data_1B5U
# 
_entry.id   1B5U 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1B5U         
RCSB  RCSB008309   
WWPDB D_1000008309 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1B5U 
_pdbx_database_status.recvd_initial_deposition_date   1999-01-11 
_pdbx_database_status.deposit_site                    BNL 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Takano, K.'    1 
'Yamagata, Y.'  2 
'Kubota, M.'    3 
'Funahashi, J.' 4 
'Fujii, S.'     5 
'Yutani, K.'    6 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 
;Contribution of hydrogen bonds to the conformational stability of human lysozyme: calorimetry and X-ray analysis of six Ser --> Ala mutants.
;
Biochemistry        38  6623 6629 1999 BICHAW US 0006-2960 0033 ? 10350481 10.1021/bi9901228 
1       
;A General Rule for the Relationship between Hydrophobic Effect and Conformational Stability of a Protein: Stability and Structure of a Series of Hydrophobic Mutants of Human Lysozyme
;
J.Mol.Biol.         280 749  ?    1998 JMOBAK UK 0022-2836 0070 ? ?        ?                 
2       
;Contribution of Hydrogen Bonds to the Conformational Stability of Human Lysozyme: Calorimetry and X-Ray Analysis of Six Tyr->Phe Mutants
;
Biochemistry        37  9355 ?    1998 BICHAW US 0006-2960 0033 ? ?        ?                 
3       
;Contribution of Hydrophobic Effect Valine Mutants to the Stability of Human Lysozyme: Calorimetric Studies and X-Ray Structural Analyses of the Nine Valine to Alanine Mutants
;
Biochemistry        36  688  ?    1997 BICHAW US 0006-2960 0033 ? ?        ?                 
4       'Contribution of Water Molecules in the Interior of a Protein to the Conformational Stability' J.Mol.Biol.         274 132 
?    1997 JMOBAK UK 0022-2836 0070 ? ?        ?                 
5       'The Structure, Stability, and Folding Process of Amyloidogenic Mutant Human Lysozyme' 'J.Biochem.(TOKYO)' 120 1216 ?    
1996 JOBIAO JA 0021-924X 0418 ? ?        ?                 
6       
;Contribution of Hydrophobic Residues to the Stability of Human Lysozyme: Calorimetric Studies and X-Ray Structural Analysis of the Five Isoleucine to Valine Mutants
;
J.Mol.Biol.         254 62   ?    1995 JMOBAK UK 0022-2836 0070 ? ?        ?                 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Takano, K.'       1  
primary 'Yamagata, Y.'     2  
primary 'Kubota, M.'       3  
primary 'Funahashi, J.'    4  
primary 'Fujii, S.'        5  
primary 'Yutani, K.'       6  
1       'Takano, K.'       7  
1       'Yamagata, Y.'     8  
1       'Yutani, K.'       9  
2       'Yamagata, Y.'     10 
2       'Kubota, M.'       11 
2       'Sumikawa, Y.'     12 
2       'Funahashi, J.'    13 
2       'Takano, K.'       14 
2       'Fujii, S.'        15 
2       'Yutani, K.'       16 
3       'Takano, K.'       17 
3       'Yamagata, Y.'     18 
3       'Fujii, S.'        19 
3       'Yutani, K.'       20 
4       'Takano, K.'       21 
4       'Funahasihi, J.F.' 22 
4       'Yamagata, Y.'     23 
4       'Fujii, S.'        24 
4       'Yutani, K.'       25 
5       'Funahashi, J.'    26 
5       'Takano, K.'       27 
5       'Ogasahara, K.'    28 
5       'Yamagata, Y.'     29 
5       'Yutani, K.'       30 
6       'Takano, K.'       31 
6       'Ogasawaha, K.'    32 
6       'Kaneda, H.'       33 
6       'Yamagata, Y.'     34 
6       'Fujii, S.'        35 
6       'Kanaya, E.'       36 
6       'Kikuchi, M.'      37 
6       'Oobatake, M.'     38 
6       'Yutani, K.'       39 
# 
_cell.entry_id           1B5U 
_cell.length_a           56.960 
_cell.length_b           60.980 
_cell.length_c           33.780 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1B5U 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'PROTEIN (LYSOZYME)' 14704.693 1   3.2.1.17 S24A ? ? 
2 non-polymer syn 'SODIUM ION'         22.990    1   ?        ?    ? ? 
3 water       nat water                18.015    233 ?        ?    ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;KVFERCELARTLKRLGMDGYRGIALANWMCLAKWESGYNTRATNYNAGDRSTDYGIFQINSRYWCNDGKTPGAVNACHLS
CSALLQDNIADAVACAKRVVRDPQGIRAWVAWRNRCQNRDVRQYVQGCGV
;
_entity_poly.pdbx_seq_one_letter_code_can   
;KVFERCELARTLKRLGMDGYRGIALANWMCLAKWESGYNTRATNYNAGDRSTDYGIFQINSRYWCNDGKTPGAVNACHLS
CSALLQDNIADAVACAKRVVRDPQGIRAWVAWRNRCQNRDVRQYVQGCGV
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   LYS n 
1 2   VAL n 
1 3   PHE n 
1 4   GLU n 
1 5   ARG n 
1 6   CYS n 
1 7   GLU n 
1 8   LEU n 
1 9   ALA n 
1 10  ARG n 
1 11  THR n 
1 12  LEU n 
1 13  LYS n 
1 14  ARG n 
1 15  LEU n 
1 16  GLY n 
1 17  MET n 
1 18  ASP n 
1 19  GLY n 
1 20  TYR n 
1 21  ARG n 
1 22  GLY n 
1 23  ILE n 
1 24  ALA n 
1 25  LEU n 
1 26  ALA n 
1 27  ASN n 
1 28  TRP n 
1 29  MET n 
1 30  CYS n 
1 31  LEU n 
1 32  ALA n 
1 33  LYS n 
1 34  TRP n 
1 35  GLU n 
1 36  SER n 
1 37  GLY n 
1 38  TYR n 
1 39  ASN n 
1 40  THR n 
1 41  ARG n 
1 42  ALA n 
1 43  THR n 
1 44  ASN n 
1 45  TYR n 
1 46  ASN n 
1 47  ALA n 
1 48  GLY n 
1 49  ASP n 
1 50  ARG n 
1 51  SER n 
1 52  THR n 
1 53  ASP n 
1 54  TYR n 
1 55  GLY n 
1 56  ILE n 
1 57  PHE n 
1 58  GLN n 
1 59  ILE n 
1 60  ASN n 
1 61  SER n 
1 62  ARG n 
1 63  TYR n 
1 64  TRP n 
1 65  CYS n 
1 66  ASN n 
1 67  ASP n 
1 68  GLY n 
1 69  LYS n 
1 70  THR n 
1 71  PRO n 
1 72  GLY n 
1 73  ALA n 
1 74  VAL n 
1 75  ASN n 
1 76  ALA n 
1 77  CYS n 
1 78  HIS n 
1 79  LEU n 
1 80  SER n 
1 81  CYS n 
1 82  SER n 
1 83  ALA n 
1 84  LEU n 
1 85  LEU n 
1 86  GLN n 
1 87  ASP n 
1 88  ASN n 
1 89  ILE n 
1 90  ALA n 
1 91  ASP n 
1 92  ALA n 
1 93  VAL n 
1 94  ALA n 
1 95  CYS n 
1 96  ALA n 
1 97  LYS n 
1 98  ARG n 
1 99  VAL n 
1 100 VAL n 
1 101 ARG n 
1 102 ASP n 
1 103 PRO n 
1 104 GLN n 
1 105 GLY n 
1 106 ILE n 
1 107 ARG n 
1 108 ALA n 
1 109 TRP n 
1 110 VAL n 
1 111 ALA n 
1 112 TRP n 
1 113 ARG n 
1 114 ASN n 
1 115 ARG n 
1 116 CYS n 
1 117 GLN n 
1 118 ASN n 
1 119 ARG n 
1 120 ASP n 
1 121 VAL n 
1 122 ARG n 
1 123 GLN n 
1 124 TYR n 
1 125 VAL n 
1 126 GLN n 
1 127 GLY n 
1 128 CYS n 
1 129 GLY n 
1 130 VAL n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    AH22R- 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               
;baker's yeast
;
_entity_src_gen.pdbx_host_org_scientific_name      'Saccharomyces cerevisiae' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     4932 
_entity_src_gen.host_org_genus                     Saccharomyces 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               AH22R- 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PGEL125 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    LYSC_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P61626 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1B5U 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 130 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P61626 
_struct_ref_seq.db_align_beg                  19 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  148 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       130 
# 
_struct_ref_seq_dif.align_id                     1 
_struct_ref_seq_dif.pdbx_pdb_id_code             1B5U 
_struct_ref_seq_dif.mon_id                       ALA 
_struct_ref_seq_dif.pdbx_pdb_strand_id           A 
_struct_ref_seq_dif.seq_num                      24 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   P61626 
_struct_ref_seq_dif.db_mon_id                    SER 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          42 
_struct_ref_seq_dif.details                      ENGINEERED 
_struct_ref_seq_dif.pdbx_auth_seq_num            24 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
NA  non-polymer         . 'SODIUM ION'    ? 'Na 1'           22.990  
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1B5U 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.0 
_exptl_crystal.density_percent_sol   38 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              4.5 
_exptl_crystal_grow.pdbx_details    '1.5M TO 1.8M NACL, 20MM ACETATE, PH 4.5' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           283 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               DIFFRACTOMETER 
_diffrn_detector.type                   WEISSENBERG 
_diffrn_detector.pdbx_collection_date   1996-10-31 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'PHOTON FACTORY BEAMLINE BL-18B' 
_diffrn_source.pdbx_synchrotron_site       'Photon Factory' 
_diffrn_source.pdbx_synchrotron_beamline   BL-18B 
_diffrn_source.pdbx_wavelength             1.0 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1B5U 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             40.0 
_reflns.d_resolution_high            1.8 
_reflns.number_obs                   10868 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         95.2 
_reflns.pdbx_Rmerge_I_obs            0.036 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        36.8 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              4.3 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             1.80 
_reflns_shell.d_res_low              1.83 
_reflns_shell.percent_possible_all   85.7 
_reflns_shell.Rmerge_I_obs           0.113 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    13.2 
_reflns_shell.pdbx_redundancy        4.0 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1B5U 
_refine.ls_number_reflns_obs                     10355 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          3.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             8.0 
_refine.ls_d_res_high                            1.8 
_refine.ls_percent_reflns_obs                    92.0 
_refine.ls_R_factor_obs                          0.156 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.156 
_refine.ls_R_factor_R_free                       ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'WILD-TYPE OF HUMAN LYSOZYME' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1028 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         1 
_refine_hist.number_atoms_solvent             233 
_refine_hist.number_atoms_total               1262 
_refine_hist.d_res_high                       1.8 
_refine_hist.d_res_low                        8.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d                0.008 ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg             1.50  ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  1B5U 
_struct.title                     
;CONTRIBUTION OF HYDROGEN BONDS TO THE CONFORMATIONAL STABILITY OF HUMAN LYSOZYME: CALORIMETRY AND X-RAY ANALYSIS OF SIX SER->ALA MUTANT
;
_struct.pdbx_descriptor           LYSOZYME 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1B5U 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            'HYDROGEN BOND, STABILITY, HYDROLASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ARG A 5   ? ARG A 14  ? ARG A 5   ARG A 14  1 ? 10 
HELX_P HELX_P2 2 TYR A 20  ? GLY A 22  ? TYR A 20  GLY A 22  5 ? 3  
HELX_P HELX_P3 3 LEU A 25  ? SER A 36  ? LEU A 25  SER A 36  1 ? 12 
HELX_P HELX_P4 4 CYS A 81  ? LEU A 85  ? CYS A 81  LEU A 85  5 ? 5  
HELX_P HELX_P5 5 ALA A 90  ? ARG A 101 ? ALA A 90  ARG A 101 1 ? 12 
HELX_P HELX_P6 6 GLY A 105 ? ALA A 108 ? GLY A 105 ALA A 108 5 ? 4  
HELX_P HELX_P7 7 VAL A 110 ? ARG A 115 ? VAL A 110 ARG A 115 1 ? 6  
HELX_P HELX_P8 8 ARG A 122 ? TYR A 124 ? ARG A 122 TYR A 124 5 ? 3  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 6  SG ? ? ? 1_555 A CYS 128 SG ? ? A CYS 6   A CYS 128 1_555 ? ? ? ? ? ? ? 2.032 ? 
disulf2 disulf ? ? A CYS 30 SG ? ? ? 1_555 A CYS 116 SG ? ? A CYS 30  A CYS 116 1_555 ? ? ? ? ? ? ? 2.025 ? 
disulf3 disulf ? ? A CYS 65 SG ? ? ? 1_555 A CYS 81  SG ? ? A CYS 65  A CYS 81  1_555 ? ? ? ? ? ? ? 2.034 ? 
disulf4 disulf ? ? A CYS 77 SG ? ? ? 1_555 A CYS 95  SG ? ? A CYS 77  A CYS 95  1_555 ? ? ? ? ? ? ? 2.029 ? 
metalc1 metalc ? ? B NA  .  NA ? ? ? 1_555 C HOH .   O  ? ? A NA  331 A HOH 145 1_555 ? ? ? ? ? ? ? 2.361 ? 
metalc2 metalc ? ? B NA  .  NA ? ? ? 1_555 C HOH .   O  ? ? A NA  331 A HOH 158 1_555 ? ? ? ? ? ? ? 2.151 ? 
metalc3 metalc ? ? B NA  .  NA ? ? ? 1_555 A SER 61  O  ? ? A NA  331 A SER 61  1_554 ? ? ? ? ? ? ? 2.037 ? 
metalc4 metalc ? ? B NA  .  NA ? ? ? 1_555 A CYS 65  O  ? ? A NA  331 A CYS 65  1_554 ? ? ? ? ? ? ? 2.252 ? 
metalc5 metalc ? ? B NA  .  NA ? ? ? 1_555 A VAL 74  O  ? ? A NA  331 A VAL 74  1_554 ? ? ? ? ? ? ? 2.461 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
metalc ? ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   2 
_struct_sheet.details          ? 
# 
_struct_sheet_order.sheet_id     A 
_struct_sheet_order.range_id_1   1 
_struct_sheet_order.range_id_2   2 
_struct_sheet_order.offset       ? 
_struct_sheet_order.sense        anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 THR A 43 ? ASN A 46 ? THR A 43 ASN A 46 
A 2 SER A 51 ? TYR A 54 ? SER A 51 TYR A 54 
# 
_pdbx_struct_sheet_hbond.sheet_id                A 
_pdbx_struct_sheet_hbond.range_id_1              1 
_pdbx_struct_sheet_hbond.range_id_2              2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id   O 
_pdbx_struct_sheet_hbond.range_1_label_comp_id   ASN 
_pdbx_struct_sheet_hbond.range_1_label_asym_id   A 
_pdbx_struct_sheet_hbond.range_1_label_seq_id    44 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code    ? 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id    O 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id    ASN 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id    A 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id     44 
_pdbx_struct_sheet_hbond.range_2_label_atom_id   N 
_pdbx_struct_sheet_hbond.range_2_label_comp_id   ASP 
_pdbx_struct_sheet_hbond.range_2_label_asym_id   A 
_pdbx_struct_sheet_hbond.range_2_label_seq_id    53 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code    ? 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id    N 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id    ASP 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id    A 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id     53 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    6 
_struct_site.details              'BINDING SITE FOR RESIDUE NA A 331' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 6 SER A 61 ? SER A 61  . ? 1_554 ? 
2 AC1 6 CYS A 65 ? CYS A 65  . ? 1_554 ? 
3 AC1 6 ALA A 73 ? ALA A 73  . ? 1_554 ? 
4 AC1 6 VAL A 74 ? VAL A 74  . ? 1_554 ? 
5 AC1 6 HOH C .  ? HOH A 145 . ? 1_555 ? 
6 AC1 6 HOH C .  ? HOH A 158 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1B5U 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1B5U 
_atom_sites.fract_transf_matrix[1][1]   0.017556 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.016399 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.029603 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
N  
NA 
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . LYS A 1 1   ? 1.056  19.428 22.850 1.00 11.24 ? 1   LYS A N   1 
ATOM   2    C  CA  . LYS A 1 1   ? 1.601  20.386 21.862 1.00 7.87  ? 1   LYS A CA  1 
ATOM   3    C  C   . LYS A 1 1   ? 2.874  19.803 21.245 1.00 9.36  ? 1   LYS A C   1 
ATOM   4    O  O   . LYS A 1 1   ? 3.664  19.158 21.932 1.00 9.41  ? 1   LYS A O   1 
ATOM   5    C  CB  . LYS A 1 1   ? 1.916  21.721 22.567 1.00 8.61  ? 1   LYS A CB  1 
ATOM   6    C  CG  . LYS A 1 1   ? 2.875  22.646 21.828 1.00 16.65 ? 1   LYS A CG  1 
ATOM   7    C  CD  . LYS A 1 1   ? 3.236  23.859 22.675 1.00 13.54 ? 1   LYS A CD  1 
ATOM   8    C  CE  . LYS A 1 1   ? 4.060  24.845 21.868 1.00 15.68 ? 1   LYS A CE  1 
ATOM   9    N  NZ  . LYS A 1 1   ? 4.367  26.057 22.670 1.00 31.73 ? 1   LYS A NZ  1 
ATOM   10   N  N   . VAL A 1 2   ? 3.030  19.998 19.939 1.00 9.00  ? 2   VAL A N   1 
ATOM   11   C  CA  . VAL A 1 2   ? 4.223  19.556 19.227 1.00 8.09  ? 2   VAL A CA  1 
ATOM   12   C  C   . VAL A 1 2   ? 5.048  20.809 18.943 1.00 8.37  ? 2   VAL A C   1 
ATOM   13   O  O   . VAL A 1 2   ? 4.636  21.654 18.151 1.00 8.38  ? 2   VAL A O   1 
ATOM   14   C  CB  . VAL A 1 2   ? 3.870  18.886 17.888 1.00 10.10 ? 2   VAL A CB  1 
ATOM   15   C  CG1 . VAL A 1 2   ? 5.143  18.506 17.145 1.00 11.20 ? 2   VAL A CG1 1 
ATOM   16   C  CG2 . VAL A 1 2   ? 2.990  17.664 18.137 1.00 10.76 ? 2   VAL A CG2 1 
ATOM   17   N  N   . PHE A 1 3   ? 6.165  20.960 19.648 1.00 5.56  ? 3   PHE A N   1 
ATOM   18   C  CA  . PHE A 1 3   ? 7.056  22.107 19.463 1.00 7.77  ? 3   PHE A CA  1 
ATOM   19   C  C   . PHE A 1 3   ? 7.814  22.071 18.140 1.00 7.75  ? 3   PHE A C   1 
ATOM   20   O  O   . PHE A 1 3   ? 8.103  20.998 17.605 1.00 8.07  ? 3   PHE A O   1 
ATOM   21   C  CB  . PHE A 1 3   ? 8.127  22.145 20.567 1.00 7.26  ? 3   PHE A CB  1 
ATOM   22   C  CG  . PHE A 1 3   ? 7.682  22.785 21.842 1.00 7.99  ? 3   PHE A CG  1 
ATOM   23   C  CD1 . PHE A 1 3   ? 6.972  22.058 22.791 1.00 9.94  ? 3   PHE A CD1 1 
ATOM   24   C  CD2 . PHE A 1 3   ? 7.993  24.121 22.112 1.00 5.90  ? 3   PHE A CD2 1 
ATOM   25   C  CE1 . PHE A 1 3   ? 6.579  22.646 23.988 1.00 9.99  ? 3   PHE A CE1 1 
ATOM   26   C  CE2 . PHE A 1 3   ? 7.605  24.708 23.299 1.00 6.58  ? 3   PHE A CE2 1 
ATOM   27   C  CZ  . PHE A 1 3   ? 6.899  23.980 24.238 1.00 9.41  ? 3   PHE A CZ  1 
ATOM   28   N  N   . GLU A 1 4   ? 8.132  23.256 17.624 1.00 7.53  ? 4   GLU A N   1 
