12 GLY A H    6  
ATOM   2510  H HA2  . GLY A 1 12 ? 0.607   5.373   -1.861  1.00 1.15 ? 12 GLY A HA2  6  
ATOM   2511  H HA3  . GLY A 1 12 ? -0.733  5.012   -2.953  1.00 1.22 ? 12 GLY A HA3  6  
ATOM   2512  N N    . ARG A 1 13 ? 1.946   6.170   -4.355  1.00 0.95 ? 13 ARG A N    6  
ATOM   2513  C CA   . ARG A 1 13 ? 2.932   5.916   -5.438  1.00 0.90 ? 13 ARG A CA   6  
ATOM   2514  C C    . ARG A 1 13 ? 4.371   6.118   -4.933  1.00 0.89 ? 13 ARG A C    6  
ATOM   2515  O O    . ARG A 1 13 ? 4.984   7.150   -5.145  1.00 0.86 ? 13 ARG A O    6  
ATOM   2516  C CB   . ARG A 1 13 ? 2.555   6.926   -6.534  1.00 0.86 ? 13 ARG A CB   6  
ATOM   2517  C CG   . ARG A 1 13 ? 2.586   8.365   -5.990  1.00 0.84 ? 13 ARG A CG   6  
ATOM   2518  C CD   . ARG A 1 13 ? 2.706   9.360   -7.153  1.00 0.91 ? 13 ARG A CD   6  
ATOM   2519  N NE   . ARG A 1 13 ? 4.000   9.031   -7.824  1.00 0.88 ? 13 ARG A NE   6  
ATOM   2520  C CZ   . ARG A 1 13 ? 5.094   9.656   -7.488  1.00 0.90 ? 13 ARG A CZ   6  
ATOM   2521  N NH1  . ARG A 1 13 ? 5.751   9.292   -6.426  1.00 0.91 ? 13 ARG A NH1  6  
ATOM   2522  N NH2  . ARG A 1 13 ? 5.530   10.641  -8.217  1.00 1.03 ? 13 ARG A NH2  6  
ATOM   2523  H H    . ARG A 1 13 ? 1.876   7.064   -3.967  1.00 0.93 ? 13 ARG A H    6  
ATOM   2524  H HA   . ARG A 1 13 ? 2.813   4.913   -5.813  1.00 0.97 ? 13 ARG A HA   6  
ATOM   2525  H HB2  . ARG A 1 13 ? 3.248   6.838   -7.346  1.00 0.86 ? 13 ARG A HB2  6  
ATOM   2526  H HB3  . ARG A 1 13 ? 1.558   6.705   -6.889  1.00 0.93 ? 13 ARG A HB3  6  
ATOM   2527  H HG2  . ARG A 1 13 ? 1.674   8.560   -5.446  1.00 0.90 ? 13 ARG A HG2  6  
ATOM   2528  H HG3  . ARG A 1 13 ? 3.429   8.487   -5.329  1.00 0.82 ? 13 ARG A HG3  6  
ATOM   2529  H HD2  . ARG A 1 13 ? 1.880   9.230   -7.840  1.00 1.03 ? 13 ARG A HD2  6  
ATOM   2530  H HD3  . ARG A 1 13 ? 2.729   10.372  -6.780  1.00 0.96 ? 13 ARG A HD3  6  
ATOM   2531  H HE   . ARG A 1 13 ? 4.028   8.345   -8.523  1.00 0.94 ? 13 ARG A HE   6  
ATOM   2532  H HH11 . ARG A 1 13 ? 5.416   8.530   -5.865  1.00 0.92 ? 13 ARG A HH11 6  
ATOM   2533  H HH12 . ARG A 1 13 ? 6.595   9.768   -6.173  1.00 1.00 ? 13 ARG A HH12 6  
ATOM   2534  H HH21 . ARG A 1 13 ? 5.028   10.920  -9.034  1.00 1.13 ? 13 ARG A HH21 6  
ATOM   2535  H HH22 . ARG A 1 13 ? 6.373   11.117  -7.961  1.00 1.10 ? 13 ARG A HH22 6  
ATOM   2536  N N    . LYS A 1 14 ? 4.910   5.135   -4.256  1.00 0.99 ? 14 LYS A N    6  
ATOM   2537  C CA   . LYS A 1 14 ? 6.308   5.245   -3.715  1.00 1.08 ? 14 LYS A CA   6  
ATOM   2538  C C    . LYS A 1 14 ? 7.364   5.145   -4.835  1.00 1.11 ? 14 LYS A C    6  
ATOM   2539  O O    . LYS A 1 14 ? 8.312   4.384   -4.743  1.00 1.25 ? 14 LYS A O    6  
ATOM   2540  C CB   . LYS A 1 14 ? 6.455   4.081   -2.716  1.00 1.25 ? 14 LYS A CB   6  
ATOM   2541  C CG   . LYS A 1 14 ? 6.038   2.741   -3.358  1.00 1.32 ? 14 LYS A CG   6  
ATOM   2542  C CD   . LYS A 1 14 ? 7.272   1.899   -3.719  1.00 1.37 ? 14 LYS A CD   6  
ATOM   2543  C CE   . LYS A 1 14 ? 8.262   1.864   -2.547  1.00 1.49 ? 14 LYS A CE   6  
ATOM   2544  N NZ   . LYS A 1 14 ? 9.450   2.639   -3.017  1.00 1.51 ? 14 LYS A NZ   6  
ATOM   2545  H H    . LYS A 1 14 ? 4.390   4.322   -4.093  1.00 1.06 ? 14 LYS A H    6  
ATOM   2546  H HA   . LYS A 1 14 ? 6.423   6.182   -3.192  1.00 1.06 ? 14 LYS A HA   6  
ATOM   2547  H HB2  . LYS A 1 14 ? 7.479   4.021   -2.397  1.00 1.34 ? 14 LYS A HB2  6  
ATOM   2548  H HB3  . LYS A 1 14 ? 5.828   4.271   -1.858  1.00 1.27 ? 14 LYS A HB3  6  
ATOM   2549  H HG2  . LYS A 1 14 ? 5.424   2.189   -2.662  1.00 1.52 ? 14 LYS A HG2  6  
ATOM   2550  H HG3  . LYS A 1 14 ? 5.471   2.932   -4.255  1.00 1.27 ? 14 LYS A HG3  6  
ATOM   2551  H HD2  . LYS A 1 14 ? 6.957   0.892   -3.949  1.00 1.45 ? 14 LYS A HD2  6  
ATOM   2552  H HD3  . LYS A 1 14 ? 7.755   2.326   -4.584  1.00 1.34 ? 14 LYS A HD3  6  
ATOM   2553  H HE2  . LYS A 1 14 ? 7.826   2.329   -1.673  1.00 1.55 ? 14 LYS A HE2  6  
ATOM   2554  H HE3  . LYS A 1 14 ? 8.548   0.847   -2.327  1.00 1.62 ? 14 LYS A HE3  6  
ATOM   2555  H HZ1  . LYS A 1 14 ? 9.140   3.413   -3.646  1.00 1.38 ? 14 LYS A HZ1  6  
ATOM   2556  H HZ2  . LYS A 1 14 ? 9.948   3.041   -2.198  1.00 1.69 ? 14 LYS A HZ2  6  
ATOM   2557  H HZ3  . LYS A 1 14 ? 10.092  2.006   -3.538  1.00 1.65 ? 14 LYS A HZ3  6  
ATOM   2558  N N    . SER A 1 15 ? 7.219   5.924   -5.878  1.00 1.00 ? 15 SER A N    6  
ATOM   2559  C CA   . SER A 1 15 ? 8.212   5.896   -6.997  1.00 1.03 ? 15 SER A CA   6  
ATOM   2560  C C    . SER A 1 15 ? 8.177   7.223   -7.767  1.00 0.97 ? 15 SER A C    6  
ATOM   2561  O O    . SER A 1 15 ? 7.211   7.533   -8.440  1.00 0.95 ? 15 SER A O    6  
ATOM   2562  C CB   . SER A 1 15 ? 7.770   4.741   -7.897  1.00 1.05 ? 15 SER A CB   6  
ATOM   2563  O OG   . SER A 1 15 ? 8.870   4.328   -8.699  1.00 1.18 ? 15 SER A OG   6  
ATOM   2564  H H    . SER A 1 15 ? 6.460   6.541   -5.920  1.00 0.92 ? 15 SER A H    6  
ATOM   2565  H HA   . SER A 1 15 ? 9.204   5.709   -6.617  1.00 1.16 ? 15 SER A HA   6  
ATOM   2566  H HB2  . SER A 1 15 ? 7.443   3.914   -7.289  1.00 1.15 ? 15 SER A HB2  6  
ATOM   2567  H HB3  . SER A 1 15 ? 6.953   5.068   -8.527  1.00 0.99 ? 15 SER A HB3  6  
ATOM   2568  H HG   . SER A 1 15 ? 8.525   3.992   -9.530  1.00 1.24 ? 15 SER A HG   6  
ATOM   2569  N N    . GLY A 1 16 ? 9.220   8.010   -7.667  1.00 1.07 ? 16 GLY A N    6  
ATOM   2570  C CA   . GLY A 1 16 ? 9.251   9.319   -8.387  1.00 1.11 ? 16 GLY A CA   6  
ATOM   2571  C C    . GLY A 1 16 ? 9.090   10.463  -7.380  1.00 1.16 ? 16 GLY A C    6  
ATOM   2572  O O    . GLY A 1 16 ? 8.018   10.685  -6.848  1.00 1.11 ? 16 GLY A O    6  
ATOM   2573  H H    . GLY A 1 16 ? 9.984   7.740   -7.115  1.00 1.20 ? 16 GLY A H    6  
ATOM   2574  H HA2  . GLY A 1 16 ? 10.193  9.424   -8.905  1.00 1.22 ? 16 GLY A HA2  6  
ATOM   2575  H HA3  . GLY A 1 16 ? 8.442   9.359   -9.101  1.00 1.05 ? 16 GLY A HA3  6  
ATOM   2576  N N    . ASN A 1 17 ? 10.148  11.187  -7.117  1.00 1.33 ? 17 ASN A N    6  
ATOM   2577  C CA   . ASN A 1 17 ? 10.066  12.322  -6.145  1.00 1.45 ? 17 ASN A CA   6  
ATOM   2578  C C    . ASN A 1 17 ? 9.562   13.594  -6.847  1.00 1.48 ? 17 ASN A C    6  
ATOM   2579  O O    . ASN A 1 17 ? 8.993   13.535  -7.922  1.00 1.45 ? 17 ASN A O    6  
ATOM   2580  C CB   . ASN A 1 17 ? 11.502  12.506  -5.627  1.00 1.67 ? 17 ASN A CB   6  
ATOM   2581  C CG   . ASN A 1 17 ? 12.397  13.079  -6.734  1.00 1.83 ? 17 ASN A CG   6  
ATOM   2582  O OD1  . ASN A 1 17 ? 12.597  12.454  -7.755  1.00 1.88 ? 17 ASN A OD1  6  
ATOM   2583  N ND2  . ASN A 1 17 ? 12.948  14.248  -6.571  1.00 2.05 ? 17 ASN A ND2  6  
ATOM   2584  H H    . ASN A 1 17 ? 10.999  10.987  -7.562  1.00 1.41 ? 17 ASN A H    6  
ATOM   2585  H HA   . ASN A 1 17 ? 9.413   12.066  -5.326  1.00 1.42 ? 17 ASN A HA   6  
ATOM   2586  H HB2  . ASN A 1 17 ? 11.496  13.183  -4.787  1.00 1.78 ? 17 ASN A HB2  6  
ATOM   2587  H HB3  . ASN A 1 17 ? 11.894  11.550  -5.313  1.00 1.68 ? 17 ASN A HB3  6  
ATOM   2588  H HD21 . ASN A 1 17 ? 12.792  14.755  -5.749  1.00 2.14 ? 17 ASN A HD21 6  
ATOM   2589  H HD22 . ASN A 1 17 ? 13.519  14.620  -7.274  1.00 2.20 ? 17 ASN A HD22 6  
ATOM   2590  N N    . LYS A 1 18 ? 9.766   14.743  -6.248  1.00 1.62 ? 18 LYS A N    6  
ATOM   2591  C CA   . LYS A 1 18 ? 9.301   16.017  -6.879  1.00 1.72 ? 18 LYS A CA   6  
ATOM   2592  C C    . LYS A 1 18 ? 10.046  16.265  -8.200  1.00 1.79 ? 18 LYS A C    6  
ATOM   2593  O O    . LYS A 1 18 ? 11.255  16.406  -8.211  1.00 1.94 ? 18 LYS A O    6  
ATOM   2594  C CB   . LYS A 1 18 ? 9.636   17.116  -5.863  1.00 1.90 ? 18 LYS A CB   6  
ATOM   2595  C CG   . LYS A 1 18 ? 8.402   17.989  -5.620  1.00 1.93 ? 18 LYS A CG   6  
ATOM   2596  C CD   . LYS A 1 18 ? 8.049   18.758  -6.900  1.00 2.04 ? 18 LYS A CD   6  
ATOM   2597  C CE   . LYS A 1 18 ? 9.108   19.832  -7.170  1.00 2.47 ? 18 LYS A CE   6  
ATOM   2598  N NZ   . LYS A 1 18 ? 8.758   20.391  -8.508  1.00 2.66 ? 18 LYS A NZ   6  
ATOM   2599  H H    . LYS A 1 18 ? 10.225  14.766  -5.383  1.00 1.69 ? 18 LYS A H    6  
ATOM   2600  H HA   . LYS A 1 18 ? 8.237   15.986  -7.046  1.00 1.68 ? 18 LYS A HA   6  
ATOM   2601  H HB2  . LYS A 1 18 ? 9.945   16.663  -4.931  1.00 1.92 ? 18 LYS A HB2  6  
ATOM   2602  H HB3  . LYS A 1 18 ? 10.440  17.728  -6.245  1.00 2.05 ? 18 LYS A HB3  6  
ATOM   2603  H HG2  . LYS A 1 18 ? 7.571   17.359  -5.337  1.00 1.98 ? 18 LYS A HG2  6  
ATOM   2604  H HG3  . LYS A 1 18 ? 8.609   18.689  -4.826  1.00 1.95 ? 18 LYS A HG3  6  
ATOM   2605  H HD2  . LYS A 1 18 ? 8.010   18.073  -7.733  1.00 2.17 ? 18 LYS A HD2  6  
ATOM   2606  H HD3  . LYS A 1 18 ? 7.085   19.230  -6.778  1.00 2.20 ? 18 LYS A HD3  6  
ATOM   2607  H HE2  . LYS A 1 18 ? 9.062   20.602  -6.412  1.00 2.74 ? 18 LYS A HE2  6  
ATOM   2608  H HE3  . LYS A 1 18 ? 10.093  19.390  -7.199  1.00 2.88 ? 18 LYS A HE3  6  
ATOM   2609  H HZ1  . LYS A 1 18 ? 7.743   20.614  -8.541  1.00 2.89 ? 18 LYS A HZ1  6  
ATOM   2610  H HZ2  . LYS A 1 18 ? 9.305   21.258  -8.675  1.00 2.64 ? 18 LYS A HZ2  6  
ATOM   2611  H HZ3  . LYS A 1 18 ? 8.984   19.689  -9.252  1.00 3.04 ? 18 LYS A HZ3  6  
ATOM   2612  N N    . PRO A 1 19 ? 9.292   16.310  -9.275  1.00 1.79 ? 19 PRO A N    6  
ATOM   2613  C CA   . PRO A 1 19 ? 9.940   16.548  -10.598 1.00 1.95 ? 19 PRO A CA   6  
ATOM   2614  C C    . PRO A 1 19 ? 10.268  18.039  -10.778 1.00 2.04 ? 19 PRO A C    6  
ATOM   2615  O O    . PRO A 1 19 ? 9.447   18.894  -10.493 1.00 2.30 ? 19 PRO A O    6  
ATOM   2616  C CB   . PRO A 1 19 ? 8.891   16.093  -11.610 1.00 2.00 ? 19 PRO A CB   6  
ATOM   2617  C CG   . PRO A 1 19 ? 7.590   16.224  -10.897 1.00 1.92 ? 19 PRO A CG   6  
ATOM   2618  C CD   . PRO A 1 19 ? 7.866   15.975  -9.441  1.00 1.77 ? 19 PRO A CD   6  
ATOM   2619  H HA   . PRO A 1 19 ? 10.829  15.947  -10.696 1.00 2.04 ? 19 PRO A HA   6  
ATOM   2620  H HB2  . PRO A 1 19 ? 8.912   16.732  -12.485 1.00 2.11 ? 19 PRO A HB2  6  
ATOM   2621  H HB3  . PRO A 1 19 ? 9.057   15.064  -11.890 1.00 2.07 ? 19 PRO A HB3  6  
ATOM   2622  H HG2  . PRO A 1 19 ? 7.192   17.222  -11.035 1.00 1.96 ? 19 PRO A HG2  6  
ATOM   2623  H HG3  . PRO A 1 19 ? 6.889   15.492  -11.265 1.00 2.02 ? 19 PRO A HG3  6  
ATOM   2624  H HD2  . PRO A 1 19 ? 7.250   16.615  -8.825  1.00 1.77 ? 19 PRO A HD2  6  
ATOM   2625  H HD3  . PRO A 1 19 ? 7.699   14.937  -9.197  1.00 1.76 ? 19 PRO A HD3  6  
ATOM   2626  N N    . PRO A 1 20 ? 11.466  18.302  -11.250 1.00 1.92 ? 20 PRO A N    6  
ATOM   2627  C CA   . PRO A 1 20 ? 11.862  19.725  -11.460 1.00 2.06 ? 20 PRO A CA   6  
ATOM   2628  C C    . PRO A 1 20 ? 11.628  20.137  -12.921 1.00 1.89 ? 20 PRO A C    6  
ATOM   2629  O O    . PRO A 1 20 ? 12.140  19.520  -13.839 1.00 1.66 ? 20 PRO A O    6  
ATOM   2630  C CB   . PRO A 1 20 ? 13.351  19.750  -11.117 1.00 2.17 ? 20 PRO A CB   6  
ATOM   2631  C CG   . PRO A 1 20 ? 13.821  18.353  -11.345 1.00 2.01 ? 20 PRO A CG   6  
ATOM   2632  C CD   . PRO A 1 20 ? 12.652  17.447  -11.064 1.00 1.88 ? 20 PRO A CD   6  
ATOM   2633  H HA   . PRO A 1 20 ? 11.319  20.373  -10.791 1.00 2.30 ? 20 PRO A HA   6  
ATOM   2634  H HB2  . PRO A 1 20 ? 13.874  20.438  -11.768 1.00 2.17 ? 20 PRO A HB2  6  
ATOM   2635  H HB3  . PRO A 1 20 ? 13.494  20.024  -10.084 1.00 2.43 ? 20 PRO A HB3  6  
ATOM   2636  H HG2  . PRO A 1 20 ? 14.143  18.235  -12.371 1.00 1.88 ? 20 PRO A HG2  6  
ATOM   2637  H HG3  . PRO A 1 20 ? 14.631  18.121  -10.672 1.00 2.24 ? 20 PRO A HG3  6  
ATOM   2638  H HD2  . PRO A 1 20 ? 12.640  16.621  -11.763 1.00 1.73 ? 20 PRO A HD2  6  
ATOM   2639  H HD3  . PRO A 1 20 ? 12.692  17.084  -10.048 1.00 2.02 ? 20 PRO A HD3  6  
ATOM   2640  N N    . SER A 1 21 ? 10.861  21.176  -13.141 1.00 2.08 ? 21 SER A N    6  
ATOM   2641  C CA   . SER A 1 21 ? 10.589  21.632  -14.543 1.00 2.04 ? 21 SER A CA   6  
ATOM   2642  C C    . SER A 1 21 ? 11.729  22.533  -15.050 1.00 1.98 ? 21 SER A C    6  
ATOM   2643  O O    . SER A 1 21 ? 12.780  22.623  -14.439 1.00 1.89 ? 21 SER A O    6  
ATOM   2644  C CB   . SER A 1 21 ? 9.277   22.415  -14.462 1.00 2.34 ? 21 SER A CB   6  
ATOM   2645  O OG   . SER A 1 21 ? 8.801   22.667  -15.780 1.00 2.43 ? 21 SER A OG   6  
ATOM   2646  H H    . SER A 1 21 ? 10.462  21.656  -12.385 1.00 2.30 ? 21 SER A H    6  
ATOM   2647  H HA   . SER A 1 21 ? 10.468  20.783  -15.196 1.00 1.94 ? 21 SER A HA   6  
ATOM   2648  H HB2  . SER A 1 21 ? 8.544   21.837  -13.923 1.00 2.42 ? 21 SER A HB2  6  
ATOM   2649  H HB3  . SER A 1 21 ? 9.448   23.350  -13.943 1.00 2.50 ? 21 SER A HB3  6  
ATOM   2650  H HG   . SER A 1 21 ? 7.849   22.531  -15.784 1.00 2.56 ? 21 SER A HG   6  
ATOM   2651  N N    . LYS A 1 22 ? 11.527  23.194  -16.165 1.00 2.09 ? 22 LYS A N    6  
ATOM   2652  C CA   . LYS A 1 22 ? 12.591  24.087  -16.722 1.00 2.08 ? 22 LYS A CA   6  
ATOM   2653  C C    . LYS A 1 22 ? 11.958  25.288  -17.444 1.00 2.29 ? 22 LYS A C    6  
ATOM   2654  O O    . LYS A 1 22 ? 11.880  25.328  -18.658 1.00 2.36 ? 22 LYS A O    6  
ATOM   2655  C CB   . LYS A 1 22 ? 13.370  23.206  -17.709 1.00 1.96 ? 22 LYS A CB   6  
ATOM   2656  C CG   . LYS A 1 22 ? 14.536  22.526  -16.985 1.00 1.80 ? 22 LYS A CG   6  
ATOM   2657  C CD   . LYS A 1 22 ? 14.252  21.026  -16.855 1.00 1.58 ? 22 LYS A CD   6  
ATOM   2658  C CE   . LYS A 1 22 ? 15.187  20.411  -15.806 1.00 1.51 ? 22 LYS A CE   6  
ATOM   2659  N NZ   . LYS A 1 22 ? 14.455  20.533  -14.510 1.00 1.57 ? 22 LYS A NZ   6  
ATOM   2660  H H    . LYS A 1 22 ? 10.671  23.100  -16.639 1.00 2.25 ? 22 LYS A H    6  
ATOM   2661  H HA   . LYS A 1 22 ? 13.246  24.426  -15.936 1.00 2.05 ? 22 LYS A HA   6  
ATOM   2662  H HB2  . LYS A 1 22 ? 12.711  22.455  -18.119 1.00 1.96 ? 22 LYS A HB2  6  
ATOM   2663  H HB3  . LYS A 1 22 ? 13.757  23.820  -18.509 1.00 2.06 ? 22 LYS A HB3  6  
ATOM   2664  H HG2  . LYS A 1 22 ? 15.445  22.673  -17.551 1.00 1.90 ? 22 LYS A HG2  6  
ATOM   2665  H HG3  . LYS A 1 22 ? 14.651  22.956  -16.001 1.00 1.87 ? 22 LYS A HG3  6  
ATOM   2666  H HD2  . LYS A 1 22 ? 13.225  20.878  -16.553 1.00 1.60 ? 22 LYS A HD2  6  
ATOM   2667  H HD3  . LYS A 1 22 ? 14.418  20.545  -17.807 1.00 1.63 ? 22 LYS A HD3  6  
ATOM   2668  H HE2  . LYS A 1 22 ? 15.377  19.372  -16.040 1.00 1.50 ? 22 LYS A HE2  6  
ATOM   2669  H HE3  . LYS A 1 22 ? 16.115  20.963  -15.761 1.00 1.60 ? 22 LYS A HE3  6  
ATOM   2670  H HZ1  . LYS A 1 22 ? 14.101  21.508  -14.397 1.00 1.69 ? 22 LYS A HZ1  6  
ATOM   2671  H HZ2  . LYS A 1 22 ? 13.649  19.869  -14.501 1.00 1.56 ? 22 LYS A HZ2  6  
ATOM   2672  H HZ3  . LYS A 1 22 ? 15.098  20.307  -13.725 1.00 1.65 ? 22 LYS A HZ3  6  
ATOM   2673  N N    . THR A 1 23 ? 11.508  26.268  -16.700 1.00 2.45 ? 23 THR A N    6  
ATOM   2674  C CA   . THR A 1 23 ? 10.880  27.474  -17.334 1.00 2.68 ? 23 THR A CA   6  
ATOM   2675  C C    . THR A 1 23 ? 11.523  28.768  -16.805 1.00 2.68 ? 23 THR A C    6  
ATOM   2676  O O    . THR A 1 23 ? 10.908  29.819  -16.800 1.00 2.95 ? 23 THR A O    6  
ATOM   2677  C CB   . THR A 1 23 ? 9.394   27.400  -16.946 1.00 2.94 ? 23 THR A CB   6  
ATOM   2678  O OG1  . THR A 1 23 ? 8.666   28.386  -17.667 1.00 3.19 ? 23 THR A OG1  6  
ATOM   2679  C CG2  . THR A 1 23 ? 9.226   27.642  -15.442 1.00 3.00 ? 23 THR A CG2  6  
ATOM   2680  H H    . THR A 1 23 ? 11.583  26.212  -15.724 1.00 2.46 ? 23 THR A H    6  
ATOM   2681  H HA   . THR A 1 23 ? 10.977  27.424  -18.407 1.00 2.71 ? 23 THR A HA   6  
ATOM   2682  H HB   . THR A 1 23 ? 9.008   26.421  -17.192 1.00 2.94 ? 23 THR A HB   6  
ATOM   2683  H HG1  . THR A 1 23 ? 9.015   29.251  -17.429 1.00 3.19 ? 23 THR A HG1  6  
ATOM   2684  H HG21 . THR A 1 23 ? 9.804   26.914  -14.893 1.00 3.15 ? 23 THR A HG21 6  
ATOM   2685  H HG22 . THR A 1 23 ? 9.570   28.636  -15.196 1.00 3.21 ? 23 THR A HG22 6  
ATOM   2686  H HG23 . THR A 1 23 ? 8.184   27.547  -15.178 1.00 3.21 ? 23 THR A HG23 6  
ATOM   2687  N N    . CYS A 1 24 ? 12.756  28.703  -16.363 1.00 2.40 ? 24 CYS A N    6  
ATOM   2688  C CA   . CYS A 1 24 ? 13.438  29.926  -15.836 1.00 2.41 ? 24 CYS A CA   6  
ATOM   2689  C C    . CYS A 1 24 ? 14.884  29.998  -16.353 1.00 1.98 ? 24 CYS A C    6  
ATOM   2690  O O    . CYS A 1 24 ? 15.822  29.636  -15.667 1.00 1.82 ? 24 CYS A O    6  
ATOM   2691  C CB   . CYS A 1 24 ? 13.402  29.782  -14.309 1.00 2.66 ? 24 CYS A CB   6  
ATOM   2692  S SG   . CYS A 1 24 ? 14.035  28.155  -13.821 1.00 2.55 ? 24 CYS A SG   6  
ATOM   2693  H H    . CYS A 1 24 ? 13.236  27.850  -16.378 1.00 2.22 ? 24 CYS A H    6  
ATOM   2694  H HA   . CYS A 1 24 ? 12.894  30.809  -16.133 1.00 2.63 ? 24 CYS A HA   6  
ATOM   2695  H HB2  . CYS A 1 24 ? 14.012  30.551  -13.862 1.00 2.70 ? 24 CYS A HB2  6  
ATOM   2696  H HB3  . CYS A 1 24 ? 12.384  29.888  -13.963 1.00 3.00 ? 24 CYS A HB3  6  
ATOM   2697  H HG   . CYS A 1 24 ? 14.967  28.117  -14.053 1.00 2.62 ? 24 CYS A HG   6  
ATOM   2698  N N    . LEU A 1 25 ? 15.066  30.466  -17.563 1.00 1.95 ? 25 LEU A N    6  
ATOM   2699  C CA   . LEU A 1 25 ? 16.446  30.568  -18.135 1.00 1.65 ? 25 LEU A CA   6  
ATOM   2700  C C    . LEU A 1 25 ? 17.040  31.952  -17.845 1.00 1.67 ? 25 LEU A C    6  
ATOM   2701  O O    . LEU A 1 25 ? 16.381  32.964  -17.996 1.00 2.23 ? 25 LEU A O    6  
ATOM   2702  C CB   . LEU A 1 25 ? 16.271  30.357  -19.642 1.00 1.77 ? 25 LEU A CB   6  
ATOM   2703  C CG   . LEU A 1 25 ? 16.172  28.859  -19.943 1.00 1.79 ? 25 LEU A CG   6  
ATOM   2704  C CD1  . LEU A 1 25 ? 15.242  28.635  -21.136 1.00 2.17 ? 25 LEU A CD1  6  
ATOM   2705  C CD2  . LEU A 1 25 ? 17.563  28.313  -20.276 1.00 1.80 ? 25 LEU A CD2  6  
ATOM   2706  H H    . LEU A 1 25 ? 14.294  30.753  -18.096 1.00 2.23 ? 25 LEU A H    6  
ATOM   2707  H HA   . LEU A 1 25 ? 17.079  29.795  -17.727 1.00 1.51 ? 25 LEU A HA   6  
ATOM   2708  H HB2  . LEU A 1 25 ? 15.369  30.852  -19.972 1.00 2.03 ? 25 LEU A HB2  6  
ATOM   2709  H HB3  . LEU A 1 25 ? 17.120  30.771  -20.164 1.00 1.72 ? 25 LEU A HB3  6  
ATOM   2710  H HG   . LEU A 1 25 ? 15.779  28.343  -19.079 1.00 1.79 ? 25 LEU A HG   6  
ATOM   2711  H HD11 . LEU A 1 25 ? 14.292  29.112  -20.945 1.00 2.65 ? 25 LEU A HD11 6  
ATOM   2712  H HD12 . LEU A 1 25 ? 15.686  29.061  -22.024 1.00 2.35 ? 25 LEU A HD12 6  
ATOM   2713  H HD13 . LEU A 1 25 ? 15.092  27.576  -21.281 1.00 2.49 ? 25 LEU A HD13 6  
ATOM   2714  H HD21 . LEU A 1 25 ? 17.972  28.858  -21.114 1.00 2.04 ? 25 LEU A HD21 6  
ATOM   2715  H HD22 . LEU A 1 25 ? 18.210  28.431  -19.420 1.00 2.07 ? 25 LEU A HD22 6  
ATOM   2716  H HD23 . LEU A 1 25 ? 17.487  27.266  -20.528 1.00 2.19 ? 25 LEU A HD23 6  
ATOM   2717  N N    . LYS A 1 26 ? 18.281  32.001  -17.429 1.00 1.26 ? 26 LYS A N    6  
ATOM   2718  C CA   . LYS A 1 26 ? 18.928  33.313  -17.123 1.00 1.32 ? 26 LYS A CA   6  
ATOM   2719  C C    . LYS A 1 26 ? 20.314  33.394  -17.777 1.00 1.20 ? 26 LYS A C    6  
ATOM   2720  O O    . LYS A 1 26 ? 20.902  32.392  -18.140 1.00 1.57 ? 26 LYS A O    6  
ATOM   2721  C CB   . LYS A 1 26 ? 19.063  33.343  -15.598 1.00 1.87 ? 26 LYS A CB   6  
ATOM   2722  C CG   . LYS A 1 26 ? 17.695  33.609  -14.961 1.00 2.53 ? 26 LYS A CG   6  
ATOM   2723  C CD   . LYS A 1 26 ? 17.157  32.321  -14.326 1.00 2.86 ? 26 LYS A CD   6  
ATOM   2724  C CE   . LYS A 1 26 ? 18.061  31.883  -13.163 1.00 3.23 ? 26 LYS A CE   6  
ATOM   2725  N NZ   . LYS A 1 26 ? 18.006  32.996  -12.169 1.00 3.76 ? 26 LYS A NZ   6  
ATOM   2726  H H    . LYS A 1 26 ? 18.791  31.173  -17.314 1.00 1.17 ? 26 LYS A H    6  
ATOM   2727  H HA   . LYS A 1 26 ? 18.306  34.130  -17.455 1.00 1.64 ? 26 LYS A HA   6  
ATOM   2728  H HB2  . LYS A 1 26 ? 19.444  32.392  -15.254 1.00 2.00 ? 26 LYS A HB2  6  
ATOM   2729  H HB3  . LYS A 1 26 ? 19.748  34.128  -15.313 1.00 2.00 ? 26 LYS A HB3  6  
ATOM   2730  H HG2  . LYS A 1 26 ? 17.796  34.372  -14.203 1.00 2.99 ? 26 LYS A HG2  6  
ATOM   2731  H HG3  . LYS A 1 26 ? 17.006  33.948  -15.721 1.00 2.52 ? 26 LYS A HG3  6  
ATOM   2732  H HD2  . LYS A 1 26 ? 16.156  32.494  -13.958 1.00 3.43 ? 26 LYS A HD2  6  
ATOM   2733  H HD3  . LYS A 1 26 ? 17.132  31.539  -15.071 1.00 2.45 ? 26 LYS A HD3  6  
ATOM   2734  H HE2  . LYS A 1 26 ? 17.688  30.967  -12.726 1.00 3.65 ? 26 LYS A HE2  6  
ATOM   2735  H HE3  . LYS A 1 26 ? 19.076  31.747  -13.508 1.00 2.88 ? 26 LYS A HE3  6  
ATOM   2736  H HZ1  . LYS A 1 26 ? 17.095  33.494  -12.246 1.00 3.85 ? 26 LYS A HZ1  6  
ATOM   2737  H HZ2  . LYS A 1 26 ? 18.108  32.610  -11.210 1.00 4.38 ? 26 LYS A HZ2  6  
ATOM   2738  H HZ3  . LYS A 1 26 ? 18.790  33.668  -12.353 1.00 3.52 ? 26 LYS A HZ3  6  
ATOM   2739  N N    . GLU A 1 27 ? 20.838  34.583  -17.915 1.00 1.44 ? 27 GLU A N    6  
ATOM   2740  C CA   . GLU A 1 27 ? 22.192  34.752  -18.533 1.00 2.02 ? 27 GLU A CA   6  
ATOM   2741  C C    . GLU A 1 27 ? 23.253  35.005  -17.446 1.00 1.98 ? 27 GLU A C    6  
ATOM   2742  O O    . GLU A 1 27 ? 24.252  35.661  -17.680 1.00 2.22 ? 27 GLU A O    6  
ATOM   2743  C CB   . GLU A 1 27 ? 22.057  35.967  -19.466 1.00 2.61 ? 27 GLU A CB   6  
ATOM   2744  C CG   . GLU A 1 27 ? 21.763  37.236  -18.649 1.00 2.46 ? 27 GLU A CG   6  
ATOM   2745  C CD   . GLU A 1 27 ? 20.272  37.570  -18.730 1.00 2.81 ? 27 GLU A CD   6  
ATOM   2746  O OE1  . GLU A 1 27 ? 19.897  38.298  -19.634 1.00 3.57 ? 27 GLU A OE1  6  
ATOM   2747  O OE2  . GLU A 1 27 ? 19.532  37.093  -17.887 1.00 2.49 ? 27 GLU A OE2  6  
ATOM   2748  H H    . GLU A 1 27 ? 20.341  35.370  -17.604 1.00 1.63 ? 27 GLU A H    6  
ATOM   2749  H HA   . GLU A 1 27 ? 22.452  33.878  -19.109 1.00 2.36 ? 27 GLU A HA   6  
ATOM   2750  H HB2  . GLU A 1 27 ? 22.978  36.100  -20.013 1.00 3.10 ? 27 GLU A HB2  6  
ATOM   2751  H HB3  . GLU A 1 27 ? 21.249  35.796  -20.162 1.00 2.90 ? 27 GLU A HB3  6  
ATOM   2752  H HG2  . GLU A 1 27 ? 22.038  37.074  -17.617 1.00 1.92 ? 27 GLU A HG2  6  
ATOM   2753  H HG3  . GLU A 1 27 ? 22.334  38.060  -19.048 1.00 2.88 ? 27 GLU A HG3  6  
ATOM   2754  N N    . GLU A 1 28 ? 23.041  34.487  -16.258 1.00 2.02 ? 28 GLU A N    6  
ATOM   2755  C CA   . GLU A 1 28 ? 24.027  34.692  -15.151 1.00 2.45 ? 28 GLU A CA   6  
ATOM   2756  C C    . GLU A 1 28 ? 25.234  33.758  -15.331 1.00 3.29 ? 28 GLU A C    6  
ATOM   2757  O O    . GLU A 1 28 ? 25.432  32.824  -14.575 1.00 3.94 ? 28 GLU A O    6  
ATOM   2758  C CB   . GLU A 1 28 ? 23.256  34.352  -13.868 1.00 2.77 ? 28 GLU A CB   6  
ATOM   2759  C CG   . GLU A 1 28 ? 22.063  35.305  -13.715 1.00 2.34 ? 28 GLU A CG   6  
ATOM   2760  C CD   . GLU A 1 28 ? 21.243  34.917  -12.482 1.00 3.12 ? 28 GLU A CD   6  
ATOM   2761  O OE1  . GLU A 1 28 ? 21.730  35.113  -11.381 1.00 3.60 ? 28 GLU A OE1  6  
ATOM   2762  O OE2  . GLU A 1 28 ? 20.136  34.433  -12.659 1.00 3.33 ? 28 GLU A OE2  6  
ATOM   2763  H H    . GLU A 1 28 ? 22.231  33.963  -16.093 1.00 1.98 ? 28 GLU A H    6  
ATOM   2764  H HA   . GLU A 1 28 ? 24.351  35.721  -15.123 1.00 2.16 ? 28 GLU A HA   6  
ATOM   2765  H HB2  . GLU A 1 28 ? 22.900  33.334  -13.922 1.00 3.11 ? 28 GLU A HB2  6  
ATOM   2766  H HB3  . GLU A 1 28 ? 23.910  34.460  -13.016 1.00 3.21 ? 28 GLU A HB3  6  
ATOM   2767  H HG2  . GLU A 1 28 ? 22.423  36.314  -13.604 1.00 1.98 ? 28 GLU A HG2  6  
ATOM   2768  H HG3  . GLU A 1 28 ? 21.437  35.242  -14.592 1.00 2.09 ? 28 GLU A HG3  6  
ATOM   2769  N N    . MET A 1 29 ? 26.041  34.004  -16.333 1.00 3.49 ? 29 MET A N    6  
ATOM   2770  C CA   . MET A 1 29 ? 27.237  33.138  -16.575 1.00 4.43 ? 29 MET A CA   6  
ATOM   2771  C C    . MET A 1 29 ? 28.414  33.981  -17.086 1.00 4.67 ? 29 MET A C    6  
ATOM   2772  O O    . MET A 1 29 ? 28.239  34.902  -17.862 1.00 4.48 ? 29 MET A O    6  
ATOM   2773  C CB   . MET A 1 29 ? 26.789  32.137  -17.643 1.00 4.77 ? 29 MET A CB   6  
ATOM   2774  C CG   . MET A 1 29 ? 27.744  30.940  -17.662 1.00 5.70 ? 29 MET A CG   6  
ATOM   2775  S SD   . MET A 1 29 ? 28.204  30.562  -19.371 1.00 6.34 ? 29 MET A SD   6  
ATOM   2776  C CE   . MET A 1 29 ? 29.676  31.614  -19.450 1.00 7.21 ? 29 MET A CE   6  
ATOM   2777  H H    . MET A 1 29 ? 25.860  34.762  -16.931 1.00 3.15 ? 29 MET A H    6  
ATOM   2778  H HA   . MET A 1 29 ? 27.511  32.616  -15.673 1.00 4.80 ? 29 MET A HA   6  
ATOM   2779  H HB2  . MET A 1 29 ? 25.788  31.795  -17.419 1.00 4.39 ? 29 MET A HB2  6  
ATOM   2780  H HB3  . MET A 1 29 ? 26.796  32.615  -18.612 1.00 4.82 ? 29 MET A HB3  6  
ATOM   2781  H HG2  . MET A 1 29 ? 28.631  31.177  -17.094 1.00 5.98 ? 29 MET A HG2  6  
ATOM   2782  H HG3  . MET A 1 29 ? 27.255  30.082  -17.223 1.00 5.84 ? 29 MET A HG3  6  
ATOM   2783  H HE1  . MET A 1 29 ? 30.362  31.336  -18.666 1.00 7.31 ? 29 MET A HE1  6  
ATOM   2784  H HE2  . MET A 1 29 ? 30.158  31.487  -20.410 1.00 7.55 ? 29 MET A HE2  6  
ATOM   2785  H HE3  . MET A 1 29 ? 29.386  32.648  -19.321 1.00 7.54 ? 29 MET A HE3  6  
ATOM   2786  N N    . ALA A 1 30 ? 29.610  33.665  -16.657 1.00 5.26 ? 30 ALA A N    6  
ATOM   2787  C CA   . ALA A 1 30 ? 30.807  34.437  -17.113 1.00 5.56 ? 30 ALA A CA   6  
ATOM   2788  C C    . ALA A 1 30 ? 31.848  33.492  -17.731 1.00 6.61 ? 30 ALA A C    6  
ATOM   2789  O O    . ALA A 1 30 ? 32.110  32.456  -17.137 1.00 7.05 ? 30 ALA A O    6  
ATOM   2790  C CB   . ALA A 1 30 ? 31.359  35.096  -15.846 1.00 5.06 ? 30 ALA A CB   6  
ATOM   2791  O OXT  . ALA A 1 30 ? 32.361  33.819  -18.787 1.00 7.09 ? 30 ALA A OXT  6  
ATOM   2792  H H    . ALA A 1 30 ? 29.725  32.916  -16.035 1.00 5.59 ? 30 ALA A H    6  
ATOM   2793  H HA   . ALA A 1 30 ? 30.519  35.193  -17.826 1.00 5.50 ? 30 ALA A HA   6  
ATOM   2794  H HB1  . ALA A 1 30 ? 30.590  35.704  -15.392 1.00 4.93 ? 30 ALA A HB1  6  
ATOM   2795  H HB2  . ALA A 1 30 ? 31.671  34.332  -15.150 1.00 5.26 ? 30 ALA A HB2  6  
ATOM   2796  H HB3  . ALA A 1 30 ? 32.205  35.716  -16.103 1.00 4.95 ? 30 ALA A HB3  6  
ATOM   2797  N N    . MET A 1 1  ? -1.372  -1.786  6.019   1.00 2.11 ? 1  MET A N    7  
ATOM   2798  C CA   . MET A 1 1  ? -1.353  -2.030  7.496   1.00 1.81 ? 1  MET A CA   7  
ATOM   2799  C C    . MET A 1 1  ? -2.410  -1.161  8.196   1.00 1.66 ? 1  MET A C    7  
ATOM   2800  O O    . MET A 1 1  ? -3.026  -0.308  7.584   1.00 1.76 ? 1  MET A O    7  
ATOM   2801  C CB   . MET A 1 1  ? 0.064   -1.648  7.957   1.00 1.75 ? 1  MET A CB   7  
ATOM   2802  C CG   . MET A 1 1  ? 0.274   -0.131  7.846   1.00 1.81 ? 1  MET A CG   7  
ATOM   2803  S SD   . MET A 1 1  ? 1.112   0.252   6.288   1.00 2.30 ? 1  MET A SD   7  
ATOM   2804  C CE   . MET A 1 1  ? 0.710   2.016   6.244   1.00 2.52 ? 1  MET A CE   7  
ATOM   2805  H H1   . MET A 1 1  ? -1.344  -0.762  5.835   1.00 2.20 ? 1  MET A H1   7  
ATOM   2806  H H2   . MET A 1 1  ? -0.545  -2.240  5.579   1.00 2.54 ? 1  MET A H2   7  
ATOM   2807  H H3   . MET A 1 1  ? -2.240  -2.188  5.612   1.00 2.43 ? 1  MET A H3   7  
ATOM   2808  H HA   . MET A 1 1  ? -1.535  -3.074  7.703   1.00 1.88 ? 1  MET A HA   7  
ATOM   2809  H HB2  . MET A 1 1  ? 0.198   -1.953  8.985   1.00 1.70 ? 1  MET A HB2  7  
ATOM   2810  H HB3  . MET A 1 1  ? 0.790   -2.155  7.337   1.00 1.91 ? 1  MET A HB3  7  
ATOM   2811  H HG2  . MET A 1 1  ? -0.681  0.372   7.873   1.00 1.93 ? 1  MET A HG2  7  
ATOM   2812  H HG3  . MET A 1 1  ? 0.881   0.209   8.673   1.00 1.88 ? 1  MET A HG3  7  
ATOM   2813  H HE1  . MET A 1 1  ? -0.361  2.143   6.324   1.00 2.83 ? 1  MET A HE1  7  
ATOM   2814  H HE2  . MET A 1 1  ? 1.192   2.517   7.068   1.00 2.75 ? 1  MET A HE2  7  
ATOM   2815  H HE3  . MET A 1 1  ? 1.060   2.441   5.312   1.00 2.83 ? 1  MET A HE3  7  
ATOM   2816  N N    . ILE A 1 2  ? -2.618  -1.368  9.472   1.00 1.54 ? 2  ILE A N    7  
ATOM   2817  C CA   . ILE A 1 2  ? -3.630  -0.549  10.210  1.00 1.44 ? 2  ILE A CA   7  
ATOM   2818  C C    . ILE A 1 2  ? -2.979  0.743   10.727  1.00 1.19 ? 2  ILE A C    7  
ATOM   2819  O O    . ILE A 1 2  ? -2.378  0.767   11.786  1.00 1.23 ? 2  ILE A O    7  
ATOM   2820  C CB   . ILE A 1 2  ? -4.102  -1.434  11.375  1.00 1.63 ? 2  ILE A CB   7  
ATOM   2821  C CG1  . ILE A 1 2  ? -4.695  -2.745  10.834  1.00 1.94 ? 2  ILE A CG1  7  
ATOM   2822  C CG2  . ILE A 1 2  ? -5.170  -0.695  12.188  1.00 1.61 ? 2  ILE A CG2  7  
ATOM   2823  C CD1  . ILE A 1 2  ? -5.840  -2.443  9.860   1.00 2.06 ? 2  ILE A CD1  7  
ATOM   2824  H H    . ILE A 1 2  ? -2.107  -2.058  9.947   1.00 1.59 ? 2  ILE A H    7  
ATOM   2825  H HA   . ILE A 1 2  ? -4.464  -0.314  9.565   1.00 1.51 ? 2  ILE A HA   7  
ATOM   2826  H HB   . ILE A 1 2  ? -3.260  -1.658  12.016  1.00 1.67 ? 2  ILE A HB   7  
ATOM   2827  H HG12 . ILE A 1 2  ? -3.925  -3.302  10.320  1.00 2.04 ? 2  ILE A HG12 7  
ATOM   2828  H HG13 . ILE A 1 2  ? -5.073  -3.333  11.657  1.00 2.07 ? 2  ILE A HG13 7  
ATOM   2829  H HG21 . ILE A 1 2  ? -5.889  -0.249  11.516  1.00 1.99 ? 2  ILE A HG21 7  
ATOM   2830  H HG22 . ILE A 1 2  ? -5.673  -1.393  12.840  1.00 1.93 ? 2  ILE A HG22 7  
ATOM   2831  H HG23 . ILE A 1 2  ? -4.702  0.078   12.779  1.00 1.77 ? 2  ILE A HG23 7  
ATOM   2832  H HD11 . ILE A 1 2  ? -6.473  -1.673  10.276  1.00 2.30 ? 2  ILE A HD11 7  
ATOM   2833  H HD12 . ILE A 1 2  ? -5.432  -2.105  8.918   1.00 2.27 ? 2  ILE A HD12 7  
ATOM   2834  H HD13 . ILE A 1 2  ? -6.421  -3.339  9.699   1.00 2.43 ? 2  ILE A HD13 7  
ATOM   2835  N N    . SER A 1 3  ? -3.092  1.817   9.983   1.00 1.03 ? 3  SER A N    7  
ATOM   2836  C CA   . SER A 1 3  ? -2.477  3.108   10.427  1.00 0.83 ? 3  SER A CA   7  
ATOM   2837  C C    . SER A 1 3  ? -3.384  3.803   11.457  1.00 0.72 ? 3  SER A C    7  
ATOM   2838  O O    . SER A 1 3  ? -4.043  4.780   11.159  1.00 0.65 ? 3  SER A O    7  
ATOM   2839  C CB   . SER A 1 3  ? -2.349  3.954   9.155   1.00 0.79 ? 3  SER A CB   7  
ATOM   2840  O OG   . SER A 1 3  ? -1.173  4.752   9.243   1.00 0.80 ? 3  SER A OG   7  
ATOM   2841  H H    . SER A 1 3  ? -3.578  1.771   9.133   1.00 1.15 ? 3  SER A H    7  
ATOM   2842  H HA   . SER A 1 3  ? -1.498  2.934   10.846  1.00 0.89 ? 3  SER A HA   7  
ATOM   2843  H HB2  . SER A 1 3  ? -2.277  3.309   8.296   1.00 1.07 ? 3  SER A HB2  7  
ATOM   2844  H HB3  . SER A 1 3  ? -3.221  4.588   9.054   1.00 0.77 ? 3  SER A HB3  7  
ATOM   2845  H HG   . SER A 1 3  ? -1.254  5.475   8.608   1.00 0.69 ? 3  SER A HG   7  
ATOM   2846  N N    . SER A 1 4  ? -3.424  3.298   12.667  1.00 0.85 ? 4  SER A N    7  
ATOM   2847  C CA   . SER A 1 4  ? -4.290  3.923   13.718  1.00 0.80 ? 4  SER A CA   7  
ATOM   2848  C C    . SER A 1 4  ? -3.563  5.096   14.387  1.00 0.71 ? 4  SER A C    7  
ATOM   2849  O O    . SER A 1 4  ? -4.156  6.114   14.683  1.00 0.69 ? 4  SER A O    7  
ATOM   2850  C CB   . SER A 1 4  ? -4.560  2.810   14.733  1.00 1.07 ? 4  SER A CB   7  
ATOM   2851  O OG   . SER A 1 4  ? -5.461  1.867   14.166  1.00 1.21 ? 4  SER A OG   7  
ATOM   2852  H H    . SER A 1 4  ? -2.889  2.504   12.884  1.00 1.05 ? 4  SER A H    7  
ATOM   2853  H HA   . SER A 1 4  ? -5.216  4.259   13.287  1.00 0.74 ? 4  SER A HA   7  
ATOM   2854  H HB2  . SER A 1 4  ? -3.637  2.314   14.980  1.00 1.23 ? 4  SER A HB2  7  
ATOM   2855  H HB3  . SER A 1 4  ? -4.987  3.240   15.631  1.00 1.15 ? 4  SER A HB3  7  
ATOM   2856  H HG   . SER A 1 4  ? -6.321  1.991   14.577  1.00 1.55 ? 4  SER A HG   7  
ATOM   2857  N N    . VAL A 1 5  ? -2.284  4.956   14.624  1.00 0.81 ? 5  VAL A N    7  
ATOM   2858  C CA   . VAL A 1 5  ? -1.506  6.060   15.275  1.00 0.92 ? 5  VAL A CA   7  
ATOM   2859  C C    . VAL A 1 5  ? -1.051  7.095   14.234  1.00 0.87 ? 5  VAL A C    7  
ATOM   2860  O O    . VAL A 1 5  ? -0.791  8.238   14.558  1.00 1.05 ? 5  VAL A O    7  
ATOM   2861  C CB   . VAL A 1 5  ? -0.303  5.370   15.933  1.00 1.20 ? 5  VAL A CB   7  
ATOM   2862  C CG1  . VAL A 1 5  ? 0.723   4.959   14.870  1.00 1.23 ? 5  VAL A CG1  7  
ATOM   2863  C CG2  . VAL A 1 5  ? 0.355   6.331   16.925  1.00 1.43 ? 5  VAL A CG2  7  
ATOM   2864  H H    . VAL A 1 5  ? -1.835  4.123   14.374  1.00 0.89 ? 5  VAL A H    7  
ATOM   2865  H HA   . VAL A 1 5  ? -2.107  6.539   16.026  1.00 0.94 ? 5  VAL A HA   7  
ATOM   2866  H HB   . VAL A 1 5  ? -0.642  4.489   16.458  1.00 1.29 ? 5  VAL A HB   7  
ATOM   2867  H HG11 . VAL A 1 5  ? 0.216   4.491   14.040  1.00 1.67 ? 5  VAL A HG11 7  
ATOM   2868  H HG12 . VAL A 1 5  ? 1.251   5.835   14.522  1.00 1.61 ? 5  VAL A HG12 7  
ATOM   2869  H HG13 . VAL A 1 5  ? 1.427   4.263   15.300  1.00 1.45 ? 5  VAL A HG13 7  
ATOM   2870  H HG21 . VAL A 1 5  ? 0.657   7.230   16.408  1.00 1.78 ? 5  VAL A HG21 7  
ATOM   2871  H HG22 . VAL A 1 5  ? -0.348  6.582   17.704  1.00 1.81 ? 5  VAL A HG22 7  
ATOM   2872  H HG23 . VAL A 1 5  ? 1.223   5.860   17.361  1.00 1.82 ? 5  VAL A HG23 7  
ATOM   2873  N N    . CYS A 1 6  ? -0.958  6.702   12.991  1.00 0.73 ? 6  CYS A N    7  
ATOM   2874  C CA   . CYS A 1 6  ? -0.525  7.652   11.924  1.00 0.80 ? 6  CYS A CA   7  
ATOM   2875  C C    . CYS A 1 6  ? -1.629  7.798   10.868  1.00 0.66 ? 6  CYS A C    7  
ATOM   2876  O O    . CYS A 1 6  ? -2.732  7.316   11.037  1.00 0.56 ? 6  CYS A O    7  
ATOM   2877  C CB   . CYS A 1 6  ? 0.730   7.012   11.318  1.00 0.97 ? 6  CYS A CB   7  
ATOM   2878  S SG   . CYS A 1 6  ? 1.929   8.304   10.906  1.00 1.40 ? 6  CYS A SG   7  
ATOM   2879  H H    . CYS A 1 6  ? -1.176  5.779   12.759  1.00 0.65 ? 6  CYS A H    7  
ATOM   2880  H HA   . CYS A 1 6  ? -0.280  8.613   12.348  1.00 0.97 ? 6  CYS A HA   7  
ATOM   2881  H HB2  . CYS A 1 6  ? 1.167   6.330   12.031  1.00 1.08 ? 6  CYS A HB2  7  
ATOM   2882  H HB3  . CYS A 1 6  ? 0.461   6.471   10.421  1.00 0.93 ? 6  CYS A HB3  7  
ATOM   2883  H HG   . CYS A 1 6  ? 2.018   8.332   9.950   1.00 1.86 ? 6  CYS A HG   7  
ATOM   2884  N N    . VAL A 1 7  ? -1.335  8.457   9.780   1.00 0.78 ? 7  VAL A N    7  
ATOM   2885  C CA   . VAL A 1 7  ? -2.352  8.637   8.703   1.00 0.83 ? 7  VAL A CA   7  
ATOM   2886  C C    . VAL A 1 7  ? -1.929  7.821   7.473   1.00 0.75 ? 7  VAL A C    7  
ATOM   2887  O O    . VAL A 1 7  ? -1.328  6.769   7.596   1.00 0.65 ? 7  VAL A O    7  
ATOM   2888  C CB   . VAL A 1 7  ? -2.367  10.149  8.395   1.00 1.12 ? 7  VAL A CB   7  
ATOM   2889  C CG1  . VAL A 1 7  ? -3.740  10.547  7.846   1.00 1.34 ? 7  VAL A CG1  7  
ATOM   2890  C CG2  . VAL A 1 7  ? -2.090  10.959  9.668   1.00 1.28 ? 7  VAL A CG2  7  
ATOM   2891  H H    . VAL A 1 7  ? -0.441  8.832   9.664   1.00 0.91 ? 7  VAL A H    7  
ATOM   2892  H HA   . VAL A 1 7  ? -3.324  8.321   9.044   1.00 0.84 ? 7  VAL A HA   7  
ATOM   2893  H HB   . VAL A 1 7  ? -1.609  10.371  7.655   1.00 1.13 ? 7  VAL A HB   7  
ATOM   2894  H HG11 . VAL A 1 7  ? -4.302  9.658   7.600   1.00 1.65 ? 7  VAL A HG11 7  
ATOM   2895  H HG12 . VAL A 1 7  ? -4.275  11.116  8.594   1.00 1.54 ? 7  VAL A HG12 7  
ATOM   2896  H HG13 . VAL A 1 7  ? -3.612  11.150  6.960   1.00 1.70 ? 7  VAL A HG13 7  
ATOM   2897  H HG21 . VAL A 1 7  ? -2.600  10.504  10.503  1.00 1.58 ? 7  VAL A HG21 7  
ATOM   2898  H HG22 . VAL A 1 7  ? -1.027  10.977  9.860   1.00 1.66 ? 7  VAL A HG22 7  
ATOM   2899  H HG23 . VAL A 1 7  ? -2.447  11.971  9.535   1.00 1.51 ? 7  VAL A HG23 7  
HETATM 2900  N N    . SEP A 1 8  ? -2.223  8.299   6.294   1.00 0.88 ? 8  SEP A N    7  
HETATM 2901  C CA   . SEP A 1 8  ? -1.824  7.555   5.061   1.00 0.87 ? 8  SEP A CA   7  
HETATM 2902  C CB   . SEP A 1 8  ? -2.733  8.086   3.950   1.00 1.00 ? 8  SEP A CB   7  
HETATM 2903  O OG   . SEP A 1 8  ? -3.934  7.305   3.899   1.00 1.14 ? 8  SEP A OG   7  
HETATM 2904  C C    . SEP A 1 8  ? -0.354  7.835   4.732   1.00 0.76 ? 8  SEP A C    7  
HETATM 2905  O O    . SEP A 1 8  ? 0.354   6.967   4.264   1.00 0.76 ? 8  SEP A O    7  
HETATM 2906  P P    . SEP A 1 8  ? -3.908  5.794   3.338   1.00 1.51 ? 8  SEP A P    7  
HETATM 2907  O O1P  . SEP A 1 8  ? -3.161  5.788   2.061   1.00 1.96 ? 8  SEP A O1P  7  
HETATM 2908  O O2P  . SEP A 1 8  ? -3.495  4.898   4.441   1.00 1.88 ? 8  SEP A O2P  7  
HETATM 2909  O O3P  . SEP A 1 8  ? -5.459  5.515   3.015   1.00 1.89 ? 8  SEP A O3P  7  
HETATM 2910  H H    . SEP A 1 8  ? -2.697  9.146   6.221   1.00 1.01 ? 8  SEP A H    7  
HETATM 2911  H HA   . SEP A 1 8  ? -1.980  6.500   5.194   1.00 0.92 ? 8  SEP A HA   7  
HETATM 2912  H HB2  . SEP A 1 8  ? -2.213  8.028   3.004   1.00 0.98 ? 8  SEP A HB2  7  
HETATM 2913  H HB3  . SEP A 1 8  ? -2.988  9.114   4.151   1.00 1.09 ? 8  SEP A HB3  7  
HETATM 2914  H HOP3 . SEP A 1 8  ? -5.721  6.131   2.328   1.00 2.03 ? 8  SEP A HOP3 7  
ATOM   2915  N N    . SER A 1 9  ? 0.096   9.045   4.990   1.00 0.73 ? 9  SER A N    7  
ATOM   2916  C CA   . SER A 1 9  ? 1.520   9.435   4.715   1.00 0.71 ? 9  SER A CA   7  
ATOM   2917  C C    . SER A 1 9  ? 1.833   9.361   3.219   1.00 0.65 ? 9  SER A C    7  
ATOM   2918  O O    . SER A 1 9  ? 1.806   8.305   2.629   1.00 0.63 ? 9  SER A O    7  
ATOM   2919  C CB   . SER A 1 9  ? 2.391   8.444   5.483   1.00 0.76 ? 9  SER A CB   7  
ATOM   2920  O OG   . SER A 1 9  ? 2.038   8.465   6.862   1.00 0.98 ? 9  SER A OG   7  
ATOM   2921  H H    . SER A 1 9  ? -0.511  9.705   5.374   1.00 0.79 ? 9  SER A H    7  
ATOM   2922  H HA   . SER A 1 9  ? 1.704   10.434  5.080   1.00 0.77 ? 9  SER A HA   7  
ATOM   2923  H HB2  . SER A 1 9  ? 2.240   7.453   5.089   1.00 0.78 ? 9  SER A HB2  7  
ATOM   2924  H HB3  . SER A 1 9  ? 3.431   8.721   5.361   1.00 0.82 ? 9  SER A HB3  7  
ATOM   2925  H HG   . SER A 1 9  ? 1.448   7.726   7.031   1.00 1.18 ? 9  SER A HG   7  
ATOM   2926  N N    . TYR A 1 10 ? 2.149   10.484  2.619   1.00 0.66 ? 10 TYR A N    7  
ATOM   2927  C CA   . TYR A 1 10 ? 2.490   10.526  1.160   1.00 0.64 ? 10 TYR A CA   7  
ATOM   2928  C C    . TYR A 1 10 ? 1.370   9.899   0.297   1.00 0.60 ? 10 TYR A C    7  
ATOM   2929  O O    . TYR A 1 10 ? 0.408   9.348   0.800   1.00 0.61 ? 10 TYR A O    7  
ATOM   2930  C CB   . TYR A 1 10 ? 3.845   9.779   1.064   1.00 0.67 ? 10 TYR A CB   7  
ATOM   2931  C CG   . TYR A 1 10 ? 3.753   8.516   0.237   1.00 0.64 ? 10 TYR A CG   7  
ATOM   2932  C CD1  . TYR A 1 10 ? 3.901   8.583   -1.148  1.00 0.64 ? 10 TYR A CD1  7  
ATOM   2933  C CD2  . TYR A 1 10 ? 3.533   7.284   0.861   1.00 0.67 ? 10 TYR A CD2  7  
ATOM   2934  C CE1  . TYR A 1 10 ? 3.824   7.418   -1.918  1.00 0.67 ? 10 TYR A CE1  7  
ATOM   2935  C CE2  . TYR A 1 10 ? 3.457   6.117   0.094   1.00 0.69 ? 10 TYR A CE2  7  
ATOM   2936  C CZ   . TYR A 1 10 ? 3.601   6.184   -1.297  1.00 0.70 ? 10 TYR A CZ   7  
ATOM   2937  O OH   . TYR A 1 10 ? 3.520   5.033   -2.053  1.00 0.77 ? 10 TYR A OH   7  
ATOM   2938  H H    . TYR A 1 10 ? 2.176   11.308  3.137   1.00 0.71 ? 10 TYR A H    7  
ATOM   2939  H HA   . TYR A 1 10 ? 2.635   11.552  0.858   1.00 0.68 ? 10 TYR A HA   7  
ATOM   2940  H HB2  . TYR A 1 10 ? 4.573   10.433  0.613   1.00 0.69 ? 10 TYR A HB2  7  
ATOM   2941  H HB3  . TYR A 1 10 ? 4.174   9.523   2.061   1.00 0.73 ? 10 TYR A HB3  7  
ATOM   2942  H HD1  . TYR A 1 10 ? 4.072   9.538   -1.622  1.00 0.66 ? 10 TYR A HD1  7  
ATOM   2943  H HD2  . TYR A 1 10 ? 3.419   7.235   1.936   1.00 0.69 ? 10 TYR A HD2  7  
ATOM   2944  H HE1  . TYR A 1 10 ? 3.936   7.472   -2.991  1.00 0.69 ? 10 TYR A HE1  7  
ATOM   2945  H HE2  . TYR A 1 10 ? 3.286   5.166   0.575   1.00 0.75 ? 10 TYR A HE2  7  
ATOM   2946  H HH   . TYR A 1 10 ? 2.691   4.597   -1.842  1.00 0.88 ? 10 TYR A HH   7  
ATOM   2947  N N    . ARG A 1 11 ? 1.483   10.002  -1.002  1.00 0.60 ? 11 ARG A N    7  
ATOM   2948  C CA   . ARG A 1 11 ? 0.440   9.427   -1.911  1.00 0.62 ? 11 ARG A CA   7  
ATOM   2949  C C    . ARG A 1 11 ? 0.499   7.890   -1.875  1.00 0.64 ? 11 ARG A C    7  
ATOM   2950  O O    . ARG A 1 11 ? 1.010   7.302   -0.944  1.00 0.66 ? 11 ARG A O    7  
ATOM   2951  C CB   . ARG A 1 11 ? 0.820   9.955   -3.301  1.00 0.63 ? 11 ARG A CB   7  
ATOM   2952  C CG   . ARG A 1 11 ? 0.072   11.259  -3.585  1.00 0.66 ? 11 ARG A CG   7  
ATOM   2953  C CD   . ARG A 1 11 ? 0.289   11.659  -5.047  1.00 0.88 ? 11 ARG A CD   7  
ATOM   2954  N NE   . ARG A 1 11 ? -0.582  12.851  -5.257  1.00 0.81 ? 11 ARG A NE   7  
ATOM   2955  C CZ   . ARG A 1 11 ? -0.653  13.412  -6.429  1.00 0.90 ? 11 ARG A CZ   7  
ATOM   2956  N NH1  . ARG A 1 11 ? -1.204  12.777  -7.422  1.00 1.10 ? 11 ARG A NH1  7  
ATOM   2957  N NH2  . ARG A 1 11 ? -0.180  14.613  -6.603  1.00 0.94 ? 11 ARG A NH2  7  
ATOM   2958  H H    . ARG A 1 11 ? 2.256   10.463  -1.384  1.00 0.62 ? 11 ARG A H    7  
ATOM   2959  H HA   . ARG A 1 11 ? -0.540  9.775   -1.637  1.00 0.66 ? 11 ARG A HA   7  
ATOM   2960  H HB2  . ARG A 1 11 ? 1.885   10.137  -3.338  1.00 0.63 ? 11 ARG A HB2  7  
ATOM   2961  H HB3  . ARG A 1 11 ? 0.559   9.225   -4.048  1.00 0.68 ? 11 ARG A HB3  7  
ATOM   2962  H HG2  . ARG A 1 11 ? -0.982  11.117  -3.401  1.00 0.88 ? 11 ARG A HG2  7  
ATOM   2963  H HG3  . ARG A 1 11 ? 0.450   12.038  -2.941  1.00 0.79 ? 11 ARG A HG3  7  
ATOM   2964  H HD2  . ARG A 1 11 ? 1.327   11.912  -5.216  1.00 1.13 ? 11 ARG A HD2  7  
ATOM   2965  H HD3  . ARG A 1 11 ? -0.014  10.858  -5.705  1.00 1.24 ? 11 ARG A HD3  7  
ATOM   2966  H HE   . ARG A 1 11 ? -1.104  13.220  -4.507  1.00 0.83 ? 11 ARG A HE   7  
ATOM   2967  H HH11 . ARG A 1 11 ? -1.574  11.860  -7.282  1.00 1.16 ? 11 ARG A HH11 7  
ATOM   2968  H HH12 . ARG A 1 11 ? -1.258  13.206  -8.322  1.00 1.25 ? 11 ARG A HH12 7  
ATOM   2969  H HH21 . ARG A 1 11 ? 0.239   15.102  -5.833  1.00 0.92 ? 11 ARG A HH21 7  
ATOM   2970  H HH22 . ARG A 1 11 ? -0.235  15.048  -7.498  1.00 1.08 ? 11 ARG A HH22 7  
ATOM   2971  N N    . GLY A 1 12 ? 0.006   7.235   -2.893  1.00 0.68 ? 12 GLY A N    7  
ATOM   2972  C CA   . GLY A 1 12 ? 0.076   5.743   -2.927  1.00 0.75 ? 12 GLY A CA   7  
ATOM   2973  C C    . GLY A 1 12 ? 1.066   5.337   -4.021  1.00 0.75 ? 12 GLY A C    7  
ATOM   2974  O O    . GLY A 1 12 ? 1.125   4.195   -4.430  1.00 0.85 ? 12 GLY A O    7  
ATOM   2975  H H    . GLY A 1 12 ? -0.382  7.720   -3.652  1.00 0.69 ? 12 GLY A H    7  
ATOM   2976  H HA2  . GLY A 1 12 ? 0.416   5.373   -1.970  1.00 0.77 ? 12 GLY A HA2  7  
ATOM   2977  H HA3  . GLY A 1 12 ? -0.896  5.338   -3.155  1.00 0.83 ? 12 GLY A HA3  7  
ATOM   2978  N N    . ARG A 1 13 ? 1.829   6.287   -4.505  1.00 0.68 ? 13 ARG A N    7  
ATOM   2979  C CA   . ARG A 1 13 ? 2.812   6.011   -5.584  1.00 0.70 ? 13 ARG A CA   7  
ATOM   2980  C C    . ARG A 1 13 ? 4.244   6.313   -5.112  1.00 0.66 ? 13 ARG A C    7  
ATOM   2981  O O    . ARG A 1 13 ? 4.815   7.337   -5.442  1.00 0.62 ? 13 ARG A O    7  
ATOM   2982  C CB   . ARG A 1 13 ? 2.382   6.945   -6.724  1.00 0.70 ? 13 ARG A CB   7  
ATOM   2983  C CG   . ARG A 1 13 ? 2.261   8.392   -6.221  1.00 0.62 ? 13 ARG A CG   7  
ATOM   2984  C CD   . ARG A 1 13 ? 2.575   9.359   -7.363  1.00 0.64 ? 13 ARG A CD   7  
ATOM   2985  N NE   . ARG A 1 13 ? 4.064   9.396   -7.443  1.00 0.54 ? 13 ARG A NE   7  
ATOM   2986  C CZ   . ARG A 1 13 ? 4.649   10.067  -8.393  1.00 0.49 ? 13 ARG A CZ   7  
ATOM   2987  N NH1  . ARG A 1 13 ? 4.448   11.347  -8.501  1.00 0.48 ? 13 ARG A NH1  7  
ATOM   2988  N NH2  . ARG A 1 13 ? 5.437   9.458   -9.229  1.00 0.53 ? 13 ARG A NH2  7  
ATOM   2989  H H    . ARG A 1 13 ? 1.748   7.195   -4.160  1.00 0.64 ? 13 ARG A H    7  
ATOM   2990  H HA   . ARG A 1 13 ? 2.735   4.985   -5.904  1.00 0.80 ? 13 ARG A HA   7  
ATOM   2991  H HB2  . ARG A 1 13 ? 3.110   6.902   -7.511  1.00 0.74 ? 13 ARG A HB2  7  
ATOM   2992  H HB3  . ARG A 1 13 ? 1.424   6.624   -7.101  1.00 0.78 ? 13 ARG A HB3  7  
ATOM   2993  H HG2  . ARG A 1 13 ? 1.255   8.566   -5.868  1.00 0.66 ? 13 ARG A HG2  7  
ATOM   2994  H HG3  . ARG A 1 13 ? 2.959   8.555   -5.413  1.00 0.58 ? 13 ARG A HG3  7  
ATOM   2995  H HD2  . ARG A 1 13 ? 2.154   8.993   -8.291  1.00 0.77 ? 13 ARG A HD2  7  
ATOM   2996  H HD3  . ARG A 1 13 ? 2.192   10.343  -7.138  1.00 0.68 ? 13 ARG A HD3  7  
ATOM   2997  H HE   . ARG A 1 13 ? 4.605   8.911   -6.781  1.00 0.56 ? 13 ARG A HE   7  
ATOM   2998  H HH11 . ARG A 1 13 ? 3.846   11.815  -7.853  1.00 0.52 ? 13 ARG A HH11 7  
ATOM   2999  H HH12 . ARG A 1 13 ? 4.897   11.867  -9.233  1.00 0.48 ? 13 ARG A HH12 7  
ATOM   3000  H HH21 . ARG A 1 13 ? 5.593   8.470   -9.139  1.00 0.61 ? 13 ARG A HH21 7  
ATOM   3001  H HH22 . ARG A 1 13 ? 5.886   9.971   -9.959  1.00 0.54 ? 13 ARG A HH22 7  
ATOM   3002  N N    . LYS A 1 14 ? 4.830   5.430   -4.343  1.00 0.71 ? 14 LYS A N    7  
ATOM   3003  C CA   . LYS A 1 14 ? 6.225   5.660   -3.844  1.00 0.73 ? 14 LYS A CA   7  
ATOM   3004  C C    . LYS A 1 14 ? 7.254   5.380   -4.953  1.00 0.75 ? 14 LYS A C    7  
ATOM   3005  O O    . LYS A 1 14 ? 8.164   4.588   -4.789  1.00 0.82 ? 14 LYS A O    7  
ATOM   3006  C CB   . LYS A 1 14 ? 6.407   4.688   -2.665  1.00 0.83 ? 14 LYS A CB   7  
ATOM   3007  C CG   . LYS A 1 14 ? 6.067   3.249   -3.090  1.00 0.94 ? 14 LYS A CG   7  
ATOM   3008  C CD   . LYS A 1 14 ? 7.318   2.369   -3.010  1.00 1.04 ? 14 LYS A CD   7  
ATOM   3009  C CE   . LYS A 1 14 ? 7.783   2.251   -1.554  1.00 1.29 ? 14 LYS A CE   7  
ATOM   3010  N NZ   . LYS A 1 14 ? 9.221   2.650   -1.572  1.00 1.75 ? 14 LYS A NZ   7  
ATOM   3011  H H    . LYS A 1 14 ? 4.351   4.616   -4.088  1.00 0.77 ? 14 LYS A H    7  
ATOM   3012  H HA   . LYS A 1 14 ? 6.330   6.676   -3.496  1.00 0.68 ? 14 LYS A HA   7  
ATOM   3013  H HB2  . LYS A 1 14 ? 7.429   4.728   -2.331  1.00 0.89 ? 14 LYS A HB2  7  
ATOM   3014  H HB3  . LYS A 1 14 ? 5.756   4.983   -1.857  1.00 0.82 ? 14 LYS A HB3  7  
ATOM   3015  H HG2  . LYS A 1 14 ? 5.306   2.852   -2.433  1.00 1.01 ? 14 LYS A HG2  7  
ATOM   3016  H HG3  . LYS A 1 14 ? 5.698   3.249   -4.104  1.00 0.92 ? 14 LYS A HG3  7  
ATOM   3017  H HD2  . LYS A 1 14 ? 7.086   1.387   -3.394  1.00 1.37 ? 14 LYS A HD2  7  
ATOM   3018  H HD3  . LYS A 1 14 ? 8.103   2.810   -3.603  1.00 1.20 ? 14 LYS A HD3  7  
ATOM   3019  H HE2  . LYS A 1 14 ? 7.211   2.920   -0.923  1.00 2.05 ? 14 LYS A HE2  7  
ATOM   3020  H HE3  . LYS A 1 14 ? 7.685   1.233   -1.209  1.00 1.48 ? 14 LYS A HE3  7  
ATOM   3021  H HZ1  . LYS A 1 14 ? 9.312   3.610   -1.962  1.00 2.03 ? 14 LYS A HZ1  7  
ATOM   3022  H HZ2  . LYS A 1 14 ? 9.598   2.633   -0.602  1.00 2.07 ? 14 LYS A HZ2  7  
ATOM   3023  H HZ3  . LYS A 1 14 ? 9.760   1.987   -2.165  1.00 2.32 ? 14 LYS A HZ3  7  
ATOM   3024  N N    . SER A 1 15 ? 7.122   6.038   -6.075  1.00 0.70 ? 15 SER A N    7  
ATOM   3025  C CA   . SER A 1 15 ? 8.088   5.828   -7.196  1.00 0.73 ? 15 SER A CA   7  
ATOM   3026  C C    . SER A 1 15 ? 9.315   6.736   -7.021  1.00 0.71 ? 15 SER A C    7  
ATOM   3027  O O    . SER A 1 15 ? 9.664   7.508   -7.897  1.00 0.69 ? 15 SER A O    7  
ATOM   3028  C CB   . SER A 1 15 ? 7.314   6.192   -8.474  1.00 0.71 ? 15 SER A CB   7  
ATOM   3029  O OG   . SER A 1 15 ? 6.431   7.284   -8.220  1.00 0.64 ? 15 SER A OG   7  
ATOM   3030  H H    . SER A 1 15 ? 6.389   6.680   -6.178  1.00 0.67 ? 15 SER A H    7  
ATOM   3031  H HA   . SER A 1 15 ? 8.395   4.795   -7.236  1.00 0.82 ? 15 SER A HA   7  
ATOM   3032  H HB2  . SER A 1 15 ? 8.009   6.476   -9.245  1.00 0.75 ? 15 SER A HB2  7  
ATOM   3033  H HB3  . SER A 1 15 ? 6.751   5.330   -8.806  1.00 0.80 ? 15 SER A HB3  7  
ATOM   3034  H HG   . SER A 1 15 ? 6.902   7.937   -7.681  1.00 0.62 ? 15 SER A HG   7  
ATOM   3035  N N    . GLY A 1 16 ? 9.978   6.642   -5.893  1.00 0.76 ? 16 GLY A N    7  
ATOM   3036  C CA   . GLY A 1 16 ? 11.187  7.487   -5.647  1.00 0.78 ? 16 GLY A CA   7  
ATOM   3037  C C    . GLY A 1 16 ? 12.441  6.731   -6.092  1.00 0.83 ? 16 GLY A C    7  
ATOM   3038  O O    . GLY A 1 16 ? 13.366  6.541   -5.326  1.00 0.92 ? 16 GLY A O    7  
ATOM   3039  H H    . GLY A 1 16 ? 9.681   6.009   -5.206  1.00 0.81 ? 16 GLY A H    7  
ATOM   3040  H HA2  . GLY A 1 16 ? 11.102  8.407   -6.209  1.00 0.73 ? 16 GLY A HA2  7  
ATOM   3041  H HA3  . GLY A 1 16 ? 11.261  7.713   -4.595  1.00 0.82 ? 16 GLY A HA3  7  
ATOM   3042  N N    . ASN A 1 17 ? 12.475  6.298   -7.326  1.00 0.82 ? 17 ASN A N    7  
ATOM   3043  C CA   . ASN A 1 17 ? 13.664  5.551   -7.839  1.00 0.89 ? 17 ASN A CA   7  
ATOM   3044  C C    . ASN A 1 17 ? 14.028  6.054   -9.246  1.00 0.74 ? 17 ASN A C    7  
ATOM   3045  O O    . ASN A 1 17 ? 13.673  7.154   -9.624  1.00 0.68 ? 17 ASN A O    7  
ATOM   3046  C CB   . ASN A 1 17 ? 13.215  4.086   -7.874  1.00 1.02 ? 17 ASN A CB   7  
ATOM   3047  C CG   . ASN A 1 17 ? 14.398  3.179   -7.532  1.00 1.18 ? 17 ASN A CG   7  
ATOM   3048  O OD1  . ASN A 1 17 ? 15.153  2.796   -8.402  1.00 1.15 ? 17 ASN A OD1  7  
ATOM   3049  N ND2  . ASN A 1 17 ? 14.597  2.819   -6.296  1.00 1.56 ? 17 ASN A ND2  7  
ATOM   3050  H H    . ASN A 1 17 ? 11.713  6.467   -7.921  1.00 0.79 ? 17 ASN A H    7  
ATOM   3051  H HA   . ASN A 1 17 ? 14.501  5.667   -7.170  1.00 1.01 ? 17 ASN A HA   7  
ATOM   3052  H HB2  . ASN A 1 17 ? 12.426  3.934   -7.151  1.00 1.10 ? 17 ASN A HB2  7  
ATOM   3053  H HB3  . ASN A 1 17 ? 12.850  3.842   -8.860  1.00 0.97 ? 17 ASN A HB3  7  
ATOM   3054  H HD21 . ASN A 1 17 ? 13.991  3.129   -5.591  1.00 1.81 ? 17 ASN A HD21 7  
ATOM   3055  H HD22 . ASN A 1 17 ? 15.354  2.239   -6.072  1.00 1.68 ? 17 ASN A HD22 7  
ATOM   3056  N N    . LYS A 1 18 ? 14.732  5.264   -10.024 1.00 0.75 ? 18 LYS A N    7  
ATOM   3057  C CA   . LYS A 1 18 ? 15.111  5.709   -11.404 1.00 0.66 ? 18 LYS A CA   7  
ATOM   3058  C C    . LYS A 1 18 ? 13.852  5.917   -12.263 1.00 0.56 ? 18 LYS A C    7  
ATOM   3059  O O    . LYS A 1 18 ? 13.120  4.979   -12.522 1.00 0.71 ? 18 LYS A O    7  
ATOM   3060  C CB   . LYS A 1 18 ? 15.968  4.573   -11.973 1.00 0.83 ? 18 LYS A CB   7  
ATOM   3061  C CG   . LYS A 1 18 ? 17.285  5.142   -12.508 1.00 0.96 ? 18 LYS A CG   7  
ATOM   3062  C CD   . LYS A 1 18 ? 17.010  6.045   -13.718 1.00 0.90 ? 18 LYS A CD   7  
ATOM   3063  C CE   . LYS A 1 18 ? 16.658  5.187   -14.937 1.00 0.93 ? 18 LYS A CE   7  
ATOM   3064  N NZ   . LYS A 1 18 ? 16.161  6.152   -15.961 1.00 0.86 ? 18 LYS A NZ   7  
ATOM   3065  H H    . LYS A 1 18 ? 15.012  4.381   -9.702  1.00 0.88 ? 18 LYS A H    7  
ATOM   3066  H HA   . LYS A 1 18 ? 15.689  6.618   -11.357 1.00 0.68 ? 18 LYS A HA   7  
ATOM   3067  H HB2  . LYS A 1 18 ? 16.179  3.853   -11.195 1.00 0.96 ? 18 LYS A HB2  7  
ATOM   3068  H HB3  . LYS A 1 18 ? 15.436  4.087   -12.778 1.00 0.85 ? 18 LYS A HB3  7  
ATOM   3069  H HG2  . LYS A 1 18 ? 17.767  5.718   -11.731 1.00 1.06 ? 18 LYS A HG2  7  
ATOM   3070  H HG3  . LYS A 1 18 ? 17.931  4.330   -12.807 1.00 1.13 ? 18 LYS A HG3  7  
ATOM   3071  H HD2  . LYS A 1 18 ? 16.186  6.706   -13.493 1.00 0.80 ? 18 LYS A HD2  7  
ATOM   3072  H HD3  . LYS A 1 18 ? 17.890  6.632   -13.936 1.00 1.10 ? 18 LYS A HD3  7  
ATOM   3073  H HE2  . LYS A 1 18 ? 17.539  4.670   -15.297 1.00 1.16 ? 18 LYS A HE2  7  
ATOM   3074  H HE3  . LYS A 1 18 ? 15.883  4.479   -14.688 1.00 0.98 ? 18 LYS A HE3  7  
ATOM   3075  H HZ1  . LYS A 1 18 ? 16.856  6.916   -16.088 1.00 0.97 ? 18 LYS A HZ1  7  
ATOM   3076  H HZ2  . LYS A 1 18 ? 16.021  5.658   -16.865 1.00 1.07 ? 18 LYS A HZ2  7  
ATOM   3077  H HZ3  . LYS A 1 18 ? 15.252  6.564   -15.644 1.00 0.72 ? 18 LYS A HZ3  7  
ATOM   3078  N N    . PRO A 1 19 ? 13.643  7.146   -12.674 1.00 0.50 ? 19 PRO A N    7  
ATOM   3079  C CA   . PRO A 1 19 ? 12.442  7.428   -13.507 1.00 0.58 ? 19 PRO A CA   7  
ATOM   3080  C C    . PRO A 1 19 ? 12.731  7.147   -14.990 1.00 0.60 ? 19 PRO A C    7  
ATOM   3081  O O    . PRO A 1 19 ? 13.873  7.192   -15.418 1.00 0.65 ? 19 PRO A O    7  
ATOM   3082  C CB   . PRO A 1 19 ? 12.174  8.912   -13.282 1.00 0.63 ? 19 PRO A CB   7  
ATOM   3083  C CG   . PRO A 1 19 ? 13.493  9.496   -12.899 1.00 0.62 ? 19 PRO A CG   7  
ATOM   3084  C CD   . PRO A 1 19 ? 14.317  8.396   -12.279 1.00 0.58 ? 19 PRO A CD   7  
ATOM   3085  H HA   . PRO A 1 19 ? 11.600  6.846   -13.168 1.00 0.74 ? 19 PRO A HA   7  
ATOM   3086  H HB2  . PRO A 1 19 ? 11.809  9.369   -14.192 1.00 0.69 ? 19 PRO A HB2  7  
ATOM   3087  H HB3  . PRO A 1 19 ? 11.464  9.048   -12.481 1.00 0.77 ? 19 PRO A HB3  7  
ATOM   3088  H HG2  . PRO A 1 19 ? 13.992  9.882   -13.777 1.00 0.66 ? 19 PRO A HG2  7  
ATOM   3089  H HG3  . PRO A 1 19 ? 13.349  10.288  -12.179 1.00 0.79 ? 19 PRO A HG3  7  
ATOM   3090  H HD2  . PRO A 1 19 ? 15.326  8.422   -12.667 1.00 0.71 ? 19 PRO A HD2  7  
ATOM   3091  H HD3  . PRO A 1 19 ? 14.323  8.490   -11.205 1.00 0.69 ? 19 PRO A HD3  7  
ATOM   3092  N N    . PRO A 1 20 ? 11.682  6.868   -15.727 1.00 0.74 ? 20 PRO A N    7  
ATOM   3093  C CA   . PRO A 1 20 ? 11.872  6.590   -17.179 1.00 0.87 ? 20 PRO A CA   7  
ATOM   3094  C C    . PRO A 1 20 ? 12.069  7.905   -17.946 1.00 0.72 ? 20 PRO A C    7  
ATOM   3095  O O    . PRO A 1 20 ? 11.257  8.808   -17.860 1.00 0.72 ? 20 PRO A O    7  
ATOM   3096  C CB   . PRO A 1 20 ? 10.577  5.900   -17.598 1.00 1.17 ? 20 PRO A CB   7  
ATOM   3097  C CG   . PRO A 1 20 ? 9.557   6.365   -16.615 1.00 1.19 ? 20 PRO A CG   7  
ATOM   3098  C CD   . PRO A 1 20 ? 10.283  6.640   -15.325 1.00 0.96 ? 20 PRO A CD   7  
ATOM   3099  H HA   . PRO A 1 20 ? 12.711  5.931   -17.332 1.00 0.96 ? 20 PRO A HA   7  
ATOM   3100  H HB2  . PRO A 1 20 ? 10.301  6.196   -18.601 1.00 1.25 ? 20 PRO A HB2  7  
ATOM   3101  H HB3  . PRO A 1 20 ? 10.686  4.828   -17.538 1.00 1.36 ? 20 PRO A HB3  7  
ATOM   3102  H HG2  . PRO A 1 20 ? 9.085   7.269   -16.976 1.00 1.21 ? 20 PRO A HG2  7  
ATOM   3103  H HG3  . PRO A 1 20 ? 8.816   5.598   -16.459 1.00 1.44 ? 20 PRO A HG3  7  
ATOM   3104  H HD2  . PRO A 1 20 ? 9.876   7.521   -14.846 1.00 0.97 ? 20 PRO A HD2  7  
ATOM   3105  H HD3  . PRO A 1 20 ? 10.221  5.788   -14.667 1.00 1.07 ? 20 PRO A HD3  7  
ATOM   3106  N N    . SER A 1 21 ? 13.148  8.018   -18.689 1.00 0.77 ? 21 SER A N    7  
ATOM   3107  C CA   . SER A 1 21 ? 13.420  9.275   -19.464 1.00 0.83 ? 21 SER A CA   7  
ATOM   3108  C C    . SER A 1 21 ? 13.454  10.494  -18.522 1.00 0.70 ? 21 SER A C    7  
ATOM   3109  O O    . SER A 1 21 ? 13.778  10.375  -17.354 1.00 0.68 ? 21 SER A O    7  
ATOM   3110  C CB   . SER A 1 21 ? 12.267  9.387   -20.470 1.00 0.96 ? 21 SER A CB   7  
ATOM   3111  O OG   . SER A 1 21 ? 12.521  10.473  -21.355 1.00 1.11 ? 21 SER A OG   7  
ATOM   3112  H H    . SER A 1 21 ? 13.785  7.276   -18.733 1.00 0.89 ? 21 SER A H    7  
ATOM   3113  H HA   . SER A 1 21 ? 14.357  9.190   -19.992 1.00 0.99 ? 21 SER A HA   7  
ATOM   3114  H HB2  . SER A 1 21 ? 12.193  8.475   -21.038 1.00 1.11 ? 21 SER A HB2  7  
ATOM   3115  H HB3  . SER A 1 21 ? 11.339  9.554   -19.938 1.00 0.92 ? 21 SER A HB3  7  
ATOM   3116  H HG   . SER A 1 21 ? 12.100  10.277  -22.197 1.00 1.38 ? 21 SER A HG   7  
ATOM   3117  N N    . LYS A 1 22 ? 13.127  11.662  -19.020 1.00 0.77 ? 22 LYS A N    7  
ATOM   3118  C CA   . LYS A 1 22 ? 13.142  12.884  -18.156 1.00 0.76 ? 22 LYS A CA   7  
ATOM   3119  C C    . LYS A 1 22 ? 11.946  13.792  -18.492 1.00 0.79 ? 22 LYS A C    7  
ATOM   3120  O O    . LYS A 1 22 ? 12.092  14.832  -19.112 1.00 0.95 ? 22 LYS A O    7  
ATOM   3121  C CB   . LYS A 1 22 ? 14.478  13.582  -18.461 1.00 0.94 ? 22 LYS A CB   7  
ATOM   3122  C CG   . LYS A 1 22 ? 14.637  13.797  -19.973 1.00 1.08 ? 22 LYS A CG   7  
ATOM   3123  C CD   . LYS A 1 22 ? 15.225  15.187  -20.236 1.00 1.28 ? 22 LYS A CD   7  
ATOM   3124  C CE   . LYS A 1 22 ? 14.360  15.929  -21.261 1.00 1.35 ? 22 LYS A CE   7  
ATOM   3125  N NZ   . LYS A 1 22 ? 13.316  16.630  -20.455 1.00 1.33 ? 22 LYS A NZ   7  
ATOM   3126  H H    . LYS A 1 22 ? 12.872  11.735  -19.966 1.00 0.90 ? 22 LYS A H    7  
ATOM   3127  H HA   . LYS A 1 22 ? 13.108  12.602  -17.115 1.00 0.70 ? 22 LYS A HA   7  
ATOM   3128  H HB2  . LYS A 1 22 ? 14.503  14.539  -17.958 1.00 1.01 ? 22 LYS A HB2  7  
ATOM   3129  H HB3  . LYS A 1 22 ? 15.291  12.970  -18.100 1.00 0.98 ? 22 LYS A HB3  7  
ATOM   3130  H HG2  . LYS A 1 22 ? 15.300  13.043  -20.374 1.00 1.19 ? 22 LYS A HG2  7  
ATOM   3131  H HG3  . LYS A 1 22 ? 13.674  13.718  -20.453 1.00 1.06 ? 22 LYS A HG3  7  
ATOM   3132  H HD2  . LYS A 1 22 ? 15.252  15.748  -19.313 1.00 1.33 ? 22 LYS A HD2  7  
ATOM   3133  H HD3  . LYS A 1 22 ? 16.228  15.085  -20.624 1.00 1.48 ? 22 LYS A HD3  7  
ATOM   3134  H HE2  . LYS A 1 22 ? 14.961  16.645  -21.809 1.00 1.55 ? 22 LYS A HE2  7  
ATOM   3135  H HE3  . LYS A 1 22 ? 13.897  15.230  -21.940 1.00 1.37 ? 22 LYS A HE3  7  
ATOM   3136  H HZ1  . LYS A 1 22 ? 12.791  15.931  -19.881 1.00 1.14 ? 22 LYS A HZ1  7  
ATOM   3137  H HZ2  . LYS A 1 22 ? 13.770  17.326  -19.828 1.00 1.54 ? 22 LYS A HZ2  7  
ATOM   3138  H HZ3  . LYS A 1 22 ? 12.656  17.117  -21.092 1.00 1.51 ? 22 LYS A HZ3  7  
ATOM   3139  N N    . THR A 1 23 ? 10.764  13.402  -18.084 1.00 0.73 ? 23 THR A N    7  
ATOM   3140  C CA   . THR A 1 23 ? 9.550   14.233  -18.377 1.00 0.86 ? 23 THR A CA   7  
ATOM   3141  C C    . THR A 1 23 ? 8.596   14.271  -17.168 1.00 0.75 ? 23 THR A C    7  
ATOM   3142  O O    . THR A 1 23 ? 7.403   14.463  -17.319 1.00 0.86 ? 23 THR A O    7  
ATOM   3143  C CB   . THR A 1 23 ? 8.882   13.548  -19.579 1.00 0.99 ? 23 THR A CB   7  
ATOM   3144  O OG1  . THR A 1 23 ? 7.808   14.354  -20.048 1.00 1.19 ? 23 THR A OG1  7  
ATOM   3145  C CG2  . THR A 1 23 ? 8.346   12.172  -19.173 1.00 0.92 ? 23 THR A CG2  7  
ATOM   3146  H H    . THR A 1 23 ? 10.672  12.560  -17.588 1.00 0.68 ? 23 THR A H    7  
ATOM   3147  H HA   . THR A 1 23 ? 9.842   15.235  -18.648 1.00 1.01 ? 23 THR A HA   7  
ATOM   3148  H HB   . THR A 1 23 ? 9.608   13.426  -20.369 1.00 1.08 ? 23 THR A HB   7  
ATOM   3149  H HG1  . THR A 1 23 ? 7.175   14.456  -19.331 1.00 1.17 ? 23 THR A HG1  7  
ATOM   3150  H HG21 . THR A 1 23 ? 9.159   11.562  -18.805 1.00 1.37 ? 23 THR A HG21 7  
ATOM   3151  H HG22 . THR A 1 23 ? 7.603   12.288  -18.397 1.00 1.37 ? 23 THR A HG22 7  
ATOM   3152  H HG23 . THR A 1 23 ? 7.897   11.694  -20.031 1.00 1.30 ? 23 THR A HG23 7  
ATOM   3153  N N    . CYS A 1 24 ? 9.109   14.096  -15.972 1.00 0.63 ? 24 CYS A N    7  
ATOM   3154  C CA   . CYS A 1 24 ? 8.230   14.127  -14.761 1.00 0.57 ? 24 CYS A CA   7  
ATOM   3155  C C    . CYS A 1 24 ? 8.930   14.855  -13.605 1.00 0.52 ? 24 CYS A C    7  
ATOM   3156  O O    . CYS A 1 24 ? 10.142  14.984  -13.583 1.00 0.59 ? 24 CYS A O    7  
ATOM   3157  C CB   . CYS A 1 24 ? 7.995   12.657  -14.403 1.00 0.58 ? 24 CYS A CB   7  
ATOM   3158  S SG   . CYS A 1 24 ? 6.556   12.034  -15.310 1.00 0.98 ? 24 CYS A SG   7  
ATOM   3159  H H    . CYS A 1 24 ? 10.070  13.949  -15.870 1.00 0.67 ? 24 CYS A H    7  
ATOM   3160  H HA   . CYS A 1 24 ? 7.291   14.603  -14.990 1.00 0.63 ? 24 CYS A HA   7  
ATOM   3161  H HB2  . CYS A 1 24 ? 8.867   12.077  -14.669 1.00 0.71 ? 24 CYS A HB2  7  
ATOM   3162  H HB3  . CYS A 1 24 ? 7.816   12.569  -13.341 1.00 0.64 ? 24 CYS A HB3  7  
ATOM   3163  H HG   . CYS A 1 24 ? 6.599   12.375  -16.205 1.00 1.50 ? 24 CYS A HG   7  
ATOM   3164  N N    . LEU A 1 25 ? 8.173   15.321  -12.641 1.00 0.52 ? 25 LEU A N    7  
ATOM   3165  C CA   . LEU A 1 25 ? 8.785   16.032  -11.474 1.00 0.55 ? 25 LEU A CA   7  
ATOM   3166  C C    . LEU A 1 25 ? 9.465   15.020  -10.537 1.00 0.52 ? 25 LEU A C    7  
ATOM   3167  O O    . LEU A 1 25 ? 9.758   13.903  -10.926 1.00 0.55 ? 25 LEU A O    7  
ATOM   3168  C CB   . LEU A 1 25 ? 7.610   16.728  -10.773 1.00 0.59 ? 25 LEU A CB   7  
ATOM   3169  C CG   . LEU A 1 25 ? 7.717   18.241  -10.966 1.00 0.76 ? 25 LEU A CG   7  
ATOM   3170  C CD1  . LEU A 1 25 ? 6.320   18.862  -10.915 1.00 1.05 ? 25 LEU A CD1  7  
ATOM   3171  C CD2  . LEU A 1 25 ? 8.576   18.840  -9.849  1.00 1.07 ? 25 LEU A CD2  7  
ATOM   3172  H H    . LEU A 1 25 ? 7.200   15.195  -12.681 1.00 0.56 ? 25 LEU A H    7  
ATOM   3173  H HA   . LEU A 1 25 ? 9.499   16.766  -11.812 1.00 0.62 ? 25 LEU A HA   7  
ATOM   3174  H HB2  . LEU A 1 25 ? 6.680   16.378  -11.196 1.00 0.59 ? 25 LEU A HB2  7  
ATOM   3175  H HB3  . LEU A 1 25 ? 7.631   16.500  -9.718  1.00 0.71 ? 25 LEU A HB3  7  
ATOM   3176  H HG   . LEU A 1 25 ? 8.169   18.451  -11.925 1.00 0.89 ? 25 LEU A HG   7  
ATOM   3177  H HD11 . LEU A 1 25 ? 5.834   18.579  -9.993  1.00 1.50 ? 25 LEU A HD11 7  
ATOM   3178  H HD12 . LEU A 1 25 ? 6.402   19.938  -10.964 1.00 1.47 ? 25 LEU A HD12 7  
ATOM   3179  H HD13 . LEU A 1 25 ? 5.738   18.506  -11.752 1.00 1.57 ? 25 LEU A HD13 7  
ATOM   3180  H HD21 . LEU A 1 25 ? 8.182   18.538  -8.891  1.00 1.61 ? 25 LEU A HD21 7  
ATOM   3181  H HD22 . LEU A 1 25 ? 9.592   18.488  -9.949  1.00 1.64 ? 25 LEU A HD22 7  
ATOM   3182  H HD23 . LEU A 1 25 ? 8.559   19.918  -9.922  1.00 1.40 ? 25 LEU A HD23 7  
ATOM   3183  N N    . LYS A 1 26 ? 9.731   15.400  -9.315  1.00 0.56 ? 26 LYS A N    7  
ATOM   3184  C CA   . LYS A 1 26 ? 10.396  14.456  -8.365  1.00 0.60 ? 26 LYS A CA   7  
ATOM   3185  C C    . LYS A 1 26 ? 9.362   13.883  -7.389  1.00 0.54 ? 26 LYS A C    7  
ATOM   3186  O O    . LYS A 1 26 ? 9.009   14.512  -6.408  1.00 0.62 ? 26 LYS A O    7  
ATOM   3187  C CB   . LYS A 1 26 ? 11.444  15.298  -7.630  1.00 0.75 ? 26 LYS A CB   7  
ATOM   3188  C CG   . LYS A 1 26 ? 12.817  15.082  -8.275  1.00 0.88 ? 26 LYS A CG   7  
ATOM   3189  C CD   . LYS A 1 26 ? 12.876  15.807  -9.626  1.00 0.94 ? 26 LYS A CD   7  
ATOM   3190  C CE   . LYS A 1 26 ? 13.418  14.856  -10.700 1.00 1.15 ? 26 LYS A CE   7  
ATOM   3191  N NZ   . LYS A 1 26 ? 12.361  14.807  -11.753 1.00 1.16 ? 26 LYS A NZ   7  
ATOM   3192  H H    . LYS A 1 26 ? 9.499   16.304  -9.021  1.00 0.64 ? 26 LYS A H    7  
ATOM   3193  H HA   . LYS A 1 26 ? 10.880  13.657  -8.906  1.00 0.61 ? 26 LYS A HA   7  
ATOM   3194  H HB2  . LYS A 1 26 ? 11.175  16.344  -7.693  1.00 0.79 ? 26 LYS A HB2  7  
ATOM   3195  H HB3  . LYS A 1 26 ? 11.485  14.999  -6.593  1.00 0.80 ? 26 LYS A HB3  7  
ATOM   3196  H HG2  . LYS A 1 26 ? 13.584  15.475  -7.622  1.00 1.02 ? 26 LYS A HG2  7  
ATOM   3197  H HG3  . LYS A 1 26 ? 12.980  14.026  -8.426  1.00 0.93 ? 26 LYS A HG3  7  
ATOM   3198  H HD2  . LYS A 1 26 ? 11.885  16.137  -9.900  1.00 0.85 ? 26 LYS A HD2  7  
ATOM   3199  H HD3  . LYS A 1 26 ? 13.530  16.663  -9.545  1.00 1.13 ? 26 LYS A HD3  7  
ATOM   3200  H HE2  . LYS A 1 26 ? 14.343  15.243  -11.108 1.00 1.30 ? 26 LYS A HE2  7  
ATOM   3201  H HE3  . LYS A 1 26 ? 13.574  13.871  -10.286 1.00 1.50 ? 26 LYS A HE3  7  
ATOM   3202  H HZ1  . LYS A 1 26 ? 12.008  15.768  -11.943 1.00 1.21 ? 26 LYS A HZ1  7  
ATOM   3203  H HZ2  . LYS A 1 26 ? 12.761  14.409  -12.628 1.00 1.39 ? 26 LYS A HZ2  7  
ATOM   3204  H HZ3  . LYS A 1 26 ? 11.572  14.208  -11.429 1.00 1.51 ? 26 LYS A HZ3  7  
ATOM   3205  N N    . GLU A 1 27 ? 8.875   12.694  -7.663  1.00 0.46 ? 27 GLU A N    7  
ATOM   3206  C CA   . GLU A 1 27 ? 7.854   12.045  -6.779  1.00 0.47 ? 27 GLU A CA   7  
ATOM   3207  C C    . GLU A 1 27 ? 6.728   13.029  -6.422  1.00 0.47 ? 27 GLU A C    7  
ATOM   3208  O O    . GLU A 1 27 ? 6.499   13.340  -5.267  1.00 0.59 ? 27 GLU A O    7  
ATOM   3209  C CB   . GLU A 1 27 ? 8.626   11.603  -5.533  1.00 0.57 ? 27 GLU A CB   7  
ATOM   3210  C CG   . GLU A 1 27 ? 9.079   10.152  -5.712  1.00 0.59 ? 27 GLU A CG   7  
ATOM   3211  C CD   . GLU A 1 27 ? 7.899   9.208   -5.467  1.00 0.59 ? 27 GLU A CD   7  
ATOM   3212  O OE1  . GLU A 1 27 ? 7.112   9.029   -6.384  1.00 0.58 ? 27 GLU A OE1  7  
ATOM   3213  O OE2  . GLU A 1 27 ? 7.802   8.679   -4.372  1.00 0.71 ? 27 GLU A OE2  7  
ATOM   3214  H H    . GLU A 1 27 ? 9.185   12.221  -8.461  1.00 0.47 ? 27 GLU A H    7  
ATOM   3215  H HA   . GLU A 1 27 ? 7.439   11.180  -7.272  1.00 0.47 ? 27 GLU A HA   7  
ATOM   3216  H HB2  . GLU A 1 27 ? 9.490   12.239  -5.398  1.00 0.65 ? 27 GLU A HB2  7  
ATOM   3217  H HB3  . GLU A 1 27 ? 7.986   11.675  -4.667  1.00 0.62 ? 27 GLU A HB3  7  
ATOM   3218  H HG2  . GLU A 1 27 ? 9.448   10.013  -6.718  1.00 0.60 ? 27 GLU A HG2  7  
ATOM   3219  H HG3  . GLU A 1 27 ? 9.866   9.933   -5.010  1.00 0.70 ? 27 GLU A HG3  7  
ATOM   3220  N N    . GLU A 1 28 ? 6.024   13.514  -7.415  1.00 0.41 ? 28 GLU A N    7  
ATOM   3221  C CA   . GLU A 1 28 ? 4.904   14.478  -7.165  1.00 0.44 ? 28 GLU A CA   7  
ATOM   3222  C C    . GLU A 1 28 ? 3.917   13.895  -6.144  1.00 0.45 ? 28 GLU A C    7  
ATOM   3223  O O    . GLU A 1 28 ? 3.212   12.941  -6.419  1.00 0.54 ? 28 GLU A O    7  
ATOM   3224  C CB   . GLU A 1 28 ? 4.222   14.669  -8.527  1.00 0.50 ? 28 GLU A CB   7  
ATOM   3225  C CG   . GLU A 1 28 ? 5.248   15.164  -9.554  1.00 0.45 ? 28 GLU A CG   7  
ATOM   3226  C CD   . GLU A 1 28 ? 5.525   14.075  -10.596 1.00 0.42 ? 28 GLU A CD   7  
ATOM   3227  O OE1  . GLU A 1 28 ? 5.843   12.964  -10.200 1.00 0.47 ? 28 GLU A OE1  7  
ATOM   3228  O OE2  . GLU A 1 28 ? 5.423   14.373  -11.775 1.00 0.60 ? 28 GLU A OE2  7  
ATOM   3229  H H    . GLU A 1 28 ? 6.235   13.245  -8.335  1.00 0.38 ? 28 GLU A H    7  
ATOM   3230  H HA   . GLU A 1 28 ? 5.294   15.421  -6.814  1.00 0.48 ? 28 GLU A HA   7  
ATOM   3231  H HB2  . GLU A 1 28 ? 3.805   13.729  -8.856  1.00 0.53 ? 28 GLU A HB2  7  
ATOM   3232  H HB3  . GLU A 1 28 ? 3.431   15.398  -8.432  1.00 0.60 ? 28 GLU A HB3  7  
ATOM   3233  H HG2  . GLU A 1 28 ? 4.863   16.041  -10.049 1.00 0.52 ? 28 GLU A HG2  7  
ATOM   3234  H HG3  . GLU A 1 28 ? 6.169   15.415  -9.049  1.00 0.43 ? 28 GLU A HG3  7  
ATOM   3235  N N    . MET A 1 29 ? 3.875   14.464  -4.965  1.00 0.50 ? 29 MET A N    7  
ATOM   3236  C CA   . MET A 1 29 ? 2.950   13.958  -3.906  1.00 0.54 ? 29 MET A CA   7  
ATOM   3237  C C    . MET A 1 29 ? 1.730   14.885  -3.776  1.00 0.65 ? 29 MET A C    7  
ATOM   3238  O O    . MET A 1 29 ? 1.389   15.597  -4.702  1.00 0.73 ? 29 MET A O    7  
ATOM   3239  C CB   . MET A 1 29 ? 3.794   13.965  -2.625  1.00 0.70 ? 29 MET A CB   7  
ATOM   3240  C CG   . MET A 1 29 ? 3.764   12.577  -1.980  1.00 0.82 ? 29 MET A CG   7  
ATOM   3241  S SD   . MET A 1 29 ? 4.279   11.333  -3.193  1.00 0.90 ? 29 MET A SD   7  
ATOM   3242  C CE   . MET A 1 29 ? 6.036   11.296  -2.756  1.00 1.31 ? 29 MET A CE   7  
ATOM   3243  H H    . MET A 1 29 ? 4.461   15.227  -4.774  1.00 0.59 ? 29 MET A H    7  
ATOM   3244  H HA   . MET A 1 29 ? 2.633   12.953  -4.133  1.00 0.50 ? 29 MET A HA   7  
ATOM   3245  H HB2  . MET A 1 29 ? 4.814   14.225  -2.868  1.00 0.72 ? 29 MET A HB2  7  
ATOM   3246  H HB3  . MET A 1 29 ? 3.394   14.689  -1.932  1.00 0.89 ? 29 MET A HB3  7  
ATOM   3247  H HG2  . MET A 1 29 ? 4.438   12.558  -1.136  1.00 1.09 ? 29 MET A HG2  7  
ATOM   3248  H HG3  . MET A 1 29 ? 2.761   12.359  -1.644  1.00 0.87 ? 29 MET A HG3  7  
ATOM   3249  H HE1  . MET A 1 29 ? 6.138   11.227  -1.683  1.00 1.79 ? 29 MET A HE1  7  
ATOM   3250  H HE2  . MET A 1 29 ? 6.503   10.440  -3.224  1.00 1.73 ? 29 MET A HE2  7  
ATOM   3251  H HE3  . MET A 1 29 ? 6.513   12.198  -3.104  1.00 1.72 ? 29 MET A HE3  7  
ATOM   3252  N N    . ALA A 1 30 ? 1.071   14.873  -2.634  1.00 0.79 ? 30 ALA A N    7  
ATOM   3253  C CA   . ALA A 1 30 ? -0.133  15.744  -2.424  1.00 0.97 ? 30 ALA A CA   7  
ATOM   3254  C C    . ALA A 1 30 ? -1.212  15.444  -3.483  1.00 0.95 ? 30 ALA A C    7  
ATOM   3255  O O    . ALA A 1 30 ? -1.420  16.267  -4.364  1.00 1.12 ? 30 ALA A O    7  
ATOM   3256  C CB   . ALA A 1 30 ? 0.385   17.186  -2.535  1.00 1.18 ? 30 ALA A CB   7  
ATOM   3257  O OXT  . ALA A 1 30 ? -1.812  14.384  -3.395  1.00 0.92 ? 30 ALA A OXT  7  
ATOM   3258  H H    . ALA A 1 30 ? 1.368   14.284  -1.911  1.00 0.84 ? 30 ALA A H    7  
ATOM   3259  H HA   . ALA A 1 30 ? -0.536  15.580  -1.437  1.00 1.08 ? 30 ALA A HA   7  
ATOM   3260  H HB1  . ALA A 1 30 ? 1.261   17.301  -1.914  1.00 1.53 ? 30 ALA A HB1  7  
ATOM   3261  H HB2  . ALA A 1 30 ? 0.641   17.400  -3.562  1.00 1.54 ? 30 ALA A HB2  7  
ATOM   3262  H HB3  . ALA A 1 30 ? -0.382  17.871  -2.205  1.00 1.72 ? 30 ALA A HB3  7  
ATOM   3263  N N    . MET A 1 1  ? -9.894  4.240   4.962   1.00 3.65 ? 1  MET A N    8  
ATOM   3264  C CA   . MET A 1 1  ? -9.771  5.034   6.225   1.00 3.07 ? 1  MET A CA   8  
ATOM   3265  C C    . MET A 1 1  ? -8.319  5.017   6.727   1.00 2.58 ? 1  MET A C    8  
ATOM   3266  O O    . MET A 1 1  ? -7.484  4.302   6.206   1.00 2.74 ? 1  MET A O    8  
ATOM   3267  C CB   . MET A 1 1  ? -10.695 4.337   7.232   1.00 2.79 ? 1  MET A CB   8  
ATOM   3268  C CG   . MET A 1 1  ? -11.991 5.139   7.383   1.00 3.23 ? 1  MET A CG   8  
ATOM   3269  S SD   . MET A 1 1  ? -11.627 6.737   8.152   1.00 3.64 ? 1  MET A SD   8  
ATOM   3270  C CE   . MET A 1 1  ? -13.249 7.000   8.912   1.00 4.33 ? 1  MET A CE   8  
ATOM   3271  H H1   . MET A 1 1  ? -9.416  3.323   5.079   1.00 3.53 ? 1  MET A H1   8  
ATOM   3272  H H2   . MET A 1 1  ? -10.898 4.081   4.746   1.00 4.03 ? 1  MET A H2   8  
ATOM   3273  H H3   . MET A 1 1  ? -9.449  4.764   4.180   1.00 4.01 ? 1  MET A H3   8  
ATOM   3274  H HA   . MET A 1 1  ? -10.099 6.049   6.064   1.00 3.41 ? 1  MET A HA   8  
ATOM   3275  H HB2  . MET A 1 1  ? -10.926 3.342   6.881   1.00 2.93 ? 1  MET A HB2  8  
ATOM   3276  H HB3  . MET A 1 1  ? -10.201 4.274   8.190   1.00 2.44 ? 1  MET A HB3  8  
ATOM   3277  H HG2  . MET A 1 1  ? -12.432 5.300   6.410   1.00 3.73 ? 1  MET A HG2  8  
ATOM   3278  H HG3  . MET A 1 1  ? -12.683 4.589   8.005   1.00 3.14 ? 1  MET A HG3  8  
ATOM   3279  H HE1  . MET A 1 1  ? -14.019 6.615   8.264   1.00 4.71 ? 1  MET A HE1  8  
ATOM   3280  H HE2  . MET A 1 1  ? -13.289 6.485   9.861   1.00 4.65 ? 1  MET A HE2  8  
ATOM   3281  H HE3  . MET A 1 1  ? -13.407 8.059   9.064   1.00 4.52 ? 1  MET A HE3  8  
ATOM   3282  N N    . ILE A 1 2  ? -8.016  5.794   7.737   1.00 2.19 ? 2  ILE A N    8  
ATOM   3283  C CA   . ILE A 1 2  ? -6.618  5.819   8.280   1.00 1.75 ? 2  ILE A CA   8  
ATOM   3284  C C    . ILE A 1 2  ? -6.442  4.703   9.323   1.00 1.26 ? 2  ILE A C    8  
ATOM   3285  O O    . ILE A 1 2  ? -7.405  4.187   9.858   1.00 1.22 ? 2  ILE A O    8  
ATOM   3286  C CB   . ILE A 1 2  ? -6.453  7.204   8.928   1.00 1.85 ? 2  ILE A CB   8  
ATOM   3287  C CG1  . ILE A 1 2  ? -6.847  8.301   7.930   1.00 2.50 ? 2  ILE A CG1  8  
ATOM   3288  C CG2  . ILE A 1 2  ? -4.992  7.410   9.340   1.00 1.61 ? 2  ILE A CG2  8  
ATOM   3289  C CD1  . ILE A 1 2  ? -8.099  9.027   8.429   1.00 2.90 ? 2  ILE A CD1  8  
ATOM   3290  H H    . ILE A 1 2  ? -8.708  6.356   8.145   1.00 2.34 ? 2  ILE A H    8  
ATOM   3291  H HA   . ILE A 1 2  ? -5.904  5.699   7.480   1.00 2.00 ? 2  ILE A HA   8  
ATOM   3292  H HB   . ILE A 1 2  ? -7.083  7.267   9.804   1.00 1.90 ? 2  ILE A HB   8  
ATOM   3293  H HG12 . ILE A 1 2  ? -6.035  9.008   7.834   1.00 2.57 ? 2  ILE A HG12 8  
ATOM   3294  H HG13 . ILE A 1 2  ? -7.051  7.857   6.967   1.00 2.81 ? 2  ILE A HG13 8  
ATOM   3295  H HG21 . ILE A 1 2  ? -4.343  6.954   8.606   1.00 1.71 ? 2  ILE A HG21 8  
ATOM   3296  H HG22 . ILE A 1 2  ? -4.780  8.467   9.399   1.00 2.02 ? 2  ILE A HG22 8  
ATOM   3297  H HG23 . ILE A 1 2  ? -4.820  6.955   10.303  1.00 1.68 ? 2  ILE A HG23 8  
ATOM   3298  H HD11 . ILE A 1 2  ? -8.260  8.794   9.472   1.00 3.19 ? 2  ILE A HD11 8  
ATOM   3299  H HD12 . ILE A 1 2  ? -7.967  10.092  8.315   1.00 3.21 ? 2  ILE A HD12 8  
ATOM   3300  H HD13 . ILE A 1 2  ? -8.955  8.706   7.853   1.00 3.16 ? 2  ILE A HD13 8  
ATOM   3301  N N    . SER A 1 3  ? -5.221  4.325   9.612   1.00 1.28 ? 3  SER A N    8  
ATOM   3302  C CA   . SER A 1 3  ? -4.987  3.235   10.617  1.00 1.39 ? 3  SER A CA   8  
ATOM   3303  C C    . SER A 1 3  ? -4.862  3.798   12.046  1.00 1.19 ? 3  SER A C    8  
ATOM   3304  O O    . SER A 1 3  ? -4.454  3.091   12.950  1.00 1.52 ? 3  SER A O    8  
ATOM   3305  C CB   . SER A 1 3  ? -3.676  2.572   10.189  1.00 1.83 ? 3  SER A CB   8  
ATOM   3306  O OG   . SER A 1 3  ? -3.571  1.296   10.810  1.00 2.22 ? 3  SER A OG   8  
ATOM   3307  H H    . SER A 1 3  ? -4.459  4.753   9.167   1.00 1.52 ? 3  SER A H    8  
ATOM   3308  H HA   . SER A 1 3  ? -5.787  2.513   10.574  1.00 1.67 ? 3  SER A HA   8  
ATOM   3309  H HB2  . SER A 1 3  ? -3.665  2.448   9.119   1.00 2.08 ? 3  SER A HB2  8  
ATOM   3310  H HB3  . SER A 1 3  ? -2.844  3.198   10.485  1.00 1.88 ? 3  SER A HB3  8  
ATOM   3311  H HG   . SER A 1 3  ? -3.532  1.427   11.762  1.00 2.54 ? 3  SER A HG   8  
ATOM   3312  N N    . SER A 1 4  ? -5.208  5.054   12.257  1.00 0.96 ? 4  SER A N    8  
ATOM   3313  C CA   . SER A 1 4  ? -5.121  5.679   13.626  1.00 1.19 ? 4  SER A CA   8  
ATOM   3314  C C    . SER A 1 4  ? -3.663  5.866   14.073  1.00 1.34 ? 4  SER A C    8  
ATOM   3315  O O    . SER A 1 4  ? -3.260  6.948   14.455  1.00 1.60 ? 4  SER A O    8  
ATOM   3316  C CB   . SER A 1 4  ? -5.863  4.728   14.572  1.00 1.51 ? 4  SER A CB   8  
ATOM   3317  O OG   . SER A 1 4  ? -6.740  5.483   15.397  1.00 1.70 ? 4  SER A OG   8  
ATOM   3318  H H    . SER A 1 4  ? -5.532  5.593   11.512  1.00 0.91 ? 4  SER A H    8  
ATOM   3319  H HA   . SER A 1 4  ? -5.617  6.633   13.621  1.00 1.24 ? 4  SER A HA   8  
ATOM   3320  H HB2  . SER A 1 4  ? -6.437  4.019   13.998  1.00 1.47 ? 4  SER A HB2  8  
ATOM   3321  H HB3  . SER A 1 4  ? -5.145  4.194   15.183  1.00 1.81 ? 4  SER A HB3  8  
ATOM   3322  H HG   . SER A 1 4  ? -7.153  4.882   16.021  1.00 2.08 ? 4  SER A HG   8  
ATOM   3323  N N    . VAL A 1 5  ? -2.872  4.825   14.032  1.00 1.31 ? 5  VAL A N    8  
ATOM   3324  C CA   . VAL A 1 5  ? -1.441  4.940   14.458  1.00 1.56 ? 5  VAL A CA   8  
ATOM   3325  C C    . VAL A 1 5  ? -0.567  5.485   13.317  1.00 1.47 ? 5  VAL A C    8  
ATOM   3326  O O    . VAL A 1 5  ? 0.501   6.020   13.548  1.00 1.67 ? 5  VAL A O    8  
ATOM   3327  C CB   . VAL A 1 5  ? -1.025  3.512   14.842  1.00 1.71 ? 5  VAL A CB   8  
ATOM   3328  C CG1  . VAL A 1 5  ? -0.799  2.666   13.584  1.00 1.58 ? 5  VAL A CG1  8  
ATOM   3329  C CG2  . VAL A 1 5  ? 0.269   3.559   15.658  1.00 2.07 ? 5  VAL A CG2  8  
ATOM   3330  H H    . VAL A 1 5  ? -3.224  3.965   13.723  1.00 1.19 ? 5  VAL A H    8  
ATOM   3331  H HA   . VAL A 1 5  ? -1.363  5.583   15.316  1.00 1.76 ? 5  VAL A HA   8  
ATOM   3332  H HB   . VAL A 1 5  ? -1.807  3.062   15.436  1.00 1.73 ? 5  VAL A HB   8  
ATOM   3333  H HG11 . VAL A 1 5  ? -1.617  2.818   12.895  1.00 1.72 ? 5  VAL A HG11 8  
ATOM   3334  H HG12 . VAL A 1 5  ? 0.127   2.961   13.113  1.00 1.76 ? 5  VAL A HG12 8  
ATOM   3335  H HG13 . VAL A 1 5  ? -0.747  1.623   13.856  1.00 1.90 ? 5  VAL A HG13 8  
ATOM   3336  H HG21 . VAL A 1 5  ? 1.027   4.091   15.101  1.00 2.42 ? 5  VAL A HG21 8  
ATOM   3337  H HG22 . VAL A 1 5  ? 0.087   4.068   16.593  1.00 2.42 ? 5  VAL A HG22 8  
ATOM   3338  H HG23 . VAL A 1 5  ? 0.607   2.553   15.856  1.00 2.31 ? 5  VAL A HG23 8  
ATOM   3339  N N    . CYS A 1 6  ? -1.016  5.359   12.095  1.00 1.22 ? 6  CYS A N    8  
ATOM   3340  C CA   . CYS A 1 6  ? -0.221  5.876   10.942  1.00 1.16 ? 6  CYS A CA   8  
ATOM   3341  C C    . CYS A 1 6  ? -0.867  7.154   10.390  1.00 1.07 ? 6  CYS A C    8  
ATOM   3342  O O    . CYS A 1 6  ? -2.047  7.394   10.571  1.00 1.11 ? 6  CYS A O    8  
ATOM   3343  C CB   . CYS A 1 6  ? -0.239  4.748   9.902   1.00 1.13 ? 6  CYS A CB   8  
ATOM   3344  S SG   . CYS A 1 6  ? -1.717  4.880   8.860   1.00 1.01 ? 6  CYS A SG   8  
ATOM   3345  H H    . CYS A 1 6  ? -1.878  4.933   11.939  1.00 1.11 ? 6  CYS A H    8  
ATOM   3346  H HA   . CYS A 1 6  ? 0.794   6.075   11.248  1.00 1.29 ? 6  CYS A HA   8  
ATOM   3347  H HB2  . CYS A 1 6  ? 0.641   4.821   9.281   1.00 1.16 ? 6  CYS A HB2  8  
ATOM   3348  H HB3  . CYS A 1 6  ? -0.241  3.793   10.408  1.00 1.27 ? 6  CYS A HB3  8  
ATOM   3349  H HG   . CYS A 1 6  ? -1.530  5.506   8.158   1.00 1.40 ? 6  CYS A HG   8  
ATOM   3350  N N    . VAL A 1 7  ? -0.101  7.969   9.719   1.00 1.01 ? 7  VAL A N    8  
ATOM   3351  C CA   . VAL A 1 7  ? -0.657  9.233   9.149   1.00 1.01 ? 7  VAL A CA   8  
ATOM   3352  C C    . VAL A 1 7  ? -1.104  9.004   7.701   1.00 0.82 ? 7  VAL A C    8  
ATOM   3353  O O    . VAL A 1 7  ? -0.788  8.000   7.089   1.00 0.73 ? 7  VAL A O    8  
ATOM   3354  C CB   . VAL A 1 7  ? 0.495   10.249  9.203   1.00 1.18 ? 7  VAL A CB   8  
ATOM   3355  C CG1  . VAL A 1 7  ? -0.044  11.654  8.922   1.00 1.34 ? 7  VAL A CG1  8  
ATOM   3356  C CG2  . VAL A 1 7  ? 1.144   10.233  10.591  1.00 1.34 ? 7  VAL A CG2  8  
ATOM   3357  H H    . VAL A 1 7  ? 0.840   7.752   9.586   1.00 1.04 ? 7  VAL A H    8  
ATOM   3358  H HA   . VAL A 1 7  ? -1.483  9.581   9.747   1.00 1.10 ? 7  VAL A HA   8  
ATOM   3359  H HB   . VAL A 1 7  ? 1.232   9.994   8.456   1.00 1.13 ? 7  VAL A HB   8  
ATOM   3360  H HG11 . VAL A 1 7  ? -1.011  11.770  9.392   1.00 1.42 ? 7  VAL A HG11 8  
ATOM   3361  H HG12 . VAL A 1 7  ? 0.640   12.388  9.323   1.00 1.83 ? 7  VAL A HG12 8  
ATOM   3362  H HG13 . VAL A 1 7  ? -0.141  11.797  7.857   1.00 1.62 ? 7  VAL A HG13 8  
ATOM   3363  H HG21 . VAL A 1 7  ? 0.395   10.012  11.337  1.00 1.38 ? 7  VAL A HG21 8  
ATOM   3364  H HG22 . VAL A 1 7  ? 1.915   9.478   10.620  1.00 1.37 ? 7  VAL A HG22 8  
ATOM   3365  H HG23 . VAL A 1 7  ? 1.580   11.200  10.796  1.00 1.48 ? 7  VAL A HG23 8  
HETATM 3366  N N    . SEP A 1 8  ? -1.837  9.937   7.154   1.00 0.86 ? 8  SEP A N    8  
HETATM 3367  C CA   . SEP A 1 8  ? -2.319  9.802   5.742   1.00 0.75 ? 8  SEP A CA   8  
HETATM 3368  C CB   . SEP A 1 8  ? -3.107  11.082  5.466   1.00 0.89 ? 8  SEP A CB   8  
HETATM 3369  O OG   . SEP A 1 8  ? -4.420  10.959  6.025   1.00 0.97 ? 8  SEP A OG   8  
HETATM 3370  C C    . SEP A 1 8  ? -1.136  9.684   4.773   1.00 0.73 ? 8  SEP A C    8  
HETATM 3371  O O    . SEP A 1 8  ? -1.183  8.934   3.817   1.00 0.70 ? 8  SEP A O    8  
HETATM 3372  P P    . SEP A 1 8  ? -5.651  11.800  5.418   1.00 1.80 ? 8  SEP A P    8  
HETATM 3373  O O1P  . SEP A 1 8  ? -5.370  13.240  5.615   1.00 2.63 ? 8  SEP A O1P  8  
HETATM 3374  O O2P  . SEP A 1 8  ? -5.939  11.283  4.062   1.00 2.62 ? 8  SEP A O2P  8  
HETATM 3375  O O3P  . SEP A 1 8  ? -6.869  11.386  6.384   1.00 2.14 ? 8  SEP A O3P  8  
HETATM 3376  H H    . SEP A 1 8  ? -2.068  10.730  7.676   1.00 1.00 ? 8  SEP A H    8  
HETATM 3377  H HA   . SEP A 1 8  ? -2.963  8.947   5.646   1.00 0.72 ? 8  SEP A HA   8  
HETATM 3378  H HB2  . SEP A 1 8  ? -3.171  11.240  4.398   1.00 0.90 ? 8  SEP A HB2  8  
HETATM 3379  H HB3  . SEP A 1 8  ? -2.606  11.922  5.920   1.00 1.02 ? 8  SEP A HB3  8  
HETATM 3380  H HOP3 . SEP A 1 8  ? -6.989  10.439  6.298   1.00 2.33 ? 8  SEP A HOP3 8  
ATOM   3381  N N    . SER A 1 9  ? -0.078  10.419  5.024   1.00 0.85 ? 9  SER A N    8  
ATOM   3382  C CA   . SER A 1 9  ? 1.131   10.372  4.142   1.00 0.94 ? 9  SER A CA   8  
ATOM   3383  C C    . SER A 1 9  ? 0.769   10.741  2.697   1.00 0.90 ? 9  SER A C    8  
ATOM   3384  O O    . SER A 1 9  ? -0.299  11.255  2.420   1.00 0.92 ? 9  SER A O    8  
ATOM   3385  C CB   . SER A 1 9  ? 1.637   8.929   4.226   1.00 0.96 ? 9  SER A CB   8  
ATOM   3386  O OG   . SER A 1 9  ? 1.843   8.577   5.590   1.00 1.42 ? 9  SER A OG   8  
ATOM   3387  H H    . SER A 1 9  ? -0.076  11.003  5.800   1.00 0.93 ? 9  SER A H    8  
ATOM   3388  H HA   . SER A 1 9  ? 1.888   11.043  4.514   1.00 1.08 ? 9  SER A HA   8  
ATOM   3389  H HB2  . SER A 1 9  ? 0.909   8.264   3.792   1.00 0.93 ? 9  SER A HB2  8  
ATOM   3390  H HB3  . SER A 1 9  ? 2.567   8.845   3.679   1.00 1.09 ? 9  SER A HB3  8  
ATOM   3391  H HG   . SER A 1 9  ? 1.048   8.139   5.909   1.00 1.71 ? 9  SER A HG   8  
ATOM   3392  N N    . TYR A 1 10 ? 1.664   10.486  1.782   1.00 0.90 ? 10 TYR A N    8  
ATOM   3393  C CA   . TYR A 1 10 ? 1.403   10.816  0.343   1.00 0.91 ? 10 TYR A CA   8  
ATOM   3394  C C    . TYR A 1 10 ? 0.323   9.890   -0.254  1.00 0.85 ? 10 TYR A C    8  
ATOM   3395  O O    . TYR A 1 10 ? -0.274  9.087   0.437   1.00 0.87 ? 10 TYR A O    8  
ATOM   3396  C CB   . TYR A 1 10 ? 2.762   10.646  -0.363  1.00 0.97 ? 10 TYR A CB   8  
ATOM   3397  C CG   . TYR A 1 10 ? 3.141   9.186   -0.534  1.00 0.90 ? 10 TYR A CG   8  
ATOM   3398  C CD1  . TYR A 1 10 ? 2.647   8.195   0.329   1.00 0.93 ? 10 TYR A CD1  8  
ATOM   3399  C CD2  . TYR A 1 10 ? 4.015   8.835   -1.566  1.00 0.88 ? 10 TYR A CD2  8  
ATOM   3400  C CE1  . TYR A 1 10 ? 3.028   6.862   0.152   1.00 0.92 ? 10 TYR A CE1  8  
ATOM   3401  C CE2  . TYR A 1 10 ? 4.397   7.502   -1.741  1.00 0.89 ? 10 TYR A CE2  8  
ATOM   3402  C CZ   . TYR A 1 10 ? 3.903   6.514   -0.883  1.00 0.90 ? 10 TYR A CZ   8  
ATOM   3403  O OH   . TYR A 1 10 ? 4.281   5.200   -1.054  1.00 0.96 ? 10 TYR A OH   8  
ATOM   3404  H H    . TYR A 1 10 ? 2.516   10.084  2.046   1.00 0.94 ? 10 TYR A H    8  
ATOM   3405  H HA   . TYR A 1 10 ? 1.086   11.841  0.259   1.00 0.94 ? 10 TYR A HA   8  
ATOM   3406  H HB2  . TYR A 1 10 ? 2.711   11.107  -1.337  1.00 1.06 ? 10 TYR A HB2  8  
ATOM   3407  H HB3  . TYR A 1 10 ? 3.524   11.140  0.221   1.00 1.05 ? 10 TYR A HB3  8  
ATOM   3408  H HD1  . TYR A 1 10 ? 1.969   8.459   1.128   1.00 1.01 ? 10 TYR A HD1  8  
ATOM   3409  H HD2  . TYR A 1 10 ? 4.396   9.596   -2.230  1.00 0.92 ? 10 TYR A HD2  8  
ATOM   3410  H HE1  . TYR A 1 10 ? 2.645   6.101   0.813   1.00 1.00 ? 10 TYR A HE1  8  
ATOM   3411  H HE2  . TYR A 1 10 ? 5.071   7.235   -2.540  1.00 0.94 ? 10 TYR A HE2  8  
ATOM   3412  H HH   . TYR A 1 10 ? 4.799   4.939   -0.290  1.00 1.26 ? 10 TYR A HH   8  
ATOM   3413  N N    . ARG A 1 11 ? 0.060   10.016  -1.533  1.00 0.85 ? 11 ARG A N    8  
ATOM   3414  C CA   . ARG A 1 11 ? -0.993  9.172   -2.189  1.00 0.83 ? 11 ARG A CA   8  
ATOM   3415  C C    . ARG A 1 11 ? -0.713  7.672   -2.027  1.00 0.89 ? 11 ARG A C    8  
ATOM   3416  O O    . ARG A 1 11 ? -1.620  6.881   -1.849  1.00 1.01 ? 11 ARG A O    8  
ATOM   3417  C CB   . ARG A 1 11 ? -0.947  9.567   -3.668  1.00 0.86 ? 11 ARG A CB   8  
ATOM   3418  C CG   . ARG A 1 11 ? -2.078  10.554  -3.968  1.00 0.82 ? 11 ARG A CG   8  
ATOM   3419  C CD   . ARG A 1 11 ? -3.158  9.861   -4.805  1.00 0.89 ? 11 ARG A CD   8  
ATOM   3420  N NE   . ARG A 1 11 ? -4.453  10.342  -4.240  1.00 0.98 ? 11 ARG A NE   8  
ATOM   3421  C CZ   . ARG A 1 11 ? -5.550  9.680   -4.465  1.00 1.07 ? 11 ARG A CZ   8  
ATOM   3422  N NH1  . ARG A 1 11 ? -5.912  8.731   -3.653  1.00 1.18 ? 11 ARG A NH1  8  
ATOM   3423  N NH2  . ARG A 1 11 ? -6.285  9.973   -5.499  1.00 1.20 ? 11 ARG A NH2  8  
ATOM   3424  H H    . ARG A 1 11 ? 0.547   10.682  -2.063  1.00 0.88 ? 11 ARG A H    8  
ATOM   3425  H HA   . ARG A 1 11 ? -1.955  9.404   -1.786  1.00 0.82 ? 11 ARG A HA   8  
ATOM   3426  H HB2  . ARG A 1 11 ? 0.004   10.030  -3.889  1.00 0.90 ? 11 ARG A HB2  8  
ATOM   3427  H HB3  . ARG A 1 11 ? -1.068  8.687   -4.279  1.00 0.94 ? 11 ARG A HB3  8  
ATOM   3428  H HG2  . ARG A 1 11 ? -2.507  10.902  -3.039  1.00 0.85 ? 11 ARG A HG2  8  
ATOM   3429  H HG3  . ARG A 1 11 ? -1.685  11.396  -4.519  1.00 0.84 ? 11 ARG A HG3  8  
ATOM   3430  H HD2  . ARG A 1 11 ? -3.068  10.149  -5.844  1.00 1.08 ? 11 ARG A HD2  8  
ATOM   3431  H HD3  . ARG A 1 11 ? -3.085  8.789   -4.702  1.00 1.00 ? 11 ARG A HD3  8  
ATOM   3432  H HE   . ARG A 1 11 ? -4.481  11.159  -3.697  1.00 1.22 ? 11 ARG A HE   8  
ATOM   3433  H HH11 . ARG A 1 11 ? -5.345  8.508   -2.862  1.00 1.16 ? 11 ARG A HH11 8  
ATOM   3434  H HH12 . ARG A 1 11 ? -6.764  8.229   -3.817  1.00 1.36 ? 11 ARG A HH12 8  
ATOM   3435  H HH21 . ARG A 1 11 ? -6.003  10.702  -6.120  1.00 1.22 ? 11 ARG A HH21 8  
ATOM   3436  H HH22 . ARG A 1 11 ? -7.137  9.475   -5.666  1.00 1.37 ? 11 ARG A HH22 8  
ATOM   3437  N N    . GLY A 1 12 ? 0.527   7.279   -2.104  1.00 0.86 ? 12 GLY A N    8  
ATOM   3438  C CA   . GLY A 1 12 ? 0.877   5.829   -1.977  1.00 0.92 ? 12 GLY A CA   8  
ATOM   3439  C C    . GLY A 1 12 ? 1.855   5.442   -3.092  1.00 0.83 ? 12 GLY A C    8  
ATOM   3440  O O    . GLY A 1 12 ? 2.354   4.335   -3.138  1.00 0.92 ? 12 GLY A O    8  
ATOM   3441  H H    . GLY A 1 12 ? 1.233   7.938   -2.262  1.00 0.84 ? 12 GLY A H    8  
ATOM   3442  H HA2  . GLY A 1 12 ? 1.335   5.652   -1.016  1.00 0.98 ? 12 GLY A HA2  8  
ATOM   3443  H HA3  . GLY A 1 12 ? -0.018  5.233   -2.066  1.00 0.98 ? 12 GLY A HA3  8  
ATOM   3444  N N    . ARG A 1 13 ? 2.120   6.354   -3.993  1.00 0.71 ? 13 ARG A N    8  
ATOM   3445  C CA   . ARG A 1 13 ? 3.052   6.081   -5.118  1.00 0.64 ? 13 ARG A CA   8  
ATOM   3446  C C    . ARG A 1 13 ? 4.505   5.983   -4.617  1.00 0.64 ? 13 ARG A C    8  
ATOM   3447  O O    . ARG A 1 13 ? 5.278   6.919   -4.703  1.00 0.60 ? 13 ARG A O    8  
ATOM   3448  C CB   . ARG A 1 13 ? 2.853   7.275   -6.060  1.00 0.57 ? 13 ARG A CB   8  
ATOM   3449  C CG   . ARG A 1 13 ? 3.236   8.588   -5.356  1.00 0.56 ? 13 ARG A CG   8  
ATOM   3450  C CD   . ARG A 1 13 ? 4.329   9.298   -6.156  1.00 0.54 ? 13 ARG A CD   8  
ATOM   3451  N NE   . ARG A 1 13 ? 3.651   9.770   -7.400  1.00 0.53 ? 13 ARG A NE   8  
ATOM   3452  C CZ   . ARG A 1 13 ? 4.350   10.208  -8.403  1.00 0.50 ? 13 ARG A CZ   8  
ATOM   3453  N NH1  . ARG A 1 13 ? 5.283   9.465   -8.925  1.00 0.59 ? 13 ARG A NH1  8  
ATOM   3454  N NH2  . ARG A 1 13 ? 4.109   11.390  -8.887  1.00 0.53 ? 13 ARG A NH2  8  
ATOM   3455  H H    . ARG A 1 13 ? 1.695   7.228   -3.932  1.00 0.71 ? 13 ARG A H    8  
ATOM   3456  H HA   . ARG A 1 13 ? 2.772   5.171   -5.619  1.00 0.67 ? 13 ARG A HA   8  
ATOM   3457  H HB2  . ARG A 1 13 ? 3.464   7.147   -6.932  1.00 0.57 ? 13 ARG A HB2  8  
ATOM   3458  H HB3  . ARG A 1 13 ? 1.814   7.324   -6.351  1.00 0.60 ? 13 ARG A HB3  8  
ATOM   3459  H HG2  . ARG A 1 13 ? 2.365   9.225   -5.289  1.00 0.61 ? 13 ARG A HG2  8  
ATOM   3460  H HG3  . ARG A 1 13 ? 3.602   8.372   -4.363  1.00 0.61 ? 13 ARG A HG3  8  
ATOM   3461  H HD2  . ARG A 1 13 ? 4.719   10.138  -5.594  1.00 0.61 ? 13 ARG A HD2  8  
ATOM   3462  H HD3  . ARG A 1 13 ? 5.123   8.610   -6.405  1.00 0.54 ? 13 ARG A HD3  8  
ATOM   3463  H HE   . ARG A 1 13 ? 2.668   9.762   -7.458  1.00 0.65 ? 13 ARG A HE   8  
ATOM   3464  H HH11 . ARG A 1 13 ? 5.463   8.556   -8.553  1.00 0.66 ? 13 ARG A HH11 8  
ATOM   3465  H HH12 . ARG A 1 13 ? 5.820   9.806   -9.700  1.00 0.67 ? 13 ARG A HH12 8  
ATOM   3466  H HH21 . ARG A 1 13 ? 3.383   11.955  -8.484  1.00 0.56 ? 13 ARG A HH21 8  
ATOM   3467  H HH22 . ARG A 1 13 ? 4.645   11.735  -9.656  1.00 0.62 ? 13 ARG A HH22 8  
ATOM   3468  N N    . LYS A 1 14 ? 4.871   4.848   -4.083  1.00 0.73 ? 14 LYS A N    8  
ATOM   3469  C CA   . LYS A 1 14 ? 6.264   4.657   -3.556  1.00 0.77 ? 14 LYS A CA   8  
ATOM   3470  C C    . LYS A 1 14 ? 7.298   4.585   -4.698  1.00 0.72 ? 14 LYS A C    8  
ATOM   3471  O O    . LYS A 1 14 ? 8.044   3.627   -4.815  1.00 0.78 ? 14 LYS A O    8  
ATOM   3472  C CB   . LYS A 1 14 ? 6.224   3.334   -2.767  1.00 0.93 ? 14 LYS A CB   8  
ATOM   3473  C CG   . LYS A 1 14 ? 5.594   2.203   -3.609  1.00 0.94 ? 14 LYS A CG   8  
ATOM   3474  C CD   . LYS A 1 14 ? 6.668   1.218   -4.095  1.00 1.00 ? 14 LYS A CD   8  
ATOM   3475  C CE   . LYS A 1 14 ? 7.612   0.838   -2.946  1.00 1.28 ? 14 LYS A CE   8  
ATOM   3476  N NZ   . LYS A 1 14 ? 8.924   1.459   -3.301  1.00 1.22 ? 14 LYS A NZ   8  
ATOM   3477  H H    . LYS A 1 14 ? 4.223   4.120   -4.019  1.00 0.78 ? 14 LYS A H    8  
ATOM   3478  H HA   . LYS A 1 14 ? 6.517   5.465   -2.888  1.00 0.76 ? 14 LYS A HA   8  
ATOM   3479  H HB2  . LYS A 1 14 ? 7.226   3.058   -2.493  1.00 0.99 ? 14 LYS A HB2  8  
ATOM   3480  H HB3  . LYS A 1 14 ? 5.637   3.475   -1.871  1.00 1.01 ? 14 LYS A HB3  8  
ATOM   3481  H HG2  . LYS A 1 14 ? 4.872   1.671   -3.006  1.00 1.16 ? 14 LYS A HG2  8  
ATOM   3482  H HG3  . LYS A 1 14 ? 5.095   2.628   -4.466  1.00 0.87 ? 14 LYS A HG3  8  
ATOM   3483  H HD2  . LYS A 1 14 ? 6.185   0.326   -4.468  1.00 1.13 ? 14 LYS A HD2  8  
ATOM   3484  H HD3  . LYS A 1 14 ? 7.236   1.673   -4.891  1.00 0.89 ? 14 LYS A HD3  8  
ATOM   3485  H HE2  . LYS A 1 14 ? 7.243   1.237   -2.009  1.00 1.43 ? 14 LYS A HE2  8  
ATOM   3486  H HE3  . LYS A 1 14 ? 7.714   -0.234  -2.882  1.00 1.53 ? 14 LYS A HE3  8  
ATOM   3487  H HZ1  . LYS A 1 14 ? 8.763   2.380   -3.763  1.00 1.00 ? 14 LYS A HZ1  8  
ATOM   3488  H HZ2  . LYS A 1 14 ? 9.486   1.598   -2.436  1.00 1.44 ? 14 LYS A HZ2  8  
ATOM   3489  H HZ3  . LYS A 1 14 ? 9.439   0.833   -3.951  1.00 1.38 ? 14 LYS A HZ3  8  
ATOM   3490  N N    . SER A 1 15 ? 7.366   5.599   -5.526  1.00 0.64 ? 15 SER A N    8  
ATOM   3491  C CA   . SER A 1 15 ? 8.358   5.601   -6.647  1.00 0.63 ? 15 SER A CA   8  
ATOM   3492  C C    . SER A 1 15 ? 9.756   5.967   -6.122  1.00 0.64 ? 15 SER A C    8  
ATOM   3493  O O    . SER A 1 15 ? 10.308  7.001   -6.451  1.00 0.71 ? 15 SER A O    8  
ATOM   3494  C CB   . SER A 1 15 ? 7.850   6.656   -7.641  1.00 0.66 ? 15 SER A CB   8  
ATOM   3495  O OG   . SER A 1 15 ? 7.281   7.756   -6.936  1.00 0.60 ? 15 SER A OG   8  
