data_1B8M
# 
_entry.id   1B8M 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1B8M         
RCSB  RCSB000418   
WWPDB D_1000000418 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1B8M 
_pdbx_database_status.recvd_initial_deposition_date   1999-02-01 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Robinson, R.C.'   1 
'Radziejewski, C.' 2 
'Stuart, D.I.'     3 
'Jones, E.Y.'      4 
'Choe, S.'         5 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 
;The structures of the neurotrophin 4 homodimer and the brain-derived neurotrophic factor/neurotrophin 4 heterodimer reveal a common Trk-binding site.
;
'Protein Sci.' 8  2589  2597 1999 PRCIEI US 0961-8368 0795 ? 10631974 ? 
1       'Structure of the Brain-Derived Neurotrophic Factor (Slash)Neurotrophin 3 Heterodimer' Biochemistry   34 4139  4146 1995 
BICHAW US 0006-2960 0033 ? ?        ? 
2       'Heterodimers of the Neurotrophic Factors: Formation, Isolation, and Differential Stability' Biochemistry   32 13350 ?    
1993 BICHAW US 0006-2960 0033 ? ?        ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Robinson, R.C.'   1  
primary 'Radziejewski, C.' 2  
primary 'Spraggon, G.'     3  
primary 'Greenwald, J.'    4  
primary 'Kostura, M.R.'    5  
primary 'Burtnick, L.D.'   6  
primary 'Stuart, D.I.'     7  
primary 'Choe, S.'         8  
primary 'Jones, E.Y.'      9  
1       'Robinson, R.C.'   10 
1       'Radziejewski, C.' 11 
1       'Stuart, D.I.'     12 
1       'Jones, E.Y.'      13 
2       'Radziejewski, C.' 14 
2       'Robinson, R.C.'   15 
# 
_cell.entry_id           1B8M 
_cell.length_a           50.700 
_cell.length_b           105.900 
_cell.length_c           51.800 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1B8M 
_symmetry.space_group_name_H-M             'P 21 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                18 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'PROTEIN (BRAIN DERIVED NEUROTROPHIC FACTOR)' 13535.575 1  ? ? ? ? 
2 polymer man 'PROTEIN (NEUROTROPHIN-4)'                    13944.647 1  ? ? ? ? 
3 water   nat water                                         18.015    57 ? ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 BDNF 
2 NT4  
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;HSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQC
RTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR
;
;HSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQC
RTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR
;
A ? 
2 'polypeptide(L)' no no 
;GVSETAPASRRGELAVCDAVSGWVTDRRTAVDLRGREVEVLGEVPAAGGSPLRQYFFETRCKADNAEEGGPGAGGGGCRG
VDRRHWVSECKAKQSYVRALTADAQGRVGWRWIRIDTACVCTLLSRTGRA
;
;GVSETAPASRRGELAVCDAVSGWVTDRRTAVDLRGREVEVLGEVPAAGGSPLRQYFFETRCKADNAEEGGPGAGGGGCRG
VDRRHWVSECKAKQSYVRALTADAQGRVGWRWIRIDTACVCTLLSRTGRA
;
B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   HIS n 
1 2   SER n 
1 3   ASP n 
1 4   PRO n 
1 5   ALA n 
1 6   ARG n 
1 7   ARG n 
1 8   GLY n 
1 9   GLU n 
1 10  LEU n 
1 11  SER n 
1 12  VAL n 
1 13  CYS n 
1 14  ASP n 
1 15  SER n 
1 16  ILE n 
1 17  SER n 
1 18  GLU n 
1 19  TRP n 
1 20  VAL n 
1 21  THR n 
1 22  ALA n 
1 23  ALA n 
1 24  ASP n 
1 25  LYS n 
1 26  LYS n 
1 27  THR n 
1 28  ALA n 
1 29  VAL n 
1 30  ASP n 
1 31  MET n 
1 32  SER n 
1 33  GLY n 
1 34  GLY n 
1 35  THR n 
1 36  VAL n 
1 37  THR n 
1 38  VAL n 
1 39  LEU n 
1 40  GLU n 
1 41  LYS n 
1 42  VAL n 
1 43  PRO n 
1 44  VAL n 
1 45  SER n 
1 46  LYS n 
1 47  GLY n 
1 48  GLN n 
1 49  LEU n 
1 50  LYS n 
1 51  GLN n 
1 52  TYR n 
1 53  PHE n 
1 54  TYR n 
1 55  GLU n 
1 56  THR n 
1 57  LYS n 
1 58  CYS n 
1 59  ASN n 
1 60  PRO n 
1 61  MET n 
1 62  GLY n 
1 63  TYR n 
1 64  THR n 
1 65  LYS n 
1 66  GLU n 
1 67  GLY n 
1 68  CYS n 
1 69  ARG n 
1 70  GLY n 
1 71  ILE n 
1 72  ASP n 
1 73  LYS n 
1 74  ARG n 
1 75  HIS n 
1 76  TRP n 
1 77  ASN n 
1 78  SER n 
1 79  GLN n 
1 80  CYS n 
1 81  ARG n 
1 82  THR n 
1 83  THR n 
1 84  GLN n 
1 85  SER n 
1 86  TYR n 
1 87  VAL n 
1 88  ARG n 
1 89  ALA n 
1 90  LEU n 
1 91  THR n 
1 92  MET n 
1 93  ASP n 
1 94  SER n 
1 95  LYS n 
1 96  LYS n 
1 97  ARG n 
1 98  ILE n 
1 99  GLY n 
1 100 TRP n 
1 101 ARG n 
1 102 PHE n 
1 103 ILE n 
1 104 ARG n 
1 105 ILE n 
1 106 ASP n 
1 107 THR n 
1 108 SER n 
1 109 CYS n 
1 110 VAL n 
1 111 CYS n 
1 112 THR n 
1 113 LEU n 
1 114 THR n 
1 115 ILE n 
1 116 LYS n 
1 117 ARG n 
1 118 GLY n 
1 119 ARG n 
2 1   GLY n 
2 2   VAL n 
2 3   SER n 
2 4   GLU n 
2 5   THR n 
2 6   ALA n 
2 7   PRO n 
2 8   ALA n 
2 9   SER n 
2 10  ARG n 
2 11  ARG n 
2 12  GLY n 
2 13  GLU n 
2 14  LEU n 
2 15  ALA n 
2 16  VAL n 
2 17  CYS n 
2 18  ASP n 
2 19  ALA n 
2 20  VAL n 
2 21  SER n 
2 22  GLY n 
2 23  TRP n 
2 24  VAL n 
2 25  THR n 
2 26  ASP n 
2 27  ARG n 
2 28  ARG n 
2 29  THR n 
2 30  ALA n 
2 31  VAL n 
2 32  ASP n 
2 33  LEU n 
2 34  ARG n 
2 35  GLY n 
2 36  ARG n 
2 37  GLU n 
2 38  VAL n 
2 39  GLU n 
2 40  VAL n 
2 41  LEU n 
2 42  GLY n 
2 43  GLU n 
2 44  VAL n 
2 45  PRO n 
2 46  ALA n 
2 47  ALA n 
2 48  GLY n 
2 49  GLY n 
2 50  SER n 
2 51  PRO n 
2 52  LEU n 
2 53  ARG n 
2 54  GLN n 
2 55  TYR n 
2 56  PHE n 
2 57  PHE n 
2 58  GLU n 
2 59  THR n 
2 60  ARG n 
2 61  CYS n 
2 62  LYS n 
2 63  ALA n 
2 64  ASP n 
2 65  ASN n 
2 66  ALA n 
2 67  GLU n 
2 68  GLU n 
2 69  GLY n 
2 70  GLY n 
2 71  PRO n 
2 72  GLY n 
2 73  ALA n 
2 74  GLY n 
2 75  GLY n 
2 76  GLY n 
2 77  GLY n 
2 78  CYS n 
2 79  ARG n 
2 80  GLY n 
2 81  VAL n 
2 82  ASP n 
2 83  ARG n 
2 84  ARG n 
2 85  HIS n 
2 86  TRP n 
2 87  VAL n 
2 88  SER n 
2 89  GLU n 
2 90  CYS n 
2 91  LYS n 
2 92  ALA n 
2 93  LYS n 
2 94  GLN n 
2 95  SER n 
2 96  TYR n 
2 97  VAL n 
2 98  ARG n 
2 99  ALA n 
2 100 LEU n 
2 101 THR n 
2 102 ALA n 
2 103 ASP n 
2 104 ALA n 
2 105 GLN n 
2 106 GLY n 
2 107 ARG n 
2 108 VAL n 
2 109 GLY n 
2 110 TRP n 
2 111 ARG n 
2 112 TRP n 
2 113 ILE n 
2 114 ARG n 
2 115 ILE n 
2 116 ASP n 
2 117 THR n 
2 118 ALA n 
2 119 CYS n 
2 120 VAL n 
2 121 CYS n 
2 122 THR n 
2 123 LEU n 
2 124 LEU n 
2 125 SER n 
2 126 ARG n 
2 127 THR n 
2 128 GLY n 
2 129 ARG n 
2 130 ALA n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? human Homo ? ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 Escherichia ? ? ? ? ? ? ? ? ? 
? ? ? ? ? ? ? ? ? ? 'SUPPLIED BY REGENERON PHARM.;' 
2 1 sample ? ? ? human Homo ? ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 Escherichia ? ? ? ? ? ? ? ? ? 
? ? ? ? ? ? ? ? ? ? 'SUPPLIED BY REGENERON PHARM.'  
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_db_isoform 
1 GB HUMBDNFB  1 M61176 ? ? ? 
2 GB HUMPPNT4P 2 M86528 ? ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1B8M A 1 ? 119 ? M61176 133 ? 251 ? 1 119 
2 2 1B8M B 1 ? 130 ? M86528 81  ? 210 ? 1 130 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1B8M 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.53 
_exptl_crystal.density_percent_sol   50 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.0 
_exptl_crystal_grow.pdbx_details    'pH 6.0' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           270.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'MAR scanner 300 mm plate' 
_diffrn_detector.pdbx_collection_date   ? 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SRS BEAMLINE PX9.6' 
_diffrn_source.pdbx_synchrotron_site       SRS 
_diffrn_source.pdbx_synchrotron_beamline   PX9.6 
_diffrn_source.pdbx_wavelength             0.97 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1B8M 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             20.0 
_reflns.d_resolution_high            2.75 
_reflns.number_obs                   7858 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         98.0 
_reflns.pdbx_Rmerge_I_obs            0.06 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              2.7 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_refine.entry_id                                 1B8M 
_refine.ls_number_reflns_obs                     7858 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               10000000.0 
_refine.pdbx_data_cutoff_low_absF                0.001 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             20.0 
_refine.ls_d_res_high                            2.75 
_refine.ls_percent_reflns_obs                    98.0 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.198 
_refine.ls_R_factor_R_free                       0.279 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               36.9 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      1BNF 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1721 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             57 
_refine_hist.number_atoms_total               1778 
_refine_hist.d_res_high                       2.75 
_refine_hist.d_res_low                        20.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d                0.014 ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg             2.0   ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  1B8M 
_struct.title                     'BRAIN DERIVED NEUROTROPHIC FACTOR, NEUROTROPHIN-4' 
_struct.pdbx_descriptor           'BRAIN DERIVED NEUROTROPHIC FACTOR, NEUROTROPHIN-4' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1B8M 
_struct_keywords.pdbx_keywords   'GROWTH FACTOR/NEUROTROPHIN-4' 
_struct_keywords.text            'COMPLEX (GROWTH FACTOR-GROWTH FACTOR), NEUROTROPHIN, GROWTH FACTOR-NEUROTROPHIN-4 COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 3 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
_struct_conf.conf_type_id            HELX_P 
_struct_conf.id                      HELX_P1 
_struct_conf.pdbx_PDB_helix_id       1 
_struct_conf.beg_label_comp_id       ALA 
_struct_conf.beg_label_asym_id       A 
_struct_conf.beg_label_seq_id        22 
_struct_conf.pdbx_beg_PDB_ins_code   ? 
_struct_conf.end_label_comp_id       LYS 
_struct_conf.end_label_asym_id       A 
_struct_conf.end_label_seq_id        25 
_struct_conf.pdbx_end_PDB_ins_code   ? 
_struct_conf.beg_auth_comp_id        ALA 
_struct_conf.beg_auth_asym_id        A 
_struct_conf.beg_auth_seq_id         22 
_struct_conf.end_auth_comp_id        LYS 
_struct_conf.end_auth_asym_id        A 
_struct_conf.end_auth_seq_id         25 
_struct_conf.pdbx_PDB_helix_class    5 
_struct_conf.details                 ? 
_struct_conf.pdbx_PDB_helix_length   4 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 13 SG ? ? ? 1_555 A CYS 80  SG ? ? A CYS 13 A CYS 80  1_555 ? ? ? ? ? ? ? 2.006 ? 
disulf2 disulf ? ? A CYS 58 SG ? ? ? 1_555 A CYS 109 SG ? ? A CYS 58 A CYS 109 1_555 ? ? ? ? ? ? ? 2.039 ? 
disulf3 disulf ? ? A CYS 68 SG ? ? ? 1_555 A CYS 111 SG ? ? A CYS 68 A CYS 111 1_555 ? ? ? ? ? ? ? 2.017 ? 
disulf4 disulf ? ? B CYS 17 SG ? ? ? 1_555 B CYS 90  SG ? ? B CYS 17 B CYS 90  1_555 ? ? ? ? ? ? ? 2.024 ? 
disulf5 disulf ? ? B CYS 61 SG ? ? ? 1_555 B CYS 119 SG ? ? B CYS 61 B CYS 119 1_555 ? ? ? ? ? ? ? 2.015 ? 
disulf6 disulf ? ? B CYS 78 SG ? ? ? 1_555 B CYS 121 SG ? ? B CYS 78 B CYS 121 1_555 ? ? ? ? ? ? ? 2.021 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 2 ? 
C ? 2 ? 
D ? 2 ? 
E ? 2 ? 
F ? 2 ? 
G ? 2 ? 
H ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? anti-parallel 
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
E 1 2 ? anti-parallel 
F 1 2 ? anti-parallel 
G 1 2 ? anti-parallel 
H 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 SER A 15  ? THR A 21  ? SER A 15  THR A 21  
A 2 TYR A 52  ? CYS A 58  ? TYR A 52  CYS A 58  
B 1 THR A 27  ? VAL A 29  ? THR A 27  VAL A 29  
B 2 THR A 35  ? THR A 37  ? THR A 35  THR A 37  
C 1 LYS A 41  ? VAL A 44  ? LYS A 41  VAL A 44  
C 2 GLY A 47  ? LYS A 50  ? GLY A 47  LYS A 50  
D 1 ASN A 77  ? MET A 92  ? ASN A 77  MET A 92  
D 2 ILE A 98  ? THR A 114 ? ILE A 98  THR A 114 
E 1 ALA B 19  ? VAL B 24  ? ALA B 19  VAL B 24  
E 2 PHE B 56  ? CYS B 61  ? PHE B 56  CYS B 61  
F 1 THR B 29  ? VAL B 31  ? THR B 29  VAL B 31  
F 2 GLU B 37  ? GLU B 39  ? GLU B 37  GLU B 39  
G 1 GLN B 94  ? ALA B 102 ? GLN B 94  ALA B 102 
G 2 VAL B 108 ? ASP B 116 ? VAL B 108 ASP B 116 
H 1 VAL B 87  ? LYS B 93  ? VAL B 87  LYS B 93  
H 2 ALA B 118 ? SER B 125 ? ALA B 118 SER B 125 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O ILE A 16 ? O ILE A 16 N LYS A 57  ? N LYS A 57  
B 1 2 O ALA A 28 ? O ALA A 28 N VAL A 36  ? N VAL A 36  
C 1 2 O VAL A 42 ? O VAL A 42 N LEU A 49  ? N LEU A 49  
D 1 2 O ASN A 77 ? O ASN A 77 N THR A 114 ? N THR A 114 
E 1 2 O VAL B 20 ? O VAL B 20 N ARG B 60  ? N ARG B 60  
F 1 2 O ALA B 30 ? O ALA B 30 N VAL B 38  ? N VAL B 38  
G 1 2 O SER B 95 ? O SER B 95 N ILE B 115 ? N ILE B 115 
H 1 2 O VAL B 87 ? O VAL B 87 N SER B 125 ? N SER B 125 
# 
_database_PDB_matrix.entry_id          1B8M 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1B8M 
_atom_sites.fract_transf_matrix[1][1]   0.019724 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009443 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.019305 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . GLY A 1 8   ? 11.467  26.654 28.879  1.00 70.68  ? 8   GLY A N   1 
ATOM   2    C CA  . GLY A 1 8   ? 10.417  26.539 29.952  1.00 70.68  ? 8   GLY A CA  1 
ATOM   3    C C   . GLY A 1 8   ? 9.867   25.128 30.164  1.00 70.68  ? 8   GLY A C   1 
ATOM   4    O O   . GLY A 1 8   ? 10.171  24.484 31.173  1.00 70.68  ? 8   GLY A O   1 
ATOM   5    N N   . GLU A 1 9   ? 9.066   24.646 29.211  1.00 67.11  ? 9   GLU A N   1 
ATOM   6    C CA  . GLU A 1 9   ? 8.467   23.310 29.286  1.00 67.11  ? 9   GLU A CA  1 
ATOM   7    C C   . GLU A 1 9   ? 9.428   22.203 28.892  1.00 67.11  ? 9   GLU A C   1 
ATOM   8    O O   . GLU A 1 9   ? 10.323  22.416 28.081  1.00 67.11  ? 9   GLU A O   1 
ATOM   9    C CB  . GLU A 1 9   ? 7.263   23.205 28.356  1.00 86.48  ? 9   GLU A CB  1 
ATOM   10   C CG  . GLU A 1 9   ? 6.114   24.112 28.683  1.00 86.48  ? 9   GLU A CG  1 
ATOM   11   C CD  . GLU A 1 9   ? 4.912   23.818 27.816  1.00 86.48  ? 9   GLU A CD  1 
ATOM   12   O OE1 . GLU A 1 9   ? 4.993   23.813 26.582  1.00 86.48  ? 9   GLU A OE1 1 
ATOM   13   O OE2 . GLU A 1 9   ? 3.787   23.558 28.457  1.00 86.48  ? 9   GLU A OE2 1 
ATOM   14   N N   . LEU A 1 10  ? 9.210   21.012 29.439  1.00 31.95  ? 10  LEU A N   1 
ATOM   15   C CA  . LEU A 1 10  ? 10.040  19.856 29.111  1.00 31.95  ? 10  LEU A CA  1 
ATOM   16   C C   . LEU A 1 10  ? 9.216   18.839 28.355  1.00 31.95  ? 10  LEU A C   1 
ATOM   17   O O   . LEU A 1 10  ? 8.288   18.264 28.911  1.00 31.95  ? 10  LEU A O   1 
ATOM   18   C CB  . LEU A 1 10  ? 10.602  19.176 30.369  1.00 13.63  ? 10  LEU A CB  1 
ATOM   19   C CG  . LEU A 1 10  ? 11.607  18.059 30.094  1.00 13.63  ? 10  LEU A CG  1 
ATOM   20   C CD1 . LEU A 1 10  ? 12.844  18.645 29.478  1.00 13.63  ? 10  LEU A CD1 1 
ATOM   21   C CD2 . LEU A 1 10  ? 11.925  17.388 31.361  1.00 13.63  ? 10  LEU A CD2 1 
ATOM   22   N N   . SER A 1 11  ? 9.593   18.614 27.102  1.00 9.51   ? 11  SER A N   1 
ATOM   23   C CA  . SER A 1 11  ? 8.942   17.675 26.207  1.00 9.51   ? 11  SER A CA  1 
ATOM   24   C C   . SER A 1 11  ? 9.673   16.359 26.240  1.00 9.51   ? 11  SER A C   1 
ATOM   25   O O   . SER A 1 11  ? 10.873  16.282 26.516  1.00 9.51   ? 11  SER A O   1 
ATOM   26   C CB  . SER A 1 11  ? 8.983   18.174 24.768  1.00 33.44  ? 11  SER A CB  1 
ATOM   27   O OG  . SER A 1 11  ? 8.313   19.405 24.645  1.00 33.44  ? 11  SER A OG  1 
ATOM   28   N N   . VAL A 1 12  ? 8.945   15.329 25.866  1.00 14.26  ? 12  VAL A N   1 
ATOM   29   C CA  . VAL A 1 12  ? 9.491   14.024 25.795  1.00 14.26  ? 12  VAL A CA  1 
ATOM   30   C C   . VAL A 1 12  ? 10.556  13.974 24.670  1.00 14.26  ? 12  VAL A C   1 
ATOM   31   O O   . VAL A 1 12  ? 11.500  13.199 24.756  1.00 14.26  ? 12  VAL A O   1 
ATOM   32   C CB  . VAL A 1 12  ? 8.341   13.042 25.592  1.00 36.22  ? 12  VAL A CB  1 
ATOM   33   C CG1 . VAL A 1 12  ? 7.608   13.308 24.302  1.00 36.22  ? 12  VAL A CG1 1 
ATOM   34   C CG2 . VAL A 1 12  ? 8.836   11.684 25.618  1.00 36.22  ? 12  VAL A CG2 1 
ATOM   35   N N   . CYS A 1 13  ? 10.438  14.834 23.642  1.00 10.02  ? 13  CYS A N   1 
ATOM   36   C CA  . CYS A 1 13  ? 11.374  14.865 22.483  1.00 10.02  ? 13  CYS A CA  1 
ATOM   37   C C   . CYS A 1 13  ? 11.988  16.245 22.266  1.00 10.02  ? 13  CYS A C   1 
ATOM   38   O O   . CYS A 1 13  ? 11.305  17.286 22.392  1.00 10.02  ? 13  CYS A O   1 
ATOM   39   C CB  . CYS A 1 13  ? 10.628  14.537 21.199  1.00 19.12  ? 13  CYS A CB  1 
ATOM   40   S SG  . CYS A 1 13  ? 10.142  12.820 21.011  1.00 19.12  ? 13  CYS A SG  1 
ATOM   41   N N   . ASP A 1 14  ? 13.269  16.261 21.933  1.00 18.98  ? 14  ASP A N   1 
ATOM   42   C CA  . ASP A 1 14  ? 13.951  17.530 21.657  1.00 18.98  ? 14  ASP A CA  1 
ATOM   43   C C   . ASP A 1 14  ? 13.718  18.009 20.230  1.00 18.98  ? 14  ASP A C   1 
ATOM   44   O O   . ASP A 1 14  ? 13.816  17.223 19.268  1.00 18.98  ? 14  ASP A O   1 
ATOM   45   C CB  . ASP A 1 14  ? 15.460  17.407 21.896  1.00 27.41  ? 14  ASP A CB  1 
ATOM   46   C CG  . ASP A 1 14  ? 15.803  17.463 23.354  1.00 27.41  ? 14  ASP A CG  1 
ATOM   47   O OD1 . ASP A 1 14  ? 15.041  18.138 24.083  1.00 27.41  ? 14  ASP A OD1 1 
ATOM   48   O OD2 . ASP A 1 14  ? 16.799  16.828 23.767  1.00 27.41  ? 14  ASP A OD2 1 
ATOM   49   N N   . SER A 1 15  ? 13.452  19.301 20.087  1.00 18.24  ? 15  SER A N   1 
ATOM   50   C CA  . SER A 1 15  ? 13.220  19.880 18.779  1.00 18.24  ? 15  SER A CA  1 
ATOM   51   C C   . SER A 1 15  ? 13.888  21.253 18.610  1.00 18.24  ? 15  SER A C   1 
ATOM   52   O O   . SER A 1 15  ? 14.294  21.871 19.588  1.00 18.24  ? 15  SER A O   1 
ATOM   53   C CB  . SER A 1 15  ? 11.722  19.959 18.537  1.00 17.10  ? 15  SER A CB  1 
ATOM   54   O OG  . SER A 1 15  ? 11.093  20.806 19.466  1.00 17.10  ? 15  SER A OG  1 
ATOM   55   N N   . ILE A 1 16  ? 14.127  21.653 17.366  1.00 22.99  ? 16  ILE A N   1 
ATOM   56   C CA  . ILE A 1 16  ? 14.730  22.937 17.026  1.00 22.99  ? 16  ILE A CA  1 
ATOM   57   C C   . ILE A 1 16  ? 13.777  23.577 16.001  1.00 22.99  ? 16  ILE A C   1 
ATOM   58   O O   . ILE A 1 16  ? 13.084  22.855 15.294  1.00 22.99  ? 16  ILE A O   1 
ATOM   59   C CB  . ILE A 1 16  ? 16.133  22.746 16.409  1.00 35.85  ? 16  ILE A CB  1 
ATOM   60   C CG1 . ILE A 1 16  ? 16.832  24.105 16.324  1.00 35.85  ? 16  ILE A CG1 1 
ATOM   61   C CG2 . ILE A 1 16  ? 16.032  22.057 15.042  1.00 35.85  ? 16  ILE A CG2 1 
ATOM   62   C CD1 . ILE A 1 16  ? 18.267  24.097 15.791  1.00 35.85  ? 16  ILE A CD1 1 
ATOM   63   N N   . SER A 1 17  ? 13.684  24.905 15.963  1.00 22.28  ? 17  SER A N   1 
ATOM   64   C CA  . SER A 1 17  ? 12.805  25.609 15.025  1.00 22.28  ? 17  SER A CA  1 
ATOM   65   C C   . SER A 1 17  ? 13.594  26.711 14.335  1.00 22.28  ? 17  SER A C   1 
ATOM   66   O O   . SER A 1 17  ? 14.538  27.290 14.944  1.00 22.28  ? 17  SER A O   1 
ATOM   67   C CB  . SER A 1 17  ? 11.664  26.286 15.769  1.00 18.72  ? 17  SER A CB  1 
ATOM   68   O OG  . SER A 1 17  ? 11.181  25.486 16.823  1.00 18.72  ? 17  SER A OG  1 
ATOM   69   N N   . GLU A 1 18  ? 13.193  27.064 13.110  1.00 15.87  ? 18  GLU A N   1 
ATOM   70   C CA  . GLU A 1 18  ? 13.880  28.132 12.390  1.00 15.87  ? 18  GLU A CA  1 
ATOM   71   C C   . GLU A 1 18  ? 13.069  28.754 11.294  1.00 15.87  ? 18  GLU A C   1 
ATOM   72   O O   . GLU A 1 18  ? 12.197  28.117 10.703  1.00 15.87  ? 18  GLU A O   1 
ATOM   73   C CB  . GLU A 1 18  ? 15.180  27.621 11.812  1.00 56.12  ? 18  GLU A CB  1 
ATOM   74   C CG  . GLU A 1 18  ? 15.005  26.398 10.982  1.00 56.12  ? 18  GLU A CG  1 
ATOM   75   C CD  . GLU A 1 18  ? 16.325  25.754 10.698  1.00 56.12  ? 18  GLU A CD  1 
ATOM   76   O OE1 . GLU A 1 18  ? 17.082  26.324 9.871   1.00 56.12  ? 18  GLU A OE1 1 
ATOM   77   O OE2 . GLU A 1 18  ? 16.607  24.700 11.320  1.00 56.12  ? 18  GLU A OE2 1 
ATOM   78   N N   . TRP A 1 19  ? 13.351  30.013 11.025  1.00 19.58  ? 19  TRP A N   1 
ATOM   79   C CA  . TRP A 1 19  ? 12.656  30.715 9.972   1.00 19.58  ? 19  TRP A CA  1 
ATOM   80   C C   . TRP A 1 19  ? 13.300  30.329 8.661   1.00 19.58  ? 19  TRP A C   1 
ATOM   81   O O   . TRP A 1 19  ? 14.467  30.637 8.462   1.00 19.58  ? 19  TRP A O   1 
ATOM   82   C CB  . TRP A 1 19  ? 12.789  32.205 10.194  1.00 25.07  ? 19  TRP A CB  1 
ATOM   83   C CG  . TRP A 1 19  ? 12.048  32.629 11.424  1.00 25.07  ? 19  TRP A CG  1 
ATOM   84   C CD1 . TRP A 1 19  ? 12.573  32.852 12.650  1.00 25.07  ? 19  TRP A CD1 1 
ATOM   85   C CD2 . TRP A 1 19  ? 10.634  32.877 11.534  1.00 25.07  ? 19  TRP A CD2 1 
ATOM   86   N NE1 . TRP A 1 19  ? 11.589  33.234 13.517  1.00 25.07  ? 19  TRP A NE1 1 
ATOM   87   C CE2 . TRP A 1 19  ? 10.387  33.258 12.866  1.00 25.07  ? 19  TRP A CE2 1 
ATOM   88   C CE3 . TRP A 1 19  ? 9.554   32.809 10.634  1.00 25.07  ? 19  TRP A CE3 1 
ATOM   89   C CZ2 . TRP A 1 19  ? 9.110   33.578 13.334  1.00 25.07  ? 19  TRP A CZ2 1 
ATOM   90   C CZ3 . TRP A 1 19  ? 8.291   33.123 11.095  1.00 25.07  ? 19  TRP A CZ3 1 
ATOM   91   C CH2 . TRP A 1 19  ? 8.077   33.506 12.441  1.00 25.07  ? 19  TRP A CH2 1 
ATOM   92   N N   . VAL A 1 20  ? 12.585  29.592 7.809   1.00 21.06  ? 20  VAL A N   1 
ATOM   93   C CA  . VAL A 1 20  ? 13.108  29.171 6.516   1.00 21.06  ? 20  VAL A CA  1 
ATOM   94   C C   . VAL A 1 20  ? 12.644  30.148 5.470   1.00 21.06  ? 20  VAL A C   1 
ATOM   95   O O   . VAL A 1 20  ? 11.486  30.529 5.433   1.00 21.06  ? 20  VAL A O   1 
ATOM   96   C CB  . VAL A 1 20  ? 12.634  27.762 6.138   1.00 20.91  ? 20  VAL A CB  1 
ATOM   97   C CG1 . VAL A 1 20  ? 13.310  27.297 4.836   1.00 20.91  ? 20  VAL A CG1 1 
ATOM   98   C CG2 . VAL A 1 20  ? 12.972  26.802 7.255   1.00 20.91  ? 20  VAL A CG2 1 
ATOM   99   N N   . THR A 1 21  ? 13.561  30.547 4.614   1.00 24.04  ? 21  THR A N   1 
ATOM   100  C CA  . THR A 1 21  ? 13.288  31.514 3.554   1.00 24.04  ? 21  THR A CA  1 
ATOM   101  C C   . THR A 1 21  ? 12.679  30.767 2.351   1.00 24.04  ? 21  THR A C   1 
ATOM   102  O O   . THR A 1 21  ? 12.891  29.559 2.213   1.00 24.04  ? 21  THR A O   1 
ATOM   103  C CB  . THR A 1 21  ? 14.645  32.218 3.199   1.00 27.64  ? 21  THR A CB  1 
ATOM   104  O OG1 . THR A 1 21  ? 14.437  33.579 2.855   1.00 27.64  ? 21  THR A OG1 1 
ATOM   105  C CG2 . THR A 1 21  ? 15.339  31.534 2.058   1.00 27.64  ? 21  THR A CG2 1 
ATOM   106  N N   . ALA A 1 22  ? 11.906  31.449 1.505   1.00 18.61  ? 22  ALA A N   1 
ATOM   107  C CA  . ALA A 1 22  ? 11.328  30.795 0.322   1.00 18.61  ? 22  ALA A CA  1 
ATOM   108  C C   . ALA A 1 22  ? 12.458  30.236 -0.563  1.00 18.61  ? 22  ALA A C   1 
ATOM   109  O O   . ALA A 1 22  ? 12.367  29.120 -1.111  1.00 18.61  ? 22  ALA A O   1 