ATOM   29   C  CA  . GLU A 1 4   ? 8.951  23.375 16.429 1.00 7.29  ? 4   GLU A CA  1 
ATOM   30   C  C   . GLU A 1 4   ? 10.342 23.404 17.068 1.00 7.92  ? 4   GLU A C   1 
ATOM   31   O  O   . GLU A 1 4   ? 10.484 23.865 18.205 1.00 7.67  ? 4   GLU A O   1 
ATOM   32   C  CB  . GLU A 1 4   ? 8.699  24.700 15.709 1.00 12.08 ? 4   GLU A CB  1 
ATOM   33   C  CG  . GLU A 1 4   ? 7.259  24.925 15.321 1.00 26.83 ? 4   GLU A CG  1 
ATOM   34   C  CD  . GLU A 1 4   ? 6.948  24.459 13.912 1.00 44.64 ? 4   GLU A CD  1 
ATOM   35   O  OE1 . GLU A 1 4   ? 6.947  23.229 13.668 1.00 54.15 ? 4   GLU A OE1 1 
ATOM   36   O  OE2 . GLU A 1 4   ? 6.692  25.332 13.050 1.00 48.88 ? 4   GLU A OE2 1 
ATOM   37   N  N   . ARG A 1 5   ? 11.355 22.932 16.347 1.00 7.86  ? 5   ARG A N   1 
ATOM   38   C  CA  . ARG A 1 5   ? 12.730 22.871 16.856 1.00 6.78  ? 5   ARG A CA  1 
ATOM   39   C  C   . ARG A 1 5   ? 13.252 24.131 17.547 1.00 8.52  ? 5   ARG A C   1 
ATOM   40   O  O   . ARG A 1 5   ? 13.522 24.114 18.747 1.00 5.15  ? 5   ARG A O   1 
ATOM   41   C  CB  . ARG A 1 5   ? 13.706 22.463 15.740 1.00 5.12  ? 5   ARG A CB  1 
ATOM   42   C  CG  . ARG A 1 5   ? 15.130 22.190 16.234 1.00 5.11  ? 5   ARG A CG  1 
ATOM   43   C  CD  . ARG A 1 5   ? 16.007 21.655 15.111 1.00 12.15 ? 5   ARG A CD  1 
ATOM   44   N  NE  . ARG A 1 5   ? 16.079 22.576 13.975 1.00 15.84 ? 5   ARG A NE  1 
ATOM   45   C  CZ  . ARG A 1 5   ? 17.032 23.495 13.806 1.00 22.29 ? 5   ARG A CZ  1 
ATOM   46   N  NH1 . ARG A 1 5   ? 18.010 23.616 14.695 1.00 14.46 ? 5   ARG A NH1 1 
ATOM   47   N  NH2 . ARG A 1 5   ? 17.020 24.287 12.741 1.00 18.00 ? 5   ARG A NH2 1 
ATOM   48   N  N   . CYS A 1 6   ? 13.365 25.236 16.814 1.00 6.24  ? 6   CYS A N   1 
ATOM   49   C  CA  . CYS A 1 6   ? 13.918 26.461 17.406 1.00 7.21  ? 6   CYS A CA  1 
ATOM   50   C  C   . CYS A 1 6   ? 13.075 27.071 18.487 1.00 6.40  ? 6   CYS A C   1 
ATOM   51   O  O   . CYS A 1 6   ? 13.601 27.692 19.402 1.00 8.47  ? 6   CYS A O   1 
ATOM   52   C  CB  . CYS A 1 6   ? 14.288 27.476 16.324 1.00 8.88  ? 6   CYS A CB  1 
ATOM   53   S  SG  . CYS A 1 6   ? 15.650 26.868 15.276 1.00 9.11  ? 6   CYS A SG  1 
ATOM   54   N  N   . GLU A 1 7   ? 11.768 26.865 18.412 1.00 5.17  ? 7   GLU A N   1 
ATOM   55   C  CA  . GLU A 1 7   ? 10.878 27.367 19.440 1.00 6.71  ? 7   GLU A CA  1 
ATOM   56   C  C   . GLU A 1 7   ? 11.230 26.662 20.753 1.00 5.99  ? 7   GLU A C   1 
ATOM   57   O  O   . GLU A 1 7   ? 11.399 27.293 21.794 1.00 5.29  ? 7   GLU A O   1 
ATOM   58   C  CB  . GLU A 1 7   ? 9.428  27.093 19.048 1.00 12.65 ? 7   GLU A CB  1 
ATOM   59   C  CG  . GLU A 1 7   ? 8.417  27.341 20.147 1.00 19.67 ? 7   GLU A CG  1 
ATOM   60   C  CD  . GLU A 1 7   ? 7.038  26.732 19.867 1.00 28.58 ? 7   GLU A CD  1 
ATOM   61   O  OE1 . GLU A 1 7   ? 6.893  25.854 18.973 1.00 19.77 ? 7   GLU A OE1 1 
ATOM   62   O  OE2 . GLU A 1 7   ? 6.089  27.135 20.574 1.00 25.87 ? 7   GLU A OE2 1 
ATOM   63   N  N   . LEU A 1 8   ? 11.385 25.347 20.708 1.00 4.43  ? 8   LEU A N   1 
ATOM   64   C  CA  . LEU A 1 8   ? 11.724 24.615 21.923 1.00 2.92  ? 8   LEU A CA  1 
ATOM   65   C  C   . LEU A 1 8   ? 13.105 25.025 22.453 1.00 2.00  ? 8   LEU A C   1 
ATOM   66   O  O   . LEU A 1 8   ? 13.302 25.144 23.657 1.00 3.33  ? 8   LEU A O   1 
ATOM   67   C  CB  . LEU A 1 8   ? 11.680 23.096 21.670 1.00 3.77  ? 8   LEU A CB  1 
ATOM   68   C  CG  . LEU A 1 8   ? 12.055 22.228 22.886 1.00 2.21  ? 8   LEU A CG  1 
ATOM   69   C  CD1 . LEU A 1 8   ? 11.066 22.421 24.010 1.00 2.00  ? 8   LEU A CD1 1 
ATOM   70   C  CD2 . LEU A 1 8   ? 12.158 20.767 22.474 1.00 7.86  ? 8   LEU A CD2 1 
ATOM   71   N  N   . ALA A 1 9   ? 14.061 25.220 21.551 1.00 2.85  ? 9   ALA A N   1 
ATOM   72   C  CA  . ALA A 1 9   ? 15.416 25.570 21.931 1.00 3.88  ? 9   ALA A CA  1 
ATOM   73   C  C   . ALA A 1 9   ? 15.415 26.872 22.720 1.00 4.57  ? 9   ALA A C   1 
ATOM   74   O  O   . ALA A 1 9   ? 16.038 26.983 23.781 1.00 3.37  ? 9   ALA A O   1 
ATOM   75   C  CB  . ALA A 1 9   ? 16.300 25.690 20.679 1.00 4.54  ? 9   ALA A CB  1 
ATOM   76   N  N   . ARG A 1 10  ? 14.673 27.851 22.224 1.00 6.60  ? 10  ARG A N   1 
ATOM   77   C  CA  . ARG A 1 10  ? 14.594 29.132 22.919 1.00 8.56  ? 10  ARG A CA  1 
ATOM   78   C  C   . ARG A 1 10  ? 13.878 29.019 24.262 1.00 4.62  ? 10  ARG A C   1 
ATOM   79   O  O   . ARG A 1 10  ? 14.336 29.602 25.254 1.00 4.85  ? 10  ARG A O   1 
ATOM   80   C  CB  . ARG A 1 10  ? 13.954 30.186 22.024 1.00 7.79  ? 10  ARG A CB  1 
ATOM   81   C  CG  . ARG A 1 10  ? 14.866 30.551 20.868 1.00 10.68 ? 10  ARG A CG  1 
ATOM   82   C  CD  . ARG A 1 10  ? 14.344 31.746 20.120 1.00 15.30 ? 10  ARG A CD  1 
ATOM   83   N  NE  . ARG A 1 10  ? 13.093 31.463 19.439 1.00 7.99  ? 10  ARG A NE  1 
ATOM   84   C  CZ  . ARG A 1 10  ? 13.021 31.043 18.183 1.00 5.83  ? 10  ARG A CZ  1 
ATOM   85   N  NH1 . ARG A 1 10  ? 14.127 30.833 17.486 1.00 8.22  ? 10  ARG A NH1 1 
ATOM   86   N  NH2 . ARG A 1 10  ? 11.840 30.814 17.630 1.00 10.79 ? 10  ARG A NH2 1 
ATOM   87   N  N   . THR A 1 11  ? 12.852 28.166 24.323 1.00 2.94  ? 11  THR A N   1 
ATOM   88   C  CA  . THR A 1 11  ? 12.089 27.946 25.541 1.00 2.93  ? 11  THR A CA  1 
ATOM   89   C  C   . THR A 1 11  ? 12.950 27.304 26.624 1.00 5.06  ? 11  THR A C   1 
ATOM   90   O  O   . THR A 1 11  ? 12.941 27.743 27.782 1.00 4.02  ? 11  THR A O   1 
ATOM   91   C  CB  . THR A 1 11  ? 10.836 27.081 25.256 1.00 3.79  ? 11  THR A CB  1 
ATOM   92   O  OG1 . THR A 1 11  ? 10.000 27.750 24.303 1.00 9.44  ? 11  THR A OG1 1 
ATOM   93   C  CG2 . THR A 1 11  ? 10.033 26.851 26.517 1.00 5.50  ? 11  THR A CG2 1 
ATOM   94   N  N   . LEU A 1 12  ? 13.725 26.284 26.244 1.00 5.83  ? 12  LEU A N   1 
ATOM   95   C  CA  . LEU A 1 12  ? 14.607 25.589 27.190 1.00 3.94  ? 12  LEU A CA  1 
ATOM   96   C  C   . LEU A 1 12  ? 15.710 26.510 27.714 1.00 4.54  ? 12  LEU A C   1 
ATOM   97   O  O   . LEU A 1 12  ? 16.065 26.463 28.896 1.00 3.90  ? 12  LEU A O   1 
ATOM   98   C  CB  . LEU A 1 12  ? 15.201 24.315 26.549 1.00 4.13  ? 12  LEU A CB  1 
ATOM   99   C  CG  . LEU A 1 12  ? 14.228 23.165 26.229 1.00 4.73  ? 12  LEU A CG  1 
ATOM   100  C  CD1 . LEU A 1 12  ? 14.953 22.013 25.529 1.00 3.35  ? 12  LEU A CD1 1 
ATOM   101  C  CD2 . LEU A 1 12  ? 13.594 22.660 27.520 1.00 5.55  ? 12  LEU A CD2 1 
ATOM   102  N  N   . LYS A 1 13  ? 16.254 27.352 26.844 1.00 4.26  ? 13  LYS A N   1 
ATOM   103  C  CA  . LYS A 1 13  ? 17.289 28.282 27.282 1.00 5.29  ? 13  LYS A CA  1 
ATOM   104  C  C   . LYS A 1 13  ? 16.711 29.239 28.325 1.00 4.90  ? 13  LYS A C   1 
ATOM   105  O  O   . LYS A 1 13  ? 17.337 29.504 29.349 1.00 7.36  ? 13  LYS A O   1 
ATOM   106  C  CB  . LYS A 1 13  ? 17.869 29.080 26.109 1.00 7.32  ? 13  LYS A CB  1 
ATOM   107  C  CG  . LYS A 1 13  ? 19.167 29.802 26.483 1.00 6.98  ? 13  LYS A CG  1 
ATOM   108  C  CD  . LYS A 1 13  ? 19.804 30.469 25.298 1.00 19.86 ? 13  LYS A CD  1 
ATOM   109  C  CE  . LYS A 1 13  ? 21.188 31.033 25.651 1.00 27.70 ? 13  LYS A CE  1 
ATOM   110  N  NZ  . LYS A 1 13  ? 21.138 32.030 26.747 1.00 32.40 ? 13  LYS A NZ  1 
ATOM   111  N  N   . ARG A 1 14  ? 15.494 29.716 28.090 1.00 4.48  ? 14  ARG A N   1 
ATOM   112  C  CA  . ARG A 1 14  ? 14.853 30.637 29.015 1.00 6.47  ? 14  ARG A CA  1 
ATOM   113  C  C   . ARG A 1 14  ? 14.573 29.975 30.368 1.00 7.80  ? 14  ARG A C   1 
ATOM   114  O  O   . ARG A 1 14  ? 14.596 30.632 31.416 1.00 7.91  ? 14  ARG A O   1 
ATOM   115  C  CB  . ARG A 1 14  ? 13.569 31.152 28.377 1.00 11.35 ? 14  ARG A CB  1 
ATOM   116  C  CG  . ARG A 1 14  ? 13.053 32.450 28.924 1.00 27.95 ? 14  ARG A CG  1 
ATOM   117  C  CD  . ARG A 1 14  ? 12.046 33.044 27.957 1.00 28.86 ? 14  ARG A CD  1 
ATOM   118  N  NE  . ARG A 1 14  ? 10.987 32.096 27.630 1.00 33.88 ? 14  ARG A NE  1 
ATOM   119  C  CZ  . ARG A 1 14  ? 10.614 31.783 26.393 1.00 33.13 ? 14  ARG A CZ  1 
ATOM   120  N  NH1 . ARG A 1 14  ? 11.223 32.331 25.346 1.00 35.49 ? 14  ARG A NH1 1 
ATOM   121  N  NH2 . ARG A 1 14  ? 9.634  30.906 26.206 1.00 24.85 ? 14  ARG A NH2 1 
ATOM   122  N  N   . LEU A 1 15  ? 14.368 28.658 30.352 1.00 7.89  ? 15  LEU A N   1 
ATOM   123  C  CA  . LEU A 1 15  ? 14.105 27.901 31.579 1.00 6.74  ? 15  LEU A CA  1 
ATOM   124  C  C   . LEU A 1 15  ? 15.384 27.457 32.297 1.00 7.83  ? 15  LEU A C   1 
ATOM   125  O  O   . LEU A 1 15  ? 15.323 26.705 33.263 1.00 9.19  ? 15  LEU A O   1 
ATOM   126  C  CB  . LEU A 1 15  ? 13.191 26.706 31.288 1.00 5.94  ? 15  LEU A CB  1 
ATOM   127  C  CG  . LEU A 1 15  ? 11.809 27.085 30.761 1.00 7.87  ? 15  LEU A CG  1 
ATOM   128  C  CD1 . LEU A 1 15  ? 11.066 25.843 30.338 1.00 9.98  ? 15  LEU A CD1 1 
ATOM   129  C  CD2 . LEU A 1 15  ? 11.034 27.837 31.813 1.00 10.70 ? 15  LEU A CD2 1 
ATOM   130  N  N   . GLY A 1 16  ? 16.541 27.886 31.793 1.00 6.39  ? 16  GLY A N   1 
ATOM   131  C  CA  . GLY A 1 16  ? 17.812 27.587 32.441 1.00 6.57  ? 16  GLY A CA  1 
ATOM   132  C  C   . GLY A 1 16  ? 18.417 26.220 32.220 1.00 6.22  ? 16  GLY A C   1 
ATOM   133  O  O   . GLY A 1 16  ? 19.193 25.754 33.048 1.00 7.29  ? 16  GLY A O   1 
ATOM   134  N  N   . MET A 1 17  ? 18.143 25.628 31.063 1.00 4.41  ? 17  MET A N   1 
ATOM   135  C  CA  . MET A 1 17  ? 18.648 24.294 30.764 1.00 5.12  ? 17  MET A CA  1 
ATOM   136  C  C   . MET A 1 17  ? 20.012 24.300 30.128 1.00 7.07  ? 17  MET A C   1 
ATOM   137  O  O   . MET A 1 17  ? 20.712 23.286 30.152 1.00 7.21  ? 17  MET A O   1 
ATOM   138  C  CB  . MET A 1 17  ? 17.662 23.541 29.874 1.00 6.11  ? 17  MET A CB  1 
ATOM   139  C  CG  . MET A 1 17  ? 16.351 23.194 30.578 1.00 8.30  ? 17  MET A CG  1 
ATOM   140  S  SD  . MET A 1 17  ? 16.620 21.987 31.888 1.00 15.15 ? 17  MET A SD  1 
ATOM   141  C  CE  . MET A 1 17  ? 15.995 20.517 31.032 1.00 16.97 ? 17  MET A CE  1 
ATOM   142  N  N   . ASP A 1 18  ? 20.423 25.439 29.583 1.00 4.89  ? 18  ASP A N   1 
ATOM   143  C  CA  . ASP A 1 18  ? 21.732 25.477 28.934 1.00 6.80  ? 18  ASP A CA  1 
ATOM   144  C  C   . ASP A 1 18  ? 22.872 25.379 29.939 1.00 7.85  ? 18  ASP A C   1 
ATOM   145  O  O   . ASP A 1 18  ? 23.119 26.308 30.700 1.00 10.05 ? 18  ASP A O   1 
ATOM   146  C  CB  . ASP A 1 18  ? 21.896 26.713 28.040 1.00 7.77  ? 18  ASP A CB  1 
ATOM   147  C  CG  . ASP A 1 18  ? 23.052 26.569 27.036 1.00 14.02 ? 18  ASP A CG  1 
ATOM   148  O  OD1 . ASP A 1 18  ? 23.619 25.454 26.902 1.00 11.26 ? 18  ASP A OD1 1 
ATOM   149  O  OD2 . ASP A 1 18  ? 23.390 27.569 26.375 1.00 21.35 ? 18  ASP A OD2 1 
ATOM   150  N  N   . GLY A 1 19  ? 23.541 24.228 29.951 1.00 6.15  ? 19  GLY A N   1 
ATOM   151  C  CA  . GLY A 1 19  ? 24.649 24.012 30.858 1.00 6.03  ? 19  GLY A CA  1 
ATOM   152  C  C   . GLY A 1 19  ? 24.249 23.522 32.238 1.00 8.45  ? 19  GLY A C   1 
ATOM   153  O  O   . GLY A 1 19  ? 25.094 23.418 33.124 1.00 11.11 ? 19  GLY A O   1 
ATOM   154  N  N   . TYR A 1 20  ? 22.970 23.212 32.442 1.00 6.63  ? 20  TYR A N   1 
ATOM   155  C  CA  . TYR A 1 20  ? 22.525 22.722 33.746 1.00 6.55  ? 20  TYR A CA  1 
ATOM   156  C  C   . TYR A 1 20  ? 23.264 21.434 34.112 1.00 7.39  ? 20  TYR A C   1 
ATOM   157  O  O   . TYR A 1 20  ? 23.202 20.448 33.384 1.00 6.91  ? 20  TYR A O   1 
ATOM   158  C  CB  . TYR A 1 20  ? 21.020 22.476 33.768 1.00 3.88  ? 20  TYR A CB  1 
ATOM   159  C  CG  . TYR A 1 20  ? 20.519 22.159 35.161 1.00 4.77  ? 20  TYR A CG  1 
ATOM   160  C  CD1 . TYR A 1 20  ? 20.315 23.171 36.096 1.00 6.00  ? 20  TYR A CD1 1 
ATOM   161  C  CD2 . TYR A 1 20  ? 20.286 20.840 35.555 1.00 6.40  ? 20  TYR A CD2 1 
ATOM   162  C  CE1 . TYR A 1 20  ? 19.895 22.878 37.390 1.00 8.01  ? 20  TYR A CE1 1 
ATOM   163  C  CE2 . TYR A 1 20  ? 19.867 20.532 36.848 1.00 7.06  ? 20  TYR A CE2 1 
ATOM   164  C  CZ  . TYR A 1 20  ? 19.674 21.555 37.762 1.00 10.82 ? 20  TYR A CZ  1 
ATOM   165  O  OH  . TYR A 1 20  ? 19.269 21.259 39.044 1.00 14.03 ? 20  TYR A OH  1 
ATOM   166  N  N   . ARG A 1 21  ? 23.957 21.462 35.248 1.00 9.05  ? 21  ARG A N   1 
ATOM   167  C  CA  . ARG A 1 21  ? 24.738 20.328 35.733 1.00 8.90  ? 21  ARG A CA  1 
ATOM   168  C  C   . ARG A 1 21  ? 25.667 19.838 34.632 1.00 8.72  ? 21  ARG A C   1 
ATOM   169  O  O   . ARG A 1 21  ? 25.847 18.632 34.444 1.00 10.77 ? 21  ARG A O   1 
ATOM   170  C  CB  . ARG A 1 21  ? 23.844 19.190 36.243 1.00 7.90  ? 21  ARG A CB  1 
ATOM   171  C  CG  . ARG A 1 21  ? 22.991 19.563 37.453 1.00 17.76 ? 21  ARG A CG  1 
ATOM   172  C  CD  . ARG A 1 21  ? 23.766 19.509 38.748 1.00 26.88 ? 21  ARG A CD  1 
ATOM   173  N  NE  . ARG A 1 21  ? 24.143 18.139 39.050 1.00 39.21 ? 21  ARG A NE  1 
ATOM   174  C  CZ  . ARG A 1 21  ? 25.122 17.787 39.875 1.00 40.44 ? 21  ARG A CZ  1 
ATOM   175  N  NH1 . ARG A 1 21  ? 25.825 18.710 40.516 1.00 34.10 ? 21  ARG A NH1 1 
ATOM   176  N  NH2 . ARG A 1 21  ? 25.383 16.499 40.068 1.00 27.83 ? 21  ARG A NH2 1 
ATOM   177  N  N   . GLY A 1 22  ? 26.222 20.789 33.889 1.00 5.13  ? 22  GLY A N   1 
ATOM   178  C  CA  . GLY A 1 22  ? 27.155 20.484 32.822 1.00 5.77  ? 22  GLY A CA  1 
ATOM   179  C  C   . GLY A 1 22  ? 26.589 19.968 31.517 1.00 6.59  ? 22  GLY A C   1 
ATOM   180  O  O   . GLY A 1 22  ? 27.345 19.516 30.659 1.00 7.24  ? 22  GLY A O   1 
ATOM   181  N  N   . ILE A 1 23  ? 25.274 20.039 31.350 1.00 4.21  ? 23  ILE A N   1 
ATOM   182  C  CA  . ILE A 1 23  ? 24.643 19.535 30.141 1.00 3.38  ? 23  ILE A CA  1 
ATOM   183  C  C   . ILE A 1 23  ? 24.288 20.621 29.134 1.00 4.60  ? 23  ILE A C   1 
ATOM   184  O  O   . ILE A 1 23  ? 23.393 21.425 29.372 1.00 4.93  ? 23  ILE A O   1 
ATOM   185  C  CB  . ILE A 1 23  ? 23.372 18.756 30.482 1.00 2.55  ? 23  ILE A CB  1 
ATOM   186  C  CG1 . ILE A 1 23  ? 23.677 17.672 31.514 1.00 4.43  ? 23  ILE A CG1 1 
ATOM   187  C  CG2 . ILE A 1 23  ? 22.786 18.171 29.221 1.00 4.08  ? 23  ILE A CG2 1 
ATOM   188  C  CD1 . ILE A 1 23  ? 22.447 17.096 32.203 1.00 6.13  ? 23  ILE A CD1 1 
ATOM   189  N  N   . ALA A 1 24  ? 24.958 20.627 27.989 1.00 4.39  ? 24  ALA A N   1 
ATOM   190  C  CA  . ALA A 1 24  ? 24.685 21.629 26.956 1.00 6.46  ? 24  ALA A CA  1 
ATOM   191  C  C   . ALA A 1 24  ? 23.261 21.516 26.409 1.00 7.31  ? 24  ALA A C   1 
ATOM   192  O  O   . ALA A 1 24  ? 22.700 20.412 26.262 1.00 5.15  ? 24  ALA A O   1 
ATOM   193  C  CB  . ALA A 1 24  ? 25.696 21.503 25.810 1.00 7.17  ? 24  ALA A CB  1 
ATOM   194  N  N   . LEU A 1 25  ? 22.717 22.664 26.021 1.00 4.75  ? 25  LEU A N   1 
ATOM   195  C  CA  . LEU A 1 25  ? 21.383 22.750 25.470 1.00 4.43  ? 25  LEU A CA  1 
ATOM   196  C  C   . LEU A 1 25  ? 21.139 21.729 24.332 1.00 5.39  ? 25  LEU A C   1 
ATOM   197  O  O   . LEU A 1 25  ? 20.092 21.068 24.302 1.00 6.64  ? 25  LEU A O   1 
ATOM   198  C  CB  . LEU A 1 25  ? 21.129 24.186 24.982 1.00 4.38  ? 25  LEU A CB  1 
ATOM   199  C  CG  . LEU A 1 25  ? 19.784 24.555 24.364 1.00 8.39  ? 25  LEU A CG  1 
ATOM   200  C  CD1 . LEU A 1 25  ? 18.664 24.316 25.358 1.00 10.30 ? 25  LEU A CD1 1 
ATOM   201  C  CD2 . LEU A 1 25  ? 19.818 26.020 23.936 1.00 6.75  ? 25  LEU A CD2 1 
ATOM   202  N  N   . ALA A 1 26  ? 22.102 21.571 23.422 1.00 3.11  ? 26  ALA A N   1 
ATOM   203  C  CA  . ALA A 1 26  ? 21.948 20.640 22.310 1.00 4.94  ? 26  ALA A CA  1 
ATOM   204  C  C   . ALA A 1 26  ? 21.660 19.197 22.750 1.00 4.86  ? 26  ALA A C   1 
ATOM   205  O  O   . ALA A 1 26  ? 21.019 18.439 22.016 1.00 6.13  ? 26  ALA A O   1 
ATOM   206  C  CB  . ALA A 1 26  ? 23.161 20.691 21.403 1.00 6.90  ? 26  ALA A CB  1 
ATOM   207  N  N   . ASN A 1 27  ? 22.128 18.810 23.937 1.00 5.07  ? 27  ASN A N   1 
ATOM   208  C  CA  . ASN A 1 27  ? 21.885 17.455 24.449 1.00 4.65  ? 27  ASN A CA  1 
ATOM   209  C  C   . ASN A 1 27  ? 20.441 17.276 24.880 1.00 4.93  ? 27  ASN A C   1 
ATOM   210  O  O   . ASN A 1 27  ? 19.853 16.198 24.698 1.00 4.72  ? 27  ASN A O   1 
ATOM   211  C  CB  . ASN A 1 27  ? 22.831 17.130 25.599 1.00 4.44  ? 27  ASN A CB  1 
ATOM   212  C  CG  . ASN A 1 27  ? 24.222 16.830 25.121 1.00 13.03 ? 27  ASN A CG  1 
ATOM   213  O  OD1 . ASN A 1 27  ? 24.447 15.869 24.366 1.00 10.86 ? 27  ASN A OD1 1 
ATOM   214  N  ND2 . ASN A 1 27  ? 25.173 17.636 25.555 1.00 9.63  ? 27  ASN A ND2 1 
ATOM   215  N  N   . TRP A 1 28  ? 19.864 18.332 25.450 1.00 4.48  ? 28  TRP A N   1 
ATOM   216  C  CA  . TRP A 1 28  ? 18.463 18.295 25.866 1.00 3.88  ? 28  TRP A CA  1 
ATOM   217  C  C   . TRP A 1 28  ? 17.575 18.254 24.632 1.00 4.19  ? 28  TRP A C   1 
ATOM   218  O  O   . TRP A 1 28  ? 16.511 17.624 24.640 1.00 4.61  ? 28  TRP A O   1 
ATOM   219  C  CB  . TRP A 1 28  ? 18.104 19.529 26.700 1.00 3.38  ? 28  TRP A CB  1 
ATOM   220  C  CG  . TRP A 1 28  ? 18.782 19.579 28.024 1.00 4.95  ? 28  TRP A CG  1 
ATOM   221  C  CD1 . TRP A 1 28  ? 19.736 20.465 28.412 1.00 5.57  ? 28  TRP A CD1 1 
ATOM   222  C  CD2 . TRP A 1 28  ? 18.490 18.778 29.171 1.00 2.59  ? 28  TRP A CD2 1 
ATOM   223  N  NE1 . TRP A 1 28  ? 20.040 20.284 29.741 1.00 6.45  ? 28  TRP A NE1 1 
ATOM   224  C  CE2 . TRP A 1 28  ? 19.284 19.249 30.237 1.00 4.31  ? 28  TRP A CE2 1 
ATOM   225  C  CE3 . TRP A 1 28  ? 17.617 17.702 29.409 1.00 4.68  ? 28  TRP A CE3 1 
ATOM   226  C  CZ2 . TRP A 1 28  ? 19.246 18.701 31.515 1.00 5.49  ? 28  TRP A CZ2 1 
ATOM   227  C  CZ3 . TRP A 1 28  ? 17.576 17.152 30.683 1.00 5.12  ? 28  TRP A CZ3 1 
ATOM   228  C  CH2 . TRP A 1 28  ? 18.387 17.654 31.720 1.00 5.31  ? 28  TRP A CH2 1 