ATOM   3496  H H    . SER A 1 15 ? 6.769   6.370   -5.403  1.00 0.61 ? 15 SER A H    8  
ATOM   3497  H HA   . SER A 1 15 ? 8.382   4.633   -7.123  1.00 0.69 ? 15 SER A HA   8  
ATOM   3498  H HB2  . SER A 1 15 ? 8.671   7.009   -8.240  1.00 0.73 ? 15 SER A HB2  8  
ATOM   3499  H HB3  . SER A 1 15 ? 7.106   6.207   -8.288  1.00 0.78 ? 15 SER A HB3  8  
ATOM   3500  H HG   . SER A 1 15 ? 7.994   8.368   -6.707  1.00 0.62 ? 15 SER A HG   8  
ATOM   3501  N N    . GLY A 1 16 ? 10.333  5.116   -5.309  1.00 0.71 ? 16 GLY A N    8  
ATOM   3502  C CA   . GLY A 1 16 ? 11.694  5.394   -4.757  1.00 0.80 ? 16 GLY A CA   8  
ATOM   3503  C C    . GLY A 1 16 ? 12.725  4.517   -5.469  1.00 0.80 ? 16 GLY A C    8  
ATOM   3504  O O    . GLY A 1 16 ? 13.394  3.709   -4.856  1.00 0.93 ? 16 GLY A O    8  
ATOM   3505  H H    . GLY A 1 16 ? 9.868   4.288   -5.064  1.00 0.79 ? 16 GLY A H    8  
ATOM   3506  H HA2  . GLY A 1 16 ? 11.939  6.436   -4.909  1.00 0.81 ? 16 GLY A HA2  8  
ATOM   3507  H HA3  . GLY A 1 16 ? 11.707  5.172   -3.700  1.00 0.90 ? 16 GLY A HA3  8  
ATOM   3508  N N    . ASN A 1 17 ? 12.856  4.674   -6.762  1.00 0.72 ? 17 ASN A N    8  
ATOM   3509  C CA   . ASN A 1 17 ? 13.843  3.855   -7.532  1.00 0.78 ? 17 ASN A CA   8  
ATOM   3510  C C    . ASN A 1 17 ? 15.104  4.679   -7.835  1.00 0.75 ? 17 ASN A C    8  
ATOM   3511  O O    . ASN A 1 17 ? 15.277  5.773   -7.329  1.00 0.81 ? 17 ASN A O    8  
ATOM   3512  C CB   . ASN A 1 17 ? 13.113  3.463   -8.829  1.00 0.81 ? 17 ASN A CB   8  
ATOM   3513  C CG   . ASN A 1 17 ? 12.774  4.710   -9.657  1.00 0.76 ? 17 ASN A CG   8  
ATOM   3514  O OD1  . ASN A 1 17 ? 12.522  5.770   -9.120  1.00 0.96 ? 17 ASN A OD1  8  
ATOM   3515  N ND2  . ASN A 1 17 ? 12.749  4.627   -10.957 1.00 0.91 ? 17 ASN A ND2  8  
ATOM   3516  H H    . ASN A 1 17 ? 12.301  5.335   -7.229  1.00 0.68 ? 17 ASN A H    8  
ATOM   3517  H HA   . ASN A 1 17 ? 14.104  2.966   -6.978  1.00 0.94 ? 17 ASN A HA   8  
ATOM   3518  H HB2  . ASN A 1 17 ? 13.746  2.811   -9.410  1.00 0.92 ? 17 ASN A HB2  8  
ATOM   3519  H HB3  . ASN A 1 17 ? 12.201  2.943   -8.579  1.00 0.92 ? 17 ASN A HB3  8  
ATOM   3520  H HD21 . ASN A 1 17 ? 12.943  3.775   -11.400 1.00 1.13 ? 17 ASN A HD21 8  
ATOM   3521  H HD22 . ASN A 1 17 ? 12.536  5.420   -11.493 1.00 1.00 ? 17 ASN A HD22 8  
ATOM   3522  N N    . LYS A 1 18 ? 15.987  4.164   -8.656  1.00 0.78 ? 18 LYS A N    8  
ATOM   3523  C CA   . LYS A 1 18 ? 17.236  4.922   -8.987  1.00 0.80 ? 18 LYS A CA   8  
ATOM   3524  C C    . LYS A 1 18 ? 16.923  6.136   -9.885  1.00 0.75 ? 18 LYS A C    8  
ATOM   3525  O O    . LYS A 1 18 ? 17.574  7.159   -9.765  1.00 0.91 ? 18 LYS A O    8  
ATOM   3526  C CB   . LYS A 1 18 ? 18.148  3.923   -9.711  1.00 0.88 ? 18 LYS A CB   8  
ATOM   3527  C CG   . LYS A 1 18 ? 19.448  3.755   -8.922  1.00 1.10 ? 18 LYS A CG   8  
ATOM   3528  C CD   . LYS A 1 18 ? 20.429  4.870   -9.303  1.00 1.16 ? 18 LYS A CD   8  
ATOM   3529  C CE   . LYS A 1 18 ? 20.404  5.972   -8.237  1.00 1.32 ? 18 LYS A CE   8  
ATOM   3530  N NZ   . LYS A 1 18 ? 20.135  7.235   -8.987  1.00 1.44 ? 18 LYS A NZ   8  
ATOM   3531  H H    . LYS A 1 18 ? 15.830  3.280   -9.050  1.00 0.88 ? 18 LYS A H    8  
ATOM   3532  H HA   . LYS A 1 18 ? 17.714  5.254   -8.079  1.00 0.92 ? 18 LYS A HA   8  
ATOM   3533  H HB2  . LYS A 1 18 ? 17.650  2.969   -9.791  1.00 0.93 ? 18 LYS A HB2  8  
ATOM   3534  H HB3  . LYS A 1 18 ? 18.376  4.293   -10.699 1.00 0.84 ? 18 LYS A HB3  8  
ATOM   3535  H HG2  . LYS A 1 18 ? 19.235  3.805   -7.864  1.00 1.20 ? 18 LYS A HG2  8  
ATOM   3536  H HG3  . LYS A 1 18 ? 19.887  2.797   -9.155  1.00 1.26 ? 18 LYS A HG3  8  
ATOM   3537  H HD2  . LYS A 1 18 ? 21.428  4.460   -9.374  1.00 1.38 ? 18 LYS A HD2  8  
ATOM   3538  H HD3  . LYS A 1 18 ? 20.145  5.288   -10.258 1.00 1.11 ? 18 LYS A HD3  8  
ATOM   3539  H HE2  . LYS A 1 18 ? 19.615  5.781   -7.521  1.00 1.44 ? 18 LYS A HE2  8  
ATOM   3540  H HE3  . LYS A 1 18 ? 21.360  6.034   -7.739  1.00 1.58 ? 18 LYS A HE3  8  
ATOM   3541  H HZ1  . LYS A 1 18 ? 20.822  7.335   -9.762  1.00 1.68 ? 18 LYS A HZ1  8  
ATOM   3542  H HZ2  . LYS A 1 18 ? 19.170  7.210   -9.383  1.00 1.64 ? 18 LYS A HZ2  8  
ATOM   3543  H HZ3  . LYS A 1 18 ? 20.224  8.046   -8.340  1.00 1.74 ? 18 LYS A HZ3  8  
ATOM   3544  N N    . PRO A 1 19 ? 15.926  5.997   -10.743 1.00 0.71 ? 19 PRO A N    8  
ATOM   3545  C CA   . PRO A 1 19 ? 15.571  7.157   -11.614 1.00 0.86 ? 19 PRO A CA   8  
ATOM   3546  C C    . PRO A 1 19 ? 14.144  7.649   -11.299 1.00 0.86 ? 19 PRO A C    8  
ATOM   3547  O O    . PRO A 1 19 ? 13.214  7.368   -12.036 1.00 0.98 ? 19 PRO A O    8  
ATOM   3548  C CB   . PRO A 1 19 ? 15.651  6.600   -13.032 1.00 1.01 ? 19 PRO A CB   8  
ATOM   3549  C CG   . PRO A 1 19 ? 15.412  5.135   -12.890 1.00 0.96 ? 19 PRO A CG   8  
ATOM   3550  C CD   . PRO A 1 19 ? 15.859  4.735   -11.509 1.00 0.78 ? 19 PRO A CD   8  
ATOM   3551  H HA   . PRO A 1 19 ? 16.283  7.957   -11.491 1.00 0.97 ? 19 PRO A HA   8  
ATOM   3552  H HB2  . PRO A 1 19 ? 14.889  7.049   -13.656 1.00 1.15 ? 19 PRO A HB2  8  
ATOM   3553  H HB3  . PRO A 1 19 ? 16.631  6.775   -13.451 1.00 1.09 ? 19 PRO A HB3  8  
ATOM   3554  H HG2  . PRO A 1 19 ? 14.360  4.922   -13.015 1.00 1.07 ? 19 PRO A HG2  8  
ATOM   3555  H HG3  . PRO A 1 19 ? 15.987  4.595   -13.627 1.00 1.09 ? 19 PRO A HG3  8  
ATOM   3556  H HD2  . PRO A 1 19 ? 15.140  4.060   -11.066 1.00 0.89 ? 19 PRO A HD2  8  
ATOM   3557  H HD3  . PRO A 1 19 ? 16.832  4.274   -11.552 1.00 0.85 ? 19 PRO A HD3  8  
ATOM   3558  N N    . PRO A 1 20 ? 14.017  8.379   -10.214 1.00 0.87 ? 20 PRO A N    8  
ATOM   3559  C CA   . PRO A 1 20 ? 12.665  8.896   -9.850  1.00 0.91 ? 20 PRO A CA   8  
ATOM   3560  C C    . PRO A 1 20 ? 12.414  10.251  -10.533 1.00 1.16 ? 20 PRO A C    8  
ATOM   3561  O O    . PRO A 1 20 ? 12.236  11.264  -9.881  1.00 1.43 ? 20 PRO A O    8  
ATOM   3562  C CB   . PRO A 1 20 ? 12.721  9.041   -8.331  1.00 0.99 ? 20 PRO A CB   8  
ATOM   3563  C CG   . PRO A 1 20 ? 14.167  9.214   -8.013  1.00 1.11 ? 20 PRO A CG   8  
ATOM   3564  C CD   . PRO A 1 20 ? 14.943  8.479   -9.073  1.00 0.96 ? 20 PRO A CD   8  
ATOM   3565  H HA   . PRO A 1 20 ? 11.902  8.185   -10.126 1.00 0.84 ? 20 PRO A HA   8  
ATOM   3566  H HB2  . PRO A 1 20 ? 12.158  9.909   -8.016  1.00 1.13 ? 20 PRO A HB2  8  
ATOM   3567  H HB3  . PRO A 1 20 ? 12.342  8.151   -7.853  1.00 0.91 ? 20 PRO A HB3  8  
ATOM   3568  H HG2  . PRO A 1 20 ? 14.425  10.265  -8.027  1.00 1.35 ? 20 PRO A HG2  8  
ATOM   3569  H HG3  . PRO A 1 20 ? 14.386  8.792   -7.045  1.00 1.19 ? 20 PRO A HG3  8  
ATOM   3570  H HD2  . PRO A 1 20 ? 15.827  9.039   -9.347  1.00 1.08 ? 20 PRO A HD2  8  
ATOM   3571  H HD3  . PRO A 1 20 ? 15.211  7.494   -8.726  1.00 0.95 ? 20 PRO A HD3  8  
ATOM   3572  N N    . SER A 1 21 ? 12.402  10.273  -11.845 1.00 1.22 ? 21 SER A N    8  
ATOM   3573  C CA   . SER A 1 21 ? 12.169  11.558  -12.583 1.00 1.52 ? 21 SER A CA   8  
ATOM   3574  C C    . SER A 1 21 ? 10.795  12.144  -12.236 1.00 1.27 ? 21 SER A C    8  
ATOM   3575  O O    . SER A 1 21 ? 10.670  13.322  -11.957 1.00 1.35 ? 21 SER A O    8  
ATOM   3576  C CB   . SER A 1 21 ? 12.238  11.192  -14.068 1.00 1.87 ? 21 SER A CB   8  
ATOM   3577  O OG   . SER A 1 21 ? 12.069  12.371  -14.852 1.00 1.90 ? 21 SER A OG   8  
ATOM   3578  H H    . SER A 1 21 ? 12.550  9.442   -12.345 1.00 1.18 ? 21 SER A H    8  
ATOM   3579  H HA   . SER A 1 21 ? 12.945  12.268  -12.346 1.00 1.78 ? 21 SER A HA   8  
ATOM   3580  H HB2  . SER A 1 21 ? 13.196  10.752  -14.287 1.00 2.24 ? 21 SER A HB2  8  
ATOM   3581  H HB3  . SER A 1 21 ? 11.456  10.480  -14.298 1.00 2.04 ? 21 SER A HB3  8  
ATOM   3582  H HG   . SER A 1 21 ? 12.723  12.354  -15.558 1.00 2.26 ? 21 SER A HG   8  
ATOM   3583  N N    . LYS A 1 22 ? 9.761   11.340  -12.260 1.00 1.07 ? 22 LYS A N    8  
ATOM   3584  C CA   . LYS A 1 22 ? 8.399   11.863  -11.935 1.00 0.93 ? 22 LYS A CA   8  
ATOM   3585  C C    . LYS A 1 22 ? 7.866   11.198  -10.659 1.00 0.73 ? 22 LYS A C    8  
ATOM   3586  O O    . LYS A 1 22 ? 6.787   10.633  -10.638 1.00 0.71 ? 22 LYS A O    8  
ATOM   3587  C CB   . LYS A 1 22 ? 7.535   11.504  -13.152 1.00 1.12 ? 22 LYS A CB   8  
ATOM   3588  C CG   . LYS A 1 22 ? 7.478   12.699  -14.109 1.00 1.28 ? 22 LYS A CG   8  
ATOM   3589  C CD   . LYS A 1 22 ? 8.688   12.665  -15.050 1.00 1.52 ? 22 LYS A CD   8  
ATOM   3590  C CE   . LYS A 1 22 ? 9.187   14.092  -15.304 1.00 1.67 ? 22 LYS A CE   8  
ATOM   3591  N NZ   . LYS A 1 22 ? 10.399  14.241  -14.446 1.00 1.68 ? 22 LYS A NZ   8  
ATOM   3592  H H    . LYS A 1 22 ? 9.881   10.396  -12.493 1.00 1.09 ? 22 LYS A H    8  
ATOM   3593  H HA   . LYS A 1 22 ? 8.429   12.933  -11.809 1.00 0.98 ? 22 LYS A HA   8  
ATOM   3594  H HB2  . LYS A 1 22 ? 7.964   10.654  -13.661 1.00 1.26 ? 22 LYS A HB2  8  
ATOM   3595  H HB3  . LYS A 1 22 ? 6.535   11.261  -12.825 1.00 1.13 ? 22 LYS A HB3  8  
ATOM   3596  H HG2  . LYS A 1 22 ? 6.568   12.650  -14.692 1.00 1.45 ? 22 LYS A HG2  8  
ATOM   3597  H HG3  . LYS A 1 22 ? 7.491   13.618  -13.542 1.00 1.27 ? 22 LYS A HG3  8  
ATOM   3598  H HD2  . LYS A 1 22 ? 9.478   12.082  -14.599 1.00 1.55 ? 22 LYS A HD2  8  
ATOM   3599  H HD3  . LYS A 1 22 ? 8.401   12.214  -15.988 1.00 1.75 ? 22 LYS A HD3  8  
ATOM   3600  H HE2  . LYS A 1 22 ? 9.444   14.217  -16.348 1.00 1.90 ? 22 LYS A HE2  8  
ATOM   3601  H HE3  . LYS A 1 22 ? 8.436   14.811  -15.012 1.00 1.65 ? 22 LYS A HE3  8  
ATOM   3602  H HZ1  . LYS A 1 22 ? 11.093  13.490  -14.682 1.00 1.77 ? 22 LYS A HZ1  8  
ATOM   3603  H HZ2  . LYS A 1 22 ? 10.829  15.173  -14.612 1.00 1.88 ? 22 LYS A HZ2  8  
ATOM   3604  H HZ3  . LYS A 1 22 ? 10.131  14.156  -13.442 1.00 1.53 ? 22 LYS A HZ3  8  
ATOM   3605  N N    . THR A 1 23 ? 8.618   11.272  -9.589  1.00 0.69 ? 23 THR A N    8  
ATOM   3606  C CA   . THR A 1 23 ? 8.167   10.654  -8.301  1.00 0.59 ? 23 THR A CA   8  
ATOM   3607  C C    . THR A 1 23 ? 7.226   11.602  -7.533  1.00 0.60 ? 23 THR A C    8  
ATOM   3608  O O    . THR A 1 23 ? 6.588   11.208  -6.576  1.00 0.80 ? 23 THR A O    8  
ATOM   3609  C CB   . THR A 1 23 ? 9.455   10.384  -7.510  1.00 0.75 ? 23 THR A CB   8  
ATOM   3610  O OG1  . THR A 1 23 ? 9.189   9.418   -6.503  1.00 0.79 ? 23 THR A OG1  8  
ATOM   3611  C CG2  . THR A 1 23 ? 9.962   11.674  -6.856  1.00 0.90 ? 23 THR A CG2  8  
ATOM   3612  H H    . THR A 1 23 ? 9.479   11.740  -9.632  1.00 0.81 ? 23 THR A H    8  
ATOM   3613  H HA   . THR A 1 23 ? 7.664   9.720   -8.498  1.00 0.58 ? 23 THR A HA   8  
ATOM   3614  H HB   . THR A 1 23 ? 10.213  10.005  -8.178  1.00 0.89 ? 23 THR A HB   8  
ATOM   3615  H HG1  . THR A 1 23 ? 9.984   8.886   -6.380  1.00 1.12 ? 23 THR A HG1  8  
ATOM   3616  H HG21 . THR A 1 23 ? 9.875   12.491  -7.556  1.00 1.31 ? 23 THR A HG21 8  
ATOM   3617  H HG22 . THR A 1 23 ? 9.371   11.888  -5.977  1.00 1.22 ? 23 THR A HG22 8  
ATOM   3618  H HG23 . THR A 1 23 ? 10.996  11.552  -6.572  1.00 1.48 ? 23 THR A HG23 8  
ATOM   3619  N N    . CYS A 1 24 ? 7.128   12.844  -7.949  1.00 0.68 ? 24 CYS A N    8  
ATOM   3620  C CA   . CYS A 1 24 ? 6.223   13.809  -7.254  1.00 0.85 ? 24 CYS A CA   8  
ATOM   3621  C C    . CYS A 1 24 ? 5.452   14.638  -8.291  1.00 0.80 ? 24 CYS A C    8  
ATOM   3622  O O    . CYS A 1 24 ? 6.039   15.337  -9.096  1.00 0.95 ? 24 CYS A O    8  
ATOM   3623  C CB   . CYS A 1 24 ? 7.152   14.702  -6.427  1.00 1.10 ? 24 CYS A CB   8  
ATOM   3624  S SG   . CYS A 1 24 ? 6.178   15.641  -5.225  1.00 1.71 ? 24 CYS A SG   8  
ATOM   3625  H H    . CYS A 1 24 ? 7.644   13.141  -8.724  1.00 0.82 ? 24 CYS A H    8  
ATOM   3626  H HA   . CYS A 1 24 ? 5.539   13.286  -6.605  1.00 0.93 ? 24 CYS A HA   8  
ATOM   3627  H HB2  . CYS A 1 24 ? 7.872   14.087  -5.906  1.00 1.21 ? 24 CYS A HB2  8  
ATOM   3628  H HB3  . CYS A 1 24 ? 7.672   15.386  -7.083  1.00 1.29 ? 24 CYS A HB3  8  
ATOM   3629  H HG   . CYS A 1 24 ? 5.786   16.390  -5.680  1.00 1.94 ? 24 CYS A HG   8  
ATOM   3630  N N    . LEU A 1 25 ? 4.145   14.557  -8.284  1.00 0.77 ? 25 LEU A N    8  
ATOM   3631  C CA   . LEU A 1 25 ? 3.334   15.332  -9.276  1.00 0.80 ? 25 LEU A CA   8  
ATOM   3632  C C    . LEU A 1 25 ? 2.089   15.929  -8.605  1.00 0.92 ? 25 LEU A C    8  
ATOM   3633  O O    . LEU A 1 25 ? 1.943   15.891  -7.396  1.00 0.95 ? 25 LEU A O    8  
ATOM   3634  C CB   . LEU A 1 25 ? 2.931   14.308  -10.346 1.00 0.74 ? 25 LEU A CB   8  
ATOM   3635  C CG   . LEU A 1 25 ? 4.119   14.031  -11.274 1.00 0.78 ? 25 LEU A CG   8  
ATOM   3636  C CD1  . LEU A 1 25 ? 3.841   12.774  -12.098 1.00 1.02 ? 25 LEU A CD1  8  
ATOM   3637  C CD2  . LEU A 1 25 ? 4.320   15.219  -12.217 1.00 1.02 ? 25 LEU A CD2  8  
ATOM   3638  H H    . LEU A 1 25 ? 3.692   13.981  -7.630  1.00 0.86 ? 25 LEU A H    8  
ATOM   3639  H HA   . LEU A 1 25 ? 3.929   16.114  -9.721  1.00 0.88 ? 25 LEU A HA   8  
ATOM   3640  H HB2  . LEU A 1 25 ? 2.628   13.389  -9.866  1.00 0.75 ? 25 LEU A HB2  8  
ATOM   3641  H HB3  . LEU A 1 25 ? 2.109   14.698  -10.926 1.00 0.85 ? 25 LEU A HB3  8  
ATOM   3642  H HG   . LEU A 1 25 ? 5.011   13.883  -10.684 1.00 0.96 ? 25 LEU A HG   8  
ATOM   3643  H HD11 . LEU A 1 25 ? 3.353   12.037  -11.479 1.00 1.39 ? 25 LEU A HD11 8  
ATOM   3644  H HD12 . LEU A 1 25 ? 3.200   13.023  -12.931 1.00 1.58 ? 25 LEU A HD12 8  
ATOM   3645  H HD13 . LEU A 1 25 ? 4.772   12.373  -12.469 1.00 1.46 ? 25 LEU A HD13 8  
ATOM   3646  H HD21 . LEU A 1 25 ? 3.373   15.491  -12.662 1.00 1.35 ? 25 LEU A HD21 8  
ATOM   3647  H HD22 . LEU A 1 25 ? 4.709   16.059  -11.662 1.00 1.62 ? 25 LEU A HD22 8  
ATOM   3648  H HD23 . LEU A 1 25 ? 5.018   14.948  -12.996 1.00 1.51 ? 25 LEU A HD23 8  
ATOM   3649  N N    . LYS A 1 26 ? 1.191   16.485  -9.378  1.00 1.08 ? 26 LYS A N    8  
ATOM   3650  C CA   . LYS A 1 26 ? -0.042  17.083  -8.785  1.00 1.24 ? 26 LYS A CA   8  
ATOM   3651  C C    . LYS A 1 26 ? -1.164  16.036  -8.717  1.00 1.25 ? 26 LYS A C    8  
ATOM   3652  O O    . LYS A 1 26 ? -2.165  16.130  -9.404  1.00 1.43 ? 26 LYS A O    8  
ATOM   3653  C CB   . LYS A 1 26 ? -0.412  18.244  -9.715  1.00 1.38 ? 26 LYS A CB   8  
ATOM   3654  C CG   . LYS A 1 26 ? -0.348  19.560  -8.936  1.00 1.53 ? 26 LYS A CG   8  
ATOM   3655  C CD   . LYS A 1 26 ? 1.078   19.788  -8.419  1.00 1.50 ? 26 LYS A CD   8  
ATOM   3656  C CE   . LYS A 1 26 ? 1.032   20.223  -6.948  1.00 1.60 ? 26 LYS A CE   8  
ATOM   3657  N NZ   . LYS A 1 26 ? 1.148   18.962  -6.156  1.00 1.51 ? 26 LYS A NZ   8  
ATOM   3658  H H    . LYS A 1 26 ? 1.329   16.510  -10.348 1.00 1.15 ? 26 LYS A H    8  
ATOM   3659  H HA   . LYS A 1 26 ? 0.169   17.459  -7.799  1.00 1.30 ? 26 LYS A HA   8  
ATOM   3660  H HB2  . LYS A 1 26 ? 0.281   18.279  -10.543 1.00 1.38 ? 26 LYS A HB2  8  
ATOM   3661  H HB3  . LYS A 1 26 ? -1.414  18.100  -10.092 1.00 1.43 ? 26 LYS A HB3  8  
ATOM   3662  H HG2  . LYS A 1 26 ? -0.629  20.375  -9.588  1.00 1.66 ? 26 LYS A HG2  8  
ATOM   3663  H HG3  . LYS A 1 26 ? -1.031  19.516  -8.101  1.00 1.60 ? 26 LYS A HG3  8  
ATOM   3664  H HD2  . LYS A 1 26 ? 1.644   18.871  -8.507  1.00 1.40 ? 26 LYS A HD2  8  
ATOM   3665  H HD3  . LYS A 1 26 ? 1.553   20.559  -9.005  1.00 1.60 ? 26 LYS A HD3  8  
ATOM   3666  H HE2  . LYS A 1 26 ? 1.860   20.885  -6.729  1.00 1.73 ? 26 LYS A HE2  8  
ATOM   3667  H HE3  . LYS A 1 26 ? 0.093   20.711  -6.731  1.00 1.71 ? 26 LYS A HE3  8  
ATOM   3668  H HZ1  . LYS A 1 26 ? 1.876   18.347  -6.576  1.00 1.71 ? 26 LYS A HZ1  8  
ATOM   3669  H HZ2  . LYS A 1 26 ? 1.409   19.191  -5.177  1.00 1.85 ? 26 LYS A HZ2  8  
ATOM   3670  H HZ3  . LYS A 1 26 ? 0.228   18.465  -6.157  1.00 1.47 ? 26 LYS A HZ3  8  
ATOM   3671  N N    . GLU A 1 27 ? -0.997  15.040  -7.883  1.00 1.14 ? 27 GLU A N    8  
ATOM   3672  C CA   . GLU A 1 27 ? -2.043  13.977  -7.749  1.00 1.21 ? 27 GLU A CA   8  
ATOM   3673  C C    . GLU A 1 27 ? -2.686  14.016  -6.349  1.00 1.36 ? 27 GLU A C    8  
ATOM   3674  O O    . GLU A 1 27 ? -3.101  13.002  -5.816  1.00 1.41 ? 27 GLU A O    8  
ATOM   3675  C CB   . GLU A 1 27 ? -1.298  12.653  -7.982  1.00 0.98 ? 27 GLU A CB   8  
ATOM   3676  C CG   . GLU A 1 27 ? -0.321  12.378  -6.827  1.00 0.82 ? 27 GLU A CG   8  
ATOM   3677  C CD   . GLU A 1 27 ? 0.979   11.789  -7.381  1.00 0.64 ? 27 GLU A CD   8  
ATOM   3678  O OE1  . GLU A 1 27 ? 1.866   12.561  -7.713  1.00 0.67 ? 27 GLU A OE1  8  
ATOM   3679  O OE2  . GLU A 1 27 ? 1.067   10.576  -7.461  1.00 1.13 ? 27 GLU A OE2  8  
ATOM   3680  H H    . GLU A 1 27 ? -0.181  14.992  -7.341  1.00 1.08 ? 27 GLU A H    8  
ATOM   3681  H HA   . GLU A 1 27 ? -2.801  14.103  -8.507  1.00 1.40 ? 27 GLU A HA   8  
ATOM   3682  H HB2  . GLU A 1 27 ? -2.014  11.846  -8.043  1.00 1.09 ? 27 GLU A HB2  8  
ATOM   3683  H HB3  . GLU A 1 27 ? -0.746  12.712  -8.908  1.00 0.97 ? 27 GLU A HB3  8  
ATOM   3684  H HG2  . GLU A 1 27 ? -0.105  13.297  -6.306  1.00 0.93 ? 27 GLU A HG2  8  
ATOM   3685  H HG3  . GLU A 1 27 ? -0.765  11.674  -6.142  1.00 1.07 ? 27 GLU A HG3  8  
ATOM   3686  N N    . GLU A 1 28 ? -2.778  15.184  -5.755  1.00 1.52 ? 28 GLU A N    8  
ATOM   3687  C CA   . GLU A 1 28 ? -3.396  15.297  -4.393  1.00 1.79 ? 28 GLU A CA   8  
ATOM   3688  C C    . GLU A 1 28 ? -4.925  15.156  -4.483  1.00 1.96 ? 28 GLU A C    8  
ATOM   3689  O O    . GLU A 1 28 ? -5.661  16.124  -4.409  1.00 2.70 ? 28 GLU A O    8  
ATOM   3690  C CB   . GLU A 1 28 ? -2.992  16.687  -3.867  1.00 1.78 ? 28 GLU A CB   8  
ATOM   3691  C CG   . GLU A 1 28 ? -3.346  17.778  -4.893  1.00 1.66 ? 28 GLU A CG   8  
ATOM   3692  C CD   . GLU A 1 28 ? -2.066  18.448  -5.399  1.00 1.51 ? 28 GLU A CD   8  
ATOM   3693  O OE1  . GLU A 1 28 ? -1.279  17.772  -6.044  1.00 1.44 ? 28 GLU A OE1  8  
ATOM   3694  O OE2  . GLU A 1 28 ? -1.887  19.624  -5.135  1.00 1.67 ? 28 GLU A OE2  8  
ATOM   3695  H H    . GLU A 1 28 ? -2.441  15.986  -6.206  1.00 1.51 ? 28 GLU A H    8  
ATOM   3696  H HA   . GLU A 1 28 ? -2.995  14.535  -3.744  1.00 1.93 ? 28 GLU A HA   8  
ATOM   3697  H HB2  . GLU A 1 28 ? -3.515  16.884  -2.944  1.00 1.93 ? 28 GLU A HB2  8  
ATOM   3698  H HB3  . GLU A 1 28 ? -1.928  16.703  -3.683  1.00 1.78 ? 28 GLU A HB3  8  
ATOM   3699  H HG2  . GLU A 1 28 ? -3.873  17.336  -5.724  1.00 1.62 ? 28 GLU A HG2  8  
ATOM   3700  H HG3  . GLU A 1 28 ? -3.974  18.519  -4.424  1.00 1.78 ? 28 GLU A HG3  8  
ATOM   3701  N N    . MET A 1 29 ? -5.404  13.948  -4.644  1.00 1.73 ? 29 MET A N    8  
ATOM   3702  C CA   . MET A 1 29 ? -6.880  13.721  -4.742  1.00 1.92 ? 29 MET A CA   8  
ATOM   3703  C C    . MET A 1 29 ? -7.307  12.559  -3.828  1.00 2.63 ? 29 MET A C    8  
ATOM   3704  O O    . MET A 1 29 ? -6.538  12.087  -3.011  1.00 3.35 ? 29 MET A O    8  
ATOM   3705  C CB   . MET A 1 29 ? -7.126  13.374  -6.214  1.00 1.95 ? 29 MET A CB   8  
ATOM   3706  C CG   . MET A 1 29 ? -8.302  14.196  -6.747  1.00 2.25 ? 29 MET A CG   8  
ATOM   3707  S SD   . MET A 1 29 ? -9.009  13.367  -8.192  1.00 2.91 ? 29 MET A SD   8  
ATOM   3708  C CE   . MET A 1 29 ? -10.073 12.208  -7.296  1.00 3.25 ? 29 MET A CE   8  
ATOM   3709  H H    . MET A 1 29 ? -4.790  13.185  -4.703  1.00 1.86 ? 29 MET A H    8  
ATOM   3710  H HA   . MET A 1 29 ? -7.417  14.620  -4.481  1.00 2.30 ? 29 MET A HA   8  
ATOM   3711  H HB2  . MET A 1 29 ? -6.240  13.597  -6.790  1.00 2.24 ? 29 MET A HB2  8  
ATOM   3712  H HB3  . MET A 1 29 ? -7.356  12.322  -6.303  1.00 2.30 ? 29 MET A HB3  8  
ATOM   3713  H HG2  . MET A 1 29 ? -9.057  14.289  -5.980  1.00 2.31 ? 29 MET A HG2  8  
ATOM   3714  H HG3  . MET A 1 29 ? -7.955  15.179  -7.030  1.00 2.68 ? 29 MET A HG3  8  
ATOM   3715  H HE1  . MET A 1 29 ? -10.704 12.753  -6.611  1.00 3.63 ? 29 MET A HE1  8  
ATOM   3716  H HE2  . MET A 1 29 ? -10.691 11.669  -8.001  1.00 3.47 ? 29 MET A HE2  8  
ATOM   3717  H HE3  . MET A 1 29 ? -9.458  11.513  -6.741  1.00 3.54 ? 29 MET A HE3  8  
ATOM   3718  N N    . ALA A 1 30 ? -8.527  12.099  -3.966  1.00 2.97 ? 30 ALA A N    8  
ATOM   3719  C CA   . ALA A 1 30 ? -9.013  10.968  -3.112  1.00 4.14 ? 30 ALA A CA   8  
ATOM   3720  C C    . ALA A 1 30 ? -8.933  9.639   -3.879  1.00 4.83 ? 30 ALA A C    8  
ATOM   3721  O O    . ALA A 1 30 ? -9.123  9.653   -5.087  1.00 5.68 ? 30 ALA A O    8  
ATOM   3722  C CB   . ALA A 1 30 ? -10.468 11.313  -2.784  1.00 4.46 ? 30 ALA A CB   8  
ATOM   3723  O OXT  . ALA A 1 30 ? -8.677  8.629   -3.245  1.00 4.74 ? 30 ALA A OXT  8  
ATOM   3724  H H    . ALA A 1 30 ? -9.124  12.496  -4.633  1.00 2.75 ? 30 ALA A H    8  
ATOM   3725  H HA   . ALA A 1 30 ? -8.435  10.909  -2.203  1.00 4.56 ? 30 ALA A HA   8  
ATOM   3726  H HB1  . ALA A 1 30 ? -10.514 12.300  -2.345  1.00 4.70 ? 30 ALA A HB1  8  
ATOM   3727  H HB2  . ALA A 1 30 ? -11.056 11.293  -3.689  1.00 4.56 ? 30 ALA A HB2  8  
ATOM   3728  H HB3  . ALA A 1 30 ? -10.858 10.590  -2.083  1.00 4.79 ? 30 ALA A HB3  8  
ATOM   3729  N N    . MET A 1 1  ? -13.577 13.302  12.232  1.00 3.37 ? 1  MET A N    9  
ATOM   3730  C CA   . MET A 1 1  ? -12.458 13.310  13.224  1.00 2.66 ? 1  MET A CA   9  
ATOM   3731  C C    . MET A 1 1  ? -11.153 12.853  12.560  1.00 2.04 ? 1  MET A C    9  
ATOM   3732  O O    . MET A 1 1  ? -11.167 12.146  11.571  1.00 2.30 ? 1  MET A O    9  
ATOM   3733  C CB   . MET A 1 1  ? -12.882 12.320  14.315  1.00 2.95 ? 1  MET A CB   9  
ATOM   3734  C CG   . MET A 1 1  ? -12.477 12.861  15.688  1.00 3.28 ? 1  MET A CG   9  
ATOM   3735  S SD   . MET A 1 1  ? -13.445 14.345  16.061  1.00 4.23 ? 1  MET A SD   9  
ATOM   3736  C CE   . MET A 1 1  ? -13.439 14.176  17.863  1.00 4.85 ? 1  MET A CE   9  
ATOM   3737  H H1   . MET A 1 1  ? -13.347 13.942  11.445  1.00 3.51 ? 1  MET A H1   9  
ATOM   3738  H H2   . MET A 1 1  ? -13.708 12.339  11.863  1.00 3.88 ? 1  MET A H2   9  
ATOM   3739  H H3   . MET A 1 1  ? -14.454 13.621  12.693  1.00 3.64 ? 1  MET A H3   9  
ATOM   3740  H HA   . MET A 1 1  ? -12.339 14.295  13.648  1.00 2.68 ? 1  MET A HA   9  
ATOM   3741  H HB2  . MET A 1 1  ? -13.955 12.185  14.284  1.00 3.59 ? 1  MET A HB2  9  
ATOM   3742  H HB3  . MET A 1 1  ? -12.396 11.369  14.148  1.00 2.64 ? 1  MET A HB3  9  
ATOM   3743  H HG2  . MET A 1 1  ? -12.666 12.109  16.442  1.00 3.43 ? 1  MET A HG2  9  
ATOM   3744  H HG3  . MET A 1 1  ? -11.426 13.109  15.684  1.00 3.19 ? 1  MET A HG3  9  
ATOM   3745  H HE1  . MET A 1 1  ? -12.438 13.941  18.199  1.00 5.10 ? 1  MET A HE1  9  
ATOM   3746  H HE2  . MET A 1 1  ? -13.759 15.101  18.315  1.00 4.96 ? 1  MET A HE2  9  
ATOM   3747  H HE3  . MET A 1 1  ? -14.117 13.384  18.152  1.00 5.29 ? 1  MET A HE3  9  
ATOM   3748  N N    . ILE A 1 2  ? -10.027 13.252  13.098  1.00 1.49 ? 2  ILE A N    9  
ATOM   3749  C CA   . ILE A 1 2  ? -8.717  12.839  12.501  1.00 1.05 ? 2  ILE A CA   9  
ATOM   3750  C C    . ILE A 1 2  ? -8.094  11.696  13.317  1.00 0.78 ? 2  ILE A C    9  
ATOM   3751  O O    . ILE A 1 2  ? -8.333  11.566  14.504  1.00 0.95 ? 2  ILE A O    9  
ATOM   3752  C CB   . ILE A 1 2  ? -7.838  14.101  12.548  1.00 1.28 ? 2  ILE A CB   9  
ATOM   3753  C CG1  . ILE A 1 2  ? -6.629  13.920  11.625  1.00 1.58 ? 2  ILE A CG1  9  
ATOM   3754  C CG2  . ILE A 1 2  ? -7.348  14.355  13.978  1.00 1.54 ? 2  ILE A CG2  9  
ATOM   3755  C CD1  . ILE A 1 2  ? -7.046  14.173  10.175  1.00 2.04 ? 2  ILE A CD1  9  
ATOM   3756  H H    . ILE A 1 2  ? -10.041 13.819  13.897  1.00 1.65 ? 2  ILE A H    9  
ATOM   3757  H HA   . ILE A 1 2  ? -8.857  12.531  11.476  1.00 1.26 ? 2  ILE A HA   9  
ATOM   3758  H HB   . ILE A 1 2  ? -8.419  14.950  12.215  1.00 1.52 ? 2  ILE A HB   9  
ATOM   3759  H HG12 . ILE A 1 2  ? -5.856  14.620  11.905  1.00 1.89 ? 2  ILE A HG12 9  
ATOM   3760  H HG13 . ILE A 1 2  ? -6.251  12.913  11.718  1.00 1.70 ? 2  ILE A HG13 9  
ATOM   3761  H HG21 . ILE A 1 2  ? -8.137  14.123  14.677  1.00 2.08 ? 2  ILE A HG21 9  
ATOM   3762  H HG22 . ILE A 1 2  ? -6.491  13.731  14.181  1.00 1.75 ? 2  ILE A HG22 9  
ATOM   3763  H HG23 . ILE A 1 2  ? -7.069  15.394  14.083  1.00 1.79 ? 2  ILE A HG23 9  
ATOM   3764  H HD11 . ILE A 1 2  ? -7.568  15.118  10.111  1.00 2.51 ? 2  ILE A HD11 9  
ATOM   3765  H HD12 . ILE A 1 2  ? -6.167  14.206  9.547   1.00 2.27 ? 2  ILE A HD12 9  
ATOM   3766  H HD13 . ILE A 1 2  ? -7.697  13.379  9.842   1.00 2.44 ? 2  ILE A HD13 9  
ATOM   3767  N N    . SER A 1 3  ? -7.300  10.865  12.686  1.00 0.83 ? 3  SER A N    9  
ATOM   3768  C CA   . SER A 1 3  ? -6.660  9.727   13.421  1.00 0.91 ? 3  SER A CA   9  
ATOM   3769  C C    . SER A 1 3  ? -5.528  10.244  14.321  1.00 0.98 ? 3  SER A C    9  
ATOM   3770  O O    . SER A 1 3  ? -5.590  10.117  15.529  1.00 1.16 ? 3  SER A O    9  
ATOM   3771  C CB   . SER A 1 3  ? -6.111  8.801   12.330  1.00 1.02 ? 3  SER A CB   9  
ATOM   3772  O OG   . SER A 1 3  ? -5.138  7.931   12.893  1.00 1.16 ? 3  SER A OG   9  
ATOM   3773  H H    . SER A 1 3  ? -7.126  10.990  11.729  1.00 1.11 ? 3  SER A H    9  
ATOM   3774  H HA   . SER A 1 3  ? -7.395  9.203   14.010  1.00 1.09 ? 3  SER A HA   9  
ATOM   3775  H HB2  . SER A 1 3  ? -6.915  8.214   11.917  1.00 1.23 ? 3  SER A HB2  9  
ATOM   3776  H HB3  . SER A 1 3  ? -5.665  9.398   11.544  1.00 1.02 ? 3  SER A HB3  9  
ATOM   3777  H HG   . SER A 1 3  ? -4.572  7.616   12.177  1.00 1.27 ? 3  SER A HG   9  
ATOM   3778  N N    . SER A 1 4  ? -4.496  10.819  13.736  1.00 1.07 ? 4  SER A N    9  
ATOM   3779  C CA   . SER A 1 4  ? -3.333  11.361  14.528  1.00 1.40 ? 4  SER A CA   9  
ATOM   3780  C C    . SER A 1 4  ? -2.439  10.239  15.085  1.00 1.61 ? 4  SER A C    9  
ATOM   3781  O O    . SER A 1 4  ? -1.231  10.375  15.130  1.00 1.92 ? 4  SER A O    9  
ATOM   3782  C CB   . SER A 1 4  ? -3.943  12.183  15.670  1.00 1.47 ? 4  SER A CB   9  
ATOM   3783  O OG   . SER A 1 4  ? -3.159  13.350  15.877  1.00 1.72 ? 4  SER A OG   9  
ATOM   3784  H H    . SER A 1 4  ? -4.483  10.897  12.759  1.00 1.03 ? 4  SER A H    9  
ATOM   3785  H HA   . SER A 1 4  ? -2.743  12.008  13.904  1.00 1.54 ? 4  SER A HA   9  
ATOM   3786  H HB2  . SER A 1 4  ? -4.948  12.472  15.413  1.00 1.28 ? 4  SER A HB2  9  
ATOM   3787  H HB3  . SER A 1 4  ? -3.964  11.585  16.573  1.00 1.65 ? 4  SER A HB3  9  
ATOM   3788  H HG   . SER A 1 4  ? -2.530  13.168  16.581  1.00 2.07 ? 4  SER A HG   9  
ATOM   3789  N N    . VAL A 1 5  ? -3.011  9.144   15.516  1.00 1.53 ? 5  VAL A N    9  
ATOM   3790  C CA   . VAL A 1 5  ? -2.184  8.026   16.077  1.00 1.83 ? 5  VAL A CA   9  
ATOM   3791  C C    . VAL A 1 5  ? -1.630  7.126   14.961  1.00 1.89 ? 5  VAL A C    9  
ATOM   3792  O O    . VAL A 1 5  ? -0.569  6.546   15.096  1.00 2.16 ? 5  VAL A O    9  
ATOM   3793  C CB   . VAL A 1 5  ? -3.135  7.248   16.999  1.00 1.90 ? 5  VAL A CB   9  
ATOM   3794  C CG1  . VAL A 1 5  ? -4.153  6.454   16.171  1.00 1.83 ? 5  VAL A CG1  9  
ATOM   3795  C CG2  . VAL A 1 5  ? -2.326  6.280   17.867  1.00 2.28 ? 5  VAL A CG2  9  
ATOM   3796  H H    . VAL A 1 5  ? -3.982  9.058   15.480  1.00 1.35 ? 5  VAL A H    9  
ATOM   3797  H HA   . VAL A 1 5  ? -1.371  8.428   16.655  1.00 2.03 ? 5  VAL A HA   9  
ATOM   3798  H HB   . VAL A 1 5  ? -3.662  7.944   17.635  1.00 1.85 ? 5  VAL A HB   9  
ATOM   3799  H HG11 . VAL A 1 5  ? -4.624  7.109   15.454  1.00 2.00 ? 5  VAL A HG11 9  
ATOM   3800  H HG12 . VAL A 1 5  ? -3.648  5.654   15.650  1.00 2.03 ? 5  VAL A HG12 9  
ATOM   3801  H HG13 . VAL A 1 5  ? -4.903  6.039   16.826  1.00 2.23 ? 5  VAL A HG13 9  
ATOM   3802  H HG21 . VAL A 1 5  ? -1.590  6.832   18.432  1.00 2.59 ? 5  VAL A HG21 9  
ATOM   3803  H HG22 . VAL A 1 5  ? -2.989  5.763   18.545  1.00 2.60 ? 5  VAL A HG22 9  
ATOM   3804  H HG23 . VAL A 1 5  ? -1.827  5.560   17.234  1.00 2.57 ? 5  VAL A HG23 9  
ATOM   3805  N N    . CYS A 1 6  ? -2.335  7.005   13.866  1.00 1.71 ? 6  CYS A N    9  
ATOM   3806  C CA   . CYS A 1 6  ? -1.847  6.143   12.747  1.00 1.82 ? 6  CYS A CA   9  
ATOM   3807  C C    . CYS A 1 6  ? -2.258  6.729   11.388  1.00 1.64 ? 6  CYS A C    9  
ATOM   3808  O O    . CYS A 1 6  ? -3.355  7.230   11.218  1.00 1.51 ? 6  CYS A O    9  
ATOM   3809  C CB   . CYS A 1 6  ? -2.501  4.775   12.975  1.00 1.98 ? 6  CYS A CB   9  
ATOM   3810  S SG   . CYS A 1 6  ? -4.301  4.910   12.822  1.00 1.93 ? 6  CYS A SG   9  
ATOM   3811  H H    . CYS A 1 6  ? -3.183  7.481   13.782  1.00 1.53 ? 6  CYS A H    9  
ATOM   3812  H HA   . CYS A 1 6  ? -0.773  6.044   12.797  1.00 2.01 ? 6  CYS A HA   9  
ATOM   3813  H HB2  . CYS A 1 6  ? -2.131  4.075   12.241  1.00 2.20 ? 6  CYS A HB2  9  
ATOM   3814  H HB3  . CYS A 1 6  ? -2.250  4.421   13.965  1.00 2.10 ? 6  CYS A HB3  9  
ATOM   3815  H HG   . CYS A 1 6  ? -4.605  5.567   13.453  1.00 2.12 ? 6  CYS A HG   9  
ATOM   3816  N N    . VAL A 1 7  ? -1.375  6.672   10.425  1.00 1.69 ? 7  VAL A N    9  
ATOM   3817  C CA   . VAL A 1 7  ? -1.683  7.218   9.072   1.00 1.59 ? 7  VAL A CA   9  
ATOM   3818  C C    . VAL A 1 7  ? -1.009  6.351   7.994   1.00 1.51 ? 7  VAL A C    9  
ATOM   3819  O O    . VAL A 1 7  ? -0.522  5.269   8.267   1.00 1.56 ? 7  VAL A O    9  
ATOM   3820  C CB   . VAL A 1 7  ? -1.110  8.644   9.100   1.00 1.64 ? 7  VAL A CB   9  
ATOM   3821  C CG1  . VAL A 1 7  ? 0.395   8.621   8.806   1.00 1.63 ? 7  VAL A CG1  9  
ATOM   3822  C CG2  . VAL A 1 7  ? -1.822  9.511   8.056   1.00 1.67 ? 7  VAL A CG2  9  
ATOM   3823  H H    . VAL A 1 7  ? -0.502  6.270   10.589  1.00 1.83 ? 7  VAL A H    9  
ATOM   3824  H HA   . VAL A 1 7  ? -2.748  7.252   8.912   1.00 1.63 ? 7  VAL A HA   9  
ATOM   3825  H HB   . VAL A 1 7  ? -1.270  9.067   10.078  1.00 1.76 ? 7  VAL A HB   9  
ATOM   3826  H HG11 . VAL A 1 7  ? 0.836   7.744   9.256   1.00 1.86 ? 7  VAL A HG11 9  
ATOM   3827  H HG12 . VAL A 1 7  ? 0.555   8.598   7.738   1.00 1.78 ? 7  VAL A HG12 9  
ATOM   3828  H HG13 . VAL A 1 7  ? 0.855   9.507   9.218   1.00 2.11 ? 7  VAL A HG13 9  
ATOM   3829  H HG21 . VAL A 1 7  ? -2.709  9.000   7.708   1.00 1.81 ? 7  VAL A HG21 9  
ATOM   3830  H HG22 . VAL A 1 7  ? -2.100  10.454  8.501   1.00 1.94 ? 7  VAL A HG22 9  
ATOM   3831  H HG23 . VAL A 1 7  ? -1.159  9.688   7.222   1.00 1.98 ? 7  VAL A HG23 9  
HETATM 3832  N N    . SEP A 1 8  ? -0.981  6.820   6.777   1.00 1.46 ? 8  SEP A N    9  
HETATM 3833  C CA   . SEP A 1 8  ? -0.342  6.034   5.675   1.00 1.43 ? 8  SEP A CA   9  
HETATM 3834  C CB   . SEP A 1 8  ? -1.338  6.061   4.505   1.00 1.51 ? 8  SEP A CB   9  
HETATM 3835  O OG   . SEP A 1 8  ? -1.986  7.341   4.435   1.00 1.57 ? 8  SEP A OG   9  
HETATM 3836  C C    . SEP A 1 8  ? 0.999   6.665   5.274   1.00 1.31 ? 8  SEP A C    9  
HETATM 3837  O O    . SEP A 1 8  ? 2.040   6.136   5.601   1.00 1.32 ? 8  SEP A O    9  
HETATM 3838  P P    . SEP A 1 8  ? -3.584  7.462   4.601   1.00 1.81 ? 8  SEP A P    9  
HETATM 3839  O O1P  . SEP A 1 8  ? -4.221  6.575   3.603   1.00 2.11 ? 8  SEP A O1P  9  
HETATM 3840  O O2P  . SEP A 1 8  ? -3.910  7.315   6.036   1.00 1.79 ? 8  SEP A O2P  9  
HETATM 3841  O O3P  . SEP A 1 8  ? -3.866  8.986   4.174   1.00 2.19 ? 8  SEP A O3P  9  
HETATM 3842  H H    . SEP A 1 8  ? -1.377  7.690   6.590   1.00 1.48 ? 8  SEP A H    9  
HETATM 3843  H HA   . SEP A 1 8  ? -0.184  5.017   5.990   1.00 1.49 ? 8  SEP A HA   9  
HETATM 3844  H HB2  . SEP A 1 8  ? -2.074  5.283   4.648   1.00 1.64 ? 8  SEP A HB2  9  
HETATM 3845  H HB3  . SEP A 1 8  ? -0.813  5.885   3.583   1.00 1.46 ? 8  SEP A HB3  9  
HETATM 3846  H HOP3 . SEP A 1 8  ? -3.330  9.544   4.742   1.00 2.38 ? 8  SEP A HOP3 9  
ATOM   3847  N N    . SER A 1 9  ? 0.948   7.794   4.581   1.00 1.27 ? 9  SER A N    9  
ATOM   3848  C CA   . SER A 1 9  ? 2.169   8.559   4.102   1.00 1.21 ? 9  SER A CA   9  
ATOM   3849  C C    . SER A 1 9  ? 1.986   8.955   2.637   1.00 1.16 ? 9  SER A C    9  
ATOM   3850  O O    . SER A 1 9  ? 1.703   8.119   1.804   1.00 1.12 ? 9  SER A O    9  
ATOM   3851  C CB   . SER A 1 9  ? 3.399   7.653   4.194   1.00 1.19 ? 9  SER A CB   9  
ATOM   3852  O OG   . SER A 1 9  ? 3.959   7.744   5.497   1.00 1.29 ? 9  SER A OG   9  
ATOM   3853  H H    . SER A 1 9  ? 0.070   8.157   4.366   1.00 1.31 ? 9  SER A H    9  
ATOM   3854  H HA   . SER A 1 9  ? 2.315   9.439   4.708   1.00 1.27 ? 9  SER A HA   9  
ATOM   3855  H HB2  . SER A 1 9  ? 3.117   6.634   3.990   1.00 1.19 ? 9  SER A HB2  9  
ATOM   3856  H HB3  . SER A 1 9  ? 4.125   7.972   3.458   1.00 1.17 ? 9  SER A HB3  9  
ATOM   3857  H HG   . SER A 1 9  ? 3.527   7.086   6.051   1.00 1.34 ? 9  SER A HG   9  
ATOM   3858  N N    . TYR A 1 10 ? 2.174   10.224  2.339   1.00 1.18 ? 10 TYR A N    9  
ATOM   3859  C CA   . TYR A 1 10 ? 2.052   10.771  0.938   1.00 1.17 ? 10 TYR A CA   9  
ATOM   3860  C C    . TYR A 1 10 ? 0.962   10.061  0.095   1.00 1.15 ? 10 TYR A C    9  
ATOM   3861  O O    . TYR A 1 10 ? 0.068   9.419   0.614   1.00 1.19 ? 10 TYR A O    9  
ATOM   3862  C CB   . TYR A 1 10 ? 3.477   10.619  0.344   1.00 1.09 ? 10 TYR A CB   9  
ATOM   3863  C CG   . TYR A 1 10 ? 3.662   9.298   -0.373  1.00 0.97 ? 10 TYR A CG   9  
ATOM   3864  C CD1  . TYR A 1 10 ? 3.889   8.125   0.353   1.00 0.96 ? 10 TYR A CD1  9  
ATOM   3865  C CD2  . TYR A 1 10 ? 3.615   9.256   -1.768  1.00 0.92 ? 10 TYR A CD2  9  
ATOM   3866  C CE1  . TYR A 1 10 ? 4.063   6.909   -0.318  1.00 0.91 ? 10 TYR A CE1  9  
ATOM   3867  C CE2  . TYR A 1 10 ? 3.789   8.043   -2.439  1.00 0.85 ? 10 TYR A CE2  9  
ATOM   3868  C CZ   . TYR A 1 10 ? 4.012   6.868   -1.714  1.00 0.85 ? 10 TYR A CZ   9  
ATOM   3869  O OH   . TYR A 1 10 ? 4.180   5.671   -2.376  1.00 0.86 ? 10 TYR A OH   9  
ATOM   3870  H H    . TYR A 1 10 ? 2.419   10.839  3.057   1.00 1.23 ? 10 TYR A H    9  
ATOM   3871  H HA   . TYR A 1 10 ? 1.817   11.819  0.992   1.00 1.26 ? 10 TYR A HA   9  
ATOM   3872  H HB2  . TYR A 1 10 ? 3.652   11.420  -0.355  1.00 1.13 ? 10 TYR A HB2  9  
ATOM   3873  H HB3  . TYR A 1 10 ? 4.199   10.688  1.145   1.00 1.11 ? 10 TYR A HB3  9  
ATOM   3874  H HD1  . TYR A 1 10 ? 3.927   8.157   1.434   1.00 1.03 ? 10 TYR A HD1  9  
ATOM   3875  H HD2  . TYR A 1 10 ? 3.443   10.163  -2.327  1.00 0.97 ? 10 TYR A HD2  9  
ATOM   3876  H HE1  . TYR A 1 10 ? 4.236   6.003   0.240   1.00 0.95 ? 10 TYR A HE1  9  
ATOM   3877  H HE2  . TYR A 1 10 ? 3.747   8.014   -3.516  1.00 0.84 ? 10 TYR A HE2  9  
ATOM   3878  H HH   . TYR A 1 10 ? 3.328   5.227   -2.405  1.00 1.01 ? 10 TYR A HH   9  
ATOM   3879  N N    . ARG A 1 11 ? 1.019   10.203  -1.206  1.00 1.12 ? 11 ARG A N    9  
ATOM   3880  C CA   . ARG A 1 11 ? 0.003   9.552   -2.088  1.00 1.15 ? 11 ARG A CA   9  
ATOM   3881  C C    . ARG A 1 11 ? 0.308   8.049   -2.212  1.00 1.07 ? 11 ARG A C    9  
ATOM   3882  O O    . ARG A 1 11 ? 0.961   7.472   -1.364  1.00 1.05 ? 11 ARG A O    9  
ATOM   3883  C CB   . ARG A 1 11 ? 0.155   10.265  -3.439  1.00 1.14 ? 11 ARG A CB   9  
ATOM   3884  C CG   . ARG A 1 11 ? -0.526  11.635  -3.376  1.00 1.36 ? 11 ARG A CG   9  
ATOM   3885  C CD   . ARG A 1 11 ? -1.995  11.499  -3.793  1.00 1.53 ? 11 ARG A CD   9  
ATOM   3886  N NE   . ARG A 1 11 ? -2.007  11.742  -5.266  1.00 1.88 ? 11 ARG A NE   9  
ATOM   3887  C CZ   . ARG A 1 11 ? -2.971  11.261  -6.000  1.00 1.99 ? 11 ARG A CZ   9  
ATOM   3888  N NH1  . ARG A 1 11 ? -4.168  11.764  -5.909  1.00 2.18 ? 11 ARG A NH1  9  
ATOM   3889  N NH2  . ARG A 1 11 ? -2.734  10.281  -6.823  1.00 2.56 ? 11 ARG A NH2  9  
ATOM   3890  H H    . ARG A 1 11 ? 1.728   10.745  -1.605  1.00 1.11 ? 11 ARG A H    9  
ATOM   3891  H HA   . ARG A 1 11 ? -0.989  9.701   -1.700  1.00 1.26 ? 11 ARG A HA   9  
ATOM   3892  H HB2  . ARG A 1 11 ? 1.205   10.395  -3.659  1.00 1.10 ? 11 ARG A HB2  9  
ATOM   3893  H HB3  . ARG A 1 11 ? -0.302  9.674   -4.214  1.00 1.13 ? 11 ARG A HB3  9  
ATOM   3894  H HG2  . ARG A 1 11 ? -0.472  12.017  -2.368  1.00 1.47 ? 11 ARG A HG2  9  
ATOM   3895  H HG3  . ARG A 1 11 ? -0.025  12.317  -4.047  1.00 1.47 ? 11 ARG A HG3  9  
ATOM   3896  H HD2  . ARG A 1 11 ? -2.357  10.504  -3.568  1.00 1.83 ? 11 ARG A HD2  9  
ATOM   3897  H HD3  . ARG A 1 11 ? -2.597  12.241  -3.292  1.00 1.67 ? 11 ARG A HD3  9  
ATOM   3898  H HE   . ARG A 1 11 ? -1.292  12.267  -5.684  1.00 2.40 ? 11 ARG A HE   9  
ATOM   3899  H HH11 . ARG A 1 11 ? -4.345  12.519  -5.278  1.00 2.41 ? 11 ARG A HH11 9  
ATOM   3900  H HH12 . ARG A 1 11 ? -4.909  11.399  -6.470  1.00 2.49 ? 11 ARG A HH12 9  
ATOM   3901  H HH21 . ARG A 1 11 ? -1.813  9.899   -6.891  1.00 3.00 ? 11 ARG A HH21 9  
ATOM   3902  H HH22 . ARG A 1 11 ? -3.471  9.909   -7.387  1.00 2.82 ? 11 ARG A HH22 9  
ATOM   3903  N N    . GLY A 1 12 ? -0.136  7.411   -3.264  1.00 1.08 ? 12 GLY A N    9  
ATOM   3904  C CA   . GLY A 1 12 ? 0.158   5.956   -3.435  1.00 1.08 ? 12 GLY A CA   9  
ATOM   3905  C C    . GLY A 1 12 ? 1.121   5.794   -4.605  1.00 0.98 ? 12 GLY A C    9  
ATOM   3906  O O    . GLY A 1 12 ? 1.078   4.824   -5.335  1.00 1.04 ? 12 GLY A O    9  
ATOM   3907  H H    . GLY A 1 12 ? -0.644  7.889   -3.953  1.00 1.10 ? 12 GLY A H    9  
ATOM   3908  H HA2  . GLY A 1 12 ? 0.614   5.570   -2.532  1.00 1.07 ? 12 GLY A HA2  9  
ATOM   3909  H HA3  . GLY A 1 12 ? -0.753  5.420   -3.642  1.00 1.19 ? 12 GLY A HA3  9  
ATOM   3910  N N    . ARG A 1 13 ? 1.979   6.761   -4.789  1.00 0.88 ? 13 ARG A N    9  
ATOM   3911  C CA   . ARG A 1 13 ? 2.949   6.717   -5.913  1.00 0.83 ? 13 ARG A CA   9  
ATOM   3912  C C    . ARG A 1 13 ? 4.392   6.659   -5.386  1.00 0.70 ? 13 ARG A C    9  
ATOM   3913  O O    . ARG A 1 13 ? 5.056   7.667   -5.233  1.00 0.63 ? 13 ARG A O    9  
ATOM   3914  C CB   . ARG A 1 13 ? 2.682   8.011   -6.698  1.00 0.83 ? 13 ARG A CB   9  
ATOM   3915  C CG   . ARG A 1 13 ? 2.760   9.239   -5.778  1.00 0.77 ? 13 ARG A CG   9  
ATOM   3916  C CD   . ARG A 1 13 ? 3.348   10.425  -6.549  1.00 0.83 ? 13 ARG A CD   9  
ATOM   3917  N NE   . ARG A 1 13 ? 4.826   10.233  -6.482  1.00 0.89 ? 13 ARG A NE   9  
ATOM   3918  C CZ   . ARG A 1 13 ? 5.513   10.764  -5.512  1.00 0.87 ? 13 ARG A CZ   9  
ATOM   3919  N NH1  . ARG A 1 13 ? 5.770   12.038  -5.521  1.00 1.06 ? 13 ARG A NH1  9  
ATOM   3920  N NH2  . ARG A 1 13 ? 5.941   10.019  -4.536  1.00 0.95 ? 13 ARG A NH2  9  
ATOM   3921  H H    . ARG A 1 13 ? 1.972   7.530   -4.188  1.00 0.90 ? 13 ARG A H    9  
ATOM   3922  H HA   . ARG A 1 13 ? 2.752   5.864   -6.538  1.00 0.93 ? 13 ARG A HA   9  
ATOM   3923  H HB2  . ARG A 1 13 ? 3.409   8.106   -7.479  1.00 0.85 ? 13 ARG A HB2  9  
ATOM   3924  H HB3  . ARG A 1 13 ? 1.695   7.961   -7.134  1.00 0.92 ? 13 ARG A HB3  9  
ATOM   3925  H HG2  . ARG A 1 13 ? 1.769   9.492   -5.432  1.00 0.85 ? 13 ARG A HG2  9  
ATOM   3926  H HG3  . ARG A 1 13 ? 3.389   9.018   -4.931  1.00 0.77 ? 13 ARG A HG3  9  
ATOM   3927  H HD2  . ARG A 1 13 ? 3.009   10.409  -7.576  1.00 0.96 ? 13 ARG A HD2  9  
ATOM   3928  H HD3  . ARG A 1 13 ? 3.073   11.355  -6.075  1.00 0.89 ? 13 ARG A HD3  9  
ATOM   3929  H HE   . ARG A 1 13 ? 5.283   9.700   -7.167  1.00 1.08 ? 13 ARG A HE   9  
ATOM   3930  H HH11 . ARG A 1 13 ? 5.442   12.610  -6.270  1.00 1.29 ? 13 ARG A HH11 9  
ATOM   3931  H HH12 . ARG A 1 13 ? 6.300   12.448  -4.770  1.00 1.11 ? 13 ARG A HH12 9  
ATOM   3932  H HH21 . ARG A 1 13 ? 5.738   9.037   -4.532  1.00 1.08 ? 13 ARG A HH21 9  
ATOM   3933  H HH22 . ARG A 1 13 ? 6.473   10.423  -3.788  1.00 1.05 ? 13 ARG A HH22 9  
ATOM   3934  N N    . LYS A 1 14 ? 4.881   5.478   -5.105  1.00 0.75 ? 14 LYS A N    9  
ATOM   3935  C CA   . LYS A 1 14 ? 6.280   5.342   -4.586  1.00 0.73 ? 14 LYS A CA   9  
ATOM   3936  C C    . LYS A 1 14 ? 7.307   5.551   -5.715  1.00 0.72 ? 14 LYS A C    9  
ATOM   3937  O O    . LYS A 1 14 ? 8.151   4.712   -5.972  1.00 0.83 ? 14 LYS A O    9  
ATOM   3938  C CB   . LYS A 1 14 ? 6.353   3.918   -4.016  1.00 0.92 ? 14 LYS A CB   9  
ATOM   3939  C CG   . LYS A 1 14 ? 6.165   2.881   -5.133  1.00 1.09 ? 14 LYS A CG   9  
ATOM   3940  C CD   . LYS A 1 14 ? 5.309   1.719   -4.618  1.00 1.58 ? 14 LYS A CD   9  
ATOM   3941  C CE   . LYS A 1 14 ? 6.173   0.776   -3.772  1.00 1.83 ? 14 LYS A CE   9  
ATOM   3942  N NZ   . LYS A 1 14 ? 5.778   1.048   -2.359  1.00 2.53 ? 14 LYS A NZ   9  
ATOM   3943  H H    . LYS A 1 14 ? 4.329   4.682   -5.233  1.00 0.86 ? 14 LYS A H    9  
ATOM   3944  H HA   . LYS A 1 14 ? 6.452   6.057   -3.797  1.00 0.68 ? 14 LYS A HA   9  
ATOM   3945  H HB2  . LYS A 1 14 ? 7.314   3.772   -3.552  1.00 0.95 ? 14 LYS A HB2  9  
ATOM   3946  H HB3  . LYS A 1 14 ? 5.577   3.790   -3.276  1.00 0.98 ? 14 LYS A HB3  9  
ATOM   3947  H HG2  . LYS A 1 14 ? 5.673   3.345   -5.977  1.00 1.19 ? 14 LYS A HG2  9  
ATOM   3948  H HG3  . LYS A 1 14 ? 7.129   2.507   -5.442  1.00 1.15 ? 14 LYS A HG3  9  
ATOM   3949  H HD2  . LYS A 1 14 ? 4.500   2.107   -4.016  1.00 2.03 ? 14 LYS A HD2  9  
ATOM   3950  H HD3  . LYS A 1 14 ? 4.901   1.174   -5.457  1.00 1.70 ? 14 LYS A HD3  9  
ATOM   3951  H HE2  . LYS A 1 14 ? 5.965   -0.254  -4.033  1.00 1.77 ? 14 LYS A HE2  9  
ATOM   3952  H HE3  . LYS A 1 14 ? 7.220   0.995   -3.914  1.00 1.96 ? 14 LYS A HE3  9  
ATOM   3953  H HZ1  . LYS A 1 14 ? 5.944   2.049   -2.137  1.00 2.79 ? 14 LYS A HZ1  9  
ATOM   3954  H HZ2  . LYS A 1 14 ? 4.770   0.826   -2.230  1.00 2.59 ? 14 LYS A HZ2  9  
ATOM   3955  H HZ3  . LYS A 1 14 ? 6.346   0.456   -1.720  1.00 2.91 ? 14 LYS A HZ3  9  
ATOM   3956  N N    . SER A 1 15 ? 7.242   6.676   -6.382  1.00 0.65 ? 15 SER A N    9  
ATOM   3957  C CA   . SER A 1 15 ? 8.201   6.966   -7.490  1.00 0.71 ? 15 SER A CA   9  
ATOM   3958  C C    . SER A 1 15 ? 8.316   8.482   -7.697  1.00 0.64 ? 15 SER A C    9  
ATOM   3959  O O    . SER A 1 15 ? 7.322   9.173   -7.833  1.00 0.85 ? 15 SER A O    9  
ATOM   3960  C CB   . SER A 1 15 ? 7.599   6.298   -8.727  1.00 0.91 ? 15 SER A CB   9  
ATOM   3961  O OG   . SER A 1 15 ? 8.639   6.007   -9.653  1.00 1.08 ? 15 SER A OG   9  
ATOM   3962  H H    . SER A 1 15 ? 6.557   7.337   -6.148  1.00 0.61 ? 15 SER A H    9  
ATOM   3963  H HA   . SER A 1 15 ? 9.169   6.540   -7.273  1.00 0.78 ? 15 SER A HA   9  
ATOM   3964  H HB2  . SER A 1 15 ? 7.111   5.381   -8.443  1.00 1.01 ? 15 SER A HB2  9  
ATOM   3965  H HB3  . SER A 1 15 ? 6.875   6.964   -9.179  1.00 0.92 ? 15 SER A HB3  9  
ATOM   3966  H HG   . SER A 1 15 ? 8.234   5.756   -10.487 1.00 1.41 ? 15 SER A HG   9  
ATOM   3967  N N    . GLY A 1 16 ? 9.518   9.002   -7.712  1.00 0.70 ? 16 GLY A N    9  
ATOM   3968  C CA   . GLY A 1 16 ? 9.701   10.473  -7.902  1.00 0.77 ? 16 GLY A CA   9  
ATOM   3969  C C    . GLY A 1 16 ? 9.402   11.201  -6.588  1.00 0.73 ? 16 GLY A C    9  
ATOM   3970  O O    . GLY A 1 16 ? 8.465   11.970  -6.495  1.00 0.90 ? 16 GLY A O    9  
ATOM   3971  H H    . GLY A 1 16 ? 10.301  8.424   -7.594  1.00 0.89 ? 16 GLY A H    9  
ATOM   3972  H HA2  . GLY A 1 16 ? 10.720  10.674  -8.202  1.00 0.85 ? 16 GLY A HA2  9  
ATOM   3973  H HA3  . GLY A 1 16 ? 9.025   10.826  -8.666  1.00 0.87 ? 16 GLY A HA3  9  
ATOM   3974  N N    . ASN A 1 17 ? 10.193  10.961  -5.572  1.00 0.69 ? 17 ASN A N    9  
ATOM   3975  C CA   . ASN A 1 17 ? 9.960   11.637  -4.259  1.00 0.73 ? 17 ASN A CA   9  
ATOM   3976  C C    . ASN A 1 17 ? 11.020  12.722  -4.023  1.00 0.76 ? 17 ASN A C    9  
ATOM   3977  O O    . ASN A 1 17 ? 12.163  12.582  -4.418  1.00 0.83 ? 17 ASN A O    9  
ATOM   3978  C CB   . ASN A 1 17 ? 10.074  10.526  -3.209  1.00 0.75 ? 17 ASN A CB   9  
ATOM   3979  C CG   . ASN A 1 17 ? 8.822   10.521  -2.328  1.00 0.96 ? 17 ASN A CG   9  
ATOM   3980  O OD1  . ASN A 1 17 ? 7.849   9.864   -2.640  1.00 1.73 ? 17 ASN A OD1  9  
ATOM   3981  N ND2  . ASN A 1 17 ? 8.801   11.233  -1.238  1.00 1.23 ? 17 ASN A ND2  9  
ATOM   3982  H H    . ASN A 1 17 ? 10.943  10.338  -5.673  1.00 0.77 ? 17 ASN A H    9  
ATOM   3983  H HA   . ASN A 1 17 ? 8.973   12.069  -4.231  1.00 0.79 ? 17 ASN A HA   9  
ATOM   3984  H HB2  . ASN A 1 17 ? 10.167  9.569   -3.703  1.00 0.78 ? 17 ASN A HB2  9  
ATOM   3985  H HB3  . ASN A 1 17 ? 10.943  10.698  -2.593  1.00 0.79 ? 17 ASN A HB3  9  
ATOM   3986  H HD21 . ASN A 1 17 ? 9.582   11.767  -0.984  1.00 1.82 ? 17 ASN A HD21 9  
ATOM   3987  H HD22 . ASN A 1 17 ? 8.001   11.235  -0.672  1.00 1.35 ? 17 ASN A HD22 9  
ATOM   3988  N N    . LYS A 1 18 ? 10.644  13.803  -3.388  1.00 0.81 ? 18 LYS A N    9  
ATOM   3989  C CA   . LYS A 1 18 ? 11.620  14.908  -3.128  1.00 0.88 ? 18 LYS A CA   9  
ATOM   3990  C C    . LYS A 1 18 ? 12.642  14.496  -2.055  1.00 1.00 ? 18 LYS A C    9  
ATOM   3991  O O    . LYS A 1 18 ? 12.295  13.846  -1.085  1.00 1.09 ? 18 LYS A O    9  
ATOM   3992  C CB   . LYS A 1 18 ? 10.766  16.082  -2.637  1.00 0.82 ? 18 LYS A CB   9  
ATOM   3993  C CG   . LYS A 1 18 ? 10.427  16.995  -3.817  1.00 0.88 ? 18 LYS A CG   9  
ATOM   3994  C CD   . LYS A 1 18 ? 9.158   17.793  -3.500  1.00 0.87 ? 18 LYS A CD   9  
ATOM   3995  C CE   . LYS A 1 18 ? 8.341   17.999  -4.782  1.00 1.03 ? 18 LYS A CE   9  
ATOM   3996  N NZ   . LYS A 1 18 ? 7.683   16.683  -5.056  1.00 1.12 ? 18 LYS A NZ   9  
ATOM   3997  H H    . LYS A 1 18 ? 9.716   13.892  -3.085  1.00 0.85 ? 18 LYS A H    9  
ATOM   3998  H HA   . LYS A 1 18 ? 12.126  15.181  -4.040  1.00 0.96 ? 18 LYS A HA   9  
ATOM   3999  H HB2  . LYS A 1 18 ? 9.854   15.704  -2.196  1.00 0.85 ? 18 LYS A HB2  9  
ATOM   4000  H HB3  . LYS A 1 18 ? 11.314  16.643  -1.897  1.00 0.87 ? 18 LYS A HB3  9  
ATOM   4001  H HG2  . LYS A 1 18 ? 11.247  17.675  -3.994  1.00 1.05 ? 18 LYS A HG2  9  
ATOM   4002  H HG3  . LYS A 1 18 ? 10.260  16.394  -4.700  1.00 1.00 ? 18 LYS A HG3  9  
ATOM   4003  H HD2  . LYS A 1 18 ? 8.565   17.253  -2.776  1.00 0.89 ? 18 LYS A HD2  9  
ATOM   4004  H HD3  . LYS A 1 18 ? 9.432   18.755  -3.093  1.00 1.05 ? 18 LYS A HD3  9  
ATOM   4005  H HE2  . LYS A 1 18 ? 7.597   18.769  -4.629  1.00 1.14 ? 18 LYS A HE2  9  
ATOM   4006  H HE3  . LYS A 1 18 ? 8.992   18.264  -5.601  1.00 1.21 ? 18 LYS A HE3  9  
ATOM   4007  H HZ1  . LYS A 1 18 ? 7.778   16.054  -4.221  1.00 1.21 ? 18 LYS A HZ1  9  
ATOM   4008  H HZ2  . LYS A 1 18 ? 6.672   16.832  -5.258  1.00 1.07 ? 18 LYS A HZ2  9  
ATOM   4009  H HZ3  . LYS A 1 18 ? 8.133   16.233  -5.875  1.00 1.31 ? 18 LYS A HZ3  9  
ATOM   4010  N N    . PRO A 1 19 ? 13.876  14.897  -2.268  1.00 1.12 ? 19 PRO A N    9  
ATOM   4011  C CA   . PRO A 1 19 ? 14.939  14.546  -1.278  1.00 1.29 ? 19 PRO A CA   9  
ATOM   4012  C C    . PRO A 1 19 ? 14.771  15.289  0.070   1.00 1.24 ? 19 PRO A C    9  
ATOM   4013  O O    . PRO A 1 19 ? 15.255  14.809  1.078   1.00 1.43 ? 19 PRO A O    9  
ATOM   4014  C CB   . PRO A 1 19 ? 16.243  14.928  -1.978  1.00 1.48 ? 19 PRO A CB   9  
ATOM   4015  C CG   . PRO A 1 19 ? 15.851  15.955  -2.983  1.00 1.43 ? 19 PRO A CG   9  
ATOM   4016  C CD   . PRO A 1 19 ? 14.456  15.604  -3.427  1.00 1.25 ? 19 PRO A CD   9  
ATOM   4017  H HA   . PRO A 1 19 ? 14.932  13.482  -1.104  1.00 1.43 ? 19 PRO A HA   9  
ATOM   4018  H HB2  . PRO A 1 19 ? 16.943  15.342  -1.265  1.00 1.54 ? 19 PRO A HB2  9  
ATOM   4019  H HB3  . PRO A 1 19 ? 16.670  14.070  -2.473  1.00 1.65 ? 19 PRO A HB3  9  
ATOM   4020  H HG2  . PRO A 1 19 ? 15.868  16.938  -2.536  1.00 1.39 ? 19 PRO A HG2  9  
ATOM   4021  H HG3  . PRO A 1 19 ? 16.521  15.921  -3.828  1.00 1.64 ? 19 PRO A HG3  9  
ATOM   4022  H HD2  . PRO A 1 19 ? 13.895  16.501  -3.649  1.00 1.17 ? 19 PRO A HD2  9  
ATOM   4023  H HD3  . PRO A 1 19 ? 14.485  14.949  -4.284  1.00 1.41 ? 19 PRO A HD3  9  
ATOM   4024  N N    . PRO A 1 20 ? 14.081  16.420  0.072   1.00 1.09 ? 20 PRO A N    9  
ATOM   4025  C CA   . PRO A 1 20 ? 13.905  17.114  1.388   1.00 1.20 ? 20 PRO A CA   9  
ATOM   4026  C C    . PRO A 1 20 ? 12.671  16.576  2.140   1.00 1.25 ? 20 PRO A C    9  
ATOM   4027  O O    . PRO A 1 20 ? 12.274  17.127  3.149   1.00 1.42 ? 20 PRO A O    9  
ATOM   4028  C CB   . PRO A 1 20 ? 13.709  18.582  1.022   1.00 1.21 ? 20 PRO A CB   9  
ATOM   4029  C CG   . PRO A 1 20 ? 13.179  18.555  -0.365  1.00 1.06 ? 20 PRO A CG   9  
ATOM   4030  C CD   . PRO A 1 20 ? 13.800  17.361  -1.032  1.00 1.05 ? 20 PRO A CD   9  
ATOM   4031  H HA   . PRO A 1 20 ? 14.790  17.003  1.994   1.00 1.35 ? 20 PRO A HA   9  
ATOM   4032  H HB2  . PRO A 1 20 ? 12.997  19.046  1.693   1.00 1.27 ? 20 PRO A HB2  9  
ATOM   4033  H HB3  . PRO A 1 20 ? 14.652  19.108  1.048   1.00 1.35 ? 20 PRO A HB3  9  
ATOM   4034  H HG2  . PRO A 1 20 ? 12.102  18.456  -0.348  1.00 1.00 ? 20 PRO A HG2  9  
ATOM   4035  H HG3  . PRO A 1 20 ? 13.462  19.453  -0.890  1.00 1.17 ? 20 PRO A HG3  9  
ATOM   4036  H HD2  . PRO A 1 20 ? 13.107  16.927  -1.739  1.00 1.00 ? 20 PRO A HD2  9  
ATOM   4037  H HD3  . PRO A 1 20 ? 14.717  17.641  -1.522  1.00 1.22 ? 20 PRO A HD3  9  
ATOM   4038  N N    . SER A 1 21 ? 12.065  15.508  1.654   1.00 1.21 ? 21 SER A N    9  
ATOM   4039  C CA   . SER A 1 21 ? 10.855  14.918  2.322   1.00 1.37 ? 21 SER A CA   9  
ATOM   4040  C C    . SER A 1 21 ? 9.662   15.889  2.259   1.00 1.34 ? 21 SER A C    9  
ATOM   4041  O O    . SER A 1 21 ? 8.727   15.673  1.514   1.00 1.35 ? 21 SER A O    9  
ATOM   4042  C CB   . SER A 1 21 ? 11.269  14.636  3.772   1.00 1.62 ? 21 SER A CB   9  
ATOM   4043  O OG   . SER A 1 21 ? 10.384  13.673  4.332   1.00 1.84 ? 21 SER A OG   9  
ATOM   4044  H H    . SER A 1 21 ? 12.408  15.087  0.839   1.00 1.16 ? 21 SER A H    9  
ATOM   4045  H HA   . SER A 1 21 ? 10.589  13.991  1.840   1.00 1.42 ? 21 SER A HA   9  
ATOM   4046  H HB2  . SER A 1 21 ? 12.274  14.248  3.792   1.00 1.76 ? 21 SER A HB2  9  
ATOM   4047  H HB3  . SER A 1 21 ? 11.229  15.552  4.345   1.00 1.73 ? 21 SER A HB3  9  
ATOM   4048  H HG   . SER A 1 21 ? 10.840  13.234  5.054   1.00 2.06 ? 21 SER A HG   9  
ATOM   4049  N N    . LYS A 1 22 ? 9.687   16.954  3.025   1.00 1.37 ? 22 LYS A N    9  
ATOM   4050  C CA   . LYS A 1 22 ? 8.552   17.927  2.995   1.00 1.39 ? 22 LYS A CA   9  
ATOM   4051  C C    . LYS A 1 22 ? 9.010   19.302  3.506   1.00 1.43 ? 22 LYS A C    9  
ATOM   4052  O O    . LYS A 1 22 ? 8.883   19.618  4.675   1.00 1.71 ? 22 LYS A O    9  
ATOM   4053  C CB   . LYS A 1 22 ? 7.483   17.327  3.918   1.00 1.73 ? 22 LYS A CB   9  
ATOM   4054  C CG   . LYS A 1 22 ? 6.130   17.322  3.199   1.00 1.66 ? 22 LYS A CG   9  
ATOM   4055  C CD   . LYS A 1 22 ? 5.101   18.108  4.021   1.00 1.82 ? 22 LYS A CD   9  
ATOM   4056  C CE   . LYS A 1 22 ? 5.392   19.612  3.927   1.00 1.61 ? 22 LYS A CE   9  
ATOM   4057  N NZ   . LYS A 1 22 ? 4.864   20.031  2.594   1.00 1.28 ? 22 LYS A NZ   9  
ATOM   4058  H H    . LYS A 1 22 ? 10.453  17.115  3.615   1.00 1.43 ? 22 LYS A H    9  
ATOM   4059  H HA   . LYS A 1 22 ? 8.163   18.014  1.992   1.00 1.24 ? 22 LYS A HA   9  
ATOM   4060  H HB2  . LYS A 1 22 ? 7.758   16.314  4.174   1.00 1.89 ? 22 LYS A HB2  9  
ATOM   4061  H HB3  . LYS A 1 22 ? 7.410   17.919  4.818   1.00 1.94 ? 22 LYS A HB3  9  
ATOM   4062  H HG2  . LYS A 1 22 ? 6.238   17.778  2.226   1.00 1.41 ? 22 LYS A HG2  9  
ATOM   4063  H HG3  . LYS A 1 22 ? 5.790   16.304  3.082   1.00 1.90 ? 22 LYS A HG3  9  
ATOM   4064  H HD2  . LYS A 1 22 ? 4.110   17.907  3.641   1.00 1.88 ? 22 LYS A HD2  9  
ATOM   4065  H HD3  . LYS A 1 22 ? 5.157   17.799  5.055   1.00 2.13 ? 22 LYS A HD3  9  
ATOM   4066  H HE2  . LYS A 1 22 ? 4.880   20.142  4.719   1.00 1.83 ? 22 LYS A HE2  9  
ATOM   4067  H HE3  . LYS A 1 22 ? 6.454   19.793  3.977   1.00 1.60 ? 22 LYS A HE3  9  
ATOM   4068  H HZ1  . LYS A 1 22 ? 3.900   19.663  2.466   1.00 1.32 ? 22 LYS A HZ1  9  
ATOM   4069  H HZ2  . LYS A 1 22 ? 4.850   21.073  2.535   1.00 1.26 ? 22 LYS A HZ2  9  
ATOM   4070  H HZ3  . LYS A 1 22 ? 5.487   19.658  1.841   1.00 1.15 ? 22 LYS A HZ3  9  
ATOM   4071  N N    . THR A 1 23 ? 9.537   20.120  2.631   1.00 1.24 ? 23 THR A N    9  
ATOM   4072  C CA   . THR A 1 23 ? 10.002  21.482  3.049   1.00 1.41 ? 23 THR A CA   9  
ATOM   4073  C C    . THR A 1 23 ? 9.304   22.574  2.217   1.00 1.36 ? 23 THR A C    9  
ATOM   4074  O O    . THR A 1 23 ? 9.784   23.688  2.117   1.00 1.53 ? 23 THR A O    9  
ATOM   4075  C CB   . THR A 1 23 ? 11.516  21.480  2.796   1.00 1.42 ? 23 THR A CB   9  
ATOM   4076  O OG1  . THR A 1 23 ? 12.092  22.652  3.357   1.00 1.75 ? 23 THR A OG1  9  
ATOM   4077  C CG2  . THR A 1 23 ? 11.803  21.443  1.291   1.00 1.24 ? 23 THR A CG2  9  
ATOM   4078  H H    . THR A 1 23 ? 9.620   19.842  1.694   1.00 1.05 ? 23 THR A H    9  
ATOM   4079  H HA   . THR A 1 23 ? 9.808   21.637  4.099   1.00 1.67 ? 23 THR A HA   9  
ATOM   4080  H HB   . THR A 1 23 ? 11.955  20.609  3.260   1.00 1.42 ? 23 THR A HB   9  
ATOM   4081  H HG1  . THR A 1 23 ? 11.672  23.417  2.952   1.00 1.78 ? 23 THR A HG1  9  
ATOM   4082  H HG21 . THR A 1 23 ? 11.329  22.286  0.812   1.00 1.61 ? 23 THR A HG21 9  
ATOM   4083  H HG22 . THR A 1 23 ? 12.870  21.490  1.127   1.00 1.71 ? 23 THR A HG22 9  
ATOM   4084  H HG23 . THR A 1 23 ? 11.416  20.526  0.872   1.00 1.43 ? 23 THR A HG23 9  
ATOM   4085  N N    . CYS A 1 24 ? 8.179   22.259  1.618   1.00 1.19 ? 24 CYS A N    9  
ATOM   4086  C CA   . CYS A 1 24 ? 7.446   23.265  0.789   1.00 1.17 ? 24 CYS A CA   9  
ATOM   4087  C C    . CYS A 1 24 ? 5.971   22.845  0.642   1.00 1.09 ? 24 CYS A C    9  
ATOM   4088  O O    . CYS A 1 24 ? 5.385   22.300  1.561   1.00 1.15 ? 24 CYS A O    9  
ATOM   4089  C CB   . CYS A 1 24 ? 8.173   23.247  -0.563  1.00 1.11 ? 24 CYS A CB   9  
ATOM   4090  S SG   . CYS A 1 24 ? 8.322   24.936  -1.195  1.00 1.51 ? 24 CYS A SG   9  
ATOM   4091  H H    . CYS A 1 24 ? 7.814   21.355  1.713   1.00 1.13 ? 24 CYS A H    9  
ATOM   4092  H HA   . CYS A 1 24 ? 7.517   24.243  1.235   1.00 1.37 ? 24 CYS A HA   9  
ATOM   4093  H HB2  . CYS A 1 24 ? 9.159   22.824  -0.436  1.00 1.19 ? 24 CYS A HB2  9  
ATOM   4094  H HB3  . CYS A 1 24 ? 7.615   22.646  -1.267  1.00 1.05 ? 24 CYS A HB3  9  
ATOM   4095  H HG   . CYS A 1 24 ? 8.992   25.388  -0.679  1.00 1.87 ? 24 CYS A HG   9  
ATOM   4096  N N    . LEU A 1 25 ? 5.366   23.079  -0.499  1.00 1.04 ? 25 LEU A N    9  
ATOM   4097  C CA   . LEU A 1 25 ? 3.938   22.674  -0.693  1.00 1.06 ? 25 LEU A CA   9  
ATOM   4098  C C    . LEU A 1 25 ? 3.782   21.874  -1.996  1.00 0.95 ? 25 LEU A C    9  
ATOM   4099  O O    . LEU A 1 25 ? 4.653   21.883  -2.847  1.00 0.94 ? 25 LEU A O    9  
ATOM   4100  C CB   . LEU A 1 25 ? 3.092   23.973  -0.715  1.00 1.20 ? 25 LEU A CB   9  
ATOM   4101  C CG   . LEU A 1 25 ? 3.724   25.111  -1.554  1.00 1.20 ? 25 LEU A CG   9  
ATOM   4102  C CD1  . LEU A 1 25 ? 4.903   25.737  -0.803  1.00 1.32 ? 25 LEU A CD1  9  
ATOM   4103  C CD2  . LEU A 1 25 ? 4.194   24.595  -2.918  1.00 1.11 ? 25 LEU A CD2  9  
ATOM   4104  H H    . LEU A 1 25 ? 5.851   23.511  -1.230  1.00 1.06 ? 25 LEU A H    9  
ATOM   4105  H HA   . LEU A 1 25 ? 3.625   22.062  0.139   1.00 1.18 ? 25 LEU A HA   9  
ATOM   4106  H HB2  . LEU A 1 25 ? 2.120   23.746  -1.124  1.00 1.26 ? 25 LEU A HB2  9  
ATOM   4107  H HB3  . LEU A 1 25 ? 2.965   24.319  0.301   1.00 1.36 ? 25 LEU A HB3  9  
ATOM   4108  H HG   . LEU A 1 25 ? 2.978   25.874  -1.709  1.00 1.33 ? 25 LEU A HG   9  
ATOM   4109  H HD11 . LEU A 1 25 ? 4.961   25.323  0.191   1.00 1.39 ? 25 LEU A HD11 9  
ATOM   4110  H HD12 . LEU A 1 25 ? 5.820   25.529  -1.334  1.00 1.62 ? 25 LEU A HD12 9  
ATOM   4111  H HD13 . LEU A 1 25 ? 4.760   26.807  -0.740  1.00 1.62 ? 25 LEU A HD13 9  
ATOM   4112  H HD21 . LEU A 1 25 ? 3.469   23.898  -3.309  1.00 1.35 ? 25 LEU A HD21 9  
ATOM   4113  H HD22 . LEU A 1 25 ? 4.295   25.426  -3.599  1.00 1.43 ? 25 LEU A HD22 9  
ATOM   4114  H HD23 . LEU A 1 25 ? 5.148   24.102  -2.812  1.00 1.66 ? 25 LEU A HD23 9  
ATOM   4115  N N    . LYS A 1 26 ? 2.681   21.171  -2.148  1.00 1.05 ? 26 LYS A N    9  
ATOM   4116  C CA   . LYS A 1 26 ? 2.455   20.352  -3.388  1.00 1.12 ? 26 LYS A CA   9  
ATOM   4117  C C    . LYS A 1 26 ? 3.687   19.483  -3.696  1.00 1.00 ? 26 LYS A C    9  
ATOM   4118  O O    . LYS A 1 26 ? 4.129   19.388  -4.828  1.00 1.13 ? 26 LYS A O    9  
ATOM   4119  C CB   . LYS A 1 26 ? 2.215   21.377  -4.503  1.00 1.27 ? 26 LYS A CB   9  
ATOM   4120  C CG   . LYS A 1 26 ? 0.718   21.681  -4.615  1.00 1.52 ? 26 LYS A CG   9  
ATOM   4121  C CD   . LYS A 1 26 ? 0.366   22.883  -3.731  1.00 1.56 ? 26 LYS A CD   9  
ATOM   4122  C CE   . LYS A 1 26 ? -0.374  22.411  -2.473  1.00 1.76 ? 26 LYS A CE   9  
ATOM   4123  N NZ   . LYS A 1 26 ? -1.676  21.864  -2.958  1.00 1.98 ? 26 LYS A NZ   9  
ATOM   4124  H H    . LYS A 1 26 ? 2.002   21.175  -1.442  1.00 1.16 ? 26 LYS A H    9  
ATOM   4125  H HA   . LYS A 1 26 ? 1.582   19.728  -3.270  1.00 1.26 ? 26 LYS A HA   9  
ATOM   4126  H HB2  . LYS A 1 26 ? 2.751   22.287  -4.275  1.00 1.23 ? 26 LYS A HB2  9  
ATOM   4127  H HB3  . LYS A 1 26 ? 2.570   20.978  -5.440  1.00 1.34 ? 26 LYS A HB3  9  
ATOM   4128  H HG2  . LYS A 1 26 ? 0.475   21.906  -5.644  1.00 1.69 ? 26 LYS A HG2  9  
ATOM   4129  H HG3  . LYS A 1 26 ? 0.153   20.819  -4.293  1.00 1.62 ? 26 LYS A HG3  9  
ATOM   4130  H HD2  . LYS A 1 26 ? 1.274   23.394  -3.441  1.00 1.47 ? 26 LYS A HD2  9  
ATOM   4131  H HD3  . LYS A 1 26 ? -0.266  23.562  -4.284  1.00 1.71 ? 26 LYS A HD3  9  
ATOM   4132  H HE2  . LYS A 1 26 ? 0.195   21.640  -1.973  1.00 1.75 ? 26 LYS A HE2  9  
ATOM   4133  H HE3  . LYS A 1 26 ? -0.547  23.241  -1.805  1.00 1.92 ? 26 LYS A HE3  9  
ATOM   4134  H HZ1  . LYS A 1 26 ? -1.997  22.401  -3.788  1.00 2.04 ? 26 LYS A HZ1  9  
ATOM   4135  H HZ2  . LYS A 1 26 ? -1.553  20.857  -3.218  1.00 1.96 ? 26 LYS A HZ2  9  
ATOM   4136  H HZ3  . LYS A 1 26 ? -2.385  21.940  -2.202  1.00 2.23 ? 26 LYS A HZ3  9  
ATOM   4137  N N    . GLU A 1 27 ? 4.251   18.857  -2.693  1.00 0.94 ? 27 GLU A N    9  
ATOM   4138  C CA   . GLU A 1 27 ? 5.460   18.009  -2.920  1.00 0.90 ? 27 GLU A CA   9  
ATOM   4139  C C    . GLU A 1 27 ? 5.056   16.567  -3.253  1.00 1.00 ? 27 GLU A C    9  
ATOM   4140  O O    . GLU A 1 27 ? 5.095   16.161  -4.399  1.00 1.01 ? 27 GLU A O    9  
ATOM   4141  C CB   . GLU A 1 27 ? 6.244   18.076  -1.606  1.00 0.87 ? 27 GLU A CB   9  
ATOM   4142  C CG   . GLU A 1 27 ? 6.818   19.486  -1.430  1.00 0.88 ? 27 GLU A CG   9  
ATOM   4143  C CD   . GLU A 1 27 ? 7.544   19.586  -0.090  1.00 0.85 ? 27 GLU A CD   9  
ATOM   4144  O OE1  . GLU A 1 27 ? 6.866   19.662  0.922   1.00 1.03 ? 27 GLU A OE1  9  
ATOM   4145  O OE2  . GLU A 1 27 ? 8.764   19.590  -0.093  1.00 0.94 ? 27 GLU A OE2  9  
ATOM   4146  H H    . GLU A 1 27 ? 3.885   18.953  -1.790  1.00 1.04 ? 27 GLU A H    9  
ATOM   4147  H HA   . GLU A 1 27 ? 6.054   18.420  -3.719  1.00 0.93 ? 27 GLU A HA   9  
ATOM   4148  H HB2  . GLU A 1 27 ? 5.584   17.850  -0.780  1.00 1.02 ? 27 GLU A HB2  9  
ATOM   4149  H HB3  . GLU A 1 27 ? 7.051   17.362  -1.629  1.00 0.89 ? 27 GLU A HB3  9  
ATOM   4150  H HG2  . GLU A 1 27 ? 7.510   19.693  -2.231  1.00 0.96 ? 27 GLU A HG2  9  
ATOM   4151  H HG3  . GLU A 1 27 ? 6.014   20.207  -1.455  1.00 1.09 ? 27 GLU A HG3  9  
ATOM   4152  N N    . GLU A 1 28 ? 4.677   15.790  -2.267  1.00 1.18 ? 28 GLU A N    9  
ATOM   4153  C CA   . GLU A 1 28 ? 4.279   14.371  -2.532  1.00 1.34 ? 28 GLU A CA   9  
ATOM   4154  C C    . GLU A 1 28 ? 2.755   14.218  -2.433  1.00 1.46 ? 28 GLU A C    9  
ATOM   4155  O O    . GLU A 1 28 ? 2.133   13.567  -3.253  1.00 1.62 ? 28 GLU A O    9  
ATOM   4156  C CB   . GLU A 1 28 ? 4.980   13.548  -1.443  1.00 1.50 ? 28 GLU A CB   9  
ATOM   4157  C CG   . GLU A 1 28 ? 6.455   13.969  -1.325  1.00 1.40 ? 28 GLU A CG   9  
ATOM   4158  C CD   . GLU A 1 28 ? 7.142   13.888  -2.694  1.00 1.39 ? 28 GLU A CD   9  
ATOM   4159  O OE1  . GLU A 1 28 ? 7.041   12.853  -3.330  1.00 1.75 ? 28 GLU A OE1  9  
ATOM   4160  O OE2  . GLU A 1 28 ? 7.762   14.866  -3.083  1.00 1.39 ? 28 GLU A OE2  9  
ATOM   4161  H H    . GLU A 1 28 ? 4.662   16.135  -1.351  1.00 1.27 ? 28 GLU A H    9  
ATOM   4162  H HA   . GLU A 1 28 ? 4.624   14.060  -3.506  1.00 1.31 ? 28 GLU A HA   9  
ATOM   4163  H HB2  . GLU A 1 28 ? 4.486   13.711  -0.496  1.00 1.63 ? 28 GLU A HB2  9  
ATOM   4164  H HB3  . GLU A 1 28 ? 4.929   12.500  -1.698  1.00 1.65 ? 28 GLU A HB3  9  
ATOM   4165  H HG2  . GLU A 1 28 ? 6.509   14.983  -0.958  1.00 1.27 ? 28 GLU A HG2  9  
ATOM   4166  H HG3  . GLU A 1 28 ? 6.959   13.315  -0.635  1.00 1.61 ? 28 GLU A HG3  9  
ATOM   4167  N N    . MET A 1 29 ? 2.151   14.820  -1.439  1.00 1.50 ? 29 MET A N    9  
ATOM   4168  C CA   . MET A 1 29 ? 0.668   14.729  -1.277  1.00 1.70 ? 29 MET A CA   9  
ATOM   4169  C C    . MET A 1 29 ? 0.095   16.117  -0.964  1.00 1.67 ? 29 MET A C    9  
ATOM   4170  O O    . MET A 1 29 ? 0.668   16.866  -0.196  1.00 1.71 ? 29 MET A O    9  
ATOM   4171  C CB   . MET A 1 29 ? 0.460   13.775  -0.098  1.00 1.83 ? 29 MET A CB   9  
ATOM   4172  C CG   . MET A 1 29 ? -1.029  13.445  0.044   1.00 2.21 ? 29 MET A CG   9  
ATOM   4173  S SD   . MET A 1 29 ? -1.287  12.467  1.545   1.00 2.82 ? 29 MET A SD   9  
ATOM   4174  C CE   . MET A 1 29 ? -2.989  12.990  1.867   1.00 3.11 ? 29 MET A CE   9  
ATOM   4175  H H    . MET A 1 29 ? 2.676   15.342  -0.796  1.00 1.47 ? 29 MET A H    9  
ATOM   4176  H HA   . MET A 1 29 ? 0.215   14.323  -2.168  1.00 1.95 ? 29 MET A HA   9  
ATOM   4177  H HB2  . MET A 1 29 ? 1.014   12.865  -0.273  1.00 1.89 ? 29 MET A HB2  9  
ATOM   4178  H HB3  . MET A 1 29 ? 0.811   14.242  0.810   1.00 1.82 ? 29 MET A HB3  9  
ATOM   4179  H HG2  . MET A 1 29 ? -1.596  14.362  0.109   1.00 2.47 ? 29 MET A HG2  9  
ATOM   4180  H HG3  . MET A 1 29 ? -1.356  12.879  -0.815  1.00 2.49 ? 29 MET A HG3  9  
ATOM   4181  H HE1  . MET A 1 29 ? -3.589  12.824  0.984   1.00 3.43 ? 29 MET A HE1  9  
ATOM   4182  H HE2  . MET A 1 29 ? -3.389  12.419  2.694   1.00 3.33 ? 29 MET A HE2  9  
ATOM   4183  H HE3  . MET A 1 29 ? -3.004  14.039  2.117   1.00 3.46 ? 29 MET A HE3  9  
ATOM   4184  N N    . ALA A 1 30 ? -1.026  16.457  -1.563  1.00 1.87 ? 30 ALA A N    9  
ATOM   4185  C CA   . ALA A 1 30 ? -1.662  17.797  -1.328  1.00 1.98 ? 30 ALA A CA   9  
ATOM   4186  C C    . ALA A 1 30 ? -0.791  18.919  -1.922  1.00 1.76 ? 30 ALA A C    9  
ATOM   4187  O O    . ALA A 1 30 ? -1.024  19.268  -3.069  1.00 1.96 ? 30 ALA A O    9  
ATOM   4188  C CB   . ALA A 1 30 ? -1.802  17.933  0.194   1.00 2.25 ? 30 ALA A CB   9  
ATOM   4189  O OXT  . ALA A 1 30 ? 0.089   19.414  -1.233  1.00 1.74 ? 30 ALA A OXT  9  
ATOM   4190  H H    . ALA A 1 30 ? -1.452  15.825  -2.178  1.00 2.09 ? 30 ALA A H    9  
ATOM   4191  H HA   . ALA A 1 30 ? -2.641  17.818  -1.783  1.00 2.29 ? 30 ALA A HA   9  
ATOM   4192  H HB1  . ALA A 1 30 ? -2.047  16.973  0.622   1.00 2.64 ? 30 ALA A HB1  9  
ATOM   4193  H HB2  . ALA A 1 30 ? -0.871  18.287  0.612   1.00 2.47 ? 30 ALA A HB2  9  
ATOM   4194  H HB3  . ALA A 1 30 ? -2.588  18.640  0.422   1.00 2.53 ? 30 ALA A HB3  9  
ATOM   4195  N N    . MET A 1 1  ? 2.067   3.859   21.711  1.00 3.57 ? 1  MET A N    10 
ATOM   4196  C CA   . MET A 1 1  ? 1.755   5.155   22.392  1.00 3.21 ? 1  MET A CA   10 
ATOM   4197  C C    . MET A 1 1  ? 0.261   5.483   22.256  1.00 2.84 ? 1  MET A C    10 
ATOM   4198  O O    . MET A 1 1  ? -0.522  4.661   21.817  1.00 2.82 ? 1  MET A O    10 
ATOM   4199  C CB   . MET A 1 1  ? 2.609   6.203   21.664  1.00 3.37 ? 1  MET A CB   10 
ATOM   4200  C CG   . MET A 1 1  ? 3.567   6.866   22.657  1.00 3.77 ? 1  MET A CG   10 
ATOM   4201  S SD   . MET A 1 1  ? 4.791   5.655   23.217  1.00 4.63 ? 1  MET A SD   10 
ATOM   4202  C CE   . MET A 1 1  ? 6.169   6.236   22.198  1.00 5.09 ? 1  MET A CE   10 
ATOM   4203  H H1   . MET A 1 1  ? 1.766   3.907   20.714  1.00 3.91 ? 1  MET A H1   10 
ATOM   4204  H H2   . MET A 1 1  ? 3.090   3.678   21.755  1.00 3.71 ? 1  MET A H2   10 
ATOM   4205  H H3   . MET A 1 1  ? 1.557   3.087   22.188  1.00 3.74 ? 1  MET A H3   10 
ATOM   4206  H HA   . MET A 1 1  ? 2.036   5.109   23.433  1.00 3.40 ? 1  MET A HA   10 
ATOM   4207  H HB2  . MET A 1 1  ? 3.178   5.724   20.880  1.00 3.60 ? 1  MET A HB2  10 
ATOM   4208  H HB3  . MET A 1 1  ? 1.966   6.955   21.231  1.00 3.28 ? 1  MET A HB3  10 
ATOM   4209  H HG2  . MET A 1 1  ? 4.071   7.691   22.175  1.00 3.96 ? 1  MET A HG2  10 
ATOM   4210  H HG3  . MET A 1 1  ? 3.008   7.233   23.507  1.00 3.77 ? 1  MET A HG3  10 
ATOM   4211  H HE1  . MET A 1 1  ? 5.855   6.300   21.168  1.00 5.36 ? 1  MET A HE1  10 
ATOM   4212  H HE2  . MET A 1 1  ? 6.482   7.213   22.540  1.00 5.31 ? 1  MET A HE2  10 
ATOM   4213  H HE3  . MET A 1 1  ? 6.992   5.539   22.278  1.00 5.33 ? 1  MET A HE3  10 
ATOM   4214  N N    . ILE A 1 2  ? -0.140  6.677   22.625  1.00 2.80 ? 2  ILE A N    10 
ATOM   4215  C CA   . ILE A 1 2  ? -1.589  7.055   22.510  1.00 2.63 ? 2  ILE A CA   10 
ATOM   4216  C C    . ILE A 1 2  ? -2.044  6.966   21.046  1.00 2.18 ? 2  ILE A C    10 
ATOM   4217  O O    . ILE A 1 2  ? -1.359  7.428   20.152  1.00 2.04 ? 2  ILE A O    10 
ATOM   4218  C CB   . ILE A 1 2  ? -1.693  8.502   23.024  1.00 3.02 ? 2  ILE A CB   10 
ATOM   4219  C CG1  . ILE A 1 2  ? -0.732  9.414   22.247  1.00 3.17 ? 2  ILE A CG1  10 
ATOM   4220  C CG2  . ILE A 1 2  ? -1.340  8.548   24.513  1.00 3.49 ? 2  ILE A CG2  10 
ATOM   4221  C CD1  . ILE A 1 2  ? -1.532  10.475  21.490  1.00 3.56 ? 2  ILE A CD1  10 
ATOM   4222  H H    . ILE A 1 2  ? 0.509   7.323   22.975  1.00 3.05 ? 2  ILE A H    10 
ATOM   4223  H HA   . ILE A 1 2  ? -2.191  6.406   23.126  1.00 2.76 ? 2  ILE A HA   10 
ATOM   4224  H HB   . ILE A 1 2  ? -2.706  8.853   22.890  1.00 3.06 ? 2  ILE A HB   10 
ATOM   4225  H HG12 . ILE A 1 2  ? -0.056  9.897   22.937  1.00 3.48 ? 2  ILE A HG12 10 
ATOM   4226  H HG13 . ILE A 1 2  ? -0.164  8.826   21.542  1.00 2.91 ? 2  ILE A HG13 10 
ATOM   4227  H HG21 . ILE A 1 2  ? -1.774  7.695   25.013  1.00 3.51 ? 2  ILE A HG21 10 
ATOM   4228  H HG22 . ILE A 1 2  ? -0.266  8.527   24.631  1.00 3.88 ? 2  ILE A HG22 10 
ATOM   4229  H HG23 . ILE A 1 2  ? -1.732  9.456   24.948  1.00 3.83 ? 2  ILE A HG23 10 
ATOM   4230  H HD11 . ILE A 1 2  ? -2.312  10.864  22.129  1.00 3.80 ? 2  ILE A HD11 10 
ATOM   4231  H HD12 . ILE A 1 2  ? -0.875  11.281  21.196  1.00 3.81 ? 2  ILE A HD12 10 
ATOM   4232  H HD13 . ILE A 1 2  ? -1.975  10.034  20.610  1.00 3.82 ? 2  ILE A HD13 10 
ATOM   4233  N N    . SER A 1 3  ? -3.189  6.362   20.806  1.00 2.07 ? 3  SER A N    10 
ATOM   4234  C CA   . SER A 1 3  ? -3.727  6.208   19.407  1.00 1.76 ? 3  SER A CA   10 
ATOM   4235  C C    . SER A 1 3  ? -2.807  5.317   18.554  1.00 1.52 ? 3  SER A C    10 
ATOM   4236  O O    . SER A 1 3  ? -3.192  4.236   18.150  1.00 1.60 ? 3  SER A O    10 
ATOM   4237  C CB   . SER A 1 3  ? -3.816  7.627   18.827  1.00 1.76 ? 3  SER A CB   10 
ATOM   4238  O OG   . SER A 1 3  ? -4.042  7.549   17.424  1.00 1.60 ? 3  SER A OG   10 
ATOM   4239  H H    . SER A 1 3  ? -3.704  5.999   21.557  1.00 2.28 ? 3  SER A H    10 
ATOM   4240  H HA   . SER A 1 3  ? -4.715  5.775   19.442  1.00 1.87 ? 3  SER A HA   10 
ATOM   4241  H HB2  . SER A 1 3  ? -4.634  8.154   19.290  1.00 1.94 ? 3  SER A HB2  10 
ATOM   4242  H HB3  . SER A 1 3  ? -2.895  8.157   19.024  1.00 1.88 ? 3  SER A HB3  10 
ATOM   4243  H HG   . SER A 1 3  ? -4.964  7.766   17.257  1.00 1.84 ? 3  SER A HG   10 
ATOM   4244  N N    . SER A 1 4  ? -1.599  5.762   18.277  1.00 1.40 ? 4  SER A N    10 
ATOM   4245  C CA   . SER A 1 4  ? -0.639  4.953   17.448  1.00 1.23 ? 4  SER A CA   10 
ATOM   4246  C C    . SER A 1 4  ? -1.234  4.611   16.072  1.00 0.96 ? 4  SER A C    10 
ATOM   4247  O O    . SER A 1 4  ? -0.832  3.657   15.433  1.00 1.08 ? 4  SER A O    10 
ATOM   4248  C CB   . SER A 1 4  ? -0.387  3.677   18.249  1.00 1.47 ? 4  SER A CB   10 
ATOM   4249  O OG   . SER A 1 4  ? 0.350   3.990   19.426  1.00 1.82 ? 4  SER A OG   10 
ATOM   4250  H H    . SER A 1 4  ? -1.320  6.640   18.617  1.00 1.53 ? 4  SER A H    10 
ATOM   4251  H HA   . SER A 1 4  ? 0.287   5.491   17.325  1.00 1.34 ? 4  SER A HA   10 
ATOM   4252  H HB2  . SER A 1 4  ? -1.328  3.234   18.526  1.00 1.52 ? 4  SER A HB2  10 
ATOM   4253  H HB3  . SER A 1 4  ? 0.167   2.981   17.637  1.00 1.54 ? 4  SER A HB3  10 
ATOM   4254  H HG   . SER A 1 4  ? -0.282  4.205   20.123  1.00 1.96 ? 4  SER A HG   10 
ATOM   4255  N N    . VAL A 1 5  ? -2.185  5.382   15.616  1.00 0.88 ? 5  VAL A N    10 
ATOM   4256  C CA   . VAL A 1 5  ? -2.812  5.109   14.283  1.00 0.90 ? 5  VAL A CA   10 
ATOM   4257  C C    . VAL A 1 5  ? -2.012  5.772   13.150  1.00 0.81 ? 5  VAL A C    10 
ATOM   4258  O O    . VAL A 1 5  ? -2.045  5.327   12.019  1.00 1.06 ? 5  VAL A O    10 
ATOM   4259  C CB   . VAL A 1 5  ? -4.229  5.695   14.378  1.00 1.19 ? 5  VAL A CB   10 
ATOM   4260  C CG1  . VAL A 1 5  ? -4.182  7.225   14.287  1.00 1.30 ? 5  VAL A CG1  10 
ATOM   4261  C CG2  . VAL A 1 5  ? -5.085  5.149   13.233  1.00 1.50 ? 5  VAL A CG2  10 
ATOM   4262  H H    . VAL A 1 5  ? -2.487  6.141   16.151  1.00 1.04 ? 5  VAL A H    10 
ATOM   4263  H HA   . VAL A 1 5  ? -2.869  4.049   14.115  1.00 1.02 ? 5  VAL A HA   10 
ATOM   4264  H HB   . VAL A 1 5  ? -4.668  5.409   15.322  1.00 1.31 ? 5  VAL A HB   10 
ATOM   4265  H HG11 . VAL A 1 5  ? -3.480  7.608   15.013  1.00 1.76 ? 5  VAL A HG11 10 
ATOM   4266  H HG12 . VAL A 1 5  ? -3.871  7.517   13.296  1.00 1.56 ? 5  VAL A HG12 10 
ATOM   4267  H HG13 . VAL A 1 5  ? -5.164  7.627   14.490  1.00 1.65 ? 5  VAL A HG13 10 
ATOM   4268  H HG21 . VAL A 1 5  ? -5.058  4.069   13.248  1.00 1.90 ? 5  VAL A HG21 10 
ATOM   4269  H HG22 . VAL A 1 5  ? -6.103  5.487   13.352  1.00 1.81 ? 5  VAL A HG22 10 
ATOM   4270  H HG23 . VAL A 1 5  ? -4.695  5.506   12.290  1.00 1.95 ? 5  VAL A HG23 10 
ATOM   4271  N N    . CYS A 1 6  ? -1.298  6.832   13.453  1.00 0.68 ? 6  CYS A N    10 
ATOM   4272  C CA   . CYS A 1 6  ? -0.489  7.545   12.413  1.00 0.72 ? 6  CYS A CA   10 
ATOM   4273  C C    . CYS A 1 6  ? -1.393  8.078   11.290  1.00 0.78 ? 6  CYS A C    10 
ATOM   4274  O O    . CYS A 1 6  ? -2.601  8.137   11.424  1.00 0.97 ? 6  CYS A O    10 
ATOM   4275  C CB   . CYS A 1 6  ? 0.495   6.496   11.877  1.00 0.97 ? 6  CYS A CB   10 
ATOM   4276  S SG   . CYS A 1 6  ? 2.127   7.250   11.662  1.00 1.66 ? 6  CYS A SG   10 
ATOM   4277  H H    . CYS A 1 6  ? -1.297  7.162   14.368  1.00 0.77 ? 6  CYS A H    10 
ATOM   4278  H HA   . CYS A 1 6  ? 0.059   8.359   12.863  1.00 0.83 ? 6  CYS A HA   10 
ATOM   4279  H HB2  . CYS A 1 6  ? 0.567   5.678   12.578  1.00 1.27 ? 6  CYS A HB2  10 
ATOM   4280  H HB3  . CYS A 1 6  ? 0.142   6.123   10.927  1.00 1.34 ? 6  CYS A HB3  10 
ATOM   4281  H HG   . CYS A 1 6  ? 2.308   7.301   10.721  1.00 2.02 ? 6  CYS A HG   10 
ATOM   4282  N N    . VAL A 1 7  ? -0.809  8.469   10.189  1.00 0.84 ? 7  VAL A N    10 
ATOM   4283  C CA   . VAL A 1 7  ? -1.610  9.000   9.049   1.00 1.06 ? 7  VAL A CA   10 
ATOM   4284  C C    . VAL A 1 7  ? -1.219  8.284   7.750   1.00 1.02 ? 7  VAL A C    10 
ATOM   4285  O O    . VAL A 1 7  ? -0.221  7.587   7.685   1.00 0.94 ? 7  VAL A O    10 
ATOM   4286  C CB   . VAL A 1 7  ? -1.269  10.496  8.986   1.00 1.33 ? 7  VAL A CB   10 
ATOM   4287  C CG1  . VAL A 1 7  ? 0.197   10.690  8.581   1.00 1.34 ? 7  VAL A CG1  10 
ATOM   4288  C CG2  . VAL A 1 7  ? -2.171  11.192  7.963   1.00 1.67 ? 7  VAL A CG2  10 
ATOM   4289  H H    . VAL A 1 7  ? 0.161   8.414   10.109  1.00 0.87 ? 7  VAL A H    10 
ATOM   4290  H HA   . VAL A 1 7  ? -2.664  8.872   9.242   1.00 1.19 ? 7  VAL A HA   10 
ATOM   4291  H HB   . VAL A 1 7  ? -1.430  10.934  9.958   1.00 1.37 ? 7  VAL A HB   10 
ATOM   4292  H HG11 . VAL A 1 7  ? 0.373   10.221  7.625   1.00 1.87 ? 7  VAL A HG11 10 
ATOM   4293  H HG12 . VAL A 1 7  ? 0.414   11.745  8.511   1.00 1.49 ? 7  VAL A HG12 10 
ATOM   4294  H HG13 . VAL A 1 7  ? 0.839   10.240  9.325   1.00 1.47 ? 7  VAL A HG13 10 
ATOM   4295  H HG21 . VAL A 1 7  ? -3.181  10.825  8.066   1.00 1.71 ? 7  VAL A HG21 10 
ATOM   4296  H HG22 . VAL A 1 7  ? -2.156  12.258  8.138   1.00 1.87 ? 7  VAL A HG22 10 
ATOM   4297  H HG23 . VAL A 1 7  ? -1.812  10.985  6.967   1.00 1.81 ? 7  VAL A HG23 10 
HETATM 4298  N N    . SEP A 1 8  ? -2.006  8.455   6.723   1.00 1.22 ? 8  SEP A N    10 
HETATM 4299  C CA   . SEP A 1 8  ? -1.715  7.794   5.407   1.00 1.26 ? 8  SEP A CA   10 
HETATM 4300  C CB   . SEP A 1 8  ? -2.705  8.418   4.422   1.00 1.37 ? 8  SEP A CB   10 
HETATM 4301  O OG   . SEP A 1 8  ? -4.036  8.035   4.787   1.00 2.03 ? 8  SEP A OG   10 
HETATM 4302  C C    . SEP A 1 8  ? -0.272  8.069   4.966   1.00 1.22 ? 8  SEP A C    10 
HETATM 4303  O O    . SEP A 1 8  ? 0.446   7.165   4.589   1.00 1.26 ? 8  SEP A O    10 
HETATM 4304  P P    . SEP A 1 8  ? -5.288  8.406   3.843   1.00 2.90 ? 8  SEP A P    10 
HETATM 4305  O O1P  . SEP A 1 8  ? -4.993  7.927   2.474   1.00 3.45 ? 8  SEP A O1P  10 
HETATM 4306  O O2P  . SEP A 1 8  ? -6.526  7.973   4.526   1.00 3.53 ? 8  SEP A O2P  10 
HETATM 4307  O O3P  . SEP A 1 8  ? -5.257  10.015  3.831   1.00 3.38 ? 8  SEP A O3P  10 
HETATM 4308  H H    . SEP A 1 8  ? -2.798  9.019   6.819   1.00 1.40 ? 8  SEP A H    10 
HETATM 4309  H HA   . SEP A 1 8  ? -1.885  6.736   5.475   1.00 1.30 ? 8  SEP A HA   10 
HETATM 4310  H HB2  . SEP A 1 8  ? -2.481  8.074   3.423   1.00 1.54 ? 8  SEP A HB2  10 
HETATM 4311  H HB3  . SEP A 1 8  ? -2.622  9.492   4.456   1.00 1.56 ? 8  SEP A HB3  10 
HETATM 4312  H HOP3 . SEP A 1 8  ? -4.476  10.281  3.342   1.00 3.51 ? 8  SEP A HOP3 10 
ATOM   4313  N N    . SER A 1 9  ? 0.145   9.313   5.028   1.00 1.27 ? 9  SER A N    10 
ATOM   4314  C CA   . SER A 1 9  ? 1.541   9.703   4.633   1.00 1.36 ? 9  SER A CA   10 
ATOM   4315  C C    . SER A 1 9  ? 1.782   9.484   3.138   1.00 1.17 ? 9  SER A C    10 
ATOM   4316  O O    . SER A 1 9  ? 1.826   8.368   2.666   1.00 1.00 ? 9  SER A O    10 
ATOM   4317  C CB   . SER A 1 9  ? 2.482   8.814   5.447   1.00 1.53 ? 9  SER A CB   10 
ATOM   4318  O OG   . SER A 1 9  ? 2.156   8.906   6.830   1.00 1.78 ? 9  SER A OG   10 
ATOM   4319  H H    . SER A 1 9  ? -0.467  10.001  5.346   1.00 1.33 ? 9  SER A H    10 
ATOM   4320  H HA   . SER A 1 9  ? 1.718   10.736  4.887   1.00 1.52 ? 9  SER A HA   10 
ATOM   4321  H HB2  . SER A 1 9  ? 2.381   7.792   5.122   1.00 1.44 ? 9  SER A HB2  10 
ATOM   4322  H HB3  . SER A 1 9  ? 3.501   9.139   5.283   1.00 1.63 ? 9  SER A HB3  10 
ATOM   4323  H HG   . SER A 1 9  ? 1.514   8.218   7.034   1.00 1.74 ? 9  SER A HG   10 
ATOM   4324  N N    . TYR A 1 10 ? 1.971   10.556  2.406   1.00 1.28 ? 10 TYR A N    10 
ATOM   4325  C CA   . TYR A 1 10 ? 2.247   10.469  0.936   1.00 1.22 ? 10 TYR A CA   10 
ATOM   4326  C C    . TYR A 1 10 ? 1.119   9.728   0.181   1.00 0.96 ? 10 TYR A C    10 
ATOM   4327  O O    . TYR A 1 10 ? 0.251   9.112   0.770   1.00 0.83 ? 10 TYR A O    10 
ATOM   4328  C CB   . TYR A 1 10 ? 3.621   9.765   0.855   1.00 1.32 ? 10 TYR A CB   10 
ATOM   4329  C CG   . TYR A 1 10 ? 3.573   8.509   0.021   1.00 1.12 ? 10 TYR A CG   10 
ATOM   4330  C CD1  . TYR A 1 10 ? 3.734   8.591   -1.361  1.00 1.02 ? 10 TYR A CD1  10 
ATOM   4331  C CD2  . TYR A 1 10 ? 3.391   7.267   0.637   1.00 1.11 ? 10 TYR A CD2  10 
ATOM   4332  C CE1  . TYR A 1 10 ? 3.710   7.428   -2.138  1.00 0.88 ? 10 TYR A CE1  10 
ATOM   4333  C CE2  . TYR A 1 10 ? 3.364   6.102   -0.136  1.00 1.04 ? 10 TYR A CE2  10 
ATOM   4334  C CZ   . TYR A 1 10 ? 3.523   6.181   -1.525  1.00 0.91 ? 10 TYR A CZ   10 
ATOM   4335  O OH   . TYR A 1 10 ? 3.498   5.033   -2.290  1.00 0.92 ? 10 TYR A OH   10 
ATOM   4336  H H    . TYR A 1 10 ? 1.954   11.429  2.834   1.00 1.45 ? 10 TYR A H    10 
ATOM   4337  H HA   . TYR A 1 10 ? 2.342   11.465  0.534   1.00 1.37 ? 10 TYR A HA   10 
ATOM   4338  H HB2  . TYR A 1 10 ? 4.334   10.443  0.415   1.00 1.42 ? 10 TYR A HB2  10 
ATOM   4339  H HB3  . TYR A 1 10 ? 3.945   9.513   1.853   1.00 1.48 ? 10 TYR A HB3  10 
ATOM   4340  H HD1  . TYR A 1 10 ? 3.873   9.555   -1.828  1.00 1.11 ? 10 TYR A HD1  10 
ATOM   4341  H HD2  . TYR A 1 10 ? 3.267   7.209   1.712   1.00 1.23 ? 10 TYR A HD2  10 
ATOM   4342  H HE1  . TYR A 1 10 ? 3.836   7.491   -3.208  1.00 0.84 ? 10 TYR A HE1  10 
ATOM   4343  H HE2  . TYR A 1 10 ? 3.219   5.143   0.337   1.00 1.14 ? 10 TYR A HE2  10 
ATOM   4344  H HH   . TYR A 1 10 ? 2.769   4.487   -1.983  1.00 1.01 ? 10 TYR A HH   10 
ATOM   4345  N N    . ARG A 1 11 ? 1.125   9.814   -1.126  1.00 0.93 ? 11 ARG A N    10 
ATOM   4346  C CA   . ARG A 1 11 ? 0.064   9.148   -1.950  1.00 0.80 ? 11 ARG A CA   10 
ATOM   4347  C C    . ARG A 1 11 ? 0.297   7.626   -2.003  1.00 0.66 ? 11 ARG A C    10 
ATOM   4348  O O    . ARG A 1 11 ? 0.762   7.028   -1.054  1.00 0.69 ? 11 ARG A O    10 
ATOM   4349  C CB   . ARG A 1 11 ? 0.211   9.774   -3.347  1.00 0.96 ? 11 ARG A CB   10 
ATOM   4350  C CG   . ARG A 1 11 ? 0.004   11.290  -3.269  1.00 1.17 ? 11 ARG A CG   10 
ATOM   4351  C CD   . ARG A 1 11 ? -1.393  11.645  -3.787  1.00 1.09 ? 11 ARG A CD   10 
ATOM   4352  N NE   . ARG A 1 11 ? -1.714  12.955  -3.152  1.00 1.26 ? 11 ARG A NE   10 
ATOM   4353  C CZ   . ARG A 1 11 ? -2.284  12.989  -1.979  1.00 1.40 ? 11 ARG A CZ   10 
ATOM   4354  N NH1  . ARG A 1 11 ? -1.557  12.964  -0.901  1.00 1.62 ? 11 ARG A NH1  10 
ATOM   4355  N NH2  . ARG A 1 11 ? -3.580  13.050  -1.886  1.00 1.44 ? 11 ARG A NH2  10 
ATOM   4356  H H    . ARG A 1 11 ? 1.826   10.333  -1.571  1.00 1.05 ? 11 ARG A H    10 
ATOM   4357  H HA   . ARG A 1 11 ? -0.912  9.360   -1.555  1.00 0.84 ? 11 ARG A HA   10 
ATOM   4358  H HB2  . ARG A 1 11 ? 1.200   9.567   -3.728  1.00 1.05 ? 11 ARG A HB2  10 
ATOM   4359  H HB3  . ARG A 1 11 ? -0.524  9.349   -4.009  1.00 0.95 ? 11 ARG A HB3  10 
ATOM   4360  H HG2  . ARG A 1 11 ? 0.101   11.614  -2.243  1.00 1.53 ? 11 ARG A HG2  10 
ATOM   4361  H HG3  . ARG A 1 11 ? 0.746   11.787  -3.874  1.00 1.26 ? 11 ARG A HG3  10 
ATOM   4362  H HD2  . ARG A 1 11 ? -1.379  11.739  -4.865  1.00 1.05 ? 11 ARG A HD2  10 
ATOM   4363  H HD3  . ARG A 1 11 ? -2.111  10.899  -3.480  1.00 1.27 ? 11 ARG A HD3  10 
ATOM   4364  H HE   . ARG A 1 11 ? -1.492  13.792  -3.615  1.00 1.39 ? 11 ARG A HE   10 
ATOM   4365  H HH11 . ARG A 1 11 ? -0.560  12.919  -0.969  1.00 1.65 ? 11 ARG A HH11 10 
ATOM   4366  H HH12 . ARG A 1 11 ? -1.997  12.984  0.001   1.00 1.83 ? 11 ARG A HH12 10 
ATOM   4367  H HH21 . ARG A 1 11 ? -4.140  13.072  -2.713  1.00 1.41 ? 11 ARG A HH21 10 
ATOM   4368  H HH22 . ARG A 1 11 ? -4.016  13.071  -0.985  1.00 1.60 ? 11 ARG A HH22 10 
ATOM   4369  N N    . GLY A 1 12 ? -0.006  7.001   -3.114  1.00 0.67 ? 12 GLY A N    10 
ATOM   4370  C CA   . GLY A 1 12 ? 0.221   5.530   -3.245  1.00 0.73 ? 12 GLY A CA   10 
ATOM   4371  C C    . GLY A 1 12 ? 1.193   5.306   -4.402  1.00 0.76 ? 12 GLY A C    10 
ATOM   4372  O O    . GLY A 1 12 ? 1.197   4.273   -5.043  1.00 0.92 ? 12 GLY A O    10 
ATOM   4373  H H    . GLY A 1 12 ? -0.364  7.503   -3.877  1.00 0.76 ? 12 GLY A H    10 
ATOM   4374  H HA2  . GLY A 1 12 ? 0.644   5.143   -2.329  1.00 0.75 ? 12 GLY A HA2  10 
ATOM   4375  H HA3  . GLY A 1 12 ? -0.711  5.032   -3.458  1.00 0.85 ? 12 GLY A HA3  10 
ATOM   4376  N N    . ARG A 1 13 ? 2.004   6.297   -4.674  1.00 0.69 ? 13 ARG A N    10 
ATOM   4377  C CA   . ARG A 1 13 ? 2.979   6.209   -5.793  1.00 0.75 ? 13 ARG A CA   10 
ATOM   4378  C C    . ARG A 1 13 ? 4.423   6.305   -5.270  1.00 0.82 ? 13 ARG A C    10 
ATOM   4379  O O    . ARG A 1 13 ? 5.076   7.327   -5.391  1.00 0.87 ? 13 ARG A O    10 
ATOM   4380  C CB   . ARG A 1 13 ? 2.618   7.401   -6.694  1.00 0.80 ? 13 ARG A CB   10 
ATOM   4381  C CG   . ARG A 1 13 ? 2.779   8.725   -5.932  1.00 0.81 ? 13 ARG A CG   10 
ATOM   4382  C CD   . ARG A 1 13 ? 1.800   9.761   -6.490  1.00 0.92 ? 13 ARG A CD   10 
ATOM   4383  N NE   . ARG A 1 13 ? 2.660   10.757  -7.189  1.00 1.05 ? 13 ARG A NE   10 
ATOM   4384  C CZ   . ARG A 1 13 ? 3.116   11.795  -6.545  1.00 1.12 ? 13 ARG A CZ   10 
ATOM   4385  N NH1  . ARG A 1 13 ? 2.307   12.756  -6.205  1.00 1.24 ? 13 ARG A NH1  10 
ATOM   4386  N NH2  . ARG A 1 13 ? 4.381   11.864  -6.240  1.00 1.19 ? 13 ARG A NH2  10 
ATOM   4387  H H    . ARG A 1 13 ? 1.957   7.113   -4.143  1.00 0.68 ? 13 ARG A H    10 
ATOM   4388  H HA   . ARG A 1 13 ? 2.841   5.288   -6.333  1.00 0.83 ? 13 ARG A HA   10 
ATOM   4389  H HB2  . ARG A 1 13 ? 3.263   7.405   -7.551  1.00 0.88 ? 13 ARG A HB2  10 
ATOM   4390  H HB3  . ARG A 1 13 ? 1.593   7.302   -7.018  1.00 0.86 ? 13 ARG A HB3  10 
ATOM   4391  H HG2  . ARG A 1 13 ? 2.578   8.570   -4.884  1.00 0.85 ? 13 ARG A HG2  10 
ATOM   4392  H HG3  . ARG A 1 13 ? 3.788   9.087   -6.053  1.00 0.84 ? 13 ARG A HG3  10 
ATOM   4393  H HD2  . ARG A 1 13 ? 1.115   9.295   -7.185  1.00 1.03 ? 13 ARG A HD2  10 
ATOM   4394  H HD3  . ARG A 1 13 ? 1.259   10.237  -5.687  1.00 0.94 ? 13 ARG A HD3  10 
ATOM   4395  H HE   . ARG A 1 13 ? 2.885   10.632  -8.134  1.00 1.18 ? 13 ARG A HE   10 
ATOM   4396  H HH11 . ARG A 1 13 ? 1.337   12.701  -6.437  1.00 1.27 ? 13 ARG A HH11 10 
ATOM   4397  H HH12 . ARG A 1 13 ? 2.657   13.555  -5.705  1.00 1.36 ? 13 ARG A HH12 10 
ATOM   4398  H HH21 . ARG A 1 13 ? 4.998   11.121  -6.497  1.00 1.18 ? 13 ARG A HH21 10 
ATOM   4399  H HH22 . ARG A 1 13 ? 4.740   12.665  -5.755  1.00 1.32 ? 13 ARG A HH22 10 
ATOM   4400  N N    . LYS A 1 14 ? 4.923   5.247   -4.686  1.00 0.92 ? 14 LYS A N    10 
ATOM   4401  C CA   . LYS A 1 14 ? 6.324   5.259   -4.146  1.00 1.09 ? 14 LYS A CA   10 
ATOM   4402  C C    . LYS A 1 14 ? 7.360   5.219   -5.288  1.00 1.12 ? 14 LYS A C    10 
ATOM   4403  O O    . LYS A 1 14 ? 8.226   4.363   -5.329  1.00 1.28 ? 14 LYS A O    10 
ATOM   4404  C CB   . LYS A 1 14 ? 6.432   4.006   -3.255  1.00 1.28 ? 14 LYS A CB   10 
ATOM   4405  C CG   . LYS A 1 14 ? 5.959   2.745   -4.008  1.00 1.30 ? 14 LYS A CG   10 
ATOM   4406  C CD   . LYS A 1 14 ? 7.155   1.880   -4.441  1.00 1.54 ? 14 LYS A CD   10 
ATOM   4407  C CE   . LYS A 1 14 ? 8.171   1.750   -3.298  1.00 1.89 ? 14 LYS A CE   10 
ATOM   4408  N NZ   . LYS A 1 14 ? 9.348   2.565   -3.726  1.00 1.86 ? 14 LYS A NZ   10 
ATOM   4409  H H    . LYS A 1 14 ? 4.375   4.443   -4.596  1.00 0.95 ? 14 LYS A H    10 
ATOM   4410  H HA   . LYS A 1 14 ? 6.477   6.142   -3.545  1.00 1.13 ? 14 LYS A HA   10 
ATOM   4411  H HB2  . LYS A 1 14 ? 7.455   3.880   -2.952  1.00 1.46 ? 14 LYS A HB2  10 
ATOM   4412  H HB3  . LYS A 1 14 ? 5.818   4.144   -2.378  1.00 1.28 ? 14 LYS A HB3  10 
ATOM   4413  H HG2  . LYS A 1 14 ? 5.319   2.164   -3.361  1.00 1.44 ? 14 LYS A HG2  10 
ATOM   4414  H HG3  . LYS A 1 14 ? 5.403   3.036   -4.886  1.00 1.13 ? 14 LYS A HG3  10 
ATOM   4415  H HD2  . LYS A 1 14 ? 6.799   0.897   -4.714  1.00 1.70 ? 14 LYS A HD2  10 
ATOM   4416  H HD3  . LYS A 1 14 ? 7.632   2.334   -5.295  1.00 1.43 ? 14 LYS A HD3  10 
ATOM   4417  H HE2  . LYS A 1 14 ? 7.753   2.138   -2.379  1.00 2.00 ? 14 LYS A HE2  10 
ATOM   4418  H HE3  . LYS A 1 14 ? 8.463   0.718   -3.172  1.00 2.17 ? 14 LYS A HE3  10 
ATOM   4419  H HZ1  . LYS A 1 14 ? 9.023   3.376   -4.305  1.00 1.62 ? 14 LYS A HZ1  10 
ATOM   4420  H HZ2  . LYS A 1 14 ? 9.849   2.918   -2.887  1.00 2.07 ? 14 LYS A HZ2  10 
ATOM   4421  H HZ3  . LYS A 1 14 ? 9.992   1.976   -4.291  1.00 1.99 ? 14 LYS A HZ3  10 
ATOM   4422  N N    . SER A 1 15 ? 7.285   6.154   -6.204  1.00 1.00 ? 15 SER A N    10 
ATOM   4423  C CA   . SER A 1 15 ? 8.260   6.185   -7.340  1.00 1.05 ? 15 SER A CA   10 
ATOM   4424  C C    . SER A 1 15 ? 9.105   7.466   -7.295  1.00 0.92 ? 15 SER A C    10 
ATOM   4425  O O    . SER A 1 15 ? 8.662   8.500   -6.829  1.00 1.23 ? 15 SER A O    10 
ATOM   4426  C CB   . SER A 1 15 ? 7.396   6.159   -8.601  1.00 1.23 ? 15 SER A CB   10 
ATOM   4427  O OG   . SER A 1 15 ? 8.228   6.305   -9.746  1.00 1.35 ? 15 SER A OG   10 
ATOM   4428  H H    . SER A 1 15 ? 6.589   6.842   -6.141  1.00 0.94 ? 15 SER A H    10 
ATOM   4429  H HA   . SER A 1 15 ? 8.896   5.315   -7.315  1.00 1.15 ? 15 SER A HA   10 
ATOM   4430  H HB2  . SER A 1 15 ? 6.870   5.220   -8.660  1.00 1.45 ? 15 SER A HB2  10 
ATOM   4431  H HB3  . SER A 1 15 ? 6.677   6.968   -8.559  1.00 1.27 ? 15 SER A HB3  10 
ATOM   4432  H HG   . SER A 1 15 ? 7.815   5.837   -10.478 1.00 1.62 ? 15 SER A HG   10 
ATOM   4433  N N    . GLY A 1 16 ? 10.320  7.400   -7.783  1.00 1.03 ? 16 GLY A N    10 
ATOM   4434  C CA   . GLY A 1 16 ? 11.207  8.604   -7.781  1.00 1.17 ? 16 GLY A CA   10 
ATOM   4435  C C    . GLY A 1 16 ? 12.430  8.340   -8.666  1.00 1.39 ? 16 GLY A C    10 
ATOM   4436  O O    . GLY A 1 16 ? 13.483  7.969   -8.184  1.00 1.80 ? 16 GLY A O    10 
ATOM   4437  H H    . GLY A 1 16 ? 10.649  6.553   -8.156  1.00 1.35 ? 16 GLY A H    10 
ATOM   4438  H HA2  . GLY A 1 16 ? 10.662  9.455   -8.163  1.00 1.04 ? 16 GLY A HA2  10 
ATOM   4439  H HA3  . GLY A 1 16 ? 11.535  8.809   -6.773  1.00 1.47 ? 16 GLY A HA3  10 
ATOM   4440  N N    . ASN A 1 17 ? 12.295  8.522   -9.956  1.00 1.34 ? 17 ASN A N    10 
ATOM   4441  C CA   . ASN A 1 17 ? 13.449  8.275   -10.880 1.00 1.79 ? 17 ASN A CA   10 
ATOM   4442  C C    . ASN A 1 17 ? 14.091  9.598   -11.334 1.00 1.72 ? 17 ASN A C    10 
ATOM   4443  O O    . ASN A 1 17 ? 14.717  9.666   -12.376 1.00 2.06 ? 17 ASN A O    10 
ATOM   4444  C CB   . ASN A 1 17 ? 12.841  7.540   -12.077 1.00 2.09 ? 17 ASN A CB   10 
ATOM   4445  C CG   . ASN A 1 17 ? 13.865  6.562   -12.654 1.00 2.69 ? 17 ASN A CG   10 
ATOM   4446  O OD1  . ASN A 1 17 ? 13.773  5.372   -12.439 1.00 2.98 ? 17 ASN A OD1  10 
ATOM   4447  N ND2  . ASN A 1 17 ? 14.849  7.013   -13.382 1.00 2.93 ? 17 ASN A ND2  10 
ATOM   4448  H H    . ASN A 1 17 ? 11.433  8.817   -10.319 1.00 1.16 ? 17 ASN A H    10 
ATOM   4449  H HA   . ASN A 1 17 ? 14.185  7.649   -10.401 1.00 2.07 ? 17 ASN A HA   10 
ATOM   4450  H HB2  . ASN A 1 17 ? 11.965  6.995   -11.757 1.00 2.00 ? 17 ASN A HB2  10 
ATOM   4451  H HB3  . ASN A 1 17 ? 12.564  8.257   -12.833 1.00 2.10 ? 17 ASN A HB3  10 
ATOM   4452  H HD21 . ASN A 1 17 ? 14.929  7.975   -13.556 1.00 2.73 ? 17 ASN A HD21 10 
ATOM   4453  H HD22 . ASN A 1 17 ? 15.507  6.391   -13.753 1.00 3.32 ? 17 ASN A HD22 10 
ATOM   4454  N N    . LYS A 1 18 ? 13.947  10.643  -10.561 1.00 1.36 ? 18 LYS A N    10 
ATOM   4455  C CA   . LYS A 1 18 ? 14.553  11.955  -10.946 1.00 1.38 ? 18 LYS A CA   10 
ATOM   4456  C C    . LYS A 1 18 ? 15.890  12.157  -10.211 1.00 1.45 ? 18 LYS A C    10 
ATOM   4457  O O    . LYS A 1 18 ? 16.163  11.483  -9.233  1.00 1.48 ? 18 LYS A O    10 
ATOM   4458  C CB   . LYS A 1 18 ? 13.526  13.003  -10.514 1.00 1.10 ? 18 LYS A CB   10 
ATOM   4459  C CG   . LYS A 1 18 ? 12.580  13.310  -11.680 1.00 1.31 ? 18 LYS A CG   10 
ATOM   4460  C CD   . LYS A 1 18 ? 12.287  14.814  -11.725 1.00 1.26 ? 18 LYS A CD   10 
ATOM   4461  C CE   . LYS A 1 18 ? 10.982  15.114  -10.973 1.00 1.10 ? 18 LYS A CE   10 
ATOM   4462  N NZ   . LYS A 1 18 ? 11.332  15.021  -9.524  1.00 0.76 ? 18 LYS A NZ   10 
ATOM   4463  H H    . LYS A 1 18 ? 13.444  10.566  -9.726  1.00 1.14 ? 18 LYS A H    10 
ATOM   4464  H HA   . LYS A 1 18 ? 14.703  12.002  -12.013 1.00 1.61 ? 18 LYS A HA   10 
ATOM   4465  H HB2  . LYS A 1 18 ? 12.955  12.623  -9.678  1.00 0.91 ? 18 LYS A HB2  10 
ATOM   4466  H HB3  . LYS A 1 18 ? 14.037  13.905  -10.219 1.00 1.07 ? 18 LYS A HB3  10 
ATOM   4467  H HG2  . LYS A 1 18 ? 13.043  13.006  -12.608 1.00 1.60 ? 18 LYS A HG2  10 
ATOM   4468  H HG3  . LYS A 1 18 ? 11.656  12.768  -11.545 1.00 1.34 ? 18 LYS A HG3  10 
ATOM   4469  H HD2  . LYS A 1 18 ? 13.101  15.355  -11.265 1.00 1.21 ? 18 LYS A HD2  10 
ATOM   4470  H HD3  . LYS A 1 18 ? 12.185  15.129  -12.752 1.00 1.52 ? 18 LYS A HD3  10 
ATOM   4471  H HE2  . LYS A 1 18 ? 10.633  16.110  -11.215 1.00 1.24 ? 18 LYS A HE2  10 
ATOM   4472  H HE3  . LYS A 1 18 ? 10.229  14.381  -11.220 1.00 1.27 ? 18 LYS A HE3  10 
ATOM   4473  H HZ1  . LYS A 1 18 ? 12.310  15.362  -9.374  1.00 0.81 ? 18 LYS A HZ1  10 
ATOM   4474  H HZ2  . LYS A 1 18 ? 10.673  15.608  -8.967  1.00 0.74 ? 18 LYS A HZ2  10 
ATOM   4475  H HZ3  . LYS A 1 18 ? 11.257  14.033  -9.211  1.00 0.74 ? 18 LYS A HZ3  10 
ATOM   4476  N N    . PRO A 1 19 ? 16.682  13.081  -10.714 1.00 1.60 ? 19 PRO A N    10 
ATOM   4477  C CA   . PRO A 1 19 ? 18.008  13.341  -10.069 1.00 1.78 ? 19 PRO A CA   10 
ATOM   4478  C C    . PRO A 1 19 ? 17.842  13.689  -8.580  1.00 1.66 ? 19 PRO A C    10 
ATOM   4479  O O    . PRO A 1 19 ? 16.833  14.239  -8.185  1.00 1.45 ? 19 PRO A O    10 
ATOM   4480  C CB   . PRO A 1 19 ? 18.569  14.529  -10.848 1.00 1.94 ? 19 PRO A CB   10 
ATOM   4481  C CG   . PRO A 1 19 ? 17.372  15.221  -11.402 1.00 1.80 ? 19 PRO A CG   10 
ATOM   4482  C CD   . PRO A 1 19 ? 16.343  14.155  -11.665 1.00 1.67 ? 19 PRO A CD   10 