ATOM   110  C CB  . ALA A 1 22  ? 10.521  31.765 -0.464  1.00 9.27   ? 22  ALA A CB  1 
ATOM   111  N N   . ALA A 1 23  ? 13.542  31.003 -0.684  1.00 19.02  ? 23  ALA A N   1 
ATOM   112  C CA  . ALA A 1 23  ? 14.690  30.581 -1.453  1.00 19.02  ? 23  ALA A CA  1 
ATOM   113  C C   . ALA A 1 23  ? 15.195  29.209 -0.973  1.00 19.02  ? 23  ALA A C   1 
ATOM   114  O O   . ALA A 1 23  ? 15.633  28.371 -1.796  1.00 19.02  ? 23  ALA A O   1 
ATOM   115  C CB  . ALA A 1 23  ? 15.785  31.620 -1.353  1.00 2.00   ? 23  ALA A CB  1 
ATOM   116  N N   . ASP A 1 24  ? 15.111  28.948 0.335   1.00 15.35  ? 24  ASP A N   1 
ATOM   117  C CA  . ASP A 1 24  ? 15.590  27.668 0.865   1.00 15.35  ? 24  ASP A CA  1 
ATOM   118  C C   . ASP A 1 24  ? 14.534  26.594 0.824   1.00 15.35  ? 24  ASP A C   1 
ATOM   119  O O   . ASP A 1 24  ? 14.783  25.429 1.191   1.00 15.35  ? 24  ASP A O   1 
ATOM   120  C CB  . ASP A 1 24  ? 16.192  27.807 2.267   1.00 41.10  ? 24  ASP A CB  1 
ATOM   121  C CG  . ASP A 1 24  ? 17.611  28.367 2.241   1.00 41.10  ? 24  ASP A CG  1 
ATOM   122  O OD1 . ASP A 1 24  ? 18.519  27.748 1.621   1.00 41.10  ? 24  ASP A OD1 1 
ATOM   123  O OD2 . ASP A 1 24  ? 17.808  29.443 2.837   1.00 41.10  ? 24  ASP A OD2 1 
ATOM   124  N N   . LYS A 1 25  ? 13.369  26.969 0.308   1.00 21.25  ? 25  LYS A N   1 
ATOM   125  C CA  . LYS A 1 25  ? 12.266  26.029 0.159   1.00 21.25  ? 25  LYS A CA  1 
ATOM   126  C C   . LYS A 1 25  ? 11.525  26.443 -1.114  1.00 21.25  ? 25  LYS A C   1 
ATOM   127  O O   . LYS A 1 25  ? 10.388  26.900 -1.056  1.00 21.25  ? 25  LYS A O   1 
ATOM   128  C CB  . LYS A 1 25  ? 11.351  26.123 1.368   1.00 35.97  ? 25  LYS A CB  1 
ATOM   129  C CG  . LYS A 1 25  ? 10.432  24.950 1.481   1.00 35.97  ? 25  LYS A CG  1 
ATOM   130  C CD  . LYS A 1 25  ? 9.357   25.159 2.544   1.00 35.97  ? 25  LYS A CD  1 
ATOM   131  C CE  . LYS A 1 25  ? 9.345   23.976 3.463   1.00 35.97  ? 25  LYS A CE  1 
ATOM   132  N NZ  . LYS A 1 25  ? 10.726  23.843 3.990   1.00 35.97  ? 25  LYS A NZ  1 
ATOM   133  N N   . LYS A 1 26  ? 12.207  26.355 -2.252  1.00 16.23  ? 26  LYS A N   1 
ATOM   134  C CA  . LYS A 1 26  ? 11.640  26.752 -3.543  1.00 16.23  ? 26  LYS A CA  1 
ATOM   135  C C   . LYS A 1 26  ? 10.529  25.856 -4.143  1.00 16.23  ? 26  LYS A C   1 
ATOM   136  O O   . LYS A 1 26  ? 9.690   26.319 -4.933  1.00 16.23  ? 26  LYS A O   1 
ATOM   137  C CB  . LYS A 1 26  ? 12.760  26.952 -4.538  1.00 19.69  ? 26  LYS A CB  1 
ATOM   138  C CG  . LYS A 1 26  ? 12.454  27.941 -5.576  1.00 19.69  ? 26  LYS A CG  1 
ATOM   139  C CD  . LYS A 1 26  ? 12.126  29.218 -4.955  1.00 19.69  ? 26  LYS A CD  1 
ATOM   140  C CE  . LYS A 1 26  ? 11.520  30.032 -6.043  1.00 19.69  ? 26  LYS A CE  1 
ATOM   141  N NZ  . LYS A 1 26  ? 11.155  31.364 -5.514  1.00 19.69  ? 26  LYS A NZ  1 
ATOM   142  N N   . THR A 1 27  ? 10.535  24.577 -3.809  1.00 19.41  ? 27  THR A N   1 
ATOM   143  C CA  . THR A 1 27  ? 9.481   23.700 -4.287  1.00 19.41  ? 27  THR A CA  1 
ATOM   144  C C   . THR A 1 27  ? 9.020   22.943 -3.047  1.00 19.41  ? 27  THR A C   1 
ATOM   145  O O   . THR A 1 27  ? 9.785   22.821 -2.062  1.00 19.41  ? 27  THR A O   1 
ATOM   146  C CB  . THR A 1 27  ? 9.891   22.734 -5.453  1.00 39.07  ? 27  THR A CB  1 
ATOM   147  O OG1 . THR A 1 27  ? 10.670  21.657 -4.953  1.00 39.07  ? 27  THR A OG1 1 
ATOM   148  C CG2 . THR A 1 27  ? 10.699  23.447 -6.499  1.00 39.07  ? 27  THR A CG2 1 
ATOM   149  N N   . ALA A 1 28  ? 7.739   22.565 -3.042  1.00 20.56  ? 28  ALA A N   1 
ATOM   150  C CA  . ALA A 1 28  ? 7.125   21.865 -1.911  1.00 20.56  ? 28  ALA A CA  1 
ATOM   151  C C   . ALA A 1 28  ? 5.937   21.097 -2.419  1.00 20.56  ? 28  ALA A C   1 
ATOM   152  O O   . ALA A 1 28  ? 5.456   21.376 -3.514  1.00 20.56  ? 28  ALA A O   1 
ATOM   153  C CB  . ALA A 1 28  ? 6.682   22.851 -0.854  1.00 36.31  ? 28  ALA A CB  1 
ATOM   154  N N   . VAL A 1 29  ? 5.508   20.094 -1.661  1.00 32.44  ? 29  VAL A N   1 
ATOM   155  C CA  . VAL A 1 29  ? 4.364   19.274 -2.043  1.00 32.44  ? 29  VAL A CA  1 
ATOM   156  C C   . VAL A 1 29  ? 3.081   19.837 -1.450  1.00 32.44  ? 29  VAL A C   1 
ATOM   157  O O   . VAL A 1 29  ? 3.044   20.223 -0.269  1.00 32.44  ? 29  VAL A O   1 
ATOM   158  C CB  . VAL A 1 29  ? 4.522   17.829 -1.583  1.00 21.89  ? 29  VAL A CB  1 
ATOM   159  C CG1 . VAL A 1 29  ? 3.369   16.995 -2.142  1.00 21.89  ? 29  VAL A CG1 1 
ATOM   160  C CG2 . VAL A 1 29  ? 5.868   17.272 -2.040  1.00 21.89  ? 29  VAL A CG2 1 
ATOM   161  N N   . ASP A 1 30  ? 2.027   19.885 -2.261  1.00 18.74  ? 30  ASP A N   1 
ATOM   162  C CA  . ASP A 1 30  ? 0.753   20.442 -1.804  1.00 18.74  ? 30  ASP A CA  1 
ATOM   163  C C   . ASP A 1 30  ? -0.158  19.331 -1.363  1.00 18.74  ? 30  ASP A C   1 
ATOM   164  O O   . ASP A 1 30  ? 0.178   18.162 -1.519  1.00 18.74  ? 30  ASP A O   1 
ATOM   165  C CB  . ASP A 1 30  ? 0.101   21.349 -2.880  1.00 32.43  ? 30  ASP A CB  1 
ATOM   166  C CG  . ASP A 1 30  ? -0.541  20.577 -4.054  1.00 32.43  ? 30  ASP A CG  1 
ATOM   167  O OD1 . ASP A 1 30  ? -0.572  19.328 -4.074  1.00 32.43  ? 30  ASP A OD1 1 
ATOM   168  O OD2 . ASP A 1 30  ? -1.053  21.243 -4.979  1.00 32.43  ? 30  ASP A OD2 1 
ATOM   169  N N   . MET A 1 31  ? -1.307  19.717 -0.824  1.00 28.43  ? 31  MET A N   1 
ATOM   170  C CA  . MET A 1 31  ? -2.342  18.816 -0.349  1.00 28.43  ? 31  MET A CA  1 
ATOM   171  C C   . MET A 1 31  ? -2.685  17.666 -1.307  1.00 28.43  ? 31  MET A C   1 
ATOM   172  O O   . MET A 1 31  ? -2.710  16.500 -0.898  1.00 28.43  ? 31  MET A O   1 
ATOM   173  C CB  . MET A 1 31  ? -3.591  19.638 -0.056  1.00 50.77  ? 31  MET A CB  1 
ATOM   174  C CG  . MET A 1 31  ? -4.714  18.861 0.589   1.00 50.77  ? 31  MET A CG  1 
ATOM   175  S SD  . MET A 1 31  ? -5.695  19.965 1.582   1.00 50.77  ? 31  MET A SD  1 
ATOM   176  C CE  . MET A 1 31  ? -4.605  20.099 3.006   1.00 50.77  ? 31  MET A CE  1 
ATOM   177  N N   . SER A 1 32  ? -2.911  17.976 -2.583  1.00 53.59  ? 32  SER A N   1 
ATOM   178  C CA  . SER A 1 32  ? -3.255  16.940 -3.566  1.00 53.59  ? 32  SER A CA  1 
ATOM   179  C C   . SER A 1 32  ? -2.117  15.977 -3.938  1.00 53.59  ? 32  SER A C   1 
ATOM   180  O O   . SER A 1 32  ? -2.327  15.030 -4.698  1.00 53.59  ? 32  SER A O   1 
ATOM   181  C CB  . SER A 1 32  ? -3.832  17.574 -4.831  1.00 42.72  ? 32  SER A CB  1 
ATOM   182  O OG  . SER A 1 32  ? -2.873  18.390 -5.483  1.00 42.72  ? 32  SER A OG  1 
ATOM   183  N N   . GLY A 1 33  ? -0.921  16.218 -3.408  1.00 33.61  ? 33  GLY A N   1 
ATOM   184  C CA  . GLY A 1 33  ? 0.213   15.361 -3.687  1.00 33.61  ? 33  GLY A CA  1 
ATOM   185  C C   . GLY A 1 33  ? 1.056   15.890 -4.826  1.00 33.61  ? 33  GLY A C   1 
ATOM   186  O O   . GLY A 1 33  ? 1.938   15.203 -5.309  1.00 33.61  ? 33  GLY A O   1 
ATOM   187  N N   . GLY A 1 34  ? 0.807   17.117 -5.252  1.00 28.02  ? 34  GLY A N   1 
ATOM   188  C CA  . GLY A 1 34  ? 1.587   17.678 -6.338  1.00 28.02  ? 34  GLY A CA  1 
ATOM   189  C C   . GLY A 1 34  ? 2.749   18.555 -5.899  1.00 28.02  ? 34  GLY A C   1 
ATOM   190  O O   . GLY A 1 34  ? 2.821   18.963 -4.747  1.00 28.02  ? 34  GLY A O   1 
ATOM   191  N N   . THR A 1 35  ? 3.683   18.820 -6.804  1.00 27.54  ? 35  THR A N   1 
ATOM   192  C CA  . THR A 1 35  ? 4.838   19.658 -6.501  1.00 27.54  ? 35  THR A CA  1 
ATOM   193  C C   . THR A 1 35  ? 4.532   21.046 -6.996  1.00 27.54  ? 35  THR A C   1 
ATOM   194  O O   . THR A 1 35  ? 4.077   21.228 -8.117  1.00 27.54  ? 35  THR A O   1 
ATOM   195  C CB  . THR A 1 35  ? 6.083   19.156 -7.205  1.00 28.90  ? 35  THR A CB  1 
ATOM   196  O OG1 . THR A 1 35  ? 6.339   17.833 -6.745  1.00 28.90  ? 35  THR A OG1 1 
ATOM   197  C CG2 . THR A 1 35  ? 7.286   20.024 -6.893  1.00 28.90  ? 35  THR A CG2 1 
ATOM   198  N N   . VAL A 1 36  ? 4.831   22.030 -6.174  1.00 16.35  ? 36  VAL A N   1 
ATOM   199  C CA  . VAL A 1 36  ? 4.540   23.376 -6.533  1.00 16.35  ? 36  VAL A CA  1 
ATOM   200  C C   . VAL A 1 36  ? 5.786   24.196 -6.241  1.00 16.35  ? 36  VAL A C   1 
ATOM   201  O O   . VAL A 1 36  ? 6.665   23.722 -5.533  1.00 16.35  ? 36  VAL A O   1 
ATOM   202  C CB  . VAL A 1 36  ? 3.286   23.866 -5.722  1.00 42.91  ? 36  VAL A CB  1 
ATOM   203  C CG1 . VAL A 1 36  ? 2.028   23.076 -6.134  1.00 42.91  ? 36  VAL A CG1 1 
ATOM   204  C CG2 . VAL A 1 36  ? 3.517   23.696 -4.227  1.00 42.91  ? 36  VAL A CG2 1 
ATOM   205  N N   . THR A 1 37  ? 5.879   25.384 -6.835  1.00 11.94  ? 37  THR A N   1 
ATOM   206  C CA  . THR A 1 37  ? 7.003   26.294 -6.652  1.00 11.94  ? 37  THR A CA  1 
ATOM   207  C C   . THR A 1 37  ? 6.523   27.387 -5.708  1.00 11.94  ? 37  THR A C   1 
ATOM   208  O O   . THR A 1 37  ? 5.483   28.010 -5.948  1.00 11.94  ? 37  THR A O   1 
ATOM   209  C CB  . THR A 1 37  ? 7.414   26.948 -8.027  1.00 15.70  ? 37  THR A CB  1 
ATOM   210  O OG1 . THR A 1 37  ? 7.939   25.926 -8.901  1.00 15.70  ? 37  THR A OG1 1 
ATOM   211  C CG2 . THR A 1 37  ? 8.423   28.114 -7.858  1.00 15.70  ? 37  THR A CG2 1 
ATOM   212  N N   . VAL A 1 38  ? 7.277   27.619 -4.642  1.00 19.32  ? 38  VAL A N   1 
ATOM   213  C CA  . VAL A 1 38  ? 6.909   28.618 -3.661  1.00 19.32  ? 38  VAL A CA  1 
ATOM   214  C C   . VAL A 1 38  ? 7.486   29.961 -4.069  1.00 19.32  ? 38  VAL A C   1 
ATOM   215  O O   . VAL A 1 38  ? 8.682   30.067 -4.261  1.00 19.32  ? 38  VAL A O   1 
ATOM   216  C CB  . VAL A 1 38  ? 7.416   28.186 -2.264  1.00 2.00   ? 38  VAL A CB  1 
ATOM   217  C CG1 . VAL A 1 38  ? 7.302   29.328 -1.268  1.00 2.00   ? 38  VAL A CG1 1 
ATOM   218  C CG2 . VAL A 1 38  ? 6.628   27.010 -1.780  1.00 2.00   ? 38  VAL A CG2 1 
ATOM   219  N N   . LEU A 1 39  ? 6.650   30.986 -4.210  1.00 19.49  ? 39  LEU A N   1 
ATOM   220  C CA  . LEU A 1 39  ? 7.142   32.310 -4.615  1.00 19.49  ? 39  LEU A CA  1 
ATOM   221  C C   . LEU A 1 39  ? 7.969   33.056 -3.566  1.00 19.49  ? 39  LEU A C   1 
ATOM   222  O O   . LEU A 1 39  ? 7.881   32.754 -2.388  1.00 19.49  ? 39  LEU A O   1 
ATOM   223  C CB  . LEU A 1 39  ? 5.995   33.183 -5.088  1.00 22.65  ? 39  LEU A CB  1 
ATOM   224  C CG  . LEU A 1 39  ? 5.021   32.517 -6.061  1.00 22.65  ? 39  LEU A CG  1 
ATOM   225  C CD1 . LEU A 1 39  ? 4.174   33.645 -6.592  1.00 22.65  ? 39  LEU A CD1 1 
ATOM   226  C CD2 . LEU A 1 39  ? 5.686   31.756 -7.224  1.00 22.65  ? 39  LEU A CD2 1 
ATOM   227  N N   . GLU A 1 40  ? 8.768   34.027 -4.005  1.00 20.34  ? 40  GLU A N   1 
ATOM   228  C CA  . GLU A 1 40  ? 9.637   34.794 -3.116  1.00 20.34  ? 40  GLU A CA  1 
ATOM   229  C C   . GLU A 1 40  ? 8.893   35.853 -2.330  1.00 20.34  ? 40  GLU A C   1 
ATOM   230  O O   . GLU A 1 40  ? 9.208   36.104 -1.162  1.00 20.34  ? 40  GLU A O   1 
ATOM   231  C CB  . GLU A 1 40  ? 10.772  35.489 -3.901  1.00 64.92  ? 40  GLU A CB  1 
ATOM   232  C CG  . GLU A 1 40  ? 11.825  34.582 -4.551  1.00 64.92  ? 40  GLU A CG  1 
ATOM   233  C CD  . GLU A 1 40  ? 12.800  33.976 -3.549  1.00 64.92  ? 40  GLU A CD  1 
ATOM   234  O OE1 . GLU A 1 40  ? 13.531  34.750 -2.884  1.00 64.92  ? 40  GLU A OE1 1 
ATOM   235  O OE2 . GLU A 1 40  ? 12.836  32.723 -3.425  1.00 64.92  ? 40  GLU A OE2 1 
ATOM   236  N N   . LYS A 1 41  ? 7.914   36.486 -2.968  1.00 33.76  ? 41  LYS A N   1 
ATOM   237  C CA  . LYS A 1 41  ? 7.158   37.576 -2.345  1.00 33.76  ? 41  LYS A CA  1 
ATOM   238  C C   . LYS A 1 41  ? 5.639   37.449 -2.558  1.00 33.76  ? 41  LYS A C   1 
ATOM   239  O O   . LYS A 1 41  ? 5.178   36.890 -3.569  1.00 33.76  ? 41  LYS A O   1 
ATOM   240  C CB  . LYS A 1 41  ? 7.657   38.940 -2.887  1.00 80.13  ? 41  LYS A CB  1 
ATOM   241  C CG  . LYS A 1 41  ? 9.192   39.190 -2.808  1.00 80.13  ? 41  LYS A CG  1 
ATOM   242  C CD  . LYS A 1 41  ? 9.610   40.528 -3.436  1.00 80.13  ? 41  LYS A CD  1 
ATOM   243  C CE  . LYS A 1 41  ? 11.124  40.659 -3.551  1.00 80.13  ? 41  LYS A CE  1 
ATOM   244  N NZ  . LYS A 1 41  ? 11.678  39.599 -4.445  1.00 80.13  ? 41  LYS A NZ  1 
ATOM   245  N N   . VAL A 1 42  ? 4.865   37.893 -1.564  1.00 40.97  ? 42  VAL A N   1 
ATOM   246  C CA  . VAL A 1 42  ? 3.400   37.853 -1.647  1.00 40.97  ? 42  VAL A CA  1 
ATOM   247  C C   . VAL A 1 42  ? 2.881   39.290 -1.738  1.00 40.97  ? 42  VAL A C   1 
ATOM   248  O O   . VAL A 1 42  ? 3.229   40.162 -0.934  1.00 40.97  ? 42  VAL A O   1 
ATOM   249  C CB  . VAL A 1 42  ? 2.719   37.046 -0.477  1.00 36.86  ? 42  VAL A CB  1 
ATOM   250  C CG1 . VAL A 1 42  ? 3.221   35.615 -0.453  1.00 36.86  ? 42  VAL A CG1 1 
ATOM   251  C CG2 . VAL A 1 42  ? 2.986   37.691 0.857   1.00 36.86  ? 42  VAL A CG2 1 
ATOM   252  N N   . PRO A 1 43  ? 2.119   39.573 -2.789  1.00 49.99  ? 43  PRO A N   1 
ATOM   253  C CA  . PRO A 1 43  ? 1.581   40.909 -2.987  1.00 49.99  ? 43  PRO A CA  1 
ATOM   254  C C   . PRO A 1 43  ? 0.446   41.189 -2.040  1.00 49.99  ? 43  PRO A C   1 
ATOM   255  O O   . PRO A 1 43  ? -0.455  40.359 -1.847  1.00 49.99  ? 43  PRO A O   1 
ATOM   256  C CB  . PRO A 1 43  ? 1.091   40.868 -4.431  1.00 47.06  ? 43  PRO A CB  1 
ATOM   257  C CG  . PRO A 1 43  ? 1.814   39.677 -5.024  1.00 47.06  ? 43  PRO A CG  1 
ATOM   258  C CD  . PRO A 1 43  ? 1.754   38.704 -3.913  1.00 47.06  ? 43  PRO A CD  1 
ATOM   259  N N   . VAL A 1 44  ? 0.518   42.366 -1.443  1.00 86.93  ? 44  VAL A N   1 
ATOM   260  C CA  . VAL A 1 44  ? -0.481  42.839 -0.516  1.00 86.93  ? 44  VAL A CA  1 
ATOM   261  C C   . VAL A 1 44  ? -0.708  44.286 -0.918  1.00 86.93  ? 44  VAL A C   1 
ATOM   262  O O   . VAL A 1 44  ? 0.144   44.893 -1.569  1.00 86.93  ? 44  VAL A O   1 
ATOM   263  C CB  . VAL A 1 44  ? 0.025   42.751 0.961   1.00 36.32  ? 44  VAL A CB  1 
ATOM   264  C CG1 . VAL A 1 44  ? 0.181   41.306 1.359   1.00 36.32  ? 44  VAL A CG1 1 
ATOM   265  C CG2 . VAL A 1 44  ? 1.372   43.484 1.149   1.00 36.32  ? 44  VAL A CG2 1 
ATOM   266  N N   . SER A 1 45  ? -1.885  44.820 -0.640  1.00 108.71 ? 45  SER A N   1 
ATOM   267  C CA  . SER A 1 45  ? -2.100  46.213 -0.969  1.00 108.71 ? 45  SER A CA  1 
ATOM   268  C C   . SER A 1 45  ? -1.090  46.937 -0.070  1.00 108.71 ? 45  SER A C   1 
ATOM   269  O O   . SER A 1 45  ? -0.832  46.494 1.056   1.00 108.71 ? 45  SER A O   1 
ATOM   270  C CB  . SER A 1 45  ? -3.530  46.636 -0.640  1.00 147.70 ? 45  SER A CB  1 
ATOM   271  O OG  . SER A 1 45  ? -3.826  47.883 -1.241  1.00 147.70 ? 45  SER A OG  1 
ATOM   272  N N   . LYS A 1 46  ? -0.474  47.989 -0.605  1.00 97.97  ? 46  LYS A N   1 
ATOM   273  C CA  . LYS A 1 46  ? 0.537   48.798 0.090   1.00 97.97  ? 46  LYS A CA  1 
ATOM   274  C C   . LYS A 1 46  ? 1.956   48.273 -0.122  1.00 97.97  ? 46  LYS A C   1 
ATOM   275  O O   . LYS A 1 46  ? 2.919   48.909 0.294   1.00 97.97  ? 46  LYS A O   1 
ATOM   276  C CB  . LYS A 1 46  ? 0.254   48.934 1.599   1.00 102.93 ? 46  LYS A CB  1 
ATOM   277  C CG  . LYS A 1 46  ? -0.987  49.745 1.962   1.00 102.93 ? 46  LYS A CG  1 
ATOM   278  C CD  . LYS A 1 46  ? -1.332  49.564 3.434   1.00 102.93 ? 46  LYS A CD  1 
ATOM   279  C CE  . LYS A 1 46  ? -2.591  50.315 3.818   1.00 102.93 ? 46  LYS A CE  1 
ATOM   280  N NZ  . LYS A 1 46  ? -2.934  50.039 5.237   1.00 102.93 ? 46  LYS A NZ  1 
ATOM   281  N N   . GLY A 1 47  ? 2.097   47.113 -0.749  1.00 47.50  ? 47  GLY A N   1 
ATOM   282  C CA  . GLY A 1 47  ? 3.431   46.590 -0.987  1.00 47.50  ? 47  GLY A CA  1 
ATOM   283  C C   . GLY A 1 47  ? 3.543   45.091 -1.190  1.00 47.50  ? 47  GLY A C   1 
ATOM   284  O O   . GLY A 1 47  ? 2.695   44.467 -1.821  1.00 47.50  ? 47  GLY A O   1 
ATOM   285  N N   . GLN A 1 48  ? 4.634   44.525 -0.691  1.00 61.30  ? 48  GLN A N   1 
ATOM   286  C CA  . GLN A 1 48  ? 4.892   43.095 -0.799  1.00 61.30  ? 48  GLN A CA  1 
ATOM   287  C C   . GLN A 1 48  ? 5.537   42.578 0.477   1.00 61.30  ? 48  GLN A C   1 
ATOM   288  O O   . GLN A 1 48  ? 6.269   43.307 1.138   1.00 61.30  ? 48  GLN A O   1 
ATOM   289  C CB  . GLN A 1 48  ? 5.814   42.809 -1.978  1.00 73.12  ? 48  GLN A CB  1 
ATOM   290  C CG  . GLN A 1 48  ? 5.131   42.926 -3.313  1.00 73.12  ? 48  GLN A CG  1 
ATOM   291  C CD  . GLN A 1 48  ? 6.020   42.495 -4.458  1.00 73.12  ? 48  GLN A CD  1 
ATOM   292  O OE1 . GLN A 1 48  ? 6.964   43.198 -4.830  1.00 73.12  ? 48  GLN A OE1 1 
ATOM   293  N NE2 . GLN A 1 48  ? 5.737   41.323 -5.017  1.00 73.12  ? 48  GLN A NE2 1 
ATOM   294  N N   . LEU A 1 49  ? 5.230   41.336 0.843   1.00 88.65  ? 49  LEU A N   1 
ATOM   295  C CA  . LEU A 1 49  ? 5.802   40.709 2.042   1.00 88.65  ? 49  LEU A CA  1 
ATOM   296  C C   . LEU A 1 49  ? 6.686   39.551 1.568   1.00 88.65  ? 49  LEU A C   1 
ATOM   297  O O   . LEU A 1 49  ? 6.419   38.965 0.519   1.00 88.65  ? 49  LEU A O   1 
ATOM   298  C CB  . LEU A 1 49  ? 4.692   40.134 2.956   1.00 42.49  ? 49  LEU A CB  1 
ATOM   299  C CG  . LEU A 1 49  ? 3.518   40.940 3.518   1.00 42.49  ? 49  LEU A CG  1 
ATOM   300  C CD1 . LEU A 1 49  ? 2.546   39.995 4.151   1.00 42.49  ? 49  LEU A CD1 1 
ATOM   301  C CD2 . LEU A 1 49  ? 3.998   41.963 4.512   1.00 42.49  ? 49  LEU A CD2 1 
ATOM   302  N N   . LYS A 1 50  ? 7.741   39.231 2.313   1.00 40.79  ? 50  LYS A N   1 
ATOM   303  C CA  . LYS A 1 50  ? 8.602   38.109 1.930   1.00 40.79  ? 50  LYS A CA  1 
ATOM   304  C C   . LYS A 1 50  ? 7.999   36.824 2.540   1.00 40.79  ? 50  LYS A C   1 
ATOM   305  O O   . LYS A 1 50  ? 7.449   36.868 3.635   1.00 40.79  ? 50  LYS A O   1 
ATOM   306  C CB  . LYS A 1 50  ? 10.051  38.341 2.401   1.00 63.87  ? 50  LYS A CB  1 
ATOM   307  C CG  . LYS A 1 50  ? 11.099  37.582 1.577   1.00 63.87  ? 50  LYS A CG  1 
ATOM   308  C CD  . LYS A 1 50  ? 12.530  37.896 2.013   1.00 63.87  ? 50  LYS A CD  1 
ATOM   309  C CE  . LYS A 1 50  ? 12.949  39.344 1.696   1.00 63.87  ? 50  LYS A CE  1 
ATOM   310  N NZ  . LYS A 1 50  ? 13.403  39.562 0.282   1.00 63.87  ? 50  LYS A NZ  1 
ATOM   311  N N   . GLN A 1 51  ? 7.980   35.723 1.785   1.00 20.53  ? 51  GLN A N   1 
ATOM   312  C CA  . GLN A 1 51  ? 7.455   34.442 2.292   1.00 20.53  ? 51  GLN A CA  1 
ATOM   313  C C   . GLN A 1 51  ? 8.536   33.731 3.102   1.00 20.53  ? 51  GLN A C   1 
ATOM   314  O O   . GLN A 1 51  ? 9.635   33.533 2.607   1.00 20.53  ? 51  GLN A O   1 
ATOM   315  C CB  . GLN A 1 51  ? 6.999   33.511 1.158   1.00 25.73  ? 51  GLN A CB  1 
ATOM   316  C CG  . GLN A 1 51  ? 5.621   33.800 0.625   1.00 25.73  ? 51  GLN A CG  1 
ATOM   317  C CD  . GLN A 1 51  ? 4.962   32.604 -0.093  1.00 25.73  ? 51  GLN A CD  1 
ATOM   318  O OE1 . GLN A 1 51  ? 4.017   31.970 0.434   1.00 25.73  ? 51  GLN A OE1 1 
ATOM   319  N NE2 . GLN A 1 51  ? 5.439   32.305 -1.302  1.00 25.73  ? 51  GLN A NE2 1 
ATOM   320  N N   . TYR A 1 52  ? 8.232   33.440 4.365   1.00 20.16  ? 52  TYR A N   1 
ATOM   321  C CA  . TYR A 1 52  ? 9.101   32.718 5.291   1.00 20.16  ? 52  TYR A CA  1 
ATOM   322  C C   . TYR A 1 52  ? 8.205   31.673 5.867   1.00 20.16  ? 52  TYR A C   1 
ATOM   323  O O   . TYR A 1 52  ? 6.977   31.851 5.896   1.00 20.16  ? 52  TYR A O   1 
ATOM   324  C CB  . TYR A 1 52  ? 9.488   33.555 6.473   1.00 26.18  ? 52  TYR A CB  1 
ATOM   325  C CG  . TYR A 1 52  ? 10.508  34.573 6.192   1.00 26.18  ? 52  TYR A CG  1 
ATOM   326  C CD1 . TYR A 1 52  ? 11.863  34.236 6.198   1.00 26.18  ? 52  TYR A CD1 1 
ATOM   327  C CD2 . TYR A 1 52  ? 10.135  35.897 5.960   1.00 26.18  ? 52  TYR A CD2 1 
ATOM   328  C CE1 . TYR A 1 52  ? 12.830  35.196 5.991   1.00 26.18  ? 52  TYR A CE1 1 
ATOM   329  C CE2 . TYR A 1 52  ? 11.071  36.863 5.747   1.00 26.18  ? 52  TYR A CE2 1 
ATOM   330  C CZ  . TYR A 1 52  ? 12.429  36.520 5.771   1.00 26.18  ? 52  TYR A CZ  1 
ATOM   331  O OH  . TYR A 1 52  ? 13.386  37.528 5.651   1.00 26.18  ? 52  TYR A OH  1 
ATOM   332  N N   . PHE A 1 53  ? 8.807   30.600 6.350   1.00 15.95  ? 53  PHE A N   1 
ATOM   333  C CA  . PHE A 1 53  ? 8.074   29.529 6.979   1.00 15.95  ? 53  PHE A CA  1 
ATOM   334  C C   . PHE A 1 53  ? 8.748   29.275 8.284   1.00 15.95  ? 53  PHE A C   1 
ATOM   335  O O   . PHE A 1 53  ? 9.947   29.508 8.434   1.00 15.95  ? 53  PHE A O   1 
ATOM   336  C CB  . PHE A 1 53  ? 8.070   28.307 6.104   1.00 32.59  ? 53  PHE A CB  1 
ATOM   337  C CG  . PHE A 1 53  ? 7.335   28.525 4.837   1.00 32.59  ? 53  PHE A CG  1 
ATOM   338  C CD1 . PHE A 1 53  ? 5.938   28.665 4.848   1.00 32.59  ? 53  PHE A CD1 1 
ATOM   339  C CD2 . PHE A 1 53  ? 8.016   28.678 3.638   1.00 32.59  ? 53  PHE A CD2 1 
ATOM   340  C CE1 . PHE A 1 53  ? 5.240   28.956 3.690   1.00 32.59  ? 53  PHE A CE1 1 
ATOM   341  C CE2 . PHE A 1 53  ? 7.317   28.971 2.473   1.00 32.59  ? 53  PHE A CE2 1 
ATOM   342  C CZ  . PHE A 1 53  ? 5.930   29.111 2.502   1.00 32.59  ? 53  PHE A CZ  1 
ATOM   343  N N   . TYR A 1 54  ? 7.968   28.862 9.262   1.00 10.24  ? 54  TYR A N   1 
ATOM   344  C CA  . TYR A 1 54  ? 8.497   28.615 10.586  1.00 10.24  ? 54  TYR A CA  1 
ATOM   345  C C   . TYR A 1 54  ? 8.541   27.137 10.786  1.00 10.24  ? 54  TYR A C   1 
ATOM   346  O O   . TYR A 1 54  ? 7.527   26.546 11.126  1.00 10.24  ? 54  TYR A O   1 
ATOM   347  C CB  . TYR A 1 54  ? 7.593   29.269 11.621  1.00 25.40  ? 54  TYR A CB  1 
ATOM   348  C CG  . TYR A 1 54  ? 8.110   29.153 13.026  1.00 25.40  ? 54  TYR A CG  1 
ATOM   349  C CD1 . TYR A 1 54  ? 9.108   30.004 13.499  1.00 25.40  ? 54  TYR A CD1 1 
ATOM   350  C CD2 . TYR A 1 54  ? 7.581   28.195 13.907  1.00 25.40  ? 54  TYR A CD2 1 
ATOM   351  C CE1 . TYR A 1 54  ? 9.560   29.904 14.815  1.00 25.40  ? 54  TYR A CE1 1 
ATOM   352  C CE2 . TYR A 1 54  ? 8.021   28.089 15.202  1.00 25.40  ? 54  TYR A CE2 1 
ATOM   353  C CZ  . TYR A 1 54  ? 9.001   28.940 15.657  1.00 25.40  ? 54  TYR A CZ  1 
ATOM   354  O OH  . TYR A 1 54  ? 9.401   28.844 16.974  1.00 25.40  ? 54  TYR A OH  1 
ATOM   355  N N   . GLU A 1 55  ? 9.682   26.502 10.546  1.00 17.24  ? 55  GLU A N   1 
ATOM   356  C CA  . GLU A 1 55  ? 9.682   25.061 10.751  1.00 17.24  ? 55  GLU A CA  1 
ATOM   357  C C   . GLU A 1 55  ? 10.351  24.555 12.007  1.00 17.24  ? 55  GLU A C   1 
ATOM   358  O O   . GLU A 1 55  ? 11.269  25.158 12.519  1.00 17.24  ? 55  GLU A O   1 
ATOM   359  C CB  . GLU A 1 55  ? 10.048  24.260 9.500   1.00 35.52  ? 55  GLU A CB  1 
ATOM   360  C CG  . GLU A 1 55  ? 11.367  24.498 8.867   1.00 35.52  ? 55  GLU A CG  1 
ATOM   361  C CD  . GLU A 1 55  ? 11.521  23.649 7.620   1.00 35.52  ? 55  GLU A CD  1 
ATOM   362  O OE1 . GLU A 1 55  ? 10.510  23.511 6.886   1.00 35.52  ? 55  GLU A OE1 1 
ATOM   363  O OE2 . GLU A 1 55  ? 12.625  23.094 7.387   1.00 35.52  ? 55  GLU A OE2 1 
ATOM   364  N N   . THR A 1 56  ? 9.809   23.466 12.519  1.00 10.04  ? 56  THR A N   1 
ATOM   365  C CA  . THR A 1 56  ? 10.246  22.842 13.743  1.00 10.04  ? 56  THR A CA  1 