ATOM   229  N  N   . MET A 1 29  ? 17.989 18.958 23.584 1.00 3.79  ? 29  MET A N   1 
ATOM   230  C  CA  . MET A 1 29  ? 17.240 18.969 22.330 1.00 4.38  ? 29  MET A CA  1 
ATOM   231  C  C   . MET A 1 29  ? 17.269 17.575 21.689 1.00 4.85  ? 29  MET A C   1 
ATOM   232  O  O   . MET A 1 29  ? 16.261 17.063 21.226 1.00 4.72  ? 29  MET A O   1 
ATOM   233  C  CB  . MET A 1 29  ? 17.827 20.006 21.362 1.00 4.15  ? 29  MET A CB  1 
ATOM   234  C  CG  . MET A 1 29  ? 17.542 21.440 21.763 1.00 5.24  ? 29  MET A CG  1 
ATOM   235  S  SD  . MET A 1 29  ? 15.784 21.825 21.727 1.00 8.90  ? 29  MET A SD  1 
ATOM   236  C  CE  . MET A 1 29  ? 15.463 21.747 19.994 1.00 7.24  ? 29  MET A CE  1 
ATOM   237  N  N   . CYS A 1 30  ? 18.448 16.971 21.659 1.00 6.21  ? 30  CYS A N   1 
ATOM   238  C  CA  . CYS A 1 30  ? 18.611 15.632 21.095 1.00 6.69  ? 30  CYS A CA  1 
ATOM   239  C  C   . CYS A 1 30  ? 17.760 14.638 21.875 1.00 4.73  ? 30  CYS A C   1 
ATOM   240  O  O   . CYS A 1 30  ? 17.078 13.798 21.278 1.00 6.40  ? 30  CYS A O   1 
ATOM   241  C  CB  . CYS A 1 30  ? 20.078 15.233 21.142 1.00 8.07  ? 30  CYS A CB  1 
ATOM   242  S  SG  . CYS A 1 30  ? 20.451 13.647 20.344 1.00 8.54  ? 30  CYS A SG  1 
ATOM   243  N  N   . LEU A 1 31  ? 17.731 14.792 23.201 1.00 3.05  ? 31  LEU A N   1 
ATOM   244  C  CA  . LEU A 1 31  ? 16.944 13.920 24.073 1.00 3.80  ? 31  LEU A CA  1 
ATOM   245  C  C   . LEU A 1 31  ? 15.439 14.032 23.781 1.00 7.82  ? 31  LEU A C   1 
ATOM   246  O  O   . LEU A 1 31  ? 14.749 13.021 23.601 1.00 6.35  ? 31  LEU A O   1 
ATOM   247  C  CB  . LEU A 1 31  ? 17.222 14.242 25.545 1.00 3.60  ? 31  LEU A CB  1 
ATOM   248  C  CG  . LEU A 1 31  ? 16.398 13.443 26.568 1.00 6.20  ? 31  LEU A CG  1 
ATOM   249  C  CD1 . LEU A 1 31  ? 16.879 11.988 26.575 1.00 8.05  ? 31  LEU A CD1 1 
ATOM   250  C  CD2 . LEU A 1 31  ? 16.527 14.065 27.972 1.00 5.96  ? 31  LEU A CD2 1 
ATOM   251  N  N   . ALA A 1 32  ? 14.929 15.258 23.725 1.00 4.13  ? 32  ALA A N   1 
ATOM   252  C  CA  . ALA A 1 32  ? 13.516 15.485 23.454 1.00 3.68  ? 32  ALA A CA  1 
ATOM   253  C  C   . ALA A 1 32  ? 13.129 14.982 22.066 1.00 4.93  ? 32  ALA A C   1 
ATOM   254  O  O   . ALA A 1 32  ? 12.023 14.461 21.864 1.00 5.57  ? 32  ALA A O   1 
ATOM   255  C  CB  . ALA A 1 32  ? 13.195 16.970 23.584 1.00 4.40  ? 32  ALA A CB  1 
ATOM   256  N  N   . LYS A 1 33  ? 14.025 15.149 21.095 1.00 4.41  ? 33  LYS A N   1 
ATOM   257  C  CA  . LYS A 1 33  ? 13.747 14.716 19.722 1.00 6.69  ? 33  LYS A CA  1 
ATOM   258  C  C   . LYS A 1 33  ? 13.543 13.210 19.639 1.00 7.71  ? 33  LYS A C   1 
ATOM   259  O  O   . LYS A 1 33  ? 12.573 12.739 19.040 1.00 7.05  ? 33  LYS A O   1 
ATOM   260  C  CB  . LYS A 1 33  ? 14.872 15.152 18.780 1.00 6.77  ? 33  LYS A CB  1 
ATOM   261  C  CG  . LYS A 1 33  ? 15.031 14.325 17.499 1.00 23.39 ? 33  LYS A CG  1 
ATOM   262  C  CD  . LYS A 1 33  ? 14.096 14.730 16.383 1.00 34.89 ? 33  LYS A CD  1 
ATOM   263  C  CE  . LYS A 1 33  ? 14.468 14.006 15.075 1.00 29.79 ? 33  LYS A CE  1 
ATOM   264  N  NZ  . LYS A 1 33  ? 14.499 12.522 15.235 1.00 27.13 ? 33  LYS A NZ  1 
ATOM   265  N  N   . TRP A 1 34  ? 14.428 12.460 20.281 1.00 9.78  ? 34  TRP A N   1 
ATOM   266  C  CA  . TRP A 1 34  ? 14.330 11.008 20.233 1.00 9.17  ? 34  TRP A CA  1 
ATOM   267  C  C   . TRP A 1 34  ? 13.336 10.387 21.193 1.00 9.70  ? 34  TRP A C   1 
ATOM   268  O  O   . TRP A 1 34  ? 12.782 9.344  20.892 1.00 13.53 ? 34  TRP A O   1 
ATOM   269  C  CB  . TRP A 1 34  ? 15.711 10.377 20.349 1.00 10.32 ? 34  TRP A CB  1 
ATOM   270  C  CG  . TRP A 1 34  ? 16.542 10.714 19.138 1.00 10.02 ? 34  TRP A CG  1 
ATOM   271  C  CD1 . TRP A 1 34  ? 17.566 11.604 19.062 1.00 10.53 ? 34  TRP A CD1 1 
ATOM   272  C  CD2 . TRP A 1 34  ? 16.342 10.208 17.810 1.00 13.60 ? 34  TRP A CD2 1 
ATOM   273  N  NE1 . TRP A 1 34  ? 18.016 11.706 17.763 1.00 11.85 ? 34  TRP A NE1 1 
ATOM   274  C  CE2 . TRP A 1 34  ? 17.279 10.857 16.976 1.00 13.09 ? 34  TRP A CE2 1 
ATOM   275  C  CE3 . TRP A 1 34  ? 15.465 9.265  17.249 1.00 17.39 ? 34  TRP A CE3 1 
ATOM   276  C  CZ2 . TRP A 1 34  ? 17.364 10.603 15.600 1.00 16.47 ? 34  TRP A CZ2 1 
ATOM   277  C  CZ3 . TRP A 1 34  ? 15.553 9.001  15.867 1.00 18.30 ? 34  TRP A CZ3 1 
ATOM   278  C  CH2 . TRP A 1 34  ? 16.495 9.671  15.069 1.00 19.13 ? 34  TRP A CH2 1 
ATOM   279  N  N   . GLU A 1 35  ? 13.063 11.036 22.322 1.00 4.86  ? 35  GLU A N   1 
ATOM   280  C  CA  . GLU A 1 35  ? 12.108 10.490 23.271 1.00 5.57  ? 35  GLU A CA  1 
ATOM   281  C  C   . GLU A 1 35  ? 10.659 10.692 22.844 1.00 6.79  ? 35  GLU A C   1 
ATOM   282  O  O   . GLU A 1 35  ? 9.855  9.781  22.931 1.00 7.89  ? 35  GLU A O   1 
ATOM   283  C  CB  . GLU A 1 35  ? 12.284 11.103 24.669 1.00 6.18  ? 35  GLU A CB  1 
ATOM   284  C  CG  . GLU A 1 35  ? 13.592 10.764 25.377 1.00 6.99  ? 35  GLU A CG  1 
ATOM   285  C  CD  . GLU A 1 35  ? 13.691 9.311  25.818 1.00 13.44 ? 35  GLU A CD  1 
ATOM   286  O  OE1 . GLU A 1 35  ? 12.692 8.571  25.774 1.00 10.91 ? 35  GLU A OE1 1 
ATOM   287  O  OE2 . GLU A 1 35  ? 14.794 8.907  26.229 1.00 11.89 ? 35  GLU A OE2 1 
ATOM   288  N  N   . SER A 1 36  ? 10.325 11.886 22.362 1.00 8.97  ? 36  SER A N   1 
ATOM   289  C  CA  . SER A 1 36  ? 8.944  12.181 21.993 1.00 5.61  ? 36  SER A CA  1 
ATOM   290  C  C   . SER A 1 36  ? 8.717  12.906 20.666 1.00 6.55  ? 36  SER A C   1 
ATOM   291  O  O   . SER A 1 36  ? 7.579  13.137 20.271 1.00 8.35  ? 36  SER A O   1 
ATOM   292  C  CB  . SER A 1 36  ? 8.346  13.058 23.090 1.00 4.97  ? 36  SER A CB  1 
ATOM   293  O  OG  . SER A 1 36  ? 9.032  14.315 23.119 1.00 8.33  ? 36  SER A OG  1 
ATOM   294  N  N   . GLY A 1 37  ? 9.777  13.290 19.978 1.00 7.91  ? 37  GLY A N   1 
ATOM   295  C  CA  . GLY A 1 37  ? 9.578  14.044 18.754 1.00 9.44  ? 37  GLY A CA  1 
ATOM   296  C  C   . GLY A 1 37  ? 9.032  15.433 19.105 1.00 8.53  ? 37  GLY A C   1 
ATOM   297  O  O   . GLY A 1 37  ? 8.213  15.999 18.377 1.00 8.07  ? 37  GLY A O   1 
ATOM   298  N  N   . TYR A 1 38  ? 9.458  15.960 20.253 1.00 7.55  ? 38  TYR A N   1 
ATOM   299  C  CA  . TYR A 1 38  ? 9.034  17.284 20.740 1.00 8.75  ? 38  TYR A CA  1 
ATOM   300  C  C   . TYR A 1 38  ? 7.523  17.383 21.042 1.00 8.59  ? 38  TYR A C   1 
ATOM   301  O  O   . TYR A 1 38  ? 6.938  18.472 20.983 1.00 6.59  ? 38  TYR A O   1 
ATOM   302  C  CB  . TYR A 1 38  ? 9.414  18.397 19.746 1.00 8.04  ? 38  TYR A CB  1 
ATOM   303  C  CG  . TYR A 1 38  ? 10.837 18.397 19.216 1.00 7.74  ? 38  TYR A CG  1 
ATOM   304  C  CD1 . TYR A 1 38  ? 11.932 18.251 20.069 1.00 7.76  ? 38  TYR A CD1 1 
ATOM   305  C  CD2 . TYR A 1 38  ? 11.083 18.587 17.858 1.00 6.49  ? 38  TYR A CD2 1 
ATOM   306  C  CE1 . TYR A 1 38  ? 13.249 18.308 19.576 1.00 7.15  ? 38  TYR A CE1 1 
ATOM   307  C  CE2 . TYR A 1 38  ? 12.398 18.643 17.357 1.00 12.67 ? 38  TYR A CE2 1 
ATOM   308  C  CZ  . TYR A 1 38  ? 13.465 18.499 18.223 1.00 8.57  ? 38  TYR A CZ  1 
ATOM   309  O  OH  . TYR A 1 38  ? 14.745 18.551 17.726 1.00 9.12  ? 38  TYR A OH  1 
ATOM   310  N  N   . ASN A 1 39  ? 6.921  16.266 21.446 1.00 5.77  ? 39  ASN A N   1 
ATOM   311  C  CA  . ASN A 1 39  ? 5.492  16.189 21.739 1.00 6.67  ? 39  ASN A CA  1 
ATOM   312  C  C   . ASN A 1 39  ? 5.250  16.083 23.249 1.00 7.14  ? 39  ASN A C   1 
ATOM   313  O  O   . ASN A 1 39  ? 5.653  15.118 23.875 1.00 6.54  ? 39  ASN A O   1 
ATOM   314  C  CB  . ASN A 1 39  ? 4.910  14.974 20.989 1.00 10.98 ? 39  ASN A CB  1 
ATOM   315  C  CG  . ASN A 1 39  ? 3.395  14.793 21.185 1.00 13.10 ? 39  ASN A CG  1 
ATOM   316  O  OD1 . ASN A 1 39  ? 2.702  15.649 21.723 1.00 10.34 ? 39  ASN A OD1 1 
ATOM   317  N  ND2 . ASN A 1 39  ? 2.889  13.656 20.739 1.00 11.94 ? 39  ASN A ND2 1 
ATOM   318  N  N   . THR A 1 40  ? 4.577  17.071 23.834 1.00 4.09  ? 40  THR A N   1 
ATOM   319  C  CA  . THR A 1 40  ? 4.319  17.064 25.274 1.00 5.58  ? 40  THR A CA  1 
ATOM   320  C  C   . THR A 1 40  ? 3.255  16.055 25.735 1.00 7.38  ? 40  THR A C   1 
ATOM   321  O  O   . THR A 1 40  ? 3.144  15.773 26.926 1.00 7.46  ? 40  THR A O   1 
ATOM   322  C  CB  . THR A 1 40  ? 3.851  18.468 25.767 1.00 5.98  ? 40  THR A CB  1 
ATOM   323  O  OG1 . THR A 1 40  ? 2.618  18.808 25.119 1.00 6.96  ? 40  THR A OG1 1 
ATOM   324  C  CG2 . THR A 1 40  ? 4.888  19.533 25.448 1.00 3.47  ? 40  THR A CG2 1 
ATOM   325  N  N   . ARG A 1 41  ? 2.427  15.567 24.823 1.00 7.47  ? 41  ARG A N   1 
ATOM   326  C  CA  . ARG A 1 41  ? 1.403  14.632 25.261 1.00 9.58  ? 41  ARG A CA  1 
ATOM   327  C  C   . ARG A 1 41  ? 1.772  13.179 25.038 1.00 10.28 ? 41  ARG A C   1 
ATOM   328  O  O   . ARG A 1 41  ? 0.958  12.286 25.288 1.00 9.99  ? 41  ARG A O   1 
ATOM   329  C  CB  . ARG A 1 41  ? 0.023  14.978 24.671 1.00 14.08 ? 41  ARG A CB  1 
ATOM   330  C  CG  . ARG A 1 41  ? -0.160 14.678 23.198 1.00 27.10 ? 41  ARG A CG  1 
ATOM   331  C  CD  . ARG A 1 41  ? -1.280 13.654 22.946 1.00 48.75 ? 41  ARG A CD  1 
ATOM   332  N  NE  . ARG A 1 41  ? -2.592 14.097 23.431 1.00 52.39 ? 41  ARG A NE  1 
ATOM   333  C  CZ  . ARG A 1 41  ? -3.677 13.323 23.491 1.00 48.59 ? 41  ARG A CZ  1 
ATOM   334  N  NH1 . ARG A 1 41  ? -3.629 12.057 23.091 1.00 39.30 ? 41  ARG A NH1 1 
ATOM   335  N  NH2 . ARG A 1 41  ? -4.808 13.805 23.996 1.00 47.47 ? 41  ARG A NH2 1 
ATOM   336  N  N   . ALA A 1 42  ? 3.011  12.943 24.603 1.00 9.22  ? 42  ALA A N   1 
ATOM   337  C  CA  . ALA A 1 42  ? 3.483  11.581 24.361 1.00 9.14  ? 42  ALA A CA  1 
ATOM   338  C  C   . ALA A 1 42  ? 3.501  10.723 25.635 1.00 8.79  ? 42  ALA A C   1 
ATOM   339  O  O   . ALA A 1 42  ? 3.931  11.160 26.699 1.00 6.03  ? 42  ALA A O   1 
ATOM   340  C  CB  . ALA A 1 42  ? 4.844  11.609 23.715 1.00 8.51  ? 42  ALA A CB  1 
ATOM   341  N  N   . THR A 1 43  ? 2.986  9.507  25.523 1.00 10.23 ? 43  THR A N   1 
ATOM   342  C  CA  . THR A 1 43  ? 2.969  8.582  26.644 1.00 9.91  ? 43  THR A CA  1 
ATOM   343  C  C   . THR A 1 43  ? 3.337  7.208  26.102 1.00 10.63 ? 43  THR A C   1 
ATOM   344  O  O   . THR A 1 43  ? 3.083  6.895  24.931 1.00 12.59 ? 43  THR A O   1 
ATOM   345  C  CB  . THR A 1 43  ? 1.583  8.530  27.372 1.00 19.98 ? 43  THR A CB  1 
ATOM   346  O  OG1 . THR A 1 43  ? 0.557  8.134  26.459 1.00 26.40 ? 43  THR A OG1 1 
ATOM   347  C  CG2 . THR A 1 43  ? 1.213  9.887  27.965 1.00 15.58 ? 43  THR A CG2 1 
ATOM   348  N  N   . ASN A 1 44  ? 3.994  6.414  26.935 1.00 10.35 ? 44  ASN A N   1 
ATOM   349  C  CA  . ASN A 1 44  ? 4.391  5.088  26.508 1.00 13.76 ? 44  ASN A CA  1 
ATOM   350  C  C   . ASN A 1 44  ? 4.368  4.136  27.677 1.00 10.93 ? 44  ASN A C   1 
ATOM   351  O  O   . ASN A 1 44  ? 5.099  4.326  28.657 1.00 9.98  ? 44  ASN A O   1 
ATOM   352  C  CB  . ASN A 1 44  ? 5.773  5.122  25.874 1.00 13.58 ? 44  ASN A CB  1 
ATOM   353  C  CG  . ASN A 1 44  ? 5.928  4.085  24.788 1.00 42.16 ? 44  ASN A CG  1 
ATOM   354  O  OD1 . ASN A 1 44  ? 5.528  4.315  23.636 1.00 51.12 ? 44  ASN A OD1 1 
ATOM   355  N  ND2 . ASN A 1 44  ? 6.496  2.931  25.141 1.00 33.49 ? 44  ASN A ND2 1 
ATOM   356  N  N   . TYR A 1 45  ? 3.486  3.144  27.593 1.00 12.17 ? 45  TYR A N   1 
ATOM   357  C  CA  . TYR A 1 45  ? 3.347  2.140  28.642 1.00 12.15 ? 45  TYR A CA  1 
ATOM   358  C  C   . TYR A 1 45  ? 4.379  1.032  28.449 1.00 11.53 ? 45  TYR A C   1 
ATOM   359  O  O   . TYR A 1 45  ? 4.602  0.556  27.334 1.00 13.46 ? 45  TYR A O   1 
ATOM   360  C  CB  . TYR A 1 45  ? 1.933  1.543  28.601 1.00 13.95 ? 45  TYR A CB  1 
ATOM   361  C  CG  . TYR A 1 45  ? 1.679  0.484  29.645 1.00 16.50 ? 45  TYR A CG  1 
ATOM   362  C  CD1 . TYR A 1 45  ? 1.698  0.806  31.000 1.00 16.68 ? 45  TYR A CD1 1 
ATOM   363  C  CD2 . TYR A 1 45  ? 1.421  -0.846 29.280 1.00 18.39 ? 45  TYR A CD2 1 
ATOM   364  C  CE1 . TYR A 1 45  ? 1.465  -0.156 31.975 1.00 17.50 ? 45  TYR A CE1 1 
ATOM   365  C  CE2 . TYR A 1 45  ? 1.183  -1.829 30.252 1.00 17.23 ? 45  TYR A CE2 1 
ATOM   366  C  CZ  . TYR A 1 45  ? 1.204  -1.472 31.595 1.00 18.83 ? 45  TYR A CZ  1 
ATOM   367  O  OH  . TYR A 1 45  ? 0.939  -2.397 32.572 1.00 16.77 ? 45  TYR A OH  1 
ATOM   368  N  N   . ASN A 1 46  ? 5.009  0.633  29.544 1.00 11.21 ? 46  ASN A N   1 
ATOM   369  C  CA  . ASN A 1 46  ? 6.009  -0.425 29.527 1.00 15.10 ? 46  ASN A CA  1 
ATOM   370  C  C   . ASN A 1 46  ? 5.362  -1.650 30.176 1.00 14.29 ? 46  ASN A C   1 
ATOM   371  O  O   . ASN A 1 46  ? 5.345  -1.786 31.407 1.00 13.30 ? 46  ASN A O   1 
ATOM   372  C  CB  . ASN A 1 46  ? 7.252  0.005  30.314 1.00 10.90 ? 46  ASN A CB  1 
ATOM   373  C  CG  . ASN A 1 46  ? 7.872  1.293  29.773 1.00 26.44 ? 46  ASN A CG  1 
ATOM   374  O  OD1 . ASN A 1 46  ? 8.295  1.358  28.610 1.00 29.01 ? 46  ASN A OD1 1 
ATOM   375  N  ND2 . ASN A 1 46  ? 7.895  2.335  30.602 1.00 20.16 ? 46  ASN A ND2 1 
ATOM   376  N  N   . ALA A 1 47  ? 4.777  -2.501 29.338 1.00 15.33 ? 47  ALA A N   1 
ATOM   377  C  CA  . ALA A 1 47  ? 4.080  -3.713 29.792 1.00 16.61 ? 47  ALA A CA  1 
ATOM   378  C  C   . ALA A 1 47  ? 4.953  -4.570 30.689 1.00 14.61 ? 47  ALA A C   1 
ATOM   379  O  O   . ALA A 1 47  ? 4.466  -5.224 31.601 1.00 14.83 ? 47  ALA A O   1 
ATOM   380  C  CB  . ALA A 1 47  ? 3.606  -4.535 28.606 1.00 17.12 ? 47  ALA A CB  1 
ATOM   381  N  N   . GLY A 1 48  ? 6.250  -4.549 30.410 1.00 14.70 ? 48  GLY A N   1 
ATOM   382  C  CA  . GLY A 1 48  ? 7.212  -5.316 31.169 1.00 14.84 ? 48  GLY A CA  1 
ATOM   383  C  C   . GLY A 1 48  ? 7.294  -5.035 32.651 1.00 15.18 ? 48  GLY A C   1 
ATOM   384  O  O   . GLY A 1 48  ? 7.483  -5.966 33.426 1.00 13.28 ? 48  GLY A O   1 
ATOM   385  N  N   . ASP A 1 49  ? 7.187  -3.772 33.071 1.00 11.89 ? 49  ASP A N   1 
ATOM   386  C  CA  . ASP A 1 49  ? 7.265  -3.474 34.498 1.00 10.79 ? 49  ASP A CA  1 
ATOM   387  C  C   . ASP A 1 49  ? 6.104  -2.649 35.022 1.00 10.96 ? 49  ASP A C   1 
ATOM   388  O  O   . ASP A 1 49  ? 6.150  -2.158 36.150 1.00 12.56 ? 49  ASP A O   1 
ATOM   389  C  CB  . ASP A 1 49  ? 8.595  -2.813 34.851 1.00 12.30 ? 49  ASP A CB  1 
ATOM   390  C  CG  . ASP A 1 49  ? 8.722  -1.391 34.315 1.00 21.36 ? 49  ASP A CG  1 
ATOM   391  O  OD1 . ASP A 1 49  ? 7.907  -0.974 33.478 1.00 21.39 ? 49  ASP A OD1 1 
ATOM   392  O  OD2 . ASP A 1 49  ? 9.657  -0.686 34.738 1.00 28.80 ? 49  ASP A OD2 1 
ATOM   393  N  N   . ARG A 1 50  ? 5.092  -2.462 34.180 1.00 10.09 ? 50  ARG A N   1 
ATOM   394  C  CA  . ARG A 1 50  ? 3.896  -1.716 34.540 1.00 10.89 ? 50  ARG A CA  1 
ATOM   395  C  C   . ARG A 1 50  ? 4.087  -0.236 34.823 1.00 11.51 ? 50  ARG A C   1 
ATOM   396  O  O   . ARG A 1 50  ? 3.274  0.378  35.521 1.00 16.28 ? 50  ARG A O   1 
ATOM   397  C  CB  . ARG A 1 50  ? 3.183  -2.400 35.700 1.00 15.76 ? 50  ARG A CB  1 
ATOM   398  C  CG  . ARG A 1 50  ? 2.704  -3.773 35.294 1.00 19.33 ? 50  ARG A CG  1 
ATOM   399  C  CD  . ARG A 1 50  ? 1.919  -4.499 36.359 1.00 29.98 ? 50  ARG A CD  1 
ATOM   400  N  NE  . ARG A 1 50  ? 1.183  -5.585 35.726 1.00 38.04 ? 50  ARG A NE  1 
ATOM   401  C  CZ  . ARG A 1 50  ? 0.561  -6.567 36.363 1.00 43.83 ? 50  ARG A CZ  1 
ATOM   402  N  NH1 . ARG A 1 50  ? 0.590  -6.641 37.688 1.00 53.60 ? 50  ARG A NH1 1 
ATOM   403  N  NH2 . ARG A 1 50  ? -0.075 -7.494 35.660 1.00 26.68 ? 50  ARG A NH2 1 
ATOM   404  N  N   . SER A 1 51  ? 5.147  0.343  34.269 1.00 8.97  ? 51  SER A N   1 
ATOM   405  C  CA  . SER A 1 51  ? 5.412  1.772  34.437 1.00 9.21  ? 51  SER A CA  1 
ATOM   406  C  C   . SER A 1 51  ? 5.084  2.481  33.116 1.00 9.60  ? 51  SER A C   1 
ATOM   407  O  O   . SER A 1 51  ? 4.973  1.840  32.075 1.00 8.63  ? 51  SER A O   1 
ATOM   408  C  CB  . SER A 1 51  ? 6.878  2.007  34.816 1.00 9.53  ? 51  SER A CB  1 
ATOM   409  O  OG  . SER A 1 51  ? 7.729  1.778  33.705 1.00 8.71  ? 51  SER A OG  1 
ATOM   410  N  N   . THR A 1 52  ? 4.936  3.806  33.165 1.00 10.16 ? 52  THR A N   1 
ATOM   411  C  CA  . THR A 1 52  ? 4.623  4.575  31.972 1.00 5.86  ? 52  THR A CA  1 
ATOM   412  C  C   . THR A 1 52  ? 5.574  5.775  31.895 1.00 5.47  ? 52  THR A C   1 
ATOM   413  O  O   . THR A 1 52  ? 5.973  6.320  32.933 1.00 5.40  ? 52  THR A O   1 
ATOM   414  C  CB  . THR A 1 52  ? 3.145  5.066  32.017 1.00 8.11  ? 52  THR A CB  1 
ATOM   415  O  OG1 . THR A 1 52  ? 2.274  3.928  32.140 1.00 11.52 ? 52  THR A OG1 1 
ATOM   416  C  CG2 . THR A 1 52  ? 2.775  5.852  30.746 1.00 4.52  ? 52  THR A CG2 1 
ATOM   417  N  N   . ASP A 1 53  ? 6.001  6.112  30.679 1.00 4.38  ? 53  ASP A N   1 
ATOM   418  C  CA  . ASP A 1 53  ? 6.892  7.253  30.421 1.00 5.50  ? 53  ASP A CA  1 
ATOM   419  C  C   . ASP A 1 53  ? 5.988  8.414  29.986 1.00 5.45  ? 53  ASP A C   1 
ATOM   420  O  O   . ASP A 1 53  ? 5.152  8.243  29.095 1.00 6.21  ? 53  ASP A O   1 
ATOM   421  C  CB  . ASP A 1 53  ? 7.871  6.907  29.307 1.00 6.74  ? 53  ASP A CB  1 
ATOM   422  C  CG  . ASP A 1 53  ? 8.797  5.771  29.678 1.00 8.12  ? 53  ASP A CG  1 
ATOM   423  O  OD1 . ASP A 1 53  ? 9.179  5.682  30.863 1.00 9.69  ? 53  ASP A OD1 1 
ATOM   424  O  OD2 . ASP A 1 53  ? 9.139  4.973  28.785 1.00 14.42 ? 53  ASP A OD2 1 
ATOM   425  N  N   . TYR A 1 54  ? 6.173  9.592  30.577 1.00 6.47  ? 54  TYR A N   1 
ATOM   426  C  CA  . TYR A 1 54  ? 5.299  10.728 30.286 1.00 6.04  ? 54  TYR A CA  1 
ATOM   427  C  C   . TYR A 1 54  ? 5.929  11.992 29.744 1.00 4.37  ? 54  TYR A C   1 
ATOM   428  O  O   . TYR A 1 54  ? 6.959  12.444 30.250 1.00 5.10  ? 54  TYR A O   1 