ATOM   4483  H HA   . PRO A 1 19 ? 18.656  12.487  -10.186 1.00 1.97 ? 19 PRO A HA   10 
ATOM   4484  H HB2  . PRO A 1 19 ? 19.116  15.188  -10.186 1.00 1.99 ? 19 PRO A HB2  10 
ATOM   4485  H HB3  . PRO A 1 19 ? 19.204  14.188  -11.650 1.00 2.17 ? 19 PRO A HB3  10 
ATOM   4486  H HG2  . PRO A 1 19 ? 16.993  15.936  -10.685 1.00 1.67 ? 19 PRO A HG2  10 
ATOM   4487  H HG3  . PRO A 1 19 ? 17.624  15.718  -12.326 1.00 2.02 ? 19 PRO A HG3  10 
ATOM   4488  H HD2  . PRO A 1 19 ? 15.350  14.536  -11.475 1.00 1.50 ? 19 PRO A HD2  10 
ATOM   4489  H HD3  . PRO A 1 19 ? 16.423  13.792  -12.678 1.00 1.91 ? 19 PRO A HD3  10 
ATOM   4490  N N    . PRO A 1 20 ? 18.848  13.348  -7.805  1.00 1.92 ? 20 PRO A N    10 
ATOM   4491  C CA   . PRO A 1 20 ? 18.782  13.635  -6.336  1.00 2.00 ? 20 PRO A CA   10 
ATOM   4492  C C    . PRO A 1 20 ? 18.437  15.108  -6.058  1.00 1.93 ? 20 PRO A C    10 
ATOM   4493  O O    . PRO A 1 20 ? 17.681  15.408  -5.154  1.00 1.92 ? 20 PRO A O    10 
ATOM   4494  C CB   . PRO A 1 20 ? 20.183  13.295  -5.830  1.00 2.38 ? 20 PRO A CB   10 
ATOM   4495  C CG   . PRO A 1 20 ? 21.063  13.441  -7.023  1.00 2.47 ? 20 PRO A CG   10 
ATOM   4496  C CD   . PRO A 1 20 ? 20.234  13.059  -8.218  1.00 2.25 ? 20 PRO A CD   10 
ATOM   4497  H HA   . PRO A 1 20 ? 18.060  12.988  -5.862  1.00 1.92 ? 20 PRO A HA   10 
ATOM   4498  H HB2  . PRO A 1 20 ? 20.479  13.986  -5.053  1.00 2.51 ? 20 PRO A HB2  10 
ATOM   4499  H HB3  . PRO A 1 20 ? 20.216  12.279  -5.467  1.00 2.48 ? 20 PRO A HB3  10 
ATOM   4500  H HG2  . PRO A 1 20 ? 21.400  14.465  -7.113  1.00 2.52 ? 20 PRO A HG2  10 
ATOM   4501  H HG3  . PRO A 1 20 ? 21.911  12.777  -6.942  1.00 2.70 ? 20 PRO A HG3  10 
ATOM   4502  H HD2  . PRO A 1 20 ? 20.510  13.660  -9.075  1.00 2.29 ? 20 PRO A HD2  10 
ATOM   4503  H HD3  . PRO A 1 20 ? 20.343  12.009  -8.437  1.00 2.33 ? 20 PRO A HD3  10 
ATOM   4504  N N    . SER A 1 21 ? 18.979  16.026  -6.827  1.00 1.99 ? 21 SER A N    10 
ATOM   4505  C CA   . SER A 1 21 ? 18.673  17.479  -6.601  1.00 2.01 ? 21 SER A CA   10 
ATOM   4506  C C    . SER A 1 21 ? 17.156  17.716  -6.635  1.00 1.73 ? 21 SER A C    10 
ATOM   4507  O O    . SER A 1 21 ? 16.603  18.367  -5.768  1.00 1.80 ? 21 SER A O    10 
ATOM   4508  C CB   . SER A 1 21 ? 19.358  18.221  -7.754  1.00 2.13 ? 21 SER A CB   10 
ATOM   4509  O OG   . SER A 1 21 ? 19.006  19.601  -7.706  1.00 2.21 ? 21 SER A OG   10 
ATOM   4510  H H    . SER A 1 21 ? 19.584  15.761  -7.550  1.00 2.06 ? 21 SER A H    10 
ATOM   4511  H HA   . SER A 1 21 ? 19.082  17.807  -5.659  1.00 2.22 ? 21 SER A HA   10 
ATOM   4512  H HB2  . SER A 1 21 ? 20.428  18.125  -7.660  1.00 2.35 ? 21 SER A HB2  10 
ATOM   4513  H HB3  . SER A 1 21 ? 19.042  17.790  -8.696  1.00 2.03 ? 21 SER A HB3  10 
ATOM   4514  H HG   . SER A 1 21 ? 19.662  20.092  -8.211  1.00 2.46 ? 21 SER A HG   10 
ATOM   4515  N N    . LYS A 1 22 ? 16.485  17.189  -7.628  1.00 1.47 ? 22 LYS A N    10 
ATOM   4516  C CA   . LYS A 1 22 ? 15.003  17.370  -7.726  1.00 1.23 ? 22 LYS A CA   10 
ATOM   4517  C C    . LYS A 1 22 ? 14.338  16.010  -7.980  1.00 0.97 ? 22 LYS A C    10 
ATOM   4518  O O    . LYS A 1 22 ? 13.689  15.800  -8.989  1.00 0.92 ? 22 LYS A O    10 
ATOM   4519  C CB   . LYS A 1 22 ? 14.784  18.317  -8.918  1.00 1.33 ? 22 LYS A CB   10 
ATOM   4520  C CG   . LYS A 1 22 ? 15.642  19.580  -8.764  1.00 1.62 ? 22 LYS A CG   10 
ATOM   4521  C CD   . LYS A 1 22 ? 15.120  20.426  -7.597  1.00 1.72 ? 22 LYS A CD   10 
ATOM   4522  C CE   . LYS A 1 22 ? 16.136  21.525  -7.261  1.00 2.04 ? 22 LYS A CE   10 
ATOM   4523  N NZ   . LYS A 1 22 ? 17.182  20.858  -6.428  1.00 2.15 ? 22 LYS A NZ   10 
ATOM   4524  H H    . LYS A 1 22 ? 16.957  16.666  -8.310  1.00 1.51 ? 22 LYS A H    10 
ATOM   4525  H HA   . LYS A 1 22 ? 14.616  17.812  -6.822  1.00 1.29 ? 22 LYS A HA   10 
ATOM   4526  H HB2  . LYS A 1 22 ? 15.057  17.809  -9.831  1.00 1.38 ? 22 LYS A HB2  10 
ATOM   4527  H HB3  . LYS A 1 22 ? 13.742  18.598  -8.963  1.00 1.31 ? 22 LYS A HB3  10 
ATOM   4528  H HG2  . LYS A 1 22 ? 16.668  19.299  -8.575  1.00 1.73 ? 22 LYS A HG2  10 
ATOM   4529  H HG3  . LYS A 1 22 ? 15.593  20.160  -9.675  1.00 1.74 ? 22 LYS A HG3  10 
ATOM   4530  H HD2  . LYS A 1 22 ? 14.179  20.879  -7.876  1.00 1.72 ? 22 LYS A HD2  10 
ATOM   4531  H HD3  . LYS A 1 22 ? 14.973  19.796  -6.733  1.00 1.66 ? 22 LYS A HD3  10 
ATOM   4532  H HE2  . LYS A 1 22 ? 16.571  21.922  -8.168  1.00 2.14 ? 22 LYS A HE2  10 
ATOM   4533  H HE3  . LYS A 1 22 ? 15.661  22.313  -6.696  1.00 2.18 ? 22 LYS A HE3  10 
ATOM   4534  H HZ1  . LYS A 1 22 ? 16.738  20.137  -5.816  1.00 2.03 ? 22 LYS A HZ1  10 
ATOM   4535  H HZ2  . LYS A 1 22 ? 17.887  20.396  -7.050  1.00 2.17 ? 22 LYS A HZ2  10 
ATOM   4536  H HZ3  . LYS A 1 22 ? 17.660  21.566  -5.837  1.00 2.40 ? 22 LYS A HZ3  10 
ATOM   4537  N N    . THR A 1 23 ? 14.510  15.079  -7.075  1.00 0.99 ? 23 THR A N    10 
ATOM   4538  C CA   . THR A 1 23 ? 13.907  13.718  -7.266  1.00 0.87 ? 23 THR A CA   10 
ATOM   4539  C C    . THR A 1 23 ? 12.439  13.678  -6.802  1.00 0.71 ? 23 THR A C    10 
ATOM   4540  O O    . THR A 1 23 ? 11.718  12.748  -7.111  1.00 0.77 ? 23 THR A O    10 
ATOM   4541  C CB   . THR A 1 23 ? 14.782  12.770  -6.430  1.00 1.12 ? 23 THR A CB   10 
ATOM   4542  O OG1  . THR A 1 23 ? 14.644  11.446  -6.928  1.00 1.18 ? 23 THR A OG1  10 
ATOM   4543  C CG2  . THR A 1 23 ? 14.358  12.806  -4.958  1.00 1.27 ? 23 THR A CG2  10 
ATOM   4544  H H    . THR A 1 23 ? 15.048  15.270  -6.277  1.00 1.19 ? 23 THR A H    10 
ATOM   4545  H HA   . THR A 1 23 ? 13.968  13.436  -8.302  1.00 0.88 ? 23 THR A HA   10 
ATOM   4546  H HB   . THR A 1 23 ? 15.814  13.074  -6.508  1.00 1.29 ? 23 THR A HB   10 
ATOM   4547  H HG1  . THR A 1 23 ? 15.291  11.324  -7.633  1.00 1.31 ? 23 THR A HG1  10 
ATOM   4548  H HG21 . THR A 1 23 ? 14.262  13.832  -4.635  1.00 1.66 ? 23 THR A HG21 10 
ATOM   4549  H HG22 . THR A 1 23 ? 13.409  12.302  -4.845  1.00 1.48 ? 23 THR A HG22 10 
ATOM   4550  H HG23 . THR A 1 23 ? 15.104  12.308  -4.357  1.00 1.75 ? 23 THR A HG23 10 
ATOM   4551  N N    . CYS A 1 24 ? 11.989  14.672  -6.075  1.00 0.71 ? 24 CYS A N    10 
ATOM   4552  C CA   . CYS A 1 24 ? 10.567  14.673  -5.603  1.00 0.77 ? 24 CYS A CA   10 
ATOM   4553  C C    . CYS A 1 24 ? 9.633   15.218  -6.695  1.00 0.71 ? 24 CYS A C    10 
ATOM   4554  O O    . CYS A 1 24 ? 10.016  16.054  -7.497  1.00 0.73 ? 24 CYS A O    10 
ATOM   4555  C CB   . CYS A 1 24 ? 10.553  15.591  -4.377  1.00 1.08 ? 24 CYS A CB   10 
ATOM   4556  S SG   . CYS A 1 24 ? 11.418  14.784  -3.007  1.00 1.52 ? 24 CYS A SG   10 
ATOM   4557  H H    . CYS A 1 24 ? 12.580  15.414  -5.838  1.00 0.82 ? 24 CYS A H    10 
ATOM   4558  H HA   . CYS A 1 24 ? 10.268  13.677  -5.317  1.00 0.80 ? 24 CYS A HA   10 
ATOM   4559  H HB2  . CYS A 1 24 ? 11.046  16.521  -4.617  1.00 1.18 ? 24 CYS A HB2  10 
ATOM   4560  H HB3  . CYS A 1 24 ? 9.530   15.790  -4.090  1.00 1.22 ? 24 CYS A HB3  10 
ATOM   4561  H HG   . CYS A 1 24 ? 10.828  14.126  -2.629  1.00 1.93 ? 24 CYS A HG   10 
ATOM   4562  N N    . LEU A 1 25 ? 8.414   14.744  -6.730  1.00 0.84 ? 25 LEU A N    10 
ATOM   4563  C CA   . LEU A 1 25 ? 7.438   15.219  -7.762  1.00 1.04 ? 25 LEU A CA   10 
ATOM   4564  C C    . LEU A 1 25 ? 6.027   15.281  -7.155  1.00 1.16 ? 25 LEU A C    10 
ATOM   4565  O O    . LEU A 1 25 ? 5.331   14.287  -7.071  1.00 1.12 ? 25 LEU A O    10 
ATOM   4566  C CB   . LEU A 1 25 ? 7.512   14.190  -8.904  1.00 1.11 ? 25 LEU A CB   10 
ATOM   4567  C CG   . LEU A 1 25 ? 7.399   12.761  -8.350  1.00 1.04 ? 25 LEU A CG   10 
ATOM   4568  C CD1  . LEU A 1 25 ? 6.405   11.962  -9.193  1.00 1.38 ? 25 LEU A CD1  10 
ATOM   4569  C CD2  . LEU A 1 25 ? 8.769   12.081  -8.409  1.00 1.10 ? 25 LEU A CD2  10 
ATOM   4570  H H    . LEU A 1 25 ? 8.134   14.069  -6.074  1.00 0.90 ? 25 LEU A H    10 
ATOM   4571  H HA   . LEU A 1 25 ? 7.727   16.192  -8.128  1.00 1.17 ? 25 LEU A HA   10 
ATOM   4572  H HB2  . LEU A 1 25 ? 6.703   14.368  -9.597  1.00 1.35 ? 25 LEU A HB2  10 
ATOM   4573  H HB3  . LEU A 1 25 ? 8.453   14.299  -9.420  1.00 1.12 ? 25 LEU A HB3  10 
ATOM   4574  H HG   . LEU A 1 25 ? 7.056   12.796  -7.327  1.00 0.97 ? 25 LEU A HG   10 
ATOM   4575  H HD11 . LEU A 1 25 ? 5.446   12.458  -9.185  1.00 1.78 ? 25 LEU A HD11 10 
ATOM   4576  H HD12 . LEU A 1 25 ? 6.767   11.894  -10.208 1.00 1.77 ? 25 LEU A HD12 10 
ATOM   4577  H HD13 . LEU A 1 25 ? 6.301   10.970  -8.780  1.00 1.80 ? 25 LEU A HD13 10 
ATOM   4578  H HD21 . LEU A 1 25 ? 9.503   12.705  -7.921  1.00 1.45 ? 25 LEU A HD21 10 
ATOM   4579  H HD22 . LEU A 1 25 ? 8.718   11.126  -7.906  1.00 1.46 ? 25 LEU A HD22 10 
ATOM   4580  H HD23 . LEU A 1 25 ? 9.053   11.931  -9.440  1.00 1.62 ? 25 LEU A HD23 10 
ATOM   4581  N N    . LYS A 1 26 ? 5.611   16.448  -6.716  1.00 1.40 ? 26 LYS A N    10 
ATOM   4582  C CA   . LYS A 1 26 ? 4.257   16.594  -6.090  1.00 1.61 ? 26 LYS A CA   10 
ATOM   4583  C C    . LYS A 1 26 ? 4.123   15.621  -4.909  1.00 1.48 ? 26 LYS A C    10 
ATOM   4584  O O    . LYS A 1 26 ? 3.324   14.703  -4.928  1.00 1.43 ? 26 LYS A O    10 
ATOM   4585  C CB   . LYS A 1 26 ? 3.250   16.264  -7.200  1.00 1.76 ? 26 LYS A CB   10 
ATOM   4586  C CG   . LYS A 1 26 ? 2.627   17.559  -7.728  1.00 2.18 ? 26 LYS A CG   10 
ATOM   4587  C CD   . LYS A 1 26 ? 3.052   17.776  -9.184  1.00 2.33 ? 26 LYS A CD   10 
ATOM   4588  C CE   . LYS A 1 26 ? 1.822   18.095  -10.041 1.00 2.75 ? 26 LYS A CE   10 
ATOM   4589  N NZ   . LYS A 1 26 ? 1.173   16.775  -10.301 1.00 3.26 ? 26 LYS A NZ   10 
ATOM   4590  H H    . LYS A 1 26 ? 6.196   17.230  -6.789  1.00 1.48 ? 26 LYS A H    10 
ATOM   4591  H HA   . LYS A 1 26 ? 4.110   17.608  -5.751  1.00 1.83 ? 26 LYS A HA   10 
ATOM   4592  H HB2  . LYS A 1 26 ? 3.758   15.752  -8.005  1.00 1.65 ? 26 LYS A HB2  10 
ATOM   4593  H HB3  . LYS A 1 26 ? 2.472   15.629  -6.804  1.00 1.78 ? 26 LYS A HB3  10 
ATOM   4594  H HG2  . LYS A 1 26 ? 1.550   17.488  -7.670  1.00 2.32 ? 26 LYS A HG2  10 
ATOM   4595  H HG3  . LYS A 1 26 ? 2.966   18.392  -7.129  1.00 2.31 ? 26 LYS A HG3  10 
ATOM   4596  H HD2  . LYS A 1 26 ? 3.749   18.601  -9.233  1.00 2.44 ? 26 LYS A HD2  10 
ATOM   4597  H HD3  . LYS A 1 26 ? 3.529   16.883  -9.557  1.00 2.21 ? 26 LYS A HD3  10 
ATOM   4598  H HE2  . LYS A 1 26 ? 1.149   18.749  -9.501  1.00 2.66 ? 26 LYS A HE2  10 
ATOM   4599  H HE3  . LYS A 1 26 ? 2.122   18.550  -10.973 1.00 3.29 ? 26 LYS A HE3  10 
ATOM   4600  H HZ1  . LYS A 1 26 ? 1.891   16.085  -10.602 1.00 3.79 ? 26 LYS A HZ1  10 
ATOM   4601  H HZ2  . LYS A 1 26 ? 0.712   16.436  -9.432  1.00 3.31 ? 26 LYS A HZ2  10 
ATOM   4602  H HZ3  . LYS A 1 26 ? 0.459   16.883  -11.052 1.00 3.58 ? 26 LYS A HZ3  10 
ATOM   4603  N N    . GLU A 1 27 ? 4.911   15.814  -3.882  1.00 1.50 ? 27 GLU A N    10 
ATOM   4604  C CA   . GLU A 1 27 ? 4.846   14.902  -2.698  1.00 1.50 ? 27 GLU A CA   10 
ATOM   4605  C C    . GLU A 1 27 ? 3.728   15.353  -1.750  1.00 1.79 ? 27 GLU A C    10 
ATOM   4606  O O    . GLU A 1 27 ? 3.973   15.817  -0.650  1.00 2.04 ? 27 GLU A O    10 
ATOM   4607  C CB   . GLU A 1 27 ? 6.224   15.013  -2.027  1.00 1.52 ? 27 GLU A CB   10 
ATOM   4608  C CG   . GLU A 1 27 ? 7.331   14.625  -3.021  1.00 1.27 ? 27 GLU A CG   10 
ATOM   4609  C CD   . GLU A 1 27 ? 7.031   13.252  -3.633  1.00 1.10 ? 27 GLU A CD   10 
ATOM   4610  O OE1  . GLU A 1 27 ? 7.147   12.270  -2.922  1.00 1.20 ? 27 GLU A OE1  10 
ATOM   4611  O OE2  . GLU A 1 27 ? 6.691   13.209  -4.804  1.00 1.12 ? 27 GLU A OE2  10 
ATOM   4612  H H    . GLU A 1 27 ? 5.552   16.556  -3.891  1.00 1.58 ? 27 GLU A H    10 
ATOM   4613  H HA   . GLU A 1 27 ? 4.676   13.885  -3.019  1.00 1.34 ? 27 GLU A HA   10 
ATOM   4614  H HB2  . GLU A 1 27 ? 6.379   16.030  -1.695  1.00 1.71 ? 27 GLU A HB2  10 
ATOM   4615  H HB3  . GLU A 1 27 ? 6.261   14.350  -1.175  1.00 1.60 ? 27 GLU A HB3  10 
ATOM   4616  H HG2  . GLU A 1 27 ? 7.383   15.364  -3.807  1.00 1.32 ? 27 GLU A HG2  10 
ATOM   4617  H HG3  . GLU A 1 27 ? 8.277   14.584  -2.505  1.00 1.33 ? 27 GLU A HG3  10 
ATOM   4618  N N    . GLU A 1 28 ? 2.497   15.225  -2.178  1.00 1.80 ? 28 GLU A N    10 
ATOM   4619  C CA   . GLU A 1 28 ? 1.347   15.646  -1.322  1.00 2.10 ? 28 GLU A CA   10 
ATOM   4620  C C    . GLU A 1 28 ? 1.117   14.617  -0.205  1.00 2.04 ? 28 GLU A C    10 
ATOM   4621  O O    . GLU A 1 28 ? 1.030   13.427  -0.453  1.00 1.75 ? 28 GLU A O    10 
ATOM   4622  C CB   . GLU A 1 28 ? 0.140   15.702  -2.267  1.00 2.11 ? 28 GLU A CB   10 
ATOM   4623  C CG   . GLU A 1 28 ? 0.487   16.541  -3.511  1.00 2.16 ? 28 GLU A CG   10 
ATOM   4624  C CD   . GLU A 1 28 ? 0.251   15.732  -4.798  1.00 1.84 ? 28 GLU A CD   10 
ATOM   4625  O OE1  . GLU A 1 28 ? 0.347   14.514  -4.751  1.00 1.57 ? 28 GLU A OE1  10 
ATOM   4626  O OE2  . GLU A 1 28 ? -0.015  16.351  -5.816  1.00 2.00 ? 28 GLU A OE2  10 
ATOM   4627  H H    . GLU A 1 28 ? 2.328   14.853  -3.071  1.00 1.66 ? 28 GLU A H    10 
ATOM   4628  H HA   . GLU A 1 28 ? 1.531   16.621  -0.900  1.00 2.43 ? 28 GLU A HA   10 
ATOM   4629  H HB2  . GLU A 1 28 ? -0.123  14.700  -2.568  1.00 1.87 ? 28 GLU A HB2  10 
ATOM   4630  H HB3  . GLU A 1 28 ? -0.696  16.153  -1.754  1.00 2.41 ? 28 GLU A HB3  10 
ATOM   4631  H HG2  . GLU A 1 28 ? -0.133  17.422  -3.528  1.00 2.46 ? 28 GLU A HG2  10 
ATOM   4632  H HG3  . GLU A 1 28 ? 1.523   16.839  -3.465  1.00 2.20 ? 28 GLU A HG3  10 
ATOM   4633  N N    . MET A 1 29 ? 1.016   15.069  1.019   1.00 2.39 ? 29 MET A N    10 
ATOM   4634  C CA   . MET A 1 29 ? 0.793   14.123  2.160   1.00 2.47 ? 29 MET A CA   10 
ATOM   4635  C C    . MET A 1 29 ? -0.691  13.734  2.262   1.00 2.41 ? 29 MET A C    10 
ATOM   4636  O O    . MET A 1 29 ? -1.532  14.295  1.585   1.00 2.45 ? 29 MET A O    10 
ATOM   4637  C CB   . MET A 1 29 ? 1.238   14.894  3.408   1.00 2.93 ? 29 MET A CB   10 
ATOM   4638  C CG   . MET A 1 29 ? 2.025   13.966  4.338   1.00 3.07 ? 29 MET A CG   10 
ATOM   4639  S SD   . MET A 1 29 ? 3.565   13.458  3.532   1.00 3.59 ? 29 MET A SD   10 
ATOM   4640  C CE   . MET A 1 29 ? 4.453   15.024  3.720   1.00 3.69 ? 29 MET A CE   10 
ATOM   4641  H H    . MET A 1 29 ? 1.089   16.032  1.191   1.00 2.66 ? 29 MET A H    10 
ATOM   4642  H HA   . MET A 1 29 ? 1.402   13.241  2.037   1.00 2.33 ? 29 MET A HA   10 
ATOM   4643  H HB2  . MET A 1 29 ? 1.865   15.723  3.114   1.00 3.05 ? 29 MET A HB2  10 
ATOM   4644  H HB3  . MET A 1 29 ? 0.369   15.269  3.928   1.00 3.14 ? 29 MET A HB3  10 
ATOM   4645  H HG2  . MET A 1 29 ? 2.254   14.488  5.256   1.00 3.36 ? 29 MET A HG2  10 
ATOM   4646  H HG3  . MET A 1 29 ? 1.430   13.093  4.564   1.00 3.12 ? 29 MET A HG3  10 
ATOM   4647  H HE1  . MET A 1 29 ? 3.994   15.610  4.501   1.00 3.96 ? 29 MET A HE1  10 
ATOM   4648  H HE2  . MET A 1 29 ? 5.483   14.823  3.981   1.00 3.97 ? 29 MET A HE2  10 
ATOM   4649  H HE3  . MET A 1 29 ? 4.412   15.573  2.790   1.00 3.79 ? 29 MET A HE3  10 
ATOM   4650  N N    . ALA A 1 30 ? -1.003  12.775  3.109   1.00 2.41 ? 30 ALA A N    10 
ATOM   4651  C CA   . ALA A 1 30 ? -2.422  12.312  3.292   1.00 2.38 ? 30 ALA A CA   10 
ATOM   4652  C C    . ALA A 1 30 ? -2.931  11.591  2.031   1.00 2.13 ? 30 ALA A C    10 
ATOM   4653  O O    . ALA A 1 30 ? -2.927  10.372  2.037   1.00 2.12 ? 30 ALA A O    10 
ATOM   4654  C CB   . ALA A 1 30 ? -3.242  13.577  3.585   1.00 2.59 ? 30 ALA A CB   10 
ATOM   4655  O OXT  . ALA A 1 30 ? -3.314  12.263  1.083   1.00 2.10 ? 30 ALA A OXT  10 
ATOM   4656  H H    . ALA A 1 30 ? -0.293  12.350  3.633   1.00 2.46 ? 30 ALA A H    10 
ATOM   4657  H HA   . ALA A 1 30 ? -2.479  11.644  4.138   1.00 2.46 ? 30 ALA A HA   10 
ATOM   4658  H HB1  . ALA A 1 30 ? -2.652  14.260  4.177   1.00 2.99 ? 30 ALA A HB1  10 
ATOM   4659  H HB2  . ALA A 1 30 ? -3.516  14.053  2.655   1.00 2.46 ? 30 ALA A HB2  10 
ATOM   4660  H HB3  . ALA A 1 30 ? -4.135  13.309  4.129   1.00 2.95 ? 30 ALA A HB3  10 
ATOM   4661  N N    . MET A 1 1  ? 0.241   3.745   24.451  1.00 4.79 ? 1  MET A N    11 
ATOM   4662  C CA   . MET A 1 1  ? -0.321  3.620   23.068  1.00 4.27 ? 1  MET A CA   11 
ATOM   4663  C C    . MET A 1 1  ? 0.528   4.418   22.067  1.00 3.49 ? 1  MET A C    11 
ATOM   4664  O O    . MET A 1 1  ? 1.372   5.205   22.451  1.00 3.60 ? 1  MET A O    11 
ATOM   4665  C CB   . MET A 1 1  ? -1.748  4.188   23.150  1.00 4.51 ? 1  MET A CB   11 
ATOM   4666  C CG   . MET A 1 1  ? -1.711  5.671   23.543  1.00 4.33 ? 1  MET A CG   11 
ATOM   4667  S SD   . MET A 1 1  ? -2.015  5.831   25.321  1.00 5.14 ? 1  MET A SD   11 
ATOM   4668  C CE   . MET A 1 1  ? -1.841  7.629   25.421  1.00 5.32 ? 1  MET A CE   11 
ATOM   4669  H H1   . MET A 1 1  ? 0.500   4.736   24.634  1.00 4.63 ? 1  MET A H1   11 
ATOM   4670  H H2   . MET A 1 1  ? -0.469  3.441   25.147  1.00 5.26 ? 1  MET A H2   11 
ATOM   4671  H H3   . MET A 1 1  ? 1.088   3.146   24.536  1.00 5.13 ? 1  MET A H3   11 
ATOM   4672  H HA   . MET A 1 1  ? -0.359  2.582   22.776  1.00 4.62 ? 1  MET A HA   11 
ATOM   4673  H HB2  . MET A 1 1  ? -2.228  4.086   22.187  1.00 4.46 ? 1  MET A HB2  11 
ATOM   4674  H HB3  . MET A 1 1  ? -2.311  3.638   23.889  1.00 5.19 ? 1  MET A HB3  11 
ATOM   4675  H HG2  . MET A 1 1  ? -0.743  6.087   23.304  1.00 4.03 ? 1  MET A HG2  11 
ATOM   4676  H HG3  . MET A 1 1  ? -2.476  6.207   22.999  1.00 4.41 ? 1  MET A HG3  11 
ATOM   4677  H HE1  . MET A 1 1  ? -0.917  7.928   24.947  1.00 5.46 ? 1  MET A HE1  11 
ATOM   4678  H HE2  . MET A 1 1  ? -2.677  8.099   24.921  1.00 5.51 ? 1  MET A HE2  11 
ATOM   4679  H HE3  . MET A 1 1  ? -1.828  7.935   26.455  1.00 5.53 ? 1  MET A HE3  11 
ATOM   4680  N N    . ILE A 1 2  ? 0.306   4.222   20.792  1.00 3.05 ? 2  ILE A N    11 
ATOM   4681  C CA   . ILE A 1 2  ? 1.099   4.972   19.762  1.00 2.54 ? 2  ILE A CA   11 
ATOM   4682  C C    . ILE A 1 2  ? 0.314   6.196   19.270  1.00 2.03 ? 2  ILE A C    11 
ATOM   4683  O O    . ILE A 1 2  ? -0.902  6.231   19.322  1.00 1.91 ? 2  ILE A O    11 
ATOM   4684  C CB   . ILE A 1 2  ? 1.337   3.981   18.610  1.00 2.74 ? 2  ILE A CB   11 
ATOM   4685  C CG1  . ILE A 1 2  ? -0.005  3.492   18.045  1.00 2.98 ? 2  ILE A CG1  11 
ATOM   4686  C CG2  . ILE A 1 2  ? 2.140   2.780   19.118  1.00 3.54 ? 2  ILE A CG2  11 
ATOM   4687  C CD1  . ILE A 1 2  ? 0.002   3.627   16.521  1.00 3.46 ? 2  ILE A CD1  11 
ATOM   4688  H H    . ILE A 1 2  ? -0.382  3.584   20.509  1.00 3.33 ? 2  ILE A H    11 
ATOM   4689  H HA   . ILE A 1 2  ? 2.046   5.281   20.177  1.00 2.97 ? 2  ILE A HA   11 
ATOM   4690  H HB   . ILE A 1 2  ? 1.896   4.475   17.828  1.00 2.71 ? 2  ILE A HB   11 
ATOM   4691  H HG12 . ILE A 1 2  ? -0.152  2.454   18.313  1.00 3.56 ? 2  ILE A HG12 11 
ATOM   4692  H HG13 . ILE A 1 2  ? -0.808  4.086   18.453  1.00 2.74 ? 2  ILE A HG13 11 
ATOM   4693  H HG21 . ILE A 1 2  ? 2.995   3.129   19.678  1.00 3.77 ? 2  ILE A HG21 11 
ATOM   4694  H HG22 . ILE A 1 2  ? 1.515   2.173   19.756  1.00 4.05 ? 2  ILE A HG22 11 
ATOM   4695  H HG23 . ILE A 1 2  ? 2.476   2.191   18.278  1.00 3.79 ? 2  ILE A HG23 11 
ATOM   4696  H HD11 . ILE A 1 2  ? 0.394   4.595   16.247  1.00 3.60 ? 2  ILE A HD11 11 
ATOM   4697  H HD12 . ILE A 1 2  ? 0.623   2.852   16.094  1.00 3.63 ? 2  ILE A HD12 11 
ATOM   4698  H HD13 . ILE A 1 2  ? -1.006  3.526   16.146  1.00 4.03 ? 2  ILE A HD13 11 
ATOM   4699  N N    . SER A 1 3  ? 1.003   7.201   18.788  1.00 2.23 ? 3  SER A N    11 
ATOM   4700  C CA   . SER A 1 3  ? 0.302   8.427   18.290  1.00 2.25 ? 3  SER A CA   11 
ATOM   4701  C C    . SER A 1 3  ? -0.007  8.296   16.788  1.00 1.87 ? 3  SER A C    11 
ATOM   4702  O O    . SER A 1 3  ? 0.406   9.115   15.991  1.00 2.33 ? 3  SER A O    11 
ATOM   4703  C CB   . SER A 1 3  ? 1.283   9.576   18.547  1.00 3.21 ? 3  SER A CB   11 
ATOM   4704  O OG   . SER A 1 3  ? 0.550   10.764  18.826  1.00 3.61 ? 3  SER A OG   11 
ATOM   4705  H H    . SER A 1 3  ? 1.982   7.149   18.754  1.00 2.67 ? 3  SER A H    11 
ATOM   4706  H HA   . SER A 1 3  ? -0.607  8.593   18.847  1.00 2.17 ? 3  SER A HA   11 
ATOM   4707  H HB2  . SER A 1 3  ? 1.905   9.339   19.394  1.00 3.59 ? 3  SER A HB2  11 
ATOM   4708  H HB3  . SER A 1 3  ? 1.906   9.721   17.674  1.00 3.45 ? 3  SER A HB3  11 
ATOM   4709  H HG   . SER A 1 3  ? 0.356   11.196  17.989  1.00 3.84 ? 3  SER A HG   11 
ATOM   4710  N N    . SER A 1 4  ? -0.736  7.264   16.409  1.00 1.19 ? 4  SER A N    11 
ATOM   4711  C CA   . SER A 1 4  ? -1.096  7.041   14.966  1.00 0.91 ? 4  SER A CA   11 
ATOM   4712  C C    . SER A 1 4  ? 0.150   6.713   14.137  1.00 1.48 ? 4  SER A C    11 
ATOM   4713  O O    . SER A 1 4  ? 0.973   7.564   13.856  1.00 2.06 ? 4  SER A O    11 
ATOM   4714  C CB   . SER A 1 4  ? -1.743  8.335   14.467  1.00 1.27 ? 4  SER A CB   11 
ATOM   4715  O OG   . SER A 1 4  ? -2.723  8.773   15.402  1.00 1.69 ? 4  SER A OG   11 
ATOM   4716  H H    . SER A 1 4  ? -1.051  6.624   17.080  1.00 1.09 ? 4  SER A H    11 
ATOM   4717  H HA   . SER A 1 4  ? -1.807  6.232   14.889  1.00 0.81 ? 4  SER A HA   11 
ATOM   4718  H HB2  . SER A 1 4  ? -0.989  9.092   14.357  1.00 1.68 ? 4  SER A HB2  11 
ATOM   4719  H HB3  . SER A 1 4  ? -2.205  8.151   13.506  1.00 1.26 ? 4  SER A HB3  11 
ATOM   4720  H HG   . SER A 1 4  ? -2.410  9.588   15.803  1.00 2.07 ? 4  SER A HG   11 
ATOM   4721  N N    . VAL A 1 5  ? 0.282   5.479   13.740  1.00 1.67 ? 5  VAL A N    11 
ATOM   4722  C CA   . VAL A 1 5  ? 1.466   5.063   12.918  1.00 2.41 ? 5  VAL A CA   11 
ATOM   4723  C C    . VAL A 1 5  ? 1.151   5.162   11.416  1.00 2.38 ? 5  VAL A C    11 
ATOM   4724  O O    . VAL A 1 5  ? 2.033   5.351   10.601  1.00 2.90 ? 5  VAL A O    11 
ATOM   4725  C CB   . VAL A 1 5  ? 1.753   3.612   13.331  1.00 2.95 ? 5  VAL A CB   11 
ATOM   4726  C CG1  . VAL A 1 5  ? 0.695   2.669   12.746  1.00 3.04 ? 5  VAL A CG1  11 
ATOM   4727  C CG2  . VAL A 1 5  ? 3.135   3.200   12.817  1.00 3.77 ? 5  VAL A CG2  11 
ATOM   4728  H H    . VAL A 1 5  ? -0.402  4.824   13.979  1.00 1.58 ? 5  VAL A H    11 
ATOM   4729  H HA   . VAL A 1 5  ? 2.312   5.683   13.154  1.00 2.74 ? 5  VAL A HA   11 
ATOM   4730  H HB   . VAL A 1 5  ? 1.736   3.540   14.409  1.00 2.87 ? 5  VAL A HB   11 
ATOM   4731  H HG11 . VAL A 1 5  ? -0.291  3.039   12.988  1.00 3.45 ? 5  VAL A HG11 11 
ATOM   4732  H HG12 . VAL A 1 5  ? 0.809   2.621   11.674  1.00 3.18 ? 5  VAL A HG12 11 
ATOM   4733  H HG13 . VAL A 1 5  ? 0.822   1.683   13.165  1.00 3.15 ? 5  VAL A HG13 11 
ATOM   4734  H HG21 . VAL A 1 5  ? 3.192   3.382   11.754  1.00 4.10 ? 5  VAL A HG21 11 
ATOM   4735  H HG22 . VAL A 1 5  ? 3.894   3.778   13.322  1.00 4.08 ? 5  VAL A HG22 11 
ATOM   4736  H HG23 . VAL A 1 5  ? 3.292   2.150   13.011  1.00 4.11 ? 5  VAL A HG23 11 
ATOM   4737  N N    . CYS A 1 6  ? -0.099  5.036   11.052  1.00 1.90 ? 6  CYS A N    11 
ATOM   4738  C CA   . CYS A 1 6  ? -0.482  5.125   9.612   1.00 1.99 ? 6  CYS A CA   11 
ATOM   4739  C C    . CYS A 1 6  ? -1.564  6.193   9.422   1.00 1.69 ? 6  CYS A C    11 
ATOM   4740  O O    . CYS A 1 6  ? -2.599  6.165   10.061  1.00 1.82 ? 6  CYS A O    11 
ATOM   4741  C CB   . CYS A 1 6  ? -1.025  3.740   9.253   1.00 2.55 ? 6  CYS A CB   11 
ATOM   4742  S SG   . CYS A 1 6  ? 0.354   2.603   8.964   1.00 3.26 ? 6  CYS A SG   11 
ATOM   4743  H H    . CYS A 1 6  ? -0.786  4.890   11.729  1.00 1.59 ? 6  CYS A H    11 
ATOM   4744  H HA   . CYS A 1 6  ? 0.380   5.351   9.005   1.00 2.20 ? 6  CYS A HA   11 
ATOM   4745  H HB2  . CYS A 1 6  ? -1.632  3.371   10.065  1.00 2.74 ? 6  CYS A HB2  11 
ATOM   4746  H HB3  . CYS A 1 6  ? -1.626  3.812   8.358   1.00 2.59 ? 6  CYS A HB3  11 
ATOM   4747  H HG   . CYS A 1 6  ? 1.102   2.902   9.488   1.00 3.41 ? 6  CYS A HG   11 
ATOM   4748  N N    . VAL A 1 7  ? -1.323  7.133   8.549   1.00 1.63 ? 7  VAL A N    11 
ATOM   4749  C CA   . VAL A 1 7  ? -2.315  8.216   8.299   1.00 1.89 ? 7  VAL A CA   11 
ATOM   4750  C C    . VAL A 1 7  ? -2.393  8.506   6.791   1.00 2.07 ? 7  VAL A C    11 
ATOM   4751  O O    . VAL A 1 7  ? -1.916  7.737   5.978   1.00 2.12 ? 7  VAL A O    11 
ATOM   4752  C CB   . VAL A 1 7  ? -1.773  9.416   9.096   1.00 2.10 ? 7  VAL A CB   11 
ATOM   4753  C CG1  . VAL A 1 7  ? -0.678  10.138  8.301   1.00 2.13 ? 7  VAL A CG1  11 
ATOM   4754  C CG2  . VAL A 1 7  ? -2.912  10.393  9.404   1.00 2.70 ? 7  VAL A CG2  11 
ATOM   4755  H H    . VAL A 1 7  ? -0.483  7.132   8.055   1.00 1.64 ? 7  VAL A H    11 
ATOM   4756  H HA   . VAL A 1 7  ? -3.285  7.933   8.676   1.00 2.13 ? 7  VAL A HA   11 
ATOM   4757  H HB   . VAL A 1 7  ? -1.354  9.059   10.023  1.00 2.08 ? 7  VAL A HB   11 
ATOM   4758  H HG11 . VAL A 1 7  ? -0.228  9.450   7.600   1.00 2.43 ? 7  VAL A HG11 11 
ATOM   4759  H HG12 . VAL A 1 7  ? -1.110  10.968  7.765   1.00 2.71 ? 7  VAL A HG12 11 
ATOM   4760  H HG13 . VAL A 1 7  ? 0.077   10.503  8.981   1.00 1.92 ? 7  VAL A HG13 11 
ATOM   4761  H HG21 . VAL A 1 7  ? -3.859  9.925   9.183   1.00 3.20 ? 7  VAL A HG21 11 
ATOM   4762  H HG22 . VAL A 1 7  ? -2.879  10.663  10.449  1.00 3.08 ? 7  VAL A HG22 11 
ATOM   4763  H HG23 . VAL A 1 7  ? -2.799  11.281  8.800   1.00 2.68 ? 7  VAL A HG23 11 
HETATM 4764  N N    . SEP A 1 8  ? -2.992  9.607   6.419   1.00 2.39 ? 8  SEP A N    11 
HETATM 4765  C CA   . SEP A 1 8  ? -3.111  9.959   4.965   1.00 2.69 ? 8  SEP A CA   11 
HETATM 4766  C CB   . SEP A 1 8  ? -3.694  11.374  4.941   1.00 3.20 ? 8  SEP A CB   11 
HETATM 4767  O OG   . SEP A 1 8  ? -5.125  11.299  4.940   1.00 3.58 ? 8  SEP A OG   11 
HETATM 4768  C C    . SEP A 1 8  ? -1.738  9.932   4.283   1.00 2.45 ? 8  SEP A C    11 
HETATM 4769  O O    . SEP A 1 8  ? -1.572  9.333   3.238   1.00 2.42 ? 8  SEP A O    11 
HETATM 4770  P P    . SEP A 1 8  ? -5.948  11.329  3.555   1.00 4.22 ? 8  SEP A P    11 
HETATM 4771  O O1P  . SEP A 1 8  ? -5.366  10.314  2.649   1.00 4.21 ? 8  SEP A O1P  11 
HETATM 4772  O O2P  . SEP A 1 8  ? -7.392  11.294  3.875   1.00 5.06 ? 8  SEP A O2P  11 
HETATM 4773  O O3P  . SEP A 1 8  ? -5.598  12.785  2.970   1.00 4.63 ? 8  SEP A O3P  11 
HETATM 4774  H H    . SEP A 1 8  ? -3.365  10.200  7.096   1.00 2.56 ? 8  SEP A H    11 
HETATM 4775  H HA   . SEP A 1 8  ? -3.782  9.279   4.472   1.00 2.81 ? 8  SEP A HA   11 
HETATM 4776  H HB2  . SEP A 1 8  ? -3.349  11.888  4.053   1.00 3.34 ? 8  SEP A HB2  11 
HETATM 4777  H HB3  . SEP A 1 8  ? -3.368  11.916  5.812   1.00 3.22 ? 8  SEP A HB3  11 
HETATM 4778  H HOP3 . SEP A 1 8  ? -5.941  13.431  3.592   1.00 4.83 ? 8  SEP A HOP3 11 
ATOM   4779  N N    . SER A 1 9  ? -0.758  10.575  4.874   1.00 2.37 ? 9  SER A N    11 
ATOM   4780  C CA   . SER A 1 9  ? 0.617   10.602  4.282   1.00 2.19 ? 9  SER A CA   11 
ATOM   4781  C C    . SER A 1 9  ? 0.581   11.140  2.847   1.00 2.29 ? 9  SER A C    11 
ATOM   4782  O O    . SER A 1 9  ? -0.279  11.920  2.480   1.00 2.58 ? 9  SER A O    11 
ATOM   4783  C CB   . SER A 1 9  ? 1.091   9.143   4.298   1.00 1.90 ? 9  SER A CB   11 
ATOM   4784  O OG   . SER A 1 9  ? 2.493   9.101   4.061   1.00 1.81 ? 9  SER A OG   11 
ATOM   4785  H H    . SER A 1 9  ? -0.928  11.041  5.711   1.00 2.47 ? 9  SER A H    11 
ATOM   4786  H HA   . SER A 1 9  ? 1.275   11.204  4.887   1.00 2.25 ? 9  SER A HA   11 
ATOM   4787  H HB2  . SER A 1 9  ? 0.878   8.701   5.256   1.00 1.92 ? 9  SER A HB2  11 
ATOM   4788  H HB3  . SER A 1 9  ? 0.570   8.589   3.525   1.00 1.86 ? 9  SER A HB3  11 
ATOM   4789  H HG   . SER A 1 9  ? 2.918   8.746   4.847   1.00 1.90 ? 9  SER A HG   11 
ATOM   4790  N N    . TYR A 1 10 ? 1.518   10.722  2.045   1.00 2.08 ? 10 TYR A N    11 
ATOM   4791  C CA   . TYR A 1 10 ? 1.579   11.177  0.619   1.00 2.13 ? 10 TYR A CA   11 
ATOM   4792  C C    . TYR A 1 10 ? 0.371   10.651  -0.187  1.00 2.19 ? 10 TYR A C    11 
ATOM   4793  O O    . TYR A 1 10 ? -0.574  10.120  0.368   1.00 2.30 ? 10 TYR A O    11 
ATOM   4794  C CB   . TYR A 1 10 ? 2.905   10.609  0.081   1.00 1.84 ? 10 TYR A CB   11 
ATOM   4795  C CG   . TYR A 1 10 ? 2.922   9.087   0.085   1.00 1.54 ? 10 TYR A CG   11 
ATOM   4796  C CD1  . TYR A 1 10 ? 1.866   8.339   0.633   1.00 1.58 ? 10 TYR A CD1  11 
ATOM   4797  C CD2  . TYR A 1 10 ? 4.016   8.427   -0.479  1.00 1.32 ? 10 TYR A CD2  11 
ATOM   4798  C CE1  . TYR A 1 10 ? 1.914   6.943   0.613   1.00 1.42 ? 10 TYR A CE1  11 
ATOM   4799  C CE2  . TYR A 1 10 ? 4.061   7.031   -0.500  1.00 1.11 ? 10 TYR A CE2  11 
ATOM   4800  C CZ   . TYR A 1 10 ? 3.010   6.289   0.045   1.00 1.18 ? 10 TYR A CZ   11 
ATOM   4801  O OH   . TYR A 1 10 ? 3.052   4.912   0.020   1.00 1.17 ? 10 TYR A OH   11 
ATOM   4802  H H    . TYR A 1 10 ? 2.193   10.099  2.388   1.00 1.90 ? 10 TYR A H    11 
ATOM   4803  H HA   . TYR A 1 10 ? 1.607   12.252  0.578   1.00 2.36 ? 10 TYR A HA   11 
ATOM   4804  H HB2  . TYR A 1 10 ? 3.052   10.955  -0.930  1.00 1.86 ? 10 TYR A HB2  11 
ATOM   4805  H HB3  . TYR A 1 10 ? 3.716   10.969  0.697   1.00 1.90 ? 10 TYR A HB3  11 
ATOM   4806  H HD1  . TYR A 1 10 ? 1.018   8.839   1.077   1.00 1.80 ? 10 TYR A HD1  11 
ATOM   4807  H HD2  . TYR A 1 10 ? 4.828   9.001   -0.898  1.00 1.40 ? 10 TYR A HD2  11 
ATOM   4808  H HE1  . TYR A 1 10 ? 1.101   6.372   1.032   1.00 1.55 ? 10 TYR A HE1  11 
ATOM   4809  H HE2  . TYR A 1 10 ? 4.910   6.527   -0.938  1.00 1.00 ? 10 TYR A HE2  11 
ATOM   4810  H HH   . TYR A 1 10 ? 2.969   4.597   0.924   1.00 1.29 ? 10 TYR A HH   11 
ATOM   4811  N N    . ARG A 1 11 ? 0.391   10.799  -1.491  1.00 2.20 ? 11 ARG A N    11 
ATOM   4812  C CA   . ARG A 1 11 ? -0.760  10.313  -2.319  1.00 2.36 ? 11 ARG A CA   11 
ATOM   4813  C C    . ARG A 1 11 ? -0.776  8.778   -2.428  1.00 2.17 ? 11 ARG A C    11 
ATOM   4814  O O    . ARG A 1 11 ? -1.769  8.189   -2.808  1.00 2.35 ? 11 ARG A O    11 
ATOM   4815  C CB   . ARG A 1 11 ? -0.568  10.974  -3.694  1.00 2.45 ? 11 ARG A CB   11 
ATOM   4816  C CG   . ARG A 1 11 ? 0.459   10.196  -4.531  1.00 2.22 ? 11 ARG A CG   11 
ATOM   4817  C CD   . ARG A 1 11 ? -0.269  9.230   -5.474  1.00 2.43 ? 11 ARG A CD   11 
ATOM   4818  N NE   . ARG A 1 11 ? -0.729  10.073  -6.617  1.00 2.57 ? 11 ARG A NE   11 
ATOM   4819  C CZ   . ARG A 1 11 ? -1.993  10.361  -6.754  1.00 2.76 ? 11 ARG A CZ   11 
ATOM   4820  N NH1  . ARG A 1 11 ? -2.821  9.459   -7.198  1.00 3.10 ? 11 ARG A NH1  11 
ATOM   4821  N NH2  . ARG A 1 11 ? -2.425  11.550  -6.446  1.00 3.07 ? 11 ARG A NH2  11 
ATOM   4822  H H    . ARG A 1 11 ? 1.154   11.232  -1.923  1.00 2.15 ? 11 ARG A H    11 
ATOM   4823  H HA   . ARG A 1 11 ? -1.681  10.649  -1.887  1.00 2.60 ? 11 ARG A HA   11 
ATOM   4824  H HB2  . ARG A 1 11 ? -1.512  10.989  -4.212  1.00 2.74 ? 11 ARG A HB2  11 
ATOM   4825  H HB3  . ARG A 1 11 ? -0.220  11.987  -3.557  1.00 2.46 ? 11 ARG A HB3  11 
ATOM   4826  H HG2  . ARG A 1 11 ? 1.047   10.892  -5.112  1.00 2.15 ? 11 ARG A HG2  11 
ATOM   4827  H HG3  . ARG A 1 11 ? 1.110   9.636   -3.877  1.00 2.05 ? 11 ARG A HG3  11 
ATOM   4828  H HD2  . ARG A 1 11 ? 0.410   8.460   -5.817  1.00 2.48 ? 11 ARG A HD2  11 
ATOM   4829  H HD3  . ARG A 1 11 ? -1.118  8.786   -4.976  1.00 2.56 ? 11 ARG A HD3  11 
ATOM   4830  H HE   . ARG A 1 11 ? -0.079  10.411  -7.269  1.00 2.73 ? 11 ARG A HE   11 
ATOM   4831  H HH11 . ARG A 1 11 ? -2.484  8.547   -7.434  1.00 3.32 ? 11 ARG A HH11 11 
ATOM   4832  H HH12 . ARG A 1 11 ? -3.790  9.676   -7.302  1.00 3.41 ? 11 ARG A HH12 11 
ATOM   4833  H HH21 . ARG A 1 11 ? -1.786  12.239  -6.106  1.00 3.26 ? 11 ARG A HH21 11 
ATOM   4834  H HH22 . ARG A 1 11 ? -3.393  11.773  -6.549  1.00 3.39 ? 11 ARG A HH22 11 
ATOM   4835  N N    . GLY A 1 12 ? 0.312   8.133   -2.103  1.00 1.89 ? 12 GLY A N    11 
ATOM   4836  C CA   . GLY A 1 12 ? 0.371   6.640   -2.187  1.00 1.78 ? 12 GLY A CA   11 
ATOM   4837  C C    . GLY A 1 12 ? 1.492   6.227   -3.142  1.00 1.47 ? 12 GLY A C    11 
ATOM   4838  O O    . GLY A 1 12 ? 1.456   5.166   -3.738  1.00 1.45 ? 12 GLY A O    11 
ATOM   4839  H H    . GLY A 1 12 ? 1.097   8.633   -1.807  1.00 1.79 ? 12 GLY A H    11 
ATOM   4840  H HA2  . GLY A 1 12 ? 0.564   6.230   -1.207  1.00 1.73 ? 12 GLY A HA2  11 
ATOM   4841  H HA3  . GLY A 1 12 ? -0.568  6.261   -2.558  1.00 2.03 ? 12 GLY A HA3  11 
ATOM   4842  N N    . ARG A 1 13 ? 2.482   7.068   -3.297  1.00 1.34 ? 13 ARG A N    11 
ATOM   4843  C CA   . ARG A 1 13 ? 3.608   6.759   -4.219  1.00 1.09 ? 13 ARG A CA   11 
ATOM   4844  C C    . ARG A 1 13 ? 4.745   6.022   -3.488  1.00 0.80 ? 13 ARG A C    11 
ATOM   4845  O O    . ARG A 1 13 ? 5.879   6.469   -3.459  1.00 0.79 ? 13 ARG A O    11 
ATOM   4846  C CB   . ARG A 1 13 ? 4.055   8.134   -4.737  1.00 1.31 ? 13 ARG A CB   11 
ATOM   4847  C CG   . ARG A 1 13 ? 4.568   9.009   -3.586  1.00 1.38 ? 13 ARG A CG   11 
ATOM   4848  C CD   . ARG A 1 13 ? 5.841   9.738   -4.022  1.00 1.54 ? 13 ARG A CD   11 
ATOM   4849  N NE   . ARG A 1 13 ? 6.942   8.767   -3.762  1.00 1.18 ? 13 ARG A NE   11 
ATOM   4850  C CZ   . ARG A 1 13 ? 8.175   9.177   -3.690  1.00 1.29 ? 13 ARG A CZ   11 
ATOM   4851  N NH1  . ARG A 1 13 ? 8.576   9.840   -2.645  1.00 1.79 ? 13 ARG A NH1  11 
ATOM   4852  N NH2  . ARG A 1 13 ? 9.001   8.921   -4.662  1.00 1.16 ? 13 ARG A NH2  11 
ATOM   4853  H H    . ARG A 1 13 ? 2.477   7.913   -2.811  1.00 1.49 ? 13 ARG A H    11 
ATOM   4854  H HA   . ARG A 1 13 ? 3.255   6.161   -5.040  1.00 1.13 ? 13 ARG A HA   11 
ATOM   4855  H HB2  . ARG A 1 13 ? 4.838   8.002   -5.460  1.00 1.27 ? 13 ARG A HB2  11 
ATOM   4856  H HB3  . ARG A 1 13 ? 3.215   8.625   -5.205  1.00 1.56 ? 13 ARG A HB3  11 
ATOM   4857  H HG2  . ARG A 1 13 ? 3.811   9.734   -3.320  1.00 1.62 ? 13 ARG A HG2  11 
ATOM   4858  H HG3  . ARG A 1 13 ? 4.786   8.389   -2.730  1.00 1.17 ? 13 ARG A HG3  11 
ATOM   4859  H HD2  . ARG A 1 13 ? 5.791   9.984   -5.075  1.00 1.71 ? 13 ARG A HD2  11 
ATOM   4860  H HD3  . ARG A 1 13 ? 5.986   10.631  -3.432  1.00 1.85 ? 13 ARG A HD3  11 
ATOM   4861  H HE   . ARG A 1 13 ? 6.735   7.811   -3.643  1.00 1.03 ? 13 ARG A HE   11 
ATOM   4862  H HH11 . ARG A 1 13 ? 7.940   10.032  -1.900  1.00 2.04 ? 13 ARG A HH11 11 
ATOM   4863  H HH12 . ARG A 1 13 ? 9.526   10.165  -2.589  1.00 2.02 ? 13 ARG A HH12 11 
ATOM   4864  H HH21 . ARG A 1 13 ? 8.690   8.408   -5.461  1.00 1.02 ? 13 ARG A HH21 11 
ATOM   4865  H HH22 . ARG A 1 13 ? 9.951   9.239   -4.610  1.00 1.43 ? 13 ARG A HH22 11 
ATOM   4866  N N    . LYS A 1 14 ? 4.448   4.884   -2.910  1.00 0.80 ? 14 LYS A N    11 
ATOM   4867  C CA   . LYS A 1 14 ? 5.502   4.093   -2.187  1.00 0.77 ? 14 LYS A CA   11 
ATOM   4868  C C    . LYS A 1 14 ? 6.500   3.476   -3.185  1.00 0.78 ? 14 LYS A C    11 
ATOM   4869  O O    . LYS A 1 14 ? 6.625   2.269   -3.296  1.00 0.99 ? 14 LYS A O    11 
ATOM   4870  C CB   . LYS A 1 14 ? 4.772   2.986   -1.385  1.00 1.03 ? 14 LYS A CB   11 
ATOM   4871  C CG   . LYS A 1 14 ? 3.502   2.470   -2.095  1.00 1.24 ? 14 LYS A CG   11 
ATOM   4872  C CD   . LYS A 1 14 ? 3.817   2.055   -3.538  1.00 1.25 ? 14 LYS A CD   11 
ATOM   4873  C CE   . LYS A 1 14 ? 2.518   1.683   -4.259  1.00 1.64 ? 14 LYS A CE   11 
ATOM   4874  N NZ   . LYS A 1 14 ? 2.081   2.933   -4.951  1.00 1.68 ? 14 LYS A NZ   11 
ATOM   4875  H H    . LYS A 1 14 ? 3.535   4.552   -2.957  1.00 0.98 ? 14 LYS A H    11 
ATOM   4876  H HA   . LYS A 1 14 ? 6.032   4.739   -1.503  1.00 0.80 ? 14 LYS A HA   11 
ATOM   4877  H HB2  . LYS A 1 14 ? 5.447   2.160   -1.243  1.00 1.17 ? 14 LYS A HB2  11 
ATOM   4878  H HB3  . LYS A 1 14 ? 4.497   3.381   -0.420  1.00 1.07 ? 14 LYS A HB3  11 
ATOM   4879  H HG2  . LYS A 1 14 ? 3.121   1.614   -1.557  1.00 1.48 ? 14 LYS A HG2  11 
ATOM   4880  H HG3  . LYS A 1 14 ? 2.751   3.246   -2.099  1.00 1.26 ? 14 LYS A HG3  11 
ATOM   4881  H HD2  . LYS A 1 14 ? 4.296   2.873   -4.054  1.00 1.04 ? 14 LYS A HD2  11 
ATOM   4882  H HD3  . LYS A 1 14 ? 4.477   1.201   -3.530  1.00 1.33 ? 14 LYS A HD3  11 
ATOM   4883  H HE2  . LYS A 1 14 ? 2.703   0.896   -4.979  1.00 1.73 ? 14 LYS A HE2  11 
ATOM   4884  H HE3  . LYS A 1 14 ? 1.767   1.372   -3.548  1.00 1.93 ? 14 LYS A HE3  11 
ATOM   4885  H HZ1  . LYS A 1 14 ? 2.854   3.292   -5.547  1.00 2.03 ? 14 LYS A HZ1  11 
ATOM   4886  H HZ2  . LYS A 1 14 ? 1.254   2.725   -5.549  1.00 1.89 ? 14 LYS A HZ2  11 
ATOM   4887  H HZ3  . LYS A 1 14 ? 1.824   3.658   -4.244  1.00 1.84 ? 14 LYS A HZ3  11 
ATOM   4888  N N    . SER A 1 15 ? 7.214   4.303   -3.907  1.00 0.68 ? 15 SER A N    11 
ATOM   4889  C CA   . SER A 1 15 ? 8.209   3.785   -4.898  1.00 0.78 ? 15 SER A CA   11 
ATOM   4890  C C    . SER A 1 15 ? 9.503   3.366   -4.183  1.00 0.78 ? 15 SER A C    11 
ATOM   4891  O O    . SER A 1 15 ? 10.527  4.013   -4.295  1.00 0.92 ? 15 SER A O    11 
ATOM   4892  C CB   . SER A 1 15 ? 8.467   4.954   -5.854  1.00 0.86 ? 15 SER A CB   11 
ATOM   4893  O OG   . SER A 1 15 ? 8.715   4.445   -7.157  1.00 0.99 ? 15 SER A OG   11 
ATOM   4894  H H    . SER A 1 15 ? 7.096   5.271   -3.792  1.00 0.67 ? 15 SER A H    11 
ATOM   4895  H HA   . SER A 1 15 ? 7.796   2.950   -5.442  1.00 0.87 ? 15 SER A HA   11 
ATOM   4896  H HB2  . SER A 1 15 ? 7.602   5.595   -5.883  1.00 0.91 ? 15 SER A HB2  11 
ATOM   4897  H HB3  . SER A 1 15 ? 9.321   5.522   -5.507  1.00 0.91 ? 15 SER A HB3  11 
ATOM   4898  H HG   . SER A 1 15 ? 9.533   3.933   -7.129  1.00 0.95 ? 15 SER A HG   11 
ATOM   4899  N N    . GLY A 1 16 ? 9.454   2.286   -3.447  1.00 0.93 ? 16 GLY A N    11 
ATOM   4900  C CA   . GLY A 1 16 ? 10.667  1.810   -2.715  1.00 0.96 ? 16 GLY A CA   11 
ATOM   4901  C C    . GLY A 1 16 ? 10.255  0.773   -1.668  1.00 0.95 ? 16 GLY A C    11 
ATOM   4902  O O    . GLY A 1 16 ? 10.448  0.963   -0.483  1.00 1.02 ? 16 GLY A O    11 
ATOM   4903  H H    . GLY A 1 16 ? 8.611   1.786   -3.374  1.00 1.16 ? 16 GLY A H    11 
ATOM   4904  H HA2  . GLY A 1 16 ? 11.359  1.362   -3.414  1.00 1.00 ? 16 GLY A HA2  11 
ATOM   4905  H HA3  . GLY A 1 16 ? 11.142  2.643   -2.221  1.00 1.01 ? 16 GLY A HA3  11 
ATOM   4906  N N    . ASN A 1 17 ? 9.682   -0.323  -2.101  1.00 0.92 ? 17 ASN A N    11 
ATOM   4907  C CA   . ASN A 1 17 ? 9.244   -1.382  -1.140  1.00 0.96 ? 17 ASN A CA   11 
ATOM   4908  C C    . ASN A 1 17 ? 9.346   -2.770  -1.793  1.00 1.00 ? 17 ASN A C    11 
ATOM   4909  O O    . ASN A 1 17 ? 9.908   -2.921  -2.863  1.00 1.06 ? 17 ASN A O    11 
ATOM   4910  C CB   . ASN A 1 17 ? 7.786   -1.033  -0.823  1.00 1.03 ? 17 ASN A CB   11 
ATOM   4911  C CG   . ASN A 1 17 ? 7.429   -1.533  0.577   1.00 1.13 ? 17 ASN A CG   11 
ATOM   4912  O OD1  . ASN A 1 17 ? 6.906   -2.616  0.731   1.00 1.23 ? 17 ASN A OD1  11 
ATOM   4913  N ND2  . ASN A 1 17 ? 7.696   -0.787  1.611   1.00 1.34 ? 17 ASN A ND2  11 
ATOM   4914  H H    . ASN A 1 17 ? 9.534   -0.448  -3.062  1.00 0.93 ? 17 ASN A H    11 
ATOM   4915  H HA   . ASN A 1 17 ? 9.838   -1.344  -0.239  1.00 1.04 ? 17 ASN A HA   11 
ATOM   4916  H HB2  . ASN A 1 17 ? 7.655   0.039   -0.867  1.00 1.08 ? 17 ASN A HB2  11 
ATOM   4917  H HB3  . ASN A 1 17 ? 7.138   -1.504  -1.547  1.00 1.05 ? 17 ASN A HB3  11 
ATOM   4918  H HD21 . ASN A 1 17 ? 8.124   0.087   1.490   1.00 1.53 ? 17 ASN A HD21 11 
ATOM   4919  H HD22 . ASN A 1 17 ? 7.470   -1.102  2.511   1.00 1.43 ? 17 ASN A HD22 11 
ATOM   4920  N N    . LYS A 1 18 ? 8.810   -3.786  -1.159  1.00 1.05 ? 18 LYS A N    11 
ATOM   4921  C CA   . LYS A 1 18 ? 8.876   -5.162  -1.746  1.00 1.18 ? 18 LYS A CA   11 
ATOM   4922  C C    . LYS A 1 18 ? 8.027   -5.253  -3.028  1.00 1.24 ? 18 LYS A C    11 
ATOM   4923  O O    . LYS A 1 18 ? 8.409   -5.942  -3.960  1.00 1.45 ? 18 LYS A O    11 
ATOM   4924  C CB   . LYS A 1 18 ? 8.325   -6.097  -0.663  1.00 1.22 ? 18 LYS A CB   11 
ATOM   4925  C CG   . LYS A 1 18 ? 9.336   -7.213  -0.392  1.00 1.36 ? 18 LYS A CG   11 
ATOM   4926  C CD   . LYS A 1 18 ? 9.229   -8.282  -1.488  1.00 1.56 ? 18 LYS A CD   11 
ATOM   4927  C CE   . LYS A 1 18 ? 10.409  -8.150  -2.458  1.00 1.72 ? 18 LYS A CE   11 
ATOM   4928  N NZ   . LYS A 1 18 ? 9.796   -8.121  -3.818  1.00 1.83 ? 18 LYS A NZ   11 
ATOM   4929  H H    . LYS A 1 18 ? 8.364   -3.645  -0.298  1.00 1.06 ? 18 LYS A H    11 
ATOM   4930  H HA   . LYS A 1 18 ? 9.900   -5.420  -1.963  1.00 1.28 ? 18 LYS A HA   11 
ATOM   4931  H HB2  . LYS A 1 18 ? 8.155   -5.538  0.246   1.00 1.18 ? 18 LYS A HB2  11 
ATOM   4932  H HB3  . LYS A 1 18 ? 7.395   -6.531  -0.998  1.00 1.29 ? 18 LYS A HB3  11 
ATOM   4933  H HG2  . LYS A 1 18 ? 10.334  -6.799  -0.385  1.00 1.41 ? 18 LYS A HG2  11 
ATOM   4934  H HG3  . LYS A 1 18 ? 9.125   -7.662  0.567   1.00 1.39 ? 18 LYS A HG3  11 
ATOM   4935  H HD2  . LYS A 1 18 ? 9.244   -9.262  -1.034  1.00 1.68 ? 18 LYS A HD2  11 
ATOM   4936  H HD3  . LYS A 1 18 ? 8.304   -8.150  -2.028  1.00 1.60 ? 18 LYS A HD3  11 
ATOM   4937  H HE2  . LYS A 1 18 ? 10.950  -7.233  -2.266  1.00 1.67 ? 18 LYS A HE2  11 
ATOM   4938  H HE3  . LYS A 1 18 ? 11.066  -9.001  -2.366  1.00 1.91 ? 18 LYS A HE3  11 
ATOM   4939  H HZ1  . LYS A 1 18 ? 9.209   -8.969  -3.954  1.00 1.97 ? 18 LYS A HZ1  11 
ATOM   4940  H HZ2  . LYS A 1 18 ? 9.201   -7.266  -3.917  1.00 1.69 ? 18 LYS A HZ2  11 
ATOM   4941  H HZ3  . LYS A 1 18 ? 10.546  -8.099  -4.536  1.00 2.06 ? 18 LYS A HZ3  11 
ATOM   4942  N N    . PRO A 1 19 ? 6.909   -4.555  -3.045  1.00 1.16 ? 19 PRO A N    11 
ATOM   4943  C CA   . PRO A 1 19 ? 6.063   -4.601  -4.264  1.00 1.32 ? 19 PRO A CA   11 
ATOM   4944  C C    . PRO A 1 19 ? 5.976   -3.206  -4.911  1.00 1.25 ? 19 PRO A C    11 
ATOM   4945  O O    . PRO A 1 19 ? 5.026   -2.477  -4.692  1.00 1.26 ? 19 PRO A O    11 
ATOM   4946  C CB   . PRO A 1 19 ? 4.703   -5.052  -3.739  1.00 1.46 ? 19 PRO A CB   11 
ATOM   4947  C CG   . PRO A 1 19 ? 4.665   -4.644  -2.297  1.00 1.33 ? 19 PRO A CG   11 
ATOM   4948  C CD   . PRO A 1 19 ? 6.066   -4.266  -1.873  1.00 1.15 ? 19 PRO A CD   11 
ATOM   4949  H HA   . PRO A 1 19 ? 6.447   -5.323  -4.966  1.00 1.47 ? 19 PRO A HA   11 
ATOM   4950  H HB2  . PRO A 1 19 ? 3.910   -4.564  -4.289  1.00 1.56 ? 19 PRO A HB2  11 
ATOM   4951  H HB3  . PRO A 1 19 ? 4.609   -6.125  -3.820  1.00 1.60 ? 19 PRO A HB3  11 
ATOM   4952  H HG2  . PRO A 1 19 ? 4.005   -3.797  -2.176  1.00 1.37 ? 19 PRO A HG2  11 
ATOM   4953  H HG3  . PRO A 1 19 ? 4.317   -5.468  -1.693  1.00 1.44 ? 19 PRO A HG3  11 
ATOM   4954  H HD2  . PRO A 1 19 ? 6.110   -3.215  -1.625  1.00 1.14 ? 19 PRO A HD2  11 
ATOM   4955  H HD3  . PRO A 1 19 ? 6.378   -4.865  -1.033  1.00 1.17 ? 19 PRO A HD3  11 
ATOM   4956  N N    . PRO A 1 20 ? 6.980   -2.881  -5.694  1.00 1.25 ? 20 PRO A N    11 
ATOM   4957  C CA   . PRO A 1 20 ? 6.969   -1.546  -6.360  1.00 1.21 ? 20 PRO A CA   11 
ATOM   4958  C C    . PRO A 1 20 ? 6.245   -1.614  -7.714  1.00 1.35 ? 20 PRO A C    11 
ATOM   4959  O O    . PRO A 1 20 ? 5.550   -0.691  -8.090  1.00 1.35 ? 20 PRO A O    11 
ATOM   4960  C CB   . PRO A 1 20 ? 8.447   -1.211  -6.548  1.00 1.21 ? 20 PRO A CB   11 
ATOM   4961  C CG   . PRO A 1 20 ? 9.139   -2.531  -6.572  1.00 1.33 ? 20 PRO A CG   11 
ATOM   4962  C CD   . PRO A 1 20 ? 8.334   -3.464  -5.708  1.00 1.31 ? 20 PRO A CD   11 
ATOM   4963  H HA   . PRO A 1 20 ? 6.505   -0.810  -5.723  1.00 1.18 ? 20 PRO A HA   11 
ATOM   4964  H HB2  . PRO A 1 20 ? 8.597   -0.688  -7.482  1.00 1.26 ? 20 PRO A HB2  11 
ATOM   4965  H HB3  . PRO A 1 20 ? 8.807   -0.620  -5.721  1.00 1.17 ? 20 PRO A HB3  11 
ATOM   4966  H HG2  . PRO A 1 20 ? 9.185   -2.907  -7.585  1.00 1.47 ? 20 PRO A HG2  11 
ATOM   4967  H HG3  . PRO A 1 20 ? 10.136  -2.433  -6.168  1.00 1.38 ? 20 PRO A HG3  11 
ATOM   4968  H HD2  . PRO A 1 20 ? 8.318   -4.456  -6.140  1.00 1.45 ? 20 PRO A HD2  11 
ATOM   4969  H HD3  . PRO A 1 20 ? 8.736   -3.493  -4.708  1.00 1.30 ? 20 PRO A HD3  11 
ATOM   4970  N N    . SER A 1 21 ? 6.411   -2.700  -8.446  1.00 1.56 ? 21 SER A N    11 
ATOM   4971  C CA   . SER A 1 21 ? 5.748   -2.858  -9.789  1.00 1.76 ? 21 SER A CA   11 
ATOM   4972  C C    . SER A 1 21 ? 6.326   -1.867  -10.813 1.00 1.74 ? 21 SER A C    11 
ATOM   4973  O O    . SER A 1 21 ? 6.861   -2.267  -11.830 1.00 1.99 ? 21 SER A O    11 
ATOM   4974  C CB   . SER A 1 21 ? 4.255   -2.599  -9.560  1.00 1.81 ? 21 SER A CB   11 
ATOM   4975  O OG   . SER A 1 21 ? 3.518   -3.087  -10.677 1.00 2.08 ? 21 SER A OG   11 
ATOM   4976  H H    . SER A 1 21 ? 6.984   -3.421  -8.109  1.00 1.64 ? 21 SER A H    11 
ATOM   4977  H HA   . SER A 1 21 ? 5.885   -3.867  -10.145 1.00 1.96 ? 21 SER A HA   11 
ATOM   4978  H HB2  . SER A 1 21 ? 3.930   -3.111  -8.668  1.00 1.87 ? 21 SER A HB2  11 
ATOM   4979  H HB3  . SER A 1 21 ? 4.086   -1.536  -9.442  1.00 1.72 ? 21 SER A HB3  11 
ATOM   4980  H HG   . SER A 1 21 ? 2.609   -3.232  -10.393 1.00 2.22 ? 21 SER A HG   11 
ATOM   4981  N N    . LYS A 1 22 ? 6.217   -0.587  -10.557 1.00 1.54 ? 22 LYS A N    11 
ATOM   4982  C CA   . LYS A 1 22 ? 6.755   0.432   -11.510 1.00 1.62 ? 22 LYS A CA   11 
ATOM   4983  C C    . LYS A 1 22 ? 7.406   1.582   -10.728 1.00 1.33 ? 22 LYS A C    11 
ATOM   4984  O O    . LYS A 1 22 ? 6.828   2.640   -10.559 1.00 1.34 ? 22 LYS A O    11 
ATOM   4985  C CB   . LYS A 1 22 ? 5.536   0.926   -12.298 1.00 1.86 ? 22 LYS A CB   11 
ATOM   4986  C CG   . LYS A 1 22 ? 5.215   -0.058  -13.427 1.00 2.19 ? 22 LYS A CG   11 
ATOM   4987  C CD   . LYS A 1 22 ? 3.929   -0.820  -13.092 1.00 2.22 ? 22 LYS A CD   11 
ATOM   4988  C CE   . LYS A 1 22 ? 3.868   -2.117  -13.907 1.00 2.49 ? 22 LYS A CE   11 
ATOM   4989  N NZ   . LYS A 1 22 ? 4.473   -3.161  -13.028 1.00 2.40 ? 22 LYS A NZ   11 
ATOM   4990  H H    . LYS A 1 22 ? 5.776   -0.292  -9.731  1.00 1.41 ? 22 LYS A H    11 
ATOM   4991  H HA   . LYS A 1 22 ? 7.472   -0.020  -12.179 1.00 1.79 ? 22 LYS A HA   11 
ATOM   4992  H HB2  . LYS A 1 22 ? 4.688   1.005   -11.634 1.00 1.80 ? 22 LYS A HB2  11 
ATOM   4993  H HB3  . LYS A 1 22 ? 5.752   1.896   -12.721 1.00 1.94 ? 22 LYS A HB3  11 
ATOM   4994  H HG2  . LYS A 1 22 ? 5.081   0.486   -14.351 1.00 2.45 ? 22 LYS A HG2  11 
ATOM   4995  H HG3  . LYS A 1 22 ? 6.029   -0.760  -13.537 1.00 2.28 ? 22 LYS A HG3  11 
ATOM   4996  H HD2  . LYS A 1 22 ? 3.915   -1.056  -12.037 1.00 2.03 ? 22 LYS A HD2  11 
ATOM   4997  H HD3  . LYS A 1 22 ? 3.074   -0.206  -13.333 1.00 2.36 ? 22 LYS A HD3  11 
ATOM   4998  H HE2  . LYS A 1 22 ? 2.840   -2.365  -14.139 1.00 2.66 ? 22 LYS A HE2  11 
ATOM   4999  H HE3  . LYS A 1 22 ? 4.443   -2.017  -14.815 1.00 2.66 ? 22 LYS A HE3  11 
ATOM   5000  H HZ1  . LYS A 1 22 ? 4.033   -3.120  -12.077 1.00 2.25 ? 22 LYS A HZ1  11 
ATOM   5001  H HZ2  . LYS A 1 22 ? 4.312   -4.101  -13.445 1.00 2.62 ? 22 LYS A HZ2  11 
ATOM   5002  H HZ3  . LYS A 1 22 ? 5.497   -2.991  -12.940 1.00 2.32 ? 22 LYS A HZ3  11 
ATOM   5003  N N    . THR A 1 23 ? 8.607   1.378   -10.245 1.00 1.22 ? 23 THR A N    11 
ATOM   5004  C CA   . THR A 1 23 ? 9.303   2.454   -9.465  1.00 1.01 ? 23 THR A CA   11 
ATOM   5005  C C    . THR A 1 23 ? 10.279  3.236   -10.361 1.00 1.31 ? 23 THR A C    11 
ATOM   5006  O O    . THR A 1 23 ? 11.374  3.579   -9.953  1.00 1.34 ? 23 THR A O    11 
ATOM   5007  C CB   . THR A 1 23 ? 10.050  1.721   -8.340  1.00 1.00 ? 23 THR A CB   11 
ATOM   5008  O OG1  . THR A 1 23 ? 10.630  2.676   -7.460  1.00 0.87 ? 23 THR A OG1  11 
ATOM   5009  C CG2  . THR A 1 23 ? 11.151  0.829   -8.928  1.00 1.50 ? 23 THR A CG2  11 
ATOM   5010  H H    . THR A 1 23 ? 9.048   0.516   -10.392 1.00 1.36 ? 23 THR A H    11 
ATOM   5011  H HA   . THR A 1 23 ? 8.576   3.128   -9.038  1.00 0.89 ? 23 THR A HA   11 
ATOM   5012  H HB   . THR A 1 23 ? 9.353   1.107   -7.790  1.00 1.00 ? 23 THR A HB   11 
ATOM   5013  H HG1  . THR A 1 23 ? 11.368  3.094   -7.918  1.00 0.96 ? 23 THR A HG1  11 
ATOM   5014  H HG21 . THR A 1 23 ? 11.195  0.968   -9.998  1.00 1.76 ? 23 THR A HG21 11 
ATOM   5015  H HG22 . THR A 1 23 ? 12.101  1.097   -8.491  1.00 1.91 ? 23 THR A HG22 11 
ATOM   5016  H HG23 . THR A 1 23 ? 10.932  -0.204  -8.708  1.00 2.04 ? 23 THR A HG23 11 
ATOM   5017  N N    . CYS A 1 24 ? 9.884   3.527   -11.574 1.00 1.66 ? 24 CYS A N    11 
ATOM   5018  C CA   . CYS A 1 24 ? 10.778  4.294   -12.498 1.00 2.06 ? 24 CYS A CA   11 
ATOM   5019  C C    . CYS A 1 24 ? 10.650  5.802   -12.237 1.00 2.10 ? 24 CYS A C    11 
ATOM   5020  O O    . CYS A 1 24 ? 11.606  6.542   -12.376 1.00 2.54 ? 24 CYS A O    11 
ATOM   5021  C CB   . CYS A 1 24 ? 10.289  3.948   -13.908 1.00 2.49 ? 24 CYS A CB   11 
ATOM   5022  S SG   . CYS A 1 24 ? 10.916  2.317   -14.381 1.00 2.68 ? 24 CYS A SG   11 
ATOM   5023  H H    . CYS A 1 24 ? 8.997   3.247   -11.877 1.00 1.71 ? 24 CYS A H    11 
ATOM   5024  H HA   . CYS A 1 24 ? 11.801  3.978   -12.376 1.00 2.11 ? 24 CYS A HA   11 
ATOM   5025  H HB2  . CYS A 1 24 ? 9.210   3.938   -13.923 1.00 2.67 ? 24 CYS A HB2  11 
ATOM   5026  H HB3  . CYS A 1 24 ? 10.651  4.689   -14.605 1.00 2.74 ? 24 CYS A HB3  11 
ATOM   5027  H HG   . CYS A 1 24 ? 11.824  2.422   -14.676 1.00 2.84 ? 24 CYS A HG   11 
ATOM   5028  N N    . LEU A 1 25 ? 9.481   6.259   -11.856 1.00 1.81 ? 25 LEU A N    11 
ATOM   5029  C CA   . LEU A 1 25 ? 9.294   7.718   -11.580 1.00 2.05 ? 25 LEU A CA   11 
ATOM   5030  C C    . LEU A 1 25 ? 9.508   8.016   -10.088 1.00 2.10 ? 25 LEU A C    11 
ATOM   5031  O O    . LEU A 1 25 ? 9.067   7.277   -9.225  1.00 2.54 ? 25 LEU A O    11 
ATOM   5032  C CB   . LEU A 1 25 ? 7.853   8.039   -12.012 1.00 1.95 ? 25 LEU A CB   11 
ATOM   5033  C CG   . LEU A 1 25 ? 6.846   7.314   -11.109 1.00 1.58 ? 25 LEU A CG   11 
ATOM   5034  C CD1  . LEU A 1 25 ? 6.229   8.308   -10.125 1.00 2.54 ? 25 LEU A CD1  11 
ATOM   5035  C CD2  . LEU A 1 25 ? 5.737   6.705   -11.971 1.00 1.73 ? 25 LEU A CD2  11 
ATOM   5036  H H    . LEU A 1 25 ? 8.727   5.643   -11.749 1.00 1.60 ? 25 LEU A H    11 
ATOM   5037  H HA   . LEU A 1 25 ? 9.987   8.296   -12.173 1.00 2.37 ? 25 LEU A HA   11 
ATOM   5038  H HB2  . LEU A 1 25 ? 7.691   9.105   -11.944 1.00 2.31 ? 25 LEU A HB2  11 
ATOM   5039  H HB3  . LEU A 1 25 ? 7.710   7.721   -13.034 1.00 2.02 ? 25 LEU A HB3  11 
ATOM   5040  H HG   . LEU A 1 25 ? 7.349   6.530   -10.561 1.00 1.40 ? 25 LEU A HG   11 
ATOM   5041  H HD11 . LEU A 1 25 ? 7.013   8.773   -9.544  1.00 2.84 ? 25 LEU A HD11 11 
ATOM   5042  H HD12 . LEU A 1 25 ? 5.689   9.068   -10.671 1.00 2.91 ? 25 LEU A HD12 11 
ATOM   5043  H HD13 . LEU A 1 25 ? 5.552   7.789   -9.465  1.00 3.15 ? 25 LEU A HD13 11 
ATOM   5044  H HD21 . LEU A 1 25 ? 5.287   7.476   -12.578 1.00 2.26 ? 25 LEU A HD21 11 
ATOM   5045  H HD22 . LEU A 1 25 ? 6.155   5.942   -12.610 1.00 2.07 ? 25 LEU A HD22 11 
ATOM   5046  H HD23 . LEU A 1 25 ? 4.985   6.266   -11.331 1.00 2.15 ? 25 LEU A HD23 11 
ATOM   5047  N N    . LYS A 1 26 ? 10.190  9.090   -9.782  1.00 1.84 ? 26 LYS A N    11 
ATOM   5048  C CA   . LYS A 1 26 ? 10.448  9.448   -8.353  1.00 2.02 ? 26 LYS A CA   11 
ATOM   5049  C C    . LYS A 1 26 ? 10.162  10.939  -8.120  1.00 1.75 ? 26 LYS A C    11 
ATOM   5050  O O    . LYS A 1 26 ? 9.486   11.579  -8.903  1.00 1.75 ? 26 LYS A O    11 
ATOM   5051  C CB   . LYS A 1 26 ? 11.937  9.142   -8.136  1.00 2.35 ? 26 LYS A CB   11 
ATOM   5052  C CG   . LYS A 1 26 ? 12.186  7.634   -8.262  1.00 2.72 ? 26 LYS A CG   11 
ATOM   5053  C CD   . LYS A 1 26 ? 12.740  7.316   -9.656  1.00 2.87 ? 26 LYS A CD   11 
ATOM   5054  C CE   . LYS A 1 26 ? 14.146  7.905   -9.801  1.00 3.38 ? 26 LYS A CE   11 
ATOM   5055  N NZ   . LYS A 1 26 ? 14.143  8.607   -11.118 1.00 3.14 ? 26 LYS A NZ   11 
ATOM   5056  H H    . LYS A 1 26 ? 10.540  9.665   -10.497 1.00 1.72 ? 26 LYS A H    11 
ATOM   5057  H HA   . LYS A 1 26 ? 9.846   8.842   -7.695  1.00 2.29 ? 26 LYS A HA   11 
ATOM   5058  H HB2  . LYS A 1 26 ? 12.521  9.668   -8.878  1.00 2.26 ? 26 LYS A HB2  11 
ATOM   5059  H HB3  . LYS A 1 26 ? 12.230  9.470   -7.150  1.00 2.62 ? 26 LYS A HB3  11 
ATOM   5060  H HG2  . LYS A 1 26 ? 12.898  7.324   -7.511  1.00 3.11 ? 26 LYS A HG2  11 
ATOM   5061  H HG3  . LYS A 1 26 ? 11.257  7.102   -8.117  1.00 2.64 ? 26 LYS A HG3  11 
ATOM   5062  H HD2  . LYS A 1 26 ? 12.782  6.245   -9.789  1.00 2.97 ? 26 LYS A HD2  11 
ATOM   5063  H HD3  . LYS A 1 26 ? 12.093  7.744   -10.406 1.00 2.65 ? 26 LYS A HD3  11 
ATOM   5064  H HE2  . LYS A 1 26 ? 14.345  8.606   -9.000  1.00 3.52 ? 26 LYS A HE2  11 
ATOM   5065  H HE3  . LYS A 1 26 ? 14.885  7.118   -9.804  1.00 3.93 ? 26 LYS A HE3  11 
ATOM   5066  H HZ1  . LYS A 1 26 ? 13.278  9.191   -11.207 1.00 2.87 ? 26 LYS A HZ1  11 
ATOM   5067  H HZ2  . LYS A 1 26 ? 14.984  9.226   -11.182 1.00 2.99 ? 26 LYS A HZ2  11 
ATOM   5068  H HZ3  . LYS A 1 26 ? 14.166  7.909   -11.888 1.00 3.58 ? 26 LYS A HZ3  11 
ATOM   5069  N N    . GLU A 1 27 ? 10.679  11.497  -7.053  1.00 1.70 ? 27 GLU A N    11 
ATOM   5070  C CA   . GLU A 1 27 ? 10.448  12.952  -6.770  1.00 1.64 ? 27 GLU A CA   11 
ATOM   5071  C C    . GLU A 1 27 ? 11.613  13.804  -7.311  1.00 1.53 ? 27 GLU A C    11 
ATOM   5072  O O    . GLU A 1 27 ? 11.929  14.851  -6.775  1.00 1.70 ? 27 GLU A O    11 
ATOM   5073  C CB   . GLU A 1 27 ? 10.343  13.063  -5.239  1.00 1.87 ? 27 GLU A CB   11 
ATOM   5074  C CG   . GLU A 1 27 ? 11.620  12.533  -4.570  1.00 1.88 ? 27 GLU A CG   11 
ATOM   5075  C CD   . GLU A 1 27 ? 11.341  11.164  -3.948  1.00 2.16 ? 27 GLU A CD   11 
ATOM   5076  O OE1  . GLU A 1 27 ? 11.481  10.175  -4.650  1.00 2.21 ? 27 GLU A OE1  11 
ATOM   5077  O OE2  . GLU A 1 27 ? 10.977  11.124  -2.784  1.00 2.44 ? 27 GLU A OE2  11 
ATOM   5078  H H    . GLU A 1 27 ? 11.223  10.960  -6.441  1.00 1.83 ? 27 GLU A H    11 
ATOM   5079  H HA   . GLU A 1 27 ? 9.520   13.272  -7.221  1.00 1.71 ? 27 GLU A HA   11 
ATOM   5080  H HB2  . GLU A 1 27 ? 10.203  14.100  -4.967  1.00 1.93 ? 27 GLU A HB2  11 
ATOM   5081  H HB3  . GLU A 1 27 ? 9.496   12.488  -4.897  1.00 2.08 ? 27 GLU A HB3  11 
ATOM   5082  H HG2  . GLU A 1 27 ? 12.405  12.441  -5.308  1.00 1.78 ? 27 GLU A HG2  11 
ATOM   5083  H HG3  . GLU A 1 27 ? 11.933  13.219  -3.798  1.00 1.94 ? 27 GLU A HG3  11 
ATOM   5084  N N    . GLU A 1 28 ? 12.241  13.365  -8.376  1.00 1.60 ? 28 GLU A N    11 
ATOM   5085  C CA   . GLU A 1 28 ? 13.375  14.139  -8.970  1.00 1.80 ? 28 GLU A CA   11 
ATOM   5086  C C    . GLU A 1 28 ? 13.040  14.515  -10.427 1.00 2.03 ? 28 GLU A C    11 
ATOM   5087  O O    . GLU A 1 28 ? 11.900  14.790  -10.751 1.00 2.13 ? 28 GLU A O    11 
ATOM   5088  C CB   . GLU A 1 28 ? 14.582  13.185  -8.891  1.00 2.10 ? 28 GLU A CB   11 
ATOM   5089  C CG   . GLU A 1 28 ? 14.332  11.936  -9.755  1.00 2.28 ? 28 GLU A CG   11 
ATOM   5090  C CD   . GLU A 1 28 ? 15.539  11.665  -10.662 1.00 2.63 ? 28 GLU A CD   11 
ATOM   5091  O OE1  . GLU A 1 28 ? 15.989  12.590  -11.320 1.00 2.76 ? 28 GLU A OE1  11 
ATOM   5092  O OE2  . GLU A 1 28 ? 15.983  10.530  -10.694 1.00 2.90 ? 28 GLU A OE2  11 
ATOM   5093  H H    . GLU A 1 28 ? 11.961  12.525  -8.794  1.00 1.75 ? 28 GLU A H    11 
ATOM   5094  H HA   . GLU A 1 28 ? 13.569  15.027  -8.389  1.00 1.78 ? 28 GLU A HA   11 
ATOM   5095  H HB2  . GLU A 1 28 ? 15.466  13.696  -9.244  1.00 2.31 ? 28 GLU A HB2  11 
ATOM   5096  H HB3  . GLU A 1 28 ? 14.729  12.883  -7.864  1.00 2.11 ? 28 GLU A HB3  11 
ATOM   5097  H HG2  . GLU A 1 28 ? 14.174  11.084  -9.110  1.00 2.33 ? 28 GLU A HG2  11 
ATOM   5098  H HG3  . GLU A 1 28 ? 13.455  12.089  -10.363 1.00 2.25 ? 28 GLU A HG3  11 
ATOM   5099  N N    . MET A 1 29 ? 14.011  14.518  -11.309 1.00 2.38 ? 29 MET A N    11 
ATOM   5100  C CA   . MET A 1 29 ? 13.730  14.861  -12.739 1.00 2.72 ? 29 MET A CA   11 
ATOM   5101  C C    . MET A 1 29 ? 13.478  13.579  -13.557 1.00 3.03 ? 29 MET A C    11 
ATOM   5102  O O    . MET A 1 29 ? 13.794  13.505  -14.730 1.00 3.52 ? 29 MET A O    11 
ATOM   5103  C CB   . MET A 1 29 ? 14.994  15.579  -13.226 1.00 3.14 ? 29 MET A CB   11 
ATOM   5104  C CG   . MET A 1 29 ? 14.660  16.440  -14.447 1.00 3.45 ? 29 MET A CG   11 
ATOM   5105  S SD   . MET A 1 29 ? 16.154  16.677  -15.443 1.00 4.02 ? 29 MET A SD   11 
ATOM   5106  C CE   . MET A 1 29 ? 16.102  15.091  -16.313 1.00 4.91 ? 29 MET A CE   11 
ATOM   5107  H H    . MET A 1 29 ? 14.923  14.282  -11.036 1.00 2.56 ? 29 MET A H    11 
ATOM   5108  H HA   . MET A 1 29 ? 12.881  15.523  -12.808 1.00 2.62 ? 29 MET A HA   11 
ATOM   5109  H HB2  . MET A 1 29 ? 15.377  16.208  -12.434 1.00 3.05 ? 29 MET A HB2  11 
ATOM   5110  H HB3  . MET A 1 29 ? 15.741  14.847  -13.496 1.00 3.49 ? 29 MET A HB3  11 
ATOM   5111  H HG2  . MET A 1 29 ? 13.906  15.946  -15.041 1.00 3.72 ? 29 MET A HG2  11 
ATOM   5112  H HG3  . MET A 1 29 ? 14.290  17.400  -14.120 1.00 3.39 ? 29 MET A HG3  11 
ATOM   5113  H HE1  . MET A 1 29 ? 15.915  14.298  -15.601 1.00 5.28 ? 29 MET A HE1  11 
ATOM   5114  H HE2  . MET A 1 29 ? 15.313  15.111  -17.051 1.00 5.22 ? 29 MET A HE2  11 
ATOM   5115  H HE3  . MET A 1 29 ? 17.045  14.916  -16.803 1.00 5.16 ? 29 MET A HE3  11 
ATOM   5116  N N    . ALA A 1 30 ? 12.904  12.569  -12.940 1.00 2.87 ? 30 ALA A N    11 
ATOM   5117  C CA   . ALA A 1 30 ? 12.622  11.291  -13.663 1.00 3.31 ? 30 ALA A CA   11 
ATOM   5118  C C    . ALA A 1 30 ? 11.661  10.419  -12.840 1.00 3.19 ? 30 ALA A C    11 
ATOM   5119  O O    . ALA A 1 30 ? 10.603  10.097  -13.353 1.00 3.51 ? 30 ALA A O    11 
ATOM   5120  C CB   . ALA A 1 30 ? 13.985  10.606  -13.808 1.00 3.65 ? 30 ALA A CB   11 
ATOM   5121  O OXT  . ALA A 1 30 ? 11.999  10.091  -11.710 1.00 3.07 ? 30 ALA A OXT  11 
ATOM   5122  H H    . ALA A 1 30 ? 12.654  12.655  -11.999 1.00 2.55 ? 30 ALA A H    11 
ATOM   5123  H HA   . ALA A 1 30 ? 12.206  11.493  -14.636 1.00 3.61 ? 30 ALA A HA   11 
ATOM   5124  H HB1  . ALA A 1 30 ? 14.583  10.803  -12.930 1.00 3.94 ? 30 ALA A HB1  11 
ATOM   5125  H HB2  . ALA A 1 30 ? 13.843  9.541   -13.915 1.00 3.85 ? 30 ALA A HB2  11 
ATOM   5126  H HB3  . ALA A 1 30 ? 14.490  10.992  -14.681 1.00 3.86 ? 30 ALA A HB3  11 
ATOM   5127  N N    . MET A 1 1  ? 4.060   16.653  17.778  1.00 3.07 ? 1  MET A N    12 
ATOM   5128  C CA   . MET A 1 1  ? 3.959   15.194  18.094  1.00 2.67 ? 1  MET A CA   12 
ATOM   5129  C C    . MET A 1 1  ? 3.962   14.367  16.801  1.00 2.47 ? 1  MET A C    12 
ATOM   5130  O O    . MET A 1 1  ? 3.823   14.899  15.716  1.00 2.69 ? 1  MET A O    12 
ATOM   5131  C CB   . MET A 1 1  ? 2.624   15.033  18.832  1.00 2.76 ? 1  MET A CB   12 
ATOM   5132  C CG   . MET A 1 1  ? 2.853   15.126  20.344  1.00 2.96 ? 1  MET A CG   12 
ATOM   5133  S SD   . MET A 1 1  ? 2.654   16.843  20.882  1.00 3.20 ? 1  MET A SD   12 
ATOM   5134  C CE   . MET A 1 1  ? 3.021   16.578  22.633  1.00 3.73 ? 1  MET A CE   12 
ATOM   5135  H H1   . MET A 1 1  ? 4.936   16.831  17.245  1.00 3.13 ? 1  MET A H1   12 
ATOM   5136  H H2   . MET A 1 1  ? 3.241   16.943  17.206  1.00 3.42 ? 1  MET A H2   12 
ATOM   5137  H H3   . MET A 1 1  ? 4.074   17.201  18.661  1.00 3.44 ? 1  MET A H3   12 
ATOM   5138  H HA   . MET A 1 1  ? 4.772   14.891  18.735  1.00 2.76 ? 1  MET A HA   12 
ATOM   5139  H HB2  . MET A 1 1  ? 1.943   15.813  18.523  1.00 2.89 ? 1  MET A HB2  12 
ATOM   5140  H HB3  . MET A 1 1  ? 2.195   14.070  18.595  1.00 2.98 ? 1  MET A HB3  12 
ATOM   5141  H HG2  . MET A 1 1  ? 2.133   14.503  20.856  1.00 3.26 ? 1  MET A HG2  12 
ATOM   5142  H HG3  . MET A 1 1  ? 3.852   14.787  20.580  1.00 3.12 ? 1  MET A HG3  12 
ATOM   5143  H HE1  . MET A 1 1  ? 3.954   16.036  22.727  1.00 4.01 ? 1  MET A HE1  12 
ATOM   5144  H HE2  . MET A 1 1  ? 3.110   17.529  23.133  1.00 4.06 ? 1  MET A HE2  12 
ATOM   5145  H HE3  . MET A 1 1  ? 2.221   16.009  23.086  1.00 4.03 ? 1  MET A HE3  12 
ATOM   5146  N N    . ILE A 1 2  ? 4.119   13.071  16.912  1.00 2.18 ? 2  ILE A N    12 
ATOM   5147  C CA   . ILE A 1 2  ? 4.130   12.203  15.688  1.00 2.05 ? 2  ILE A CA   12 
ATOM   5148  C C    . ILE A 1 2  ? 2.737   11.607  15.444  1.00 1.73 ? 2  ILE A C    12 
ATOM   5149  O O    . ILE A 1 2  ? 1.849   11.719  16.269  1.00 1.72 ? 2  ILE A O    12 
ATOM   5150  C CB   . ILE A 1 2  ? 5.151   11.089  15.971  1.00 2.10 ? 2  ILE A CB   12 
ATOM   5151  C CG1  . ILE A 1 2  ? 4.755   10.317  17.237  1.00 1.89 ? 2  ILE A CG1  12 
ATOM   5152  C CG2  . ILE A 1 2  ? 6.544   11.699  16.162  1.00 2.53 ? 2  ILE A CG2  12 
ATOM   5153  C CD1  . ILE A 1 2  ? 5.152   8.847   17.086  1.00 2.01 ? 2  ILE A CD1  12 
ATOM   5154  H H    . ILE A 1 2  ? 4.227   12.668  17.799  1.00 2.16 ? 2  ILE A H    12 
ATOM   5155  H HA   . ILE A 1 2  ? 4.443   12.777  14.829  1.00 2.28 ? 2  ILE A HA   12 
ATOM   5156  H HB   . ILE A 1 2  ? 5.177   10.410  15.129  1.00 2.11 ? 2  ILE A HB   12 
ATOM   5157  H HG12 . ILE A 1 2  ? 5.265   10.741  18.091  1.00 2.09 ? 2  ILE A HG12 12 
ATOM   5158  H HG13 . ILE A 1 2  ? 3.688   10.386  17.385  1.00 1.67 ? 2  ILE A HG13 12 
ATOM   5159  H HG21 . ILE A 1 2  ? 6.640   12.579  15.543  1.00 2.84 ? 2  ILE A HG21 12 
ATOM   5160  H HG22 . ILE A 1 2  ? 6.677   11.971  17.198  1.00 2.96 ? 2  ILE A HG22 12 
ATOM   5161  H HG23 . ILE A 1 2  ? 7.294   10.976  15.880  1.00 2.61 ? 2  ILE A HG23 12 
ATOM   5162  H HD11 . ILE A 1 2  ? 4.695   8.440   16.195  1.00 2.22 ? 2  ILE A HD11 12 
ATOM   5163  H HD12 . ILE A 1 2  ? 6.226   8.770   17.006  1.00 2.38 ? 2  ILE A HD12 12 
ATOM   5164  H HD13 . ILE A 1 2  ? 4.814   8.292   17.949  1.00 2.31 ? 2  ILE A HD13 12 
ATOM   5165  N N    . SER A 1 3  ? 2.544   10.966  14.316  1.00 1.59 ? 3  SER A N    12 
ATOM   5166  C CA   . SER A 1 3  ? 1.212   10.352  14.013  1.00 1.39 ? 3  SER A CA   12 
ATOM   5167  C C    . SER A 1 3  ? 0.899   9.231   15.015  1.00 1.16 ? 3  SER A C    12 
ATOM   5168  O O    . SER A 1 3  ? -0.210  9.127   15.506  1.00 1.19 ? 3  SER A O    12 
ATOM   5169  C CB   . SER A 1 3  ? 1.344   9.785   12.596  1.00 1.56 ? 3  SER A CB   12 
ATOM   5170  O OG   . SER A 1 3  ? 0.171   9.046   12.270  1.00 1.54 ? 3  SER A OG   12 
ATOM   5171  H H    . SER A 1 3  ? 3.279   10.887  13.670  1.00 1.73 ? 3  SER A H    12 
ATOM   5172  H HA   . SER A 1 3  ? 0.438   11.103  14.037  1.00 1.48 ? 3  SER A HA   12 
ATOM   5173  H HB2  . SER A 1 3  ? 1.461   10.593  11.892  1.00 1.80 ? 3  SER A HB2  12 
ATOM   5174  H HB3  . SER A 1 3  ? 2.213   9.142   12.547  1.00 1.76 ? 3  SER A HB3  12 
ATOM   5175  H HG   . SER A 1 3  ? -0.267  9.488   11.538  1.00 1.75 ? 3  SER A HG   12 
ATOM   5176  N N    . SER A 1 4  ? 1.874   8.395   15.314  1.00 1.13 ? 4  SER A N    12 
ATOM   5177  C CA   . SER A 1 4  ? 1.675   7.259   16.284  1.00 1.17 ? 4  SER A CA   12 
ATOM   5178  C C    . SER A 1 4  ? 0.766   6.177   15.683  1.00 1.13 ? 4  SER A C    12 
ATOM   5179  O O    . SER A 1 4  ? 1.132   5.020   15.615  1.00 1.30 ? 4  SER A O    12 
ATOM   5180  C CB   . SER A 1 4  ? 1.047   7.875   17.538  1.00 1.30 ? 4  SER A CB   12 
ATOM   5181  O OG   . SER A 1 4  ? 1.799   7.481   18.680  1.00 1.69 ? 4  SER A OG   12 
ATOM   5182  H H    . SER A 1 4  ? 2.748   8.513   14.893  1.00 1.24 ? 4  SER A H    12 
ATOM   5183  H HA   . SER A 1 4  ? 2.628   6.828   16.535  1.00 1.34 ? 4  SER A HA   12 
ATOM   5184  H HB2  . SER A 1 4  ? 1.059   8.950   17.462  1.00 1.26 ? 4  SER A HB2  12 
ATOM   5185  H HB3  . SER A 1 4  ? 0.023   7.536   17.634  1.00 1.35 ? 4  SER A HB3  12 
ATOM   5186  H HG   . SER A 1 4  ? 1.579   6.566   18.881  1.00 2.01 ? 4  SER A HG   12 
ATOM   5187  N N    . VAL A 1 5  ? -0.407  6.547   15.247  1.00 1.08 ? 5  VAL A N    12 
ATOM   5188  C CA   . VAL A 1 5  ? -1.346  5.548   14.641  1.00 1.22 ? 5  VAL A CA   12 
ATOM   5189  C C    . VAL A 1 5  ? -1.026  5.327   13.153  1.00 1.15 ? 5  VAL A C    12 
ATOM   5190  O O    . VAL A 1 5  ? -1.476  4.367   12.556  1.00 1.28 ? 5  VAL A O    12 
ATOM   5191  C CB   . VAL A 1 5  ? -2.742  6.161   14.818  1.00 1.38 ? 5  VAL A CB   12 
ATOM   5192  C CG1  . VAL A 1 5  ? -2.943  7.315   13.829  1.00 1.32 ? 5  VAL A CG1  12 
ATOM   5193  C CG2  . VAL A 1 5  ? -3.806  5.090   14.567  1.00 1.70 ? 5  VAL A CG2  12 
ATOM   5194  H H    . VAL A 1 5  ? -0.671  7.488   15.312  1.00 1.06 ? 5  VAL A H    12 
ATOM   5195  H HA   . VAL A 1 5  ? -1.286  4.616   15.173  1.00 1.38 ? 5  VAL A HA   12 
ATOM   5196  H HB   . VAL A 1 5  ? -2.840  6.536   15.826  1.00 1.43 ? 5  VAL A HB   12 
ATOM   5197  H HG11 . VAL A 1 5  ? -2.097  7.985   13.879  1.00 1.56 ? 5  VAL A HG11 12 
ATOM   5198  H HG12 . VAL A 1 5  ? -3.030  6.919   12.827  1.00 1.55 ? 5  VAL A HG12 12 
ATOM   5199  H HG13 . VAL A 1 5  ? -3.843  7.853   14.082  1.00 1.66 ? 5  VAL A HG13 12 
ATOM   5200  H HG21 . VAL A 1 5  ? -3.627  4.246   15.218  1.00 2.03 ? 5  VAL A HG21 12 
ATOM   5201  H HG22 . VAL A 1 5  ? -4.784  5.499   14.769  1.00 2.06 ? 5  VAL A HG22 12 
ATOM   5202  H HG23 . VAL A 1 5  ? -3.756  4.767   13.537  1.00 2.08 ? 5  VAL A HG23 12 
ATOM   5203  N N    . CYS A 1 6  ? -0.259  6.218   12.562  1.00 1.02 ? 6  CYS A N    12 
ATOM   5204  C CA   . CYS A 1 6  ? 0.112   6.109   11.112  1.00 1.01 ? 6  CYS A CA   12 
ATOM   5205  C C    . CYS A 1 6  ? -1.090  6.439   10.219  1.00 0.94 ? 6  CYS A C    12 
ATOM   5206  O O    . CYS A 1 6  ? -2.211  6.043   10.482  1.00 1.01 ? 6  CYS A O    12 
ATOM   5207  C CB   . CYS A 1 6  ? 0.576   4.665   10.891  1.00 1.17 ? 6  CYS A CB   12 
ATOM   5208  S SG   . CYS A 1 6  ? 1.684   4.597   9.461   1.00 1.41 ? 6  CYS A SG   12 
ATOM   5209  H H    . CYS A 1 6  ? 0.072   6.977   13.080  1.00 1.01 ? 6  CYS A H    12 
ATOM   5210  H HA   . CYS A 1 6  ? 0.925   6.785   10.892  1.00 1.05 ? 6  CYS A HA   12 
ATOM   5211  H HB2  . CYS A 1 6  ? 1.100   4.318   11.769  1.00 1.22 ? 6  CYS A HB2  12 
ATOM   5212  H HB3  . CYS A 1 6  ? -0.283  4.036   10.711  1.00 1.26 ? 6  CYS A HB3  12 
ATOM   5213  H HG   . CYS A 1 6  ? 1.267   5.071   8.739   1.00 1.80 ? 6  CYS A HG   12 
ATOM   5214  N N    . VAL A 1 7  ? -0.855  7.169   9.161   1.00 0.91 ? 7  VAL A N    12 
ATOM   5215  C CA   . VAL A 1 7  ? -1.958  7.544   8.233   1.00 0.90 ? 7  VAL A CA   12 
ATOM   5216  C C    . VAL A 1 7  ? -1.500  7.361   6.780   1.00 0.85 ? 7  VAL A C    12 
ATOM   5217  O O    . VAL A 1 7  ? -0.370  6.989   6.518   1.00 0.92 ? 7  VAL A O    12 
ATOM   5218  C CB   . VAL A 1 7  ? -2.244  9.021   8.552   1.00 1.00 ? 7  VAL A CB   12 
ATOM   5219  C CG1  . VAL A 1 7  ? -1.143  9.912   7.967   1.00 1.07 ? 7  VAL A CG1  12 
ATOM   5220  C CG2  . VAL A 1 7  ? -3.596  9.429   7.961   1.00 1.14 ? 7  VAL A CG2  12 
ATOM   5221  H H    . VAL A 1 7  ? 0.053   7.473   8.975   1.00 0.96 ? 7  VAL A H    12 
ATOM   5222  H HA   . VAL A 1 7  ? -2.835  6.949   8.428   1.00 0.96 ? 7  VAL A HA   12 
ATOM   5223  H HB   . VAL A 1 7  ? -2.272  9.148   9.622   1.00 1.06 ? 7  VAL A HB   12 
ATOM   5224  H HG11 . VAL A 1 7  ? -0.176  9.528   8.258   1.00 1.61 ? 7  VAL A HG11 12 
ATOM   5225  H HG12 . VAL A 1 7  ? -1.218  9.919   6.890   1.00 1.10 ? 7  VAL A HG12 12 
ATOM   5226  H HG13 . VAL A 1 7  ? -1.258  10.918  8.342   1.00 1.56 ? 7  VAL A HG13 12 
ATOM   5227  H HG21 . VAL A 1 7  ? -4.243  8.564   7.908   1.00 1.34 ? 7  VAL A HG21 12 
ATOM   5228  H HG22 . VAL A 1 7  ? -4.052  10.180  8.590   1.00 1.73 ? 7  VAL A HG22 12 
ATOM   5229  H HG23 . VAL A 1 7  ? -3.451  9.830   6.970   1.00 1.42 ? 7  VAL A HG23 12 
HETATM 5230  N N    . SEP A 1 8  ? -2.372  7.618   5.841   1.00 0.85 ? 8  SEP A N    12 
HETATM 5231  C CA   . SEP A 1 8  ? -2.009  7.464   4.393   1.00 0.84 ? 8  SEP A CA   12 
HETATM 5232  C CB   . SEP A 1 8  ? -3.145  8.133   3.612   1.00 0.93 ? 8  SEP A CB   12 
HETATM 5233  O OG   . SEP A 1 8  ? -3.274  7.507   2.328   1.00 0.97 ? 8  SEP A OG   12 
HETATM 5234  C C    . SEP A 1 8  ? -0.677  8.158   4.093   1.00 0.84 ? 8  SEP A C    12 
HETATM 5235  O O    . SEP A 1 8  ? 0.249   7.542   3.600   1.00 0.80 ? 8  SEP A O    12 
HETATM 5236  P P    . SEP A 1 8  ? -2.518  8.112   1.040   1.00 1.17 ? 8  SEP A P    12 
HETATM 5237  O O1P  . SEP A 1 8  ? -3.170  7.575   -0.174  1.00 1.58 ? 8  SEP A O1P  12 
HETATM 5238  O O2P  . SEP A 1 8  ? -2.390  9.576   1.222   1.00 1.80 ? 8  SEP A O2P  12 
HETATM 5239  O O3P  . SEP A 1 8  ? -1.054  7.457   1.152   1.00 1.57 ? 8  SEP A O3P  12 
HETATM 5240  H H    . SEP A 1 8  ? -3.268  7.914   6.093   1.00 0.94 ? 8  SEP A H    12 
HETATM 5241  H HA   . SEP A 1 8  ? -1.951  6.423   4.132   1.00 0.87 ? 8  SEP A HA   12 
HETATM 5242  H HB2  . SEP A 1 8  ? -2.928  9.186   3.491   1.00 1.08 ? 8  SEP A HB2  12 
HETATM 5243  H HB3  . SEP A 1 8  ? -4.069  8.023   4.154   1.00 0.97 ? 8  SEP A HB3  12 
HETATM 5244  H HOP3 . SEP A 1 8  ? -0.475  7.951   0.567   1.00 1.93 ? 8  SEP A HOP3 12 
ATOM   5245  N N    . SER A 1 9  ? -0.583  9.434   4.396   1.00 0.96 ? 9  SER A N    12 
ATOM   5246  C CA   . SER A 1 9  ? 0.677   10.209  4.149   1.00 1.03 ? 9  SER A CA   12 
ATOM   5247  C C    . SER A 1 9  ? 0.974   10.300  2.648   1.00 0.91 ? 9  SER A C    12 
ATOM   5248  O O    . SER A 1 9  ? 0.563   9.457   1.881   1.00 0.72 ? 9  SER A O    12 
ATOM   5249  C CB   . SER A 1 9  ? 1.789   9.444   4.873   1.00 1.07 ? 9  SER A CB   12 
ATOM   5250  O OG   . SER A 1 9  ? 1.410   9.218   6.228   1.00 1.25 ? 9  SER A OG   12 
ATOM   5251  H H    . SER A 1 9  ? -1.348  9.885   4.793   1.00 1.04 ? 9  SER A H    12 
ATOM   5252  H HA   . SER A 1 9  ? 0.587   11.199  4.568   1.00 1.21 ? 9  SER A HA   12 
ATOM   5253  H HB2  . SER A 1 9  ? 1.953   8.497   4.387   1.00 0.93 ? 9  SER A HB2  12 
ATOM   5254  H HB3  . SER A 1 9  ? 2.702   10.024  4.836   1.00 1.16 ? 9  SER A HB3  12 
ATOM   5255  H HG   . SER A 1 9  ? 0.995   8.349   6.282   1.00 1.20 ? 9  SER A HG   12 
ATOM   5256  N N    . TYR A 1 10 ? 1.702   11.322  2.248   1.00 1.09 ? 10 TYR A N    12 
ATOM   5257  C CA   . TYR A 1 10 ? 2.088   11.536  0.803   1.00 1.09 ? 10 TYR A CA   12 
ATOM   5258  C C    . TYR A 1 10 ? 0.986   11.076  -0.187  1.00 0.93 ? 10 TYR A C    12 
ATOM   5259  O O    . TYR A 1 10 ? -0.175  10.958  0.161   1.00 0.89 ? 10 TYR A O    12 
ATOM   5260  C CB   . TYR A 1 10 ? 3.421   10.753  0.643   1.00 1.05 ? 10 TYR A CB   12 
ATOM   5261  C CG   . TYR A 1 10 ? 3.199   9.330   0.170   1.00 0.77 ? 10 TYR A CG   12 
ATOM   5262  C CD1  . TYR A 1 10 ? 2.761   8.347   1.062   1.00 0.73 ? 10 TYR A CD1  12 
ATOM   5263  C CD2  . TYR A 1 10 ? 3.437   9.001   -1.168  1.00 0.66 ? 10 TYR A CD2  12 
ATOM   5264  C CE1  . TYR A 1 10 ? 2.554   7.038   0.614   1.00 0.65 ? 10 TYR A CE1  12 
ATOM   5265  C CE2  . TYR A 1 10 ? 3.233   7.694   -1.616  1.00 0.53 ? 10 TYR A CE2  12 
ATOM   5266  C CZ   . TYR A 1 10 ? 2.789   6.712   -0.726  1.00 0.58 ? 10 TYR A CZ   12 
ATOM   5267  O OH   . TYR A 1 10 ? 2.573   5.425   -1.170  1.00 0.74 ? 10 TYR A OH   12 
ATOM   5268  H H    . TYR A 1 10 ? 2.013   11.963  2.915   1.00 1.26 ? 10 TYR A H    12 
ATOM   5269  H HA   . TYR A 1 10 ? 2.284   12.582  0.641   1.00 1.31 ? 10 TYR A HA   12 
ATOM   5270  H HB2  . TYR A 1 10 ? 4.044   11.263  -0.073  1.00 1.17 ? 10 TYR A HB2  12 
ATOM   5271  H HB3  . TYR A 1 10 ? 3.928   10.731  1.596   1.00 1.19 ? 10 TYR A HB3  12 
ATOM   5272  H HD1  . TYR A 1 10 ? 2.577   8.599   2.098   1.00 0.87 ? 10 TYR A HD1  12 
ATOM   5273  H HD2  . TYR A 1 10 ? 3.780   9.761   -1.853  1.00 0.78 ? 10 TYR A HD2  12 
ATOM   5274  H HE1  . TYR A 1 10 ? 2.215   6.279   1.302   1.00 0.77 ? 10 TYR A HE1  12 
ATOM   5275  H HE2  . TYR A 1 10 ? 3.414   7.445   -2.650  1.00 0.55 ? 10 TYR A HE2  12 
ATOM   5276  H HH   . TYR A 1 10 ? 1.627   5.265   -1.159  1.00 0.89 ? 10 TYR A HH   12 
ATOM   5277  N N    . ARG A 1 11 ? 1.334   10.841  -1.425  1.00 0.91 ? 11 ARG A N    12 
ATOM   5278  C CA   . ARG A 1 11 ? 0.314   10.391  -2.419  1.00 0.94 ? 11 ARG A CA   12 
ATOM   5279  C C    . ARG A 1 11 ? 0.137   8.866   -2.304  1.00 0.75 ? 11 ARG A C    12 
ATOM   5280  O O    . ARG A 1 11 ? 0.257   8.308   -1.231  1.00 0.61 ? 11 ARG A O    12 
ATOM   5281  C CB   . ARG A 1 11 ? 0.888   10.804  -3.780  1.00 1.08 ? 11 ARG A CB   12 
ATOM   5282  C CG   . ARG A 1 11 ? 0.838   12.332  -3.917  1.00 1.47 ? 11 ARG A CG   12 
ATOM   5283  C CD   . ARG A 1 11 ? -0.618  12.814  -3.848  1.00 1.77 ? 11 ARG A CD   12 
ATOM   5284  N NE   . ARG A 1 11 ? -0.810  13.285  -2.442  1.00 1.96 ? 11 ARG A NE   12 
ATOM   5285  C CZ   . ARG A 1 11 ? -1.982  13.199  -1.876  1.00 1.98 ? 11 ARG A CZ   12 
ATOM   5286  N NH1  . ARG A 1 11 ? -2.952  13.974  -2.274  1.00 2.46 ? 11 ARG A NH1  12 
ATOM   5287  N NH2  . ARG A 1 11 ? -2.182  12.345  -0.912  1.00 1.87 ? 11 ARG A NH2  12 
ATOM   5288  H H    . ARG A 1 11 ? 2.261   10.965  -1.703  1.00 0.96 ? 11 ARG A H    12 
ATOM   5289  H HA   . ARG A 1 11 ? -0.624  10.884  -2.249  1.00 1.08 ? 11 ARG A HA   12 
ATOM   5290  H HB2  . ARG A 1 11 ? 1.913   10.468  -3.856  1.00 0.97 ? 11 ARG A HB2  12 
ATOM   5291  H HB3  . ARG A 1 11 ? 0.305   10.358  -4.568  1.00 1.10 ? 11 ARG A HB3  12 
ATOM   5292  H HG2  . ARG A 1 11 ? 1.406   12.782  -3.115  1.00 1.59 ? 11 ARG A HG2  12 
ATOM   5293  H HG3  . ARG A 1 11 ? 1.266   12.621  -4.865  1.00 1.52 ? 11 ARG A HG3  12 
ATOM   5294  H HD2  . ARG A 1 11 ? -0.773  13.628  -4.544  1.00 2.11 ? 11 ARG A HD2  12 
ATOM   5295  H HD3  . ARG A 1 11 ? -1.294  12.002  -4.064  1.00 1.67 ? 11 ARG A HD3  12 
ATOM   5296  H HE   . ARG A 1 11 ? -0.056  13.661  -1.942  1.00 2.25 ? 11 ARG A HE   12 
ATOM   5297  H HH11 . ARG A 1 11 ? -2.795  14.631  -3.009  1.00 2.82 ? 11 ARG A HH11 12 
ATOM   5298  H HH12 . ARG A 1 11 ? -3.851  13.912  -1.843  1.00 2.63 ? 11 ARG A HH12 12 
ATOM   5299  H HH21 . ARG A 1 11 ? -1.434  11.752  -0.602  1.00 1.88 ? 11 ARG A HH21 12 
ATOM   5300  H HH22 . ARG A 1 11 ? -3.080  12.280  -0.479  1.00 2.02 ? 11 ARG A HH22 12 
ATOM   5301  N N    . GLY A 1 12 ? -0.131  8.183   -3.387  1.00 0.89 ? 12 GLY A N    12 
ATOM   5302  C CA   . GLY A 1 12 ? -0.290  6.697   -3.311  1.00 0.93 ? 12 GLY A CA   12 
ATOM   5303  C C    . GLY A 1 12 ? 0.832   6.035   -4.109  1.00 0.93 ? 12 GLY A C    12 
ATOM   5304  O O    . GLY A 1 12 ? 0.743   4.881   -4.487  1.00 1.11 ? 12 GLY A O    12 
ATOM   5305  H H    . GLY A 1 12 ? -0.212  8.636   -4.252  1.00 1.04 ? 12 GLY A H    12 
ATOM   5306  H HA2  . GLY A 1 12 ? -0.235  6.381   -2.279  1.00 0.83 ? 12 GLY A HA2  12 
ATOM   5307  H HA3  . GLY A 1 12 ? -1.242  6.413   -3.729  1.00 1.15 ? 12 GLY A HA3  12 
ATOM   5308  N N    . ARG A 1 13 ? 1.883   6.767   -4.371  1.00 0.78 ? 13 ARG A N    12 
ATOM   5309  C CA   . ARG A 1 13 ? 3.018   6.214   -5.157  1.00 0.77 ? 13 ARG A CA   12 
ATOM   5310  C C    . ARG A 1 13 ? 4.253   6.001   -4.264  1.00 0.63 ? 13 ARG A C    12 
ATOM   5311  O O    . ARG A 1 13 ? 5.210   6.752   -4.308  1.00 0.59 ? 13 ARG A O    12 
ATOM   5312  C CB   . ARG A 1 13 ? 3.266   7.264   -6.253  1.00 0.85 ? 13 ARG A CB   12 
ATOM   5313  C CG   . ARG A 1 13 ? 3.585   8.638   -5.636  1.00 0.79 ? 13 ARG A CG   12 
ATOM   5314  C CD   . ARG A 1 13 ? 4.115   9.589   -6.719  1.00 0.95 ? 13 ARG A CD   12 
ATOM   5315  N NE   . ARG A 1 13 ? 5.243   8.859   -7.374  1.00 0.99 ? 13 ARG A NE   12 
ATOM   5316  C CZ   . ARG A 1 13 ? 6.453   8.951   -6.897  1.00 1.01 ? 13 ARG A CZ   12 
ATOM   5317  N NH1  . ARG A 1 13 ? 6.808   8.221   -5.880  1.00 0.96 ? 13 ARG A NH1  12 
ATOM   5318  N NH2  . ARG A 1 13 ? 7.303   9.771   -7.443  1.00 1.26 ? 13 ARG A NH2  12 
ATOM   5319  H H    . ARG A 1 13 ? 1.920   7.691   -4.057  1.00 0.73 ? 13 ARG A H    12 
ATOM   5320  H HA   . ARG A 1 13 ? 2.729   5.281   -5.610  1.00 0.91 ? 13 ARG A HA   12 
ATOM   5321  H HB2  . ARG A 1 13 ? 4.088   6.948   -6.862  1.00 0.89 ? 13 ARG A HB2  12 
ATOM   5322  H HB3  . ARG A 1 13 ? 2.379   7.350   -6.865  1.00 1.00 ? 13 ARG A HB3  12 
ATOM   5323  H HG2  . ARG A 1 13 ? 2.686   9.054   -5.207  1.00 0.85 ? 13 ARG A HG2  12 
ATOM   5324  H HG3  . ARG A 1 13 ? 4.329   8.526   -4.865  1.00 0.70 ? 13 ARG A HG3  12 
ATOM   5325  H HD2  . ARG A 1 13 ? 3.337   9.804   -7.439  1.00 1.12 ? 13 ARG A HD2  12 
ATOM   5326  H HD3  . ARG A 1 13 ? 4.475   10.502  -6.272  1.00 0.99 ? 13 ARG A HD3  12 
ATOM   5327  H HE   . ARG A 1 13 ? 5.074   8.309   -8.168  1.00 1.15 ? 13 ARG A HE   12 
ATOM   5328  H HH11 . ARG A 1 13 ? 6.150   7.591   -5.464  1.00 0.89 ? 13 ARG A HH11 12 
ATOM   5329  H HH12 . ARG A 1 13 ? 7.740   8.283   -5.516  1.00 1.12 ? 13 ARG A HH12 12 
ATOM   5330  H HH21 . ARG A 1 13 ? 7.027   10.329  -8.226  1.00 1.39 ? 13 ARG A HH21 12 
ATOM   5331  H HH22 . ARG A 1 13 ? 8.232   9.844   -7.082  1.00 1.39 ? 13 ARG A HH22 12 
ATOM   5332  N N    . LYS A 1 14 ? 4.222   4.974   -3.450  1.00 0.69 ? 14 LYS A N    12 
ATOM   5333  C CA   . LYS A 1 14 ? 5.371   4.677   -2.531  1.00 0.72 ? 14 LYS A CA   12 
ATOM   5334  C C    . LYS A 1 14 ? 6.616   4.245   -3.325  1.00 0.80 ? 14 LYS A C    12 
ATOM   5335  O O    . LYS A 1 14 ? 7.035   3.102   -3.282  1.00 1.00 ? 14 LYS A O    12 
ATOM   5336  C CB   . LYS A 1 14 ? 4.880   3.541   -1.613  1.00 0.92 ? 14 LYS A CB   12 
ATOM   5337  C CG   . LYS A 1 14 ? 4.301   2.383   -2.441  1.00 1.10 ? 14 LYS A CG   12 
ATOM   5338  C CD   . LYS A 1 14 ? 2.799   2.251   -2.155  1.00 1.21 ? 14 LYS A CD   12 
ATOM   5339  C CE   . LYS A 1 14 ? 2.059   1.847   -3.436  1.00 1.40 ? 14 LYS A CE   12 
ATOM   5340  N NZ   . LYS A 1 14 ? 0.724   2.514   -3.347  1.00 1.38 ? 14 LYS A NZ   12 
ATOM   5341  H H    . LYS A 1 14 ? 3.435   4.399   -3.438  1.00 0.79 ? 14 LYS A H    12 
ATOM   5342  H HA   . LYS A 1 14 ? 5.599   5.547   -1.934  1.00 0.66 ? 14 LYS A HA   12 
ATOM   5343  H HB2  . LYS A 1 14 ? 5.709   3.177   -1.030  1.00 1.03 ? 14 LYS A HB2  12 
ATOM   5344  H HB3  . LYS A 1 14 ? 4.119   3.921   -0.949  1.00 0.89 ? 14 LYS A HB3  12 
ATOM   5345  H HG2  . LYS A 1 14 ? 4.454   2.578   -3.493  1.00 1.10 ? 14 LYS A HG2  12 
ATOM   5346  H HG3  . LYS A 1 14 ? 4.798   1.464   -2.170  1.00 1.27 ? 14 LYS A HG3  12 
ATOM   5347  H HD2  . LYS A 1 14 ? 2.644   1.496   -1.397  1.00 1.42 ? 14 LYS A HD2  12 
ATOM   5348  H HD3  . LYS A 1 14 ? 2.416   3.196   -1.803  1.00 1.11 ? 14 LYS A HD3  12 
ATOM   5349  H HE2  . LYS A 1 14 ? 2.599   2.196   -4.306  1.00 1.39 ? 14 LYS A HE2  12 
ATOM   5350  H HE3  . LYS A 1 14 ? 1.934   0.775   -3.476  1.00 1.68 ? 14 LYS A HE3  12 
ATOM   5351  H HZ1  . LYS A 1 14 ? 0.423   2.574   -2.352  1.00 1.45 ? 14 LYS A HZ1  12 
ATOM   5352  H HZ2  . LYS A 1 14 ? 0.786   3.478   -3.747  1.00 1.22 ? 14 LYS A HZ2  12 
ATOM   5353  H HZ3  . LYS A 1 14 ? 0.023   1.962   -3.886  1.00 1.62 ? 14 LYS A HZ3  12 
ATOM   5354  N N    . SER A 1 15 ? 7.212   5.164   -4.040  1.00 0.70 ? 15 SER A N    12 
ATOM   5355  C CA   . SER A 1 15 ? 8.435   4.844   -4.839  1.00 0.81 ? 15 SER A CA   12 
ATOM   5356  C C    . SER A 1 15 ? 9.402   6.035   -4.821  1.00 0.75 ? 15 SER A C    12 
ATOM   5357  O O    . SER A 1 15 ? 8.988   7.181   -4.762  1.00 0.93 ? 15 SER A O    12 
ATOM   5358  C CB   . SER A 1 15 ? 7.929   4.583   -6.257  1.00 0.93 ? 15 SER A CB   12 
ATOM   5359  O OG   . SER A 1 15 ? 8.973   3.999   -7.024  1.00 1.13 ? 15 SER A OG   12 
ATOM   5360  H H    . SER A 1 15 ? 6.852   6.076   -4.047  1.00 0.61 ? 15 SER A H    12 
ATOM   5361  H HA   . SER A 1 15 ? 8.918   3.959   -4.452  1.00 0.93 ? 15 SER A HA   12 
ATOM   5362  H HB2  . SER A 1 15 ? 7.090   3.909   -6.224  1.00 1.03 ? 15 SER A HB2  12 
ATOM   5363  H HB3  . SER A 1 15 ? 7.617   5.519   -6.704  1.00 0.92 ? 15 SER A HB3  12 
ATOM   5364  H HG   . SER A 1 15 ? 8.754   4.099   -7.955  1.00 1.43 ? 15 SER A HG   12 
ATOM   5365  N N    . GLY A 1 16 ? 10.684  5.775   -4.865  1.00 0.79 ? 16 GLY A N    12 
ATOM   5366  C CA   . GLY A 1 16 ? 11.683  6.889   -4.841  1.00 0.90 ? 16 GLY A CA   12 
ATOM   5367  C C    . GLY A 1 16 ? 12.087  7.175   -3.393  1.00 0.92 ? 16 GLY A C    12 
ATOM   5368  O O    . GLY A 1 16 ? 13.238  7.045   -3.026  1.00 1.14 ? 16 GLY A O    12 
ATOM   5369  H H    . GLY A 1 16 ? 10.993  4.845   -4.906  1.00 0.91 ? 16 GLY A H    12 
ATOM   5370  H HA2  . GLY A 1 16 ? 12.556  6.602   -5.411  1.00 1.09 ? 16 GLY A HA2  12 
ATOM   5371  H HA3  . GLY A 1 16 ? 11.246  7.777   -5.272  1.00 0.94 ? 16 GLY A HA3  12 
ATOM   5372  N N    . ASN A 1 17 ? 11.143  7.553   -2.569  1.00 0.88 ? 17 ASN A N    12 
ATOM   5373  C CA   . ASN A 1 17 ? 11.460  7.839   -1.135  1.00 1.06 ? 17 ASN A CA   12 
ATOM   5374  C C    . ASN A 1 17 ? 11.156  6.602   -0.275  1.00 0.94 ? 17 ASN A C    12 
ATOM   5375  O O    . ASN A 1 17 ? 10.762  5.568   -0.783  1.00 0.87 ? 17 ASN A O    12 
ATOM   5376  C CB   . ASN A 1 17 ? 10.550  9.011   -0.748  1.00 1.26 ? 17 ASN A CB   12 
ATOM   5377  C CG   . ASN A 1 17 ? 11.253  9.881   0.297   1.00 1.62 ? 17 ASN A CG   12 
ATOM   5378  O OD1  . ASN A 1 17 ? 11.427  9.471   1.425   1.00 1.70 ? 17 ASN A OD1  12 
ATOM   5379  N ND2  . ASN A 1 17 ? 11.670  11.071  -0.032  1.00 2.20 ? 17 ASN A ND2  12 
ATOM   5380  H H    . ASN A 1 17 ? 10.221  7.641   -2.892  1.00 0.89 ? 17 ASN A H    12 
ATOM   5381  H HA   . ASN A 1 17 ? 12.496  8.124   -1.029  1.00 1.23 ? 17 ASN A HA   12 
ATOM   5382  H HB2  . ASN A 1 17 ? 10.336  9.605   -1.624  1.00 1.28 ? 17 ASN A HB2  12 
ATOM   5383  H HB3  . ASN A 1 17 ? 9.628   8.631   -0.335  1.00 1.28 ? 17 ASN A HB3  12 
ATOM   5384  H HD21 . ASN A 1 17 ? 11.534  11.405  -0.943  1.00 2.53 ? 17 ASN A HD21 12 
ATOM   5385  H HD22 . ASN A 1 17 ? 12.121  11.632  0.633   1.00 2.48 ? 17 ASN A HD22 12 
ATOM   5386  N N    . LYS A 1 18 ? 11.336  6.700   1.021   1.00 1.00 ? 18 LYS A N    12 
ATOM   5387  C CA   . LYS A 1 18 ? 11.061  5.530   1.915   1.00 0.92 ? 18 LYS A CA   12 
ATOM   5388  C C    . LYS A 1 18 ? 9.576   5.129   1.849   1.00 0.84 ? 18 LYS A C    12 
ATOM   5389  O O    . LYS A 1 18 ? 8.704   5.953   2.054   1.00 0.93 ? 18 LYS A O    12 
ATOM   5390  C CB   . LYS A 1 18 ? 11.421  6.009   3.326   1.00 0.99 ? 18 LYS A CB   12 
ATOM   5391  C CG   . LYS A 1 18 ? 12.267  4.942   4.028   1.00 1.09 ? 18 LYS A CG   12 
ATOM   5392  C CD   . LYS A 1 18 ? 11.349  3.895   4.667   1.00 0.94 ? 18 LYS A CD   12 
ATOM   5393  C CE   . LYS A 1 18 ? 11.850  2.488   4.318   1.00 0.85 ? 18 LYS A CE   12 
ATOM   5394  N NZ   . LYS A 1 18 ? 10.656  1.604   4.455   1.00 0.67 ? 18 LYS A NZ   12 
ATOM   5395  H H    . LYS A 1 18 ? 11.656  7.543   1.406   1.00 1.15 ? 18 LYS A H    12 
ATOM   5396  H HA   . LYS A 1 18 ? 11.686  4.696   1.642   1.00 0.99 ? 18 LYS A HA   12 
ATOM   5397  H HB2  . LYS A 1 18 ? 11.984  6.929   3.262   1.00 1.14 ? 18 LYS A HB2  12 
ATOM   5398  H HB3  . LYS A 1 18 ? 10.518  6.179   3.892   1.00 0.95 ? 18 LYS A HB3  12 
ATOM   5399  H HG2  . LYS A 1 18 ? 12.915  4.468   3.306   1.00 1.17 ? 18 LYS A HG2  12 
ATOM   5400  H HG3  . LYS A 1 18 ? 12.865  5.411   4.795   1.00 1.31 ? 18 LYS A HG3  12 
ATOM   5401  H HD2  . LYS A 1 18 ? 11.350  4.022   5.740   1.00 1.16 ? 18 LYS A HD2  12 
ATOM   5402  H HD3  . LYS A 1 18 ? 10.344  4.020   4.291   1.00 0.90 ? 18 LYS A HD3  12 
ATOM   5403  H HE2  . LYS A 1 18 ? 12.224  2.466   3.303   1.00 0.92 ? 18 LYS A HE2  12 
ATOM   5404  H HE3  . LYS A 1 18 ? 12.619  2.182   5.010   1.00 1.03 ? 18 LYS A HE3  12 
ATOM   5405  H HZ1  . LYS A 1 18 ? 9.835   2.040   3.975   1.00 0.66 ? 18 LYS A HZ1  12 
ATOM   5406  H HZ2  . LYS A 1 18 ? 10.851  0.677   4.022   1.00 0.74 ? 18 LYS A HZ2  12 
ATOM   5407  H HZ3  . LYS A 1 18 ? 10.431  1.470   5.469   1.00 0.65 ? 18 LYS A HZ3  12 
ATOM   5408  N N    . PRO A 1 19 ? 9.343   3.866   1.566   1.00 0.86 ? 19 PRO A N    12 
ATOM   5409  C CA   . PRO A 1 19 ? 7.932   3.394   1.493   1.00 0.96 ? 19 PRO A CA   12 
ATOM   5410  C C    . PRO A 1 19 ? 7.551   2.662   2.789   1.00 0.88 ? 19 PRO A C    12 
ATOM   5411  O O    . PRO A 1 19 ? 8.413   2.297   3.568   1.00 0.77 ? 19 PRO A O    12 
ATOM   5412  C CB   . PRO A 1 19 ? 7.926   2.431   0.311   1.00 1.15 ? 19 PRO A CB   12 
ATOM   5413  C CG   . PRO A 1 19 ? 9.329   1.937   0.199   1.00 1.14 ? 19 PRO A CG   12 
ATOM   5414  C CD   . PRO A 1 19 ? 10.232  2.995   0.778   1.00 1.01 ? 19 PRO A CD   12 
ATOM   5415  H HA   . PRO A 1 19 ? 7.262   4.218   1.306   1.00 1.05 ? 19 PRO A HA   12 
ATOM   5416  H HB2  . PRO A 1 19 ? 7.249   1.609   0.501   1.00 1.25 ? 19 PRO A HB2  12 
ATOM   5417  H HB3  . PRO A 1 19 ? 7.645   2.949   -0.594  1.00 1.28 ? 19 PRO A HB3  12 
ATOM   5418  H HG2  . PRO A 1 19 ? 9.438   1.014   0.753   1.00 1.13 ? 19 PRO A HG2  12 
ATOM   5419  H HG3  . PRO A 1 19 ? 9.581   1.774   -0.839  1.00 1.34 ? 19 PRO A HG3  12 
ATOM   5420  H HD2  . PRO A 1 19 ? 10.980  2.541   1.413   1.00 1.02 ? 19 PRO A HD2  12 
ATOM   5421  H HD3  . PRO A 1 19 ? 10.702  3.561   -0.011  1.00 1.13 ? 19 PRO A HD3  12 
ATOM   5422  N N    . PRO A 1 20 ? 6.268   2.461   2.976   1.00 1.07 ? 20 PRO A N    12 
ATOM   5423  C CA   . PRO A 1 20 ? 5.826   1.746   4.211   1.00 1.08 ? 20 PRO A CA   12 
ATOM   5424  C C    . PRO A 1 20 ? 6.020   0.229   4.044   1.00 1.04 ? 20 PRO A C    12 
ATOM   5425  O O    . PRO A 1 20 ? 5.067   -0.531  3.989   1.00 1.22 ? 20 PRO A O    12 
ATOM   5426  C CB   . PRO A 1 20 ? 4.346   2.108   4.335   1.00 1.39 ? 20 PRO A CB   12 
ATOM   5427  C CG   . PRO A 1 20 ? 3.914   2.436   2.947   1.00 1.53 ? 20 PRO A CG   12 
ATOM   5428  C CD   . PRO A 1 20 ? 5.114   3.006   2.240   1.00 1.34 ? 20 PRO A CD   12 
ATOM   5429  H HA   . PRO A 1 20 ? 6.367   2.106   5.071   1.00 1.00 ? 20 PRO A HA   12 
ATOM   5430  H HB2  . PRO A 1 20 ? 3.784   1.266   4.719   1.00 1.47 ? 20 PRO A HB2  12 
ATOM   5431  H HB3  . PRO A 1 20 ? 4.222   2.969   4.974   1.00 1.46 ? 20 PRO A HB3  12 
ATOM   5432  H HG2  . PRO A 1 20 ? 3.576   1.539   2.444   1.00 1.62 ? 20 PRO A HG2  12 
ATOM   5433  H HG3  . PRO A 1 20 ? 3.123   3.169   2.968   1.00 1.72 ? 20 PRO A HG3  12 
ATOM   5434  H HD2  . PRO A 1 20 ? 5.132   2.680   1.208   1.00 1.42 ? 20 PRO A HD2  12 
ATOM   5435  H HD3  . PRO A 1 20 ? 5.112   4.083   2.297   1.00 1.39 ? 20 PRO A HD3  12 
ATOM   5436  N N    . SER A 1 21 ? 7.253   -0.213  3.961   1.00 0.88 ? 21 SER A N    12 
ATOM   5437  C CA   . SER A 1 21 ? 7.530   -1.679  3.791   1.00 0.95 ? 21 SER A CA   12 
ATOM   5438  C C    . SER A 1 21 ? 7.198   -2.451  5.078   1.00 0.84 ? 21 SER A C    12 
ATOM   5439  O O    . SER A 1 21 ? 6.641   -1.902  6.009   1.00 0.78 ? 21 SER A O    12 
ATOM   5440  C CB   . SER A 1 21 ? 9.029   -1.777  3.468   1.00 0.98 ? 21 SER A CB   12 
ATOM   5441  O OG   . SER A 1 21 ? 9.762   -0.836  4.249   1.00 0.81 ? 21 SER A OG   12 
ATOM   5442  H H    . SER A 1 21 ? 8.001   0.421   4.006   1.00 0.79 ? 21 SER A H    12 
ATOM   5443  H HA   . SER A 1 21 ? 6.954   -2.071  2.967   1.00 1.15 ? 21 SER A HA   12 
ATOM   5444  H HB2  . SER A 1 21 ? 9.383   -2.770  3.690   1.00 1.12 ? 21 SER A HB2  12 
ATOM   5445  H HB3  . SER A 1 21 ? 9.179   -1.577  2.414   1.00 1.08 ? 21 SER A HB3  12 
ATOM   5446  H HG   . SER A 1 21 ? 9.504   -0.942  5.171   1.00 0.94 ? 21 SER A HG   12 
ATOM   5447  N N    . LYS A 1 22 ? 7.529   -3.726  5.119   1.00 0.91 ? 22 LYS A N    12 
ATOM   5448  C CA   . LYS A 1 22 ? 7.238   -4.579  6.326   1.00 0.87 ? 22 LYS A CA   12 
ATOM   5449  C C    . LYS A 1 22 ? 5.724   -4.745  6.510   1.00 0.98 ? 22 LYS A C    12 
ATOM   5450  O O    . LYS A 1 22 ? 5.013   -3.803  6.809   1.00 0.96 ? 22 LYS A O    12 
ATOM   5451  C CB   . LYS A 1 22 ? 7.859   -3.855  7.532   1.00 0.72 ? 22 LYS A CB   12 
ATOM   5452  C CG   . LYS A 1 22 ? 9.379   -3.763  7.363   1.00 0.86 ? 22 LYS A CG   12 
ATOM   5453  C CD   . LYS A 1 22 ? 9.862   -2.383  7.822   1.00 0.84 ? 22 LYS A CD   12 
ATOM   5454  C CE   . LYS A 1 22 ? 9.995   -2.362  9.350   1.00 0.92 ? 22 LYS A CE   12 
ATOM   5455  N NZ   . LYS A 1 22 ? 8.794   -1.626  9.836   1.00 0.83 ? 22 LYS A NZ   12 
ATOM   5456  H H    . LYS A 1 22 ? 7.966   -4.134  4.340   1.00 1.04 ? 22 LYS A H    12 
ATOM   5457  H HA   . LYS A 1 22 ? 7.700   -5.551  6.214   1.00 0.97 ? 22 LYS A HA   12 
ATOM   5458  H HB2  . LYS A 1 22 ? 7.443   -2.862  7.610   1.00 0.76 ? 22 LYS A HB2  12 
ATOM   5459  H HB3  . LYS A 1 22 ? 7.635   -4.406  8.433   1.00 0.83 ? 22 LYS A HB3  12 
ATOM   5460  H HG2  . LYS A 1 22 ? 9.854   -4.529  7.958   1.00 1.05 ? 22 LYS A HG2  12 
ATOM   5461  H HG3  . LYS A 1 22 ? 9.636   -3.904  6.324   1.00 1.10 ? 22 LYS A HG3  12 
ATOM   5462  H HD2  . LYS A 1 22 ? 10.822  -2.172  7.374   1.00 1.07 ? 22 LYS A HD2  12 
ATOM   5463  H HD3  . LYS A 1 22 ? 9.150   -1.632  7.515   1.00 0.75 ? 22 LYS A HD3  12 
ATOM   5464  H HE2  . LYS A 1 22 ? 10.005  -3.372  9.739   1.00 1.04 ? 22 LYS A HE2  12 
ATOM   5465  H HE3  . LYS A 1 22 ? 10.893  -1.838  9.641   1.00 1.07 ? 22 LYS A HE3  12 
ATOM   5466  H HZ1  . LYS A 1 22 ? 8.740   -0.689  9.369   1.00 0.79 ? 22 LYS A HZ1  12 
ATOM   5467  H HZ2  . LYS A 1 22 ? 7.932   -2.171  9.611   1.00 0.78 ? 22 LYS A HZ2  12 
ATOM   5468  H HZ3  . LYS A 1 22 ? 8.858   -1.495  10.874  1.00 1.00 ? 22 LYS A HZ3  12 
ATOM   5469  N N    . THR A 1 23 ? 5.226   -5.939  6.327   1.00 1.19 ? 23 THR A N    12 