ATOM   366  C C   . THR A 1 56  ? 10.493  21.389 13.403  1.00 10.04  ? 56  THR A C   1 
ATOM   367  O O   . THR A 1 56  ? 9.608   20.754 12.845  1.00 10.04  ? 56  THR A O   1 
ATOM   368  C CB  . THR A 1 56  ? 9.100   22.916 14.773  1.00 10.65  ? 56  THR A CB  1 
ATOM   369  O OG1 . THR A 1 56  ? 8.773   24.302 15.001  1.00 10.65  ? 56  THR A OG1 1 
ATOM   370  C CG2 . THR A 1 56  ? 9.470   22.220 16.061  1.00 10.65  ? 56  THR A CG2 1 
ATOM   371  N N   . LYS A 1 57  ? 11.672  20.853 13.720  1.00 20.41  ? 57  LYS A N   1 
ATOM   372  C CA  . LYS A 1 57  ? 11.949  19.454 13.409  1.00 20.41  ? 57  LYS A CA  1 
ATOM   373  C C   . LYS A 1 57  ? 12.662  18.848 14.586  1.00 20.41  ? 57  LYS A C   1 
ATOM   374  O O   . LYS A 1 57  ? 12.981  19.569 15.515  1.00 20.41  ? 57  LYS A O   1 
ATOM   375  C CB  . LYS A 1 57  ? 12.785  19.308 12.132  1.00 34.04  ? 57  LYS A CB  1 
ATOM   376  C CG  . LYS A 1 57  ? 13.978  20.229 12.000  1.00 34.04  ? 57  LYS A CG  1 
ATOM   377  C CD  . LYS A 1 57  ? 14.570  20.045 10.607  1.00 34.04  ? 57  LYS A CD  1 
ATOM   378  C CE  . LYS A 1 57  ? 15.528  21.165 10.180  1.00 34.04  ? 57  LYS A CE  1 
ATOM   379  N NZ  . LYS A 1 57  ? 15.854  21.049 8.698   1.00 34.04  ? 57  LYS A NZ  1 
ATOM   380  N N   . CYS A 1 58  ? 12.815  17.524 14.600  1.00 30.78  ? 58  CYS A N   1 
ATOM   381  C CA  . CYS A 1 58  ? 13.532  16.876 15.689  1.00 30.78  ? 58  CYS A CA  1 
ATOM   382  C C   . CYS A 1 58  ? 14.982  17.368 15.643  1.00 30.78  ? 58  CYS A C   1 
ATOM   383  O O   . CYS A 1 58  ? 15.573  17.524 14.567  1.00 30.78  ? 58  CYS A O   1 
ATOM   384  C CB  . CYS A 1 58  ? 13.506  15.350 15.581  1.00 15.42  ? 58  CYS A CB  1 
ATOM   385  S SG  . CYS A 1 58  ? 11.920  14.525 15.972  1.00 15.42  ? 58  CYS A SG  1 
ATOM   386  N N   . ASN A 1 59  ? 15.533  17.622 16.823  1.00 33.02  ? 59  ASN A N   1 
ATOM   387  C CA  . ASN A 1 59  ? 16.884  18.123 16.979  1.00 33.02  ? 59  ASN A CA  1 
ATOM   388  C C   . ASN A 1 59  ? 17.932  17.041 16.774  1.00 33.02  ? 59  ASN A C   1 
ATOM   389  O O   . ASN A 1 59  ? 18.018  16.075 17.538  1.00 33.02  ? 59  ASN A O   1 
ATOM   390  C CB  . ASN A 1 59  ? 17.040  18.718 18.364  1.00 26.61  ? 59  ASN A CB  1 
ATOM   391  C CG  . ASN A 1 59  ? 18.233  19.605 18.482  1.00 26.61  ? 59  ASN A CG  1 
ATOM   392  O OD1 . ASN A 1 59  ? 19.261  19.378 17.854  1.00 26.61  ? 59  ASN A OD1 1 
ATOM   393  N ND2 . ASN A 1 59  ? 18.107  20.631 19.292  1.00 26.61  ? 59  ASN A ND2 1 
ATOM   394  N N   . PRO A 1 60  ? 18.774  17.218 15.754  1.00 45.46  ? 60  PRO A N   1 
ATOM   395  C CA  . PRO A 1 60  ? 19.811  16.230 15.483  1.00 45.46  ? 60  PRO A CA  1 
ATOM   396  C C   . PRO A 1 60  ? 20.995  16.354 16.463  1.00 45.46  ? 60  PRO A C   1 
ATOM   397  O O   . PRO A 1 60  ? 21.806  15.437 16.569  1.00 45.46  ? 60  PRO A O   1 
ATOM   398  C CB  . PRO A 1 60  ? 20.174  16.537 14.035  1.00 30.04  ? 60  PRO A CB  1 
ATOM   399  C CG  . PRO A 1 60  ? 20.015  18.049 13.952  1.00 30.04  ? 60  PRO A CG  1 
ATOM   400  C CD  . PRO A 1 60  ? 18.795  18.335 14.782  1.00 30.04  ? 60  PRO A CD  1 
ATOM   401  N N   . MET A 1 61  ? 21.097  17.487 17.164  1.00 55.49  ? 61  MET A N   1 
ATOM   402  C CA  . MET A 1 61  ? 22.157  17.707 18.156  1.00 55.49  ? 61  MET A CA  1 
ATOM   403  C C   . MET A 1 61  ? 21.523  17.681 19.566  1.00 55.49  ? 61  MET A C   1 
ATOM   404  O O   . MET A 1 61  ? 21.894  18.485 20.434  1.00 55.49  ? 61  MET A O   1 
ATOM   405  C CB  . MET A 1 61  ? 22.807  19.089 17.981  1.00 87.89  ? 61  MET A CB  1 
ATOM   406  C CG  . MET A 1 61  ? 23.506  19.409 16.674  1.00 87.89  ? 61  MET A CG  1 
ATOM   407  S SD  . MET A 1 61  ? 23.989  21.180 16.751  1.00 87.89  ? 61  MET A SD  1 
ATOM   408  C CE  . MET A 1 61  ? 22.375  22.033 16.398  1.00 87.89  ? 61  MET A CE  1 
ATOM   409  N N   . GLY A 1 62  ? 20.586  16.762 19.807  1.00 37.45  ? 62  GLY A N   1 
ATOM   410  C CA  . GLY A 1 62  ? 19.906  16.715 21.094  1.00 37.45  ? 62  GLY A CA  1 
ATOM   411  C C   . GLY A 1 62  ? 20.034  15.435 21.893  1.00 37.45  ? 62  GLY A C   1 
ATOM   412  O O   . GLY A 1 62  ? 20.730  14.499 21.497  1.00 37.45  ? 62  GLY A O   1 
ATOM   413  N N   . TYR A 1 63  ? 19.249  15.345 22.961  1.00 20.41  ? 63  TYR A N   1 
ATOM   414  C CA  . TYR A 1 63  ? 19.327  14.210 23.869  1.00 20.41  ? 63  TYR A CA  1 
ATOM   415  C C   . TYR A 1 63  ? 18.334  13.083 23.747  1.00 20.41  ? 63  TYR A C   1 
ATOM   416  O O   . TYR A 1 63  ? 18.406  12.108 24.509  1.00 20.41  ? 63  TYR A O   1 
ATOM   417  C CB  . TYR A 1 63  ? 19.342  14.720 25.298  1.00 18.61  ? 63  TYR A CB  1 
ATOM   418  C CG  . TYR A 1 63  ? 20.540  15.575 25.562  1.00 18.61  ? 63  TYR A CG  1 
ATOM   419  C CD1 . TYR A 1 63  ? 21.740  14.988 25.976  1.00 18.61  ? 63  TYR A CD1 1 
ATOM   420  C CD2 . TYR A 1 63  ? 20.507  16.973 25.340  1.00 18.61  ? 63  TYR A CD2 1 
ATOM   421  C CE1 . TYR A 1 63  ? 22.884  15.751 26.162  1.00 18.61  ? 63  TYR A CE1 1 
ATOM   422  C CE2 . TYR A 1 63  ? 21.650  17.756 25.524  1.00 18.61  ? 63  TYR A CE2 1 
ATOM   423  C CZ  . TYR A 1 63  ? 22.838  17.122 25.937  1.00 18.61  ? 63  TYR A CZ  1 
ATOM   424  O OH  . TYR A 1 63  ? 24.004  17.827 26.127  1.00 18.61  ? 63  TYR A OH  1 
ATOM   425  N N   . THR A 1 64  ? 17.428  13.196 22.782  1.00 38.96  ? 64  THR A N   1 
ATOM   426  C CA  . THR A 1 64  ? 16.410  12.179 22.583  1.00 38.96  ? 64  THR A CA  1 
ATOM   427  C C   . THR A 1 64  ? 16.535  11.451 21.249  1.00 38.96  ? 64  THR A C   1 
ATOM   428  O O   . THR A 1 64  ? 15.537  11.163 20.603  1.00 38.96  ? 64  THR A O   1 
ATOM   429  C CB  . THR A 1 64  ? 14.973  12.766 22.805  1.00 24.19  ? 64  THR A CB  1 
ATOM   430  O OG1 . THR A 1 64  ? 14.692  13.840 21.877  1.00 24.19  ? 64  THR A OG1 1 
ATOM   431  C CG2 . THR A 1 64  ? 14.845  13.312 24.252  1.00 24.19  ? 64  THR A CG2 1 
ATOM   432  N N   . LYS A 1 65  ? 17.765  11.166 20.831  1.00 38.21  ? 65  LYS A N   1 
ATOM   433  C CA  . LYS A 1 65  ? 18.005  10.432 19.588  1.00 38.21  ? 65  LYS A CA  1 
ATOM   434  C C   . LYS A 1 65  ? 17.775  8.937  19.786  1.00 38.21  ? 65  LYS A C   1 
ATOM   435  O O   . LYS A 1 65  ? 17.327  8.253  18.870  1.00 38.21  ? 65  LYS A O   1 
ATOM   436  C CB  . LYS A 1 65  ? 19.426  10.651 19.092  1.00 45.66  ? 65  LYS A CB  1 
ATOM   437  C CG  . LYS A 1 65  ? 19.602  11.916 18.329  1.00 45.66  ? 65  LYS A CG  1 
ATOM   438  C CD  . LYS A 1 65  ? 21.044  12.098 17.911  1.00 45.66  ? 65  LYS A CD  1 
ATOM   439  C CE  . LYS A 1 65  ? 21.908  12.591 19.088  1.00 45.66  ? 65  LYS A CE  1 
ATOM   440  N NZ  . LYS A 1 65  ? 23.176  13.268 18.636  1.00 45.66  ? 65  LYS A NZ  1 
ATOM   441  N N   . GLU A 1 66  ? 18.057  8.451  20.998  1.00 31.96  ? 66  GLU A N   1 
ATOM   442  C CA  . GLU A 1 66  ? 17.914  7.041  21.361  1.00 31.96  ? 66  GLU A CA  1 
ATOM   443  C C   . GLU A 1 66  ? 16.470  6.650  21.632  1.00 31.96  ? 66  GLU A C   1 
ATOM   444  O O   . GLU A 1 66  ? 16.076  5.503  21.452  1.00 31.96  ? 66  GLU A O   1 
ATOM   445  C CB  . GLU A 1 66  ? 18.727  6.736  22.631  1.00 89.57  ? 66  GLU A CB  1 
ATOM   446  C CG  . GLU A 1 66  ? 20.199  7.146  22.596  1.00 89.57  ? 66  GLU A CG  1 
ATOM   447  C CD  . GLU A 1 66  ? 21.012  6.308  21.640  1.00 89.57  ? 66  GLU A CD  1 
ATOM   448  O OE1 . GLU A 1 66  ? 21.024  5.071  21.810  1.00 89.57  ? 66  GLU A OE1 1 
ATOM   449  O OE2 . GLU A 1 66  ? 21.628  6.887  20.717  1.00 89.57  ? 66  GLU A OE2 1 
ATOM   450  N N   . GLY A 1 67  ? 15.719  7.568  22.209  1.00 22.08  ? 67  GLY A N   1 
ATOM   451  C CA  . GLY A 1 67  ? 14.336  7.286  22.516  1.00 22.08  ? 67  GLY A CA  1 
ATOM   452  C C   . GLY A 1 67  ? 13.798  8.537  23.144  1.00 22.08  ? 67  GLY A C   1 
ATOM   453  O O   . GLY A 1 67  ? 14.563  9.454  23.433  1.00 22.08  ? 67  GLY A O   1 
ATOM   454  N N   . CYS A 1 68  ? 12.492  8.638  23.293  1.00 15.16  ? 68  CYS A N   1 
ATOM   455  C CA  . CYS A 1 68  ? 11.958  9.826  23.935  1.00 15.16  ? 68  CYS A CA  1 
ATOM   456  C C   . CYS A 1 68  ? 12.206  9.751  25.448  1.00 15.16  ? 68  CYS A C   1 
ATOM   457  O O   . CYS A 1 68  ? 12.326  8.668  26.011  1.00 15.16  ? 68  CYS A O   1 
ATOM   458  C CB  . CYS A 1 68  ? 10.468  9.941  23.682  1.00 21.70  ? 68  CYS A CB  1 
ATOM   459  S SG  . CYS A 1 68  ? 9.884   9.207  22.150  1.00 21.70  ? 68  CYS A SG  1 
ATOM   460  N N   . ARG A 1 69  ? 12.309  10.917 26.073  1.00 24.19  ? 69  ARG A N   1 
ATOM   461  C CA  . ARG A 1 69  ? 12.518  11.073 27.512  1.00 24.19  ? 69  ARG A CA  1 
ATOM   462  C C   . ARG A 1 69  ? 11.376  10.500 28.327  1.00 24.19  ? 69  ARG A C   1 
ATOM   463  O O   . ARG A 1 69  ? 10.244  10.494 27.877  1.00 24.19  ? 69  ARG A O   1 
ATOM   464  C CB  . ARG A 1 69  ? 12.564  12.553 27.844  1.00 22.56  ? 69  ARG A CB  1 
ATOM   465  C CG  . ARG A 1 69  ? 13.909  13.044 28.050  1.00 22.56  ? 69  ARG A CG  1 
ATOM   466  C CD  . ARG A 1 69  ? 13.851  14.386 28.662  1.00 22.56  ? 69  ARG A CD  1 
ATOM   467  N NE  . ARG A 1 69  ? 13.645  15.383 27.632  1.00 22.56  ? 69  ARG A NE  1 
ATOM   468  C CZ  . ARG A 1 69  ? 14.600  15.822 26.822  1.00 22.56  ? 69  ARG A CZ  1 
ATOM   469  N NH1 . ARG A 1 69  ? 15.845  15.376 26.916  1.00 22.56  ? 69  ARG A NH1 1 
ATOM   470  N NH2 . ARG A 1 69  ? 14.306  16.725 25.924  1.00 22.56  ? 69  ARG A NH2 1 
ATOM   471  N N   . GLY A 1 70  ? 11.673  10.020 29.527  1.00 31.37  ? 70  GLY A N   1 
ATOM   472  C CA  . GLY A 1 70  ? 10.627  9.529  30.415  1.00 31.37  ? 70  GLY A CA  1 
ATOM   473  C C   . GLY A 1 70  ? 9.773   8.333  30.057  1.00 31.37  ? 70  GLY A C   1 
ATOM   474  O O   . GLY A 1 70  ? 8.917   7.943  30.839  1.00 31.37  ? 70  GLY A O   1 
ATOM   475  N N   . ILE A 1 71  ? 9.990   7.735  28.901  1.00 22.34  ? 71  ILE A N   1 
ATOM   476  C CA  . ILE A 1 71  ? 9.215   6.572  28.522  1.00 22.34  ? 71  ILE A CA  1 
ATOM   477  C C   . ILE A 1 71  ? 9.539   5.415  29.470  1.00 22.34  ? 71  ILE A C   1 
ATOM   478  O O   . ILE A 1 71  ? 10.624  5.357  30.046  1.00 22.34  ? 71  ILE A O   1 
ATOM   479  C CB  . ILE A 1 71  ? 9.502   6.188  27.054  1.00 17.72  ? 71  ILE A CB  1 
ATOM   480  C CG1 . ILE A 1 71  ? 8.849   7.228  26.134  1.00 17.72  ? 71  ILE A CG1 1 
ATOM   481  C CG2 . ILE A 1 71  ? 9.041   4.786  26.746  1.00 17.72  ? 71  ILE A CG2 1 
ATOM   482  C CD1 . ILE A 1 71  ? 7.436   7.599  26.524  1.00 17.72  ? 71  ILE A CD1 1 
ATOM   483  N N   . ASP A 1 72  ? 8.568   4.534  29.676  1.00 29.64  ? 72  ASP A N   1 
ATOM   484  C CA  . ASP A 1 72  ? 8.708   3.373  30.540  1.00 29.64  ? 72  ASP A CA  1 
ATOM   485  C C   . ASP A 1 72  ? 9.408   2.240  29.769  1.00 29.64  ? 72  ASP A C   1 
ATOM   486  O O   . ASP A 1 72  ? 8.749   1.405  29.150  1.00 29.64  ? 72  ASP A O   1 
ATOM   487  C CB  . ASP A 1 72  ? 7.307   2.944  31.001  1.00 42.66  ? 72  ASP A CB  1 
ATOM   488  C CG  . ASP A 1 72  ? 7.314   1.735  31.924  1.00 42.66  ? 72  ASP A CG  1 
ATOM   489  O OD1 . ASP A 1 72  ? 8.381   1.149  32.177  1.00 42.66  ? 72  ASP A OD1 1 
ATOM   490  O OD2 . ASP A 1 72  ? 6.224   1.368  32.406  1.00 42.66  ? 72  ASP A OD2 1 
ATOM   491  N N   . LYS A 1 73  ? 10.733  2.175  29.892  1.00 27.66  ? 73  LYS A N   1 
ATOM   492  C CA  . LYS A 1 73  ? 11.570  1.182  29.218  1.00 27.66  ? 73  LYS A CA  1 
ATOM   493  C C   . LYS A 1 73  ? 11.160  -0.269 29.494  1.00 27.66  ? 73  LYS A C   1 
ATOM   494  O O   . LYS A 1 73  ? 11.480  -1.166 28.705  1.00 27.66  ? 73  LYS A O   1 
ATOM   495  C CB  . LYS A 1 73  ? 13.026  1.374  29.635  1.00 50.97  ? 73  LYS A CB  1 
ATOM   496  C CG  . LYS A 1 73  ? 13.450  2.826  29.819  1.00 50.97  ? 73  LYS A CG  1 
ATOM   497  C CD  . LYS A 1 73  ? 13.715  3.511  28.498  1.00 50.97  ? 73  LYS A CD  1 
ATOM   498  C CE  . LYS A 1 73  ? 15.060  3.096  27.925  1.00 50.97  ? 73  LYS A CE  1 
ATOM   499  N NZ  . LYS A 1 73  ? 16.181  3.508  28.818  1.00 50.97  ? 73  LYS A NZ  1 
ATOM   500  N N   . ARG A 1 74  ? 10.459  -0.510 30.600  1.00 44.60  ? 74  ARG A N   1 
ATOM   501  C CA  . ARG A 1 74  ? 10.017  -1.874 30.940  1.00 44.60  ? 74  ARG A CA  1 
ATOM   502  C C   . ARG A 1 74  ? 9.028   -2.521 29.906  1.00 44.60  ? 74  ARG A C   1 
ATOM   503  O O   . ARG A 1 74  ? 9.072   -3.739 29.671  1.00 44.60  ? 74  ARG A O   1 
ATOM   504  C CB  . ARG A 1 74  ? 9.369   -1.897 32.345  1.00 66.39  ? 74  ARG A CB  1 
ATOM   505  C CG  . ARG A 1 74  ? 10.120  -1.148 33.461  1.00 66.39  ? 74  ARG A CG  1 
ATOM   506  C CD  . ARG A 1 74  ? 9.145   -0.587 34.530  1.00 66.39  ? 74  ARG A CD  1 
ATOM   507  N NE  . ARG A 1 74  ? 8.403   -1.626 35.241  1.00 66.39  ? 74  ARG A NE  1 
ATOM   508  C CZ  . ARG A 1 74  ? 7.291   -1.429 35.953  1.00 66.39  ? 74  ARG A CZ  1 
ATOM   509  N NH1 . ARG A 1 74  ? 6.753   -0.219 36.064  1.00 66.39  ? 74  ARG A NH1 1 
ATOM   510  N NH2 . ARG A 1 74  ? 6.720   -2.454 36.580  1.00 66.39  ? 74  ARG A NH2 1 
ATOM   511  N N   . HIS A 1 75  ? 8.156   -1.701 29.297  1.00 38.84  ? 75  HIS A N   1 
ATOM   512  C CA  . HIS A 1 75  ? 7.128   -2.154 28.353  1.00 38.84  ? 75  HIS A CA  1 
ATOM   513  C C   . HIS A 1 75  ? 7.218   -1.657 26.908  1.00 38.84  ? 75  HIS A C   1 
ATOM   514  O O   . HIS A 1 75  ? 6.597   -2.267 26.011  1.00 38.84  ? 75  HIS A O   1 
ATOM   515  C CB  . HIS A 1 75  ? 5.751   -1.739 28.870  1.00 56.25  ? 75  HIS A CB  1 
ATOM   516  C CG  . HIS A 1 75  ? 5.470   -2.164 30.278  1.00 56.25  ? 75  HIS A CG  1 
ATOM   517  N ND1 . HIS A 1 75  ? 4.950   -1.305 31.225  1.00 56.25  ? 75  HIS A ND1 1 
ATOM   518  C CD2 . HIS A 1 75  ? 5.610   -3.362 30.897  1.00 56.25  ? 75  HIS A CD2 1 
ATOM   519  C CE1 . HIS A 1 75  ? 4.778   -1.954 32.362  1.00 56.25  ? 75  HIS A CE1 1 
ATOM   520  N NE2 . HIS A 1 75  ? 5.171   -3.204 32.190  1.00 56.25  ? 75  HIS A NE2 1 
ATOM   521  N N   . TRP A 1 76  ? 7.958   -0.561 26.677  1.00 27.52  ? 76  TRP A N   1 
ATOM   522  C CA  . TRP A 1 76  ? 8.050   0.051  25.338  1.00 27.52  ? 76  TRP A CA  1 
ATOM   523  C C   . TRP A 1 76  ? 9.394   0.555  24.833  1.00 27.52  ? 76  TRP A C   1 
ATOM   524  O O   . TRP A 1 76  ? 10.285  0.912  25.597  1.00 27.52  ? 76  TRP A O   1 
ATOM   525  C CB  . TRP A 1 76  ? 7.187   1.321  25.280  1.00 27.85  ? 76  TRP A CB  1 
ATOM   526  C CG  . TRP A 1 76  ? 5.848   1.271  25.897  1.00 27.85  ? 76  TRP A CG  1 
ATOM   527  C CD1 . TRP A 1 76  ? 5.486   1.756  27.120  1.00 27.85  ? 76  TRP A CD1 1 
ATOM   528  C CD2 . TRP A 1 76  ? 4.664   0.767  25.294  1.00 27.85  ? 76  TRP A CD2 1 
ATOM   529  N NE1 . TRP A 1 76  ? 4.137   1.587  27.316  1.00 27.85  ? 76  TRP A NE1 1 
ATOM   530  C CE2 . TRP A 1 76  ? 3.610   0.976  26.208  1.00 27.85  ? 76  TRP A CE2 1 
ATOM   531  C CE3 . TRP A 1 76  ? 4.385   0.150  24.067  1.00 27.85  ? 76  TRP A CE3 1 
ATOM   532  C CZ2 . TRP A 1 76  ? 2.293   0.594  25.926  1.00 27.85  ? 76  TRP A CZ2 1 
ATOM   533  C CZ3 . TRP A 1 76  ? 3.076   -0.230 23.791  1.00 27.85  ? 76  TRP A CZ3 1 
ATOM   534  C CH2 . TRP A 1 76  ? 2.050   -0.009 24.717  1.00 27.85  ? 76  TRP A CH2 1 
ATOM   535  N N   . ASN A 1 77  ? 9.440   0.741  23.523  1.00 24.81  ? 77  ASN A N   1 
ATOM   536  C CA  . ASN A 1 77  ? 10.567  1.371  22.852  1.00 24.81  ? 77  ASN A CA  1 
ATOM   537  C C   . ASN A 1 77  ? 9.932   2.669  22.342  1.00 24.81  ? 77  ASN A C   1 
ATOM   538  O O   . ASN A 1 77  ? 8.699   2.794  22.278  1.00 24.81  ? 77  ASN A O   1 
ATOM   539  C CB  . ASN A 1 77  ? 11.111  0.530  21.710  1.00 55.59  ? 77  ASN A CB  1 
ATOM   540  C CG  . ASN A 1 77  ? 12.076  -0.518 22.192  1.00 55.59  ? 77  ASN A CG  1 
ATOM   541  O OD1 . ASN A 1 77  ? 12.928  -0.233 23.033  1.00 55.59  ? 77  ASN A OD1 1 
ATOM   542  N ND2 . ASN A 1 77  ? 11.962  -1.733 21.666  1.00 55.59  ? 77  ASN A ND2 1 
ATOM   543  N N   . SER A 1 78  ? 10.739  3.668  22.050  1.00 28.61  ? 78  SER A N   1 
ATOM   544  C CA  . SER A 1 78  ? 10.169  4.914  21.591  1.00 28.61  ? 78  SER A CA  1 
ATOM   545  C C   . SER A 1 78  ? 11.045  5.474  20.517  1.00 28.61  ? 78  SER A C   1 
ATOM   546  O O   . SER A 1 78  ? 12.159  4.995  20.320  1.00 28.61  ? 78  SER A O   1 
ATOM   547  C CB  . SER A 1 78  ? 10.045  5.911  22.755  1.00 24.72  ? 78  SER A CB  1 
ATOM   548  O OG  . SER A 1 78  ? 11.298  6.222  23.363  1.00 24.72  ? 78  SER A OG  1 
ATOM   549  N N   . GLN A 1 79  ? 10.553  6.504  19.837  1.00 22.05  ? 79  GLN A N   1 
ATOM   550  C CA  . GLN A 1 79  ? 11.316  7.132  18.778  1.00 22.05  ? 79  GLN A CA  1 
ATOM   551  C C   . GLN A 1 79  ? 10.771  8.522  18.573  1.00 22.05  ? 79  GLN A C   1 
ATOM   552  O O   . GLN A 1 79  ? 9.575   8.709  18.611  1.00 22.05  ? 79  GLN A O   1 
ATOM   553  C CB  . GLN A 1 79  ? 11.169  6.311  17.506  1.00 79.57  ? 79  GLN A CB  1 
ATOM   554  C CG  . GLN A 1 79  ? 12.441  6.197  16.699  1.00 79.57  ? 79  GLN A CG  1 
ATOM   555  C CD  . GLN A 1 79  ? 12.246  5.439  15.388  1.00 79.57  ? 79  GLN A CD  1 
ATOM   556  O OE1 . GLN A 1 79  ? 13.144  5.397  14.540  1.00 79.57  ? 79  GLN A OE1 1 
ATOM   557  N NE2 . GLN A 1 79  ? 11.075  4.831  15.218  1.00 79.57  ? 79  GLN A NE2 1 
ATOM   558  N N   . CYS A 1 80  ? 11.640  9.515  18.472  1.00 16.32  ? 80  CYS A N   1 
ATOM   559  C CA  . CYS A 1 80  ? 11.188  10.874 18.227  1.00 16.32  ? 80  CYS A CA  1 
ATOM   560  C C   . CYS A 1 80  ? 11.260  11.073 16.706  1.00 16.32  ? 80  CYS A C   1 
ATOM   561  O O   . CYS A 1 80  ? 12.318  10.865 16.106  1.00 16.32  ? 80  CYS A O   1 
ATOM   562  C CB  . CYS A 1 80  ? 12.106  11.874 18.936  1.00 22.05  ? 80  CYS A CB  1 
ATOM   563  S SG  . CYS A 1 80  ? 11.924  11.938 20.749  1.00 22.05  ? 80  CYS A SG  1 
ATOM   564  N N   . ARG A 1 81  ? 10.147  11.443 16.073  1.00 15.51  ? 81  ARG A N   1 
ATOM   565  C CA  . ARG A 1 81  ? 10.107  11.626 14.617  1.00 15.51  ? 81  ARG A CA  1 
ATOM   566  C C   . ARG A 1 81  ? 9.544   12.991 14.231  1.00 15.51  ? 81  ARG A C   1 
ATOM   567  O O   . ARG A 1 81  ? 8.599   13.466 14.859  1.00 15.51  ? 81  ARG A O   1 
ATOM   568  C CB  . ARG A 1 81  ? 9.218   10.546 13.987  1.00 72.42  ? 81  ARG A CB  1 
ATOM   569  C CG  . ARG A 1 81  ? 9.670   9.117  14.159  1.00 72.42  ? 81  ARG A CG  1 
ATOM   570  C CD  . ARG A 1 81  ? 8.529   8.194  13.761  1.00 72.42  ? 81  ARG A CD  1 
ATOM   571  N NE  . ARG A 1 81  ? 8.853   6.764  13.866  1.00 72.42  ? 81  ARG A NE  1 
ATOM   572  C CZ  . ARG A 1 81  ? 7.955   5.774  13.768  1.00 72.42  ? 81  ARG A CZ  1 
ATOM   573  N NH1 . ARG A 1 81  ? 6.665   6.046  13.559  1.00 72.42  ? 81  ARG A NH1 1 
ATOM   574  N NH2 . ARG A 1 81  ? 8.331   4.504  13.906  1.00 72.42  ? 81  ARG A NH2 1 
ATOM   575  N N   . THR A 1 82  ? 10.103  13.635 13.212  1.00 21.85  ? 82  THR A N   1 
ATOM   576  C CA  . THR A 1 82  ? 9.567   14.924 12.759  1.00 21.85  ? 82  THR A CA  1 
ATOM   577  C C   . THR A 1 82  ? 8.204   14.700 12.063  1.00 21.85  ? 82  THR A C   1 
ATOM   578  O O   . THR A 1 82  ? 8.068   13.765 11.281  1.00 21.85  ? 82  THR A O   1 
ATOM   579  C CB  . THR A 1 82  ? 10.487  15.552 11.703  1.00 21.83  ? 82  THR A CB  1 
ATOM   580  O OG1 . THR A 1 82  ? 11.836  15.550 12.179  1.00 21.83  ? 82  THR A OG1 1 
ATOM   581  C CG2 . THR A 1 82  ? 10.037  16.980 11.352  1.00 21.83  ? 82  THR A CG2 1 
ATOM   582  N N   . THR A 1 83  ? 7.188   15.503 12.354  1.00 18.58  ? 83  THR A N   1 
ATOM   583  C CA  . THR A 1 83  ? 5.915   15.331 11.656  1.00 18.58  ? 83  THR A CA  1 
ATOM   584  C C   . THR A 1 83  ? 5.616   16.581 10.838  1.00 18.58  ? 83  THR A C   1 
ATOM   585  O O   . THR A 1 83  ? 6.080   17.670 11.174  1.00 18.58  ? 83  THR A O   1 
ATOM   586  C CB  . THR A 1 83  ? 4.708   15.006 12.598  1.00 18.14  ? 83  THR A CB  1 
ATOM   587  O OG1 . THR A 1 83  ? 4.407   16.137 13.438  1.00 18.14  ? 83  THR A OG1 1 
ATOM   588  C CG2 . THR A 1 83  ? 5.024   13.792 13.425  1.00 18.14  ? 83  THR A CG2 1 
ATOM   589  N N   . GLN A 1 84  ? 4.855   16.421 9.759   1.00 26.28  ? 84  GLN A N   1 
ATOM   590  C CA  . GLN A 1 84  ? 4.518   17.550 8.905   1.00 26.28  ? 84  GLN A CA  1 
ATOM   591  C C   . GLN A 1 84  ? 3.083   18.049 9.188   1.00 26.28  ? 84  GLN A C   1 
ATOM   592  O O   . GLN A 1 84  ? 2.306   17.380 9.880   1.00 26.28  ? 84  GLN A O   1 
ATOM   593  C CB  . GLN A 1 84  ? 4.668   17.142 7.441   1.00 50.35  ? 84  GLN A CB  1 
ATOM   594  C CG  . GLN A 1 84  ? 5.905   16.310 7.095   1.00 50.35  ? 84  GLN A CG  1 
ATOM   595  C CD  . GLN A 1 84  ? 6.201   16.347 5.591   1.00 50.35  ? 84  GLN A CD  1 
ATOM   596  O OE1 . GLN A 1 84  ? 6.766   17.323 5.086   1.00 50.35  ? 84  GLN A OE1 1 
ATOM   597  N NE2 . GLN A 1 84  ? 5.777   15.308 4.864   1.00 50.35  ? 84  GLN A NE2 1 
ATOM   598  N N   . SER A 1 85  ? 2.726   19.199 8.621   1.00 29.15  ? 85  SER A N   1 
ATOM   599  C CA  . SER A 1 85  ? 1.402   19.818 8.802   1.00 29.15  ? 85  SER A CA  1 
ATOM   600  C C   . SER A 1 85  ? 1.241   20.750 7.597   1.00 29.15  ? 85  SER A C   1 
ATOM   601  O O   . SER A 1 85  ? 2.238   21.154 7.009   1.00 29.15  ? 85  SER A O   1 
ATOM   602  C CB  . SER A 1 85  ? 1.404   20.641 10.103  1.00 48.73  ? 85  SER A CB  1 
ATOM   603  O OG  . SER A 1 85  ? 0.171   21.283 10.369  1.00 48.73  ? 85  SER A OG  1 
ATOM   604  N N   . TYR A 1 86  ? 0.010   21.078 7.214   1.00 22.50  ? 86  TYR A N   1 
ATOM   605  C CA  . TYR A 1 86  ? -0.220  21.969 6.062   1.00 22.50  ? 86  TYR A CA  1 
ATOM   606  C C   . TYR A 1 86  ? -0.307  23.417 6.452   1.00 22.50  ? 86  TYR A C   1 
ATOM   607  O O   . TYR A 1 86  ? -0.990  23.780 7.416   1.00 22.50  ? 86  TYR A O   1 
ATOM   608  C CB  . TYR A 1 86  ? -1.465  21.572 5.253   1.00 50.81  ? 86  TYR A CB  1 
ATOM   609  C CG  . TYR A 1 86  ? -1.339  20.229 4.583   1.00 50.81  ? 86  TYR A CG  1 
ATOM   610  C CD1 . TYR A 1 86  ? -0.579  20.060 3.428   1.00 50.81  ? 86  TYR A CD1 1 
ATOM   611  C CD2 . TYR A 1 86  ? -1.950  19.114 5.132   1.00 50.81  ? 86  TYR A CD2 1 
ATOM   612  C CE1 . TYR A 1 86  ? -0.430  18.788 2.841   1.00 50.81  ? 86  TYR A CE1 1 
ATOM   613  C CE2 . TYR A 1 86  ? -1.816  17.864 4.569   1.00 50.81  ? 86  TYR A CE2 1 
ATOM   614  C CZ  . TYR A 1 86  ? -1.057  17.691 3.434   1.00 50.81  ? 86  TYR A CZ  1 
ATOM   615  O OH  . TYR A 1 86  ? -0.906  16.405 2.962   1.00 50.81  ? 86  TYR A OH  1 
ATOM   616  N N   . VAL A 1 87  ? 0.419   24.232 5.701   1.00 13.43  ? 87  VAL A N   1 
ATOM   617  C CA  . VAL A 1 87  ? 0.489   25.679 5.904   1.00 13.43  ? 87  VAL A CA  1 
ATOM   618  C C   . VAL A 1 87  ? 0.251   26.261 4.518   1.00 13.43  ? 87  VAL A C   1 
ATOM   619  O O   . VAL A 1 87  ? 0.715   25.717 3.515   1.00 13.43  ? 87  VAL A O   1 
ATOM   620  C CB  . VAL A 1 87  ? 1.884   26.132 6.441   1.00 19.48  ? 87  VAL A CB  1 
ATOM   621  C CG1 . VAL A 1 87  ? 2.959   25.883 5.403   1.00 19.48  ? 87  VAL A CG1 1 