ATOM   429  C  CB  . TYR A 1 54  ? 4.587  11.144 31.570 1.00 6.15  ? 54  TYR A CB  1 
ATOM   430  C  CG  . TYR A 1 54  ? 3.604  10.146 32.128 1.00 7.36  ? 54  TYR A CG  1 
ATOM   431  C  CD1 . TYR A 1 54  ? 2.269  10.173 31.748 1.00 9.44  ? 54  TYR A CD1 1 
ATOM   432  C  CD2 . TYR A 1 54  ? 4.007  9.192  33.067 1.00 9.35  ? 54  TYR A CD2 1 
ATOM   433  C  CE1 . TYR A 1 54  ? 1.359  9.273  32.271 1.00 7.41  ? 54  TYR A CE1 1 
ATOM   434  C  CE2 . TYR A 1 54  ? 3.101  8.279  33.610 1.00 6.21  ? 54  TYR A CE2 1 
ATOM   435  C  CZ  . TYR A 1 54  ? 1.782  8.336  33.209 1.00 5.28  ? 54  TYR A CZ  1 
ATOM   436  O  OH  . TYR A 1 54  ? 0.872  7.455  33.734 1.00 7.06  ? 54  TYR A OH  1 
ATOM   437  N  N   . GLY A 1 55  ? 5.293  12.574 28.734 1.00 2.69  ? 55  GLY A N   1 
ATOM   438  C  CA  . GLY A 1 55  ? 5.740  13.864 28.216 1.00 4.84  ? 55  GLY A CA  1 
ATOM   439  C  C   . GLY A 1 55  ? 6.906  13.999 27.267 1.00 6.21  ? 55  GLY A C   1 
ATOM   440  O  O   . GLY A 1 55  ? 7.475  12.997 26.787 1.00 6.49  ? 55  GLY A O   1 
ATOM   441  N  N   . ILE A 1 56  ? 7.310  15.255 27.059 1.00 3.97  ? 56  ILE A N   1 
ATOM   442  C  CA  . ILE A 1 56  ? 8.384  15.578 26.125 1.00 3.49  ? 56  ILE A CA  1 
ATOM   443  C  C   . ILE A 1 56  ? 9.720  14.888 26.416 1.00 3.85  ? 56  ILE A C   1 
ATOM   444  O  O   . ILE A 1 56  ? 10.484 14.586 25.484 1.00 5.66  ? 56  ILE A O   1 
ATOM   445  C  CB  . ILE A 1 56  ? 8.547  17.127 25.982 1.00 3.28  ? 56  ILE A CB  1 
ATOM   446  C  CG1 . ILE A 1 56  ? 9.324  17.467 24.712 1.00 6.29  ? 56  ILE A CG1 1 
ATOM   447  C  CG2 . ILE A 1 56  ? 9.179  17.733 27.227 1.00 3.21  ? 56  ILE A CG2 1 
ATOM   448  C  CD1 . ILE A 1 56  ? 9.127  18.894 24.254 1.00 8.28  ? 56  ILE A CD1 1 
ATOM   449  N  N   . PHE A 1 57  ? 9.995  14.631 27.690 1.00 4.79  ? 57  PHE A N   1 
ATOM   450  C  CA  . PHE A 1 57  ? 11.240 13.951 28.078 1.00 5.47  ? 57  PHE A CA  1 
ATOM   451  C  C   . PHE A 1 57  ? 11.019 12.479 28.436 1.00 5.65  ? 57  PHE A C   1 
ATOM   452  O  O   . PHE A 1 57  ? 11.964 11.777 28.835 1.00 6.97  ? 57  PHE A O   1 
ATOM   453  C  CB  . PHE A 1 57  ? 11.908 14.671 29.248 1.00 6.36  ? 57  PHE A CB  1 
ATOM   454  C  CG  . PHE A 1 57  ? 12.449 16.032 28.889 1.00 9.92  ? 57  PHE A CG  1 
ATOM   455  C  CD1 . PHE A 1 57  ? 13.241 16.201 27.745 1.00 10.94 ? 57  PHE A CD1 1 
ATOM   456  C  CD2 . PHE A 1 57  ? 12.122 17.139 29.652 1.00 11.45 ? 57  PHE A CD2 1 
ATOM   457  C  CE1 . PHE A 1 57  ? 13.701 17.465 27.365 1.00 12.86 ? 57  PHE A CE1 1 
ATOM   458  C  CE2 . PHE A 1 57  ? 12.575 18.414 29.287 1.00 13.74 ? 57  PHE A CE2 1 
ATOM   459  C  CZ  . PHE A 1 57  ? 13.365 18.574 28.131 1.00 12.96 ? 57  PHE A CZ  1 
ATOM   460  N  N   . GLN A 1 58  ? 9.775  12.012 28.297 1.00 4.17  ? 58  GLN A N   1 
ATOM   461  C  CA  . GLN A 1 58  ? 9.439  10.624 28.616 1.00 4.87  ? 58  GLN A CA  1 
ATOM   462  C  C   . GLN A 1 58  ? 9.953  10.208 29.998 1.00 7.33  ? 58  GLN A C   1 
ATOM   463  O  O   . GLN A 1 58  ? 10.755 9.281  30.141 1.00 10.61 ? 58  GLN A O   1 
ATOM   464  C  CB  . GLN A 1 58  ? 9.963  9.705  27.523 1.00 2.30  ? 58  GLN A CB  1 
ATOM   465  C  CG  . GLN A 1 58  ? 9.178  9.832  26.225 1.00 2.00  ? 58  GLN A CG  1 
ATOM   466  C  CD  . GLN A 1 58  ? 7.775  9.246  26.353 1.00 6.67  ? 58  GLN A CD  1 
ATOM   467  O  OE1 . GLN A 1 58  ? 7.588  8.039  26.250 1.00 9.25  ? 58  GLN A OE1 1 
ATOM   468  N  NE2 . GLN A 1 58  ? 6.788  10.100 26.577 1.00 7.18  ? 58  GLN A NE2 1 
ATOM   469  N  N   . ILE A 1 59  ? 9.470  10.909 31.015 1.00 4.34  ? 59  ILE A N   1 
ATOM   470  C  CA  . ILE A 1 59  ? 9.857  10.683 32.396 1.00 5.95  ? 59  ILE A CA  1 
ATOM   471  C  C   . ILE A 1 59  ? 9.028  9.543  32.974 1.00 6.27  ? 59  ILE A C   1 
ATOM   472  O  O   . ILE A 1 59  ? 7.812  9.528  32.848 1.00 7.07  ? 59  ILE A O   1 
ATOM   473  C  CB  . ILE A 1 59  ? 9.728  12.008 33.198 1.00 6.23  ? 59  ILE A CB  1 
ATOM   474  C  CG1 . ILE A 1 59  ? 10.798 12.986 32.663 1.00 8.64  ? 59  ILE A CG1 1 
ATOM   475  C  CG2 . ILE A 1 59  ? 9.847  11.755 34.695 1.00 9.10  ? 59  ILE A CG2 1 
ATOM   476  C  CD1 . ILE A 1 59  ? 10.789 14.348 33.304 1.00 8.59  ? 59  ILE A CD1 1 
ATOM   477  N  N   . ASN A 1 60  ? 9.718  8.573  33.565 1.00 8.59  ? 60  ASN A N   1 
ATOM   478  C  CA  . ASN A 1 60  ? 9.117  7.353  34.111 1.00 9.02  ? 60  ASN A CA  1 
ATOM   479  C  C   . ASN A 1 60  ? 8.408  7.427  35.476 1.00 7.66  ? 60  ASN A C   1 
ATOM   480  O  O   . ASN A 1 60  ? 8.961  7.936  36.466 1.00 8.01  ? 60  ASN A O   1 
ATOM   481  C  CB  . ASN A 1 60  ? 10.192 6.253  34.107 1.00 9.25  ? 60  ASN A CB  1 
ATOM   482  C  CG  . ASN A 1 60  ? 9.628  4.882  34.403 1.00 8.11  ? 60  ASN A CG  1 
ATOM   483  O  OD1 . ASN A 1 60  ? 9.556  4.480  35.558 1.00 12.87 ? 60  ASN A OD1 1 
ATOM   484  N  ND2 . ASN A 1 60  ? 9.268  4.143  33.360 1.00 11.26 ? 60  ASN A ND2 1 
ATOM   485  N  N   . SER A 1 61  ? 7.209  6.846  35.536 1.00 7.83  ? 61  SER A N   1 
ATOM   486  C  CA  . SER A 1 61  ? 6.389  6.847  36.748 1.00 8.90  ? 61  SER A CA  1 
ATOM   487  C  C   . SER A 1 61  ? 6.918  6.016  37.924 1.00 13.11 ? 61  SER A C   1 
ATOM   488  O  O   . SER A 1 61  ? 6.404  6.129  39.042 1.00 11.81 ? 61  SER A O   1 
ATOM   489  C  CB  . SER A 1 61  ? 4.991  6.354  36.406 1.00 4.84  ? 61  SER A CB  1 
ATOM   490  O  OG  . SER A 1 61  ? 5.069  5.048  35.859 1.00 9.41  ? 61  SER A OG  1 
ATOM   491  N  N   . ARG A 1 62  ? 7.912  5.160  37.693 1.00 13.40 ? 62  ARG A N   1 
ATOM   492  C  CA  . ARG A 1 62  ? 8.412  4.352  38.803 1.00 15.48 ? 62  ARG A CA  1 
ATOM   493  C  C   . ARG A 1 62  ? 9.238  5.147  39.807 1.00 18.05 ? 62  ARG A C   1 
ATOM   494  O  O   . ARG A 1 62  ? 9.214  4.860  41.017 1.00 18.05 ? 62  ARG A O   1 
ATOM   495  C  CB  . ARG A 1 62  ? 9.239  3.166  38.305 1.00 16.29 ? 62  ARG A CB  1 
ATOM   496  C  CG  . ARG A 1 62  ? 9.796  2.307  39.432 1.00 20.15 ? 62  ARG A CG  1 
ATOM   497  C  CD  . ARG A 1 62  ? 10.132 0.925  38.915 1.00 36.14 ? 62  ARG A CD  1 
ATOM   498  N  NE  . ARG A 1 62  ? 8.945  0.293  38.350 1.00 47.70 ? 62  ARG A NE  1 
ATOM   499  C  CZ  . ARG A 1 62  ? 8.028  -0.339 39.073 1.00 42.85 ? 62  ARG A CZ  1 
ATOM   500  N  NH1 . ARG A 1 62  ? 8.203  -0.493 40.382 1.00 37.95 ? 62  ARG A NH1 1 
ATOM   501  N  NH2 . ARG A 1 62  ? 6.969  -0.876 38.481 1.00 36.75 ? 62  ARG A NH2 1 
ATOM   502  N  N   . TYR A 1 63  ? 9.928  6.173  39.322 1.00 16.09 ? 63  TYR A N   1 
ATOM   503  C  CA  . TYR A 1 63  ? 10.797 6.947  40.198 1.00 16.21 ? 63  TYR A CA  1 
ATOM   504  C  C   . TYR A 1 63  ? 10.518 8.435  40.286 1.00 15.38 ? 63  TYR A C   1 
ATOM   505  O  O   . TYR A 1 63  ? 10.703 9.045  41.344 1.00 15.30 ? 63  TYR A O   1 
ATOM   506  C  CB  . TYR A 1 63  ? 12.259 6.795  39.753 1.00 19.75 ? 63  TYR A CB  1 
ATOM   507  C  CG  . TYR A 1 63  ? 12.665 5.419  39.253 1.00 27.58 ? 63  TYR A CG  1 
ATOM   508  C  CD1 . TYR A 1 63  ? 12.487 5.061  37.919 1.00 28.19 ? 63  TYR A CD1 1 
ATOM   509  C  CD2 . TYR A 1 63  ? 13.263 4.484  40.113 1.00 29.57 ? 63  TYR A CD2 1 
ATOM   510  C  CE1 . TYR A 1 63  ? 12.892 3.820  37.451 1.00 32.52 ? 63  TYR A CE1 1 
ATOM   511  C  CE2 . TYR A 1 63  ? 13.669 3.236  39.648 1.00 28.60 ? 63  TYR A CE2 1 
ATOM   512  C  CZ  . TYR A 1 63  ? 13.480 2.918  38.319 1.00 34.54 ? 63  TYR A CZ  1 
ATOM   513  O  OH  . TYR A 1 63  ? 13.857 1.683  37.848 1.00 49.07 ? 63  TYR A OH  1 
ATOM   514  N  N   . TRP A 1 64  ? 10.027 9.017  39.199 1.00 11.89 ? 64  TRP A N   1 
ATOM   515  C  CA  . TRP A 1 64  ? 9.868  10.462 39.156 1.00 9.33  ? 64  TRP A CA  1 
ATOM   516  C  C   . TRP A 1 64  ? 8.539  11.125 39.402 1.00 9.07  ? 64  TRP A C   1 
ATOM   517  O  O   . TRP A 1 64  ? 8.494  12.210 39.991 1.00 9.97  ? 64  TRP A O   1 
ATOM   518  C  CB  . TRP A 1 64  ? 10.481 10.952 37.851 1.00 9.49  ? 64  TRP A CB  1 
ATOM   519  C  CG  . TRP A 1 64  ? 11.826 10.324 37.633 1.00 10.10 ? 64  TRP A CG  1 
ATOM   520  C  CD1 . TRP A 1 64  ? 12.127 9.334  36.755 1.00 10.34 ? 64  TRP A CD1 1 
ATOM   521  C  CD2 . TRP A 1 64  ? 13.023 10.584 38.386 1.00 10.89 ? 64  TRP A CD2 1 
ATOM   522  N  NE1 . TRP A 1 64  ? 13.428 8.947  36.916 1.00 12.03 ? 64  TRP A NE1 1 
ATOM   523  C  CE2 . TRP A 1 64  ? 14.011 9.695  37.907 1.00 11.69 ? 64  TRP A CE2 1 
ATOM   524  C  CE3 . TRP A 1 64  ? 13.359 11.479 39.414 1.00 11.35 ? 64  TRP A CE3 1 
ATOM   525  C  CZ2 . TRP A 1 64  ? 15.322 9.670  38.421 1.00 10.82 ? 64  TRP A CZ2 1 
ATOM   526  C  CZ3 . TRP A 1 64  ? 14.662 11.458 39.926 1.00 12.17 ? 64  TRP A CZ3 1 
ATOM   527  C  CH2 . TRP A 1 64  ? 15.626 10.552 39.422 1.00 11.26 ? 64  TRP A CH2 1 
ATOM   528  N  N   . CYS A 1 65  ? 7.457  10.531 38.918 1.00 6.82  ? 65  CYS A N   1 
ATOM   529  C  CA  . CYS A 1 65  ? 6.163  11.149 39.117 1.00 6.46  ? 65  CYS A CA  1 
ATOM   530  C  C   . CYS A 1 65  ? 5.175  10.103 39.575 1.00 7.42  ? 65  CYS A C   1 
ATOM   531  O  O   . CYS A 1 65  ? 5.414  8.903  39.424 1.00 9.79  ? 65  CYS A O   1 
ATOM   532  C  CB  . CYS A 1 65  ? 5.688  11.850 37.836 1.00 6.01  ? 65  CYS A CB  1 
ATOM   533  S  SG  . CYS A 1 65  ? 5.385  10.783 36.404 1.00 6.73  ? 65  CYS A SG  1 
ATOM   534  N  N   . ASN A 1 66  ? 4.070  10.559 40.148 1.00 7.07  ? 66  ASN A N   1 
ATOM   535  C  CA  . ASN A 1 66  ? 3.052  9.650  40.633 1.00 11.78 ? 66  ASN A CA  1 
ATOM   536  C  C   . ASN A 1 66  ? 1.842  9.524  39.712 1.00 9.66  ? 66  ASN A C   1 
ATOM   537  O  O   . ASN A 1 66  ? 1.208  10.528 39.376 1.00 5.53  ? 66  ASN A O   1 
ATOM   538  C  CB  . ASN A 1 66  ? 2.584  10.100 42.015 1.00 10.79 ? 66  ASN A CB  1 
ATOM   539  C  CG  . ASN A 1 66  ? 1.526  9.187  42.586 1.00 10.50 ? 66  ASN A CG  1 
ATOM   540  O  OD1 . ASN A 1 66  ? 1.639  7.959  42.491 1.00 14.49 ? 66  ASN A OD1 1 
ATOM   541  N  ND2 . ASN A 1 66  ? 0.498  9.764  43.185 1.00 12.74 ? 66  ASN A ND2 1 
ATOM   542  N  N   . ASP A 1 67  ? 1.546  8.290  39.290 1.00 9.41  ? 67  ASP A N   1 
ATOM   543  C  CA  . ASP A 1 67  ? 0.359  8.034  38.480 1.00 8.14  ? 67  ASP A CA  1 
ATOM   544  C  C   . ASP A 1 67  ? -0.567 7.053  39.212 1.00 6.07  ? 67  ASP A C   1 
ATOM   545  O  O   . ASP A 1 67  ? -1.599 6.646  38.696 1.00 6.78  ? 67  ASP A O   1 
ATOM   546  C  CB  . ASP A 1 67  ? 0.667  7.611  37.021 1.00 4.04  ? 67  ASP A CB  1 
ATOM   547  C  CG  . ASP A 1 67  ? 1.256  6.200  36.883 1.00 5.04  ? 67  ASP A CG  1 
ATOM   548  O  OD1 . ASP A 1 67  ? 1.452  5.479  37.879 1.00 7.78  ? 67  ASP A OD1 1 
ATOM   549  O  OD2 . ASP A 1 67  ? 1.510  5.822  35.725 1.00 7.34  ? 67  ASP A OD2 1 
ATOM   550  N  N   . GLY A 1 68  ? -0.178 6.697  40.432 1.00 6.82  ? 68  GLY A N   1 
ATOM   551  C  CA  . GLY A 1 68  ? -0.975 5.820  41.275 1.00 10.32 ? 68  GLY A CA  1 
ATOM   552  C  C   . GLY A 1 68  ? -1.108 4.354  40.913 1.00 12.82 ? 68  GLY A C   1 
ATOM   553  O  O   . GLY A 1 68  ? -1.441 3.539  41.770 1.00 14.51 ? 68  GLY A O   1 
ATOM   554  N  N   . LYS A 1 69  ? -0.861 4.006  39.658 1.00 13.29 ? 69  LYS A N   1 
ATOM   555  C  CA  . LYS A 1 69  ? -0.976 2.619  39.228 1.00 11.96 ? 69  LYS A CA  1 
ATOM   556  C  C   . LYS A 1 69  ? 0.340  1.901  39.028 1.00 13.13 ? 69  LYS A C   1 
ATOM   557  O  O   . LYS A 1 69  ? 0.348  0.756  38.588 1.00 16.42 ? 69  LYS A O   1 
ATOM   558  C  CB  . LYS A 1 69  ? -1.797 2.513  37.948 1.00 9.56  ? 69  LYS A CB  1 
ATOM   559  C  CG  . LYS A 1 69  ? -1.325 3.369  36.795 1.00 8.69  ? 69  LYS A CG  1 
ATOM   560  C  CD  . LYS A 1 69  ? -2.175 3.100  35.577 1.00 9.90  ? 69  LYS A CD  1 
ATOM   561  C  CE  . LYS A 1 69  ? -1.821 4.004  34.423 1.00 21.37 ? 69  LYS A CE  1 
ATOM   562  N  NZ  . LYS A 1 69  ? -0.389 3.908  34.069 1.00 42.99 ? 69  LYS A NZ  1 
ATOM   563  N  N   . THR A 1 70  ? 1.461  2.562  39.304 1.00 10.01 ? 70  THR A N   1 
ATOM   564  C  CA  . THR A 1 70  ? 2.769  1.910  39.128 1.00 13.40 ? 70  THR A CA  1 
ATOM   565  C  C   . THR A 1 70  ? 3.239  1.283  40.444 1.00 11.67 ? 70  THR A C   1 
ATOM   566  O  O   . THR A 1 70  ? 3.412  1.976  41.432 1.00 13.25 ? 70  THR A O   1 
ATOM   567  C  CB  . THR A 1 70  ? 3.831  2.900  38.589 1.00 12.88 ? 70  THR A CB  1 
ATOM   568  O  OG1 . THR A 1 70  ? 3.365  3.505  37.370 1.00 9.32  ? 70  THR A OG1 1 
ATOM   569  C  CG2 . THR A 1 70  ? 5.156  2.170  38.324 1.00 9.46  ? 70  THR A CG2 1 
ATOM   570  N  N   . PRO A 1 71  ? 3.446  -0.050 40.465 1.00 14.18 ? 71  PRO A N   1 
ATOM   571  C  CA  . PRO A 1 71  ? 3.894  -0.757 41.675 1.00 15.69 ? 71  PRO A CA  1 
ATOM   572  C  C   . PRO A 1 71  ? 5.231  -0.290 42.218 1.00 17.16 ? 71  PRO A C   1 
ATOM   573  O  O   . PRO A 1 71  ? 6.118  0.072  41.457 1.00 19.09 ? 71  PRO A O   1 
ATOM   574  C  CB  . PRO A 1 71  ? 3.994  -2.209 41.195 1.00 15.99 ? 71  PRO A CB  1 
ATOM   575  C  CG  . PRO A 1 71  ? 3.018  -2.289 40.106 1.00 16.16 ? 71  PRO A CG  1 
ATOM   576  C  CD  . PRO A 1 71  ? 3.248  -0.996 39.363 1.00 14.96 ? 71  PRO A CD  1 
ATOM   577  N  N   . GLY A 1 72  ? 5.356  -0.284 43.545 1.00 20.03 ? 72  GLY A N   1 
ATOM   578  C  CA  . GLY A 1 72  ? 6.587  0.115  44.214 1.00 21.79 ? 72  GLY A CA  1 
ATOM   579  C  C   . GLY A 1 72  ? 7.214  1.377  43.673 1.00 27.48 ? 72  GLY A C   1 
ATOM   580  O  O   . GLY A 1 72  ? 8.436  1.472  43.535 1.00 31.34 ? 72  GLY A O   1 
ATOM   581  N  N   . ALA A 1 73  ? 6.381  2.377  43.408 1.00 22.71 ? 73  ALA A N   1 
ATOM   582  C  CA  . ALA A 1 73  ? 6.877  3.605  42.840 1.00 21.75 ? 73  ALA A CA  1 
ATOM   583  C  C   . ALA A 1 73  ? 7.123  4.696  43.836 1.00 21.12 ? 73  ALA A C   1 
ATOM   584  O  O   . ALA A 1 73  ? 6.484  4.779  44.892 1.00 21.38 ? 73  ALA A O   1 
ATOM   585  C  CB  . ALA A 1 73  ? 5.920  4.105  41.769 1.00 21.66 ? 73  ALA A CB  1 
ATOM   586  N  N   . VAL A 1 74  ? 8.059  5.557  43.475 1.00 19.76 ? 74  VAL A N   1 
ATOM   587  C  CA  . VAL A 1 74  ? 8.360  6.709  44.277 1.00 20.65 ? 74  VAL A CA  1 
ATOM   588  C  C   . VAL A 1 74  ? 8.020  7.905  43.383 1.00 19.67 ? 74  VAL A C   1 
ATOM   589  O  O   . VAL A 1 74  ? 7.694  7.747  42.184 1.00 19.50 ? 74  VAL A O   1 
ATOM   590  C  CB  . VAL A 1 74  ? 9.810  6.708  44.819 1.00 22.50 ? 74  VAL A CB  1 
ATOM   591  C  CG1 . VAL A 1 74  ? 9.972  5.549  45.798 1.00 23.99 ? 74  VAL A CG1 1 
ATOM   592  C  CG2 . VAL A 1 74  ? 10.839 6.590  43.692 1.00 22.79 ? 74  VAL A CG2 1 
ATOM   593  N  N   . ASN A 1 75  ? 7.998  9.079  43.988 1.00 20.34 ? 75  ASN A N   1 
ATOM   594  C  CA  . ASN A 1 75  ? 7.646  10.300 43.272 1.00 17.40 ? 75  ASN A CA  1 
ATOM   595  C  C   . ASN A 1 75  ? 8.694  11.354 43.641 1.00 12.91 ? 75  ASN A C   1 
ATOM   596  O  O   . ASN A 1 75  ? 8.398  12.311 44.353 1.00 13.47 ? 75  ASN A O   1 
ATOM   597  C  CB  . ASN A 1 75  ? 6.250  10.721 43.738 1.00 13.40 ? 75  ASN A CB  1 
ATOM   598  C  CG  . ASN A 1 75  ? 5.743  11.970 43.077 1.00 10.00 ? 75  ASN A CG  1 
ATOM   599  O  OD1 . ASN A 1 75  ? 6.327  12.469 42.117 1.00 14.52 ? 75  ASN A OD1 1 
ATOM   600  N  ND2 . ASN A 1 75  ? 4.655  12.488 43.593 1.00 16.52 ? 75  ASN A ND2 1 
ATOM   601  N  N   . ALA A 1 76  ? 9.917  11.168 43.152 1.00 13.26 ? 76  ALA A N   1 
ATOM   602  C  CA  . ALA A 1 76  ? 11.005 12.084 43.472 1.00 12.19 ? 76  ALA A CA  1 
ATOM   603  C  C   . ALA A 1 76  ? 10.771 13.518 43.032 1.00 13.86 ? 76  ALA A C   1 
ATOM   604  O  O   . ALA A 1 76  ? 11.266 14.450 43.671 1.00 16.16 ? 76  ALA A O   1 
ATOM   605  C  CB  . ALA A 1 76  ? 12.332 11.562 42.941 1.00 12.11 ? 76  ALA A CB  1 
ATOM   606  N  N   . CYS A 1 77  ? 10.008 13.726 41.966 1.00 13.46 ? 77  CYS A N   1 
ATOM   607  C  CA  . CYS A 1 77  ? 9.752  15.094 41.534 1.00 10.78 ? 77  CYS A CA  1 
ATOM   608  C  C   . CYS A 1 77  ? 8.572  15.720 42.275 1.00 11.80 ? 77  CYS A C   1 
ATOM   609  O  O   . CYS A 1 77  ? 8.301  16.912 42.144 1.00 12.73 ? 77  CYS A O   1 
ATOM   610  C  CB  . CYS A 1 77  ? 9.515  15.142 40.028 1.00 9.78  ? 77  CYS A CB  1 
ATOM   611  S  SG  . CYS A 1 77  ? 10.984 14.759 39.039 1.00 11.60 ? 77  CYS A SG  1 
ATOM   612  N  N   . HIS A 1 78  ? 7.889  14.910 43.078 1.00 14.96 ? 78  HIS A N   1 
ATOM   613  C  CA  . HIS A 1 78  ? 6.725  15.360 43.840 1.00 18.66 ? 78  HIS A CA  1 
ATOM   614  C  C   . HIS A 1 78  ? 5.714  16.027 42.915 1.00 14.30 ? 78  HIS A C   1 
ATOM   615  O  O   . HIS A 1 78  ? 5.286  17.154 43.137 1.00 14.88 ? 78  HIS A O   1 
ATOM   616  C  CB  . HIS A 1 78  ? 7.155  16.270 44.998 1.00 23.65 ? 78  HIS A CB  1 
ATOM   617  C  CG  . HIS A 1 78  ? 8.242  15.679 45.832 1.00 31.81 ? 78  HIS A CG  1 
ATOM   618  N  ND1 . HIS A 1 78  ? 9.475  16.277 45.987 1.00 35.46 ? 78  HIS A ND1 1 
ATOM   619  C  CD2 . HIS A 1 78  ? 8.324  14.483 46.472 1.00 34.95 ? 78  HIS A CD2 1 
ATOM   620  C  CE1 . HIS A 1 78  ? 10.271 15.478 46.680 1.00 36.52 ? 78  HIS A CE1 1 
ATOM   621  N  NE2 . HIS A 1 78  ? 9.597  14.384 46.986 1.00 36.31 ? 78  HIS A NE2 1 
ATOM   622  N  N   . LEU A 1 79  ? 5.345  15.305 41.868 1.00 12.79 ? 79  LEU A N   1 
ATOM   623  C  CA  . LEU A 1 79  ? 4.383  15.785 40.880 1.00 12.82 ? 79  LEU A CA  1 
ATOM   624  C  C   . LEU A 1 79  ? 3.486  14.661 40.430 1.00 12.03 ? 79  LEU A C   1 
ATOM   625  O  O   . LEU A 1 79  ? 3.849  13.490 40.499 1.00 11.51 ? 79  LEU A O   1 
ATOM   626  C  CB  . LEU A 1 79  ? 5.089  16.261 39.611 1.00 13.75 ? 79  LEU A CB  1 
ATOM   627  C  CG  . LEU A 1 79  ? 5.879  17.558 39.513 1.00 15.35 ? 79  LEU A CG  1 
ATOM   628  C  CD1 . LEU A 1 79  ? 6.632  17.547 38.187 1.00 12.98 ? 79  LEU A CD1 1 
ATOM   629  C  CD2 . LEU A 1 79  ? 4.934  18.755 39.591 1.00 15.25 ? 79  LEU A CD2 1 