ATOM   5470  C CA   . THR A 1 23 ? 3.753   -6.174  6.484   1.00 1.39 ? 23 THR A CA   12 
ATOM   5471  C C    . THR A 1 23 ? 3.379   -6.377  7.963   1.00 1.37 ? 23 THR A C    12 
ATOM   5472  O O    . THR A 1 23 ? 2.224   -6.285  8.328   1.00 1.57 ? 23 THR A O    12 
ATOM   5473  C CB   . THR A 1 23 ? 3.452   -7.438  5.665   1.00 1.64 ? 23 THR A CB   12 
ATOM   5474  O OG1  . THR A 1 23 ? 2.047   -7.560  5.486   1.00 1.87 ? 23 THR A OG1  12 
ATOM   5475  C CG2  . THR A 1 23 ? 3.983   -8.680  6.388   1.00 1.71 ? 23 THR A CG2  12 
ATOM   5476  H H    . THR A 1 23 ? 5.818   -6.681  6.081   1.00 1.26 ? 23 THR A H    12 
ATOM   5477  H HA   . THR A 1 23 ? 3.201   -5.342  6.077   1.00 1.41 ? 23 THR A HA   12 
ATOM   5478  H HB   . THR A 1 23 ? 3.930   -7.360  4.699   1.00 1.67 ? 23 THR A HB   12 
ATOM   5479  H HG1  . THR A 1 23 ? 1.637   -7.606  6.354   1.00 1.90 ? 23 THR A HG1  12 
ATOM   5480  H HG21 . THR A 1 23 ? 4.942   -8.459  6.832   1.00 2.14 ? 23 THR A HG21 12 
ATOM   5481  H HG22 . THR A 1 23 ? 3.288   -8.973  7.161   1.00 1.82 ? 23 THR A HG22 12 
ATOM   5482  H HG23 . THR A 1 23 ? 4.093   -9.489  5.681   1.00 2.01 ? 23 THR A HG23 12 
ATOM   5483  N N    . CYS A 1 24 ? 4.341   -6.650  8.814   1.00 1.21 ? 24 CYS A N    12 
ATOM   5484  C CA   . CYS A 1 24 ? 4.028   -6.852  10.262  1.00 1.25 ? 24 CYS A CA   12 
ATOM   5485  C C    . CYS A 1 24 ? 3.955   -5.498  10.983  1.00 1.17 ? 24 CYS A C    12 
ATOM   5486  O O    . CYS A 1 24 ? 2.991   -5.202  11.661  1.00 1.31 ? 24 CYS A O    12 
ATOM   5487  C CB   . CYS A 1 24 ? 5.183   -7.697  10.810  1.00 1.28 ? 24 CYS A CB   12 
ATOM   5488  S SG   . CYS A 1 24 ? 4.993   -9.410  10.259  1.00 1.98 ? 24 CYS A SG   12 
ATOM   5489  H H    . CYS A 1 24 ? 5.265   -6.719  8.503   1.00 1.11 ? 24 CYS A H    12 
ATOM   5490  H HA   . CYS A 1 24 ? 3.098   -7.385  10.373  1.00 1.42 ? 24 CYS A HA   12 
ATOM   5491  H HB2  . CYS A 1 24 ? 6.121   -7.303  10.448  1.00 1.40 ? 24 CYS A HB2  12 
ATOM   5492  H HB3  . CYS A 1 24 ? 5.171   -7.663  11.890  1.00 1.46 ? 24 CYS A HB3  12 
ATOM   5493  H HG   . CYS A 1 24 ? 4.413   -9.859  10.877  1.00 2.27 ? 24 CYS A HG   12 
ATOM   5494  N N    . LEU A 1 25 ? 4.968   -4.677  10.840  1.00 1.02 ? 25 LEU A N    12 
ATOM   5495  C CA   . LEU A 1 25 ? 4.959   -3.343  11.515  1.00 1.07 ? 25 LEU A CA   12 
ATOM   5496  C C    . LEU A 1 25 ? 5.507   -2.259  10.577  1.00 0.93 ? 25 LEU A C    12 
ATOM   5497  O O    . LEU A 1 25 ? 6.403   -2.502  9.790   1.00 0.82 ? 25 LEU A O    12 
ATOM   5498  C CB   . LEU A 1 25 ? 5.878   -3.508  12.731  1.00 1.20 ? 25 LEU A CB   12 
ATOM   5499  C CG   . LEU A 1 25 ? 5.080   -4.081  13.904  1.00 1.38 ? 25 LEU A CG   12 
ATOM   5500  C CD1  . LEU A 1 25 ? 6.045   -4.623  14.959  1.00 1.63 ? 25 LEU A CD1  12 
ATOM   5501  C CD2  . LEU A 1 25 ? 4.219   -2.977  14.525  1.00 1.67 ? 25 LEU A CD2  12 
ATOM   5502  H H    . LEU A 1 25 ? 5.733   -4.937  10.288  1.00 0.97 ? 25 LEU A H    12 
ATOM   5503  H HA   . LEU A 1 25 ? 3.963   -3.090  11.839  1.00 1.21 ? 25 LEU A HA   12 
ATOM   5504  H HB2  . LEU A 1 25 ? 6.686   -4.180  12.482  1.00 1.18 ? 25 LEU A HB2  12 
ATOM   5505  H HB3  . LEU A 1 25 ? 6.282   -2.546  13.010  1.00 1.32 ? 25 LEU A HB3  12 
ATOM   5506  H HG   . LEU A 1 25 ? 4.446   -4.881  13.551  1.00 1.38 ? 25 LEU A HG   12 
ATOM   5507  H HD11 . LEU A 1 25 ? 6.887   -3.953  15.054  1.00 2.11 ? 25 LEU A HD11 12 
ATOM   5508  H HD12 . LEU A 1 25 ? 5.536   -4.696  15.909  1.00 1.82 ? 25 LEU A HD12 12 
ATOM   5509  H HD13 . LEU A 1 25 ? 6.393   -5.600  14.661  1.00 2.00 ? 25 LEU A HD13 12 
ATOM   5510  H HD21 . LEU A 1 25 ? 4.850   -2.156  14.829  1.00 2.04 ? 25 LEU A HD21 12 
ATOM   5511  H HD22 . LEU A 1 25 ? 3.501   -2.630  13.797  1.00 2.08 ? 25 LEU A HD22 12 
ATOM   5512  H HD23 . LEU A 1 25 ? 3.699   -3.369  15.385  1.00 1.99 ? 25 LEU A HD23 12 
ATOM   5513  N N    . LYS A 1 26 ? 4.978   -1.065  10.665  1.00 1.01 ? 26 LYS A N    12 
ATOM   5514  C CA   . LYS A 1 26 ? 5.465   0.048   9.793   1.00 0.94 ? 26 LYS A CA   12 
ATOM   5515  C C    . LYS A 1 26 ? 5.899   1.239   10.659  1.00 1.10 ? 26 LYS A C    12 
ATOM   5516  O O    . LYS A 1 26 ? 5.291   2.293   10.640  1.00 1.23 ? 26 LYS A O    12 
ATOM   5517  C CB   . LYS A 1 26 ? 4.266   0.416   8.912   1.00 1.01 ? 26 LYS A CB   12 
ATOM   5518  C CG   . LYS A 1 26 ? 4.300   -0.418  7.629   1.00 0.93 ? 26 LYS A CG   12 
ATOM   5519  C CD   . LYS A 1 26 ? 3.113   -1.385  7.611   1.00 1.09 ? 26 LYS A CD   12 
ATOM   5520  C CE   . LYS A 1 26 ? 2.558   -1.500  6.185   1.00 1.23 ? 26 LYS A CE   12 
ATOM   5521  N NZ   . LYS A 1 26 ? 3.629   -2.178  5.393   1.00 1.10 ? 26 LYS A NZ   12 
ATOM   5522  H H    . LYS A 1 26 ? 4.262   -0.896  11.312  1.00 1.15 ? 26 LYS A H    12 
ATOM   5523  H HA   . LYS A 1 26 ? 6.285   -0.287  9.178   1.00 0.83 ? 26 LYS A HA   12 
ATOM   5524  H HB2  . LYS A 1 26 ? 3.350   0.217   9.450   1.00 1.15 ? 26 LYS A HB2  12 
ATOM   5525  H HB3  . LYS A 1 26 ? 4.315   1.464   8.658   1.00 1.08 ? 26 LYS A HB3  12 
ATOM   5526  H HG2  . LYS A 1 26 ? 4.246   0.238   6.773   1.00 1.02 ? 26 LYS A HG2  12 
ATOM   5527  H HG3  . LYS A 1 26 ? 5.220   -0.982  7.592   1.00 0.87 ? 26 LYS A HG3  12 
ATOM   5528  H HD2  . LYS A 1 26 ? 3.436   -2.358  7.952   1.00 1.10 ? 26 LYS A HD2  12 
ATOM   5529  H HD3  . LYS A 1 26 ? 2.338   -1.015  8.266   1.00 1.24 ? 26 LYS A HD3  12 
ATOM   5530  H HE2  . LYS A 1 26 ? 1.654   -2.095  6.185   1.00 1.45 ? 26 LYS A HE2  12 
ATOM   5531  H HE3  . LYS A 1 26 ? 2.362   -0.519  5.779   1.00 1.34 ? 26 LYS A HE3  12 
ATOM   5532  H HZ1  . LYS A 1 26 ? 4.227   -2.757  6.028   1.00 1.35 ? 26 LYS A HZ1  12 
ATOM   5533  H HZ2  . LYS A 1 26 ? 3.195   -2.789  4.673   1.00 1.54 ? 26 LYS A HZ2  12 
ATOM   5534  H HZ3  . LYS A 1 26 ? 4.222   -1.458  4.920   1.00 1.44 ? 26 LYS A HZ3  12 
ATOM   5535  N N    . GLU A 1 27 ? 6.945   1.068   11.430  1.00 1.18 ? 27 GLU A N    12 
ATOM   5536  C CA   . GLU A 1 27 ? 7.430   2.176   12.316  1.00 1.42 ? 27 GLU A CA   12 
ATOM   5537  C C    . GLU A 1 27 ? 8.004   3.345   11.494  1.00 1.40 ? 27 GLU A C    12 
ATOM   5538  O O    . GLU A 1 27 ? 8.126   4.450   11.991  1.00 1.61 ? 27 GLU A O    12 
ATOM   5539  C CB   . GLU A 1 27 ? 8.521   1.538   13.184  1.00 1.55 ? 27 GLU A CB   12 
ATOM   5540  C CG   . GLU A 1 27 ? 7.917   0.397   14.018  1.00 1.58 ? 27 GLU A CG   12 
ATOM   5541  C CD   . GLU A 1 27 ? 8.495   -0.947  13.563  1.00 1.43 ? 27 GLU A CD   12 
ATOM   5542  O OE1  . GLU A 1 27 ? 8.372   -1.259  12.387  1.00 1.24 ? 27 GLU A OE1  12 
ATOM   5543  O OE2  . GLU A 1 27 ? 9.044   -1.646  14.398  1.00 1.63 ? 27 GLU A OE2  12 
ATOM   5544  H H    . GLU A 1 27 ? 7.410   0.204   11.435  1.00 1.13 ? 27 GLU A H    12 
ATOM   5545  H HA   . GLU A 1 27 ? 6.626   2.526   12.945  1.00 1.57 ? 27 GLU A HA   12 
ATOM   5546  H HB2  . GLU A 1 27 ? 9.303   1.147   12.549  1.00 1.47 ? 27 GLU A HB2  12 
ATOM   5547  H HB3  . GLU A 1 27 ? 8.936   2.284   13.847  1.00 1.75 ? 27 GLU A HB3  12 
ATOM   5548  H HG2  . GLU A 1 27 ? 8.151   0.553   15.058  1.00 1.80 ? 27 GLU A HG2  12 
ATOM   5549  H HG3  . GLU A 1 27 ? 6.845   0.386   13.889  1.00 1.57 ? 27 GLU A HG3  12 
ATOM   5550  N N    . GLU A 1 28 ? 8.355   3.119   10.247  1.00 1.20 ? 28 GLU A N    12 
ATOM   5551  C CA   . GLU A 1 28 ? 8.916   4.227   9.406   1.00 1.23 ? 28 GLU A CA   12 
ATOM   5552  C C    . GLU A 1 28 ? 7.798   5.192   8.967   1.00 1.28 ? 28 GLU A C    12 
ATOM   5553  O O    . GLU A 1 28 ? 7.436   5.260   7.805   1.00 1.29 ? 28 GLU A O    12 
ATOM   5554  C CB   . GLU A 1 28 ? 9.563   3.533   8.194   1.00 1.04 ? 28 GLU A CB   12 
ATOM   5555  C CG   . GLU A 1 28 ? 8.523   2.681   7.446   1.00 0.79 ? 28 GLU A CG   12 
ATOM   5556  C CD   . GLU A 1 28 ? 8.868   1.198   7.589   1.00 0.69 ? 28 GLU A CD   12 
ATOM   5557  O OE1  . GLU A 1 28 ? 8.442   0.605   8.566   1.00 0.81 ? 28 GLU A OE1  12 
ATOM   5558  O OE2  . GLU A 1 28 ? 9.551   0.682   6.720   1.00 0.67 ? 28 GLU A OE2  12 
ATOM   5559  H H    . GLU A 1 28 ? 8.249   2.223   9.864   1.00 1.06 ? 28 GLU A H    12 
ATOM   5560  H HA   . GLU A 1 28 ? 9.670   4.765   9.960   1.00 1.41 ? 28 GLU A HA   12 
ATOM   5561  H HB2  . GLU A 1 28 ? 9.959   4.282   7.524   1.00 1.10 ? 28 GLU A HB2  12 
ATOM   5562  H HB3  . GLU A 1 28 ? 10.367  2.897   8.534   1.00 1.11 ? 28 GLU A HB3  12 
ATOM   5563  H HG2  . GLU A 1 28 ? 7.542   2.863   7.861   1.00 0.87 ? 28 GLU A HG2  12 
ATOM   5564  H HG3  . GLU A 1 28 ? 8.525   2.948   6.402   1.00 0.75 ? 28 GLU A HG3  12 
ATOM   5565  N N    . MET A 1 29 ? 7.250   5.941   9.895   1.00 1.49 ? 29 MET A N    12 
ATOM   5566  C CA   . MET A 1 29 ? 6.158   6.903   9.546   1.00 1.61 ? 29 MET A CA   12 
ATOM   5567  C C    . MET A 1 29 ? 6.751   8.190   8.955   1.00 1.84 ? 29 MET A C    12 
ATOM   5568  O O    . MET A 1 29 ? 6.968   9.164   9.656   1.00 1.96 ? 29 MET A O    12 
ATOM   5569  C CB   . MET A 1 29 ? 5.438   7.191   10.869  1.00 1.71 ? 29 MET A CB   12 
ATOM   5570  C CG   . MET A 1 29 ? 4.145   6.377   10.938  1.00 1.91 ? 29 MET A CG   12 
ATOM   5571  S SD   . MET A 1 29 ? 3.322   6.686   12.520  1.00 2.22 ? 29 MET A SD   12 
ATOM   5572  C CE   . MET A 1 29 ? 3.517   5.023   13.208  1.00 2.51 ? 29 MET A CE   12 
ATOM   5573  H H    . MET A 1 29 ? 7.560   5.869   10.824  1.00 1.66 ? 29 MET A H    12 
ATOM   5574  H HA   . MET A 1 29 ? 5.472   6.453   8.845   1.00 1.64 ? 29 MET A HA   12 
ATOM   5575  H HB2  . MET A 1 29 ? 6.079   6.919   11.695  1.00 1.70 ? 29 MET A HB2  12 
ATOM   5576  H HB3  . MET A 1 29 ? 5.203   8.242   10.929  1.00 2.01 ? 29 MET A HB3  12 
ATOM   5577  H HG2  . MET A 1 29 ? 3.491   6.670   10.129  1.00 2.22 ? 29 MET A HG2  12 
ATOM   5578  H HG3  . MET A 1 29 ? 4.375   5.326   10.850  1.00 2.19 ? 29 MET A HG3  12 
ATOM   5579  H HE1  . MET A 1 29 ? 3.500   4.298   12.411  1.00 2.95 ? 29 MET A HE1  12 
ATOM   5580  H HE2  . MET A 1 29 ? 4.463   4.959   13.730  1.00 2.90 ? 29 MET A HE2  12 
ATOM   5581  H HE3  . MET A 1 29 ? 2.707   4.821   13.894  1.00 2.68 ? 29 MET A HE3  12 
ATOM   5582  N N    . ALA A 1 30 ? 7.016   8.190   7.667   1.00 2.11 ? 30 ALA A N    12 
ATOM   5583  C CA   . ALA A 1 30 ? 7.600   9.398   6.995   1.00 2.51 ? 30 ALA A CA   12 
ATOM   5584  C C    . ALA A 1 30 ? 8.943   9.789   7.645   1.00 2.68 ? 30 ALA A C    12 
ATOM   5585  O O    . ALA A 1 30 ? 9.700   8.890   7.981   1.00 2.64 ? 30 ALA A O    12 
ATOM   5586  C CB   . ALA A 1 30 ? 6.548   10.502  7.172   1.00 2.49 ? 30 ALA A CB   12 
ATOM   5587  O OXT  . ALA A 1 30 ? 9.198   10.977  7.787   1.00 2.99 ? 30 ALA A OXT  12 
ATOM   5588  H H    . ALA A 1 30 ? 6.832   7.387   7.138   1.00 2.16 ? 30 ALA A H    12 
ATOM   5589  H HA   . ALA A 1 30 ? 7.746   9.200   5.944   1.00 2.84 ? 30 ALA A HA   12 
ATOM   5590  H HB1  . ALA A 1 30 ? 5.561   10.064  7.171   1.00 2.87 ? 30 ALA A HB1  12 
ATOM   5591  H HB2  . ALA A 1 30 ? 6.715   11.012  8.109   1.00 2.50 ? 30 ALA A HB2  12 
ATOM   5592  H HB3  . ALA A 1 30 ? 6.629   11.209  6.358   1.00 2.66 ? 30 ALA A HB3  12 
ATOM   5593  N N    . MET A 1 1  ? -9.248  5.135   11.545  1.00 2.83 ? 1  MET A N    13 
ATOM   5594  C CA   . MET A 1 1  ? -7.909  5.286   10.895  1.00 2.27 ? 1  MET A CA   13 
ATOM   5595  C C    . MET A 1 1  ? -7.466  6.757   10.921  1.00 2.14 ? 1  MET A C    13 
ATOM   5596  O O    . MET A 1 1  ? -8.276  7.645   11.101  1.00 2.40 ? 1  MET A O    13 
ATOM   5597  C CB   . MET A 1 1  ? -8.105  4.809   9.450   1.00 2.41 ? 1  MET A CB   13 
ATOM   5598  C CG   . MET A 1 1  ? -7.333  3.506   9.228   1.00 2.52 ? 1  MET A CG   13 
ATOM   5599  S SD   . MET A 1 1  ? -8.011  2.210   10.294  1.00 3.24 ? 1  MET A SD   13 
ATOM   5600  C CE   . MET A 1 1  ? -6.867  0.894   9.810   1.00 3.70 ? 1  MET A CE   13 
ATOM   5601  H H1   . MET A 1 1  ? -9.930  5.780   11.092  1.00 3.12 ? 1  MET A H1   13 
ATOM   5602  H H2   . MET A 1 1  ? -9.579  4.155   11.441  1.00 3.24 ? 1  MET A H2   13 
ATOM   5603  H H3   . MET A 1 1  ? -9.172  5.367   12.555  1.00 2.90 ? 1  MET A H3   13 
ATOM   5604  H HA   . MET A 1 1  ? -7.178  4.667   11.392  1.00 2.19 ? 1  MET A HA   13 
ATOM   5605  H HB2  . MET A 1 1  ? -9.156  4.642   9.264   1.00 2.82 ? 1  MET A HB2  13 
ATOM   5606  H HB3  . MET A 1 1  ? -7.736  5.562   8.769   1.00 2.32 ? 1  MET A HB3  13 
ATOM   5607  H HG2  . MET A 1 1  ? -7.425  3.204   8.195   1.00 2.78 ? 1  MET A HG2  13 
ATOM   5608  H HG3  . MET A 1 1  ? -6.290  3.659   9.465   1.00 2.71 ? 1  MET A HG3  13 
ATOM   5609  H HE1  . MET A 1 1  ? -6.857  0.802   8.736   1.00 4.03 ? 1  MET A HE1  13 
ATOM   5610  H HE2  . MET A 1 1  ? -5.873  1.137   10.158  1.00 3.97 ? 1  MET A HE2  13 
ATOM   5611  H HE3  . MET A 1 1  ? -7.190  -0.041  10.247  1.00 3.97 ? 1  MET A HE3  13 
ATOM   5612  N N    . ILE A 1 2  ? -6.187  7.007   10.739  1.00 1.95 ? 2  ILE A N    13 
ATOM   5613  C CA   . ILE A 1 2  ? -5.657  8.417   10.746  1.00 2.11 ? 2  ILE A CA   13 
ATOM   5614  C C    . ILE A 1 2  ? -6.008  9.123   12.069  1.00 2.40 ? 2  ILE A C    13 
ATOM   5615  O O    . ILE A 1 2  ? -7.053  9.734   12.202  1.00 2.76 ? 2  ILE A O    13 
ATOM   5616  C CB   . ILE A 1 2  ? -6.321  9.115   9.549   1.00 2.26 ? 2  ILE A CB   13 
ATOM   5617  C CG1  . ILE A 1 2  ? -5.951  8.381   8.254   1.00 2.05 ? 2  ILE A CG1  13 
ATOM   5618  C CG2  . ILE A 1 2  ? -5.826  10.562  9.459   1.00 2.65 ? 2  ILE A CG2  13 
ATOM   5619  C CD1  . ILE A 1 2  ? -7.221  8.074   7.457   1.00 2.34 ? 2  ILE A CD1  13 
ATOM   5620  H H    . ILE A 1 2  ? -5.566  6.262   10.594  1.00 1.87 ? 2  ILE A H    13 
ATOM   5621  H HA   . ILE A 1 2  ? -4.588  8.408   10.610  1.00 2.12 ? 2  ILE A HA   13 
ATOM   5622  H HB   . ILE A 1 2  ? -7.393  9.111   9.677   1.00 2.46 ? 2  ILE A HB   13 
ATOM   5623  H HG12 . ILE A 1 2  ? -5.297  9.003   7.661   1.00 2.19 ? 2  ILE A HG12 13 
ATOM   5624  H HG13 . ILE A 1 2  ? -5.448  7.456   8.492   1.00 1.91 ? 2  ILE A HG13 13 
ATOM   5625  H HG21 . ILE A 1 2  ? -4.746  10.575  9.465   1.00 3.13 ? 2  ILE A HG21 13 
ATOM   5626  H HG22 . ILE A 1 2  ? -6.187  11.010  8.546   1.00 2.83 ? 2  ILE A HG22 13 
ATOM   5627  H HG23 . ILE A 1 2  ? -6.197  11.122  10.306  1.00 2.82 ? 2  ILE A HG23 13 
ATOM   5628  H HD11 . ILE A 1 2  ? -8.032  7.863   8.138   1.00 2.62 ? 2  ILE A HD11 13 
ATOM   5629  H HD12 . ILE A 1 2  ? -7.477  8.928   6.846   1.00 2.66 ? 2  ILE A HD12 13 
ATOM   5630  H HD13 . ILE A 1 2  ? -7.051  7.217   6.823   1.00 2.66 ? 2  ILE A HD13 13 
ATOM   5631  N N    . SER A 1 3  ? -5.140  9.041   13.048  1.00 2.38 ? 3  SER A N    13 
ATOM   5632  C CA   . SER A 1 3  ? -5.421  9.703   14.362  1.00 2.74 ? 3  SER A CA   13 
ATOM   5633  C C    . SER A 1 3  ? -4.114  10.133  15.049  1.00 2.14 ? 3  SER A C    13 
ATOM   5634  O O    . SER A 1 3  ? -3.835  9.737   16.167  1.00 2.23 ? 3  SER A O    13 
ATOM   5635  C CB   . SER A 1 3  ? -6.142  8.634   15.189  1.00 3.36 ? 3  SER A CB   13 
ATOM   5636  O OG   . SER A 1 3  ? -6.636  9.221   16.387  1.00 3.90 ? 3  SER A OG   13 
ATOM   5637  H H    . SER A 1 3  ? -4.302  8.544   12.919  1.00 2.23 ? 3  SER A H    13 
ATOM   5638  H HA   . SER A 1 3  ? -6.070  10.554  14.224  1.00 3.22 ? 3  SER A HA   13 
ATOM   5639  H HB2  . SER A 1 3  ? -6.968  8.235   14.623  1.00 3.74 ? 3  SER A HB2  13 
ATOM   5640  H HB3  . SER A 1 3  ? -5.451  7.836   15.425  1.00 3.19 ? 3  SER A HB3  13 
ATOM   5641  H HG   . SER A 1 3  ? -5.897  9.331   16.992  1.00 3.67 ? 3  SER A HG   13 
ATOM   5642  N N    . SER A 1 4  ? -3.313  10.944  14.385  1.00 1.72 ? 4  SER A N    13 
ATOM   5643  C CA   . SER A 1 4  ? -2.011  11.427  14.971  1.00 1.51 ? 4  SER A CA   13 
ATOM   5644  C C    . SER A 1 4  ? -0.984  10.289  15.064  1.00 1.55 ? 4  SER A C    13 
ATOM   5645  O O    . SER A 1 4  ? 0.106   10.386  14.535  1.00 1.80 ? 4  SER A O    13 
ATOM   5646  C CB   . SER A 1 4  ? -2.348  11.978  16.363  1.00 1.75 ? 4  SER A CB   13 
ATOM   5647  O OG   . SER A 1 4  ? -1.713  13.239  16.533  1.00 2.18 ? 4  SER A OG   13 
ATOM   5648  H H    . SER A 1 4  ? -3.570  11.240  13.489  1.00 1.78 ? 4  SER A H    13 
ATOM   5649  H HA   . SER A 1 4  ? -1.612  12.219  14.362  1.00 1.62 ? 4  SER A HA   13 
ATOM   5650  H HB2  . SER A 1 4  ? -3.415  12.103  16.455  1.00 1.99 ? 4  SER A HB2  13 
ATOM   5651  H HB3  . SER A 1 4  ? -2.002  11.285  17.118  1.00 1.77 ? 4  SER A HB3  13 
ATOM   5652  H HG   . SER A 1 4  ? -2.395  13.905  16.636  1.00 2.36 ? 4  SER A HG   13 
ATOM   5653  N N    . VAL A 1 5  ? -1.324  9.216   15.727  1.00 1.85 ? 5  VAL A N    13 
ATOM   5654  C CA   . VAL A 1 5  ? -0.371  8.065   15.854  1.00 2.41 ? 5  VAL A CA   13 
ATOM   5655  C C    . VAL A 1 5  ? -0.443  7.164   14.611  1.00 2.71 ? 5  VAL A C    13 
ATOM   5656  O O    . VAL A 1 5  ? 0.495   6.462   14.288  1.00 3.30 ? 5  VAL A O    13 
ATOM   5657  C CB   . VAL A 1 5  ? -0.818  7.312   17.116  1.00 2.94 ? 5  VAL A CB   13 
ATOM   5658  C CG1  . VAL A 1 5  ? -2.107  6.530   16.840  1.00 3.36 ? 5  VAL A CG1  13 
ATOM   5659  C CG2  . VAL A 1 5  ? 0.282   6.339   17.545  1.00 3.53 ? 5  VAL A CG2  13 
ATOM   5660  H H    . VAL A 1 5  ? -2.211  9.164   16.140  1.00 1.98 ? 5  VAL A H    13 
ATOM   5661  H HA   . VAL A 1 5  ? 0.632   8.431   15.983  1.00 2.46 ? 5  VAL A HA   13 
ATOM   5662  H HB   . VAL A 1 5  ? -0.997  8.023   17.908  1.00 2.79 ? 5  VAL A HB   13 
ATOM   5663  H HG11 . VAL A 1 5  ? -2.827  7.176   16.360  1.00 4.20 ? 5  VAL A HG11 13 
ATOM   5664  H HG12 . VAL A 1 5  ? -1.889  5.692   16.196  1.00 3.36 ? 5  VAL A HG12 13 
ATOM   5665  H HG13 . VAL A 1 5  ? -2.514  6.169   17.774  1.00 3.20 ? 5  VAL A HG13 13 
ATOM   5666  H HG21 . VAL A 1 5  ? 0.507   5.666   16.730  1.00 3.80 ? 5  VAL A HG21 13 
ATOM   5667  H HG22 . VAL A 1 5  ? 1.171   6.893   17.809  1.00 3.57 ? 5  VAL A HG22 13 
ATOM   5668  H HG23 . VAL A 1 5  ? -0.054  5.769   18.399  1.00 3.93 ? 5  VAL A HG23 13 
ATOM   5669  N N    . CYS A 1 6  ? -1.548  7.193   13.914  1.00 2.40 ? 6  CYS A N    13 
ATOM   5670  C CA   . CYS A 1 6  ? -1.699  6.361   12.686  1.00 2.72 ? 6  CYS A CA   13 
ATOM   5671  C C    . CYS A 1 6  ? -2.124  7.251   11.512  1.00 2.25 ? 6  CYS A C    13 
ATOM   5672  O O    . CYS A 1 6  ? -2.798  8.247   11.695  1.00 2.06 ? 6  CYS A O    13 
ATOM   5673  C CB   . CYS A 1 6  ? -2.797  5.348   13.023  1.00 3.22 ? 6  CYS A CB   13 
ATOM   5674  S SG   . CYS A 1 6  ? -2.065  3.918   13.859  1.00 4.25 ? 6  CYS A SG   13 
ATOM   5675  H H    . CYS A 1 6  ? -2.278  7.776   14.195  1.00 2.03 ? 6  CYS A H    13 
ATOM   5676  H HA   . CYS A 1 6  ? -0.778  5.848   12.458  1.00 3.05 ? 6  CYS A HA   13 
ATOM   5677  H HB2  . CYS A 1 6  ? -3.527  5.809   13.671  1.00 3.33 ? 6  CYS A HB2  13 
ATOM   5678  H HB3  . CYS A 1 6  ? -3.279  5.024   12.112  1.00 3.06 ? 6  CYS A HB3  13 
ATOM   5679  H HG   . CYS A 1 6  ? -1.457  4.244   14.526  1.00 4.50 ? 6  CYS A HG   13 
ATOM   5680  N N    . VAL A 1 7  ? -1.730  6.903   10.315  1.00 2.15 ? 7  VAL A N    13 
ATOM   5681  C CA   . VAL A 1 7  ? -2.099  7.724   9.126   1.00 1.81 ? 7  VAL A CA   13 
ATOM   5682  C C    . VAL A 1 7  ? -2.396  6.817   7.923   1.00 1.60 ? 7  VAL A C    13 
ATOM   5683  O O    . VAL A 1 7  ? -2.346  5.604   8.012   1.00 1.65 ? 7  VAL A O    13 
ATOM   5684  C CB   . VAL A 1 7  ? -0.869  8.608   8.874   1.00 2.11 ? 7  VAL A CB   13 
ATOM   5685  C CG1  . VAL A 1 7  ? 0.210   7.818   8.125   1.00 2.34 ? 7  VAL A CG1  13 
ATOM   5686  C CG2  . VAL A 1 7  ? -1.271  9.833   8.047   1.00 2.04 ? 7  VAL A CG2  13 
ATOM   5687  H H    . VAL A 1 7  ? -1.185  6.103   10.196  1.00 2.35 ? 7  VAL A H    13 
ATOM   5688  H HA   . VAL A 1 7  ? -2.954  8.341   9.348   1.00 1.68 ? 7  VAL A HA   13 
ATOM   5689  H HB   . VAL A 1 7  ? -0.471  8.936   9.822   1.00 2.36 ? 7  VAL A HB   13 
ATOM   5690  H HG11 . VAL A 1 7  ? 0.240   6.805   8.499   1.00 1.98 ? 7  VAL A HG11 13 
ATOM   5691  H HG12 . VAL A 1 7  ? -0.019  7.806   7.070   1.00 2.82 ? 7  VAL A HG12 13 
ATOM   5692  H HG13 . VAL A 1 7  ? 1.171   8.286   8.279   1.00 2.89 ? 7  VAL A HG13 13 
ATOM   5693  H HG21 . VAL A 1 7  ? -2.329  10.016  8.165   1.00 2.20 ? 7  VAL A HG21 13 
ATOM   5694  H HG22 . VAL A 1 7  ? -0.716  10.694  8.389   1.00 2.25 ? 7  VAL A HG22 13 
ATOM   5695  H HG23 . VAL A 1 7  ? -1.049  9.652   7.006   1.00 2.17 ? 7  VAL A HG23 13 
HETATM 5696  N N    . SEP A 1 8  ? -2.700  7.406   6.800   1.00 1.50 ? 8  SEP A N    13 
HETATM 5697  C CA   . SEP A 1 8  ? -3.002  6.602   5.573   1.00 1.36 ? 8  SEP A CA   13 
HETATM 5698  C CB   . SEP A 1 8  ? -3.889  7.502   4.710   1.00 1.38 ? 8  SEP A CB   13 
HETATM 5699  O OG   . SEP A 1 8  ? -4.954  6.723   4.154   1.00 1.52 ? 8  SEP A OG   13 
HETATM 5700  C C    . SEP A 1 8  ? -1.707  6.257   4.827   1.00 1.25 ? 8  SEP A C    13 
HETATM 5701  O O    . SEP A 1 8  ? -1.517  5.130   4.421   1.00 1.23 ? 8  SEP A O    13 
HETATM 5702  P P    . SEP A 1 8  ? -5.942  7.358   3.053   1.00 1.38 ? 8  SEP A P    13 
HETATM 5703  O O1P  . SEP A 1 8  ? -6.740  8.419   3.706   1.00 1.96 ? 8  SEP A O1P  13 
HETATM 5704  O O2P  . SEP A 1 8  ? -5.149  7.669   1.844   1.00 1.76 ? 8  SEP A O2P  13 
HETATM 5705  O O3P  . SEP A 1 8  ? -6.922  6.128   2.710   1.00 2.02 ? 8  SEP A O3P  13 
HETATM 5706  H H    . SEP A 1 8  ? -2.728  8.381   6.766   1.00 1.62 ? 8  SEP A H    13 
HETATM 5707  H HA   . SEP A 1 8  ? -3.532  5.704   5.833   1.00 1.42 ? 8  SEP A HA   13 
HETATM 5708  H HB2  . SEP A 1 8  ? -3.296  7.937   3.916   1.00 1.33 ? 8  SEP A HB2  13 
HETATM 5709  H HB3  . SEP A 1 8  ? -4.305  8.289   5.316   1.00 1.50 ? 8  SEP A HB3  13 
HETATM 5710  H HOP3 . SEP A 1 8  ? -6.381  5.430   2.338   1.00 2.22 ? 8  SEP A HOP3 13 
ATOM   5711  N N    . SER A 1 9  ? -0.842  7.246   4.667   1.00 1.26 ? 9  SER A N    13 
ATOM   5712  C CA   . SER A 1 9  ? 0.489   7.114   3.955   1.00 1.20 ? 9  SER A CA   13 
ATOM   5713  C C    . SER A 1 9  ? 0.671   8.300   3.002   1.00 1.17 ? 9  SER A C    13 
ATOM   5714  O O    . SER A 1 9  ? -0.160  9.186   2.929   1.00 1.26 ? 9  SER A O    13 
ATOM   5715  C CB   . SER A 1 9  ? 0.484   5.822   3.129   1.00 1.05 ? 9  SER A CB   13 
ATOM   5716  O OG   . SER A 1 9  ? 0.912   4.739   3.946   1.00 1.21 ? 9  SER A OG   13 
ATOM   5717  H H    . SER A 1 9  ? -1.077  8.120   5.026   1.00 1.33 ? 9  SER A H    13 
ATOM   5718  H HA   . SER A 1 9  ? 1.295   7.090   4.672   1.00 1.34 ? 9  SER A HA   13 
ATOM   5719  H HB2  . SER A 1 9  ? -0.507  5.628   2.760   1.00 0.99 ? 9  SER A HB2  13 
ATOM   5720  H HB3  . SER A 1 9  ? 1.158   5.936   2.290   1.00 0.97 ? 9  SER A HB3  13 
ATOM   5721  H HG   . SER A 1 9  ? 0.141   4.399   4.412   1.00 1.30 ? 9  SER A HG   13 
ATOM   5722  N N    . TYR A 1 10 ? 1.756   8.316   2.279   1.00 1.13 ? 10 TYR A N    13 
ATOM   5723  C CA   . TYR A 1 10 ? 2.021   9.436   1.318   1.00 1.17 ? 10 TYR A CA   13 
ATOM   5724  C C    . TYR A 1 10 ? 0.973   9.468   0.185   1.00 1.06 ? 10 TYR A C    13 
ATOM   5725  O O    . TYR A 1 10 ? 0.021   8.709   0.183   1.00 0.97 ? 10 TYR A O    13 
ATOM   5726  C CB   . TYR A 1 10 ? 3.443   9.180   0.786   1.00 1.12 ? 10 TYR A CB   13 
ATOM   5727  C CG   . TYR A 1 10 ? 3.495   8.007   -0.178  1.00 0.84 ? 10 TYR A CG   13 
ATOM   5728  C CD1  . TYR A 1 10 ? 2.535   6.983   -0.140  1.00 0.69 ? 10 TYR A CD1  13 
ATOM   5729  C CD2  . TYR A 1 10 ? 4.536   7.948   -1.108  1.00 0.78 ? 10 TYR A CD2  13 
ATOM   5730  C CE1  . TYR A 1 10 ? 2.624   5.910   -1.033  1.00 0.50 ? 10 TYR A CE1  13 
ATOM   5731  C CE2  . TYR A 1 10 ? 4.622   6.877   -2.002  1.00 0.59 ? 10 TYR A CE2  13 
ATOM   5732  C CZ   . TYR A 1 10 ? 3.667   5.858   -1.964  1.00 0.47 ? 10 TYR A CZ   13 
ATOM   5733  O OH   . TYR A 1 10 ? 3.754   4.800   -2.844  1.00 0.51 ? 10 TYR A OH   13 
ATOM   5734  H H    . TYR A 1 10 ? 2.404   7.589   2.372   1.00 1.12 ? 10 TYR A H    13 
ATOM   5735  H HA   . TYR A 1 10 ? 2.006   10.375  1.847   1.00 1.37 ? 10 TYR A HA   13 
ATOM   5736  H HB2  . TYR A 1 10 ? 3.792   10.062  0.277   1.00 1.23 ? 10 TYR A HB2  13 
ATOM   5737  H HB3  . TYR A 1 10 ? 4.097   8.976   1.620   1.00 1.25 ? 10 TYR A HB3  13 
ATOM   5738  H HD1  . TYR A 1 10 ? 1.727   7.021   0.576   1.00 0.79 ? 10 TYR A HD1  13 
ATOM   5739  H HD2  . TYR A 1 10 ? 5.273   8.736   -1.138  1.00 0.93 ? 10 TYR A HD2  13 
ATOM   5740  H HE1  . TYR A 1 10 ? 1.886   5.124   -1.005  1.00 0.48 ? 10 TYR A HE1  13 
ATOM   5741  H HE2  . TYR A 1 10 ? 5.426   6.839   -2.721  1.00 0.62 ? 10 TYR A HE2  13 
ATOM   5742  H HH   . TYR A 1 10 ? 4.164   4.065   -2.384  1.00 1.03 ? 10 TYR A HH   13 
ATOM   5743  N N    . ARG A 1 11 ? 1.135   10.357  -0.767  1.00 1.14 ? 11 ARG A N    13 
ATOM   5744  C CA   . ARG A 1 11 ? 0.147   10.471  -1.892  1.00 1.16 ? 11 ARG A CA   13 
ATOM   5745  C C    . ARG A 1 11 ? 0.017   9.162   -2.682  1.00 0.94 ? 11 ARG A C    13 
ATOM   5746  O O    . ARG A 1 11 ? -1.030  8.860   -3.224  1.00 1.05 ? 11 ARG A O    13 
ATOM   5747  C CB   . ARG A 1 11 ? 0.699   11.582  -2.791  1.00 1.41 ? 11 ARG A CB   13 
ATOM   5748  C CG   . ARG A 1 11 ? 0.396   12.949  -2.167  1.00 1.69 ? 11 ARG A CG   13 
ATOM   5749  C CD   . ARG A 1 11 ? -0.144  13.899  -3.241  1.00 1.85 ? 11 ARG A CD   13 
ATOM   5750  N NE   . ARG A 1 11 ? 1.065   14.401  -3.958  1.00 1.83 ? 11 ARG A NE   13 
ATOM   5751  C CZ   . ARG A 1 11 ? 1.582   15.554  -3.643  1.00 2.01 ? 11 ARG A CZ   13 
ATOM   5752  N NH1  . ARG A 1 11 ? 1.004   16.654  -4.032  1.00 2.22 ? 11 ARG A NH1  13 
ATOM   5753  N NH2  . ARG A 1 11 ? 2.679   15.603  -2.943  1.00 2.08 ? 11 ARG A NH2  13 
ATOM   5754  H H    . ARG A 1 11 ? 1.905   10.966  -0.736  1.00 1.24 ? 11 ARG A H    13 
ATOM   5755  H HA   . ARG A 1 11 ? -0.810  10.759  -1.512  1.00 1.25 ? 11 ARG A HA   13 
ATOM   5756  H HB2  . ARG A 1 11 ? 1.768   11.463  -2.895  1.00 1.42 ? 11 ARG A HB2  13 
ATOM   5757  H HB3  . ARG A 1 11 ? 0.236   11.520  -3.761  1.00 1.45 ? 11 ARG A HB3  13 
ATOM   5758  H HG2  . ARG A 1 11 ? -0.341  12.833  -1.385  1.00 1.80 ? 11 ARG A HG2  13 
ATOM   5759  H HG3  . ARG A 1 11 ? 1.302   13.361  -1.748  1.00 1.79 ? 11 ARG A HG3  13 
ATOM   5760  H HD2  . ARG A 1 11 ? -0.794  13.363  -3.921  1.00 1.85 ? 11 ARG A HD2  13 
ATOM   5761  H HD3  . ARG A 1 11 ? -0.672  14.722  -2.784  1.00 2.08 ? 11 ARG A HD3  13 
ATOM   5762  H HE   . ARG A 1 11 ? 1.473   13.861  -4.666  1.00 1.80 ? 11 ARG A HE   13 
ATOM   5763  H HH11 . ARG A 1 11 ? 0.164   16.611  -4.571  1.00 2.25 ? 11 ARG A HH11 13 
ATOM   5764  H HH12 . ARG A 1 11 ? 1.399   17.539  -3.791  1.00 2.41 ? 11 ARG A HH12 13 
ATOM   5765  H HH21 . ARG A 1 11 ? 3.125   14.751  -2.648  1.00 1.98 ? 11 ARG A HH21 13 
ATOM   5766  H HH22 . ARG A 1 11 ? 3.078   16.485  -2.698  1.00 2.28 ? 11 ARG A HH22 13 
ATOM   5767  N N    . GLY A 1 12 ? 1.067   8.396   -2.762  1.00 0.74 ? 12 GLY A N    13 
ATOM   5768  C CA   . GLY A 1 12 ? 1.017   7.111   -3.529  1.00 0.61 ? 12 GLY A CA   13 
ATOM   5769  C C    . GLY A 1 12 ? 2.066   7.142   -4.643  1.00 0.67 ? 12 GLY A C    13 
ATOM   5770  O O    . GLY A 1 12 ? 1.969   6.431   -5.626  1.00 0.78 ? 12 GLY A O    13 
ATOM   5771  H H    . GLY A 1 12 ? 1.898   8.671   -2.324  1.00 0.77 ? 12 GLY A H    13 
ATOM   5772  H HA2  . GLY A 1 12 ? 1.221   6.286   -2.865  1.00 0.51 ? 12 GLY A HA2  13 
ATOM   5773  H HA3  . GLY A 1 12 ? 0.039   6.989   -3.966  1.00 0.72 ? 12 GLY A HA3  13 
ATOM   5774  N N    . ARG A 1 13 ? 3.066   7.971   -4.492  1.00 0.78 ? 13 ARG A N    13 
ATOM   5775  C CA   . ARG A 1 13 ? 4.133   8.084   -5.522  1.00 0.90 ? 13 ARG A CA   13 
ATOM   5776  C C    . ARG A 1 13 ? 5.166   6.953   -5.363  1.00 0.72 ? 13 ARG A C    13 
ATOM   5777  O O    . ARG A 1 13 ? 6.317   7.181   -5.033  1.00 0.74 ? 13 ARG A O    13 
ATOM   5778  C CB   . ARG A 1 13 ? 4.746   9.470   -5.265  1.00 1.12 ? 13 ARG A CB   13 
ATOM   5779  C CG   . ARG A 1 13 ? 5.385   9.528   -3.872  1.00 1.09 ? 13 ARG A CG   13 
ATOM   5780  C CD   . ARG A 1 13 ? 6.629   10.416  -3.918  1.00 1.42 ? 13 ARG A CD   13 
ATOM   5781  N NE   . ARG A 1 13 ? 6.241   11.646  -3.173  1.00 1.74 ? 13 ARG A NE   13 
ATOM   5782  C CZ   . ARG A 1 13 ? 7.024   12.128  -2.253  1.00 1.57 ? 13 ARG A CZ   13 
ATOM   5783  N NH1  . ARG A 1 13 ? 7.167   11.496  -1.124  1.00 2.12 ? 13 ARG A NH1  13 
ATOM   5784  N NH2  . ARG A 1 13 ? 7.660   13.242  -2.458  1.00 1.66 ? 13 ARG A NH2  13 
ATOM   5785  H H    . ARG A 1 13 ? 3.111   8.531   -3.697  1.00 0.88 ? 13 ARG A H    13 
ATOM   5786  H HA   . ARG A 1 13 ? 3.701   8.054   -6.507  1.00 1.06 ? 13 ARG A HA   13 
ATOM   5787  H HB2  . ARG A 1 13 ? 5.491   9.675   -6.007  1.00 1.32 ? 13 ARG A HB2  13 
ATOM   5788  H HB3  . ARG A 1 13 ? 3.966   10.216  -5.324  1.00 1.19 ? 13 ARG A HB3  13 
ATOM   5789  H HG2  . ARG A 1 13 ? 4.675   9.938   -3.167  1.00 1.22 ? 13 ARG A HG2  13 
ATOM   5790  H HG3  . ARG A 1 13 ? 5.667   8.536   -3.559  1.00 0.88 ? 13 ARG A HG3  13 
ATOM   5791  H HD2  . ARG A 1 13 ? 7.461   9.923   -3.432  1.00 1.47 ? 13 ARG A HD2  13 
ATOM   5792  H HD3  . ARG A 1 13 ? 6.880   10.664  -4.938  1.00 1.56 ? 13 ARG A HD3  13 
ATOM   5793  H HE   . ARG A 1 13 ? 5.389   12.092  -3.372  1.00 2.29 ? 13 ARG A HE   13 
ATOM   5794  H HH11 . ARG A 1 13 ? 6.673   10.642  -0.965  1.00 2.63 ? 13 ARG A HH11 13 
ATOM   5795  H HH12 . ARG A 1 13 ? 7.772   11.864  -0.418  1.00 2.35 ? 13 ARG A HH12 13 
ATOM   5796  H HH21 . ARG A 1 13 ? 7.548   13.729  -3.323  1.00 2.09 ? 13 ARG A HH21 13 
ATOM   5797  H HH22 . ARG A 1 13 ? 8.261   13.613  -1.747  1.00 1.79 ? 13 ARG A HH22 13 
ATOM   5798  N N    . LYS A 1 14 ? 4.752   5.733   -5.598  1.00 0.66 ? 14 LYS A N    13 
ATOM   5799  C CA   . LYS A 1 14 ? 5.684   4.562   -5.466  1.00 0.67 ? 14 LYS A CA   13 
ATOM   5800  C C    . LYS A 1 14 ? 6.745   4.556   -6.584  1.00 0.83 ? 14 LYS A C    13 
ATOM   5801  O O    . LYS A 1 14 ? 6.825   3.635   -7.377  1.00 1.02 ? 14 LYS A O    13 
ATOM   5802  C CB   . LYS A 1 14 ? 4.788   3.310   -5.545  1.00 0.81 ? 14 LYS A CB   13 
ATOM   5803  C CG   . LYS A 1 14 ? 3.841   3.374   -6.764  1.00 1.02 ? 14 LYS A CG   13 
ATOM   5804  C CD   . LYS A 1 14 ? 4.315   2.431   -7.883  1.00 1.19 ? 14 LYS A CD   13 
ATOM   5805  C CE   . LYS A 1 14 ? 4.766   1.083   -7.305  1.00 1.33 ? 14 LYS A CE   13 
ATOM   5806  N NZ   . LYS A 1 14 ? 6.253   1.075   -7.450  1.00 1.43 ? 14 LYS A NZ   13 
ATOM   5807  H H    . LYS A 1 14 ? 3.821   5.584   -5.854  1.00 0.72 ? 14 LYS A H    13 
ATOM   5808  H HA   . LYS A 1 14 ? 6.173   4.593   -4.503  1.00 0.58 ? 14 LYS A HA   13 
ATOM   5809  H HB2  . LYS A 1 14 ? 5.413   2.439   -5.622  1.00 0.94 ? 14 LYS A HB2  13 
ATOM   5810  H HB3  . LYS A 1 14 ? 4.198   3.242   -4.643  1.00 0.74 ? 14 LYS A HB3  13 
ATOM   5811  H HG2  . LYS A 1 14 ? 2.847   3.086   -6.456  1.00 1.14 ? 14 LYS A HG2  13 
ATOM   5812  H HG3  . LYS A 1 14 ? 3.814   4.382   -7.146  1.00 1.10 ? 14 LYS A HG3  13 
ATOM   5813  H HD2  . LYS A 1 14 ? 3.500   2.267   -8.573  1.00 1.36 ? 14 LYS A HD2  13 
ATOM   5814  H HD3  . LYS A 1 14 ? 5.137   2.888   -8.410  1.00 1.18 ? 14 LYS A HD3  13 
ATOM   5815  H HE2  . LYS A 1 14 ? 4.483   1.006   -6.263  1.00 1.30 ? 14 LYS A HE2  13 
ATOM   5816  H HE3  . LYS A 1 14 ? 4.335   0.270   -7.870  1.00 1.53 ? 14 LYS A HE3  13 
ATOM   5817  H HZ1  . LYS A 1 14 ? 6.623   2.047   -7.338  1.00 1.25 ? 14 LYS A HZ1  13 
ATOM   5818  H HZ2  . LYS A 1 14 ? 6.670   0.461   -6.722  1.00 1.62 ? 14 LYS A HZ2  13 
ATOM   5819  H HZ3  . LYS A 1 14 ? 6.508   0.719   -8.393  1.00 1.63 ? 14 LYS A HZ3  13 
ATOM   5820  N N    . SER A 1 15 ? 7.569   5.571   -6.639  1.00 0.83 ? 15 SER A N    13 
ATOM   5821  C CA   . SER A 1 15 ? 8.636   5.632   -7.691  1.00 1.00 ? 15 SER A CA   13 
ATOM   5822  C C    . SER A 1 15 ? 9.636   4.478   -7.516  1.00 0.97 ? 15 SER A C    13 
ATOM   5823  O O    . SER A 1 15 ? 9.960   4.088   -6.409  1.00 1.08 ? 15 SER A O    13 
ATOM   5824  C CB   . SER A 1 15 ? 9.333   6.978   -7.477  1.00 1.11 ? 15 SER A CB   13 
ATOM   5825  O OG   . SER A 1 15 ? 10.512  7.032   -8.273  1.00 1.29 ? 15 SER A OG   13 
ATOM   5826  H H    . SER A 1 15 ? 7.492   6.294   -5.979  1.00 0.78 ? 15 SER A H    13 
ATOM   5827  H HA   . SER A 1 15 ? 8.196   5.600   -8.675  1.00 1.20 ? 15 SER A HA   13 
ATOM   5828  H HB2  . SER A 1 15 ? 8.672   7.778   -7.767  1.00 1.30 ? 15 SER A HB2  13 
ATOM   5829  H HB3  . SER A 1 15 ? 9.587   7.087   -6.430  1.00 1.08 ? 15 SER A HB3  13 
ATOM   5830  H HG   . SER A 1 15 ? 11.268  6.884   -7.694  1.00 1.46 ? 15 SER A HG   13 
ATOM   5831  N N    . GLY A 1 16 ? 10.126  3.934   -8.603  1.00 1.16 ? 16 GLY A N    13 
ATOM   5832  C CA   . GLY A 1 16 ? 11.108  2.809   -8.511  1.00 1.31 ? 16 GLY A CA   13 
ATOM   5833  C C    . GLY A 1 16 ? 12.518  3.330   -8.799  1.00 1.26 ? 16 GLY A C    13 
ATOM   5834  O O    . GLY A 1 16 ? 13.193  2.852   -9.689  1.00 1.39 ? 16 GLY A O    13 
ATOM   5835  H H    . GLY A 1 16 ? 9.853   4.269   -9.483  1.00 1.37 ? 16 GLY A H    13 
ATOM   5836  H HA2  . GLY A 1 16 ? 11.076  2.384   -7.517  1.00 1.32 ? 16 GLY A HA2  13 
ATOM   5837  H HA3  . GLY A 1 16 ? 10.854  2.050   -9.234  1.00 1.54 ? 16 GLY A HA3  13 
ATOM   5838  N N    . ASN A 1 17 ? 12.964  4.309   -8.053  1.00 1.14 ? 17 ASN A N    13 
ATOM   5839  C CA   . ASN A 1 17 ? 14.338  4.868   -8.282  1.00 1.15 ? 17 ASN A CA   13 
ATOM   5840  C C    . ASN A 1 17 ? 15.386  4.091   -7.470  1.00 1.11 ? 17 ASN A C    13 
ATOM   5841  O O    . ASN A 1 17 ? 15.060  3.265   -6.637  1.00 1.07 ? 17 ASN A O    13 
ATOM   5842  C CB   . ASN A 1 17 ? 14.277  6.341   -7.844  1.00 1.16 ? 17 ASN A CB   13 
ATOM   5843  C CG   . ASN A 1 17 ? 13.633  6.468   -6.460  1.00 1.15 ? 17 ASN A CG   13 
ATOM   5844  O OD1  . ASN A 1 17 ? 12.427  6.392   -6.332  1.00 1.43 ? 17 ASN A OD1  13 
ATOM   5845  N ND2  . ASN A 1 17 ? 14.386  6.666   -5.418  1.00 1.27 ? 17 ASN A ND2  13 
ATOM   5846  H H    . ASN A 1 17 ? 12.397  4.675   -7.343  1.00 1.10 ? 17 ASN A H    13 
ATOM   5847  H HA   . ASN A 1 17 ? 14.581  4.815   -9.333  1.00 1.27 ? 17 ASN A HA   13 
ATOM   5848  H HB2  . ASN A 1 17 ? 15.278  6.742   -7.808  1.00 1.21 ? 17 ASN A HB2  13 
ATOM   5849  H HB3  . ASN A 1 17 ? 13.696  6.900   -8.560  1.00 1.24 ? 17 ASN A HB3  13 
ATOM   5850  H HD21 . ASN A 1 17 ? 15.356  6.732   -5.520  1.00 1.54 ? 17 ASN A HD21 13 
ATOM   5851  H HD22 . ASN A 1 17 ? 13.979  6.749   -4.532  1.00 1.33 ? 17 ASN A HD22 13 
ATOM   5852  N N    . LYS A 1 18 ? 16.646  4.340   -7.728  1.00 1.22 ? 18 LYS A N    13 
ATOM   5853  C CA   . LYS A 1 18 ? 17.734  3.607   -7.001  1.00 1.24 ? 18 LYS A CA   13 
ATOM   5854  C C    . LYS A 1 18 ? 17.936  4.119   -5.558  1.00 1.04 ? 18 LYS A C    13 
ATOM   5855  O O    . LYS A 1 18 ? 18.370  3.359   -4.711  1.00 1.02 ? 18 LYS A O    13 
ATOM   5856  C CB   . LYS A 1 18 ? 19.002  3.846   -7.830  1.00 1.48 ? 18 LYS A CB   13 
ATOM   5857  C CG   . LYS A 1 18 ? 19.498  2.518   -8.415  1.00 1.72 ? 18 LYS A CG   13 
ATOM   5858  C CD   . LYS A 1 18 ? 19.823  1.529   -7.287  1.00 1.70 ? 18 LYS A CD   13 
ATOM   5859  C CE   . LYS A 1 18 ? 20.979  2.067   -6.433  1.00 1.71 ? 18 LYS A CE   13 
ATOM   5860  N NZ   . LYS A 1 18 ? 20.533  1.888   -5.020  1.00 1.53 ? 18 LYS A NZ   13 
ATOM   5861  H H    . LYS A 1 18 ? 16.878  4.998   -8.416  1.00 1.34 ? 18 LYS A H    13 
ATOM   5862  H HA   . LYS A 1 18 ? 17.514  2.553   -6.984  1.00 1.32 ? 18 LYS A HA   13 
ATOM   5863  H HB2  . LYS A 1 18 ? 18.783  4.532   -8.634  1.00 1.56 ? 18 LYS A HB2  13 
ATOM   5864  H HB3  . LYS A 1 18 ? 19.770  4.267   -7.199  1.00 1.49 ? 18 LYS A HB3  13 
ATOM   5865  H HG2  . LYS A 1 18 ? 18.728  2.099   -9.049  1.00 1.81 ? 18 LYS A HG2  13 
ATOM   5866  H HG3  . LYS A 1 18 ? 20.387  2.696   -9.003  1.00 1.90 ? 18 LYS A HG3  13 
ATOM   5867  H HD2  . LYS A 1 18 ? 18.950  1.393   -6.665  1.00 1.54 ? 18 LYS A HD2  13 
ATOM   5868  H HD3  . LYS A 1 18 ? 20.109  0.580   -7.714  1.00 1.97 ? 18 LYS A HD3  13 
ATOM   5869  H HE2  . LYS A 1 18 ? 21.880  1.498   -6.622  1.00 1.95 ? 18 LYS A HE2  13 
ATOM   5870  H HE3  . LYS A 1 18 ? 21.145  3.114   -6.640  1.00 1.75 ? 18 LYS A HE3  13 
ATOM   5871  H HZ1  . LYS A 1 18 ? 19.646  2.419   -4.862  1.00 1.39 ? 18 LYS A HZ1  13 
ATOM   5872  H HZ2  . LYS A 1 18 ? 20.371  0.879   -4.831  1.00 1.65 ? 18 LYS A HZ2  13 
ATOM   5873  H HZ3  . LYS A 1 18 ? 21.267  2.244   -4.376  1.00 1.64 ? 18 LYS A HZ3  13 
ATOM   5874  N N    . PRO A 1 19 ? 17.631  5.381   -5.315  1.00 0.99 ? 19 PRO A N    13 
ATOM   5875  C CA   . PRO A 1 19 ? 17.825  5.893   -3.922  1.00 0.90 ? 19 PRO A CA   13 
ATOM   5876  C C    . PRO A 1 19 ? 16.474  6.164   -3.232  1.00 0.78 ? 19 PRO A C    13 
ATOM   5877  O O    . PRO A 1 19 ? 15.997  7.284   -3.224  1.00 0.93 ? 19 PRO A O    13 
ATOM   5878  C CB   . PRO A 1 19 ? 18.609  7.190   -4.108  1.00 1.14 ? 19 PRO A CB   13 
ATOM   5879  C CG   . PRO A 1 19 ? 18.277  7.646   -5.488  1.00 1.29 ? 19 PRO A CG   13 
ATOM   5880  C CD   . PRO A 1 19 ? 17.998  6.414   -6.304  1.00 1.21 ? 19 PRO A CD   13 
ATOM   5881  H HA   . PRO A 1 19 ? 18.408  5.196   -3.342  1.00 0.88 ? 19 PRO A HA   13 
ATOM   5882  H HB2  . PRO A 1 19 ? 18.295  7.926   -3.381  1.00 1.17 ? 19 PRO A HB2  13 
ATOM   5883  H HB3  . PRO A 1 19 ? 19.669  7.006   -4.026  1.00 1.24 ? 19 PRO A HB3  13 
ATOM   5884  H HG2  . PRO A 1 19 ? 17.403  8.283   -5.464  1.00 1.33 ? 19 PRO A HG2  13 
ATOM   5885  H HG3  . PRO A 1 19 ? 19.112  8.181   -5.911  1.00 1.50 ? 19 PRO A HG3  13 
ATOM   5886  H HD2  . PRO A 1 19 ? 17.180  6.595   -6.987  1.00 1.26 ? 19 PRO A HD2  13 
ATOM   5887  H HD3  . PRO A 1 19 ? 18.882  6.113   -6.844  1.00 1.36 ? 19 PRO A HD3  13 
ATOM   5888  N N    . PRO A 1 20 ? 15.905  5.125   -2.664  1.00 0.71 ? 20 PRO A N    13 
ATOM   5889  C CA   . PRO A 1 20 ? 14.599  5.315   -1.966  1.00 0.77 ? 20 PRO A CA   13 
ATOM   5890  C C    . PRO A 1 20 ? 14.832  5.795   -0.523  1.00 0.77 ? 20 PRO A C    13 
ATOM   5891  O O    . PRO A 1 20 ? 14.614  5.070   0.431   1.00 0.91 ? 20 PRO A O    13 
ATOM   5892  C CB   . PRO A 1 20 ? 13.957  3.929   -1.993  1.00 0.99 ? 20 PRO A CB   13 
ATOM   5893  C CG   . PRO A 1 20 ? 15.101  2.981   -2.108  1.00 1.04 ? 20 PRO A CG   13 
ATOM   5894  C CD   . PRO A 1 20 ? 16.181  3.693   -2.877  1.00 0.87 ? 20 PRO A CD   13 
ATOM   5895  H HA   . PRO A 1 20 ? 13.983  6.019   -2.502  1.00 0.81 ? 20 PRO A HA   13 
ATOM   5896  H HB2  . PRO A 1 20 ? 13.406  3.752   -1.078  1.00 1.10 ? 20 PRO A HB2  13 
ATOM   5897  H HB3  . PRO A 1 20 ? 13.309  3.832   -2.850  1.00 1.10 ? 20 PRO A HB3  13 
ATOM   5898  H HG2  . PRO A 1 20 ? 15.458  2.714   -1.122  1.00 1.13 ? 20 PRO A HG2  13 
ATOM   5899  H HG3  . PRO A 1 20 ? 14.796  2.096   -2.644  1.00 1.23 ? 20 PRO A HG3  13 
ATOM   5900  H HD2  . PRO A 1 20 ? 17.155  3.430   -2.486  1.00 0.94 ? 20 PRO A HD2  13 
ATOM   5901  H HD3  . PRO A 1 20 ? 16.115  3.455   -3.926  1.00 1.00 ? 20 PRO A HD3  13 
ATOM   5902  N N    . SER A 1 21 ? 15.278  7.015   -0.361  1.00 0.76 ? 21 SER A N    13 
ATOM   5903  C CA   . SER A 1 21 ? 15.532  7.552   1.012   1.00 0.89 ? 21 SER A CA   13 
ATOM   5904  C C    . SER A 1 21 ? 15.447  9.082   1.010   1.00 0.83 ? 21 SER A C    13 
ATOM   5905  O O    . SER A 1 21 ? 15.761  9.729   0.026   1.00 0.90 ? 21 SER A O    13 
ATOM   5906  C CB   . SER A 1 21 ? 16.948  7.097   1.365   1.00 1.03 ? 21 SER A CB   13 
ATOM   5907  O OG   . SER A 1 21 ? 17.238  7.467   2.707   1.00 1.67 ? 21 SER A OG   13 
ATOM   5908  H H    . SER A 1 21 ? 15.450  7.579   -1.146  1.00 0.77 ? 21 SER A H    13 
ATOM   5909  H HA   . SER A 1 21 ? 14.827  7.137   1.715   1.00 1.03 ? 21 SER A HA   13 
ATOM   5910  H HB2  . SER A 1 21 ? 17.018  6.025   1.267   1.00 1.46 ? 21 SER A HB2  13 
ATOM   5911  H HB3  . SER A 1 21 ? 17.654  7.564   0.690   1.00 0.96 ? 21 SER A HB3  13 
ATOM   5912  H HG   . SER A 1 21 ? 17.676  6.725   3.133   1.00 2.11 ? 21 SER A HG   13 
ATOM   5913  N N    . LYS A 1 22 ? 15.034  9.668   2.106   1.00 0.91 ? 22 LYS A N    13 
ATOM   5914  C CA   . LYS A 1 22 ? 14.932  11.161  2.174   1.00 0.99 ? 22 LYS A CA   13 
ATOM   5915  C C    . LYS A 1 22 ? 16.324  11.775  2.389   1.00 1.18 ? 22 LYS A C    13 
ATOM   5916  O O    . LYS A 1 22 ? 16.586  12.424  3.386   1.00 1.52 ? 22 LYS A O    13 
ATOM   5917  C CB   . LYS A 1 22 ? 14.011  11.444  3.368   1.00 1.38 ? 22 LYS A CB   13 
ATOM   5918  C CG   . LYS A 1 22 ? 13.357  12.819  3.202   1.00 1.45 ? 22 LYS A CG   13 
ATOM   5919  C CD   . LYS A 1 22 ? 13.842  13.758  4.312   1.00 1.84 ? 22 LYS A CD   13 
ATOM   5920  C CE   . LYS A 1 22 ? 14.485  15.003  3.691   1.00 1.82 ? 22 LYS A CE   13 
ATOM   5921  N NZ   . LYS A 1 22 ? 15.951  14.856  3.935   1.00 1.85 ? 22 LYS A NZ   13 
ATOM   5922  H H    . LYS A 1 22 ? 14.795  9.127   2.886   1.00 1.04 ? 22 LYS A H    13 
ATOM   5923  H HA   . LYS A 1 22 ? 14.491  11.546  1.269   1.00 0.88 ? 22 LYS A HA   13 
ATOM   5924  H HB2  . LYS A 1 22 ? 13.243  10.684  3.417   1.00 1.53 ? 22 LYS A HB2  13 
ATOM   5925  H HB3  . LYS A 1 22 ? 14.590  11.429  4.280   1.00 1.63 ? 22 LYS A HB3  13 
ATOM   5926  H HG2  . LYS A 1 22 ? 13.623  13.230  2.238   1.00 1.24 ? 22 LYS A HG2  13 
ATOM   5927  H HG3  . LYS A 1 22 ? 12.284  12.716  3.264   1.00 1.66 ? 22 LYS A HG3  13 
ATOM   5928  H HD2  . LYS A 1 22 ? 13.001  14.056  4.923   1.00 2.13 ? 22 LYS A HD2  13 
ATOM   5929  H HD3  . LYS A 1 22 ? 14.569  13.248  4.926   1.00 2.01 ? 22 LYS A HD3  13 
ATOM   5930  H HE2  . LYS A 1 22 ? 14.281  15.038  2.628   1.00 1.63 ? 22 LYS A HE2  13 
ATOM   5931  H HE3  . LYS A 1 22 ? 14.117  15.897  4.173   1.00 2.19 ? 22 LYS A HE3  13 
ATOM   5932  H HZ1  . LYS A 1 22 ? 16.228  13.852  3.830   1.00 1.70 ? 22 LYS A HZ1  13 
ATOM   5933  H HZ2  . LYS A 1 22 ? 16.478  15.435  3.242   1.00 1.79 ? 22 LYS A HZ2  13 
ATOM   5934  H HZ3  . LYS A 1 22 ? 16.178  15.180  4.896   1.00 2.26 ? 22 LYS A HZ3  13 
ATOM   5935  N N    . THR A 1 23 ? 17.216  11.573  1.452   1.00 1.17 ? 23 THR A N    13 
ATOM   5936  C CA   . THR A 1 23 ? 18.599  12.138  1.584   1.00 1.58 ? 23 THR A CA   13 
ATOM   5937  C C    . THR A 1 23 ? 18.683  13.560  0.997   1.00 1.74 ? 23 THR A C    13 
ATOM   5938  O O    . THR A 1 23 ? 19.709  14.206  1.085   1.00 2.07 ? 23 THR A O    13 
ATOM   5939  C CB   . THR A 1 23 ? 19.504  11.174  0.803   1.00 1.70 ? 23 THR A CB   13 
ATOM   5940  O OG1  . THR A 1 23 ? 20.866  11.460  1.096   1.00 2.16 ? 23 THR A OG1  13 
ATOM   5941  C CG2  . THR A 1 23 ? 19.267  11.323  -0.704  1.00 1.73 ? 23 THR A CG2  13 
ATOM   5942  H H    . THR A 1 23 ? 16.974  11.047  0.659   1.00 1.02 ? 23 THR A H    13 
ATOM   5943  H HA   . THR A 1 23 ? 18.896  12.150  2.621   1.00 1.78 ? 23 THR A HA   13 
ATOM   5944  H HB   . THR A 1 23 ? 19.283  10.158  1.096   1.00 1.55 ? 23 THR A HB   13 
ATOM   5945  H HG1  . THR A 1 23 ? 21.033  12.382  0.878   1.00 2.29 ? 23 THR A HG1  13 
ATOM   5946  H HG21 . THR A 1 23 ? 18.233  11.576  -0.884  1.00 1.91 ? 23 THR A HG21 13 
ATOM   5947  H HG22 . THR A 1 23 ? 19.902  12.107  -1.091  1.00 2.19 ? 23 THR A HG22 13 
ATOM   5948  H HG23 . THR A 1 23 ? 19.502  10.393  -1.199  1.00 1.96 ? 23 THR A HG23 13 
ATOM   5949  N N    . CYS A 1 24 ? 17.622  14.052  0.402   1.00 1.58 ? 24 CYS A N    13 
ATOM   5950  C CA   . CYS A 1 24 ? 17.657  15.430  -0.183  1.00 1.78 ? 24 CYS A CA   13 
ATOM   5951  C C    . CYS A 1 24 ? 17.365  16.482  0.898   1.00 1.85 ? 24 CYS A C    13 
ATOM   5952  O O    . CYS A 1 24 ? 16.992  16.158  2.011   1.00 1.81 ? 24 CYS A O    13 
ATOM   5953  C CB   . CYS A 1 24 ? 16.564  15.435  -1.259  1.00 1.70 ? 24 CYS A CB   13 
ATOM   5954  S SG   . CYS A 1 24 ? 14.931  15.328  -0.480  1.00 2.66 ? 24 CYS A SG   13 
ATOM   5955  H H    . CYS A 1 24 ? 16.805  13.519  0.339   1.00 1.40 ? 24 CYS A H    13 
ATOM   5956  H HA   . CYS A 1 24 ? 18.617  15.617  -0.637  1.00 1.95 ? 24 CYS A HA   13 
ATOM   5957  H HB2  . CYS A 1 24 ? 16.629  16.349  -1.831  1.00 1.93 ? 24 CYS A HB2  13 
ATOM   5958  H HB3  . CYS A 1 24 ? 16.703  14.589  -1.917  1.00 1.64 ? 24 CYS A HB3  13 
ATOM   5959  H HG   . CYS A 1 24 ? 14.757  14.405  -0.281  1.00 2.98 ? 24 CYS A HG   13 
ATOM   5960  N N    . LEU A 1 25 ? 17.527  17.742  0.576   1.00 2.05 ? 25 LEU A N    13 
ATOM   5961  C CA   . LEU A 1 25 ? 17.257  18.819  1.582   1.00 2.16 ? 25 LEU A CA   13 
ATOM   5962  C C    . LEU A 1 25 ? 15.811  19.324  1.448   1.00 1.96 ? 25 LEU A C    13 
ATOM   5963  O O    . LEU A 1 25 ? 15.556  20.514  1.430   1.00 2.14 ? 25 LEU A O    13 
ATOM   5964  C CB   . LEU A 1 25 ? 18.259  19.931  1.252   1.00 2.53 ? 25 LEU A CB   13 
ATOM   5965  C CG   . LEU A 1 25 ? 19.660  19.514  1.710   1.00 2.80 ? 25 LEU A CG   13 
ATOM   5966  C CD1  . LEU A 1 25 ? 20.688  19.931  0.657   1.00 3.18 ? 25 LEU A CD1  13 
ATOM   5967  C CD2  . LEU A 1 25 ? 19.988  20.203  3.036   1.00 3.10 ? 25 LEU A CD2  13 
ATOM   5968  H H    . LEU A 1 25 ? 17.825  17.980  -0.327  1.00 2.19 ? 25 LEU A H    13 
ATOM   5969  H HA   . LEU A 1 25 ? 17.432  18.451  2.580   1.00 2.17 ? 25 LEU A HA   13 
ATOM   5970  H HB2  . LEU A 1 25 ? 18.265  20.105  0.185   1.00 2.60 ? 25 LEU A HB2  13 
ATOM   5971  H HB3  . LEU A 1 25 ? 17.970  20.838  1.762   1.00 2.62 ? 25 LEU A HB3  13 
ATOM   5972  H HG   . LEU A 1 25 ? 19.693  18.443  1.841   1.00 2.69 ? 25 LEU A HG   13 
ATOM   5973  H HD11 . LEU A 1 25 ? 20.455  20.922  0.297   1.00 3.56 ? 25 LEU A HD11 13 
ATOM   5974  H HD12 . LEU A 1 25 ? 21.674  19.930  1.096   1.00 3.25 ? 25 LEU A HD12 13 
ATOM   5975  H HD13 . LEU A 1 25 ? 20.661  19.234  -0.168  1.00 3.47 ? 25 LEU A HD13 13 
ATOM   5976  H HD21 . LEU A 1 25 ? 19.227  19.963  3.764   1.00 3.38 ? 25 LEU A HD21 13 
ATOM   5977  H HD22 . LEU A 1 25 ? 20.947  19.859  3.392   1.00 3.41 ? 25 LEU A HD22 13 
ATOM   5978  H HD23 . LEU A 1 25 ? 20.021  21.273  2.888   1.00 3.26 ? 25 LEU A HD23 13 
ATOM   5979  N N    . LYS A 1 26 ? 14.867  18.421  1.355   1.00 1.65 ? 26 LYS A N    13 
ATOM   5980  C CA   . LYS A 1 26 ? 13.433  18.822  1.222   1.00 1.51 ? 26 LYS A CA   13 
ATOM   5981  C C    . LYS A 1 26 ? 12.542  17.875  2.033   1.00 1.25 ? 26 LYS A C    13 
ATOM   5982  O O    . LYS A 1 26 ? 12.797  16.688  2.113   1.00 1.11 ? 26 LYS A O    13 
ATOM   5983  C CB   . LYS A 1 26 ? 13.118  18.686  -0.270  1.00 1.52 ? 26 LYS A CB   13 
ATOM   5984  C CG   . LYS A 1 26 ? 13.719  19.864  -1.040  1.00 1.90 ? 26 LYS A CG   13 
ATOM   5985  C CD   . LYS A 1 26 ? 14.946  19.396  -1.833  1.00 2.00 ? 26 LYS A CD   13 
ATOM   5986  C CE   . LYS A 1 26 ? 14.535  18.355  -2.887  1.00 1.87 ? 26 LYS A CE   13 
ATOM   5987  N NZ   . LYS A 1 26 ? 13.528  19.034  -3.759  1.00 2.10 ? 26 LYS A NZ   13 
ATOM   5988  H H    . LYS A 1 26 ? 15.100  17.473  1.372   1.00 1.56 ? 26 LYS A H    13 
ATOM   5989  H HA   . LYS A 1 26 ? 13.291  19.844  1.539   1.00 1.70 ? 26 LYS A HA   13 
ATOM   5990  H HB2  . LYS A 1 26 ? 13.536  17.761  -0.640  1.00 1.39 ? 26 LYS A HB2  13 
ATOM   5991  H HB3  . LYS A 1 26 ? 12.047  18.677  -0.412  1.00 1.51 ? 26 LYS A HB3  13 
ATOM   5992  H HG2  . LYS A 1 26 ? 12.980  20.264  -1.719  1.00 2.02 ? 26 LYS A HG2  13 
ATOM   5993  H HG3  . LYS A 1 26 ? 14.018  20.634  -0.344  1.00 2.05 ? 26 LYS A HG3  13 
ATOM   5994  H HD2  . LYS A 1 26 ? 15.401  20.243  -2.324  1.00 2.33 ? 26 LYS A HD2  13 
ATOM   5995  H HD3  . LYS A 1 26 ? 15.660  18.950  -1.156  1.00 1.92 ? 26 LYS A HD3  13 
ATOM   5996  H HE2  . LYS A 1 26 ? 15.396  18.056  -3.470  1.00 2.01 ? 26 LYS A HE2  13 
ATOM   5997  H HE3  . LYS A 1 26 ? 14.089  17.496  -2.411  1.00 1.60 ? 26 LYS A HE3  13 
ATOM   5998  H HZ1  . LYS A 1 26 ? 13.701  20.061  -3.765  1.00 2.27 ? 26 LYS A HZ1  13 
ATOM   5999  H HZ2  . LYS A 1 26 ? 13.601  18.666  -4.727  1.00 2.29 ? 26 LYS A HZ2  13 
ATOM   6000  H HZ3  . LYS A 1 26 ? 12.564  18.845  -3.391  1.00 1.99 ? 26 LYS A HZ3  13 
ATOM   6001  N N    . GLU A 1 27 ? 11.495  18.388  2.621   1.00 1.31 ? 27 GLU A N    13 
ATOM   6002  C CA   . GLU A 1 27 ? 10.575  17.516  3.420   1.00 1.30 ? 27 GLU A CA   13 
ATOM   6003  C C    . GLU A 1 27 ? 9.404   17.032  2.547   1.00 1.08 ? 27 GLU A C    13 
ATOM   6004  O O    . GLU A 1 27 ? 8.272   16.955  2.992   1.00 1.16 ? 27 GLU A O    13 
ATOM   6005  C CB   . GLU A 1 27 ? 10.076  18.401  4.575   1.00 1.60 ? 27 GLU A CB   13 
ATOM   6006  C CG   . GLU A 1 27 ? 9.311   19.615  4.025   1.00 1.53 ? 27 GLU A CG   13 
ATOM   6007  C CD   . GLU A 1 27 ? 10.191  20.863  4.118   1.00 1.79 ? 27 GLU A CD   13 
ATOM   6008  O OE1  . GLU A 1 27 ? 10.160  21.511  5.150   1.00 2.08 ? 27 GLU A OE1  13 
ATOM   6009  O OE2  . GLU A 1 27 ? 10.884  21.146  3.153   1.00 1.81 ? 27 GLU A OE2  13 
ATOM   6010  H H    . GLU A 1 27 ? 11.310  19.347  2.531   1.00 1.45 ? 27 GLU A H    13 
ATOM   6011  H HA   . GLU A 1 27 ? 11.115  16.671  3.818   1.00 1.39 ? 27 GLU A HA   13 
ATOM   6012  H HB2  . GLU A 1 27 ? 9.420   17.823  5.210   1.00 1.72 ? 27 GLU A HB2  13 
ATOM   6013  H HB3  . GLU A 1 27 ? 10.921  18.744  5.152   1.00 1.85 ? 27 GLU A HB3  13 
ATOM   6014  H HG2  . GLU A 1 27 ? 9.046   19.438  2.993   1.00 1.30 ? 27 GLU A HG2  13 
ATOM   6015  H HG3  . GLU A 1 27 ? 8.414   19.768  4.604   1.00 1.64 ? 27 GLU A HG3  13 
ATOM   6016  N N    . GLU A 1 28 ? 9.670   16.700  1.305   1.00 0.94 ? 28 GLU A N    13 
ATOM   6017  C CA   . GLU A 1 28 ? 8.583   16.221  0.394   1.00 0.98 ? 28 GLU A CA   13 
ATOM   6018  C C    . GLU A 1 28 ? 8.205   14.768  0.724   1.00 1.15 ? 28 GLU A C    13 
ATOM   6019  O O    . GLU A 1 28 ? 8.508   13.849  -0.020  1.00 1.43 ? 28 GLU A O    13 
ATOM   6020  C CB   . GLU A 1 28 ? 9.174   16.326  -1.017  1.00 1.11 ? 28 GLU A CB   13 
ATOM   6021  C CG   . GLU A 1 28 ? 9.451   17.796  -1.350  1.00 1.24 ? 28 GLU A CG   13 
ATOM   6022  C CD   . GLU A 1 28 ? 10.015  17.910  -2.768  1.00 1.64 ? 28 GLU A CD   13 
ATOM   6023  O OE1  . GLU A 1 28 ? 9.301   17.581  -3.701  1.00 2.01 ? 28 GLU A OE1  13 
ATOM   6024  O OE2  . GLU A 1 28 ? 11.155  18.329  -2.896  1.00 1.82 ? 28 GLU A OE2  13 
ATOM   6025  H H    . GLU A 1 28 ? 10.587  16.768  0.970   1.00 0.96 ? 28 GLU A H    13 
ATOM   6026  H HA   . GLU A 1 28 ? 7.718   16.860  0.477   1.00 1.03 ? 28 GLU A HA   13 
ATOM   6027  H HB2  . GLU A 1 28 ? 10.097  15.764  -1.063  1.00 1.11 ? 28 GLU A HB2  13 
ATOM   6028  H HB3  . GLU A 1 28 ? 8.472   15.923  -1.732  1.00 1.36 ? 28 GLU A HB3  13 
ATOM   6029  H HG2  . GLU A 1 28 ? 8.532   18.357  -1.282  1.00 1.27 ? 28 GLU A HG2  13 
ATOM   6030  H HG3  . GLU A 1 28 ? 10.167  18.194  -0.648  1.00 1.25 ? 28 GLU A HG3  13 
ATOM   6031  N N    . MET A 1 29 ? 7.539   14.557  1.831   1.00 1.16 ? 29 MET A N    13 
ATOM   6032  C CA   . MET A 1 29 ? 7.132   13.170  2.216   1.00 1.50 ? 29 MET A CA   13 
ATOM   6033  C C    . MET A 1 29 ? 5.675   12.905  1.799   1.00 1.63 ? 29 MET A C    13 
ATOM   6034  O O    . MET A 1 29 ? 4.904   12.321  2.538   1.00 1.87 ? 29 MET A O    13 
ATOM   6035  C CB   . MET A 1 29 ? 7.281   13.125  3.741   1.00 1.62 ? 29 MET A CB   13 
ATOM   6036  C CG   . MET A 1 29 ? 7.356   11.668  4.210   1.00 1.99 ? 29 MET A CG   13 
ATOM   6037  S SD   . MET A 1 29 ? 8.984   11.349  4.934   1.00 3.00 ? 29 MET A SD   13 
ATOM   6038  C CE   . MET A 1 29 ? 8.489   11.470  6.670   1.00 3.44 ? 29 MET A CE   13 
ATOM   6039  H H    . MET A 1 29 ? 7.304   15.314  2.411   1.00 1.06 ? 29 MET A H    13 
ATOM   6040  H HA   . MET A 1 29 ? 7.789   12.446  1.762   1.00 1.69 ? 29 MET A HA   13 
ATOM   6041  H HB2  . MET A 1 29 ? 8.185   13.643  4.029   1.00 1.60 ? 29 MET A HB2  13 
ATOM   6042  H HB3  . MET A 1 29 ? 6.430   13.606  4.200   1.00 1.71 ? 29 MET A HB3  13 
ATOM   6043  H HG2  . MET A 1 29 ? 6.592   11.490  4.951   1.00 2.26 ? 29 MET A HG2  13 
ATOM   6044  H HG3  . MET A 1 29 ? 7.201   11.009  3.368   1.00 2.09 ? 29 MET A HG3  13 
ATOM   6045  H HE1  . MET A 1 29 ? 7.691   10.766  6.866   1.00 3.61 ? 29 MET A HE1  13 
ATOM   6046  H HE2  . MET A 1 29 ? 9.331   11.241  7.303   1.00 3.79 ? 29 MET A HE2  13 
ATOM   6047  H HE3  . MET A 1 29 ? 8.148   12.475  6.877   1.00 3.80 ? 29 MET A HE3  13 
ATOM   6048  N N    . ALA A 1 30 ? 5.294   13.328  0.617   1.00 1.56 ? 30 ALA A N    13 
ATOM   6049  C CA   . ALA A 1 30 ? 3.892   13.103  0.149   1.00 1.75 ? 30 ALA A CA   13 
ATOM   6050  C C    . ALA A 1 30 ? 3.888   12.613  -1.307  1.00 1.62 ? 30 ALA A C    13 
ATOM   6051  O O    . ALA A 1 30 ? 4.104   13.424  -2.196  1.00 1.69 ? 30 ALA A O    13 
ATOM   6052  C CB   . ALA A 1 30 ? 3.211   14.469  0.275   1.00 2.00 ? 30 ALA A CB   13 
ATOM   6053  O OXT  . ALA A 1 30 ? 3.672   11.431  -1.509  1.00 1.59 ? 30 ALA A OXT  13 
ATOM   6054  H H    . ALA A 1 30 ? 5.929   13.795  0.036   1.00 1.45 ? 30 ALA A H    13 
ATOM   6055  H HA   . ALA A 1 30 ? 3.395   12.387  0.785   1.00 1.91 ? 30 ALA A HA   13 
ATOM   6056  H HB1  . ALA A 1 30 ? 3.758   15.199  -0.305  1.00 2.13 ? 30 ALA A HB1  13 
ATOM   6057  H HB2  . ALA A 1 30 ? 2.198   14.402  -0.094  1.00 2.57 ? 30 ALA A HB2  13 
ATOM   6058  H HB3  . ALA A 1 30 ? 3.198   14.772  1.312   1.00 2.19 ? 30 ALA A HB3  13 
ATOM   6059  N N    . MET A 1 1  ? -10.256 -1.923  11.856  1.00 3.37 ? 1  MET A N    14 
ATOM   6060  C CA   . MET A 1 1  ? -9.445  -0.887  11.143  1.00 2.29 ? 1  MET A CA   14 
ATOM   6061  C C    . MET A 1 1  ? -8.678  -0.021  12.154  1.00 2.12 ? 1  MET A C    14 
ATOM   6062  O O    . MET A 1 1  ? -7.465  -0.068  12.211  1.00 2.33 ? 1  MET A O    14 
ATOM   6063  C CB   . MET A 1 1  ? -10.460 -0.041  10.361  1.00 2.69 ? 1  MET A CB   14 
ATOM   6064  C CG   . MET A 1 1  ? -10.705 -0.669  8.985   1.00 2.53 ? 1  MET A CG   14 
ATOM   6065  S SD   . MET A 1 1  ? -12.135 -1.774  9.071   1.00 2.80 ? 1  MET A SD   14 
ATOM   6066  C CE   . MET A 1 1  ? -12.099 -2.328  7.349   1.00 2.97 ? 1  MET A CE   14 
ATOM   6067  H H1   . MET A 1 1  ? -9.646  -2.449  12.515  1.00 3.82 ? 1  MET A H1   14 
ATOM   6068  H H2   . MET A 1 1  ? -11.024 -1.463  12.387  1.00 3.76 ? 1  MET A H2   14 
ATOM   6069  H H3   . MET A 1 1  ? -10.661 -2.584  11.163  1.00 3.71 ? 1  MET A H3   14 
ATOM   6070  H HA   . MET A 1 1  ? -8.756  -1.357  10.459  1.00 2.01 ? 1  MET A HA   14 
ATOM   6071  H HB2  . MET A 1 1  ? -11.391 0.002   10.908  1.00 3.46 ? 1  MET A HB2  14 
ATOM   6072  H HB3  . MET A 1 1  ? -10.072 0.959   10.233  1.00 2.93 ? 1  MET A HB3  14 
ATOM   6073  H HG2  . MET A 1 1  ? -10.896 0.112   8.264   1.00 3.19 ? 1  MET A HG2  14 
ATOM   6074  H HG3  . MET A 1 1  ? -9.832  -1.231  8.684   1.00 2.27 ? 1  MET A HG3  14 
ATOM   6075  H HE1  . MET A 1 1  ? -11.137 -2.761  7.129   1.00 3.29 ? 1  MET A HE1  14 
ATOM   6076  H HE2  . MET A 1 1  ? -12.871 -3.071  7.195   1.00 3.31 ? 1  MET A HE2  14 
ATOM   6077  H HE3  . MET A 1 1  ? -12.269 -1.482  6.696   1.00 3.21 ? 1  MET A HE3  14 
ATOM   6078  N N    . ILE A 1 2  ? -9.384  0.762   12.949  1.00 1.93 ? 2  ILE A N    14 
ATOM   6079  C CA   . ILE A 1 2  ? -8.722  1.647   13.974  1.00 1.93 ? 2  ILE A CA   14 
ATOM   6080  C C    . ILE A 1 2  ? -7.863  2.730   13.296  1.00 1.55 ? 2  ILE A C    14 
ATOM   6081  O O    . ILE A 1 2  ? -7.452  2.596   12.159  1.00 1.64 ? 2  ILE A O    14 
ATOM   6082  C CB   . ILE A 1 2  ? -7.852  0.718   14.841  1.00 2.47 ? 2  ILE A CB   14 
ATOM   6083  C CG1  . ILE A 1 2  ? -8.721  -0.394  15.445  1.00 2.91 ? 2  ILE A CG1  14 
ATOM   6084  C CG2  . ILE A 1 2  ? -7.211  1.521   15.976  1.00 2.62 ? 2  ILE A CG2  14 
ATOM   6085  C CD1  . ILE A 1 2  ? -8.079  -1.754  15.164  1.00 3.44 ? 2  ILE A CD1  14 
ATOM   6086  H H    . ILE A 1 2  ? -10.360 0.768   12.872  1.00 1.94 ? 2  ILE A H    14 
ATOM   6087  H HA   . ILE A 1 2  ? -9.474  2.113   14.593  1.00 2.03 ? 2  ILE A HA   14 
ATOM   6088  H HB   . ILE A 1 2  ? -7.075  0.279   14.232  1.00 2.62 ? 2  ILE A HB   14 
ATOM   6089  H HG12 . ILE A 1 2  ? -8.801  -0.247  16.513  1.00 3.12 ? 2  ILE A HG12 14 
ATOM   6090  H HG13 . ILE A 1 2  ? -9.705  -0.365  15.004  1.00 2.85 ? 2  ILE A HG13 14 
ATOM   6091  H HG21 . ILE A 1 2  ? -7.965  2.115   16.469  1.00 3.01 ? 2  ILE A HG21 14 
ATOM   6092  H HG22 . ILE A 1 2  ? -6.764  0.843   16.688  1.00 2.91 ? 2  ILE A HG22 14 
ATOM   6093  H HG23 . ILE A 1 2  ? -6.447  2.171   15.571  1.00 2.57 ? 2  ILE A HG23 14 
ATOM   6094  H HD11 . ILE A 1 2  ? -7.673  -1.763  14.165  1.00 3.75 ? 2  ILE A HD11 14 
ATOM   6095  H HD12 . ILE A 1 2  ? -7.286  -1.932  15.876  1.00 3.90 ? 2  ILE A HD12 14 
ATOM   6096  H HD13 . ILE A 1 2  ? -8.826  -2.530  15.257  1.00 3.51 ? 2  ILE A HD13 14 
ATOM   6097  N N    . SER A 1 3  ? -7.595  3.808   13.992  1.00 1.32 ? 3  SER A N    14 
ATOM   6098  C CA   . SER A 1 3  ? -6.766  4.906   13.401  1.00 1.08 ? 3  SER A CA   14 
ATOM   6099  C C    . SER A 1 3  ? -6.104  5.738   14.513  1.00 1.03 ? 3  SER A C    14 
ATOM   6100  O O    . SER A 1 3  ? -5.906  5.260   15.614  1.00 1.18 ? 3  SER A O    14 
ATOM   6101  C CB   . SER A 1 3  ? -7.750  5.757   12.594  1.00 1.30 ? 3  SER A CB   14 
ATOM   6102  O OG   . SER A 1 3  ? -7.022  6.686   11.797  1.00 1.40 ? 3  SER A OG   14 
ATOM   6103  H H    . SER A 1 3  ? -7.939  3.897   14.906  1.00 1.48 ? 3  SER A H    14 
ATOM   6104  H HA   . SER A 1 3  ? -6.014  4.495   12.744  1.00 1.15 ? 3  SER A HA   14 
ATOM   6105  H HB2  . SER A 1 3  ? -8.338  5.121   11.953  1.00 1.47 ? 3  SER A HB2  14 
ATOM   6106  H HB3  . SER A 1 3  ? -8.407  6.286   13.272  1.00 1.49 ? 3  SER A HB3  14 
ATOM   6107  H HG   . SER A 1 3  ? -6.981  6.342   10.900  1.00 1.76 ? 3  SER A HG   14 
ATOM   6108  N N    . SER A 1 4  ? -5.756  6.977   14.225  1.00 1.01 ? 4  SER A N    14 
ATOM   6109  C CA   . SER A 1 4  ? -5.098  7.869   15.247  1.00 1.16 ? 4  SER A CA   14 
ATOM   6110  C C    . SER A 1 4  ? -3.668  7.404   15.580  1.00 1.15 ? 4  SER A C    14 
ATOM   6111  O O    . SER A 1 4  ? -2.992  8.004   16.393  1.00 1.38 ? 4  SER A O    14 
ATOM   6112  C CB   . SER A 1 4  ? -5.985  7.799   16.491  1.00 1.41 ? 4  SER A CB   14 
ATOM   6113  O OG   . SER A 1 4  ? -6.193  9.113   16.995  1.00 1.69 ? 4  SER A OG   14 
ATOM   6114  H H    . SER A 1 4  ? -5.927  7.327   13.323  1.00 1.04 ? 4  SER A H    14 
ATOM   6115  H HA   . SER A 1 4  ? -5.072  8.882   14.883  1.00 1.25 ? 4  SER A HA   14 
ATOM   6116  H HB2  . SER A 1 4  ? -6.934  7.363   16.233  1.00 1.40 ? 4  SER A HB2  14 
ATOM   6117  H HB3  . SER A 1 4  ? -5.503  7.185   17.242  1.00 1.51 ? 4  SER A HB3  14 
ATOM   6118  H HG   . SER A 1 4  ? -5.455  9.333   17.569  1.00 2.10 ? 4  SER A HG   14 
ATOM   6119  N N    . VAL A 1 5  ? -3.203  6.349   14.959  1.00 1.07 ? 5  VAL A N    14 
ATOM   6120  C CA   . VAL A 1 5  ? -1.818  5.851   15.236  1.00 1.30 ? 5  VAL A CA   14 
ATOM   6121  C C    . VAL A 1 5  ? -0.880  6.240   14.087  1.00 1.22 ? 5  VAL A C    14 
ATOM   6122  O O    . VAL A 1 5  ? 0.227   6.694   14.303  1.00 1.46 ? 5  VAL A O    14 
ATOM   6123  C CB   . VAL A 1 5  ? -1.955  4.327   15.337  1.00 1.47 ? 5  VAL A CB   14 
ATOM   6124  C CG1  . VAL A 1 5  ? -0.576  3.698   15.547  1.00 1.89 ? 5  VAL A CG1  14 
ATOM   6125  C CG2  . VAL A 1 5  ? -2.858  3.971   16.521  1.00 1.66 ? 5  VAL A CG2  14 
ATOM   6126  H H    . VAL A 1 5  ? -3.761  5.885   14.309  1.00 0.98 ? 5  VAL A H    14 
ATOM   6127  H HA   . VAL A 1 5  ? -1.455  6.250   16.164  1.00 1.53 ? 5  VAL A HA   14 
ATOM   6128  H HB   . VAL A 1 5  ? -2.388  3.942   14.425  1.00 1.35 ? 5  VAL A HB   14 
ATOM   6129  H HG11 . VAL A 1 5  ? -0.077  4.192   16.368  1.00 2.20 ? 5  VAL A HG11 14 
ATOM   6130  H HG12 . VAL A 1 5  ? -0.690  2.649   15.773  1.00 2.26 ? 5  VAL A HG12 14 
ATOM   6131  H HG13 . VAL A 1 5  ? 0.012   3.811   14.647  1.00 2.16 ? 5  VAL A HG13 14 
ATOM   6132  H HG21 . VAL A 1 5  ? -2.552  4.534   17.390  1.00 2.09 ? 5  VAL A HG21 14 
ATOM   6133  H HG22 . VAL A 1 5  ? -3.882  4.212   16.278  1.00 1.99 ? 5  VAL A HG22 14 
ATOM   6134  H HG23 . VAL A 1 5  ? -2.777  2.914   16.730  1.00 1.87 ? 5  VAL A HG23 14 
ATOM   6135  N N    . CYS A 1 6  ? -1.325  6.067   12.871  1.00 0.97 ? 6  CYS A N    14 
ATOM   6136  C CA   . CYS A 1 6  ? -0.483  6.422   11.691  1.00 1.01 ? 6  CYS A CA   14 
ATOM   6137  C C    . CYS A 1 6  ? -1.325  7.178   10.654  1.00 0.84 ? 6  CYS A C    14 
ATOM   6138  O O    . CYS A 1 6  ? -2.539  7.226   10.741  1.00 0.82 ? 6  CYS A O    14 
ATOM   6139  C CB   . CYS A 1 6  ? -0.005  5.081   11.127  1.00 1.15 ? 6  CYS A CB   14 
ATOM   6140  S SG   . CYS A 1 6  ? 1.632   5.288   10.383  1.00 1.58 ? 6  CYS A SG   14 
ATOM   6141  H H    . CYS A 1 6  ? -2.219  5.703   12.734  1.00 0.85 ? 6  CYS A H    14 
ATOM   6142  H HA   . CYS A 1 6  ? 0.363   7.018   11.996  1.00 1.22 ? 6  CYS A HA   14 
ATOM   6143  H HB2  . CYS A 1 6  ? 0.052   4.355   11.924  1.00 1.25 ? 6  CYS A HB2  14 
ATOM   6144  H HB3  . CYS A 1 6  ? -0.701  4.738   10.375  1.00 1.12 ? 6  CYS A HB3  14 
ATOM   6145  H HG   . CYS A 1 6  ? 2.100   4.453   10.459  1.00 1.74 ? 6  CYS A HG   14 
ATOM   6146  N N    . VAL A 1 7  ? -0.688  7.765   9.676   1.00 0.90 ? 7  VAL A N    14 
ATOM   6147  C CA   . VAL A 1 7  ? -1.436  8.521   8.628   1.00 0.94 ? 7  VAL A CA   14 
ATOM   6148  C C    . VAL A 1 7  ? -1.249  7.849   7.261   1.00 0.82 ? 7  VAL A C    14 
ATOM   6149  O O    . VAL A 1 7  ? -0.403  6.991   7.085   1.00 0.73 ? 7  VAL A O    14 
ATOM   6150  C CB   . VAL A 1 7  ? -0.823  9.929   8.622   1.00 1.25 ? 7  VAL A CB   14 
ATOM   6151  C CG1  . VAL A 1 7  ? -1.730  10.883  7.842   1.00 1.49 ? 7  VAL A CG1  14 
ATOM   6152  C CG2  . VAL A 1 7  ? -0.677  10.444  10.059  1.00 1.48 ? 7  VAL A CG2  14 
ATOM   6153  H H    . VAL A 1 7  ? 0.283   7.711   9.627   1.00 1.02 ? 7  VAL A H    14 
ATOM   6154  H HA   . VAL A 1 7  ? -2.483  8.576   8.878   1.00 0.97 ? 7  VAL A HA   14 
ATOM   6155  H HB   . VAL A 1 7  ? 0.149   9.894   8.150   1.00 1.24 ? 7  VAL A HB   14 
ATOM   6156  H HG11 . VAL A 1 7  ? -2.764  10.641  8.040   1.00 1.78 ? 7  VAL A HG11 14 
ATOM   6157  H HG12 . VAL A 1 7  ? -1.534  11.899  8.150   1.00 2.05 ? 7  VAL A HG12 14 
ATOM   6158  H HG13 . VAL A 1 7  ? -1.533  10.783  6.785   1.00 1.61 ? 7  VAL A HG13 14 
ATOM   6159  H HG21 . VAL A 1 7  ? -1.552  10.170  10.629  1.00 1.65 ? 7  VAL A HG21 14 
ATOM   6160  H HG22 . VAL A 1 7  ? 0.200   10.004  10.511  1.00 1.53 ? 7  VAL A HG22 14 
ATOM   6161  H HG23 . VAL A 1 7  ? -0.576  11.518  10.048  1.00 2.02 ? 7  VAL A HG23 14 
HETATM 6162  N N    . SEP A 1 8  ? -2.035  8.242   6.295   1.00 0.94 ? 8  SEP A N    14 
HETATM 6163  C CA   . SEP A 1 8  ? -1.922  7.643   4.924   1.00 0.95 ? 8  SEP A CA   14 
HETATM 6164  C CB   . SEP A 1 8  ? -3.019  8.315   4.098   1.00 1.10 ? 8  SEP A CB   14 
HETATM 6165  O OG   . SEP A 1 8  ? -4.192  7.493   4.112   1.00 1.21 ? 8  SEP A OG   14 
HETATM 6166  C C    . SEP A 1 8  ? -0.546  7.928   4.307   1.00 0.91 ? 8  SEP A C    14 
HETATM 6167  O O    . SEP A 1 8  ? -0.038  7.139   3.536   1.00 0.94 ? 8  SEP A O    14 
HETATM 6168  P P    . SEP A 1 8  ? -5.611  8.101   4.566   1.00 1.47 ? 8  SEP A P    14 
HETATM 6169  O O1P  . SEP A 1 8  ? -5.519  8.471   5.997   1.00 2.03 ? 8  SEP A O1P  14 
HETATM 6170  O O2P  . SEP A 1 8  ? -6.023  9.111   3.568   1.00 2.28 ? 8  SEP A O2P  14 
HETATM 6171  O O3P  . SEP A 1 8  ? -6.594  6.833   4.435   1.00 2.29 ? 8  SEP A O3P  14 
HETATM 6172  H H    . SEP A 1 8  ? -2.699  8.935   6.473   1.00 1.08 ? 8  SEP A H    14 
HETATM 6173  H HA   . SEP A 1 8  ? -2.095  6.583   4.967   1.00 0.96 ? 8  SEP A HA   14 
HETATM 6174  H HB2  . SEP A 1 8  ? -2.672  8.447   3.083   1.00 1.14 ? 8  SEP A HB2  14 
HETATM 6175  H HB3  . SEP A 1 8  ? -3.254  9.278   4.519   1.00 1.16 ? 8  SEP A HB3  14 
HETATM 6176  H HOP3 . SEP A 1 8  ? -6.573  6.553   3.517   1.00 2.62 ? 8  SEP A HOP3 14 
ATOM   6177  N N    . SER A 1 9  ? 0.044   9.054   4.643   1.00 0.91 ? 9  SER A N    14 
ATOM   6178  C CA   . SER A 1 9  ? 1.390   9.443   4.097   1.00 0.90 ? 9  SER A CA   14 
ATOM   6179  C C    . SER A 1 9  ? 1.316   9.709   2.584   1.00 0.89 ? 9  SER A C    14 
ATOM   6180  O O    . SER A 1 9  ? 1.031   8.825   1.797   1.00 0.91 ? 9  SER A O    14 
ATOM   6181  C CB   . SER A 1 9  ? 2.345   8.284   4.432   1.00 0.90 ? 9  SER A CB   14 
ATOM   6182  O OG   . SER A 1 9  ? 2.434   7.370   3.342   1.00 0.90 ? 9  SER A OG   14 
ATOM   6183  H H    . SER A 1 9  ? -0.407  9.659   5.262   1.00 0.96 ? 9  SER A H    14 
ATOM   6184  H HA   . SER A 1 9  ? 1.732   10.336  4.596   1.00 0.96 ? 9  SER A HA   14 
ATOM   6185  H HB2  . SER A 1 9  ? 3.325   8.682   4.632   1.00 0.94 ? 9  SER A HB2  14 
ATOM   6186  H HB3  . SER A 1 9  ? 1.983   7.774   5.314   1.00 0.94 ? 9  SER A HB3  14 
ATOM   6187  H HG   . SER A 1 9  ? 1.536   7.109   3.097   1.00 0.91 ? 9  SER A HG   14 
ATOM   6188  N N    . TYR A 1 10 ? 1.577   10.941  2.196   1.00 0.94 ? 10 TYR A N    14 
ATOM   6189  C CA   . TYR A 1 10 ? 1.543   11.352  0.747   1.00 1.00 ? 10 TYR A CA   14 
ATOM   6190  C C    . TYR A 1 10 ? 0.514   10.522  -0.063  1.00 1.00 ? 10 TYR A C    14 
ATOM   6191  O O    . TYR A 1 10 ? -0.598  10.315  0.387   1.00 1.01 ? 10 TYR A O    14 
ATOM   6192  C CB   . TYR A 1 10 ? 2.994   11.190  0.243   1.00 1.06 ? 10 TYR A CB   14 
ATOM   6193  C CG   . TYR A 1 10 ? 3.580   9.871   0.682   1.00 1.03 ? 10 TYR A CG   14 
ATOM   6194  C CD1  . TYR A 1 10 ? 3.261   8.712   -0.014  1.00 1.01 ? 10 TYR A CD1  14 
ATOM   6195  C CD2  . TYR A 1 10 ? 4.440   9.813   1.783   1.00 1.06 ? 10 TYR A CD2  14 
ATOM   6196  C CE1  . TYR A 1 10 ? 3.790   7.485   0.382   1.00 1.03 ? 10 TYR A CE1  14 
ATOM   6197  C CE2  . TYR A 1 10 ? 4.976   8.584   2.181   1.00 1.09 ? 10 TYR A CE2  14 
ATOM   6198  C CZ   . TYR A 1 10 ? 4.650   7.419   1.480   1.00 1.07 ? 10 TYR A CZ   14 
ATOM   6199  O OH   . TYR A 1 10 ? 5.173   6.206   1.873   1.00 1.13 ? 10 TYR A OH   14 
ATOM   6200  H H    . TYR A 1 10 ? 1.803   11.609  2.872   1.00 0.97 ? 10 TYR A H    14 
ATOM   6201  H HA   . TYR A 1 10 ? 1.272   12.391  0.684   1.00 1.04 ? 10 TYR A HA   14 
ATOM   6202  H HB2  . TYR A 1 10 ? 3.010   11.243  -0.833  1.00 1.12 ? 10 TYR A HB2  14 
ATOM   6203  H HB3  . TYR A 1 10 ? 3.596   11.992  0.645   1.00 1.10 ? 10 TYR A HB3  14 
ATOM   6204  H HD1  . TYR A 1 10 ? 2.600   8.763   -0.859  1.00 1.01 ? 10 TYR A HD1  14 
ATOM   6205  H HD2  . TYR A 1 10 ? 4.687   10.714  2.325   1.00 1.10 ? 10 TYR A HD2  14 
ATOM   6206  H HE1  . TYR A 1 10 ? 3.536   6.589   -0.164  1.00 1.05 ? 10 TYR A HE1  14 
ATOM   6207  H HE2  . TYR A 1 10 ? 5.639   8.535   3.026   1.00 1.15 ? 10 TYR A HE2  14 
ATOM   6208  H HH   . TYR A 1 10 ? 4.645   5.881   2.607   1.00 1.24 ? 10 TYR A HH   14 
ATOM   6209  N N    . ARG A 1 11 ? 0.846   10.074  -1.255  1.00 1.04 ? 11 ARG A N    14 
ATOM   6210  C CA   . ARG A 1 11 ? -0.146  9.293   -2.063  1.00 1.09 ? 11 ARG A CA   14 
ATOM   6211  C C    . ARG A 1 11 ? 0.330   7.853   -2.329  1.00 1.04 ? 11 ARG A C    14 
ATOM   6212  O O    . ARG A 1 11 ? 0.097   7.306   -3.392  1.00 1.06 ? 11 ARG A O    14 
ATOM   6213  C CB   . ARG A 1 11 ? -0.261  10.067  -3.378  1.00 1.19 ? 11 ARG A CB   14 
ATOM   6214  C CG   . ARG A 1 11 ? -1.068  11.349  -3.154  1.00 1.20 ? 11 ARG A CG   14 
ATOM   6215  C CD   . ARG A 1 11 ? -1.466  11.948  -4.507  1.00 1.04 ? 11 ARG A CD   14 
ATOM   6216  N NE   . ARG A 1 11 ? -0.177  12.341  -5.151  1.00 0.85 ? 11 ARG A NE   14 
ATOM   6217  C CZ   . ARG A 1 11 ? 0.030   12.083  -6.411  1.00 0.75 ? 11 ARG A CZ   14 
ATOM   6218  N NH1  . ARG A 1 11 ? 0.085   10.850  -6.824  1.00 0.86 ? 11 ARG A NH1  14 
ATOM   6219  N NH2  . ARG A 1 11 ? 0.183   13.059  -7.257  1.00 0.92 ? 11 ARG A NH2  14 
ATOM   6220  H H    . ARG A 1 11 ? 1.727   10.269  -1.626  1.00 1.06 ? 11 ARG A H    14 
ATOM   6221  H HA   . ARG A 1 11 ? -1.099  9.279   -1.567  1.00 1.13 ? 11 ARG A HA   14 
ATOM   6222  H HB2  . ARG A 1 11 ? 0.728   10.321  -3.731  1.00 1.21 ? 11 ARG A HB2  14 
ATOM   6223  H HB3  . ARG A 1 11 ? -0.757  9.455   -4.111  1.00 1.26 ? 11 ARG A HB3  14 
ATOM   6224  H HG2  . ARG A 1 11 ? -1.957  11.119  -2.584  1.00 1.35 ? 11 ARG A HG2  14 
ATOM   6225  H HG3  . ARG A 1 11 ? -0.466  12.063  -2.609  1.00 1.23 ? 11 ARG A HG3  14 
ATOM   6226  H HD2  . ARG A 1 11 ? -1.981  11.208  -5.106  1.00 1.07 ? 11 ARG A HD2  14 
ATOM   6227  H HD3  . ARG A 1 11 ? -2.090  12.818  -4.365  1.00 1.20 ? 11 ARG A HD3  14 
ATOM   6228  H HE   . ARG A 1 11 ? 0.516   12.794  -4.625  1.00 0.97 ? 11 ARG A HE   14 
ATOM   6229  H HH11 . ARG A 1 11 ? -0.032  10.098  -6.175  1.00 1.03 ? 11 ARG A HH11 14 
ATOM   6230  H HH12 . ARG A 1 11 ? 0.238   10.653  -7.795  1.00 1.01 ? 11 ARG A HH12 14 
ATOM   6231  H HH21 . ARG A 1 11 ? 0.142   14.006  -6.943  1.00 1.13 ? 11 ARG A HH21 14 
ATOM   6232  H HH22 . ARG A 1 11 ? 0.340   12.859  -8.228  1.00 1.04 ? 11 ARG A HH22 14 
ATOM   6233  N N    . GLY A 1 12 ? 0.995   7.231   -1.388  1.00 1.02 ? 12 GLY A N    14 
ATOM   6234  C CA   . GLY A 1 12 ? 1.479   5.834   -1.608  1.00 1.01 ? 12 GLY A CA   14 
ATOM   6235  C C    . GLY A 1 12 ? 2.830   5.856   -2.331  1.00 0.93 ? 12 GLY A C    14 
ATOM   6236  O O    . GLY A 1 12 ? 3.412   4.821   -2.581  1.00 0.91 ? 12 GLY A O    14 
ATOM   6237  H H    . GLY A 1 12 ? 1.186   7.679   -0.541  1.00 1.04 ? 12 GLY A H    14 
ATOM   6238  H HA2  . GLY A 1 12 ? 1.597   5.343   -0.653  1.00 1.07 ? 12 GLY A HA2  14 
ATOM   6239  H HA3  . GLY A 1 12 ? 0.766   5.295   -2.206  1.00 1.03 ? 12 GLY A HA3  14 
ATOM   6240  N N    . ARG A 1 13 ? 3.326   7.038   -2.644  1.00 0.92 ? 13 ARG A N    14 
ATOM   6241  C CA   . ARG A 1 13 ? 4.645   7.201   -3.326  1.00 0.89 ? 13 ARG A CA   14 
ATOM   6242  C C    . ARG A 1 13 ? 4.940   6.056   -4.319  1.00 0.84 ? 13 ARG A C    14 
ATOM   6243  O O    . ARG A 1 13 ? 5.859   5.275   -4.145  1.00 0.90 ? 13 ARG A O    14 
ATOM   6244  C CB   . ARG A 1 13 ? 5.652   7.267   -2.170  1.00 0.96 ? 13 ARG A CB   14 
ATOM   6245  C CG   . ARG A 1 13 ? 5.759   5.918   -1.447  1.00 1.01 ? 13 ARG A CG   14 
ATOM   6246  C CD   . ARG A 1 13 ? 7.228   5.605   -1.158  1.00 1.12 ? 13 ARG A CD   14 
ATOM   6247  N NE   . ARG A 1 13 ? 7.729   4.966   -2.408  1.00 1.03 ? 13 ARG A NE   14 
ATOM   6248  C CZ   . ARG A 1 13 ? 8.672   4.073   -2.354  1.00 1.29 ? 13 ARG A CZ   14 
ATOM   6249  N NH1  . ARG A 1 13 ? 9.919   4.439   -2.431  1.00 1.72 ? 13 ARG A NH1  14 
ATOM   6250  N NH2  . ARG A 1 13 ? 8.363   2.816   -2.226  1.00 1.52 ? 13 ARG A NH2  14 
ATOM   6251  H H    . ARG A 1 13 ? 2.825   7.838   -2.410  1.00 0.96 ? 13 ARG A H    14 
ATOM   6252  H HA   . ARG A 1 13 ? 4.658   8.141   -3.851  1.00 0.90 ? 13 ARG A HA   14 
ATOM   6253  H HB2  . ARG A 1 13 ? 6.612   7.544   -2.556  1.00 0.99 ? 13 ARG A HB2  14 
ATOM   6254  H HB3  . ARG A 1 13 ? 5.324   8.018   -1.466  1.00 1.00 ? 13 ARG A HB3  14 
ATOM   6255  H HG2  . ARG A 1 13 ? 5.211   5.966   -0.518  1.00 1.09 ? 13 ARG A HG2  14 
ATOM   6256  H HG3  . ARG A 1 13 ? 5.343   5.142   -2.066  1.00 0.93 ? 13 ARG A HG3  14 
ATOM   6257  H HD2  . ARG A 1 13 ? 7.773   6.517   -0.949  1.00 1.26 ? 13 ARG A HD2  14 
ATOM   6258  H HD3  . ARG A 1 13 ? 7.311   4.917   -0.330  1.00 1.19 ? 13 ARG A HD3  14 
ATOM   6259  H HE   . ARG A 1 13 ? 7.335   5.213   -3.274  1.00 1.01 ? 13 ARG A HE   14 
ATOM   6260  H HH11 . ARG A 1 13 ? 10.150  5.406   -2.531  1.00 1.93 ? 13 ARG A HH11 14 
ATOM   6261  H HH12 . ARG A 1 13 ? 10.645  3.753   -2.390  1.00 2.02 ? 13 ARG A HH12 14 
ATOM   6262  H HH21 . ARG A 1 13 ? 7.403   2.542   -2.170  1.00 1.63 ? 13 ARG A HH21 14 
ATOM   6263  H HH22 . ARG A 1 13 ? 9.082   2.125   -2.181  1.00 1.84 ? 13 ARG A HH22 14 
ATOM   6264  N N    . LYS A 1 14 ? 4.163   5.968   -5.370  1.00 0.78 ? 14 LYS A N    14 
ATOM   6265  C CA   . LYS A 1 14 ? 4.372   4.896   -6.390  1.00 0.78 ? 14 LYS A CA   14 
ATOM   6266  C C    . LYS A 1 14 ? 5.625   5.186   -7.228  1.00 0.77 ? 14 LYS A C    14 
ATOM   6267  O O    . LYS A 1 14 ? 5.542   5.556   -8.384  1.00 0.80 ? 14 LYS A O    14 
ATOM   6268  C CB   . LYS A 1 14 ? 3.116   4.941   -7.266  1.00 0.79 ? 14 LYS A CB   14 
ATOM   6269  C CG   . LYS A 1 14 ? 1.918   4.397   -6.483  1.00 0.90 ? 14 LYS A CG   14 
ATOM   6270  C CD   . LYS A 1 14 ? 0.871   5.501   -6.327  1.00 0.92 ? 14 LYS A CD   14 
ATOM   6271  C CE   . LYS A 1 14 ? -0.444  4.897   -5.830  1.00 1.17 ? 14 LYS A CE   14 
ATOM   6272  N NZ   . LYS A 1 14 ? -1.155  6.023   -5.161  1.00 1.10 ? 14 LYS A NZ   14 
ATOM   6273  H H    . LYS A 1 14 ? 3.439   6.613   -5.493  1.00 0.78 ? 14 LYS A H    14 
ATOM   6274  H HA   . LYS A 1 14 ? 4.453   3.932   -5.913  1.00 0.85 ? 14 LYS A HA   14 
ATOM   6275  H HB2  . LYS A 1 14 ? 2.920   5.962   -7.561  1.00 0.76 ? 14 LYS A HB2  14 
ATOM   6276  H HB3  . LYS A 1 14 ? 3.272   4.339   -8.144  1.00 0.84 ? 14 LYS A HB3  14 
ATOM   6277  H HG2  . LYS A 1 14 ? 1.487   3.563   -7.020  1.00 1.05 ? 14 LYS A HG2  14 
ATOM   6278  H HG3  . LYS A 1 14 ? 2.241   4.068   -5.507  1.00 0.96 ? 14 LYS A HG3  14 
ATOM   6279  H HD2  . LYS A 1 14 ? 1.223   6.232   -5.613  1.00 0.98 ? 14 LYS A HD2  14 
ATOM   6280  H HD3  . LYS A 1 14 ? 0.706   5.980   -7.280  1.00 1.06 ? 14 LYS A HD3  14 
ATOM   6281  H HE2  . LYS A 1 14 ? -1.022  4.523   -6.665  1.00 1.39 ? 14 LYS A HE2  14 
ATOM   6282  H HE3  . LYS A 1 14 ? -0.251  4.107   -5.120  1.00 1.40 ? 14 LYS A HE3  14 
ATOM   6283  H HZ1  . LYS A 1 14 ? -1.277  6.811   -5.839  1.00 1.03 ? 14 LYS A HZ1  14 
ATOM   6284  H HZ2  . LYS A 1 14 ? -2.086  5.701   -4.832  1.00 1.31 ? 14 LYS A HZ2  14 
ATOM   6285  H HZ3  . LYS A 1 14 ? -0.596  6.356   -4.344  1.00 1.07 ? 14 LYS A HZ3  14 
ATOM   6286  N N    . SER A 1 15 ? 6.786   5.013   -6.652  1.00 0.81 ? 15 SER A N    14 
ATOM   6287  C CA   . SER A 1 15 ? 8.050   5.271   -7.411  1.00 0.89 ? 15 SER A CA   14 
ATOM   6288  C C    . SER A 1 15 ? 8.357   4.085   -8.335  1.00 0.85 ? 15 SER A C    14 
ATOM   6289  O O    . SER A 1 15 ? 9.043   3.153   -7.957  1.00 1.03 ? 15 SER A O    14 
ATOM   6290  C CB   . SER A 1 15 ? 9.139   5.425   -6.345  1.00 1.09 ? 15 SER A CB   14 
ATOM   6291  O OG   . SER A 1 15 ? 10.265  6.082   -6.915  1.00 1.33 ? 15 SER A OG   14 
ATOM   6292  H H    . SER A 1 15 ? 6.824   4.713   -5.718  1.00 0.85 ? 15 SER A H    14 
ATOM   6293  H HA   . SER A 1 15 ? 7.965   6.180   -7.984  1.00 0.92 ? 15 SER A HA   14 
ATOM   6294  H HB2  . SER A 1 15 ? 8.762   6.015   -5.526  1.00 1.27 ? 15 SER A HB2  14 
ATOM   6295  H HB3  . SER A 1 15 ? 9.425   4.447   -5.979  1.00 1.12 ? 15 SER A HB3  14 
ATOM   6296  H HG   . SER A 1 15 ? 10.694  5.471   -7.523  1.00 1.61 ? 15 SER A HG   14 
ATOM   6297  N N    . GLY A 1 16 ? 7.846   4.114   -9.543  1.00 0.80 ? 16 GLY A N    14 
ATOM   6298  C CA   . GLY A 1 16 ? 8.097   2.990   -10.501 1.00 0.84 ? 16 GLY A CA   14 
ATOM   6299  C C    . GLY A 1 16 ? 9.585   2.933   -10.861 1.00 0.89 ? 16 GLY A C    14 
ATOM   6300  O O    . GLY A 1 16 ? 10.231  1.915   -10.698 1.00 1.03 ? 16 GLY A O    14 
ATOM   6301  H H    . GLY A 1 16 ? 7.291   4.874   -9.819  1.00 0.87 ? 16 GLY A H    14 
ATOM   6302  H HA2  . GLY A 1 16 ? 7.801   2.057   -10.044 1.00 0.90 ? 16 GLY A HA2  14 
ATOM   6303  H HA3  . GLY A 1 16 ? 7.521   3.149   -11.400 1.00 0.83 ? 16 GLY A HA3  14 
ATOM   6304  N N    . ASN A 1 17 ? 10.132  4.018   -11.348 1.00 0.89 ? 17 ASN A N    14 
ATOM   6305  C CA   . ASN A 1 17 ? 11.581  4.035   -11.719 1.00 1.00 ? 17 ASN A CA   14 
ATOM   6306  C C    . ASN A 1 17 ? 12.285  5.229   -11.053 1.00 1.11 ? 17 ASN A C    14 
ATOM   6307  O O    . ASN A 1 17 ? 11.773  5.818   -10.119 1.00 1.17 ? 17 ASN A O    14 
ATOM   6308  C CB   . ASN A 1 17 ? 11.591  4.173   -13.247 1.00 0.94 ? 17 ASN A CB   14 
ATOM   6309  C CG   . ASN A 1 17 ? 12.741  3.347   -13.835 1.00 1.08 ? 17 ASN A CG   14 
ATOM   6310  O OD1  . ASN A 1 17 ? 13.872  3.460   -13.401 1.00 1.23 ? 17 ASN A OD1  14 
ATOM   6311  N ND2  . ASN A 1 17 ? 12.502  2.518   -14.811 1.00 1.16 ? 17 ASN A ND2  14 
ATOM   6312  H H    . ASN A 1 17 ? 9.589   4.825   -11.469 1.00 0.88 ? 17 ASN A H    14 
ATOM   6313  H HA   . ASN A 1 17 ? 12.055  3.111   -11.428 1.00 1.11 ? 17 ASN A HA   14 
ATOM   6314  H HB2  . ASN A 1 17 ? 10.653  3.815   -13.645 1.00 0.89 ? 17 ASN A HB2  14 
ATOM   6315  H HB3  . ASN A 1 17 ? 11.722  5.210   -13.513 1.00 0.94 ? 17 ASN A HB3  14 
ATOM   6316  H HD21 . ASN A 1 17 ? 11.592  2.424   -15.164 1.00 1.19 ? 17 ASN A HD21 14 
ATOM   6317  H HD22 . ASN A 1 17 ? 13.231  1.988   -15.192 1.00 1.26 ? 17 ASN A HD22 14 
ATOM   6318  N N    . LYS A 1 18 ? 13.456  5.589   -11.526 1.00 1.20 ? 18 LYS A N    14 
ATOM   6319  C CA   . LYS A 1 18 ? 14.197  6.743   -10.924 1.00 1.36 ? 18 LYS A CA   14 
ATOM   6320  C C    . LYS A 1 18 ? 13.413  8.056   -11.116 1.00 1.34 ? 18 LYS A C    14 
ATOM   6321  O O    . LYS A 1 18 ? 13.213  8.790   -10.167 1.00 1.46 ? 18 LYS A O    14 
ATOM   6322  C CB   . LYS A 1 18 ? 15.535  6.791   -11.668 1.00 1.45 ? 18 LYS A CB   14 
ATOM   6323  C CG   . LYS A 1 18 ? 16.524  5.824   -11.011 1.00 1.61 ? 18 LYS A CG   14 
ATOM   6324  C CD   . LYS A 1 18 ? 16.734  4.605   -11.917 1.00 1.65 ? 18 LYS A CD   14 
ATOM   6325  C CE   . LYS A 1 18 ? 16.308  3.333   -11.178 1.00 1.75 ? 18 LYS A CE   14 
ATOM   6326  N NZ   . LYS A 1 18 ? 15.917  2.374   -12.253 1.00 1.72 ? 18 LYS A NZ   14 
ATOM   6327  H H    . LYS A 1 18 ? 13.849  5.097   -12.277 1.00 1.21 ? 18 LYS A H    14 
ATOM   6328  H HA   . LYS A 1 18 ? 14.369  6.566   -9.874  1.00 1.47 ? 18 LYS A HA   14 
ATOM   6329  H HB2  . LYS A 1 18 ? 15.385  6.509   -12.700 1.00 1.38 ? 18 LYS A HB2  14 
ATOM   6330  H HB3  . LYS A 1 18 ? 15.933  7.793   -11.625 1.00 1.54 ? 18 LYS A HB3  14 
ATOM   6331  H HG2  . LYS A 1 18 ? 17.470  6.326   -10.858 1.00 1.77 ? 18 LYS A HG2  14 
ATOM   6332  H HG3  . LYS A 1 18 ? 16.133  5.499   -10.058 1.00 1.67 ? 18 LYS A HG3  14 
ATOM   6333  H HD2  . LYS A 1 18 ? 16.142  4.718   -12.814 1.00 1.62 ? 18 LYS A HD2  14 
ATOM   6334  H HD3  . LYS A 1 18 ? 17.778  4.530   -12.183 1.00 1.81 ? 18 LYS A HD3  14 
ATOM   6335  H HE2  . LYS A 1 18 ? 17.135  2.940   -10.601 1.00 2.02 ? 18 LYS A HE2  14 
ATOM   6336  H HE3  . LYS A 1 18 ? 15.462  3.535   -10.538 1.00 1.75 ? 18 LYS A HE3  14 
ATOM   6337  H HZ1  . LYS A 1 18 ? 16.712  2.241   -12.908 1.00 1.87 ? 18 LYS A HZ1  14 
ATOM   6338  H HZ2  . LYS A 1 18 ? 15.661  1.460   -11.826 1.00 1.92 ? 18 LYS A HZ2  14 
ATOM   6339  H HZ3  . LYS A 1 18 ? 15.096  2.755   -12.778 1.00 1.50 ? 18 LYS A HZ3  14 
ATOM   6340  N N    . PRO A 1 19 ? 12.987  8.308   -12.338 1.00 1.26 ? 19 PRO A N    14 
ATOM   6341  C CA   . PRO A 1 19 ? 12.214  9.566   -12.574 1.00 1.33 ? 19 PRO A CA   14 
ATOM   6342  C C    . PRO A 1 19 ? 10.771  9.419   -12.063 1.00 1.21 ? 19 PRO A C    14 
ATOM   6343  O O    . PRO A 1 19 ? 10.272  8.315   -11.923 1.00 1.09 ? 19 PRO A O    14 
ATOM   6344  C CB   . PRO A 1 19 ? 12.239  9.742   -14.091 1.00 1.36 ? 19 PRO A CB   14 
ATOM   6345  C CG   . PRO A 1 19 ? 12.444  8.368   -14.627 1.00 1.22 ? 19 PRO A CG   14 
ATOM   6346  C CD   . PRO A 1 19 ? 13.282  7.635   -13.617 1.00 1.20 ? 19 PRO A CD   14 
ATOM   6347  H HA   . PRO A 1 19 ? 12.700  10.403  -12.099 1.00 1.49 ? 19 PRO A HA   14 
ATOM   6348  H HB2  . PRO A 1 19 ? 11.299  10.150  -14.438 1.00 1.37 ? 19 PRO A HB2  14 
ATOM   6349  H HB3  . PRO A 1 19 ? 13.059  10.379  -14.384 1.00 1.52 ? 19 PRO A HB3  14 
ATOM   6350  H HG2  . PRO A 1 19 ? 11.489  7.874   -14.750 1.00 1.13 ? 19 PRO A HG2  14 
ATOM   6351  H HG3  . PRO A 1 19 ? 12.964  8.411   -15.571 1.00 1.34 ? 19 PRO A HG3  14 
ATOM   6352  H HD2  . PRO A 1 19 ? 12.995  6.594   -13.576 1.00 1.14 ? 19 PRO A HD2  14 
ATOM   6353  H HD3  . PRO A 1 19 ? 14.330  7.731   -13.854 1.00 1.30 ? 19 PRO A HD3  14 
ATOM   6354  N N    . PRO A 1 20 ? 10.147  10.545  -11.799 1.00 1.31 ? 20 PRO A N    14 
ATOM   6355  C CA   . PRO A 1 20 ? 8.742   10.498  -11.294 1.00 1.25 ? 20 PRO A CA   14 
ATOM   6356  C C    . PRO A 1 20 ? 7.764   10.149  -12.432 1.00 1.10 ? 20 PRO A C    14 
ATOM   6357  O O    . PRO A 1 20 ? 6.954   10.960  -12.844 1.00 1.32 ? 20 PRO A O    14 
ATOM   6358  C CB   . PRO A 1 20 ? 8.494   11.910  -10.763 1.00 1.52 ? 20 PRO A CB   14 
ATOM   6359  C CG   . PRO A 1 20 ? 9.446   12.774  -11.518 1.00 1.68 ? 20 PRO A CG   14 
ATOM   6360  C CD   . PRO A 1 20 ? 10.652  11.929  -11.827 1.00 1.54 ? 20 PRO A CD   14 
ATOM   6361  H HA   . PRO A 1 20 ? 8.653   9.783   -10.491 1.00 1.22 ? 20 PRO A HA   14 
ATOM   6362  H HB2  . PRO A 1 20 ? 7.473   12.210  -10.957 1.00 1.54 ? 20 PRO A HB2  14 
ATOM   6363  H HB3  . PRO A 1 20 ? 8.709   11.958  -9.707  1.00 1.65 ? 20 PRO A HB3  14 
ATOM   6364  H HG2  . PRO A 1 20 ? 8.986   13.116  -12.435 1.00 1.71 ? 20 PRO A HG2  14 
ATOM   6365  H HG3  . PRO A 1 20 ? 9.739   13.618  -10.913 1.00 1.91 ? 20 PRO A HG3  14 
ATOM   6366  H HD2  . PRO A 1 20 ? 11.041  12.173  -12.806 1.00 1.57 ? 20 PRO A HD2  14 
ATOM   6367  H HD3  . PRO A 1 20 ? 11.410  12.061  -11.072 1.00 1.64 ? 20 PRO A HD3  14 
ATOM   6368  N N    . SER A 1 21 ? 7.834   8.941   -12.934 1.00 0.86 ? 21 SER A N    14 
ATOM   6369  C CA   . SER A 1 21 ? 6.915   8.523   -14.037 1.00 0.82 ? 21 SER A CA   14 
ATOM   6370  C C    . SER A 1 21 ? 5.922   7.472   -13.526 1.00 0.64 ? 21 SER A C    14 
ATOM   6371  O O    . SER A 1 21 ? 6.258   6.634   -12.707 1.00 0.68 ? 21 SER A O    14 
ATOM   6372  C CB   . SER A 1 21 ? 7.826   7.927   -15.110 1.00 0.94 ? 21 SER A CB   14 
ATOM   6373  O OG   . SER A 1 21 ? 7.103   7.817   -16.332 1.00 1.18 ? 21 SER A OG   14 
ATOM   6374  H H    . SER A 1 21 ? 8.491   8.304   -12.580 1.00 0.84 ? 21 SER A H    14 
ATOM   6375  H HA   . SER A 1 21 ? 6.388   9.377   -14.433 1.00 0.96 ? 21 SER A HA   14 
ATOM   6376  H HB2  . SER A 1 21 ? 8.679   8.569   -15.258 1.00 1.06 ? 21 SER A HB2  14 
ATOM   6377  H HB3  . SER A 1 21 ? 8.165   6.950   -14.791 1.00 0.96 ? 21 SER A HB3  14 
ATOM   6378  H HG   . SER A 1 21 ? 7.590   8.291   -17.011 1.00 1.41 ? 21 SER A HG   14 
ATOM   6379  N N    . LYS A 1 22 ? 4.705   7.508   -14.006 1.00 0.59 ? 22 LYS A N    14 
ATOM   6380  C CA   . LYS A 1 22 ? 3.685   6.513   -13.556 1.00 0.53 ? 22 LYS A CA   14 
ATOM   6381  C C    . LYS A 1 22 ? 2.827   6.054   -14.743 1.00 0.60 ? 22 LYS A C    14 
ATOM   6382  O O    . LYS A 1 22 ? 1.863   6.695   -15.120 1.00 0.66 ? 22 LYS A O    14 
ATOM   6383  C CB   . LYS A 1 22 ? 2.830   7.240   -12.502 1.00 0.58 ? 22 LYS A CB   14 
ATOM   6384  C CG   . LYS A 1 22 ? 2.396   8.622   -13.015 1.00 0.66 ? 22 LYS A CG   14 
ATOM   6385  C CD   . LYS A 1 22 ? 1.088   9.035   -12.332 1.00 0.76 ? 22 LYS A CD   14 
ATOM   6386  C CE   . LYS A 1 22 ? -0.105  8.581   -13.180 1.00 0.73 ? 22 LYS A CE   14 
ATOM   6387  N NZ   . LYS A 1 22 ? -0.910  9.814   -13.408 1.00 0.78 ? 22 LYS A NZ   14 
ATOM   6388  H H    . LYS A 1 22 ? 4.462   8.189   -14.667 1.00 0.72 ? 22 LYS A H    14 
ATOM   6389  H HA   . LYS A 1 22 ? 4.172   5.663   -13.103 1.00 0.56 ? 22 LYS A HA   14 
ATOM   6390  H HB2  . LYS A 1 22 ? 1.952   6.647   -12.284 1.00 0.65 ? 22 LYS A HB2  14 
ATOM   6391  H HB3  . LYS A 1 22 ? 3.408   7.362   -11.597 1.00 0.69 ? 22 LYS A HB3  14 
ATOM   6392  H HG2  . LYS A 1 22 ? 3.166   9.345   -12.787 1.00 0.82 ? 22 LYS A HG2  14 
ATOM   6393  H HG3  . LYS A 1 22 ? 2.246   8.581   -14.082 1.00 0.71 ? 22 LYS A HG3  14 
ATOM   6394  H HD2  . LYS A 1 22 ? 1.031   8.576   -11.355 1.00 0.96 ? 22 LYS A HD2  14 
ATOM   6395  H HD3  . LYS A 1 22 ? 1.064   10.109  -12.225 1.00 0.92 ? 22 LYS A HD3  14 
ATOM   6396  H HE2  . LYS A 1 22 ? 0.238   8.173   -14.122 1.00 0.80 ? 22 LYS A HE2  14 
ATOM   6397  H HE3  . LYS A 1 22 ? -0.691  7.850   -12.643 1.00 0.90 ? 22 LYS A HE3  14 
ATOM   6398  H HZ1  . LYS A 1 22 ? -1.099  10.285  -12.489 1.00 0.83 ? 22 LYS A HZ1  14 
ATOM   6399  H HZ2  . LYS A 1 22 ? -0.383  10.464  -14.032 1.00 0.85 ? 22 LYS A HZ2  14 
ATOM   6400  H HZ3  . LYS A 1 22 ? -1.814  9.566   -13.863 1.00 0.96 ? 22 LYS A HZ3  14 
ATOM   6401  N N    . THR A 1 23 ? 3.172   4.940   -15.335 1.00 0.68 ? 23 THR A N    14 
ATOM   6402  C CA   . THR A 1 23 ? 2.379   4.430   -16.502 1.00 0.85 ? 23 THR A CA   14 
ATOM   6403  C C    . THR A 1 23 ? 1.130   3.673   -16.021 1.00 0.91 ? 23 THR A C    14 
ATOM   6404  O O    . THR A 1 23 ? 0.176   3.513   -16.759 1.00 1.15 ? 23 THR A O    14 
ATOM   6405  C CB   . THR A 1 23 ? 3.330   3.494   -17.264 1.00 0.98 ? 23 THR A CB   14 
ATOM   6406  O OG1  . THR A 1 23 ? 2.764   3.177   -18.528 1.00 1.13 ? 23 THR A OG1  14 
ATOM   6407  C CG2  . THR A 1 23 ? 3.558   2.202   -16.470 1.00 1.05 ? 23 THR A CG2  14 
ATOM   6408  H H    . THR A 1 23 ? 3.952   4.440   -15.014 1.00 0.69 ? 23 THR A H    14 
ATOM   6409  H HA   . THR A 1 23 ? 2.090   5.251   -17.140 1.00 0.90 ? 23 THR A HA   14 
ATOM   6410  H HB   . THR A 1 23 ? 4.277   3.990   -17.413 1.00 0.99 ? 23 THR A HB   14 
ATOM   6411  H HG1  . THR A 1 23 ? 1.940   2.704   -18.380 1.00 1.10 ? 23 THR A HG1  14 
ATOM   6412  H HG21 . THR A 1 23 ? 3.716   2.441   -15.429 1.00 1.35 ? 23 THR A HG21 14 
ATOM   6413  H HG22 . THR A 1 23 ? 2.693   1.563   -16.566 1.00 1.65 ? 23 THR A HG22 14 
ATOM   6414  H HG23 . THR A 1 23 ? 4.426   1.692   -16.857 1.00 1.35 ? 23 THR A HG23 14 
ATOM   6415  N N    . CYS A 1 24 ? 1.121   3.221   -14.790 1.00 0.85 ? 24 CYS A N    14 
ATOM   6416  C CA   . CYS A 1 24 ? -0.068  2.488   -14.259 1.00 0.98 ? 24 CYS A CA   14 
ATOM   6417  C C    . CYS A 1 24 ? -0.689  3.266   -13.089 1.00 0.88 ? 24 CYS A C    14 
ATOM   6418  O O    . CYS A 1 24 ? -0.060  4.128   -12.504 1.00 0.75 ? 24 CYS A O    14 
ATOM   6419  C CB   . CYS A 1 24 ? 0.480   1.140   -13.783 1.00 1.10 ? 24 CYS A CB   14 
ATOM   6420  S SG   . CYS A 1 24 ? -0.864  -0.070  -13.715 1.00 2.04 ? 24 CYS A SG   14 
ATOM   6421  H H    . CYS A 1 24 ? 1.894   3.370   -14.208 1.00 0.84 ? 24 CYS A H    14 
ATOM   6422  H HA   . CYS A 1 24 ? -0.795  2.336   -15.040 1.00 1.10 ? 24 CYS A HA   14 
ATOM   6423  H HB2  . CYS A 1 24 ? 1.238   0.796   -14.471 1.00 1.15 ? 24 CYS A HB2  14 
ATOM   6424  H HB3  . CYS A 1 24 ? 0.912   1.254   -12.799 1.00 1.68 ? 24 CYS A HB3  14 
ATOM   6425  H HG   . CYS A 1 24 ? -1.278  -0.104  -14.581 1.00 2.46 ? 24 CYS A HG   14 
ATOM   6426  N N    . LEU A 1 25 ? -1.922  2.961   -12.750 1.00 1.01 ? 25 LEU A N    14 
ATOM   6427  C CA   . LEU A 1 25 ? -2.615  3.659   -11.615 1.00 0.99 ? 25 LEU A CA   14 
ATOM   6428  C C    . LEU A 1 25 ? -2.652  5.184   -11.833 1.00 0.83 ? 25 LEU A C    14 
ATOM   6429  O O    . LEU A 1 25 ? -1.843  5.922   -11.301 1.00 0.70 ? 25 LEU A O    14 
ATOM   6430  C CB   . LEU A 1 25 ? -1.803  3.301   -10.364 1.00 1.03 ? 25 LEU A CB   14 
ATOM   6431  C CG   . LEU A 1 25 ? -2.593  2.306   -9.509  1.00 1.31 ? 25 LEU A CG   14 
ATOM   6432  C CD1  . LEU A 1 25 ? -1.712  1.099   -9.184  1.00 1.50 ? 25 LEU A CD1  14 
ATOM   6433  C CD2  . LEU A 1 25 ? -3.026  2.984   -8.207  1.00 1.56 ? 25 LEU A CD2  14 
ATOM   6434  H H    . LEU A 1 25 ? -2.397  2.259   -13.241 1.00 1.16 ? 25 LEU A H    14 
ATOM   6435  H HA   . LEU A 1 25 ? -3.620  3.282   -11.512 1.00 1.16 ? 25 LEU A HA   14 
ATOM   6436  H HB2  . LEU A 1 25 ? -0.864  2.857   -10.660 1.00 1.01 ? 25 LEU A HB2  14 
ATOM   6437  H HB3  . LEU A 1 25 ? -1.612  4.195   -9.790  1.00 1.00 ? 25 LEU A HB3  14 
ATOM   6438  H HG   . LEU A 1 25 ? -3.466  1.976   -10.054 1.00 1.47 ? 25 LEU A HG   14 
ATOM   6439  H HD11 . LEU A 1 25 ? -1.243  0.740   -10.089 1.00 1.97 ? 25 LEU A HD11 14 
ATOM   6440  H HD12 . LEU A 1 25 ? -0.950  1.388   -8.475  1.00 1.84 ? 25 LEU A HD12 14 
ATOM   6441  H HD13 . LEU A 1 25 ? -2.320  0.314   -8.759  1.00 1.81 ? 25 LEU A HD13 14 
ATOM   6442  H HD21 . LEU A 1 25 ? -3.066  4.053   -8.353  1.00 1.97 ? 25 LEU A HD21 14 
ATOM   6443  H HD22 . LEU A 1 25 ? -4.003  2.623   -7.922  1.00 2.01 ? 25 LEU A HD22 14 
ATOM   6444  H HD23 . LEU A 1 25 ? -2.316  2.753   -7.427  1.00 1.83 ? 25 LEU A HD23 14 
ATOM   6445  N N    . LYS A 1 26 ? -3.601  5.658   -12.601 1.00 0.92 ? 26 LYS A N    14 
ATOM   6446  C CA   . LYS A 1 26 ? -3.709  7.132   -12.843 1.00 0.84 ? 26 LYS A CA   14 
ATOM   6447  C C    . LYS A 1 26 ? -4.563  7.773   -11.737 1.00 0.88 ? 26 LYS A C    14 
ATOM   6448  O O    . LYS A 1 26 ? -5.731  8.058   -11.925 1.00 0.99 ? 26 LYS A O    14 
ATOM   6449  C CB   . LYS A 1 26 ? -4.388  7.263   -14.212 1.00 1.00 ? 26 LYS A CB   14 
ATOM   6450  C CG   . LYS A 1 26 ? -3.325  7.387   -15.310 1.00 0.99 ? 26 LYS A CG   14 
ATOM   6451  C CD   . LYS A 1 26 ? -2.821  5.996   -15.708 1.00 1.03 ? 26 LYS A CD   14 
ATOM   6452  C CE   . LYS A 1 26 ? -1.418  5.772   -15.134 1.00 0.90 ? 26 LYS A CE   14 
ATOM   6453  N NZ   . LYS A 1 26 ? -0.484  6.341   -16.148 1.00 0.90 ? 26 LYS A NZ   14 
ATOM   6454  H H    . LYS A 1 26 ? -4.250  5.048   -13.009 1.00 1.10 ? 26 LYS A H    14 
ATOM   6455  H HA   . LYS A 1 26 ? -2.729  7.582   -12.869 1.00 0.72 ? 26 LYS A HA   14 