ATOM   622  C CG2 . VAL A 1 87  ? 1.887   27.585 6.778   1.00 19.48  ? 87  VAL A CG2 1 
ATOM   623  N N   . ARG A 1 88  ? -0.535  27.322 4.472   1.00 18.64  ? 88  ARG A N   1 
ATOM   624  C CA  . ARG A 1 88  ? -0.891  27.942 3.224   1.00 18.64  ? 88  ARG A CA  1 
ATOM   625  C C   . ARG A 1 88  ? 0.189   28.877 2.762   1.00 18.64  ? 88  ARG A C   1 
ATOM   626  O O   . ARG A 1 88  ? 0.779   29.593 3.582   1.00 18.64  ? 88  ARG A O   1 
ATOM   627  C CB  . ARG A 1 88  ? -2.230  28.642 3.377   1.00 32.97  ? 88  ARG A CB  1 
ATOM   628  C CG  . ARG A 1 88  ? -2.567  29.572 2.289   1.00 32.97  ? 88  ARG A CG  1 
ATOM   629  C CD  . ARG A 1 88  ? -3.994  29.940 2.427   1.00 32.97  ? 88  ARG A CD  1 
ATOM   630  N NE  . ARG A 1 88  ? -4.840  29.024 1.674   1.00 32.97  ? 88  ARG A NE  1 
ATOM   631  C CZ  . ARG A 1 88  ? -6.144  29.203 1.492   1.00 32.97  ? 88  ARG A CZ  1 
ATOM   632  N NH1 . ARG A 1 88  ? -6.765  30.236 2.052   1.00 32.97  ? 88  ARG A NH1 1 
ATOM   633  N NH2 . ARG A 1 88  ? -6.833  28.325 0.774   1.00 32.97  ? 88  ARG A NH2 1 
ATOM   634  N N   . ALA A 1 89  ? 0.457   28.851 1.452   1.00 31.19  ? 89  ALA A N   1 
ATOM   635  C CA  . ALA A 1 89  ? 1.509   29.667 0.845   1.00 31.19  ? 89  ALA A CA  1 
ATOM   636  C C   . ALA A 1 89  ? 1.157   30.047 -0.573  1.00 31.19  ? 89  ALA A C   1 
ATOM   637  O O   . ALA A 1 89  ? 0.388   29.329 -1.203  1.00 31.19  ? 89  ALA A O   1 
ATOM   638  C CB  . ALA A 1 89  ? 2.796   28.876 0.831   1.00 8.82   ? 89  ALA A CB  1 
ATOM   639  N N   . LEU A 1 90  ? 1.695   31.174 -1.061  1.00 16.60  ? 90  LEU A N   1 
ATOM   640  C CA  . LEU A 1 90  ? 1.475   31.625 -2.449  1.00 16.60  ? 90  LEU A CA  1 
ATOM   641  C C   . LEU A 1 90  ? 2.429   30.787 -3.305  1.00 16.60  ? 90  LEU A C   1 
ATOM   642  O O   . LEU A 1 90  ? 3.644   30.953 -3.255  1.00 16.60  ? 90  LEU A O   1 
ATOM   643  C CB  . LEU A 1 90  ? 1.778   33.105 -2.611  1.00 13.99  ? 90  LEU A CB  1 
ATOM   644  C CG  . LEU A 1 90  ? 1.279   33.685 -3.948  1.00 13.99  ? 90  LEU A CG  1 
ATOM   645  C CD1 . LEU A 1 90  ? -0.236  33.422 -4.096  1.00 13.99  ? 90  LEU A CD1 1 
ATOM   646  C CD2 . LEU A 1 90  ? 1.577   35.194 -4.045  1.00 13.99  ? 90  LEU A CD2 1 
ATOM   647  N N   . THR A 1 91  ? 1.861   29.850 -4.046  1.00 25.88  ? 91  THR A N   1 
ATOM   648  C CA  . THR A 1 91  ? 2.610   28.911 -4.857  1.00 25.88  ? 91  THR A CA  1 
ATOM   649  C C   . THR A 1 91  ? 2.313   29.045 -6.353  1.00 25.88  ? 91  THR A C   1 
ATOM   650  O O   . THR A 1 91  ? 1.459   29.836 -6.757  1.00 25.88  ? 91  THR A O   1 
ATOM   651  C CB  . THR A 1 91  ? 2.179   27.512 -4.451  1.00 15.71  ? 91  THR A CB  1 
ATOM   652  O OG1 . THR A 1 91  ? 0.747   27.489 -4.405  1.00 15.71  ? 91  THR A OG1 1 
ATOM   653  C CG2 . THR A 1 91  ? 2.707   27.141 -3.074  1.00 15.71  ? 91  THR A CG2 1 
ATOM   654  N N   . MET A 1 92  ? 3.003   28.256 -7.170  1.00 21.00  ? 92  MET A N   1 
ATOM   655  C CA  . MET A 1 92  ? 2.770   28.248 -8.613  1.00 21.00  ? 92  MET A CA  1 
ATOM   656  C C   . MET A 1 92  ? 2.962   26.815 -9.072  1.00 21.00  ? 92  MET A C   1 
ATOM   657  O O   . MET A 1 92  ? 4.063   26.284 -8.903  1.00 21.00  ? 92  MET A O   1 
ATOM   658  C CB  . MET A 1 92  ? 3.762   29.145 -9.346  1.00 31.67  ? 92  MET A CB  1 
ATOM   659  C CG  . MET A 1 92  ? 3.637   29.024 -10.882 1.00 31.67  ? 92  MET A CG  1 
ATOM   660  S SD  . MET A 1 92  ? 4.891   29.847 -11.917 1.00 31.67  ? 92  MET A SD  1 
ATOM   661  C CE  . MET A 1 92  ? 6.234   30.401 -10.745 1.00 31.67  ? 92  MET A CE  1 
ATOM   662  N N   . ASP A 1 93  ? 1.912   26.181 -9.608  1.00 23.92  ? 93  ASP A N   1 
ATOM   663  C CA  . ASP A 1 93  ? 1.999   24.772 -10.045 1.00 23.92  ? 93  ASP A CA  1 
ATOM   664  C C   . ASP A 1 93  ? 2.714   24.512 -11.371 1.00 23.92  ? 93  ASP A C   1 
ATOM   665  O O   . ASP A 1 93  ? 3.222   25.450 -12.003 1.00 23.92  ? 93  ASP A O   1 
ATOM   666  C CB  . ASP A 1 93  ? 0.639   24.039 -9.991  1.00 47.57  ? 93  ASP A CB  1 
ATOM   667  C CG  . ASP A 1 93  ? -0.372  24.529 -11.025 1.00 47.57  ? 93  ASP A CG  1 
ATOM   668  O OD1 . ASP A 1 93  ? -0.048  25.344 -11.926 1.00 47.57  ? 93  ASP A OD1 1 
ATOM   669  O OD2 . ASP A 1 93  ? -1.533  24.070 -10.924 1.00 47.57  ? 93  ASP A OD2 1 
ATOM   670  N N   . SER A 1 94  ? 2.749   23.250 -11.786 1.00 44.75  ? 94  SER A N   1 
ATOM   671  C CA  . SER A 1 94  ? 3.428   22.864 -13.020 1.00 44.75  ? 94  SER A CA  1 
ATOM   672  C C   . SER A 1 94  ? 2.898   23.540 -14.300 1.00 44.75  ? 94  SER A C   1 
ATOM   673  O O   . SER A 1 94  ? 3.638   23.652 -15.291 1.00 44.75  ? 94  SER A O   1 
ATOM   674  C CB  . SER A 1 94  ? 3.461   21.330 -13.160 1.00 51.12  ? 94  SER A CB  1 
ATOM   675  O OG  . SER A 1 94  ? 2.183   20.744 -12.918 1.00 51.12  ? 94  SER A OG  1 
ATOM   676  N N   . LYS A 1 95  ? 1.639   24.001 -14.270 1.00 57.58  ? 95  LYS A N   1 
ATOM   677  C CA  . LYS A 1 95  ? 1.023   24.689 -15.414 1.00 57.58  ? 95  LYS A CA  1 
ATOM   678  C C   . LYS A 1 95  ? 1.073   26.221 -15.294 1.00 57.58  ? 95  LYS A C   1 
ATOM   679  O O   . LYS A 1 95  ? 0.271   26.927 -15.910 1.00 57.58  ? 95  LYS A O   1 
ATOM   680  C CB  . LYS A 1 95  ? -0.421  24.218 -15.640 1.00 63.21  ? 95  LYS A CB  1 
ATOM   681  C CG  . LYS A 1 95  ? -0.592  23.130 -16.700 1.00 63.21  ? 95  LYS A CG  1 
ATOM   682  C CD  . LYS A 1 95  ? -0.340  21.714 -16.179 1.00 63.21  ? 95  LYS A CD  1 
ATOM   683  C CE  . LYS A 1 95  ? -1.485  21.187 -15.292 1.00 63.21  ? 95  LYS A CE  1 
ATOM   684  N NZ  . LYS A 1 95  ? -1.279  21.428 -13.815 1.00 63.21  ? 95  LYS A NZ  1 
ATOM   685  N N   . LYS A 1 96  ? 1.984   26.710 -14.454 1.00 43.60  ? 96  LYS A N   1 
ATOM   686  C CA  . LYS A 1 96  ? 2.227   28.140 -14.234 1.00 43.60  ? 96  LYS A CA  1 
ATOM   687  C C   . LYS A 1 96  ? 1.148   28.940 -13.506 1.00 43.60  ? 96  LYS A C   1 
ATOM   688  O O   . LYS A 1 96  ? 1.240   30.170 -13.428 1.00 43.60  ? 96  LYS A O   1 
ATOM   689  C CB  . LYS A 1 96  ? 2.574   28.835 -15.559 1.00 72.38  ? 96  LYS A CB  1 
ATOM   690  C CG  . LYS A 1 96  ? 3.727   28.205 -16.338 1.00 72.38  ? 96  LYS A CG  1 
ATOM   691  C CD  . LYS A 1 96  ? 5.057   28.367 -15.614 1.00 72.38  ? 96  LYS A CD  1 
ATOM   692  C CE  . LYS A 1 96  ? 6.185   27.589 -16.294 1.00 72.38  ? 96  LYS A CE  1 
ATOM   693  N NZ  . LYS A 1 96  ? 7.504   27.784 -15.602 1.00 72.38  ? 96  LYS A NZ  1 
ATOM   694  N N   . ARG A 1 97  ? 0.147   28.254 -12.955 1.00 31.98  ? 97  ARG A N   1 
ATOM   695  C CA  . ARG A 1 97  ? -0.933  28.931 -12.250 1.00 31.98  ? 97  ARG A CA  1 
ATOM   696  C C   . ARG A 1 97  ? -0.597  29.368 -10.832 1.00 31.98  ? 97  ARG A C   1 
ATOM   697  O O   . ARG A 1 97  ? -0.368  28.526 -9.954  1.00 31.98  ? 97  ARG A O   1 
ATOM   698  C CB  . ARG A 1 97  ? -2.174  28.060 -12.236 1.00 74.08  ? 97  ARG A CB  1 
ATOM   699  C CG  . ARG A 1 97  ? -2.998  28.196 -13.478 1.00 74.08  ? 97  ARG A CG  1 
ATOM   700  C CD  . ARG A 1 97  ? -4.249  27.373 -13.370 1.00 74.08  ? 97  ARG A CD  1 
ATOM   701  N NE  . ARG A 1 97  ? -3.905  25.978 -13.123 1.00 74.08  ? 97  ARG A NE  1 
ATOM   702  C CZ  . ARG A 1 97  ? -3.874  25.032 -14.056 1.00 74.08  ? 97  ARG A CZ  1 
ATOM   703  N NH1 . ARG A 1 97  ? -4.207  25.312 -15.314 1.00 74.08  ? 97  ARG A NH1 1 
ATOM   704  N NH2 . ARG A 1 97  ? -3.539  23.794 -13.717 1.00 74.08  ? 97  ARG A NH2 1 
ATOM   705  N N   . ILE A 1 98  ? -0.561  30.678 -10.613 1.00 32.96  ? 98  ILE A N   1 
ATOM   706  C CA  . ILE A 1 98  ? -0.273  31.260 -9.295  1.00 32.96  ? 98  ILE A CA  1 
ATOM   707  C C   . ILE A 1 98  ? -1.478  31.179 -8.338  1.00 32.96  ? 98  ILE A C   1 
ATOM   708  O O   . ILE A 1 98  ? -2.556  31.708 -8.633  1.00 32.96  ? 98  ILE A O   1 
ATOM   709  C CB  . ILE A 1 98  ? 0.054   32.775 -9.410  1.00 18.90  ? 98  ILE A CB  1 
ATOM   710  C CG1 . ILE A 1 98  ? 1.188   33.028 -10.401 1.00 18.90  ? 98  ILE A CG1 1 
ATOM   711  C CG2 . ILE A 1 98  ? 0.261   33.385 -8.016  1.00 18.90  ? 98  ILE A CG2 1 
ATOM   712  C CD1 . ILE A 1 98  ? 2.291   32.050 -10.288 1.00 18.90  ? 98  ILE A CD1 1 
ATOM   713  N N   . GLY A 1 99  ? -1.302  30.590 -7.169  1.00 37.23  ? 99  GLY A N   1 
ATOM   714  C CA  . GLY A 1 99  ? -2.429  30.540 -6.261  1.00 37.23  ? 99  GLY A CA  1 
ATOM   715  C C   . GLY A 1 99  ? -2.062  30.173 -4.839  1.00 37.23  ? 99  GLY A C   1 
ATOM   716  O O   . GLY A 1 99  ? -0.941  29.722 -4.577  1.00 37.23  ? 99  GLY A O   1 
ATOM   717  N N   . TRP A 1 100 ? -2.972  30.438 -3.905  1.00 26.61  ? 100 TRP A N   1 
ATOM   718  C CA  . TRP A 1 100 ? -2.741  30.075 -2.523  1.00 26.61  ? 100 TRP A CA  1 
ATOM   719  C C   . TRP A 1 100 ? -3.058  28.594 -2.406  1.00 26.61  ? 100 TRP A C   1 
ATOM   720  O O   . TRP A 1 100 ? -4.151  28.180 -2.784  1.00 26.61  ? 100 TRP A O   1 
ATOM   721  C CB  . TRP A 1 100 ? -3.637  30.875 -1.590  1.00 22.59  ? 100 TRP A CB  1 
ATOM   722  C CG  . TRP A 1 100 ? -3.157  32.258 -1.403  1.00 22.59  ? 100 TRP A CG  1 
ATOM   723  C CD1 . TRP A 1 100 ? -3.552  33.355 -2.101  1.00 22.59  ? 100 TRP A CD1 1 
ATOM   724  C CD2 . TRP A 1 100 ? -2.166  32.710 -0.469  1.00 22.59  ? 100 TRP A CD2 1 
ATOM   725  N NE1 . TRP A 1 100 ? -2.872  34.466 -1.665  1.00 22.59  ? 100 TRP A NE1 1 
ATOM   726  C CE2 . TRP A 1 100 ? -2.007  34.100 -0.666  1.00 22.59  ? 100 TRP A CE2 1 
ATOM   727  C CE3 . TRP A 1 100 ? -1.385  32.078 0.506   1.00 22.59  ? 100 TRP A CE3 1 
ATOM   728  C CZ2 . TRP A 1 100 ? -1.103  34.873 0.082   1.00 22.59  ? 100 TRP A CZ2 1 
ATOM   729  C CZ3 . TRP A 1 100 ? -0.485  32.850 1.250   1.00 22.59  ? 100 TRP A CZ3 1 
ATOM   730  C CH2 . TRP A 1 100 ? -0.353  34.229 1.024   1.00 22.59  ? 100 TRP A CH2 1 
ATOM   731  N N   . ARG A 1 101 ? -2.090  27.787 -1.958  1.00 18.47  ? 101 ARG A N   1 
ATOM   732  C CA  . ARG A 1 101 ? -2.304  26.352 -1.796  1.00 18.47  ? 101 ARG A CA  1 
ATOM   733  C C   . ARG A 1 101 ? -1.767  25.975 -0.425  1.00 18.47  ? 101 ARG A C   1 
ATOM   734  O O   . ARG A 1 101 ? -1.126  26.802 0.237   1.00 18.47  ? 101 ARG A O   1 
ATOM   735  C CB  . ARG A 1 101 ? -1.580  25.572 -2.885  1.00 22.59  ? 101 ARG A CB  1 
ATOM   736  C CG  . ARG A 1 101 ? -2.069  25.881 -4.282  1.00 22.59  ? 101 ARG A CG  1 
ATOM   737  C CD  . ARG A 1 101 ? -1.280  25.122 -5.350  1.00 22.59  ? 101 ARG A CD  1 
ATOM   738  N NE  . ARG A 1 101 ? -1.765  25.412 -6.692  1.00 22.59  ? 101 ARG A NE  1 
ATOM   739  C CZ  . ARG A 1 101 ? -1.479  26.513 -7.399  1.00 22.59  ? 101 ARG A CZ  1 
ATOM   740  N NH1 . ARG A 1 101 ? -0.659  27.471 -6.955  1.00 22.59  ? 101 ARG A NH1 1 
ATOM   741  N NH2 . ARG A 1 101 ? -1.999  26.650 -8.601  1.00 22.59  ? 101 ARG A NH2 1 
ATOM   742  N N   . PHE A 1 102 ? -2.115  24.778 0.044   1.00 10.91  ? 102 PHE A N   1 
ATOM   743  C CA  . PHE A 1 102 ? -1.645  24.291 1.323   1.00 10.91  ? 102 PHE A CA  1 
ATOM   744  C C   . PHE A 1 102 ? -0.530  23.336 1.020   1.00 10.91  ? 102 PHE A C   1 
ATOM   745  O O   . PHE A 1 102 ? -0.726  22.304 0.367   1.00 10.91  ? 102 PHE A O   1 
ATOM   746  C CB  . PHE A 1 102 ? -2.754  23.561 2.068   1.00 13.51  ? 102 PHE A CB  1 
ATOM   747  C CG  . PHE A 1 102 ? -3.705  24.484 2.792   1.00 13.51  ? 102 PHE A CG  1 
ATOM   748  C CD1 . PHE A 1 102 ? -3.356  25.035 4.026   1.00 13.51  ? 102 PHE A CD1 1 
ATOM   749  C CD2 . PHE A 1 102 ? -4.920  24.848 2.221   1.00 13.51  ? 102 PHE A CD2 1 
ATOM   750  C CE1 . PHE A 1 102 ? -4.190  25.933 4.671   1.00 13.51  ? 102 PHE A CE1 1 
ATOM   751  C CE2 . PHE A 1 102 ? -5.767  25.752 2.860   1.00 13.51  ? 102 PHE A CE2 1 
ATOM   752  C CZ  . PHE A 1 102 ? -5.406  26.301 4.088   1.00 13.51  ? 102 PHE A CZ  1 
ATOM   753  N N   . ILE A 1 103 ? 0.657   23.700 1.450   1.00 12.49  ? 103 ILE A N   1 
ATOM   754  C CA  . ILE A 1 103 ? 1.835   22.869 1.223   1.00 12.49  ? 103 ILE A CA  1 
ATOM   755  C C   . ILE A 1 103 ? 2.252   22.259 2.569   1.00 12.49  ? 103 ILE A C   1 
ATOM   756  O O   . ILE A 1 103 ? 1.945   22.827 3.622   1.00 12.49  ? 103 ILE A O   1 
ATOM   757  C CB  . ILE A 1 103 ? 2.983   23.728 0.646   1.00 11.80  ? 103 ILE A CB  1 
ATOM   758  C CG1 . ILE A 1 103 ? 3.210   24.940 1.547   1.00 11.80  ? 103 ILE A CG1 1 
ATOM   759  C CG2 . ILE A 1 103 ? 2.604   24.222 -0.734  1.00 11.80  ? 103 ILE A CG2 1 
ATOM   760  C CD1 . ILE A 1 103 ? 4.466   25.722 1.267   1.00 11.80  ? 103 ILE A CD1 1 
ATOM   761  N N   . ARG A 1 104 ? 2.902   21.101 2.561   1.00 30.04  ? 104 ARG A N   1 
ATOM   762  C CA  . ARG A 1 104 ? 3.299   20.535 3.835   1.00 30.04  ? 104 ARG A CA  1 
ATOM   763  C C   . ARG A 1 104 ? 4.713   20.949 4.197   1.00 30.04  ? 104 ARG A C   1 
ATOM   764  O O   . ARG A 1 104 ? 5.565   21.065 3.315   1.00 30.04  ? 104 ARG A O   1 
ATOM   765  C CB  . ARG A 1 104 ? 3.101   19.020 3.887   1.00 67.57  ? 104 ARG A CB  1 
ATOM   766  C CG  . ARG A 1 104 ? 4.014   18.208 3.044   1.00 67.57  ? 104 ARG A CG  1 
ATOM   767  C CD  . ARG A 1 104 ? 3.669   16.756 3.237   1.00 67.57  ? 104 ARG A CD  1 
ATOM   768  N NE  . ARG A 1 104 ? 2.517   16.365 2.432   1.00 67.57  ? 104 ARG A NE  1 
ATOM   769  C CZ  . ARG A 1 104 ? 2.513   15.300 1.627   1.00 67.57  ? 104 ARG A CZ  1 
ATOM   770  N NH1 . ARG A 1 104 ? 3.596   14.524 1.569   1.00 67.57  ? 104 ARG A NH1 1 
ATOM   771  N NH2 . ARG A 1 104 ? 1.434   14.996 0.898   1.00 67.57  ? 104 ARG A NH2 1 
ATOM   772  N N   . ILE A 1 105 ? 4.898   21.335 5.464   1.00 23.53  ? 105 ILE A N   1 
ATOM   773  C CA  . ILE A 1 105 ? 6.186   21.754 6.012   1.00 23.53  ? 105 ILE A CA  1 
ATOM   774  C C   . ILE A 1 105 ? 6.372   21.103 7.378   1.00 23.53  ? 105 ILE A C   1 
ATOM   775  O O   . ILE A 1 105 ? 5.396   20.679 7.997   1.00 23.53  ? 105 ILE A O   1 
ATOM   776  C CB  . ILE A 1 105 ? 6.289   23.289 6.160   1.00 36.05  ? 105 ILE A CB  1 
ATOM   777  C CG1 . ILE A 1 105 ? 5.511   23.774 7.377   1.00 36.05  ? 105 ILE A CG1 1 
ATOM   778  C CG2 . ILE A 1 105 ? 5.704   23.960 4.954   1.00 36.05  ? 105 ILE A CG2 1 
ATOM   779  C CD1 . ILE A 1 105 ? 5.878   25.183 7.789   1.00 36.05  ? 105 ILE A CD1 1 
ATOM   780  N N   . ASP A 1 106 ? 7.618   20.994 7.834   1.00 17.30  ? 106 ASP A N   1 
ATOM   781  C CA  . ASP A 1 106 ? 7.921   20.392 9.157   1.00 17.30  ? 106 ASP A CA  1 
ATOM   782  C C   . ASP A 1 106 ? 7.390   21.265 10.341  1.00 17.30  ? 106 ASP A C   1 
ATOM   783  O O   . ASP A 1 106 ? 7.818   22.413 10.506  1.00 17.30  ? 106 ASP A O   1 
ATOM   784  C CB  . ASP A 1 106 ? 9.434   20.170 9.298   1.00 21.97  ? 106 ASP A CB  1 
ATOM   785  C CG  . ASP A 1 106 ? 9.964   19.047 8.396   1.00 21.97  ? 106 ASP A CG  1 
ATOM   786  O OD1 . ASP A 1 106 ? 9.194   18.147 7.992   1.00 21.97  ? 106 ASP A OD1 1 
ATOM   787  O OD2 . ASP A 1 106 ? 11.177  19.051 8.103   1.00 21.97  ? 106 ASP A OD2 1 
ATOM   788  N N   . THR A 1 107 ? 6.496   20.714 11.178  1.00 20.53  ? 107 THR A N   1 
ATOM   789  C CA  . THR A 1 107 ? 5.925   21.501 12.276  1.00 20.53  ? 107 THR A CA  1 
ATOM   790  C C   . THR A 1 107 ? 6.057   21.000 13.729  1.00 20.53  ? 107 THR A C   1 
ATOM   791  O O   . THR A 1 107 ? 5.700   21.709 14.681  1.00 20.53  ? 107 THR A O   1 
ATOM   792  C CB  . THR A 1 107 ? 4.463   21.785 12.014  1.00 17.94  ? 107 THR A CB  1 
ATOM   793  O OG1 . THR A 1 107 ? 3.729   20.550 12.076  1.00 17.94  ? 107 THR A OG1 1 
ATOM   794  C CG2 . THR A 1 107 ? 4.298   22.445 10.653  1.00 17.94  ? 107 THR A CG2 1 
ATOM   795  N N   . SER A 1 108 ? 6.536   19.780 13.906  1.00 19.76  ? 108 SER A N   1 
ATOM   796  C CA  . SER A 1 108 ? 6.704   19.228 15.239  1.00 19.76  ? 108 SER A CA  1 
ATOM   797  C C   . SER A 1 108 ? 7.614   18.005 15.229  1.00 19.76  ? 108 SER A C   1 
ATOM   798  O O   . SER A 1 108 ? 8.008   17.503 14.172  1.00 19.76  ? 108 SER A O   1 
ATOM   799  C CB  . SER A 1 108 ? 5.343   18.896 15.871  1.00 62.59  ? 108 SER A CB  1 
ATOM   800  O OG  . SER A 1 108 ? 4.606   17.965 15.098  1.00 62.59  ? 108 SER A OG  1 
ATOM   801  N N   . CYS A 1 109 ? 8.045   17.608 16.411  1.00 15.04  ? 109 CYS A N   1 
ATOM   802  C CA  . CYS A 1 109 ? 8.881   16.441 16.579  1.00 15.04  ? 109 CYS A CA  1 
ATOM   803  C C   . CYS A 1 109 ? 8.170   15.686 17.704  1.00 15.04  ? 109 CYS A C   1 
ATOM   804  O O   . CYS A 1 109 ? 8.174   16.123 18.859  1.00 15.04  ? 109 CYS A O   1 
ATOM   805  C CB  . CYS A 1 109 ? 10.255  16.883 16.984  1.00 10.89  ? 109 CYS A CB  1 
ATOM   806  S SG  . CYS A 1 109 ? 11.231  15.516 17.615  1.00 10.89  ? 109 CYS A SG  1 
ATOM   807  N N   . VAL A 1 110 ? 7.498   14.593 17.355  1.00 16.37  ? 110 VAL A N   1 
ATOM   808  C CA  . VAL A 1 110 ? 6.709   13.848 18.330  1.00 16.37  ? 110 VAL A CA  1 
ATOM   809  C C   . VAL A 1 110 ? 7.162   12.433 18.600  1.00 16.37  ? 110 VAL A C   1 
ATOM   810  O O   . VAL A 1 110 ? 7.781   11.812 17.762  1.00 16.37  ? 110 VAL A O   1 
ATOM   811  C CB  . VAL A 1 110 ? 5.216   13.846 17.930  1.00 6.35   ? 110 VAL A CB  1 
ATOM   812  C CG1 . VAL A 1 110 ? 4.733   15.273 17.736  1.00 6.35   ? 110 VAL A CG1 1 
ATOM   813  C CG2 . VAL A 1 110 ? 5.023   13.091 16.680  1.00 6.35   ? 110 VAL A CG2 1 
ATOM   814  N N   . CYS A 1 111 ? 6.768   11.912 19.757  1.00 16.06  ? 111 CYS A N   1 
ATOM   815  C CA  . CYS A 1 111 ? 7.160   10.596 20.219  1.00 16.06  ? 111 CYS A CA  1 
ATOM   816  C C   . CYS A 1 111 ? 6.214   9.539  19.785  1.00 16.06  ? 111 CYS A C   1 
ATOM   817  O O   . CYS A 1 111 ? 5.011   9.760  19.727  1.00 16.06  ? 111 CYS A O   1 
ATOM   818  C CB  . CYS A 1 111 ? 7.245   10.589 21.744  1.00 17.40  ? 111 CYS A CB  1 
ATOM   819  S SG  . CYS A 1 111 ? 7.901   9.062  22.491  1.00 17.40  ? 111 CYS A SG  1 
ATOM   820  N N   . THR A 1 112 ? 6.757   8.359  19.540  1.00 24.32  ? 112 THR A N   1 
ATOM   821  C CA  . THR A 1 112 ? 5.969   7.248  19.112  1.00 24.32  ? 112 THR A CA  1 
ATOM   822  C C   . THR A 1 112 ? 6.472   6.002  19.768  1.00 24.32  ? 112 THR A C   1 
ATOM   823  O O   . THR A 1 112 ? 7.681   5.726  19.764  1.00 24.32  ? 112 THR A O   1 
ATOM   824  C CB  . THR A 1 112 ? 5.978   7.135  17.597  1.00 27.21  ? 112 THR A CB  1 
ATOM   825  O OG1 . THR A 1 112 ? 4.712   7.598  17.137  1.00 27.21  ? 112 THR A OG1 1 
ATOM   826  C CG2 . THR A 1 112 ? 6.181   5.713  17.129  1.00 27.21  ? 112 THR A CG2 1 
ATOM   827  N N   . LEU A 1 113 ? 5.525   5.271  20.352  1.00 24.45  ? 113 LEU A N   1 
ATOM   828  C CA  . LEU A 1 113 ? 5.795   4.033  21.070  1.00 24.45  ? 113 LEU A CA  1 
ATOM   829  C C   . LEU A 1 113 ? 5.825   2.831  20.157  1.00 24.45  ? 113 LEU A C   1 
ATOM   830  O O   . LEU A 1 113 ? 5.136   2.810  19.138  1.00 24.45  ? 113 LEU A O   1 
ATOM   831  C CB  . LEU A 1 113 ? 4.716   3.831  22.124  1.00 15.44  ? 113 LEU A CB  1 
ATOM   832  C CG  . LEU A 1 113 ? 4.933   4.382  23.537  1.00 15.44  ? 113 LEU A CG  1 
ATOM   833  C CD1 . LEU A 1 113 ? 5.989   5.472  23.613  1.00 15.44  ? 113 LEU A CD1 1 
ATOM   834  C CD2 . LEU A 1 113 ? 3.585   4.835  24.067  1.00 15.44  ? 113 LEU A CD2 1 
ATOM   835  N N   . THR A 1 114 ? 6.625   1.837  20.505  1.00 50.88  ? 114 THR A N   1 
ATOM   836  C CA  . THR A 1 114 ? 6.697   0.621  19.706  1.00 50.88  ? 114 THR A CA  1 
ATOM   837  C C   . THR A 1 114 ? 6.982   -0.516 20.696  1.00 50.88  ? 114 THR A C   1 
ATOM   838  O O   . THR A 1 114 ? 7.540   -0.265 21.761  1.00 50.88  ? 114 THR A O   1 
ATOM   839  C CB  . THR A 1 114 ? 7.742   0.749  18.524  1.00 67.73  ? 114 THR A CB  1 
ATOM   840  O OG1 . THR A 1 114 ? 7.468   -0.248 17.539  1.00 67.73  ? 114 THR A OG1 1 
ATOM   841  C CG2 . THR A 1 114 ? 9.192   0.595  18.985  1.00 67.73  ? 114 THR A CG2 1 
ATOM   842  N N   . ILE A 1 115 ? 6.500   -1.726 20.427  1.00 45.22  ? 115 ILE A N   1 
ATOM   843  C CA  . ILE A 1 115 ? 6.735   -2.834 21.353  1.00 45.22  ? 115 ILE A CA  1 
ATOM   844  C C   . ILE A 1 115 ? 8.202   -3.335 21.359  1.00 45.22  ? 115 ILE A C   1 
ATOM   845  O O   . ILE A 1 115 ? 9.008   -2.959 20.485  1.00 45.22  ? 115 ILE A O   1 
ATOM   846  C CB  . ILE A 1 115 ? 5.764   -4.006 21.061  1.00 41.39  ? 115 ILE A CB  1 
ATOM   847  C CG1 . ILE A 1 115 ? 6.020   -4.567 19.668  1.00 41.39  ? 115 ILE A CG1 1 
ATOM   848  C CG2 . ILE A 1 115 ? 4.330   -3.540 21.139  1.00 41.39  ? 115 ILE A CG2 1 
ATOM   849  C CD1 . ILE A 1 115 ? 5.171   -5.777 19.323  1.00 41.39  ? 115 ILE A CD1 1 
ATOM   850  N N   . LYS A 1 116 ? 8.497   -4.226 22.306  1.00 92.25  ? 116 LYS A N   1 
ATOM   851  C CA  . LYS A 1 116 ? 9.812   -4.852 22.528  1.00 92.25  ? 116 LYS A CA  1 
ATOM   852  C C   . LYS A 1 116 ? 10.532  -4.132 23.672  1.00 92.25  ? 116 LYS A C   1 
ATOM   853  O O   . LYS A 1 116 ? 9.828   -3.650 24.589  1.00 80.81  ? 116 LYS A O   1 
ATOM   854  C CB  . LYS A 1 116 ? 10.712  -4.893 21.266  1.00 80.81  ? 116 LYS A CB  1 
ATOM   855  C CG  . LYS A 1 116 ? 10.405  -5.991 20.239  1.00 80.81  ? 116 LYS A CG  1 
ATOM   856  C CD  . LYS A 1 116 ? 11.604  -6.225 19.299  1.00 80.81  ? 116 LYS A CD  1 
ATOM   857  C CE  . LYS A 1 116 ? 12.314  -7.555 19.592  1.00 80.81  ? 116 LYS A CE  1 
ATOM   858  N NZ  . LYS A 1 116 ? 12.659  -7.733 21.036  1.00 80.81  ? 116 LYS A NZ  1 
ATOM   859  N N   . GLY B 2 12  ? 3.347   -1.219 13.394  1.00 83.52  ? 12  GLY B N   1 
ATOM   860  C CA  . GLY B 2 12  ? 2.725   -1.428 14.742  1.00 83.52  ? 12  GLY B CA  1 
ATOM   861  C C   . GLY B 2 12  ? 3.205   -0.456 15.817  1.00 83.52  ? 12  GLY B C   1 
ATOM   862  O O   . GLY B 2 12  ? 3.691   -0.887 16.871  1.00 83.52  ? 12  GLY B O   1 
ATOM   863  N N   . GLU B 2 13  ? 3.092   0.847  15.537  1.00 95.18  ? 13  GLU B N   1 
ATOM   864  C CA  . GLU B 2 13  ? 3.504   1.905  16.465  1.00 95.18  ? 13  GLU B CA  1 
ATOM   865  C C   . GLU B 2 13  ? 2.281   2.672  17.011  1.00 95.18  ? 13  GLU B C   1 
ATOM   866  O O   . GLU B 2 13  ? 1.203   2.629  16.417  1.00 95.18  ? 13  GLU B O   1 
ATOM   867  C CB  . GLU B 2 13  ? 4.515   2.856  15.796  1.00 97.81  ? 13  GLU B CB  1 
ATOM   868  C CG  . GLU B 2 13  ? 3.949   3.763  14.717  1.00 97.81  ? 13  GLU B CG  1 
ATOM   869  C CD  . GLU B 2 13  ? 4.236   3.290  13.309  1.00 97.81  ? 13  GLU B CD  1 
ATOM   870  O OE1 . GLU B 2 13  ? 4.330   2.086  13.033  1.00 97.81  ? 13  GLU B OE1 1 
ATOM   871  O OE2 . GLU B 2 13  ? 4.352   4.243  12.396  1.00 97.81  ? 13  GLU B OE2 1 
ATOM   872  N N   . LEU B 2 14  ? 2.464   3.423  18.093  1.00 38.77  ? 14  LEU B N   1 
ATOM   873  C CA  . LEU B 2 14  ? 1.366   4.136  18.736  1.00 38.77  ? 14  LEU B CA  1 
ATOM   874  C C   . LEU B 2 14  ? 1.744   5.514  19.322  1.00 38.77  ? 14  LEU B C   1 
ATOM   875  O O   . LEU B 2 14  ? 2.825   5.685  19.897  1.00 38.77  ? 14  LEU B O   1 
ATOM   876  C CB  . LEU B 2 14  ? 0.848   3.246  19.847  1.00 62.46  ? 14  LEU B CB  1 
ATOM   877  C CG  . LEU B 2 14  ? -0.552  3.518  20.351  1.00 62.46  ? 14  LEU B CG  1 
ATOM   878  C CD1 . LEU B 2 14  ? -1.584  3.339  19.223  1.00 62.46  ? 14  LEU B CD1 1 