ATOM   630  N  N   . SER A 1 80  ? 2.299  15.017 39.972 1.00 12.20 ? 80  SER A N   1 
ATOM   631  C  CA  . SER A 1 80  ? 1.408  14.020 39.409 1.00 12.52 ? 80  SER A CA  1 
ATOM   632  C  C   . SER A 1 80  ? 1.976  13.883 37.991 1.00 11.07 ? 80  SER A C   1 
ATOM   633  O  O   . SER A 1 80  ? 2.428  14.883 37.404 1.00 8.54  ? 80  SER A O   1 
ATOM   634  C  CB  . SER A 1 80  ? -0.021 14.566 39.324 1.00 13.50 ? 80  SER A CB  1 
ATOM   635  O  OG  . SER A 1 80  ? -0.808 13.816 38.415 1.00 14.17 ? 80  SER A OG  1 
ATOM   636  N  N   . CYS A 1 81  ? 1.958  12.677 37.433 1.00 7.18  ? 81  CYS A N   1 
ATOM   637  C  CA  . CYS A 1 81  ? 2.458  12.485 36.085 1.00 5.88  ? 81  CYS A CA  1 
ATOM   638  C  C   . CYS A 1 81  ? 1.649  13.321 35.100 1.00 6.19  ? 81  CYS A C   1 
ATOM   639  O  O   . CYS A 1 81  ? 2.130  13.627 34.006 1.00 7.29  ? 81  CYS A O   1 
ATOM   640  C  CB  . CYS A 1 81  ? 2.429  11.017 35.700 1.00 7.37  ? 81  CYS A CB  1 
ATOM   641  S  SG  . CYS A 1 81  ? 3.536  10.006 36.740 1.00 6.36  ? 81  CYS A SG  1 
ATOM   642  N  N   . SER A 1 82  ? 0.431  13.701 35.503 1.00 4.11  ? 82  SER A N   1 
ATOM   643  C  CA  . SER A 1 82  ? -0.463 14.540 34.705 1.00 5.47  ? 82  SER A CA  1 
ATOM   644  C  C   . SER A 1 82  ? 0.214  15.871 34.343 1.00 5.76  ? 82  SER A C   1 
ATOM   645  O  O   . SER A 1 82  ? 0.046  16.393 33.235 1.00 5.14  ? 82  SER A O   1 
ATOM   646  C  CB  . SER A 1 82  ? -1.740 14.830 35.511 1.00 7.52  ? 82  SER A CB  1 
ATOM   647  O  OG  . SER A 1 82  ? -2.655 15.624 34.775 1.00 20.27 ? 82  SER A OG  1 
ATOM   648  N  N   . ALA A 1 83  ? 0.998  16.399 35.276 1.00 6.94  ? 83  ALA A N   1 
ATOM   649  C  CA  . ALA A 1 83  ? 1.710  17.663 35.079 1.00 7.26  ? 83  ALA A CA  1 
ATOM   650  C  C   . ALA A 1 83  ? 2.716  17.619 33.924 1.00 8.00  ? 83  ALA A C   1 
ATOM   651  O  O   . ALA A 1 83  ? 3.051  18.663 33.341 1.00 8.20  ? 83  ALA A O   1 
ATOM   652  C  CB  . ALA A 1 83  ? 2.415  18.063 36.373 1.00 7.44  ? 83  ALA A CB  1 
ATOM   653  N  N   . LEU A 1 84  ? 3.164  16.411 33.573 1.00 6.38  ? 84  LEU A N   1 
ATOM   654  C  CA  . LEU A 1 84  ? 4.138  16.218 32.506 1.00 4.97  ? 84  LEU A CA  1 
ATOM   655  C  C   . LEU A 1 84  ? 3.483  16.063 31.148 1.00 6.15  ? 84  LEU A C   1 
ATOM   656  O  O   . LEU A 1 84  ? 4.158  15.775 30.170 1.00 9.48  ? 84  LEU A O   1 
ATOM   657  C  CB  . LEU A 1 84  ? 5.041  15.011 32.803 1.00 6.49  ? 84  LEU A CB  1 
ATOM   658  C  CG  . LEU A 1 84  ? 5.747  15.015 34.168 1.00 9.97  ? 84  LEU A CG  1 
ATOM   659  C  CD1 . LEU A 1 84  ? 6.529  13.713 34.337 1.00 11.68 ? 84  LEU A CD1 1 
ATOM   660  C  CD2 . LEU A 1 84  ? 6.669  16.220 34.302 1.00 12.01 ? 84  LEU A CD2 1 
ATOM   661  N  N   . LEU A 1 85  ? 2.168  16.266 31.087 1.00 3.85  ? 85  LEU A N   1 
ATOM   662  C  CA  . LEU A 1 85  ? 1.426  16.181 29.834 1.00 5.29  ? 85  LEU A CA  1 
ATOM   663  C  C   . LEU A 1 85  ? 0.846  17.542 29.432 1.00 6.84  ? 85  LEU A C   1 
ATOM   664  O  O   . LEU A 1 85  ? 0.041  17.627 28.518 1.00 8.47  ? 85  LEU A O   1 
ATOM   665  C  CB  . LEU A 1 85  ? 0.298  15.147 29.955 1.00 6.38  ? 85  LEU A CB  1 
ATOM   666  C  CG  . LEU A 1 85  ? 0.763  13.716 30.263 1.00 7.00  ? 85  LEU A CG  1 
ATOM   667  C  CD1 . LEU A 1 85  ? -0.431 12.807 30.423 1.00 6.83  ? 85  LEU A CD1 1 
ATOM   668  C  CD2 . LEU A 1 85  ? 1.672  13.210 29.145 1.00 6.61  ? 85  LEU A CD2 1 
ATOM   669  N  N   . GLN A 1 86  ? 1.256  18.604 30.115 1.00 5.80  ? 86  GLN A N   1 
ATOM   670  C  CA  . GLN A 1 86  ? 0.745  19.954 29.819 1.00 6.52  ? 86  GLN A CA  1 
ATOM   671  C  C   . GLN A 1 86  ? 1.473  20.561 28.634 1.00 7.12  ? 86  GLN A C   1 
ATOM   672  O  O   . GLN A 1 86  ? 2.540  20.092 28.265 1.00 10.53 ? 86  GLN A O   1 
ATOM   673  C  CB  . GLN A 1 86  ? 0.982  20.883 31.002 1.00 4.77  ? 86  GLN A CB  1 
ATOM   674  C  CG  . GLN A 1 86  ? 0.401  20.433 32.324 1.00 10.49 ? 86  GLN A CG  1 
ATOM   675  C  CD  . GLN A 1 86  ? 0.756  21.404 33.433 1.00 18.75 ? 86  GLN A CD  1 
ATOM   676  O  OE1 . GLN A 1 86  ? 0.184  22.489 33.522 1.00 24.81 ? 86  GLN A OE1 1 
ATOM   677  N  NE2 . GLN A 1 86  ? 1.728  21.045 34.256 1.00 15.57 ? 86  GLN A NE2 1 
ATOM   678  N  N   . ASP A 1 87  ? 0.914  21.622 28.054 1.00 5.77  ? 87  ASP A N   1 
ATOM   679  C  CA  . ASP A 1 87  ? 1.564  22.307 26.945 1.00 4.58  ? 87  ASP A CA  1 
ATOM   680  C  C   . ASP A 1 87  ? 2.722  23.153 27.485 1.00 5.90  ? 87  ASP A C   1 
ATOM   681  O  O   . ASP A 1 87  ? 3.713  23.380 26.796 1.00 10.24 ? 87  ASP A O   1 
ATOM   682  C  CB  . ASP A 1 87  ? 0.577  23.212 26.214 1.00 10.06 ? 87  ASP A CB  1 
ATOM   683  C  CG  . ASP A 1 87  ? -0.326 22.462 25.236 1.00 17.13 ? 87  ASP A CG  1 
ATOM   684  O  OD1 . ASP A 1 87  ? -0.191 21.227 25.075 1.00 12.24 ? 87  ASP A OD1 1 
ATOM   685  O  OD2 . ASP A 1 87  ? -1.185 23.133 24.617 1.00 16.66 ? 87  ASP A OD2 1 
ATOM   686  N  N   . ASN A 1 88  ? 2.555  23.666 28.699 1.00 7.35  ? 88  ASN A N   1 
ATOM   687  C  CA  . ASN A 1 88  ? 3.569  24.479 29.351 1.00 7.54  ? 88  ASN A CA  1 
ATOM   688  C  C   . ASN A 1 88  ? 4.543  23.488 29.987 1.00 7.58  ? 88  ASN A C   1 
ATOM   689  O  O   . ASN A 1 88  ? 4.190  22.786 30.926 1.00 11.68 ? 88  ASN A O   1 
ATOM   690  C  CB  . ASN A 1 88  ? 2.916  25.353 30.427 1.00 15.51 ? 88  ASN A CB  1 
ATOM   691  C  CG  . ASN A 1 88  ? 3.916  26.264 31.132 1.00 25.64 ? 88  ASN A CG  1 
ATOM   692  O  OD1 . ASN A 1 88  ? 4.923  25.803 31.656 1.00 19.89 ? 88  ASN A OD1 1 
ATOM   693  N  ND2 . ASN A 1 88  ? 3.641  27.564 31.134 1.00 29.11 ? 88  ASN A ND2 1 
ATOM   694  N  N   . ILE A 1 89  ? 5.774  23.468 29.500 1.00 6.13  ? 89  ILE A N   1 
ATOM   695  C  CA  . ILE A 1 89  ? 6.775  22.524 29.978 1.00 6.51  ? 89  ILE A CA  1 
ATOM   696  C  C   . ILE A 1 89  ? 7.573  22.876 31.239 1.00 7.77  ? 89  ILE A C   1 
ATOM   697  O  O   . ILE A 1 89  ? 8.546  22.182 31.581 1.00 6.05  ? 89  ILE A O   1 
ATOM   698  C  CB  . ILE A 1 89  ? 7.753  22.159 28.828 1.00 6.44  ? 89  ILE A CB  1 
ATOM   699  C  CG1 . ILE A 1 89  ? 8.525  23.392 28.361 1.00 4.70  ? 89  ILE A CG1 1 
ATOM   700  C  CG2 . ILE A 1 89  ? 6.983  21.602 27.650 1.00 8.21  ? 89  ILE A CG2 1 
ATOM   701  C  CD1 . ILE A 1 89  ? 9.669  23.031 27.457 1.00 11.50 ? 89  ILE A CD1 1 
ATOM   702  N  N   . ALA A 1 90  ? 7.137  23.906 31.958 1.00 6.19  ? 90  ALA A N   1 
ATOM   703  C  CA  . ALA A 1 90  ? 7.830  24.315 33.176 1.00 7.00  ? 90  ALA A CA  1 
ATOM   704  C  C   . ALA A 1 90  ? 8.006  23.177 34.179 1.00 7.01  ? 90  ALA A C   1 
ATOM   705  O  O   . ALA A 1 90  ? 9.104  22.987 34.707 1.00 5.89  ? 90  ALA A O   1 
ATOM   706  C  CB  . ALA A 1 90  ? 7.121  25.481 33.833 1.00 7.17  ? 90  ALA A CB  1 
ATOM   707  N  N   . ASP A 1 91  ? 6.936  22.428 34.453 1.00 7.37  ? 91  ASP A N   1 
ATOM   708  C  CA  . ASP A 1 91  ? 7.032  21.311 35.403 1.00 6.12  ? 91  ASP A CA  1 
ATOM   709  C  C   . ASP A 1 91  ? 7.919  20.177 34.886 1.00 5.12  ? 91  ASP A C   1 
ATOM   710  O  O   . ASP A 1 91  ? 8.705  19.606 35.645 1.00 6.75  ? 91  ASP A O   1 
ATOM   711  C  CB  . ASP A 1 91  ? 5.651  20.773 35.772 1.00 10.75 ? 91  ASP A CB  1 
ATOM   712  C  CG  . ASP A 1 91  ? 4.866  21.733 36.625 1.00 15.12 ? 91  ASP A CG  1 
ATOM   713  O  OD1 . ASP A 1 91  ? 5.476  22.466 37.436 1.00 17.52 ? 91  ASP A OD1 1 
ATOM   714  O  OD2 . ASP A 1 91  ? 3.631  21.753 36.485 1.00 13.75 ? 91  ASP A OD2 1 
ATOM   715  N  N   . ALA A 1 92  ? 7.799  19.874 33.599 1.00 5.61  ? 92  ALA A N   1 
ATOM   716  C  CA  . ALA A 1 92  ? 8.599  18.840 32.953 1.00 5.21  ? 92  ALA A CA  1 
ATOM   717  C  C   . ALA A 1 92  ? 10.086 19.184 33.071 1.00 8.89  ? 92  ALA A C   1 
ATOM   718  O  O   . ALA A 1 92  ? 10.914 18.310 33.342 1.00 7.44  ? 92  ALA A O   1 
ATOM   719  C  CB  . ALA A 1 92  ? 8.204  18.713 31.496 1.00 5.25  ? 92  ALA A CB  1 
ATOM   720  N  N   . VAL A 1 93  ? 10.414 20.465 32.892 1.00 6.31  ? 93  VAL A N   1 
ATOM   721  C  CA  . VAL A 1 93  ? 11.795 20.927 32.999 1.00 4.60  ? 93  VAL A CA  1 
ATOM   722  C  C   . VAL A 1 93  ? 12.315 20.816 34.429 1.00 5.39  ? 93  VAL A C   1 
ATOM   723  O  O   . VAL A 1 93  ? 13.435 20.352 34.659 1.00 7.71  ? 93  VAL A O   1 
ATOM   724  C  CB  . VAL A 1 93  ? 11.948 22.375 32.454 1.00 4.97  ? 93  VAL A CB  1 
ATOM   725  C  CG1 . VAL A 1 93  ? 13.269 22.991 32.927 1.00 6.98  ? 93  VAL A CG1 1 
ATOM   726  C  CG2 . VAL A 1 93  ? 11.915 22.344 30.932 1.00 5.42  ? 93  VAL A CG2 1 
ATOM   727  N  N   . ALA A 1 94  ? 11.493 21.227 35.389 1.00 5.51  ? 94  ALA A N   1 
ATOM   728  C  CA  . ALA A 1 94  ? 11.861 21.137 36.792 1.00 5.66  ? 94  ALA A CA  1 
ATOM   729  C  C   . ALA A 1 94  ? 12.156 19.677 37.178 1.00 5.87  ? 94  ALA A C   1 
ATOM   730  O  O   . ALA A 1 94  ? 13.083 19.401 37.941 1.00 6.17  ? 94  ALA A O   1 
ATOM   731  C  CB  . ALA A 1 94  ? 10.733 21.697 37.656 1.00 6.26  ? 94  ALA A CB  1 
ATOM   732  N  N   . CYS A 1 95  ? 11.366 18.744 36.656 1.00 4.99  ? 95  CYS A N   1 
ATOM   733  C  CA  . CYS A 1 95  ? 11.567 17.329 36.965 1.00 6.55  ? 95  CYS A CA  1 
ATOM   734  C  C   . CYS A 1 95  ? 12.801 16.755 36.241 1.00 4.65  ? 95  CYS A C   1 
ATOM   735  O  O   . CYS A 1 95  ? 13.582 16.004 36.834 1.00 4.79  ? 95  CYS A O   1 
ATOM   736  C  CB  . CYS A 1 95  ? 10.283 16.551 36.655 1.00 7.65  ? 95  CYS A CB  1 
ATOM   737  S  SG  . CYS A 1 95  ? 10.290 14.790 37.133 1.00 10.50 ? 95  CYS A SG  1 
ATOM   738  N  N   . ALA A 1 96  ? 13.017 17.138 34.984 1.00 4.07  ? 96  ALA A N   1 
ATOM   739  C  CA  . ALA A 1 96  ? 14.196 16.677 34.250 1.00 4.91  ? 96  ALA A CA  1 
ATOM   740  C  C   . ALA A 1 96  ? 15.465 17.181 34.964 1.00 5.30  ? 96  ALA A C   1 
ATOM   741  O  O   . ALA A 1 96  ? 16.503 16.507 34.954 1.00 5.70  ? 96  ALA A O   1 
ATOM   742  C  CB  . ALA A 1 96  ? 14.162 17.180 32.799 1.00 6.37  ? 96  ALA A CB  1 
ATOM   743  N  N   . LYS A 1 97  ? 15.401 18.371 35.568 1.00 3.86  ? 97  LYS A N   1 
ATOM   744  C  CA  . LYS A 1 97  ? 16.556 18.897 36.303 1.00 3.76  ? 97  LYS A CA  1 
ATOM   745  C  C   . LYS A 1 97  ? 16.802 17.998 37.520 1.00 5.86  ? 97  LYS A C   1 
ATOM   746  O  O   . LYS A 1 97  ? 17.947 17.749 37.903 1.00 6.08  ? 97  LYS A O   1 
ATOM   747  C  CB  . LYS A 1 97  ? 16.312 20.343 36.776 1.00 6.91  ? 97  LYS A CB  1 
ATOM   748  C  CG  . LYS A 1 97  ? 16.357 21.394 35.664 1.00 7.33  ? 97  LYS A CG  1 
ATOM   749  C  CD  . LYS A 1 97  ? 16.188 22.798 36.219 1.00 4.16  ? 97  LYS A CD  1 
ATOM   750  C  CE  . LYS A 1 97  ? 16.292 23.808 35.099 1.00 6.89  ? 97  LYS A CE  1 
ATOM   751  N  NZ  . LYS A 1 97  ? 15.990 25.173 35.579 1.00 9.98  ? 97  LYS A NZ  1 
ATOM   752  N  N   . ARG A 1 98  ? 15.720 17.513 38.126 1.00 7.40  ? 98  ARG A N   1 
ATOM   753  C  CA  . ARG A 1 98  ? 15.823 16.621 39.284 1.00 5.93  ? 98  ARG A CA  1 
ATOM   754  C  C   . ARG A 1 98  ? 16.464 15.295 38.864 1.00 6.75  ? 98  ARG A C   1 
ATOM   755  O  O   . ARG A 1 98  ? 17.367 14.791 39.538 1.00 7.67  ? 98  ARG A O   1 
ATOM   756  C  CB  . ARG A 1 98  ? 14.430 16.378 39.896 1.00 7.14  ? 98  ARG A CB  1 
ATOM   757  C  CG  . ARG A 1 98  ? 14.369 15.295 40.973 1.00 11.16 ? 98  ARG A CG  1 
ATOM   758  C  CD  . ARG A 1 98  ? 15.256 15.601 42.175 1.00 15.72 ? 98  ARG A CD  1 
ATOM   759  N  NE  . ARG A 1 98  ? 15.310 14.466 43.092 1.00 27.60 ? 98  ARG A NE  1 
ATOM   760  C  CZ  . ARG A 1 98  ? 16.154 13.442 42.976 1.00 29.16 ? 98  ARG A CZ  1 
ATOM   761  N  NH1 . ARG A 1 98  ? 17.085 13.425 42.026 1.00 20.85 ? 98  ARG A NH1 1 
ATOM   762  N  NH2 . ARG A 1 98  ? 16.109 12.457 43.857 1.00 24.06 ? 98  ARG A NH2 1 
ATOM   763  N  N   . VAL A 1 99  ? 16.017 14.744 37.741 1.00 5.63  ? 99  VAL A N   1 
ATOM   764  C  CA  . VAL A 1 99  ? 16.557 13.484 37.248 1.00 6.49  ? 99  VAL A CA  1 
ATOM   765  C  C   . VAL A 1 99  ? 18.076 13.532 37.101 1.00 8.81  ? 99  VAL A C   1 
ATOM   766  O  O   . VAL A 1 99  ? 18.762 12.610 37.544 1.00 9.67  ? 99  VAL A O   1 
ATOM   767  C  CB  . VAL A 1 99  ? 15.957 13.095 35.872 1.00 6.25  ? 99  VAL A CB  1 
ATOM   768  C  CG1 . VAL A 1 99  ? 16.698 11.890 35.291 1.00 6.88  ? 99  VAL A CG1 1 
ATOM   769  C  CG2 . VAL A 1 99  ? 14.475 12.807 36.005 1.00 6.38  ? 99  VAL A CG2 1 
ATOM   770  N  N   . VAL A 1 100 ? 18.597 14.589 36.481 1.00 6.31  ? 100 VAL A N   1 
ATOM   771  C  CA  . VAL A 1 100 ? 20.030 14.702 36.253 1.00 8.03  ? 100 VAL A CA  1 
ATOM   772  C  C   . VAL A 1 100 ? 20.861 15.065 37.467 1.00 11.28 ? 100 VAL A C   1 
ATOM   773  O  O   . VAL A 1 100 ? 22.096 15.089 37.394 1.00 13.18 ? 100 VAL A O   1 
ATOM   774  C  CB  . VAL A 1 100 ? 20.372 15.625 35.071 1.00 8.92  ? 100 VAL A CB  1 
ATOM   775  C  CG1 . VAL A 1 100 ? 19.647 15.147 33.822 1.00 9.24  ? 100 VAL A CG1 1 
ATOM   776  C  CG2 . VAL A 1 100 ? 20.056 17.097 35.397 1.00 9.46  ? 100 VAL A CG2 1 
ATOM   777  N  N   . ARG A 1 101 ? 20.197 15.380 38.575 1.00 13.29 ? 101 ARG A N   1 
ATOM   778  C  CA  . ARG A 1 101 ? 20.907 15.685 39.803 1.00 17.47 ? 101 ARG A CA  1 
ATOM   779  C  C   . ARG A 1 101 ? 21.468 14.373 40.395 1.00 21.42 ? 101 ARG A C   1 
ATOM   780  O  O   . ARG A 1 101 ? 22.350 14.397 41.257 1.00 24.54 ? 101 ARG A O   1 
ATOM   781  C  CB  . ARG A 1 101 ? 19.978 16.387 40.786 1.00 20.32 ? 101 ARG A CB  1 
ATOM   782  C  CG  . ARG A 1 101 ? 20.334 17.846 41.035 1.00 21.12 ? 101 ARG A CG  1 
ATOM   783  C  CD  . ARG A 1 101 ? 19.305 18.502 41.936 1.00 18.88 ? 101 ARG A CD  1 
ATOM   784  N  NE  . ARG A 1 101 ? 18.487 19.431 41.182 1.00 35.17 ? 101 ARG A NE  1 
ATOM   785  C  CZ  . ARG A 1 101 ? 17.190 19.636 41.362 1.00 15.77 ? 101 ARG A CZ  1 
ATOM   786  N  NH1 . ARG A 1 101 ? 16.510 18.968 42.283 1.00 16.07 ? 101 ARG A NH1 1 
ATOM   787  N  NH2 . ARG A 1 101 ? 16.574 20.518 40.596 1.00 28.39 ? 101 ARG A NH2 1 
ATOM   788  N  N   . ASP A 1 102 ? 20.959 13.236 39.921 1.00 16.96 ? 102 ASP A N   1 
ATOM   789  C  CA  . ASP A 1 102 ? 21.434 11.928 40.355 1.00 15.73 ? 102 ASP A CA  1 
ATOM   790  C  C   . ASP A 1 102 ? 22.759 11.665 39.657 1.00 16.41 ? 102 ASP A C   1 
ATOM   791  O  O   . ASP A 1 102 ? 22.997 12.198 38.580 1.00 16.22 ? 102 ASP A O   1 
ATOM   792  C  CB  . ASP A 1 102 ? 20.432 10.832 39.968 1.00 18.90 ? 102 ASP A CB  1 
ATOM   793  C  CG  . ASP A 1 102 ? 19.381 10.580 41.048 1.00 29.69 ? 102 ASP A CG  1 
ATOM   794  O  OD1 . ASP A 1 102 ? 19.190 11.425 41.950 1.00 31.10 ? 102 ASP A OD1 1 
ATOM   795  O  OD2 . ASP A 1 102 ? 18.736 9.519  40.978 1.00 35.05 ? 102 ASP A OD2 1 
ATOM   796  N  N   . PRO A 1 103 ? 23.616 10.804 40.233 1.00 21.47 ? 103 PRO A N   1 
ATOM   797  C  CA  . PRO A 1 103 ? 24.929 10.473 39.666 1.00 21.53 ? 103 PRO A CA  1 
ATOM   798  C  C   . PRO A 1 103 ? 25.031 10.162 38.172 1.00 20.08 ? 103 PRO A C   1 
ATOM   799  O  O   . PRO A 1 103 ? 26.043 10.493 37.547 1.00 20.09 ? 103 PRO A O   1 
ATOM   800  C  CB  . PRO A 1 103 ? 25.418 9.308  40.541 1.00 22.59 ? 103 PRO A CB  1 
ATOM   801  C  CG  . PRO A 1 103 ? 24.183 8.859  41.311 1.00 25.56 ? 103 PRO A CG  1 
ATOM   802  C  CD  . PRO A 1 103 ? 23.440 10.135 41.536 1.00 23.58 ? 103 PRO A CD  1 
ATOM   803  N  N   . GLN A 1 104 ? 24.007 9.535  37.601 1.00 16.39 ? 104 GLN A N   1 
ATOM   804  C  CA  . GLN A 1 104 ? 24.022 9.192  36.171 1.00 17.38 ? 104 GLN A CA  1 
ATOM   805  C  C   . GLN A 1 104 ? 23.905 10.385 35.228 1.00 14.93 ? 104 GLN A C   1 
ATOM   806  O  O   . GLN A 1 104 ? 24.286 10.296 34.048 1.00 14.76 ? 104 GLN A O   1 
ATOM   807  C  CB  . GLN A 1 104 ? 22.896 8.219  35.829 1.00 25.29 ? 104 GLN A CB  1 
ATOM   808  C  CG  . GLN A 1 104 ? 23.080 6.816  36.329 1.00 36.33 ? 104 GLN A CG  1 
ATOM   809  C  CD  . GLN A 1 104 ? 22.027 5.900  35.756 1.00 44.83 ? 104 GLN A CD  1 
ATOM   810  O  OE1 . GLN A 1 104 ? 20.933 5.768  36.316 1.00 50.39 ? 104 GLN A OE1 1 
ATOM   811  N  NE2 . GLN A 1 104 ? 22.327 5.295  34.612 1.00 36.65 ? 104 GLN A NE2 1 
ATOM   812  N  N   . GLY A 1 105 ? 23.330 11.474 35.720 1.00 12.57 ? 105 GLY A N   1 
ATOM   813  C  CA  . GLY A 1 105 ? 23.167 12.643 34.873 1.00 10.16 ? 105 GLY A CA  1 
ATOM   814  C  C   . GLY A 1 105 ? 22.271 12.306 33.697 1.00 7.57  ? 105 GLY A C   1 
ATOM   815  O  O   . GLY A 1 105 ? 21.351 11.494 33.823 1.00 11.55 ? 105 GLY A O   1 
ATOM   816  N  N   . ILE A 1 106 ? 22.579 12.894 32.548 1.00 10.13 ? 106 ILE A N   1 
ATOM   817  C  CA  . ILE A 1 106 ? 21.824 12.705 31.308 1.00 10.62 ? 106 ILE A CA  1 
ATOM   818  C  C   . ILE A 1 106 ? 21.783 11.233 30.849 1.00 11.15 ? 106 ILE A C   1 
ATOM   819  O  O   . ILE A 1 106 ? 20.893 10.825 30.112 1.00 11.60 ? 106 ILE A O   1 
ATOM   820  C  CB  . ILE A 1 106 ? 22.427 13.614 30.195 1.00 12.43 ? 106 ILE A CB  1 
ATOM   821  C  CG1 . ILE A 1 106 ? 21.547 13.620 28.938 1.00 21.09 ? 106 ILE A CG1 1 
ATOM   822  C  CG2 . ILE A 1 106 ? 23.854 13.192 29.874 1.00 13.25 ? 106 ILE A CG2 1 
ATOM   823  C  CD1 . ILE A 1 106 ? 20.267 14.412 29.085 1.00 18.04 ? 106 ILE A CD1 1 
ATOM   824  N  N   . ARG A 1 107 ? 22.728 10.427 31.327 1.00 12.09 ? 107 ARG A N   1 
ATOM   825  C  CA  . ARG A 1 107 ? 22.798 9.016  30.963 1.00 12.33 ? 107 ARG A CA  1 
ATOM   826  C  C   . ARG A 1 107 ? 21.621 8.215  31.512 1.00 15.27 ? 107 ARG A C   1 
ATOM   827  O  O   . ARG A 1 107 ? 21.419 7.079  31.118 1.00 15.37 ? 107 ARG A O   1 
ATOM   828  C  CB  . ARG A 1 107 ? 24.132 8.399  31.428 1.00 13.31 ? 107 ARG A CB  1 
ATOM   829  C  CG  . ARG A 1 107 ? 25.345 8.838  30.592 1.00 17.65 ? 107 ARG A CG  1 