ATOM   6456  H HB2  . LYS A 1 26 ? -4.998  6.391   -14.398 1.00 1.14 ? 26 LYS A HB2  14 
ATOM   6457  H HB3  . LYS A 1 26 ? -5.011  8.145   -14.220 1.00 1.06 ? 26 LYS A HB3  14 
ATOM   6458  H HG2  . LYS A 1 26 ? -3.757  7.873   -16.173 1.00 1.22 ? 26 LYS A HG2  14 
ATOM   6459  H HG3  . LYS A 1 26 ? -2.497  7.976   -14.944 1.00 0.88 ? 26 LYS A HG3  14 
ATOM   6460  H HD2  . LYS A 1 26 ? -3.493  5.244   -15.321 1.00 1.15 ? 26 LYS A HD2  14 
ATOM   6461  H HD3  . LYS A 1 26 ? -2.783  5.921   -16.785 1.00 1.17 ? 26 LYS A HD3  14 
ATOM   6462  H HE2  . LYS A 1 26 ? -1.314  6.287   -14.188 1.00 0.80 ? 26 LYS A HE2  14 
ATOM   6463  H HE3  . LYS A 1 26 ? -1.229  4.716   -15.009 1.00 1.14 ? 26 LYS A HE3  14 
ATOM   6464  H HZ1  . LYS A 1 26 ? -0.778  7.318   -16.392 1.00 0.88 ? 26 LYS A HZ1  14 
ATOM   6465  H HZ2  . LYS A 1 26 ? 0.483   6.368   -15.756 1.00 0.83 ? 26 LYS A HZ2  14 
ATOM   6466  H HZ3  . LYS A 1 26 ? -0.495  5.751   -17.005 1.00 1.12 ? 26 LYS A HZ3  14 
ATOM   6467  N N    . GLU A 1 27 ? -3.989  7.978   -10.575 1.00 0.83 ? 27 GLU A N    14 
ATOM   6468  C CA   . GLU A 1 27 ? -4.765  8.580   -9.440  1.00 0.93 ? 27 GLU A CA   14 
ATOM   6469  C C    . GLU A 1 27 ? -5.052  10.077  -9.674  1.00 0.91 ? 27 GLU A C    14 
ATOM   6470  O O    . GLU A 1 27 ? -6.078  10.579  -9.258  1.00 1.04 ? 27 GLU A O    14 
ATOM   6471  C CB   . GLU A 1 27 ? -3.898  8.362   -8.188  1.00 0.97 ? 27 GLU A CB   14 
ATOM   6472  C CG   . GLU A 1 27 ? -2.581  9.144   -8.297  1.00 0.83 ? 27 GLU A CG   14 
ATOM   6473  C CD   . GLU A 1 27 ? -1.429  8.300   -7.749  1.00 0.82 ? 27 GLU A CD   14 
ATOM   6474  O OE1  . GLU A 1 27 ? -1.244  8.294   -6.541  1.00 1.08 ? 27 GLU A OE1  14 
ATOM   6475  O OE2  . GLU A 1 27 ? -0.750  7.673   -8.544  1.00 0.95 ? 27 GLU A OE2  14 
ATOM   6476  H H    . GLU A 1 27 ? -3.050  7.723   -10.445 1.00 0.79 ? 27 GLU A H    14 
ATOM   6477  H HA   . GLU A 1 27 ? -5.698  8.051   -9.322  1.00 1.03 ? 27 GLU A HA   14 
ATOM   6478  H HB2  . GLU A 1 27 ? -4.441  8.699   -7.317  1.00 1.14 ? 27 GLU A HB2  14 
ATOM   6479  H HB3  . GLU A 1 27 ? -3.680  7.309   -8.085  1.00 1.02 ? 27 GLU A HB3  14 
ATOM   6480  H HG2  . GLU A 1 27 ? -2.388  9.386   -9.329  1.00 0.75 ? 27 GLU A HG2  14 
ATOM   6481  H HG3  . GLU A 1 27 ? -2.658  10.054  -7.723  1.00 0.96 ? 27 GLU A HG3  14 
ATOM   6482  N N    . GLU A 1 28 ? -4.168  10.792  -10.332 1.00 0.82 ? 28 GLU A N    14 
ATOM   6483  C CA   . GLU A 1 28 ? -4.416  12.251  -10.582 1.00 0.89 ? 28 GLU A CA   14 
ATOM   6484  C C    . GLU A 1 28 ? -4.761  12.471  -12.059 1.00 0.90 ? 28 GLU A C    14 
ATOM   6485  O O    . GLU A 1 28 ? -5.851  12.892  -12.394 1.00 1.02 ? 28 GLU A O    14 
ATOM   6486  C CB   . GLU A 1 28 ? -3.110  12.996  -10.231 1.00 0.89 ? 28 GLU A CB   14 
ATOM   6487  C CG   . GLU A 1 28 ? -2.238  12.174  -9.271  1.00 0.79 ? 28 GLU A CG   14 
ATOM   6488  C CD   . GLU A 1 28 ? -1.119  11.472  -10.050 1.00 0.67 ? 28 GLU A CD   14 
ATOM   6489  O OE1  . GLU A 1 28 ? -1.421  10.832  -11.047 1.00 0.73 ? 28 GLU A OE1  14 
ATOM   6490  O OE2  . GLU A 1 28 ? 0.021   11.581  -9.633  1.00 0.70 ? 28 GLU A OE2  14 
ATOM   6491  H H    . GLU A 1 28 ? -3.345  10.375  -10.662 1.00 0.76 ? 28 GLU A H    14 
ATOM   6492  H HA   . GLU A 1 28 ? -5.219  12.605  -9.956  1.00 0.99 ? 28 GLU A HA   14 
ATOM   6493  H HB2  . GLU A 1 28 ? -2.554  13.186  -11.138 1.00 0.90 ? 28 GLU A HB2  14 
ATOM   6494  H HB3  . GLU A 1 28 ? -3.357  13.938  -9.766  1.00 1.06 ? 28 GLU A HB3  14 
ATOM   6495  H HG2  . GLU A 1 28 ? -1.804  12.830  -8.536  1.00 0.87 ? 28 GLU A HG2  14 
ATOM   6496  H HG3  . GLU A 1 28 ? -2.845  11.437  -8.774  1.00 0.85 ? 28 GLU A HG3  14 
ATOM   6497  N N    . MET A 1 29 ? -3.833  12.189  -12.940 1.00 0.86 ? 29 MET A N    14 
ATOM   6498  C CA   . MET A 1 29 ? -4.086  12.378  -14.401 1.00 0.96 ? 29 MET A CA   14 
ATOM   6499  C C    . MET A 1 29 ? -3.362  11.282  -15.201 1.00 0.92 ? 29 MET A C    14 
ATOM   6500  O O    . MET A 1 29 ? -3.181  10.179  -14.721 1.00 0.89 ? 29 MET A O    14 
ATOM   6501  C CB   . MET A 1 29 ? -3.516  13.767  -14.714 1.00 1.11 ? 29 MET A CB   14 
ATOM   6502  C CG   . MET A 1 29 ? -4.425  14.482  -15.718 1.00 1.32 ? 29 MET A CG   14 
ATOM   6503  S SD   . MET A 1 29 ? -3.409  15.291  -16.979 1.00 2.02 ? 29 MET A SD   14 
ATOM   6504  C CE   . MET A 1 29 ? -4.746  15.682  -18.132 1.00 2.53 ? 29 MET A CE   14 
ATOM   6505  H H    . MET A 1 29 ? -2.963  11.852  -12.638 1.00 0.81 ? 29 MET A H    14 
ATOM   6506  H HA   . MET A 1 29 ? -5.146  12.356  -14.606 1.00 1.05 ? 29 MET A HA   14 
ATOM   6507  H HB2  . MET A 1 29 ? -3.461  14.346  -13.803 1.00 1.19 ? 29 MET A HB2  14 
ATOM   6508  H HB3  . MET A 1 29 ? -2.527  13.664  -15.135 1.00 1.14 ? 29 MET A HB3  14 
ATOM   6509  H HG2  . MET A 1 29 ? -5.079  13.764  -16.190 1.00 1.49 ? 29 MET A HG2  14 
ATOM   6510  H HG3  . MET A 1 29 ? -5.016  15.224  -15.203 1.00 1.46 ? 29 MET A HG3  14 
ATOM   6511  H HE1  . MET A 1 29 ? -5.541  16.186  -17.606 1.00 2.89 ? 29 MET A HE1  14 
ATOM   6512  H HE2  . MET A 1 29 ? -4.369  16.327  -18.914 1.00 2.84 ? 29 MET A HE2  14 
ATOM   6513  H HE3  . MET A 1 29 ? -5.126  14.767  -18.566 1.00 2.95 ? 29 MET A HE3  14 
ATOM   6514  N N    . ALA A 1 30 ? -2.944  11.576  -16.412 1.00 1.05 ? 30 ALA A N    14 
ATOM   6515  C CA   . ALA A 1 30 ? -2.228  10.549  -17.239 1.00 1.11 ? 30 ALA A CA   14 
ATOM   6516  C C    . ALA A 1 30 ? -0.960  10.057  -16.520 1.00 1.00 ? 30 ALA A C    14 
ATOM   6517  O O    . ALA A 1 30 ? -0.686  8.874   -16.602 1.00 0.98 ? 30 ALA A O    14 
ATOM   6518  C CB   . ALA A 1 30 ? -1.861  11.264  -18.542 1.00 1.34 ? 30 ALA A CB   14 
ATOM   6519  O OXT  . ALA A 1 30 ? -0.291  10.870  -15.899 1.00 1.06 ? 30 ALA A OXT  14 
ATOM   6520  H H    . ALA A 1 30 ? -3.099  12.471  -16.777 1.00 1.16 ? 30 ALA A H    14 
ATOM   6521  H HA   . ALA A 1 30 ? -2.882  9.718   -17.449 1.00 1.20 ? 30 ALA A HA   14 
ATOM   6522  H HB1  . ALA A 1 30 ? -1.260  12.134  -18.319 1.00 1.62 ? 30 ALA A HB1  14 
ATOM   6523  H HB2  . ALA A 1 30 ? -1.298  10.592  -19.174 1.00 1.72 ? 30 ALA A HB2  14 
ATOM   6524  H HB3  . ALA A 1 30 ? -2.761  11.568  -19.053 1.00 1.79 ? 30 ALA A HB3  14 
ATOM   6525  N N    . MET A 1 1  ? -9.222  3.163   5.754   1.00 3.11 ? 1  MET A N    15 
ATOM   6526  C CA   . MET A 1 1  ? -8.733  2.627   7.062   1.00 2.82 ? 1  MET A CA   15 
ATOM   6527  C C    . MET A 1 1  ? -7.543  3.455   7.568   1.00 2.39 ? 1  MET A C    15 
ATOM   6528  O O    . MET A 1 1  ? -7.057  4.338   6.886   1.00 2.34 ? 1  MET A O    15 
ATOM   6529  C CB   . MET A 1 1  ? -8.301  1.183   6.771   1.00 3.19 ? 1  MET A CB   15 
ATOM   6530  C CG   . MET A 1 1  ? -9.311  0.209   7.385   1.00 3.71 ? 1  MET A CG   15 
ATOM   6531  S SD   . MET A 1 1  ? -9.302  0.381   9.188   1.00 3.94 ? 1  MET A SD   15 
ATOM   6532  C CE   . MET A 1 1  ? -7.868  -0.674  9.514   1.00 4.88 ? 1  MET A CE   15 
ATOM   6533  H H1   . MET A 1 1  ? -9.519  4.152   5.873   1.00 3.31 ? 1  MET A H1   15 
ATOM   6534  H H2   . MET A 1 1  ? -8.456  3.113   5.050   1.00 3.22 ? 1  MET A H2   15 
ATOM   6535  H H3   . MET A 1 1  ? -10.032 2.598   5.426   1.00 3.32 ? 1  MET A H3   15 
ATOM   6536  H HA   . MET A 1 1  ? -9.529  2.633   7.791   1.00 3.00 ? 1  MET A HA   15 
ATOM   6537  H HB2  . MET A 1 1  ? -8.255  1.029   5.702   1.00 3.47 ? 1  MET A HB2  15 
ATOM   6538  H HB3  . MET A 1 1  ? -7.327  1.006   7.201   1.00 3.18 ? 1  MET A HB3  15 
ATOM   6539  H HG2  . MET A 1 1  ? -10.299 0.429   7.008   1.00 3.88 ? 1  MET A HG2  15 
ATOM   6540  H HG3  . MET A 1 1  ? -9.041  -0.803  7.119   1.00 4.14 ? 1  MET A HG3  15 
ATOM   6541  H HE1  . MET A 1 1  ? -7.936  -1.569  8.912   1.00 5.20 ? 1  MET A HE1  15 
ATOM   6542  H HE2  . MET A 1 1  ? -6.963  -0.143  9.264   1.00 5.20 ? 1  MET A HE2  15 
ATOM   6543  H HE3  . MET A 1 1  ? -7.849  -0.940  10.562  1.00 5.21 ? 1  MET A HE3  15 
ATOM   6544  N N    . ILE A 1 2  ? -7.072  3.173   8.758   1.00 2.24 ? 2  ILE A N    15 
ATOM   6545  C CA   . ILE A 1 2  ? -5.914  3.938   9.317   1.00 1.83 ? 2  ILE A CA   15 
ATOM   6546  C C    . ILE A 1 2  ? -4.946  2.985   10.038  1.00 1.75 ? 2  ILE A C    15 
ATOM   6547  O O    . ILE A 1 2  ? -5.324  1.907   10.459  1.00 2.02 ? 2  ILE A O    15 
ATOM   6548  C CB   . ILE A 1 2  ? -6.538  4.940   10.301  1.00 1.74 ? 2  ILE A CB   15 
ATOM   6549  C CG1  . ILE A 1 2  ? -5.496  5.992   10.693  1.00 1.66 ? 2  ILE A CG1  15 
ATOM   6550  C CG2  . ILE A 1 2  ? -7.022  4.214   11.561  1.00 1.69 ? 2  ILE A CG2  15 
ATOM   6551  C CD1  . ILE A 1 2  ? -6.197  7.218   11.281  1.00 1.89 ? 2  ILE A CD1  15 
ATOM   6552  H H    . ILE A 1 2  ? -7.481  2.455   9.287   1.00 2.49 ? 2  ILE A H    15 
ATOM   6553  H HA   . ILE A 1 2  ? -5.399  4.468   8.531   1.00 1.77 ? 2  ILE A HA   15 
ATOM   6554  H HB   . ILE A 1 2  ? -7.379  5.428   9.826   1.00 1.89 ? 2  ILE A HB   15 
ATOM   6555  H HG12 . ILE A 1 2  ? -4.823  5.574   11.428  1.00 1.78 ? 2  ILE A HG12 15 
ATOM   6556  H HG13 . ILE A 1 2  ? -4.936  6.286   9.819   1.00 1.64 ? 2  ILE A HG13 15 
ATOM   6557  H HG21 . ILE A 1 2  ? -7.530  3.302   11.281  1.00 1.90 ? 2  ILE A HG21 15 
ATOM   6558  H HG22 . ILE A 1 2  ? -6.176  3.976   12.188  1.00 1.53 ? 2  ILE A HG22 15 
ATOM   6559  H HG23 . ILE A 1 2  ? -7.704  4.851   12.105  1.00 2.36 ? 2  ILE A HG23 15 
ATOM   6560  H HD11 . ILE A 1 2  ? -6.991  6.897   11.939  1.00 2.24 ? 2  ILE A HD11 15 
ATOM   6561  H HD12 . ILE A 1 2  ? -5.485  7.808   11.838  1.00 2.14 ? 2  ILE A HD12 15 
ATOM   6562  H HD13 . ILE A 1 2  ? -6.610  7.815   10.481  1.00 2.23 ? 2  ILE A HD13 15 
ATOM   6563  N N    . SER A 1 3  ? -3.704  3.375   10.186  1.00 1.47 ? 3  SER A N    15 
ATOM   6564  C CA   . SER A 1 3  ? -2.717  2.492   10.884  1.00 1.54 ? 3  SER A CA   15 
ATOM   6565  C C    . SER A 1 3  ? -2.901  2.594   12.405  1.00 1.57 ? 3  SER A C    15 
ATOM   6566  O O    . SER A 1 3  ? -3.125  1.607   13.078  1.00 1.85 ? 3  SER A O    15 
ATOM   6567  C CB   . SER A 1 3  ? -1.337  3.013   10.460  1.00 1.31 ? 3  SER A CB   15 
ATOM   6568  O OG   . SER A 1 3  ? -1.159  4.344   10.933  1.00 1.18 ? 3  SER A OG   15 
ATOM   6569  H H    . SER A 1 3  ? -3.420  4.248   9.841   1.00 1.28 ? 3  SER A H    15 
ATOM   6570  H HA   . SER A 1 3  ? -2.837  1.469   10.562  1.00 1.79 ? 3  SER A HA   15 
ATOM   6571  H HB2  . SER A 1 3  ? -0.571  2.384   10.879  1.00 1.45 ? 3  SER A HB2  15 
ATOM   6572  H HB3  . SER A 1 3  ? -1.265  2.991   9.379   1.00 1.36 ? 3  SER A HB3  15 
ATOM   6573  H HG   . SER A 1 3  ? -1.353  4.949   10.209  1.00 0.95 ? 3  SER A HG   15 
ATOM   6574  N N    . SER A 1 4  ? -2.813  3.785   12.946  1.00 1.32 ? 4  SER A N    15 
ATOM   6575  C CA   . SER A 1 4  ? -2.988  3.968   14.422  1.00 1.36 ? 4  SER A CA   15 
ATOM   6576  C C    . SER A 1 4  ? -3.329  5.431   14.728  1.00 1.20 ? 4  SER A C    15 
ATOM   6577  O O    . SER A 1 4  ? -4.458  5.763   15.034  1.00 1.33 ? 4  SER A O    15 
ATOM   6578  C CB   . SER A 1 4  ? -1.642  3.571   15.045  1.00 1.41 ? 4  SER A CB   15 
ATOM   6579  O OG   . SER A 1 4  ? -0.601  4.366   14.486  1.00 1.23 ? 4  SER A OG   15 
ATOM   6580  H H    . SER A 1 4  ? -2.632  4.563   12.377  1.00 1.14 ? 4  SER A H    15 
ATOM   6581  H HA   . SER A 1 4  ? -3.766  3.322   14.789  1.00 1.56 ? 4  SER A HA   15 
ATOM   6582  H HB2  . SER A 1 4  ? -1.677  3.732   16.110  1.00 1.51 ? 4  SER A HB2  15 
ATOM   6583  H HB3  . SER A 1 4  ? -1.453  2.523   14.850  1.00 1.59 ? 4  SER A HB3  15 
ATOM   6584  H HG   . SER A 1 4  ? -0.322  3.958   13.661  1.00 1.35 ? 4  SER A HG   15 
ATOM   6585  N N    . VAL A 1 5  ? -2.362  6.306   14.634  1.00 1.05 ? 5  VAL A N    15 
ATOM   6586  C CA   . VAL A 1 5  ? -2.617  7.756   14.903  1.00 1.03 ? 5  VAL A CA   15 
ATOM   6587  C C    . VAL A 1 5  ? -2.965  8.475   13.595  1.00 0.98 ? 5  VAL A C    15 
ATOM   6588  O O    . VAL A 1 5  ? -3.850  9.307   13.546  1.00 1.13 ? 5  VAL A O    15 
ATOM   6589  C CB   . VAL A 1 5  ? -1.305  8.290   15.489  1.00 1.10 ? 5  VAL A CB   15 
ATOM   6590  C CG1  . VAL A 1 5  ? -1.409  9.803   15.694  1.00 1.31 ? 5  VAL A CG1  15 
ATOM   6591  C CG2  . VAL A 1 5  ? -1.033  7.615   16.836  1.00 1.26 ? 5  VAL A CG2  15 
ATOM   6592  H H    . VAL A 1 5  ? -1.464  6.006   14.378  1.00 1.06 ? 5  VAL A H    15 
ATOM   6593  H HA   . VAL A 1 5  ? -3.413  7.870   15.614  1.00 1.15 ? 5  VAL A HA   15 
ATOM   6594  H HB   . VAL A 1 5  ? -0.493  8.076   14.809  1.00 1.14 ? 5  VAL A HB   15 
ATOM   6595  H HG11 . VAL A 1 5  ? -2.351  10.038  16.166  1.00 1.85 ? 5  VAL A HG11 15 
ATOM   6596  H HG12 . VAL A 1 5  ? -0.597  10.138  16.323  1.00 1.64 ? 5  VAL A HG12 15 
ATOM   6597  H HG13 . VAL A 1 5  ? -1.351  10.301  14.738  1.00 1.66 ? 5  VAL A HG13 15 
ATOM   6598  H HG21 . VAL A 1 5  ? -1.926  7.651   17.443  1.00 1.52 ? 5  VAL A HG21 15 
ATOM   6599  H HG22 . VAL A 1 5  ? -0.750  6.586   16.672  1.00 1.76 ? 5  VAL A HG22 15 
ATOM   6600  H HG23 . VAL A 1 5  ? -0.232  8.132   17.343  1.00 1.67 ? 5  VAL A HG23 15 
ATOM   6601  N N    . CYS A 1 6  ? -2.271  8.149   12.538  1.00 0.87 ? 6  CYS A N    15 
ATOM   6602  C CA   . CYS A 1 6  ? -2.541  8.791   11.217  1.00 0.85 ? 6  CYS A CA   15 
ATOM   6603  C C    . CYS A 1 6  ? -2.633  7.721   10.119  1.00 0.76 ? 6  CYS A C    15 
ATOM   6604  O O    . CYS A 1 6  ? -2.640  6.534   10.394  1.00 0.85 ? 6  CYS A O    15 
ATOM   6605  C CB   . CYS A 1 6  ? -1.343  9.716   10.978  1.00 0.91 ? 6  CYS A CB   15 
ATOM   6606  S SG   . CYS A 1 6  ? -1.911  11.265  10.233  1.00 1.26 ? 6  CYS A SG   15 
ATOM   6607  H H    . CYS A 1 6  ? -1.570  7.474   12.612  1.00 0.88 ? 6  CYS A H    15 
ATOM   6608  H HA   . CYS A 1 6  ? -3.451  9.369   11.256  1.00 1.01 ? 6  CYS A HA   15 
ATOM   6609  H HB2  . CYS A 1 6  ? -0.857  9.927   11.919  1.00 0.94 ? 6  CYS A HB2  15 
ATOM   6610  H HB3  . CYS A 1 6  ? -0.641  9.233   10.313  1.00 0.92 ? 6  CYS A HB3  15 
ATOM   6611  H HG   . CYS A 1 6  ? -2.471  11.712  10.871  1.00 1.61 ? 6  CYS A HG   15 
ATOM   6612  N N    . VAL A 1 7  ? -2.702  8.133   8.878   1.00 0.71 ? 7  VAL A N    15 
ATOM   6613  C CA   . VAL A 1 7  ? -2.793  7.147   7.753   1.00 0.69 ? 7  VAL A CA   15 
ATOM   6614  C C    . VAL A 1 7  ? -1.518  6.295   7.685   1.00 0.63 ? 7  VAL A C    15 
ATOM   6615  O O    . VAL A 1 7  ? -1.505  5.145   8.084   1.00 0.73 ? 7  VAL A O    15 
ATOM   6616  C CB   . VAL A 1 7  ? -2.958  8.001   6.484   1.00 0.78 ? 7  VAL A CB   15 
ATOM   6617  C CG1  . VAL A 1 7  ? -2.753  7.135   5.236   1.00 0.91 ? 7  VAL A CG1  15 
ATOM   6618  C CG2  . VAL A 1 7  ? -4.366  8.601   6.451   1.00 1.02 ? 7  VAL A CG2  15 
ATOM   6619  H H    . VAL A 1 7  ? -2.694  9.092   8.686   1.00 0.76 ? 7  VAL A H    15 
ATOM   6620  H HA   . VAL A 1 7  ? -3.652  6.514   7.880   1.00 0.82 ? 7  VAL A HA   15 
ATOM   6621  H HB   . VAL A 1 7  ? -2.229  8.798   6.491   1.00 0.71 ? 7  VAL A HB   15 
ATOM   6622  H HG11 . VAL A 1 7  ? -3.215  6.172   5.385   1.00 1.46 ? 7  VAL A HG11 15 
ATOM   6623  H HG12 . VAL A 1 7  ? -3.201  7.622   4.383   1.00 1.22 ? 7  VAL A HG12 15 
ATOM   6624  H HG13 . VAL A 1 7  ? -1.696  7.004   5.059   1.00 0.98 ? 7  VAL A HG13 15 
ATOM   6625  H HG21 . VAL A 1 7  ? -5.094  7.820   6.616   1.00 1.25 ? 7  VAL A HG21 15 
ATOM   6626  H HG22 . VAL A 1 7  ? -4.457  9.347   7.227   1.00 1.48 ? 7  VAL A HG22 15 
ATOM   6627  H HG23 . VAL A 1 7  ? -4.540  9.059   5.490   1.00 1.18 ? 7  VAL A HG23 15 
HETATM 6628  N N    . SEP A 1 8  ? -0.451  6.857   7.181   1.00 0.63 ? 8  SEP A N    15 
HETATM 6629  C CA   . SEP A 1 8  ? 0.839   6.105   7.072   1.00 0.79 ? 8  SEP A CA   15 
HETATM 6630  C CB   . SEP A 1 8  ? 0.616   5.086   5.950   1.00 0.88 ? 8  SEP A CB   15 
HETATM 6631  O OG   . SEP A 1 8  ? 1.037   3.788   6.392   1.00 1.13 ? 8  SEP A OG   15 
HETATM 6632  C C    . SEP A 1 8  ? 1.979   7.059   6.705   1.00 0.84 ? 8  SEP A C    15 
HETATM 6633  O O    . SEP A 1 8  ? 3.030   7.019   7.311   1.00 1.06 ? 8  SEP A O    15 
HETATM 6634  P P    . SEP A 1 8  ? 2.602   3.424   6.496   1.00 1.34 ? 8  SEP A P    15 
HETATM 6635  O O1P  . SEP A 1 8  ? 3.240   3.747   5.201   1.00 1.41 ? 8  SEP A O1P  15 
HETATM 6636  O O2P  . SEP A 1 8  ? 3.131   4.009   7.747   1.00 1.46 ? 8  SEP A O2P  15 
HETATM 6637  O O3P  . SEP A 1 8  ? 2.580   1.823   6.661   1.00 1.61 ? 8  SEP A O3P  15 
HETATM 6638  H H    . SEP A 1 8  ? -0.499  7.782   6.873   1.00 0.63 ? 8  SEP A H    15 
HETATM 6639  H HA   . SEP A 1 8  ? 1.057   5.597   7.994   1.00 0.91 ? 8  SEP A HA   15 
HETATM 6640  H HB2  . SEP A 1 8  ? 1.184   5.383   5.078   1.00 0.92 ? 8  SEP A HB2  15 
HETATM 6641  H HB3  . SEP A 1 8  ? -0.430  5.050   5.696   1.00 0.84 ? 8  SEP A HB3  15 
HETATM 6642  H HOP3 . SEP A 1 8  ? 3.492   1.532   6.724   1.00 1.75 ? 8  SEP A HOP3 15 
ATOM   6643  N N    . SER A 1 9  ? 1.738   7.910   5.716   1.00 0.75 ? 9  SER A N    15 
ATOM   6644  C CA   . SER A 1 9  ? 2.736   8.932   5.206   1.00 0.92 ? 9  SER A CA   15 
ATOM   6645  C C    . SER A 1 9  ? 2.761   8.901   3.678   1.00 0.88 ? 9  SER A C    15 
ATOM   6646  O O    . SER A 1 9  ? 2.878   7.850   3.081   1.00 0.84 ? 9  SER A O    15 
ATOM   6647  C CB   . SER A 1 9  ? 4.132   8.560   5.706   1.00 1.13 ? 9  SER A CB   15 
ATOM   6648  O OG   . SER A 1 9  ? 4.334   9.110   7.003   1.00 1.30 ? 9  SER A OG   15 
ATOM   6649  H H    . SER A 1 9  ? 0.860   7.875   5.288   1.00 0.66 ? 9  SER A H    15 
ATOM   6650  H HA   . SER A 1 9  ? 2.470   9.918   5.554   1.00 1.00 ? 9  SER A HA   15 
ATOM   6651  H HB2  . SER A 1 9  ? 4.230   7.490   5.743   1.00 1.11 ? 9  SER A HB2  15 
ATOM   6652  H HB3  . SER A 1 9  ? 4.867   8.958   5.018   1.00 1.23 ? 9  SER A HB3  15 
ATOM   6653  H HG   . SER A 1 9  ? 4.004   8.473   7.648   1.00 1.28 ? 9  SER A HG   15 
ATOM   6654  N N    . TYR A 1 10 ? 2.670   10.052  3.055   1.00 0.98 ? 10 TYR A N    15 
ATOM   6655  C CA   . TYR A 1 10 ? 2.702   10.143  1.559   1.00 1.03 ? 10 TYR A CA   15 
ATOM   6656  C C    . TYR A 1 10 ? 1.574   9.304   0.915   1.00 0.91 ? 10 TYR A C    15 
ATOM   6657  O O    . TYR A 1 10 ? 0.946   8.479   1.551   1.00 0.84 ? 10 TYR A O    15 
ATOM   6658  C CB   . TYR A 1 10 ? 4.120   9.662   1.176   1.00 1.17 ? 10 TYR A CB   15 
ATOM   6659  C CG   . TYR A 1 10 ? 4.084   8.496   0.216   1.00 1.10 ? 10 TYR A CG   15 
ATOM   6660  C CD1  . TYR A 1 10 ? 3.951   8.730   -1.154  1.00 1.12 ? 10 TYR A CD1  15 
ATOM   6661  C CD2  . TYR A 1 10 ? 4.197   7.190   0.700   1.00 1.10 ? 10 TYR A CD2  15 
ATOM   6662  C CE1  . TYR A 1 10 ? 3.926   7.653   -2.048  1.00 1.12 ? 10 TYR A CE1  15 
ATOM   6663  C CE2  . TYR A 1 10 ? 4.172   6.112   -0.190  1.00 1.15 ? 10 TYR A CE2  15 
ATOM   6664  C CZ   . TYR A 1 10 ? 4.035   6.342   -1.565  1.00 1.16 ? 10 TYR A CZ   15 
ATOM   6665  O OH   . TYR A 1 10 ? 4.004   5.278   -2.442  1.00 1.26 ? 10 TYR A OH   15 
ATOM   6666  H H    . TYR A 1 10 ? 2.596   10.869  3.578   1.00 1.06 ? 10 TYR A H    15 
ATOM   6667  H HA   . TYR A 1 10 ? 2.590   11.174  1.263   1.00 1.14 ? 10 TYR A HA   15 
ATOM   6668  H HB2  . TYR A 1 10 ? 4.652   10.476  0.712   1.00 1.28 ? 10 TYR A HB2  15 
ATOM   6669  H HB3  . TYR A 1 10 ? 4.645   9.365   2.071   1.00 1.27 ? 10 TYR A HB3  15 
ATOM   6670  H HD1  . TYR A 1 10 ? 3.863   9.743   -1.518  1.00 1.18 ? 10 TYR A HD1  15 
ATOM   6671  H HD2  . TYR A 1 10 ? 4.301   7.015   1.763   1.00 1.11 ? 10 TYR A HD2  15 
ATOM   6672  H HE1  . TYR A 1 10 ? 3.824   7.833   -3.108  1.00 1.15 ? 10 TYR A HE1  15 
ATOM   6673  H HE2  . TYR A 1 10 ? 4.255   5.103   0.181   1.00 1.24 ? 10 TYR A HE2  15 
ATOM   6674  H HH   . TYR A 1 10 ? 3.367   4.639   -2.112  1.00 1.30 ? 10 TYR A HH   15 
ATOM   6675  N N    . ARG A 1 11 ? 1.310   9.535   -0.346  1.00 0.95 ? 11 ARG A N    15 
ATOM   6676  C CA   . ARG A 1 11 ? 0.230   8.777   -1.055  1.00 0.93 ? 11 ARG A CA   15 
ATOM   6677  C C    . ARG A 1 11 ? 0.655   7.315   -1.275  1.00 0.90 ? 11 ARG A C    15 
ATOM   6678  O O    . ARG A 1 11 ? 1.431   6.766   -0.521  1.00 0.90 ? 11 ARG A O    15 
ATOM   6679  C CB   . ARG A 1 11 ? 0.070   9.515   -2.392  1.00 1.04 ? 11 ARG A CB   15 
ATOM   6680  C CG   . ARG A 1 11 ? -1.360  10.038  -2.522  1.00 1.18 ? 11 ARG A CG   15 
ATOM   6681  C CD   . ARG A 1 11 ? -2.139  9.164   -3.508  1.00 1.27 ? 11 ARG A CD   15 
ATOM   6682  N NE   . ARG A 1 11 ? -3.320  9.985   -3.896  1.00 1.33 ? 11 ARG A NE   15 
ATOM   6683  C CZ   . ARG A 1 11 ? -4.488  9.736   -3.379  1.00 1.37 ? 11 ARG A CZ   15 
ATOM   6684  N NH1  . ARG A 1 11 ? -5.266  8.848   -3.926  1.00 1.83 ? 11 ARG A NH1  15 
ATOM   6685  N NH2  . ARG A 1 11 ? -4.875  10.377  -2.313  1.00 1.55 ? 11 ARG A NH2  15 
ATOM   6686  H H    . ARG A 1 11 ? 1.821   10.216  -0.829  1.00 1.04 ? 11 ARG A H    15 
ATOM   6687  H HA   . ARG A 1 11 ? -0.690  8.818   -0.500  1.00 0.96 ? 11 ARG A HA   15 
ATOM   6688  H HB2  . ARG A 1 11 ? 0.759   10.346  -2.428  1.00 1.10 ? 11 ARG A HB2  15 
ATOM   6689  H HB3  . ARG A 1 11 ? 0.281   8.841   -3.207  1.00 1.03 ? 11 ARG A HB3  15 
ATOM   6690  H HG2  . ARG A 1 11 ? -1.842  10.012  -1.555  1.00 1.20 ? 11 ARG A HG2  15 
ATOM   6691  H HG3  . ARG A 1 11 ? -1.338  11.055  -2.884  1.00 1.35 ? 11 ARG A HG3  15 
ATOM   6692  H HD2  . ARG A 1 11 ? -1.530  8.941   -4.373  1.00 1.52 ? 11 ARG A HD2  15 
ATOM   6693  H HD3  . ARG A 1 11 ? -2.463  8.253   -3.029  1.00 1.34 ? 11 ARG A HD3  15 
ATOM   6694  H HE   . ARG A 1 11 ? -3.219  10.714  -4.544  1.00 1.69 ? 11 ARG A HE   15 
ATOM   6695  H HH11 . ARG A 1 11 ? -4.966  8.358   -4.744  1.00 2.20 ? 11 ARG A HH11 15 
ATOM   6696  H HH12 . ARG A 1 11 ? -6.163  8.655   -3.531  1.00 2.06 ? 11 ARG A HH12 15 
ATOM   6697  H HH21 . ARG A 1 11 ? -4.275  11.058  -1.895  1.00 1.73 ? 11 ARG A HH21 15 
ATOM   6698  H HH22 . ARG A 1 11 ? -5.770  10.188  -1.913  1.00 1.87 ? 11 ARG A HH22 15 
ATOM   6699  N N    . GLY A 1 12 ? 0.168   6.687   -2.313  1.00 0.98 ? 12 GLY A N    15 
ATOM   6700  C CA   . GLY A 1 12 ? 0.567   5.277   -2.597  1.00 1.08 ? 12 GLY A CA   15 
ATOM   6701  C C    . GLY A 1 12 ? 1.267   5.242   -3.956  1.00 1.16 ? 12 GLY A C    15 
ATOM   6702  O O    . GLY A 1 12 ? 1.340   4.217   -4.605  1.00 1.32 ? 12 GLY A O    15 
ATOM   6703  H H    . GLY A 1 12 ? -0.446  7.147   -2.924  1.00 1.03 ? 12 GLY A H    15 
ATOM   6704  H HA2  . GLY A 1 12 ? 1.243   4.928   -1.829  1.00 1.07 ? 12 GLY A HA2  15 
ATOM   6705  H HA3  . GLY A 1 12 ? -0.308  4.648   -2.629  1.00 1.18 ? 12 GLY A HA3  15 
ATOM   6706  N N    . ARG A 1 13 ? 1.760   6.374   -4.395  1.00 1.11 ? 13 ARG A N    15 
ATOM   6707  C CA   . ARG A 1 13 ? 2.435   6.452   -5.719  1.00 1.21 ? 13 ARG A CA   15 
ATOM   6708  C C    . ARG A 1 13 ? 3.908   6.878   -5.579  1.00 1.27 ? 13 ARG A C    15 
ATOM   6709  O O    . ARG A 1 13 ? 4.304   7.939   -6.030  1.00 1.30 ? 13 ARG A O    15 
ATOM   6710  C CB   . ARG A 1 13 ? 1.614   7.490   -6.499  1.00 1.22 ? 13 ARG A CB   15 
ATOM   6711  C CG   . ARG A 1 13 ? 1.536   8.825   -5.728  1.00 1.22 ? 13 ARG A CG   15 
ATOM   6712  C CD   . ARG A 1 13 ? 2.220   9.958   -6.513  1.00 1.14 ? 13 ARG A CD   15 
ATOM   6713  N NE   . ARG A 1 13 ? 1.868   9.739   -7.949  1.00 1.37 ? 13 ARG A NE   15 
ATOM   6714  C CZ   . ARG A 1 13 ? 2.812   9.626   -8.843  1.00 1.33 ? 13 ARG A CZ   15 
ATOM   6715  N NH1  . ARG A 1 13 ? 3.870   8.912   -8.584  1.00 1.27 ? 13 ARG A NH1  15 
ATOM   6716  N NH2  . ARG A 1 13 ? 2.696   10.228  -9.992  1.00 1.48 ? 13 ARG A NH2  15 
ATOM   6717  H H    . ARG A 1 13 ? 1.668   7.182   -3.854  1.00 1.04 ? 13 ARG A H    15 
ATOM   6718  H HA   . ARG A 1 13 ? 2.376   5.499   -6.214  1.00 1.32 ? 13 ARG A HA   15 
ATOM   6719  H HB2  . ARG A 1 13 ? 2.072   7.654   -7.453  1.00 1.29 ? 13 ARG A HB2  15 
ATOM   6720  H HB3  . ARG A 1 13 ? 0.614   7.109   -6.643  1.00 1.23 ? 13 ARG A HB3  15 
ATOM   6721  H HG2  . ARG A 1 13 ? 0.500   9.081   -5.568  1.00 1.29 ? 13 ARG A HG2  15 
ATOM   6722  H HG3  . ARG A 1 13 ? 2.025   8.715   -4.772  1.00 1.36 ? 13 ARG A HG3  15 
ATOM   6723  H HD2  . ARG A 1 13 ? 1.848   10.917  -6.179  1.00 1.46 ? 13 ARG A HD2  15 
ATOM   6724  H HD3  . ARG A 1 13 ? 3.291   9.910   -6.383  1.00 0.89 ? 13 ARG A HD3  15 
ATOM   6725  H HE   . ARG A 1 13 ? 0.929   9.678   -8.220  1.00 1.68 ? 13 ARG A HE   15 
ATOM   6726  H HH11 . ARG A 1 13 ? 3.956   8.451   -7.699  1.00 1.24 ? 13 ARG A HH11 15 
ATOM   6727  H HH12 . ARG A 1 13 ? 4.600   8.825   -9.266  1.00 1.37 ? 13 ARG A HH12 15 
ATOM   6728  H HH21 . ARG A 1 13 ? 1.883   10.776  -10.189 1.00 1.58 ? 13 ARG A HH21 15 
ATOM   6729  H HH22 . ARG A 1 13 ? 3.418   10.142  -10.678 1.00 1.58 ? 13 ARG A HH22 15 
ATOM   6730  N N    . LYS A 1 14 ? 4.725   6.053   -4.974  1.00 1.36 ? 14 LYS A N    15 
ATOM   6731  C CA   . LYS A 1 14 ? 6.174   6.400   -4.812  1.00 1.53 ? 14 LYS A CA   15 
ATOM   6732  C C    . LYS A 1 14 ? 6.934   6.173   -6.132  1.00 1.63 ? 14 LYS A C    15 
ATOM   6733  O O    . LYS A 1 14 ? 7.832   5.357   -6.216  1.00 1.83 ? 14 LYS A O    15 
ATOM   6734  C CB   . LYS A 1 14 ? 6.695   5.464   -3.708  1.00 1.69 ? 14 LYS A CB   15 
ATOM   6735  C CG   . LYS A 1 14 ? 6.390   3.998   -4.057  1.00 1.77 ? 14 LYS A CG   15 
ATOM   6736  C CD   . LYS A 1 14 ? 7.686   3.184   -4.042  1.00 2.03 ? 14 LYS A CD   15 
ATOM   6737  C CE   . LYS A 1 14 ? 8.076   2.859   -2.596  1.00 2.46 ? 14 LYS A CE   15 
ATOM   6738  N NZ   . LYS A 1 14 ? 8.794   1.553   -2.670  1.00 2.53 ? 14 LYS A NZ   15 
ATOM   6739  H H    . LYS A 1 14 ? 4.388   5.202   -4.627  1.00 1.38 ? 14 LYS A H    15 
ATOM   6740  H HA   . LYS A 1 14 ? 6.278   7.426   -4.498  1.00 1.52 ? 14 LYS A HA   15 
ATOM   6741  H HB2  . LYS A 1 14 ? 7.760   5.592   -3.610  1.00 1.85 ? 14 LYS A HB2  15 
ATOM   6742  H HB3  . LYS A 1 14 ? 6.217   5.714   -2.773  1.00 1.63 ? 14 LYS A HB3  15 
ATOM   6743  H HG2  . LYS A 1 14 ? 5.701   3.592   -3.331  1.00 1.79 ? 14 LYS A HG2  15 
ATOM   6744  H HG3  . LYS A 1 14 ? 5.947   3.945   -5.041  1.00 1.67 ? 14 LYS A HG3  15 
ATOM   6745  H HD2  . LYS A 1 14 ? 7.535   2.266   -4.592  1.00 2.05 ? 14 LYS A HD2  15 
ATOM   6746  H HD3  . LYS A 1 14 ? 8.473   3.757   -4.508  1.00 2.04 ? 14 LYS A HD3  15 
ATOM   6747  H HE2  . LYS A 1 14 ? 8.729   3.629   -2.204  1.00 2.71 ? 14 LYS A HE2  15 
ATOM   6748  H HE3  . LYS A 1 14 ? 7.195   2.764   -1.980  1.00 2.96 ? 14 LYS A HE3  15 
ATOM   6749  H HZ1  . LYS A 1 14 ? 9.548   1.609   -3.384  1.00 2.90 ? 14 LYS A HZ1  15 
ATOM   6750  H HZ2  . LYS A 1 14 ? 9.214   1.334   -1.744  1.00 2.73 ? 14 LYS A HZ2  15 
ATOM   6751  H HZ3  . LYS A 1 14 ? 8.123   0.801   -2.931  1.00 2.75 ? 14 LYS A HZ3  15 
ATOM   6752  N N    . SER A 1 15 ? 6.576   6.899   -7.163  1.00 1.53 ? 15 SER A N    15 
ATOM   6753  C CA   . SER A 1 15 ? 7.268   6.739   -8.482  1.00 1.62 ? 15 SER A CA   15 
ATOM   6754  C C    . SER A 1 15 ? 7.197   8.043   -9.287  1.00 1.54 ? 15 SER A C    15 
ATOM   6755  O O    . SER A 1 15 ? 6.136   8.462   -9.716  1.00 1.56 ? 15 SER A O    15 
ATOM   6756  C CB   . SER A 1 15 ? 6.506   5.623   -9.197  1.00 1.64 ? 15 SER A CB   15 
ATOM   6757  O OG   . SER A 1 15 ? 7.257   5.194   -10.326 1.00 1.84 ? 15 SER A OG   15 
ATOM   6758  H H    . SER A 1 15 ? 5.850   7.550   -7.069  1.00 1.41 ? 15 SER A H    15 
ATOM   6759  H HA   . SER A 1 15 ? 8.295   6.444   -8.334  1.00 1.78 ? 15 SER A HA   15 
ATOM   6760  H HB2  . SER A 1 15 ? 6.366   4.793   -8.526  1.00 1.71 ? 15 SER A HB2  15 
ATOM   6761  H HB3  . SER A 1 15 ? 5.539   5.995   -9.515  1.00 1.55 ? 15 SER A HB3  15 
ATOM   6762  H HG   . SER A 1 15 ? 6.695   4.627   -10.861 1.00 2.10 ? 15 SER A HG   15 
ATOM   6763  N N    . GLY A 1 16 ? 8.319   8.688   -9.496  1.00 1.59 ? 16 GLY A N    15 
ATOM   6764  C CA   . GLY A 1 16 ? 8.323   9.966   -10.272 1.00 1.59 ? 16 GLY A CA   15 
ATOM   6765  C C    . GLY A 1 16 ? 9.720   10.216  -10.846 1.00 1.70 ? 16 GLY A C    15 
ATOM   6766  O O    . GLY A 1 16 ? 10.474  11.019  -10.332 1.00 1.99 ? 16 GLY A O    15 
ATOM   6767  H H    . GLY A 1 16 ? 9.159   8.330   -9.140  1.00 1.70 ? 16 GLY A H    15 
ATOM   6768  H HA2  . GLY A 1 16 ? 7.608   9.899   -11.080 1.00 1.50 ? 16 GLY A HA2  15 
ATOM   6769  H HA3  . GLY A 1 16 ? 8.055   10.783  -9.621  1.00 1.70 ? 16 GLY A HA3  15 
ATOM   6770  N N    . ASN A 1 17 ? 10.068  9.534   -11.908 1.00 1.53 ? 17 ASN A N    15 
ATOM   6771  C CA   . ASN A 1 17 ? 11.417  9.726   -12.524 1.00 1.67 ? 17 ASN A CA   15 
ATOM   6772  C C    . ASN A 1 17 ? 11.317  9.684   -14.058 1.00 1.36 ? 17 ASN A C    15 
ATOM   6773  O O    . ASN A 1 17 ? 10.234  9.696   -14.615 1.00 1.25 ? 17 ASN A O    15 
ATOM   6774  C CB   . ASN A 1 17 ? 12.255  8.554   -12.001 1.00 1.88 ? 17 ASN A CB   15 
ATOM   6775  C CG   . ASN A 1 17 ? 13.690  9.023   -11.751 1.00 2.23 ? 17 ASN A CG   15 
ATOM   6776  O OD1  . ASN A 1 17 ? 14.421  9.297   -12.681 1.00 2.19 ? 17 ASN A OD1  15 
ATOM   6777  N ND2  . ASN A 1 17 ? 14.127  9.129   -10.527 1.00 2.68 ? 17 ASN A ND2  15 
ATOM   6778  H H    . ASN A 1 17 ? 9.440   8.891   -12.302 1.00 1.37 ? 17 ASN A H    15 
ATOM   6779  H HA   . ASN A 1 17 ? 11.849  10.660  -12.202 1.00 1.94 ? 17 ASN A HA   15 
ATOM   6780  H HB2  . ASN A 1 17 ? 11.829  8.190   -11.078 1.00 2.04 ? 17 ASN A HB2  15 
ATOM   6781  H HB3  . ASN A 1 17 ? 12.260  7.760   -12.733 1.00 1.72 ? 17 ASN A HB3  15 
ATOM   6782  H HD21 . ASN A 1 17 ? 13.539  8.910   -9.775  1.00 2.83 ? 17 ASN A HD21 15 
ATOM   6783  H HD22 . ASN A 1 17 ? 15.044  9.428   -10.361 1.00 2.92 ? 17 ASN A HD22 15 
ATOM   6784  N N    . LYS A 1 18 ? 12.435  9.639   -14.742 1.00 1.33 ? 18 LYS A N    15 
ATOM   6785  C CA   . LYS A 1 18 ? 12.406  9.598   -16.239 1.00 1.16 ? 18 LYS A CA   15 
ATOM   6786  C C    . LYS A 1 18 ? 11.722  8.313   -16.733 1.00 1.18 ? 18 LYS A C    15 
ATOM   6787  O O    . LYS A 1 18 ? 12.147  7.220   -16.404 1.00 1.35 ? 18 LYS A O    15 
ATOM   6788  C CB   . LYS A 1 18 ? 13.877  9.618   -16.669 1.00 1.23 ? 18 LYS A CB   15 
ATOM   6789  C CG   . LYS A 1 18 ? 14.061  10.599  -17.829 1.00 1.39 ? 18 LYS A CG   15 
ATOM   6790  C CD   . LYS A 1 18 ? 13.535  9.975   -19.128 1.00 1.43 ? 18 LYS A CD   15 
ATOM   6791  C CE   . LYS A 1 18 ? 14.549  8.957   -19.662 1.00 1.51 ? 18 LYS A CE   15 
ATOM   6792  N NZ   . LYS A 1 18 ? 13.821  8.210   -20.729 1.00 1.58 ? 18 LYS A NZ   15 
ATOM   6793  H H    . LYS A 1 18 ? 13.295  9.633   -14.270 1.00 1.49 ? 18 LYS A H    15 
ATOM   6794  H HA   . LYS A 1 18 ? 11.900  10.468  -16.626 1.00 1.20 ? 18 LYS A HA   15 
ATOM   6795  H HB2  . LYS A 1 18 ? 14.492  9.928   -15.835 1.00 1.35 ? 18 LYS A HB2  15 
ATOM   6796  H HB3  . LYS A 1 18 ? 14.174  8.629   -16.985 1.00 1.28 ? 18 LYS A HB3  15 
ATOM   6797  H HG2  . LYS A 1 18 ? 13.514  11.508  -17.619 1.00 1.52 ? 18 LYS A HG2  15 
ATOM   6798  H HG3  . LYS A 1 18 ? 15.110  10.829  -17.940 1.00 1.56 ? 18 LYS A HG3  15 
ATOM   6799  H HD2  . LYS A 1 18 ? 12.596  9.479   -18.933 1.00 1.33 ? 18 LYS A HD2  15 
ATOM   6800  H HD3  . LYS A 1 18 ? 13.387  10.751  -19.864 1.00 1.72 ? 18 LYS A HD3  15 
ATOM   6801  H HE2  . LYS A 1 18 ? 15.409  9.467   -20.076 1.00 1.81 ? 18 LYS A HE2  15 
ATOM   6802  H HE3  . LYS A 1 18 ? 14.852  8.281   -18.877 1.00 1.45 ? 18 LYS A HE3  15 
ATOM   6803  H HZ1  . LYS A 1 18 ? 12.938  7.805   -20.333 1.00 1.40 ? 18 LYS A HZ1  15 
ATOM   6804  H HZ2  . LYS A 1 18 ? 13.584  8.856   -21.508 1.00 1.74 ? 18 LYS A HZ2  15 
ATOM   6805  H HZ3  . LYS A 1 18 ? 14.422  7.441   -21.089 1.00 1.93 ? 18 LYS A HZ3  15 
ATOM   6806  N N    . PRO A 1 19 ? 10.685  8.491   -17.518 1.00 1.19 ? 19 PRO A N    15 
ATOM   6807  C CA   . PRO A 1 19 ? 9.967   7.295   -18.051 1.00 1.37 ? 19 PRO A CA   15 
ATOM   6808  C C    . PRO A 1 19 ? 10.744  6.682   -19.229 1.00 1.43 ? 19 PRO A C    15 
ATOM   6809  O O    . PRO A 1 19 ? 11.665  7.290   -19.746 1.00 1.39 ? 19 PRO A O    15 
ATOM   6810  C CB   . PRO A 1 19 ? 8.619   7.848   -18.511 1.00 1.45 ? 19 PRO A CB   15 
ATOM   6811  C CG   . PRO A 1 19 ? 8.873   9.290   -18.789 1.00 1.37 ? 19 PRO A CG   15 
ATOM   6812  C CD   . PRO A 1 19 ? 9.954   9.730   -17.841 1.00 1.24 ? 19 PRO A CD   15 
ATOM   6813  H HA   . PRO A 1 19 ? 9.820   6.565   -17.272 1.00 1.59 ? 19 PRO A HA   15 
ATOM   6814  H HB2  . PRO A 1 19 ? 8.292   7.341   -19.409 1.00 1.55 ? 19 PRO A HB2  15 
ATOM   6815  H HB3  . PRO A 1 19 ? 7.883   7.746   -17.730 1.00 1.64 ? 19 PRO A HB3  15 
ATOM   6816  H HG2  . PRO A 1 19 ? 9.200   9.416   -19.813 1.00 1.39 ? 19 PRO A HG2  15 
ATOM   6817  H HG3  . PRO A 1 19 ? 7.978   9.866   -18.612 1.00 1.55 ? 19 PRO A HG3  15 
ATOM   6818  H HD2  . PRO A 1 19 ? 10.608  10.444  -18.321 1.00 1.28 ? 19 PRO A HD2  15 
ATOM   6819  H HD3  . PRO A 1 19 ? 9.524   10.150  -16.945 1.00 1.37 ? 19 PRO A HD3  15 
ATOM   6820  N N    . PRO A 1 20 ? 10.346  5.491   -19.613 1.00 1.70 ? 20 PRO A N    15 
ATOM   6821  C CA   . PRO A 1 20 ? 11.051  4.826   -20.750 1.00 1.94 ? 20 PRO A CA   15 
ATOM   6822  C C    . PRO A 1 20 ? 10.823  5.592   -22.065 1.00 1.84 ? 20 PRO A C    15 
ATOM   6823  O O    . PRO A 1 20 ? 11.747  5.817   -22.822 1.00 1.87 ? 20 PRO A O    15 
ATOM   6824  C CB   . PRO A 1 20 ? 10.428  3.432   -20.808 1.00 2.34 ? 20 PRO A CB   15 
ATOM   6825  C CG   . PRO A 1 20 ? 9.085   3.587   -20.181 1.00 2.34 ? 20 PRO A CG   15 
ATOM   6826  C CD   . PRO A 1 20 ? 9.215   4.669   -19.145 1.00 2.00 ? 20 PRO A CD   15 
ATOM   6827  H HA   . PRO A 1 20 ? 12.106  4.746   -20.542 1.00 2.00 ? 20 PRO A HA   15 
ATOM   6828  H HB2  . PRO A 1 20 ? 10.332  3.105   -21.835 1.00 2.50 ? 20 PRO A HB2  15 
ATOM   6829  H HB3  . PRO A 1 20 ? 11.022  2.730   -20.243 1.00 2.52 ? 20 PRO A HB3  15 
ATOM   6830  H HG2  . PRO A 1 20 ? 8.358   3.871   -20.930 1.00 2.35 ? 20 PRO A HG2  15 
ATOM   6831  H HG3  . PRO A 1 20 ? 8.789   2.664   -19.707 1.00 2.63 ? 20 PRO A HG3  15 
ATOM   6832  H HD2  . PRO A 1 20 ? 8.308   5.259   -19.099 1.00 1.96 ? 20 PRO A HD2  15 
ATOM   6833  H HD3  . PRO A 1 20 ? 9.440   4.245   -18.179 1.00 2.11 ? 20 PRO A HD3  15 
ATOM   6834  N N    . SER A 1 21 ? 9.606   5.998   -22.334 1.00 1.91 ? 21 SER A N    15 
ATOM   6835  C CA   . SER A 1 21 ? 9.324   6.753   -23.596 1.00 1.90 ? 21 SER A CA   15 
ATOM   6836  C C    . SER A 1 21 ? 9.040   8.231   -23.287 1.00 1.69 ? 21 SER A C    15 
ATOM   6837  O O    . SER A 1 21 ? 9.218   8.687   -22.171 1.00 1.80 ? 21 SER A O    15 
ATOM   6838  C CB   . SER A 1 21 ? 8.088   6.079   -24.195 1.00 1.93 ? 21 SER A CB   15 
ATOM   6839  O OG   . SER A 1 21 ? 7.924   6.513   -25.541 1.00 2.10 ? 21 SER A OG   15 
ATOM   6840  H H    . SER A 1 21 ? 8.878   5.811   -21.706 1.00 2.10 ? 21 SER A H    15 
ATOM   6841  H HA   . SER A 1 21 ? 10.154  6.667   -24.279 1.00 2.10 ? 21 SER A HA   15 
ATOM   6842  H HB2  . SER A 1 21 ? 8.216   5.009   -24.179 1.00 2.13 ? 21 SER A HB2  15 
ATOM   6843  H HB3  . SER A 1 21 ? 7.216   6.344   -23.611 1.00 1.82 ? 21 SER A HB3  15 
ATOM   6844  H HG   . SER A 1 21 ? 7.767   5.739   -26.088 1.00 2.38 ? 21 SER A HG   15 
ATOM   6845  N N    . LYS A 1 22 ? 8.600   8.982   -24.267 1.00 1.49 ? 22 LYS A N    15 
ATOM   6846  C CA   . LYS A 1 22 ? 8.304   10.430  -24.037 1.00 1.38 ? 22 LYS A CA   15 
ATOM   6847  C C    . LYS A 1 22 ? 6.902   10.778  -24.562 1.00 1.35 ? 22 LYS A C    15 
ATOM   6848  O O    . LYS A 1 22 ? 6.752   11.427  -25.582 1.00 1.39 ? 22 LYS A O    15 
ATOM   6849  C CB   . LYS A 1 22 ? 9.387   11.184  -24.819 1.00 1.49 ? 22 LYS A CB   15 
ATOM   6850  C CG   . LYS A 1 22 ? 9.425   12.648  -24.367 1.00 1.50 ? 22 LYS A CG   15 
ATOM   6851  C CD   . LYS A 1 22 ? 9.505   13.564  -25.594 1.00 1.70 ? 22 LYS A CD   15 
ATOM   6852  C CE   . LYS A 1 22 ? 8.220   14.394  -25.706 1.00 1.68 ? 22 LYS A CE   15 
ATOM   6853  N NZ   . LYS A 1 22 ? 7.365   13.660  -26.682 1.00 1.60 ? 22 LYS A NZ   15 
ATOM   6854  H H    . LYS A 1 22 ? 8.464   8.591   -25.157 1.00 1.49 ? 22 LYS A H    15 
ATOM   6855  H HA   . LYS A 1 22 ? 8.379   10.666  -22.987 1.00 1.45 ? 22 LYS A HA   15 
ATOM   6856  H HB2  . LYS A 1 22 ? 10.347  10.724  -24.634 1.00 1.66 ? 22 LYS A HB2  15 
ATOM   6857  H HB3  . LYS A 1 22 ? 9.165   11.139  -25.875 1.00 1.55 ? 22 LYS A HB3  15 
ATOM   6858  H HG2  . LYS A 1 22 ? 8.531   12.874  -23.802 1.00 1.43 ? 22 LYS A HG2  15 
ATOM   6859  H HG3  . LYS A 1 22 ? 10.292  12.808  -23.744 1.00 1.61 ? 22 LYS A HG3  15 
ATOM   6860  H HD2  . LYS A 1 22 ? 10.352  14.227  -25.490 1.00 1.94 ? 22 LYS A HD2  15 
ATOM   6861  H HD3  . LYS A 1 22 ? 9.624   12.965  -26.484 1.00 1.77 ? 22 LYS A HD3  15 
ATOM   6862  H HE2  . LYS A 1 22 ? 7.729   14.456  -24.743 1.00 1.60 ? 22 LYS A HE2  15 
ATOM   6863  H HE3  . LYS A 1 22 ? 8.443   15.382  -26.078 1.00 1.96 ? 22 LYS A HE3  15 
ATOM   6864  H HZ1  . LYS A 1 22 ? 7.189   12.690  -26.334 1.00 1.43 ? 22 LYS A HZ1  15 
ATOM   6865  H HZ2  . LYS A 1 22 ? 6.450   14.162  -26.787 1.00 1.64 ? 22 LYS A HZ2  15 
ATOM   6866  H HZ3  . LYS A 1 22 ? 7.842   13.616  -27.604 1.00 1.75 ? 22 LYS A HZ3  15 
ATOM   6867  N N    . THR A 1 23 ? 5.879   10.350  -23.868 1.00 1.48 ? 23 THR A N    15 
ATOM   6868  C CA   . THR A 1 23 ? 4.479   10.652  -24.314 1.00 1.66 ? 23 THR A CA   15 
ATOM   6869  C C    . THR A 1 23 ? 3.625   11.151  -23.134 1.00 1.97 ? 23 THR A C    15 
ATOM   6870  O O    . THR A 1 23 ? 2.421   10.976  -23.113 1.00 2.25 ? 23 THR A O    15 
ATOM   6871  C CB   . THR A 1 23 ? 3.938   9.321   -24.860 1.00 1.73 ? 23 THR A CB   15 
ATOM   6872  O OG1  . THR A 1 23 ? 2.655   9.530   -25.437 1.00 2.00 ? 23 THR A OG1  15 
ATOM   6873  C CG2  . THR A 1 23 ? 3.826   8.292   -23.729 1.00 1.91 ? 23 THR A CG2  15 
ATOM   6874  H H    . THR A 1 23 ? 6.030   9.830   -23.050 1.00 1.58 ? 23 THR A H    15 
ATOM   6875  H HA   . THR A 1 23 ? 4.489   11.389  -25.101 1.00 1.63 ? 23 THR A HA   15 
ATOM   6876  H HB   . THR A 1 23 ? 4.611   8.944   -25.615 1.00 1.56 ? 23 THR A HB   15 
ATOM   6877  H HG1  . THR A 1 23 ? 2.081   9.913   -24.765 1.00 2.19 ? 23 THR A HG1  15 
ATOM   6878  H HG21 . THR A 1 23 ? 3.167   8.670   -22.961 1.00 2.15 ? 23 THR A HG21 15 
ATOM   6879  H HG22 . THR A 1 23 ? 3.428   7.368   -24.121 1.00 2.44 ? 23 THR A HG22 15 
ATOM   6880  H HG23 . THR A 1 23 ? 4.804   8.113   -23.307 1.00 2.00 ? 23 THR A HG23 15 
ATOM   6881  N N    . CYS A 1 24 ? 4.239   11.771  -22.155 1.00 2.00 ? 24 CYS A N    15 
ATOM   6882  C CA   . CYS A 1 24 ? 3.467   12.284  -20.979 1.00 2.35 ? 24 CYS A CA   15 
ATOM   6883  C C    . CYS A 1 24 ? 4.061   13.614  -20.484 1.00 2.23 ? 24 CYS A C    15 
ATOM   6884  O O    . CYS A 1 24 ? 4.175   13.852  -19.295 1.00 2.43 ? 24 CYS A O    15 
ATOM   6885  C CB   . CYS A 1 24 ? 3.602   11.191  -19.910 1.00 2.71 ? 24 CYS A CB   15 
ATOM   6886  S SG   . CYS A 1 24 ? 5.353   10.906  -19.539 1.00 2.66 ? 24 CYS A SG   15 
ATOM   6887  H H    . CYS A 1 24 ? 5.208   11.903  -22.193 1.00 1.82 ? 24 CYS A H    15 
ATOM   6888  H HA   . CYS A 1 24 ? 2.430   12.414  -21.241 1.00 2.52 ? 24 CYS A HA   15 
ATOM   6889  H HB2  . CYS A 1 24 ? 3.091   11.503  -19.011 1.00 2.97 ? 24 CYS A HB2  15 
ATOM   6890  H HB3  . CYS A 1 24 ? 3.158   10.276  -20.276 1.00 2.85 ? 24 CYS A HB3  15 
ATOM   6891  H HG   . CYS A 1 24 ? 5.666   11.640  -19.006 1.00 2.73 ? 24 CYS A HG   15 
ATOM   6892  N N    . LEU A 1 25 ? 4.439   14.480  -21.393 1.00 1.93 ? 25 LEU A N    15 
ATOM   6893  C CA   . LEU A 1 25 ? 5.027   15.795  -20.993 1.00 1.83 ? 25 LEU A CA   15 
ATOM   6894  C C    . LEU A 1 25 ? 4.387   16.928  -21.811 1.00 1.69 ? 25 LEU A C    15 
ATOM   6895  O O    . LEU A 1 25 ? 3.328   16.763  -22.386 1.00 1.78 ? 25 LEU A O    15 
ATOM   6896  C CB   . LEU A 1 25 ? 6.522   15.664  -21.316 1.00 1.70 ? 25 LEU A CB   15 
ATOM   6897  C CG   . LEU A 1 25 ? 7.210   14.822  -20.239 1.00 1.97 ? 25 LEU A CG   15 
ATOM   6898  C CD1  . LEU A 1 25 ? 8.268   13.927  -20.887 1.00 1.96 ? 25 LEU A CD1  15 
ATOM   6899  C CD2  . LEU A 1 25 ? 7.883   15.747  -19.223 1.00 2.25 ? 25 LEU A CD2  15 
ATOM   6900  H H    . LEU A 1 25 ? 4.336   14.264  -22.343 1.00 1.80 ? 25 LEU A H    15 
ATOM   6901  H HA   . LEU A 1 25 ? 4.891   15.969  -19.938 1.00 2.03 ? 25 LEU A HA   15 
ATOM   6902  H HB2  . LEU A 1 25 ? 6.639   15.185  -22.278 1.00 1.55 ? 25 LEU A HB2  15 
ATOM   6903  H HB3  . LEU A 1 25 ? 6.972   16.644  -21.347 1.00 1.68 ? 25 LEU A HB3  15 
ATOM   6904  H HG   . LEU A 1 25 ? 6.477   14.208  -19.739 1.00 2.14 ? 25 LEU A HG   15 
ATOM   6905  H HD11 . LEU A 1 25 ? 8.996   14.540  -21.397 1.00 2.19 ? 25 LEU A HD11 15 
ATOM   6906  H HD12 . LEU A 1 25 ? 8.760   13.343  -20.124 1.00 2.27 ? 25 LEU A HD12 15 
ATOM   6907  H HD13 . LEU A 1 25 ? 7.792   13.266  -21.597 1.00 2.24 ? 25 LEU A HD13 15 
ATOM   6908  H HD21 . LEU A 1 25 ? 7.150   16.424  -18.811 1.00 2.57 ? 25 LEU A HD21 15 
ATOM   6909  H HD22 . LEU A 1 25 ? 8.314   15.157  -18.429 1.00 2.63 ? 25 LEU A HD22 15 
ATOM   6910  H HD23 . LEU A 1 25 ? 8.662   16.315  -19.712 1.00 2.42 ? 25 LEU A HD23 15 
ATOM   6911  N N    . LYS A 1 26 ? 5.020   18.073  -21.866 1.00 1.60 ? 26 LYS A N    15 
ATOM   6912  C CA   . LYS A 1 26 ? 4.450   19.209  -22.652 1.00 1.50 ? 26 LYS A CA   15 
ATOM   6913  C C    . LYS A 1 26 ? 4.572   18.917  -24.155 1.00 1.30 ? 26 LYS A C    15 
ATOM   6914  O O    . LYS A 1 26 ? 5.548   19.274  -24.790 1.00 1.17 ? 26 LYS A O    15 
ATOM   6915  C CB   . LYS A 1 26 ? 5.292   20.426  -22.268 1.00 1.50 ? 26 LYS A CB   15 
ATOM   6916  C CG   . LYS A 1 26 ? 4.711   21.073  -21.009 1.00 1.93 ? 26 LYS A CG   15 
ATOM   6917  C CD   . LYS A 1 26 ? 5.827   21.783  -20.235 1.00 2.18 ? 26 LYS A CD   15 
ATOM   6918  C CE   . LYS A 1 26 ? 6.422   22.917  -21.084 1.00 2.07 ? 26 LYS A CE   15 
ATOM   6919  N NZ   . LYS A 1 26 ? 5.297   23.872  -21.323 1.00 2.04 ? 26 LYS A NZ   15 
ATOM   6920  H H    . LYS A 1 26 ? 5.870   18.185  -21.393 1.00 1.70 ? 26 LYS A H    15 
ATOM   6921  H HA   . LYS A 1 26 ? 3.418   19.372  -22.385 1.00 1.79 ? 26 LYS A HA   15 
ATOM   6922  H HB2  . LYS A 1 26 ? 6.310   20.115  -22.078 1.00 1.52 ? 26 LYS A HB2  15 
ATOM   6923  H HB3  . LYS A 1 26 ? 5.281   21.142  -23.077 1.00 1.38 ? 26 LYS A HB3  15 
ATOM   6924  H HG2  . LYS A 1 26 ? 3.953   21.791  -21.290 1.00 1.98 ? 26 LYS A HG2  15 
ATOM   6925  H HG3  . LYS A 1 26 ? 4.271   20.312  -20.384 1.00 2.18 ? 26 LYS A HG3  15 
ATOM   6926  H HD2  . LYS A 1 26 ? 5.425   22.191  -19.320 1.00 2.54 ? 26 LYS A HD2  15 
ATOM   6927  H HD3  . LYS A 1 26 ? 6.605   21.070  -19.998 1.00 2.21 ? 26 LYS A HD3  15 
ATOM   6928  H HE2  . LYS A 1 26 ? 7.223   23.404  -20.546 1.00 2.41 ? 26 LYS A HE2  15 
ATOM   6929  H HE3  . LYS A 1 26 ? 6.783   22.530  -22.025 1.00 1.82 ? 26 LYS A HE3  15 
ATOM   6930  H HZ1  . LYS A 1 26 ? 4.676   23.901  -20.488 1.00 2.25 ? 26 LYS A HZ1  15 
ATOM   6931  H HZ2  . LYS A 1 26 ? 5.680   24.820  -21.503 1.00 2.18 ? 26 LYS A HZ2  15 
ATOM   6932  H HZ3  . LYS A 1 26 ? 4.745   23.561  -22.160 1.00 1.76 ? 26 LYS A HZ3  15 
ATOM   6933  N N    . GLU A 1 27 ? 3.590   18.267  -24.725 1.00 1.56 ? 27 GLU A N    15 
ATOM   6934  C CA   . GLU A 1 27 ? 3.645   17.945  -26.187 1.00 1.74 ? 27 GLU A CA   15 
ATOM   6935  C C    . GLU A 1 27 ? 3.111   19.130  -27.013 1.00 1.86 ? 27 GLU A C    15 
ATOM   6936  O O    . GLU A 1 27 ? 2.283   18.966  -27.891 1.00 2.25 ? 27 GLU A O    15 
ATOM   6937  C CB   . GLU A 1 27 ? 2.749   16.708  -26.370 1.00 2.18 ? 27 GLU A CB   15 
ATOM   6938  C CG   . GLU A 1 27 ? 3.151   15.593  -25.387 1.00 2.05 ? 27 GLU A CG   15 
ATOM   6939  C CD   . GLU A 1 27 ? 4.645   15.274  -25.517 1.00 1.99 ? 27 GLU A CD   15 
ATOM   6940  O OE1  . GLU A 1 27 ? 5.072   14.948  -26.614 1.00 1.75 ? 27 GLU A OE1  15 
ATOM   6941  O OE2  . GLU A 1 27 ? 5.336   15.348  -24.513 1.00 2.35 ? 27 GLU A OE2  15 
ATOM   6942  H H    . GLU A 1 27 ? 2.816   17.988  -24.191 1.00 1.81 ? 27 GLU A H    15 
ATOM   6943  H HA   . GLU A 1 27 ? 4.657   17.712  -26.481 1.00 1.61 ? 27 GLU A HA   15 
ATOM   6944  H HB2  . GLU A 1 27 ? 1.720   16.985  -26.194 1.00 2.43 ? 27 GLU A HB2  15 
ATOM   6945  H HB3  . GLU A 1 27 ? 2.850   16.343  -27.382 1.00 2.43 ? 27 GLU A HB3  15 
ATOM   6946  H HG2  . GLU A 1 27 ? 2.941   15.911  -24.379 1.00 2.09 ? 27 GLU A HG2  15 
ATOM   6947  H HG3  . GLU A 1 27 ? 2.579   14.705  -25.606 1.00 2.04 ? 27 GLU A HG3  15 
ATOM   6948  N N    . GLU A 1 28 ? 3.580   20.323  -26.737 1.00 1.60 ? 28 GLU A N    15 
ATOM   6949  C CA   . GLU A 1 28 ? 3.104   21.521  -27.496 1.00 1.73 ? 28 GLU A CA   15 
ATOM   6950  C C    . GLU A 1 28 ? 3.915   21.689  -28.790 1.00 2.03 ? 28 GLU A C    15 
ATOM   6951  O O    . GLU A 1 28 ? 4.654   22.643  -28.954 1.00 2.17 ? 28 GLU A O    15 
ATOM   6952  C CB   . GLU A 1 28 ? 3.334   22.707  -26.548 1.00 1.47 ? 28 GLU A CB   15 
ATOM   6953  C CG   . GLU A 1 28 ? 2.572   22.478  -25.237 1.00 1.40 ? 28 GLU A CG   15 
ATOM   6954  C CD   . GLU A 1 28 ? 3.071   23.457  -24.171 1.00 1.45 ? 28 GLU A CD   15 
ATOM   6955  O OE1  . GLU A 1 28 ? 4.022   23.120  -23.486 1.00 1.52 ? 28 GLU A OE1  15 
ATOM   6956  O OE2  . GLU A 1 28 ? 2.492   24.523  -24.054 1.00 1.67 ? 28 GLU A OE2  15 
ATOM   6957  H H    . GLU A 1 28 ? 4.245   20.433  -26.027 1.00 1.39 ? 28 GLU A H    15 
ATOM   6958  H HA   . GLU A 1 28 ? 2.053   21.430  -27.721 1.00 1.92 ? 28 GLU A HA   15 
ATOM   6959  H HB2  . GLU A 1 28 ? 4.391   22.800  -26.339 1.00 1.47 ? 28 GLU A HB2  15 
ATOM   6960  H HB3  . GLU A 1 28 ? 2.979   23.614  -27.014 1.00 1.58 ? 28 GLU A HB3  15 
ATOM   6961  H HG2  . GLU A 1 28 ? 1.519   22.632  -25.403 1.00 1.63 ? 28 GLU A HG2  15 
ATOM   6962  H HG3  . GLU A 1 28 ? 2.736   21.467  -24.895 1.00 1.34 ? 28 GLU A HG3  15 
ATOM   6963  N N    . MET A 1 29 ? 3.780   20.766  -29.710 1.00 2.39 ? 29 MET A N    15 
ATOM   6964  C CA   . MET A 1 29 ? 4.539   20.865  -30.997 1.00 2.82 ? 29 MET A CA   15 
ATOM   6965  C C    . MET A 1 29 ? 3.575   20.917  -32.195 1.00 3.34 ? 29 MET A C    15 
ATOM   6966  O O    . MET A 1 29 ? 3.895   20.457  -33.276 1.00 3.96 ? 29 MET A O    15 
ATOM   6967  C CB   . MET A 1 29 ? 5.396   19.596  -31.044 1.00 2.96 ? 29 MET A CB   15 
ATOM   6968  C CG   . MET A 1 29 ? 6.710   19.891  -31.772 1.00 3.33 ? 29 MET A CG   15 
ATOM   6969  S SD   . MET A 1 29 ? 7.264   18.404  -32.644 1.00 4.01 ? 29 MET A SD   15 
ATOM   6970  C CE   . MET A 1 29 ? 6.447   18.748  -34.222 1.00 4.61 ? 29 MET A CE   15 
ATOM   6971  H H    . MET A 1 29 ? 3.178   20.006  -29.556 1.00 2.49 ? 29 MET A H    15 
ATOM   6972  H HA   . MET A 1 29 ? 5.175   21.737  -30.992 1.00 2.90 ? 29 MET A HA   15 
ATOM   6973  H HB2  . MET A 1 29 ? 5.607   19.267  -30.036 1.00 2.77 ? 29 MET A HB2  15 
ATOM   6974  H HB3  . MET A 1 29 ? 4.862   18.820  -31.571 1.00 3.26 ? 29 MET A HB3  15 
ATOM   6975  H HG2  . MET A 1 29 ? 6.559   20.690  -32.482 1.00 3.59 ? 29 MET A HG2  15 
ATOM   6976  H HG3  . MET A 1 29 ? 7.461   20.187  -31.053 1.00 3.42 ? 29 MET A HG3  15 
ATOM   6977  H HE1  . MET A 1 29 ? 6.715   19.737  -34.559 1.00 4.97 ? 29 MET A HE1  15 
ATOM   6978  H HE2  . MET A 1 29 ? 6.763   18.021  -34.956 1.00 4.88 ? 29 MET A HE2  15 
ATOM   6979  H HE3  . MET A 1 29 ? 5.374   18.693  -34.090 1.00 4.82 ? 29 MET A HE3  15 
ATOM   6980  N N    . ALA A 1 30 ? 2.400   21.482  -32.007 1.00 3.33 ? 30 ALA A N    15 
ATOM   6981  C CA   . ALA A 1 30 ? 1.399   21.578  -33.121 1.00 4.02 ? 30 ALA A CA   15 
ATOM   6982  C C    . ALA A 1 30 ? 1.056   20.180  -33.677 1.00 4.45 ? 30 ALA A C    15 
ATOM   6983  O O    . ALA A 1 30 ? 0.830   20.070  -34.874 1.00 5.10 ? 30 ALA A O    15 
ATOM   6984  C CB   . ALA A 1 30 ? 2.072   22.454  -34.188 1.00 4.53 ? 30 ALA A CB   15 
ATOM   6985  O OXT  . ALA A 1 30 ? 1.014   19.245  -32.892 1.00 4.34 ? 30 ALA A OXT  15 
ATOM   6986  H H    . ALA A 1 30 ? 2.175   21.848  -31.127 1.00 3.05 ? 30 ALA A H    15 
ATOM   6987  H HA   . ALA A 1 30 ? 0.502   22.063  -32.770 1.00 4.08 ? 30 ALA A HA   15 
ATOM   6988  H HB1  . ALA A 1 30 ? 2.623   23.248  -33.706 1.00 4.73 ? 30 ALA A HB1  15 
ATOM   6989  H HB2  . ALA A 1 30 ? 2.749   21.850  -34.774 1.00 4.72 ? 30 ALA A HB2  15 
ATOM   6990  H HB3  . ALA A 1 30 ? 1.318   22.879  -34.833 1.00 4.88 ? 30 ALA A HB3  15 
ATOM   6991  N N    . MET A 1 1  ? 3.426   9.027   25.979  1.00 3.83 ? 1  MET A N    16 
ATOM   6992  C CA   . MET A 1 1  ? 2.147   8.312   25.671  1.00 3.99 ? 1  MET A CA   16 
ATOM   6993  C C    . MET A 1 1  ? 2.206   7.686   24.269  1.00 3.05 ? 1  MET A C    16 
ATOM   6994  O O    . MET A 1 1  ? 3.057   8.023   23.466  1.00 2.36 ? 1  MET A O    16 
ATOM   6995  C CB   . MET A 1 1  ? 1.049   9.386   25.747  1.00 4.93 ? 1  MET A CB   16 
ATOM   6996  C CG   . MET A 1 1  ? 1.174   10.365  24.572  1.00 4.74 ? 1  MET A CG   16 
ATOM   6997  S SD   . MET A 1 1  ? -0.156  10.054  23.385  1.00 5.59 ? 1  MET A SD   16 
ATOM   6998  C CE   . MET A 1 1  ? 0.831   10.245  21.880  1.00 6.20 ? 1  MET A CE   16 
ATOM   6999  H H1   . MET A 1 1  ? 3.694   9.627   25.172  1.00 4.01 ? 1  MET A H1   16 
ATOM   7000  H H2   . MET A 1 1  ? 3.299   9.620   26.825  1.00 3.56 ? 1  MET A H2   16 
ATOM   7001  H H3   . MET A 1 1  ? 4.178   8.331   26.154  1.00 4.25 ? 1  MET A H3   16 
ATOM   7002  H HA   . MET A 1 1  ? 1.961   7.548   26.410  1.00 4.50 ? 1  MET A HA   16 
ATOM   7003  H HB2  . MET A 1 1  ? 0.080   8.908   25.712  1.00 5.40 ? 1  MET A HB2  16 
ATOM   7004  H HB3  . MET A 1 1  ? 1.144   9.929   26.676  1.00 5.60 ? 1  MET A HB3  16 
ATOM   7005  H HG2  . MET A 1 1  ? 1.098   11.378  24.939  1.00 3.92 ? 1  MET A HG2  16 
ATOM   7006  H HG3  . MET A 1 1  ? 2.129   10.230  24.086  1.00 5.26 ? 1  MET A HG3  16 
ATOM   7007  H HE1  . MET A 1 1  ? 1.293   11.223  21.877  1.00 6.49 ? 1  MET A HE1  16 
ATOM   7008  H HE2  . MET A 1 1  ? 1.598   9.487   21.853  1.00 6.39 ? 1  MET A HE2  16 
ATOM   7009  H HE3  . MET A 1 1  ? 0.191   10.140  21.016  1.00 6.45 ? 1  MET A HE3  16 
ATOM   7010  N N    . ILE A 1 2  ? 1.307   6.780   23.971  1.00 3.41 ? 2  ILE A N    16 
ATOM   7011  C CA   . ILE A 1 2  ? 1.306   6.132   22.621  1.00 2.89 ? 2  ILE A CA   16 
ATOM   7012  C C    . ILE A 1 2  ? 0.171   6.704   21.763  1.00 2.60 ? 2  ILE A C    16 
ATOM   7013  O O    . ILE A 1 2  ? -0.968  6.759   22.185  1.00 3.35 ? 2  ILE A O    16 
ATOM   7014  C CB   . ILE A 1 2  ? 1.085   4.638   22.893  1.00 4.02 ? 2  ILE A CB   16 
ATOM   7015  C CG1  . ILE A 1 2  ? 2.283   4.070   23.663  1.00 4.73 ? 2  ILE A CG1  16 
ATOM   7016  C CG2  . ILE A 1 2  ? 0.940   3.887   21.565  1.00 4.06 ? 2  ILE A CG2  16 
ATOM   7017  C CD1  . ILE A 1 2  ? 1.828   3.601   25.046  1.00 5.98 ? 2  ILE A CD1  16 
ATOM   7018  H H    . ILE A 1 2  ? 0.630   6.527   24.633  1.00 4.25 ? 2  ILE A H    16 
ATOM   7019  H HA   . ILE A 1 2  ? 2.257   6.279   22.133  1.00 2.52 ? 2  ILE A HA   16 
ATOM   7020  H HB   . ILE A 1 2  ? 0.185   4.509   23.477  1.00 4.63 ? 2  ILE A HB   16 
ATOM   7021  H HG12 . ILE A 1 2  ? 2.698   3.235   23.118  1.00 4.91 ? 2  ILE A HG12 16 
ATOM   7022  H HG13 . ILE A 1 2  ? 3.036   4.836   23.774  1.00 4.46 ? 2  ILE A HG13 16 
ATOM   7023  H HG21 . ILE A 1 2  ? 1.649   4.276   20.851  1.00 4.22 ? 2  ILE A HG21 16 
ATOM   7024  H HG22 . ILE A 1 2  ? 1.130   2.835   21.724  1.00 4.45 ? 2  ILE A HG22 16 
ATOM   7025  H HG23 . ILE A 1 2  ? -0.063  4.017   21.185  1.00 3.98 ? 2  ILE A HG23 16 
ATOM   7026  H HD11 . ILE A 1 2  ? 0.973   2.950   24.942  1.00 6.41 ? 2  ILE A HD11 16 
ATOM   7027  H HD12 . ILE A 1 2  ? 2.633   3.064   25.527  1.00 6.29 ? 2  ILE A HD12 16 
ATOM   7028  H HD13 . ILE A 1 2  ? 1.558   4.457   25.647  1.00 6.40 ? 2  ILE A HD13 16 
ATOM   7029  N N    . SER A 1 3  ? 0.477   7.131   20.563  1.00 2.04 ? 3  SER A N    16 
ATOM   7030  C CA   . SER A 1 3  ? -0.584  7.702   19.672  1.00 2.43 ? 3  SER A CA   16 
ATOM   7031  C C    . SER A 1 3  ? -1.444  6.580   19.076  1.00 2.20 ? 3  SER A C    16 
ATOM   7032  O O    . SER A 1 3  ? -2.650  6.567   19.237  1.00 2.23 ? 3  SER A O    16 
ATOM   7033  C CB   . SER A 1 3  ? 0.174   8.448   18.568  1.00 2.88 ? 3  SER A CB   16 
ATOM   7034  O OG   . SER A 1 3  ? -0.704  8.701   17.478  1.00 3.81 ? 3  SER A OG   16 
ATOM   7035  H H    . SER A 1 3  ? 1.404   7.076   20.247  1.00 1.93 ? 3  SER A H    16 
ATOM   7036  H HA   . SER A 1 3  ? -1.202  8.394   20.222  1.00 3.00 ? 3  SER A HA   16 
ATOM   7037  H HB2  . SER A 1 3  ? 0.544   9.384   18.952  1.00 2.91 ? 3  SER A HB2  16 
ATOM   7038  H HB3  . SER A 1 3  ? 1.010   7.845   18.236  1.00 2.86 ? 3  SER A HB3  16 
ATOM   7039  H HG   . SER A 1 3  ? -1.201  9.500   17.674  1.00 4.20 ? 3  SER A HG   16 
ATOM   7040  N N    . SER A 1 4  ? -0.830  5.641   18.388  1.00 2.15 ? 4  SER A N    16 
ATOM   7041  C CA   . SER A 1 4  ? -1.597  4.504   17.768  1.00 1.99 ? 4  SER A CA   16 
ATOM   7042  C C    . SER A 1 4  ? -2.660  5.013   16.778  1.00 1.99 ? 4  SER A C    16 
ATOM   7043  O O    . SER A 1 4  ? -3.593  4.307   16.444  1.00 2.06 ? 4  SER A O    16 
ATOM   7044  C CB   . SER A 1 4  ? -2.263  3.785   18.939  1.00 1.96 ? 4  SER A CB   16 
ATOM   7045  O OG   . SER A 1 4  ? -1.595  2.552   19.178  1.00 2.22 ? 4  SER A OG   16 
ATOM   7046  H H    . SER A 1 4  ? 0.142   5.682   18.275  1.00 2.35 ? 4  SER A H    16 
ATOM   7047  H HA   . SER A 1 4  ? -0.921  3.831   17.268  1.00 2.16 ? 4  SER A HA   16 
ATOM   7048  H HB2  . SER A 1 4  ? -2.203  4.400   19.821  1.00 1.94 ? 4  SER A HB2  16 
ATOM   7049  H HB3  . SER A 1 4  ? -3.303  3.606   18.700  1.00 1.99 ? 4  SER A HB3  16 
ATOM   7050  H HG   . SER A 1 4  ? -2.091  2.068   19.843  1.00 2.30 ? 4  SER A HG   16 
ATOM   7051  N N    . VAL A 1 5  ? -2.525  6.226   16.309  1.00 2.20 ? 5  VAL A N    16 
ATOM   7052  C CA   . VAL A 1 5  ? -3.526  6.781   15.340  1.00 2.48 ? 5  VAL A CA   16 
ATOM   7053  C C    . VAL A 1 5  ? -3.170  6.390   13.896  1.00 2.27 ? 5  VAL A C    16 
ATOM   7054  O O    . VAL A 1 5  ? -4.030  6.325   13.039  1.00 2.50 ? 5  VAL A O    16 
ATOM   7055  C CB   . VAL A 1 5  ? -3.471  8.304   15.535  1.00 3.01 ? 5  VAL A CB   16 
ATOM   7056  C CG1  . VAL A 1 5  ? -2.249  8.891   14.821  1.00 3.09 ? 5  VAL A CG1  16 
ATOM   7057  C CG2  . VAL A 1 5  ? -4.742  8.937   14.966  1.00 3.49 ? 5  VAL A CG2  16 
ATOM   7058  H H    . VAL A 1 5  ? -1.767  6.773   16.592  1.00 2.34 ? 5  VAL A H    16 
ATOM   7059  H HA   . VAL A 1 5  ? -4.509  6.420   15.583  1.00 2.60 ? 5  VAL A HA   16 
ATOM   7060  H HB   . VAL A 1 5  ? -3.404  8.523   16.591  1.00 3.12 ? 5  VAL A HB   16 
ATOM   7061  H HG11 . VAL A 1 5  ? -1.363  8.346   15.112  1.00 3.38 ? 5  VAL A HG11 16 
ATOM   7062  H HG12 . VAL A 1 5  ? -2.384  8.815   13.752  1.00 3.17 ? 5  VAL A HG12 16 
ATOM   7063  H HG13 . VAL A 1 5  ? -2.137  9.930   15.095  1.00 3.19 ? 5  VAL A HG13 16 
ATOM   7064  H HG21 . VAL A 1 5  ? -5.607  8.510   15.452  1.00 3.92 ? 5  VAL A HG21 16 
ATOM   7065  H HG22 . VAL A 1 5  ? -4.722  10.003  15.137  1.00 3.66 ? 5  VAL A HG22 16 
ATOM   7066  H HG23 . VAL A 1 5  ? -4.796  8.743   13.904  1.00 3.64 ? 5  VAL A HG23 16 
ATOM   7067  N N    . CYS A 1 6  ? -1.907  6.131   13.634  1.00 1.96 ? 6  CYS A N    16 
ATOM   7068  C CA   . CYS A 1 6  ? -1.451  5.741   12.257  1.00 1.75 ? 6  CYS A CA   16 
ATOM   7069  C C    . CYS A 1 6  ? -1.589  6.914   11.274  1.00 2.01 ? 6  CYS A C    16 
ATOM   7070  O O    . CYS A 1 6  ? -2.352  7.838   11.487  1.00 2.45 ? 6  CYS A O    16 
ATOM   7071  C CB   . CYS A 1 6  ? -2.347  4.570   11.836  1.00 1.81 ? 6  CYS A CB   16 
ATOM   7072  S SG   . CYS A 1 6  ? -1.441  3.497   10.693  1.00 2.30 ? 6  CYS A SG   16 
ATOM   7073  H H    . CYS A 1 6  ? -1.250  6.197   14.352  1.00 1.96 ? 6  CYS A H    16 
ATOM   7074  H HA   . CYS A 1 6  ? -0.424  5.414   12.292  1.00 1.65 ? 6  CYS A HA   16 
ATOM   7075  H HB2  . CYS A 1 6  ? -2.633  4.004   12.709  1.00 2.02 ? 6  CYS A HB2  16 
ATOM   7076  H HB3  . CYS A 1 6  ? -3.231  4.951   11.348  1.00 2.30 ? 6  CYS A HB3  16 
ATOM   7077  H HG   . CYS A 1 6  ? -1.489  3.889   9.818   1.00 2.64 ? 6  CYS A HG   16 
ATOM   7078  N N    . VAL A 1 7  ? -0.845  6.878   10.200  1.00 1.90 ? 7  VAL A N    16 
ATOM   7079  C CA   . VAL A 1 7  ? -0.909  7.974   9.191   1.00 2.25 ? 7  VAL A CA   16 
ATOM   7080  C C    . VAL A 1 7  ? -0.736  7.404   7.776   1.00 2.05 ? 7  VAL A C    16 
ATOM   7081  O O    . VAL A 1 7  ? -0.453  6.235   7.592   1.00 1.89 ? 7  VAL A O    16 
ATOM   7082  C CB   . VAL A 1 7  ? 0.252   8.910   9.556   1.00 2.48 ? 7  VAL A CB   16 
ATOM   7083  C CG1  . VAL A 1 7  ? 1.586   8.292   9.124   1.00 2.21 ? 7  VAL A CG1  16 
ATOM   7084  C CG2  . VAL A 1 7  ? 0.068   10.259  8.858   1.00 3.07 ? 7  VAL A CG2  16 
ATOM   7085  H H    . VAL A 1 7  ? -0.238  6.130   10.055  1.00 1.68 ? 7  VAL A H    16 
ATOM   7086  H HA   . VAL A 1 7  ? -1.845  8.502   9.270   1.00 2.62 ? 7  VAL A HA   16 
ATOM   7087  H HB   . VAL A 1 7  ? 0.259   9.059   10.624  1.00 2.57 ? 7  VAL A HB   16 
ATOM   7088  H HG11 . VAL A 1 7  ? 1.556   7.223   9.279   1.00 2.13 ? 7  VAL A HG11 16 
ATOM   7089  H HG12 . VAL A 1 7  ? 1.757   8.498   8.077   1.00 2.59 ? 7  VAL A HG12 16 
ATOM   7090  H HG13 . VAL A 1 7  ? 2.387   8.717   9.710   1.00 2.41 ? 7  VAL A HG13 16 
ATOM   7091  H HG21 . VAL A 1 7  ? -0.985  10.467  8.746   1.00 3.21 ? 7  VAL A HG21 16 
ATOM   7092  H HG22 . VAL A 1 7  ? 0.528   11.036  9.451   1.00 3.45 ? 7  VAL A HG22 16 
ATOM   7093  H HG23 . VAL A 1 7  ? 0.535   10.227  7.884   1.00 3.36 ? 7  VAL A HG23 16 
HETATM 7094  N N    . SEP A 1 8  ? -0.904  8.228   6.783   1.00 2.20 ? 8  SEP A N    16 
HETATM 7095  C CA   . SEP A 1 8  ? -0.752  7.760   5.369   1.00 2.08 ? 8  SEP A CA   16 
HETATM 7096  C CB   . SEP A 1 8  ? -2.023  8.228   4.655   1.00 2.51 ? 8  SEP A CB   16 
HETATM 7097  O OG   . SEP A 1 8  ? -2.929  7.124   4.521   1.00 2.62 ? 8  SEP A OG   16 
HETATM 7098  C C    . SEP A 1 8  ? 0.494   8.388   4.734   1.00 1.86 ? 8  SEP A C    16 
HETATM 7099  O O    . SEP A 1 8  ? 1.385   7.690   4.294   1.00 1.60 ? 8  SEP A O    16 
HETATM 7100  P P    . SEP A 1 8  ? -3.803  6.618   5.776   1.00 2.87 ? 8  SEP A P    16 
HETATM 7101  O O1P  . SEP A 1 8  ? -3.796  7.680   6.807   1.00 3.04 ? 8  SEP A O1P  16 
HETATM 7102  O O2P  . SEP A 1 8  ? -5.090  6.096   5.264   1.00 3.12 ? 8  SEP A O2P  16 
HETATM 7103  O O3P  . SEP A 1 8  ? -2.941  5.377   6.328   1.00 2.85 ? 8  SEP A O3P  16 
HETATM 7104  H H    . SEP A 1 8  ? -1.128  9.161   6.969   1.00 2.46 ? 8  SEP A H    16 
HETATM 7105  H HA   . SEP A 1 8  ? -0.685  6.689   5.334   1.00 1.94 ? 8  SEP A HA   16 
HETATM 7106  H HB2  . SEP A 1 8  ? -1.763  8.614   3.679   1.00 2.58 ? 8  SEP A HB2  16 
HETATM 7107  H HB3  . SEP A 1 8  ? -2.496  9.008   5.230   1.00 2.73 ? 8  SEP A HB3  16 
HETATM 7108  H HOP3 . SEP A 1 8  ? -2.076  5.716   6.568   1.00 2.98 ? 8  SEP A HOP3 16 
ATOM   7109  N N    . SER A 1 9  ? 0.551   9.703   4.701   1.00 2.05 ? 9  SER A N    16 
ATOM   7110  C CA   . SER A 1 9  ? 1.723   10.435  4.114   1.00 2.01 ? 9  SER A CA   16 
ATOM   7111  C C    . SER A 1 9  ? 1.858   10.176  2.611   1.00 1.95 ? 9  SER A C    16 
ATOM   7112  O O    . SER A 1 9  ? 1.810   9.053   2.160   1.00 1.74 ? 9  SER A O    16 
ATOM   7113  C CB   . SER A 1 9  ? 2.959   9.917   4.849   1.00 1.79 ? 9  SER A CB   16 
ATOM   7114  O OG   . SER A 1 9  ? 2.852   10.230  6.233   1.00 1.95 ? 9  SER A OG   16 
ATOM   7115  H H    . SER A 1 9  ? -0.186  10.218  5.075   1.00 2.28 ? 9  SER A H    16 
ATOM   7116  H HA   . SER A 1 9  ? 1.619   11.494  4.293   1.00 2.26 ? 9  SER A HA   16 
ATOM   7117  H HB2  . SER A 1 9  ? 3.033   8.851   4.726   1.00 1.58 ? 9  SER A HB2  16 
ATOM   7118  H HB3  . SER A 1 9  ? 3.841   10.387  4.430   1.00 1.84 ? 9  SER A HB3  16 
ATOM   7119  H HG   . SER A 1 9  ? 3.542   9.752   6.701   1.00 2.05 ? 9  SER A HG   16 
ATOM   7120  N N    . TYR A 1 10 ? 2.053   11.226  1.848   1.00 2.18 ? 10 TYR A N    16 
ATOM   7121  C CA   . TYR A 1 10 ? 2.230   11.112  0.361   1.00 2.21 ? 10 TYR A CA   16 
ATOM   7122  C C    . TYR A 1 10 ? 1.119   10.261  -0.299  1.00 2.07 ? 10 TYR A C    16 
ATOM   7123  O O    . TYR A 1 10 ? 0.234   9.742   0.356   1.00 2.05 ? 10 TYR A O    16 
ATOM   7124  C CB   . TYR A 1 10 ? 3.653   10.520  0.197   1.00 2.13 ? 10 TYR A CB   16 
ATOM   7125  C CG   . TYR A 1 10 ? 3.641   9.121   -0.378  1.00 1.84 ? 10 TYR A CG   16 
ATOM   7126  C CD1  . TYR A 1 10 ? 3.689   8.941   -1.761  1.00 1.86 ? 10 TYR A CD1  16 
ATOM   7127  C CD2  . TYR A 1 10 ? 3.609   8.011   0.473   1.00 1.62 ? 10 TYR A CD2  16 
ATOM   7128  C CE1  . TYR A 1 10 ? 3.695   7.651   -2.300  1.00 1.69 ? 10 TYR A CE1  16 
ATOM   7129  C CE2  . TYR A 1 10 ? 3.617   6.719   -0.065  1.00 1.43 ? 10 TYR A CE2  16 
ATOM   7130  C CZ   . TYR A 1 10 ? 3.658   6.538   -1.452  1.00 1.48 ? 10 TYR A CZ   16 
ATOM   7131  O OH   . TYR A 1 10 ? 3.667   5.263   -1.982  1.00 1.44 ? 10 TYR A OH   16 
ATOM   7132  H H    . TYR A 1 10 ? 2.106   12.106  2.263   1.00 2.36 ? 10 TYR A H    16 
ATOM   7133  H HA   . TYR A 1 10 ? 2.216   12.098  -0.072  1.00 2.45 ? 10 TYR A HA   16 
ATOM   7134  H HB2  . TYR A 1 10 ? 4.222   11.157  -0.461  1.00 2.29 ? 10 TYR A HB2  16 
ATOM   7135  H HB3  . TYR A 1 10 ? 4.134   10.498  1.164   1.00 2.18 ? 10 TYR A HB3  16 
ATOM   7136  H HD1  . TYR A 1 10 ? 3.715   9.803   -2.412  1.00 2.06 ? 10 TYR A HD1  16 
ATOM   7137  H HD2  . TYR A 1 10 ? 3.573   8.152   1.546   1.00 1.66 ? 10 TYR A HD2  16 
ATOM   7138  H HE1  . TYR A 1 10 ? 3.726   7.515   -3.371  1.00 1.78 ? 10 TYR A HE1  16 
ATOM   7139  H HE2  . TYR A 1 10 ? 3.590   5.862   0.591   1.00 1.31 ? 10 TYR A HE2  16 
ATOM   7140  H HH   . TYR A 1 10 ? 2.876   4.810   -1.677  1.00 1.39 ? 10 TYR A HH   16 
ATOM   7141  N N    . ARG A 1 11 ? 1.154   10.141  -1.603  1.00 2.06 ? 11 ARG A N    16 
ATOM   7142  C CA   . ARG A 1 11 ? 0.114   9.343   -2.330  1.00 2.01 ? 11 ARG A CA   16 
ATOM   7143  C C    . ARG A 1 11 ? 0.334   7.840   -2.084  1.00 1.72 ? 11 ARG A C    16 
ATOM   7144  O O    . ARG A 1 11 ? 0.842   7.442   -1.054  1.00 1.59 ? 11 ARG A O    16 
ATOM   7145  C CB   . ARG A 1 11 ? 0.324   9.698   -3.809  1.00 2.15 ? 11 ARG A CB   16 
ATOM   7146  C CG   . ARG A 1 11 ? -0.004  11.177  -4.041  1.00 2.56 ? 11 ARG A CG   16 
ATOM   7147  C CD   . ARG A 1 11 ? -1.169  11.296  -5.029  1.00 2.78 ? 11 ARG A CD   16 
ATOM   7148  N NE   . ARG A 1 11 ? -2.199  12.102  -4.312  1.00 3.19 ? 11 ARG A NE   16 
ATOM   7149  C CZ   . ARG A 1 11 ? -3.242  11.519  -3.796  1.00 3.33 ? 11 ARG A CZ   16 
ATOM   7150  N NH1  . ARG A 1 11 ? -4.296  11.305  -4.530  1.00 3.90 ? 11 ARG A NH1  16 
ATOM   7151  N NH2  . ARG A 1 11 ? -3.230  11.152  -2.547  1.00 3.29 ? 11 ARG A NH2  16 
ATOM   7152  H H    . ARG A 1 11 ? 1.863   10.585  -2.111  1.00 2.14 ? 11 ARG A H    16 
ATOM   7153  H HA   . ARG A 1 11 ? -0.872  9.631   -2.019  1.00 2.14 ? 11 ARG A HA   16 
ATOM   7154  H HB2  . ARG A 1 11 ? 1.354   9.512   -4.080  1.00 2.16 ? 11 ARG A HB2  16 
ATOM   7155  H HB3  . ARG A 1 11 ? -0.321  9.090   -4.420  1.00 2.08 ? 11 ARG A HB3  16 
ATOM   7156  H HG2  . ARG A 1 11 ? -0.278  11.637  -3.102  1.00 2.70 ? 11 ARG A HG2  16 
ATOM   7157  H HG3  . ARG A 1 11 ? 0.861   11.678  -4.446  1.00 2.67 ? 11 ARG A HG3  16 
ATOM   7158  H HD2  . ARG A 1 11 ? -0.846  11.806  -5.928  1.00 3.09 ? 11 ARG A HD2  16 
ATOM   7159  H HD3  . ARG A 1 11 ? -1.563  10.320  -5.270  1.00 2.52 ? 11 ARG A HD3  16 
ATOM   7160  H HE   . ARG A 1 11 ? -2.091  13.072  -4.228  1.00 3.58 ? 11 ARG A HE   16 
ATOM   7161  H HH11 . ARG A 1 11 ? -4.301  11.588  -5.488  1.00 4.28 ? 11 ARG A HH11 16 
ATOM   7162  H HH12 . ARG A 1 11 ? -5.100  10.859  -4.137  1.00 4.15 ? 11 ARG A HH12 16 
ATOM   7163  H HH21 . ARG A 1 11 ? -2.420  11.320  -1.986  1.00 3.30 ? 11 ARG A HH21 16 
ATOM   7164  H HH22 . ARG A 1 11 ? -4.029  10.704  -2.149  1.00 3.52 ? 11 ARG A HH22 16 
ATOM   7165  N N    . GLY A 1 12 ? -0.026  7.003   -3.023  1.00 1.70 ? 12 GLY A N    16 
ATOM   7166  C CA   . GLY A 1 12 ? 0.190   5.537   -2.842  1.00 1.55 ? 12 GLY A CA   16 
ATOM   7167  C C    . GLY A 1 12 ? 1.199   5.051   -3.884  1.00 1.59 ? 12 GLY A C    16 
ATOM   7168  O O    . GLY A 1 12 ? 1.381   3.867   -4.080  1.00 1.67 ? 12 GLY A O    16 
ATOM   7169  H H    . GLY A 1 12 ? -0.420  7.335   -3.858  1.00 1.83 ? 12 GLY A H    16 
ATOM   7170  H HA2  . GLY A 1 12 ? 0.572   5.346   -1.850  1.00 1.43 ? 12 GLY A HA2  16 
ATOM   7171  H HA3  . GLY A 1 12 ? -0.743  5.013   -2.980  1.00 1.64 ? 12 GLY A HA3  16 
ATOM   7172  N N    . ARG A 1 13 ? 1.849   5.968   -4.559  1.00 1.68 ? 13 ARG A N    16 
ATOM   7173  C CA   . ARG A 1 13 ? 2.839   5.589   -5.599  1.00 1.83 ? 13 ARG A CA   16 
ATOM   7174  C C    . ARG A 1 13 ? 4.242   6.105   -5.230  1.00 1.87 ? 13 ARG A C    16 
ATOM   7175  O O    . ARG A 1 13 ? 4.657   7.173   -5.643  1.00 2.03 ? 13 ARG A O    16 
ATOM   7176  C CB   . ARG A 1 13 ? 2.303   6.239   -6.883  1.00 2.01 ? 13 ARG A CB   16 
ATOM   7177  C CG   . ARG A 1 13 ? 2.229   7.767   -6.734  1.00 2.07 ? 13 ARG A CG   16 
ATOM   7178  C CD   . ARG A 1 13 ? 3.065   8.433   -7.834  1.00 2.32 ? 13 ARG A CD   16 
ATOM   7179  N NE   . ARG A 1 13 ? 2.274   8.253   -9.089  1.00 2.52 ? 13 ARG A NE   16 
ATOM   7180  C CZ   . ARG A 1 13 ? 2.882   8.171   -10.238 1.00 2.84 ? 13 ARG A CZ   16 
ATOM   7181  N NH1  . ARG A 1 13 ? 3.176   9.256   -10.896 1.00 3.21 ? 13 ARG A NH1  16 
ATOM   7182  N NH2  . ARG A 1 13 ? 3.194   7.005   -10.727 1.00 2.91 ? 13 ARG A NH2  16 
ATOM   7183  H H    . ARG A 1 13 ? 1.678   6.912   -4.383  1.00 1.71 ? 13 ARG A H    16 
ATOM   7184  H HA   . ARG A 1 13 ? 2.861   4.518   -5.716  1.00 1.87 ? 13 ARG A HA   16 
ATOM   7185  H HB2  . ARG A 1 13 ? 2.950   5.992   -7.700  1.00 2.17 ? 13 ARG A HB2  16 
ATOM   7186  H HB3  . ARG A 1 13 ? 1.312   5.857   -7.083  1.00 2.01 ? 13 ARG A HB3  16 
ATOM   7187  H HG2  . ARG A 1 13 ? 1.200   8.087   -6.819  1.00 2.11 ? 13 ARG A HG2  16 
ATOM   7188  H HG3  . ARG A 1 13 ? 2.616   8.056   -5.768  1.00 1.98 ? 13 ARG A HG3  16 
ATOM   7189  H HD2  . ARG A 1 13 ? 3.198   9.484   -7.616  1.00 2.39 ? 13 ARG A HD2  16 
ATOM   7190  H HD3  . ARG A 1 13 ? 4.023   7.943   -7.926  1.00 2.37 ? 13 ARG A HD3  16 
ATOM   7191  H HE   . ARG A 1 13 ? 1.297   8.199   -9.049  1.00 2.46 ? 13 ARG A HE   16 
ATOM   7192  H HH11 . ARG A 1 13 ? 2.935   10.148  -10.517 1.00 3.29 ? 13 ARG A HH11 16 
ATOM   7193  H HH12 . ARG A 1 13 ? 3.642   9.195   -11.777 1.00 3.49 ? 13 ARG A HH12 16 
ATOM   7194  H HH21 . ARG A 1 13 ? 2.967   6.175   -10.219 1.00 2.75 ? 13 ARG A HH21 16 
ATOM   7195  H HH22 . ARG A 1 13 ? 3.659   6.940   -11.609 1.00 3.22 ? 13 ARG A HH22 16 
ATOM   7196  N N    . LYS A 1 14 ? 4.972   5.352   -4.446  1.00 1.76 ? 14 LYS A N    16 
ATOM   7197  C CA   . LYS A 1 14 ? 6.349   5.785   -4.030  1.00 1.83 ? 14 LYS A CA   16 
ATOM   7198  C C    . LYS A 1 14 ? 7.348   5.696   -5.202  1.00 2.08 ? 14 LYS A C    16 
ATOM   7199  O O    . LYS A 1 14 ? 8.410   5.110   -5.085  1.00 2.15 ? 14 LYS A O    16 
ATOM   7200  C CB   . LYS A 1 14 ? 6.754   4.835   -2.884  1.00 1.69 ? 14 LYS A CB   16 
ATOM   7201  C CG   . LYS A 1 14 ? 6.535   3.356   -3.271  1.00 1.68 ? 14 LYS A CG   16 
ATOM   7202  C CD   . LYS A 1 14 ? 7.859   2.691   -3.677  1.00 1.84 ? 14 LYS A CD   16 
ATOM   7203  C CE   . LYS A 1 14 ? 8.953   2.990   -2.644  1.00 1.86 ? 14 LYS A CE   16 
ATOM   7204  N NZ   . LYS A 1 14 ? 9.977   3.785   -3.386  1.00 1.99 ? 14 LYS A NZ   16 
ATOM   7205  H H    . LYS A 1 14 ? 4.608   4.507   -4.120  1.00 1.66 ? 14 LYS A H    16 
ATOM   7206  H HA   . LYS A 1 14 ? 6.316   6.798   -3.660  1.00 1.86 ? 14 LYS A HA   16 
ATOM   7207  H HB2  . LYS A 1 14 ? 7.791   4.992   -2.652  1.00 1.76 ? 14 LYS A HB2  16 
ATOM   7208  H HB3  . LYS A 1 14 ? 6.159   5.063   -2.012  1.00 1.58 ? 14 LYS A HB3  16 
ATOM   7209  H HG2  . LYS A 1 14 ? 6.117   2.826   -2.427  1.00 1.61 ? 14 LYS A HG2  16 
ATOM   7210  H HG3  . LYS A 1 14 ? 5.847   3.298   -4.099  1.00 1.72 ? 14 LYS A HG3  16 
ATOM   7211  H HD2  . LYS A 1 14 ? 7.712   1.622   -3.741  1.00 1.85 ? 14 LYS A HD2  16 
ATOM   7212  H HD3  . LYS A 1 14 ? 8.165   3.064   -4.642  1.00 2.00 ? 14 LYS A HD3  16 
ATOM   7213  H HE2  . LYS A 1 14 ? 8.548   3.564   -1.820  1.00 1.81 ? 14 LYS A HE2  16 
ATOM   7214  H HE3  . LYS A 1 14 ? 9.390   2.072   -2.282  1.00 1.88 ? 14 LYS A HE3  16 
ATOM   7215  H HZ1  . LYS A 1 14 ? 9.501   4.484   -3.998  1.00 2.04 ? 14 LYS A HZ1  16 
ATOM   7216  H HZ2  . LYS A 1 14 ? 10.593  4.286   -2.706  1.00 1.99 ? 14 LYS A HZ2  16 
ATOM   7217  H HZ3  . LYS A 1 14 ? 10.553  3.146   -3.971  1.00 2.11 ? 14 LYS A HZ3  16 
ATOM   7218  N N    . SER A 1 15 ? 7.026   6.295   -6.323  1.00 2.25 ? 15 SER A N    16 
ATOM   7219  C CA   . SER A 1 15 ? 7.954   6.261   -7.496  1.00 2.52 ? 15 SER A CA   16 
ATOM   7220  C C    . SER A 1 15 ? 8.954   7.426   -7.420  1.00 2.63 ? 15 SER A C    16 
ATOM   7221  O O    . SER A 1 15 ? 8.967   8.304   -8.263  1.00 2.80 ? 15 SER A O    16 
ATOM   7222  C CB   . SER A 1 15 ? 7.048   6.401   -8.722  1.00 2.71 ? 15 SER A CB   16 
ATOM   7223  O OG   . SER A 1 15 ? 7.802   6.131   -9.898  1.00 2.95 ? 15 SER A OG   16 
ATOM   7224  H H    . SER A 1 15 ? 6.176   6.780   -6.387  1.00 2.21 ? 15 SER A H    16 
ATOM   7225  H HA   . SER A 1 15 ? 8.480   5.319   -7.534  1.00 2.54 ? 15 SER A HA   16 
ATOM   7226  H HB2  . SER A 1 15 ? 6.235   5.696   -8.653  1.00 2.67 ? 15 SER A HB2  16 
ATOM   7227  H HB3  . SER A 1 15 ? 6.648   7.406   -8.760  1.00 2.80 ? 15 SER A HB3  16 
ATOM   7228  H HG   . SER A 1 15 ? 8.371   6.887   -10.068 1.00 3.17 ? 15 SER A HG   16 
ATOM   7229  N N    . GLY A 1 16 ? 9.790   7.434   -6.412  1.00 2.68 ? 16 GLY A N    16 
ATOM   7230  C CA   . GLY A 1 16 ? 10.792  8.535   -6.269  1.00 2.82 ? 16 GLY A CA   16 
ATOM   7231  C C    . GLY A 1 16 ? 11.541  8.375   -4.944  1.00 2.49 ? 16 GLY A C    16 
ATOM   7232  O O    . GLY A 1 16 ? 11.196  8.984   -3.950  1.00 2.41 ? 16 GLY A O    16 
ATOM   7233  H H    . GLY A 1 16 ? 9.758   6.714   -5.748  1.00 2.73 ? 16 GLY A H    16 
ATOM   7234  H HA2  . GLY A 1 16 ? 11.494  8.492   -7.089  1.00 3.08 ? 16 GLY A HA2  16 
ATOM   7235  H HA3  . GLY A 1 16 ? 10.285  9.487   -6.278  1.00 2.99 ? 16 GLY A HA3  16 
ATOM   7236  N N    . ASN A 1 17 ? 12.563  7.556   -4.923  1.00 2.45 ? 17 ASN A N    16 
ATOM   7237  C CA   . ASN A 1 17 ? 13.338  7.350   -3.661  1.00 2.27 ? 17 ASN A CA   16 
ATOM   7238  C C    . ASN A 1 17 ? 14.733  7.978   -3.781  1.00 2.28 ? 17 ASN A C    16 
ATOM   7239  O O    . ASN A 1 17 ? 15.342  7.965   -4.835  1.00 2.30 ? 17 ASN A O    16 
ATOM   7240  C CB   . ASN A 1 17 ? 13.442  5.830   -3.503  1.00 2.33 ? 17 ASN A CB   16 
ATOM   7241  C CG   . ASN A 1 17 ? 12.915  5.419   -2.128  1.00 2.23 ? 17 ASN A CG   16 
ATOM   7242  O OD1  . ASN A 1 17 ? 11.796  4.959   -2.006  1.00 2.10 ? 17 ASN A OD1  16 
ATOM   7243  N ND2  . ASN A 1 17 ? 13.675  5.565   -1.079  1.00 2.39 ? 17 ASN A ND2  16 
ATOM   7244  H H    . ASN A 1 17 ? 12.821  7.076   -5.737  1.00 2.63 ? 17 ASN A H    16 
ATOM   7245  H HA   . ASN A 1 17 ? 12.809  7.771   -2.822  1.00 2.23 ? 17 ASN A HA   16 
ATOM   7246  H HB2  . ASN A 1 17 ? 12.855  5.347   -4.271  1.00 2.44 ? 17 ASN A HB2  16 
ATOM   7247  H HB3  . ASN A 1 17 ? 14.473  5.527   -3.597  1.00 2.44 ? 17 ASN A HB3  16 
ATOM   7248  H HD21 . ASN A 1 17 ? 14.578  5.935   -1.173  1.00 2.55 ? 17 ASN A HD21 16 
ATOM   7249  H HD22 . ASN A 1 17 ? 13.343  5.304   -0.195  1.00 2.41 ? 17 ASN A HD22 16 
ATOM   7250  N N    . LYS A 1 18 ? 15.244  8.524   -2.705  1.00 2.38 ? 18 LYS A N    16 
ATOM   7251  C CA   . LYS A 1 18 ? 16.599  9.153   -2.746  1.00 2.47 ? 18 LYS A CA   16 
ATOM   7252  C C    . LYS A 1 18 ? 17.638  8.222   -2.100  1.00 2.34 ? 18 LYS A C    16 
ATOM   7253  O O    . LYS A 1 18 ? 17.526  7.885   -0.936  1.00 2.59 ? 18 LYS A O    16 
ATOM   7254  C CB   . LYS A 1 18 ? 16.457  10.449  -1.941  1.00 3.00 ? 18 LYS A CB   16 
ATOM   7255  C CG   . LYS A 1 18 ? 16.008  11.584  -2.868  1.00 3.25 ? 18 LYS A CG   16 
ATOM   7256  C CD   . LYS A 1 18 ? 17.116  12.640  -2.964  1.00 3.47 ? 18 LYS A CD   16 
ATOM   7257  C CE   . LYS A 1 18 ? 17.434  12.927  -4.438  1.00 3.41 ? 18 LYS A CE   16 
ATOM   7258  N NZ   . LYS A 1 18 ? 18.255  11.768  -4.901  1.00 2.83 ? 18 LYS A NZ   16 
ATOM   7259  H H    . LYS A 1 18 ? 14.734  8.520   -1.867  1.00 2.47 ? 18 LYS A H    16 
ATOM   7260  H HA   . LYS A 1 18 ? 16.878  9.381   -3.762  1.00 2.38 ? 18 LYS A HA   16 
ATOM   7261  H HB2  . LYS A 1 18 ? 15.723  10.309  -1.160  1.00 3.13 ? 18 LYS A HB2  16 
ATOM   7262  H HB3  . LYS A 1 18 ? 17.407  10.702  -1.498  1.00 3.17 ? 18 LYS A HB3  16 
ATOM   7263  H HG2  . LYS A 1 18 ? 15.801  11.185  -3.851  1.00 3.06 ? 18 LYS A HG2  16 
ATOM   7264  H HG3  . LYS A 1 18 ? 15.114  12.039  -2.470  1.00 3.55 ? 18 LYS A HG3  16 
ATOM   7265  H HD2  . LYS A 1 18 ? 16.784  13.550  -2.485  1.00 3.97 ? 18 LYS A HD2  16 
ATOM   7266  H HD3  . LYS A 1 18 ? 18.003  12.278  -2.469  1.00 3.27 ? 18 LYS A HD3  16 
ATOM   7267  H HE2  . LYS A 1 18 ? 16.519  12.998  -5.010  1.00 3.45 ? 18 LYS A HE2  16 
ATOM   7268  H HE3  . LYS A 1 18 ? 18.003  13.841  -4.525  1.00 3.85 ? 18 LYS A HE3  16 
ATOM   7269  H HZ1  . LYS A 1 18 ? 18.798  11.370  -4.097  1.00 2.67 ? 18 LYS A HZ1  16 
ATOM   7270  H HZ2  . LYS A 1 18 ? 17.632  11.034  -5.291  1.00 2.75 ? 18 LYS A HZ2  16 
ATOM   7271  H HZ3  . LYS A 1 18 ? 18.921  12.088  -5.642  1.00 2.80 ? 18 LYS A HZ3  16 
ATOM   7272  N N    . PRO A 1 19 ? 18.616  7.835   -2.886  1.00 2.09 ? 19 PRO A N    16 
ATOM   7273  C CA   . PRO A 1 19 ? 19.669  6.927   -2.339  1.00 2.15 ? 19 PRO A CA   16 
ATOM   7274  C C    . PRO A 1 19 ? 20.863  7.736   -1.799  1.00 2.28 ? 19 PRO A C    16 
ATOM   7275  O O    . PRO A 1 19 ? 20.899  8.947   -1.924  1.00 2.32 ? 19 PRO A O    16 
ATOM   7276  C CB   . PRO A 1 19 ? 20.087  6.083   -3.540  1.00 1.93 ? 19 PRO A CB   16 
ATOM   7277  C CG   . PRO A 1 19 ? 19.759  6.917   -4.733  1.00 1.71 ? 19 PRO A CG   16 
ATOM   7278  C CD   . PRO A 1 19 ? 18.583  7.777   -4.358  1.00 1.86 ? 19 PRO A CD   16 
ATOM   7279  H HA   . PRO A 1 19 ? 19.260  6.294   -1.568  1.00 2.37 ? 19 PRO A HA   16 
ATOM   7280  H HB2  . PRO A 1 19 ? 21.149  5.876   -3.504  1.00 1.97 ? 19 PRO A HB2  16 
ATOM   7281  H HB3  . PRO A 1 19 ? 19.525  5.163   -3.568  1.00 2.06 ? 19 PRO A HB3  16 
ATOM   7282  H HG2  . PRO A 1 19 ? 20.606  7.538   -4.991  1.00 1.58 ? 19 PRO A HG2  16 
ATOM   7283  H HG3  . PRO A 1 19 ? 19.495  6.285   -5.566  1.00 1.80 ? 19 PRO A HG3  16 
ATOM   7284  H HD2  . PRO A 1 19 ? 18.692  8.768   -4.780  1.00 1.98 ? 19 PRO A HD2  16 
ATOM   7285  H HD3  . PRO A 1 19 ? 17.662  7.324   -4.691  1.00 1.89 ? 19 PRO A HD3  16 
ATOM   7286  N N    . PRO A 1 20 ? 21.807  7.030   -1.219  1.00 2.51 ? 20 PRO A N    16 
ATOM   7287  C CA   . PRO A 1 20 ? 23.008  7.729   -0.673  1.00 2.77 ? 20 PRO A CA   16 
ATOM   7288  C C    . PRO A 1 20 ? 24.089  7.871   -1.760  1.00 2.42 ? 20 PRO A C    16 
ATOM   7289  O O    . PRO A 1 20 ? 23.843  7.613   -2.923  1.00 1.98 ? 20 PRO A O    16 
ATOM   7290  C CB   . PRO A 1 20 ? 23.482  6.817   0.457   1.00 3.32 ? 20 PRO A CB   16 
ATOM   7291  C CG   . PRO A 1 20 ? 22.970  5.463   0.099   1.00 3.25 ? 20 PRO A CG   16 
ATOM   7292  C CD   . PRO A 1 20 ? 21.693  5.668   -0.669  1.00 2.81 ? 20 PRO A CD   16 
ATOM   7293  H HA   . PRO A 1 20 ? 22.737  8.696   -0.279  1.00 2.91 ? 20 PRO A HA   16 
ATOM   7294  H HB2  . PRO A 1 20 ? 24.562  6.812   0.509   1.00 3.47 ? 20 PRO A HB2  16 
ATOM   7295  H HB3  . PRO A 1 20 ? 23.061  7.134   1.399   1.00 3.64 ? 20 PRO A HB3  16 
ATOM   7296  H HG2  . PRO A 1 20 ? 23.694  4.945   -0.516  1.00 3.21 ? 20 PRO A HG2  16 
ATOM   7297  H HG3  . PRO A 1 20 ? 22.769  4.895   0.994   1.00 3.63 ? 20 PRO A HG3  16 
ATOM   7298  H HD2  . PRO A 1 20 ? 21.612  4.940   -1.465  1.00 2.63 ? 20 PRO A HD2  16 
ATOM   7299  H HD3  . PRO A 1 20 ? 20.841  5.606   -0.008  1.00 3.01 ? 20 PRO A HD3  16 
ATOM   7300  N N    . SER A 1 21 ? 25.282  8.281   -1.383  1.00 2.68 ? 21 SER A N    16 
ATOM   7301  C CA   . SER A 1 21 ? 26.393  8.447   -2.381  1.00 2.44 ? 21 SER A CA   16 
ATOM   7302  C C    . SER A 1 21 ? 25.980  9.428   -3.491  1.00 1.91 ? 21 SER A C    16 
ATOM   7303  O O    . SER A 1 21 ? 25.650  9.030   -4.592  1.00 1.49 ? 21 SER A O    16 
ATOM   7304  C CB   . SER A 1 21 ? 26.637  7.044   -2.951  1.00 2.43 ? 21 SER A CB   16 
ATOM   7305  O OG   . SER A 1 21 ? 27.943  6.985   -3.517  1.00 2.52 ? 21 SER A OG   16 
ATOM   7306  H H    . SER A 1 21 ? 25.449  8.482   -0.438  1.00 3.07 ? 21 SER A H    16 
ATOM   7307  H HA   . SER A 1 21 ? 27.286  8.799   -1.888  1.00 2.79 ? 21 SER A HA   16 
ATOM   7308  H HB2  . SER A 1 21 ? 26.557  6.314   -2.162  1.00 2.83 ? 21 SER A HB2  16 
ATOM   7309  H HB3  . SER A 1 21 ? 25.895  6.831   -3.710  1.00 2.09 ? 21 SER A HB3  16 
ATOM   7310  H HG   . SER A 1 21 ? 28.390  6.213   -3.153  1.00 2.89 ? 21 SER A HG   16 
ATOM   7311  N N    . LYS A 1 22 ? 25.999  10.711  -3.199  1.00 2.09 ? 22 LYS A N    16 
ATOM   7312  C CA   . LYS A 1 22 ? 25.603  11.749  -4.217  1.00 1.84 ? 22 LYS A CA   16 
ATOM   7313  C C    . LYS A 1 22 ? 24.157  11.512  -4.675  1.00 1.68 ? 22 LYS A C    16 
ATOM   7314  O O    . LYS A 1 22 ? 23.907  10.961  -5.731  1.00 1.35 ? 22 LYS A O    16 
ATOM   7315  C CB   . LYS A 1 22 ? 26.578  11.589  -5.395  1.00 1.49 ? 22 LYS A CB   16 
ATOM   7316  C CG   . LYS A 1 22 ? 28.020  11.791  -4.918  1.00 1.83 ? 22 LYS A CG   16 
ATOM   7317  C CD   . LYS A 1 22 ? 28.954  10.864  -5.704  1.00 1.74 ? 22 LYS A CD   16 
ATOM   7318  C CE   . LYS A 1 22 ? 29.226  9.594   -4.889  1.00 2.15 ? 22 LYS A CE   16 
ATOM   7319  N NZ   . LYS A 1 22 ? 28.315  8.559   -5.460  1.00 1.87 ? 22 LYS A NZ   16 
ATOM   7320  H H    . LYS A 1 22 ? 26.269  10.995  -2.299  1.00 2.51 ? 22 LYS A H    16 
ATOM   7321  H HA   . LYS A 1 22 ? 25.698  12.739  -3.798  1.00 2.19 ? 22 LYS A HA   16 
ATOM   7322  H HB2  . LYS A 1 22 ? 26.472  10.603  -5.819  1.00 1.22 ? 22 LYS A HB2  16 
ATOM   7323  H HB3  . LYS A 1 22 ? 26.347  12.326  -6.150  1.00 1.54 ? 22 LYS A HB3  16 
ATOM   7324  H HG2  . LYS A 1 22 ? 28.311  12.819  -5.081  1.00 2.00 ? 22 LYS A HG2  16 
ATOM   7325  H HG3  . LYS A 1 22 ? 28.088  11.561  -3.865  1.00 2.19 ? 22 LYS A HG3  16 
ATOM   7326  H HD2  . LYS A 1 22 ? 28.490  10.598  -6.643  1.00 1.46 ? 22 LYS A HD2  16 
ATOM   7327  H HD3  . LYS A 1 22 ? 29.886  11.372  -5.895  1.00 1.93 ? 22 LYS A HD3  16 
ATOM   7328  H HE2  . LYS A 1 22 ? 30.259  9.292   -5.005  1.00 2.50 ? 22 LYS A HE2  16 
ATOM   7329  H HE3  . LYS A 1 22 ? 28.995  9.758   -3.848  1.00 2.45 ? 22 LYS A HE3  16 
ATOM   7330  H HZ1  . LYS A 1 22 ? 27.356  8.953   -5.559  1.00 1.51 ? 22 LYS A HZ1  16 
ATOM   7331  H HZ2  . LYS A 1 22 ? 28.669  8.260   -6.400  1.00 1.90 ? 22 LYS A HZ2  16 
ATOM   7332  H HZ3  . LYS A 1 22 ? 28.286  7.733   -4.821  1.00 2.17 ? 22 LYS A HZ3  16 
ATOM   7333  N N    . THR A 1 23 ? 23.201  11.924  -3.881  1.00 2.10 ? 23 THR A N    16 
ATOM   7334  C CA   . THR A 1 23 ? 21.768  11.720  -4.262  1.00 2.14 ? 23 THR A CA   16 
ATOM   7335  C C    . THR A 1 23 ? 21.290  12.836  -5.209  1.00 2.45 ? 23 THR A C    16 
ATOM   7336  O O    . THR A 1 23 ? 20.402  12.630  -6.016  1.00 2.66 ? 23 THR A O    16 
ATOM   7337  C CB   . THR A 1 23 ? 20.994  11.729  -2.933  1.00 2.59 ? 23 THR A CB   16 
ATOM   7338  O OG1  . THR A 1 23 ? 19.795  10.983  -3.087  1.00 2.55 ? 23 THR A OG1  16 
ATOM   7339  C CG2  . THR A 1 23 ? 20.650  13.162  -2.514  1.00 3.18 ? 23 THR A CG2  16 
ATOM   7340  H H    . THR A 1 23 ? 23.427  12.364  -3.034  1.00 2.45 ? 23 THR A H    16 
ATOM   7341  H HA   . THR A 1 23 ? 21.650  10.760  -4.741  1.00 1.78 ? 23 THR A HA   16 
ATOM   7342  H HB   . THR A 1 23 ? 21.602  11.273  -2.166  1.00 2.65 ? 23 THR A HB   16 
ATOM   7343  H HG1  . THR A 1 23 ? 19.902  10.153  -2.602  1.00 2.44 ? 23 THR A HG1  16 
ATOM   7344  H HG21 . THR A 1 23 ? 21.548  13.761  -2.507  1.00 3.77 ? 23 THR A HG21 16 
ATOM   7345  H HG22 . THR A 1 23 ? 19.943  13.582  -3.212  1.00 2.91 ? 23 THR A HG22 16 
ATOM   7346  H HG23 . THR A 1 23 ? 20.217  13.151  -1.525  1.00 3.57 ? 23 THR A HG23 16 
ATOM   7347  N N    . CYS A 1 24 ? 21.877  14.007  -5.127  1.00 2.64 ? 24 CYS A N    16 
ATOM   7348  C CA   . CYS A 1 24 ? 21.462  15.120  -6.033  1.00 3.11 ? 24 CYS A CA   16 
ATOM   7349  C C    . CYS A 1 24 ? 22.481  15.262  -7.170  1.00 2.88 ? 24 CYS A C    16 
ATOM   7350  O O    . CYS A 1 24 ? 22.157  15.082  -8.330  1.00 3.00 ? 24 CYS A O    16 
ATOM   7351  C CB   . CYS A 1 24 ? 21.445  16.373  -5.152  1.00 3.66 ? 24 CYS A CB   16 
ATOM   7352  S SG   . CYS A 1 24 ? 19.924  16.402  -4.172  1.00 4.43 ? 24 CYS A SG   16 
ATOM   7353  H H    . CYS A 1 24 ? 22.596  14.149  -4.479  1.00 2.56 ? 24 CYS A H    16 
ATOM   7354  H HA   . CYS A 1 24 ? 20.478  14.934  -6.432  1.00 3.33 ? 24 CYS A HA   16 
ATOM   7355  H HB2  . CYS A 1 24 ? 22.299  16.362  -4.491  1.00 3.78 ? 24 CYS A HB2  16 
ATOM   7356  H HB3  . CYS A 1 24 ? 21.487  17.254  -5.777  1.00 3.76 ? 24 CYS A HB3  16 
ATOM   7357  H HG   . CYS A 1 24 ? 20.139  16.115  -3.282  1.00 4.66 ? 24 CYS A HG   16 
ATOM   7358  N N    . LEU A 1 25 ? 23.713  15.564  -6.842  1.00 2.67 ? 25 LEU A N    16 
ATOM   7359  C CA   . LEU A 1 25 ? 24.765  15.704  -7.894  1.00 2.50 ? 25 LEU A CA   16 
ATOM   7360  C C    . LEU A 1 25 ? 25.508  14.372  -8.065  1.00 1.91 ? 25 LEU A C    16 
ATOM   7361  O O    . LEU A 1 25 ? 26.604  14.188  -7.568  1.00 1.63 ? 25 LEU A O    16 
ATOM   7362  C CB   . LEU A 1 25 ? 25.706  16.798  -7.380  1.00 2.69 ? 25 LEU A CB   16 
ATOM   7363  C CG   . LEU A 1 25 ? 25.315  18.141  -7.997  1.00 3.40 ? 25 LEU A CG   16 
ATOM   7364  C CD1  . LEU A 1 25 ? 25.722  19.276  -7.057  1.00 3.71 ? 25 LEU A CD1  16 
ATOM   7365  C CD2  . LEU A 1 25 ? 26.031  18.313  -9.339  1.00 3.68 ? 25 LEU A CD2  16 
ATOM   7366  H H    . LEU A 1 25 ? 23.950  15.690  -5.899  1.00 2.72 ? 25 LEU A H    16 
ATOM   7367  H HA   . LEU A 1 25 ? 24.322  16.008  -8.830  1.00 2.83 ? 25 LEU A HA   16 
ATOM   7368  H HB2  . LEU A 1 25 ? 25.631  16.861  -6.303  1.00 2.66 ? 25 LEU A HB2  16 
ATOM   7369  H HB3  . LEU A 1 25 ? 26.722  16.559  -7.656  1.00 2.54 ? 25 LEU A HB3  16 
ATOM   7370  H HG   . LEU A 1 25 ? 24.246  18.170  -8.152  1.00 3.67 ? 25 LEU A HG   16 
ATOM   7371  H HD11 . LEU A 1 25 ? 25.223  19.153  -6.108  1.00 3.99 ? 25 LEU A HD11 16 
ATOM   7372  H HD12 . LEU A 1 25 ? 26.791  19.253  -6.907  1.00 3.81 ? 25 LEU A HD12 16 
ATOM   7373  H HD13 . LEU A 1 25 ? 25.439  20.222  -7.492  1.00 4.00 ? 25 LEU A HD13 16 
ATOM   7374  H HD21 . LEU A 1 25 ? 25.833  17.455  -9.966  1.00 3.77 ? 25 LEU A HD21 16 
ATOM   7375  H HD22 . LEU A 1 25 ? 25.673  19.205  -9.828  1.00 4.05 ? 25 LEU A HD22 16 
ATOM   7376  H HD23 . LEU A 1 25 ? 27.095  18.397  -9.171  1.00 3.90 ? 25 LEU A HD23 16 
ATOM   7377  N N    . LYS A 1 26 ? 24.915  13.445  -8.770  1.00 1.99 ? 26 LYS A N    16 
ATOM   7378  C CA   . LYS A 1 26 ? 25.574  12.119  -8.987  1.00 1.76 ? 26 LYS A CA   16 
ATOM   7379  C C    . LYS A 1 26 ? 26.310  12.111  -10.336 1.00 2.20 ? 26 LYS A C    16 
ATOM   7380  O O    . LYS A 1 26 ? 26.187  11.189  -11.121 1.00 2.56 ? 26 LYS A O    16 
ATOM   7381  C CB   . LYS A 1 26 ? 24.429  11.089  -8.964  1.00 1.79 ? 26 LYS A CB   16 
ATOM   7382  C CG   . LYS A 1 26 ? 23.452  11.344  -10.123 1.00 2.29 ? 26 LYS A CG   16 
ATOM   7383  C CD   . LYS A 1 26 ? 22.141  11.922  -9.576  1.00 2.51 ? 26 LYS A CD   16 
ATOM   7384  C CE   . LYS A 1 26 ? 21.370  12.616  -10.707 1.00 3.16 ? 26 LYS A CE   16 
ATOM   7385  N NZ   . LYS A 1 26 ? 21.835  14.037  -10.690 1.00 3.30 ? 26 LYS A NZ   16 
ATOM   7386  H H    . LYS A 1 26 ? 24.036  13.622  -9.161  1.00 2.40 ? 26 LYS A H    16 
ATOM   7387  H HA   . LYS A 1 26 ? 26.267  11.912  -8.186  1.00 1.57 ? 26 LYS A HA   16 
ATOM   7388  H HB2  . LYS A 1 26 ? 24.843  10.096  -9.059  1.00 1.81 ? 26 LYS A HB2  16 
ATOM   7389  H HB3  . LYS A 1 26 ? 23.899  11.165  -8.026  1.00 1.65 ? 26 LYS A HB3  16 
ATOM   7390  H HG2  . LYS A 1 26 ? 23.892  12.041  -10.819 1.00 2.53 ? 26 LYS A HG2  16 
ATOM   7391  H HG3  . LYS A 1 26 ? 23.248  10.412  -10.630 1.00 2.45 ? 26 LYS A HG3  16 
ATOM   7392  H HD2  . LYS A 1 26 ? 21.539  11.120  -9.171  1.00 2.49 ? 26 LYS A HD2  16 
ATOM   7393  H HD3  . LYS A 1 26 ? 22.358  12.636  -8.797  1.00 2.40 ? 26 LYS A HD3  16 
ATOM   7394  H HE2  . LYS A 1 26 ? 21.603  12.153  -11.657 1.00 3.35 ? 26 LYS A HE2  16 
ATOM   7395  H HE3  . LYS A 1 26 ? 20.308  12.572  -10.518 1.00 3.44 ? 26 LYS A HE3  16 
ATOM   7396  H HZ1  . LYS A 1 26 ? 21.870  14.386  -9.706  1.00 3.13 ? 26 LYS A HZ1  16 
ATOM   7397  H HZ2  . LYS A 1 26 ? 22.794  14.096  -11.112 1.00 3.17 ? 26 LYS A HZ2  16 
ATOM   7398  H HZ3  . LYS A 1 26 ? 21.178  14.623  -11.243 1.00 3.79 ? 26 LYS A HZ3  16 
ATOM   7399  N N    . GLU A 1 27 ? 27.078  13.138  -10.605 1.00 2.31 ? 27 GLU A N    16 
ATOM   7400  C CA   . GLU A 1 27 ? 27.826  13.204  -11.900 1.00 2.85 ? 27 GLU A CA   16 
ATOM   7401  C C    . GLU A 1 27 ? 29.309  12.870  -11.669 1.00 2.69 ? 27 GLU A C    16 
ATOM   7402  O O    . GLU A 1 27 ? 30.191  13.609  -12.067 1.00 2.87 ? 27 GLU A O    16 
ATOM   7403  C CB   . GLU A 1 27 ? 27.674  14.654  -12.413 1.00 3.25 ? 27 GLU A CB   16 
ATOM   7404  C CG   . GLU A 1 27 ? 26.313  15.262  -12.014 1.00 3.43 ? 27 GLU A CG   16 
ATOM   7405  C CD   . GLU A 1 27 ? 25.156  14.358  -12.461 1.00 3.25 ? 27 GLU A CD   16 
ATOM   7406  O OE1  . GLU A 1 27 ? 25.168  13.920  -13.599 1.00 3.38 ? 27 GLU A OE1  16 
ATOM   7407  O OE2  . GLU A 1 27 ? 24.268  14.131  -11.653 1.00 3.16 ? 27 GLU A OE2  16 
ATOM   7408  H H    . GLU A 1 27 ? 27.165  13.865  -9.954  1.00 2.13 ? 27 GLU A H    16 
ATOM   7409  H HA   . GLU A 1 27 ? 27.397  12.517  -12.614 1.00 3.25 ? 27 GLU A HA   16 
ATOM   7410  H HB2  . GLU A 1 27 ? 28.465  15.261  -11.996 1.00 3.49 ? 27 GLU A HB2  16 
ATOM   7411  H HB3  . GLU A 1 27 ? 27.760  14.657  -13.490 1.00 3.38 ? 27 GLU A HB3  16 
ATOM   7412  H HG2  . GLU A 1 27 ? 26.274  15.386  -10.943 1.00 3.37 ? 27 GLU A HG2  16 
ATOM   7413  H HG3  . GLU A 1 27 ? 26.206  16.228  -12.485 1.00 3.90 ? 27 GLU A HG3  16 
ATOM   7414  N N    . GLU A 1 28 ? 29.592  11.763  -11.024 1.00 2.58 ? 28 GLU A N    16 
ATOM   7415  C CA   . GLU A 1 28 ? 31.019  11.385  -10.765 1.00 2.83 ? 28 GLU A CA   16 
ATOM   7416  C C    . GLU A 1 28 ? 31.578  10.512  -11.904 1.00 3.49 ? 28 GLU A C    16 
ATOM   7417  O O    . GLU A 1 28 ? 32.775  10.440  -12.102 1.00 3.88 ? 28 GLU A O    16 
ATOM   7418  C CB   . GLU A 1 28 ? 30.998  10.614  -9.436  1.00 2.63 ? 28 GLU A CB   16 
ATOM   7419  C CG   . GLU A 1 28 ? 30.455  9.194   -9.651  1.00 2.67 ? 28 GLU A CG   16 
ATOM   7420  C CD   . GLU A 1 28 ? 30.421  8.445   -8.316  1.00 2.45 ? 28 GLU A CD   16 
ATOM   7421  O OE1  . GLU A 1 28 ? 31.483  8.165   -7.784  1.00 2.94 ? 28 GLU A OE1  16 
ATOM   7422  O OE2  . GLU A 1 28 ? 29.330  8.163   -7.847  1.00 2.06 ? 28 GLU A OE2  16 
ATOM   7423  H H    . GLU A 1 28 ? 28.868  11.182  -10.710 1.00 2.47 ? 28 GLU A H    16 
ATOM   7424  H HA   . GLU A 1 28 ? 31.621  12.274  -10.657 1.00 2.85 ? 28 GLU A HA   16 
ATOM   7425  H HB2  . GLU A 1 28 ? 32.003  10.556  -9.041  1.00 3.02 ? 28 GLU A HB2  16 
ATOM   7426  H HB3  . GLU A 1 28 ? 30.367  11.134  -8.731  1.00 2.29 ? 28 GLU A HB3  16 
ATOM   7427  H HG2  . GLU A 1 28 ? 29.456  9.248   -10.057 1.00 2.58 ? 28 GLU A HG2  16 
ATOM   7428  H HG3  . GLU A 1 28 ? 31.094  8.664   -10.340 1.00 3.15 ? 28 GLU A HG3  16 
ATOM   7429  N N    . MET A 1 29 ? 30.725  9.850   -12.651 1.00 3.87 ? 29 MET A N    16 
ATOM   7430  C CA   . MET A 1 29 ? 31.215  8.986   -13.769 1.00 4.59 ? 29 MET A CA   16 
ATOM   7431  C C    . MET A 1 29 ? 31.200  9.763   -15.093 1.00 4.83 ? 29 MET A C    16 
ATOM   7432  O O    . MET A 1 29 ? 30.243  10.441  -15.415 1.00 4.78 ? 29 MET A O    16 
ATOM   7433  C CB   . MET A 1 29 ? 30.235  7.809   -13.824 1.00 5.18 ? 29 MET A CB   16 
ATOM   7434  C CG   . MET A 1 29 ? 30.947  6.530   -13.379 1.00 5.82 ? 29 MET A CG   16 
ATOM   7435  S SD   . MET A 1 29 ? 29.885  5.102   -13.709 1.00 6.51 ? 29 MET A SD   16 
ATOM   7436  C CE   . MET A 1 29 ? 30.314  4.897   -15.455 1.00 7.57 ? 29 MET A CE   16 
ATOM   7437  H H    . MET A 1 29 ? 29.764  9.922   -12.476 1.00 3.84 ? 29 MET A H    16 
ATOM   7438  H HA   . MET A 1 29 ? 32.209  8.628   -13.557 1.00 4.77 ? 29 MET A HA   16 
ATOM   7439  H HB2  . MET A 1 29 ? 29.400  8.004   -13.168 1.00 5.07 ? 29 MET A HB2  16 
ATOM   7440  H HB3  . MET A 1 29 ? 29.876  7.685   -14.836 1.00 5.51 ? 29 MET A HB3  16 
ATOM   7441  H HG2  . MET A 1 29 ? 31.873  6.423   -13.925 1.00 5.73 ? 29 MET A HG2  16 
ATOM   7442  H HG3  . MET A 1 29 ? 31.158  6.585   -12.321 1.00 6.26 ? 29 MET A HG3  16 