ATOM   879  C CD2 . LEU B 2 14  ? -0.800  2.564  21.498  1.00 62.46  ? 14  LEU B CD2 1 
ATOM   880  N N   . ALA B 2 15  ? 0.841   6.486  19.210  1.00 28.33  ? 15  ALA B N   1 
ATOM   881  C CA  . ALA B 2 15  ? 1.090   7.830  19.725  1.00 28.33  ? 15  ALA B CA  1 
ATOM   882  C C   . ALA B 2 15  ? 1.086   7.897  21.234  1.00 28.33  ? 15  ALA B C   1 
ATOM   883  O O   . ALA B 2 15  ? 0.286   7.243  21.903  1.00 28.33  ? 15  ALA B O   1 
ATOM   884  C CB  . ALA B 2 15  ? 0.059   8.793  19.210  1.00 6.56   ? 15  ALA B CB  1 
ATOM   885  N N   . VAL B 2 16  ? 1.916   8.777  21.762  1.00 19.76  ? 16  VAL B N   1 
ATOM   886  C CA  . VAL B 2 16  ? 1.996   8.977  23.188  1.00 19.76  ? 16  VAL B CA  1 
ATOM   887  C C   . VAL B 2 16  ? 0.873   9.946  23.585  1.00 19.76  ? 16  VAL B C   1 
ATOM   888  O O   . VAL B 2 16  ? 0.375   9.923  24.717  1.00 19.76  ? 16  VAL B O   1 
ATOM   889  C CB  . VAL B 2 16  ? 3.369   9.519  23.522  1.00 19.51  ? 16  VAL B CB  1 
ATOM   890  C CG1 . VAL B 2 16  ? 3.453   9.873  24.967  1.00 19.51  ? 16  VAL B CG1 1 
ATOM   891  C CG2 . VAL B 2 16  ? 4.421   8.469  23.173  1.00 19.51  ? 16  VAL B CG2 1 
ATOM   892  N N   . CYS B 2 17  ? 0.487   10.807 22.645  1.00 24.56  ? 17  CYS B N   1 
ATOM   893  C CA  . CYS B 2 17  ? -0.596  11.779 22.829  1.00 24.56  ? 17  CYS B CA  1 
ATOM   894  C C   . CYS B 2 17  ? -1.476  11.723 21.591  1.00 24.56  ? 17  CYS B C   1 
ATOM   895  O O   . CYS B 2 17  ? -0.983  11.798 20.457  1.00 24.56  ? 17  CYS B O   1 
ATOM   896  C CB  . CYS B 2 17  ? -0.083  13.206 23.008  1.00 27.14  ? 17  CYS B CB  1 
ATOM   897  S SG  . CYS B 2 17  ? 0.685   13.541 24.621  1.00 27.14  ? 17  CYS B SG  1 
ATOM   898  N N   . ASP B 2 18  ? -2.773  11.521 21.812  1.00 28.15  ? 18  ASP B N   1 
ATOM   899  C CA  . ASP B 2 18  ? -3.739  11.437 20.723  1.00 28.15  ? 18  ASP B CA  1 
ATOM   900  C C   . ASP B 2 18  ? -4.148  12.827 20.278  1.00 28.15  ? 18  ASP B C   1 
ATOM   901  O O   . ASP B 2 18  ? -4.627  13.646 21.085  1.00 28.15  ? 18  ASP B O   1 
ATOM   902  C CB  . ASP B 2 18  ? -4.927  10.595 21.152  1.00 25.83  ? 18  ASP B CB  1 
ATOM   903  C CG  . ASP B 2 18  ? -4.506  9.210  21.556  1.00 25.83  ? 18  ASP B CG  1 
ATOM   904  O OD1 . ASP B 2 18  ? -3.945  8.481  20.713  1.00 25.83  ? 18  ASP B OD1 1 
ATOM   905  O OD2 . ASP B 2 18  ? -4.678  8.872  22.731  1.00 25.83  ? 18  ASP B OD2 1 
ATOM   906  N N   . ALA B 2 19  ? -3.928  13.075 18.991  1.00 26.16  ? 19  ALA B N   1 
ATOM   907  C CA  . ALA B 2 19  ? -4.191  14.362 18.381  1.00 26.16  ? 19  ALA B CA  1 
ATOM   908  C C   . ALA B 2 19  ? -5.320  14.329 17.385  1.00 26.16  ? 19  ALA B C   1 
ATOM   909  O O   . ALA B 2 19  ? -5.732  13.267 16.962  1.00 26.16  ? 19  ALA B O   1 
ATOM   910  C CB  . ALA B 2 19  ? -2.939  14.836 17.697  1.00 7.75   ? 19  ALA B CB  1 
ATOM   911  N N   . VAL B 2 20  ? -5.829  15.495 17.016  1.00 24.21  ? 20  VAL B N   1 
ATOM   912  C CA  . VAL B 2 20  ? -6.887  15.578 16.027  1.00 24.21  ? 20  VAL B CA  1 
ATOM   913  C C   . VAL B 2 20  ? -6.494  16.670 15.043  1.00 24.21  ? 20  VAL B C   1 
ATOM   914  O O   . VAL B 2 20  ? -6.086  17.760 15.452  1.00 24.21  ? 20  VAL B O   1 
ATOM   915  C CB  . VAL B 2 20  ? -8.262  15.949 16.633  1.00 38.82  ? 20  VAL B CB  1 
ATOM   916  C CG1 . VAL B 2 20  ? -9.252  14.821 16.389  1.00 38.82  ? 20  VAL B CG1 1 
ATOM   917  C CG2 . VAL B 2 20  ? -8.146  16.279 18.107  1.00 38.82  ? 20  VAL B CG2 1 
ATOM   918  N N   . SER B 2 21  ? -6.615  16.381 13.755  1.00 29.51  ? 21  SER B N   1 
ATOM   919  C CA  . SER B 2 21  ? -6.264  17.342 12.722  1.00 29.51  ? 21  SER B CA  1 
ATOM   920  C C   . SER B 2 21  ? -7.456  17.777 11.860  1.00 29.51  ? 21  SER B C   1 
ATOM   921  O O   . SER B 2 21  ? -8.338  16.973 11.503  1.00 29.51  ? 21  SER B O   1 
ATOM   922  C CB  . SER B 2 21  ? -5.165  16.759 11.840  1.00 31.94  ? 21  SER B CB  1 
ATOM   923  O OG  . SER B 2 21  ? -3.936  16.650 12.547  1.00 31.94  ? 21  SER B OG  1 
ATOM   924  N N   . GLY B 2 22  ? -7.505  19.052 11.502  1.00 18.95  ? 22  GLY B N   1 
ATOM   925  C CA  . GLY B 2 22  ? -8.621  19.452 10.682  1.00 18.95  ? 22  GLY B CA  1 
ATOM   926  C C   . GLY B 2 22  ? -8.587  20.914 10.383  1.00 18.95  ? 22  GLY B C   1 
ATOM   927  O O   . GLY B 2 22  ? -7.645  21.601 10.778  1.00 18.95  ? 22  GLY B O   1 
ATOM   928  N N   . TRP B 2 23  ? -9.650  21.367 9.717   1.00 24.09  ? 23  TRP B N   1 
ATOM   929  C CA  . TRP B 2 23  ? -9.817  22.737 9.311   1.00 24.09  ? 23  TRP B CA  1 
ATOM   930  C C   . TRP B 2 23  ? -10.463 23.458 10.436  1.00 24.09  ? 23  TRP B C   1 
ATOM   931  O O   . TRP B 2 23  ? -11.379 22.920 11.085  1.00 24.09  ? 23  TRP B O   1 
ATOM   932  C CB  . TRP B 2 23  ? -10.691 22.805 8.075   1.00 26.94  ? 23  TRP B CB  1 
ATOM   933  C CG  . TRP B 2 23  ? -10.080 22.054 6.989   1.00 26.94  ? 23  TRP B CG  1 
ATOM   934  C CD1 . TRP B 2 23  ? -10.397 20.787 6.581   1.00 26.94  ? 23  TRP B CD1 1 
ATOM   935  C CD2 . TRP B 2 23  ? -8.931  22.450 6.231   1.00 26.94  ? 23  TRP B CD2 1 
ATOM   936  N NE1 . TRP B 2 23  ? -9.500  20.354 5.620   1.00 26.94  ? 23  TRP B NE1 1 
ATOM   937  C CE2 . TRP B 2 23  ? -8.588  21.356 5.388   1.00 26.94  ? 23  TRP B CE2 1 
ATOM   938  C CE3 . TRP B 2 23  ? -8.148  23.616 6.192   1.00 26.94  ? 23  TRP B CE3 1 
ATOM   939  C CZ2 . TRP B 2 23  ? -7.486  21.398 4.508   1.00 26.94  ? 23  TRP B CZ2 1 
ATOM   940  C CZ3 . TRP B 2 23  ? -7.055  23.665 5.327   1.00 26.94  ? 23  TRP B CZ3 1 
ATOM   941  C CH2 . TRP B 2 23  ? -6.733  22.555 4.490   1.00 26.94  ? 23  TRP B CH2 1 
ATOM   942  N N   . VAL B 2 24  ? -9.915  24.635 10.724  1.00 11.36  ? 24  VAL B N   1 
ATOM   943  C CA  . VAL B 2 24  ? -10.402 25.498 11.786  1.00 11.36  ? 24  VAL B CA  1 
ATOM   944  C C   . VAL B 2 24  ? -10.920 26.735 11.081  1.00 11.36  ? 24  VAL B C   1 
ATOM   945  O O   . VAL B 2 24  ? -10.166 27.495 10.438  1.00 11.36  ? 24  VAL B O   1 
ATOM   946  C CB  . VAL B 2 24  ? -9.290  25.863 12.814  1.00 2.00   ? 24  VAL B CB  1 
ATOM   947  C CG1 . VAL B 2 24  ? -9.692  27.078 13.666  1.00 2.00   ? 24  VAL B CG1 1 
ATOM   948  C CG2 . VAL B 2 24  ? -9.032  24.716 13.690  1.00 2.00   ? 24  VAL B CG2 1 
ATOM   949  N N   . THR B 2 25  ? -12.237 26.881 11.161  1.00 26.42  ? 25  THR B N   1 
ATOM   950  C CA  . THR B 2 25  ? -12.923 27.998 10.549  1.00 26.42  ? 25  THR B CA  1 
ATOM   951  C C   . THR B 2 25  ? -13.431 28.939 11.630  1.00 26.42  ? 25  THR B C   1 
ATOM   952  O O   . THR B 2 25  ? -13.939 29.999 11.333  1.00 26.42  ? 25  THR B O   1 
ATOM   953  C CB  . THR B 2 25  ? -14.062 27.494 9.568   1.00 19.96  ? 25  THR B CB  1 
ATOM   954  O OG1 . THR B 2 25  ? -14.976 26.646 10.261  1.00 19.96  ? 25  THR B OG1 1 
ATOM   955  C CG2 . THR B 2 25  ? -13.460 26.663 8.460   1.00 19.96  ? 25  THR B CG2 1 
ATOM   956  N N   . ASP B 2 26  ? -13.214 28.576 12.889  1.00 37.56  ? 26  ASP B N   1 
ATOM   957  C CA  . ASP B 2 26  ? -13.676 29.404 14.012  1.00 37.56  ? 26  ASP B CA  1 
ATOM   958  C C   . ASP B 2 26  ? -12.622 30.163 14.832  1.00 37.56  ? 26  ASP B C   1 
ATOM   959  O O   . ASP B 2 26  ? -12.910 30.679 15.894  1.00 37.56  ? 26  ASP B O   1 
ATOM   960  C CB  . ASP B 2 26  ? -14.632 28.614 14.929  1.00 34.70  ? 26  ASP B CB  1 
ATOM   961  C CG  . ASP B 2 26  ? -13.952 27.488 15.713  1.00 34.70  ? 26  ASP B CG  1 
ATOM   962  O OD1 . ASP B 2 26  ? -12.793 27.107 15.440  1.00 34.70  ? 26  ASP B OD1 1 
ATOM   963  O OD2 . ASP B 2 26  ? -14.615 26.963 16.631  1.00 34.70  ? 26  ASP B OD2 1 
ATOM   964  N N   . ARG B 2 27  ? -11.409 30.260 14.320  1.00 33.46  ? 27  ARG B N   1 
ATOM   965  C CA  . ARG B 2 27  ? -10.357 30.978 15.006  1.00 33.46  ? 27  ARG B CA  1 
ATOM   966  C C   . ARG B 2 27  ? -10.545 32.470 14.800  1.00 33.46  ? 27  ARG B C   1 
ATOM   967  O O   . ARG B 2 27  ? -10.190 33.014 13.749  1.00 33.46  ? 27  ARG B O   1 
ATOM   968  C CB  . ARG B 2 27  ? -9.046  30.552 14.426  1.00 13.70  ? 27  ARG B CB  1 
ATOM   969  C CG  . ARG B 2 27  ? -7.867  31.288 14.935  1.00 13.70  ? 27  ARG B CG  1 
ATOM   970  C CD  . ARG B 2 27  ? -6.712  30.316 15.014  1.00 13.70  ? 27  ARG B CD  1 
ATOM   971  N NE  . ARG B 2 27  ? -6.011  30.644 16.219  1.00 13.70  ? 27  ARG B NE  1 
ATOM   972  C CZ  . ARG B 2 27  ? -5.455  29.767 17.028  1.00 13.70  ? 27  ARG B CZ  1 
ATOM   973  N NH1 . ARG B 2 27  ? -5.481  28.456 16.790  1.00 13.70  ? 27  ARG B NH1 1 
ATOM   974  N NH2 . ARG B 2 27  ? -4.902  30.242 18.120  1.00 13.70  ? 27  ARG B NH2 1 
ATOM   975  N N   . ARG B 2 28  ? -11.103 33.118 15.819  1.00 16.68  ? 28  ARG B N   1 
ATOM   976  C CA  . ARG B 2 28  ? -11.393 34.544 15.819  1.00 16.68  ? 28  ARG B CA  1 
ATOM   977  C C   . ARG B 2 28  ? -10.304 35.397 16.480  1.00 16.68  ? 28  ARG B C   1 
ATOM   978  O O   . ARG B 2 28  ? -10.323 36.615 16.376  1.00 16.68  ? 28  ARG B O   1 
ATOM   979  C CB  . ARG B 2 28  ? -12.716 34.748 16.542  1.00 36.65  ? 28  ARG B CB  1 
ATOM   980  C CG  . ARG B 2 28  ? -13.885 34.073 15.850  1.00 36.65  ? 28  ARG B CG  1 
ATOM   981  C CD  . ARG B 2 28  ? -14.967 33.630 16.804  1.00 36.65  ? 28  ARG B CD  1 
ATOM   982  N NE  . ARG B 2 28  ? -14.530 32.450 17.549  1.00 36.65  ? 28  ARG B NE  1 
ATOM   983  C CZ  . ARG B 2 28  ? -15.334 31.534 18.088  1.00 36.65  ? 28  ARG B CZ  1 
ATOM   984  N NH1 . ARG B 2 28  ? -16.641 31.643 17.980  1.00 36.65  ? 28  ARG B NH1 1 
ATOM   985  N NH2 . ARG B 2 28  ? -14.824 30.491 18.727  1.00 36.65  ? 28  ARG B NH2 1 
ATOM   986  N N   . THR B 2 29  ? -9.354  34.770 17.165  1.00 10.89  ? 29  THR B N   1 
ATOM   987  C CA  . THR B 2 29  ? -8.284  35.501 17.849  1.00 10.89  ? 29  THR B CA  1 
ATOM   988  C C   . THR B 2 29  ? -7.076  34.575 17.858  1.00 10.89  ? 29  THR B C   1 
ATOM   989  O O   . THR B 2 29  ? -7.198  33.373 17.532  1.00 10.89  ? 29  THR B O   1 
ATOM   990  C CB  . THR B 2 29  ? -8.650  35.831 19.365  1.00 7.92   ? 29  THR B CB  1 
ATOM   991  O OG1 . THR B 2 29  ? -8.939  34.616 20.064  1.00 7.92   ? 29  THR B OG1 1 
ATOM   992  C CG2 . THR B 2 29  ? -9.866  36.770 19.496  1.00 7.92   ? 29  THR B CG2 1 
ATOM   993  N N   . ALA B 2 30  ? -5.921  35.135 18.221  1.00 8.28   ? 30  ALA B N   1 
ATOM   994  C CA  . ALA B 2 30  ? -4.662  34.397 18.315  1.00 8.28   ? 30  ALA B CA  1 
ATOM   995  C C   . ALA B 2 30  ? -3.633  35.283 19.009  1.00 8.28   ? 30  ALA B C   1 
ATOM   996  O O   . ALA B 2 30  ? -3.830  36.502 19.145  1.00 8.28   ? 30  ALA B O   1 
ATOM   997  C CB  . ALA B 2 30  ? -4.160  33.987 16.922  1.00 12.60  ? 30  ALA B CB  1 
ATOM   998  N N   . VAL B 2 31  ? -2.564  34.668 19.503  1.00 9.27   ? 31  VAL B N   1 
ATOM   999  C CA  . VAL B 2 31  ? -1.480  35.411 20.183  1.00 9.27   ? 31  VAL B CA  1 
ATOM   1000 C C   . VAL B 2 31  ? -0.384  35.730 19.121  1.00 9.27   ? 31  VAL B C   1 
ATOM   1001 O O   . VAL B 2 31  ? -0.075  34.902 18.274  1.00 9.27   ? 31  VAL B O   1 
ATOM   1002 C CB  . VAL B 2 31  ? -0.859  34.545 21.300  1.00 12.15  ? 31  VAL B CB  1 
ATOM   1003 C CG1 . VAL B 2 31  ? 0.118   35.345 22.102  1.00 12.15  ? 31  VAL B CG1 1 
ATOM   1004 C CG2 . VAL B 2 31  ? -1.936  33.954 22.152  1.00 12.15  ? 31  VAL B CG2 1 
ATOM   1005 N N   . ASP B 2 32  ? 0.186   36.917 19.147  1.00 15.63  ? 32  ASP B N   1 
ATOM   1006 C CA  . ASP B 2 32  ? 1.180   37.195 18.141  1.00 15.63  ? 32  ASP B CA  1 
ATOM   1007 C C   . ASP B 2 32  ? 2.636   36.949 18.588  1.00 15.63  ? 32  ASP B C   1 
ATOM   1008 O O   . ASP B 2 32  ? 2.874   36.411 19.678  1.00 15.63  ? 32  ASP B O   1 
ATOM   1009 C CB  . ASP B 2 32  ? 0.949   38.586 17.493  1.00 25.00  ? 32  ASP B CB  1 
ATOM   1010 C CG  . ASP B 2 32  ? 1.211   39.745 18.440  1.00 25.00  ? 32  ASP B CG  1 
ATOM   1011 O OD1 . ASP B 2 32  ? 1.706   39.510 19.564  1.00 25.00  ? 32  ASP B OD1 1 
ATOM   1012 O OD2 . ASP B 2 32  ? 0.954   40.907 18.043  1.00 25.00  ? 32  ASP B OD2 1 
ATOM   1013 N N   . LEU B 2 33  ? 3.586   37.288 17.717  1.00 40.98  ? 33  LEU B N   1 
ATOM   1014 C CA  . LEU B 2 33  ? 5.006   37.129 17.996  1.00 40.98  ? 33  LEU B CA  1 
ATOM   1015 C C   . LEU B 2 33  ? 5.323   37.756 19.350  1.00 40.98  ? 33  LEU B C   1 
ATOM   1016 O O   . LEU B 2 33  ? 6.008   37.152 20.179  1.00 40.98  ? 33  LEU B O   1 
ATOM   1017 C CB  . LEU B 2 33  ? 5.841   37.858 16.925  1.00 26.63  ? 33  LEU B CB  1 
ATOM   1018 C CG  . LEU B 2 33  ? 7.206   37.310 16.486  1.00 26.63  ? 33  LEU B CG  1 
ATOM   1019 C CD1 . LEU B 2 33  ? 7.959   36.616 17.637  1.00 26.63  ? 33  LEU B CD1 1 
ATOM   1020 C CD2 . LEU B 2 33  ? 6.986   36.312 15.418  1.00 26.63  ? 33  LEU B CD2 1 
ATOM   1021 N N   . ARG B 2 34  ? 4.757   38.942 19.582  1.00 33.17  ? 34  ARG B N   1 
ATOM   1022 C CA  . ARG B 2 34  ? 4.990   39.717 20.805  1.00 33.17  ? 34  ARG B CA  1 
ATOM   1023 C C   . ARG B 2 34  ? 4.191   39.275 22.024  1.00 33.17  ? 34  ARG B C   1 
ATOM   1024 O O   . ARG B 2 34  ? 4.228   39.943 23.046  1.00 33.17  ? 34  ARG B O   1 
ATOM   1025 C CB  . ARG B 2 34  ? 4.729   41.214 20.551  1.00 93.16  ? 34  ARG B CB  1 
ATOM   1026 C CG  . ARG B 2 34  ? 5.128   41.730 19.167  1.00 93.16  ? 34  ARG B CG  1 
ATOM   1027 C CD  . ARG B 2 34  ? 5.309   43.251 19.153  1.00 93.16  ? 34  ARG B CD  1 
ATOM   1028 N NE  . ARG B 2 34  ? 6.616   43.644 19.687  1.00 93.16  ? 34  ARG B NE  1 
ATOM   1029 C CZ  . ARG B 2 34  ? 6.819   44.555 20.641  1.00 93.16  ? 34  ARG B CZ  1 
ATOM   1030 N NH1 . ARG B 2 34  ? 5.799   45.210 21.200  1.00 93.16  ? 34  ARG B NH1 1 
ATOM   1031 N NH2 . ARG B 2 34  ? 8.058   44.777 21.070  1.00 93.16  ? 34  ARG B NH2 1 
ATOM   1032 N N   . GLY B 2 35  ? 3.457   38.173 21.927  1.00 30.90  ? 35  GLY B N   1 
ATOM   1033 C CA  . GLY B 2 35  ? 2.655   37.715 23.057  1.00 30.90  ? 35  GLY B CA  1 
ATOM   1034 C C   . GLY B 2 35  ? 1.310   38.407 23.318  1.00 30.90  ? 35  GLY B C   1 
ATOM   1035 O O   . GLY B 2 35  ? 0.613   38.055 24.276  1.00 30.90  ? 35  GLY B O   1 
ATOM   1036 N N   . ARG B 2 36  ? 0.976   39.418 22.515  1.00 27.93  ? 36  ARG B N   1 
ATOM   1037 C CA  . ARG B 2 36  ? -0.287  40.146 22.623  1.00 27.93  ? 36  ARG B CA  1 
ATOM   1038 C C   . ARG B 2 36  ? -1.412  39.323 21.949  1.00 27.93  ? 36  ARG B C   1 
ATOM   1039 O O   . ARG B 2 36  ? -1.139  38.303 21.309  1.00 27.93  ? 36  ARG B O   1 
ATOM   1040 C CB  . ARG B 2 36  ? -0.178  41.519 21.947  1.00 57.51  ? 36  ARG B CB  1 
ATOM   1041 C CG  . ARG B 2 36  ? 0.770   42.500 22.609  1.00 57.51  ? 36  ARG B CG  1 
ATOM   1042 C CD  . ARG B 2 36  ? 0.776   43.864 21.875  1.00 57.51  ? 36  ARG B CD  1 
ATOM   1043 N NE  . ARG B 2 36  ? 1.743   43.989 20.759  1.00 57.51  ? 36  ARG B NE  1 
ATOM   1044 C CZ  . ARG B 2 36  ? 1.449   43.982 19.448  1.00 57.51  ? 36  ARG B CZ  1 
ATOM   1045 N NH1 . ARG B 2 36  ? 0.196   43.846 19.014  1.00 57.51  ? 36  ARG B NH1 1 
ATOM   1046 N NH2 . ARG B 2 36  ? 2.425   44.157 18.558  1.00 57.51  ? 36  ARG B NH2 1 
ATOM   1047 N N   . GLU B 2 37  ? -2.673  39.717 22.140  1.00 25.66  ? 37  GLU B N   1 
ATOM   1048 C CA  . GLU B 2 37  ? -3.781  39.015 21.512  1.00 25.66  ? 37  GLU B CA  1 
ATOM   1049 C C   . GLU B 2 37  ? -4.339  39.898 20.426  1.00 25.66  ? 37  GLU B C   1 
ATOM   1050 O O   . GLU B 2 37  ? -4.646  41.053 20.675  1.00 25.66  ? 37  GLU B O   1 
ATOM   1051 C CB  . GLU B 2 37  ? -4.894  38.685 22.495  1.00 18.10  ? 37  GLU B CB  1 
ATOM   1052 C CG  . GLU B 2 37  ? -6.187  38.323 21.788  1.00 18.10  ? 37  GLU B CG  1 
ATOM   1053 C CD  . GLU B 2 37  ? -7.260  37.788 22.710  1.00 18.10  ? 37  GLU B CD  1 
ATOM   1054 O OE1 . GLU B 2 37  ? -7.105  36.615 23.173  1.00 18.10  ? 37  GLU B OE1 1 
ATOM   1055 O OE2 . GLU B 2 37  ? -8.264  38.526 22.936  1.00 18.10  ? 37  GLU B OE2 1 
ATOM   1056 N N   . VAL B 2 38  ? -4.465  39.335 19.229  1.00 23.96  ? 38  VAL B N   1 
ATOM   1057 C CA  . VAL B 2 38  ? -4.996  40.033 18.073  1.00 23.96  ? 38  VAL B CA  1 
ATOM   1058 C C   . VAL B 2 38  ? -6.218  39.283 17.537  1.00 23.96  ? 38  VAL B C   1 
ATOM   1059 O O   . VAL B 2 38  ? -6.446  38.097 17.828  1.00 23.96  ? 38  VAL B O   1 
ATOM   1060 C CB  . VAL B 2 38  ? -3.929  40.219 16.940  1.00 16.68  ? 38  VAL B CB  1 
ATOM   1061 C CG1 . VAL B 2 38  ? -2.688  40.975 17.470  1.00 16.68  ? 38  VAL B CG1 1 
ATOM   1062 C CG2 . VAL B 2 38  ? -3.525  38.878 16.324  1.00 16.68  ? 38  VAL B CG2 1 
ATOM   1063 N N   . GLU B 2 39  ? -7.019  40.007 16.774  1.00 28.46  ? 39  GLU B N   1 
ATOM   1064 C CA  . GLU B 2 39  ? -8.243  39.481 16.203  1.00 28.46  ? 39  GLU B CA  1 
ATOM   1065 C C   . GLU B 2 39  ? -7.892  38.984 14.793  1.00 28.46  ? 39  GLU B C   1 
ATOM   1066 O O   . GLU B 2 39  ? -7.121  39.622 14.104  1.00 28.46  ? 39  GLU B O   1 
ATOM   1067 C CB  . GLU B 2 39  ? -9.270  40.613 16.169  1.00 20.34  ? 39  GLU B CB  1 
ATOM   1068 C CG  . GLU B 2 39  ? -9.656  41.251 17.521  1.00 20.34  ? 39  GLU B CG  1 
ATOM   1069 C CD  . GLU B 2 39  ? -10.643 42.448 17.357  1.00 20.34  ? 39  GLU B CD  1 
ATOM   1070 O OE1 . GLU B 2 39  ? -11.161 42.654 16.244  1.00 20.34  ? 39  GLU B OE1 1 
ATOM   1071 O OE2 . GLU B 2 39  ? -10.900 43.202 18.325  1.00 20.34  ? 39  GLU B OE2 1 
ATOM   1072 N N   . VAL B 2 40  ? -8.437  37.849 14.377  1.00 13.16  ? 40  VAL B N   1 
ATOM   1073 C CA  . VAL B 2 40  ? -8.146  37.260 13.061  1.00 13.16  ? 40  VAL B CA  1 
ATOM   1074 C C   . VAL B 2 40  ? -9.311  37.419 12.084  1.00 13.16  ? 40  VAL B C   1 
ATOM   1075 O O   . VAL B 2 40  ? -10.373 36.821 12.292  1.00 13.16  ? 40  VAL B O   1 
ATOM   1076 C CB  . VAL B 2 40  ? -7.799  35.739 13.187  1.00 9.95   ? 40  VAL B CB  1 
ATOM   1077 C CG1 . VAL B 2 40  ? -7.572  35.091 11.819  1.00 9.95   ? 40  VAL B CG1 1 
ATOM   1078 C CG2 . VAL B 2 40  ? -6.567  35.571 14.054  1.00 9.95   ? 40  VAL B CG2 1 
ATOM   1079 N N   . LEU B 2 41  ? -9.092  38.177 11.000  1.00 20.44  ? 41  LEU B N   1 
ATOM   1080 C CA  . LEU B 2 41  ? -10.134 38.427 10.000  1.00 20.44  ? 41  LEU B CA  1 
ATOM   1081 C C   . LEU B 2 41  ? -10.528 37.169 9.247   1.00 20.44  ? 41  LEU B C   1 
ATOM   1082 O O   . LEU B 2 41  ? -9.725  36.235 9.088   1.00 20.44  ? 41  LEU B O   1 
ATOM   1083 C CB  . LEU B 2 41  ? -9.711  39.529 9.026   1.00 10.73  ? 41  LEU B CB  1 
ATOM   1084 C CG  . LEU B 2 41  ? -9.796  40.982 9.513   1.00 10.73  ? 41  LEU B CG  1 
ATOM   1085 C CD1 . LEU B 2 41  ? -9.052  41.144 10.796  1.00 10.73  ? 41  LEU B CD1 1 
ATOM   1086 C CD2 . LEU B 2 41  ? -9.196  41.920 8.475   1.00 10.73  ? 41  LEU B CD2 1 
ATOM   1087 N N   . GLY B 2 42  ? -11.778 37.126 8.801   1.00 26.97  ? 42  GLY B N   1 
ATOM   1088 C CA  . GLY B 2 42  ? -12.271 35.956 8.083   1.00 26.97  ? 42  GLY B CA  1 
ATOM   1089 C C   . GLY B 2 42  ? -11.953 35.940 6.602   1.00 26.97  ? 42  GLY B C   1 
ATOM   1090 O O   . GLY B 2 42  ? -11.885 34.867 5.983   1.00 26.97  ? 42  GLY B O   1 
ATOM   1091 N N   . GLU B 2 43  ? -11.752 37.129 6.042   1.00 29.96  ? 43  GLU B N   1 
ATOM   1092 C CA  . GLU B 2 43  ? -11.432 37.260 4.642   1.00 29.96  ? 43  GLU B CA  1 
ATOM   1093 C C   . GLU B 2 43  ? -10.368 38.316 4.394   1.00 29.96  ? 43  GLU B C   1 
ATOM   1094 O O   . GLU B 2 43  ? -10.274 39.341 5.107   1.00 29.96  ? 43  GLU B O   1 
ATOM   1095 C CB  . GLU B 2 43  ? -12.677 37.585 3.832   1.00 57.85  ? 43  GLU B CB  1 
ATOM   1096 C CG  . GLU B 2 43  ? -13.337 38.864 4.240   1.00 57.85  ? 43  GLU B CG  1 
ATOM   1097 C CD  . GLU B 2 43  ? -14.664 39.053 3.562   1.00 57.85  ? 43  GLU B CD  1 
ATOM   1098 O OE1 . GLU B 2 43  ? -15.537 38.176 3.744   1.00 57.85  ? 43  GLU B OE1 1 
ATOM   1099 O OE2 . GLU B 2 43  ? -14.826 40.072 2.843   1.00 57.85  ? 43  GLU B OE2 1 
ATOM   1100 N N   . VAL B 2 44  ? -9.558  38.019 3.382   1.00 59.75  ? 44  VAL B N   1 
ATOM   1101 C CA  . VAL B 2 44  ? -8.468  38.861 2.917   1.00 59.75  ? 44  VAL B CA  1 
ATOM   1102 C C   . VAL B 2 44  ? -8.937  39.466 1.605   1.00 59.75  ? 44  VAL B C   1 
ATOM   1103 O O   . VAL B 2 44  ? -9.365  38.742 0.695   1.00 59.75  ? 44  VAL B O   1 
ATOM   1104 C CB  . VAL B 2 44  ? -7.207  38.016 2.597   1.00 54.84  ? 44  VAL B CB  1 
ATOM   1105 C CG1 . VAL B 2 44  ? -6.115  38.900 1.995   1.00 54.84  ? 44  VAL B CG1 1 
ATOM   1106 C CG2 . VAL B 2 44  ? -6.717  37.304 3.842   1.00 54.84  ? 44  VAL B CG2 1 
ATOM   1107 N N   . PRO B 2 45  ? -8.944  40.793 1.506   1.00 70.54  ? 45  PRO B N   1 
ATOM   1108 C CA  . PRO B 2 45  ? -9.392  41.355 0.228   1.00 70.54  ? 45  PRO B CA  1 
ATOM   1109 C C   . PRO B 2 45  ? -8.346  41.125 -0.892  1.00 70.54  ? 45  PRO B C   1 
ATOM   1110 O O   . PRO B 2 45  ? -7.344  41.836 -0.976  1.00 70.54  ? 45  PRO B O   1 
ATOM   1111 C CB  . PRO B 2 45  ? -9.618  42.833 0.572   1.00 43.96  ? 45  PRO B CB  1 
ATOM   1112 C CG  . PRO B 2 45  ? -8.652  43.071 1.730   1.00 43.96  ? 45  PRO B CG  1 
ATOM   1113 C CD  . PRO B 2 45  ? -8.826  41.829 2.546   1.00 43.96  ? 45  PRO B CD  1 
ATOM   1114 N N   . ALA B 2 46  ? -8.535  40.074 -1.686  1.00 129.62 ? 46  ALA B N   1 
ATOM   1115 C CA  . ALA B 2 46  ? -7.610  39.776 -2.779  1.00 129.62 ? 46  ALA B CA  1 
ATOM   1116 C C   . ALA B 2 46  ? -7.954  40.713 -3.931  1.00 129.62 ? 46  ALA B C   1 
ATOM   1117 O O   . ALA B 2 46  ? -9.122  41.066 -4.125  1.00 129.62 ? 46  ALA B O   1 
ATOM   1118 C CB  . ALA B 2 46  ? -7.731  38.315 -3.212  1.00 111.16 ? 46  ALA B CB  1 
ATOM   1119 N N   . ALA B 2 47  ? -6.940  41.130 -4.681  1.00 103.80 ? 47  ALA B N   1 
ATOM   1120 C CA  . ALA B 2 47  ? -7.150  42.047 -5.795  1.00 103.80 ? 47  ALA B CA  1 
ATOM   1121 C C   . ALA B 2 47  ? -7.980  41.423 -6.926  1.00 103.80 ? 47  ALA B C   1 
ATOM   1122 O O   . ALA B 2 47  ? -7.594  40.392 -7.494  1.00 103.80 ? 47  ALA B O   1 
ATOM   1123 C CB  . ALA B 2 47  ? -5.809  42.544 -6.315  1.00 79.27  ? 47  ALA B CB  1 
ATOM   1124 N N   . GLY B 2 48  ? -9.135  42.030 -7.216  1.00 86.63  ? 48  GLY B N   1 
ATOM   1125 C CA  . GLY B 2 48  ? -10.012 41.541 -8.275  1.00 86.63  ? 48  GLY B CA  1 
ATOM   1126 C C   . GLY B 2 48  ? -11.489 41.391 -7.917  1.00 86.63  ? 48  GLY B C   1 
ATOM   1127 O O   . GLY B 2 48  ? -12.147 42.351 -7.496  1.00 86.63  ? 48  GLY B O   1 
ATOM   1128 N N   . GLY B 2 49  ? -11.991 40.165 -8.068  1.00 163.51 ? 49  GLY B N   1 
ATOM   1129 C CA  . GLY B 2 49  ? -13.387 39.867 -7.794  1.00 163.51 ? 49  GLY B CA  1 
ATOM   1130 C C   . GLY B 2 49  ? -13.732 39.383 -6.395  1.00 163.51 ? 49  GLY B C   1 
ATOM   1131 O O   . GLY B 2 49  ? -14.097 40.189 -5.538  1.00 163.51 ? 49  GLY B O   1 
ATOM   1132 N N   . SER B 2 50  ? -13.643 38.072 -6.167  1.00 75.99  ? 50  SER B N   1 
ATOM   1133 C CA  . SER B 2 50  ? -13.974 37.483 -4.857  1.00 75.99  ? 50  SER B CA  1 
ATOM   1134 C C   . SER B 2 50  ? -12.834 37.496 -3.812  1.00 75.99  ? 50  SER B C   1 