ATOM   830  C  CD  . ARG A 1 107 ? 26.678 8.551  31.306 1.00 24.68 ? 107 ARG A CD  1 
ATOM   831  N  NE  . ARG A 1 107 ? 27.835 8.628  30.411 1.00 27.00 ? 107 ARG A NE  1 
ATOM   832  C  CZ  . ARG A 1 107 ? 28.324 9.745  29.870 1.00 32.20 ? 107 ARG A CZ  1 
ATOM   833  N  NH1 . ARG A 1 107 ? 27.782 10.933 30.130 1.00 27.68 ? 107 ARG A NH1 1 
ATOM   834  N  NH2 . ARG A 1 107 ? 29.375 9.676  29.059 1.00 30.17 ? 107 ARG A NH2 1 
ATOM   835  N  N   . ALA A 1 108 ? 20.829 8.811  32.398 1.00 15.23 ? 108 ALA A N   1 
ATOM   836  C  CA  . ALA A 1 108 ? 19.675 8.120  32.960 1.00 15.08 ? 108 ALA A CA  1 
ATOM   837  C  C   . ALA A 1 108 ? 18.696 7.688  31.864 1.00 15.61 ? 108 ALA A C   1 
ATOM   838  O  O   . ALA A 1 108 ? 17.884 6.782  32.083 1.00 19.92 ? 108 ALA A O   1 
ATOM   839  C  CB  . ALA A 1 108 ? 18.976 9.003  33.978 1.00 14.38 ? 108 ALA A CB  1 
ATOM   840  N  N   . TRP A 1 109 ? 18.746 8.345  30.705 1.00 12.67 ? 109 TRP A N   1 
ATOM   841  C  CA  . TRP A 1 109 ? 17.863 7.988  29.593 1.00 11.04 ? 109 TRP A CA  1 
ATOM   842  C  C   . TRP A 1 109 ? 18.695 7.172  28.615 1.00 11.45 ? 109 TRP A C   1 
ATOM   843  O  O   . TRP A 1 109 ? 19.643 7.705  28.013 1.00 7.85  ? 109 TRP A O   1 
ATOM   844  C  CB  . TRP A 1 109 ? 17.359 9.238  28.860 1.00 9.87  ? 109 TRP A CB  1 
ATOM   845  C  CG  . TRP A 1 109 ? 16.263 10.017 29.558 1.00 11.12 ? 109 TRP A CG  1 
ATOM   846  C  CD1 . TRP A 1 109 ? 14.931 9.789  29.478 1.00 10.11 ? 109 TRP A CD1 1 
ATOM   847  C  CD2 . TRP A 1 109 ? 16.431 11.185 30.379 1.00 10.40 ? 109 TRP A CD2 1 
ATOM   848  N  NE1 . TRP A 1 109 ? 14.242 10.739 30.195 1.00 10.00 ? 109 TRP A NE1 1 
ATOM   849  C  CE2 . TRP A 1 109 ? 15.136 11.612 30.758 1.00 11.65 ? 109 TRP A CE2 1 
ATOM   850  C  CE3 . TRP A 1 109 ? 17.540 11.915 30.830 1.00 10.74 ? 109 TRP A CE3 1 
ATOM   851  C  CZ2 . TRP A 1 109 ? 14.914 12.734 31.569 1.00 11.12 ? 109 TRP A CZ2 1 
ATOM   852  C  CZ3 . TRP A 1 109 ? 17.324 13.040 31.637 1.00 11.60 ? 109 TRP A CZ3 1 
ATOM   853  C  CH2 . TRP A 1 109 ? 16.011 13.436 31.995 1.00 11.11 ? 109 TRP A CH2 1 
ATOM   854  N  N   . VAL A 1 110 ? 18.331 5.906  28.405 1.00 14.77 ? 110 VAL A N   1 
ATOM   855  C  CA  . VAL A 1 110 ? 19.100 5.070  27.485 1.00 17.69 ? 110 VAL A CA  1 
ATOM   856  C  C   . VAL A 1 110 ? 19.097 5.614  26.060 1.00 16.01 ? 110 VAL A C   1 
ATOM   857  O  O   . VAL A 1 110 ? 20.081 5.456  25.331 1.00 16.67 ? 110 VAL A O   1 
ATOM   858  C  CB  . VAL A 1 110 ? 18.621 3.591  27.474 1.00 21.36 ? 110 VAL A CB  1 
ATOM   859  C  CG1 . VAL A 1 110 ? 19.486 2.768  26.525 1.00 21.64 ? 110 VAL A CG1 1 
ATOM   860  C  CG2 . VAL A 1 110 ? 18.725 2.999  28.864 1.00 21.56 ? 110 VAL A CG2 1 
ATOM   861  N  N   . ALA A 1 111 ? 18.015 6.274  25.664 1.00 13.09 ? 111 ALA A N   1 
ATOM   862  C  CA  . ALA A 1 111 ? 17.942 6.842  24.321 1.00 13.15 ? 111 ALA A CA  1 
ATOM   863  C  C   . ALA A 1 111 ? 19.047 7.881  24.087 1.00 11.86 ? 111 ALA A C   1 
ATOM   864  O  O   . ALA A 1 111 ? 19.534 8.023  22.966 1.00 13.58 ? 111 ALA A O   1 
ATOM   865  C  CB  . ALA A 1 111 ? 16.570 7.464  24.072 1.00 14.14 ? 111 ALA A CB  1 
ATOM   866  N  N   . TRP A 1 112 ? 19.454 8.595  25.136 1.00 8.70  ? 112 TRP A N   1 
ATOM   867  C  CA  . TRP A 1 112 ? 20.509 9.587  25.001 1.00 6.90  ? 112 TRP A CA  1 
ATOM   868  C  C   . TRP A 1 112 ? 21.821 8.880  24.638 1.00 6.37  ? 112 TRP A C   1 
ATOM   869  O  O   . TRP A 1 112 ? 22.550 9.318  23.765 1.00 7.50  ? 112 TRP A O   1 
ATOM   870  C  CB  . TRP A 1 112 ? 20.664 10.414 26.284 1.00 6.81  ? 112 TRP A CB  1 
ATOM   871  C  CG  . TRP A 1 112 ? 21.700 11.484 26.115 1.00 7.09  ? 112 TRP A CG  1 
ATOM   872  C  CD1 . TRP A 1 112 ? 21.539 12.709 25.511 1.00 6.65  ? 112 TRP A CD1 1 
ATOM   873  C  CD2 . TRP A 1 112 ? 23.080 11.390 26.462 1.00 8.70  ? 112 TRP A CD2 1 
ATOM   874  N  NE1 . TRP A 1 112 ? 22.737 13.371 25.453 1.00 7.55  ? 112 TRP A NE1 1 
ATOM   875  C  CE2 . TRP A 1 112 ? 23.704 12.590 26.031 1.00 8.24  ? 112 TRP A CE2 1 
ATOM   876  C  CE3 . TRP A 1 112 ? 23.857 10.409 27.094 1.00 9.73  ? 112 TRP A CE3 1 
ATOM   877  C  CZ2 . TRP A 1 112 ? 25.074 12.825 26.211 1.00 10.24 ? 112 TRP A CZ2 1 
ATOM   878  C  CZ3 . TRP A 1 112 ? 25.221 10.649 27.273 1.00 10.69 ? 112 TRP A CZ3 1 
ATOM   879  C  CH2 . TRP A 1 112 ? 25.814 11.851 26.833 1.00 11.04 ? 112 TRP A CH2 1 
ATOM   880  N  N   . ARG A 1 113 ? 22.101 7.769  25.300 1.00 9.58  ? 113 ARG A N   1 
ATOM   881  C  CA  . ARG A 1 113 ? 23.308 7.000  25.024 1.00 9.39  ? 113 ARG A CA  1 
ATOM   882  C  C   . ARG A 1 113 ? 23.327 6.473  23.585 1.00 11.31 ? 113 ARG A C   1 
ATOM   883  O  O   . ARG A 1 113 ? 24.335 6.583  22.897 1.00 10.89 ? 113 ARG A O   1 
ATOM   884  C  CB  . ARG A 1 113 ? 23.411 5.827  26.001 1.00 12.80 ? 113 ARG A CB  1 
ATOM   885  C  CG  . ARG A 1 113 ? 23.808 6.249  27.392 1.00 14.53 ? 113 ARG A CG  1 
ATOM   886  C  CD  . ARG A 1 113 ? 22.858 5.723  28.415 1.00 29.98 ? 113 ARG A CD  1 
ATOM   887  N  NE  . ARG A 1 113 ? 23.025 4.298  28.645 1.00 37.03 ? 113 ARG A NE  1 
ATOM   888  C  CZ  . ARG A 1 113 ? 22.656 3.681  29.765 1.00 50.96 ? 113 ARG A CZ  1 
ATOM   889  N  NH1 . ARG A 1 113 ? 22.131 4.377  30.768 1.00 47.45 ? 113 ARG A NH1 1 
ATOM   890  N  NH2 . ARG A 1 113 ? 22.838 2.372  29.899 1.00 48.25 ? 113 ARG A NH2 1 
ATOM   891  N  N   . ASN A 1 114 ? 22.188 5.950  23.130 1.00 13.74 ? 114 ASN A N   1 
ATOM   892  C  CA  . ASN A 1 114 ? 22.059 5.384  21.784 1.00 11.77 ? 114 ASN A CA  1 
ATOM   893  C  C   . ASN A 1 114 ? 22.122 6.392  20.656 1.00 11.82 ? 114 ASN A C   1 
ATOM   894  O  O   . ASN A 1 114 ? 22.763 6.141  19.634 1.00 10.65 ? 114 ASN A O   1 
ATOM   895  C  CB  . ASN A 1 114 ? 20.723 4.638  21.607 1.00 11.04 ? 114 ASN A CB  1 
ATOM   896  C  CG  . ASN A 1 114 ? 20.517 3.514  22.602 1.00 21.51 ? 114 ASN A CG  1 
ATOM   897  O  OD1 . ASN A 1 114 ? 21.454 3.027  23.209 1.00 19.29 ? 114 ASN A OD1 1 
ATOM   898  N  ND2 . ASN A 1 114 ? 19.272 3.110  22.776 1.00 23.48 ? 114 ASN A ND2 1 
ATOM   899  N  N   . ARG A 1 115 ? 21.423 7.514  20.810 1.00 11.43 ? 115 ARG A N   1 
ATOM   900  C  CA  . ARG A 1 115 ? 21.353 8.492  19.728 1.00 10.76 ? 115 ARG A CA  1 
ATOM   901  C  C   . ARG A 1 115 ? 22.043 9.829  19.869 1.00 8.60  ? 115 ARG A C   1 
ATOM   902  O  O   . ARG A 1 115 ? 22.081 10.577 18.901 1.00 10.86 ? 115 ARG A O   1 
ATOM   903  C  CB  . ARG A 1 115 ? 19.889 8.819  19.372 1.00 13.94 ? 115 ARG A CB  1 
ATOM   904  C  CG  . ARG A 1 115 ? 18.789 8.025  20.055 1.00 18.35 ? 115 ARG A CG  1 
ATOM   905  C  CD  . ARG A 1 115 ? 18.486 6.705  19.373 1.00 27.51 ? 115 ARG A CD  1 
ATOM   906  N  NE  . ARG A 1 115 ? 18.343 6.800  17.924 1.00 35.79 ? 115 ARG A NE  1 
ATOM   907  C  CZ  . ARG A 1 115 ? 17.653 5.938  17.176 1.00 28.65 ? 115 ARG A CZ  1 
ATOM   908  N  NH1 . ARG A 1 115 ? 16.987 4.940  17.741 1.00 33.54 ? 115 ARG A NH1 1 
ATOM   909  N  NH2 . ARG A 1 115 ? 17.596 6.098  15.859 1.00 18.87 ? 115 ARG A NH2 1 
ATOM   910  N  N   . CYS A 1 116 ? 22.533 10.162 21.055 1.00 7.55  ? 116 CYS A N   1 
ATOM   911  C  CA  . CYS A 1 116 ? 23.139 11.481 21.256 1.00 9.69  ? 116 CYS A CA  1 
ATOM   912  C  C   . CYS A 1 116 ? 24.599 11.509 21.698 1.00 10.00 ? 116 CYS A C   1 
ATOM   913  O  O   . CYS A 1 116 ? 25.377 12.358 21.239 1.00 9.58  ? 116 CYS A O   1 
ATOM   914  C  CB  . CYS A 1 116 ? 22.309 12.285 22.268 1.00 9.22  ? 116 CYS A CB  1 
ATOM   915  S  SG  . CYS A 1 116 ? 20.533 12.367 21.911 1.00 9.05  ? 116 CYS A SG  1 
ATOM   916  N  N   . GLN A 1 117 ? 24.944 10.611 22.619 1.00 11.27 ? 117 GLN A N   1 
ATOM   917  C  CA  . GLN A 1 117 ? 26.297 10.528 23.166 1.00 11.54 ? 117 GLN A CA  1 
ATOM   918  C  C   . GLN A 1 117 ? 27.383 10.370 22.098 1.00 11.64 ? 117 GLN A C   1 
ATOM   919  O  O   . GLN A 1 117 ? 27.259 9.544  21.193 1.00 10.33 ? 117 GLN A O   1 
ATOM   920  C  CB  . GLN A 1 117 ? 26.377 9.367  24.154 1.00 8.56  ? 117 GLN A CB  1 
ATOM   921  C  CG  . GLN A 1 117 ? 27.715 9.304  24.871 1.00 10.49 ? 117 GLN A CG  1 
ATOM   922  C  CD  . GLN A 1 117 ? 27.852 8.091  25.774 1.00 23.02 ? 117 GLN A CD  1 
ATOM   923  O  OE1 . GLN A 1 117 ? 28.953 7.756  26.202 1.00 33.32 ? 117 GLN A OE1 1 
ATOM   924  N  NE2 . GLN A 1 117 ? 26.738 7.438  26.084 1.00 15.19 ? 117 GLN A NE2 1 
ATOM   925  N  N   . ASN A 1 118 ? 28.444 11.169 22.213 1.00 12.99 ? 118 ASN A N   1 
ATOM   926  C  CA  . ASN A 1 118 ? 29.569 11.110 21.279 1.00 13.20 ? 118 ASN A CA  1 
ATOM   927  C  C   . ASN A 1 118 ? 29.221 11.501 19.853 1.00 13.70 ? 118 ASN A C   1 
ATOM   928  O  O   . ASN A 1 118 ? 29.983 11.205 18.936 1.00 16.97 ? 118 ASN A O   1 
ATOM   929  C  CB  . ASN A 1 118 ? 30.199 9.718  21.236 1.00 17.65 ? 118 ASN A CB  1 
ATOM   930  C  CG  . ASN A 1 118 ? 30.748 9.273  22.565 1.00 32.85 ? 118 ASN A CG  1 
ATOM   931  O  OD1 . ASN A 1 118 ? 30.737 8.079  22.883 1.00 41.35 ? 118 ASN A OD1 1 
ATOM   932  N  ND2 . ASN A 1 118 ? 31.230 10.224 23.358 1.00 33.21 ? 118 ASN A ND2 1 
ATOM   933  N  N   . ARG A 1 119 ? 28.080 12.145 19.643 1.00 10.99 ? 119 ARG A N   1 
ATOM   934  C  CA  . ARG A 1 119 ? 27.705 12.537 18.298 1.00 10.75 ? 119 ARG A CA  1 
ATOM   935  C  C   . ARG A 1 119 ? 27.806 14.043 18.122 1.00 13.26 ? 119 ARG A C   1 
ATOM   936  O  O   . ARG A 1 119 ? 28.009 14.773 19.092 1.00 15.95 ? 119 ARG A O   1 
ATOM   937  C  CB  . ARG A 1 119 ? 26.280 12.084 17.972 1.00 10.38 ? 119 ARG A CB  1 
ATOM   938  C  CG  . ARG A 1 119 ? 26.101 10.593 18.074 1.00 10.46 ? 119 ARG A CG  1 
ATOM   939  C  CD  . ARG A 1 119 ? 24.885 10.164 17.347 1.00 17.47 ? 119 ARG A CD  1 
ATOM   940  N  NE  . ARG A 1 119 ? 24.556 8.779  17.656 1.00 22.98 ? 119 ARG A NE  1 
ATOM   941  C  CZ  . ARG A 1 119 ? 24.322 7.853  16.735 1.00 25.77 ? 119 ARG A CZ  1 
ATOM   942  N  NH1 . ARG A 1 119 ? 24.414 8.152  15.445 1.00 23.90 ? 119 ARG A NH1 1 
ATOM   943  N  NH2 . ARG A 1 119 ? 24.015 6.619  17.107 1.00 28.41 ? 119 ARG A NH2 1 
ATOM   944  N  N   . ASP A 1 120 ? 27.690 14.499 16.881 1.00 13.12 ? 120 ASP A N   1 
ATOM   945  C  CA  . ASP A 1 120 ? 27.725 15.920 16.583 1.00 14.84 ? 120 ASP A CA  1 
ATOM   946  C  C   . ASP A 1 120 ? 26.272 16.352 16.770 1.00 13.13 ? 120 ASP A C   1 
ATOM   947  O  O   . ASP A 1 120 ? 25.437 16.079 15.917 1.00 16.60 ? 120 ASP A O   1 
ATOM   948  C  CB  . ASP A 1 120 ? 28.168 16.119 15.137 1.00 16.01 ? 120 ASP A CB  1 
ATOM   949  C  CG  . ASP A 1 120 ? 28.394 17.576 14.770 1.00 18.83 ? 120 ASP A CG  1 
ATOM   950  O  OD1 . ASP A 1 120 ? 28.224 18.484 15.615 1.00 21.90 ? 120 ASP A OD1 1 
ATOM   951  O  OD2 . ASP A 1 120 ? 28.742 17.799 13.608 1.00 22.19 ? 120 ASP A OD2 1 
ATOM   952  N  N   . VAL A 1 121 ? 25.969 16.955 17.917 1.00 10.57 ? 121 VAL A N   1 
ATOM   953  C  CA  . VAL A 1 121 ? 24.612 17.378 18.226 1.00 11.74 ? 121 VAL A CA  1 
ATOM   954  C  C   . VAL A 1 121 ? 24.314 18.844 17.908 1.00 12.18 ? 121 VAL A C   1 
ATOM   955  O  O   . VAL A 1 121 ? 23.225 19.335 18.220 1.00 10.13 ? 121 VAL A O   1 
ATOM   956  C  CB  . VAL A 1 121 ? 24.243 17.077 19.703 1.00 10.97 ? 121 VAL A CB  1 
ATOM   957  C  CG1 . VAL A 1 121 ? 24.223 15.560 19.943 1.00 12.19 ? 121 VAL A CG1 1 
ATOM   958  C  CG2 . VAL A 1 121 ? 25.220 17.774 20.660 1.00 10.30 ? 121 VAL A CG2 1 
ATOM   959  N  N   . ARG A 1 122 ? 25.264 19.525 17.275 1.00 14.03 ? 122 ARG A N   1 
ATOM   960  C  CA  . ARG A 1 122 ? 25.101 20.937 16.903 1.00 17.45 ? 122 ARG A CA  1 
ATOM   961  C  C   . ARG A 1 122 ? 23.842 21.177 16.083 1.00 14.96 ? 122 ARG A C   1 
ATOM   962  O  O   . ARG A 1 122 ? 23.130 22.172 16.268 1.00 15.17 ? 122 ARG A O   1 
ATOM   963  C  CB  . ARG A 1 122 ? 26.291 21.426 16.077 1.00 18.61 ? 122 ARG A CB  1 
ATOM   964  C  CG  . ARG A 1 122 ? 27.527 21.754 16.867 1.00 31.19 ? 122 ARG A CG  1 
ATOM   965  C  CD  . ARG A 1 122 ? 28.701 21.997 15.922 1.00 46.63 ? 122 ARG A CD  1 
ATOM   966  N  NE  . ARG A 1 122 ? 29.900 22.403 16.646 1.00 60.46 ? 122 ARG A NE  1 
ATOM   967  C  CZ  . ARG A 1 122 ? 30.727 21.572 17.283 1.00 68.61 ? 122 ARG A CZ  1 
ATOM   968  N  NH1 . ARG A 1 122 ? 30.525 20.253 17.266 1.00 67.73 ? 122 ARG A NH1 1 
ATOM   969  N  NH2 . ARG A 1 122 ? 31.783 22.070 17.923 1.00 67.53 ? 122 ARG A NH2 1 
ATOM   970  N  N   . GLN A 1 123 ? 23.579 20.259 15.164 1.00 11.84 ? 123 GLN A N   1 
ATOM   971  C  CA  . GLN A 1 123 ? 22.426 20.347 14.292 1.00 13.15 ? 123 GLN A CA  1 
ATOM   972  C  C   . GLN A 1 123 ? 21.096 20.653 14.974 1.00 13.06 ? 123 GLN A C   1 
ATOM   973  O  O   . GLN A 1 123 ? 20.243 21.309 14.393 1.00 13.66 ? 123 GLN A O   1 
ATOM   974  C  CB  . GLN A 1 123 ? 22.292 19.066 13.484 1.00 25.02 ? 123 GLN A CB  1 
ATOM   975  C  CG  . GLN A 1 123 ? 22.143 17.825 14.327 1.00 30.46 ? 123 GLN A CG  1 
ATOM   976  C  CD  . GLN A 1 123 ? 21.593 16.681 13.534 1.00 38.82 ? 123 GLN A CD  1 
ATOM   977  O  OE1 . GLN A 1 123 ? 20.462 16.735 13.051 1.00 51.53 ? 123 GLN A OE1 1 
ATOM   978  N  NE2 . GLN A 1 123 ? 22.389 15.638 13.371 1.00 49.50 ? 123 GLN A NE2 1 
ATOM   979  N  N   . TYR A 1 124 ? 20.931 20.200 16.213 1.00 12.83 ? 124 TYR A N   1 
ATOM   980  C  CA  . TYR A 1 124 ? 19.688 20.417 16.949 1.00 13.52 ? 124 TYR A CA  1 
ATOM   981  C  C   . TYR A 1 124 ? 19.412 21.876 17.349 1.00 14.99 ? 124 TYR A C   1 
ATOM   982  O  O   . TYR A 1 124 ? 18.248 22.243 17.530 1.00 18.80 ? 124 TYR A O   1 
ATOM   983  C  CB  . TYR A 1 124 ? 19.625 19.506 18.176 1.00 11.17 ? 124 TYR A CB  1 
ATOM   984  C  CG  . TYR A 1 124 ? 19.615 18.039 17.810 1.00 12.35 ? 124 TYR A CG  1 
ATOM   985  C  CD1 . TYR A 1 124 ? 18.442 17.421 17.384 1.00 14.99 ? 124 TYR A CD1 1 
ATOM   986  C  CD2 . TYR A 1 124 ? 20.781 17.278 17.852 1.00 12.44 ? 124 TYR A CD2 1 
ATOM   987  C  CE1 . TYR A 1 124 ? 18.429 16.077 17.004 1.00 15.05 ? 124 TYR A CE1 1 
ATOM   988  C  CE2 . TYR A 1 124 ? 20.779 15.937 17.475 1.00 11.94 ? 124 TYR A CE2 1 
ATOM   989  C  CZ  . TYR A 1 124 ? 19.597 15.347 17.050 1.00 15.44 ? 124 TYR A CZ  1 
ATOM   990  O  OH  . TYR A 1 124 ? 19.571 14.032 16.643 1.00 18.82 ? 124 TYR A OH  1 
ATOM   991  N  N   . VAL A 1 125 ? 20.457 22.698 17.489 1.00 9.24  ? 125 VAL A N   1 
ATOM   992  C  CA  . VAL A 1 125 ? 20.275 24.110 17.861 1.00 10.75 ? 125 VAL A CA  1 
ATOM   993  C  C   . VAL A 1 125 ? 20.711 25.117 16.799 1.00 12.10 ? 125 VAL A C   1 
ATOM   994  O  O   . VAL A 1 125 ? 20.567 26.313 16.996 1.00 13.00 ? 125 VAL A O   1 
ATOM   995  C  CB  . VAL A 1 125 ? 21.022 24.480 19.161 1.00 10.14 ? 125 VAL A CB  1 
ATOM   996  C  CG1 . VAL A 1 125 ? 20.438 23.738 20.347 1.00 11.62 ? 125 VAL A CG1 1 
ATOM   997  C  CG2 . VAL A 1 125 ? 22.519 24.214 19.019 1.00 10.67 ? 125 VAL A CG2 1 
ATOM   998  N  N   . GLN A 1 126 ? 21.268 24.640 15.692 1.00 14.18 ? 126 GLN A N   1 
ATOM   999  C  CA  . GLN A 1 126 ? 21.748 25.550 14.658 1.00 14.14 ? 126 GLN A CA  1 
ATOM   1000 C  C   . GLN A 1 126 ? 20.664 26.420 14.064 1.00 13.29 ? 126 GLN A C   1 
ATOM   1001 O  O   . GLN A 1 126 ? 19.583 25.944 13.728 1.00 14.97 ? 126 GLN A O   1 
ATOM   1002 C  CB  . GLN A 1 126 ? 22.482 24.805 13.545 1.00 19.86 ? 126 GLN A CB  1 
ATOM   1003 C  CG  . GLN A 1 126 ? 23.777 24.127 13.983 1.00 38.23 ? 126 GLN A CG  1 
ATOM   1004 C  CD  . GLN A 1 126 ? 24.696 25.025 14.813 1.00 47.01 ? 126 GLN A CD  1 
ATOM   1005 O  OE1 . GLN A 1 126 ? 25.551 25.738 14.277 1.00 43.15 ? 126 GLN A OE1 1 
ATOM   1006 N  NE2 . GLN A 1 126 ? 24.535 24.971 16.128 1.00 45.59 ? 126 GLN A NE2 1 
ATOM   1007 N  N   . GLY A 1 127 ? 20.964 27.716 13.994 1.00 15.52 ? 127 GLY A N   1 
ATOM   1008 C  CA  . GLY A 1 127 ? 20.053 28.699 13.433 1.00 13.14 ? 127 GLY A CA  1 
ATOM   1009 C  C   . GLY A 1 127 ? 18.923 29.168 14.324 1.00 13.74 ? 127 GLY A C   1 
ATOM   1010 O  O   . GLY A 1 127 ? 18.122 30.010 13.906 1.00 13.75 ? 127 GLY A O   1 
ATOM   1011 N  N   . CYS A 1 128 ? 18.872 28.671 15.555 1.00 11.29 ? 128 CYS A N   1 
ATOM   1012 C  CA  . CYS A 1 128 ? 17.797 29.034 16.485 1.00 11.68 ? 128 CYS A CA  1 
ATOM   1013 C  C   . CYS A 1 128 ? 17.982 30.315 17.292 1.00 10.74 ? 128 CYS A C   1 
ATOM   1014 O  O   . CYS A 1 128 ? 17.054 30.742 17.988 1.00 11.14 ? 128 CYS A O   1 
ATOM   1015 C  CB  . CYS A 1 128 ? 17.503 27.879 17.450 1.00 10.44 ? 128 CYS A CB  1 
ATOM   1016 S  SG  . CYS A 1 128 ? 17.091 26.331 16.604 1.00 9.80  ? 128 CYS A SG  1 
ATOM   1017 N  N   . GLY A 1 129 ? 19.179 30.896 17.231 1.00 12.89 ? 129 GLY A N   1 
ATOM   1018 C  CA  . GLY A 1 129 ? 19.443 32.132 17.953 1.00 14.44 ? 129 GLY A CA  1 
ATOM   1019 C  C   . GLY A 1 129 ? 19.651 31.940 19.442 1.00 18.96 ? 129 GLY A C   1 
ATOM   1020 O  O   . GLY A 1 129 ? 19.357 32.834 20.243 1.00 18.24 ? 129 GLY A O   1 
ATOM   1021 N  N   . VAL A 1 130 ? 20.133 30.763 19.820 1.00 18.78 ? 130 VAL A N   1 
ATOM   1022 C  CA  . VAL A 1 130 ? 20.392 30.457 21.227 1.00 19.87 ? 130 VAL A CA  1 
ATOM   1023 C  C   . VAL A 1 130 ? 21.903 30.367 21.480 1.00 24.52 ? 130 VAL A C   1 
ATOM   1024 O  O   . VAL A 1 130 ? 22.669 30.579 20.519 1.00 29.04 ? 130 VAL A O   1 
ATOM   1025 C  CB  . VAL A 1 130 ? 19.727 29.120 21.650 1.00 19.53 ? 130 VAL A CB  1 
ATOM   1026 C  CG1 . VAL A 1 130 ? 18.211 29.249 21.584 1.00 17.55 ? 130 VAL A CG1 1 
ATOM   1027 C  CG2 . VAL A 1 130 ? 20.211 27.972 20.764 1.00 18.13 ? 130 VAL A CG2 1 
ATOM   1028 O  OXT . VAL A 1 130 ? 22.308 30.085 22.616 1.00 24.81 ? 130 VAL A OXT 1 
HETATM 1029 NA NA  . NA  B 2 .   ? 5.815  7.111  6.947  1.00 34.61 ? 331 NA  A NA  1 