ATOM   7443  H HE1  . MET A 1 29 ? 31.382  4.759   -15.549 1.00 7.71 ? 29 MET A HE1  16 
ATOM   7444  H HE2  . MET A 1 29 ? 29.797  4.034   -15.852 1.00 7.98 ? 29 MET A HE2  16 
ATOM   7445  H HE3  . MET A 1 29 ? 30.017  5.775   -16.006 1.00 7.94 ? 29 MET A HE3  16 
ATOM   7446  N N    . ALA A 1 30 ? 32.257  9.663   -15.861 1.00 5.35 ? 30 ALA A N    16 
ATOM   7447  C CA   . ALA A 1 30 ? 32.316  10.388  -17.168 1.00 5.75 ? 30 ALA A CA   16 
ATOM   7448  C C    . ALA A 1 30 ? 33.047  9.539   -18.219 1.00 6.65 ? 30 ALA A C    16 
ATOM   7449  O O    . ALA A 1 30 ? 34.049  8.931   -17.875 1.00 6.95 ? 30 ALA A O    16 
ATOM   7450  C CB   . ALA A 1 30 ? 33.097  11.672  -16.873 1.00 5.46 ? 30 ALA A CB   16 
ATOM   7451  O OXT  . ALA A 1 30 ? 32.592  9.514   -19.350 1.00 7.22 ? 30 ALA A OXT  16 
ATOM   7452  H H    . ALA A 1 30 ? 33.013  9.108   -15.580 1.00 5.62 ? 30 ALA A H    16 
ATOM   7453  H HA   . ALA A 1 30 ? 31.322  10.633  -17.509 1.00 5.82 ? 30 ALA A HA   16 
ATOM   7454  H HB1  . ALA A 1 30 ? 34.064  11.417  -16.466 1.00 5.69 ? 30 ALA A HB1  16 
ATOM   7455  H HB2  . ALA A 1 30 ? 33.226  12.232  -17.787 1.00 5.46 ? 30 ALA A HB2  16 
ATOM   7456  H HB3  . ALA A 1 30 ? 32.551  12.269  -16.159 1.00 5.42 ? 30 ALA A HB3  16 
ATOM   7457  N N    . MET A 1 1  ? -10.827 12.193  16.721  1.00 3.23 ? 1  MET A N    17 
ATOM   7458  C CA   . MET A 1 1  ? -9.880  11.151  16.216  1.00 2.47 ? 1  MET A CA   17 
ATOM   7459  C C    . MET A 1 1  ? -8.585  11.805  15.713  1.00 2.16 ? 1  MET A C    17 
ATOM   7460  O O    . MET A 1 1  ? -8.584  12.944  15.287  1.00 2.59 ? 1  MET A O    17 
ATOM   7461  C CB   . MET A 1 1  ? -10.618 10.462  15.061  1.00 2.71 ? 1  MET A CB   17 
ATOM   7462  C CG   . MET A 1 1  ? -10.916 9.007   15.434  1.00 2.75 ? 1  MET A CG   17 
ATOM   7463  S SD   . MET A 1 1  ? -12.085 8.962   16.815  1.00 3.22 ? 1  MET A SD   17 
ATOM   7464  C CE   . MET A 1 1  ? -12.184 7.162   16.971  1.00 3.59 ? 1  MET A CE   17 
ATOM   7465  H H1   . MET A 1 1  ? -10.948 12.933  15.999  1.00 3.58 ? 1  MET A H1   17 
ATOM   7466  H H2   . MET A 1 1  ? -11.749 11.757  16.925  1.00 3.44 ? 1  MET A H2   17 
ATOM   7467  H H3   . MET A 1 1  ? -10.444 12.617  17.591  1.00 3.55 ? 1  MET A H3   17 
ATOM   7468  H HA   . MET A 1 1  ? -9.661  10.434  16.992  1.00 2.39 ? 1  MET A HA   17 
ATOM   7469  H HB2  . MET A 1 1  ? -11.547 10.980  14.865  1.00 3.30 ? 1  MET A HB2  17 
ATOM   7470  H HB3  . MET A 1 1  ? -10.002 10.484  14.175  1.00 2.64 ? 1  MET A HB3  17 
ATOM   7471  H HG2  . MET A 1 1  ? -11.345 8.498   14.583  1.00 3.03 ? 1  MET A HG2  17 
ATOM   7472  H HG3  . MET A 1 1  ? -9.999  8.514   15.722  1.00 2.83 ? 1  MET A HG3  17 
ATOM   7473  H HE1  . MET A 1 1  ? -11.186 6.752   17.043  1.00 3.79 ? 1  MET A HE1  17 
ATOM   7474  H HE2  . MET A 1 1  ? -12.748 6.909   17.858  1.00 3.76 ? 1  MET A HE2  17 
ATOM   7475  H HE3  . MET A 1 1  ? -12.677 6.750   16.104  1.00 4.08 ? 1  MET A HE3  17 
ATOM   7476  N N    . ILE A 1 2  ? -7.487  11.090  15.759  1.00 1.72 ? 2  ILE A N    17 
ATOM   7477  C CA   . ILE A 1 2  ? -6.187  11.666  15.283  1.00 1.88 ? 2  ILE A CA   17 
ATOM   7478  C C    . ILE A 1 2  ? -5.424  10.636  14.439  1.00 1.58 ? 2  ILE A C    17 
ATOM   7479  O O    . ILE A 1 2  ? -5.570  9.441   14.619  1.00 1.58 ? 2  ILE A O    17 
ATOM   7480  C CB   . ILE A 1 2  ? -5.393  12.016  16.553  1.00 2.14 ? 2  ILE A CB   17 
ATOM   7481  C CG1  . ILE A 1 2  ? -5.288  10.787  17.466  1.00 1.95 ? 2  ILE A CG1  17 
ATOM   7482  C CG2  . ILE A 1 2  ? -6.096  13.148  17.306  1.00 2.58 ? 2  ILE A CG2  17 
ATOM   7483  C CD1  . ILE A 1 2  ? -3.951  10.815  18.210  1.00 2.55 ? 2  ILE A CD1  17 
ATOM   7484  H H    . ILE A 1 2  ? -7.516  10.173  16.106  1.00 1.59 ? 2  ILE A H    17 
ATOM   7485  H HA   . ILE A 1 2  ? -6.365  12.560  14.706  1.00 2.34 ? 2  ILE A HA   17 
ATOM   7486  H HB   . ILE A 1 2  ? -4.401  12.340  16.271  1.00 2.48 ? 2  ILE A HB   17 
ATOM   7487  H HG12 . ILE A 1 2  ? -6.097  10.800  18.182  1.00 2.02 ? 2  ILE A HG12 17 
ATOM   7488  H HG13 . ILE A 1 2  ? -5.347  9.888   16.873  1.00 1.64 ? 2  ILE A HG13 17 
ATOM   7489  H HG21 . ILE A 1 2  ? -6.465  13.877  16.600  1.00 2.97 ? 2  ILE A HG21 17 
ATOM   7490  H HG22 . ILE A 1 2  ? -6.922  12.745  17.873  1.00 2.85 ? 2  ILE A HG22 17 
ATOM   7491  H HG23 . ILE A 1 2  ? -5.395  13.621  17.979  1.00 2.79 ? 2  ILE A HG23 17 
ATOM   7492  H HD11 . ILE A 1 2  ? -3.152  10.997  17.506  1.00 2.79 ? 2  ILE A HD11 17 
ATOM   7493  H HD12 . ILE A 1 2  ? -3.966  11.604  18.948  1.00 2.93 ? 2  ILE A HD12 17 
ATOM   7494  H HD13 . ILE A 1 2  ? -3.791  9.867   18.701  1.00 2.94 ? 2  ILE A HD13 17 
ATOM   7495  N N    . SER A 1 3  ? -4.608  11.092  13.523  1.00 1.66 ? 3  SER A N    17 
ATOM   7496  C CA   . SER A 1 3  ? -3.828  10.143  12.667  1.00 1.48 ? 3  SER A CA   17 
ATOM   7497  C C    . SER A 1 3  ? -2.337  10.184  13.040  1.00 1.47 ? 3  SER A C    17 
ATOM   7498  O O    . SER A 1 3  ? -1.472  10.184  12.185  1.00 1.62 ? 3  SER A O    17 
ATOM   7499  C CB   . SER A 1 3  ? -4.044  10.633  11.230  1.00 1.76 ? 3  SER A CB   17 
ATOM   7500  O OG   . SER A 1 3  ? -4.708  9.620   10.481  1.00 1.91 ? 3  SER A OG   17 
ATOM   7501  H H    . SER A 1 3  ? -4.503  12.059  13.400  1.00 2.01 ? 3  SER A H    17 
ATOM   7502  H HA   . SER A 1 3  ? -4.212  9.140   12.772  1.00 1.62 ? 3  SER A HA   17 
ATOM   7503  H HB2  . SER A 1 3  ? -4.651  11.523  11.238  1.00 2.08 ? 3  SER A HB2  17 
ATOM   7504  H HB3  . SER A 1 3  ? -3.085  10.859  10.779  1.00 2.37 ? 3  SER A HB3  17 
ATOM   7505  H HG   . SER A 1 3  ? -4.254  8.782   10.639  1.00 1.87 ? 3  SER A HG   17 
ATOM   7506  N N    . SER A 1 4  ? -2.032  10.219  14.315  1.00 1.68 ? 4  SER A N    17 
ATOM   7507  C CA   . SER A 1 4  ? -0.597  10.262  14.748  1.00 2.22 ? 4  SER A CA   17 
ATOM   7508  C C    . SER A 1 4  ? 0.048   8.879   14.603  1.00 2.50 ? 4  SER A C    17 
ATOM   7509  O O    . SER A 1 4  ? 1.131   8.746   14.068  1.00 3.02 ? 4  SER A O    17 
ATOM   7510  C CB   . SER A 1 4  ? -0.629  10.691  16.217  1.00 2.54 ? 4  SER A CB   17 
ATOM   7511  O OG   . SER A 1 4  ? -1.231  11.976  16.319  1.00 2.87 ? 4  SER A OG   17 
ATOM   7512  H H    . SER A 1 4  ? -2.744  10.219  14.989  1.00 1.66 ? 4  SER A H    17 
ATOM   7513  H HA   . SER A 1 4  ? -0.055  10.986  14.167  1.00 2.41 ? 4  SER A HA   17 
ATOM   7514  H HB2  . SER A 1 4  ? -1.204  9.983   16.789  1.00 2.30 ? 4  SER A HB2  17 
ATOM   7515  H HB3  . SER A 1 4  ? 0.382   10.723  16.603  1.00 2.95 ? 4  SER A HB3  17 
ATOM   7516  H HG   . SER A 1 4  ? -0.530  12.628  16.403  1.00 3.12 ? 4  SER A HG   17 
ATOM   7517  N N    . VAL A 1 5  ? -0.615  7.853   15.071  1.00 2.36 ? 5  VAL A N    17 
ATOM   7518  C CA   . VAL A 1 5  ? -0.048  6.471   14.959  1.00 2.86 ? 5  VAL A CA   17 
ATOM   7519  C C    . VAL A 1 5  ? -0.387  5.856   13.593  1.00 2.67 ? 5  VAL A C    17 
ATOM   7520  O O    . VAL A 1 5  ? 0.343   5.029   13.079  1.00 3.08 ? 5  VAL A O    17 
ATOM   7521  C CB   . VAL A 1 5  ? -0.696  5.675   16.103  1.00 3.15 ? 5  VAL A CB   17 
ATOM   7522  C CG1  . VAL A 1 5  ? -2.162  5.369   15.778  1.00 2.92 ? 5  VAL A CG1  17 
ATOM   7523  C CG2  . VAL A 1 5  ? 0.062   4.360   16.299  1.00 3.88 ? 5  VAL A CG2  17 
ATOM   7524  H H    . VAL A 1 5  ? -1.485  7.993   15.493  1.00 2.09 ? 5  VAL A H    17 
ATOM   7525  H HA   . VAL A 1 5  ? 1.018   6.498   15.093  1.00 3.28 ? 5  VAL A HA   17 
ATOM   7526  H HB   . VAL A 1 5  ? -0.647  6.256   17.012  1.00 3.17 ? 5  VAL A HB   17 
ATOM   7527  H HG11 . VAL A 1 5  ? -2.654  6.271   15.443  1.00 2.99 ? 5  VAL A HG11 17 
ATOM   7528  H HG12 . VAL A 1 5  ? -2.211  4.623   14.999  1.00 3.00 ? 5  VAL A HG12 17 
ATOM   7529  H HG13 . VAL A 1 5  ? -2.657  4.997   16.663  1.00 3.19 ? 5  VAL A HG13 17 
ATOM   7530  H HG21 . VAL A 1 5  ? 0.108   3.827   15.361  1.00 4.15 ? 5  VAL A HG21 17 
ATOM   7531  H HG22 . VAL A 1 5  ? 1.064   4.569   16.643  1.00 4.16 ? 5  VAL A HG22 17 
ATOM   7532  H HG23 . VAL A 1 5  ? -0.451  3.755   17.032  1.00 4.20 ? 5  VAL A HG23 17 
ATOM   7533  N N    . CYS A 1 6  ? -1.482  6.260   13.006  1.00 2.10 ? 6  CYS A N    17 
ATOM   7534  C CA   . CYS A 1 6  ? -1.878  5.714   11.673  1.00 1.90 ? 6  CYS A CA   17 
ATOM   7535  C C    . CYS A 1 6  ? -2.392  6.844   10.774  1.00 1.30 ? 6  CYS A C    17 
ATOM   7536  O O    . CYS A 1 6  ? -3.374  7.497   11.077  1.00 1.11 ? 6  CYS A O    17 
ATOM   7537  C CB   . CYS A 1 6  ? -2.997  4.711   11.964  1.00 2.21 ? 6  CYS A CB   17 
ATOM   7538  S SG   . CYS A 1 6  ? -2.281  3.146   12.523  1.00 3.03 ? 6  CYS A SG   17 
ATOM   7539  H H    . CYS A 1 6  ? -2.045  6.929   13.443  1.00 1.86 ? 6  CYS A H    17 
ATOM   7540  H HA   . CYS A 1 6  ? -1.045  5.211   11.208  1.00 2.15 ? 6  CYS A HA   17 
ATOM   7541  H HB2  . CYS A 1 6  ? -3.644  5.108   12.731  1.00 2.27 ? 6  CYS A HB2  17 
ATOM   7542  H HB3  . CYS A 1 6  ? -3.569  4.543   11.063  1.00 2.11 ? 6  CYS A HB3  17 
ATOM   7543  H HG   . CYS A 1 6  ? -1.652  3.340   13.223  1.00 3.27 ? 6  CYS A HG   17 
ATOM   7544  N N    . VAL A 1 7  ? -1.729  7.078   9.673   1.00 1.23 ? 7  VAL A N    17 
ATOM   7545  C CA   . VAL A 1 7  ? -2.157  8.159   8.742   1.00 0.99 ? 7  VAL A CA   17 
ATOM   7546  C C    . VAL A 1 7  ? -2.013  7.692   7.289   1.00 0.84 ? 7  VAL A C    17 
ATOM   7547  O O    . VAL A 1 7  ? -1.424  6.665   7.008   1.00 0.90 ? 7  VAL A O    17 
ATOM   7548  C CB   . VAL A 1 7  ? -1.218  9.333   9.047   1.00 1.56 ? 7  VAL A CB   17 
ATOM   7549  C CG1  . VAL A 1 7  ? 0.200   9.017   8.561   1.00 1.89 ? 7  VAL A CG1  17 
ATOM   7550  C CG2  . VAL A 1 7  ? -1.724  10.597  8.347   1.00 1.86 ? 7  VAL A CG2  17 
ATOM   7551  H H    . VAL A 1 7  ? -0.946  6.541   9.456   1.00 1.54 ? 7  VAL A H    17 
ATOM   7552  H HA   . VAL A 1 7  ? -3.177  8.444   8.942   1.00 0.92 ? 7  VAL A HA   17 
ATOM   7553  H HB   . VAL A 1 7  ? -1.199  9.499   10.111  1.00 1.74 ? 7  VAL A HB   17 
ATOM   7554  H HG11 . VAL A 1 7  ? 0.513   8.062   8.957   1.00 2.23 ? 7  VAL A HG11 17 
ATOM   7555  H HG12 . VAL A 1 7  ? 0.214   8.981   7.483   1.00 2.25 ? 7  VAL A HG12 17 
ATOM   7556  H HG13 . VAL A 1 7  ? 0.877   9.786   8.903   1.00 2.21 ? 7  VAL A HG13 17 
ATOM   7557  H HG21 . VAL A 1 7  ? -2.802  10.633  8.405   1.00 1.71 ? 7  VAL A HG21 17 
ATOM   7558  H HG22 . VAL A 1 7  ? -1.309  11.467  8.835   1.00 2.25 ? 7  VAL A HG22 17 
ATOM   7559  H HG23 . VAL A 1 7  ? -1.418  10.584  7.313   1.00 2.27 ? 7  VAL A HG23 17 
HETATM 7560  N N    . SEP A 1 8  ? -2.554  8.445   6.372   1.00 1.00 ? 8  SEP A N    17 
HETATM 7561  C CA   . SEP A 1 8  ? -2.470  8.069   4.921   1.00 0.94 ? 8  SEP A CA   17 
HETATM 7562  C CB   . SEP A 1 8  ? -3.162  9.208   4.169   1.00 1.01 ? 8  SEP A CB   17 
HETATM 7563  O OG   . SEP A 1 8  ? -4.571  8.951   4.115   1.00 1.07 ? 8  SEP A OG   17 
HETATM 7564  C C    . SEP A 1 8  ? -1.008  7.940   4.475   1.00 0.90 ? 8  SEP A C    17 
HETATM 7565  O O    . SEP A 1 8  ? -0.655  7.018   3.767   1.00 0.90 ? 8  SEP A O    17 
HETATM 7566  P P    . SEP A 1 8  ? -5.588  9.752   5.072   1.00 1.13 ? 8  SEP A P    17 
HETATM 7567  O O1P  . SEP A 1 8  ? -5.413  9.256   6.454   1.00 1.46 ? 8  SEP A O1P  17 
HETATM 7568  O O2P  . SEP A 1 8  ? -5.454  11.197  4.783   1.00 1.79 ? 8  SEP A O2P  17 
HETATM 7569  O O3P  . SEP A 1 8  ? -7.027  9.262   4.542   1.00 2.00 ? 8  SEP A O3P  17 
HETATM 7570  H H    . SEP A 1 8  ? -3.019  9.261   6.640   1.00 1.29 ? 8  SEP A H    17 
HETATM 7571  H HA   . SEP A 1 8  ? -2.993  7.146   4.747   1.00 0.97 ? 8  SEP A HA   17 
HETATM 7572  H HB2  . SEP A 1 8  ? -2.760  9.271   3.167   1.00 1.08 ? 8  SEP A HB2  17 
HETATM 7573  H HB3  . SEP A 1 8  ? -2.989  10.140  4.681   1.00 1.09 ? 8  SEP A HB3  17 
HETATM 7574  H HOP3 . SEP A 1 8  ? -7.062  8.311   4.655   1.00 2.43 ? 8  SEP A HOP3 17 
ATOM   7575  N N    . SER A 1 9  ? -0.169  8.858   4.897   1.00 0.95 ? 9  SER A N    17 
ATOM   7576  C CA   . SER A 1 9  ? 1.288   8.831   4.531   1.00 0.97 ? 9  SER A CA   17 
ATOM   7577  C C    . SER A 1 9  ? 1.488   9.045   3.026   1.00 0.86 ? 9  SER A C    17 
ATOM   7578  O O    . SER A 1 9  ? 1.129   8.210   2.225   1.00 0.78 ? 9  SER A O    17 
ATOM   7579  C CB   . SER A 1 9  ? 1.808   7.454   4.946   1.00 1.07 ? 9  SER A CB   17 
ATOM   7580  O OG   . SER A 1 9  ? 1.515   7.227   6.322   1.00 1.27 ? 9  SER A OG   17 
ATOM   7581  H H    . SER A 1 9  ? -0.500  9.574   5.468   1.00 1.01 ? 9  SER A H    17 
ATOM   7582  H HA   . SER A 1 9  ? 1.815   9.593   5.082   1.00 1.08 ? 9  SER A HA   17 
ATOM   7583  H HB2  . SER A 1 9  ? 1.334   6.694   4.349   1.00 1.02 ? 9  SER A HB2  17 
ATOM   7584  H HB3  . SER A 1 9  ? 2.876   7.418   4.784   1.00 1.16 ? 9  SER A HB3  17 
ATOM   7585  H HG   . SER A 1 9  ? 0.645   6.817   6.381   1.00 1.67 ? 9  SER A HG   17 
ATOM   7586  N N    . TYR A 1 10 ? 2.086   10.162  2.667   1.00 0.90 ? 10 TYR A N    17 
ATOM   7587  C CA   . TYR A 1 10 ? 2.379   10.515  1.229   1.00 0.85 ? 10 TYR A CA   17 
ATOM   7588  C C    . TYR A 1 10 ? 1.255   10.086  0.254   1.00 0.74 ? 10 TYR A C    17 
ATOM   7589  O O    . TYR A 1 10 ? 0.154   9.752   0.650   1.00 0.74 ? 10 TYR A O    17 
ATOM   7590  C CB   . TYR A 1 10 ? 3.738   9.833   0.929   1.00 0.90 ? 10 TYR A CB   17 
ATOM   7591  C CG   . TYR A 1 10 ? 3.575   8.461   0.304   1.00 0.85 ? 10 TYR A CG   17 
ATOM   7592  C CD1  . TYR A 1 10 ? 3.321   7.345   1.106   1.00 0.89 ? 10 TYR A CD1  17 
ATOM   7593  C CD2  . TYR A 1 10 ? 3.701   8.309   -1.081  1.00 0.84 ? 10 TYR A CD2  17 
ATOM   7594  C CE1  . TYR A 1 10 ? 3.186   6.080   0.525   1.00 0.95 ? 10 TYR A CE1  17 
ATOM   7595  C CE2  . TYR A 1 10 ? 3.565   7.044   -1.666  1.00 0.92 ? 10 TYR A CE2  17 
ATOM   7596  C CZ   . TYR A 1 10 ? 3.307   5.927   -0.862  1.00 0.98 ? 10 TYR A CZ   17 
ATOM   7597  O OH   . TYR A 1 10 ? 3.174   4.676   -1.434  1.00 1.12 ? 10 TYR A OH   17 
ATOM   7598  H H    . TYR A 1 10 ? 2.369   10.782  3.365   1.00 1.01 ? 10 TYR A H    17 
ATOM   7599  H HA   . TYR A 1 10 ? 2.510   11.581  1.153   1.00 0.94 ? 10 TYR A HA   17 
ATOM   7600  H HB2  . TYR A 1 10 ? 4.301   10.455  0.253   1.00 0.94 ? 10 TYR A HB2  17 
ATOM   7601  H HB3  . TYR A 1 10 ? 4.289   9.733   1.853   1.00 1.03 ? 10 TYR A HB3  17 
ATOM   7602  H HD1  . TYR A 1 10 ? 3.223   7.462   2.178   1.00 0.94 ? 10 TYR A HD1  17 
ATOM   7603  H HD2  . TYR A 1 10 ? 3.900   9.171   -1.699  1.00 0.85 ? 10 TYR A HD2  17 
ATOM   7604  H HE1  . TYR A 1 10 ? 2.987   5.221   1.145   1.00 1.02 ? 10 TYR A HE1  17 
ATOM   7605  H HE2  . TYR A 1 10 ? 3.657   6.932   -2.735  1.00 0.99 ? 10 TYR A HE2  17 
ATOM   7606  H HH   . TYR A 1 10 ? 3.322   4.019   -0.746  1.00 1.32 ? 10 TYR A HH   17 
ATOM   7607  N N    . ARG A 1 11 ? 1.525   10.125  -1.026  1.00 0.73 ? 11 ARG A N    17 
ATOM   7608  C CA   . ARG A 1 11 ? 0.494   9.731   -2.033  1.00 0.77 ? 11 ARG A CA   17 
ATOM   7609  C C    . ARG A 1 11 ? 0.413   8.198   -2.109  1.00 0.78 ? 11 ARG A C    17 
ATOM   7610  O O    . ARG A 1 11 ? 0.769   7.506   -1.176  1.00 0.77 ? 11 ARG A O    17 
ATOM   7611  C CB   . ARG A 1 11 ? 1.005   10.323  -3.353  1.00 0.82 ? 11 ARG A CB   17 
ATOM   7612  C CG   . ARG A 1 11 ? 0.181   11.559  -3.713  1.00 0.94 ? 11 ARG A CG   17 
ATOM   7613  C CD   . ARG A 1 11 ? 0.115   11.703  -5.237  1.00 1.07 ? 11 ARG A CD   17 
ATOM   7614  N NE   . ARG A 1 11 ? 0.105   13.174  -5.484  1.00 1.32 ? 11 ARG A NE   17 
ATOM   7615  C CZ   . ARG A 1 11 ? -1.024  13.806  -5.627  1.00 1.80 ? 11 ARG A CZ   17 
ATOM   7616  N NH1  . ARG A 1 11 ? -1.820  13.960  -4.606  1.00 2.11 ? 11 ARG A NH1  17 
ATOM   7617  N NH2  . ARG A 1 11 ? -1.351  14.288  -6.790  1.00 2.53 ? 11 ARG A NH2  17 
ATOM   7618  H H    . ARG A 1 11 ? 2.406   10.422  -1.327  1.00 0.76 ? 11 ARG A H    17 
ATOM   7619  H HA   . ARG A 1 11 ? -0.465  10.148  -1.784  1.00 0.84 ? 11 ARG A HA   17 
ATOM   7620  H HB2  . ARG A 1 11 ? 2.043   10.605  -3.243  1.00 0.80 ? 11 ARG A HB2  17 
ATOM   7621  H HB3  . ARG A 1 11 ? 0.916   9.592   -4.139  1.00 0.89 ? 11 ARG A HB3  17 
ATOM   7622  H HG2  . ARG A 1 11 ? -0.817  11.453  -3.316  1.00 1.21 ? 11 ARG A HG2  17 
ATOM   7623  H HG3  . ARG A 1 11 ? 0.648   12.437  -3.290  1.00 1.15 ? 11 ARG A HG3  17 
ATOM   7624  H HD2  . ARG A 1 11 ? 0.983   11.248  -5.694  1.00 1.06 ? 11 ARG A HD2  17 
ATOM   7625  H HD3  . ARG A 1 11 ? -0.790  11.257  -5.618  1.00 1.48 ? 11 ARG A HD3  17 
ATOM   7626  H HE   . ARG A 1 11 ? 0.955   13.668  -5.548  1.00 1.51 ? 11 ARG A HE   17 
ATOM   7627  H HH11 . ARG A 1 11 ? -1.560  13.593  -3.714  1.00 2.17 ? 11 ARG A HH11 17 
ATOM   7628  H HH12 . ARG A 1 11 ? -2.687  14.444  -4.714  1.00 2.66 ? 11 ARG A HH12 17 
ATOM   7629  H HH21 . ARG A 1 11 ? -0.730  14.171  -7.570  1.00 2.81 ? 11 ARG A HH21 17 
ATOM   7630  H HH22 . ARG A 1 11 ? -2.215  14.774  -6.908  1.00 3.04 ? 11 ARG A HH22 17 
ATOM   7631  N N    . GLY A 1 12 ? -0.023  7.658   -3.217  1.00 0.89 ? 12 GLY A N    17 
ATOM   7632  C CA   . GLY A 1 12 ? -0.081  6.173   -3.346  1.00 1.01 ? 12 GLY A CA   17 
ATOM   7633  C C    . GLY A 1 12 ? 1.015   5.729   -4.315  1.00 1.08 ? 12 GLY A C    17 
ATOM   7634  O O    . GLY A 1 12 ? 1.036   4.601   -4.773  1.00 1.23 ? 12 GLY A O    17 
ATOM   7635  H H    . GLY A 1 12 ? -0.284  8.224   -3.974  1.00 0.95 ? 12 GLY A H    17 
ATOM   7636  H HA2  . GLY A 1 12 ? 0.081   5.718   -2.379  1.00 0.99 ? 12 GLY A HA2  17 
ATOM   7637  H HA3  . GLY A 1 12 ? -1.042  5.879   -3.733  1.00 1.14 ? 12 GLY A HA3  17 
ATOM   7638  N N    . ARG A 1 13 ? 1.924   6.620   -4.632  1.00 0.99 ? 13 ARG A N    17 
ATOM   7639  C CA   . ARG A 1 13 ? 3.020   6.289   -5.576  1.00 1.07 ? 13 ARG A CA   17 
ATOM   7640  C C    . ARG A 1 13 ? 4.387   6.394   -4.879  1.00 1.03 ? 13 ARG A C    17 
ATOM   7641  O O    . ARG A 1 13 ? 5.041   7.421   -4.900  1.00 0.97 ? 13 ARG A O    17 
ATOM   7642  C CB   . ARG A 1 13 ? 2.864   7.319   -6.707  1.00 1.05 ? 13 ARG A CB   17 
ATOM   7643  C CG   . ARG A 1 13 ? 3.034   8.751   -6.173  1.00 0.88 ? 13 ARG A CG   17 
ATOM   7644  C CD   . ARG A 1 13 ? 4.255   9.404   -6.829  1.00 0.88 ? 13 ARG A CD   17 
ATOM   7645  N NE   . ARG A 1 13 ? 3.713   10.151  -8.002  1.00 0.94 ? 13 ARG A NE   17 
ATOM   7646  C CZ   . ARG A 1 13 ? 3.612   11.449  -7.961  1.00 1.05 ? 13 ARG A CZ   17 
ATOM   7647  N NH1  . ARG A 1 13 ? 4.684   12.183  -7.886  1.00 1.25 ? 13 ARG A NH1  17 
ATOM   7648  N NH2  . ARG A 1 13 ? 2.438   12.010  -8.000  1.00 1.19 ? 13 ARG A NH2  17 
ATOM   7649  H H    . ARG A 1 13 ? 1.879   7.516   -4.252  1.00 0.90 ? 13 ARG A H    17 
ATOM   7650  H HA   . ARG A 1 13 ? 2.882   5.296   -5.966  1.00 1.21 ? 13 ARG A HA   17 
ATOM   7651  H HB2  . ARG A 1 13 ? 3.603   7.130   -7.460  1.00 1.14 ? 13 ARG A HB2  17 
ATOM   7652  H HB3  . ARG A 1 13 ? 1.879   7.220   -7.139  1.00 1.11 ? 13 ARG A HB3  17 
ATOM   7653  H HG2  . ARG A 1 13 ? 2.150   9.327   -6.404  1.00 0.90 ? 13 ARG A HG2  17 
ATOM   7654  H HG3  . ARG A 1 13 ? 3.176   8.724   -5.103  1.00 0.83 ? 13 ARG A HG3  17 
ATOM   7655  H HD2  . ARG A 1 13 ? 4.735   10.081  -6.135  1.00 0.87 ? 13 ARG A HD2  17 
ATOM   7656  H HD3  . ARG A 1 13 ? 4.953   8.650   -7.161  1.00 1.04 ? 13 ARG A HD3  17 
ATOM   7657  H HE   . ARG A 1 13 ? 3.437   9.666   -8.808  1.00 1.08 ? 13 ARG A HE   17 
ATOM   7658  H HH11 . ARG A 1 13 ? 5.589   11.749  -7.860  1.00 1.28 ? 13 ARG A HH11 17 
ATOM   7659  H HH12 . ARG A 1 13 ? 4.606   13.184  -7.849  1.00 1.49 ? 13 ARG A HH12 17 
ATOM   7660  H HH21 . ARG A 1 13 ? 1.616   11.446  -8.059  1.00 1.15 ? 13 ARG A HH21 17 
ATOM   7661  H HH22 . ARG A 1 13 ? 2.357   13.007  -7.970  1.00 1.47 ? 13 ARG A HH22 17 
ATOM   7662  N N    . LYS A 1 14 ? 4.820   5.330   -4.258  1.00 1.11 ? 14 LYS A N    17 
ATOM   7663  C CA   . LYS A 1 14 ? 6.141   5.341   -3.551  1.00 1.16 ? 14 LYS A CA   17 
ATOM   7664  C C    . LYS A 1 14 ? 7.301   5.176   -4.552  1.00 1.28 ? 14 LYS A C    17 
ATOM   7665  O O    . LYS A 1 14 ? 8.190   4.367   -4.361  1.00 1.46 ? 14 LYS A O    17 
ATOM   7666  C CB   . LYS A 1 14 ? 6.079   4.153   -2.579  1.00 1.31 ? 14 LYS A CB   17 
ATOM   7667  C CG   . LYS A 1 14 ? 5.864   2.841   -3.349  1.00 1.51 ? 14 LYS A CG   17 
ATOM   7668  C CD   . LYS A 1 14 ? 4.633   2.108   -2.797  1.00 1.58 ? 14 LYS A CD   17 
ATOM   7669  C CE   . LYS A 1 14 ? 3.508   2.124   -3.840  1.00 1.59 ? 14 LYS A CE   17 
ATOM   7670  N NZ   . LYS A 1 14 ? 2.435   2.986   -3.256  1.00 1.44 ? 14 LYS A NZ   17 
ATOM   7671  H H    . LYS A 1 14 ? 4.275   4.522   -4.254  1.00 1.18 ? 14 LYS A H    17 
ATOM   7672  H HA   . LYS A 1 14 ? 6.259   6.259   -2.998  1.00 1.07 ? 14 LYS A HA   17 
ATOM   7673  H HB2  . LYS A 1 14 ? 7.004   4.096   -2.030  1.00 1.40 ? 14 LYS A HB2  17 
ATOM   7674  H HB3  . LYS A 1 14 ? 5.263   4.299   -1.888  1.00 1.24 ? 14 LYS A HB3  17 
ATOM   7675  H HG2  . LYS A 1 14 ? 5.717   3.057   -4.398  1.00 1.52 ? 14 LYS A HG2  17 
ATOM   7676  H HG3  . LYS A 1 14 ? 6.734   2.212   -3.233  1.00 1.67 ? 14 LYS A HG3  17 
ATOM   7677  H HD2  . LYS A 1 14 ? 4.898   1.085   -2.570  1.00 1.77 ? 14 LYS A HD2  17 
ATOM   7678  H HD3  . LYS A 1 14 ? 4.296   2.598   -1.898  1.00 1.53 ? 14 LYS A HD3  17 
ATOM   7679  H HE2  . LYS A 1 14 ? 3.866   2.542   -4.772  1.00 1.60 ? 14 LYS A HE2  17 
ATOM   7680  H HE3  . LYS A 1 14 ? 3.132   1.124   -4.000  1.00 1.79 ? 14 LYS A HE3  17 
ATOM   7681  H HZ1  . LYS A 1 14 ? 2.863   3.778   -2.725  1.00 1.42 ? 14 LYS A HZ1  17 
ATOM   7682  H HZ2  . LYS A 1 14 ? 1.839   3.369   -4.026  1.00 1.37 ? 14 LYS A HZ2  17 
ATOM   7683  H HZ3  . LYS A 1 14 ? 1.846   2.420   -2.615  1.00 1.68 ? 14 LYS A HZ3  17 
ATOM   7684  N N    . SER A 1 15 ? 7.298   5.944   -5.615  1.00 1.22 ? 15 SER A N    17 
ATOM   7685  C CA   . SER A 1 15 ? 8.392   5.845   -6.630  1.00 1.34 ? 15 SER A CA   17 
ATOM   7686  C C    . SER A 1 15 ? 8.360   7.063   -7.566  1.00 1.22 ? 15 SER A C    17 
ATOM   7687  O O    . SER A 1 15 ? 7.894   6.982   -8.688  1.00 1.42 ? 15 SER A O    17 
ATOM   7688  C CB   . SER A 1 15 ? 8.100   4.559   -7.408  1.00 1.53 ? 15 SER A CB   17 
ATOM   7689  O OG   . SER A 1 15 ? 9.219   4.243   -8.228  1.00 1.72 ? 15 SER A OG   17 
ATOM   7690  H H    . SER A 1 15 ? 6.575   6.591   -5.743  1.00 1.10 ? 15 SER A H    17 
ATOM   7691  H HA   . SER A 1 15 ? 9.352   5.771   -6.144  1.00 1.42 ? 15 SER A HA   17 
ATOM   7692  H HB2  . SER A 1 15 ? 7.927   3.751   -6.718  1.00 1.60 ? 15 SER A HB2  17 
ATOM   7693  H HB3  . SER A 1 15 ? 7.219   4.702   -8.020  1.00 1.50 ? 15 SER A HB3  17 
ATOM   7694  H HG   . SER A 1 15 ? 9.169   4.784   -9.022  1.00 2.12 ? 15 SER A HG   17 
ATOM   7695  N N    . GLY A 1 16 ? 8.850   8.191   -7.113  1.00 1.19 ? 16 GLY A N    17 
ATOM   7696  C CA   . GLY A 1 16 ? 8.850   9.411   -7.977  1.00 1.12 ? 16 GLY A CA   17 
ATOM   7697  C C    . GLY A 1 16 ? 8.098   10.550  -7.280  1.00 1.02 ? 16 GLY A C    17 
ATOM   7698  O O    . GLY A 1 16 ? 6.995   10.900  -7.659  1.00 1.10 ? 16 GLY A O    17 
ATOM   7699  H H    . GLY A 1 16 ? 9.220   8.233   -6.206  1.00 1.40 ? 16 GLY A H    17 
ATOM   7700  H HA2  . GLY A 1 16 ? 9.869   9.717   -8.164  1.00 1.14 ? 16 GLY A HA2  17 
ATOM   7701  H HA3  . GLY A 1 16 ? 8.364   9.189   -8.915  1.00 1.19 ? 16 GLY A HA3  17 
ATOM   7702  N N    . ASN A 1 17 ? 8.691   11.135  -6.270  1.00 0.92 ? 17 ASN A N    17 
ATOM   7703  C CA   . ASN A 1 17 ? 8.022   12.263  -5.548  1.00 0.89 ? 17 ASN A CA   17 
ATOM   7704  C C    . ASN A 1 17 ? 8.831   13.559  -5.725  1.00 0.82 ? 17 ASN A C    17 
ATOM   7705  O O    . ASN A 1 17 ? 9.740   13.627  -6.533  1.00 0.78 ? 17 ASN A O    17 
ATOM   7706  C CB   . ASN A 1 17 ? 7.982   11.831  -4.075  1.00 0.97 ? 17 ASN A CB   17 
ATOM   7707  C CG   . ASN A 1 17 ? 9.401   11.583  -3.554  1.00 1.02 ? 17 ASN A CG   17 
ATOM   7708  O OD1  . ASN A 1 17 ? 9.949   10.515  -3.737  1.00 1.29 ? 17 ASN A OD1  17 
ATOM   7709  N ND2  . ASN A 1 17 ? 10.023  12.528  -2.907  1.00 1.28 ? 17 ASN A ND2  17 
ATOM   7710  H H    . ASN A 1 17 ? 9.582   10.839  -5.990  1.00 0.92 ? 17 ASN A H    17 
ATOM   7711  H HA   . ASN A 1 17 ? 7.018   12.399  -5.917  1.00 0.94 ? 17 ASN A HA   17 
ATOM   7712  H HB2  . ASN A 1 17 ? 7.517   12.608  -3.488  1.00 1.04 ? 17 ASN A HB2  17 
ATOM   7713  H HB3  . ASN A 1 17 ? 7.406   10.924  -3.985  1.00 1.02 ? 17 ASN A HB3  17 
ATOM   7714  H HD21 . ASN A 1 17 ? 9.585   13.392  -2.757  1.00 1.63 ? 17 ASN A HD21 17 
ATOM   7715  H HD22 . ASN A 1 17 ? 10.930  12.375  -2.571  1.00 1.38 ? 17 ASN A HD22 17 
ATOM   7716  N N    . LYS A 1 18 ? 8.505   14.589  -4.982  1.00 0.86 ? 18 LYS A N    17 
ATOM   7717  C CA   . LYS A 1 18 ? 9.250   15.877  -5.114  1.00 0.84 ? 18 LYS A CA   17 
ATOM   7718  C C    . LYS A 1 18 ? 10.053  16.172  -3.835  1.00 0.98 ? 18 LYS A C    17 
ATOM   7719  O O    . LYS A 1 18 ? 9.514   16.682  -2.868  1.00 1.14 ? 18 LYS A O    17 
ATOM   7720  C CB   . LYS A 1 18 ? 8.164   16.935  -5.331  1.00 0.86 ? 18 LYS A CB   17 
ATOM   7721  C CG   . LYS A 1 18 ? 7.804   17.007  -6.818  1.00 0.79 ? 18 LYS A CG   17 
ATOM   7722  C CD   . LYS A 1 18 ? 8.298   18.333  -7.405  1.00 0.73 ? 18 LYS A CD   17 
ATOM   7723  C CE   . LYS A 1 18 ? 9.173   18.059  -8.632  1.00 0.70 ? 18 LYS A CE   17 
ATOM   7724  N NZ   . LYS A 1 18 ? 9.837   19.358  -8.931  1.00 0.69 ? 18 LYS A NZ   17 
ATOM   7725  H H    . LYS A 1 18 ? 7.767   14.515  -4.342  1.00 0.94 ? 18 LYS A H    17 
ATOM   7726  H HA   . LYS A 1 18 ? 9.906   15.847  -5.969  1.00 0.79 ? 18 LYS A HA   17 
ATOM   7727  H HB2  . LYS A 1 18 ? 7.285   16.670  -4.759  1.00 0.94 ? 18 LYS A HB2  17 
ATOM   7728  H HB3  . LYS A 1 18 ? 8.528   17.895  -5.002  1.00 0.92 ? 18 LYS A HB3  17 
ATOM   7729  H HG2  . LYS A 1 18 ? 8.268   16.183  -7.341  1.00 0.80 ? 18 LYS A HG2  17 
ATOM   7730  H HG3  . LYS A 1 18 ? 6.731   16.944  -6.931  1.00 0.90 ? 18 LYS A HG3  17 
ATOM   7731  H HD2  . LYS A 1 18 ? 7.449   18.936  -7.695  1.00 0.86 ? 18 LYS A HD2  17 
ATOM   7732  H HD3  . LYS A 1 18 ? 8.877   18.861  -6.663  1.00 0.92 ? 18 LYS A HD3  17 
ATOM   7733  H HE2  . LYS A 1 18 ? 9.910   17.300  -8.404  1.00 0.93 ? 18 LYS A HE2  17 
ATOM   7734  H HE3  . LYS A 1 18 ? 8.563   17.752  -9.469  1.00 0.81 ? 18 LYS A HE3  17 
ATOM   7735  H HZ1  . LYS A 1 18 ? 10.263  19.744  -8.058  1.00 1.29 ? 18 LYS A HZ1  17 
ATOM   7736  H HZ2  . LYS A 1 18 ? 10.587  19.208  -9.640  1.00 1.08 ? 18 LYS A HZ2  17 
ATOM   7737  H HZ3  . LYS A 1 18 ? 9.133   20.037  -9.306  1.00 1.06 ? 18 LYS A HZ3  17 
ATOM   7738  N N    . PRO A 1 19 ? 11.326  15.845  -3.877  1.00 1.07 ? 19 PRO A N    17 
ATOM   7739  C CA   . PRO A 1 19 ? 12.179  16.108  -2.682  1.00 1.25 ? 19 PRO A CA   17 
ATOM   7740  C C    . PRO A 1 19 ? 12.900  17.460  -2.823  1.00 1.30 ? 19 PRO A C    17 
ATOM   7741  O O    . PRO A 1 19 ? 13.125  17.931  -3.923  1.00 1.30 ? 19 PRO A O    17 
ATOM   7742  C CB   . PRO A 1 19 ? 13.177  14.954  -2.675  1.00 1.33 ? 19 PRO A CB   17 
ATOM   7743  C CG   . PRO A 1 19 ? 13.255  14.500  -4.093  1.00 1.22 ? 19 PRO A CG   17 
ATOM   7744  C CD   . PRO A 1 19 ? 11.928  14.809  -4.736  1.00 1.07 ? 19 PRO A CD   17 
ATOM   7745  H HA   . PRO A 1 19 ? 11.585  16.087  -1.783  1.00 1.34 ? 19 PRO A HA   17 
ATOM   7746  H HB2  . PRO A 1 19 ? 14.144  15.297  -2.333  1.00 1.44 ? 19 PRO A HB2  17 
ATOM   7747  H HB3  . PRO A 1 19 ? 12.819  14.151  -2.050  1.00 1.41 ? 19 PRO A HB3  17 
ATOM   7748  H HG2  . PRO A 1 19 ? 14.047  15.029  -4.604  1.00 1.26 ? 19 PRO A HG2  17 
ATOM   7749  H HG3  . PRO A 1 19 ? 13.436  13.437  -4.131  1.00 1.27 ? 19 PRO A HG3  17 
ATOM   7750  H HD2  . PRO A 1 19 ? 12.077  15.186  -5.739  1.00 1.08 ? 19 PRO A HD2  17 
ATOM   7751  H HD3  . PRO A 1 19 ? 11.303  13.930  -4.751  1.00 1.08 ? 19 PRO A HD3  17 
ATOM   7752  N N    . PRO A 1 20 ? 13.235  18.043  -1.696  1.00 1.47 ? 20 PRO A N    17 
ATOM   7753  C CA   . PRO A 1 20 ? 13.932  19.365  -1.739  1.00 1.58 ? 20 PRO A CA   17 
ATOM   7754  C C    . PRO A 1 20 ? 15.366  19.229  -2.280  1.00 1.66 ? 20 PRO A C    17 
ATOM   7755  O O    . PRO A 1 20 ? 15.826  20.063  -3.035  1.00 1.73 ? 20 PRO A O    17 
ATOM   7756  C CB   . PRO A 1 20 ? 13.939  19.827  -0.283  1.00 1.80 ? 20 PRO A CB   17 
ATOM   7757  C CG   . PRO A 1 20 ? 13.837  18.572  0.517   1.00 1.86 ? 20 PRO A CG   17 
ATOM   7758  C CD   . PRO A 1 20 ? 13.037  17.599  -0.304  1.00 1.65 ? 20 PRO A CD   17 
ATOM   7759  H HA   . PRO A 1 20 ? 13.372  20.064  -2.339  1.00 1.51 ? 20 PRO A HA   17 
ATOM   7760  H HB2  . PRO A 1 20 ? 14.860  20.347  -0.058  1.00 1.93 ? 20 PRO A HB2  17 
ATOM   7761  H HB3  . PRO A 1 20 ? 13.088  20.460  -0.084  1.00 1.83 ? 20 PRO A HB3  17 
ATOM   7762  H HG2  . PRO A 1 20 ? 14.825  18.176  0.709   1.00 1.95 ? 20 PRO A HG2  17 
ATOM   7763  H HG3  . PRO A 1 20 ? 13.328  18.767  1.449   1.00 2.00 ? 20 PRO A HG3  17 
ATOM   7764  H HD2  . PRO A 1 20 ? 13.412  16.593  -0.167  1.00 1.67 ? 20 PRO A HD2  17 
ATOM   7765  H HD3  . PRO A 1 20 ? 11.991  17.653  -0.042  1.00 1.68 ? 20 PRO A HD3  17 
ATOM   7766  N N    . SER A 1 21 ? 16.075  18.193  -1.896  1.00 1.72 ? 21 SER A N    17 
ATOM   7767  C CA   . SER A 1 21 ? 17.483  18.014  -2.388  1.00 1.85 ? 21 SER A CA   17 
ATOM   7768  C C    . SER A 1 21 ? 17.512  17.777  -3.907  1.00 1.74 ? 21 SER A C    17 
ATOM   7769  O O    . SER A 1 21 ? 18.432  18.198  -4.585  1.00 1.88 ? 21 SER A O    17 
ATOM   7770  C CB   . SER A 1 21 ? 18.019  16.788  -1.645  1.00 1.98 ? 21 SER A CB   17 
ATOM   7771  O OG   . SER A 1 21 ? 19.432  16.713  -1.817  1.00 2.14 ? 21 SER A OG   17 
ATOM   7772  H H    . SER A 1 21 ? 15.684  17.535  -1.284  1.00 1.73 ? 21 SER A H    17 
ATOM   7773  H HA   . SER A 1 21 ? 18.076  18.879  -2.138  1.00 1.99 ? 21 SER A HA   17 
ATOM   7774  H HB2  . SER A 1 21 ? 17.793  16.874  -0.595  1.00 2.08 ? 21 SER A HB2  17 
ATOM   7775  H HB3  . SER A 1 21 ? 17.549  15.897  -2.039  1.00 2.01 ? 21 SER A HB3  17 
ATOM   7776  H HG   . SER A 1 21 ? 19.842  16.786  -0.948  1.00 2.36 ? 21 SER A HG   17 
ATOM   7777  N N    . LYS A 1 22 ? 16.521  17.105  -4.443  1.00 1.53 ? 22 LYS A N    17 
ATOM   7778  C CA   . LYS A 1 22 ? 16.499  16.840  -5.916  1.00 1.47 ? 22 LYS A CA   17 
ATOM   7779  C C    . LYS A 1 22 ? 15.056  16.886  -6.443  1.00 1.21 ? 22 LYS A C    17 
ATOM   7780  O O    . LYS A 1 22 ? 14.408  15.870  -6.606  1.00 1.07 ? 22 LYS A O    17 
ATOM   7781  C CB   . LYS A 1 22 ? 17.095  15.435  -6.073  1.00 1.55 ? 22 LYS A CB   17 
ATOM   7782  C CG   . LYS A 1 22 ? 18.621  15.530  -6.183  1.00 1.82 ? 22 LYS A CG   17 
ATOM   7783  C CD   . LYS A 1 22 ? 19.261  15.057  -4.871  1.00 1.91 ? 22 LYS A CD   17 
ATOM   7784  C CE   . LYS A 1 22 ? 20.708  15.555  -4.792  1.00 2.21 ? 22 LYS A CE   17 
ATOM   7785  N NZ   . LYS A 1 22 ? 20.638  16.840  -4.035  1.00 2.23 ? 22 LYS A NZ   17 
ATOM   7786  H H    . LYS A 1 22 ? 15.793  16.774  -3.878  1.00 1.46 ? 22 LYS A H    17 
ATOM   7787  H HA   . LYS A 1 22 ? 17.110  17.560  -6.437  1.00 1.61 ? 22 LYS A HA   17 
ATOM   7788  H HB2  . LYS A 1 22 ? 16.830  14.833  -5.216  1.00 1.54 ? 22 LYS A HB2  17 
ATOM   7789  H HB3  . LYS A 1 22 ? 16.702  14.976  -6.969  1.00 1.49 ? 22 LYS A HB3  17 
ATOM   7790  H HG2  . LYS A 1 22 ? 18.962  14.906  -6.996  1.00 1.92 ? 22 LYS A HG2  17 
ATOM   7791  H HG3  . LYS A 1 22 ? 18.907  16.554  -6.371  1.00 1.93 ? 22 LYS A HG3  17 
ATOM   7792  H HD2  . LYS A 1 22 ? 18.698  15.447  -4.036  1.00 1.84 ? 22 LYS A HD2  17 
ATOM   7793  H HD3  . LYS A 1 22 ? 19.253  13.978  -4.838  1.00 1.95 ? 22 LYS A HD3  17 
ATOM   7794  H HE2  . LYS A 1 22 ? 21.322  14.837  -4.265  1.00 2.34 ? 22 LYS A HE2  17 
ATOM   7795  H HE3  . LYS A 1 22 ? 21.100  15.731  -5.783  1.00 2.34 ? 22 LYS A HE3  17 
ATOM   7796  H HZ1  . LYS A 1 22 ? 20.218  16.670  -3.090  1.00 2.18 ? 22 LYS A HZ1  17 
ATOM   7797  H HZ2  . LYS A 1 22 ? 21.596  17.230  -3.924  1.00 2.45 ? 22 LYS A HZ2  17 
ATOM   7798  H HZ3  . LYS A 1 22 ? 20.042  17.520  -4.555  1.00 2.15 ? 22 LYS A HZ3  17 
ATOM   7799  N N    . THR A 1 23 ? 14.552  18.065  -6.711  1.00 1.19 ? 23 THR A N    17 
ATOM   7800  C CA   . THR A 1 23 ? 13.148  18.192  -7.228  1.00 0.99 ? 23 THR A CA   17 
ATOM   7801  C C    . THR A 1 23 ? 13.114  18.123  -8.770  1.00 0.96 ? 23 THR A C    17 
ATOM   7802  O O    . THR A 1 23 ? 12.273  18.728  -9.411  1.00 0.86 ? 23 THR A O    17 
ATOM   7803  C CB   . THR A 1 23 ? 12.665  19.561  -6.719  1.00 1.07 ? 23 THR A CB   17 
ATOM   7804  O OG1  . THR A 1 23 ? 11.251  19.641  -6.832  1.00 0.93 ? 23 THR A OG1  17 
ATOM   7805  C CG2  . THR A 1 23 ? 13.306  20.687  -7.536  1.00 1.22 ? 23 THR A CG2  17 
ATOM   7806  H H    . THR A 1 23 ? 15.095  18.869  -6.571  1.00 1.35 ? 23 THR A H    17 
ATOM   7807  H HA   . THR A 1 23 ? 12.528  17.414  -6.811  1.00 0.89 ? 23 THR A HA   17 
ATOM   7808  H HB   . THR A 1 23 ? 12.948  19.675  -5.681  1.00 1.20 ? 23 THR A HB   17 
ATOM   7809  H HG1  . THR A 1 23 ? 10.875  19.489  -5.958  1.00 1.16 ? 23 THR A HG1  17 
ATOM   7810  H HG21 . THR A 1 23 ? 14.338  20.441  -7.743  1.00 1.42 ? 23 THR A HG21 17 
ATOM   7811  H HG22 . THR A 1 23 ? 12.772  20.805  -8.467  1.00 1.69 ? 23 THR A HG22 17 
ATOM   7812  H HG23 . THR A 1 23 ? 13.261  21.609  -6.977  1.00 1.67 ? 23 THR A HG23 17 
ATOM   7813  N N    . CYS A 1 24 ? 14.012  17.382  -9.372  1.00 1.14 ? 24 CYS A N    17 
ATOM   7814  C CA   . CYS A 1 24 ? 14.024  17.270  -10.866 1.00 1.22 ? 24 CYS A CA   17 
ATOM   7815  C C    . CYS A 1 24 ? 13.069  16.154  -11.329 1.00 1.08 ? 24 CYS A C    17 
ATOM   7816  O O    . CYS A 1 24 ? 13.467  15.218  -11.999 1.00 1.29 ? 24 CYS A O    17 
ATOM   7817  C CB   . CYS A 1 24 ? 15.479  16.946  -11.235 1.00 1.54 ? 24 CYS A CB   17 
ATOM   7818  S SG   . CYS A 1 24 ? 15.990  15.396  -10.444 1.00 1.66 ? 24 CYS A SG   17 
ATOM   7819  H H    . CYS A 1 24 ? 14.674  16.896  -8.843  1.00 1.26 ? 24 CYS A H    17 
ATOM   7820  H HA   . CYS A 1 24 ? 13.737  18.210  -11.309 1.00 1.21 ? 24 CYS A HA   17 
ATOM   7821  H HB2  . CYS A 1 24 ? 15.562  16.843  -12.306 1.00 1.63 ? 24 CYS A HB2  17 
ATOM   7822  H HB3  . CYS A 1 24 ? 16.120  17.748  -10.900 1.00 1.67 ? 24 CYS A HB3  17 
ATOM   7823  H HG   . CYS A 1 24 ? 16.499  15.616  -9.660  1.00 1.95 ? 24 CYS A HG   17 
ATOM   7824  N N    . LEU A 1 25 ? 11.811  16.253  -10.976 1.00 0.83 ? 25 LEU A N    17 
ATOM   7825  C CA   . LEU A 1 25 ? 10.821  15.209  -11.388 1.00 0.78 ? 25 LEU A CA   17 
ATOM   7826  C C    . LEU A 1 25 ? 9.554   15.869  -11.945 1.00 0.67 ? 25 LEU A C    17 
ATOM   7827  O O    . LEU A 1 25 ? 9.205   16.974  -11.570 1.00 0.76 ? 25 LEU A O    17 
ATOM   7828  C CB   . LEU A 1 25 ? 10.503  14.438  -10.102 1.00 0.73 ? 25 LEU A CB   17 
ATOM   7829  C CG   . LEU A 1 25 ? 11.717  13.602  -9.685  1.00 0.93 ? 25 LEU A CG   17 
ATOM   7830  C CD1  . LEU A 1 25 ? 12.342  14.200  -8.424  1.00 1.01 ? 25 LEU A CD1  17 
ATOM   7831  C CD2  . LEU A 1 25 ? 11.274  12.167  -9.399  1.00 1.29 ? 25 LEU A CD2  17 
ATOM   7832  H H    . LEU A 1 25 ? 11.516  17.016  -10.439 1.00 0.78 ? 25 LEU A H    17 
ATOM   7833  H HA   . LEU A 1 25 ? 11.253  14.545  -12.119 1.00 0.96 ? 25 LEU A HA   17 
ATOM   7834  H HB2  . LEU A 1 25 ? 10.258  15.137  -9.315  1.00 0.67 ? 25 LEU A HB2  17 
ATOM   7835  H HB3  . LEU A 1 25 ? 9.661   13.784  -10.276 1.00 0.75 ? 25 LEU A HB3  17 
ATOM   7836  H HG   . LEU A 1 25 ? 12.445  13.605  -10.483 1.00 1.10 ? 25 LEU A HG   17 
ATOM   7837  H HD11 . LEU A 1 25 ? 11.562  14.583  -7.782  1.00 1.47 ? 25 LEU A HD11 17 
ATOM   7838  H HD12 . LEU A 1 25 ? 12.895  13.433  -7.899  1.00 1.45 ? 25 LEU A HD12 17 
ATOM   7839  H HD13 . LEU A 1 25 ? 13.010  15.002  -8.698  1.00 1.51 ? 25 LEU A HD13 17 
ATOM   7840  H HD21 . LEU A 1 25 ? 10.518  12.170  -8.627  1.00 1.81 ? 25 LEU A HD21 17 
ATOM   7841  H HD22 . LEU A 1 25 ? 10.868  11.729  -10.298 1.00 1.75 ? 25 LEU A HD22 17 
ATOM   7842  H HD23 . LEU A 1 25 ? 12.124  11.587  -9.068  1.00 1.58 ? 25 LEU A HD23 17 
ATOM   7843  N N    . LYS A 1 26 ? 8.860   15.197  -12.832 1.00 0.76 ? 26 LYS A N    17 
ATOM   7844  C CA   . LYS A 1 26 ? 7.609   15.780  -13.415 1.00 0.84 ? 26 LYS A CA   17 
ATOM   7845  C C    . LYS A 1 26 ? 6.549   15.958  -12.320 1.00 0.78 ? 26 LYS A C    17 
ATOM   7846  O O    . LYS A 1 26 ? 5.895   15.015  -11.914 1.00 0.87 ? 26 LYS A O    17 
ATOM   7847  C CB   . LYS A 1 26 ? 7.138   14.764  -14.461 1.00 1.06 ? 26 LYS A CB   17 
ATOM   7848  C CG   . LYS A 1 26 ? 7.786   15.077  -15.812 1.00 1.61 ? 26 LYS A CG   17 
ATOM   7849  C CD   . LYS A 1 26 ? 7.914   13.786  -16.627 1.00 1.91 ? 26 LYS A CD   17 
ATOM   7850  C CE   . LYS A 1 26 ? 7.112   13.911  -17.929 1.00 2.61 ? 26 LYS A CE   17 
ATOM   7851  N NZ   . LYS A 1 26 ? 5.721   13.500  -17.574 1.00 2.92 ? 26 LYS A NZ   17 
ATOM   7852  H H    . LYS A 1 26 ? 9.160   14.309  -13.113 1.00 0.94 ? 26 LYS A H    17 
ATOM   7853  H HA   . LYS A 1 26 ? 7.821   16.726  -13.889 1.00 0.89 ? 26 LYS A HA   17 
ATOM   7854  H HB2  . LYS A 1 26 ? 7.419   13.769  -14.147 1.00 1.00 ? 26 LYS A HB2  17 
ATOM   7855  H HB3  . LYS A 1 26 ? 6.064   14.820  -14.558 1.00 1.17 ? 26 LYS A HB3  17 
ATOM   7856  H HG2  . LYS A 1 26 ? 7.171   15.787  -16.349 1.00 1.57 ? 26 LYS A HG2  17 
ATOM   7857  H HG3  . LYS A 1 26 ? 8.767   15.499  -15.653 1.00 2.37 ? 26 LYS A HG3  17 
ATOM   7858  H HD2  . LYS A 1 26 ? 8.955   13.614  -16.861 1.00 2.00 ? 26 LYS A HD2  17 
ATOM   7859  H HD3  . LYS A 1 26 ? 7.535   12.957  -16.050 1.00 2.20 ? 26 LYS A HD3  17 
ATOM   7860  H HE2  . LYS A 1 26 ? 7.128   14.935  -18.279 1.00 2.62 ? 26 LYS A HE2  17 
ATOM   7861  H HE3  . LYS A 1 26 ? 7.513   13.251  -18.682 1.00 3.20 ? 26 LYS A HE3  17 
ATOM   7862  H HZ1  . LYS A 1 26 ? 5.744   12.624  -17.016 1.00 2.88 ? 26 LYS A HZ1  17 
ATOM   7863  H HZ2  . LYS A 1 26 ? 5.264   14.262  -17.013 1.00 2.75 ? 26 LYS A HZ2  17 
ATOM   7864  H HZ3  . LYS A 1 26 ? 5.175   13.341  -18.444 1.00 3.65 ? 26 LYS A HZ3  17 
ATOM   7865  N N    . GLU A 1 27 ? 6.378   17.164  -11.841 1.00 0.70 ? 27 GLU A N    17 
ATOM   7866  C CA   . GLU A 1 27 ? 5.363   17.414  -10.766 1.00 0.74 ? 27 GLU A CA   17 
ATOM   7867  C C    . GLU A 1 27 ? 3.965   17.675  -11.358 1.00 0.95 ? 27 GLU A C    17 
ATOM   7868  O O    . GLU A 1 27 ? 3.119   18.266  -10.712 1.00 1.12 ? 27 GLU A O    17 
ATOM   7869  C CB   . GLU A 1 27 ? 5.871   18.648  -10.006 1.00 0.70 ? 27 GLU A CB   17 
ATOM   7870  C CG   . GLU A 1 27 ? 5.967   19.856  -10.951 1.00 0.79 ? 27 GLU A CG   17 
ATOM   7871  C CD   . GLU A 1 27 ? 7.437   20.170  -11.231 1.00 0.66 ? 27 GLU A CD   17 
ATOM   7872  O OE1  . GLU A 1 27 ? 8.076   20.750  -10.367 1.00 0.69 ? 27 GLU A OE1  17 
ATOM   7873  O OE2  . GLU A 1 27 ? 7.902   19.818  -12.303 1.00 0.82 ? 27 GLU A OE2  17 
ATOM   7874  H H    . GLU A 1 27 ? 6.921   17.904  -12.187 1.00 0.67 ? 27 GLU A H    17 
ATOM   7875  H HA   . GLU A 1 27 ? 5.324   16.571  -10.095 1.00 0.72 ? 27 GLU A HA   17 
ATOM   7876  H HB2  . GLU A 1 27 ? 5.187   18.878  -9.202  1.00 0.84 ? 27 GLU A HB2  17 
ATOM   7877  H HB3  . GLU A 1 27 ? 6.846   18.438  -9.596  1.00 0.59 ? 27 GLU A HB3  17 
ATOM   7878  H HG2  . GLU A 1 27 ? 5.463   19.631  -11.879 1.00 0.94 ? 27 GLU A HG2  17 
ATOM   7879  H HG3  . GLU A 1 27 ? 5.502   20.713  -10.488 1.00 0.97 ? 27 GLU A HG3  17 
ATOM   7880  N N    . GLU A 1 28 ? 3.708   17.229  -12.569 1.00 1.09 ? 28 GLU A N    17 
ATOM   7881  C CA   . GLU A 1 28 ? 2.357   17.442  -13.187 1.00 1.33 ? 28 GLU A CA   17 
ATOM   7882  C C    . GLU A 1 28 ? 1.258   16.889  -12.266 1.00 1.12 ? 28 GLU A C    17 
ATOM   7883  O O    . GLU A 1 28 ? 0.187   17.453  -12.160 1.00 1.29 ? 28 GLU A O    17 
ATOM   7884  C CB   . GLU A 1 28 ? 2.395   16.667  -14.509 1.00 1.67 ? 28 GLU A CB   17 
ATOM   7885  C CG   . GLU A 1 28 ? 3.386   17.335  -15.471 1.00 1.91 ? 28 GLU A CG   17 
ATOM   7886  C CD   . GLU A 1 28 ? 3.729   16.375  -16.613 1.00 2.37 ? 28 GLU A CD   17 
ATOM   7887  O OE1  . GLU A 1 28 ? 4.493   15.454  -16.375 1.00 2.64 ? 28 GLU A OE1  17 
ATOM   7888  O OE2  . GLU A 1 28 ? 3.224   16.576  -17.704 1.00 2.69 ? 28 GLU A OE2  17 
ATOM   7889  H H    . GLU A 1 28 ? 4.396   16.746  -13.069 1.00 1.14 ? 28 GLU A H    17 
ATOM   7890  H HA   . GLU A 1 28 ? 2.194   18.491  -13.379 1.00 1.54 ? 28 GLU A HA   17 
ATOM   7891  H HB2  . GLU A 1 28 ? 2.705   15.649  -14.322 1.00 1.63 ? 28 GLU A HB2  17 
ATOM   7892  H HB3  . GLU A 1 28 ? 1.411   16.667  -14.955 1.00 1.89 ? 28 GLU A HB3  17 
ATOM   7893  H HG2  . GLU A 1 28 ? 2.944   18.231  -15.875 1.00 2.03 ? 28 GLU A HG2  17 
ATOM   7894  H HG3  . GLU A 1 28 ? 4.289   17.591  -14.939 1.00 1.98 ? 28 GLU A HG3  17 
ATOM   7895  N N    . MET A 1 29 ? 1.527   15.796  -11.591 1.00 0.99 ? 29 MET A N    17 
ATOM   7896  C CA   . MET A 1 29 ? 0.511   15.209  -10.663 1.00 1.03 ? 29 MET A CA   17 
ATOM   7897  C C    . MET A 1 29 ? 1.024   15.257  -9.211  1.00 1.20 ? 29 MET A C    17 
ATOM   7898  O O    . MET A 1 29 ? 0.724   14.388  -8.413  1.00 1.52 ? 29 MET A O    17 
ATOM   7899  C CB   . MET A 1 29 ? 0.341   13.760  -11.135 1.00 1.35 ? 29 MET A CB   17 
ATOM   7900  C CG   . MET A 1 29 ? -1.029  13.231  -10.699 1.00 1.51 ? 29 MET A CG   17 
ATOM   7901  S SD   . MET A 1 29 ? -0.808  11.888  -9.506  1.00 2.45 ? 29 MET A SD   17 
ATOM   7902  C CE   . MET A 1 29 ? -0.857  10.518  -10.688 1.00 2.93 ? 29 MET A CE   17 
ATOM   7903  H H    . MET A 1 29 ? 2.403   15.367  -11.688 1.00 1.07 ? 29 MET A H    17 
ATOM   7904  H HA   . MET A 1 29 ? -0.426  15.736  -10.748 1.00 1.08 ? 29 MET A HA   17 
ATOM   7905  H HB2  . MET A 1 29 ? 0.416   13.723  -12.213 1.00 1.56 ? 29 MET A HB2  17 
ATOM   7906  H HB3  . MET A 1 29 ? 1.116   13.147  -10.700 1.00 1.59 ? 29 MET A HB3  17 
ATOM   7907  H HG2  . MET A 1 29 ? -1.595  14.029  -10.242 1.00 1.54 ? 29 MET A HG2  17 
ATOM   7908  H HG3  . MET A 1 29 ? -1.562  12.861  -11.563 1.00 1.82 ? 29 MET A HG3  17 
ATOM   7909  H HE1  . MET A 1 29 ? -0.484  10.855  -11.645 1.00 3.19 ? 29 MET A HE1  17 
ATOM   7910  H HE2  . MET A 1 29 ? -0.245  9.705   -10.321 1.00 3.38 ? 29 MET A HE2  17 
ATOM   7911  H HE3  . MET A 1 29 ? -1.874  10.175  -10.802 1.00 3.26 ? 29 MET A HE3  17 
ATOM   7912  N N    . ALA A 1 30 ? 1.791   16.274  -8.870  1.00 1.24 ? 30 ALA A N    17 
ATOM   7913  C CA   . ALA A 1 30 ? 2.337   16.409  -7.477  1.00 1.71 ? 30 ALA A CA   17 
ATOM   7914  C C    . ALA A 1 30 ? 3.033   15.108  -7.028  1.00 1.97 ? 30 ALA A C    17 
ATOM   7915  O O    . ALA A 1 30 ? 4.090   14.817  -7.563  1.00 1.95 ? 30 ALA A O    17 
ATOM   7916  C CB   . ALA A 1 30 ? 1.119   16.731  -6.600  1.00 2.13 ? 30 ALA A CB   17 
ATOM   7917  O OXT  . ALA A 1 30 ? 2.500   14.422  -6.165  1.00 2.43 ? 30 ALA A OXT  17 
ATOM   7918  H H    . ALA A 1 30 ? 2.010   16.959  -9.537  1.00 1.10 ? 30 ALA A H    17 
ATOM   7919  H HA   . ALA A 1 30 ? 3.038   17.229  -7.436  1.00 1.76 ? 30 ALA A HA   17 
ATOM   7920  H HB1  . ALA A 1 30 ? 0.628   17.616  -6.978  1.00 2.55 ? 30 ALA A HB1  17 
ATOM   7921  H HB2  . ALA A 1 30 ? 0.431   15.900  -6.622  1.00 2.44 ? 30 ALA A HB2  17 
ATOM   7922  H HB3  . ALA A 1 30 ? 1.443   16.903  -5.585  1.00 2.41 ? 30 ALA A HB3  17 
ATOM   7923  N N    . MET A 1 1  ? -10.827 12.193  16.721  1.00 3.23 ? 1  MET A N    18 
ATOM   7924  C CA   . MET A 1 1  ? -9.880  11.151  16.216  1.00 2.47 ? 1  MET A CA   18 
ATOM   7925  C C    . MET A 1 1  ? -8.585  11.805  15.713  1.00 2.16 ? 1  MET A C    18 
ATOM   7926  O O    . MET A 1 1  ? -8.584  12.944  15.287  1.00 2.59 ? 1  MET A O    18 
ATOM   7927  C CB   . MET A 1 1  ? -10.618 10.462  15.061  1.00 2.71 ? 1  MET A CB   18 
ATOM   7928  C CG   . MET A 1 1  ? -10.916 9.007   15.434  1.00 2.75 ? 1  MET A CG   18 
ATOM   7929  S SD   . MET A 1 1  ? -12.085 8.962   16.815  1.00 3.22 ? 1  MET A SD   18 
ATOM   7930  C CE   . MET A 1 1  ? -12.184 7.162   16.971  1.00 3.59 ? 1  MET A CE   18 
ATOM   7931  H H1   . MET A 1 1  ? -10.948 12.933  15.999  1.00 3.58 ? 1  MET A H1   18 
ATOM   7932  H H2   . MET A 1 1  ? -11.749 11.757  16.925  1.00 3.44 ? 1  MET A H2   18 
ATOM   7933  H H3   . MET A 1 1  ? -10.444 12.617  17.591  1.00 3.55 ? 1  MET A H3   18 
ATOM   7934  H HA   . MET A 1 1  ? -9.661  10.434  16.992  1.00 2.39 ? 1  MET A HA   18 
ATOM   7935  H HB2  . MET A 1 1  ? -11.547 10.980  14.865  1.00 3.30 ? 1  MET A HB2  18 
ATOM   7936  H HB3  . MET A 1 1  ? -10.002 10.484  14.175  1.00 2.64 ? 1  MET A HB3  18 
ATOM   7937  H HG2  . MET A 1 1  ? -11.345 8.498   14.583  1.00 3.03 ? 1  MET A HG2  18 
ATOM   7938  H HG3  . MET A 1 1  ? -9.999  8.514   15.722  1.00 2.83 ? 1  MET A HG3  18 
ATOM   7939  H HE1  . MET A 1 1  ? -11.186 6.752   17.043  1.00 3.79 ? 1  MET A HE1  18 
ATOM   7940  H HE2  . MET A 1 1  ? -12.748 6.909   17.858  1.00 3.76 ? 1  MET A HE2  18 
ATOM   7941  H HE3  . MET A 1 1  ? -12.677 6.750   16.104  1.00 4.08 ? 1  MET A HE3  18 
ATOM   7942  N N    . ILE A 1 2  ? -7.487  11.090  15.759  1.00 1.72 ? 2  ILE A N    18 
ATOM   7943  C CA   . ILE A 1 2  ? -6.187  11.666  15.283  1.00 1.88 ? 2  ILE A CA   18 
ATOM   7944  C C    . ILE A 1 2  ? -5.424  10.636  14.439  1.00 1.58 ? 2  ILE A C    18 
ATOM   7945  O O    . ILE A 1 2  ? -5.570  9.441   14.619  1.00 1.58 ? 2  ILE A O    18 
ATOM   7946  C CB   . ILE A 1 2  ? -5.393  12.016  16.553  1.00 2.14 ? 2  ILE A CB   18 
ATOM   7947  C CG1  . ILE A 1 2  ? -5.288  10.787  17.466  1.00 1.95 ? 2  ILE A CG1  18 
ATOM   7948  C CG2  . ILE A 1 2  ? -6.096  13.148  17.306  1.00 2.58 ? 2  ILE A CG2  18 
ATOM   7949  C CD1  . ILE A 1 2  ? -3.951  10.815  18.210  1.00 2.55 ? 2  ILE A CD1  18 
ATOM   7950  H H    . ILE A 1 2  ? -7.516  10.173  16.106  1.00 1.59 ? 2  ILE A H    18 
ATOM   7951  H HA   . ILE A 1 2  ? -6.365  12.560  14.706  1.00 2.34 ? 2  ILE A HA   18 
ATOM   7952  H HB   . ILE A 1 2  ? -4.401  12.340  16.271  1.00 2.48 ? 2  ILE A HB   18 
ATOM   7953  H HG12 . ILE A 1 2  ? -6.097  10.800  18.182  1.00 2.02 ? 2  ILE A HG12 18 
ATOM   7954  H HG13 . ILE A 1 2  ? -5.347  9.888   16.873  1.00 1.64 ? 2  ILE A HG13 18 
ATOM   7955  H HG21 . ILE A 1 2  ? -6.465  13.877  16.600  1.00 2.97 ? 2  ILE A HG21 18 
ATOM   7956  H HG22 . ILE A 1 2  ? -6.922  12.745  17.873  1.00 2.85 ? 2  ILE A HG22 18 
ATOM   7957  H HG23 . ILE A 1 2  ? -5.395  13.621  17.979  1.00 2.79 ? 2  ILE A HG23 18 
ATOM   7958  H HD11 . ILE A 1 2  ? -3.152  10.997  17.506  1.00 2.79 ? 2  ILE A HD11 18 
ATOM   7959  H HD12 . ILE A 1 2  ? -3.966  11.604  18.948  1.00 2.93 ? 2  ILE A HD12 18 
ATOM   7960  H HD13 . ILE A 1 2  ? -3.791  9.867   18.701  1.00 2.94 ? 2  ILE A HD13 18 
ATOM   7961  N N    . SER A 1 3  ? -4.608  11.092  13.523  1.00 1.66 ? 3  SER A N    18 
ATOM   7962  C CA   . SER A 1 3  ? -3.828  10.143  12.667  1.00 1.48 ? 3  SER A CA   18 
ATOM   7963  C C    . SER A 1 3  ? -2.337  10.184  13.040  1.00 1.47 ? 3  SER A C    18 
ATOM   7964  O O    . SER A 1 3  ? -1.472  10.184  12.185  1.00 1.62 ? 3  SER A O    18 
ATOM   7965  C CB   . SER A 1 3  ? -4.044  10.633  11.230  1.00 1.76 ? 3  SER A CB   18 
ATOM   7966  O OG   . SER A 1 3  ? -4.708  9.620   10.481  1.00 1.91 ? 3  SER A OG   18 
ATOM   7967  H H    . SER A 1 3  ? -4.503  12.059  13.400  1.00 2.01 ? 3  SER A H    18 
ATOM   7968  H HA   . SER A 1 3  ? -4.212  9.140   12.772  1.00 1.62 ? 3  SER A HA   18 
ATOM   7969  H HB2  . SER A 1 3  ? -4.651  11.523  11.238  1.00 2.08 ? 3  SER A HB2  18 
ATOM   7970  H HB3  . SER A 1 3  ? -3.085  10.859  10.779  1.00 2.37 ? 3  SER A HB3  18 
ATOM   7971  H HG   . SER A 1 3  ? -4.254  8.782   10.639  1.00 1.87 ? 3  SER A HG   18 
ATOM   7972  N N    . SER A 1 4  ? -2.032  10.219  14.315  1.00 1.68 ? 4  SER A N    18 
ATOM   7973  C CA   . SER A 1 4  ? -0.597  10.262  14.748  1.00 2.22 ? 4  SER A CA   18 
ATOM   7974  C C    . SER A 1 4  ? 0.048   8.879   14.603  1.00 2.50 ? 4  SER A C    18 
ATOM   7975  O O    . SER A 1 4  ? 1.131   8.746   14.068  1.00 3.02 ? 4  SER A O    18 
ATOM   7976  C CB   . SER A 1 4  ? -0.629  10.691  16.217  1.00 2.54 ? 4  SER A CB   18 
ATOM   7977  O OG   . SER A 1 4  ? -1.231  11.976  16.319  1.00 2.87 ? 4  SER A OG   18 
ATOM   7978  H H    . SER A 1 4  ? -2.744  10.219  14.989  1.00 1.66 ? 4  SER A H    18 
ATOM   7979  H HA   . SER A 1 4  ? -0.055  10.986  14.167  1.00 2.41 ? 4  SER A HA   18 
ATOM   7980  H HB2  . SER A 1 4  ? -1.204  9.983   16.789  1.00 2.30 ? 4  SER A HB2  18 
ATOM   7981  H HB3  . SER A 1 4  ? 0.382   10.723  16.603  1.00 2.95 ? 4  SER A HB3  18 
ATOM   7982  H HG   . SER A 1 4  ? -0.530  12.628  16.403  1.00 3.12 ? 4  SER A HG   18 
ATOM   7983  N N    . VAL A 1 5  ? -0.615  7.853   15.071  1.00 2.36 ? 5  VAL A N    18 
ATOM   7984  C CA   . VAL A 1 5  ? -0.048  6.471   14.959  1.00 2.86 ? 5  VAL A CA   18 
ATOM   7985  C C    . VAL A 1 5  ? -0.387  5.856   13.593  1.00 2.67 ? 5  VAL A C    18 
ATOM   7986  O O    . VAL A 1 5  ? 0.343   5.029   13.079  1.00 3.08 ? 5  VAL A O    18 
ATOM   7987  C CB   . VAL A 1 5  ? -0.696  5.675   16.103  1.00 3.15 ? 5  VAL A CB   18 
ATOM   7988  C CG1  . VAL A 1 5  ? -2.162  5.369   15.778  1.00 2.92 ? 5  VAL A CG1  18 
ATOM   7989  C CG2  . VAL A 1 5  ? 0.062   4.360   16.299  1.00 3.88 ? 5  VAL A CG2  18 
ATOM   7990  H H    . VAL A 1 5  ? -1.485  7.993   15.493  1.00 2.09 ? 5  VAL A H    18 
ATOM   7991  H HA   . VAL A 1 5  ? 1.018   6.498   15.093  1.00 3.28 ? 5  VAL A HA   18 
ATOM   7992  H HB   . VAL A 1 5  ? -0.647  6.256   17.012  1.00 3.17 ? 5  VAL A HB   18 
ATOM   7993  H HG11 . VAL A 1 5  ? -2.654  6.271   15.443  1.00 2.99 ? 5  VAL A HG11 18 
ATOM   7994  H HG12 . VAL A 1 5  ? -2.211  4.623   14.999  1.00 3.00 ? 5  VAL A HG12 18 
ATOM   7995  H HG13 . VAL A 1 5  ? -2.657  4.997   16.663  1.00 3.19 ? 5  VAL A HG13 18 
ATOM   7996  H HG21 . VAL A 1 5  ? 0.108   3.827   15.361  1.00 4.15 ? 5  VAL A HG21 18 
ATOM   7997  H HG22 . VAL A 1 5  ? 1.064   4.569   16.643  1.00 4.16 ? 5  VAL A HG22 18 
ATOM   7998  H HG23 . VAL A 1 5  ? -0.451  3.755   17.032  1.00 4.20 ? 5  VAL A HG23 18 
ATOM   7999  N N    . CYS A 1 6  ? -1.482  6.260   13.006  1.00 2.10 ? 6  CYS A N    18 
ATOM   8000  C CA   . CYS A 1 6  ? -1.878  5.714   11.673  1.00 1.90 ? 6  CYS A CA   18 
ATOM   8001  C C    . CYS A 1 6  ? -2.392  6.844   10.774  1.00 1.30 ? 6  CYS A C    18 
ATOM   8002  O O    . CYS A 1 6  ? -3.374  7.497   11.077  1.00 1.11 ? 6  CYS A O    18 
ATOM   8003  C CB   . CYS A 1 6  ? -2.997  4.711   11.964  1.00 2.21 ? 6  CYS A CB   18 
ATOM   8004  S SG   . CYS A 1 6  ? -2.281  3.146   12.523  1.00 3.03 ? 6  CYS A SG   18 
ATOM   8005  H H    . CYS A 1 6  ? -2.045  6.929   13.443  1.00 1.86 ? 6  CYS A H    18 
ATOM   8006  H HA   . CYS A 1 6  ? -1.045  5.211   11.208  1.00 2.15 ? 6  CYS A HA   18 
ATOM   8007  H HB2  . CYS A 1 6  ? -3.644  5.108   12.731  1.00 2.27 ? 6  CYS A HB2  18 
ATOM   8008  H HB3  . CYS A 1 6  ? -3.569  4.543   11.063  1.00 2.11 ? 6  CYS A HB3  18 
ATOM   8009  H HG   . CYS A 1 6  ? -1.652  3.340   13.223  1.00 3.27 ? 6  CYS A HG   18 
ATOM   8010  N N    . VAL A 1 7  ? -1.729  7.078   9.673   1.00 1.23 ? 7  VAL A N    18 
ATOM   8011  C CA   . VAL A 1 7  ? -2.157  8.159   8.742   1.00 0.99 ? 7  VAL A CA   18 
ATOM   8012  C C    . VAL A 1 7  ? -2.013  7.692   7.289   1.00 0.84 ? 7  VAL A C    18 
ATOM   8013  O O    . VAL A 1 7  ? -1.424  6.665   7.008   1.00 0.90 ? 7  VAL A O    18 
ATOM   8014  C CB   . VAL A 1 7  ? -1.218  9.333   9.047   1.00 1.56 ? 7  VAL A CB   18 
ATOM   8015  C CG1  . VAL A 1 7  ? 0.200   9.017   8.561   1.00 1.89 ? 7  VAL A CG1  18 
ATOM   8016  C CG2  . VAL A 1 7  ? -1.724  10.597  8.347   1.00 1.86 ? 7  VAL A CG2  18 
ATOM   8017  H H    . VAL A 1 7  ? -0.946  6.541   9.456   1.00 1.54 ? 7  VAL A H    18 
ATOM   8018  H HA   . VAL A 1 7  ? -3.177  8.444   8.942   1.00 0.92 ? 7  VAL A HA   18 
ATOM   8019  H HB   . VAL A 1 7  ? -1.199  9.499   10.111  1.00 1.74 ? 7  VAL A HB   18 
ATOM   8020  H HG11 . VAL A 1 7  ? 0.513   8.062   8.957   1.00 2.23 ? 7  VAL A HG11 18 
ATOM   8021  H HG12 . VAL A 1 7  ? 0.214   8.981   7.483   1.00 2.25 ? 7  VAL A HG12 18 
ATOM   8022  H HG13 . VAL A 1 7  ? 0.877   9.786   8.903   1.00 2.21 ? 7  VAL A HG13 18 
ATOM   8023  H HG21 . VAL A 1 7  ? -2.802  10.633  8.405   1.00 1.71 ? 7  VAL A HG21 18 
ATOM   8024  H HG22 . VAL A 1 7  ? -1.309  11.467  8.835   1.00 2.25 ? 7  VAL A HG22 18 
ATOM   8025  H HG23 . VAL A 1 7  ? -1.418  10.584  7.313   1.00 2.27 ? 7  VAL A HG23 18 
HETATM 8026  N N    . SEP A 1 8  ? -2.554  8.445   6.372   1.00 1.00 ? 8  SEP A N    18 
HETATM 8027  C CA   . SEP A 1 8  ? -2.470  8.069   4.921   1.00 0.94 ? 8  SEP A CA   18 
HETATM 8028  C CB   . SEP A 1 8  ? -3.162  9.208   4.169   1.00 1.01 ? 8  SEP A CB   18 
HETATM 8029  O OG   . SEP A 1 8  ? -4.571  8.951   4.115   1.00 1.07 ? 8  SEP A OG   18 
HETATM 8030  C C    . SEP A 1 8  ? -1.008  7.940   4.475   1.00 0.90 ? 8  SEP A C    18 
HETATM 8031  O O    . SEP A 1 8  ? -0.655  7.018   3.767   1.00 0.90 ? 8  SEP A O    18 
HETATM 8032  P P    . SEP A 1 8  ? -5.588  9.752   5.072   1.00 1.13 ? 8  SEP A P    18 
HETATM 8033  O O1P  . SEP A 1 8  ? -5.413  9.256   6.454   1.00 1.46 ? 8  SEP A O1P  18 
HETATM 8034  O O2P  . SEP A 1 8  ? -5.454  11.197  4.783   1.00 1.79 ? 8  SEP A O2P  18 
HETATM 8035  O O3P  . SEP A 1 8  ? -7.027  9.262   4.542   1.00 2.00 ? 8  SEP A O3P  18 
HETATM 8036  H H    . SEP A 1 8  ? -3.019  9.261   6.640   1.00 1.29 ? 8  SEP A H    18 
HETATM 8037  H HA   . SEP A 1 8  ? -2.993  7.146   4.747   1.00 0.97 ? 8  SEP A HA   18 
HETATM 8038  H HB2  . SEP A 1 8  ? -2.760  9.271   3.167   1.00 1.08 ? 8  SEP A HB2  18 
HETATM 8039  H HB3  . SEP A 1 8  ? -2.989  10.140  4.681   1.00 1.09 ? 8  SEP A HB3  18 
HETATM 8040  H HOP3 . SEP A 1 8  ? -7.062  8.311   4.655   1.00 2.43 ? 8  SEP A HOP3 18 
ATOM   8041  N N    . SER A 1 9  ? -0.169  8.858   4.897   1.00 0.95 ? 9  SER A N    18 
ATOM   8042  C CA   . SER A 1 9  ? 1.288   8.831   4.531   1.00 0.97 ? 9  SER A CA   18 
ATOM   8043  C C    . SER A 1 9  ? 1.488   9.045   3.026   1.00 0.86 ? 9  SER A C    18 
ATOM   8044  O O    . SER A 1 9  ? 1.129   8.210   2.225   1.00 0.78 ? 9  SER A O    18 
ATOM   8045  C CB   . SER A 1 9  ? 1.808   7.454   4.946   1.00 1.07 ? 9  SER A CB   18 
ATOM   8046  O OG   . SER A 1 9  ? 1.515   7.227   6.322   1.00 1.27 ? 9  SER A OG   18 
ATOM   8047  H H    . SER A 1 9  ? -0.500  9.574   5.468   1.00 1.01 ? 9  SER A H    18 
ATOM   8048  H HA   . SER A 1 9  ? 1.815   9.593   5.082   1.00 1.08 ? 9  SER A HA   18 
ATOM   8049  H HB2  . SER A 1 9  ? 1.334   6.694   4.349   1.00 1.02 ? 9  SER A HB2  18 
ATOM   8050  H HB3  . SER A 1 9  ? 2.876   7.418   4.784   1.00 1.16 ? 9  SER A HB3  18 
ATOM   8051  H HG   . SER A 1 9  ? 0.645   6.817   6.381   1.00 1.67 ? 9  SER A HG   18 
ATOM   8052  N N    . TYR A 1 10 ? 2.086   10.162  2.667   1.00 0.90 ? 10 TYR A N    18 
ATOM   8053  C CA   . TYR A 1 10 ? 2.379   10.515  1.229   1.00 0.85 ? 10 TYR A CA   18 
ATOM   8054  C C    . TYR A 1 10 ? 1.255   10.086  0.254   1.00 0.74 ? 10 TYR A C    18 
ATOM   8055  O O    . TYR A 1 10 ? 0.154   9.752   0.650   1.00 0.74 ? 10 TYR A O    18 
ATOM   8056  C CB   . TYR A 1 10 ? 3.738   9.833   0.929   1.00 0.90 ? 10 TYR A CB   18 
ATOM   8057  C CG   . TYR A 1 10 ? 3.575   8.461   0.304   1.00 0.85 ? 10 TYR A CG   18 
ATOM   8058  C CD1  . TYR A 1 10 ? 3.321   7.345   1.106   1.00 0.89 ? 10 TYR A CD1  18 
ATOM   8059  C CD2  . TYR A 1 10 ? 3.701   8.309   -1.081  1.00 0.84 ? 10 TYR A CD2  18 
ATOM   8060  C CE1  . TYR A 1 10 ? 3.186   6.080   0.525   1.00 0.95 ? 10 TYR A CE1  18 
ATOM   8061  C CE2  . TYR A 1 10 ? 3.565   7.044   -1.666  1.00 0.92 ? 10 TYR A CE2  18 
ATOM   8062  C CZ   . TYR A 1 10 ? 3.307   5.927   -0.862  1.00 0.98 ? 10 TYR A CZ   18 
ATOM   8063  O OH   . TYR A 1 10 ? 3.174   4.676   -1.434  1.00 1.12 ? 10 TYR A OH   18 
ATOM   8064  H H    . TYR A 1 10 ? 2.369   10.782  3.365   1.00 1.01 ? 10 TYR A H    18 
ATOM   8065  H HA   . TYR A 1 10 ? 2.510   11.581  1.153   1.00 0.94 ? 10 TYR A HA   18 
ATOM   8066  H HB2  . TYR A 1 10 ? 4.301   10.455  0.253   1.00 0.94 ? 10 TYR A HB2  18 
ATOM   8067  H HB3  . TYR A 1 10 ? 4.289   9.733   1.853   1.00 1.03 ? 10 TYR A HB3  18 
ATOM   8068  H HD1  . TYR A 1 10 ? 3.223   7.462   2.178   1.00 0.94 ? 10 TYR A HD1  18 
ATOM   8069  H HD2  . TYR A 1 10 ? 3.900   9.171   -1.699  1.00 0.85 ? 10 TYR A HD2  18 
ATOM   8070  H HE1  . TYR A 1 10 ? 2.987   5.221   1.145   1.00 1.02 ? 10 TYR A HE1  18 
ATOM   8071  H HE2  . TYR A 1 10 ? 3.657   6.932   -2.735  1.00 0.99 ? 10 TYR A HE2  18 
ATOM   8072  H HH   . TYR A 1 10 ? 3.322   4.019   -0.746  1.00 1.32 ? 10 TYR A HH   18 
ATOM   8073  N N    . ARG A 1 11 ? 1.525   10.125  -1.026  1.00 0.73 ? 11 ARG A N    18 
ATOM   8074  C CA   . ARG A 1 11 ? 0.494   9.731   -2.033  1.00 0.77 ? 11 ARG A CA   18 
ATOM   8075  C C    . ARG A 1 11 ? 0.413   8.198   -2.109  1.00 0.78 ? 11 ARG A C    18 
ATOM   8076  O O    . ARG A 1 11 ? 0.769   7.506   -1.176  1.00 0.77 ? 11 ARG A O    18 
ATOM   8077  C CB   . ARG A 1 11 ? 1.005   10.323  -3.353  1.00 0.82 ? 11 ARG A CB   18 
ATOM   8078  C CG   . ARG A 1 11 ? 0.181   11.559  -3.713  1.00 0.94 ? 11 ARG A CG   18 
ATOM   8079  C CD   . ARG A 1 11 ? 0.115   11.703  -5.237  1.00 1.07 ? 11 ARG A CD   18 
ATOM   8080  N NE   . ARG A 1 11 ? 0.105   13.174  -5.484  1.00 1.32 ? 11 ARG A NE   18 
ATOM   8081  C CZ   . ARG A 1 11 ? -1.024  13.806  -5.627  1.00 1.80 ? 11 ARG A CZ   18 
ATOM   8082  N NH1  . ARG A 1 11 ? -1.820  13.960  -4.606  1.00 2.11 ? 11 ARG A NH1  18 
ATOM   8083  N NH2  . ARG A 1 11 ? -1.351  14.288  -6.790  1.00 2.53 ? 11 ARG A NH2  18 
ATOM   8084  H H    . ARG A 1 11 ? 2.406   10.422  -1.327  1.00 0.76 ? 11 ARG A H    18 
ATOM   8085  H HA   . ARG A 1 11 ? -0.465  10.148  -1.784  1.00 0.84 ? 11 ARG A HA   18 
ATOM   8086  H HB2  . ARG A 1 11 ? 2.043   10.605  -3.243  1.00 0.80 ? 11 ARG A HB2  18 
ATOM   8087  H HB3  . ARG A 1 11 ? 0.916   9.592   -4.139  1.00 0.89 ? 11 ARG A HB3  18 
ATOM   8088  H HG2  . ARG A 1 11 ? -0.817  11.453  -3.316  1.00 1.21 ? 11 ARG A HG2  18 
ATOM   8089  H HG3  . ARG A 1 11 ? 0.648   12.437  -3.290  1.00 1.15 ? 11 ARG A HG3  18 
ATOM   8090  H HD2  . ARG A 1 11 ? 0.983   11.248  -5.694  1.00 1.06 ? 11 ARG A HD2  18 
ATOM   8091  H HD3  . ARG A 1 11 ? -0.790  11.257  -5.618  1.00 1.48 ? 11 ARG A HD3  18 
ATOM   8092  H HE   . ARG A 1 11 ? 0.955   13.668  -5.548  1.00 1.51 ? 11 ARG A HE   18 
ATOM   8093  H HH11 . ARG A 1 11 ? -1.560  13.593  -3.714  1.00 2.17 ? 11 ARG A HH11 18 
ATOM   8094  H HH12 . ARG A 1 11 ? -2.687  14.444  -4.714  1.00 2.66 ? 11 ARG A HH12 18 
ATOM   8095  H HH21 . ARG A 1 11 ? -0.730  14.171  -7.570  1.00 2.81 ? 11 ARG A HH21 18 
ATOM   8096  H HH22 . ARG A 1 11 ? -2.215  14.774  -6.908  1.00 3.04 ? 11 ARG A HH22 18 
ATOM   8097  N N    . GLY A 1 12 ? -0.023  7.658   -3.217  1.00 0.89 ? 12 GLY A N    18 
ATOM   8098  C CA   . GLY A 1 12 ? -0.081  6.173   -3.346  1.00 1.01 ? 12 GLY A CA   18 
ATOM   8099  C C    . GLY A 1 12 ? 1.015   5.729   -4.315  1.00 1.08 ? 12 GLY A C    18 
ATOM   8100  O O    . GLY A 1 12 ? 1.036   4.601   -4.773  1.00 1.23 ? 12 GLY A O    18 
ATOM   8101  H H    . GLY A 1 12 ? -0.284  8.224   -3.974  1.00 0.95 ? 12 GLY A H    18 
ATOM   8102  H HA2  . GLY A 1 12 ? 0.081   5.718   -2.379  1.00 0.99 ? 12 GLY A HA2  18 
ATOM   8103  H HA3  . GLY A 1 12 ? -1.042  5.879   -3.733  1.00 1.14 ? 12 GLY A HA3  18 
ATOM   8104  N N    . ARG A 1 13 ? 1.924   6.620   -4.632  1.00 0.99 ? 13 ARG A N    18 
ATOM   8105  C CA   . ARG A 1 13 ? 3.020   6.289   -5.576  1.00 1.07 ? 13 ARG A CA   18 
ATOM   8106  C C    . ARG A 1 13 ? 4.387   6.394   -4.879  1.00 1.03 ? 13 ARG A C    18 
ATOM   8107  O O    . ARG A 1 13 ? 5.041   7.421   -4.900  1.00 0.97 ? 13 ARG A O    18 
ATOM   8108  C CB   . ARG A 1 13 ? 2.864   7.319   -6.707  1.00 1.05 ? 13 ARG A CB   18 
ATOM   8109  C CG   . ARG A 1 13 ? 3.034   8.751   -6.173  1.00 0.88 ? 13 ARG A CG   18 
ATOM   8110  C CD   . ARG A 1 13 ? 4.255   9.404   -6.829  1.00 0.88 ? 13 ARG A CD   18 
ATOM   8111  N NE   . ARG A 1 13 ? 3.713   10.151  -8.002  1.00 0.94 ? 13 ARG A NE   18 
ATOM   8112  C CZ   . ARG A 1 13 ? 3.612   11.449  -7.961  1.00 1.05 ? 13 ARG A CZ   18 
ATOM   8113  N NH1  . ARG A 1 13 ? 4.684   12.183  -7.886  1.00 1.25 ? 13 ARG A NH1  18 
ATOM   8114  N NH2  . ARG A 1 13 ? 2.438   12.010  -8.000  1.00 1.19 ? 13 ARG A NH2  18 
ATOM   8115  H H    . ARG A 1 13 ? 1.879   7.516   -4.252  1.00 0.90 ? 13 ARG A H    18 
ATOM   8116  H HA   . ARG A 1 13 ? 2.882   5.296   -5.966  1.00 1.21 ? 13 ARG A HA   18 
ATOM   8117  H HB2  . ARG A 1 13 ? 3.603   7.130   -7.460  1.00 1.14 ? 13 ARG A HB2  18 
ATOM   8118  H HB3  . ARG A 1 13 ? 1.879   7.220   -7.139  1.00 1.11 ? 13 ARG A HB3  18 
ATOM   8119  H HG2  . ARG A 1 13 ? 2.150   9.327   -6.404  1.00 0.90 ? 13 ARG A HG2  18 
ATOM   8120  H HG3  . ARG A 1 13 ? 3.176   8.724   -5.103  1.00 0.83 ? 13 ARG A HG3  18 
ATOM   8121  H HD2  . ARG A 1 13 ? 4.735   10.081  -6.135  1.00 0.87 ? 13 ARG A HD2  18 
ATOM   8122  H HD3  . ARG A 1 13 ? 4.953   8.650   -7.161  1.00 1.04 ? 13 ARG A HD3  18 
ATOM   8123  H HE   . ARG A 1 13 ? 3.437   9.666   -8.808  1.00 1.08 ? 13 ARG A HE   18 
ATOM   8124  H HH11 . ARG A 1 13 ? 5.589   11.749  -7.860  1.00 1.28 ? 13 ARG A HH11 18 
ATOM   8125  H HH12 . ARG A 1 13 ? 4.606   13.184  -7.849  1.00 1.49 ? 13 ARG A HH12 18 
ATOM   8126  H HH21 . ARG A 1 13 ? 1.616   11.446  -8.059  1.00 1.15 ? 13 ARG A HH21 18 
ATOM   8127  H HH22 . ARG A 1 13 ? 2.357   13.007  -7.970  1.00 1.47 ? 13 ARG A HH22 18 
ATOM   8128  N N    . LYS A 1 14 ? 4.820   5.330   -4.258  1.00 1.11 ? 14 LYS A N    18 
ATOM   8129  C CA   . LYS A 1 14 ? 6.141   5.341   -3.551  1.00 1.16 ? 14 LYS A CA   18 
ATOM   8130  C C    . LYS A 1 14 ? 7.301   5.176   -4.552  1.00 1.28 ? 14 LYS A C    18 
ATOM   8131  O O    . LYS A 1 14 ? 8.190   4.367   -4.361  1.00 1.46 ? 14 LYS A O    18 
ATOM   8132  C CB   . LYS A 1 14 ? 6.079   4.153   -2.579  1.00 1.31 ? 14 LYS A CB   18 
ATOM   8133  C CG   . LYS A 1 14 ? 5.864   2.841   -3.349  1.00 1.51 ? 14 LYS A CG   18 
ATOM   8134  C CD   . LYS A 1 14 ? 4.633   2.108   -2.797  1.00 1.58 ? 14 LYS A CD   18 
ATOM   8135  C CE   . LYS A 1 14 ? 3.508   2.124   -3.840  1.00 1.59 ? 14 LYS A CE   18 
ATOM   8136  N NZ   . LYS A 1 14 ? 2.435   2.986   -3.256  1.00 1.44 ? 14 LYS A NZ   18 
ATOM   8137  H H    . LYS A 1 14 ? 4.275   4.522   -4.254  1.00 1.18 ? 14 LYS A H    18 
ATOM   8138  H HA   . LYS A 1 14 ? 6.259   6.259   -2.998  1.00 1.07 ? 14 LYS A HA   18 
ATOM   8139  H HB2  . LYS A 1 14 ? 7.004   4.096   -2.030  1.00 1.40 ? 14 LYS A HB2  18 
ATOM   8140  H HB3  . LYS A 1 14 ? 5.263   4.299   -1.888  1.00 1.24 ? 14 LYS A HB3  18 
ATOM   8141  H HG2  . LYS A 1 14 ? 5.717   3.057   -4.398  1.00 1.52 ? 14 LYS A HG2  18 
ATOM   8142  H HG3  . LYS A 1 14 ? 6.734   2.212   -3.233  1.00 1.67 ? 14 LYS A HG3  18 
ATOM   8143  H HD2  . LYS A 1 14 ? 4.898   1.085   -2.570  1.00 1.77 ? 14 LYS A HD2  18 
ATOM   8144  H HD3  . LYS A 1 14 ? 4.296   2.598   -1.898  1.00 1.53 ? 14 LYS A HD3  18 
ATOM   8145  H HE2  . LYS A 1 14 ? 3.866   2.542   -4.772  1.00 1.60 ? 14 LYS A HE2  18 
ATOM   8146  H HE3  . LYS A 1 14 ? 3.132   1.124   -4.000  1.00 1.79 ? 14 LYS A HE3  18 
ATOM   8147  H HZ1  . LYS A 1 14 ? 2.863   3.778   -2.725  1.00 1.42 ? 14 LYS A HZ1  18 
ATOM   8148  H HZ2  . LYS A 1 14 ? 1.839   3.369   -4.026  1.00 1.37 ? 14 LYS A HZ2  18 
ATOM   8149  H HZ3  . LYS A 1 14 ? 1.846   2.420   -2.615  1.00 1.68 ? 14 LYS A HZ3  18 
ATOM   8150  N N    . SER A 1 15 ? 7.298   5.944   -5.615  1.00 1.22 ? 15 SER A N    18 
ATOM   8151  C CA   . SER A 1 15 ? 8.392   5.845   -6.630  1.00 1.34 ? 15 SER A CA   18 
ATOM   8152  C C    . SER A 1 15 ? 8.360   7.063   -7.566  1.00 1.22 ? 15 SER A C    18 
ATOM   8153  O O    . SER A 1 15 ? 7.894   6.982   -8.688  1.00 1.42 ? 15 SER A O    18 
ATOM   8154  C CB   . SER A 1 15 ? 8.100   4.559   -7.408  1.00 1.53 ? 15 SER A CB   18 
ATOM   8155  O OG   . SER A 1 15 ? 9.219   4.243   -8.228  1.00 1.72 ? 15 SER A OG   18 
ATOM   8156  H H    . SER A 1 15 ? 6.575   6.591   -5.743  1.00 1.10 ? 15 SER A H    18 
ATOM   8157  H HA   . SER A 1 15 ? 9.352   5.771   -6.144  1.00 1.42 ? 15 SER A HA   18 
ATOM   8158  H HB2  . SER A 1 15 ? 7.927   3.751   -6.718  1.00 1.60 ? 15 SER A HB2  18 
ATOM   8159  H HB3  . SER A 1 15 ? 7.219   4.702   -8.020  1.00 1.50 ? 15 SER A HB3  18 
ATOM   8160  H HG   . SER A 1 15 ? 9.169   4.784   -9.022  1.00 2.12 ? 15 SER A HG   18 
ATOM   8161  N N    . GLY A 1 16 ? 8.850   8.191   -7.113  1.00 1.19 ? 16 GLY A N    18 
ATOM   8162  C CA   . GLY A 1 16 ? 8.850   9.411   -7.977  1.00 1.12 ? 16 GLY A CA   18 
ATOM   8163  C C    . GLY A 1 16 ? 8.098   10.550  -7.280  1.00 1.02 ? 16 GLY A C    18 
ATOM   8164  O O    . GLY A 1 16 ? 6.995   10.900  -7.659  1.00 1.10 ? 16 GLY A O    18 
ATOM   8165  H H    . GLY A 1 16 ? 9.220   8.233   -6.206  1.00 1.40 ? 16 GLY A H    18 
ATOM   8166  H HA2  . GLY A 1 16 ? 9.869   9.717   -8.164  1.00 1.14 ? 16 GLY A HA2  18 
ATOM   8167  H HA3  . GLY A 1 16 ? 8.364   9.189   -8.915  1.00 1.19 ? 16 GLY A HA3  18 
ATOM   8168  N N    . ASN A 1 17 ? 8.691   11.135  -6.270  1.00 0.92 ? 17 ASN A N    18 
ATOM   8169  C CA   . ASN A 1 17 ? 8.022   12.263  -5.548  1.00 0.89 ? 17 ASN A CA   18 
ATOM   8170  C C    . ASN A 1 17 ? 8.831   13.559  -5.725  1.00 0.82 ? 17 ASN A C    18 
ATOM   8171  O O    . ASN A 1 17 ? 9.740   13.627  -6.533  1.00 0.78 ? 17 ASN A O    18 
ATOM   8172  C CB   . ASN A 1 17 ? 7.982   11.831  -4.075  1.00 0.97 ? 17 ASN A CB   18 
ATOM   8173  C CG   . ASN A 1 17 ? 9.401   11.583  -3.554  1.00 1.02 ? 17 ASN A CG   18 
ATOM   8174  O OD1  . ASN A 1 17 ? 9.949   10.515  -3.737  1.00 1.29 ? 17 ASN A OD1  18 
ATOM   8175  N ND2  . ASN A 1 17 ? 10.023  12.528  -2.907  1.00 1.28 ? 17 ASN A ND2  18 
ATOM   8176  H H    . ASN A 1 17 ? 9.582   10.839  -5.990  1.00 0.92 ? 17 ASN A H    18 
ATOM   8177  H HA   . ASN A 1 17 ? 7.018   12.399  -5.917  1.00 0.94 ? 17 ASN A HA   18 
ATOM   8178  H HB2  . ASN A 1 17 ? 7.517   12.608  -3.488  1.00 1.04 ? 17 ASN A HB2  18 
ATOM   8179  H HB3  . ASN A 1 17 ? 7.406   10.924  -3.985  1.00 1.02 ? 17 ASN A HB3  18 
ATOM   8180  H HD21 . ASN A 1 17 ? 9.585   13.392  -2.757  1.00 1.63 ? 17 ASN A HD21 18 
ATOM   8181  H HD22 . ASN A 1 17 ? 10.930  12.375  -2.571  1.00 1.38 ? 17 ASN A HD22 18 
ATOM   8182  N N    . LYS A 1 18 ? 8.505   14.589  -4.982  1.00 0.86 ? 18 LYS A N    18 
ATOM   8183  C CA   . LYS A 1 18 ? 9.250   15.877  -5.114  1.00 0.84 ? 18 LYS A CA   18 
ATOM   8184  C C    . LYS A 1 18 ? 10.053  16.172  -3.835  1.00 0.98 ? 18 LYS A C    18 
ATOM   8185  O O    . LYS A 1 18 ? 9.514   16.682  -2.868  1.00 1.14 ? 18 LYS A O    18 
ATOM   8186  C CB   . LYS A 1 18 ? 8.164   16.935  -5.331  1.00 0.86 ? 18 LYS A CB   18 
ATOM   8187  C CG   . LYS A 1 18 ? 7.804   17.007  -6.818  1.00 0.79 ? 18 LYS A CG   18 
ATOM   8188  C CD   . LYS A 1 18 ? 8.298   18.333  -7.405  1.00 0.73 ? 18 LYS A CD   18 
ATOM   8189  C CE   . LYS A 1 18 ? 9.173   18.059  -8.632  1.00 0.70 ? 18 LYS A CE   18 
ATOM   8190  N NZ   . LYS A 1 18 ? 9.837   19.358  -8.931  1.00 0.69 ? 18 LYS A NZ   18 
ATOM   8191  H H    . LYS A 1 18 ? 7.767   14.515  -4.342  1.00 0.94 ? 18 LYS A H    18 
ATOM   8192  H HA   . LYS A 1 18 ? 9.906   15.847  -5.969  1.00 0.79 ? 18 LYS A HA   18 
ATOM   8193  H HB2  . LYS A 1 18 ? 7.285   16.670  -4.759  1.00 0.94 ? 18 LYS A HB2  18 
ATOM   8194  H HB3  . LYS A 1 18 ? 8.528   17.895  -5.002  1.00 0.92 ? 18 LYS A HB3  18 
ATOM   8195  H HG2  . LYS A 1 18 ? 8.268   16.183  -7.341  1.00 0.80 ? 18 LYS A HG2  18 
ATOM   8196  H HG3  . LYS A 1 18 ? 6.731   16.944  -6.931  1.00 0.90 ? 18 LYS A HG3  18 
ATOM   8197  H HD2  . LYS A 1 18 ? 7.449   18.936  -7.695  1.00 0.86 ? 18 LYS A HD2  18 
ATOM   8198  H HD3  . LYS A 1 18 ? 8.877   18.861  -6.663  1.00 0.92 ? 18 LYS A HD3  18 
ATOM   8199  H HE2  . LYS A 1 18 ? 9.910   17.300  -8.404  1.00 0.93 ? 18 LYS A HE2  18 
ATOM   8200  H HE3  . LYS A 1 18 ? 8.563   17.752  -9.469  1.00 0.81 ? 18 LYS A HE3  18 
ATOM   8201  H HZ1  . LYS A 1 18 ? 10.263  19.744  -8.058  1.00 1.29 ? 18 LYS A HZ1  18 
ATOM   8202  H HZ2  . LYS A 1 18 ? 10.587  19.208  -9.640  1.00 1.08 ? 18 LYS A HZ2  18 
ATOM   8203  H HZ3  . LYS A 1 18 ? 9.133   20.037  -9.306  1.00 1.06 ? 18 LYS A HZ3  18 
ATOM   8204  N N    . PRO A 1 19 ? 11.326  15.845  -3.877  1.00 1.07 ? 19 PRO A N    18 
ATOM   8205  C CA   . PRO A 1 19 ? 12.179  16.108  -2.682  1.00 1.25 ? 19 PRO A CA   18 
ATOM   8206  C C    . PRO A 1 19 ? 12.900  17.460  -2.823  1.00 1.30 ? 19 PRO A C    18 
ATOM   8207  O O    . PRO A 1 19 ? 13.125  17.931  -3.923  1.00 1.30 ? 19 PRO A O    18 
ATOM   8208  C CB   . PRO A 1 19 ? 13.177  14.954  -2.675  1.00 1.33 ? 19 PRO A CB   18 
ATOM   8209  C CG   . PRO A 1 19 ? 13.255  14.500  -4.093  1.00 1.22 ? 19 PRO A CG   18 
ATOM   8210  C CD   . PRO A 1 19 ? 11.928  14.809  -4.736  1.00 1.07 ? 19 PRO A CD   18 
ATOM   8211  H HA   . PRO A 1 19 ? 11.585  16.087  -1.783  1.00 1.34 ? 19 PRO A HA   18 
ATOM   8212  H HB2  . PRO A 1 19 ? 14.144  15.297  -2.333  1.00 1.44 ? 19 PRO A HB2  18 
ATOM   8213  H HB3  . PRO A 1 19 ? 12.819  14.151  -2.050  1.00 1.41 ? 19 PRO A HB3  18 
ATOM   8214  H HG2  . PRO A 1 19 ? 14.047  15.029  -4.604  1.00 1.26 ? 19 PRO A HG2  18 
ATOM   8215  H HG3  . PRO A 1 19 ? 13.436  13.437  -4.131  1.00 1.27 ? 19 PRO A HG3  18 
ATOM   8216  H HD2  . PRO A 1 19 ? 12.077  15.186  -5.739  1.00 1.08 ? 19 PRO A HD2  18 
ATOM   8217  H HD3  . PRO A 1 19 ? 11.303  13.930  -4.751  1.00 1.08 ? 19 PRO A HD3  18 
ATOM   8218  N N    . PRO A 1 20 ? 13.235  18.043  -1.696  1.00 1.47 ? 20 PRO A N    18 
ATOM   8219  C CA   . PRO A 1 20 ? 13.932  19.365  -1.739  1.00 1.58 ? 20 PRO A CA   18 
ATOM   8220  C C    . PRO A 1 20 ? 15.366  19.229  -2.280  1.00 1.66 ? 20 PRO A C    18 
ATOM   8221  O O    . PRO A 1 20 ? 15.826  20.063  -3.035  1.00 1.73 ? 20 PRO A O    18 
ATOM   8222  C CB   . PRO A 1 20 ? 13.939  19.827  -0.283  1.00 1.80 ? 20 PRO A CB   18 
ATOM   8223  C CG   . PRO A 1 20 ? 13.837  18.572  0.517   1.00 1.86 ? 20 PRO A CG   18 
ATOM   8224  C CD   . PRO A 1 20 ? 13.037  17.599  -0.304  1.00 1.65 ? 20 PRO A CD   18 
ATOM   8225  H HA   . PRO A 1 20 ? 13.372  20.064  -2.339  1.00 1.51 ? 20 PRO A HA   18 
ATOM   8226  H HB2  . PRO A 1 20 ? 14.860  20.347  -0.058  1.00 1.93 ? 20 PRO A HB2  18 
ATOM   8227  H HB3  . PRO A 1 20 ? 13.088  20.460  -0.084  1.00 1.83 ? 20 PRO A HB3  18 
ATOM   8228  H HG2  . PRO A 1 20 ? 14.825  18.176  0.709   1.00 1.95 ? 20 PRO A HG2  18 
ATOM   8229  H HG3  . PRO A 1 20 ? 13.328  18.767  1.449   1.00 2.00 ? 20 PRO A HG3  18 
ATOM   8230  H HD2  . PRO A 1 20 ? 13.412  16.593  -0.167  1.00 1.67 ? 20 PRO A HD2  18 
ATOM   8231  H HD3  . PRO A 1 20 ? 11.991  17.653  -0.042  1.00 1.68 ? 20 PRO A HD3  18 
ATOM   8232  N N    . SER A 1 21 ? 16.075  18.193  -1.896  1.00 1.72 ? 21 SER A N    18 
ATOM   8233  C CA   . SER A 1 21 ? 17.483  18.014  -2.388  1.00 1.85 ? 21 SER A CA   18 
ATOM   8234  C C    . SER A 1 21 ? 17.512  17.777  -3.907  1.00 1.74 ? 21 SER A C    18 
ATOM   8235  O O    . SER A 1 21 ? 18.432  18.198  -4.585  1.00 1.88 ? 21 SER A O    18 
ATOM   8236  C CB   . SER A 1 21 ? 18.019  16.788  -1.645  1.00 1.98 ? 21 SER A CB   18 
ATOM   8237  O OG   . SER A 1 21 ? 19.432  16.713  -1.817  1.00 2.14 ? 21 SER A OG   18 
ATOM   8238  H H    . SER A 1 21 ? 15.684  17.535  -1.284  1.00 1.73 ? 21 SER A H    18 
ATOM   8239  H HA   . SER A 1 21 ? 18.076  18.879  -2.138  1.00 1.99 ? 21 SER A HA   18 
ATOM   8240  H HB2  . SER A 1 21 ? 17.793  16.874  -0.595  1.00 2.08 ? 21 SER A HB2  18 
ATOM   8241  H HB3  . SER A 1 21 ? 17.549  15.897  -2.039  1.00 2.01 ? 21 SER A HB3  18 
ATOM   8242  H HG   . SER A 1 21 ? 19.842  16.786  -0.948  1.00 2.36 ? 21 SER A HG   18 
ATOM   8243  N N    . LYS A 1 22 ? 16.521  17.105  -4.443  1.00 1.53 ? 22 LYS A N    18 
ATOM   8244  C CA   . LYS A 1 22 ? 16.499  16.840  -5.916  1.00 1.47 ? 22 LYS A CA   18 
ATOM   8245  C C    . LYS A 1 22 ? 15.056  16.886  -6.443  1.00 1.21 ? 22 LYS A C    18 
ATOM   8246  O O    . LYS A 1 22 ? 14.408  15.870  -6.606  1.00 1.07 ? 22 LYS A O    18 
ATOM   8247  C CB   . LYS A 1 22 ? 17.095  15.435  -6.073  1.00 1.55 ? 22 LYS A CB   18 
ATOM   8248  C CG   . LYS A 1 22 ? 18.621  15.530  -6.183  1.00 1.82 ? 22 LYS A CG   18 
ATOM   8249  C CD   . LYS A 1 22 ? 19.261  15.057  -4.871  1.00 1.91 ? 22 LYS A CD   18 
ATOM   8250  C CE   . LYS A 1 22 ? 20.708  15.555  -4.792  1.00 2.21 ? 22 LYS A CE   18 
ATOM   8251  N NZ   . LYS A 1 22 ? 20.638  16.840  -4.035  1.00 2.23 ? 22 LYS A NZ   18 
ATOM   8252  H H    . LYS A 1 22 ? 15.793  16.774  -3.878  1.00 1.46 ? 22 LYS A H    18 
ATOM   8253  H HA   . LYS A 1 22 ? 17.110  17.560  -6.437  1.00 1.61 ? 22 LYS A HA   18 
ATOM   8254  H HB2  . LYS A 1 22 ? 16.830  14.833  -5.216  1.00 1.54 ? 22 LYS A HB2  18 
ATOM   8255  H HB3  . LYS A 1 22 ? 16.702  14.976  -6.969  1.00 1.49 ? 22 LYS A HB3  18 
ATOM   8256  H HG2  . LYS A 1 22 ? 18.962  14.906  -6.996  1.00 1.92 ? 22 LYS A HG2  18 
ATOM   8257  H HG3  . LYS A 1 22 ? 18.907  16.554  -6.371  1.00 1.93 ? 22 LYS A HG3  18 
ATOM   8258  H HD2  . LYS A 1 22 ? 18.698  15.447  -4.036  1.00 1.84 ? 22 LYS A HD2  18 
ATOM   8259  H HD3  . LYS A 1 22 ? 19.253  13.978  -4.838  1.00 1.95 ? 22 LYS A HD3  18 
ATOM   8260  H HE2  . LYS A 1 22 ? 21.322  14.837  -4.265  1.00 2.34 ? 22 LYS A HE2  18 
ATOM   8261  H HE3  . LYS A 1 22 ? 21.100  15.731  -5.783  1.00 2.34 ? 22 LYS A HE3  18 
ATOM   8262  H HZ1  . LYS A 1 22 ? 20.218  16.670  -3.090  1.00 2.18 ? 22 LYS A HZ1  18 
ATOM   8263  H HZ2  . LYS A 1 22 ? 21.596  17.230  -3.924  1.00 2.45 ? 22 LYS A HZ2  18 
ATOM   8264  H HZ3  . LYS A 1 22 ? 20.042  17.520  -4.555  1.00 2.15 ? 22 LYS A HZ3  18 
ATOM   8265  N N    . THR A 1 23 ? 14.552  18.065  -6.711  1.00 1.19 ? 23 THR A N    18 
ATOM   8266  C CA   . THR A 1 23 ? 13.148  18.192  -7.228  1.00 0.99 ? 23 THR A CA   18 
ATOM   8267  C C    . THR A 1 23 ? 13.114  18.123  -8.770  1.00 0.96 ? 23 THR A C    18 
ATOM   8268  O O    . THR A 1 23 ? 12.273  18.728  -9.411  1.00 0.86 ? 23 THR A O    18 
ATOM   8269  C CB   . THR A 1 23 ? 12.665  19.561  -6.719  1.00 1.07 ? 23 THR A CB   18 
ATOM   8270  O OG1  . THR A 1 23 ? 11.251  19.641  -6.832  1.00 0.93 ? 23 THR A OG1  18 
ATOM   8271  C CG2  . THR A 1 23 ? 13.306  20.687  -7.536  1.00 1.22 ? 23 THR A CG2  18 
ATOM   8272  H H    . THR A 1 23 ? 15.095  18.869  -6.571  1.00 1.35 ? 23 THR A H    18 
ATOM   8273  H HA   . THR A 1 23 ? 12.528  17.414  -6.811  1.00 0.89 ? 23 THR A HA   18 
ATOM   8274  H HB   . THR A 1 23 ? 12.948  19.675  -5.681  1.00 1.20 ? 23 THR A HB   18 
ATOM   8275  H HG1  . THR A 1 23 ? 10.875  19.489  -5.958  1.00 1.16 ? 23 THR A HG1  18 
ATOM   8276  H HG21 . THR A 1 23 ? 14.338  20.441  -7.743  1.00 1.42 ? 23 THR A HG21 18 
ATOM   8277  H HG22 . THR A 1 23 ? 12.772  20.805  -8.467  1.00 1.69 ? 23 THR A HG22 18 
ATOM   8278  H HG23 . THR A 1 23 ? 13.261  21.609  -6.977  1.00 1.67 ? 23 THR A HG23 18 
ATOM   8279  N N    . CYS A 1 24 ? 14.012  17.382  -9.372  1.00 1.14 ? 24 CYS A N    18 
ATOM   8280  C CA   . CYS A 1 24 ? 14.024  17.270  -10.866 1.00 1.22 ? 24 CYS A CA   18 
ATOM   8281  C C    . CYS A 1 24 ? 13.069  16.154  -11.329 1.00 1.08 ? 24 CYS A C    18 
ATOM   8282  O O    . CYS A 1 24 ? 13.467  15.218  -11.999 1.00 1.29 ? 24 CYS A O    18 
ATOM   8283  C CB   . CYS A 1 24 ? 15.479  16.946  -11.235 1.00 1.54 ? 24 CYS A CB   18 
ATOM   8284  S SG   . CYS A 1 24 ? 15.990  15.396  -10.444 1.00 1.66 ? 24 CYS A SG   18 
ATOM   8285  H H    . CYS A 1 24 ? 14.674  16.896  -8.843  1.00 1.26 ? 24 CYS A H    18 
ATOM   8286  H HA   . CYS A 1 24 ? 13.737  18.210  -11.309 1.00 1.21 ? 24 CYS A HA   18 
ATOM   8287  H HB2  . CYS A 1 24 ? 15.562  16.843  -12.306 1.00 1.63 ? 24 CYS A HB2  18 
ATOM   8288  H HB3  . CYS A 1 24 ? 16.120  17.748  -10.900 1.00 1.67 ? 24 CYS A HB3  18 
ATOM   8289  H HG   . CYS A 1 24 ? 16.499  15.616  -9.660  1.00 1.95 ? 24 CYS A HG   18 
ATOM   8290  N N    . LEU A 1 25 ? 11.811  16.253  -10.976 1.00 0.83 ? 25 LEU A N    18 
ATOM   8291  C CA   . LEU A 1 25 ? 10.821  15.209  -11.388 1.00 0.78 ? 25 LEU A CA   18 
ATOM   8292  C C    . LEU A 1 25 ? 9.554   15.869  -11.945 1.00 0.67 ? 25 LEU A C    18 
ATOM   8293  O O    . LEU A 1 25 ? 9.205   16.974  -11.570 1.00 0.76 ? 25 LEU A O    18 
ATOM   8294  C CB   . LEU A 1 25 ? 10.503  14.438  -10.102 1.00 0.73 ? 25 LEU A CB   18 
ATOM   8295  C CG   . LEU A 1 25 ? 11.717  13.602  -9.685  1.00 0.93 ? 25 LEU A CG   18 
ATOM   8296  C CD1  . LEU A 1 25 ? 12.342  14.200  -8.424  1.00 1.01 ? 25 LEU A CD1  18 
ATOM   8297  C CD2  . LEU A 1 25 ? 11.274  12.167  -9.399  1.00 1.29 ? 25 LEU A CD2  18 
ATOM   8298  H H    . LEU A 1 25 ? 11.516  17.016  -10.439 1.00 0.78 ? 25 LEU A H    18 
ATOM   8299  H HA   . LEU A 1 25 ? 11.253  14.545  -12.119 1.00 0.96 ? 25 LEU A HA   18 
ATOM   8300  H HB2  . LEU A 1 25 ? 10.258  15.137  -9.315  1.00 0.67 ? 25 LEU A HB2  18 
ATOM   8301  H HB3  . LEU A 1 25 ? 9.661   13.784  -10.276 1.00 0.75 ? 25 LEU A HB3  18 
ATOM   8302  H HG   . LEU A 1 25 ? 12.445  13.605  -10.483 1.00 1.10 ? 25 LEU A HG   18 
ATOM   8303  H HD11 . LEU A 1 25 ? 11.562  14.583  -7.782  1.00 1.47 ? 25 LEU A HD11 18 
ATOM   8304  H HD12 . LEU A 1 25 ? 12.895  13.433  -7.899  1.00 1.45 ? 25 LEU A HD12 18 
ATOM   8305  H HD13 . LEU A 1 25 ? 13.010  15.002  -8.698  1.00 1.51 ? 25 LEU A HD13 18 
ATOM   8306  H HD21 . LEU A 1 25 ? 10.518  12.170  -8.627  1.00 1.81 ? 25 LEU A HD21 18 
ATOM   8307  H HD22 . LEU A 1 25 ? 10.868  11.729  -10.298 1.00 1.75 ? 25 LEU A HD22 18 
ATOM   8308  H HD23 . LEU A 1 25 ? 12.124  11.587  -9.068  1.00 1.58 ? 25 LEU A HD23 18 
ATOM   8309  N N    . LYS A 1 26 ? 8.860   15.197  -12.832 1.00 0.76 ? 26 LYS A N    18 
ATOM   8310  C CA   . LYS A 1 26 ? 7.609   15.780  -13.415 1.00 0.84 ? 26 LYS A CA   18 
ATOM   8311  C C    . LYS A 1 26 ? 6.549   15.958  -12.320 1.00 0.78 ? 26 LYS A C    18 
ATOM   8312  O O    . LYS A 1 26 ? 5.895   15.015  -11.914 1.00 0.87 ? 26 LYS A O    18 
ATOM   8313  C CB   . LYS A 1 26 ? 7.138   14.764  -14.461 1.00 1.06 ? 26 LYS A CB   18 
ATOM   8314  C CG   . LYS A 1 26 ? 7.786   15.077  -15.812 1.00 1.61 ? 26 LYS A CG   18 
ATOM   8315  C CD   . LYS A 1 26 ? 7.914   13.786  -16.627 1.00 1.91 ? 26 LYS A CD   18 
ATOM   8316  C CE   . LYS A 1 26 ? 7.112   13.911  -17.929 1.00 2.61 ? 26 LYS A CE   18 
ATOM   8317  N NZ   . LYS A 1 26 ? 5.721   13.500  -17.574 1.00 2.92 ? 26 LYS A NZ   18 
ATOM   8318  H H    . LYS A 1 26 ? 9.160   14.309  -13.113 1.00 0.94 ? 26 LYS A H    18 
ATOM   8319  H HA   . LYS A 1 26 ? 7.821   16.726  -13.889 1.00 0.89 ? 26 LYS A HA   18 
ATOM   8320  H HB2  . LYS A 1 26 ? 7.419   13.769  -14.147 1.00 1.00 ? 26 LYS A HB2  18 
ATOM   8321  H HB3  . LYS A 1 26 ? 6.064   14.820  -14.558 1.00 1.17 ? 26 LYS A HB3  18 
ATOM   8322  H HG2  . LYS A 1 26 ? 7.171   15.787  -16.349 1.00 1.57 ? 26 LYS A HG2  18 
ATOM   8323  H HG3  . LYS A 1 26 ? 8.767   15.499  -15.653 1.00 2.37 ? 26 LYS A HG3  18 
ATOM   8324  H HD2  . LYS A 1 26 ? 8.955   13.614  -16.861 1.00 2.00 ? 26 LYS A HD2  18 
ATOM   8325  H HD3  . LYS A 1 26 ? 7.535   12.957  -16.050 1.00 2.20 ? 26 LYS A HD3  18 
ATOM   8326  H HE2  . LYS A 1 26 ? 7.128   14.935  -18.279 1.00 2.62 ? 26 LYS A HE2  18 
ATOM   8327  H HE3  . LYS A 1 26 ? 7.513   13.251  -18.682 1.00 3.20 ? 26 LYS A HE3  18 
ATOM   8328  H HZ1  . LYS A 1 26 ? 5.744   12.624  -17.016 1.00 2.88 ? 26 LYS A HZ1  18 
ATOM   8329  H HZ2  . LYS A 1 26 ? 5.264   14.262  -17.013 1.00 2.75 ? 26 LYS A HZ2  18 
ATOM   8330  H HZ3  . LYS A 1 26 ? 5.175   13.341  -18.444 1.00 3.65 ? 26 LYS A HZ3  18 
ATOM   8331  N N    . GLU A 1 27 ? 6.378   17.164  -11.841 1.00 0.70 ? 27 GLU A N    18 
ATOM   8332  C CA   . GLU A 1 27 ? 5.363   17.414  -10.766 1.00 0.74 ? 27 GLU A CA   18 
ATOM   8333  C C    . GLU A 1 27 ? 3.965   17.675  -11.358 1.00 0.95 ? 27 GLU A C    18 
ATOM   8334  O O    . GLU A 1 27 ? 3.119   18.266  -10.712 1.00 1.12 ? 27 GLU A O    18 
ATOM   8335  C CB   . GLU A 1 27 ? 5.871   18.648  -10.006 1.00 0.70 ? 27 GLU A CB   18 
ATOM   8336  C CG   . GLU A 1 27 ? 5.967   19.856  -10.951 1.00 0.79 ? 27 GLU A CG   18 
ATOM   8337  C CD   . GLU A 1 27 ? 7.437   20.170  -11.231 1.00 0.66 ? 27 GLU A CD   18 
ATOM   8338  O OE1  . GLU A 1 27 ? 8.076   20.750  -10.367 1.00 0.69 ? 27 GLU A OE1  18 
ATOM   8339  O OE2  . GLU A 1 27 ? 7.902   19.818  -12.303 1.00 0.82 ? 27 GLU A OE2  18 
ATOM   8340  H H    . GLU A 1 27 ? 6.921   17.904  -12.187 1.00 0.67 ? 27 GLU A H    18 
ATOM   8341  H HA   . GLU A 1 27 ? 5.324   16.571  -10.095 1.00 0.72 ? 27 GLU A HA   18 
ATOM   8342  H HB2  . GLU A 1 27 ? 5.187   18.878  -9.202  1.00 0.84 ? 27 GLU A HB2  18 
ATOM   8343  H HB3  . GLU A 1 27 ? 6.846   18.438  -9.596  1.00 0.59 ? 27 GLU A HB3  18 
ATOM   8344  H HG2  . GLU A 1 27 ? 5.463   19.631  -11.879 1.00 0.94 ? 27 GLU A HG2  18 
ATOM   8345  H HG3  . GLU A 1 27 ? 5.502   20.713  -10.488 1.00 0.97 ? 27 GLU A HG3  18 
ATOM   8346  N N    . GLU A 1 28 ? 3.708   17.229  -12.569 1.00 1.09 ? 28 GLU A N    18 
ATOM   8347  C CA   . GLU A 1 28 ? 2.357   17.442  -13.187 1.00 1.33 ? 28 GLU A CA   18 
ATOM   8348  C C    . GLU A 1 28 ? 1.258   16.889  -12.266 1.00 1.12 ? 28 GLU A C    18 
ATOM   8349  O O    . GLU A 1 28 ? 0.187   17.453  -12.160 1.00 1.29 ? 28 GLU A O    18 
ATOM   8350  C CB   . GLU A 1 28 ? 2.395   16.667  -14.509 1.00 1.67 ? 28 GLU A CB   18 
ATOM   8351  C CG   . GLU A 1 28 ? 3.386   17.335  -15.471 1.00 1.91 ? 28 GLU A CG   18 
ATOM   8352  C CD   . GLU A 1 28 ? 3.729   16.375  -16.613 1.00 2.37 ? 28 GLU A CD   18 
ATOM   8353  O OE1  . GLU A 1 28 ? 4.493   15.454  -16.375 1.00 2.64 ? 28 GLU A OE1  18 
ATOM   8354  O OE2  . GLU A 1 28 ? 3.224   16.576  -17.704 1.00 2.69 ? 28 GLU A OE2  18 
ATOM   8355  H H    . GLU A 1 28 ? 4.396   16.746  -13.069 1.00 1.14 ? 28 GLU A H    18 
ATOM   8356  H HA   . GLU A 1 28 ? 2.194   18.491  -13.379 1.00 1.54 ? 28 GLU A HA   18 
ATOM   8357  H HB2  . GLU A 1 28 ? 2.705   15.649  -14.322 1.00 1.63 ? 28 GLU A HB2  18 
ATOM   8358  H HB3  . GLU A 1 28 ? 1.411   16.667  -14.955 1.00 1.89 ? 28 GLU A HB3  18 
ATOM   8359  H HG2  . GLU A 1 28 ? 2.944   18.231  -15.875 1.00 2.03 ? 28 GLU A HG2  18 
ATOM   8360  H HG3  . GLU A 1 28 ? 4.289   17.591  -14.939 1.00 1.98 ? 28 GLU A HG3  18 
ATOM   8361  N N    . MET A 1 29 ? 1.527   15.796  -11.591 1.00 0.99 ? 29 MET A N    18 
ATOM   8362  C CA   . MET A 1 29 ? 0.511   15.209  -10.663 1.00 1.03 ? 29 MET A CA   18 
ATOM   8363  C C    . MET A 1 29 ? 1.024   15.257  -9.211  1.00 1.20 ? 29 MET A C    18 
ATOM   8364  O O    . MET A 1 29 ? 0.724   14.388  -8.413  1.00 1.52 ? 29 MET A O    18 
ATOM   8365  C CB   . MET A 1 29 ? 0.341   13.760  -11.135 1.00 1.35 ? 29 MET A CB   18 
ATOM   8366  C CG   . MET A 1 29 ? -1.029  13.231  -10.699 1.00 1.51 ? 29 MET A CG   18 
ATOM   8367  S SD   . MET A 1 29 ? -0.808  11.888  -9.506  1.00 2.45 ? 29 MET A SD   18 
ATOM   8368  C CE   . MET A 1 29 ? -0.857  10.518  -10.688 1.00 2.93 ? 29 MET A CE   18 
ATOM   8369  H H    . MET A 1 29 ? 2.403   15.367  -11.688 1.00 1.07 ? 29 MET A H    18 
ATOM   8370  H HA   . MET A 1 29 ? -0.426  15.736  -10.748 1.00 1.08 ? 29 MET A HA   18 
ATOM   8371  H HB2  . MET A 1 29 ? 0.416   13.723  -12.213 1.00 1.56 ? 29 MET A HB2  18 
ATOM   8372  H HB3  . MET A 1 29 ? 1.116   13.147  -10.700 1.00 1.59 ? 29 MET A HB3  18 
ATOM   8373  H HG2  . MET A 1 29 ? -1.595  14.029  -10.242 1.00 1.54 ? 29 MET A HG2  18 
ATOM   8374  H HG3  . MET A 1 29 ? -1.562  12.861  -11.563 1.00 1.82 ? 29 MET A HG3  18 
ATOM   8375  H HE1  . MET A 1 29 ? -0.484  10.855  -11.645 1.00 3.19 ? 29 MET A HE1  18 
ATOM   8376  H HE2  . MET A 1 29 ? -0.245  9.705   -10.321 1.00 3.38 ? 29 MET A HE2  18 
ATOM   8377  H HE3  . MET A 1 29 ? -1.874  10.175  -10.802 1.00 3.26 ? 29 MET A HE3  18 
ATOM   8378  N N    . ALA A 1 30 ? 1.791   16.274  -8.870  1.00 1.24 ? 30 ALA A N    18 
ATOM   8379  C CA   . ALA A 1 30 ? 2.337   16.409  -7.477  1.00 1.71 ? 30 ALA A CA   18 
ATOM   8380  C C    . ALA A 1 30 ? 3.033   15.108  -7.028  1.00 1.97 ? 30 ALA A C    18 
ATOM   8381  O O    . ALA A 1 30 ? 4.090   14.817  -7.563  1.00 1.95 ? 30 ALA A O    18 
ATOM   8382  C CB   . ALA A 1 30 ? 1.119   16.731  -6.600  1.00 2.13 ? 30 ALA A CB   18 
ATOM   8383  O OXT  . ALA A 1 30 ? 2.500   14.422  -6.165  1.00 2.43 ? 30 ALA A OXT  18 
ATOM   8384  H H    . ALA A 1 30 ? 2.010   16.959  -9.537  1.00 1.10 ? 30 ALA A H    18 
ATOM   8385  H HA   . ALA A 1 30 ? 3.038   17.229  -7.436  1.00 1.76 ? 30 ALA A HA   18 
ATOM   8386  H HB1  . ALA A 1 30 ? 0.628   17.616  -6.978  1.00 2.55 ? 30 ALA A HB1  18 
ATOM   8387  H HB2  . ALA A 1 30 ? 0.431   15.900  -6.622  1.00 2.44 ? 30 ALA A HB2  18 
ATOM   8388  H HB3  . ALA A 1 30 ? 1.443   16.903  -5.585  1.00 2.41 ? 30 ALA A HB3  18 
ATOM   8389  N N    . MET A 1 1  ? 3.649   -2.318  12.546  1.00 3.14 ? 1  MET A N    19 
ATOM   8390  C CA   . MET A 1 1  ? 2.360   -1.570  12.436  1.00 2.70 ? 1  MET A CA   19 
ATOM   8391  C C    . MET A 1 1  ? 2.534   -0.134  12.951  1.00 2.24 ? 1  MET A C    19 
ATOM   8392  O O    . MET A 1 1  ? 2.354   0.144   14.123  1.00 2.48 ? 1  MET A O    19 
ATOM   8393  C CB   . MET A 1 1  ? 1.363   -2.348  13.306  1.00 3.30 ? 1  MET A CB   19 
ATOM   8394  C CG   . MET A 1 1  ? 0.334   -3.043  12.410  1.00 3.59 ? 1  MET A CG   19 
ATOM   8395  S SD   . MET A 1 1  ? 1.138   -4.371  11.477  1.00 4.21 ? 1  MET A SD   19 
ATOM   8396  C CE   . MET A 1 1  ? 1.245   -3.509  9.888   1.00 4.66 ? 1  MET A CE   19 
ATOM   8397  H H1   . MET A 1 1  ? 4.029   -2.221  13.509  1.00 3.29 ? 1  MET A H1   19 
ATOM   8398  H H2   . MET A 1 1  ? 3.488   -3.324  12.334  1.00 3.29 ? 1  MET A H2   19 
ATOM   8399  H H3   . MET A 1 1  ? 4.335   -1.926  11.864  1.00 3.36 ? 1  MET A H3   19 
ATOM   8400  H HA   . MET A 1 1  ? 2.020   -1.559  11.412  1.00 2.46 ? 1  MET A HA   19 
ATOM   8401  H HB2  . MET A 1 1  ? 1.893   -3.089  13.888  1.00 3.77 ? 1  MET A HB2  19 
ATOM   8402  H HB3  . MET A 1 1  ? 0.855   -1.665  13.971  1.00 3.30 ? 1  MET A HB3  19 
ATOM   8403  H HG2  . MET A 1 1  ? -0.453  -3.460  13.023  1.00 3.96 ? 1  MET A HG2  19 
ATOM   8404  H HG3  . MET A 1 1  ? -0.089  -2.324  11.723  1.00 3.37 ? 1  MET A HG3  19 
ATOM   8405  H HE1  . MET A 1 1  ? 0.453   -2.782  9.816   1.00 4.74 ? 1  MET A HE1  19 
ATOM   8406  H HE2  . MET A 1 1  ? 2.201   -3.007  9.815   1.00 4.90 ? 1  MET A HE2  19 
ATOM   8407  H HE3  . MET A 1 1  ? 1.146   -4.226  9.084   1.00 5.08 ? 1  MET A HE3  19 
ATOM   8408  N N    . ILE A 1 2  ? 2.887   0.779   12.081  1.00 1.74 ? 2  ILE A N    19 
ATOM   8409  C CA   . ILE A 1 2  ? 3.078   2.200   12.509  1.00 1.65 ? 2  ILE A CA   19 
ATOM   8410  C C    . ILE A 1 2  ? 1.925   3.065   11.975  1.00 1.13 ? 2  ILE A C    19 
ATOM   8411  O O    . ILE A 1 2  ? 2.081   3.820   11.034  1.00 1.10 ? 2  ILE A O    19 
ATOM   8412  C CB   . ILE A 1 2  ? 4.424   2.630   11.898  1.00 1.80 ? 2  ILE A CB   19 
ATOM   8413  C CG1  . ILE A 1 2  ? 5.527   1.634   12.290  1.00 2.32 ? 2  ILE A CG1  19 
ATOM   8414  C CG2  . ILE A 1 2  ? 4.799   4.025   12.405  1.00 2.19 ? 2  ILE A CG2  19 
ATOM   8415  C CD1  . ILE A 1 2  ? 5.635   1.541   13.817  1.00 2.92 ? 2  ILE A CD1  19 
ATOM   8416  H H    . ILE A 1 2  ? 3.028   0.529   11.141  1.00 1.61 ? 2  ILE A H    19 
ATOM   8417  H HA   . ILE A 1 2  ? 3.127   2.265   13.585  1.00 2.07 ? 2  ILE A HA   19 
ATOM   8418  H HB   . ILE A 1 2  ? 4.330   2.658   10.820  1.00 1.46 ? 2  ILE A HB   19 
ATOM   8419  H HG12 . ILE A 1 2  ? 5.291   0.660   11.888  1.00 2.28 ? 2  ILE A HG12 19 
ATOM   8420  H HG13 . ILE A 1 2  ? 6.470   1.969   11.885  1.00 2.45 ? 2  ILE A HG13 19 
ATOM   8421  H HG21 . ILE A 1 2  ? 4.626   4.080   13.470  1.00 2.43 ? 2  ILE A HG21 19 
ATOM   8422  H HG22 . ILE A 1 2  ? 5.842   4.214   12.201  1.00 2.46 ? 2  ILE A HG22 19 
ATOM   8423  H HG23 . ILE A 1 2  ? 4.194   4.766   11.904  1.00 2.62 ? 2  ILE A HG23 19 
ATOM   8424  H HD11 . ILE A 1 2  ? 5.743   2.533   14.232  1.00 3.08 ? 2  ILE A HD11 19 
ATOM   8425  H HD12 . ILE A 1 2  ? 4.745   1.079   14.214  1.00 3.31 ? 2  ILE A HD12 19 
ATOM   8426  H HD13 . ILE A 1 2  ? 6.497   0.946   14.080  1.00 3.31 ? 2  ILE A HD13 19 
ATOM   8427  N N    . SER A 1 3  ? 0.763   2.950   12.571  1.00 1.03 ? 3  SER A N    19 
ATOM   8428  C CA   . SER A 1 3  ? -0.410  3.754   12.106  1.00 0.76 ? 3  SER A CA   19 