ATOM   1135 O O   . SER B 2 50  ? -11.669 37.204 -4.138  1.00 75.99  ? 50  SER B O   1 
ATOM   1136 C CB  . SER B 2 50  ? -14.477 36.035 -5.033  1.00 79.82  ? 50  SER B CB  1 
ATOM   1137 O OG  . SER B 2 50  ? -15.566 35.941 -5.941  1.00 79.82  ? 50  SER B OG  1 
ATOM   1138 N N   . PRO B 2 51  ? -13.155 37.860 -2.546  1.00 80.21  ? 51  PRO B N   1 
ATOM   1139 C CA  . PRO B 2 51  ? -12.172 37.903 -1.455  1.00 80.21  ? 51  PRO B CA  1 
ATOM   1140 C C   . PRO B 2 51  ? -11.634 36.510 -1.142  1.00 80.21  ? 51  PRO B C   1 
ATOM   1141 O O   . PRO B 2 51  ? -12.314 35.495 -1.343  1.00 80.21  ? 51  PRO B O   1 
ATOM   1142 C CB  . PRO B 2 51  ? -12.990 38.432 -0.267  1.00 46.94  ? 51  PRO B CB  1 
ATOM   1143 C CG  . PRO B 2 51  ? -13.996 39.287 -0.898  1.00 46.94  ? 51  PRO B CG  1 
ATOM   1144 C CD  . PRO B 2 51  ? -14.426 38.463 -2.108  1.00 46.94  ? 51  PRO B CD  1 
ATOM   1145 N N   . LEU B 2 52  ? -10.415 36.473 -0.636  1.00 39.50  ? 52  LEU B N   1 
ATOM   1146 C CA  . LEU B 2 52  ? -9.768  35.223 -0.271  1.00 39.50  ? 52  LEU B CA  1 
ATOM   1147 C C   . LEU B 2 52  ? -10.205 34.891 1.169   1.00 39.50  ? 52  LEU B C   1 
ATOM   1148 O O   . LEU B 2 52  ? -10.178 35.750 2.050   1.00 39.50  ? 52  LEU B O   1 
ATOM   1149 C CB  . LEU B 2 52  ? -8.236  35.403 -0.364  1.00 52.35  ? 52  LEU B CB  1 
ATOM   1150 C CG  . LEU B 2 52  ? -7.258  34.332 0.148   1.00 52.35  ? 52  LEU B CG  1 
ATOM   1151 C CD1 . LEU B 2 52  ? -7.068  33.246 -0.894  1.00 52.35  ? 52  LEU B CD1 1 
ATOM   1152 C CD2 . LEU B 2 52  ? -5.921  34.978 0.492   1.00 52.35  ? 52  LEU B CD2 1 
ATOM   1153 N N   . ARG B 2 53  ? -10.615 33.652 1.402   1.00 26.75  ? 53  ARG B N   1 
ATOM   1154 C CA  . ARG B 2 53  ? -11.070 33.218 2.733   1.00 26.75  ? 53  ARG B CA  1 
ATOM   1155 C C   . ARG B 2 53  ? -9.893  32.832 3.655   1.00 26.75  ? 53  ARG B C   1 
ATOM   1156 O O   . ARG B 2 53  ? -9.008  32.082 3.250   1.00 26.75  ? 53  ARG B O   1 
ATOM   1157 C CB  . ARG B 2 53  ? -12.031 32.026 2.569   1.00 34.38  ? 53  ARG B CB  1 
ATOM   1158 C CG  . ARG B 2 53  ? -12.909 32.080 1.292   1.00 34.38  ? 53  ARG B CG  1 
ATOM   1159 C CD  . ARG B 2 53  ? -14.399 32.337 1.579   1.00 34.38  ? 53  ARG B CD  1 
ATOM   1160 N NE  . ARG B 2 53  ? -14.750 33.709 1.972   1.00 34.38  ? 53  ARG B NE  1 
ATOM   1161 C CZ  . ARG B 2 53  ? -15.355 34.048 3.120   1.00 34.38  ? 53  ARG B CZ  1 
ATOM   1162 N NH1 . ARG B 2 53  ? -15.676 33.133 4.035   1.00 34.38  ? 53  ARG B NH1 1 
ATOM   1163 N NH2 . ARG B 2 53  ? -15.739 35.310 3.326   1.00 34.38  ? 53  ARG B NH2 1 
ATOM   1164 N N   . GLN B 2 54  ? -9.854  33.369 4.871   1.00 22.90  ? 54  GLN B N   1 
ATOM   1165 C CA  . GLN B 2 54  ? -8.761  33.050 5.813   1.00 22.90  ? 54  GLN B CA  1 
ATOM   1166 C C   . GLN B 2 54  ? -9.125  31.980 6.846   1.00 22.90  ? 54  GLN B C   1 
ATOM   1167 O O   . GLN B 2 54  ? -9.985  32.187 7.686   1.00 22.90  ? 54  GLN B O   1 
ATOM   1168 C CB  . GLN B 2 54  ? -8.294  34.316 6.546   1.00 22.98  ? 54  GLN B CB  1 
ATOM   1169 C CG  . GLN B 2 54  ? -7.029  34.163 7.373   1.00 22.98  ? 54  GLN B CG  1 
ATOM   1170 C CD  . GLN B 2 54  ? -6.416  35.511 7.740   1.00 22.98  ? 54  GLN B CD  1 
ATOM   1171 O OE1 . GLN B 2 54  ? -5.371  35.894 7.228   1.00 22.98  ? 54  GLN B OE1 1 
ATOM   1172 N NE2 . GLN B 2 54  ? -7.074  36.239 8.617   1.00 22.98  ? 54  GLN B NE2 1 
ATOM   1173 N N   . TYR B 2 55  ? -8.518  30.815 6.739   1.00 12.89  ? 55  TYR B N   1 
ATOM   1174 C CA  . TYR B 2 55  ? -8.736  29.747 7.707   1.00 12.89  ? 55  TYR B CA  1 
ATOM   1175 C C   . TYR B 2 55  ? -7.432  28.939 7.787   1.00 12.89  ? 55  TYR B C   1 
ATOM   1176 O O   . TYR B 2 55  ? -6.531  29.144 6.953   1.00 12.89  ? 55  TYR B O   1 
ATOM   1177 C CB  . TYR B 2 55  ? -9.948  28.886 7.395   1.00 14.96  ? 55  TYR B CB  1 
ATOM   1178 C CG  . TYR B 2 55  ? -9.913  28.314 6.037   1.00 14.96  ? 55  TYR B CG  1 
ATOM   1179 C CD1 . TYR B 2 55  ? -10.430 29.024 4.960   1.00 14.96  ? 55  TYR B CD1 1 
ATOM   1180 C CD2 . TYR B 2 55  ? -9.352  27.074 5.802   1.00 14.96  ? 55  TYR B CD2 1 
ATOM   1181 C CE1 . TYR B 2 55  ? -10.391 28.516 3.678   1.00 14.96  ? 55  TYR B CE1 1 
ATOM   1182 C CE2 . TYR B 2 55  ? -9.305  26.559 4.519   1.00 14.96  ? 55  TYR B CE2 1 
ATOM   1183 C CZ  . TYR B 2 55  ? -9.832  27.301 3.474   1.00 14.96  ? 55  TYR B CZ  1 
ATOM   1184 O OH  . TYR B 2 55  ? -9.796  26.819 2.209   1.00 14.96  ? 55  TYR B OH  1 
ATOM   1185 N N   . PHE B 2 56  ? -7.346  28.001 8.737   1.00 9.66   ? 56  PHE B N   1 
ATOM   1186 C CA  . PHE B 2 56  ? -6.107  27.285 8.985   1.00 9.66   ? 56  PHE B CA  1 
ATOM   1187 C C   . PHE B 2 56  ? -6.252  25.817 9.098   1.00 9.66   ? 56  PHE B C   1 
ATOM   1188 O O   . PHE B 2 56  ? -7.349  25.309 9.147   1.00 9.66   ? 56  PHE B O   1 
ATOM   1189 C CB  . PHE B 2 56  ? -5.550  27.774 10.316  1.00 7.40   ? 56  PHE B CB  1 
ATOM   1190 C CG  . PHE B 2 56  ? -5.595  29.244 10.469  1.00 7.40   ? 56  PHE B CG  1 
ATOM   1191 C CD1 . PHE B 2 56  ? -4.559  30.027 9.996   1.00 7.40   ? 56  PHE B CD1 1 
ATOM   1192 C CD2 . PHE B 2 56  ? -6.718  29.857 11.006  1.00 7.40   ? 56  PHE B CD2 1 
ATOM   1193 C CE1 . PHE B 2 56  ? -4.636  31.430 10.044  1.00 7.40   ? 56  PHE B CE1 1 
ATOM   1194 C CE2 . PHE B 2 56  ? -6.828  31.233 11.066  1.00 7.40   ? 56  PHE B CE2 1 
ATOM   1195 C CZ  . PHE B 2 56  ? -5.781  32.039 10.582  1.00 7.40   ? 56  PHE B CZ  1 
ATOM   1196 N N   . PHE B 2 57  ? -5.134  25.123 9.185   1.00 16.06  ? 57  PHE B N   1 
ATOM   1197 C CA  . PHE B 2 57  ? -5.184  23.702 9.357   1.00 16.06  ? 57  PHE B CA  1 
ATOM   1198 C C   . PHE B 2 57  ? -4.355  23.451 10.615  1.00 16.06  ? 57  PHE B C   1 
ATOM   1199 O O   . PHE B 2 57  ? -3.156  23.695 10.631  1.00 16.06  ? 57  PHE B O   1 
ATOM   1200 C CB  . PHE B 2 57  ? -4.613  22.985 8.144   1.00 8.78   ? 57  PHE B CB  1 
ATOM   1201 C CG  . PHE B 2 57  ? -4.584  21.500 8.311   1.00 8.78   ? 57  PHE B CG  1 
ATOM   1202 C CD1 . PHE B 2 57  ? -3.546  20.886 9.020   1.00 8.78   ? 57  PHE B CD1 1 
ATOM   1203 C CD2 . PHE B 2 57  ? -5.613  20.712 7.821   1.00 8.78   ? 57  PHE B CD2 1 
ATOM   1204 C CE1 . PHE B 2 57  ? -3.539  19.500 9.241   1.00 8.78   ? 57  PHE B CE1 1 
ATOM   1205 C CE2 . PHE B 2 57  ? -5.606  19.316 8.045   1.00 8.78   ? 57  PHE B CE2 1 
ATOM   1206 C CZ  . PHE B 2 57  ? -4.562  18.710 8.757   1.00 8.78   ? 57  PHE B CZ  1 
ATOM   1207 N N   . GLU B 2 58  ? -4.977  22.914 11.656  1.00 18.11  ? 58  GLU B N   1 
ATOM   1208 C CA  . GLU B 2 58  ? -4.293  22.722 12.922  1.00 18.11  ? 58  GLU B CA  1 
ATOM   1209 C C   . GLU B 2 58  ? -4.424  21.332 13.537  1.00 18.11  ? 58  GLU B C   1 
ATOM   1210 O O   . GLU B 2 58  ? -5.384  20.596 13.269  1.00 18.11  ? 58  GLU B O   1 
ATOM   1211 C CB  . GLU B 2 58  ? -4.837  23.752 13.916  1.00 7.42   ? 58  GLU B CB  1 
ATOM   1212 C CG  . GLU B 2 58  ? -4.902  25.211 13.419  1.00 7.42   ? 58  GLU B CG  1 
ATOM   1213 C CD  . GLU B 2 58  ? -5.365  26.172 14.510  1.00 7.42   ? 58  GLU B CD  1 
ATOM   1214 O OE1 . GLU B 2 58  ? -5.170  25.849 15.687  1.00 7.42   ? 58  GLU B OE1 1 
ATOM   1215 O OE2 . GLU B 2 58  ? -5.926  27.258 14.251  1.00 7.42   ? 58  GLU B OE2 1 
ATOM   1216 N N   . THR B 2 59  ? -3.458  20.982 14.372  1.00 14.15  ? 59  THR B N   1 
ATOM   1217 C CA  . THR B 2 59  ? -3.479  19.719 15.067  1.00 14.15  ? 59  THR B CA  1 
ATOM   1218 C C   . THR B 2 59  ? -3.510  20.022 16.560  1.00 14.15  ? 59  THR B C   1 
ATOM   1219 O O   . THR B 2 59  ? -2.659  20.769 17.050  1.00 14.15  ? 59  THR B O   1 
ATOM   1220 C CB  . THR B 2 59  ? -2.242  18.907 14.753  1.00 14.96  ? 59  THR B CB  1 
ATOM   1221 O OG1 . THR B 2 59  ? -2.133  18.744 13.338  1.00 14.96  ? 59  THR B OG1 1 
ATOM   1222 C CG2 . THR B 2 59  ? -2.336  17.543 15.385  1.00 14.96  ? 59  THR B CG2 1 
ATOM   1223 N N   . ARG B 2 60  ? -4.501  19.466 17.261  1.00 28.16  ? 60  ARG B N   1 
ATOM   1224 C CA  . ARG B 2 60  ? -4.713  19.638 18.710  1.00 28.16  ? 60  ARG B CA  1 
ATOM   1225 C C   . ARG B 2 60  ? -4.752  18.308 19.473  1.00 28.16  ? 60  ARG B C   1 
ATOM   1226 O O   . ARG B 2 60  ? -4.631  17.216 18.880  1.00 28.16  ? 60  ARG B O   1 
ATOM   1227 C CB  . ARG B 2 60  ? -6.020  20.379 18.946  1.00 41.12  ? 60  ARG B CB  1 
ATOM   1228 C CG  . ARG B 2 60  ? -5.921  21.746 18.412  1.00 41.12  ? 60  ARG B CG  1 
ATOM   1229 C CD  . ARG B 2 60  ? -7.250  22.431 18.256  1.00 41.12  ? 60  ARG B CD  1 
ATOM   1230 N NE  . ARG B 2 60  ? -7.046  23.838 17.868  1.00 41.12  ? 60  ARG B NE  1 
ATOM   1231 C CZ  . ARG B 2 60  ? -8.016  24.643 17.433  1.00 41.12  ? 60  ARG B CZ  1 
ATOM   1232 N NH1 . ARG B 2 60  ? -9.268  24.187 17.313  1.00 41.12  ? 60  ARG B NH1 1 
ATOM   1233 N NH2 . ARG B 2 60  ? -7.746  25.917 17.154  1.00 41.12  ? 60  ARG B NH2 1 
ATOM   1234 N N   . CYS B 2 61  ? -4.976  18.385 20.783  1.00 13.77  ? 61  CYS B N   1 
ATOM   1235 C CA  . CYS B 2 61  ? -5.021  17.173 21.603  1.00 13.77  ? 61  CYS B CA  1 
ATOM   1236 C C   . CYS B 2 61  ? -6.440  16.655 21.691  1.00 13.77  ? 61  CYS B C   1 
ATOM   1237 O O   . CYS B 2 61  ? -7.347  17.451 21.750  1.00 13.77  ? 61  CYS B O   1 
ATOM   1238 C CB  . CYS B 2 61  ? -4.480  17.495 22.985  1.00 14.37  ? 61  CYS B CB  1 
ATOM   1239 S SG  . CYS B 2 61  ? -2.723  17.940 22.956  1.00 14.37  ? 61  CYS B SG  1 
ATOM   1240 N N   . LYS B 2 62  ? -6.642  15.341 21.698  1.00 39.90  ? 62  LYS B N   1 
ATOM   1241 C CA  . LYS B 2 62  ? -7.995  14.802 21.778  1.00 39.90  ? 62  LYS B CA  1 
ATOM   1242 C C   . LYS B 2 62  ? -8.477  14.870 23.214  1.00 39.90  ? 62  LYS B C   1 
ATOM   1243 O O   . LYS B 2 62  ? -9.589  14.472 23.514  1.00 39.90  ? 62  LYS B O   1 
ATOM   1244 C CB  . LYS B 2 62  ? -8.054  13.349 21.262  1.00 75.40  ? 62  LYS B CB  1 
ATOM   1245 C CG  . LYS B 2 62  ? -9.430  12.934 20.673  1.00 75.40  ? 62  LYS B CG  1 
ATOM   1246 C CD  . LYS B 2 62  ? -9.476  11.481 20.125  1.00 75.40  ? 62  LYS B CD  1 
ATOM   1247 C CE  . LYS B 2 62  ? -9.530  10.403 21.234  1.00 75.40  ? 62  LYS B CE  1 
ATOM   1248 N NZ  . LYS B 2 62  ? -9.531  8.996  20.704  1.00 75.40  ? 62  LYS B NZ  1 
ATOM   1249 N N   . ALA B 2 63  ? -7.629  15.343 24.115  1.00 139.65 ? 63  ALA B N   1 
ATOM   1250 C CA  . ALA B 2 63  ? -8.003  15.450 25.517  1.00 139.65 ? 63  ALA B CA  1 
ATOM   1251 C C   . ALA B 2 63  ? -9.059  16.544 25.736  1.00 139.65 ? 63  ALA B C   1 
ATOM   1252 O O   . ALA B 2 63  ? -10.087 16.246 26.385  1.00 111.81 ? 63  ALA B O   1 
ATOM   1253 C CB  . ALA B 2 63  ? -6.765  15.712 26.362  1.00 58.09  ? 63  ALA B CB  1 
ATOM   1254 N N   . GLU B 2 68  ? -12.408 20.641 34.771  1.00 101.40 ? 68  GLU B N   1 
ATOM   1255 C CA  . GLU B 2 68  ? -13.760 20.239 34.261  1.00 101.40 ? 68  GLU B CA  1 
ATOM   1256 C C   . GLU B 2 68  ? -13.956 18.721 34.010  1.00 101.40 ? 68  GLU B C   1 
ATOM   1257 O O   . GLU B 2 68  ? -14.608 18.310 33.051  1.00 101.40 ? 68  GLU B O   1 
ATOM   1258 C CB  . GLU B 2 68  ? -14.125 21.051 33.011  1.00 83.72  ? 68  GLU B CB  1 
ATOM   1259 N N   . GLY B 2 69  ? -13.383 17.907 34.891  1.00 94.94  ? 69  GLY B N   1 
ATOM   1260 C CA  . GLY B 2 69  ? -13.514 16.457 34.836  1.00 94.94  ? 69  GLY B CA  1 
ATOM   1261 C C   . GLY B 2 69  ? -13.775 16.126 36.300  1.00 94.94  ? 69  GLY B C   1 
ATOM   1262 O O   . GLY B 2 69  ? -13.493 16.970 37.144  1.00 94.94  ? 69  GLY B O   1 
ATOM   1263 N N   . GLY B 2 70  ? -14.317 14.959 36.633  1.00 58.42  ? 70  GLY B N   1 
ATOM   1264 C CA  . GLY B 2 70  ? -14.578 14.660 38.037  1.00 58.42  ? 70  GLY B CA  1 
ATOM   1265 C C   . GLY B 2 70  ? -13.451 15.077 38.981  1.00 58.42  ? 70  GLY B C   1 
ATOM   1266 O O   . GLY B 2 70  ? -12.282 14.925 38.628  1.00 58.42  ? 70  GLY B O   1 
ATOM   1267 N N   . PRO B 2 71  ? -13.756 15.618 40.172  1.00 60.40  ? 71  PRO B N   1 
ATOM   1268 C CA  . PRO B 2 71  ? -12.760 16.059 41.170  1.00 60.40  ? 71  PRO B CA  1 
ATOM   1269 C C   . PRO B 2 71  ? -11.922 14.892 41.708  1.00 60.40  ? 71  PRO B C   1 
ATOM   1270 O O   . PRO B 2 71  ? -12.365 13.724 41.718  1.00 60.40  ? 71  PRO B O   1 
ATOM   1271 C CB  . PRO B 2 71  ? -13.623 16.652 42.275  1.00 38.21  ? 71  PRO B CB  1 
ATOM   1272 C CG  . PRO B 2 71  ? -14.845 15.791 42.230  1.00 38.21  ? 71  PRO B CG  1 
ATOM   1273 C CD  . PRO B 2 71  ? -15.114 15.691 40.728  1.00 38.21  ? 71  PRO B CD  1 
ATOM   1274 N N   . GLY B 2 72  ? -10.741 15.210 42.229  1.00 80.89  ? 72  GLY B N   1 
ATOM   1275 C CA  . GLY B 2 72  ? -9.868  14.153 42.704  1.00 80.89  ? 72  GLY B CA  1 
ATOM   1276 C C   . GLY B 2 72  ? -9.367  13.504 41.426  1.00 80.89  ? 72  GLY B C   1 
ATOM   1277 O O   . GLY B 2 72  ? -8.363  13.957 40.870  1.00 80.89  ? 72  GLY B O   1 
ATOM   1278 N N   . ALA B 2 73  ? -10.144 12.545 40.911  1.00 124.00 ? 73  ALA B N   1 
ATOM   1279 C CA  . ALA B 2 73  ? -9.859  11.801 39.676  1.00 126.64 ? 73  ALA B CA  1 
ATOM   1280 C C   . ALA B 2 73  ? -8.563  12.172 38.922  1.00 125.69 ? 73  ALA B C   1 
ATOM   1281 O O   . ALA B 2 73  ? -7.471  11.776 39.338  1.00 127.93 ? 73  ALA B O   1 
ATOM   1282 C CB  . ALA B 2 73  ? -11.076 11.868 38.736  1.00 46.13  ? 73  ALA B CB  1 
ATOM   1283 N N   . GLY B 2 74  ? -8.688  12.908 37.818  1.00 95.35  ? 74  GLY B N   1 
ATOM   1284 C CA  . GLY B 2 74  ? -7.529  13.318 37.031  1.00 97.29  ? 74  GLY B CA  1 
ATOM   1285 C C   . GLY B 2 74  ? -6.454  12.282 36.695  1.00 95.81  ? 74  GLY B C   1 
ATOM   1286 O O   . GLY B 2 74  ? -6.753  11.172 36.234  1.00 99.42  ? 74  GLY B O   1 
ATOM   1287 N N   . GLY B 2 75  ? -5.192  12.685 36.875  1.00 84.45  ? 75  GLY B N   1 
ATOM   1288 C CA  . GLY B 2 75  ? -4.047  11.825 36.604  1.00 83.70  ? 75  GLY B CA  1 
ATOM   1289 C C   . GLY B 2 75  ? -3.870  11.402 35.156  1.00 84.48  ? 75  GLY B C   1 
ATOM   1290 O O   . GLY B 2 75  ? -3.337  10.331 34.873  1.00 86.92  ? 75  GLY B O   1 
ATOM   1291 N N   . GLY B 2 76  ? -4.258  12.270 34.231  1.00 132.46 ? 76  GLY B N   1 
ATOM   1292 C CA  . GLY B 2 76  ? -4.149  11.938 32.822  1.00 130.50 ? 76  GLY B CA  1 
ATOM   1293 C C   . GLY B 2 76  ? -2.818  12.258 32.171  1.00 128.00 ? 76  GLY B C   1 
ATOM   1294 O O   . GLY B 2 76  ? -2.618  13.364 31.660  1.00 130.17 ? 76  GLY B O   1 
ATOM   1295 N N   . GLY B 2 77  ? -1.911  11.288 32.173  1.00 47.65  ? 77  GLY B N   1 
ATOM   1296 C CA  . GLY B 2 77  ? -0.611  11.506 31.562  1.00 50.82  ? 77  GLY B CA  1 
ATOM   1297 C C   . GLY B 2 77  ? -0.520  11.003 30.128  1.00 50.56  ? 77  GLY B C   1 
ATOM   1298 O O   . GLY B 2 77  ? -1.528  10.631 29.529  1.00 47.19  ? 77  GLY B O   1 
ATOM   1299 N N   . CYS B 2 78  ? 0.700   10.958 29.592  1.00 23.96  ? 78  CYS B N   1 
ATOM   1300 C CA  . CYS B 2 78  ? 0.930   10.501 28.220  1.00 23.96  ? 78  CYS B CA  1 
ATOM   1301 C C   . CYS B 2 78  ? 1.008   8.989  28.240  1.00 23.96  ? 78  CYS B C   1 
ATOM   1302 O O   . CYS B 2 78  ? 1.370   8.394  29.228  1.00 23.96  ? 78  CYS B O   1 
ATOM   1303 C CB  . CYS B 2 78  ? 2.214   11.122 27.672  1.00 20.05  ? 78  CYS B CB  1 
ATOM   1304 S SG  . CYS B 2 78  ? 2.462   12.863 28.204  1.00 20.05  ? 78  CYS B SG  1 
ATOM   1305 N N   . ARG B 2 79  ? 0.581   8.359  27.171  1.00 15.84  ? 79  ARG B N   1 
ATOM   1306 C CA  . ARG B 2 79  ? 0.614   6.914  27.112  1.00 15.84  ? 79  ARG B CA  1 
ATOM   1307 C C   . ARG B 2 79  ? 2.054   6.480  27.074  1.00 15.84  ? 79  ARG B C   1 
ATOM   1308 O O   . ARG B 2 79  ? 2.846   7.071  26.352  1.00 15.84  ? 79  ARG B O   1 
ATOM   1309 C CB  . ARG B 2 79  ? -0.123  6.463  25.874  1.00 16.81  ? 79  ARG B CB  1 
ATOM   1310 C CG  . ARG B 2 79  ? -0.154  4.991  25.576  1.00 16.81  ? 79  ARG B CG  1 
ATOM   1311 C CD  . ARG B 2 79  ? -0.922  4.820  24.234  1.00 16.81  ? 79  ARG B CD  1 
ATOM   1312 N NE  . ARG B 2 79  ? -2.320  5.259  24.370  1.00 16.81  ? 79  ARG B NE  1 
ATOM   1313 C CZ  . ARG B 2 79  ? -2.904  6.281  23.733  1.00 16.81  ? 79  ARG B CZ  1 
ATOM   1314 N NH1 . ARG B 2 79  ? -2.235  7.047  22.871  1.00 16.81  ? 79  ARG B NH1 1 
ATOM   1315 N NH2 . ARG B 2 79  ? -4.192  6.528  23.958  1.00 16.81  ? 79  ARG B NH2 1 
ATOM   1316 N N   . GLY B 2 80  ? 2.406   5.532  27.946  1.00 17.23  ? 80  GLY B N   1 
ATOM   1317 C CA  . GLY B 2 80  ? 3.769   5.013  27.984  1.00 17.23  ? 80  GLY B CA  1 
ATOM   1318 C C   . GLY B 2 80  ? 4.809   5.681  28.886  1.00 17.23  ? 80  GLY B C   1 
ATOM   1319 O O   . GLY B 2 80  ? 5.942   5.205  28.937  1.00 17.23  ? 80  GLY B O   1 
ATOM   1320 N N   . VAL B 2 81  ? 4.499   6.803  29.536  1.00 28.42  ? 81  VAL B N   1 
ATOM   1321 C CA  . VAL B 2 81  ? 5.512   7.386  30.409  1.00 28.42  ? 81  VAL B CA  1 
ATOM   1322 C C   . VAL B 2 81  ? 5.462   6.732  31.768  1.00 28.42  ? 81  VAL B C   1 
ATOM   1323 O O   . VAL B 2 81  ? 4.381   6.475  32.307  1.00 28.42  ? 81  VAL B O   1 
ATOM   1324 C CB  . VAL B 2 81  ? 5.410   8.902  30.573  1.00 45.44  ? 81  VAL B CB  1 
ATOM   1325 C CG1 . VAL B 2 81  ? 5.750   9.585  29.277  1.00 45.44  ? 81  VAL B CG1 1 
ATOM   1326 C CG2 . VAL B 2 81  ? 4.052   9.284  31.068  1.00 45.44  ? 81  VAL B CG2 1 
ATOM   1327 N N   . ASP B 2 82  ? 6.637   6.450  32.316  1.00 47.44  ? 82  ASP B N   1 
ATOM   1328 C CA  . ASP B 2 82  ? 6.746   5.799  33.615  1.00 47.44  ? 82  ASP B CA  1 
ATOM   1329 C C   . ASP B 2 82  ? 6.071   6.607  34.735  1.00 47.44  ? 82  ASP B C   1 
ATOM   1330 O O   . ASP B 2 82  ? 6.689   7.472  35.359  1.00 47.44  ? 82  ASP B O   1 
ATOM   1331 C CB  . ASP B 2 82  ? 8.214   5.554  33.933  1.00 35.06  ? 82  ASP B CB  1 
ATOM   1332 C CG  . ASP B 2 82  ? 8.410   4.464  34.947  1.00 35.06  ? 82  ASP B CG  1 
ATOM   1333 O OD1 . ASP B 2 82  ? 7.435   4.149  35.683  1.00 35.06  ? 82  ASP B OD1 1 
ATOM   1334 O OD2 . ASP B 2 82  ? 9.547   3.926  35.006  1.00 35.06  ? 82  ASP B OD2 1 
ATOM   1335 N N   . ARG B 2 83  ? 4.812   6.274  35.012  1.00 34.80  ? 83  ARG B N   1 
ATOM   1336 C CA  . ARG B 2 83  ? 4.017   6.955  36.029  1.00 34.80  ? 83  ARG B CA  1 
ATOM   1337 C C   . ARG B 2 83  ? 4.686   6.964  37.413  1.00 34.80  ? 83  ARG B C   1 
ATOM   1338 O O   . ARG B 2 83  ? 4.367   7.814  38.249  1.00 34.80  ? 83  ARG B O   1 
ATOM   1339 C CB  . ARG B 2 83  ? 2.624   6.319  36.106  1.00 138.77 ? 83  ARG B CB  1 
ATOM   1340 C CG  . ARG B 2 83  ? 1.928   6.187  34.753  1.00 138.77 ? 83  ARG B CG  1 
ATOM   1341 C CD  . ARG B 2 83  ? 0.456   5.851  34.907  1.00 138.77 ? 83  ARG B CD  1 
ATOM   1342 N NE  . ARG B 2 83  ? -0.260  6.890  35.646  1.00 138.77 ? 83  ARG B NE  1 
ATOM   1343 C CZ  . ARG B 2 83  ? -0.496  8.123  35.197  1.00 138.77 ? 83  ARG B CZ  1 
ATOM   1344 N NH1 . ARG B 2 83  ? -0.080  8.503  33.995  1.00 138.77 ? 83  ARG B NH1 1 
ATOM   1345 N NH2 . ARG B 2 83  ? -1.145  8.990  35.963  1.00 138.77 ? 83  ARG B NH2 1 
ATOM   1346 N N   . ARG B 2 84  ? 5.597   6.020  37.656  1.00 47.63  ? 84  ARG B N   1 
ATOM   1347 C CA  . ARG B 2 84  ? 6.311   5.936  38.937  1.00 47.63  ? 84  ARG B CA  1 
ATOM   1348 C C   . ARG B 2 84  ? 7.367   7.056  39.106  1.00 47.63  ? 84  ARG B C   1 
ATOM   1349 O O   . ARG B 2 84  ? 7.709   7.435  40.225  1.00 47.63  ? 84  ARG B O   1 
ATOM   1350 C CB  . ARG B 2 84  ? 7.028   4.589  39.059  1.00 59.08  ? 84  ARG B CB  1 
ATOM   1351 C CG  . ARG B 2 84  ? 6.188   3.361  38.748  1.00 59.08  ? 84  ARG B CG  1 
ATOM   1352 C CD  . ARG B 2 84  ? 7.062   2.121  38.747  1.00 59.08  ? 84  ARG B CD  1 
ATOM   1353 N NE  . ARG B 2 84  ? 8.241   2.318  37.903  1.00 59.08  ? 84  ARG B NE  1 
ATOM   1354 C CZ  . ARG B 2 84  ? 9.297   1.505  37.858  1.00 59.08  ? 84  ARG B CZ  1 
ATOM   1355 N NH1 . ARG B 2 84  ? 9.351   0.413  38.617  1.00 59.08  ? 84  ARG B NH1 1 
ATOM   1356 N NH2 . ARG B 2 84  ? 10.295  1.769  37.024  1.00 59.08  ? 84  ARG B NH2 1 
ATOM   1357 N N   . HIS B 2 85  ? 7.911   7.545  37.991  1.00 25.51  ? 85  HIS B N   1 
ATOM   1358 C CA  . HIS B 2 85  ? 8.932   8.585  37.990  1.00 25.51  ? 85  HIS B CA  1 
ATOM   1359 C C   . HIS B 2 85  ? 8.377   9.937  37.540  1.00 25.51  ? 85  HIS B C   1 
ATOM   1360 O O   . HIS B 2 85  ? 8.857   10.983 37.970  1.00 25.51  ? 85  HIS B O   1 
ATOM   1361 C CB  . HIS B 2 85  ? 10.078  8.237  37.005  1.00 46.94  ? 85  HIS B CB  1 
ATOM   1362 C CG  . HIS B 2 85  ? 10.785  6.931  37.258  1.00 46.94  ? 85  HIS B CG  1 
ATOM   1363 N ND1 . HIS B 2 85  ? 10.606  6.167  38.402  1.00 46.94  ? 85  HIS B ND1 1 
ATOM   1364 C CD2 . HIS B 2 85  ? 11.707  6.271  36.509  1.00 46.94  ? 85  HIS B CD2 1 
ATOM   1365 C CE1 . HIS B 2 85  ? 11.389  5.101  38.340  1.00 46.94  ? 85  HIS B CE1 1 
ATOM   1366 N NE2 . HIS B 2 85  ? 12.065  5.137  37.207  1.00 46.94  ? 85  HIS B NE2 1 
ATOM   1367 N N   . TRP B 2 86  ? 7.359   9.948  36.686  1.00 16.12  ? 86  TRP B N   1 
ATOM   1368 C CA  . TRP B 2 86  ? 6.897   11.224 36.151  1.00 16.12  ? 86  TRP B CA  1 
ATOM   1369 C C   . TRP B 2 86  ? 5.430   11.586 36.173  1.00 16.12  ? 86  TRP B C   1 
ATOM   1370 O O   . TRP B 2 86  ? 4.553   10.734 35.987  1.00 16.12  ? 86  TRP B O   1 
ATOM   1371 C CB  . TRP B 2 86  ? 7.324   11.329 34.690  1.00 14.07  ? 86  TRP B CB  1 
ATOM   1372 C CG  . TRP B 2 86  ? 8.789   11.259 34.426  1.00 14.07  ? 86  TRP B CG  1 
ATOM   1373 C CD1 . TRP B 2 86  ? 9.508   10.161 34.021  1.00 14.07  ? 86  TRP B CD1 1 
ATOM   1374 C CD2 . TRP B 2 86  ? 9.701   12.349 34.446  1.00 14.07  ? 86  TRP B CD2 1 
ATOM   1375 N NE1 . TRP B 2 86  ? 10.814  10.510 33.779  1.00 14.07  ? 86  TRP B NE1 1 
ATOM   1376 C CE2 . TRP B 2 86  ? 10.964  11.848 34.030  1.00 14.07  ? 86  TRP B CE2 1 
ATOM   1377 C CE3 . TRP B 2 86  ? 9.568   13.719 34.762  1.00 14.07  ? 86  TRP B CE3 1 
ATOM   1378 C CZ2 . TRP B 2 86  ? 12.093  12.666 33.912  1.00 14.07  ? 86  TRP B CZ2 1 
ATOM   1379 C CZ3 . TRP B 2 86  ? 10.677  14.532 34.647  1.00 14.07  ? 86  TRP B CZ3 1 
ATOM   1380 C CH2 . TRP B 2 86  ? 11.932  14.005 34.221  1.00 14.07  ? 86  TRP B CH2 1 
ATOM   1381 N N   . VAL B 2 87  ? 5.204   12.891 36.309  1.00 34.65  ? 87  VAL B N   1 
ATOM   1382 C CA  . VAL B 2 87  ? 3.885   13.481 36.246  1.00 34.65  ? 87  VAL B CA  1 
ATOM   1383 C C   . VAL B 2 87  ? 3.922   14.078 34.834  1.00 34.65  ? 87  VAL B C   1 
ATOM   1384 O O   . VAL B 2 87  ? 4.790   14.892 34.537  1.00 34.65  ? 87  VAL B O   1 
ATOM   1385 C CB  . VAL B 2 87  ? 3.755   14.603 37.228  1.00 32.86  ? 87  VAL B CB  1 
ATOM   1386 C CG1 . VAL B 2 87  ? 2.441   15.327 37.009  1.00 32.86  ? 87  VAL B CG1 1 
ATOM   1387 C CG2 . VAL B 2 87  ? 3.829   14.064 38.620  1.00 32.86  ? 87  VAL B CG2 1 
ATOM   1388 N N   . SER B 2 88  ? 3.020   13.653 33.953  1.00 30.35  ? 88  SER B N   1 
ATOM   1389 C CA  . SER B 2 88  ? 3.018   14.140 32.582  1.00 30.35  ? 88  SER B CA  1 
ATOM   1390 C C   . SER B 2 88  ? 1.680   14.729 32.133  1.00 30.35  ? 88  SER B C   1 