HETATM 1030 O  O   . HOH C 3 .   ? 1.166  18.065 40.219 1.00 4.11  ? 131 HOH A O   1 
HETATM 1031 O  O   . HOH C 3 .   ? -0.164 12.701 42.673 1.00 2.00  ? 132 HOH A O   1 
HETATM 1032 O  O   . HOH C 3 .   ? 8.420  14.910 30.142 1.00 7.19  ? 133 HOH A O   1 
HETATM 1033 O  O   . HOH C 3 .   ? -4.176 6.779  44.625 1.00 3.56  ? 134 HOH A O   1 
HETATM 1034 O  O   . HOH C 3 .   ? 12.255 25.554 13.839 1.00 13.03 ? 135 HOH A O   1 
HETATM 1035 O  O   . HOH C 3 .   ? 5.033  20.291 32.355 1.00 7.56  ? 136 HOH A O   1 
HETATM 1036 O  O   . HOH C 3 .   ? 4.790  19.248 29.635 1.00 9.83  ? 137 HOH A O   1 
HETATM 1037 O  O   . HOH C 3 .   ? 29.157 9.288  15.313 1.00 12.39 ? 138 HOH A O   1 
HETATM 1038 O  O   . HOH C 3 .   ? 6.216  17.072 28.891 1.00 9.35  ? 139 HOH A O   1 
HETATM 1039 O  O   . HOH C 3 .   ? 1.976  3.301  34.787 1.00 10.60 ? 140 HOH A O   1 
HETATM 1040 O  O   . HOH C 3 .   ? 4.236  23.215 33.741 1.00 12.70 ? 141 HOH A O   1 
HETATM 1041 O  O   . HOH C 3 .   ? 24.818 14.924 37.857 1.00 22.89 ? 142 HOH A O   1 
HETATM 1042 O  O   . HOH C 3 .   ? 0.203  17.647 43.078 1.00 19.88 ? 143 HOH A O   1 
HETATM 1043 O  O   . HOH C 3 .   ? 2.060  4.408  7.838  1.00 17.51 ? 144 HOH A O   1 
HETATM 1044 O  O   . HOH C 3 .   ? 3.717  6.293  6.236  1.00 12.56 ? 145 HOH A O   1 
HETATM 1045 O  O   . HOH C 3 .   ? 8.386  19.684 15.056 1.00 17.67 ? 146 HOH A O   1 
HETATM 1046 O  O   . HOH C 3 .   ? 3.260  -7.798 37.299 1.00 15.19 ? 147 HOH A O   1 
HETATM 1047 O  O   . HOH C 3 .   ? 27.659 12.246 14.627 1.00 18.03 ? 148 HOH A O   1 
HETATM 1048 O  O   . HOH C 3 .   ? 15.090 18.260 14.921 1.00 15.02 ? 149 HOH A O   1 
HETATM 1049 O  O   . HOH C 3 .   ? 27.599 6.801  37.969 1.00 11.20 ? 150 HOH A O   1 
HETATM 1050 O  O   . HOH C 3 .   ? 6.363  26.072 27.840 1.00 18.63 ? 151 HOH A O   1 
HETATM 1051 O  O   . HOH C 3 .   ? 11.012 29.674 15.120 1.00 28.28 ? 152 HOH A O   1 
HETATM 1052 O  O   . HOH C 3 .   ? -0.342 4.290  30.837 1.00 30.92 ? 153 HOH A O   1 
HETATM 1053 O  O   . HOH C 3 .   ? 15.245 6.211  27.081 1.00 14.32 ? 154 HOH A O   1 
HETATM 1054 O  O   . HOH C 3 .   ? -1.821 18.709 34.988 1.00 20.53 ? 155 HOH A O   1 
HETATM 1055 O  O   . HOH C 3 .   ? 26.759 4.835  15.048 1.00 28.46 ? 156 HOH A O   1 
HETATM 1056 O  O   . HOH C 3 .   ? 21.695 28.604 17.607 1.00 29.88 ? 157 HOH A O   1 
HETATM 1057 O  O   . HOH C 3 .   ? 4.908  7.178  8.896  1.00 32.62 ? 158 HOH A O   1 
HETATM 1058 O  O   . HOH C 3 .   ? 23.945 23.756 37.314 1.00 19.12 ? 159 HOH A O   1 
HETATM 1059 O  O   . HOH C 3 .   ? 8.221  9.648  46.851 1.00 46.45 ? 160 HOH A O   1 
HETATM 1060 O  O   . HOH C 3 .   ? 4.203  21.878 15.239 1.00 27.43 ? 161 HOH A O   1 
HETATM 1061 O  O   . HOH C 3 .   ? 4.347  25.754 25.769 1.00 26.19 ? 162 HOH A O   1 
HETATM 1062 O  O   . HOH C 3 .   ? 10.419 25.229 35.455 1.00 20.77 ? 163 HOH A O   1 
HETATM 1063 O  O   . HOH C 3 .   ? 26.307 12.922 35.766 1.00 23.38 ? 164 HOH A O   1 
HETATM 1064 O  O   . HOH C 3 .   ? 10.636 21.095 14.141 1.00 28.35 ? 165 HOH A O   1 
HETATM 1065 O  O   . HOH C 3 .   ? 12.660 8.658  33.052 1.00 22.73 ? 166 HOH A O   1 
HETATM 1066 O  O   . HOH C 3 .   ? 27.129 23.900 35.521 1.00 17.57 ? 167 HOH A O   1 
HETATM 1067 O  O   . HOH C 3 .   ? 10.956 1.751  34.979 1.00 28.24 ? 168 HOH A O   1 
HETATM 1068 O  O   . HOH C 3 .   ? 28.558 18.383 19.039 1.00 29.09 ? 169 HOH A O   1 
HETATM 1069 O  O   . HOH C 3 .   ? 28.637 11.658 41.392 1.00 21.62 ? 170 HOH A O   1 
HETATM 1070 O  O   . HOH C 3 .   ? 1.496  -5.579 40.132 1.00 26.73 ? 171 HOH A O   1 
HETATM 1071 O  O   . HOH C 3 .   ? 33.398 18.676 14.201 1.00 28.07 ? 172 HOH A O   1 
HETATM 1072 O  O   . HOH C 3 .   ? 23.549 28.950 14.881 1.00 27.23 ? 173 HOH A O   1 
HETATM 1073 O  O   . HOH C 3 .   ? 24.851 16.010 35.025 1.00 14.73 ? 174 HOH A O   1 
HETATM 1074 O  O   . HOH C 3 .   ? -1.387 7.848  45.153 1.00 25.53 ? 175 HOH A O   1 
HETATM 1075 O  O   . HOH C 3 .   ? 0.456  -4.682 26.868 1.00 39.90 ? 176 HOH A O   1 
HETATM 1076 O  O   . HOH C 3 .   ? 5.804  2.453  46.742 1.00 38.34 ? 177 HOH A O   1 
HETATM 1077 O  O   . HOH C 3 .   ? 19.190 29.613 36.030 1.00 30.38 ? 178 HOH A O   1 
HETATM 1078 O  O   . HOH C 3 .   ? 15.381 8.492  32.902 1.00 36.83 ? 179 HOH A O   1 
HETATM 1079 O  O   . HOH C 3 .   ? 1.444  27.192 26.641 1.00 43.53 ? 180 HOH A O   1 
HETATM 1080 O  O   . HOH C 3 .   ? 13.827 20.667 40.103 1.00 20.22 ? 181 HOH A O   1 
HETATM 1081 O  O   . HOH C 3 .   ? 0.380  0.247  35.358 1.00 17.97 ? 182 HOH A O   1 
HETATM 1082 O  O   . HOH C 3 .   ? 3.110  -1.757 44.966 1.00 29.59 ? 183 HOH A O   1 
HETATM 1083 O  O   . HOH C 3 .   ? 2.419  20.288 41.330 1.00 34.29 ? 184 HOH A O   1 
HETATM 1084 O  O   . HOH C 3 .   ? 20.417 10.634 36.437 1.00 29.93 ? 185 HOH A O   1 
HETATM 1085 O  O   . HOH C 3 .   ? 26.951 9.891  13.859 1.00 33.60 ? 186 HOH A O   1 
HETATM 1086 O  O   . HOH C 3 .   ? 10.629 27.100 15.361 1.00 28.30 ? 187 HOH A O   1 
HETATM 1087 O  O   . HOH C 3 .   ? 9.452  6.188  25.358 1.00 26.27 ? 188 HOH A O   1 
HETATM 1088 O  O   . HOH C 3 .   ? 11.552 -4.668 37.975 1.00 21.46 ? 189 HOH A O   1 
HETATM 1089 O  O   . HOH C 3 .   ? 13.239 24.893 36.832 1.00 23.72 ? 190 HOH A O   1 
HETATM 1090 O  O   . HOH C 3 .   ? 17.480 26.168 37.745 1.00 30.54 ? 191 HOH A O   1 
HETATM 1091 O  O   . HOH C 3 .   ? 10.818 3.117  42.562 1.00 42.11 ? 192 HOH A O   1 
HETATM 1092 O  O   . HOH C 3 .   ? 1.474  5.478  44.138 1.00 36.77 ? 193 HOH A O   1 
HETATM 1093 O  O   . HOH C 3 .   ? -5.844 3.782  33.958 1.00 34.76 ? 194 HOH A O   1 
HETATM 1094 O  O   . HOH C 3 .   ? 12.719 16.972 43.687 1.00 41.77 ? 195 HOH A O   1 
HETATM 1095 O  O   . HOH C 3 .   ? 15.922 5.180  30.110 1.00 32.30 ? 196 HOH A O   1 
HETATM 1096 O  O   . HOH C 3 .   ? 18.985 8.516  37.510 1.00 36.43 ? 197 HOH A O   1 
HETATM 1097 O  O   . HOH C 3 .   ? -1.352 -3.517 28.628 1.00 39.76 ? 198 HOH A O   1 
HETATM 1098 O  O   . HOH C 3 .   ? 19.488 31.157 30.296 1.00 39.25 ? 199 HOH A O   1 
HETATM 1099 O  O   . HOH C 3 .   ? 15.688 32.138 24.850 1.00 25.16 ? 200 HOH A O   1 
HETATM 1100 O  O   . HOH C 3 .   ? 22.202 12.533 16.959 1.00 36.68 ? 201 HOH A O   1 
HETATM 1101 O  O   . HOH C 3 .   ? 30.450 20.275 13.437 1.00 46.20 ? 202 HOH A O   1 
HETATM 1102 O  O   . HOH C 3 .   ? 1.723  24.695 34.956 1.00 30.69 ? 204 HOH A O   1 
HETATM 1103 O  O   . HOH C 3 .   ? 24.906 27.074 18.237 1.00 45.43 ? 205 HOH A O   1 
HETATM 1104 O  O   . HOH C 3 .   ? -1.412 4.828  45.126 1.00 38.59 ? 206 HOH A O   1 
HETATM 1105 O  O   . HOH C 3 .   ? 10.649 6.697  22.928 1.00 35.64 ? 207 HOH A O   1 
HETATM 1106 O  O   . HOH C 3 .   ? -3.623 4.389  43.340 1.00 35.03 ? 208 HOH A O   1 
HETATM 1107 O  O   . HOH C 3 .   ? 19.072 23.448 41.025 1.00 40.79 ? 210 HOH A O   1 
HETATM 1108 O  O   . HOH C 3 .   ? 18.095 13.727 14.127 1.00 38.46 ? 211 HOH A O   1 
HETATM 1109 O  O   . HOH C 3 .   ? 18.109 25.700 9.547  1.00 36.68 ? 212 HOH A O   1 
HETATM 1110 O  O   . HOH C 3 .   ? 13.384 14.393 11.871 1.00 34.66 ? 213 HOH A O   1 
HETATM 1111 O  O   . HOH C 3 .   ? 26.654 6.705  35.104 1.00 38.48 ? 214 HOH A O   1 
HETATM 1112 O  O   . HOH C 3 .   ? 7.666  10.118 17.919 1.00 44.03 ? 215 HOH A O   1 
HETATM 1113 O  O   . HOH C 3 .   ? 17.675 18.507 13.689 1.00 43.18 ? 217 HOH A O   1 
HETATM 1114 O  O   . HOH C 3 .   ? 8.275  16.886 15.259 1.00 35.25 ? 219 HOH A O   1 
HETATM 1115 O  O   . HOH C 3 .   ? 11.169 23.332 12.434 1.00 40.99 ? 220 HOH A O   1 
HETATM 1116 O  O   . HOH C 3 .   ? 10.620 13.171 15.388 1.00 42.68 ? 222 HOH A O   1 
HETATM 1117 O  O   . HOH C 3 .   ? 12.190 11.453 13.289 1.00 41.52 ? 224 HOH A O   1 
HETATM 1118 O  O   . HOH C 3 .   ? 23.780 33.195 25.997 1.00 41.30 ? 225 HOH A O   1 
HETATM 1119 O  O   . HOH C 3 .   ? 29.382 15.866 21.236 1.00 43.44 ? 226 HOH A O   1 
HETATM 1120 O  O   . HOH C 3 .   ? 26.355 21.218 40.223 1.00 38.13 ? 229 HOH A O   1 
HETATM 1121 O  O   . HOH C 3 .   ? -1.235 -1.663 37.703 1.00 40.10 ? 230 HOH A O   1 
HETATM 1122 O  O   . HOH C 3 .   ? 26.906 14.947 23.498 1.00 32.50 ? 231 HOH A O   1 
HETATM 1123 O  O   . HOH C 3 .   ? 7.476  28.329 16.522 1.00 40.12 ? 232 HOH A O   1 
HETATM 1124 O  O   . HOH C 3 .   ? 4.538  24.458 18.070 1.00 36.76 ? 233 HOH A O   1 
HETATM 1125 O  O   . HOH C 3 .   ? 18.596 31.684 11.571 1.00 36.34 ? 235 HOH A O   1 
HETATM 1126 O  O   . HOH C 3 .   ? -2.448 -1.127 29.290 1.00 40.43 ? 236 HOH A O   1 
HETATM 1127 O  O   . HOH C 3 .   ? 14.828 7.017  35.424 1.00 33.31 ? 239 HOH A O   1 
HETATM 1128 O  O   . HOH C 3 .   ? 26.598 12.649 42.726 1.00 40.44 ? 242 HOH A O   1 
HETATM 1129 O  O   . HOH C 3 .   ? 12.448 18.941 13.391 1.00 39.62 ? 244 HOH A O   1 
HETATM 1130 O  O   . HOH C 3 .   ? 17.353 33.055 22.656 1.00 31.95 ? 246 HOH A O   1 
HETATM 1131 O  O   . HOH C 3 .   ? 12.076 6.121  26.721 1.00 23.73 ? 248 HOH A O   1 
HETATM 1132 O  O   . HOH C 3 .   ? 26.020 8.316  11.565 1.00 29.34 ? 249 HOH A O   1 
HETATM 1133 O  O   . HOH C 3 .   ? -1.214 11.667 39.930 1.00 7.32  ? 251 HOH A O   1 
HETATM 1134 O  O   . HOH C 3 .   ? 19.829 28.169 29.930 1.00 13.45 ? 252 HOH A O   1 
HETATM 1135 O  O   . HOH C 3 .   ? 25.065 20.922 11.942 1.00 36.16 ? 253 HOH A O   1 
HETATM 1136 O  O   . HOH C 3 .   ? -5.790 1.423  36.219 1.00 38.08 ? 254 HOH A O   1 
HETATM 1137 O  O   . HOH C 3 .   ? 26.457 10.881 44.658 1.00 36.84 ? 255 HOH A O   1 
HETATM 1138 O  O   . HOH C 3 .   ? 1.253  8.397  46.543 1.00 38.58 ? 256 HOH A O   1 
HETATM 1139 O  O   . HOH C 3 .   ? 20.591 8.744  15.911 1.00 40.32 ? 257 HOH A O   1 
HETATM 1140 O  O   . HOH C 3 .   ? 7.901  12.059 15.865 1.00 39.64 ? 258 HOH A O   1 
HETATM 1141 O  O   . HOH C 3 .   ? 4.287  8.926  21.309 1.00 46.86 ? 259 HOH A O   1 
HETATM 1142 O  O   . HOH C 3 .   ? -1.817 0.032  33.605 1.00 39.06 ? 260 HOH A O   1 
HETATM 1143 O  O   . HOH C 3 .   ? 13.915 21.597 12.042 1.00 38.79 ? 261 HOH A O   1 
HETATM 1144 O  O   . HOH C 3 .   ? 21.050 32.936 12.974 1.00 41.07 ? 262 HOH A O   1 
HETATM 1145 O  O   . HOH C 3 .   ? 12.218 6.986  29.399 1.00 39.01 ? 263 HOH A O   1 
HETATM 1146 O  O   . HOH C 3 .   ? 4.051  25.804 36.017 1.00 42.82 ? 264 HOH A O   1 
HETATM 1147 O  O   . HOH C 3 .   ? 23.533 8.073  12.362 1.00 33.67 ? 265 HOH A O   1 
HETATM 1148 O  O   . HOH C 3 .   ? -2.539 7.519  47.897 1.00 42.98 ? 266 HOH A O   1 
HETATM 1149 O  O   . HOH C 3 .   ? 4.259  7.495  45.684 1.00 39.33 ? 267 HOH A O   1 
HETATM 1150 O  O   . HOH C 3 .   ? 13.552 23.682 39.479 1.00 39.55 ? 268 HOH A O   1 
HETATM 1151 O  O   . HOH C 3 .   ? 12.286 27.250 35.696 1.00 35.87 ? 270 HOH A O   1 
HETATM 1152 O  O   . HOH C 3 .   ? 30.180 6.069  15.225 1.00 38.96 ? 271 HOH A O   1 
HETATM 1153 O  O   . HOH C 3 .   ? -0.280 26.426 28.935 1.00 44.78 ? 272 HOH A O   1 
HETATM 1154 O  O   . HOH C 3 .   ? 1.589  21.451 16.087 1.00 40.26 ? 273 HOH A O   1 
HETATM 1155 O  O   . HOH C 3 .   ? 14.972 17.819 44.871 1.00 44.42 ? 274 HOH A O   1 
HETATM 1156 O  O   . HOH C 3 .   ? 26.229 14.046 40.362 1.00 36.03 ? 275 HOH A O   1 
HETATM 1157 O  O   . HOH C 3 .   ? 2.670  16.738 44.316 1.00 44.55 ? 276 HOH A O   1 
HETATM 1158 O  O   . HOH C 3 .   ? 6.187  14.586 16.924 1.00 41.03 ? 277 HOH A O   1 
HETATM 1159 O  O   . HOH C 3 .   ? 10.867 3.071  30.178 1.00 42.97 ? 278 HOH A O   1 
HETATM 1160 O  O   . HOH C 3 .   ? 0.432  4.793  27.922 1.00 42.17 ? 279 HOH A O   1 
HETATM 1161 O  O   . HOH C 3 .   ? 0.347  6.442  23.033 1.00 43.26 ? 280 HOH A O   1 
HETATM 1162 O  O   . HOH C 3 .   ? 11.800 18.484 41.041 1.00 39.83 ? 283 HOH A O   1 
HETATM 1163 O  O   . HOH C 3 .   ? 22.270 22.065 10.979 1.00 43.12 ? 284 HOH A O   1 
HETATM 1164 O  O   . HOH C 3 .   ? 18.457 4.242  33.123 1.00 41.06 ? 286 HOH A O   1 
HETATM 1165 O  O   . HOH C 3 .   ? 7.718  21.226 39.479 1.00 37.91 ? 288 HOH A O   1 
HETATM 1166 O  O   . HOH C 3 .   ? 6.852  28.049 25.500 1.00 45.70 ? 289 HOH A O   1 
HETATM 1167 O  O   . HOH C 3 .   ? 24.415 13.917 42.861 1.00 36.06 ? 290 HOH A O   1 
HETATM 1168 O  O   . HOH C 3 .   ? 21.641 7.021  44.490 1.00 41.60 ? 292 HOH A O   1 
HETATM 1169 O  O   . HOH C 3 .   ? 11.455 10.817 17.540 1.00 40.04 ? 293 HOH A O   1 
HETATM 1170 O  O   . HOH C 3 .   ? 13.998 6.352  19.598 1.00 41.98 ? 294 HOH A O   1 
HETATM 1171 O  O   . HOH C 3 .   ? 9.499  18.696 39.784 1.00 34.04 ? 295 HOH A O   1 
HETATM 1172 O  O   . HOH C 3 .   ? 3.577  3.742  45.057 1.00 42.50 ? 296 HOH A O   1 
HETATM 1173 O  O   . HOH C 3 .   ? -2.230 -5.973 41.645 1.00 40.04 ? 297 HOH A O   1 
HETATM 1174 O  O   . HOH C 3 .   ? 14.351 11.461 11.944 1.00 39.68 ? 298 HOH A O   1 
HETATM 1175 O  O   . HOH C 3 .   ? 20.422 26.981 35.107 1.00 39.59 ? 299 HOH A O   1 
HETATM 1176 O  O   . HOH C 3 .   ? 5.751  20.404 13.638 1.00 41.49 ? 300 HOH A O   1 
HETATM 1177 O  O   . HOH C 3 .   ? 18.073 16.838 10.661 1.00 45.58 ? 301 HOH A O   1 
HETATM 1178 O  O   . HOH C 3 .   ? 0.803  2.124  43.601 1.00 46.61 ? 303 HOH A O   1 
HETATM 1179 O  O   . HOH C 3 .   ? 9.385  25.512 38.111 1.00 37.97 ? 305 HOH A O   1 
HETATM 1180 O  O   . HOH C 3 .   ? 14.148 4.313  25.375 1.00 47.35 ? 306 HOH A O   1 
HETATM 1181 O  O   . HOH C 3 .   ? 13.937 5.394  33.564 1.00 49.13 ? 307 HOH A O   1 
HETATM 1182 O  O   . HOH C 3 .   ? 6.861  19.995 42.606 1.00 41.97 ? 313 HOH A O   1 
HETATM 1183 O  O   . HOH C 3 .   ? 10.795 0.650  32.163 1.00 40.34 ? 314 HOH A O   1 
HETATM 1184 O  O   . HOH C 3 .   ? 25.924 5.404  41.780 1.00 41.76 ? 317 HOH A O   1 
HETATM 1185 O  O   . HOH C 3 .   ? 5.671  -2.709 26.629 1.00 44.17 ? 318 HOH A O   1 
HETATM 1186 O  O   . HOH C 3 .   ? 3.463  24.432 13.619 1.00 44.08 ? 319 HOH A O   1 
HETATM 1187 O  O   . HOH C 3 .   ? 8.842  23.406 40.502 1.00 42.99 ? 322 HOH A O   1 
HETATM 1188 O  O   . HOH C 3 .   ? 14.942 8.584  11.214 1.00 41.67 ? 323 HOH A O   1 
HETATM 1189 O  O   . HOH C 3 .   ? 6.847  24.677 37.752 1.00 39.25 ? 324 HOH A O   1 
HETATM 1190 O  O   . HOH C 3 .   ? 8.503  30.040 22.262 1.00 43.29 ? 328 HOH A O   1 
HETATM 1191 O  O   . HOH C 3 .   ? 29.143 13.131 12.453 1.00 14.83 ? 329 HOH A O   1 
HETATM 1192 O  O   . HOH C 3 .   ? 21.673 31.322 15.588 1.00 25.61 ? 330 HOH A O   1 
HETATM 1193 O  O   . HOH C 3 .   ? 4.815  28.284 34.674 1.00 37.65 ? 332 HOH A O   1 
HETATM 1194 O  O   . HOH C 3 .   ? 3.426  10.249 45.681 1.00 35.04 ? 333 HOH A O   1 
HETATM 1195 O  O   . HOH C 3 .   ? 4.395  17.893 13.413 1.00 38.41 ? 334 HOH A O   1 
HETATM 1196 O  O   . HOH C 3 .   ? 0.866  3.412  25.307 1.00 38.54 ? 335 HOH A O   1 
HETATM 1197 O  O   . HOH C 3 .   ? 11.403 -1.764 37.233 1.00 42.81 ? 336 HOH A O   1 
HETATM 1198 O  O   . HOH C 3 .   ? -1.704 2.026  31.880 1.00 40.30 ? 337 HOH A O   1 
HETATM 1199 O  O   . HOH C 3 .   ? -2.874 1.040  42.156 1.00 45.50 ? 338 HOH A O   1 
HETATM 1200 O  O   . HOH C 3 .   ? 3.509  0.885  45.265 1.00 45.11 ? 340 HOH A O   1 
HETATM 1201 O  O   . HOH C 3 .   ? 23.096 22.394 40.269 1.00 47.93 ? 341 HOH A O   1 
HETATM 1202 O  O   . HOH C 3 .   ? 22.496 6.095  42.071 1.00 46.30 ? 342 HOH A O   1 
HETATM 1203 O  O   . HOH C 3 .   ? 11.511 19.347 43.964 1.00 41.90 ? 343 HOH A O   1 
HETATM 1204 O  O   . HOH C 3 .   ? 13.227 6.647  22.060 1.00 46.20 ? 344 HOH A O   1 
HETATM 1205 O  O   . HOH C 3 .   ? -1.079 -0.865 26.252 1.00 46.27 ? 345 HOH A O   1 
HETATM 1206 O  O   . HOH C 3 .   ? 27.566 19.919 42.947 1.00 45.01 ? 346 HOH A O   1 
HETATM 1207 O  O   . HOH C 3 .   ? 2.552  23.454 38.656 1.00 43.59 ? 348 HOH A O   1 
HETATM 1208 O  O   . HOH C 3 .   ? 9.680  8.582  19.615 1.00 46.67 ? 349 HOH A O   1 
HETATM 1209 O  O   . HOH C 3 .   ? 17.504 6.347  36.224 1.00 43.23 ? 350 HOH A O   1 
HETATM 1210 O  O   . HOH C 3 .   ? 27.474 27.712 14.033 1.00 47.31 ? 351 HOH A O   1 
HETATM 1211 O  O   . HOH C 3 .   ? 14.552 24.902 11.770 1.00 45.87 ? 352 HOH A O   1 
HETATM 1212 O  O   . HOH C 3 .   ? 4.261  21.840 40.219 1.00 42.73 ? 353 HOH A O   1 
HETATM 1213 O  O   . HOH C 3 .   ? 14.421 5.942  10.334 1.00 45.07 ? 355 HOH A O   1 
HETATM 1214 O  O   . HOH C 3 .   ? 15.920 3.367  36.380 1.00 43.82 ? 357 HOH A O   1 
HETATM 1215 O  O   . HOH C 3 .   ? 22.343 33.676 21.834 1.00 45.49 ? 358 HOH A O   1 
HETATM 1216 O  O   . HOH C 3 .   ? 2.991  13.953 16.641 1.00 44.34 ? 359 HOH A O   1 
HETATM 1217 O  O   . HOH C 3 .   ? 15.013 35.222 26.243 1.00 47.26 ? 360 HOH A O   1 
HETATM 1218 O  O   . HOH C 3 .   ? 18.424 7.287  12.564 1.00 43.18 ? 362 HOH A O   1 
HETATM 1219 O  O   . HOH C 3 .   ? 3.803  25.977 39.617 1.00 47.43 ? 363 HOH A O   1 
HETATM 1220 O  O   . HOH C 3 .   ? 25.561 18.369 13.759 1.00 46.10 ? 364 HOH A O   1 
HETATM 1221 O  O   . HOH C 3 .   ? 12.000 8.027  17.840 1.00 44.60 ? 365 HOH A O   1 
HETATM 1222 O  O   . HOH C 3 .   ? 21.969 30.592 29.310 1.00 42.77 ? 366 HOH A O   1 
HETATM 1223 O  O   . HOH C 3 .   ? 9.055  21.605 11.915 1.00 46.74 ? 367 HOH A O   1 
HETATM 1224 O  O   . HOH C 3 .   ? 29.931 28.640 11.753 1.00 44.26 ? 368 HOH A O   1 
HETATM 1225 O  O   . HOH C 3 .   ? 16.685 16.044 13.926 1.00 49.66 ? 369 HOH A O   1 
HETATM 1226 O  O   . HOH C 3 .   ? 22.079 7.996  38.989 1.00 34.00 ? 370 HOH A O   1 
HETATM 1227 O  O   . HOH C 3 .   ? 3.070  2.238  24.857 1.00 39.16 ? 371 HOH A O   1 
HETATM 1228 O  O   . HOH C 3 .   ? 14.308 8.449  41.644 1.00 39.08 ? 372 HOH A O   1 
HETATM 1229 O  O   . HOH C 3 .   ? 1.552  -4.821 44.030 1.00 42.41 ? 373 HOH A O   1 