ATOM   8429  C C    . SER A 1 3  ? -1.439  3.913   13.242  1.00 0.79 ? 3  SER A C    19 
ATOM   8430  O O    . SER A 1 3  ? -1.072  4.079   14.391  1.00 0.96 ? 3  SER A O    19 
ATOM   8431  C CB   . SER A 1 3  ? -0.992  2.953   10.936  1.00 0.85 ? 3  SER A CB   19 
ATOM   8432  O OG   . SER A 1 3  ? -2.009  3.720   10.299  1.00 1.09 ? 3  SER A OG   19 
ATOM   8433  H H    . SER A 1 3  ? 0.661   2.330   13.324  1.00 1.35 ? 3  SER A H    19 
ATOM   8434  H HA   . SER A 1 3  ? -0.086  4.724   11.760  1.00 0.94 ? 3  SER A HA   19 
ATOM   8435  H HB2  . SER A 1 3  ? -0.213  2.735   10.225  1.00 1.02 ? 3  SER A HB2  19 
ATOM   8436  H HB3  . SER A 1 3  ? -1.406  2.024   11.308  1.00 1.03 ? 3  SER A HB3  19 
ATOM   8437  H HG   . SER A 1 3  ? -1.588  4.458   9.847   1.00 1.22 ? 3  SER A HG   19 
ATOM   8438  N N    . SER A 1 4  ? -2.720  3.878   12.926  1.00 0.73 ? 4  SER A N    19 
ATOM   8439  C CA   . SER A 1 4  ? -3.801  4.037   13.965  1.00 0.87 ? 4  SER A CA   19 
ATOM   8440  C C    . SER A 1 4  ? -3.878  5.493   14.442  1.00 1.03 ? 4  SER A C    19 
ATOM   8441  O O    . SER A 1 4  ? -4.912  6.126   14.355  1.00 1.22 ? 4  SER A O    19 
ATOM   8442  C CB   . SER A 1 4  ? -3.438  3.094   15.120  1.00 1.05 ? 4  SER A CB   19 
ATOM   8443  O OG   . SER A 1 4  ? -4.633  2.640   15.744  1.00 1.19 ? 4  SER A OG   19 
ATOM   8444  H H    . SER A 1 4  ? -2.977  3.757   11.989  1.00 0.67 ? 4  SER A H    19 
ATOM   8445  H HA   . SER A 1 4  ? -4.749  3.745   13.548  1.00 0.86 ? 4  SER A HA   19 
ATOM   8446  H HB2  . SER A 1 4  ? -2.893  2.246   14.738  1.00 1.03 ? 4  SER A HB2  19 
ATOM   8447  H HB3  . SER A 1 4  ? -2.822  3.621   15.837  1.00 1.21 ? 4  SER A HB3  19 
ATOM   8448  H HG   . SER A 1 4  ? -4.896  3.292   16.399  1.00 1.53 ? 4  SER A HG   19 
ATOM   8449  N N    . VAL A 1 5  ? -2.790  6.028   14.927  1.00 1.03 ? 5  VAL A N    19 
ATOM   8450  C CA   . VAL A 1 5  ? -2.787  7.450   15.394  1.00 1.25 ? 5  VAL A CA   19 
ATOM   8451  C C    . VAL A 1 5  ? -2.559  8.398   14.205  1.00 1.20 ? 5  VAL A C    19 
ATOM   8452  O O    . VAL A 1 5  ? -2.916  9.560   14.247  1.00 1.41 ? 5  VAL A O    19 
ATOM   8453  C CB   . VAL A 1 5  ? -1.635  7.539   16.405  1.00 1.40 ? 5  VAL A CB   19 
ATOM   8454  C CG1  . VAL A 1 5  ? -0.285  7.522   15.678  1.00 1.25 ? 5  VAL A CG1  19 
ATOM   8455  C CG2  . VAL A 1 5  ? -1.759  8.837   17.207  1.00 1.72 ? 5  VAL A CG2  19 
ATOM   8456  H H    . VAL A 1 5  ? -1.970  5.497   14.972  1.00 0.95 ? 5  VAL A H    19 
ATOM   8457  H HA   . VAL A 1 5  ? -3.719  7.684   15.877  1.00 1.41 ? 5  VAL A HA   19 
ATOM   8458  H HB   . VAL A 1 5  ? -1.686  6.695   17.078  1.00 1.45 ? 5  VAL A HB   19 
ATOM   8459  H HG11 . VAL A 1 5  ? -0.262  6.698   14.979  1.00 1.29 ? 5  VAL A HG11 19 
ATOM   8460  H HG12 . VAL A 1 5  ? -0.151  8.451   15.144  1.00 1.55 ? 5  VAL A HG12 19 
ATOM   8461  H HG13 . VAL A 1 5  ? 0.510   7.403   16.399  1.00 1.75 ? 5  VAL A HG13 19 
ATOM   8462  H HG21 . VAL A 1 5  ? -1.720  9.681   16.534  1.00 1.96 ? 5  VAL A HG21 19 
ATOM   8463  H HG22 . VAL A 1 5  ? -2.699  8.843   17.739  1.00 2.10 ? 5  VAL A HG22 19 
ATOM   8464  H HG23 . VAL A 1 5  ? -0.945  8.902   17.914  1.00 2.14 ? 5  VAL A HG23 19 
ATOM   8465  N N    . CYS A 1 6  ? -1.973  7.899   13.148  1.00 0.98 ? 6  CYS A N    19 
ATOM   8466  C CA   . CYS A 1 6  ? -1.716  8.742   11.944  1.00 1.01 ? 6  CYS A CA   19 
ATOM   8467  C C    . CYS A 1 6  ? -2.075  7.962   10.669  1.00 0.92 ? 6  CYS A C    19 
ATOM   8468  O O    . CYS A 1 6  ? -2.546  6.840   10.727  1.00 0.87 ? 6  CYS A O    19 
ATOM   8469  C CB   . CYS A 1 6  ? -0.216  9.052   11.993  1.00 1.02 ? 6  CYS A CB   19 
ATOM   8470  S SG   . CYS A 1 6  ? 0.736   7.527   11.771  1.00 0.89 ? 6  CYS A SG   19 
ATOM   8471  H H    . CYS A 1 6  ? -1.703  6.961   13.144  1.00 0.87 ? 6  CYS A H    19 
ATOM   8472  H HA   . CYS A 1 6  ? -2.284  9.658   11.997  1.00 1.18 ? 6  CYS A HA   19 
ATOM   8473  H HB2  . CYS A 1 6  ? 0.032   9.747   11.205  1.00 1.14 ? 6  CYS A HB2  19 
ATOM   8474  H HB3  . CYS A 1 6  ? 0.028   9.492   12.949  1.00 1.13 ? 6  CYS A HB3  19 
ATOM   8475  H HG   . CYS A 1 6  ? 0.680   7.021   12.585  1.00 1.26 ? 6  CYS A HG   19 
ATOM   8476  N N    . VAL A 1 7  ? -1.851  8.548   9.523   1.00 0.96 ? 7  VAL A N    19 
ATOM   8477  C CA   . VAL A 1 7  ? -2.171  7.855   8.241   1.00 0.98 ? 7  VAL A CA   19 
ATOM   8478  C C    . VAL A 1 7  ? -0.978  6.994   7.795   1.00 0.90 ? 7  VAL A C    19 
ATOM   8479  O O    . VAL A 1 7  ? -0.066  6.732   8.557   1.00 0.83 ? 7  VAL A O    19 
ATOM   8480  C CB   . VAL A 1 7  ? -2.461  8.999   7.251   1.00 1.18 ? 7  VAL A CB   19 
ATOM   8481  C CG1  . VAL A 1 7  ? -1.155  9.538   6.655   1.00 1.23 ? 7  VAL A CG1  19 
ATOM   8482  C CG2  . VAL A 1 7  ? -3.367  8.494   6.123   1.00 1.32 ? 7  VAL A CG2  19 
ATOM   8483  H H    . VAL A 1 7  ? -1.469  9.446   9.504   1.00 1.04 ? 7  VAL A H    19 
ATOM   8484  H HA   . VAL A 1 7  ? -3.048  7.241   8.357   1.00 0.97 ? 7  VAL A HA   19 
ATOM   8485  H HB   . VAL A 1 7  ? -2.961  9.797   7.775   1.00 1.27 ? 7  VAL A HB   19 
ATOM   8486  H HG11 . VAL A 1 7  ? -0.363  9.452   7.384   1.00 1.78 ? 7  VAL A HG11 19 
ATOM   8487  H HG12 . VAL A 1 7  ? -0.898  8.970   5.775   1.00 1.34 ? 7  VAL A HG12 19 
ATOM   8488  H HG13 . VAL A 1 7  ? -1.285  10.577  6.387   1.00 1.50 ? 7  VAL A HG13 19 
ATOM   8489  H HG21 . VAL A 1 7  ? -3.761  7.523   6.384   1.00 1.65 ? 7  VAL A HG21 19 
ATOM   8490  H HG22 . VAL A 1 7  ? -4.183  9.186   5.981   1.00 1.71 ? 7  VAL A HG22 19 
ATOM   8491  H HG23 . VAL A 1 7  ? -2.797  8.418   5.209   1.00 1.54 ? 7  VAL A HG23 19 
HETATM 8492  N N    . SEP A 1 8  ? -0.985  6.552   6.567   1.00 1.00 ? 8  SEP A N    19 
HETATM 8493  C CA   . SEP A 1 8  ? 0.139   5.705   6.056   1.00 1.01 ? 8  SEP A CA   19 
HETATM 8494  C CB   . SEP A 1 8  ? -0.347  5.147   4.709   1.00 1.11 ? 8  SEP A CB   19 
HETATM 8495  O OG   . SEP A 1 8  ? -0.872  6.210   3.897   1.00 1.19 ? 8  SEP A OG   19 
HETATM 8496  C C    . SEP A 1 8  ? 1.406   6.548   5.863   1.00 0.95 ? 8  SEP A C    19 
HETATM 8497  O O    . SEP A 1 8  ? 2.444   6.228   6.403   1.00 1.01 ? 8  SEP A O    19 
HETATM 8498  P P    . SEP A 1 8  ? -1.076  6.011   2.311   1.00 1.39 ? 8  SEP A P    19 
HETATM 8499  O O1P  . SEP A 1 8  ? -1.686  4.683   2.086   1.00 1.66 ? 8  SEP A O1P  19 
HETATM 8500  O O2P  . SEP A 1 8  ? -1.730  7.224   1.774   1.00 1.56 ? 8  SEP A O2P  19 
HETATM 8501  O O3P  . SEP A 1 8  ? 0.436   5.969   1.762   1.00 1.33 ? 8  SEP A O3P  19 
HETATM 8502  H H    . SEP A 1 8  ? -1.732  6.777   5.982   1.00 1.11 ? 8  SEP A H    19 
HETATM 8503  H HA   . SEP A 1 8  ? 0.335   4.895   6.736   1.00 1.04 ? 8  SEP A HA   19 
HETATM 8504  H HB2  . SEP A 1 8  ? -1.114  4.407   4.887   1.00 1.13 ? 8  SEP A HB2  19 
HETATM 8505  H HB3  . SEP A 1 8  ? 0.477   4.686   4.194   1.00 1.20 ? 8  SEP A HB3  19 
HETATM 8506  H HOP3 . SEP A 1 8  ? 0.775   6.867   1.795   1.00 1.48 ? 8  SEP A HOP3 19 
ATOM   8507  N N    . SER A 1 9  ? 1.287   7.610   5.088   1.00 0.87 ? 9  SER A N    19 
ATOM   8508  C CA   . SER A 1 9  ? 2.413   8.566   4.756   1.00 0.83 ? 9  SER A CA   19 
ATOM   8509  C C    . SER A 1 9  ? 2.410   8.803   3.250   1.00 0.75 ? 9  SER A C    19 
ATOM   8510  O O    . SER A 1 9  ? 2.326   7.866   2.488   1.00 0.76 ? 9  SER A O    19 
ATOM   8511  C CB   . SER A 1 9  ? 3.748   7.926   5.141   1.00 0.90 ? 9  SER A CB   19 
ATOM   8512  O OG   . SER A 1 9  ? 4.013   8.171   6.518   1.00 0.99 ? 9  SER A OG   19 
ATOM   8513  H H    . SER A 1 9  ? 0.413   7.786   4.694   1.00 0.86 ? 9  SER A H    19 
ATOM   8514  H HA   . SER A 1 9  ? 2.281   9.499   5.283   1.00 0.84 ? 9  SER A HA   19 
ATOM   8515  H HB2  . SER A 1 9  ? 3.707   6.865   4.962   1.00 0.94 ? 9  SER A HB2  19 
ATOM   8516  H HB3  . SER A 1 9  ? 4.531   8.357   4.532   1.00 0.87 ? 9  SER A HB3  19 
ATOM   8517  H HG   . SER A 1 9  ? 3.608   7.460   7.027   1.00 1.04 ? 9  SER A HG   19 
ATOM   8518  N N    . TYR A 1 10 ? 2.507   10.043  2.826   1.00 0.72 ? 10 TYR A N    19 
ATOM   8519  C CA   . TYR A 1 10 ? 2.518   10.381  1.361   1.00 0.68 ? 10 TYR A CA   19 
ATOM   8520  C C    . TYR A 1 10 ? 1.376   9.665   0.599   1.00 0.68 ? 10 TYR A C    19 
ATOM   8521  O O    . TYR A 1 10 ? 0.578   8.947   1.172   1.00 0.74 ? 10 TYR A O    19 
ATOM   8522  C CB   . TYR A 1 10 ? 3.936   9.970   0.880   1.00 0.69 ? 10 TYR A CB   19 
ATOM   8523  C CG   . TYR A 1 10 ? 3.922   8.716   0.031   1.00 0.68 ? 10 TYR A CG   19 
ATOM   8524  C CD1  . TYR A 1 10 ? 3.754   8.816   -1.352  1.00 0.68 ? 10 TYR A CD1  19 
ATOM   8525  C CD2  . TYR A 1 10 ? 4.086   7.459   0.625   1.00 0.75 ? 10 TYR A CD2  19 
ATOM   8526  C CE1  . TYR A 1 10 ? 3.743   7.663   -2.144  1.00 0.75 ? 10 TYR A CE1  19 
ATOM   8527  C CE2  . TYR A 1 10 ? 4.075   6.305   -0.164  1.00 0.82 ? 10 TYR A CE2  19 
ATOM   8528  C CZ   . TYR A 1 10 ? 3.902   6.406   -1.549  1.00 0.82 ? 10 TYR A CZ   19 
ATOM   8529  O OH   . TYR A 1 10 ? 3.884   5.267   -2.328  1.00 0.95 ? 10 TYR A OH   19 
ATOM   8530  H H    . TYR A 1 10 ? 2.579   10.761  3.479   1.00 0.75 ? 10 TYR A H    19 
ATOM   8531  H HA   . TYR A 1 10 ? 2.405   11.446  1.242   1.00 0.71 ? 10 TYR A HA   19 
ATOM   8532  H HB2  . TYR A 1 10 ? 4.355   10.776  0.298   1.00 0.71 ? 10 TYR A HB2  19 
ATOM   8533  H HB3  . TYR A 1 10 ? 4.563   9.801   1.744   1.00 0.74 ? 10 TYR A HB3  19 
ATOM   8534  H HD1  . TYR A 1 10 ? 3.628   9.787   -1.807  1.00 0.68 ? 10 TYR A HD1  19 
ATOM   8535  H HD2  . TYR A 1 10 ? 4.221   7.383   1.698   1.00 0.79 ? 10 TYR A HD2  19 
ATOM   8536  H HE1  . TYR A 1 10 ? 3.614   7.743   -3.212  1.00 0.79 ? 10 TYR A HE1  19 
ATOM   8537  H HE2  . TYR A 1 10 ? 4.197   5.336   0.296   1.00 0.92 ? 10 TYR A HE2  19 
ATOM   8538  H HH   . TYR A 1 10 ? 3.290   4.634   -1.917  1.00 1.05 ? 10 TYR A HH   19 
ATOM   8539  N N    . ARG A 1 11 ? 1.286   9.874   -0.690  1.00 0.69 ? 11 ARG A N    19 
ATOM   8540  C CA   . ARG A 1 11 ? 0.209   9.212   -1.493  1.00 0.75 ? 11 ARG A CA   19 
ATOM   8541  C C    . ARG A 1 11 ? 0.491   7.701   -1.591  1.00 0.81 ? 11 ARG A C    19 
ATOM   8542  O O    . ARG A 1 11 ? 1.151   7.132   -0.744  1.00 0.81 ? 11 ARG A O    19 
ATOM   8543  C CB   . ARG A 1 11 ? 0.290   9.887   -2.870  1.00 0.80 ? 11 ARG A CB   19 
ATOM   8544  C CG   . ARG A 1 11 ? -0.815  10.940  -2.989  1.00 0.88 ? 11 ARG A CG   19 
ATOM   8545  C CD   . ARG A 1 11 ? -1.757  10.568  -4.137  1.00 1.08 ? 11 ARG A CD   19 
ATOM   8546  N NE   . ARG A 1 11 ? -2.961  11.425  -3.935  1.00 1.11 ? 11 ARG A NE   19 
ATOM   8547  C CZ   . ARG A 1 11 ? -4.153  10.910  -4.024  1.00 1.41 ? 11 ARG A CZ   19 
ATOM   8548  N NH1  . ARG A 1 11 ? -4.657  10.263  -3.013  1.00 2.03 ? 11 ARG A NH1  19 
ATOM   8549  N NH2  . ARG A 1 11 ? -4.840  11.046  -5.122  1.00 1.91 ? 11 ARG A NH2  19 
ATOM   8550  H H    . ARG A 1 11 ? 1.926   10.469  -1.133  1.00 0.69 ? 11 ARG A H    19 
ATOM   8551  H HA   . ARG A 1 11 ? -0.756  9.384   -1.052  1.00 0.78 ? 11 ARG A HA   19 
ATOM   8552  H HB2  . ARG A 1 11 ? 1.254   10.364  -2.980  1.00 0.77 ? 11 ARG A HB2  19 
ATOM   8553  H HB3  . ARG A 1 11 ? 0.167   9.150   -3.644  1.00 0.88 ? 11 ARG A HB3  19 
ATOM   8554  H HG2  . ARG A 1 11 ? -1.371  10.985  -2.064  1.00 0.90 ? 11 ARG A HG2  19 
ATOM   8555  H HG3  . ARG A 1 11 ? -0.372  11.904  -3.189  1.00 0.98 ? 11 ARG A HG3  19 
ATOM   8556  H HD2  . ARG A 1 11 ? -1.291  10.784  -5.090  1.00 1.53 ? 11 ARG A HD2  19 
ATOM   8557  H HD3  . ARG A 1 11 ? -2.030  9.525   -4.078  1.00 1.49 ? 11 ARG A HD3  19 
ATOM   8558  H HE   . ARG A 1 11 ? -2.856  12.379  -3.736  1.00 1.60 ? 11 ARG A HE   19 
ATOM   8559  H HH11 . ARG A 1 11 ? -4.129  10.164  -2.170  1.00 2.37 ? 11 ARG A HH11 19 
ATOM   8560  H HH12 . ARG A 1 11 ? -5.572  9.867   -3.078  1.00 2.51 ? 11 ARG A HH12 19 
ATOM   8561  H HH21 . ARG A 1 11 ? -4.450  11.545  -5.894  1.00 2.26 ? 11 ARG A HH21 19 
ATOM   8562  H HH22 . ARG A 1 11 ? -5.756  10.652  -5.193  1.00 2.34 ? 11 ARG A HH22 19 
ATOM   8563  N N    . GLY A 1 12 ? 0.018   7.047   -2.620  1.00 0.90 ? 12 GLY A N    19 
ATOM   8564  C CA   . GLY A 1 12 ? 0.294   5.584   -2.765  1.00 1.01 ? 12 GLY A CA   19 
ATOM   8565  C C    . GLY A 1 12 ? 1.168   5.368   -4.002  1.00 1.04 ? 12 GLY A C    19 
ATOM   8566  O O    . GLY A 1 12 ? 1.303   4.264   -4.493  1.00 1.19 ? 12 GLY A O    19 
ATOM   8567  H H    . GLY A 1 12 ? -0.501  7.514   -3.309  1.00 0.93 ? 12 GLY A H    19 
ATOM   8568  H HA2  . GLY A 1 12 ? 0.810   5.224   -1.888  1.00 1.00 ? 12 GLY A HA2  19 
ATOM   8569  H HA3  . GLY A 1 12 ? -0.635  5.051   -2.887  1.00 1.11 ? 12 GLY A HA3  19 
ATOM   8570  N N    . ARG A 1 13 ? 1.747   6.426   -4.514  1.00 0.92 ? 13 ARG A N    19 
ATOM   8571  C CA   . ARG A 1 13 ? 2.598   6.316   -5.727  1.00 0.96 ? 13 ARG A CA   19 
ATOM   8572  C C    . ARG A 1 13 ? 4.046   6.752   -5.430  1.00 0.83 ? 13 ARG A C    19 
ATOM   8573  O O    . ARG A 1 13 ? 4.462   7.846   -5.768  1.00 0.75 ? 13 ARG A O    19 
ATOM   8574  C CB   . ARG A 1 13 ? 1.917   7.244   -6.744  1.00 1.01 ? 13 ARG A CB   19 
ATOM   8575  C CG   . ARG A 1 13 ? 1.792   8.669   -6.185  1.00 0.87 ? 13 ARG A CG   19 
ATOM   8576  C CD   . ARG A 1 13 ? 2.107   9.684   -7.290  1.00 0.98 ? 13 ARG A CD   19 
ATOM   8577  N NE   . ARG A 1 13 ? 3.585   9.600   -7.476  1.00 0.90 ? 13 ARG A NE   19 
ATOM   8578  C CZ   . ARG A 1 13 ? 4.170   10.296  -8.407  1.00 1.00 ? 13 ARG A CZ   19 
ATOM   8579  N NH1  . ARG A 1 13 ? 4.272   9.813   -9.612  1.00 1.18 ? 13 ARG A NH1  19 
ATOM   8580  N NH2  . ARG A 1 13 ? 4.654   11.472  -8.130  1.00 1.12 ? 13 ARG A NH2  19 
ATOM   8581  H H    . ARG A 1 13 ? 1.610   7.300   -4.103  1.00 0.83 ? 13 ARG A H    19 
ATOM   8582  H HA   . ARG A 1 13 ? 2.588   5.304   -6.095  1.00 1.12 ? 13 ARG A HA   19 
ATOM   8583  H HB2  . ARG A 1 13 ? 2.496   7.264   -7.645  1.00 1.08 ? 13 ARG A HB2  19 
ATOM   8584  H HB3  . ARG A 1 13 ? 0.930   6.863   -6.960  1.00 1.14 ? 13 ARG A HB3  19 
ATOM   8585  H HG2  . ARG A 1 13 ? 0.784   8.828   -5.829  1.00 0.92 ? 13 ARG A HG2  19 
ATOM   8586  H HG3  . ARG A 1 13 ? 2.487   8.802   -5.370  1.00 0.75 ? 13 ARG A HG3  19 
ATOM   8587  H HD2  . ARG A 1 13 ? 1.593   9.415   -8.204  1.00 1.17 ? 13 ARG A HD2  19 
ATOM   8588  H HD3  . ARG A 1 13 ? 1.829   10.678  -6.978  1.00 0.99 ? 13 ARG A HD3  19 
ATOM   8589  H HE   . ARG A 1 13 ? 4.120   9.016   -6.893  1.00 0.87 ? 13 ARG A HE   19 
ATOM   8590  H HH11 . ARG A 1 13 ? 3.902   8.909   -9.820  1.00 1.28 ? 13 ARG A HH11 19 
ATOM   8591  H HH12 . ARG A 1 13 ? 4.719   10.346  -10.330 1.00 1.33 ? 13 ARG A HH12 19 
ATOM   8592  H HH21 . ARG A 1 13 ? 4.574   11.838  -7.204  1.00 1.18 ? 13 ARG A HH21 19 
ATOM   8593  H HH22 . ARG A 1 13 ? 5.107   12.008  -8.841  1.00 1.28 ? 13 ARG A HH22 19 
ATOM   8594  N N    . LYS A 1 14 ? 4.820   5.899   -4.804  1.00 0.87 ? 14 LYS A N    19 
ATOM   8595  C CA   . LYS A 1 14 ? 6.242   6.254   -4.483  1.00 0.82 ? 14 LYS A CA   19 
ATOM   8596  C C    . LYS A 1 14 ? 7.137   6.114   -5.730  1.00 0.84 ? 14 LYS A C    19 
ATOM   8597  O O    . LYS A 1 14 ? 8.146   5.428   -5.711  1.00 0.96 ? 14 LYS A O    19 
ATOM   8598  C CB   . LYS A 1 14 ? 6.665   5.261   -3.392  1.00 0.98 ? 14 LYS A CB   19 
ATOM   8599  C CG   . LYS A 1 14 ? 6.460   3.818   -3.876  1.00 1.19 ? 14 LYS A CG   19 
ATOM   8600  C CD   . LYS A 1 14 ? 7.759   3.031   -3.698  1.00 1.55 ? 14 LYS A CD   19 
ATOM   8601  C CE   . LYS A 1 14 ? 7.974   2.108   -4.902  1.00 1.85 ? 14 LYS A CE   19 
ATOM   8602  N NZ   . LYS A 1 14 ? 8.804   2.900   -5.860  1.00 1.93 ? 14 LYS A NZ   19 
ATOM   8603  H H    . LYS A 1 14 ? 4.467   5.025   -4.541  1.00 0.99 ? 14 LYS A H    19 
ATOM   8604  H HA   . LYS A 1 14 ? 6.296   7.261   -4.101  1.00 0.71 ? 14 LYS A HA   19 
ATOM   8605  H HB2  . LYS A 1 14 ? 7.703   5.415   -3.156  1.00 1.05 ? 14 LYS A HB2  19 
ATOM   8606  H HB3  . LYS A 1 14 ? 6.070   5.427   -2.506  1.00 0.96 ? 14 LYS A HB3  19 
ATOM   8607  H HG2  . LYS A 1 14 ? 5.675   3.352   -3.297  1.00 1.26 ? 14 LYS A HG2  19 
ATOM   8608  H HG3  . LYS A 1 14 ? 6.183   3.822   -4.919  1.00 1.25 ? 14 LYS A HG3  19 
ATOM   8609  H HD2  . LYS A 1 14 ? 8.587   3.720   -3.618  1.00 1.57 ? 14 LYS A HD2  19 
ATOM   8610  H HD3  . LYS A 1 14 ? 7.696   2.437   -2.800  1.00 1.84 ? 14 LYS A HD3  19 
ATOM   8611  H HE2  . LYS A 1 14 ? 8.498   1.212   -4.596  1.00 2.27 ? 14 LYS A HE2  19 
ATOM   8612  H HE3  . LYS A 1 14 ? 7.027   1.854   -5.355  1.00 1.87 ? 14 LYS A HE3  19 
ATOM   8613  H HZ1  . LYS A 1 14 ? 8.515   3.905   -5.831  1.00 1.70 ? 14 LYS A HZ1  19 
ATOM   8614  H HZ2  . LYS A 1 14 ? 9.807   2.820   -5.597  1.00 2.06 ? 14 LYS A HZ2  19 
ATOM   8615  H HZ3  . LYS A 1 14 ? 8.670   2.531   -6.823  1.00 2.34 ? 14 LYS A HZ3  19 
ATOM   8616  N N    . SER A 1 15 ? 6.774   6.773   -6.807  1.00 0.81 ? 15 SER A N    19 
ATOM   8617  C CA   . SER A 1 15 ? 7.582   6.708   -8.070  1.00 0.89 ? 15 SER A CA   19 
ATOM   8618  C C    . SER A 1 15 ? 7.809   5.253   -8.519  1.00 1.12 ? 15 SER A C    19 
ATOM   8619  O O    . SER A 1 15 ? 7.200   4.329   -8.011  1.00 1.27 ? 15 SER A O    19 
ATOM   8620  C CB   . SER A 1 15 ? 8.907   7.386   -7.726  1.00 0.74 ? 15 SER A CB   19 
ATOM   8621  O OG   . SER A 1 15 ? 9.664   7.568   -8.916  1.00 0.86 ? 15 SER A OG   19 
ATOM   8622  H H    . SER A 1 15 ? 5.965   7.322   -6.784  1.00 0.79 ? 15 SER A H    19 
ATOM   8623  H HA   . SER A 1 15 ? 7.089   7.260   -8.854  1.00 0.97 ? 15 SER A HA   19 
ATOM   8624  H HB2  . SER A 1 15 ? 8.716   8.347   -7.277  1.00 0.70 ? 15 SER A HB2  19 
ATOM   8625  H HB3  . SER A 1 15 ? 9.454   6.768   -7.027  1.00 0.74 ? 15 SER A HB3  19 
ATOM   8626  H HG   . SER A 1 15 ? 10.512  7.959   -8.673  1.00 0.64 ? 15 SER A HG   19 
ATOM   8627  N N    . GLY A 1 16 ? 8.680   5.049   -9.477  1.00 1.20 ? 16 GLY A N    19 
ATOM   8628  C CA   . GLY A 1 16 ? 8.953   3.667   -9.974  1.00 1.46 ? 16 GLY A CA   19 
ATOM   8629  C C    . GLY A 1 16 ? 9.180   3.705   -11.488 1.00 1.52 ? 16 GLY A C    19 
ATOM   8630  O O    . GLY A 1 16 ? 8.243   3.705   -12.261 1.00 1.93 ? 16 GLY A O    19 
ATOM   8631  H H    . GLY A 1 16 ? 9.154   5.814   -9.872  1.00 1.11 ? 16 GLY A H    19 
ATOM   8632  H HA2  . GLY A 1 16 ? 9.833   3.274   -9.486  1.00 1.38 ? 16 GLY A HA2  19 
ATOM   8633  H HA3  . GLY A 1 16 ? 8.107   3.031   -9.759  1.00 1.79 ? 16 GLY A HA3  19 
ATOM   8634  N N    . ASN A 1 17 ? 10.418  3.740   -11.917 1.00 1.24 ? 17 ASN A N    19 
ATOM   8635  C CA   . ASN A 1 17 ? 10.704  3.783   -13.386 1.00 1.46 ? 17 ASN A CA   19 
ATOM   8636  C C    . ASN A 1 17 ? 11.968  2.977   -13.720 1.00 1.27 ? 17 ASN A C    19 
ATOM   8637  O O    . ASN A 1 17 ? 12.780  2.691   -12.861 1.00 1.04 ? 17 ASN A O    19 
ATOM   8638  C CB   . ASN A 1 17 ? 10.912  5.267   -13.702 1.00 1.51 ? 17 ASN A CB   19 
ATOM   8639  C CG   . ASN A 1 17 ? 10.444  5.566   -15.130 1.00 2.13 ? 17 ASN A CG   19 
ATOM   8640  O OD1  . ASN A 1 17 ? 10.352  4.679   -15.955 1.00 2.07 ? 17 ASN A OD1  19 
ATOM   8641  N ND2  . ASN A 1 17 ? 10.146  6.790   -15.461 1.00 2.89 ? 17 ASN A ND2  19 
ATOM   8642  H H    . ASN A 1 17 ? 11.159  3.741   -11.274 1.00 0.98 ? 17 ASN A H    19 
ATOM   8643  H HA   . ASN A 1 17 ? 9.861   3.405   -13.943 1.00 1.92 ? 17 ASN A HA   19 
ATOM   8644  H HB2  . ASN A 1 17 ? 10.344  5.865   -13.005 1.00 1.52 ? 17 ASN A HB2  19 
ATOM   8645  H HB3  . ASN A 1 17 ? 11.960  5.509   -13.611 1.00 1.28 ? 17 ASN A HB3  19 
ATOM   8646  H HD21 . ASN A 1 17 ? 10.220  7.509   -14.801 1.00 3.12 ? 17 ASN A HD21 19 
ATOM   8647  H HD22 . ASN A 1 17 ? 9.846   6.989   -16.372 1.00 3.31 ? 17 ASN A HD22 19 
ATOM   8648  N N    . LYS A 1 18 ? 12.134  2.611   -14.967 1.00 1.53 ? 18 LYS A N    19 
ATOM   8649  C CA   . LYS A 1 18 ? 13.339  1.821   -15.373 1.00 1.42 ? 18 LYS A CA   19 
ATOM   8650  C C    . LYS A 1 18 ? 14.609  2.693   -15.380 1.00 1.00 ? 18 LYS A C    19 
ATOM   8651  O O    . LYS A 1 18 ? 15.632  2.276   -14.865 1.00 0.89 ? 18 LYS A O    19 
ATOM   8652  C CB   . LYS A 1 18 ? 13.032  1.307   -16.783 1.00 1.83 ? 18 LYS A CB   19 
ATOM   8653  C CG   . LYS A 1 18 ? 13.215  -0.212  -16.823 1.00 2.19 ? 18 LYS A CG   19 
ATOM   8654  C CD   . LYS A 1 18 ? 14.709  -0.554  -16.758 1.00 2.09 ? 18 LYS A CD   19 
ATOM   8655  C CE   . LYS A 1 18 ? 15.066  -1.056  -15.354 1.00 1.96 ? 18 LYS A CE   19 
ATOM   8656  N NZ   . LYS A 1 18 ? 16.267  -0.266  -14.949 1.00 1.58 ? 18 LYS A NZ   19 
ATOM   8657  H H    . LYS A 1 18 ? 11.461  2.854   -15.639 1.00 1.85 ? 18 LYS A H    19 
ATOM   8658  H HA   . LYS A 1 18 ? 13.472  0.985   -14.705 1.00 1.50 ? 18 LYS A HA   19 
ATOM   8659  H HB2  . LYS A 1 18 ? 12.013  1.554   -17.044 1.00 2.10 ? 18 LYS A HB2  19 
ATOM   8660  H HB3  . LYS A 1 18 ? 13.707  1.767   -17.490 1.00 1.72 ? 18 LYS A HB3  19 
ATOM   8661  H HG2  . LYS A 1 18 ? 12.704  -0.655  -15.980 1.00 2.25 ? 18 LYS A HG2  19 
ATOM   8662  H HG3  . LYS A 1 18 ? 12.798  -0.598  -17.739 1.00 2.55 ? 18 LYS A HG3  19 
ATOM   8663  H HD2  . LYS A 1 18 ? 14.930  -1.326  -17.482 1.00 2.47 ? 18 LYS A HD2  19 
ATOM   8664  H HD3  . LYS A 1 18 ? 15.291  0.327   -16.984 1.00 1.89 ? 18 LYS A HD3  19 
ATOM   8665  H HE2  . LYS A 1 18 ? 14.246  -0.874  -14.671 1.00 1.95 ? 18 LYS A HE2  19 
ATOM   8666  H HE3  . LYS A 1 18 ? 15.306  -2.108  -15.381 1.00 2.30 ? 18 LYS A HE3  19 
ATOM   8667  H HZ1  . LYS A 1 18 ? 17.028  -0.405  -15.644 1.00 1.65 ? 18 LYS A HZ1  19 
ATOM   8668  H HZ2  . LYS A 1 18 ? 16.021  0.749   -14.902 1.00 1.27 ? 18 LYS A HZ2  19 
ATOM   8669  H HZ3  . LYS A 1 18 ? 16.594  -0.584  -14.014 1.00 1.78 ? 18 LYS A HZ3  19 
ATOM   8670  N N    . PRO A 1 19 ? 14.513  3.869   -15.967 1.00 1.06 ? 19 PRO A N    19 
ATOM   8671  C CA   . PRO A 1 19 ? 15.723  4.745   -16.000 1.00 1.03 ? 19 PRO A CA   19 
ATOM   8672  C C    . PRO A 1 19 ? 15.976  5.371   -14.618 1.00 0.90 ? 19 PRO A C    19 
ATOM   8673  O O    . PRO A 1 19 ? 15.055  5.545   -13.838 1.00 0.91 ? 19 PRO A O    19 
ATOM   8674  C CB   . PRO A 1 19 ? 15.385  5.816   -17.034 1.00 1.50 ? 19 PRO A CB   19 
ATOM   8675  C CG   . PRO A 1 19 ? 13.897  5.865   -17.054 1.00 1.69 ? 19 PRO A CG   19 
ATOM   8676  C CD   . PRO A 1 19 ? 13.419  4.473   -16.750 1.00 1.51 ? 19 PRO A CD   19 
ATOM   8677  H HA   . PRO A 1 19 ? 16.585  4.184   -16.322 1.00 0.98 ? 19 PRO A HA   19 
ATOM   8678  H HB2  . PRO A 1 19 ? 15.792  6.772   -16.731 1.00 1.67 ? 19 PRO A HB2  19 
ATOM   8679  H HB3  . PRO A 1 19 ? 15.759  5.535   -18.005 1.00 1.63 ? 19 PRO A HB3  19 
ATOM   8680  H HG2  . PRO A 1 19 ? 13.540  6.555   -16.302 1.00 1.77 ? 19 PRO A HG2  19 
ATOM   8681  H HG3  . PRO A 1 19 ? 13.549  6.165   -18.029 1.00 2.00 ? 19 PRO A HG3  19 
ATOM   8682  H HD2  . PRO A 1 19 ? 12.509  4.509   -16.168 1.00 1.67 ? 19 PRO A HD2  19 
ATOM   8683  H HD3  . PRO A 1 19 ? 13.265  3.917   -17.662 1.00 1.70 ? 19 PRO A HD3  19 
ATOM   8684  N N    . PRO A 1 20 ? 17.225  5.688   -14.363 1.00 1.00 ? 20 PRO A N    19 
ATOM   8685  C CA   . PRO A 1 20 ? 17.568  6.297   -13.044 1.00 1.14 ? 20 PRO A CA   19 
ATOM   8686  C C    . PRO A 1 20 ? 17.117  7.766   -12.984 1.00 1.32 ? 20 PRO A C    19 
ATOM   8687  O O    . PRO A 1 20 ? 17.923  8.677   -13.002 1.00 1.82 ? 20 PRO A O    19 
ATOM   8688  C CB   . PRO A 1 20 ? 19.090  6.182   -12.971 1.00 1.52 ? 20 PRO A CB   19 
ATOM   8689  C CG   . PRO A 1 20 ? 19.538  6.122   -14.391 1.00 1.58 ? 20 PRO A CG   19 
ATOM   8690  C CD   . PRO A 1 20 ? 18.436  5.456   -15.169 1.00 1.22 ? 20 PRO A CD   19 
ATOM   8691  H HA   . PRO A 1 20 ? 17.120  5.733   -12.241 1.00 1.02 ? 20 PRO A HA   19 
ATOM   8692  H HB2  . PRO A 1 20 ? 19.509  7.049   -12.477 1.00 1.79 ? 20 PRO A HB2  19 
ATOM   8693  H HB3  . PRO A 1 20 ? 19.375  5.278   -12.454 1.00 1.55 ? 20 PRO A HB3  19 
ATOM   8694  H HG2  . PRO A 1 20 ? 19.707  7.122   -14.766 1.00 1.82 ? 20 PRO A HG2  19 
ATOM   8695  H HG3  . PRO A 1 20 ? 20.443  5.538   -14.471 1.00 1.73 ? 20 PRO A HG3  19 
ATOM   8696  H HD2  . PRO A 1 20 ? 18.337  5.911   -16.145 1.00 1.38 ? 20 PRO A HD2  19 
ATOM   8697  H HD3  . PRO A 1 20 ? 18.624  4.398   -15.260 1.00 1.10 ? 20 PRO A HD3  19 
ATOM   8698  N N    . SER A 1 21 ? 15.831  7.999   -12.906 1.00 1.07 ? 21 SER A N    19 
ATOM   8699  C CA   . SER A 1 21 ? 15.318  9.404   -12.837 1.00 1.33 ? 21 SER A CA   19 
ATOM   8700  C C    . SER A 1 21 ? 15.052  9.789   -11.375 1.00 1.14 ? 21 SER A C    19 
ATOM   8701  O O    . SER A 1 21 ? 15.761  10.591  -10.796 1.00 1.38 ? 21 SER A O    19 
ATOM   8702  C CB   . SER A 1 21 ? 14.016  9.397   -13.648 1.00 1.47 ? 21 SER A CB   19 
ATOM   8703  O OG   . SER A 1 21 ? 13.193  8.314   -13.220 1.00 1.29 ? 21 SER A OG   19 
ATOM   8704  H H    . SER A 1 21 ? 15.200  7.247   -12.889 1.00 0.90 ? 21 SER A H    19 
ATOM   8705  H HA   . SER A 1 21 ? 16.025  10.085  -13.281 1.00 1.67 ? 21 SER A HA   19 
ATOM   8706  H HB2  . SER A 1 21 ? 13.488  10.323  -13.492 1.00 1.70 ? 21 SER A HB2  19 
ATOM   8707  H HB3  . SER A 1 21 ? 14.250  9.293   -14.699 1.00 1.67 ? 21 SER A HB3  19 
ATOM   8708  H HG   . SER A 1 21 ? 13.070  7.721   -13.968 1.00 1.57 ? 21 SER A HG   19 
ATOM   8709  N N    . LYS A 1 22 ? 14.040  9.215   -10.776 1.00 0.82 ? 22 LYS A N    19 
ATOM   8710  C CA   . LYS A 1 22 ? 13.723  9.529   -9.348  1.00 0.66 ? 22 LYS A CA   19 
ATOM   8711  C C    . LYS A 1 22 ? 13.007  8.335   -8.705  1.00 0.47 ? 22 LYS A C    19 
ATOM   8712  O O    . LYS A 1 22 ? 11.923  8.457   -8.165  1.00 0.53 ? 22 LYS A O    19 
ATOM   8713  C CB   . LYS A 1 22 ? 12.811  10.760  -9.402  1.00 0.78 ? 22 LYS A CB   19 
ATOM   8714  C CG   . LYS A 1 22 ? 13.048  11.630  -8.164  1.00 0.97 ? 22 LYS A CG   19 
ATOM   8715  C CD   . LYS A 1 22 ? 14.225  12.578  -8.418  1.00 1.47 ? 22 LYS A CD   19 
ATOM   8716  C CE   . LYS A 1 22 ? 15.490  12.025  -7.749  1.00 1.78 ? 22 LYS A CE   19 
ATOM   8717  N NZ   . LYS A 1 22 ? 16.528  12.028  -8.821  1.00 1.90 ? 22 LYS A NZ   19 
ATOM   8718  H H    . LYS A 1 22 ? 13.490  8.567   -11.266 1.00 0.82 ? 22 LYS A H    19 
ATOM   8719  H HA   . LYS A 1 22 ? 14.626  9.758   -8.805  1.00 0.82 ? 22 LYS A HA   19 
ATOM   8720  H HB2  . LYS A 1 22 ? 13.030  11.331  -10.292 1.00 1.04 ? 22 LYS A HB2  19 
ATOM   8721  H HB3  . LYS A 1 22 ? 11.779  10.443  -9.424  1.00 0.73 ? 22 LYS A HB3  19 
ATOM   8722  H HG2  . LYS A 1 22 ? 12.159  12.209  -7.956  1.00 0.97 ? 22 LYS A HG2  19 
ATOM   8723  H HG3  . LYS A 1 22 ? 13.272  10.998  -7.316  1.00 1.06 ? 22 LYS A HG3  19 
ATOM   8724  H HD2  . LYS A 1 22 ? 14.390  12.670  -9.481  1.00 1.58 ? 22 LYS A HD2  19 
ATOM   8725  H HD3  . LYS A 1 22 ? 14.000  13.550  -8.005  1.00 1.71 ? 22 LYS A HD3  19 
ATOM   8726  H HE2  . LYS A 1 22 ? 15.789  12.666  -6.930  1.00 2.19 ? 22 LYS A HE2  19 
ATOM   8727  H HE3  . LYS A 1 22 ? 15.322  11.018  -7.399  1.00 1.74 ? 22 LYS A HE3  19 
ATOM   8728  H HZ1  . LYS A 1 22 ? 16.669  12.999  -9.168  1.00 2.17 ? 22 LYS A HZ1  19 
ATOM   8729  H HZ2  . LYS A 1 22 ? 17.424  11.663  -8.437  1.00 2.11 ? 22 LYS A HZ2  19 
ATOM   8730  H HZ3  . LYS A 1 22 ? 16.216  11.420  -9.615  1.00 1.65 ? 22 LYS A HZ3  19 
ATOM   8731  N N    . THR A 1 23 ? 13.612  7.177   -8.769  1.00 0.52 ? 23 THR A N    19 
ATOM   8732  C CA   . THR A 1 23 ? 12.982  5.953   -8.177  1.00 0.75 ? 23 THR A CA   19 
ATOM   8733  C C    . THR A 1 23 ? 14.016  5.147   -7.372  1.00 1.05 ? 23 THR A C    19 
ATOM   8734  O O    . THR A 1 23 ? 14.006  3.930   -7.374  1.00 1.32 ? 23 THR A O    19 
ATOM   8735  C CB   . THR A 1 23 ? 12.480  5.149   -9.387  1.00 0.83 ? 23 THR A CB   19 
ATOM   8736  O OG1  . THR A 1 23 ? 11.832  3.966   -8.939  1.00 1.18 ? 23 THR A OG1  19 
ATOM   8737  C CG2  . THR A 1 23 ? 13.656  4.772   -10.295 1.00 0.85 ? 23 THR A CG2  19 
ATOM   8738  H H    . THR A 1 23 ? 14.482  7.110   -9.215  1.00 0.58 ? 23 THR A H    19 
ATOM   8739  H HA   . THR A 1 23 ? 12.150  6.225   -7.549  1.00 0.79 ? 23 THR A HA   19 
ATOM   8740  H HB   . THR A 1 23 ? 11.779  5.749   -9.948  1.00 0.80 ? 23 THR A HB   19 
ATOM   8741  H HG1  . THR A 1 23 ? 12.476  3.435   -8.458  1.00 1.32 ? 23 THR A HG1  19 
ATOM   8742  H HG21 . THR A 1 23 ? 14.525  4.558   -9.690  1.00 1.18 ? 23 THR A HG21 19 
ATOM   8743  H HG22 . THR A 1 23 ? 13.398  3.899   -10.874 1.00 1.37 ? 23 THR A HG22 19 
ATOM   8744  H HG23 . THR A 1 23 ? 13.875  5.594   -10.960 1.00 1.34 ? 23 THR A HG23 19 
ATOM   8745  N N    . CYS A 1 24 ? 14.906  5.817   -6.685  1.00 1.13 ? 24 CYS A N    19 
ATOM   8746  C CA   . CYS A 1 24 ? 15.940  5.096   -5.881  1.00 1.53 ? 24 CYS A CA   19 
ATOM   8747  C C    . CYS A 1 24 ? 15.603  5.152   -4.382  1.00 1.42 ? 24 CYS A C    19 
ATOM   8748  O O    . CYS A 1 24 ? 16.405  5.576   -3.570  1.00 1.45 ? 24 CYS A O    19 
ATOM   8749  C CB   . CYS A 1 24 ? 17.252  5.830   -6.177  1.00 1.86 ? 24 CYS A CB   19 
ATOM   8750  S SG   . CYS A 1 24 ? 17.748  5.519   -7.891  1.00 2.51 ? 24 CYS A SG   19 
ATOM   8751  H H    . CYS A 1 24 ? 14.896  6.796   -6.698  1.00 1.02 ? 24 CYS A H    19 
ATOM   8752  H HA   . CYS A 1 24 ? 16.015  4.070   -6.207  1.00 1.74 ? 24 CYS A HA   19 
ATOM   8753  H HB2  . CYS A 1 24 ? 17.112  6.890   -6.029  1.00 1.78 ? 24 CYS A HB2  19 
ATOM   8754  H HB3  . CYS A 1 24 ? 18.022  5.472   -5.510  1.00 2.23 ? 24 CYS A HB3  19 
ATOM   8755  H HG   . CYS A 1 24 ? 18.227  4.687   -7.915  1.00 2.76 ? 24 CYS A HG   19 
ATOM   8756  N N    . LEU A 1 25 ? 14.424  4.716   -4.008  1.00 1.42 ? 25 LEU A N    19 
ATOM   8757  C CA   . LEU A 1 25 ? 14.035  4.732   -2.563  1.00 1.37 ? 25 LEU A CA   19 
ATOM   8758  C C    . LEU A 1 25 ? 13.468  3.367   -2.140  1.00 1.28 ? 25 LEU A C    19 
ATOM   8759  O O    . LEU A 1 25 ? 13.296  2.477   -2.951  1.00 1.32 ? 25 LEU A O    19 
ATOM   8760  C CB   . LEU A 1 25 ? 12.987  5.859   -2.392  1.00 1.60 ? 25 LEU A CB   19 
ATOM   8761  C CG   . LEU A 1 25 ? 11.874  5.833   -3.467  1.00 1.81 ? 25 LEU A CG   19 
ATOM   8762  C CD1  . LEU A 1 25 ? 12.394  6.409   -4.786  1.00 1.95 ? 25 LEU A CD1  19 
ATOM   8763  C CD2  . LEU A 1 25 ? 11.356  4.409   -3.696  1.00 1.74 ? 25 LEU A CD2  19 
ATOM   8764  H H    . LEU A 1 25 ? 13.798  4.370   -4.676  1.00 1.52 ? 25 LEU A H    19 
ATOM   8765  H HA   . LEU A 1 25 ? 14.903  4.960   -1.961  1.00 1.37 ? 25 LEU A HA   19 
ATOM   8766  H HB2  . LEU A 1 25 ? 12.528  5.761   -1.420  1.00 1.60 ? 25 LEU A HB2  19 
ATOM   8767  H HB3  . LEU A 1 25 ? 13.494  6.812   -2.438  1.00 1.74 ? 25 LEU A HB3  19 
ATOM   8768  H HG   . LEU A 1 25 ? 11.056  6.450   -3.126  1.00 1.99 ? 25 LEU A HG   19 
ATOM   8769  H HD11 . LEU A 1 25 ? 13.399  6.778   -4.648  1.00 2.24 ? 25 LEU A HD11 19 
ATOM   8770  H HD12 . LEU A 1 25 ? 12.393  5.637   -5.541  1.00 1.97 ? 25 LEU A HD12 19 
ATOM   8771  H HD13 . LEU A 1 25 ? 11.753  7.220   -5.102  1.00 2.01 ? 25 LEU A HD13 19 
ATOM   8772  H HD21 . LEU A 1 25 ? 11.224  3.916   -2.744  1.00 1.74 ? 25 LEU A HD21 19 
ATOM   8773  H HD22 . LEU A 1 25 ? 10.410  4.451   -4.212  1.00 1.98 ? 25 LEU A HD22 19 
ATOM   8774  H HD23 . LEU A 1 25 ? 12.065  3.857   -4.293  1.00 1.73 ? 25 LEU A HD23 19 
ATOM   8775  N N    . LYS A 1 26 ? 13.187  3.196   -0.871  1.00 1.29 ? 26 LYS A N    19 
ATOM   8776  C CA   . LYS A 1 26 ? 12.637  1.893   -0.387  1.00 1.36 ? 26 LYS A CA   19 
ATOM   8777  C C    . LYS A 1 26 ? 11.433  2.131   0.531   1.00 1.39 ? 26 LYS A C    19 
ATOM   8778  O O    . LYS A 1 26 ? 11.518  2.854   1.507   1.00 1.24 ? 26 LYS A O    19 
ATOM   8779  C CB   . LYS A 1 26 ? 13.779  1.240   0.396   1.00 1.44 ? 26 LYS A CB   19 
ATOM   8780  C CG   . LYS A 1 26 ? 14.881  0.789   -0.566  1.00 1.57 ? 26 LYS A CG   19 
ATOM   8781  C CD   . LYS A 1 26 ? 16.235  1.299   -0.062  1.00 1.65 ? 26 LYS A CD   19 
ATOM   8782  C CE   . LYS A 1 26 ? 16.906  0.223   0.799   1.00 1.75 ? 26 LYS A CE   19 
ATOM   8783  N NZ   . LYS A 1 26 ? 16.926  0.783   2.181   1.00 1.69 ? 26 LYS A NZ   19 
ATOM   8784  H H    . LYS A 1 26 ? 13.341  3.924   -0.234  1.00 1.33 ? 26 LYS A H    19 
ATOM   8785  H HA   . LYS A 1 26 ? 12.357  1.267   -1.221  1.00 1.49 ? 26 LYS A HA   19 
ATOM   8786  H HB2  . LYS A 1 26 ? 14.183  1.953   1.101   1.00 1.42 ? 26 LYS A HB2  19 
ATOM   8787  H HB3  . LYS A 1 26 ? 13.400  0.382   0.933   1.00 1.62 ? 26 LYS A HB3  19 
ATOM   8788  H HG2  . LYS A 1 26 ? 14.897  -0.290  -0.615  1.00 1.68 ? 26 LYS A HG2  19 
ATOM   8789  H HG3  . LYS A 1 26 ? 14.691  1.191   -1.549  1.00 1.64 ? 26 LYS A HG3  19 
ATOM   8790  H HD2  . LYS A 1 26 ? 16.867  1.531   -0.908  1.00 1.82 ? 26 LYS A HD2  19 
ATOM   8791  H HD3  . LYS A 1 26 ? 16.085  2.191   0.529   1.00 1.62 ? 26 LYS A HD3  19 
ATOM   8792  H HE2  . LYS A 1 26 ? 16.330  -0.694  0.770   1.00 1.78 ? 26 LYS A HE2  19 
ATOM   8793  H HE3  . LYS A 1 26 ? 17.915  0.043   0.457   1.00 2.02 ? 26 LYS A HE3  19 
ATOM   8794  H HZ1  . LYS A 1 26 ? 17.339  1.736   2.168   1.00 1.75 ? 26 LYS A HZ1  19 
ATOM   8795  H HZ2  . LYS A 1 26 ? 15.948  0.834   2.553   1.00 1.55 ? 26 LYS A HZ2  19 
ATOM   8796  H HZ3  . LYS A 1 26 ? 17.495  0.166   2.796   1.00 1.92 ? 26 LYS A HZ3  19 
ATOM   8797  N N    . GLU A 1 27 ? 10.316  1.524   0.229   1.00 1.71 ? 27 GLU A N    19 
ATOM   8798  C CA   . GLU A 1 27 ? 9.097   1.703   1.085   1.00 1.89 ? 27 GLU A CA   19 
ATOM   8799  C C    . GLU A 1 27 ? 9.140   0.744   2.291   1.00 1.79 ? 27 GLU A C    19 
ATOM   8800  O O    . GLU A 1 27 ? 8.228   -0.033  2.519   1.00 2.12 ? 27 GLU A O    19 
ATOM   8801  C CB   . GLU A 1 27 ? 7.902   1.390   0.166   1.00 2.39 ? 27 GLU A CB   19 
ATOM   8802  C CG   . GLU A 1 27 ? 8.033   -0.023  -0.427  1.00 2.54 ? 27 GLU A CG   19 
ATOM   8803  C CD   . GLU A 1 27 ? 8.381   0.069   -1.915  1.00 2.62 ? 27 GLU A CD   19 
ATOM   8804  O OE1  . GLU A 1 27 ? 9.531   0.342   -2.219  1.00 2.33 ? 27 GLU A OE1  19 
ATOM   8805  O OE2  . GLU A 1 27 ? 7.493   -0.132  -2.726  1.00 3.03 ? 27 GLU A OE2  19 
ATOM   8806  H H    . GLU A 1 27 ? 10.280  0.945   -0.563  1.00 1.88 ? 27 GLU A H    19 
ATOM   8807  H HA   . GLU A 1 27 ? 9.034   2.723   1.428   1.00 1.85 ? 27 GLU A HA   19 
ATOM   8808  H HB2  . GLU A 1 27 ? 6.987   1.453   0.738   1.00 2.58 ? 27 GLU A HB2  19 
ATOM   8809  H HB3  . GLU A 1 27 ? 7.871   2.111   -0.637  1.00 2.51 ? 27 GLU A HB3  19 
ATOM   8810  H HG2  . GLU A 1 27 ? 8.812   -0.563  0.092   1.00 2.34 ? 27 GLU A HG2  19 
ATOM   8811  H HG3  . GLU A 1 27 ? 7.097   -0.549  -0.312  1.00 2.83 ? 27 GLU A HG3  19 
ATOM   8812  N N    . GLU A 1 28 ? 10.196  0.798   3.068   1.00 1.44 ? 28 GLU A N    19 
ATOM   8813  C CA   . GLU A 1 28 ? 10.310  -0.100  4.259   1.00 1.50 ? 28 GLU A CA   19 
ATOM   8814  C C    . GLU A 1 28 ? 9.507   0.470   5.439   1.00 1.56 ? 28 GLU A C    19 
ATOM   8815  O O    . GLU A 1 28 ? 10.060  0.900   6.435   1.00 1.74 ? 28 GLU A O    19 
ATOM   8816  C CB   . GLU A 1 28 ? 11.809  -0.135  4.587   1.00 1.36 ? 28 GLU A CB   19 
ATOM   8817  C CG   . GLU A 1 28 ? 12.591  -0.677  3.384   1.00 1.35 ? 28 GLU A CG   19 
ATOM   8818  C CD   . GLU A 1 28 ? 14.090  -0.470  3.608   1.00 1.54 ? 28 GLU A CD   19 
ATOM   8819  O OE1  . GLU A 1 28 ? 14.568  0.615   3.318   1.00 1.54 ? 28 GLU A OE1  19 
ATOM   8820  O OE2  . GLU A 1 28 ? 14.738  -1.401  4.058   1.00 1.96 ? 28 GLU A OE2  19 
ATOM   8821  H H    . GLU A 1 28 ? 10.915  1.433   2.867   1.00 1.25 ? 28 GLU A H    19 
ATOM   8822  H HA   . GLU A 1 28 ? 9.965   -1.093  4.015   1.00 1.73 ? 28 GLU A HA   19 
ATOM   8823  H HB2  . GLU A 1 28 ? 12.149  0.864   4.818   1.00 1.25 ? 28 GLU A HB2  19 
ATOM   8824  H HB3  . GLU A 1 28 ? 11.976  -0.777  5.439   1.00 1.55 ? 28 GLU A HB3  19 
ATOM   8825  H HG2  . GLU A 1 28 ? 12.385  -1.729  3.266   1.00 1.49 ? 28 GLU A HG2  19 
ATOM   8826  H HG3  . GLU A 1 28 ? 12.289  -0.151  2.492   1.00 1.20 ? 28 GLU A HG3  19 
ATOM   8827  N N    . MET A 1 29 ? 8.201   0.477   5.332   1.00 1.68 ? 29 MET A N    19 
ATOM   8828  C CA   . MET A 1 29 ? 7.357   1.021   6.441   1.00 1.80 ? 29 MET A CA   19 
ATOM   8829  C C    . MET A 1 29 ? 6.098   0.161   6.628   1.00 1.79 ? 29 MET A C    19 
ATOM   8830  O O    . MET A 1 29 ? 5.307   -0.003  5.716   1.00 2.05 ? 29 MET A O    19 
ATOM   8831  C CB   . MET A 1 29 ? 6.982   2.437   5.992   1.00 2.18 ? 29 MET A CB   19 
ATOM   8832  C CG   . MET A 1 29 ? 6.580   3.272   7.209   1.00 2.45 ? 29 MET A CG   19 
ATOM   8833  S SD   . MET A 1 29 ? 5.757   4.786   6.653   1.00 2.35 ? 29 MET A SD   19 
ATOM   8834  C CE   . MET A 1 29 ? 6.271   5.844   8.029   1.00 3.15 ? 29 MET A CE   19 
ATOM   8835  H H    . MET A 1 29 ? 7.775   0.127   4.519   1.00 1.84 ? 29 MET A H    19 
ATOM   8836  H HA   . MET A 1 29 ? 7.922   1.064   7.357   1.00 1.80 ? 29 MET A HA   19 
ATOM   8837  H HB2  . MET A 1 29 ? 7.831   2.895   5.505   1.00 2.26 ? 29 MET A HB2  19 
ATOM   8838  H HB3  . MET A 1 29 ? 6.154   2.388   5.301   1.00 2.30 ? 29 MET A HB3  19 
ATOM   8839  H HG2  . MET A 1 29 ? 5.903   2.703   7.830   1.00 2.70 ? 29 MET A HG2  19 
ATOM   8840  H HG3  . MET A 1 29 ? 7.461   3.529   7.778   1.00 2.90 ? 29 MET A HG3  19 
ATOM   8841  H HE1  . MET A 1 29 ? 5.937   5.415   8.959   1.00 3.54 ? 29 MET A HE1  19 
ATOM   8842  H HE2  . MET A 1 29 ? 7.349   5.924   8.037   1.00 3.50 ? 29 MET A HE2  19 
ATOM   8843  H HE3  . MET A 1 29 ? 5.833   6.826   7.909   1.00 3.51 ? 29 MET A HE3  19 
ATOM   8844  N N    . ALA A 1 30 ? 5.908   -0.383  7.803   1.00 1.74 ? 30 ALA A N    19 
ATOM   8845  C CA   . ALA A 1 30 ? 4.704   -1.230  8.058   1.00 1.95 ? 30 ALA A CA   19 
ATOM   8846  C C    . ALA A 1 30 ? 4.175   -0.988  9.478   1.00 2.14 ? 30 ALA A C    19 
ATOM   8847  O O    . ALA A 1 30 ? 4.918   -1.221  10.421  1.00 2.97 ? 30 ALA A O    19 
ATOM   8848  C CB   . ALA A 1 30 ? 5.192   -2.671  7.895   1.00 1.95 ? 30 ALA A CB   19 
ATOM   8849  O OXT  . ALA A 1 30 ? 3.036   -0.570  9.600   1.00 1.67 ? 30 ALA A OXT  19 
ATOM   8850  H H    . ALA A 1 30 ? 6.558   -0.234  8.521   1.00 1.74 ? 30 ALA A H    19 
ATOM   8851  H HA   . ALA A 1 30 ? 3.935   -1.018  7.331   1.00 2.15 ? 30 ALA A HA   19 
ATOM   8852  H HB1  . ALA A 1 30 ? 5.659   -2.787  6.927   1.00 2.41 ? 30 ALA A HB1  19 
ATOM   8853  H HB2  . ALA A 1 30 ? 5.909   -2.898  8.670   1.00 2.11 ? 30 ALA A HB2  19 
ATOM   8854  H HB3  . ALA A 1 30 ? 4.352   -3.346  7.972   1.00 2.12 ? 30 ALA A HB3  19 
ATOM   8855  N N    . MET A 1 1  ? -9.134  12.537  20.559  1.00 3.19 ? 1  MET A N    20 
ATOM   8856  C CA   . MET A 1 1  ? -8.554  11.878  19.348  1.00 2.83 ? 1  MET A CA   20 
ATOM   8857  C C    . MET A 1 1  ? -7.709  10.663  19.753  1.00 2.58 ? 1  MET A C    20 
ATOM   8858  O O    . MET A 1 1  ? -7.297  10.537  20.891  1.00 2.73 ? 1  MET A O    20 
ATOM   8859  C CB   . MET A 1 1  ? -7.676  12.949  18.688  1.00 3.20 ? 1  MET A CB   20 
ATOM   8860  C CG   . MET A 1 1  ? -8.141  13.179  17.247  1.00 3.47 ? 1  MET A CG   20 
ATOM   8861  S SD   . MET A 1 1  ? -9.767  13.973  17.255  1.00 3.61 ? 1  MET A SD   20 
ATOM   8862  C CE   . MET A 1 1  ? -10.088 13.852  15.479  1.00 4.56 ? 1  MET A CE   20 
ATOM   8863  H H1   . MET A 1 1  ? -8.369  12.799  21.213  1.00 3.42 ? 1  MET A H1   20 
ATOM   8864  H H2   . MET A 1 1  ? -9.656  13.392  20.274  1.00 3.43 ? 1  MET A H2   20 
ATOM   8865  H H3   . MET A 1 1  ? -9.782  11.878  21.035  1.00 3.30 ? 1  MET A H3   20 
ATOM   8866  H HA   . MET A 1 1  ? -9.340  11.579  18.671  1.00 2.84 ? 1  MET A HA   20 
ATOM   8867  H HB2  . MET A 1 1  ? -7.756  13.874  19.243  1.00 3.51 ? 1  MET A HB2  20 
ATOM   8868  H HB3  . MET A 1 1  ? -6.648  12.621  18.683  1.00 3.25 ? 1  MET A HB3  20 
ATOM   8869  H HG2  . MET A 1 1  ? -7.432  13.815  16.737  1.00 3.93 ? 1  MET A HG2  20 
ATOM   8870  H HG3  . MET A 1 1  ? -8.206  12.231  16.734  1.00 3.39 ? 1  MET A HG3  20 
ATOM   8871  H HE1  . MET A 1 1  ? -9.869  12.848  15.142  1.00 4.81 ? 1  MET A HE1  20 
ATOM   8872  H HE2  . MET A 1 1  ? -11.126 14.085  15.285  1.00 4.93 ? 1  MET A HE2  20 
ATOM   8873  H HE3  . MET A 1 1  ? -9.460  14.551  14.950  1.00 4.98 ? 1  MET A HE3  20 
ATOM   8874  N N    . ILE A 1 2  ? -7.449  9.771   18.829  1.00 2.45 ? 2  ILE A N    20 
ATOM   8875  C CA   . ILE A 1 2  ? -6.630  8.560   19.153  1.00 2.40 ? 2  ILE A CA   20 
ATOM   8876  C C    . ILE A 1 2  ? -5.250  8.663   18.490  1.00 2.25 ? 2  ILE A C    20 
ATOM   8877  O O    . ILE A 1 2  ? -5.122  9.134   17.375  1.00 2.29 ? 2  ILE A O    20 
ATOM   8878  C CB   . ILE A 1 2  ? -7.421  7.375   18.583  1.00 2.68 ? 2  ILE A CB   20 
ATOM   8879  C CG1  . ILE A 1 2  ? -8.765  7.254   19.310  1.00 2.87 ? 2  ILE A CG1  20 
ATOM   8880  C CG2  . ILE A 1 2  ? -6.625  6.081   18.777  1.00 2.88 ? 2  ILE A CG2  20 
ATOM   8881  C CD1  . ILE A 1 2  ? -9.900  7.650   18.364  1.00 3.09 ? 2  ILE A CD1  20 
ATOM   8882  H H    . ILE A 1 2  ? -7.792  9.896   17.919  1.00 2.57 ? 2  ILE A H    20 
ATOM   8883  H HA   . ILE A 1 2  ? -6.525  8.452   20.221  1.00 2.47 ? 2  ILE A HA   20 
ATOM   8884  H HB   . ILE A 1 2  ? -7.592  7.535   17.527  1.00 2.77 ? 2  ILE A HB   20 
ATOM   8885  H HG12 . ILE A 1 2  ? -8.908  6.232   19.634  1.00 3.07 ? 2  ILE A HG12 20 
ATOM   8886  H HG13 . ILE A 1 2  ? -8.771  7.907   20.169  1.00 2.87 ? 2  ILE A HG13 20 
ATOM   8887  H HG21 . ILE A 1 2  ? -6.295  6.011   19.804  1.00 3.02 ? 2  ILE A HG21 20 
ATOM   8888  H HG22 . ILE A 1 2  ? -7.253  5.235   18.543  1.00 3.17 ? 2  ILE A HG22 20 
ATOM   8889  H HG23 . ILE A 1 2  ? -5.766  6.083   18.123  1.00 3.12 ? 2  ILE A HG23 20 
ATOM   8890  H HD11 . ILE A 1 2  ? -9.647  7.358   17.354  1.00 3.23 ? 2  ILE A HD11 20 
ATOM   8891  H HD12 . ILE A 1 2  ? -10.810 7.152   18.664  1.00 3.33 ? 2  ILE A HD12 20 
ATOM   8892  H HD13 . ILE A 1 2  ? -10.046 8.719   18.403  1.00 3.42 ? 2  ILE A HD13 20 
ATOM   8893  N N    . SER A 1 3  ? -4.218  8.222   19.166  1.00 2.21 ? 3  SER A N    20 
ATOM   8894  C CA   . SER A 1 3  ? -2.844  8.289   18.576  1.00 2.14 ? 3  SER A CA   20 
ATOM   8895  C C    . SER A 1 3  ? -2.325  6.878   18.258  1.00 2.05 ? 3  SER A C    20 
ATOM   8896  O O    . SER A 1 3  ? -3.076  5.920   18.258  1.00 2.01 ? 3  SER A O    20 
ATOM   8897  C CB   . SER A 1 3  ? -1.982  8.952   19.653  1.00 2.40 ? 3  SER A CB   20 
ATOM   8898  O OG   . SER A 1 3  ? -0.707  9.263   19.103  1.00 2.47 ? 3  SER A OG   20 
ATOM   8899  H H    . SER A 1 3  ? -4.348  7.843   20.062  1.00 2.30 ? 3  SER A H    20 
ATOM   8900  H HA   . SER A 1 3  ? -2.849  8.896   17.685  1.00 2.09 ? 3  SER A HA   20 
ATOM   8901  H HB2  . SER A 1 3  ? -2.456  9.861   19.986  1.00 2.52 ? 3  SER A HB2  20 
ATOM   8902  H HB3  . SER A 1 3  ? -1.871  8.277   20.491  1.00 2.48 ? 3  SER A HB3  20 
ATOM   8903  H HG   . SER A 1 3  ? -0.233  9.809   19.737  1.00 2.74 ? 3  SER A HG   20 
ATOM   8904  N N    . SER A 1 4  ? -1.043  6.748   17.983  1.00 2.13 ? 4  SER A N    20 
ATOM   8905  C CA   . SER A 1 4  ? -0.446  5.405   17.656  1.00 2.19 ? 4  SER A CA   20 
ATOM   8906  C C    . SER A 1 4  ? -1.058  4.805   16.379  1.00 1.98 ? 4  SER A C    20 
ATOM   8907  O O    . SER A 1 4  ? -0.870  3.640   16.084  1.00 2.09 ? 4  SER A O    20 
ATOM   8908  C CB   . SER A 1 4  ? -0.761  4.521   18.861  1.00 2.33 ? 4  SER A CB   20 
ATOM   8909  O OG   . SER A 1 4  ? 0.389   3.756   19.199  1.00 2.62 ? 4  SER A OG   20 
ATOM   8910  H H    . SER A 1 4  ? -0.465  7.542   17.990  1.00 2.24 ? 4  SER A H    20 
ATOM   8911  H HA   . SER A 1 4  ? 0.622   5.494   17.545  1.00 2.35 ? 4  SER A HA   20 
ATOM   8912  H HB2  . SER A 1 4  ? -1.037  5.139   19.697  1.00 2.33 ? 4  SER A HB2  20 
ATOM   8913  H HB3  . SER A 1 4  ? -1.587  3.864   18.616  1.00 2.29 ? 4  SER A HB3  20 
ATOM   8914  H HG   . SER A 1 4  ? 0.423   2.995   18.613  1.00 2.61 ? 4  SER A HG   20 
ATOM   8915  N N    . VAL A 1 5  ? -1.783  5.588   15.622  1.00 1.77 ? 5  VAL A N    20 
ATOM   8916  C CA   . VAL A 1 5  ? -2.407  5.064   14.365  1.00 1.63 ? 5  VAL A CA   20 
ATOM   8917  C C    . VAL A 1 5  ? -1.675  5.597   13.123  1.00 1.50 ? 5  VAL A C    20 
ATOM   8918  O O    . VAL A 1 5  ? -1.639  4.949   12.095  1.00 1.45 ? 5  VAL A O    20 
ATOM   8919  C CB   . VAL A 1 5  ? -3.863  5.553   14.405  1.00 1.60 ? 5  VAL A CB   20 
ATOM   8920  C CG1  . VAL A 1 5  ? -3.927  7.067   14.165  1.00 1.53 ? 5  VAL A CG1  20 
ATOM   8921  C CG2  . VAL A 1 5  ? -4.671  4.837   13.319  1.00 1.65 ? 5  VAL A CG2  20 
ATOM   8922  H H    . VAL A 1 5  ? -1.919  6.518   15.881  1.00 1.77 ? 5  VAL A H    20 
ATOM   8923  H HA   . VAL A 1 5  ? -2.387  3.990   14.364  1.00 1.75 ? 5  VAL A HA   20 
ATOM   8924  H HB   . VAL A 1 5  ? -4.286  5.330   15.373  1.00 1.74 ? 5  VAL A HB   20 
ATOM   8925  H HG11 . VAL A 1 5  ? -3.232  7.567   14.822  1.00 1.89 ? 5  VAL A HG11 20 
ATOM   8926  H HG12 . VAL A 1 5  ? -3.668  7.279   13.138  1.00 1.93 ? 5  VAL A HG12 20 
ATOM   8927  H HG13 . VAL A 1 5  ? -4.928  7.419   14.363  1.00 1.38 ? 5  VAL A HG13 20 
ATOM   8928  H HG21 . VAL A 1 5  ? -4.228  5.031   12.353  1.00 1.93 ? 5  VAL A HG21 20 
ATOM   8929  H HG22 . VAL A 1 5  ? -4.665  3.774   13.509  1.00 2.05 ? 5  VAL A HG22 20 
ATOM   8930  H HG23 . VAL A 1 5  ? -5.688  5.200   13.328  1.00 1.90 ? 5  VAL A HG23 20 
ATOM   8931  N N    . CYS A 1 6  ? -1.097  6.774   13.219  1.00 1.54 ? 6  CYS A N    20 
ATOM   8932  C CA   . CYS A 1 6  ? -0.361  7.381   12.062  1.00 1.51 ? 6  CYS A CA   20 
ATOM   8933  C C    . CYS A 1 6  ? -1.324  7.701   10.907  1.00 1.34 ? 6  CYS A C    20 
ATOM   8934  O O    . CYS A 1 6  ? -2.486  7.337   10.928  1.00 1.27 ? 6  CYS A O    20 
ATOM   8935  C CB   . CYS A 1 6  ? 0.675   6.333   11.638  1.00 1.56 ? 6  CYS A CB   20 
ATOM   8936  S SG   . CYS A 1 6  ? 2.163   7.164   11.027  1.00 1.90 ? 6  CYS A SG   20 
ATOM   8937  H H    . CYS A 1 6  ? -1.150  7.264   14.060  1.00 1.65 ? 6  CYS A H    20 
ATOM   8938  H HA   . CYS A 1 6  ? 0.144   8.280   12.379  1.00 1.67 ? 6  CYS A HA   20 
ATOM   8939  H HB2  . CYS A 1 6  ? 0.932   5.715   12.486  1.00 1.74 ? 6  CYS A HB2  20 
ATOM   8940  H HB3  . CYS A 1 6  ? 0.261   5.713   10.855  1.00 1.41 ? 6  CYS A HB3  20 
ATOM   8941  H HG   . CYS A 1 6  ? 2.639   7.514   11.784  1.00 2.15 ? 6  CYS A HG   20 
ATOM   8942  N N    . VAL A 1 7  ? -0.843  8.386   9.903   1.00 1.39 ? 7  VAL A N    20 
ATOM   8943  C CA   . VAL A 1 7  ? -1.709  8.742   8.741   1.00 1.38 ? 7  VAL A CA   20 
ATOM   8944  C C    . VAL A 1 7  ? -1.219  8.014   7.484   1.00 1.24 ? 7  VAL A C    20 
ATOM   8945  O O    . VAL A 1 7  ? -0.143  7.442   7.463   1.00 1.14 ? 7  VAL A O    20 
ATOM   8946  C CB   . VAL A 1 7  ? -1.558  10.262  8.573   1.00 1.64 ? 7  VAL A CB   20 
ATOM   8947  C CG1  . VAL A 1 7  ? -2.615  10.781  7.597   1.00 1.83 ? 7  VAL A CG1  20 
ATOM   8948  C CG2  . VAL A 1 7  ? -1.743  10.958  9.926   1.00 1.83 ? 7  VAL A CG2  20 
ATOM   8949  H H    . VAL A 1 7  ? 0.089   8.669   9.913   1.00 1.50 ? 7  VAL A H    20 
ATOM   8950  H HA   . VAL A 1 7  ? -2.737  8.492   8.944   1.00 1.38 ? 7  VAL A HA   20 
ATOM   8951  H HB   . VAL A 1 7  ? -0.574  10.482  8.184   1.00 1.66 ? 7  VAL A HB   20 
ATOM   8952  H HG11 . VAL A 1 7  ? -3.540  10.241  7.744   1.00 2.01 ? 7  VAL A HG11 20 
ATOM   8953  H HG12 . VAL A 1 7  ? -2.783  11.834  7.773   1.00 2.17 ? 7  VAL A HG12 20 
ATOM   8954  H HG13 . VAL A 1 7  ? -2.272  10.637  6.583   1.00 1.97 ? 7  VAL A HG13 20 
ATOM   8955  H HG21 . VAL A 1 7  ? -2.560  10.495  10.461  1.00 1.45 ? 7  VAL A HG21 20 
ATOM   8956  H HG22 . VAL A 1 7  ? -0.835  10.866  10.505  1.00 2.49 ? 7  VAL A HG22 20 
ATOM   8957  H HG23 . VAL A 1 7  ? -1.963  12.003  9.766   1.00 2.23 ? 7  VAL A HG23 20 
HETATM 8958  N N    . SEP A 1 8  ? -2.001  8.040   6.438   1.00 1.31 ? 8  SEP A N    20 
HETATM 8959  C CA   . SEP A 1 8  ? -1.597  7.361   5.162   1.00 1.23 ? 8  SEP A CA   20 
HETATM 8960  C CB   . SEP A 1 8  ? -2.677  7.737   4.145   1.00 1.29 ? 8  SEP A CB   20 
HETATM 8961  O OG   . SEP A 1 8  ? -3.739  6.778   4.207   1.00 1.34 ? 8  SEP A OG   20 
HETATM 8962  C C    . SEP A 1 8  ? -0.222  7.857   4.699   1.00 1.20 ? 8  SEP A C    20 
HETATM 8963  O O    . SEP A 1 8  ? 0.591   7.085   4.233   1.00 1.14 ? 8  SEP A O    20 
HETATM 8964  P P    . SEP A 1 8  ? -5.206  7.208   4.718   1.00 1.41 ? 8  SEP A P    20 
HETATM 8965  O O1P  . SEP A 1 8  ? -5.084  7.706   6.106   1.00 1.64 ? 8  SEP A O1P  20 
HETATM 8966  O O2P  . SEP A 1 8  ? -5.825  8.060   3.678   1.00 2.45 ? 8  SEP A O2P  20 
HETATM 8967  O O3P  . SEP A 1 8  ? -5.992  5.805   4.752   1.00 1.91 ? 8  SEP A O3P  20 
HETATM 8968  H H    . SEP A 1 8  ? -2.853  8.514   6.490   1.00 1.45 ? 8  SEP A H    20 
HETATM 8969  H HA   . SEP A 1 8  ? -1.580  6.295   5.299   1.00 1.23 ? 8  SEP A HA   20 
HETATM 8970  H HB2  . SEP A 1 8  ? -2.246  7.749   3.153   1.00 1.28 ? 8  SEP A HB2  20 
HETATM 8971  H HB3  . SEP A 1 8  ? -3.066  8.716   4.374   1.00 1.37 ? 8  SEP A HB3  20 
HETATM 8972  H HOP3 . SEP A 1 8  ? -6.874  5.982   5.084   1.00 2.08 ? 8  SEP A HOP3 20 
ATOM   8973  N N    . SER A 1 9  ? 0.032   9.140   4.847   1.00 1.28 ? 9  SER A N    20 
ATOM   8974  C CA   . SER A 1 9  ? 1.347   9.741   4.446   1.00 1.31 ? 9  SER A CA   20 
ATOM   8975  C C    . SER A 1 9  ? 1.565   9.670   2.931   1.00 1.21 ? 9  SER A C    20 
ATOM   8976  O O    . SER A 1 9  ? 1.430   8.630   2.327   1.00 1.07 ? 9  SER A O    20 
ATOM   8977  C CB   . SER A 1 9  ? 2.423   8.932   5.170   1.00 1.32 ? 9  SER A CB   20 
ATOM   8978  O OG   . SER A 1 9  ? 2.177   8.959   6.573   1.00 1.51 ? 9  SER A OG   20 
ATOM   8979  H H    . SER A 1 9  ? -0.650  9.715   5.237   1.00 1.36 ? 9  SER A H    20 
ATOM   8980  H HA   . SER A 1 9  ? 1.393   10.768  4.772   1.00 1.45 ? 9  SER A HA   20 
ATOM   8981  H HB2  . SER A 1 9  ? 2.403   7.913   4.823   1.00 1.23 ? 9  SER A HB2  20 
ATOM   8982  H HB3  . SER A 1 9  ? 3.392   9.362   4.956   1.00 1.37 ? 9  SER A HB3  20 
ATOM   8983  H HG   . SER A 1 9  ? 1.565   8.245   6.784   1.00 1.69 ? 9  SER A HG   20 
ATOM   8984  N N    . TYR A 1 10 ? 1.929   10.784  2.337   1.00 1.31 ? 10 TYR A N    20 
ATOM   8985  C CA   . TYR A 1 10 ? 2.206   10.860  0.861   1.00 1.27 ? 10 TYR A CA   20 
ATOM   8986  C C    . TYR A 1 10 ? 1.099   10.190  0.009   1.00 1.13 ? 10 TYR A C    20 
ATOM   8987  O O    . TYR A 1 10 ? 0.123   9.672   0.517   1.00 1.14 ? 10 TYR A O    20 
ATOM   8988  C CB   . TYR A 1 10 ? 3.597   10.195  0.704   1.00 1.25 ? 10 TYR A CB   20 
ATOM   8989  C CG   . TYR A 1 10 ? 3.527   8.859   -0.003  1.00 1.05 ? 10 TYR A CG   20 
ATOM   8990  C CD1  . TYR A 1 10 ? 3.337   7.684   0.730   1.00 1.01 ? 10 TYR A CD1  20 
ATOM   8991  C CD2  . TYR A 1 10 ? 3.673   8.802   -1.391  1.00 0.94 ? 10 TYR A CD2  20 
ATOM   8992  C CE1  . TYR A 1 10 ? 3.284   6.450   0.073   1.00 0.88 ? 10 TYR A CE1  20 
ATOM   8993  C CE2  . TYR A 1 10 ? 3.624   7.570   -2.051  1.00 0.81 ? 10 TYR A CE2  20 
ATOM   8994  C CZ   . TYR A 1 10 ? 3.427   6.392   -1.319  1.00 0.80 ? 10 TYR A CZ   20 
ATOM   8995  O OH   . TYR A 1 10 ? 3.375   5.175   -1.968  1.00 0.79 ? 10 TYR A OH   20 
ATOM   8996  H H    . TYR A 1 10 ? 2.044   11.588  2.878   1.00 1.45 ? 10 TYR A H    20 
ATOM   8997  H HA   . TYR A 1 10 ? 2.286   11.895  0.571   1.00 1.43 ? 10 TYR A HA   20 
ATOM   8998  H HB2  . TYR A 1 10 ? 4.236   10.852  0.137   1.00 1.32 ? 10 TYR A HB2  20 
ATOM   8999  H HB3  . TYR A 1 10 ? 4.027   10.050  1.684   1.00 1.36 ? 10 TYR A HB3  20 
ATOM   9000  H HD1  . TYR A 1 10 ? 3.227   7.731   1.806   1.00 1.11 ? 10 TYR A HD1  20 
ATOM   9001  H HD2  . TYR A 1 10 ? 3.819   9.713   -1.952  1.00 1.01 ? 10 TYR A HD2  20 
ATOM   9002  H HE1  . TYR A 1 10 ? 3.132   5.545   0.638   1.00 0.91 ? 10 TYR A HE1  20 
ATOM   9003  H HE2  . TYR A 1 10 ? 3.737   7.527   -3.124  1.00 0.78 ? 10 TYR A HE2  20 
ATOM   9004  H HH   . TYR A 1 10 ? 2.660   4.663   -1.582  1.00 0.88 ? 10 TYR A HH   20 
ATOM   9005  N N    . ARG A 1 11 ? 1.244   10.229  -1.292  1.00 1.06 ? 11 ARG A N    20 
ATOM   9006  C CA   . ARG A 1 11 ? 0.220   9.615   -2.197  1.00 1.01 ? 11 ARG A CA   20 
ATOM   9007  C C    . ARG A 1 11 ? 0.288   8.080   -2.116  1.00 0.85 ? 11 ARG A C    20 
ATOM   9008  O O    . ARG A 1 11 ? 0.727   7.522   -1.131  1.00 0.82 ? 11 ARG A O    20 
ATOM   9009  C CB   . ARG A 1 11 ? 0.607   10.110  -3.598  1.00 1.01 ? 11 ARG A CB   20 
ATOM   9010  C CG   . ARG A 1 11 ? -0.499  11.010  -4.150  1.00 1.25 ? 11 ARG A CG   20 
ATOM   9011  C CD   . ARG A 1 11 ? -1.252  10.273  -5.260  1.00 1.42 ? 11 ARG A CD   20 
ATOM   9012  N NE   . ARG A 1 11 ? -2.157  11.297  -5.853  1.00 1.95 ? 11 ARG A NE   20 
ATOM   9013  C CZ   . ARG A 1 11 ? -3.428  11.286  -5.574  1.00 2.24 ? 11 ARG A CZ   20 
ATOM   9014  N NH1  . ARG A 1 11 ? -4.241  10.548  -6.273  1.00 2.22 ? 11 ARG A NH1  20 
ATOM   9015  N NH2  . ARG A 1 11 ? -3.883  12.015  -4.597  1.00 2.91 ? 11 ARG A NH2  20 
ATOM   9016  H H    . ARG A 1 11 ? 2.027   10.672  -1.678  1.00 1.08 ? 11 ARG A H    20 
ATOM   9017  H HA   . ARG A 1 11 ? -0.765  9.959   -1.943  1.00 1.14 ? 11 ARG A HA   20 
ATOM   9018  H HB2  . ARG A 1 11 ? 1.529   10.670  -3.539  1.00 0.99 ? 11 ARG A HB2  20 
ATOM   9019  H HB3  . ARG A 1 11 ? 0.744   9.267   -4.253  1.00 0.94 ? 11 ARG A HB3  20 
ATOM   9020  H HG2  . ARG A 1 11 ? -1.184  11.266  -3.355  1.00 1.41 ? 11 ARG A HG2  20 
ATOM   9021  H HG3  . ARG A 1 11 ? -0.060  11.911  -4.551  1.00 1.31 ? 11 ARG A HG3  20 
ATOM   9022  H HD2  . ARG A 1 11 ? -0.557  9.902   -6.002  1.00 1.64 ? 11 ARG A HD2  20 
ATOM   9023  H HD3  . ARG A 1 11 ? -1.831  9.460   -4.847  1.00 1.58 ? 11 ARG A HD3  20 
ATOM   9024  H HE   . ARG A 1 11 ? -1.796  11.980  -6.457  1.00 2.40 ? 11 ARG A HE   20 
ATOM   9025  H HH11 . ARG A 1 11 ? -3.887  9.990   -7.022  1.00 2.11 ? 11 ARG A HH11 20 
ATOM   9026  H HH12 . ARG A 1 11 ? -5.217  10.537  -6.060  1.00 2.59 ? 11 ARG A HH12 20 
ATOM   9027  H HH21 . ARG A 1 11 ? -3.254  12.581  -4.063  1.00 3.16 ? 11 ARG A HH21 20 
ATOM   9028  H HH22 . ARG A 1 11 ? -4.857  12.011  -4.380  1.00 3.34 ? 11 ARG A HH22 20 
ATOM   9029  N N    . GLY A 1 12 ? -0.121  7.392   -3.152  1.00 0.83 ? 12 GLY A N    20 
ATOM   9030  C CA   . GLY A 1 12 ? -0.050  5.900   -3.137  1.00 0.80 ? 12 GLY A CA   20 
ATOM   9031  C C    . GLY A 1 12 ? 0.951   5.454   -4.202  1.00 0.75 ? 12 GLY A C    20 
ATOM   9032  O O    . GLY A 1 12 ? 0.896   4.346   -4.698  1.00 0.83 ? 12 GLY A O    20 
ATOM   9033  H H    . GLY A 1 12 ? -0.454  7.854   -3.951  1.00 0.91 ? 12 GLY A H    20 
ATOM   9034  H HA2  . GLY A 1 12 ? 0.278   5.561   -2.165  1.00 0.77 ? 12 GLY A HA2  20 
ATOM   9035  H HA3  . GLY A 1 12 ? -1.020  5.486   -3.362  1.00 0.92 ? 12 GLY A HA3  20 
ATOM   9036  N N    . ARG A 1 13 ? 1.855   6.329   -4.560  1.00 0.71 ? 13 ARG A N    20 
ATOM   9037  C CA   . ARG A 1 13 ? 2.864   6.003   -5.600  1.00 0.73 ? 13 ARG A CA   20 
ATOM   9038  C C    . ARG A 1 13 ? 4.284   6.057   -5.010  1.00 0.75 ? 13 ARG A C    20 
ATOM   9039  O O    . ARG A 1 13 ? 4.984   7.049   -5.120  1.00 0.82 ? 13 ARG A O    20 
ATOM   9040  C CB   . ARG A 1 13 ? 2.644   7.066   -6.687  1.00 0.80 ? 13 ARG A CB   20 
ATOM   9041  C CG   . ARG A 1 13 ? 2.739   8.484   -6.099  1.00 0.85 ? 13 ARG A CG   20 
ATOM   9042  C CD   . ARG A 1 13 ? 2.718   9.522   -7.230  1.00 0.98 ? 13 ARG A CD   20 
ATOM   9043  N NE   . ARG A 1 13 ? 3.838   9.140   -8.141  1.00 1.01 ? 13 ARG A NE   20 
ATOM   9044  C CZ   . ARG A 1 13 ? 5.057   9.521   -7.882  1.00 1.18 ? 13 ARG A CZ   20 
ATOM   9045  N NH1  . ARG A 1 13 ? 5.752   8.897   -6.975  1.00 1.20 ? 13 ARG A NH1  20 
ATOM   9046  N NH2  . ARG A 1 13 ? 5.577   10.521  -8.531  1.00 1.52 ? 13 ARG A NH2  20 
ATOM   9047  H H    . ARG A 1 13 ? 1.863   7.213   -4.146  1.00 0.73 ? 13 ARG A H    20 
ATOM   9048  H HA   . ARG A 1 13 ? 2.672   5.023   -6.005  1.00 0.79 ? 13 ARG A HA   20 
ATOM   9049  H HB2  . ARG A 1 13 ? 3.389   6.949   -7.450  1.00 0.84 ? 13 ARG A HB2  20 
ATOM   9050  H HB3  . ARG A 1 13 ? 1.664   6.930   -7.120  1.00 0.88 ? 13 ARG A HB3  20 
ATOM   9051  H HG2  . ARG A 1 13 ? 1.899   8.655   -5.443  1.00 0.97 ? 13 ARG A HG2  20 
ATOM   9052  H HG3  . ARG A 1 13 ? 3.655   8.586   -5.539  1.00 0.89 ? 13 ARG A HG3  20 
ATOM   9053  H HD2  . ARG A 1 13 ? 1.772   9.482   -7.754  1.00 1.18 ? 13 ARG A HD2  20 
ATOM   9054  H HD3  . ARG A 1 13 ? 2.885   10.513  -6.833  1.00 1.19 ? 13 ARG A HD3  20 
ATOM   9055  H HE   . ARG A 1 13 ? 3.657   8.599   -8.939  1.00 1.12 ? 13 ARG A HE   20 
ATOM   9056  H HH11 . ARG A 1 13 ? 5.349   8.129   -6.477  1.00 1.05 ? 13 ARG A HH11 20 
ATOM   9057  H HH12 . ARG A 1 13 ? 6.693   9.181   -6.778  1.00 1.48 ? 13 ARG A HH12 20 
ATOM   9058  H HH21 . ARG A 1 13 ? 5.040   10.998  -9.227  1.00 1.59 ? 13 ARG A HH21 20 
ATOM   9059  H HH22 . ARG A 1 13 ? 6.513   10.814  -8.336  1.00 1.78 ? 13 ARG A HH22 20 
ATOM   9060  N N    . LYS A 1 14 ? 4.701   4.991   -4.371  1.00 0.78 ? 14 LYS A N    20 
ATOM   9061  C CA   . LYS A 1 14 ? 6.065   4.945   -3.742  1.00 0.92 ? 14 LYS A CA   20 
ATOM   9062  C C    . LYS A 1 14 ? 7.182   4.965   -4.803  1.00 1.00 ? 14 LYS A C    20 
ATOM   9063  O O    . LYS A 1 14 ? 7.939   4.021   -4.950  1.00 1.12 ? 14 LYS A O    20 
ATOM   9064  C CB   . LYS A 1 14 ? 6.102   3.640   -2.924  1.00 0.97 ? 14 LYS A CB   20 
ATOM   9065  C CG   . LYS A 1 14 ? 5.593   2.440   -3.753  1.00 0.95 ? 14 LYS A CG   20 
ATOM   9066  C CD   . LYS A 1 14 ? 6.752   1.514   -4.161  1.00 1.06 ? 14 LYS A CD   20 
ATOM   9067  C CE   . LYS A 1 14 ? 7.755   1.350   -3.009  1.00 1.19 ? 14 LYS A CE   20 
ATOM   9068  N NZ   . LYS A 1 14 ? 8.950   2.149   -3.416  1.00 1.11 ? 14 LYS A NZ   20 
ATOM   9069  H H    . LYS A 1 14 ? 4.107   4.221   -4.289  1.00 0.76 ? 14 LYS A H    20 
ATOM   9070  H HA   . LYS A 1 14 ? 6.185   5.786   -3.077  1.00 1.01 ? 14 LYS A HA   20 
ATOM   9071  H HB2  . LYS A 1 14 ? 7.112   3.455   -2.610  1.00 1.08 ? 14 LYS A HB2  20 
ATOM   9072  H HB3  . LYS A 1 14 ? 5.477   3.755   -2.050  1.00 0.99 ? 14 LYS A HB3  20 
ATOM   9073  H HG2  . LYS A 1 14 ? 4.884   1.878   -3.164  1.00 1.01 ? 14 LYS A HG2  20 
ATOM   9074  H HG3  . LYS A 1 14 ? 5.104   2.802   -4.644  1.00 0.93 ? 14 LYS A HG3  20 
ATOM   9075  H HD2  . LYS A 1 14 ? 6.353   0.546   -4.425  1.00 1.15 ? 14 LYS A HD2  20 
ATOM   9076  H HD3  . LYS A 1 14 ? 7.257   1.934   -5.018  1.00 1.07 ? 14 LYS A HD3  20 
ATOM   9077  H HE2  . LYS A 1 14 ? 7.336   1.734   -2.088  1.00 1.27 ? 14 LYS A HE2  20 
ATOM   9078  H HE3  . LYS A 1 14 ? 8.026   0.312   -2.894  1.00 1.37 ? 14 LYS A HE3  20 
ATOM   9079  H HZ1  . LYS A 1 14 ? 8.666   2.887   -4.100  1.00 1.12 ? 14 LYS A HZ1  20 
ATOM   9080  H HZ2  . LYS A 1 14 ? 9.371   2.604   -2.577  1.00 1.19 ? 14 LYS A HZ2  20 
ATOM   9081  H HZ3  . LYS A 1 14 ? 9.656   1.519   -3.861  1.00 1.10 ? 14 LYS A HZ3  20 
ATOM   9082  N N    . SER A 1 15 ? 7.300   6.048   -5.527  1.00 1.00 ? 15 SER A N    20 
ATOM   9083  C CA   . SER A 1 15 ? 8.368   6.159   -6.568  1.00 1.14 ? 15 SER A CA   20 
ATOM   9084  C C    . SER A 1 15 ? 8.994   7.559   -6.530  1.00 1.23 ? 15 SER A C    20 
ATOM   9085  O O    . SER A 1 15 ? 8.301   8.556   -6.442  1.00 1.37 ? 15 SER A O    20 
ATOM   9086  C CB   . SER A 1 15 ? 7.658   5.924   -7.900  1.00 1.17 ? 15 SER A CB   20 
ATOM   9087  O OG   . SER A 1 15 ? 8.627   5.609   -8.893  1.00 1.41 ? 15 SER A OG   20 
ATOM   9088  H H    . SER A 1 15 ? 6.687   6.799   -5.376  1.00 0.93 ? 15 SER A H    20 
ATOM   9089  H HA   . SER A 1 15 ? 9.124   5.404   -6.415  1.00 1.21 ? 15 SER A HA   20 
ATOM   9090  H HB2  . SER A 1 15 ? 6.968   5.101   -7.803  1.00 1.17 ? 15 SER A HB2  20 
ATOM   9091  H HB3  . SER A 1 15 ? 7.114   6.817   -8.181  1.00 1.20 ? 15 SER A HB3  20 
ATOM   9092  H HG   . SER A 1 15 ? 8.206   5.678   -9.754  1.00 1.64 ? 15 SER A HG   20 
ATOM   9093  N N    . GLY A 1 16 ? 10.301  7.639   -6.593  1.00 1.31 ? 16 GLY A N    20 
ATOM   9094  C CA   . GLY A 1 16 ? 10.983  8.971   -6.557  1.00 1.44 ? 16 GLY A CA   20 
ATOM   9095  C C    . GLY A 1 16 ? 11.079  9.465   -5.109  1.00 1.41 ? 16 GLY A C    20 
ATOM   9096  O O    . GLY A 1 16 ? 10.846  10.624  -4.825  1.00 1.58 ? 16 GLY A O    20 
ATOM   9097  H H    . GLY A 1 16 ? 10.837  6.820   -6.661  1.00 1.38 ? 16 GLY A H    20 
ATOM   9098  H HA2  . GLY A 1 16 ? 11.976  8.878   -6.972  1.00 1.43 ? 16 GLY A HA2  20 
ATOM   9099  H HA3  . GLY A 1 16 ? 10.414  9.682   -7.137  1.00 1.60 ? 16 GLY A HA3  20 
ATOM   9100  N N    . ASN A 1 17 ? 11.421  8.592   -4.194  1.00 1.26 ? 17 ASN A N    20 
ATOM   9101  C CA   . ASN A 1 17 ? 11.537  8.997   -2.759  1.00 1.31 ? 17 ASN A CA   20 
ATOM   9102  C C    . ASN A 1 17 ? 12.679  8.220   -2.086  1.00 1.16 ? 17 ASN A C    20 
ATOM   9103  O O    . ASN A 1 17 ? 13.443  7.539   -2.745  1.00 1.06 ? 17 ASN A O    20 
ATOM   9104  C CB   . ASN A 1 17 ? 10.184  8.627   -2.141  1.00 1.41 ? 17 ASN A CB   20 
ATOM   9105  C CG   . ASN A 1 17 ? 9.844   9.611   -1.017  1.00 1.59 ? 17 ASN A CG   20 
ATOM   9106  O OD1  . ASN A 1 17 ? 10.463  9.594   0.027   1.00 1.63 ? 17 ASN A OD1  20 
ATOM   9107  N ND2  . ASN A 1 17 ? 8.880   10.472  -1.188  1.00 1.86 ? 17 ASN A ND2  20 
ATOM   9108  H H    . ASN A 1 17 ? 11.603  7.664   -4.452  1.00 1.17 ? 17 ASN A H    20 
ATOM   9109  H HA   . ASN A 1 17 ? 11.705  10.061  -2.678  1.00 1.44 ? 17 ASN A HA   20 
ATOM   9110  H HB2  . ASN A 1 17 ? 9.418   8.672   -2.901  1.00 1.47 ? 17 ASN A HB2  20 
ATOM   9111  H HB3  . ASN A 1 17 ? 10.234  7.627   -1.739  1.00 1.33 ? 17 ASN A HB3  20 
ATOM   9112  H HD21 . ASN A 1 17 ? 8.379   10.488  -2.030  1.00 2.01 ? 17 ASN A HD21 20 
ATOM   9113  H HD22 . ASN A 1 17 ? 8.657   11.103  -0.472  1.00 1.99 ? 17 ASN A HD22 20 
ATOM   9114  N N    . LYS A 1 18 ? 12.800  8.309   -0.781  1.00 1.24 ? 18 LYS A N    20 
ATOM   9115  C CA   . LYS A 1 18 ? 13.894  7.568   -0.075  1.00 1.18 ? 18 LYS A CA   20 
ATOM   9116  C C    . LYS A 1 18 ? 13.700  6.045   -0.224  1.00 1.10 ? 18 LYS A C    20 
ATOM   9117  O O    . LYS A 1 18 ? 14.674  5.317   -0.307  1.00 1.08 ? 18 LYS A O    20 
ATOM   9118  C CB   . LYS A 1 18 ? 13.803  8.017   1.399   1.00 1.39 ? 18 LYS A CB   20 
ATOM   9119  C CG   . LYS A 1 18 ? 14.070  6.840   2.352   1.00 1.49 ? 18 LYS A CG   20 
ATOM   9120  C CD   . LYS A 1 18 ? 15.560  6.473   2.331   1.00 1.47 ? 18 LYS A CD   20 
ATOM   9121  C CE   . LYS A 1 18 ? 15.749  5.044   2.866   1.00 1.56 ? 18 LYS A CE   20 
ATOM   9122  N NZ   . LYS A 1 18 ? 15.776  4.156   1.662   1.00 1.38 ? 18 LYS A NZ   20 
ATOM   9123  H H    . LYS A 1 18 ? 12.173  8.861   -0.267  1.00 1.39 ? 18 LYS A H    20 
ATOM   9124  H HA   . LYS A 1 18 ? 14.852  7.854   -0.480  1.00 1.13 ? 18 LYS A HA   20 
ATOM   9125  H HB2  . LYS A 1 18 ? 14.535  8.791   1.579   1.00 1.41 ? 18 LYS A HB2  20 
ATOM   9126  H HB3  . LYS A 1 18 ? 12.816  8.411   1.593   1.00 1.52 ? 18 LYS A HB3  20 
ATOM   9127  H HG2  . LYS A 1 18 ? 13.785  7.125   3.355   1.00 1.68 ? 18 LYS A HG2  20 
ATOM   9128  H HG3  . LYS A 1 18 ? 13.486  5.987   2.044   1.00 1.46 ? 18 LYS A HG3  20 
ATOM   9129  H HD2  . LYS A 1 18 ? 15.932  6.533   1.318   1.00 1.33 ? 18 LYS A HD2  20 
ATOM   9130  H HD3  . LYS A 1 18 ? 16.109  7.163   2.955   1.00 1.60 ? 18 LYS A HD3  20 
ATOM   9131  H HE2  . LYS A 1 18 ? 16.683  4.972   3.407   1.00 1.72 ? 18 LYS A HE2  20 
ATOM   9132  H HE3  . LYS A 1 18 ? 14.923  4.773   3.507   1.00 1.68 ? 18 LYS A HE3  20 
ATOM   9133  H HZ1  . LYS A 1 18 ? 15.556  4.710   0.803   1.00 1.25 ? 18 LYS A HZ1  20 
ATOM   9134  H HZ2  . LYS A 1 18 ? 16.725  3.725   1.566   1.00 1.39 ? 18 LYS A HZ2  20 
ATOM   9135  H HZ3  . LYS A 1 18 ? 15.065  3.396   1.769   1.00 1.45 ? 18 LYS A HZ3  20 
ATOM   9136  N N    . PRO A 1 19 ? 12.455  5.605   -0.261  1.00 1.15 ? 19 PRO A N    20 
ATOM   9137  C CA   . PRO A 1 19 ? 12.232  4.141   -0.412  1.00 1.14 ? 19 PRO A CA   20 
ATOM   9138  C C    . PRO A 1 19 ? 11.632  3.811   -1.792  1.00 1.03 ? 19 PRO A C    20 
ATOM   9139  O O    . PRO A 1 19 ? 10.429  3.663   -1.925  1.00 1.10 ? 19 PRO A O    20 
ATOM   9140  C CB   . PRO A 1 19 ? 11.251  3.797   0.705   1.00 1.37 ? 19 PRO A CB   20 
ATOM   9141  C CG   . PRO A 1 19 ? 10.513  5.063   0.991   1.00 1.47 ? 19 PRO A CG   20 
ATOM   9142  C CD   . PRO A 1 19 ? 11.375  6.215   0.540   1.00 1.35 ? 19 PRO A CD   20 
ATOM   9143  H HA   . PRO A 1 19 ? 13.155  3.603   -0.265  1.00 1.14 ? 19 PRO A HA   20 
ATOM   9144  H HB2  . PRO A 1 19 ? 10.566  3.027   0.377   1.00 1.39 ? 19 PRO A HB2  20 
ATOM   9145  H HB3  . PRO A 1 19 ? 11.784  3.475   1.587   1.00 1.48 ? 19 PRO A HB3  20 
ATOM   9146  H HG2  . PRO A 1 19 ? 9.577   5.070   0.449   1.00 1.51 ? 19 PRO A HG2  20 
ATOM   9147  H HG3  . PRO A 1 19 ? 10.324  5.146   2.050   1.00 1.66 ? 19 PRO A HG3  20 
ATOM   9148  H HD2  . PRO A 1 19 ? 10.796  6.898   -0.065  1.00 1.38 ? 19 PRO A HD2  20 
ATOM   9149  H HD3  . PRO A 1 19 ? 11.789  6.727   1.393   1.00 1.48 ? 19 PRO A HD3  20 
ATOM   9150  N N    . PRO A 1 20 ? 12.496  3.687   -2.779  1.00 0.95 ? 20 PRO A N    20 
ATOM   9151  C CA   . PRO A 1 20 ? 11.986  3.352   -4.136  1.00 0.93 ? 20 PRO A CA   20 
ATOM   9152  C C    . PRO A 1 20 ? 12.106  1.840   -4.397  1.00 0.98 ? 20 PRO A C    20 
ATOM   9153  O O    . PRO A 1 20 ? 11.112  1.139   -4.451  1.00 1.09 ? 20 PRO A O    20 
ATOM   9154  C CB   . PRO A 1 20 ? 12.872  4.160   -5.081  1.00 0.98 ? 20 PRO A CB   20 
ATOM   9155  C CG   . PRO A 1 20 ? 14.142  4.394   -4.331  1.00 0.97 ? 20 PRO A CG   20 
ATOM   9156  C CD   . PRO A 1 20 ? 13.815  4.342   -2.860  1.00 0.92 ? 20 PRO A CD   20 
ATOM   9157  H HA   . PRO A 1 20 ? 10.960  3.668   -4.239  1.00 1.02 ? 20 PRO A HA   20 
ATOM   9158  H HB2  . PRO A 1 20 ? 13.066  3.598   -5.986  1.00 1.05 ? 20 PRO A HB2  20 
ATOM   9159  H HB3  . PRO A 1 20 ? 12.406  5.103   -5.318  1.00 1.08 ? 20 PRO A HB3  20 
ATOM   9160  H HG2  . PRO A 1 20 ? 14.862  3.627   -4.578  1.00 1.05 ? 20 PRO A HG2  20 
ATOM   9161  H HG3  . PRO A 1 20 ? 14.540  5.366   -4.578  1.00 1.09 ? 20 PRO A HG3  20 
ATOM   9162  H HD2  . PRO A 1 20 ? 14.559  3.762   -2.331  1.00 1.01 ? 20 PRO A HD2  20 
ATOM   9163  H HD3  . PRO A 1 20 ? 13.757  5.339   -2.456  1.00 0.97 ? 20 PRO A HD3  20 
ATOM   9164  N N    . SER A 1 21 ? 13.305  1.332   -4.553  1.00 1.07 ? 21 SER A N    20 
ATOM   9165  C CA   . SER A 1 21 ? 13.481  -0.132  -4.806  1.00 1.28 ? 21 SER A CA   20 
ATOM   9166  C C    . SER A 1 21 ? 14.427  -0.743  -3.763  1.00 1.42 ? 21 SER A C    20 
ATOM   9167  O O    . SER A 1 21 ? 14.023  -1.546  -2.945  1.00 1.59 ? 21 SER A O    20 
ATOM   9168  C CB   . SER A 1 21 ? 14.083  -0.227  -6.212  1.00 1.40 ? 21 SER A CB   20 
ATOM   9169  O OG   . SER A 1 21 ? 15.317  0.487   -6.252  1.00 1.49 ? 21 SER A OG   20 
ATOM   9170  H H    . SER A 1 21 ? 14.091  1.911   -4.502  1.00 1.10 ? 21 SER A H    20 
ATOM   9171  H HA   . SER A 1 21 ? 12.527  -0.634  -4.782  1.00 1.33 ? 21 SER A HA   20 
ATOM   9172  H HB2  . SER A 1 21 ? 14.263  -1.260  -6.460  1.00 1.62 ? 21 SER A HB2  20 
ATOM   9173  H HB3  . SER A 1 21 ? 13.388  0.195   -6.928  1.00 1.35 ? 21 SER A HB3  20 
ATOM   9174  H HG   . SER A 1 21 ? 15.858  0.109   -6.951  1.00 1.69 ? 21 SER A HG   20 
ATOM   9175  N N    . LYS A 1 22 ? 15.682  -0.365  -3.786  1.00 1.44 ? 22 LYS A N    20 
ATOM   9176  C CA   . LYS A 1 22 ? 16.661  -0.917  -2.799  1.00 1.62 ? 22 LYS A CA   20 
ATOM   9177  C C    . LYS A 1 22 ? 16.542  -0.169  -1.463  1.00 1.50 ? 22 LYS A C    20 
ATOM   9178  O O    . LYS A 1 22 ? 17.419  0.580   -1.074  1.00 1.47 ? 22 LYS A O    20 
ATOM   9179  C CB   . LYS A 1 22 ? 18.037  -0.692  -3.436  1.00 1.75 ? 22 LYS A CB   20 
ATOM   9180  C CG   . LYS A 1 22 ? 19.101  -1.476  -2.659  1.00 1.98 ? 22 LYS A CG   20 
ATOM   9181  C CD   . LYS A 1 22 ? 20.352  -0.606  -2.478  1.00 1.98 ? 22 LYS A CD   20 
ATOM   9182  C CE   . LYS A 1 22 ? 20.616  -0.381  -0.985  1.00 1.91 ? 22 LYS A CE   20 
ATOM   9183  N NZ   . LYS A 1 22 ? 19.907  0.889   -0.652  1.00 1.63 ? 22 LYS A NZ   20 
ATOM   9184  H H    . LYS A 1 22 ? 15.978  0.287   -4.455  1.00 1.38 ? 22 LYS A H    20 
ATOM   9185  H HA   . LYS A 1 22 ? 16.490  -1.971  -2.653  1.00 1.83 ? 22 LYS A HA   20 
ATOM   9186  H HB2  . LYS A 1 22 ? 18.018  -1.032  -4.462  1.00 1.88 ? 22 LYS A HB2  20 
ATOM   9187  H HB3  . LYS A 1 22 ? 18.279  0.361   -3.411  1.00 1.61 ? 22 LYS A HB3  20 
ATOM   9188  H HG2  . LYS A 1 22 ? 18.709  -1.752  -1.689  1.00 1.98 ? 22 LYS A HG2  20 
ATOM   9189  H HG3  . LYS A 1 22 ? 19.363  -2.368  -3.208  1.00 2.25 ? 22 LYS A HG3  20 
ATOM   9190  H HD2  . LYS A 1 22 ? 21.201  -1.105  -2.923  1.00 2.24 ? 22 LYS A HD2  20 
ATOM   9191  H HD3  . LYS A 1 22 ? 20.201  0.347   -2.963  1.00 1.87 ? 22 LYS A HD3  20 
ATOM   9192  H HE2  . LYS A 1 22 ? 20.215  -1.202  -0.406  1.00 2.02 ? 22 LYS A HE2  20 
ATOM   9193  H HE3  . LYS A 1 22 ? 21.674  -0.273  -0.803  1.00 2.04 ? 22 LYS A HE3  20 
ATOM   9194  H HZ1  . LYS A 1 22 ? 18.898  0.808   -0.919  1.00 1.51 ? 22 LYS A HZ1  20 
ATOM   9195  H HZ2  . LYS A 1 22 ? 19.977  1.070   0.377   1.00 1.66 ? 22 LYS A HZ2  20 
ATOM   9196  H HZ3  . LYS A 1 22 ? 20.341  1.679   -1.169  1.00 1.66 ? 22 LYS A HZ3  20 
ATOM   9197  N N    . THR A 1 23 ? 15.458  -0.371  -0.764  1.00 1.51 ? 23 THR A N    20 
ATOM   9198  C CA   . THR A 1 23 ? 15.264  0.321   0.552   1.00 1.54 ? 23 THR A CA   20 
ATOM   9199  C C    . THR A 1 23 ? 14.711  -0.653  1.607   1.00 1.81 ? 23 THR A C    20 
ATOM   9200  O O    . THR A 1 23 ? 14.077  -0.245  2.562   1.00 1.95 ? 23 THR A O    20 
ATOM   9201  C CB   . THR A 1 23 ? 14.258  1.444   0.268   1.00 1.43 ? 23 THR A CB   20 
ATOM   9202  O OG1  . THR A 1 23 ? 14.108  2.251   1.433   1.00 1.52 ? 23 THR A OG1  20 
ATOM   9203  C CG2  . THR A 1 23 ? 12.900  0.849   -0.121  1.00 1.55 ? 23 THR A CG2  20 
ATOM   9204  H H    . THR A 1 23 ? 14.766  -0.978  -1.105  1.00 1.57 ? 23 THR A H    20 
ATOM   9205  H HA   . THR A 1 23 ? 16.196  0.745   0.891   1.00 1.50 ? 23 THR A HA   20 
ATOM   9206  H HB   . THR A 1 23 ? 14.622  2.055   -0.544  1.00 1.29 ? 23 THR A HB   20 
ATOM   9207  H HG1  . THR A 1 23 ? 13.744  1.697   2.134   1.00 1.73 ? 23 THR A HG1  20 
ATOM   9208  H HG21 . THR A 1 23 ? 13.034  0.141   -0.926  1.00 1.92 ? 23 THR A HG21 20 
ATOM   9209  H HG22 . THR A 1 23 ? 12.470  0.345   0.732   1.00 1.71 ? 23 THR A HG22 20 
ATOM   9210  H HG23 . THR A 1 23 ? 12.238  1.637   -0.443  1.00 2.01 ? 23 THR A HG23 20 
ATOM   9211  N N    . CYS A 1 24 ? 14.952  -1.933  1.448   1.00 1.97 ? 24 CYS A N    20 
ATOM   9212  C CA   . CYS A 1 24 ? 14.445  -2.927  2.444   1.00 2.28 ? 24 CYS A CA   20 
ATOM   9213  C C    . CYS A 1 24 ? 15.597  -3.447  3.322   1.00 2.27 ? 24 CYS A C    20 
ATOM   9214  O O    . CYS A 1 24 ? 15.550  -4.552  3.828   1.00 2.41 ? 24 CYS A O    20 
ATOM   9215  C CB   . CYS A 1 24 ? 13.851  -4.060  1.602   1.00 2.53 ? 24 CYS A CB   20 
ATOM   9216  S SG   . CYS A 1 24 ? 12.285  -3.518  0.874   1.00 3.13 ? 24 CYS A SG   20 
ATOM   9217  H H    . CYS A 1 24 ? 15.469  -2.240  0.675   1.00 1.94 ? 24 CYS A H    20 
ATOM   9218  H HA   . CYS A 1 24 ? 13.677  -2.485  3.057   1.00 2.39 ? 24 CYS A HA   20 
ATOM   9219  H HB2  . CYS A 1 24 ? 14.542  -4.325  0.814   1.00 2.57 ? 24 CYS A HB2  20 
ATOM   9220  H HB3  . CYS A 1 24 ? 13.677  -4.922  2.230   1.00 2.65 ? 24 CYS A HB3  20 
ATOM   9221  H HG   . CYS A 1 24 ? 11.623  -3.509  1.569   1.00 3.26 ? 24 CYS A HG   20 
ATOM   9222  N N    . LEU A 1 25 ? 16.625  -2.655  3.509   1.00 2.23 ? 25 LEU A N    20 
ATOM   9223  C CA   . LEU A 1 25 ? 17.781  -3.092  4.352   1.00 2.26 ? 25 LEU A CA   20 
ATOM   9224  C C    . LEU A 1 25 ? 18.166  -1.978  5.335   1.00 2.15 ? 25 LEU A C    20 
ATOM   9225  O O    . LEU A 1 25 ? 17.545  -0.932  5.375   1.00 2.12 ? 25 LEU A O    20 
ATOM   9226  C CB   . LEU A 1 25 ? 18.921  -3.352  3.360   1.00 2.20 ? 25 LEU A CB   20 
ATOM   9227  C CG   . LEU A 1 25 ? 18.562  -4.533  2.451   1.00 2.49 ? 25 LEU A CG   20 
ATOM   9228  C CD1  . LEU A 1 25 ? 18.301  -4.028  1.032   1.00 2.53 ? 25 LEU A CD1  20 
ATOM   9229  C CD2  . LEU A 1 25 ? 19.722  -5.530  2.428   1.00 2.87 ? 25 LEU A CD2  20 
ATOM   9230  H H    . LEU A 1 25 ? 16.639  -1.768  3.094   1.00 2.25 ? 25 LEU A H    20 
ATOM   9231  H HA   . LEU A 1 25 ? 17.541  -3.999  4.885   1.00 2.50 ? 25 LEU A HA   20 
ATOM   9232  H HB2  . LEU A 1 25 ? 19.078  -2.469  2.757   1.00 2.03 ? 25 LEU A HB2  20 
ATOM   9233  H HB3  . LEU A 1 25 ? 19.825  -3.581  3.902   1.00 2.25 ? 25 LEU A HB3  20 
ATOM   9234  H HG   . LEU A 1 25 ? 17.674  -5.020  2.829   1.00 2.62 ? 25 LEU A HG   20 
ATOM   9235  H HD11 . LEU A 1 25 ? 17.523  -3.280  1.053   1.00 2.66 ? 25 LEU A HD11 20 
ATOM   9236  H HD12 . LEU A 1 25 ? 19.206  -3.597  0.632   1.00 2.83 ? 25 LEU A HD12 20 
ATOM   9237  H HD13 . LEU A 1 25 ? 17.990  -4.854  0.409   1.00 2.79 ? 25 LEU A HD13 20 
ATOM   9238  H HD21 . LEU A 1 25 ? 20.653  -4.997  2.304   1.00 3.21 ? 25 LEU A HD21 20 
ATOM   9239  H HD22 . LEU A 1 25 ? 19.742  -6.080  3.357   1.00 3.03 ? 25 LEU A HD22 20 
ATOM   9240  H HD23 . LEU A 1 25 ? 19.588  -6.217  1.606   1.00 3.14 ? 25 LEU A HD23 20 
ATOM   9241  N N    . LYS A 1 26 ? 19.189  -2.192  6.127   1.00 2.17 ? 26 LYS A N    20 
ATOM   9242  C CA   . LYS A 1 26 ? 19.617  -1.141  7.104   1.00 2.16 ? 26 LYS A CA   20 
ATOM   9243  C C    . LYS A 1 26 ? 20.238  0.050   6.361   1.00 1.88 ? 26 LYS A C    20 
ATOM   9244  O O    . LYS A 1 26 ? 21.427  0.082   6.100   1.00 1.81 ? 26 LYS A O    20 
ATOM   9245  C CB   . LYS A 1 26 ? 20.657  -1.821  8.001   1.00 2.35 ? 26 LYS A CB   20 
ATOM   9246  C CG   . LYS A 1 26 ? 20.020  -2.179  9.345   1.00 2.72 ? 26 LYS A CG   20 
ATOM   9247  C CD   . LYS A 1 26 ? 20.772  -3.359  9.965   1.00 2.90 ? 26 LYS A CD   20 
ATOM   9248  C CE   . LYS A 1 26 ? 21.082  -3.059  11.436  1.00 3.11 ? 26 LYS A CE   20 
ATOM   9249  N NZ   . LYS A 1 26 ? 22.479  -2.534  11.444  1.00 2.99 ? 26 LYS A NZ   20 
ATOM   9250  H H    . LYS A 1 26 ? 19.677  -3.041  6.079   1.00 2.25 ? 26 LYS A H    20 
ATOM   9251  H HA   . LYS A 1 26 ? 18.776  -0.815  7.696   1.00 2.33 ? 26 LYS A HA   20 
ATOM   9252  H HB2  . LYS A 1 26 ? 21.016  -2.720  7.520   1.00 2.31 ? 26 LYS A HB2  20 
ATOM   9253  H HB3  . LYS A 1 26 ? 21.485  -1.147  8.167   1.00 2.41 ? 26 LYS A HB3  20 
ATOM   9254  H HG2  . LYS A 1 26 ? 20.073  -1.325  10.007  1.00 2.94 ? 26 LYS A HG2  20 
ATOM   9255  H HG3  . LYS A 1 26 ? 18.987  -2.453  9.193   1.00 2.76 ? 26 LYS A HG3  20 
ATOM   9256  H HD2  . LYS A 1 26 ? 20.161  -4.247  9.898   1.00 3.09 ? 26 LYS A HD2  20 
ATOM   9257  H HD3  . LYS A 1 26 ? 21.696  -3.517  9.429   1.00 2.81 ? 26 LYS A HD3  20 
ATOM   9258  H HE2  . LYS A 1 26 ? 20.395  -2.315  11.819  1.00 3.22 ? 26 LYS A HE2  20 
ATOM   9259  H HE3  . LYS A 1 26 ? 21.024  -3.963  12.024  1.00 3.34 ? 26 LYS A HE3  20 
ATOM   9260  H HZ1  . LYS A 1 26 ? 23.118  -3.237  11.021  1.00 2.93 ? 26 LYS A HZ1  20 
ATOM   9261  H HZ2  . LYS A 1 26 ? 22.522  -1.644  10.889  1.00 2.92 ? 26 LYS A HZ2  20 
ATOM   9262  H HZ3  . LYS A 1 26 ? 22.773  -2.340  12.421  1.00 3.17 ? 26 LYS A HZ3  20 
ATOM   9263  N N    . GLU A 1 27 ? 19.439  1.030   6.020   1.00 1.85 ? 27 GLU A N    20 
ATOM   9264  C CA   . GLU A 1 27 ? 19.975  2.226   5.294   1.00 1.66 ? 27 GLU A CA   20 
ATOM   9265  C C    . GLU A 1 27 ? 20.629  3.192   6.297   1.00 1.74 ? 27 GLU A C    20 
ATOM   9266  O O    . GLU A 1 27 ? 20.206  4.323   6.457   1.00 1.92 ? 27 GLU A O    20 
ATOM   9267  C CB   . GLU A 1 27 ? 18.755  2.873   4.622   1.00 1.80 ? 27 GLU A CB   20 
ATOM   9268  C CG   . GLU A 1 27 ? 18.092  1.874   3.662   1.00 1.87 ? 27 GLU A CG   20 
ATOM   9269  C CD   . GLU A 1 27 ? 18.652  2.056   2.250   1.00 1.58 ? 27 GLU A CD   20 
ATOM   9270  O OE1  . GLU A 1 27 ? 19.652  1.426   1.942   1.00 1.68 ? 27 GLU A OE1  20 
ATOM   9271  O OE2  . GLU A 1 27 ? 18.066  2.816   1.495   1.00 1.45 ? 27 GLU A OE2  20 
ATOM   9272  H H    . GLU A 1 27 ? 18.485  0.979   6.241   1.00 2.04 ? 27 GLU A H    20 
ATOM   9273  H HA   . GLU A 1 27 ? 20.691  1.920   4.546   1.00 1.56 ? 27 GLU A HA   20 
ATOM   9274  H HB2  . GLU A 1 27 ? 18.044  3.170   5.379   1.00 2.03 ? 27 GLU A HB2  20 
ATOM   9275  H HB3  . GLU A 1 27 ? 19.072  3.745   4.067   1.00 1.78 ? 27 GLU A HB3  20 
ATOM   9276  H HG2  . GLU A 1 27 ? 18.289  0.866   3.996   1.00 2.11 ? 27 GLU A HG2  20 
ATOM   9277  H HG3  . GLU A 1 27 ? 17.027  2.044   3.646   1.00 2.08 ? 27 GLU A HG3  20 
ATOM   9278  N N    . GLU A 1 28 ? 21.655  2.744   6.978   1.00 1.79 ? 28 GLU A N    20 
ATOM   9279  C CA   . GLU A 1 28 ? 22.342  3.614   7.983   1.00 2.05 ? 28 GLU A CA   20 
ATOM   9280  C C    . GLU A 1 28 ? 23.571  4.287   7.355   1.00 2.06 ? 28 GLU A C    20 
ATOM   9281  O O    . GLU A 1 28 ? 24.389  3.642   6.725   1.00 2.25 ? 28 GLU A O    20 
ATOM   9282  C CB   . GLU A 1 28 ? 22.769  2.663   9.110   1.00 2.28 ? 28 GLU A CB   20 
ATOM   9283  C CG   . GLU A 1 28 ? 21.563  1.840   9.581   1.00 2.38 ? 28 GLU A CG   20 
ATOM   9284  C CD   . GLU A 1 28 ? 22.014  0.806   10.614  1.00 2.79 ? 28 GLU A CD   20 
ATOM   9285  O OE1  . GLU A 1 28 ? 22.549  -0.215  10.208  1.00 2.90 ? 28 GLU A OE1  20 
ATOM   9286  O OE2  . GLU A 1 28 ? 21.813  1.044   11.792  1.00 3.10 ? 28 GLU A OE2  20 
ATOM   9287  H H    . GLU A 1 28 ? 21.971  1.827   6.835   1.00 1.76 ? 28 GLU A H    20 
ATOM   9288  H HA   . GLU A 1 28 ? 21.661  4.357   8.367   1.00 2.24 ? 28 GLU A HA   20 
ATOM   9289  H HB2  . GLU A 1 28 ? 23.539  1.998   8.745   1.00 2.24 ? 28 GLU A HB2  20 
ATOM   9290  H HB3  . GLU A 1 28 ? 23.155  3.238   9.938   1.00 2.56 ? 28 GLU A HB3  20 
ATOM   9291  H HG2  . GLU A 1 28 ? 20.831  2.497   10.025  1.00 2.47 ? 28 GLU A HG2  20 
ATOM   9292  H HG3  . GLU A 1 28 ? 21.122  1.330   8.739   1.00 2.20 ? 28 GLU A HG3  20 
ATOM   9293  N N    . MET A 1 29 ? 23.704  5.580   7.523   1.00 2.35 ? 29 MET A N    20 
ATOM   9294  C CA   . MET A 1 29 ? 24.877  6.301   6.938   1.00 2.56 ? 29 MET A CA   20 
ATOM   9295  C C    . MET A 1 29 ? 25.758  6.879   8.052   1.00 3.38 ? 29 MET A C    20 
ATOM   9296  O O    . MET A 1 29 ? 25.267  7.349   9.062   1.00 4.01 ? 29 MET A O    20 
ATOM   9297  C CB   . MET A 1 29 ? 24.271  7.424   6.093   1.00 2.86 ? 29 MET A CB   20 
ATOM   9298  C CG   . MET A 1 29 ? 25.266  7.847   5.008   1.00 2.85 ? 29 MET A CG   20 
ATOM   9299  S SD   . MET A 1 29 ? 25.456  9.647   5.031   1.00 3.67 ? 29 MET A SD   20 
ATOM   9300  C CE   . MET A 1 29 ? 26.889  9.714   6.133   1.00 4.16 ? 29 MET A CE   20 
ATOM   9301  H H    . MET A 1 29 ? 23.032  6.077   8.035   1.00 2.71 ? 29 MET A H    20 
ATOM   9302  H HA   . MET A 1 29 ? 25.452  5.637   6.310   1.00 2.41 ? 29 MET A HA   20 
ATOM   9303  H HB2  . MET A 1 29 ? 23.359  7.073   5.628   1.00 2.95 ? 29 MET A HB2  20 
ATOM   9304  H HB3  . MET A 1 29 ? 24.049  8.271   6.724   1.00 3.47 ? 29 MET A HB3  20 
ATOM   9305  H HG2  . MET A 1 29 ? 26.223  7.382   5.194   1.00 3.03 ? 29 MET A HG2  20 
ATOM   9306  H HG3  . MET A 1 29 ? 24.899  7.536   4.041   1.00 2.73 ? 29 MET A HG3  20 
ATOM   9307  H HE1  . MET A 1 29 ? 27.617  8.977   5.823   1.00 4.60 ? 29 MET A HE1  20 
ATOM   9308  H HE2  . MET A 1 29 ? 27.328  10.702  6.093   1.00 4.31 ? 29 MET A HE2  20 
ATOM   9309  H HE3  . MET A 1 29 ? 26.579  9.503   7.144   1.00 4.41 ? 29 MET A HE3  20 
ATOM   9310  N N    . ALA A 1 30 ? 27.055  6.849   7.871   1.00 3.77 ? 30 ALA A N    20 
ATOM   9311  C CA   . ALA A 1 30 ? 27.979  7.398   8.912   1.00 4.86 ? 30 ALA A CA   20 
ATOM   9312  C C    . ALA A 1 30 ? 29.047  8.287   8.261   1.00 5.33 ? 30 ALA A C    20 
ATOM   9313  O O    . ALA A 1 30 ? 29.275  9.372   8.772   1.00 6.03 ? 30 ALA A O    20 
ATOM   9314  C CB   . ALA A 1 30 ? 28.619  6.167   9.560   1.00 5.33 ? 30 ALA A CB   20 
ATOM   9315  O OXT  . ALA A 1 30 ? 29.616  7.871   7.263   1.00 5.18 ? 30 ALA A OXT  20 
ATOM   9316  H H    . ALA A 1 30 ? 27.423  6.468   7.048   1.00 3.58 ? 30 ALA A H    20 
ATOM   9317  H HA   . ALA A 1 30 ? 27.425  7.955   9.651   1.00 5.19 ? 30 ALA A HA   20 
ATOM   9318  H HB1  . ALA A 1 30 ? 27.848  5.538   9.978   1.00 5.61 ? 30 ALA A HB1  20 
ATOM   9319  H HB2  . ALA A 1 30 ? 29.171  5.615   8.813   1.00 5.40 ? 30 ALA A HB2  20 
ATOM   9320  H HB3  . ALA A 1 30 ? 29.292  6.484   10.344  1.00 5.69 ? 30 ALA A HB3  20 
ATOM   9321  N N    . MET A 1 1  ? 3.038   6.212   25.542  1.00 3.40 ? 1  MET A N    21 
ATOM   9322  C CA   . MET A 1 1  ? 2.201   5.332   24.667  1.00 2.98 ? 1  MET A CA   21 
ATOM   9323  C C    . MET A 1 1  ? 2.533   5.574   23.186  1.00 2.62 ? 1  MET A C    21 
ATOM   9324  O O    . MET A 1 1  ? 3.202   6.530   22.842  1.00 2.69 ? 1  MET A O    21 
ATOM   9325  C CB   . MET A 1 1  ? 0.743   5.715   24.970  1.00 3.13 ? 1  MET A CB   21 
ATOM   9326  C CG   . MET A 1 1  ? 0.484   7.178   24.584  1.00 3.34 ? 1  MET A CG   21 
ATOM   9327  S SD   . MET A 1 1  ? 0.604   8.221   26.059  1.00 3.98 ? 1  MET A SD   21 
ATOM   9328  C CE   . MET A 1 1  ? 0.043   9.761   25.293  1.00 4.48 ? 1  MET A CE   21 
ATOM   9329  H H1   . MET A 1 1  ? 3.056   7.177   25.152  1.00 3.46 ? 1  MET A H1   21 
ATOM   9330  H H2   . MET A 1 1  ? 2.637   6.233   26.502  1.00 3.68 ? 1  MET A H2   21 
ATOM   9331  H H3   . MET A 1 1  ? 4.008   5.841   25.580  1.00 3.52 ? 1  MET A H3   21 
ATOM   9332  H HA   . MET A 1 1  ? 2.365   4.296   24.917  1.00 3.04 ? 1  MET A HA   21 
ATOM   9333  H HB2  . MET A 1 1  ? 0.081   5.075   24.404  1.00 3.02 ? 1  MET A HB2  21 
ATOM   9334  H HB3  . MET A 1 1  ? 0.550   5.585   26.024  1.00 3.39 ? 1  MET A HB3  21 
ATOM   9335  H HG2  . MET A 1 1  ? 1.214   7.498   23.856  1.00 3.21 ? 1  MET A HG2  21 
ATOM   9336  H HG3  . MET A 1 1  ? -0.506  7.267   24.161  1.00 3.44 ? 1  MET A HG3  21 
ATOM   9337  H HE1  . MET A 1 1  ? 0.655   9.983   24.434  1.00 4.60 ? 1  MET A HE1  21 
ATOM   9338  H HE2  . MET A 1 1  ? -0.987  9.654   24.980  1.00 4.64 ? 1  MET A HE2  21 
ATOM   9339  H HE3  . MET A 1 1  ? 0.124   10.569  26.008  1.00 4.93 ? 1  MET A HE3  21 
ATOM   9340  N N    . ILE A 1 2  ? 2.069   4.716   22.312  1.00 2.40 ? 2  ILE A N    21 
ATOM   9341  C CA   . ILE A 1 2  ? 2.354   4.893   20.853  1.00 2.22 ? 2  ILE A CA   21 
ATOM   9342  C C    . ILE A 1 2  ? 1.163   5.570   20.154  1.00 1.94 ? 2  ILE A C    21 
ATOM   9343  O O    . ILE A 1 2  ? 0.076   5.646   20.696  1.00 1.91 ? 2  ILE A O    21 
ATOM   9344  C CB   . ILE A 1 2  ? 2.577   3.470   20.315  1.00 2.45 ? 2  ILE A CB   21 
ATOM   9345  C CG1  . ILE A 1 2  ? 3.303   3.539   18.968  1.00 2.54 ? 2  ILE A CG1  21 
ATOM   9346  C CG2  . ILE A 1 2  ? 1.232   2.754   20.131  1.00 2.51 ? 2  ILE A CG2  21 
ATOM   9347  C CD1  . ILE A 1 2  ? 4.015   2.212   18.700  1.00 3.13 ? 2  ILE A CD1  21 
ATOM   9348  H H    . ILE A 1 2  ? 1.530   3.954   22.615  1.00 2.49 ? 2  ILE A H    21 
ATOM   9349  H HA   . ILE A 1 2  ? 3.248   5.479   20.716  1.00 2.33 ? 2  ILE A HA   21 
ATOM   9350  H HB   . ILE A 1 2  ? 3.181   2.914   21.019  1.00 2.71 ? 2  ILE A HB   21 
ATOM   9351  H HG12 . ILE A 1 2  ? 2.585   3.727   18.182  1.00 2.54 ? 2  ILE A HG12 21 
ATOM   9352  H HG13 . ILE A 1 2  ? 4.030   4.337   18.990  1.00 2.52 ? 2  ILE A HG13 21 
ATOM   9353  H HG21 . ILE A 1 2  ? 0.555   3.047   20.920  1.00 2.70 ? 2  ILE A HG21 21 
ATOM   9354  H HG22 . ILE A 1 2  ? 0.808   3.025   19.176  1.00 2.61 ? 2  ILE A HG22 21 
ATOM   9355  H HG23 . ILE A 1 2  ? 1.385   1.686   20.166  1.00 2.86 ? 2  ILE A HG23 21 
ATOM   9356  H HD11 . ILE A 1 2  ? 3.313   1.399   18.804  1.00 3.39 ? 2  ILE A HD11 21 
ATOM   9357  H HD12 . ILE A 1 2  ? 4.417   2.215   17.697  1.00 3.46 ? 2  ILE A HD12 21 
ATOM   9358  H HD13 . ILE A 1 2  ? 4.819   2.086   19.410  1.00 3.47 ? 2  ILE A HD13 21 
ATOM   9359  N N    . SER A 1 3  ? 1.363   6.061   18.954  1.00 1.91 ? 3  SER A N    21 
ATOM   9360  C CA   . SER A 1 3  ? 0.245   6.733   18.213  1.00 1.85 ? 3  SER A CA   21 
ATOM   9361  C C    . SER A 1 3  ? -0.904  5.745   17.971  1.00 1.88 ? 3  SER A C    21 
ATOM   9362  O O    . SER A 1 3  ? -2.055  6.057   18.208  1.00 2.14 ? 3  SER A O    21 
ATOM   9363  C CB   . SER A 1 3  ? 0.854   7.184   16.880  1.00 1.85 ? 3  SER A CB   21 
ATOM   9364  O OG   . SER A 1 3  ? -0.181  7.352   15.915  1.00 1.78 ? 3  SER A OG   21 
ATOM   9365  H H    . SER A 1 3  ? 2.249   5.986   18.540  1.00 2.04 ? 3  SER A H    21 
ATOM   9366  H HA   . SER A 1 3  ? -0.108  7.589   18.765  1.00 1.98 ? 3  SER A HA   21 
ATOM   9367  H HB2  . SER A 1 3  ? 1.367   8.122   17.017  1.00 2.06 ? 3  SER A HB2  21 
ATOM   9368  H HB3  . SER A 1 3  ? 1.561   6.440   16.538  1.00 1.95 ? 3  SER A HB3  21 
ATOM   9369  H HG   . SER A 1 3  ? -0.391  8.290   15.861  1.00 1.97 ? 3  SER A HG   21 
ATOM   9370  N N    . SER A 1 4  ? -0.594  4.558   17.490  1.00 1.80 ? 4  SER A N    21 
ATOM   9371  C CA   . SER A 1 4  ? -1.654  3.528   17.213  1.00 2.07 ? 4  SER A CA   21 
ATOM   9372  C C    . SER A 1 4  ? -2.625  3.998   16.113  1.00 2.10 ? 4  SER A C    21 
ATOM   9373  O O    . SER A 1 4  ? -3.636  3.371   15.866  1.00 2.38 ? 4  SER A O    21 
ATOM   9374  C CB   . SER A 1 4  ? -2.396  3.342   18.538  1.00 2.43 ? 4  SER A CB   21 
ATOM   9375  O OG   . SER A 1 4  ? -2.196  2.014   19.005  1.00 2.69 ? 4  SER A OG   21 
ATOM   9376  H H    . SER A 1 4  ? 0.344   4.344   17.305  1.00 1.69 ? 4  SER A H    21 
ATOM   9377  H HA   . SER A 1 4  ? -1.195  2.598   16.922  1.00 2.10 ? 4  SER A HA   21 
ATOM   9378  H HB2  . SER A 1 4  ? -2.012  4.036   19.266  1.00 2.35 ? 4  SER A HB2  21 
ATOM   9379  H HB3  . SER A 1 4  ? -3.450  3.529   18.386  1.00 2.64 ? 4  SER A HB3  21 
ATOM   9380  H HG   . SER A 1 4  ? -2.958  1.488   18.745  1.00 2.95 ? 4  SER A HG   21 
ATOM   9381  N N    . VAL A 1 5  ? -2.324  5.091   15.458  1.00 1.94 ? 5  VAL A N    21 
ATOM   9382  C CA   . VAL A 1 5  ? -3.222  5.605   14.378  1.00 2.10 ? 5  VAL A CA   21 
ATOM   9383  C C    . VAL A 1 5  ? -2.425  5.827   13.086  1.00 1.88 ? 5  VAL A C    21 
ATOM   9384  O O    . VAL A 1 5  ? -2.827  5.398   12.021  1.00 2.03 ? 5  VAL A O    21 
ATOM   9385  C CB   . VAL A 1 5  ? -3.772  6.930   14.919  1.00 2.19 ? 5  VAL A CB   21 
ATOM   9386  C CG1  . VAL A 1 5  ? -4.607  7.621   13.840  1.00 2.48 ? 5  VAL A CG1  21 
ATOM   9387  C CG2  . VAL A 1 5  ? -4.652  6.657   16.142  1.00 2.44 ? 5  VAL A CG2  21 
ATOM   9388  H H    . VAL A 1 5  ? -1.508  5.577   15.678  1.00 1.82 ? 5  VAL A H    21 
ATOM   9389  H HA   . VAL A 1 5  ? -4.028  4.918   14.202  1.00 2.39 ? 5  VAL A HA   21 
ATOM   9390  H HB   . VAL A 1 5  ? -2.950  7.573   15.204  1.00 2.01 ? 5  VAL A HB   21 
ATOM   9391  H HG11 . VAL A 1 5  ? -5.330  6.924   13.444  1.00 2.79 ? 5  VAL A HG11 21 
ATOM   9392  H HG12 . VAL A 1 5  ? -5.122  8.468   14.270  1.00 2.75 ? 5  VAL A HG12 21 
ATOM   9393  H HG13 . VAL A 1 5  ? -3.959  7.960   13.045  1.00 2.49 ? 5  VAL A HG13 21 
ATOM   9394  H HG21 . VAL A 1 5  ? -5.257  5.780   15.961  1.00 2.42 ? 5  VAL A HG21 21 
ATOM   9395  H HG22 . VAL A 1 5  ? -4.025  6.489   17.005  1.00 2.78 ? 5  VAL A HG22 21 
ATOM   9396  H HG23 . VAL A 1 5  ? -5.293  7.506   16.321  1.00 2.82 ? 5  VAL A HG23 21 
ATOM   9397  N N    . CYS A 1 6  ? -1.297  6.497   13.183  1.00 1.58 ? 6  CYS A N    21 
ATOM   9398  C CA   . CYS A 1 6  ? -0.440  6.770   11.981  1.00 1.38 ? 6  CYS A CA   21 
ATOM   9399  C C    . CYS A 1 6  ? -1.158  7.704   10.993  1.00 1.36 ? 6  CYS A C    21 
ATOM   9400  O O    . CYS A 1 6  ? -2.343  7.957   11.100  1.00 1.61 ? 6  CYS A O    21 
ATOM   9401  C CB   . CYS A 1 6  ? -0.176  5.401   11.344  1.00 1.56 ? 6  CYS A CB   21 
ATOM   9402  S SG   . CYS A 1 6  ? 1.434   5.420   10.514  1.00 1.68 ? 6  CYS A SG   21 
ATOM   9403  H H    . CYS A 1 6  ? -1.011  6.824   14.057  1.00 1.55 ? 6  CYS A H    21 
ATOM   9404  H HA   . CYS A 1 6  ? 0.494   7.212   12.289  1.00 1.31 ? 6  CYS A HA   21 
ATOM   9405  H HB2  . CYS A 1 6  ? -0.175  4.641   12.112  1.00 1.55 ? 6  CYS A HB2  21 
ATOM   9406  H HB3  . CYS A 1 6  ? -0.949  5.183   10.623  1.00 1.78 ? 6  CYS A HB3  21 
ATOM   9407  H HG   . CYS A 1 6  ? 1.293   5.675   9.600   1.00 1.86 ? 6  CYS A HG   21 
ATOM   9408  N N    . VAL A 1 7  ? -0.436  8.218   10.032  1.00 1.22 ? 7  VAL A N    21 
ATOM   9409  C CA   . VAL A 1 7  ? -1.049  9.135   9.027   1.00 1.36 ? 7  VAL A CA   21 
ATOM   9410  C C    . VAL A 1 7  ? -1.039  8.474   7.644   1.00 1.23 ? 7  VAL A C    21 
ATOM   9411  O O    . VAL A 1 7  ? -0.339  7.506   7.410   1.00 1.16 ? 7  VAL A O    21 
ATOM   9412  C CB   . VAL A 1 7  ? -0.168  10.391  9.026   1.00 1.50 ? 7  VAL A CB   21 
ATOM   9413  C CG1  . VAL A 1 7  ? -0.859  11.505  8.236   1.00 1.85 ? 7  VAL A CG1  21 
ATOM   9414  C CG2  . VAL A 1 7  ? 0.064   10.869  10.465  1.00 1.57 ? 7  VAL A CG2  21 
ATOM   9415  H H    . VAL A 1 7  ? 0.512   8.003   9.969   1.00 1.13 ? 7  VAL A H    21 