ATOM   1391 O O   . SER B 2 88  ? 0.664   14.576 32.786  1.00 30.35  ? 88  SER B O   1 
ATOM   1392 C CB  . SER B 2 88  ? 3.436   13.009 31.653  1.00 20.50  ? 88  SER B CB  1 
ATOM   1393 O OG  . SER B 2 88  ? 2.527   11.931 31.749  1.00 20.50  ? 88  SER B OG  1 
ATOM   1394 N N   . GLU B 2 89  ? 1.665   15.336 30.963  1.00 31.51  ? 89  GLU B N   1 
ATOM   1395 C CA  . GLU B 2 89  ? 0.451   15.957 30.477  1.00 31.51  ? 89  GLU B CA  1 
ATOM   1396 C C   . GLU B 2 89  ? 0.623   16.272 28.985  1.00 31.51  ? 89  GLU B C   1 
ATOM   1397 O O   . GLU B 2 89  ? 1.668   16.714 28.579  1.00 31.51  ? 89  GLU B O   1 
ATOM   1398 C CB  . GLU B 2 89  ? 0.201   17.216 31.322  1.00 31.36  ? 89  GLU B CB  1 
ATOM   1399 C CG  . GLU B 2 89  ? -0.774  18.200 30.752  1.00 31.36  ? 89  GLU B CG  1 
ATOM   1400 C CD  . GLU B 2 89  ? -1.034  19.391 31.679  1.00 31.36  ? 89  GLU B CD  1 
ATOM   1401 O OE1 . GLU B 2 89  ? -1.910  19.255 32.549  1.00 31.36  ? 89  GLU B OE1 1 
ATOM   1402 O OE2 . GLU B 2 89  ? -0.396  20.464 31.547  1.00 31.36  ? 89  GLU B OE2 1 
ATOM   1403 N N   . CYS B 2 90  ? -0.339  15.888 28.158  1.00 19.75  ? 90  CYS B N   1 
ATOM   1404 C CA  . CYS B 2 90  ? -0.298  16.187 26.733  1.00 19.75  ? 90  CYS B CA  1 
ATOM   1405 C C   . CYS B 2 90  ? -0.702  17.651 26.550  1.00 19.75  ? 90  CYS B C   1 
ATOM   1406 O O   . CYS B 2 90  ? -1.736  18.077 27.047  1.00 19.75  ? 90  CYS B O   1 
ATOM   1407 C CB  . CYS B 2 90  ? -1.306  15.341 26.001  1.00 17.17  ? 90  CYS B CB  1 
ATOM   1408 S SG  . CYS B 2 90  ? -0.884  13.586 25.899  1.00 17.17  ? 90  CYS B SG  1 
ATOM   1409 N N   . LYS B 2 91  ? 0.105   18.438 25.862  1.00 36.85  ? 91  LYS B N   1 
ATOM   1410 C CA  . LYS B 2 91  ? -0.225  19.839 25.654  1.00 36.85  ? 91  LYS B CA  1 
ATOM   1411 C C   . LYS B 2 91  ? -0.045  20.084 24.160  1.00 36.85  ? 91  LYS B C   1 
ATOM   1412 O O   . LYS B 2 91  ? 0.552   19.266 23.458  1.00 36.85  ? 91  LYS B O   1 
ATOM   1413 C CB  . LYS B 2 91  ? 0.688   20.734 26.498  1.00 56.44  ? 91  LYS B CB  1 
ATOM   1414 C CG  . LYS B 2 91  ? -0.041  21.893 27.165  1.00 56.44  ? 91  LYS B CG  1 
ATOM   1415 C CD  . LYS B 2 91  ? 0.808   22.621 28.206  1.00 56.44  ? 91  LYS B CD  1 
ATOM   1416 C CE  . LYS B 2 91  ? 1.383   21.655 29.254  1.00 56.44  ? 91  LYS B CE  1 
ATOM   1417 N NZ  . LYS B 2 91  ? 1.670   22.314 30.574  1.00 56.44  ? 91  LYS B NZ  1 
ATOM   1418 N N   . ALA B 2 92  ? -0.651  21.143 23.647  1.00 25.83  ? 92  ALA B N   1 
ATOM   1419 C CA  . ALA B 2 92  ? -0.533  21.458 22.226  1.00 25.83  ? 92  ALA B CA  1 
ATOM   1420 C C   . ALA B 2 92  ? 0.714   22.305 21.991  1.00 25.83  ? 92  ALA B C   1 
ATOM   1421 O O   . ALA B 2 92  ? 1.158   23.046 22.876  1.00 25.83  ? 92  ALA B O   1 
ATOM   1422 C CB  . ALA B 2 92  ? -1.816  22.189 21.719  1.00 2.00   ? 92  ALA B CB  1 
ATOM   1423 N N   . LYS B 2 93  ? 1.270   22.195 20.794  1.00 25.26  ? 93  LYS B N   1 
ATOM   1424 C CA  . LYS B 2 93  ? 2.471   22.943 20.423  1.00 25.26  ? 93  LYS B CA  1 
ATOM   1425 C C   . LYS B 2 93  ? 2.079   23.930 19.293  1.00 25.26  ? 93  LYS B C   1 
ATOM   1426 O O   . LYS B 2 93  ? 1.190   23.628 18.492  1.00 25.26  ? 93  LYS B O   1 
ATOM   1427 C CB  . LYS B 2 93  ? 3.556   21.950 19.956  1.00 50.49  ? 93  LYS B CB  1 
ATOM   1428 C CG  . LYS B 2 93  ? 5.007   22.416 20.074  1.00 50.49  ? 93  LYS B CG  1 
ATOM   1429 C CD  . LYS B 2 93  ? 5.513   22.434 21.521  1.00 50.49  ? 93  LYS B CD  1 
ATOM   1430 C CE  . LYS B 2 93  ? 6.879   21.695 21.681  1.00 50.49  ? 93  LYS B CE  1 
ATOM   1431 N NZ  . LYS B 2 93  ? 8.019   22.202 20.825  1.00 50.49  ? 93  LYS B NZ  1 
ATOM   1432 N N   . GLN B 2 94  ? 2.710   25.109 19.260  1.00 24.46  ? 94  GLN B N   1 
ATOM   1433 C CA  . GLN B 2 94  ? 2.447   26.126 18.228  1.00 24.46  ? 94  GLN B CA  1 
ATOM   1434 C C   . GLN B 2 94  ? 3.541   26.350 17.182  1.00 24.46  ? 94  GLN B C   1 
ATOM   1435 O O   . GLN B 2 94  ? 4.734   26.050 17.387  1.00 24.46  ? 94  GLN B O   1 
ATOM   1436 C CB  . GLN B 2 94  ? 2.175   27.495 18.845  1.00 34.40  ? 94  GLN B CB  1 
ATOM   1437 C CG  . GLN B 2 94  ? 0.799   27.690 19.362  1.00 34.40  ? 94  GLN B CG  1 
ATOM   1438 C CD  . GLN B 2 94  ? 0.699   27.293 20.774  1.00 34.40  ? 94  GLN B CD  1 
ATOM   1439 O OE1 . GLN B 2 94  ? 0.563   26.112 21.092  1.00 34.40  ? 94  GLN B OE1 1 
ATOM   1440 N NE2 . GLN B 2 94  ? 0.803   28.268 21.660  1.00 34.40  ? 94  GLN B NE2 1 
ATOM   1441 N N   . SER B 2 95  ? 3.114   26.975 16.095  1.00 28.19  ? 95  SER B N   1 
ATOM   1442 C CA  . SER B 2 95  ? 3.972   27.343 14.993  1.00 28.19  ? 95  SER B CA  1 
ATOM   1443 C C   . SER B 2 95  ? 3.337   28.639 14.559  1.00 28.19  ? 95  SER B C   1 
ATOM   1444 O O   . SER B 2 95  ? 2.144   28.857 14.801  1.00 28.19  ? 95  SER B O   1 
ATOM   1445 C CB  . SER B 2 95  ? 3.874   26.333 13.868  1.00 15.90  ? 95  SER B CB  1 
ATOM   1446 O OG  . SER B 2 95  ? 4.098   25.044 14.361  1.00 15.90  ? 95  SER B OG  1 
ATOM   1447 N N   . TYR B 2 96  ? 4.125   29.498 13.931  1.00 11.53  ? 96  TYR B N   1 
ATOM   1448 C CA  . TYR B 2 96  ? 3.655   30.785 13.481  1.00 11.53  ? 96  TYR B CA  1 
ATOM   1449 C C   . TYR B 2 96  ? 3.276   30.734 12.035  1.00 11.53  ? 96  TYR B C   1 
ATOM   1450 O O   . TYR B 2 96  ? 3.953   30.089 11.231  1.00 11.53  ? 96  TYR B O   1 
ATOM   1451 C CB  . TYR B 2 96  ? 4.762   31.824 13.638  1.00 21.83  ? 96  TYR B CB  1 
ATOM   1452 C CG  . TYR B 2 96  ? 5.091   32.154 15.071  1.00 21.83  ? 96  TYR B CG  1 
ATOM   1453 C CD1 . TYR B 2 96  ? 4.304   33.054 15.791  1.00 21.83  ? 96  TYR B CD1 1 
ATOM   1454 C CD2 . TYR B 2 96  ? 6.184   31.580 15.705  1.00 21.83  ? 96  TYR B CD2 1 
ATOM   1455 C CE1 . TYR B 2 96  ? 4.586   33.385 17.100  1.00 21.83  ? 96  TYR B CE1 1 
ATOM   1456 C CE2 . TYR B 2 96  ? 6.481   31.888 17.015  1.00 21.83  ? 96  TYR B CE2 1 
ATOM   1457 C CZ  . TYR B 2 96  ? 5.673   32.797 17.715  1.00 21.83  ? 96  TYR B CZ  1 
ATOM   1458 O OH  . TYR B 2 96  ? 5.931   33.096 19.045  1.00 21.83  ? 96  TYR B OH  1 
ATOM   1459 N N   . VAL B 2 97  ? 2.175   31.390 11.703  1.00 8.90   ? 97  VAL B N   1 
ATOM   1460 C CA  . VAL B 2 97  ? 1.765   31.501 10.316  1.00 8.90   ? 97  VAL B CA  1 
ATOM   1461 C C   . VAL B 2 97  ? 1.445   32.977 10.194  1.00 8.90   ? 97  VAL B C   1 
ATOM   1462 O O   . VAL B 2 97  ? 1.275   33.669 11.213  1.00 8.90   ? 97  VAL B O   1 
ATOM   1463 C CB  . VAL B 2 97  ? 0.522   30.654 9.963   1.00 5.20   ? 97  VAL B CB  1 
ATOM   1464 C CG1 . VAL B 2 97  ? 0.790   29.170 10.143  1.00 5.20   ? 97  VAL B CG1 1 
ATOM   1465 C CG2 . VAL B 2 97  ? -0.652  31.071 10.776  1.00 5.20   ? 97  VAL B CG2 1 
ATOM   1466 N N   . ARG B 2 98  ? 1.480   33.498 8.976   1.00 15.50  ? 98  ARG B N   1 
ATOM   1467 C CA  . ARG B 2 98  ? 1.174   34.900 8.771   1.00 15.50  ? 98  ARG B CA  1 
ATOM   1468 C C   . ARG B 2 98  ? -0.321  34.991 8.487   1.00 15.50  ? 98  ARG B C   1 
ATOM   1469 O O   . ARG B 2 98  ? -0.878  34.165 7.766   1.00 15.50  ? 98  ARG B O   1 
ATOM   1470 C CB  . ARG B 2 98  ? 1.994   35.468 7.628   1.00 35.35  ? 98  ARG B CB  1 
ATOM   1471 C CG  . ARG B 2 98  ? 1.765   36.919 7.460   1.00 35.35  ? 98  ARG B CG  1 
ATOM   1472 C CD  . ARG B 2 98  ? 2.936   37.698 7.902   1.00 35.35  ? 98  ARG B CD  1 
ATOM   1473 N NE  . ARG B 2 98  ? 4.000   37.521 6.931   1.00 35.35  ? 98  ARG B NE  1 
ATOM   1474 C CZ  . ARG B 2 98  ? 5.093   38.278 6.864   1.00 35.35  ? 98  ARG B CZ  1 
ATOM   1475 N NH1 . ARG B 2 98  ? 5.296   39.273 7.723   1.00 35.35  ? 98  ARG B NH1 1 
ATOM   1476 N NH2 . ARG B 2 98  ? 6.004   38.018 5.939   1.00 35.35  ? 98  ARG B NH2 1 
ATOM   1477 N N   . ALA B 2 99  ? -0.983  35.960 9.101   1.00 9.45   ? 99  ALA B N   1 
ATOM   1478 C CA  . ALA B 2 99  ? -2.417  36.115 8.922   1.00 9.45   ? 99  ALA B CA  1 
ATOM   1479 C C   . ALA B 2 99  ? -2.792  37.574 9.027   1.00 9.45   ? 99  ALA B C   1 
ATOM   1480 O O   . ALA B 2 99  ? -2.093  38.350 9.725   1.00 9.45   ? 99  ALA B O   1 
ATOM   1481 C CB  . ALA B 2 99  ? -3.152  35.334 9.950   1.00 2.00   ? 99  ALA B CB  1 
ATOM   1482 N N   . LEU B 2 100 ? -3.828  37.968 8.276   1.00 15.27  ? 100 LEU B N   1 
ATOM   1483 C CA  . LEU B 2 100 ? -4.276  39.344 8.304   1.00 15.27  ? 100 LEU B CA  1 
ATOM   1484 C C   . LEU B 2 100 ? -5.081  39.432 9.575   1.00 15.27  ? 100 LEU B C   1 
ATOM   1485 O O   . LEU B 2 100 ? -6.063  38.691 9.755   1.00 15.27  ? 100 LEU B O   1 
ATOM   1486 C CB  . LEU B 2 100 ? -5.145  39.662 7.112   1.00 19.10  ? 100 LEU B CB  1 
ATOM   1487 C CG  . LEU B 2 100 ? -5.584  41.123 7.122   1.00 19.10  ? 100 LEU B CG  1 
ATOM   1488 C CD1 . LEU B 2 100 ? -4.368  42.055 7.043   1.00 19.10  ? 100 LEU B CD1 1 
ATOM   1489 C CD2 . LEU B 2 100 ? -6.523  41.324 5.947   1.00 19.10  ? 100 LEU B CD2 1 
ATOM   1490 N N   . THR B 2 101 ? -4.677  40.343 10.446  1.00 23.77  ? 101 THR B N   1 
ATOM   1491 C CA  . THR B 2 101 ? -5.294  40.468 11.747  1.00 23.77  ? 101 THR B CA  1 
ATOM   1492 C C   . THR B 2 101 ? -5.426  41.928 12.156  1.00 23.77  ? 101 THR B C   1 
ATOM   1493 O O   . THR B 2 101 ? -4.869  42.797 11.486  1.00 23.77  ? 101 THR B O   1 
ATOM   1494 C CB  . THR B 2 101 ? -4.387  39.782 12.770  1.00 5.77   ? 101 THR B CB  1 
ATOM   1495 O OG1 . THR B 2 101 ? -3.130  40.469 12.820  1.00 5.77   ? 101 THR B OG1 1 
ATOM   1496 C CG2 . THR B 2 101 ? -4.108  38.344 12.391  1.00 5.77   ? 101 THR B CG2 1 
ATOM   1497 N N   . ALA B 2 102 ? -6.123  42.190 13.266  1.00 28.77  ? 102 ALA B N   1 
ATOM   1498 C CA  . ALA B 2 102 ? -6.318  43.550 13.801  1.00 28.77  ? 102 ALA B CA  1 
ATOM   1499 C C   . ALA B 2 102 ? -5.803  43.559 15.220  1.00 28.77  ? 102 ALA B C   1 
ATOM   1500 O O   . ALA B 2 102 ? -6.160  42.658 15.967  1.00 28.77  ? 102 ALA B O   1 
ATOM   1501 C CB  . ALA B 2 102 ? -7.767  43.886 13.818  1.00 8.73   ? 102 ALA B CB  1 
ATOM   1502 N N   . ASP B 2 103 ? -4.974  44.535 15.608  1.00 19.48  ? 103 ASP B N   1 
ATOM   1503 C CA  . ASP B 2 103 ? -4.439  44.554 16.981  1.00 19.48  ? 103 ASP B CA  1 
ATOM   1504 C C   . ASP B 2 103 ? -5.389  45.240 17.967  1.00 19.48  ? 103 ASP B C   1 
ATOM   1505 O O   . ASP B 2 103 ? -6.486  45.663 17.579  1.00 19.48  ? 103 ASP B O   1 
ATOM   1506 C CB  . ASP B 2 103 ? -3.053  45.186 17.039  1.00 50.05  ? 103 ASP B CB  1 
ATOM   1507 C CG  . ASP B 2 103 ? -3.079  46.683 16.812  1.00 50.05  ? 103 ASP B CG  1 
ATOM   1508 O OD1 . ASP B 2 103 ? -4.122  47.212 16.357  1.00 50.05  ? 103 ASP B OD1 1 
ATOM   1509 O OD2 . ASP B 2 103 ? -2.041  47.339 17.082  1.00 50.05  ? 103 ASP B OD2 1 
ATOM   1510 N N   . ALA B 2 104 ? -4.968  45.364 19.227  1.00 52.06  ? 104 ALA B N   1 
ATOM   1511 C CA  . ALA B 2 104 ? -5.791  46.001 20.274  1.00 52.06  ? 104 ALA B CA  1 
ATOM   1512 C C   . ALA B 2 104 ? -6.293  47.421 19.956  1.00 52.06  ? 104 ALA B C   1 
ATOM   1513 O O   . ALA B 2 104 ? -7.360  47.808 20.412  1.00 52.06  ? 104 ALA B O   1 
ATOM   1514 C CB  . ALA B 2 104 ? -5.048  45.992 21.630  1.00 17.18  ? 104 ALA B CB  1 
ATOM   1515 N N   . GLN B 2 105 ? -5.512  48.187 19.193  1.00 67.41  ? 105 GLN B N   1 
ATOM   1516 C CA  . GLN B 2 105 ? -5.875  49.550 18.813  1.00 67.41  ? 105 GLN B CA  1 
ATOM   1517 C C   . GLN B 2 105 ? -6.576  49.674 17.457  1.00 67.41  ? 105 GLN B C   1 
ATOM   1518 O O   . GLN B 2 105 ? -6.806  50.791 16.979  1.00 67.41  ? 105 GLN B O   1 
ATOM   1519 C CB  . GLN B 2 105 ? -4.654  50.474 18.834  1.00 132.99 ? 105 GLN B CB  1 
ATOM   1520 C CG  . GLN B 2 105 ? -4.307  51.035 20.197  1.00 132.99 ? 105 GLN B CG  1 
ATOM   1521 C CD  . GLN B 2 105 ? -3.023  50.458 20.745  1.00 132.99 ? 105 GLN B CD  1 
ATOM   1522 O OE1 . GLN B 2 105 ? -3.041  49.654 21.676  1.00 132.99 ? 105 GLN B OE1 1 
ATOM   1523 N NE2 . GLN B 2 105 ? -1.895  50.860 20.162  1.00 132.99 ? 105 GLN B NE2 1 
ATOM   1524 N N   . GLY B 2 106 ? -6.880  48.546 16.818  1.00 34.93  ? 106 GLY B N   1 
ATOM   1525 C CA  . GLY B 2 106 ? -7.569  48.595 15.547  1.00 34.93  ? 106 GLY B CA  1 
ATOM   1526 C C   . GLY B 2 106 ? -6.723  48.468 14.303  1.00 34.93  ? 106 GLY B C   1 
ATOM   1527 O O   . GLY B 2 106 ? -7.267  48.109 13.269  1.00 34.93  ? 106 GLY B O   1 
ATOM   1528 N N   . ARG B 2 107 ? -5.417  48.736 14.367  1.00 39.96  ? 107 ARG B N   1 
ATOM   1529 C CA  . ARG B 2 107 ? -4.555  48.623 13.172  1.00 39.96  ? 107 ARG B CA  1 
ATOM   1530 C C   . ARG B 2 107 ? -4.643  47.245 12.524  1.00 39.96  ? 107 ARG B C   1 
ATOM   1531 O O   . ARG B 2 107 ? -4.355  46.242 13.168  1.00 39.96  ? 107 ARG B O   1 
ATOM   1532 C CB  . ARG B 2 107 ? -3.101  48.916 13.521  1.00 87.42  ? 107 ARG B CB  1 
ATOM   1533 C CG  . ARG B 2 107 ? -2.886  50.323 13.938  1.00 87.42  ? 107 ARG B CG  1 
ATOM   1534 C CD  . ARG B 2 107 ? -1.547  50.518 14.587  1.00 87.42  ? 107 ARG B CD  1 
ATOM   1535 N NE  . ARG B 2 107 ? -1.453  51.890 15.078  1.00 87.42  ? 107 ARG B NE  1 
ATOM   1536 C CZ  . ARG B 2 107 ? -1.802  52.281 16.305  1.00 87.42  ? 107 ARG B CZ  1 
ATOM   1537 N NH1 . ARG B 2 107 ? -2.220  51.390 17.200  1.00 87.42  ? 107 ARG B NH1 1 
ATOM   1538 N NH2 . ARG B 2 107 ? -1.689  53.563 16.653  1.00 87.42  ? 107 ARG B NH2 1 
ATOM   1539 N N   . VAL B 2 108 ? -5.093  47.203 11.272  1.00 40.49  ? 108 VAL B N   1 
ATOM   1540 C CA  . VAL B 2 108 ? -5.213  45.954 10.494  1.00 40.49  ? 108 VAL B CA  1 
ATOM   1541 C C   . VAL B 2 108 ? -3.868  45.670 9.826   1.00 40.49  ? 108 VAL B C   1 
ATOM   1542 O O   . VAL B 2 108 ? -3.116  46.596 9.535   1.00 40.49  ? 108 VAL B O   1 
ATOM   1543 C CB  . VAL B 2 108 ? -6.320  46.078 9.395   1.00 33.04  ? 108 VAL B CB  1 
ATOM   1544 C CG1 . VAL B 2 108 ? -6.379  44.820 8.514   1.00 33.04  ? 108 VAL B CG1 1 
ATOM   1545 C CG2 . VAL B 2 108 ? -7.680  46.357 10.052  1.00 33.04  ? 108 VAL B CG2 1 
ATOM   1546 N N   . GLY B 2 109 ? -3.549  44.400 9.603   1.00 50.30  ? 109 GLY B N   1 
ATOM   1547 C CA  . GLY B 2 109 ? -2.278  44.074 8.990   1.00 50.30  ? 109 GLY B CA  1 
ATOM   1548 C C   . GLY B 2 109 ? -1.869  42.624 9.117   1.00 50.30  ? 109 GLY B C   1 
ATOM   1549 O O   . GLY B 2 109 ? -2.537  41.816 9.758   1.00 50.30  ? 109 GLY B O   1 
ATOM   1550 N N   . TRP B 2 110 ? -0.742  42.308 8.496   1.00 21.71  ? 110 TRP B N   1 
ATOM   1551 C CA  . TRP B 2 110 ? -0.218  40.966 8.485   1.00 21.71  ? 110 TRP B CA  1 
ATOM   1552 C C   . TRP B 2 110 ? 0.729   40.771 9.631   1.00 21.71  ? 110 TRP B C   1 
ATOM   1553 O O   . TRP B 2 110 ? 1.724   41.474 9.739   1.00 21.71  ? 110 TRP B O   1 
ATOM   1554 C CB  . TRP B 2 110 ? 0.486   40.715 7.167   1.00 19.62  ? 110 TRP B CB  1 
ATOM   1555 C CG  . TRP B 2 110 ? -0.464  40.688 6.010   1.00 19.62  ? 110 TRP B CG  1 
ATOM   1556 C CD1 . TRP B 2 110 ? -0.954  41.773 5.303   1.00 19.62  ? 110 TRP B CD1 1 
ATOM   1557 C CD2 . TRP B 2 110 ? -1.146  39.529 5.489   1.00 19.62  ? 110 TRP B CD2 1 
ATOM   1558 N NE1 . TRP B 2 110 ? -1.915  41.349 4.396   1.00 19.62  ? 110 TRP B NE1 1 
ATOM   1559 C CE2 . TRP B 2 110 ? -2.052  39.982 4.490   1.00 19.62  ? 110 TRP B CE2 1 
ATOM   1560 C CE3 . TRP B 2 110 ? -1.083  38.156 5.780   1.00 19.62  ? 110 TRP B CE3 1 
ATOM   1561 C CZ2 . TRP B 2 110 ? -2.894  39.106 3.776   1.00 19.62  ? 110 TRP B CZ2 1 
ATOM   1562 C CZ3 . TRP B 2 110 ? -1.926  37.269 5.060   1.00 19.62  ? 110 TRP B CZ3 1 
ATOM   1563 C CH2 . TRP B 2 110 ? -2.820  37.754 4.071   1.00 19.62  ? 110 TRP B CH2 1 
ATOM   1564 N N   . ARG B 2 111 ? 0.420   39.796 10.479  1.00 26.01  ? 111 ARG B N   1 
ATOM   1565 C CA  . ARG B 2 111 ? 1.235   39.502 11.641  1.00 26.01  ? 111 ARG B CA  1 
ATOM   1566 C C   . ARG B 2 111 ? 1.436   38.016 11.773  1.00 26.01  ? 111 ARG B C   1 
ATOM   1567 O O   . ARG B 2 111 ? 0.725   37.238 11.132  1.00 26.01  ? 111 ARG B O   1 
ATOM   1568 C CB  . ARG B 2 111 ? 0.556   40.051 12.890  1.00 23.17  ? 111 ARG B CB  1 
ATOM   1569 C CG  . ARG B 2 111 ? 0.737   41.526 13.054  1.00 23.17  ? 111 ARG B CG  1 
ATOM   1570 C CD  . ARG B 2 111 ? -0.026  42.058 14.216  1.00 23.17  ? 111 ARG B CD  1 
ATOM   1571 N NE  . ARG B 2 111 ? -1.312  42.596 13.797  1.00 23.17  ? 111 ARG B NE  1 
ATOM   1572 C CZ  . ARG B 2 111 ? -1.590  43.893 13.750  1.00 23.17  ? 111 ARG B CZ  1 
ATOM   1573 N NH1 . ARG B 2 111 ? -0.669  44.794 14.102  1.00 23.17  ? 111 ARG B NH1 1 
ATOM   1574 N NH2 . ARG B 2 111 ? -2.793  44.286 13.368  1.00 23.17  ? 111 ARG B NH2 1 
ATOM   1575 N N   . TRP B 2 112 ? 2.447   37.640 12.561  1.00 27.28  ? 112 TRP B N   1 
ATOM   1576 C CA  . TRP B 2 112 ? 2.760   36.231 12.811  1.00 27.28  ? 112 TRP B CA  1 
ATOM   1577 C C   . TRP B 2 112 ? 1.934   35.872 13.997  1.00 27.28  ? 112 TRP B C   1 
ATOM   1578 O O   . TRP B 2 112 ? 1.904   36.625 14.969  1.00 27.28  ? 112 TRP B O   1 
ATOM   1579 C CB  . TRP B 2 112 ? 4.238   36.036 13.120  1.00 18.92  ? 112 TRP B CB  1 
ATOM   1580 C CG  . TRP B 2 112 ? 5.103   36.259 11.894  1.00 18.92  ? 112 TRP B CG  1 
ATOM   1581 C CD1 . TRP B 2 112 ? 5.848   37.370 11.594  1.00 18.92  ? 112 TRP B CD1 1 
ATOM   1582 C CD2 . TRP B 2 112 ? 5.234   35.382 10.765  1.00 18.92  ? 112 TRP B CD2 1 
ATOM   1583 N NE1 . TRP B 2 112 ? 6.420   37.237 10.351  1.00 18.92  ? 112 TRP B NE1 1 
ATOM   1584 C CE2 . TRP B 2 112 ? 6.062   36.026 9.826   1.00 18.92  ? 112 TRP B CE2 1 
ATOM   1585 C CE3 . TRP B 2 112 ? 4.726   34.111 10.461  1.00 18.92  ? 112 TRP B CE3 1 
ATOM   1586 C CZ2 . TRP B 2 112 ? 6.397   35.442 8.606   1.00 18.92  ? 112 TRP B CZ2 1 
ATOM   1587 C CZ3 . TRP B 2 112 ? 5.064   33.534 9.247   1.00 18.92  ? 112 TRP B CZ3 1 
ATOM   1588 C CH2 . TRP B 2 112 ? 5.891   34.198 8.335   1.00 18.92  ? 112 TRP B CH2 1 
ATOM   1589 N N   . ILE B 2 113 ? 1.205   34.770 13.874  1.00 12.77  ? 113 ILE B N   1 
ATOM   1590 C CA  . ILE B 2 113 ? 0.324   34.304 14.927  1.00 12.77  ? 113 ILE B CA  1 
ATOM   1591 C C   . ILE B 2 113 ? 0.544   32.840 15.269  1.00 12.77  ? 113 ILE B C   1 
ATOM   1592 O O   . ILE B 2 113 ? 0.991   32.042 14.430  1.00 12.77  ? 113 ILE B O   1 
ATOM   1593 C CB  . ILE B 2 113 ? -1.172  34.509 14.542  1.00 2.00   ? 113 ILE B CB  1 
ATOM   1594 C CG1 . ILE B 2 113 ? -1.548  33.673 13.299  1.00 2.00   ? 113 ILE B CG1 1 
ATOM   1595 C CG2 . ILE B 2 113 ? -1.478  36.009 14.395  1.00 2.00   ? 113 ILE B CG2 1 
ATOM   1596 C CD1 . ILE B 2 113 ? -3.023  33.491 13.077  1.00 2.00   ? 113 ILE B CD1 1 
ATOM   1597 N N   . ARG B 2 114 ? 0.259   32.481 16.507  1.00 18.92  ? 114 ARG B N   1 
ATOM   1598 C CA  . ARG B 2 114 ? 0.422   31.110 16.938  1.00 18.92  ? 114 ARG B CA  1 
ATOM   1599 C C   . ARG B 2 114 ? -0.818  30.272 16.697  1.00 18.92  ? 114 ARG B C   1 
ATOM   1600 O O   . ARG B 2 114 ? -1.898  30.633 17.185  1.00 18.92  ? 114 ARG B O   1 
ATOM   1601 C CB  . ARG B 2 114 ? 0.736   31.048 18.422  1.00 42.70  ? 114 ARG B CB  1 
ATOM   1602 C CG  . ARG B 2 114 ? 1.989   31.714 18.753  1.00 42.70  ? 114 ARG B CG  1 
ATOM   1603 C CD  . ARG B 2 114 ? 2.383   31.534 20.184  1.00 42.70  ? 114 ARG B CD  1 
ATOM   1604 N NE  . ARG B 2 114 ? 3.110   32.736 20.555  1.00 42.70  ? 114 ARG B NE  1 
ATOM   1605 C CZ  . ARG B 2 114 ? 3.524   33.035 21.778  1.00 42.70  ? 114 ARG B CZ  1 
ATOM   1606 N NH1 . ARG B 2 114 ? 3.330   32.171 22.776  1.00 42.70  ? 114 ARG B NH1 1 
ATOM   1607 N NH2 . ARG B 2 114 ? 4.165   34.191 21.984  1.00 42.70  ? 114 ARG B NH2 1 
ATOM   1608 N N   . ILE B 2 115 ? -0.677  29.210 15.892  1.00 12.80  ? 115 ILE B N   1 
ATOM   1609 C CA  . ILE B 2 115 ? -1.765  28.247 15.660  1.00 12.80  ? 115 ILE B CA  1 
ATOM   1610 C C   . ILE B 2 115 ? -1.226  26.901 16.170  1.00 12.80  ? 115 ILE B C   1 
ATOM   1611 O O   . ILE B 2 115 ? -0.011  26.731 16.265  1.00 12.80  ? 115 ILE B O   1 
ATOM   1612 C CB  . ILE B 2 115 ? -2.260  28.138 14.133  1.00 13.05  ? 115 ILE B CB  1 
ATOM   1613 C CG1 . ILE B 2 115 ? -1.131  27.731 13.157  1.00 13.05  ? 115 ILE B CG1 1 
ATOM   1614 C CG2 . ILE B 2 115 ? -2.956  29.413 13.730  1.00 13.05  ? 115 ILE B CG2 1 
ATOM   1615 C CD1 . ILE B 2 115 ? -1.601  26.903 11.971  1.00 13.05  ? 115 ILE B CD1 1 
ATOM   1616 N N   . ASP B 2 116 ? -2.104  25.955 16.487  1.00 7.24   ? 116 ASP B N   1 
ATOM   1617 C CA  . ASP B 2 116 ? -1.662  24.659 17.013  1.00 7.24   ? 116 ASP B CA  1 
ATOM   1618 C C   . ASP B 2 116 ? -1.296  23.693 15.946  1.00 7.24   ? 116 ASP B C   1 
ATOM   1619 O O   . ASP B 2 116 ? -2.137  23.323 15.174  1.00 7.24   ? 116 ASP B O   1 
ATOM   1620 C CB  . ASP B 2 116 ? -2.753  23.989 17.817  1.00 20.66  ? 116 ASP B CB  1 
ATOM   1621 C CG  . ASP B 2 116 ? -3.153  24.772 19.030  1.00 20.66  ? 116 ASP B CG  1 
ATOM   1622 O OD1 . ASP B 2 116 ? -2.326  25.533 19.600  1.00 20.66  ? 116 ASP B OD1 1 
ATOM   1623 O OD2 . ASP B 2 116 ? -4.320  24.607 19.430  1.00 20.66  ? 116 ASP B OD2 1 
ATOM   1624 N N   . THR B 2 117 ? -0.072  23.194 15.961  1.00 22.42  ? 117 THR B N   1 
ATOM   1625 C CA  . THR B 2 117 ? 0.331   22.233 14.951  1.00 22.42  ? 117 THR B CA  1 
ATOM   1626 C C   . THR B 2 117 ? 0.742   20.866 15.473  1.00 22.42  ? 117 THR B C   1 
ATOM   1627 O O   . THR B 2 117 ? 1.291   20.057 14.719  1.00 22.42  ? 117 THR B O   1 
ATOM   1628 C CB  . THR B 2 117 ? 1.422   22.776 14.047  1.00 11.65  ? 117 THR B CB  1 
ATOM   1629 O OG1 . THR B 2 117 ? 2.538   23.152 14.842  1.00 11.65  ? 117 THR B OG1 1 
ATOM   1630 C CG2 . THR B 2 117 ? 0.935   23.979 13.267  1.00 11.65  ? 117 THR B CG2 1 
ATOM   1631 N N   . ALA B 2 118 ? 0.479   20.598 16.752  1.00 19.93  ? 118 ALA B N   1 
ATOM   1632 C CA  . ALA B 2 118 ? 0.793   19.281 17.337  1.00 19.93  ? 118 ALA B CA  1 
ATOM   1633 C C   . ALA B 2 118 ? 0.340   19.107 18.783  1.00 19.93  ? 118 ALA B C   1 
ATOM   1634 O O   . ALA B 2 118 ? 0.030   20.090 19.484  1.00 19.93  ? 118 ALA B O   1 
ATOM   1635 C CB  . ALA B 2 118 ? 2.277   18.985 17.241  1.00 19.03  ? 118 ALA B CB  1 
ATOM   1636 N N   . CYS B 2 119 ? 0.287   17.847 19.214  1.00 33.31  ? 119 CYS B N   1 
ATOM   1637 C CA  . CYS B 2 119 ? -0.086  17.500 20.584  1.00 33.31  ? 119 CYS B CA  1 
ATOM   1638 C C   . CYS B 2 119 ? 1.102   16.688 21.075  1.00 33.31  ? 119 CYS B C   1 
ATOM   1639 O O   . CYS B 2 119 ? 1.360   15.583 20.584  1.00 33.31  ? 119 CYS B O   1 
ATOM   1640 C CB  . CYS B 2 119 ? -1.364  16.671 20.611  1.00 16.16  ? 119 CYS B CB  1 
ATOM   1641 S SG  . CYS B 2 119 ? -1.895  16.227 22.293  1.00 16.16  ? 119 CYS B SG  1 
ATOM   1642 N N   . VAL B 2 120 ? 1.845   17.269 22.009  1.00 22.63  ? 120 VAL B N   1 
ATOM   1643 C CA  . VAL B 2 120 ? 3.052   16.658 22.519  1.00 22.63  ? 120 VAL B CA  1 
ATOM   1644 C C   . VAL B 2 120 ? 2.975   16.316 24.002  1.00 22.63  ? 120 VAL B C   1 
ATOM   1645 O O   . VAL B 2 120 ? 2.250   16.948 24.748  1.00 22.63  ? 120 VAL B O   1 
ATOM   1646 C CB  . VAL B 2 120 ? 4.280   17.639 22.319  1.00 9.35   ? 120 VAL B CB  1 