HETATM 1230 O  O   . HOH C 3 .   ? 29.607 21.694 10.660 1.00 47.41 ? 374 HOH A O   1 
HETATM 1231 O  O   . HOH C 3 .   ? 10.763 31.742 21.354 1.00 44.06 ? 375 HOH A O   1 
HETATM 1232 O  O   . HOH C 3 .   ? 15.421 3.574  23.286 1.00 45.18 ? 376 HOH A O   1 
HETATM 1233 O  O   . HOH C 3 .   ? 9.002  18.932 44.273 1.00 42.08 ? 377 HOH A O   1 
HETATM 1234 O  O   . HOH C 3 .   ? 19.119 21.109 11.777 1.00 47.99 ? 378 HOH A O   1 
HETATM 1235 O  O   . HOH C 3 .   ? 5.893  15.164 14.342 1.00 49.35 ? 380 HOH A O   1 
HETATM 1236 O  O   . HOH C 3 .   ? 0.345  -3.216 39.427 1.00 48.03 ? 381 HOH A O   1 
HETATM 1237 O  O   . HOH C 3 .   ? 26.321 22.652 37.935 1.00 40.98 ? 382 HOH A O   1 
HETATM 1238 O  O   . HOH C 3 .   ? 27.606 7.036  13.236 1.00 46.95 ? 383 HOH A O   1 
HETATM 1239 O  O   . HOH C 3 .   ? 0.685  0.243  24.493 1.00 43.91 ? 384 HOH A O   1 
HETATM 1240 O  O   . HOH C 3 .   ? 2.075  26.564 37.290 1.00 47.99 ? 385 HOH A O   1 
HETATM 1241 O  O   . HOH C 3 .   ? 11.720 8.716  14.746 1.00 49.84 ? 386 HOH A O   1 
HETATM 1242 O  O   . HOH C 3 .   ? 27.803 19.954 12.529 1.00 49.70 ? 387 HOH A O   1 
HETATM 1243 O  O   . HOH C 3 .   ? 23.159 25.780 35.959 1.00 45.12 ? 388 HOH A O   1 
HETATM 1244 O  O   . HOH C 3 .   ? 19.553 6.849  40.843 1.00 47.10 ? 389 HOH A O   1 
HETATM 1245 O  O   . HOH C 3 .   ? -1.021 9.809  47.137 1.00 48.70 ? 390 HOH A O   1 
HETATM 1246 O  O   . HOH C 3 .   ? 7.294  8.596  21.912 1.00 48.03 ? 391 HOH A O   1 
HETATM 1247 O  O   . HOH C 3 .   ? 22.994 30.205 11.869 1.00 47.31 ? 392 HOH A O   1 
HETATM 1248 O  O   . HOH C 3 .   ? -3.046 24.638 28.420 1.00 45.40 ? 393 HOH A O   1 
HETATM 1249 O  O   . HOH C 3 .   ? -3.156 1.922  45.900 1.00 49.11 ? 394 HOH A O   1 
HETATM 1250 O  O   . HOH C 3 .   ? 20.396 13.339 10.266 1.00 47.19 ? 395 HOH A O   1 
HETATM 1251 O  O   . HOH C 3 .   ? 1.103  26.730 40.652 1.00 47.94 ? 396 HOH A O   1 
HETATM 1252 O  O   . HOH C 3 .   ? 18.902 23.017 10.074 1.00 46.12 ? 397 HOH A O   1 
HETATM 1253 O  O   . HOH C 3 .   ? 16.247 23.282 39.836 1.00 47.58 ? 399 HOH A O   1 
HETATM 1254 O  O   . HOH C 3 .   ? 13.340 5.958  17.325 1.00 46.44 ? 400 HOH A O   1 
HETATM 1255 O  O   . HOH C 3 .   ? 17.130 9.856  43.546 1.00 47.66 ? 401 HOH A O   1 
HETATM 1256 O  O   . HOH C 3 .   ? 5.071  0.303  24.383 1.00 45.56 ? 402 HOH A O   1 
HETATM 1257 O  O   . HOH C 3 .   ? 12.861 22.242 42.588 1.00 44.75 ? 403 HOH A O   1 
HETATM 1258 O  O   . HOH C 3 .   ? 24.497 1.737  36.673 1.00 48.54 ? 404 HOH A O   1 
HETATM 1259 O  O   . HOH C 3 .   ? 16.567 6.300  40.131 1.00 47.63 ? 405 HOH A O   1 
HETATM 1260 O  O   . HOH C 3 .   ? -4.005 2.691  30.348 1.00 47.86 ? 406 HOH A O   1 
HETATM 1261 O  O   . HOH C 3 .   ? 14.674 6.277  13.178 1.00 46.32 ? 407 HOH A O   1 
HETATM 1262 O  O   . HOH C 3 .   ? 2.592  14.123 43.438 1.00 39.58 ? 408 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   LYS 1   1   1   LYS LYS A . n 
A 1 2   VAL 2   2   2   VAL VAL A . n 
A 1 3   PHE 3   3   3   PHE PHE A . n 
A 1 4   GLU 4   4   4   GLU GLU A . n 
A 1 5   ARG 5   5   5   ARG ARG A . n 
A 1 6   CYS 6   6   6   CYS CYS A . n 
A 1 7   GLU 7   7   7   GLU GLU A . n 
A 1 8   LEU 8   8   8   LEU LEU A . n 
A 1 9   ALA 9   9   9   ALA ALA A . n 
A 1 10  ARG 10  10  10  ARG ARG A . n 
A 1 11  THR 11  11  11  THR THR A . n 
A 1 12  LEU 12  12  12  LEU LEU A . n 
A 1 13  LYS 13  13  13  LYS LYS A . n 
A 1 14  ARG 14  14  14  ARG ARG A . n 
A 1 15  LEU 15  15  15  LEU LEU A . n 
A 1 16  GLY 16  16  16  GLY GLY A . n 
A 1 17  MET 17  17  17  MET MET A . n 
A 1 18  ASP 18  18  18  ASP ASP A . n 
A 1 19  GLY 19  19  19  GLY GLY A . n 
A 1 20  TYR 20  20  20  TYR TYR A . n 
A 1 21  ARG 21  21  21  ARG ARG A . n 
A 1 22  GLY 22  22  22  GLY GLY A . n 
A 1 23  ILE 23  23  23  ILE ILE A . n 
A 1 24  ALA 24  24  24  ALA ALA A . n 
A 1 25  LEU 25  25  25  LEU LEU A . n 
A 1 26  ALA 26  26  26  ALA ALA A . n 
A 1 27  ASN 27  27  27  ASN ASN A . n 
A 1 28  TRP 28  28  28  TRP TRP A . n 
A 1 29  MET 29  29  29  MET MET A . n 
A 1 30  CYS 30  30  30  CYS CYS A . n 
A 1 31  LEU 31  31  31  LEU LEU A . n 
A 1 32  ALA 32  32  32  ALA ALA A . n 
A 1 33  LYS 33  33  33  LYS LYS A . n 
A 1 34  TRP 34  34  34  TRP TRP A . n 
A 1 35  GLU 35  35  35  GLU GLU A . n 
A 1 36  SER 36  36  36  SER SER A . n 
A 1 37  GLY 37  37  37  GLY GLY A . n 
A 1 38  TYR 38  38  38  TYR TYR A . n 
A 1 39  ASN 39  39  39  ASN ASN A . n 
A 1 40  THR 40  40  40  THR THR A . n 
A 1 41  ARG 41  41  41  ARG ARG A . n 
A 1 42  ALA 42  42  42  ALA ALA A . n 
A 1 43  THR 43  43  43  THR THR A . n 
A 1 44  ASN 44  44  44  ASN ASN A . n 
A 1 45  TYR 45  45  45  TYR TYR A . n 
A 1 46  ASN 46  46  46  ASN ASN A . n 
A 1 47  ALA 47  47  47  ALA ALA A . n 
A 1 48  GLY 48  48  48  GLY GLY A . n 
A 1 49  ASP 49  49  49  ASP ASP A . n 
A 1 50  ARG 50  50  50  ARG ARG A . n 
A 1 51  SER 51  51  51  SER SER A . n 
A 1 52  THR 52  52  52  THR THR A . n 
A 1 53  ASP 53  53  53  ASP ASP A . n 
A 1 54  TYR 54  54  54  TYR TYR A . n 
A 1 55  GLY 55  55  55  GLY GLY A . n 
A 1 56  ILE 56  56  56  ILE ILE A . n 
A 1 57  PHE 57  57  57  PHE PHE A . n 
A 1 58  GLN 58  58  58  GLN GLN A . n 
A 1 59  ILE 59  59  59  ILE ILE A . n 
A 1 60  ASN 60  60  60  ASN ASN A . n 
A 1 61  SER 61  61  61  SER SER A . n 
A 1 62  ARG 62  62  62  ARG ARG A . n 
A 1 63  TYR 63  63  63  TYR TYR A . n 
A 1 64  TRP 64  64  64  TRP TRP A . n 
A 1 65  CYS 65  65  65  CYS CYS A . n 
A 1 66  ASN 66  66  66  ASN ASN A . n 
A 1 67  ASP 67  67  67  ASP ASP A . n 
A 1 68  GLY 68  68  68  GLY GLY A . n 
A 1 69  LYS 69  69  69  LYS LYS A . n 
A 1 70  THR 70  70  70  THR THR A . n 
A 1 71  PRO 71  71  71  PRO PRO A . n 
A 1 72  GLY 72  72  72  GLY GLY A . n 
A 1 73  ALA 73  73  73  ALA ALA A . n 
A 1 74  VAL 74  74  74  VAL VAL A . n 
A 1 75  ASN 75  75  75  ASN ASN A . n 
A 1 76  ALA 76  76  76  ALA ALA A . n 
A 1 77  CYS 77  77  77  CYS CYS A . n 
A 1 78  HIS 78  78  78  HIS HIS A . n 
A 1 79  LEU 79  79  79  LEU LEU A . n 
A 1 80  SER 80  80  80  SER SER A . n 
A 1 81  CYS 81  81  81  CYS CYS A . n 
A 1 82  SER 82  82  82  SER SER A . n 
A 1 83  ALA 83  83  83  ALA ALA A . n 
A 1 84  LEU 84  84  84  LEU LEU A . n 
A 1 85  LEU 85  85  85  LEU LEU A . n 
A 1 86  GLN 86  86  86  GLN GLN A . n 
A 1 87  ASP 87  87  87  ASP ASP A . n 
A 1 88  ASN 88  88  88  ASN ASN A . n 
A 1 89  ILE 89  89  89  ILE ILE A . n 
A 1 90  ALA 90  90  90  ALA ALA A . n 
A 1 91  ASP 91  91  91  ASP ASP A . n 
A 1 92  ALA 92  92  92  ALA ALA A . n 
A 1 93  VAL 93  93  93  VAL VAL A . n 
A 1 94  ALA 94  94  94  ALA ALA A . n 
A 1 95  CYS 95  95  95  CYS CYS A . n 
A 1 96  ALA 96  96  96  ALA ALA A . n 
A 1 97  LYS 97  97  97  LYS LYS A . n 
A 1 98  ARG 98  98  98  ARG ARG A . n 
A 1 99  VAL 99  99  99  VAL VAL A . n 
A 1 100 VAL 100 100 100 VAL VAL A . n 
A 1 101 ARG 101 101 101 ARG ARG A . n 
A 1 102 ASP 102 102 102 ASP ASP A . n 
A 1 103 PRO 103 103 103 PRO PRO A . n 
A 1 104 GLN 104 104 104 GLN GLN A . n 
A 1 105 GLY 105 105 105 GLY GLY A . n 
A 1 106 ILE 106 106 106 ILE ILE A . n 
A 1 107 ARG 107 107 107 ARG ARG A . n 
A 1 108 ALA 108 108 108 ALA ALA A . n 
A 1 109 TRP 109 109 109 TRP TRP A . n 
A 1 110 VAL 110 110 110 VAL VAL A . n 
A 1 111 ALA 111 111 111 ALA ALA A . n 
A 1 112 TRP 112 112 112 TRP TRP A . n 
A 1 113 ARG 113 113 113 ARG ARG A . n 
A 1 114 ASN 114 114 114 ASN ASN A . n 
A 1 115 ARG 115 115 115 ARG ARG A . n 
A 1 116 CYS 116 116 116 CYS CYS A . n 
A 1 117 GLN 117 117 117 GLN GLN A . n 
A 1 118 ASN 118 118 118 ASN ASN A . n 
A 1 119 ARG 119 119 119 ARG ARG A . n 
A 1 120 ASP 120 120 120 ASP ASP A . n 
A 1 121 VAL 121 121 121 VAL VAL A . n 
A 1 122 ARG 122 122 122 ARG ARG A . n 
A 1 123 GLN 123 123 123 GLN GLN A . n 
A 1 124 TYR 124 124 124 TYR TYR A . n 
A 1 125 VAL 125 125 125 VAL VAL A . n 
A 1 126 GLN 126 126 126 GLN GLN A . n 
A 1 127 GLY 127 127 127 GLY GLY A . n 
A 1 128 CYS 128 128 128 CYS CYS A . n 
A 1 129 GLY 129 129 129 GLY GLY A . n 
A 1 130 VAL 130 130 130 VAL VAL A . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  O ? C HOH .  ? A HOH 145 ? 1_555 NA ? B NA . ? A NA 331 ? 1_555 O ? C HOH .  ? A HOH 158 ? 1_555 84.8  ? 
2  O ? C HOH .  ? A HOH 145 ? 1_555 NA ? B NA . ? A NA 331 ? 1_555 O ? A SER 61 ? A SER 61  ? 1_554 80.8  ? 
3  O ? C HOH .  ? A HOH 158 ? 1_555 NA ? B NA . ? A NA 331 ? 1_555 O ? A SER 61 ? A SER 61  ? 1_554 152.4 ? 
4  O ? C HOH .  ? A HOH 145 ? 1_555 NA ? B NA . ? A NA 331 ? 1_555 O ? A CYS 65 ? A CYS 65  ? 1_554 86.7  ? 
5  O ? C HOH .  ? A HOH 158 ? 1_555 NA ? B NA . ? A NA 331 ? 1_555 O ? A CYS 65 ? A CYS 65  ? 1_554 115.1 ? 
6  O ? A SER 61 ? A SER 61  ? 1_554 NA ? B NA . ? A NA 331 ? 1_555 O ? A CYS 65 ? A CYS 65  ? 1_554 87.5  ? 
7  O ? C HOH .  ? A HOH 145 ? 1_555 NA ? B NA . ? A NA 331 ? 1_555 O ? A VAL 74 ? A VAL 74  ? 1_554 161.1 ? 
8  O ? C HOH .  ? A HOH 158 ? 1_555 NA ? B NA . ? A NA 331 ? 1_555 O ? A VAL 74 ? A VAL 74  ? 1_554 77.1  ? 
9  O ? A SER 61 ? A SER 61  ? 1_554 NA ? B NA . ? A NA 331 ? 1_555 O ? A VAL 74 ? A VAL 74  ? 1_554 113.2 ? 
10 O ? A CYS 65 ? A CYS 65  ? 1_554 NA ? B NA . ? A NA 331 ? 1_555 O ? A VAL 74 ? A VAL 74  ? 1_554 105.8 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1999-01-20 
2 'Structure model' 1 1 2008-04-27 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
DENZO     'data reduction' .   ? 1 
SCALEPACK 'data scaling'   .   ? 2 
X-PLOR    'model building' .   ? 3 
X-PLOR    refinement       3.1 ? 4 
X-PLOR    phasing          .   ? 5 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'SODIUM ION' NA  
3 water        HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 NA  1   331 331 NA  NA  A . 
C 3 HOH 1   131 131 HOH HOH A . 
C 3 HOH 2   132 132 HOH HOH A . 
C 3 HOH 3   133 133 HOH HOH A . 
C 3 HOH 4   134 134 HOH HOH A . 
C 3 HOH 5   135 135 HOH HOH A . 
C 3 HOH 6   136 136 HOH HOH A . 
C 3 HOH 7   137 137 HOH HOH A . 
C 3 HOH 8   138 138 HOH HOH A . 
C 3 HOH 9   139 139 HOH HOH A . 
C 3 HOH 10  140 140 HOH HOH A . 
C 3 HOH 11  141 141 HOH HOH A . 
C 3 HOH 12  142 142 HOH HOH A . 
C 3 HOH 13  143 143 HOH HOH A . 
C 3 HOH 14  144 144 HOH HOH A . 
C 3 HOH 15  145 145 HOH HOH A . 
C 3 HOH 16  146 146 HOH HOH A . 
C 3 HOH 17  147 147 HOH HOH A . 
C 3 HOH 18  148 148 HOH HOH A . 
C 3 HOH 19  149 149 HOH HOH A . 
C 3 HOH 20  150 150 HOH HOH A . 
C 3 HOH 21  151 151 HOH HOH A . 
C 3 HOH 22  152 152 HOH HOH A . 
C 3 HOH 23  153 153 HOH HOH A . 
C 3 HOH 24  154 154 HOH HOH A . 
C 3 HOH 25  155 155 HOH HOH A . 
C 3 HOH 26  156 156 HOH HOH A . 
C 3 HOH 27  157 157 HOH HOH A . 
C 3 HOH 28  158 158 HOH HOH A . 
C 3 HOH 29  159 159 HOH HOH A . 
C 3 HOH 30  160 160 HOH HOH A . 
C 3 HOH 31  161 161 HOH HOH A . 
C 3 HOH 32  162 162 HOH HOH A . 
C 3 HOH 33  163 163 HOH HOH A . 
C 3 HOH 34  164 164 HOH HOH A . 
C 3 HOH 35  165 165 HOH HOH A . 
C 3 HOH 36  166 166 HOH HOH A . 
C 3 HOH 37  167 167 HOH HOH A . 
C 3 HOH 38  168 168 HOH HOH A . 
C 3 HOH 39  169 169 HOH HOH A . 
C 3 HOH 40  170 170 HOH HOH A . 
C 3 HOH 41  171 171 HOH HOH A . 
C 3 HOH 42  172 172 HOH HOH A . 
C 3 HOH 43  173 173 HOH HOH A . 
C 3 HOH 44  174 174 HOH HOH A . 
C 3 HOH 45  175 175 HOH HOH A . 
C 3 HOH 46  176 176 HOH HOH A . 
C 3 HOH 47  177 177 HOH HOH A . 
C 3 HOH 48  178 178 HOH HOH A . 
C 3 HOH 49  179 179 HOH HOH A . 
C 3 HOH 50  180 180 HOH HOH A . 
C 3 HOH 51  181 181 HOH HOH A . 
C 3 HOH 52  182 182 HOH HOH A . 
C 3 HOH 53  183 183 HOH HOH A . 
C 3 HOH 54  184 184 HOH HOH A . 
C 3 HOH 55  185 185 HOH HOH A . 
C 3 HOH 56  186 186 HOH HOH A . 
C 3 HOH 57  187 187 HOH HOH A . 
C 3 HOH 58  188 188 HOH HOH A . 
C 3 HOH 59  189 189 HOH HOH A . 
C 3 HOH 60  190 190 HOH HOH A . 
C 3 HOH 61  191 191 HOH HOH A . 
C 3 HOH 62  192 192 HOH HOH A . 
C 3 HOH 63  193 193 HOH HOH A . 
C 3 HOH 64  194 194 HOH HOH A . 
C 3 HOH 65  195 195 HOH HOH A . 
C 3 HOH 66  196 196 HOH HOH A . 
C 3 HOH 67  197 197 HOH HOH A . 
C 3 HOH 68  198 198 HOH HOH A . 
C 3 HOH 69  199 199 HOH HOH A . 
C 3 HOH 70  200 200 HOH HOH A . 
C 3 HOH 71  201 201 HOH HOH A . 
C 3 HOH 72  202 202 HOH HOH A . 
C 3 HOH 73  204 204 HOH HOH A . 
C 3 HOH 74  205 205 HOH HOH A . 
C 3 HOH 75  206 206 HOH HOH A . 
C 3 HOH 76  207 207 HOH HOH A . 
C 3 HOH 77  208 208 HOH HOH A . 
C 3 HOH 78  210 210 HOH HOH A . 
C 3 HOH 79  211 211 HOH HOH A . 
C 3 HOH 80  212 212 HOH HOH A . 
C 3 HOH 81  213 213 HOH HOH A . 
C 3 HOH 82  214 214 HOH HOH A . 
C 3 HOH 83  215 215 HOH HOH A . 
C 3 HOH 84  217 217 HOH HOH A . 
C 3 HOH 85  219 219 HOH HOH A . 
C 3 HOH 86  220 220 HOH HOH A . 
C 3 HOH 87  222 222 HOH HOH A . 
C 3 HOH 88  224 224 HOH HOH A . 
C 3 HOH 89  225 225 HOH HOH A . 
C 3 HOH 90  226 226 HOH HOH A . 
C 3 HOH 91  229 229 HOH HOH A . 
C 3 HOH 92  230 230 HOH HOH A . 
C 3 HOH 93  231 231 HOH HOH A . 
C 3 HOH 94  232 232 HOH HOH A . 
C 3 HOH 95  233 233 HOH HOH A . 
C 3 HOH 96  235 235 HOH HOH A . 
C 3 HOH 97  236 236 HOH HOH A . 
C 3 HOH 98  239 239 HOH HOH A . 
C 3 HOH 99  242 242 HOH HOH A . 
C 3 HOH 100 244 244 HOH HOH A . 
C 3 HOH 101 246 246 HOH HOH A . 
C 3 HOH 102 248 248 HOH HOH A . 
C 3 HOH 103 249 249 HOH HOH A . 
C 3 HOH 104 251 251 HOH HOH A . 
C 3 HOH 105 252 252 HOH HOH A . 
C 3 HOH 106 253 253 HOH HOH A . 
C 3 HOH 107 254 254 HOH HOH A . 
C 3 HOH 108 255 255 HOH HOH A . 
C 3 HOH 109 256 256 HOH HOH A . 
C 3 HOH 110 257 257 HOH HOH A . 
C 3 HOH 111 258 258 HOH HOH A . 
C 3 HOH 112 259 259 HOH HOH A . 
C 3 HOH 113 260 260 HOH HOH A . 
C 3 HOH 114 261 261 HOH HOH A . 
C 3 HOH 115 262 262 HOH HOH A . 
C 3 HOH 116 263 263 HOH HOH A . 
C 3 HOH 117 264 264 HOH HOH A . 
C 3 HOH 118 265 265 HOH HOH A . 
C 3 HOH 119 266 266 HOH HOH A . 
C 3 HOH 120 267 267 HOH HOH A . 
C 3 HOH 121 268 268 HOH HOH A . 
C 3 HOH 122 270 270 HOH HOH A . 
C 3 HOH 123 271 271 HOH HOH A . 
C 3 HOH 124 272 272 HOH HOH A . 
C 3 HOH 125 273 273 HOH HOH A . 
C 3 HOH 126 274 274 HOH HOH A . 
C 3 HOH 127 275 275 HOH HOH A . 
C 3 HOH 128 276 276 HOH HOH A . 
C 3 HOH 129 277 277 HOH HOH A . 
C 3 HOH 130 278 278 HOH HOH A . 
C 3 HOH 131 279 279 HOH HOH A . 
C 3 HOH 132 280 280 HOH HOH A . 
C 3 HOH 133 283 283 HOH HOH A . 
C 3 HOH 134 284 284 HOH HOH A . 
C 3 HOH 135 286 286 HOH HOH A . 
C 3 HOH 136 288 288 HOH HOH A . 
C 3 HOH 137 289 289 HOH HOH A . 
C 3 HOH 138 290 290 HOH HOH A . 
C 3 HOH 139 292 292 HOH HOH A . 
C 3 HOH 140 293 293 HOH HOH A . 
C 3 HOH 141 294 294 HOH HOH A . 
C 3 HOH 142 295 295 HOH HOH A . 
C 3 HOH 143 296 296 HOH HOH A . 
C 3 HOH 144 297 297 HOH HOH A . 
C 3 HOH 145 298 298 HOH HOH A . 
C 3 HOH 146 299 299 HOH HOH A . 
C 3 HOH 147 300 300 HOH HOH A . 
C 3 HOH 148 301 301 HOH HOH A . 
C 3 HOH 149 303 303 HOH HOH A . 
C 3 HOH 150 305 305 HOH HOH A . 
C 3 HOH 151 306 306 HOH HOH A . 
C 3 HOH 152 307 307 HOH HOH A . 
C 3 HOH 153 313 313 HOH HOH A . 
C 3 HOH 154 314 314 HOH HOH A . 
C 3 HOH 155 317 317 HOH HOH A . 
C 3 HOH 156 318 318 HOH HOH A . 
C 3 HOH 157 319 319 HOH HOH A . 
C 3 HOH 158 322 322 HOH HOH A . 
C 3 HOH 159 323 323 HOH HOH A . 
C 3 HOH 160 324 324 HOH HOH A . 
C 3 HOH 161 328 328 HOH HOH A . 
C 3 HOH 162 329 329 HOH HOH A . 
C 3 HOH 163 330 330 HOH HOH A . 
C 3 HOH 164 332 332 HOH HOH A . 
C 3 HOH 165 333 333 HOH HOH A . 
C 3 HOH 166 334 334 HOH HOH A . 
C 3 HOH 167 335 335 HOH HOH A . 
C 3 HOH 168 336 336 HOH HOH A . 
C 3 HOH 169 337 337 HOH HOH A . 
C 3 HOH 170 338 338 HOH HOH A . 
C 3 HOH 171 340 340 HOH HOH A . 
C 3 HOH 172 341 341 HOH HOH A . 
C 3 HOH 173 342 342 HOH HOH A . 
C 3 HOH 174 343 343 HOH HOH A . 
C 3 HOH 175 344 344 HOH HOH A . 
C 3 HOH 176 345 345 HOH HOH A . 
C 3 HOH 177 346 346 HOH HOH A . 
C 3 HOH 178 348 348 HOH HOH A . 
C 3 HOH 179 349 349 HOH HOH A . 
C 3 HOH 180 350 350 HOH HOH A . 
C 3 HOH 181 351 351 HOH HOH A . 
C 3 HOH 182 352 352 HOH HOH A . 
C 3 HOH 183 353 353 HOH HOH A . 
C 3 HOH 184 355 355 HOH HOH A . 
C 3 HOH 185 357 357 HOH HOH A . 
C 3 HOH 186 358 358 HOH HOH A . 
C 3 HOH 187 359 359 HOH HOH A . 
C 3 HOH 188 360 360 HOH HOH A . 
C 3 HOH 189 362 362 HOH HOH A . 
C 3 HOH 190 363 363 HOH HOH A . 
C 3 HOH 191 364 364 HOH HOH A . 
C 3 HOH 192 365 365 HOH HOH A . 
C 3 HOH 193 366 366 HOH HOH A . 
C 3 HOH 194 367 367 HOH HOH A . 
C 3 HOH 195 368 368 HOH HOH A . 
C 3 HOH 196 369 369 HOH HOH A . 
C 3 HOH 197 370 370 HOH HOH A . 
C 3 HOH 198 371 371 HOH HOH A . 
C 3 HOH 199 372 372 HOH HOH A . 
C 3 HOH 200 373 373 HOH HOH A . 
C 3 HOH 201 374 374 HOH HOH A . 
C 3 HOH 202 375 375 HOH HOH A . 
C 3 HOH 203 376 376 HOH HOH A . 
C 3 HOH 204 377 377 HOH HOH A . 
C 3 HOH 205 378 378 HOH HOH A . 
C 3 HOH 206 380 380 HOH HOH A . 
C 3 HOH 207 381 381 HOH HOH A . 
C 3 HOH 208 382 382 HOH HOH A . 
C 3 HOH 209 383 383 HOH HOH A . 
C 3 HOH 210 384 384 HOH HOH A . 
C 3 HOH 211 385 385 HOH HOH A . 
C 3 HOH 212 386 386 HOH HOH A . 
C 3 HOH 213 387 387 HOH HOH A . 
C 3 HOH 214 388 388 HOH HOH A . 
C 3 HOH 215 389 389 HOH HOH A . 
C 3 HOH 216 390 390 HOH HOH A . 
C 3 HOH 217 391 391 HOH HOH A . 
C 3 HOH 218 392 392 HOH HOH A . 
C 3 HOH 219 393 393 HOH HOH A . 
C 3 HOH 220 394 394 HOH HOH A . 
C 3 HOH 221 395 395 HOH HOH A . 
C 3 HOH 222 396 396 HOH HOH A . 
C 3 HOH 223 397 397 HOH HOH A . 
C 3 HOH 224 399 399 HOH HOH A . 
C 3 HOH 225 400 400 HOH HOH A . 
C 3 HOH 226 401 401 HOH HOH A . 
C 3 HOH 227 402 402 HOH HOH A . 
C 3 HOH 228 403 403 HOH HOH A . 
C 3 HOH 229 404 404 HOH HOH A . 
C 3 HOH 230 405 405 HOH HOH A . 
C 3 HOH 231 406 406 HOH HOH A . 
C 3 HOH 232 407 407 HOH HOH A . 
C 3 HOH 233 408 408 HOH HOH A . 
#