ATOM   9416  H HA   . VAL A 1 7  ? -2.057  9.391   9.315   1.00 1.58 ? 7  VAL A HA   21 
ATOM   9417  H HB   . VAL A 1 7  ? 0.781   10.162  8.563   1.00 1.40 ? 7  VAL A HB   21 
ATOM   9418  H HG11 . VAL A 1 7  ? -1.920  11.487  8.441   1.00 2.32 ? 7  VAL A HG11 21 
ATOM   9419  H HG12 . VAL A 1 7  ? -0.453  12.462  8.532   1.00 2.09 ? 7  VAL A HG12 21 
ATOM   9420  H HG13 . VAL A 1 7  ? -0.693  11.355  7.181   1.00 1.97 ? 7  VAL A HG13 21 
ATOM   9421  H HG21 . VAL A 1 7  ? -0.848  10.760  11.032  1.00 1.46 ? 7  VAL A HG21 21 
ATOM   9422  H HG22 . VAL A 1 7  ? 0.844   10.275  10.919  1.00 1.83 ? 7  VAL A HG22 21 
ATOM   9423  H HG23 . VAL A 1 7  ? 0.361   11.907  10.456  1.00 1.95 ? 7  VAL A HG23 21 
HETATM 9424  N N    . SEP A 1 8  ? -1.808  9.000   6.728   1.00 1.30 ? 8  SEP A N    21 
HETATM 9425  C CA   . SEP A 1 8  ? -1.857  8.420   5.344   1.00 1.23 ? 8  SEP A CA   21 
HETATM 9426  C CB   . SEP A 1 8  ? -2.778  9.343   4.541   1.00 1.36 ? 8  SEP A CB   21 
HETATM 9427  O OG   . SEP A 1 8  ? -3.963  8.625   4.170   1.00 1.45 ? 8  SEP A OG   21 
HETATM 9428  C C    . SEP A 1 8  ? -0.456  8.388   4.721   1.00 1.07 ? 8  SEP A C    21 
HETATM 9429  O O    . SEP A 1 8  ? -0.106  7.456   4.026   1.00 0.99 ? 8  SEP A O    21 
HETATM 9430  P P    . SEP A 1 8  ? -4.007  7.754   2.816   1.00 1.59 ? 8  SEP A P    21 
HETATM 9431  O O1P  . SEP A 1 8  ? -5.364  7.186   2.674   1.00 1.78 ? 8  SEP A O1P  21 
HETATM 9432  O O2P  . SEP A 1 8  ? -3.432  8.570   1.721   1.00 1.75 ? 8  SEP A O2P  21 
HETATM 9433  O O3P  . SEP A 1 8  ? -2.987  6.552   3.136   1.00 1.68 ? 8  SEP A O3P  21 
HETATM 9434  H H    . SEP A 1 8  ? -2.351  9.780   6.953   1.00 1.45 ? 8  SEP A H    21 
HETATM 9435  H HA   . SEP A 1 8  ? -2.268  7.427   5.375   1.00 1.26 ? 8  SEP A HA   21 
HETATM 9436  H HB2  . SEP A 1 8  ? -2.260  9.683   3.654   1.00 1.35 ? 8  SEP A HB2  21 
HETATM 9437  H HB3  . SEP A 1 8  ? -3.053  10.195  5.139   1.00 1.45 ? 8  SEP A HB3  21 
HETATM 9438  H HOP3 . SEP A 1 8  ? -2.977  5.976   2.367   1.00 2.09 ? 8  SEP A HOP3 21 
ATOM   9439  N N    . SER A 1 9  ? 0.338   9.404   4.979   1.00 1.08 ? 9  SER A N    21 
ATOM   9440  C CA   . SER A 1 9  ? 1.733   9.475   4.428   1.00 0.97 ? 9  SER A CA   21 
ATOM   9441  C C    . SER A 1 9  ? 1.728   9.470   2.896   1.00 0.87 ? 9  SER A C    21 
ATOM   9442  O O    . SER A 1 9  ? 1.561   8.441   2.279   1.00 0.79 ? 9  SER A O    21 
ATOM   9443  C CB   . SER A 1 9  ? 2.457   8.239   4.957   1.00 0.91 ? 9  SER A CB   21 
ATOM   9444  O OG   . SER A 1 9  ? 2.361   8.199   6.376   1.00 1.09 ? 9  SER A OG   21 
ATOM   9445  H H    . SER A 1 9  ? 0.014   10.126  5.550   1.00 1.18 ? 9  SER A H    21 
ATOM   9446  H HA   . SER A 1 9  ? 2.227   10.362  4.792   1.00 1.06 ? 9  SER A HA   21 
ATOM   9447  H HB2  . SER A 1 9  ? 2.005   7.355   4.541   1.00 0.88 ? 9  SER A HB2  21 
ATOM   9448  H HB3  . SER A 1 9  ? 3.495   8.284   4.655   1.00 0.89 ? 9  SER A HB3  21 
ATOM   9449  H HG   . SER A 1 9  ? 1.556   7.724   6.609   1.00 1.39 ? 9  SER A HG   21 
ATOM   9450  N N    . TYR A 1 10 ? 1.935   10.624  2.299   1.00 0.91 ? 10 TYR A N    21 
ATOM   9451  C CA   . TYR A 1 10 ? 1.976   10.766  0.801   1.00 0.87 ? 10 TYR A CA   21 
ATOM   9452  C C    . TYR A 1 10 ? 0.878   9.931   0.096   1.00 0.79 ? 10 TYR A C    21 
ATOM   9453  O O    . TYR A 1 10 ? -0.025  9.407   0.719   1.00 0.83 ? 10 TYR A O    21 
ATOM   9454  C CB   . TYR A 1 10 ? 3.421   10.354  0.415   1.00 0.81 ? 10 TYR A CB   21 
ATOM   9455  C CG   . TYR A 1 10 ? 3.513   8.938   -0.116  1.00 0.65 ? 10 TYR A CG   21 
ATOM   9456  C CD1  . TYR A 1 10 ? 3.601   7.857   0.766   1.00 0.62 ? 10 TYR A CD1  21 
ATOM   9457  C CD2  . TYR A 1 10 ? 3.535   8.716   -1.496  1.00 0.61 ? 10 TYR A CD2  21 
ATOM   9458  C CE1  . TYR A 1 10 ? 3.700   6.553   0.268   1.00 0.55 ? 10 TYR A CE1  21 
ATOM   9459  C CE2  . TYR A 1 10 ? 3.636   7.414   -1.996  1.00 0.55 ? 10 TYR A CE2  21 
ATOM   9460  C CZ   . TYR A 1 10 ? 3.717   6.331   -1.113  1.00 0.52 ? 10 TYR A CZ   21 
ATOM   9461  O OH   . TYR A 1 10 ? 3.813   5.042   -1.600  1.00 0.58 ? 10 TYR A OH   21 
ATOM   9462  H H    . TYR A 1 10 ? 2.084   11.415  2.849   1.00 1.00 ? 10 TYR A H    21 
ATOM   9463  H HA   . TYR A 1 10 ? 1.836   11.803  0.545   1.00 0.99 ? 10 TYR A HA   21 
ATOM   9464  H HB2  . TYR A 1 10 ? 3.785   11.029  -0.342  1.00 0.87 ? 10 TYR A HB2  21 
ATOM   9465  H HB3  . TYR A 1 10 ? 4.052   10.441  1.289   1.00 0.86 ? 10 TYR A HB3  21 
ATOM   9466  H HD1  . TYR A 1 10 ? 3.587   8.029   1.835   1.00 0.71 ? 10 TYR A HD1  21 
ATOM   9467  H HD2  . TYR A 1 10 ? 3.465   9.552   -2.174  1.00 0.70 ? 10 TYR A HD2  21 
ATOM   9468  H HE1  . TYR A 1 10 ? 3.761   5.719   0.948   1.00 0.60 ? 10 TYR A HE1  21 
ATOM   9469  H HE2  . TYR A 1 10 ? 3.653   7.246   -3.062  1.00 0.61 ? 10 TYR A HE2  21 
ATOM   9470  H HH   . TYR A 1 10 ? 2.937   4.775   -1.895  1.00 0.65 ? 10 TYR A HH   21 
ATOM   9471  N N    . ARG A 1 11 ? 0.932   9.833   -1.208  1.00 0.73 ? 11 ARG A N    21 
ATOM   9472  C CA   . ARG A 1 11 ? -0.103  9.049   -1.949  1.00 0.70 ? 11 ARG A CA   21 
ATOM   9473  C C    . ARG A 1 11 ? 0.259   7.556   -1.900  1.00 0.62 ? 11 ARG A C    21 
ATOM   9474  O O    . ARG A 1 11 ? 0.905   7.102   -0.977  1.00 0.60 ? 11 ARG A O    21 
ATOM   9475  C CB   . ARG A 1 11 ? -0.046  9.598   -3.382  1.00 0.74 ? 11 ARG A CB   21 
ATOM   9476  C CG   . ARG A 1 11 ? -0.741  10.963  -3.437  1.00 0.89 ? 11 ARG A CG   21 
ATOM   9477  C CD   . ARG A 1 11 ? -2.253  10.765  -3.595  1.00 0.93 ? 11 ARG A CD   21 
ATOM   9478  N NE   . ARG A 1 11 ? -2.857  11.428  -2.401  1.00 1.03 ? 11 ARG A NE   21 
ATOM   9479  C CZ   . ARG A 1 11 ? -3.099  10.741  -1.323  1.00 1.19 ? 11 ARG A CZ   21 
ATOM   9480  N NH1  . ARG A 1 11 ? -4.090  9.896   -1.300  1.00 1.35 ? 11 ARG A NH1  21 
ATOM   9481  N NH2  . ARG A 1 11 ? -2.353  10.903  -0.269  1.00 1.43 ? 11 ARG A NH2  21 
ATOM   9482  H H    . ARG A 1 11 ? 1.646   10.283  -1.702  1.00 0.75 ? 11 ARG A H    21 
ATOM   9483  H HA   . ARG A 1 11 ? -1.078  9.211   -1.528  1.00 0.78 ? 11 ARG A HA   21 
ATOM   9484  H HB2  . ARG A 1 11 ? 0.986   9.708   -3.683  1.00 0.77 ? 11 ARG A HB2  21 
ATOM   9485  H HB3  . ARG A 1 11 ? -0.544  8.918   -4.051  1.00 0.73 ? 11 ARG A HB3  21 
ATOM   9486  H HG2  . ARG A 1 11 ? -0.541  11.506  -2.525  1.00 0.94 ? 11 ARG A HG2  21 
ATOM   9487  H HG3  . ARG A 1 11 ? -0.365  11.524  -4.279  1.00 1.00 ? 11 ARG A HG3  21 
ATOM   9488  H HD2  . ARG A 1 11 ? -2.598  11.235  -4.506  1.00 0.99 ? 11 ARG A HD2  21 
ATOM   9489  H HD3  . ARG A 1 11 ? -2.498  9.713   -3.598  1.00 0.91 ? 11 ARG A HD3  21 
ATOM   9490  H HE   . ARG A 1 11 ? -3.073  12.384  -2.430  1.00 1.12 ? 11 ARG A HE   21 
ATOM   9491  H HH11 . ARG A 1 11 ? -4.662  9.776   -2.110  1.00 1.37 ? 11 ARG A HH11 21 
ATOM   9492  H HH12 . ARG A 1 11 ? -4.279  9.368   -0.472  1.00 1.59 ? 11 ARG A HH12 21 
ATOM   9493  H HH21 . ARG A 1 11 ? -1.594  11.553  -0.290  1.00 1.52 ? 11 ARG A HH21 21 
ATOM   9494  H HH22 . ARG A 1 11 ? -2.534  10.375  0.560   1.00 1.63 ? 11 ARG A HH22 21 
ATOM   9495  N N    . GLY A 1 12 ? -0.125  6.791   -2.889  1.00 0.64 ? 12 GLY A N    21 
ATOM   9496  C CA   . GLY A 1 12 ? 0.236   5.341   -2.895  1.00 0.67 ? 12 GLY A CA   21 
ATOM   9497  C C    . GLY A 1 12 ? 1.214   5.104   -4.041  1.00 0.69 ? 12 GLY A C    21 
ATOM   9498  O O    . GLY A 1 12 ? 1.301   4.023   -4.588  1.00 0.81 ? 12 GLY A O    21 
ATOM   9499  H H    . GLY A 1 12 ? -0.627  7.170   -3.640  1.00 0.69 ? 12 GLY A H    21 
ATOM   9500  H HA2  . GLY A 1 12 ? 0.700   5.078   -1.955  1.00 0.65 ? 12 GLY A HA2  21 
ATOM   9501  H HA3  . GLY A 1 12 ? -0.649  4.745   -3.048  1.00 0.76 ? 12 GLY A HA3  21 
ATOM   9502  N N    . ARG A 1 13 ? 1.932   6.132   -4.418  1.00 0.65 ? 13 ARG A N    21 
ATOM   9503  C CA   . ARG A 1 13 ? 2.894   6.023   -5.546  1.00 0.75 ? 13 ARG A CA   21 
ATOM   9504  C C    . ARG A 1 13 ? 4.338   6.293   -5.081  1.00 0.75 ? 13 ARG A C    21 
ATOM   9505  O O    . ARG A 1 13 ? 4.880   7.365   -5.284  1.00 0.79 ? 13 ARG A O    21 
ATOM   9506  C CB   . ARG A 1 13 ? 2.409   7.086   -6.541  1.00 0.81 ? 13 ARG A CB   21 
ATOM   9507  C CG   . ARG A 1 13 ? 2.369   8.471   -5.874  1.00 0.78 ? 13 ARG A CG   21 
ATOM   9508  C CD   . ARG A 1 13 ? 2.780   9.541   -6.888  1.00 0.91 ? 13 ARG A CD   21 
ATOM   9509  N NE   . ARG A 1 13 ? 1.593   9.702   -7.778  1.00 0.96 ? 13 ARG A NE   21 
ATOM   9510  C CZ   . ARG A 1 13 ? 1.750   10.066  -9.017  1.00 1.03 ? 13 ARG A CZ   21 
ATOM   9511  N NH1  . ARG A 1 13 ? 2.067   11.297  -9.298  1.00 1.12 ? 13 ARG A NH1  21 
ATOM   9512  N NH2  . ARG A 1 13 ? 1.586   9.198   -9.973  1.00 1.13 ? 13 ARG A NH2  21 
ATOM   9513  H H    . ARG A 1 13 ? 1.820   6.990   -3.967  1.00 0.62 ? 13 ARG A H    21 
ATOM   9514  H HA   . ARG A 1 13 ? 2.828   5.048   -5.996  1.00 0.85 ? 13 ARG A HA   21 
ATOM   9515  H HB2  . ARG A 1 13 ? 3.072   7.117   -7.382  1.00 0.92 ? 13 ARG A HB2  21 
ATOM   9516  H HB3  . ARG A 1 13 ? 1.415   6.830   -6.876  1.00 0.82 ? 13 ARG A HB3  21 
ATOM   9517  H HG2  . ARG A 1 13 ? 1.367   8.673   -5.526  1.00 0.79 ? 13 ARG A HG2  21 
ATOM   9518  H HG3  . ARG A 1 13 ? 3.051   8.491   -5.038  1.00 0.73 ? 13 ARG A HG3  21 
ATOM   9519  H HD2  . ARG A 1 13 ? 3.005   10.470  -6.381  1.00 0.95 ? 13 ARG A HD2  21 
ATOM   9520  H HD3  . ARG A 1 13 ? 3.633   9.208   -7.462  1.00 0.99 ? 13 ARG A HD3  21 
ATOM   9521  H HE   . ARG A 1 13 ? 0.694   9.532   -7.430  1.00 1.00 ? 13 ARG A HE   21 
ATOM   9522  H HH11 . ARG A 1 13 ? 2.191   11.960  -8.561  1.00 1.15 ? 13 ARG A HH11 21 
ATOM   9523  H HH12 . ARG A 1 13 ? 2.189   11.579  -10.249 1.00 1.24 ? 13 ARG A HH12 21 
ATOM   9524  H HH21 . ARG A 1 13 ? 1.339   8.254   -9.755  1.00 1.18 ? 13 ARG A HH21 21 
ATOM   9525  H HH22 . ARG A 1 13 ? 1.706   9.474   -10.926 1.00 1.24 ? 13 ARG A HH22 21 
ATOM   9526  N N    . LYS A 1 14 ? 4.965   5.323   -4.467  1.00 0.74 ? 14 LYS A N    21 
ATOM   9527  C CA   . LYS A 1 14 ? 6.373   5.512   -3.996  1.00 0.76 ? 14 LYS A CA   21 
ATOM   9528  C C    . LYS A 1 14 ? 7.355   5.361   -5.173  1.00 0.89 ? 14 LYS A C    21 
ATOM   9529  O O    . LYS A 1 14 ? 8.150   4.441   -5.227  1.00 0.99 ? 14 LYS A O    21 
ATOM   9530  C CB   . LYS A 1 14 ? 6.601   4.425   -2.935  1.00 0.80 ? 14 LYS A CB   21 
ATOM   9531  C CG   . LYS A 1 14 ? 6.379   3.026   -3.534  1.00 0.95 ? 14 LYS A CG   21 
ATOM   9532  C CD   . LYS A 1 14 ? 5.301   2.284   -2.736  1.00 1.08 ? 14 LYS A CD   21 
ATOM   9533  C CE   . LYS A 1 14 ? 5.762   2.105   -1.284  1.00 1.40 ? 14 LYS A CE   21 
ATOM   9534  N NZ   . LYS A 1 14 ? 4.741   2.820   -0.462  1.00 1.71 ? 14 LYS A NZ   21 
ATOM   9535  H H    . LYS A 1 14 ? 4.513   4.469   -4.319  1.00 0.75 ? 14 LYS A H    21 
ATOM   9536  H HA   . LYS A 1 14 ? 6.485   6.488   -3.548  1.00 0.72 ? 14 LYS A HA   21 
ATOM   9537  H HB2  . LYS A 1 14 ? 7.610   4.496   -2.568  1.00 0.87 ? 14 LYS A HB2  21 
ATOM   9538  H HB3  . LYS A 1 14 ? 5.914   4.576   -2.117  1.00 0.75 ? 14 LYS A HB3  21 
ATOM   9539  H HG2  . LYS A 1 14 ? 6.063   3.122   -4.564  1.00 1.03 ? 14 LYS A HG2  21 
ATOM   9540  H HG3  . LYS A 1 14 ? 7.302   2.469   -3.494  1.00 1.04 ? 14 LYS A HG3  21 
ATOM   9541  H HD2  . LYS A 1 14 ? 4.383   2.853   -2.757  1.00 1.22 ? 14 LYS A HD2  21 
ATOM   9542  H HD3  . LYS A 1 14 ? 5.132   1.314   -3.178  1.00 1.23 ? 14 LYS A HD3  21 
ATOM   9543  H HE2  . LYS A 1 14 ? 5.789   1.055   -1.027  1.00 1.45 ? 14 LYS A HE2  21 
ATOM   9544  H HE3  . LYS A 1 14 ? 6.734   2.554   -1.139  1.00 1.97 ? 14 LYS A HE3  21 
ATOM   9545  H HZ1  . LYS A 1 14 ? 4.540   3.753   -0.884  1.00 2.25 ? 14 LYS A HZ1  21 
ATOM   9546  H HZ2  . LYS A 1 14 ? 3.866   2.260   -0.432  1.00 2.03 ? 14 LYS A HZ2  21 
ATOM   9547  H HZ3  . LYS A 1 14 ? 5.104   2.948   0.506   1.00 1.82 ? 14 LYS A HZ3  21 
ATOM   9548  N N    . SER A 1 15 ? 7.296   6.267   -6.116  1.00 0.94 ? 15 SER A N    21 
ATOM   9549  C CA   . SER A 1 15 ? 8.213   6.195   -7.299  1.00 1.10 ? 15 SER A CA   21 
ATOM   9550  C C    . SER A 1 15 ? 9.489   7.012   -7.045  1.00 1.05 ? 15 SER A C    21 
ATOM   9551  O O    . SER A 1 15 ? 9.777   7.401   -5.927  1.00 0.94 ? 15 SER A O    21 
ATOM   9552  C CB   . SER A 1 15 ? 7.411   6.790   -8.458  1.00 1.24 ? 15 SER A CB   21 
ATOM   9553  O OG   . SER A 1 15 ? 8.129   6.600   -9.671  1.00 1.49 ? 15 SER A OG   21 
ATOM   9554  H H    . SER A 1 15 ? 6.644   6.998   -6.047  1.00 0.90 ? 15 SER A H    21 
ATOM   9555  H HA   . SER A 1 15 ? 8.465   5.169   -7.518  1.00 1.19 ? 15 SER A HA   21 
ATOM   9556  H HB2  . SER A 1 15 ? 6.456   6.297   -8.528  1.00 1.27 ? 15 SER A HB2  21 
ATOM   9557  H HB3  . SER A 1 15 ? 7.255   7.848   -8.281  1.00 1.21 ? 15 SER A HB3  21 
ATOM   9558  H HG   . SER A 1 15 ? 7.508   6.311   -10.346 1.00 1.93 ? 15 SER A HG   21 
ATOM   9559  N N    . GLY A 1 16 ? 10.255  7.276   -8.076  1.00 1.19 ? 16 GLY A N    21 
ATOM   9560  C CA   . GLY A 1 16 ? 11.515  8.066   -7.909  1.00 1.19 ? 16 GLY A CA   21 
ATOM   9561  C C    . GLY A 1 16 ? 11.191  9.562   -7.835  1.00 1.20 ? 16 GLY A C    21 
ATOM   9562  O O    . GLY A 1 16 ? 11.684  10.352  -8.616  1.00 1.31 ? 16 GLY A O    21 
ATOM   9563  H H    . GLY A 1 16 ? 9.998   6.952   -8.966  1.00 1.33 ? 16 GLY A H    21 
ATOM   9564  H HA2  . GLY A 1 16 ? 12.012  7.760   -6.998  1.00 1.11 ? 16 GLY A HA2  21 
ATOM   9565  H HA3  . GLY A 1 16 ? 12.167  7.886   -8.750  1.00 1.30 ? 16 GLY A HA3  21 
ATOM   9566  N N    . ASN A 1 17 ? 10.368  9.953   -6.897  1.00 1.12 ? 17 ASN A N    21 
ATOM   9567  C CA   . ASN A 1 17 ? 10.003  11.396  -6.753  1.00 1.19 ? 17 ASN A CA   21 
ATOM   9568  C C    . ASN A 1 17 ? 9.459   11.660  -5.342  1.00 1.08 ? 17 ASN A C    21 
ATOM   9569  O O    . ASN A 1 17 ? 9.074   10.746  -4.637  1.00 1.00 ? 17 ASN A O    21 
ATOM   9570  C CB   . ASN A 1 17 ? 8.916   11.637  -7.804  1.00 1.34 ? 17 ASN A CB   21 
ATOM   9571  C CG   . ASN A 1 17 ? 8.883   13.120  -8.180  1.00 1.52 ? 17 ASN A CG   21 
ATOM   9572  O OD1  . ASN A 1 17 ? 8.374   13.934  -7.439  1.00 1.53 ? 17 ASN A OD1  21 
ATOM   9573  N ND2  . ASN A 1 17 ? 9.410   13.508  -9.307  1.00 1.86 ? 17 ASN A ND2  21 
ATOM   9574  H H    . ASN A 1 17 ? 9.988   9.293   -6.278  1.00 1.05 ? 17 ASN A H    21 
ATOM   9575  H HA   . ASN A 1 17 ? 10.857  12.022  -6.953  1.00 1.26 ? 17 ASN A HA   21 
ATOM   9576  H HB2  . ASN A 1 17 ? 9.129   11.047  -8.684  1.00 1.47 ? 17 ASN A HB2  21 
ATOM   9577  H HB3  . ASN A 1 17 ? 7.957   11.348  -7.403  1.00 1.25 ? 17 ASN A HB3  21 
ATOM   9578  H HD21 . ASN A 1 17 ? 9.824   12.853  -9.907  1.00 2.07 ? 17 ASN A HD21 21 
ATOM   9579  H HD22 . ASN A 1 17 ? 9.393   14.457  -9.552  1.00 2.00 ? 17 ASN A HD22 21 
ATOM   9580  N N    . LYS A 1 18 ? 9.426   12.901  -4.926  1.00 1.15 ? 18 LYS A N    21 
ATOM   9581  C CA   . LYS A 1 18 ? 8.908   13.221  -3.562  1.00 1.11 ? 18 LYS A CA   21 
ATOM   9582  C C    . LYS A 1 18 ? 7.549   13.933  -3.650  1.00 1.10 ? 18 LYS A C    21 
ATOM   9583  O O    . LYS A 1 18 ? 7.482   15.150  -3.602  1.00 1.16 ? 18 LYS A O    21 
ATOM   9584  C CB   . LYS A 1 18 ? 9.967   14.141  -2.946  1.00 1.25 ? 18 LYS A CB   21 
ATOM   9585  C CG   . LYS A 1 18 ? 10.560  13.473  -1.705  1.00 1.30 ? 18 LYS A CG   21 
ATOM   9586  C CD   . LYS A 1 18 ? 9.662   13.747  -0.494  1.00 1.33 ? 18 LYS A CD   21 
ATOM   9587  C CE   . LYS A 1 18 ? 10.101  15.046  0.189   1.00 1.43 ? 18 LYS A CE   21 
ATOM   9588  N NZ   . LYS A 1 18 ? 9.197   15.194  1.367   1.00 1.45 ? 18 LYS A NZ   21 
ATOM   9589  H H    . LYS A 1 18 ? 9.742   13.622  -5.509  1.00 1.25 ? 18 LYS A H    21 
ATOM   9590  H HA   . LYS A 1 18 ? 8.820   12.321  -2.974  1.00 1.07 ? 18 LYS A HA   21 
ATOM   9591  H HB2  . LYS A 1 18 ? 10.752  14.322  -3.667  1.00 1.33 ? 18 LYS A HB2  21 
ATOM   9592  H HB3  . LYS A 1 18 ? 9.513   15.080  -2.666  1.00 1.28 ? 18 LYS A HB3  21 
ATOM   9593  H HG2  . LYS A 1 18 ? 10.627  12.406  -1.873  1.00 1.30 ? 18 LYS A HG2  21 
ATOM   9594  H HG3  . LYS A 1 18 ? 11.546  13.871  -1.521  1.00 1.39 ? 18 LYS A HG3  21 
ATOM   9595  H HD2  . LYS A 1 18 ? 8.636   13.840  -0.820  1.00 1.31 ? 18 LYS A HD2  21 
ATOM   9596  H HD3  . LYS A 1 18 ? 9.744   12.929  0.206   1.00 1.40 ? 18 LYS A HD3  21 
ATOM   9597  H HE2  . LYS A 1 18 ? 11.133  14.969  0.510   1.00 1.56 ? 18 LYS A HE2  21 
ATOM   9598  H HE3  . LYS A 1 18 ? 9.977   15.884  -0.481  1.00 1.45 ? 18 LYS A HE3  21 
ATOM   9599  H HZ1  . LYS A 1 18 ? 9.186   14.309  1.914   1.00 1.47 ? 18 LYS A HZ1  21 
ATOM   9600  H HZ2  . LYS A 1 18 ? 9.539   15.968  1.972   1.00 1.56 ? 18 LYS A HZ2  21 
ATOM   9601  H HZ3  . LYS A 1 18 ? 8.227   15.414  1.040   1.00 1.41 ? 18 LYS A HZ3  21 
ATOM   9602  N N    . PRO A 1 19 ? 6.501   13.148  -3.762  1.00 1.08 ? 19 PRO A N    21 
ATOM   9603  C CA   . PRO A 1 19 ? 5.149   13.773  -3.836  1.00 1.12 ? 19 PRO A CA   21 
ATOM   9604  C C    . PRO A 1 19 ? 4.775   14.503  -2.524  1.00 1.17 ? 19 PRO A C    21 
ATOM   9605  O O    . PRO A 1 19 ? 4.062   15.489  -2.573  1.00 1.23 ? 19 PRO A O    21 
ATOM   9606  C CB   . PRO A 1 19 ? 4.208   12.608  -4.146  1.00 1.19 ? 19 PRO A CB   21 
ATOM   9607  C CG   . PRO A 1 19 ? 4.929   11.394  -3.671  1.00 1.19 ? 19 PRO A CG   21 
ATOM   9608  C CD   . PRO A 1 19 ? 6.398   11.676  -3.849  1.00 1.12 ? 19 PRO A CD   21 
ATOM   9609  H HA   . PRO A 1 19 ? 5.123   14.475  -4.655  1.00 1.13 ? 19 PRO A HA   21 
ATOM   9610  H HB2  . PRO A 1 19 ? 3.275   12.727  -3.612  1.00 1.27 ? 19 PRO A HB2  21 
ATOM   9611  H HB3  . PRO A 1 19 ? 4.029   12.540  -5.208  1.00 1.22 ? 19 PRO A HB3  21 
ATOM   9612  H HG2  . PRO A 1 19 ? 4.701   11.209  -2.633  1.00 1.24 ? 19 PRO A HG2  21 
ATOM   9613  H HG3  . PRO A 1 19 ? 4.650   10.540  -4.269  1.00 1.25 ? 19 PRO A HG3  21 
ATOM   9614  H HD2  . PRO A 1 19 ? 6.971   11.205  -3.061  1.00 1.13 ? 19 PRO A HD2  21 
ATOM   9615  H HD3  . PRO A 1 19 ? 6.734   11.338  -4.816  1.00 1.13 ? 19 PRO A HD3  21 
ATOM   9616  N N    . PRO A 1 20 ? 5.279   14.031  -1.393  1.00 1.20 ? 20 PRO A N    21 
ATOM   9617  C CA   . PRO A 1 20 ? 4.935   14.764  -0.138  1.00 1.30 ? 20 PRO A CA   21 
ATOM   9618  C C    . PRO A 1 20 ? 5.859   15.983  0.017   1.00 1.31 ? 20 PRO A C    21 
ATOM   9619  O O    . PRO A 1 20 ? 6.798   15.971  0.797   1.00 1.39 ? 20 PRO A O    21 
ATOM   9620  C CB   . PRO A 1 20 ? 5.169   13.750  0.978   1.00 1.38 ? 20 PRO A CB   21 
ATOM   9621  C CG   . PRO A 1 20 ? 6.167   12.801  0.422   1.00 1.32 ? 20 PRO A CG   21 
ATOM   9622  C CD   . PRO A 1 20 ? 5.942   12.752  -1.062  1.00 1.24 ? 20 PRO A CD   21 
ATOM   9623  H HA   . PRO A 1 20 ? 3.901   15.072  -0.150  1.00 1.34 ? 20 PRO A HA   21 
ATOM   9624  H HB2  . PRO A 1 20 ? 5.563   14.244  1.857   1.00 1.45 ? 20 PRO A HB2  21 
ATOM   9625  H HB3  . PRO A 1 20 ? 4.254   13.230  1.213   1.00 1.45 ? 20 PRO A HB3  21 
ATOM   9626  H HG2  . PRO A 1 20 ? 7.168   13.151  0.636   1.00 1.32 ? 20 PRO A HG2  21 
ATOM   9627  H HG3  . PRO A 1 20 ? 6.020   11.819  0.844   1.00 1.40 ? 20 PRO A HG3  21 
ATOM   9628  H HD2  . PRO A 1 20 ? 6.888   12.668  -1.579  1.00 1.21 ? 20 PRO A HD2  21 
ATOM   9629  H HD3  . PRO A 1 20 ? 5.300   11.926  -1.313  1.00 1.32 ? 20 PRO A HD3  21 
ATOM   9630  N N    . SER A 1 21 ? 5.607   17.027  -0.733  1.00 1.28 ? 21 SER A N    21 
ATOM   9631  C CA   . SER A 1 21 ? 6.469   18.248  -0.649  1.00 1.35 ? 21 SER A CA   21 
ATOM   9632  C C    . SER A 1 21 ? 5.662   19.498  -1.040  1.00 1.36 ? 21 SER A C    21 
ATOM   9633  O O    . SER A 1 21 ? 5.236   20.257  -0.190  1.00 1.51 ? 21 SER A O    21 
ATOM   9634  C CB   . SER A 1 21 ? 7.614   17.996  -1.639  1.00 1.31 ? 21 SER A CB   21 
ATOM   9635  O OG   . SER A 1 21 ? 7.079   17.697  -2.926  1.00 1.20 ? 21 SER A OG   21 
ATOM   9636  H H    . SER A 1 21 ? 4.854   17.003  -1.362  1.00 1.24 ? 21 SER A H    21 
ATOM   9637  H HA   . SER A 1 21 ? 6.864   18.359  0.348   1.00 1.47 ? 21 SER A HA   21 
ATOM   9638  H HB2  . SER A 1 21 ? 8.230   18.878  -1.709  1.00 1.43 ? 21 SER A HB2  21 
ATOM   9639  H HB3  . SER A 1 21 ? 8.216   17.169  -1.287  1.00 1.32 ? 21 SER A HB3  21 
ATOM   9640  H HG   . SER A 1 21 ? 7.223   16.758  -3.102  1.00 1.16 ? 21 SER A HG   21 
ATOM   9641  N N    . LYS A 1 22 ? 5.449   19.714  -2.316  1.00 1.27 ? 22 LYS A N    21 
ATOM   9642  C CA   . LYS A 1 22 ? 4.668   20.912  -2.764  1.00 1.31 ? 22 LYS A CA   21 
ATOM   9643  C C    . LYS A 1 22 ? 3.892   20.589  -4.051  1.00 1.25 ? 22 LYS A C    21 
ATOM   9644  O O    . LYS A 1 22 ? 4.047   21.242  -5.069  1.00 1.28 ? 22 LYS A O    21 
ATOM   9645  C CB   . LYS A 1 22 ? 5.714   22.013  -3.004  1.00 1.40 ? 22 LYS A CB   21 
ATOM   9646  C CG   . LYS A 1 22 ? 6.754   21.545  -4.032  1.00 1.39 ? 22 LYS A CG   21 
ATOM   9647  C CD   . LYS A 1 22 ? 7.219   22.740  -4.872  1.00 1.51 ? 22 LYS A CD   21 
ATOM   9648  C CE   . LYS A 1 22 ? 6.806   22.540  -6.335  1.00 1.51 ? 22 LYS A CE   21 
ATOM   9649  N NZ   . LYS A 1 22 ? 5.390   23.008  -6.410  1.00 1.50 ? 22 LYS A NZ   21 
ATOM   9650  H H    . LYS A 1 22 ? 5.803   19.084  -2.981  1.00 1.22 ? 22 LYS A H    21 
ATOM   9651  H HA   . LYS A 1 22 ? 3.984   21.220  -1.989  1.00 1.38 ? 22 LYS A HA   21 
ATOM   9652  H HB2  . LYS A 1 22 ? 5.220   22.900  -3.371  1.00 1.44 ? 22 LYS A HB2  21 
ATOM   9653  H HB3  . LYS A 1 22 ? 6.212   22.241  -2.073  1.00 1.48 ? 22 LYS A HB3  21 
ATOM   9654  H HG2  . LYS A 1 22 ? 7.601   21.116  -3.515  1.00 1.46 ? 22 LYS A HG2  21 
ATOM   9655  H HG3  . LYS A 1 22 ? 6.315   20.801  -4.678  1.00 1.33 ? 22 LYS A HG3  21 
ATOM   9656  H HD2  . LYS A 1 22 ? 6.770   23.646  -4.490  1.00 1.57 ? 22 LYS A HD2  21 
ATOM   9657  H HD3  . LYS A 1 22 ? 8.294   22.822  -4.813  1.00 1.61 ? 22 LYS A HD3  21 
ATOM   9658  H HE2  . LYS A 1 22 ? 7.436   23.133  -6.986  1.00 1.64 ? 22 LYS A HE2  21 
ATOM   9659  H HE3  . LYS A 1 22 ? 6.866   21.496  -6.604  1.00 1.46 ? 22 LYS A HE3  21 
ATOM   9660  H HZ1  . LYS A 1 22 ? 5.318   23.969  -6.016  1.00 1.61 ? 22 LYS A HZ1  21 
ATOM   9661  H HZ2  . LYS A 1 22 ? 5.078   23.016  -7.402  1.00 1.57 ? 22 LYS A HZ2  21 
ATOM   9662  H HZ3  . LYS A 1 22 ? 4.779   22.359  -5.863  1.00 1.39 ? 22 LYS A HZ3  21 
ATOM   9663  N N    . THR A 1 23 ? 3.057   19.582  -4.008  1.00 1.25 ? 23 THR A N    21 
ATOM   9664  C CA   . THR A 1 23 ? 2.265   19.201  -5.223  1.00 1.27 ? 23 THR A CA   21 
ATOM   9665  C C    . THR A 1 23 ? 0.991   20.057  -5.347  1.00 1.30 ? 23 THR A C    21 
ATOM   9666  O O    . THR A 1 23 ? 0.446   20.206  -6.424  1.00 1.43 ? 23 THR A O    21 
ATOM   9667  C CB   . THR A 1 23 ? 1.918   17.714  -5.031  1.00 1.38 ? 23 THR A CB   21 
ATOM   9668  O OG1  . THR A 1 23 ? 1.508   17.160  -6.274  1.00 1.47 ? 23 THR A OG1  21 
ATOM   9669  C CG2  . THR A 1 23 ? 0.789   17.555  -4.006  1.00 1.47 ? 23 THR A CG2  21 
ATOM   9670  H H    . THR A 1 23 ? 2.951   19.074  -3.175  1.00 1.27 ? 23 THR A H    21 
ATOM   9671  H HA   . THR A 1 23 ? 2.871   19.316  -6.108  1.00 1.29 ? 23 THR A HA   21 
ATOM   9672  H HB   . THR A 1 23 ? 2.792   17.187  -4.677  1.00 1.43 ? 23 THR A HB   21 
ATOM   9673  H HG1  . THR A 1 23 ? 0.770   17.678  -6.605  1.00 1.45 ? 23 THR A HG1  21 
ATOM   9674  H HG21 . THR A 1 23 ? 0.994   18.170  -3.143  1.00 1.83 ? 23 THR A HG21 21 
ATOM   9675  H HG22 . THR A 1 23 ? -0.147  17.858  -4.451  1.00 1.87 ? 23 THR A HG22 21 
ATOM   9676  H HG23 . THR A 1 23 ? 0.723   16.520  -3.702  1.00 1.72 ? 23 THR A HG23 21 
ATOM   9677  N N    . CYS A 1 24 ? 0.517   20.623  -4.261  1.00 1.28 ? 24 CYS A N    21 
ATOM   9678  C CA   . CYS A 1 24 ? -0.713  21.468  -4.324  1.00 1.39 ? 24 CYS A CA   21 
ATOM   9679  C C    . CYS A 1 24 ? -0.421  22.866  -3.766  1.00 1.17 ? 24 CYS A C    21 
ATOM   9680  O O    . CYS A 1 24 ? 0.043   23.013  -2.650  1.00 1.12 ? 24 CYS A O    21 
ATOM   9681  C CB   . CYS A 1 24 ? -1.740  20.742  -3.452  1.00 1.65 ? 24 CYS A CB   21 
ATOM   9682  S SG   . CYS A 1 24 ? -3.403  21.330  -3.859  1.00 2.05 ? 24 CYS A SG   21 
ATOM   9683  H H    . CYS A 1 24 ? 0.971   20.494  -3.404  1.00 1.27 ? 24 CYS A H    21 
ATOM   9684  H HA   . CYS A 1 24 ? -1.073  21.535  -5.338  1.00 1.63 ? 24 CYS A HA   21 
ATOM   9685  H HB2  . CYS A 1 24 ? -1.680  19.678  -3.633  1.00 1.85 ? 24 CYS A HB2  21 
ATOM   9686  H HB3  . CYS A 1 24 ? -1.534  20.941  -2.410  1.00 1.80 ? 24 CYS A HB3  21 
ATOM   9687  H HG   . CYS A 1 24 ? -3.399  22.289  -3.815  1.00 2.30 ? 24 CYS A HG   21 
ATOM   9688  N N    . LEU A 1 25 ? -0.683  23.892  -4.536  1.00 1.38 ? 25 LEU A N    21 
ATOM   9689  C CA   . LEU A 1 25 ? -0.414  25.284  -4.058  1.00 1.40 ? 25 LEU A CA   21 
ATOM   9690  C C    . LEU A 1 25 ? -1.665  26.155  -4.220  1.00 1.32 ? 25 LEU A C    21 
ATOM   9691  O O    . LEU A 1 25 ? -2.347  26.096  -5.227  1.00 1.94 ? 25 LEU A O    21 
ATOM   9692  C CB   . LEU A 1 25 ? 0.723   25.798  -4.948  1.00 2.03 ? 25 LEU A CB   21 
ATOM   9693  C CG   . LEU A 1 25 ? 1.993   24.984  -4.681  1.00 2.26 ? 25 LEU A CG   21 
ATOM   9694  C CD1  . LEU A 1 25 ? 2.259   24.046  -5.861  1.00 2.86 ? 25 LEU A CD1  21 
ATOM   9695  C CD2  . LEU A 1 25 ? 3.181   25.933  -4.510  1.00 2.63 ? 25 LEU A CD2  21 
ATOM   9696  H H    . LEU A 1 25 ? -1.050  23.749  -5.434  1.00 1.68 ? 25 LEU A H    21 
ATOM   9697  H HA   . LEU A 1 25 ? -0.096  25.272  -3.026  1.00 1.31 ? 25 LEU A HA   21 
ATOM   9698  H HB2  . LEU A 1 25 ? 0.439   25.697  -5.986  1.00 2.29 ? 25 LEU A HB2  21 
ATOM   9699  H HB3  . LEU A 1 25 ? 0.911   26.838  -4.725  1.00 2.23 ? 25 LEU A HB3  21 
ATOM   9700  H HG   . LEU A 1 25 ? 1.865   24.400  -3.782  1.00 1.99 ? 25 LEU A HG   21 
ATOM   9701  H HD11 . LEU A 1 25 ? 1.330   23.834  -6.369  1.00 3.18 ? 25 LEU A HD11 21 
ATOM   9702  H HD12 . LEU A 1 25 ? 2.945   24.518  -6.550  1.00 3.29 ? 25 LEU A HD12 21 
ATOM   9703  H HD13 . LEU A 1 25 ? 2.689   23.125  -5.499  1.00 3.07 ? 25 LEU A HD13 21 
ATOM   9704  H HD21 . LEU A 1 25 ? 2.924   26.707  -3.802  1.00 3.21 ? 25 LEU A HD21 21 
ATOM   9705  H HD22 . LEU A 1 25 ? 4.034   25.379  -4.144  1.00 2.52 ? 25 LEU A HD22 21 
ATOM   9706  H HD23 . LEU A 1 25 ? 3.425   26.381  -5.462  1.00 3.01 ? 25 LEU A HD23 21 
ATOM   9707  N N    . LYS A 1 26 ? -1.971  26.964  -3.236  1.00 0.97 ? 26 LYS A N    21 
ATOM   9708  C CA   . LYS A 1 26 ? -3.178  27.842  -3.329  1.00 0.87 ? 26 LYS A CA   21 
ATOM   9709  C C    . LYS A 1 26 ? -2.901  29.034  -4.254  1.00 1.32 ? 26 LYS A C    21 
ATOM   9710  O O    . LYS A 1 26 ? -2.267  29.998  -3.866  1.00 1.58 ? 26 LYS A O    21 
ATOM   9711  C CB   . LYS A 1 26 ? -3.436  28.328  -1.900  1.00 1.09 ? 26 LYS A CB   21 
ATOM   9712  C CG   . LYS A 1 26 ? -4.155  27.238  -1.103  1.00 1.71 ? 26 LYS A CG   21 
ATOM   9713  C CD   . LYS A 1 26 ? -4.046  27.549  0.394   1.00 2.53 ? 26 LYS A CD   21 
ATOM   9714  C CE   . LYS A 1 26 ? -5.364  28.155  0.895   1.00 3.21 ? 26 LYS A CE   21 
ATOM   9715  N NZ   . LYS A 1 26 ? -5.210  29.635  0.754   1.00 2.88 ? 26 LYS A NZ   21 
ATOM   9716  H H    . LYS A 1 26 ? -1.408  26.994  -2.436  1.00 1.21 ? 26 LYS A H    21 
ATOM   9717  H HA   . LYS A 1 26 ? -4.027  27.279  -3.685  1.00 1.21 ? 26 LYS A HA   21 
ATOM   9718  H HB2  . LYS A 1 26 ? -2.494  28.561  -1.424  1.00 1.51 ? 26 LYS A HB2  21 
ATOM   9719  H HB3  . LYS A 1 26 ? -4.051  29.215  -1.928  1.00 1.16 ? 26 LYS A HB3  21 
ATOM   9720  H HG2  . LYS A 1 26 ? -5.195  27.207  -1.393  1.00 2.07 ? 26 LYS A HG2  21 
ATOM   9721  H HG3  . LYS A 1 26 ? -3.696  26.282  -1.303  1.00 1.63 ? 26 LYS A HG3  21 
ATOM   9722  H HD2  . LYS A 1 26 ? -3.839  26.637  0.934   1.00 2.85 ? 26 LYS A HD2  21 
ATOM   9723  H HD3  . LYS A 1 26 ? -3.242  28.253  0.558   1.00 2.56 ? 26 LYS A HD3  21 
ATOM   9724  H HE2  . LYS A 1 26 ? -6.190  27.803  0.290   1.00 3.36 ? 26 LYS A HE2  21 
ATOM   9725  H HE3  . LYS A 1 26 ? -5.524  27.898  1.931   1.00 3.92 ? 26 LYS A HE3  21 
ATOM   9726  H HZ1  . LYS A 1 26 ? -4.351  29.857  0.202   1.00 2.61 ? 26 LYS A HZ1  21 
ATOM   9727  H HZ2  . LYS A 1 26 ? -6.043  30.029  0.260   1.00 2.53 ? 26 LYS A HZ2  21 
ATOM   9728  H HZ3  . LYS A 1 26 ? -5.129  30.069  1.697   1.00 3.44 ? 26 LYS A HZ3  21 
ATOM   9729  N N    . GLU A 1 27 ? -3.380  28.978  -5.470  1.00 1.95 ? 27 GLU A N    21 
ATOM   9730  C CA   . GLU A 1 27 ? -3.156  30.113  -6.422  1.00 2.62 ? 27 GLU A CA   21 
ATOM   9731  C C    . GLU A 1 27 ? -4.129  31.259  -6.098  1.00 2.34 ? 27 GLU A C    21 
ATOM   9732  O O    . GLU A 1 27 ? -4.963  31.632  -6.902  1.00 2.99 ? 27 GLU A O    21 
ATOM   9733  C CB   . GLU A 1 27 ? -3.435  29.531  -7.813  1.00 3.44 ? 27 GLU A CB   21 
ATOM   9734  C CG   . GLU A 1 27 ? -2.238  28.687  -8.267  1.00 3.80 ? 27 GLU A CG   21 
ATOM   9735  C CD   . GLU A 1 27 ? -1.257  29.562  -9.052  1.00 4.54 ? 27 GLU A CD   21 
ATOM   9736  O OE1  . GLU A 1 27 ? -1.434  29.682  -10.254 1.00 5.18 ? 27 GLU A OE1  21 
ATOM   9737  O OE2  . GLU A 1 27 ? -0.346  30.094  -8.441  1.00 4.62 ? 27 GLU A OE2  21 
ATOM   9738  H H    . GLU A 1 27 ? -3.891  28.192  -5.757  1.00 2.17 ? 27 GLU A H    21 
ATOM   9739  H HA   . GLU A 1 27 ? -2.136  30.458  -6.363  1.00 2.90 ? 27 GLU A HA   21 
ATOM   9740  H HB2  . GLU A 1 27 ? -4.319  28.911  -7.774  1.00 3.42 ? 27 GLU A HB2  21 
ATOM   9741  H HB3  . GLU A 1 27 ? -3.591  30.337  -8.515  1.00 3.93 ? 27 GLU A HB3  21 
ATOM   9742  H HG2  . GLU A 1 27 ? -1.738  28.277  -7.401  1.00 3.41 ? 27 GLU A HG2  21 
ATOM   9743  H HG3  . GLU A 1 27 ? -2.582  27.883  -8.897  1.00 4.06 ? 27 GLU A HG3  21 
ATOM   9744  N N    . GLU A 1 28 ? -4.029  31.807  -4.912  1.00 1.50 ? 28 GLU A N    21 
ATOM   9745  C CA   . GLU A 1 28 ? -4.941  32.917  -4.501  1.00 1.20 ? 28 GLU A CA   21 
ATOM   9746  C C    . GLU A 1 28 ? -4.238  33.822  -3.469  1.00 1.52 ? 28 GLU A C    21 
ATOM   9747  O O    . GLU A 1 28 ? -3.042  34.034  -3.538  1.00 2.23 ? 28 GLU A O    21 
ATOM   9748  C CB   . GLU A 1 28 ? -6.153  32.199  -3.887  1.00 0.91 ? 28 GLU A CB   21 
ATOM   9749  C CG   . GLU A 1 28 ? -5.723  31.418  -2.633  1.00 1.02 ? 28 GLU A CG   21 
ATOM   9750  C CD   . GLU A 1 28 ? -6.704  31.677  -1.484  1.00 1.69 ? 28 GLU A CD   21 
ATOM   9751  O OE1  . GLU A 1 28 ? -7.052  32.827  -1.266  1.00 1.93 ? 28 GLU A OE1  21 
ATOM   9752  O OE2  . GLU A 1 28 ? -7.083  30.717  -0.831  1.00 2.19 ? 28 GLU A OE2  21 
ATOM   9753  H H    . GLU A 1 28 ? -3.355  31.478  -4.281  1.00 1.24 ? 28 GLU A H    21 
ATOM   9754  H HA   . GLU A 1 28 ? -5.247  33.491  -5.360  1.00 1.64 ? 28 GLU A HA   21 
ATOM   9755  H HB2  . GLU A 1 28 ? -6.903  32.926  -3.621  1.00 1.01 ? 28 GLU A HB2  21 
ATOM   9756  H HB3  . GLU A 1 28 ? -6.561  31.510  -4.611  1.00 1.43 ? 28 GLU A HB3  21 
ATOM   9757  H HG2  . GLU A 1 28 ? -5.708  30.362  -2.857  1.00 1.06 ? 28 GLU A HG2  21 
ATOM   9758  H HG3  . GLU A 1 28 ? -4.734  31.733  -2.332  1.00 1.31 ? 28 GLU A HG3  21 
ATOM   9759  N N    . MET A 1 29 ? -4.966  34.349  -2.513  1.00 1.53 ? 29 MET A N    21 
ATOM   9760  C CA   . MET A 1 29 ? -4.332  35.225  -1.481  1.00 2.43 ? 29 MET A CA   21 
ATOM   9761  C C    . MET A 1 29 ? -3.723  34.359  -0.365  1.00 2.99 ? 29 MET A C    21 
ATOM   9762  O O    . MET A 1 29 ? -4.278  34.240  0.712   1.00 3.43 ? 29 MET A O    21 
ATOM   9763  C CB   . MET A 1 29 ? -5.473  36.096  -0.943  1.00 2.47 ? 29 MET A CB   21 
ATOM   9764  C CG   . MET A 1 29 ? -4.893  37.292  -0.184  1.00 3.26 ? 29 MET A CG   21 
ATOM   9765  S SD   . MET A 1 29 ? -6.218  38.466  0.193   1.00 3.36 ? 29 MET A SD   21 
ATOM   9766  C CE   . MET A 1 29 ? -5.246  39.576  1.240   1.00 4.25 ? 29 MET A CE   21 
ATOM   9767  H H    . MET A 1 29 ? -5.928  34.161  -2.466  1.00 1.25 ? 29 MET A H    21 
ATOM   9768  H HA   . MET A 1 29 ? -3.572  35.846  -1.930  1.00 2.83 ? 29 MET A HA   21 
ATOM   9769  H HB2  . MET A 1 29 ? -6.074  36.450  -1.768  1.00 1.95 ? 29 MET A HB2  21 
ATOM   9770  H HB3  . MET A 1 29 ? -6.088  35.512  -0.275  1.00 2.73 ? 29 MET A HB3  21 
ATOM   9771  H HG2  . MET A 1 29 ? -4.441  36.950  0.736   1.00 3.77 ? 29 MET A HG2  21 
ATOM   9772  H HG3  . MET A 1 29 ? -4.145  37.778  -0.794  1.00 3.71 ? 29 MET A HG3  21 
ATOM   9773  H HE1  . MET A 1 29 ? -4.659  38.993  1.937   1.00 4.51 ? 29 MET A HE1  21 
ATOM   9774  H HE2  . MET A 1 29 ? -4.591  40.172  0.620   1.00 4.67 ? 29 MET A HE2  21 
ATOM   9775  H HE3  . MET A 1 29 ? -5.908  40.228  1.789   1.00 4.59 ? 29 MET A HE3  21 
ATOM   9776  N N    . ALA A 1 30 ? -2.585  33.756  -0.630  1.00 3.19 ? 30 ALA A N    21 
ATOM   9777  C CA   . ALA A 1 30 ? -1.910  32.882  0.388   1.00 3.77 ? 30 ALA A CA   21 
ATOM   9778  C C    . ALA A 1 30 ? -2.806  31.681  0.751   1.00 3.38 ? 30 ALA A C    21 
ATOM   9779  O O    . ALA A 1 30 ? -2.936  30.800  -0.084  1.00 2.80 ? 30 ALA A O    21 
ATOM   9780  C CB   . ALA A 1 30 ? -1.654  33.791  1.600   1.00 4.72 ? 30 ALA A CB   21 
ATOM   9781  O OXT  . ALA A 1 30 ? -3.346  31.656  1.849   1.00 3.88 ? 30 ALA A OXT  21 
ATOM   9782  H H    . ALA A 1 30 ? -2.172  33.873  -1.511  1.00 3.11 ? 30 ALA A H    21 
ATOM   9783  H HA   . ALA A 1 30 ? -0.968  32.527  -0.002  1.00 3.97 ? 30 ALA A HA   21 
ATOM   9784  H HB1  . ALA A 1 30 ? -1.295  34.751  1.263   1.00 5.11 ? 30 ALA A HB1  21 
ATOM   9785  H HB2  . ALA A 1 30 ? -2.574  33.924  2.151   1.00 4.95 ? 30 ALA A HB2  21 
ATOM   9786  H HB3  . ALA A 1 30 ? -0.915  33.335  2.241   1.00 5.07 ? 30 ALA A HB3  21 
ATOM   9787  N N    . MET A 1 1  ? -9.170  11.635  4.976   1.00 2.61 ? 1  MET A N    22 
ATOM   9788  C CA   . MET A 1 1  ? -9.708  10.597  5.910   1.00 2.48 ? 1  MET A CA   22 
ATOM   9789  C C    . MET A 1 1  ? -8.800  10.467  7.142   1.00 2.00 ? 1  MET A C    22 
ATOM   9790  O O    . MET A 1 1  ? -7.741  11.062  7.207   1.00 1.84 ? 1  MET A O    22 
ATOM   9791  C CB   . MET A 1 1  ? -9.712  9.291   5.105   1.00 2.65 ? 1  MET A CB   22 
ATOM   9792  C CG   . MET A 1 1  ? -11.155 8.839   4.865   1.00 3.24 ? 1  MET A CG   22 
ATOM   9793  S SD   . MET A 1 1  ? -11.962 9.978   3.711   1.00 3.64 ? 1  MET A SD   22 
ATOM   9794  C CE   . MET A 1 1  ? -13.417 8.959   3.365   1.00 4.41 ? 1  MET A CE   22 
ATOM   9795  H H1   . MET A 1 1  ? -8.168  11.437  4.775   1.00 2.79 ? 1  MET A H1   22 
ATOM   9796  H H2   . MET A 1 1  ? -9.712  11.618  4.088   1.00 2.91 ? 1  MET A H2   22 
ATOM   9797  H H3   . MET A 1 1  ? -9.256  12.574  5.414   1.00 2.67 ? 1  MET A H3   22 
ATOM   9798  H HA   . MET A 1 1  ? -10.712 10.847  6.212   1.00 2.77 ? 1  MET A HA   22 
ATOM   9799  H HB2  . MET A 1 1  ? -9.223  9.451   4.155   1.00 2.72 ? 1  MET A HB2  22 
ATOM   9800  H HB3  . MET A 1 1  ? -9.185  8.526   5.654   1.00 2.49 ? 1  MET A HB3  22 
ATOM   9801  H HG2  . MET A 1 1  ? -11.156 7.843   4.446   1.00 3.47 ? 1  MET A HG2  22 
ATOM   9802  H HG3  . MET A 1 1  ? -11.693 8.835   5.801   1.00 3.38 ? 1  MET A HG3  22 
ATOM   9803  H HE1  . MET A 1 1  ? -13.101 8.007   2.963   1.00 4.78 ? 1  MET A HE1  22 
ATOM   9804  H HE2  . MET A 1 1  ? -13.972 8.805   4.279   1.00 4.64 ? 1  MET A HE2  22 
ATOM   9805  H HE3  . MET A 1 1  ? -14.045 9.460   2.646   1.00 4.69 ? 1  MET A HE3  22 
ATOM   9806  N N    . ILE A 1 2  ? -9.208  9.691   8.116   1.00 1.89 ? 2  ILE A N    22 
ATOM   9807  C CA   . ILE A 1 2  ? -8.370  9.519   9.347   1.00 1.51 ? 2  ILE A CA   22 
ATOM   9808  C C    . ILE A 1 2  ? -7.499  8.258   9.234   1.00 1.20 ? 2  ILE A C    22 
ATOM   9809  O O    . ILE A 1 2  ? -7.719  7.416   8.382   1.00 1.41 ? 2  ILE A O    22 
ATOM   9810  C CB   . ILE A 1 2  ? -9.360  9.391   10.517  1.00 1.65 ? 2  ILE A CB   22 
ATOM   9811  C CG1  . ILE A 1 2  ? -10.276 8.177   10.306  1.00 1.89 ? 2  ILE A CG1  22 
ATOM   9812  C CG2  . ILE A 1 2  ? -10.214 10.659  10.612  1.00 2.00 ? 2  ILE A CG2  22 
ATOM   9813  C CD1  . ILE A 1 2  ? -10.417 7.408   11.622  1.00 2.01 ? 2  ILE A CD1  22 
ATOM   9814  H H    . ILE A 1 2  ? -10.065 9.221   8.038   1.00 2.16 ? 2  ILE A H    22 
ATOM   9815  H HA   . ILE A 1 2  ? -7.744  10.387  9.494   1.00 1.53 ? 2  ILE A HA   22 
ATOM   9816  H HB   . ILE A 1 2  ? -8.808  9.268   11.438  1.00 1.53 ? 2  ILE A HB   22 
ATOM   9817  H HG12 . ILE A 1 2  ? -11.250 8.513   9.979   1.00 2.21 ? 2  ILE A HG12 22 
ATOM   9818  H HG13 . ILE A 1 2  ? -9.850  7.528   9.557   1.00 1.91 ? 2  ILE A HG13 22 
ATOM   9819  H HG21 . ILE A 1 2  ? -9.577  11.529  10.544  1.00 2.10 ? 2  ILE A HG21 22 
ATOM   9820  H HG22 . ILE A 1 2  ? -10.931 10.672  9.804   1.00 2.47 ? 2  ILE A HG22 22 
ATOM   9821  H HG23 . ILE A 1 2  ? -10.738 10.669  11.556  1.00 2.34 ? 2  ILE A HG23 22 
ATOM   9822  H HD11 . ILE A 1 2  ? -10.832 8.059   12.376  1.00 2.30 ? 2  ILE A HD11 22 
ATOM   9823  H HD12 . ILE A 1 2  ? -11.072 6.562   11.475  1.00 2.23 ? 2  ILE A HD12 22 
ATOM   9824  H HD13 . ILE A 1 2  ? -9.446  7.060   11.940  1.00 2.37 ? 2  ILE A HD13 22 
ATOM   9825  N N    . SER A 1 3  ? -6.514  8.127   10.086  1.00 0.92 ? 3  SER A N    22 
ATOM   9826  C CA   . SER A 1 3  ? -5.623  6.924   10.037  1.00 0.84 ? 3  SER A CA   22 
ATOM   9827  C C    . SER A 1 3  ? -5.613  6.210   11.397  1.00 0.95 ? 3  SER A C    22 
ATOM   9828  O O    . SER A 1 3  ? -6.512  6.379   12.199  1.00 1.07 ? 3  SER A O    22 
ATOM   9829  C CB   . SER A 1 3  ? -4.238  7.480   9.702   1.00 0.71 ? 3  SER A CB   22 
ATOM   9830  O OG   . SER A 1 3  ? -3.379  6.409   9.331   1.00 0.93 ? 3  SER A OG   22 
ATOM   9831  H H    . SER A 1 3  ? -6.359  8.819   10.762  1.00 0.96 ? 3  SER A H    22 
ATOM   9832  H HA   . SER A 1 3  ? -5.945  6.249   9.259   1.00 1.04 ? 3  SER A HA   22 
ATOM   9833  H HB2  . SER A 1 3  ? -4.315  8.174   8.882   1.00 0.69 ? 3  SER A HB2  22 
ATOM   9834  H HB3  . SER A 1 3  ? -3.840  7.993   10.568  1.00 0.74 ? 3  SER A HB3  22 
ATOM   9835  H HG   . SER A 1 3  ? -2.731  6.751   8.705   1.00 0.95 ? 3  SER A HG   22 
ATOM   9836  N N    . SER A 1 4  ? -4.608  5.408   11.662  1.00 1.07 ? 4  SER A N    22 
ATOM   9837  C CA   . SER A 1 4  ? -4.549  4.681   12.971  1.00 1.31 ? 4  SER A CA   22 
ATOM   9838  C C    . SER A 1 4  ? -3.121  4.689   13.538  1.00 1.36 ? 4  SER A C    22 
ATOM   9839  O O    . SER A 1 4  ? -2.832  5.382   14.495  1.00 1.35 ? 4  SER A O    22 
ATOM   9840  C CB   . SER A 1 4  ? -5.006  3.252   12.656  1.00 1.54 ? 4  SER A CB   22 
ATOM   9841  O OG   . SER A 1 4  ? -4.154  2.683   11.666  1.00 1.54 ? 4  SER A OG   22 
ATOM   9842  H H    . SER A 1 4  ? -3.894  5.283   11.000  1.00 1.10 ? 4  SER A H    22 
ATOM   9843  H HA   . SER A 1 4  ? -5.225  5.130   13.675  1.00 1.36 ? 4  SER A HA   22 
ATOM   9844  H HB2  . SER A 1 4  ? -4.959  2.652   13.550  1.00 1.76 ? 4  SER A HB2  22 
ATOM   9845  H HB3  . SER A 1 4  ? -6.028  3.275   12.296  1.00 1.57 ? 4  SER A HB3  22 
ATOM   9846  H HG   . SER A 1 4  ? -4.707  2.256   11.006  1.00 1.64 ? 4  SER A HG   22 
ATOM   9847  N N    . VAL A 1 5  ? -2.236  3.921   12.958  1.00 1.51 ? 5  VAL A N    22 
ATOM   9848  C CA   . VAL A 1 5  ? -0.824  3.872   13.462  1.00 1.68 ? 5  VAL A CA   22 
ATOM   9849  C C    . VAL A 1 5  ? 0.014   5.022   12.878  1.00 1.56 ? 5  VAL A C    22 
ATOM   9850  O O    . VAL A 1 5  ? 1.048   5.379   13.411  1.00 1.71 ? 5  VAL A O    22 
ATOM   9851  C CB   . VAL A 1 5  ? -0.288  2.508   13.004  1.00 1.98 ? 5  VAL A CB   22 
ATOM   9852  C CG1  . VAL A 1 5  ? 0.072   2.551   11.514  1.00 1.97 ? 5  VAL A CG1  22 
ATOM   9853  C CG2  . VAL A 1 5  ? 0.960   2.153   13.815  1.00 2.27 ? 5  VAL A CG2  22 
ATOM   9854  H H    . VAL A 1 5  ? -2.504  3.370   12.193  1.00 1.57 ? 5  VAL A H    22 
ATOM   9855  H HA   . VAL A 1 5  ? -0.815  3.924   14.535  1.00 1.75 ? 5  VAL A HA   22 
ATOM   9856  H HB   . VAL A 1 5  ? -1.047  1.757   13.164  1.00 2.06 ? 5  VAL A HB   22 
ATOM   9857  H HG11 . VAL A 1 5  ? -0.731  3.017   10.962  1.00 2.25 ? 5  VAL A HG11 22 
ATOM   9858  H HG12 . VAL A 1 5  ? 0.980   3.120   11.379  1.00 2.33 ? 5  VAL A HG12 22 
ATOM   9859  H HG13 . VAL A 1 5  ? 0.221   1.545   11.152  1.00 1.99 ? 5  VAL A HG13 22 
ATOM   9860  H HG21 . VAL A 1 5  ? 1.713   2.914   13.671  1.00 2.66 ? 5  VAL A HG21 22 
ATOM   9861  H HG22 . VAL A 1 5  ? 0.704   2.094   14.863  1.00 2.49 ? 5  VAL A HG22 22 
ATOM   9862  H HG23 . VAL A 1 5  ? 1.345   1.199   13.485  1.00 2.48 ? 5  VAL A HG23 22 
ATOM   9863  N N    . CYS A 1 6  ? -0.425  5.598   11.791  1.00 1.35 ? 6  CYS A N    22 
ATOM   9864  C CA   . CYS A 1 6  ? 0.336   6.721   11.166  1.00 1.27 ? 6  CYS A CA   22 
ATOM   9865  C C    . CYS A 1 6  ? -0.635  7.812   10.689  1.00 1.06 ? 6  CYS A C    22 
ATOM   9866  O O    . CYS A 1 6  ? -1.725  7.954   11.210  1.00 0.99 ? 6  CYS A O    22 
ATOM   9867  C CB   . CYS A 1 6  ? 1.070   6.079   9.984   1.00 1.32 ? 6  CYS A CB   22 
ATOM   9868  S SG   . CYS A 1 6  ? 2.730   6.785   9.846   1.00 1.54 ? 6  CYS A SG   22 
ATOM   9869  H H    . CYS A 1 6  ? -1.258  5.291   11.384  1.00 1.29 ? 6  CYS A H    22 
ATOM   9870  H HA   . CYS A 1 6  ? 1.048   7.132   11.864  1.00 1.40 ? 6  CYS A HA   22 
ATOM   9871  H HB2  . CYS A 1 6  ? 1.146   5.013   10.144  1.00 1.48 ? 6  CYS A HB2  22 
ATOM   9872  H HB3  . CYS A 1 6  ? 0.522   6.266   9.072   1.00 1.20 ? 6  CYS A HB3  22 
ATOM   9873  H HG   . CYS A 1 6  ? 3.076   6.567   8.978   1.00 1.74 ? 6  CYS A HG   22 
ATOM   9874  N N    . VAL A 1 7  ? -0.248  8.579   9.703   1.00 1.03 ? 7  VAL A N    22 
ATOM   9875  C CA   . VAL A 1 7  ? -1.140  9.655   9.181   1.00 0.94 ? 7  VAL A CA   22 
ATOM   9876  C C    . VAL A 1 7  ? -1.720  9.209   7.827   1.00 0.85 ? 7  VAL A C    22 
ATOM   9877  O O    . VAL A 1 7  ? -2.072  8.059   7.649   1.00 0.83 ? 7  VAL A O    22 
ATOM   9878  C CB   . VAL A 1 7  ? -0.239  10.900  9.034   1.00 1.11 ? 7  VAL A CB   22 
ATOM   9879  C CG1  . VAL A 1 7  ? -1.103  12.166  9.057   1.00 1.21 ? 7  VAL A CG1  22 
ATOM   9880  C CG2  . VAL A 1 7  ? 0.765   10.970  10.191  1.00 1.30 ? 7  VAL A CG2  22 
ATOM   9881  H H    . VAL A 1 7  ? 0.630   8.445   9.299   1.00 1.12 ? 7  VAL A H    22 
ATOM   9882  H HA   . VAL A 1 7  ? -1.936  9.856   9.877   1.00 0.93 ? 7  VAL A HA   22 
ATOM   9883  H HB   . VAL A 1 7  ? 0.295   10.847  8.096   1.00 1.11 ? 7  VAL A HB   22 
ATOM   9884  H HG11 . VAL A 1 7  ? -2.145  11.893  8.969   1.00 1.42 ? 7  VAL A HG11 22 
ATOM   9885  H HG12 . VAL A 1 7  ? -0.946  12.692  9.987   1.00 1.68 ? 7  VAL A HG12 22 
ATOM   9886  H HG13 . VAL A 1 7  ? -0.827  12.805  8.231   1.00 1.50 ? 7  VAL A HG13 22 
ATOM   9887  H HG21 . VAL A 1 7  ? 0.268   10.711  11.115  1.00 1.47 ? 7  VAL A HG21 22 
ATOM   9888  H HG22 . VAL A 1 7  ? 1.572   10.276  10.009  1.00 2.03 ? 7  VAL A HG22 22 
ATOM   9889  H HG23 . VAL A 1 7  ? 1.161   11.971  10.263  1.00 1.26 ? 7  VAL A HG23 22 
HETATM 9890  N N    . SEP A 1 8  ? -1.815  10.101  6.878   1.00 0.88 ? 8  SEP A N    22 
HETATM 9891  C CA   . SEP A 1 8  ? -2.364  9.726   5.538   1.00 0.87 ? 8  SEP A CA   22 
HETATM 9892  C CB   . SEP A 1 8  ? -3.262  10.895  5.133   1.00 0.99 ? 8  SEP A CB   22 
HETATM 9893  O OG   . SEP A 1 8  ? -4.633  10.519  5.314   1.00 1.05 ? 8  SEP A OG   22 
HETATM 9894  C C    . SEP A 1 8  ? -1.231  9.540   4.522   1.00 0.82 ? 8  SEP A C    22 
HETATM 9895  O O    . SEP A 1 8  ? -1.364  8.794   3.571   1.00 0.83 ? 8  SEP A O    22 
HETATM 9896  P P    . SEP A 1 8  ? -5.479  9.896   4.095   1.00 1.16 ? 8  SEP A P    22 
HETATM 9897  O O1P  . SEP A 1 8  ? -6.797  9.469   4.617   1.00 1.44 ? 8  SEP A O1P  22 
HETATM 9898  O O2P  . SEP A 1 8  ? -5.409  10.836  2.955   1.00 1.48 ? 8  SEP A O2P  22 
HETATM 9899  O O3P  . SEP A 1 8  ? -4.637  8.578   3.713   1.00 1.46 ? 8  SEP A O3P  22 
HETATM 9900  H H    . SEP A 1 8  ? -1.523  11.015  7.044   1.00 0.96 ? 8  SEP A H    22 
HETATM 9901  H HA   . SEP A 1 8  ? -2.947  8.825   5.612   1.00 0.88 ? 8  SEP A HA   22 
HETATM 9902  H HB2  . SEP A 1 8  ? -3.080  11.146  4.097   1.00 1.04 ? 8  SEP A HB2  22 
HETATM 9903  H HB3  . SEP A 1 8  ? -3.044  11.751  5.751   1.00 1.04 ? 8  SEP A HB3  22 
HETATM 9904  H HOP3 . SEP A 1 8  ? -3.783  8.871   3.388   1.00 1.73 ? 8  SEP A HOP3 22 
ATOM   9905  N N    . SER A 1 9  ? -0.123  10.218  4.725   1.00 0.83 ? 9  SER A N    22 
ATOM   9906  C CA   . SER A 1 9  ? 1.047   10.109  3.794   1.00 0.82 ? 9  SER A CA   22 
ATOM   9907  C C    . SER A 1 9  ? 0.682   10.570  2.376   1.00 0.86 ? 9  SER A C    22 
ATOM   9908  O O    . SER A 1 9  ? -0.377  11.119  2.131   1.00 1.10 ? 9  SER A O    22 
ATOM   9909  C CB   . SER A 1 9  ? 1.460   8.627   3.809   1.00 0.76 ? 9  SER A CB   22 
ATOM   9910  O OG   . SER A 1 9  ? 0.862   7.939   2.713   1.00 0.75 ? 9  SER A OG   22 
ATOM   9911  H H    . SER A 1 9  ? -0.058  10.805  5.499   1.00 0.87 ? 9  SER A H    22 
ATOM   9912  H HA   . SER A 1 9  ? 1.864   10.709  4.167   1.00 0.90 ? 9  SER A HA   22 
ATOM   9913  H HB2  . SER A 1 9  ? 2.531   8.553   3.724   1.00 0.83 ? 9  SER A HB2  22 
ATOM   9914  H HB3  . SER A 1 9  ? 1.146   8.178   4.742   1.00 0.83 ? 9  SER A HB3  22 
ATOM   9915  H HG   . SER A 1 9  ? -0.096  7.999   2.810   1.00 0.78 ? 9  SER A HG   22 
ATOM   9916  N N    . TYR A 1 10 ? 1.577   10.348  1.454   1.00 0.95 ? 10 TYR A N    22 
ATOM   9917  C CA   . TYR A 1 10 ? 1.350   10.752  0.026   1.00 1.01 ? 10 TYR A CA   22 
ATOM   9918  C C    . TYR A 1 10 ? 0.178   9.972   -0.609  1.00 1.04 ? 10 TYR A C    22 
ATOM   9919  O O    . TYR A 1 10 ? -0.576  9.298   0.066   1.00 1.20 ? 10 TYR A O    22 
ATOM   9920  C CB   . TYR A 1 10 ? 2.677   10.435  -0.691  1.00 0.99 ? 10 TYR A CB   22 
ATOM   9921  C CG   . TYR A 1 10 ? 3.097   8.981   -0.507  1.00 0.87 ? 10 TYR A CG   22 
ATOM   9922  C CD1  . TYR A 1 10 ? 2.227   8.029   0.051   1.00 0.87 ? 10 TYR A CD1  22 
ATOM   9923  C CD2  . TYR A 1 10 ? 4.376   8.592   -0.914  1.00 0.82 ? 10 TYR A CD2  22 
ATOM   9924  C CE1  . TYR A 1 10 ? 2.639   6.702   0.196   1.00 0.83 ? 10 TYR A CE1  22 
ATOM   9925  C CE2  . TYR A 1 10 ? 4.786   7.264   -0.769  1.00 0.77 ? 10 TYR A CE2  22 
ATOM   9926  C CZ   . TYR A 1 10 ? 3.918   6.318   -0.215  1.00 0.77 ? 10 TYR A CZ   22 
ATOM   9927  O OH   . TYR A 1 10 ? 4.324   5.007   -0.073  1.00 0.80 ? 10 TYR A OH   22 
ATOM   9928  H H    . TYR A 1 10 ? 2.417   9.914   1.708   1.00 1.16 ? 10 TYR A H    22 
ATOM   9929  H HA   . TYR A 1 10 ? 1.158   11.810  -0.029  1.00 1.09 ? 10 TYR A HA   22 
ATOM   9930  H HB2  . TYR A 1 10 ? 2.566   10.634  -1.744  1.00 1.05 ? 10 TYR A HB2  22 
ATOM   9931  H HB3  . TYR A 1 10 ? 3.451   11.074  -0.292  1.00 1.03 ? 10 TYR A HB3  22 
ATOM   9932  H HD1  . TYR A 1 10 ? 1.241   8.320   0.377   1.00 0.95 ? 10 TYR A HD1  22 
ATOM   9933  H HD2  . TYR A 1 10 ? 5.047   9.321   -1.340  1.00 0.88 ? 10 TYR A HD2  22 
ATOM   9934  H HE1  . TYR A 1 10 ? 1.966   5.974   0.621   1.00 0.89 ? 10 TYR A HE1  22 
ATOM   9935  H HE2  . TYR A 1 10 ? 5.773   6.969   -1.088  1.00 0.78 ? 10 TYR A HE2  22 
ATOM   9936  H HH   . TYR A 1 10 ? 4.479   4.844   0.860   1.00 0.91 ? 10 TYR A HH   22 
ATOM   9937  N N    . ARG A 1 11 ? 0.024   10.059  -1.909  1.00 1.00 ? 11 ARG A N    22 
ATOM   9938  C CA   . ARG A 1 11 ? -1.089  9.327   -2.590  1.00 1.09 ? 11 ARG A CA   22 
ATOM   9939  C C    . ARG A 1 11 ? -0.663  7.893   -2.945  1.00 1.02 ? 11 ARG A C    22 
ATOM   9940  O O    . ARG A 1 11 ? -0.839  7.441   -4.062  1.00 1.09 ? 11 ARG A O    22 
ATOM   9941  C CB   . ARG A 1 11 ? -1.375  10.143  -3.857  1.00 1.20 ? 11 ARG A CB   22 
ATOM   9942  C CG   . ARG A 1 11 ? -2.835  10.597  -3.856  1.00 1.40 ? 11 ARG A CG   22 
ATOM   9943  C CD   . ARG A 1 11 ? -3.545  10.058  -5.103  1.00 1.52 ? 11 ARG A CD   22 
ATOM   9944  N NE   . ARG A 1 11 ? -3.741  8.600   -4.842  1.00 1.51 ? 11 ARG A NE   22 
ATOM   9945  C CZ   . ARG A 1 11 ? -3.640  7.741   -5.816  1.00 1.54 ? 11 ARG A CZ   22 
ATOM   9946  N NH1  . ARG A 1 11 ? -4.644  7.555   -6.625  1.00 1.75 ? 11 ARG A NH1  22 
ATOM   9947  N NH2  . ARG A 1 11 ? -2.538  7.067   -5.976  1.00 1.42 ? 11 ARG A NH2  22 
ATOM   9948  H H    . ARG A 1 11 ? 0.639   10.607  -2.437  1.00 0.98 ? 11 ARG A H    22 
ATOM   9949  H HA   . ARG A 1 11 ? -1.961  9.308   -1.961  1.00 1.19 ? 11 ARG A HA   22 
ATOM   9950  H HB2  . ARG A 1 11 ? -0.729  11.009  -3.880  1.00 1.17 ? 11 ARG A HB2  22 
ATOM   9951  H HB3  . ARG A 1 11 ? -1.188  9.534   -4.729  1.00 1.23 ? 11 ARG A HB3  22 
ATOM   9952  H HG2  . ARG A 1 11 ? -3.325  10.223  -2.969  1.00 1.42 ? 11 ARG A HG2  22 
ATOM   9953  H HG3  . ARG A 1 11 ? -2.873  11.676  -3.860  1.00 1.49 ? 11 ARG A HG3  22 
ATOM   9954  H HD2  . ARG A 1 11 ? -4.500  10.552  -5.232  1.00 1.73 ? 11 ARG A HD2  22 
ATOM   9955  H HD3  . ARG A 1 11 ? -2.927  10.199  -5.978  1.00 1.50 ? 11 ARG A HD3  22 
ATOM   9956  H HE   . ARG A 1 11 ? -3.944  8.288   -3.937  1.00 1.56 ? 11 ARG A HE   22 
ATOM   9957  H HH11 . ARG A 1 11 ? -5.490  8.071   -6.496  1.00 1.85 ? 11 ARG A HH11 22 
ATOM   9958  H HH12 . ARG A 1 11 ? -4.571  6.895   -7.373  1.00 1.83 ? 11 ARG A HH12 22 
ATOM   9959  H HH21 . ARG A 1 11 ? -1.768  7.211   -5.346  1.00 1.29 ? 11 ARG A HH21 22 
ATOM   9960  H HH22 . ARG A 1 11 ? -2.457  6.407   -6.720  1.00 1.50 ? 11 ARG A HH22 22 
ATOM   9961  N N    . GLY A 1 12 ? -0.094  7.181   -2.004  1.00 0.92 ? 12 GLY A N    22 
ATOM   9962  C CA   . GLY A 1 12 ? 0.361   5.782   -2.277  1.00 0.89 ? 12 GLY A CA   22 
ATOM   9963  C C    . GLY A 1 12 ? 1.505   5.819   -3.289  1.00 0.78 ? 12 GLY A C    22 
ATOM   9964  O O    . GLY A 1 12 ? 1.688   4.910   -4.074  1.00 0.78 ? 12 GLY A O    22 
ATOM   9965  H H    . GLY A 1 12 ? 0.047   7.571   -1.122  1.00 0.90 ? 12 GLY A H    22 
ATOM   9966  H HA2  . GLY A 1 12 ? 0.708   5.330   -1.358  1.00 0.87 ? 12 GLY A HA2  22 
ATOM   9967  H HA3  . GLY A 1 12 ? -0.454  5.205   -2.681  1.00 1.01 ? 12 GLY A HA3  22 
ATOM   9968  N N    . ARG A 1 13 ? 2.261   6.883   -3.277  1.00 0.76 ? 13 ARG A N    22 
ATOM   9969  C CA   . ARG A 1 13 ? 3.391   7.031   -4.235  1.00 0.70 ? 13 ARG A CA   22 
ATOM   9970  C C    . ARG A 1 13 ? 4.659   6.360   -3.686  1.00 0.60 ? 13 ARG A C    22 
ATOM   9971  O O    . ARG A 1 13 ? 5.677   6.996   -3.485  1.00 0.61 ? 13 ARG A O    22 
ATOM   9972  C CB   . ARG A 1 13 ? 3.577   8.546   -4.357  1.00 0.81 ? 13 ARG A CB   22 
ATOM   9973  C CG   . ARG A 1 13 ? 2.264   9.196   -4.815  1.00 0.96 ? 13 ARG A CG   22 
ATOM   9974  C CD   . ARG A 1 13 ? 2.536   10.136  -5.993  1.00 1.06 ? 13 ARG A CD   22 
ATOM   9975  N NE   . ARG A 1 13 ? 3.209   11.327  -5.395  1.00 1.21 ? 13 ARG A NE   22 
ATOM   9976  C CZ   . ARG A 1 13 ? 4.189   11.908  -6.026  1.00 1.32 ? 13 ARG A CZ   22 
ATOM   9977  N NH1  . ARG A 1 13 ? 5.382   11.387  -5.993  1.00 1.54 ? 13 ARG A NH1  22 
ATOM   9978  N NH2  . ARG A 1 13 ? 3.975   13.010  -6.684  1.00 1.42 ? 13 ARG A NH2  22 
ATOM   9979  H H    . ARG A 1 13 ? 2.075   7.600   -2.639  1.00 0.85 ? 13 ARG A H    22 
ATOM   9980  H HA   . ARG A 1 13 ? 3.130   6.613   -5.191  1.00 0.73 ? 13 ARG A HA   22 
ATOM   9981  H HB2  . ARG A 1 13 ? 3.862   8.950   -3.397  1.00 0.84 ? 13 ARG A HB2  22 
ATOM   9982  H HB3  . ARG A 1 13 ? 4.346   8.753   -5.074  1.00 0.82 ? 13 ARG A HB3  22 
ATOM   9983  H HG2  . ARG A 1 13 ? 1.568   8.428   -5.119  1.00 0.95 ? 13 ARG A HG2  22 
ATOM   9984  H HG3  . ARG A 1 13 ? 1.840   9.761   -3.997  1.00 1.11 ? 13 ARG A HG3  22 
ATOM   9985  H HD2  . ARG A 1 13 ? 3.184   9.654   -6.714  1.00 1.04 ? 13 ARG A HD2  22 
ATOM   9986  H HD3  . ARG A 1 13 ? 1.608   10.430  -6.461  1.00 1.15 ? 13 ARG A HD3  22 
ATOM   9987  H HE   . ARG A 1 13 ? 2.912   11.674  -4.529  1.00 1.33 ? 13 ARG A HE   22 
ATOM   9988  H HH11 . ARG A 1 13 ? 5.543   10.542  -5.484  1.00 1.63 ? 13 ARG A HH11 22 
ATOM   9989  H HH12 . ARG A 1 13 ? 6.135   11.829  -6.477  1.00 1.73 ? 13 ARG A HH12 22 
ATOM   9990  H HH21 . ARG A 1 13 ? 3.059   13.408  -6.705  1.00 1.44 ? 13 ARG A HH21 22 
ATOM   9991  H HH22 . ARG A 1 13 ? 4.724   13.459  -7.168  1.00 1.60 ? 13 ARG A HH22 22 
ATOM   9992  N N    . LYS A 1 14 ? 4.599   5.074   -3.444  1.00 0.60 ? 14 LYS A N    22 
ATOM   9993  C CA   . LYS A 1 14 ? 5.785   4.341   -2.904  1.00 0.62 ? 14 LYS A CA   22 
ATOM   9994  C C    . LYS A 1 14 ? 6.845   4.113   -3.997  1.00 0.68 ? 14 LYS A C    22 
ATOM   9995  O O    . LYS A 1 14 ? 7.194   2.989   -4.318  1.00 0.80 ? 14 LYS A O    22 
ATOM   9996  C CB   . LYS A 1 14 ? 5.220   3.008   -2.394  1.00 0.73 ? 14 LYS A CB   22 
ATOM   9997  C CG   . LYS A 1 14 ? 4.507   2.263   -3.532  1.00 0.85 ? 14 LYS A CG   22 
ATOM   9998  C CD   . LYS A 1 14 ? 4.924   0.792   -3.522  1.00 0.94 ? 14 LYS A CD   22 
ATOM   9999  C CE   . LYS A 1 14 ? 5.287   0.345   -4.943  1.00 1.19 ? 14 LYS A CE   22 
ATOM   10000 N NZ   . LYS A 1 14 ? 6.755   0.587   -5.066  1.00 1.55 ? 14 LYS A NZ   22 
ATOM   10001 H H    . LYS A 1 14 ? 3.767   4.586   -3.616  1.00 0.67 ? 14 LYS A H    22 
ATOM   10002 H HA   . LYS A 1 14 ? 6.216   4.889   -2.080  1.00 0.63 ? 14 LYS A HA   22 
ATOM   10003 H HB2  . LYS A 1 14 ? 6.026   2.400   -2.019  1.00 0.80 ? 14 LYS A HB2  22 
ATOM   10004 H HB3  . LYS A 1 14 ? 4.516   3.198   -1.596  1.00 0.76 ? 14 LYS A HB3  22 
ATOM   10005 H HG2  . LYS A 1 14 ? 3.437   2.335   -3.393  1.00 0.97 ? 14 LYS A HG2  22 
ATOM   10006 H HG3  . LYS A 1 14 ? 4.776   2.706   -4.478  1.00 0.83 ? 14 LYS A HG3  22 
ATOM   10007 H HD2  . LYS A 1 14 ? 5.779   0.668   -2.874  1.00 0.99 ? 14 LYS A HD2  22 
ATOM   10008 H HD3  . LYS A 1 14 ? 4.105   0.192   -3.155  1.00 0.95 ? 14 LYS A HD3  22 
ATOM   10009 H HE2  . LYS A 1 14 ? 5.062   -0.706  -5.072  1.00 1.42 ? 14 LYS A HE2  22 
ATOM   10010 H HE3  . LYS A 1 14 ? 4.752   0.936   -5.671  1.00 1.38 ? 14 LYS A HE3  22 
ATOM   10011 H HZ1  . LYS A 1 14 ? 6.976   1.563   -4.760  1.00 1.85 ? 14 LYS A HZ1  22 
ATOM   10012 H HZ2  . LYS A 1 14 ? 7.270   -0.086  -4.465  1.00 2.05 ? 14 LYS A HZ2  22 
ATOM   10013 H HZ3  . LYS A 1 14 ? 7.045   0.460   -6.057  1.00 1.92 ? 14 LYS A HZ3  22 
ATOM   10014 N N    . SER A 1 15 ? 7.371   5.170   -4.560  1.00 0.69 ? 15 SER A N    22 
ATOM   10015 C CA   . SER A 1 15 ? 8.415   5.020   -5.622  1.00 0.81 ? 15 SER A CA   22 
ATOM   10016 C C    . SER A 1 15 ? 9.812   5.040   -4.984  1.00 0.84 ? 15 SER A C    22 
ATOM   10017 O O    . SER A 1 15 ? 10.540  6.010   -5.087  1.00 1.03 ? 15 SER A O    22 
ATOM   10018 C CB   . SER A 1 15 ? 8.221   6.221   -6.550  1.00 0.96 ? 15 SER A CB   22 
ATOM   10019 O OG   . SER A 1 15 ? 8.916   5.989   -7.770  1.00 1.36 ? 15 SER A OG   22 
ATOM   10020 H H    . SER A 1 15 ? 7.083   6.065   -4.278  1.00 0.67 ? 15 SER A H    22 
ATOM   10021 H HA   . SER A 1 15 ? 8.266   4.103   -6.170  1.00 0.94 ? 15 SER A HA   22 
ATOM   10022 H HB2  . SER A 1 15 ? 7.172   6.351   -6.759  1.00 1.02 ? 15 SER A HB2  22 
ATOM   10023 H HB3  . SER A 1 15 ? 8.602   7.114   -6.069  1.00 1.10 ? 15 SER A HB3  22 
ATOM   10024 H HG   . SER A 1 15 ? 9.842   6.208   -7.632  1.00 1.56 ? 15 SER A HG   22 
ATOM   10025 N N    . GLY A 1 16 ? 10.185  3.975   -4.317  1.00 0.89 ? 16 GLY A N    22 
ATOM   10026 C CA   . GLY A 1 16 ? 11.527  3.925   -3.659  1.00 1.07 ? 16 GLY A CA   22 
ATOM   10027 C C    . GLY A 1 16 ? 11.452  4.632   -2.303  1.00 0.98 ? 16 GLY A C    22 
ATOM   10028 O O    . GLY A 1 16 ? 11.763  5.801   -2.188  1.00 1.12 ? 16 GLY A O    22 
ATOM   10029 H H    . GLY A 1 16 ? 9.576   3.210   -4.243  1.00 0.96 ? 16 GLY A H    22 
ATOM   10030 H HA2  . GLY A 1 16 ? 11.820  2.894   -3.516  1.00 1.22 ? 16 GLY A HA2  22 
ATOM   10031 H HA3  . GLY A 1 16 ? 12.253  4.425   -4.282  1.00 1.22 ? 16 GLY A HA3  22 
ATOM   10032 N N    . ASN A 1 17 ? 11.034  3.931   -1.278  1.00 0.88 ? 17 ASN A N    22 
ATOM   10033 C CA   . ASN A 1 17 ? 10.929  4.563   0.074   1.00 0.87 ? 17 ASN A CA   22 
ATOM   10034 C C    . ASN A 1 17 ? 11.348  3.569   1.171   1.00 0.87 ? 17 ASN A C    22 
ATOM   10035 O O    . ASN A 1 17 ? 11.887  2.514   0.894   1.00 0.93 ? 17 ASN A O    22 
ATOM   10036 C CB   . ASN A 1 17 ? 9.448   4.930   0.213   1.00 0.80 ? 17 ASN A CB   22 
ATOM   10037 C CG   . ASN A 1 17 ? 9.313   6.235   1.001   1.00 0.96 ? 17 ASN A CG   22 
ATOM   10038 O OD1  . ASN A 1 17 ? 9.341   6.229   2.215   1.00 0.88 ? 17 ASN A OD1  22 
ATOM   10039 N ND2  . ASN A 1 17 ? 9.168   7.359   0.360   1.00 1.44 ? 17 ASN A ND2  22 
ATOM   10040 H H    . ASN A 1 17 ? 10.784  2.992   -1.399  1.00 0.91 ? 17 ASN A H    22 
ATOM   10041 H HA   . ASN A 1 17 ? 11.536  5.453   0.123   1.00 1.01 ? 17 ASN A HA   22 
ATOM   10042 H HB2  . ASN A 1 17 ? 9.017   5.058   -0.770  1.00 0.81 ? 17 ASN A HB2  22 
ATOM   10043 H HB3  . ASN A 1 17 ? 8.929   4.142   0.734   1.00 0.76 ? 17 ASN A HB3  22 
ATOM   10044 H HD21 . ASN A 1 17 ? 9.147   7.366   -0.619  1.00 1.73 ? 17 ASN A HD21 22 
ATOM   10045 H HD22 . ASN A 1 17 ? 9.078   8.197   0.859   1.00 1.59 ? 17 ASN A HD22 22 
ATOM   10046 N N    . LYS A 1 18 ? 11.097  3.902   2.414   1.00 0.88 ? 18 LYS A N    22 
ATOM   10047 C CA   . LYS A 1 18 ? 11.472  2.985   3.537   1.00 0.92 ? 18 LYS A CA   22 
ATOM   10048 C C    . LYS A 1 18 ? 10.470  1.824   3.636   1.00 0.99 ? 18 LYS A C    22 
ATOM   10049 O O    . LYS A 1 18 ? 9.401   1.875   3.054   1.00 1.11 ? 18 LYS A O    22 
ATOM   10050 C CB   . LYS A 1 18 ? 11.410  3.857   4.795   1.00 0.91 ? 18 LYS A CB   22 
ATOM   10051 C CG   . LYS A 1 18 ? 12.753  4.563   5.000   1.00 0.97 ? 18 LYS A CG   22 
ATOM   10052 C CD   . LYS A 1 18 ? 12.530  5.883   5.745   1.00 0.95 ? 18 LYS A CD   22 
ATOM   10053 C CE   . LYS A 1 18 ? 12.047  6.954   4.761   1.00 1.12 ? 18 LYS A CE   22 
ATOM   10054 N NZ   . LYS A 1 18 ? 10.822  7.531   5.385   1.00 1.09 ? 18 LYS A NZ   22 
ATOM   10055 H H    . LYS A 1 18 ? 10.659  4.757   2.612   1.00 0.91 ? 18 LYS A H    22 
ATOM   10056 H HA   . LYS A 1 18 ? 12.473  2.608   3.398   1.00 0.98 ? 18 LYS A HA   22 
ATOM   10057 H HB2  . LYS A 1 18 ? 10.628  4.594   4.682   1.00 0.88 ? 18 LYS A HB2  22 
ATOM   10058 H HB3  . LYS A 1 18 ? 11.197  3.237   5.651   1.00 0.99 ? 18 LYS A HB3  22 
ATOM   10059 H HG2  . LYS A 1 18 ? 13.409  3.928   5.580   1.00 1.07 ? 18 LYS A HG2  22 
ATOM   10060 H HG3  . LYS A 1 18 ? 13.205  4.765   4.040   1.00 1.15 ? 18 LYS A HG3  22 
ATOM   10061 H HD2  . LYS A 1 18 ? 11.787  5.738   6.516   1.00 0.90 ? 18 LYS A HD2  22 
ATOM   10062 H HD3  . LYS A 1 18 ? 13.458  6.203   6.195   1.00 1.10 ? 18 LYS A HD3  22 
ATOM   10063 H HE2  . LYS A 1 18 ? 12.805  7.719   4.640   1.00 1.36 ? 18 LYS A HE2  22 
ATOM   10064 H HE3  . LYS A 1 18 ? 11.803  6.510   3.809   1.00 1.27 ? 18 LYS A HE3  22 
ATOM   10065 H HZ1  . LYS A 1 18 ? 11.039  7.851   6.355   1.00 1.10 ? 18 LYS A HZ1  22 
ATOM   10066 H HZ2  . LYS A 1 18 ? 10.499  8.345   4.824   1.00 1.20 ? 18 LYS A HZ2  22 
ATOM   10067 H HZ3  . LYS A 1 18 ? 10.064  6.806   5.417   1.00 1.07 ? 18 LYS A HZ3  22 
ATOM   10068 N N    . PRO A 1 19 ? 10.852  0.809   4.379   1.00 1.03 ? 19 PRO A N    22 
ATOM   10069 C CA   . PRO A 1 19 ? 9.937   -0.363  4.532   1.00 1.14 ? 19 PRO A CA   22 
ATOM   10070 C C    . PRO A 1 19 ? 8.679   0.026   5.327   1.00 1.12 ? 19 PRO A C    22 
ATOM   10071 O O    . PRO A 1 19 ? 8.702   0.965   6.104   1.00 1.06 ? 19 PRO A O    22 
ATOM   10072 C CB   . PRO A 1 19 ? 10.772  -1.386  5.298   1.00 1.20 ? 19 PRO A CB   22 
ATOM   10073 C CG   . PRO A 1 19 ? 11.785  -0.576  6.034   1.00 1.10 ? 19 PRO A CG   22 
ATOM   10074 C CD   . PRO A 1 19 ? 12.075  0.628   5.180   1.00 0.99 ? 19 PRO A CD   22 
ATOM   10075 H HA   . PRO A 1 19 ? 9.667   -0.758  3.566   1.00 1.28 ? 19 PRO A HA   22 
ATOM   10076 H HB2  . PRO A 1 19 ? 10.150  -1.938  5.990   1.00 1.23 ? 19 PRO A HB2  22 
ATOM   10077 H HB3  . PRO A 1 19 ? 11.265  -2.060  4.614   1.00 1.33 ? 19 PRO A HB3  22 
ATOM   10078 H HG2  . PRO A 1 19 ? 11.384  -0.266  6.990   1.00 1.09 ? 19 PRO A HG2  22 
ATOM   10079 H HG3  . PRO A 1 19 ? 12.687  -1.148  6.176   1.00 1.22 ? 19 PRO A HG3  22 
ATOM   10080 H HD2  . PRO A 1 19 ? 12.258  1.494   5.801   1.00 0.92 ? 19 PRO A HD2  22 
ATOM   10081 H HD3  . PRO A 1 19 ? 12.917  0.439   4.532   1.00 1.10 ? 19 PRO A HD3  22 
ATOM   10082 N N    . PRO A 1 20 ? 7.618   -0.715  5.101   1.00 1.28 ? 20 PRO A N    22 
ATOM   10083 C CA   . PRO A 1 20 ? 6.345   -0.412  5.824   1.00 1.39 ? 20 PRO A CA   22 
ATOM   10084 C C    . PRO A 1 20 ? 6.454   -0.797  7.310   1.00 1.36 ? 20 PRO A C    22 
ATOM   10085 O O    . PRO A 1 20 ? 5.929   -1.804  7.747   1.00 1.47 ? 20 PRO A O    22 
ATOM   10086 C CB   . PRO A 1 20 ? 5.302   -1.267  5.106   1.00 1.61 ? 20 PRO A CB   22 
ATOM   10087 C CG   . PRO A 1 20 ? 6.076   -2.388  4.502   1.00 1.60 ? 20 PRO A CG   22 
ATOM   10088 C CD   . PRO A 1 20 ? 7.441   -1.848  4.175   1.00 1.44 ? 20 PRO A CD   22 
ATOM   10089 H HA   . PRO A 1 20 ? 6.096   0.631   5.724   1.00 1.39 ? 20 PRO A HA   22 
ATOM   10090 H HB2  . PRO A 1 20 ? 4.574   -1.644  5.811   1.00 1.70 ? 20 PRO A HB2  22 
ATOM   10091 H HB3  . PRO A 1 20 ? 4.815   -0.695  4.330   1.00 1.71 ? 20 PRO A HB3  22 
ATOM   10092 H HG2  . PRO A 1 20 ? 6.158   -3.202  5.209   1.00 1.62 ? 20 PRO A HG2  22 
ATOM   10093 H HG3  . PRO A 1 20 ? 5.594   -2.729  3.599   1.00 1.74 ? 20 PRO A HG3  22 
ATOM   10094 H HD2  . PRO A 1 20 ? 8.196   -2.603  4.347   1.00 1.44 ? 20 PRO A HD2  22 
ATOM   10095 H HD3  . PRO A 1 20 ? 7.476   -1.501  3.153   1.00 1.52 ? 20 PRO A HD3  22 
ATOM   10096 N N    . SER A 1 21 ? 7.137   0.007   8.086   1.00 1.28 ? 21 SER A N    22 
ATOM   10097 C CA   . SER A 1 21 ? 7.293   -0.288  9.546   1.00 1.33 ? 21 SER A CA   22 
ATOM   10098 C C    . SER A 1 21 ? 7.598   1.006   10.314  1.00 1.34 ? 21 SER A C    22 
ATOM   10099 O O    . SER A 1 21 ? 6.832   1.430   11.156  1.00 1.54 ? 21 SER A O    22 
ATOM   10100 C CB   . SER A 1 21 ? 8.464   -1.274  9.645   1.00 1.25 ? 21 SER A CB   22 
ATOM   10101 O OG   . SER A 1 21 ? 9.576   -0.782  8.897   1.00 1.09 ? 21 SER A OG   22 
ATOM   10102 H H    . SER A 1 21 ? 7.551   0.812   7.705   1.00 1.23 ? 21 SER A H    22 
ATOM   10103 H HA   . SER A 1 21 ? 6.395   -0.745  9.932   1.00 1.48 ? 21 SER A HA   22 
ATOM   10104 H HB2  . SER A 1 21 ? 8.754   -1.389  10.675  1.00 1.34 ? 21 SER A HB2  22 
ATOM   10105 H HB3  . SER A 1 21 ? 8.153   -2.236  9.255   1.00 1.30 ? 21 SER A HB3  22 
ATOM   10106 H HG   . SER A 1 21 ? 9.426   -0.995  7.970   1.00 1.05 ? 21 SER A HG   22 
ATOM   10107 N N    . LYS A 1 22 ? 8.705   1.640   10.016  1.00 1.19 ? 22 LYS A N    22 
ATOM   10108 C CA   . LYS A 1 22 ? 9.060   2.916   10.715  1.00 1.24 ? 22 LYS A CA   22 
ATOM   10109 C C    . LYS A 1 22 ? 9.633   3.925   9.708   1.00 1.08 ? 22 LYS A C    22 
ATOM   10110 O O    . LYS A 1 22 ? 10.816  4.209   9.693   1.00 1.01 ? 22 LYS A O    22 
ATOM   10111 C CB   . LYS A 1 22 ? 10.101  2.533   11.782  1.00 1.35 ? 22 LYS A CB   22 
ATOM   10112 C CG   . LYS A 1 22 ? 11.262  1.757   11.147  1.00 1.27 ? 22 LYS A CG   22 
ATOM   10113 C CD   . LYS A 1 22 ? 11.177  0.284   11.560  1.00 1.38 ? 22 LYS A CD   22 
ATOM   10114 C CE   . LYS A 1 22 ? 12.337  -0.499  10.935  1.00 1.39 ? 22 LYS A CE   22 
ATOM   10115 N NZ   . LYS A 1 22 ? 12.025  -0.569  9.475   1.00 1.26 ? 22 LYS A NZ   22 
ATOM   10116 H H    . LYS A 1 22 ? 9.300   1.281   9.325   1.00 1.10 ? 22 LYS A H    22 
ATOM   10117 H HA   . LYS A 1 22 ? 8.186   3.332   11.193  1.00 1.39 ? 22 LYS A HA   22 
ATOM   10118 H HB2  . LYS A 1 22 ? 10.484  3.432   12.244  1.00 1.44 ? 22 LYS A HB2  22 
ATOM   10119 H HB3  . LYS A 1 22 ? 9.630   1.919   12.534  1.00 1.49 ? 22 LYS A HB3  22 
ATOM   10120 H HG2  . LYS A 1 22 ? 11.202  1.835   10.070  1.00 1.14 ? 22 LYS A HG2  22 
ATOM   10121 H HG3  . LYS A 1 22 ? 12.199  2.171   11.486  1.00 1.38 ? 22 LYS A HG3  22 
ATOM   10122 H HD2  . LYS A 1 22 ? 11.233  0.210   12.637  1.00 1.62 ? 22 LYS A HD2  22 
ATOM   10123 H HD3  . LYS A 1 22 ? 10.241  -0.132  11.221  1.00 1.37 ? 22 LYS A HD3  22 
ATOM   10124 H HE2  . LYS A 1 22 ? 13.271  0.024   11.098  1.00 1.59 ? 22 LYS A HE2  22 
ATOM   10125 H HE3  . LYS A 1 22 ? 12.385  -1.494  11.351  1.00 1.67 ? 22 LYS A HE3  22 
ATOM   10126 H HZ1  . LYS A 1 22 ? 10.992  -0.679  9.339   1.00 1.16 ? 22 LYS A HZ1  22 
ATOM   10127 H HZ2  . LYS A 1 22 ? 12.341  0.305   9.011   1.00 1.51 ? 22 LYS A HZ2  22 
ATOM   10128 H HZ3  . LYS A 1 22 ? 12.518  -1.384  9.056   1.00 1.57 ? 22 LYS A HZ3  22 
ATOM   10129 N N    . THR A 1 23 ? 8.792   4.464   8.860   1.00 1.11 ? 23 THR A N    22 
ATOM   10130 C CA   . THR A 1 23 ? 9.271   5.454   7.841   1.00 1.03 ? 23 THR A CA   22 
ATOM   10131 C C    . THR A 1 23 ? 9.155   6.895   8.371   1.00 1.16 ? 23 THR A C    22 
ATOM   10132 O O    . THR A 1 23 ? 9.823   7.790   7.888   1.00 1.16 ? 23 THR A O    22 
ATOM   10133 C CB   . THR A 1 23 ? 8.366   5.242   6.616   1.00 1.15 ? 23 THR A CB   22 
ATOM   10134 O OG1  . THR A 1 23 ? 8.954   5.868   5.484   1.00 1.14 ? 23 THR A OG1  22 
ATOM   10135 C CG2  . THR A 1 23 ? 6.980   5.846   6.866   1.00 1.45 ? 23 THR A CG2  22 
ATOM   10136 H H    . THR A 1 23 ? 7.844   4.214   8.891   1.00 1.25 ? 23 THR A H    22 
ATOM   10137 H HA   . THR A 1 23 ? 10.294  5.242   7.574   1.00 0.87 ? 23 THR A HA   22 
ATOM   10138 H HB   . THR A 1 23 ? 8.263   4.184   6.427   1.00 1.15 ? 23 THR A HB   22 
ATOM   10139 H HG1  . THR A 1 23 ? 8.488   5.560   4.698   1.00 1.31 ? 23 THR A HG1  22 
ATOM   10140 H HG21 . THR A 1 23 ? 6.661   5.616   7.872   1.00 1.55 ? 23 THR A HG21 22 
ATOM   10141 H HG22 . THR A 1 23 ? 7.026   6.918   6.739   1.00 1.56 ? 23 THR A HG22 22 
ATOM   10142 H HG23 . THR A 1 23 ? 6.274   5.431   6.162   1.00 2.00 ? 23 THR A HG23 22 
ATOM   10143 N N    . CYS A 1 24 ? 8.318   7.127   9.356   1.00 1.33 ? 24 CYS A N    22 
ATOM   10144 C CA   . CYS A 1 24 ? 8.166   8.511   9.905   1.00 1.51 ? 24 CYS A CA   22 
ATOM   10145 C C    . CYS A 1 24 ? 9.265   8.798   10.940  1.00 1.46 ? 24 CYS A C    22 
ATOM   10146 O O    . CYS A 1 24 ? 9.025   8.810   12.136  1.00 1.65 ? 24 CYS A O    22 
ATOM   10147 C CB   . CYS A 1 24 ? 6.778   8.532   10.555  1.00 1.77 ? 24 CYS A CB   22 
ATOM   10148 S SG   . CYS A 1 24 ? 5.515   8.738   9.275   1.00 2.11 ? 24 CYS A SG   22 
ATOM   10149 H H    . CYS A 1 24 ? 7.789   6.395   9.733   1.00 1.38 ? 24 CYS A H    22 
ATOM   10150 H HA   . CYS A 1 24 ? 8.208   9.235   9.108   1.00 1.54 ? 24 CYS A HA   22 
ATOM   10151 H HB2  . CYS A 1 24 ? 6.612   7.603   11.080  1.00 1.96 ? 24 CYS A HB2  22 
ATOM   10152 H HB3  . CYS A 1 24 ? 6.720   9.355   11.253  1.00 1.87 ? 24 CYS A HB3  22 
ATOM   10153 H HG   . CYS A 1 24 ? 5.774   9.475   8.717   1.00 2.36 ? 24 CYS A HG   22 
ATOM   10154 N N    . LEU A 1 25 ? 10.468  9.028   10.482  1.00 1.28 ? 25 LEU A N    22 
ATOM   10155 C CA   . LEU A 1 25 ? 11.599  9.318   11.416  1.00 1.31 ? 25 LEU A CA   22 
ATOM   10156 C C    . LEU A 1 25 ? 12.407  10.519  10.905  1.00 1.25 ? 25 LEU A C    22 
ATOM   10157 O O    . LEU A 1 25 ? 11.926  11.304  10.110  1.00 1.25 ? 25 LEU A O    22 
ATOM   10158 C CB   . LEU A 1 25 ? 12.447  8.036   11.415  1.00 1.17 ? 25 LEU A CB   22 
ATOM   10159 C CG   . LEU A 1 25 ? 13.113  7.843   10.044  1.00 1.00 ? 25 LEU A CG   22 
ATOM   10160 C CD1  . LEU A 1 25 ? 14.634  7.815   10.210  1.00 1.07 ? 25 LEU A CD1  22 
ATOM   10161 C CD2  . LEU A 1 25 ? 12.649  6.520   9.435   1.00 0.96 ? 25 LEU A CD2  22 
ATOM   10162 H H    . LEU A 1 25 ? 10.629  9.012   9.514   1.00 1.20 ? 25 LEU A H    22 
ATOM   10163 H HA   . LEU A 1 25 ? 11.228  9.513   12.411  1.00 1.51 ? 25 LEU A HA   22 
ATOM   10164 H HB2  . LEU A 1 25 ? 13.208  8.111   12.177  1.00 1.28 ? 25 LEU A HB2  22 
ATOM   10165 H HB3  . LEU A 1 25 ? 11.813  7.188   11.625  1.00 1.19 ? 25 LEU A HB3  22 
ATOM   10166 H HG   . LEU A 1 25 ? 12.838  8.659   9.390   1.00 1.09 ? 25 LEU A HG   22 
ATOM   10167 H HD11 . LEU A 1 25 ? 14.888  7.274   11.109  1.00 1.51 ? 25 LEU A HD11 22 
ATOM   10168 H HD12 . LEU A 1 25 ? 15.079  7.326   9.357   1.00 1.46 ? 25 LEU A HD12 22 
ATOM   10169 H HD13 . LEU A 1 25 ? 15.007  8.826   10.280  1.00 1.56 ? 25 LEU A HD13 22 
ATOM   10170 H HD21 . LEU A 1 25 ? 11.570  6.505   9.385   1.00 1.49 ? 25 LEU A HD21 22 
ATOM   10171 H HD22 . LEU A 1 25 ? 13.056  6.420   8.440   1.00 1.35 ? 25 LEU A HD22 22 
ATOM   10172 H HD23 . LEU A 1 25 ? 12.992  5.700   10.048  1.00 1.29 ? 25 LEU A HD23 22 
ATOM   10173 N N    . LYS A 1 26 ? 13.631  10.665  11.349  1.00 1.28 ? 26 LYS A N    22 
ATOM   10174 C CA   . LYS A 1 26 ? 14.469  11.808  10.878  1.00 1.26 ? 26 LYS A CA   22 
ATOM   10175 C C    . LYS A 1 26 ? 14.785  11.643  9.385   1.00 1.00 ? 26 LYS A C    22 
ATOM   10176 O O    . LYS A 1 26 ? 15.723  10.960  9.012   1.00 0.92 ? 26 LYS A O    22 
ATOM   10177 C CB   . LYS A 1 26 ? 15.754  11.738  11.711  1.00 1.41 ? 26 LYS A CB   22 
ATOM   10178 C CG   . LYS A 1 26 ? 15.761  12.864  12.745  1.00 1.73 ? 26 LYS A CG   22 
ATOM   10179 C CD   . LYS A 1 26 ? 16.659  12.468  13.919  1.00 1.89 ? 26 LYS A CD   22 
ATOM   10180 C CE   . LYS A 1 26 ? 17.621  13.616  14.246  1.00 2.05 ? 26 LYS A CE   22 
ATOM   10181 N NZ   . LYS A 1 26 ? 18.969  13.127  13.832  1.00 2.02 ? 26 LYS A NZ   22 
ATOM   10182 H H    . LYS A 1 26 ? 13.998  10.021  11.988  1.00 1.36 ? 26 LYS A H    22 
ATOM   10183 H HA   . LYS A 1 26 ? 13.964  12.745  11.054  1.00 1.40 ? 26 LYS A HA   22 
ATOM   10184 H HB2  . LYS A 1 26 ? 15.804  10.784  12.215  1.00 1.41 ? 26 LYS A HB2  22 
ATOM   10185 H HB3  . LYS A 1 26 ? 16.610  11.845  11.061  1.00 1.41 ? 26 LYS A HB3  22 
ATOM   10186 H HG2  . LYS A 1 26 ? 16.137  13.769  12.288  1.00 1.84 ? 26 LYS A HG2  22 
ATOM   10187 H HG3  . LYS A 1 26 ? 14.755  13.032  13.103  1.00 1.82 ? 26 LYS A HG3  22 
ATOM   10188 H HD2  . LYS A 1 26 ? 16.045  12.253  14.782  1.00 2.06 ? 26 LYS A HD2  22 
ATOM   10189 H HD3  . LYS A 1 26 ? 17.226  11.588  13.656  1.00 1.84 ? 26 LYS A HD3  22 
ATOM   10190 H HE2  . LYS A 1 26 ? 17.351  14.501  13.686  1.00 2.10 ? 26 LYS A HE2  22 
ATOM   10191 H HE3  . LYS A 1 26 ? 17.612  13.824  15.306  1.00 2.25 ? 26 LYS A HE3  22 
ATOM   10192 H HZ1  . LYS A 1 26 ? 19.206  12.264  14.359  1.00 2.08 ? 26 LYS A HZ1  22 
ATOM   10193 H HZ2  . LYS A 1 26 ? 18.964  12.915  12.808  1.00 1.88 ? 26 LYS A HZ2  22 
ATOM   10194 H HZ3  . LYS A 1 26 ? 19.679  13.861  14.030  1.00 2.26 ? 26 LYS A HZ3  22 
ATOM   10195 N N    . GLU A 1 27 ? 14.009  12.260  8.530   1.00 0.96 ? 27 GLU A N    22 
ATOM   10196 C CA   . GLU A 1 27 ? 14.262  12.142  7.058   1.00 0.77 ? 27 GLU A CA   22 
ATOM   10197 C C    . GLU A 1 27 ? 15.435  13.054  6.662   1.00 0.78 ? 27 GLU A C    22 
ATOM   10198 O O    . GLU A 1 27 ? 15.293  13.967  5.869   1.00 0.86 ? 27 GLU A O    22 
ATOM   10199 C CB   . GLU A 1 27 ? 12.960  12.597  6.380   1.00 0.92 ? 27 GLU A CB   22 
ATOM   10200 C CG   . GLU A 1 27 ? 11.795  11.687  6.800   1.00 0.98 ? 27 GLU A CG   22 
ATOM   10201 C CD   . GLU A 1 27 ? 11.978  10.287  6.207   1.00 0.81 ? 27 GLU A CD   22 
ATOM   10202 O OE1  . GLU A 1 27 ? 11.815  10.147  5.004   1.00 1.19 ? 27 GLU A OE1  22 
ATOM   10203 O OE2  . GLU A 1 27 ? 12.267  9.377   6.966   1.00 0.95 ? 27 GLU A OE2  22 
ATOM   10204 H H    . GLU A 1 27 ? 13.261  12.801  8.857   1.00 1.12 ? 27 GLU A H    22 
ATOM   10205 H HA   . GLU A 1 27 ? 14.478  11.117  6.795   1.00 0.65 ? 27 GLU A HA   22 
ATOM   10206 H HB2  . GLU A 1 27 ? 12.743  13.614  6.671   1.00 1.13 ? 27 GLU A HB2  22 
ATOM   10207 H HB3  . GLU A 1 27 ? 13.080  12.550  5.308   1.00 0.91 ? 27 GLU A HB3  22 
ATOM   10208 H HG2  . GLU A 1 27 ? 11.761  11.617  7.876   1.00 1.06 ? 27 GLU A HG2  22 
ATOM   10209 H HG3  . GLU A 1 27 ? 10.868  12.105  6.440   1.00 1.25 ? 27 GLU A HG3  22 
ATOM   10210 N N    . GLU A 1 28 ? 16.594  12.814  7.225   1.00 0.83 ? 28 GLU A N    22 
ATOM   10211 C CA   . GLU A 1 28 ? 17.784  13.662  6.912   1.00 0.97 ? 28 GLU A CA   22 
ATOM   10212 C C    . GLU A 1 28 ? 18.566  13.070  5.731   1.00 0.96 ? 28 GLU A C    22 
ATOM   10213 O O    . GLU A 1 28 ? 19.589  12.432  5.904   1.00 1.18 ? 28 GLU A O    22 
ATOM   10214 C CB   . GLU A 1 28 ? 18.629  13.647  8.194   1.00 1.22 ? 28 GLU A CB   22 
ATOM   10215 C CG   . GLU A 1 28 ? 17.768  14.088  9.386   1.00 1.37 ? 28 GLU A CG   22 
ATOM   10216 C CD   . GLU A 1 28 ? 18.593  14.030  10.674  1.00 1.67 ? 28 GLU A CD   22 
ATOM   10217 O OE1  . GLU A 1 28 ? 18.814  12.935  11.168  1.00 1.81 ? 28 GLU A OE1  22 
ATOM   10218 O OE2  . GLU A 1 28 ? 18.980  15.081  11.155  1.00 1.86 ? 28 GLU A OE2  22 
ATOM   10219 H H    . GLU A 1 28 ? 16.679  12.077  7.867   1.00 0.86 ? 28 GLU A H    22 
ATOM   10220 H HA   . GLU A 1 28 ? 17.477  14.671  6.687   1.00 1.04 ? 28 GLU A HA   22 
ATOM   10221 H HB2  . GLU A 1 28 ? 19.001  12.647  8.368   1.00 1.26 ? 28 GLU A HB2  22 
ATOM   10222 H HB3  . GLU A 1 28 ? 19.461  14.326  8.084   1.00 1.38 ? 28 GLU A HB3  22 
ATOM   10223 H HG2  . GLU A 1 28 ? 17.422  15.096  9.226   1.00 1.41 ? 28 GLU A HG2  22 
ATOM   10224 H HG3  . GLU A 1 28 ? 16.919  13.429  9.480   1.00 1.33 ? 28 GLU A HG3  22 
ATOM   10225 N N    . MET A 1 29 ? 18.087  13.278  4.530   1.00 0.99 ? 29 MET A N    22 
ATOM   10226 C CA   . MET A 1 29 ? 18.794  12.732  3.330   1.00 1.23 ? 29 MET A CA   22 
ATOM   10227 C C    . MET A 1 29 ? 18.682  13.713  2.154   1.00 1.41 ? 29 MET A C    22 
ATOM   10228 O O    . MET A 1 29 ? 17.612  14.202  1.843   1.00 1.75 ? 29 MET A O    22 
ATOM   10229 C CB   . MET A 1 29 ? 18.075  11.419  3.009   1.00 1.56 ? 29 MET A CB   22 
ATOM   10230 C CG   . MET A 1 29 ? 19.059  10.440  2.365   1.00 1.90 ? 29 MET A CG   22 
ATOM   10231 S SD   . MET A 1 29 ? 18.571  8.743   2.767   1.00 2.46 ? 29 MET A SD   22 
ATOM   10232 C CE   . MET A 1 29 ? 19.288  8.685   4.429   1.00 2.92 ? 29 MET A CE   22 
ATOM   10233 H H    . MET A 1 29 ? 17.261  13.794  4.416   1.00 1.05 ? 29 MET A H    22 
ATOM   10234 H HA   . MET A 1 29 ? 19.829  12.539  3.560   1.00 1.28 ? 29 MET A HA   22 
ATOM   10235 H HB2  . MET A 1 29 ? 17.684  10.992  3.921   1.00 1.63 ? 29 MET A HB2  22 
ATOM   10236 H HB3  . MET A 1 29 ? 17.262  11.611  2.325   1.00 1.77 ? 29 MET A HB3  22 
ATOM   10237 H HG2  . MET A 1 29 ? 19.050  10.571  1.293   1.00 2.23 ? 29 MET A HG2  22 
ATOM   10238 H HG3  . MET A 1 29 ? 20.054  10.626  2.742   1.00 2.20 ? 29 MET A HG3  22 
ATOM   10239 H HE1  . MET A 1 29 ? 19.454  9.689   4.786   1.00 3.36 ? 29 MET A HE1  22 
ATOM   10240 H HE2  . MET A 1 29 ? 18.606  8.176   5.096   1.00 3.24 ? 29 MET A HE2  22 
ATOM   10241 H HE3  . MET A 1 29 ? 20.230  8.157   4.395   1.00 3.17 ? 29 MET A HE3  22 
ATOM   10242 N N    . ALA A 1 30 ? 19.781  14.000  1.502   1.00 1.55 ? 30 ALA A N    22 
ATOM   10243 C CA   . ALA A 1 30 ? 19.749  14.947  0.346   1.00 1.87 ? 30 ALA A CA   22 
ATOM   10244 C C    . ALA A 1 30 ? 20.766  14.520  -0.722  1.00 2.31 ? 30 ALA A C    22 
ATOM   10245 O O    . ALA A 1 30 ? 20.408  14.531  -1.888  1.00 2.59 ? 30 ALA A O    22 
ATOM   10246 C CB   . ALA A 1 30 ? 20.126  16.307  0.938   1.00 2.15 ? 30 ALA A CB   22 
ATOM   10247 O OXT  . ALA A 1 30 ? 21.884  14.189  -0.356  1.00 2.68 ? 30 ALA A OXT  22 
ATOM   10248 H H    . ALA A 1 30 ? 20.630  13.593  1.773   1.00 1.69 ? 30 ALA A H    22 
ATOM   10249 H HA   . ALA A 1 30 ? 18.758  14.992  -0.077  1.00 2.01 ? 30 ALA A HA   22 
ATOM   10250 H HB1  . ALA A 1 30 ? 19.492  16.520  1.785   1.00 2.39 ? 30 ALA A HB1  22 
ATOM   10251 H HB2  . ALA A 1 30 ? 21.158  16.287  1.257   1.00 2.24 ? 30 ALA A HB2  22 
ATOM   10252 H HB3  . ALA A 1 30 ? 19.997  17.074  0.189   1.00 2.64 ? 30 ALA A HB3  22 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  MET 1  1  1  MET MET A . n 
A 1 2  ILE 2  2  2  ILE ILE A . n 
A 1 3  SER 3  3  3  SER SER A . n 
A 1 4  SER 4  4  4  SER SER A . n 
A 1 5  VAL 5  5  5  VAL VAL A . n 
A 1 6  CYS 6  6  6  CYS CYS A . n 
A 1 7  VAL 7  7  7  VAL VAL A . n 
A 1 8  SEP 8  8  8  SEP SEP A . n 
A 1 9  SER 9  9  9  SER SER A . n 
A 1 10 TYR 10 10 10 TYR TYR A . n 
A 1 11 ARG 11 11 11 ARG ARG A . n 
A 1 12 GLY 12 12 12 GLY GLY A . n 
A 1 13 ARG 13 13 13 ARG ARG A . n 
A 1 14 LYS 14 14 14 LYS LYS A . n 
A 1 15 SER 15 15 15 SER SER A . n 
A 1 16 GLY 16 16 16 GLY GLY A . n 
A 1 17 ASN 17 17 17 ASN ASN A . n 
A 1 18 LYS 18 18 18 LYS LYS A . n 
A 1 19 PRO 19 19 19 PRO PRO A . n 
A 1 20 PRO 20 20 20 PRO PRO A . n 
A 1 21 SER 21 21 21 SER SER A . n 
A 1 22 LYS 22 22 22 LYS LYS A . n 
A 1 23 THR 23 23 23 THR THR A . n 
A 1 24 CYS 24 24 24 CYS CYS A . n 
A 1 25 LEU 25 25 25 LEU LEU A . n 
A 1 26 LYS 26 26 26 LYS LYS A . n 
A 1 27 GLU 27 27 27 GLU GLU A . n 
A 1 28 GLU 28 28 28 GLU GLU A . n 
A 1 29 MET 29 29 29 MET MET A . n 
A 1 30 ALA 30 30 30 ALA ALA A . n 
# 
_pdbx_struct_mod_residue.id               1 
_pdbx_struct_mod_residue.label_asym_id    A 
_pdbx_struct_mod_residue.label_comp_id    SEP 
_pdbx_struct_mod_residue.label_seq_id     8 
_pdbx_struct_mod_residue.auth_asym_id     A 
_pdbx_struct_mod_residue.auth_comp_id     SEP 
_pdbx_struct_mod_residue.auth_seq_id      8 
_pdbx_struct_mod_residue.PDB_ins_code     ? 
_pdbx_struct_mod_residue.parent_comp_id   SER 
_pdbx_struct_mod_residue.details          PHOSPHOSERINE 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1999-04-27 
2 'Structure model' 1 1 2008-03-24 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
X-PLOR 'model building' 3.8 ? 1 
X-PLOR refinement       3.8 ? 2 
X-PLOR phasing          3.8 ? 3 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1  1  OG   A SER 21 ? ? HZ2 A LYS 22 ? ? 1.48 
2  1  HZ2  A LYS 18 ? ? OG1 A THR 23 ? ? 1.50 
3  1  HZ2  A LYS 14 ? ? O   A GLY 16 ? ? 1.53 
4  1  HZ3  A LYS 18 ? ? OE2 A GLU 27 ? ? 1.57 
5  1  HZ3  A LYS 26 ? ? OXT A ALA 30 ? ? 1.58 
6  2  HZ2  A LYS 18 ? ? O   A PRO 19 ? ? 1.51 
7  3  HZ1  A LYS 22 ? ? O   A MET 29 ? ? 1.53 
8  3  HZ3  A LYS 14 ? ? OD1 A ASN 17 ? ? 1.56 
9  3  HZ2  A LYS 18 ? ? O   A PRO 19 ? ? 1.57 
10 4  HZ3  A LYS 18 ? ? OG  A SER 21 ? ? 1.52 
11 4  HZ2  A LYS 26 ? ? OE1 A GLU 28 ? ? 1.57 
12 5  HZ3  A LYS 26 ? ? OE1 A GLU 28 ? ? 1.57 
13 5  HZ1  A LYS 22 ? ? O   A ALA 30 ? ? 1.58 
14 5  OG   A SER 15 ? ? HG1 A THR 23 ? ? 1.60 
15 6  HZ3  A LYS 18 ? ? O   A PRO 19 ? ? 1.54 
16 6  HZ3  A LYS 26 ? ? OE2 A GLU 28 ? ? 1.58 
17 7  HZ3  A LYS 18 ? ? O   A PRO 19 ? ? 1.53 
18 8  OG   A SER 21 ? ? HZ1 A LYS 22 ? ? 1.49 
19 8  HH12 A ARG 13 ? ? O   A LYS 22 ? ? 1.58 
20 9  HG   A SER 3  ? ? O   A CYS 6  ? ? 1.60 
21 10 HZ1  A LYS 18 ? ? O   A LYS 22 ? ? 1.50 
22 10 OG   A SER 21 ? ? HZ2 A LYS 22 ? ? 1.52 
23 10 HH12 A ARG 13 ? ? O   A LYS 26 ? ? 1.54 
24 11 OG   A SER 21 ? ? HZ1 A LYS 22 ? ? 1.49 
25 12 HZ1  A LYS 18 ? ? O   A PRO 19 ? ? 1.50 
26 12 O    A LYS 22 ? ? HZ1 A LYS 26 ? ? 1.52 
27 12 HZ1  A LYS 22 ? ? OE1 A GLU 28 ? ? 1.55 
28 12 O    A PRO 20 ? ? HZ3 A LYS 26 ? ? 1.56 
29 12 HZ2  A LYS 22 ? ? O   A LEU 25 ? ? 1.57 
30 12 O    A GLY 12 ? ? HZ2 A LYS 14 ? ? 1.59 
31 13 HZ2  A LYS 22 ? ? O   A CYS 24 ? ? 1.52 
32 13 HZ3  A LYS 26 ? ? OE2 A GLU 28 ? ? 1.58 
33 14 O    A ARG 11 ? ? HZ3 A LYS 14 ? ? 1.51 
34 14 OD1  A ASN 17 ? ? HZ3 A LYS 18 ? ? 1.54 
35 14 O    A LYS 22 ? ? HZ2 A LYS 26 ? ? 1.55 
36 14 HZ1  A LYS 26 ? ? O   A ALA 30 ? ? 1.57 
37 14 HZ1  A LYS 22 ? ? OE1 A GLU 28 ? ? 1.58 
38 15 HZ1  A LYS 18 ? ? O   A PRO 19 ? ? 1.49 
39 15 HZ3  A LYS 26 ? ? OE1 A GLU 28 ? ? 1.57 
40 15 HZ2  A LYS 22 ? ? OE1 A GLU 27 ? ? 1.60 
41 16 HZ1  A LYS 18 ? ? OG1 A THR 23 ? ? 1.47 
42 16 OG   A SER 21 ? ? HZ3 A LYS 22 ? ? 1.54 
43 16 HZ2  A LYS 14 ? ? OD1 A ASN 17 ? ? 1.55 
44 16 O    A CYS 24 ? ? HZ1 A LYS 26 ? ? 1.57 
45 16 HZ2  A LYS 26 ? ? OE2 A GLU 27 ? ? 1.57 
46 16 HZ2  A LYS 22 ? ? OE2 A GLU 28 ? ? 1.59 
47 17 OG   A SER 21 ? ? HZ1 A LYS 22 ? ? 1.50 
48 17 HZ2  A LYS 26 ? ? OE1 A GLU 28 ? ? 1.56 
49 17 HZ1  A LYS 18 ? ? OG1 A THR 23 ? ? 1.58 
50 18 OG   A SER 21 ? ? HZ1 A LYS 22 ? ? 1.50 
51 18 HZ2  A LYS 26 ? ? OE1 A GLU 28 ? ? 1.56 
52 18 HZ1  A LYS 18 ? ? OG1 A THR 23 ? ? 1.58 
53 19 O    A SER 21 ? ? HZ3 A LYS 22 ? ? 1.51 
54 19 HG   A SER 15 ? ? O   A LYS 22 ? ? 1.58 
55 19 HZ2  A LYS 26 ? ? OE1 A GLU 28 ? ? 1.59 
56 20 HZ3  A LYS 18 ? ? OG1 A THR 23 ? ? 1.53 
57 20 HZ2  A LYS 26 ? ? OE1 A GLU 28 ? ? 1.58 
58 21 HZ3  A LYS 18 ? ? O   A PRO 20 ? ? 1.55 
59 22 HZ3  A LYS 18 ? ? OG1 A THR 23 ? ? 1.45 
60 22 OG   A SER 21 ? ? HZ1 A LYS 22 ? ? 1.49 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1   1  SER A 4  ? ? 56.73   17.20   
2   1  VAL A 7  ? ? -77.33  -77.84  
3   1  SEP A 8  ? ? -169.43 -47.36  
4   1  SER A 9  ? ? 64.02   115.63  
5   1  TYR A 10 ? ? 58.16   165.78  
6   1  ARG A 11 ? ? -72.02  -143.79 
7   1  GLU A 28 ? ? -76.66  -159.67 
8   2  SER A 4  ? ? 75.02   -35.36  
9   2  SER A 9  ? ? 64.86   121.10  
10  2  TYR A 10 ? ? 53.83   174.18  
11  2  ARG A 11 ? ? -84.70  -137.59 
12  2  ARG A 13 ? ? -112.51 65.80   
13  2  LYS A 22 ? ? -89.35  48.33   
14  2  LEU A 25 ? ? 58.62   -173.27 
15  3  SER A 4  ? ? 63.72   99.66   
16  3  VAL A 7  ? ? -87.01  -137.35 
17  3  SER A 9  ? ? 63.52   121.26  
18  3  TYR A 10 ? ? 52.40   175.74  
19  3  ARG A 11 ? ? -68.37  -157.82 
20  3  SER A 21 ? ? 57.66   -148.88 
21  3  LYS A 22 ? ? -117.48 63.84   
22  3  THR A 23 ? ? -152.35 32.15   
23  3  CYS A 24 ? ? -159.52 -64.29  
24  3  LYS A 26 ? ? 18.17   79.60   
25  4  SER A 4  ? ? -111.35 -71.61  
26  4  CYS A 6  ? ? 66.48   154.14  
27  4  SEP A 8  ? ? -169.23 -59.88  
28  4  SER A 9  ? ? 60.76   113.21  
29  4  TYR A 10 ? ? 48.29   179.72  
30  4  ARG A 11 ? ? -73.32  -153.40 
31  4  LEU A 25 ? ? -112.82 -169.29 
32  4  LYS A 26 ? ? -98.89  43.45   
33  4  MET A 29 ? ? -103.05 -161.19 
34  5  CYS A 6  ? ? 69.00   156.55  
35  5  SER A 9  ? ? 62.53   -161.47 
36  5  LYS A 14 ? ? -68.49  55.49   
37  5  LYS A 22 ? ? -119.90 54.84   
38  6  SEP A 8  ? ? -126.60 -58.13  
39  6  SER A 9  ? ? 62.95   111.62  
40  6  TYR A 10 ? ? 35.93   -161.92 
41  6  ARG A 11 ? ? -85.17  -146.74 
42  7  VAL A 7  ? ? -111.28 -146.49 
43  7  SER A 9  ? ? 63.32   116.49  
44  7  TYR A 10 ? ? 54.64   172.94  
45  7  ARG A 11 ? ? -70.15  -157.51 
46  7  ARG A 13 ? ? -118.89 78.08   
47  7  ASN A 17 ? ? -136.61 -158.22 
48  7  SER A 21 ? ? 56.92   -152.24 
49  7  LEU A 25 ? ? -74.63  -161.98 
50  7  MET A 29 ? ? -103.36 -157.09 
51  8  SER A 4  ? ? 69.25   -52.81  
52  8  SER A 9  ? ? 58.12   -166.88 
53  8  TYR A 10 ? ? -69.88  -175.74 
54  8  PRO A 19 ? ? -116.33 77.76   
55  8  LYS A 22 ? ? -115.67 54.67   
56  9  SER A 4  ? ? 73.60   -37.84  
57  9  SEP A 8  ? ? -106.77 -73.52  
58  9  SER A 9  ? ? 133.60  128.21  
59  9  TYR A 10 ? ? 34.20   -162.07 
60  9  ARG A 11 ? ? -76.47  -156.08 
61  9  SER A 21 ? ? 65.74   -72.74  
62  9  LYS A 22 ? ? -157.87 86.89   
63  9  CYS A 24 ? ? -159.25 -143.65 
64  9  GLU A 27 ? ? -89.42  -77.56  
65  10 SER A 3  ? ? 64.36   -65.93  
66  10 CYS A 6  ? ? 60.67   -166.00 
67  10 SER A 9  ? ? 65.70   113.23  
68  10 TYR A 10 ? ? 57.80   167.35  
69  10 ARG A 11 ? ? -74.77  -144.91 
70  10 ARG A 13 ? ? -117.86 75.97   
71  11 SER A 3  ? ? -90.87  57.63   
72  11 SER A 4  ? ? 66.83   107.31  
73  11 SER A 9  ? ? 55.77   -152.21 
74  11 TYR A 10 ? ? -66.40  -169.99 
75  11 ARG A 13 ? ? -90.59  58.62   
76  11 SER A 21 ? ? 67.54   -60.24  
77  11 THR A 23 ? ? -97.68  40.88   
78  11 GLU A 27 ? ? -94.90  30.54   
79  11 GLU A 28 ? ? -120.39 -143.88 
80  11 MET A 29 ? ? -94.18  32.49   
81  12 SER A 4  ? ? 70.30   -54.93  
82  12 CYS A 6  ? ? 72.67   138.66  
83  12 SER A 9  ? ? 64.74   154.86  
84  12 TYR A 10 ? ? 34.54   -160.30 
85  12 ARG A 11 ? ? -83.83  -146.46 
86  12 ARG A 13 ? ? -109.56 75.02   
87  12 LYS A 14 ? ? -67.53  69.76   
88  12 LYS A 22 ? ? 66.22   112.54  
89  13 ILE A 2  ? ? 56.92   91.03   
90  13 SER A 3  ? ? -150.05 57.21   
91  13 SER A 4  ? ? 69.98   -56.09  
92  13 SER A 9  ? ? 134.41  -178.03 
93  13 TYR A 10 ? ? -64.45  -176.25 
94  13 LEU A 25 ? ? -93.26  46.67   
95  13 GLU A 27 ? ? -93.96  39.41   
96  13 MET A 29 ? ? -97.43  42.45   
97  14 ILE A 2  ? ? 65.20   158.02  
98  14 SER A 3  ? ? -156.25 -156.14 
99  14 SER A 9  ? ? 66.52   116.03  
100 14 TYR A 10 ? ? 30.52   -136.86 
101 14 ARG A 13 ? ? 34.13   65.85   
102 14 ASN A 17 ? ? -128.07 -163.28 
103 14 LEU A 25 ? ? 57.04   82.53   
104 14 GLU A 28 ? ? -107.16 -63.87  
105 14 MET A 29 ? ? -145.10 -149.53 
106 15 SER A 4  ? ? -160.19 -73.91  
107 15 VAL A 7  ? ? -64.08  -76.00  
108 15 SEP A 8  ? ? -169.22 -46.62  
109 15 SER A 9  ? ? 134.03  131.25  
110 15 TYR A 10 ? ? 57.89   165.13  
111 15 ARG A 11 ? ? -70.80  -150.96 
112 15 ARG A 13 ? ? -118.41 66.23   
113 15 CYS A 24 ? ? -143.89 41.06   
114 15 GLU A 27 ? ? -85.57  48.81   
115 16 SER A 4  ? ? 58.89   19.28   
116 16 CYS A 6  ? ? 67.89   157.80  
117 16 SER A 9  ? ? 64.67   133.10  
118 16 TYR A 10 ? ? 50.26   177.54  
119 16 ARG A 11 ? ? -72.54  -150.04 
120 16 SER A 21 ? ? 57.45   76.82   
121 16 LYS A 22 ? ? 59.50   79.09   
122 16 CYS A 24 ? ? -101.73 -61.81  
123 16 LYS A 26 ? ? -96.11  47.63   
124 16 GLU A 27 ? ? -103.64 51.83   
125 17 SER A 3  ? ? -109.33 42.44   
126 17 SER A 9  ? ? 65.62   113.29  
127 17 TYR A 10 ? ? 37.80   -167.70 
128 17 ARG A 11 ? ? -78.52  -154.94 
129 17 LYS A 14 ? ? -78.94  48.89   
130 17 SER A 15 ? ? -165.58 77.60   
131 17 ASN A 17 ? ? -115.74 -169.14 
132 17 THR A 23 ? ? -89.28  31.89   
133 18 SER A 3  ? ? -109.33 42.44   
134 18 SER A 9  ? ? 65.62   113.29  
135 18 TYR A 10 ? ? 37.80   -167.70 
136 18 ARG A 11 ? ? -78.52  -154.94 
137 18 LYS A 14 ? ? -78.94  48.89   
138 18 SER A 15 ? ? -165.58 77.60   
139 18 ASN A 17 ? ? -115.74 -169.14 
140 18 THR A 23 ? ? -89.28  31.89   
141 19 ILE A 2  ? ? -107.88 74.63   
142 19 SER A 3  ? ? -156.50 -142.57 
143 19 SER A 4  ? ? 72.75   -56.34  
144 19 SER A 9  ? ? 132.44  133.23  
145 19 TYR A 10 ? ? 48.11   -179.58 
146 19 ARG A 11 ? ? -70.06  -153.75 
147 19 ARG A 13 ? ? -118.63 78.14   
148 19 SER A 15 ? ? 54.16   -168.99 
149 19 SER A 21 ? ? -97.09  -70.33  
150 19 LYS A 22 ? ? -153.18 54.93   
151 19 CYS A 24 ? ? -104.49 55.23   
152 20 SER A 3  ? ? -111.13 -166.94 
153 20 CYS A 6  ? ? 65.55   171.67  
154 20 SER A 9  ? ? 65.64   130.32  
155 20 TYR A 10 ? ? 47.67   178.81  
156 20 ARG A 11 ? ? -71.56  -153.95 
157 20 LYS A 14 ? ? -67.30  65.40   
158 20 PRO A 20 ? ? -97.21  -70.01  
159 20 SER A 21 ? ? -124.76 -66.80  
160 21 CYS A 6  ? ? 65.82   167.65  
161 21 SER A 9  ? ? 60.37   103.23  
162 21 TYR A 10 ? ? 41.40   -170.88 
163 21 ARG A 11 ? ? -81.81  -151.19 
164 21 ARG A 13 ? ? -118.16 78.86   
165 21 SER A 21 ? ? -152.68 -77.80  
166 21 LYS A 22 ? ? -148.11 57.40   
167 21 GLU A 28 ? ? -151.75 -144.68 
168 22 SER A 3  ? ? -123.94 -159.59 
169 22 SER A 4  ? ? -138.36 -73.11  
170 22 CYS A 6  ? ? -138.93 -154.06 
171 22 VAL A 7  ? ? -105.43 -139.82 
172 22 SER A 9  ? ? 61.33   -171.25 
173 22 TYR A 10 ? ? -64.77  -168.45 
174 22 ARG A 11 ? ? -86.78  48.63   
175 22 SER A 21 ? ? -156.83 -62.31  
176 22 LEU A 25 ? ? -134.26 -159.86 
177 22 LYS A 26 ? ? -66.81  95.29   
# 
loop_
_pdbx_validate_planes.id 
_pdbx_validate_planes.PDB_model_num 
_pdbx_validate_planes.auth_comp_id 
_pdbx_validate_planes.auth_asym_id 
_pdbx_validate_planes.auth_seq_id 
_pdbx_validate_planes.PDB_ins_code 
_pdbx_validate_planes.label_alt_id 
_pdbx_validate_planes.rmsd 
_pdbx_validate_planes.type 
1  1  ARG A 11 ? ? 0.316 'SIDE CHAIN' 
2  1  ARG A 13 ? ? 0.314 'SIDE CHAIN' 
3  2  ARG A 11 ? ? 0.296 'SIDE CHAIN' 
4  2  ARG A 13 ? ? 0.317 'SIDE CHAIN' 
5  3  ARG A 11 ? ? 0.315 'SIDE CHAIN' 
6  3  ARG A 13 ? ? 0.287 'SIDE CHAIN' 
7  4  ARG A 11 ? ? 0.315 'SIDE CHAIN' 
8  4  ARG A 13 ? ? 0.314 'SIDE CHAIN' 
9  5  ARG A 11 ? ? 0.255 'SIDE CHAIN' 
10 5  ARG A 13 ? ? 0.210 'SIDE CHAIN' 
11 6  ARG A 11 ? ? 0.295 'SIDE CHAIN' 
12 6  ARG A 13 ? ? 0.312 'SIDE CHAIN' 
13 7  ARG A 11 ? ? 0.289 'SIDE CHAIN' 
14 7  ARG A 13 ? ? 0.271 'SIDE CHAIN' 
15 8  ARG A 11 ? ? 0.316 'SIDE CHAIN' 
16 8  ARG A 13 ? ? 0.255 'SIDE CHAIN' 
17 9  ARG A 11 ? ? 0.298 'SIDE CHAIN' 
18 9  ARG A 13 ? ? 0.306 'SIDE CHAIN' 
19 10 ARG A 11 ? ? 0.317 'SIDE CHAIN' 
20 10 ARG A 13 ? ? 0.300 'SIDE CHAIN' 
21 11 ARG A 11 ? ? 0.306 'SIDE CHAIN' 
22 11 ARG A 13 ? ? 0.302 'SIDE CHAIN' 
23 12 ARG A 11 ? ? 0.297 'SIDE CHAIN' 
24 12 ARG A 13 ? ? 0.312 'SIDE CHAIN' 
25 13 ARG A 11 ? ? 0.306 'SIDE CHAIN' 
26 13 ARG A 13 ? ? 0.297 'SIDE CHAIN' 
27 14 ARG A 11 ? ? 0.283 'SIDE CHAIN' 
28 14 ARG A 13 ? ? 0.316 'SIDE CHAIN' 
29 15 ARG A 11 ? ? 0.316 'SIDE CHAIN' 
30 15 ARG A 13 ? ? 0.211 'SIDE CHAIN' 
31 16 ARG A 11 ? ? 0.316 'SIDE CHAIN' 
32 16 ARG A 13 ? ? 0.317 'SIDE CHAIN' 
33 17 ARG A 11 ? ? 0.294 'SIDE CHAIN' 
34 17 ARG A 13 ? ? 0.285 'SIDE CHAIN' 
35 18 ARG A 11 ? ? 0.294 'SIDE CHAIN' 
36 18 ARG A 13 ? ? 0.285 'SIDE CHAIN' 
37 19 ARG A 11 ? ? 0.312 'SIDE CHAIN' 
38 19 ARG A 13 ? ? 0.315 'SIDE CHAIN' 
39 20 ARG A 11 ? ? 0.316 'SIDE CHAIN' 
40 20 ARG A 13 ? ? 0.309 'SIDE CHAIN' 
41 21 ARG A 11 ? ? 0.302 'SIDE CHAIN' 
42 21 ARG A 13 ? ? 0.302 'SIDE CHAIN' 
43 22 ARG A 11 ? ? 0.312 'SIDE CHAIN' 
44 22 ARG A 13 ? ? 0.310 'SIDE CHAIN' 
#