ATOM   1647 C CG1 . VAL B 2 120 ? 4.407   18.099 20.899  1.00 9.35   ? 120 VAL B CG1 1 
ATOM   1648 C CG2 . VAL B 2 120 ? 4.175   18.848 23.261  1.00 9.35   ? 120 VAL B CG2 1 
ATOM   1649 N N   . CYS B 2 121 ? 3.781   15.357 24.438  1.00 12.07  ? 121 CYS B N   1 
ATOM   1650 C CA  . CYS B 2 121 ? 3.833   14.994 25.837  1.00 12.07  ? 121 CYS B CA  1 
ATOM   1651 C C   . CYS B 2 121 ? 4.765   15.919 26.665  1.00 12.07  ? 121 CYS B C   1 
ATOM   1652 O O   . CYS B 2 121 ? 5.932   16.104 26.322  1.00 12.07  ? 121 CYS B O   1 
ATOM   1653 C CB  . CYS B 2 121 ? 4.336   13.585 25.954  1.00 19.22  ? 121 CYS B CB  1 
ATOM   1654 S SG  . CYS B 2 121 ? 4.399   13.134 27.695  1.00 19.22  ? 121 CYS B SG  1 
ATOM   1655 N N   . THR B 2 122 ? 4.285   16.418 27.795  1.00 36.11  ? 122 THR B N   1 
ATOM   1656 C CA  . THR B 2 122 ? 5.052   17.308 28.677  1.00 36.11  ? 122 THR B CA  1 
ATOM   1657 C C   . THR B 2 122 ? 5.339   16.646 30.013  1.00 36.11  ? 122 THR B C   1 
ATOM   1658 O O   . THR B 2 122 ? 4.457   16.085 30.633  1.00 36.11  ? 122 THR B O   1 
ATOM   1659 C CB  . THR B 2 122 ? 4.239   18.542 28.975  1.00 40.44  ? 122 THR B CB  1 
ATOM   1660 O OG1 . THR B 2 122 ? 3.941   19.175 27.740  1.00 40.44  ? 122 THR B OG1 1 
ATOM   1661 C CG2 . THR B 2 122 ? 4.995   19.504 29.841  1.00 40.44  ? 122 THR B CG2 1 
ATOM   1662 N N   . LEU B 2 123 ? 6.561   16.740 30.486  1.00 24.25  ? 123 LEU B N   1 
ATOM   1663 C CA  . LEU B 2 123 ? 6.894   16.133 31.758  1.00 24.25  ? 123 LEU B CA  1 
ATOM   1664 C C   . LEU B 2 123 ? 6.829   17.224 32.802  1.00 24.25  ? 123 LEU B C   1 
ATOM   1665 O O   . LEU B 2 123 ? 7.527   18.217 32.685  1.00 24.25  ? 123 LEU B O   1 
ATOM   1666 C CB  . LEU B 2 123 ? 8.297   15.542 31.704  1.00 12.50  ? 123 LEU B CB  1 
ATOM   1667 C CG  . LEU B 2 123 ? 8.484   14.452 30.657  1.00 12.50  ? 123 LEU B CG  1 
ATOM   1668 C CD1 . LEU B 2 123 ? 9.856   13.861 30.763  1.00 12.50  ? 123 LEU B CD1 1 
ATOM   1669 C CD2 . LEU B 2 123 ? 7.440   13.417 30.877  1.00 12.50  ? 123 LEU B CD2 1 
ATOM   1670 N N   . LEU B 2 124 ? 5.950   17.086 33.784  1.00 30.13  ? 124 LEU B N   1 
ATOM   1671 C CA  . LEU B 2 124 ? 5.822   18.110 34.814  1.00 30.13  ? 124 LEU B CA  1 
ATOM   1672 C C   . LEU B 2 124 ? 6.777   18.044 36.018  1.00 30.13  ? 124 LEU B C   1 
ATOM   1673 O O   . LEU B 2 124 ? 7.358   19.070 36.390  1.00 30.13  ? 124 LEU B O   1 
ATOM   1674 C CB  . LEU B 2 124 ? 4.377   18.206 35.277  1.00 31.52  ? 124 LEU B CB  1 
ATOM   1675 C CG  . LEU B 2 124 ? 3.440   18.690 34.160  1.00 31.52  ? 124 LEU B CG  1 
ATOM   1676 C CD1 . LEU B 2 124 ? 2.002   18.432 34.561  1.00 31.52  ? 124 LEU B CD1 1 
ATOM   1677 C CD2 . LEU B 2 124 ? 3.651   20.177 33.822  1.00 31.52  ? 124 LEU B CD2 1 
ATOM   1678 N N   . SER B 2 125 ? 6.986   16.865 36.610  1.00 31.93  ? 125 SER B N   1 
ATOM   1679 C CA  . SER B 2 125 ? 7.862   16.804 37.771  1.00 31.93  ? 125 SER B CA  1 
ATOM   1680 C C   . SER B 2 125 ? 8.392   15.436 38.052  1.00 31.93  ? 125 SER B C   1 
ATOM   1681 O O   . SER B 2 125 ? 7.911   14.466 37.471  1.00 31.93  ? 125 SER B O   1 
ATOM   1682 C CB  . SER B 2 125 ? 7.081   17.254 38.992  1.00 39.70  ? 125 SER B CB  1 
ATOM   1683 O OG  . SER B 2 125 ? 5.903   16.483 39.072  1.00 39.70  ? 125 SER B OG  1 
ATOM   1684 N N   . ARG B 2 126 ? 9.323   15.383 39.012  1.00 52.60  ? 126 ARG B N   1 
ATOM   1685 C CA  . ARG B 2 126 ? 9.960   14.159 39.505  1.00 52.60  ? 126 ARG B CA  1 
ATOM   1686 C C   . ARG B 2 126 ? 11.070  13.563 38.645  1.00 52.60  ? 126 ARG B C   1 
ATOM   1687 O O   . ARG B 2 126 ? 11.602  14.260 37.804  1.00 52.60  ? 126 ARG B O   1 
ATOM   1688 C CB  . ARG B 2 126 ? 8.903   13.124 39.795  1.00 34.62  ? 126 ARG B CB  1 
ATOM   1689 C CG  . ARG B 2 126 ? 7.922   13.510 40.919  1.00 34.62  ? 126 ARG B CG  1 
ATOM   1690 C CD  . ARG B 2 126 ? 7.068   12.315 41.331  1.00 34.62  ? 126 ARG B CD  1 
ATOM   1691 N NE  . ARG B 2 126 ? 7.781   11.025 41.266  1.00 34.62  ? 126 ARG B NE  1 
ATOM   1692 C CZ  . ARG B 2 126 ? 9.072   10.795 41.557  1.00 34.62  ? 126 ARG B CZ  1 
ATOM   1693 N NH1 . ARG B 2 126 ? 9.913   11.756 41.962  1.00 34.62  ? 126 ARG B NH1 1 
ATOM   1694 N NH2 . ARG B 2 126 ? 9.542   9.564  41.415  1.00 34.62  ? 126 ARG B NH2 1 
ATOM   1695 N N   . THR B 2 127 ? 11.437  12.298 38.897  1.00 47.37  ? 127 THR B N   1 
ATOM   1696 C CA  . THR B 2 127 ? 12.518  11.538 38.201  1.00 47.37  ? 127 THR B CA  1 
ATOM   1697 C C   . THR B 2 127 ? 12.813  10.177 38.934  1.00 47.37  ? 127 THR B C   1 
ATOM   1698 O O   . THR B 2 127 ? 12.381  9.990  40.069  1.00 47.37  ? 127 THR B O   1 
ATOM   1699 C CB  . THR B 2 127 ? 13.822  12.350 38.193  1.00 250.28 ? 127 THR B CB  1 
ATOM   1700 O OG1 . THR B 2 127 ? 13.909  13.113 39.401  1.00 250.28 ? 127 THR B OG1 1 
ATOM   1701 C CG2 . THR B 2 127 ? 13.874  13.291 37.004  1.00 250.28 ? 127 THR B CG2 1 
ATOM   1702 N N   . GLY B 2 128 ? 13.557  9.263  38.300  1.00 73.44  ? 128 GLY B N   1 
ATOM   1703 C CA  . GLY B 2 128 ? 13.932  7.934  38.839  1.00 73.44  ? 128 GLY B CA  1 
ATOM   1704 C C   . GLY B 2 128 ? 13.499  7.179  40.135  1.00 73.44  ? 128 GLY B C   1 
ATOM   1705 O O   . GLY B 2 128 ? 14.132  6.171  40.519  1.00 73.44  ? 128 GLY B O   1 
ATOM   1706 N N   . ARG B 2 129 ? 12.346  7.544  40.694  1.00 90.94  ? 129 ARG B N   1 
ATOM   1707 C CA  . ARG B 2 129 ? 11.797  6.985  41.932  1.00 90.94  ? 129 ARG B CA  1 
ATOM   1708 C C   . ARG B 2 129 ? 12.448  7.788  43.028  1.00 90.94  ? 129 ARG B C   1 
ATOM   1709 O O   . ARG B 2 129 ? 13.330  7.306  43.734  1.00 90.94  ? 129 ARG B O   1 
ATOM   1710 C CB  . ARG B 2 129 ? 12.040  5.472  42.108  1.00 114.95 ? 129 ARG B CB  1 
ATOM   1711 C CG  . ARG B 2 129 ? 10.987  4.824  42.997  1.00 114.95 ? 129 ARG B CG  1 
ATOM   1712 C CD  . ARG B 2 129 ? 9.646   5.478  42.673  1.00 114.95 ? 129 ARG B CD  1 
ATOM   1713 N NE  . ARG B 2 129 ? 8.539   5.107  43.551  1.00 114.95 ? 129 ARG B NE  1 
ATOM   1714 C CZ  . ARG B 2 129 ? 7.491   5.894  43.817  1.00 114.95 ? 129 ARG B CZ  1 
ATOM   1715 N NH1 . ARG B 2 129 ? 7.393   7.114  43.295  1.00 114.95 ? 129 ARG B NH1 1 
ATOM   1716 N NH2 . ARG B 2 129 ? 6.504   5.445  44.582  1.00 114.95 ? 129 ARG B NH2 1 
ATOM   1717 N N   . ALA B 2 130 ? 12.105  9.072  43.019  1.00 147.94 ? 130 ALA B N   1 
ATOM   1718 C CA  . ALA B 2 130 ? 12.591  10.038 43.979  1.00 147.94 ? 130 ALA B CA  1 
ATOM   1719 C C   . ALA B 2 130 ? 11.728  9.812  45.193  1.00 147.94 ? 130 ALA B C   1 
ATOM   1720 O O   . ALA B 2 130 ? 12.293  9.704  46.302  1.00 103.04 ? 130 ALA B O   1 
ATOM   1721 C CB  . ALA B 2 130 ? 12.386  11.452 43.453  1.00 103.04 ? 130 ALA B CB  1 
HETATM 1722 O O   . HOH C 3 .   ? 8.019   29.535 27.825  1.00 26.40  ? 120 HOH A O   1 
HETATM 1723 O O   . HOH C 3 .   ? 13.658  21.033 22.529  1.00 26.40  ? 121 HOH A O   1 
HETATM 1724 O O   . HOH C 3 .   ? 9.945   27.088 25.453  1.00 26.40  ? 122 HOH A O   1 
HETATM 1725 O O   . HOH C 3 .   ? 7.140   22.385 24.812  1.00 26.40  ? 123 HOH A O   1 
HETATM 1726 O O   . HOH C 3 .   ? 14.459  14.845 18.939  1.00 26.40  ? 124 HOH A O   1 
HETATM 1727 O O   . HOH C 3 .   ? 8.112   27.849 19.312  1.00 26.40  ? 125 HOH A O   1 
HETATM 1728 O O   . HOH C 3 .   ? 17.289  29.696 14.712  1.00 26.40  ? 126 HOH A O   1 
HETATM 1729 O O   . HOH C 3 .   ? 15.880  30.666 12.575  1.00 26.40  ? 127 HOH A O   1 
HETATM 1730 O O   . HOH C 3 .   ? 16.773  29.540 9.053   1.00 26.40  ? 128 HOH A O   1 
HETATM 1731 O O   . HOH C 3 .   ? 16.520  30.331 5.232   1.00 26.40  ? 129 HOH A O   1 
HETATM 1732 O O   . HOH C 3 .   ? 9.974   33.193 -7.676  1.00 26.40  ? 130 HOH A O   1 
HETATM 1733 O O   . HOH C 3 .   ? 8.337   34.928 -6.888  1.00 26.40  ? 131 HOH A O   1 
HETATM 1734 O O   . HOH C 3 .   ? 12.097  20.004 -6.704  1.00 26.40  ? 132 HOH A O   1 
HETATM 1735 O O   . HOH C 3 .   ? 11.207  20.375 -9.494  1.00 26.40  ? 133 HOH A O   1 
HETATM 1736 O O   . HOH C 3 .   ? 6.468   19.828 0.882   1.00 26.40  ? 134 HOH A O   1 
HETATM 1737 O O   . HOH C 3 .   ? -4.213  23.027 -1.569  1.00 26.40  ? 135 HOH A O   1 
HETATM 1738 O O   . HOH C 3 .   ? 1.583   12.616 -6.512  1.00 26.40  ? 136 HOH A O   1 
HETATM 1739 O O   . HOH C 3 .   ? 6.339   24.702 -10.469 1.00 26.40  ? 137 HOH A O   1 
HETATM 1740 O O   . HOH C 3 .   ? 6.710   24.770 13.111  1.00 26.40  ? 138 HOH A O   1 
HETATM 1741 O O   . HOH C 3 .   ? 17.552  14.870 20.116  1.00 26.40  ? 139 HOH A O   1 
HETATM 1742 O O   . HOH C 3 .   ? 18.703  9.616  23.701  1.00 26.40  ? 140 HOH A O   1 
HETATM 1743 O O   . HOH C 3 .   ? 22.795  9.109  17.283  1.00 26.40  ? 141 HOH A O   1 
HETATM 1744 O O   . HOH C 3 .   ? 2.601   11.217 20.196  1.00 26.40  ? 142 HOH A O   1 
HETATM 1745 O O   . HOH C 3 .   ? 13.346  6.116  31.146  1.00 26.40  ? 143 HOH A O   1 
HETATM 1746 O O   . HOH C 3 .   ? 14.112  9.902  30.743  1.00 26.40  ? 144 HOH A O   1 
HETATM 1747 O O   . HOH C 3 .   ? 16.100  11.806 30.759  1.00 26.40  ? 145 HOH A O   1 
HETATM 1748 O O   . HOH C 3 .   ? 10.187  -3.050 37.822  1.00 26.40  ? 146 HOH A O   1 
HETATM 1749 O O   . HOH C 3 .   ? 12.423  4.111  24.789  1.00 26.40  ? 147 HOH A O   1 
HETATM 1750 O O   . HOH C 3 .   ? 12.574  12.266 12.489  1.00 26.40  ? 148 HOH A O   1 
HETATM 1751 O O   . HOH C 3 .   ? -5.752  31.324 4.498   1.00 26.40  ? 149 HOH A O   1 
HETATM 1752 O O   . HOH C 3 .   ? -1.818  28.704 6.668   1.00 26.40  ? 150 HOH A O   1 
HETATM 1753 O O   . HOH C 3 .   ? 0.511   30.770 6.194   1.00 26.40  ? 151 HOH A O   1 
HETATM 1754 O O   . HOH C 3 .   ? 2.647   31.433 3.438   1.00 26.40  ? 152 HOH A O   1 
HETATM 1755 O O   . HOH C 3 .   ? -5.974  31.688 -4.939  1.00 26.40  ? 153 HOH A O   1 
HETATM 1756 O O   . HOH C 3 .   ? 13.329  16.531 8.332   1.00 26.40  ? 154 HOH A O   1 
HETATM 1757 O O   . HOH C 3 .   ? 13.379  23.440 3.912   1.00 26.40  ? 155 HOH A O   1 
HETATM 1758 O O   . HOH C 3 .   ? 6.960   19.476 18.319  1.00 26.40  ? 156 HOH A O   1 
HETATM 1759 O O   . HOH C 3 .   ? 5.411   13.737 21.996  1.00 26.40  ? 157 HOH A O   1 
HETATM 1760 O O   . HOH D 3 .   ? -7.099  16.381 38.553  1.00 26.40  ? 131 HOH B O   1 
HETATM 1761 O O   . HOH D 3 .   ? -15.606 31.550 -1.510  1.00 26.40  ? 132 HOH B O   1 
HETATM 1762 O O   . HOH D 3 .   ? 4.736   29.301 8.649   1.00 26.40  ? 133 HOH B O   1 
HETATM 1763 O O   . HOH D 3 .   ? 6.329   23.672 16.809  1.00 26.40  ? 134 HOH B O   1 
HETATM 1764 O O   . HOH D 3 .   ? -2.433  26.268 8.429   1.00 26.40  ? 135 HOH B O   1 
HETATM 1765 O O   . HOH D 3 .   ? -4.072  30.491 6.525   1.00 26.40  ? 136 HOH B O   1 
HETATM 1766 O O   . HOH D 3 .   ? -2.507  10.877 17.933  1.00 26.40  ? 137 HOH B O   1 
HETATM 1767 O O   . HOH D 3 .   ? -11.960 18.867 9.840   1.00 26.40  ? 138 HOH B O   1 
HETATM 1768 O O   . HOH D 3 .   ? -6.876  14.052 12.273  1.00 26.40  ? 139 HOH B O   1 
HETATM 1769 O O   . HOH D 3 .   ? -14.408 19.285 10.829  1.00 26.40  ? 140 HOH B O   1 
HETATM 1770 O O   . HOH D 3 .   ? -10.388 30.096 11.421  1.00 26.40  ? 141 HOH B O   1 
HETATM 1771 O O   . HOH D 3 .   ? -10.817 32.445 10.220  1.00 26.40  ? 142 HOH B O   1 
HETATM 1772 O O   . HOH D 3 .   ? -11.952 34.584 12.010  1.00 26.40  ? 143 HOH B O   1 
HETATM 1773 O O   . HOH D 3 .   ? -11.402 31.898 18.824  1.00 26.40  ? 144 HOH B O   1 
HETATM 1774 O O   . HOH D 3 .   ? -8.971  29.915 19.525  1.00 26.40  ? 145 HOH B O   1 
HETATM 1775 O O   . HOH D 3 .   ? -3.202  32.007 19.402  1.00 26.40  ? 146 HOH B O   1 
HETATM 1776 O O   . HOH D 3 .   ? -1.151  30.141 21.358  1.00 26.40  ? 147 HOH B O   1 
HETATM 1777 O O   . HOH D 3 .   ? -13.318 44.855 18.351  1.00 26.40  ? 148 HOH B O   1 
HETATM 1778 O O   . HOH D 3 .   ? -8.957  38.338 -8.236  1.00 26.40  ? 149 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   HIS 1   1   ?   ?   ?   A . n 
A 1 2   SER 2   2   ?   ?   ?   A . n 
A 1 3   ASP 3   3   ?   ?   ?   A . n 
A 1 4   PRO 4   4   ?   ?   ?   A . n 
A 1 5   ALA 5   5   ?   ?   ?   A . n 
A 1 6   ARG 6   6   ?   ?   ?   A . n 
A 1 7   ARG 7   7   ?   ?   ?   A . n 
A 1 8   GLY 8   8   8   GLY GLY A . n 
A 1 9   GLU 9   9   9   GLU GLU A . n 
A 1 10  LEU 10  10  10  LEU LEU A . n 
A 1 11  SER 11  11  11  SER SER A . n 
A 1 12  VAL 12  12  12  VAL VAL A . n 
A 1 13  CYS 13  13  13  CYS CYS A . n 
A 1 14  ASP 14  14  14  ASP ASP A . n 
A 1 15  SER 15  15  15  SER SER A . n 
A 1 16  ILE 16  16  16  ILE ILE A . n 
A 1 17  SER 17  17  17  SER SER A . n 
A 1 18  GLU 18  18  18  GLU GLU A . n 
A 1 19  TRP 19  19  19  TRP TRP A . n 
A 1 20  VAL 20  20  20  VAL VAL A . n 
A 1 21  THR 21  21  21  THR THR A . n 
A 1 22  ALA 22  22  22  ALA ALA A . n 
A 1 23  ALA 23  23  23  ALA ALA A . n 
A 1 24  ASP 24  24  24  ASP ASP A . n 
A 1 25  LYS 25  25  25  LYS LYS A . n 
A 1 26  LYS 26  26  26  LYS LYS A . n 
A 1 27  THR 27  27  27  THR THR A . n 
A 1 28  ALA 28  28  28  ALA ALA A . n 
A 1 29  VAL 29  29  29  VAL VAL A . n 
A 1 30  ASP 30  30  30  ASP ASP A . n 
A 1 31  MET 31  31  31  MET MET A . n 
A 1 32  SER 32  32  32  SER SER A . n 
A 1 33  GLY 33  33  33  GLY GLY A . n 
A 1 34  GLY 34  34  34  GLY GLY A . n 
A 1 35  THR 35  35  35  THR THR A . n 
A 1 36  VAL 36  36  36  VAL VAL A . n 
A 1 37  THR 37  37  37  THR THR A . n 
A 1 38  VAL 38  38  38  VAL VAL A . n 
A 1 39  LEU 39  39  39  LEU LEU A . n 
A 1 40  GLU 40  40  40  GLU GLU A . n 
A 1 41  LYS 41  41  41  LYS LYS A . n 
A 1 42  VAL 42  42  42  VAL VAL A . n 
A 1 43  PRO 43  43  43  PRO PRO A . n 
A 1 44  VAL 44  44  44  VAL VAL A . n 
A 1 45  SER 45  45  45  SER SER A . n 
A 1 46  LYS 46  46  46  LYS LYS A . n 
A 1 47  GLY 47  47  47  GLY GLY A . n 
A 1 48  GLN 48  48  48  GLN GLN A . n 
A 1 49  LEU 49  49  49  LEU LEU A . n 
A 1 50  LYS 50  50  50  LYS LYS A . n 
A 1 51  GLN 51  51  51  GLN GLN A . n 
A 1 52  TYR 52  52  52  TYR TYR A . n 
A 1 53  PHE 53  53  53  PHE PHE A . n 
A 1 54  TYR 54  54  54  TYR TYR A . n 
A 1 55  GLU 55  55  55  GLU GLU A . n 
A 1 56  THR 56  56  56  THR THR A . n 
A 1 57  LYS 57  57  57  LYS LYS A . n 
A 1 58  CYS 58  58  58  CYS CYS A . n 
A 1 59  ASN 59  59  59  ASN ASN A . n 
A 1 60  PRO 60  60  60  PRO PRO A . n 
A 1 61  MET 61  61  61  MET MET A . n 
A 1 62  GLY 62  62  62  GLY GLY A . n 
A 1 63  TYR 63  63  63  TYR TYR A . n 
A 1 64  THR 64  64  64  THR THR A . n 
A 1 65  LYS 65  65  65  LYS LYS A . n 
A 1 66  GLU 66  66  66  GLU GLU A . n 
A 1 67  GLY 67  67  67  GLY GLY A . n 
A 1 68  CYS 68  68  68  CYS CYS A . n 
A 1 69  ARG 69  69  69  ARG ARG A . n 
A 1 70  GLY 70  70  70  GLY GLY A . n 
A 1 71  ILE 71  71  71  ILE ILE A . n 
A 1 72  ASP 72  72  72  ASP ASP A . n 
A 1 73  LYS 73  73  73  LYS LYS A . n 
A 1 74  ARG 74  74  74  ARG ARG A . n 
A 1 75  HIS 75  75  75  HIS HIS A . n 
A 1 76  TRP 76  76  76  TRP TRP A . n 
A 1 77  ASN 77  77  77  ASN ASN A . n 
A 1 78  SER 78  78  78  SER SER A . n 
A 1 79  GLN 79  79  79  GLN GLN A . n 
A 1 80  CYS 80  80  80  CYS CYS A . n 
A 1 81  ARG 81  81  81  ARG ARG A . n 
A 1 82  THR 82  82  82  THR THR A . n 
A 1 83  THR 83  83  83  THR THR A . n 
A 1 84  GLN 84  84  84  GLN GLN A . n 
A 1 85  SER 85  85  85  SER SER A . n 
A 1 86  TYR 86  86  86  TYR TYR A . n 
A 1 87  VAL 87  87  87  VAL VAL A . n 
A 1 88  ARG 88  88  88  ARG ARG A . n 
A 1 89  ALA 89  89  89  ALA ALA A . n 
A 1 90  LEU 90  90  90  LEU LEU A . n 
A 1 91  THR 91  91  91  THR THR A . n 
A 1 92  MET 92  92  92  MET MET A . n 
A 1 93  ASP 93  93  93  ASP ASP A . n 
A 1 94  SER 94  94  94  SER SER A . n 
A 1 95  LYS 95  95  95  LYS LYS A . n 
A 1 96  LYS 96  96  96  LYS LYS A . n 
A 1 97  ARG 97  97  97  ARG ARG A . n 
A 1 98  ILE 98  98  98  ILE ILE A . n 
A 1 99  GLY 99  99  99  GLY GLY A . n 
A 1 100 TRP 100 100 100 TRP TRP A . n 
A 1 101 ARG 101 101 101 ARG ARG A . n 
A 1 102 PHE 102 102 102 PHE PHE A . n 
A 1 103 ILE 103 103 103 ILE ILE A . n 
A 1 104 ARG 104 104 104 ARG ARG A . n 
A 1 105 ILE 105 105 105 ILE ILE A . n 
A 1 106 ASP 106 106 106 ASP ASP A . n 
A 1 107 THR 107 107 107 THR THR A . n 
A 1 108 SER 108 108 108 SER SER A . n 
A 1 109 CYS 109 109 109 CYS CYS A . n 
A 1 110 VAL 110 110 110 VAL VAL A . n 
A 1 111 CYS 111 111 111 CYS CYS A . n 
A 1 112 THR 112 112 112 THR THR A . n 
A 1 113 LEU 113 113 113 LEU LEU A . n 
A 1 114 THR 114 114 114 THR THR A . n 
A 1 115 ILE 115 115 115 ILE ILE A . n 
A 1 116 LYS 116 116 116 LYS LYS A . n 
A 1 117 ARG 117 117 ?   ?   ?   A . n 
A 1 118 GLY 118 118 ?   ?   ?   A . n 
A 1 119 ARG 119 119 ?   ?   ?   A . n 
B 2 1   GLY 1   1   ?   ?   ?   B . n 
B 2 2   VAL 2   2   ?   ?   ?   B . n 
B 2 3   SER 3   3   ?   ?   ?   B . n 
B 2 4   GLU 4   4   ?   ?   ?   B . n 
B 2 5   THR 5   5   ?   ?   ?   B . n 
B 2 6   ALA 6   6   ?   ?   ?   B . n 
B 2 7   PRO 7   7   ?   ?   ?   B . n 
B 2 8   ALA 8   8   ?   ?   ?   B . n 
B 2 9   SER 9   9   ?   ?   ?   B . n 
B 2 10  ARG 10  10  ?   ?   ?   B . n 
B 2 11  ARG 11  11  ?   ?   ?   B . n 
B 2 12  GLY 12  12  12  GLY GLY B . n 
B 2 13  GLU 13  13  13  GLU GLU B . n 
B 2 14  LEU 14  14  14  LEU LEU B . n 
B 2 15  ALA 15  15  15  ALA ALA B . n 
B 2 16  VAL 16  16  16  VAL VAL B . n 
B 2 17  CYS 17  17  17  CYS CYS B . n 
B 2 18  ASP 18  18  18  ASP ASP B . n 
B 2 19  ALA 19  19  19  ALA ALA B . n 
B 2 20  VAL 20  20  20  VAL VAL B . n 
B 2 21  SER 21  21  21  SER SER B . n 
B 2 22  GLY 22  22  22  GLY GLY B . n 
B 2 23  TRP 23  23  23  TRP TRP B . n 
B 2 24  VAL 24  24  24  VAL VAL B . n 
B 2 25  THR 25  25  25  THR THR B . n 
B 2 26  ASP 26  26  26  ASP ASP B . n 
B 2 27  ARG 27  27  27  ARG ARG B . n 
B 2 28  ARG 28  28  28  ARG ARG B . n 
B 2 29  THR 29  29  29  THR THR B . n 
B 2 30  ALA 30  30  30  ALA ALA B . n 
B 2 31  VAL 31  31  31  VAL VAL B . n 
B 2 32  ASP 32  32  32  ASP ASP B . n 
B 2 33  LEU 33  33  33  LEU LEU B . n 
B 2 34  ARG 34  34  34  ARG ARG B . n 
B 2 35  GLY 35  35  35  GLY GLY B . n 
B 2 36  ARG 36  36  36  ARG ARG B . n 
B 2 37  GLU 37  37  37  GLU GLU B . n 
B 2 38  VAL 38  38  38  VAL VAL B . n 
B 2 39  GLU 39  39  39  GLU GLU B . n 
B 2 40  VAL 40  40  40  VAL VAL B . n 
B 2 41  LEU 41  41  41  LEU LEU B . n 
B 2 42  GLY 42  42  42  GLY GLY B . n 
B 2 43  GLU 43  43  43  GLU GLU B . n 
B 2 44  VAL 44  44  44  VAL VAL B . n 
B 2 45  PRO 45  45  45  PRO PRO B . n 
B 2 46  ALA 46  46  46  ALA ALA B . n 
B 2 47  ALA 47  47  47  ALA ALA B . n 
B 2 48  GLY 48  48  48  GLY GLY B . n 
B 2 49  GLY 49  49  49  GLY GLY B . n 
B 2 50  SER 50  50  50  SER SER B . n 
B 2 51  PRO 51  51  51  PRO PRO B . n 
B 2 52  LEU 52  52  52  LEU LEU B . n 
B 2 53  ARG 53  53  53  ARG ARG B . n 
B 2 54  GLN 54  54  54  GLN GLN B . n 
B 2 55  TYR 55  55  55  TYR TYR B . n 
B 2 56  PHE 56  56  56  PHE PHE B . n 
B 2 57  PHE 57  57  57  PHE PHE B . n 
B 2 58  GLU 58  58  58  GLU GLU B . n 
B 2 59  THR 59  59  59  THR THR B . n 
B 2 60  ARG 60  60  60  ARG ARG B . n 
B 2 61  CYS 61  61  61  CYS CYS B . n 
B 2 62  LYS 62  62  62  LYS LYS B . n 
B 2 63  ALA 63  63  63  ALA ALA B . n 
B 2 64  ASP 64  64  ?   ?   ?   B . n 
B 2 65  ASN 65  65  ?   ?   ?   B . n 
B 2 66  ALA 66  66  ?   ?   ?   B . n 
B 2 67  GLU 67  67  ?   ?   ?   B . n 
B 2 68  GLU 68  68  68  GLU ALA B . n 
B 2 69  GLY 69  69  69  GLY GLY B . n 
B 2 70  GLY 70  70  70  GLY GLY B . n 
B 2 71  PRO 71  71  71  PRO PRO B . n 
B 2 72  GLY 72  72  72  GLY GLY B . n 
B 2 73  ALA 73  73  73  ALA ALA B . n 
B 2 74  GLY 74  74  74  GLY GLY B . n 
B 2 75  GLY 75  75  75  GLY GLY B . n 
B 2 76  GLY 76  76  76  GLY GLY B . n 
B 2 77  GLY 77  77  77  GLY GLY B . n 
B 2 78  CYS 78  78  78  CYS CYS B . n 
B 2 79  ARG 79  79  79  ARG ARG B . n 
B 2 80  GLY 80  80  80  GLY GLY B . n 
B 2 81  VAL 81  81  81  VAL VAL B . n 
B 2 82  ASP 82  82  82  ASP ASP B . n 
B 2 83  ARG 83  83  83  ARG ARG B . n 
B 2 84  ARG 84  84  84  ARG ARG B . n 
B 2 85  HIS 85  85  85  HIS HIS B . n 
B 2 86  TRP 86  86  86  TRP TRP B . n 
B 2 87  VAL 87  87  87  VAL VAL B . n 
B 2 88  SER 88  88  88  SER SER B . n 
B 2 89  GLU 89  89  89  GLU GLU B . n 
B 2 90  CYS 90  90  90  CYS CYS B . n 
B 2 91  LYS 91  91  91  LYS LYS B . n 
B 2 92  ALA 92  92  92  ALA ALA B . n 
B 2 93  LYS 93  93  93  LYS LYS B . n 
B 2 94  GLN 94  94  94  GLN GLN B . n 
B 2 95  SER 95  95  95  SER SER B . n 
B 2 96  TYR 96  96  96  TYR TYR B . n 
B 2 97  VAL 97  97  97  VAL VAL B . n 
B 2 98  ARG 98  98  98  ARG ARG B . n 
B 2 99  ALA 99  99  99  ALA ALA B . n 
B 2 100 LEU 100 100 100 LEU LEU B . n 
B 2 101 THR 101 101 101 THR THR B . n 
B 2 102 ALA 102 102 102 ALA ALA B . n 
B 2 103 ASP 103 103 103 ASP ASP B . n 
B 2 104 ALA 104 104 104 ALA ALA B . n 
B 2 105 GLN 105 105 105 GLN GLN B . n 
B 2 106 GLY 106 106 106 GLY GLY B . n 
B 2 107 ARG 107 107 107 ARG ARG B . n 
B 2 108 VAL 108 108 108 VAL VAL B . n 
B 2 109 GLY 109 109 109 GLY GLY B . n 
B 2 110 TRP 110 110 110 TRP TRP B . n 
B 2 111 ARG 111 111 111 ARG ARG B . n 
B 2 112 TRP 112 112 112 TRP TRP B . n 
B 2 113 ILE 113 113 113 ILE ILE B . n 
B 2 114 ARG 114 114 114 ARG ARG B . n 
B 2 115 ILE 115 115 115 ILE ILE B . n 
B 2 116 ASP 116 116 116 ASP ASP B . n 
B 2 117 THR 117 117 117 THR THR B . n 
B 2 118 ALA 118 118 118 ALA ALA B . n 
B 2 119 CYS 119 119 119 CYS CYS B . n 
B 2 120 VAL 120 120 120 VAL VAL B . n 
B 2 121 CYS 121 121 121 CYS CYS B . n 
B 2 122 THR 122 122 122 THR THR B . n 
B 2 123 LEU 123 123 123 LEU LEU B . n 
B 2 124 LEU 124 124 124 LEU LEU B . n 
B 2 125 SER 125 125 125 SER SER B . n 
B 2 126 ARG 126 126 126 ARG ARG B . n 
B 2 127 THR 127 127 127 THR THR B . n 
B 2 128 GLY 128 128 128 GLY GLY B . n 
B 2 129 ARG 129 129 129 ARG ARG B . n 
B 2 130 ALA 130 130 130 ALA ALA B . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 2830  ? 
1 MORE         -17   ? 
1 'SSA (A^2)'  13150 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1999-02-09 
2 'Structure model' 1 1 2008-04-26 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
DENZO     'data reduction' . ? 1 
SCALEPACK 'data scaling'   . ? 2 
AMoRE     phasing          . ? 3 
X-PLOR    refinement       . ? 4 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 CD A GLU 9  ? ? OE2 A GLU 9  ? ? 1.321 1.252 0.069 0.011 N 
2 1 CD B GLU 13 ? ? OE2 B GLU 13 ? ? 1.325 1.252 0.073 0.011 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 NE B ARG 27  ? ? CZ B ARG 27  ? ? NH2 B ARG 27  ? ? 116.62 120.30 -3.68 0.50 N 
2 1 N  B GLY 128 ? ? CA B GLY 128 ? ? C   B GLY 128 ? ? 131.70 113.10 18.60 2.50 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 LYS A 46  ? ? 89.82   -7.38   
2 1 MET A 61  ? ? -109.15 40.83   
3 1 ALA B 73  ? ? -0.36   -103.97 
4 1 ASP B 82  ? ? -59.17  94.15   
5 1 ARG B 126 ? ? 78.59   -164.23 
6 1 THR B 127 ? ? 170.41  166.96  
7 1 ARG B 129 ? ? 85.23   64.88   
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 B GLU 68 ? CG  ? B GLU 68 CG  
2 1 Y 1 B GLU 68 ? CD  ? B GLU 68 CD  
3 1 Y 1 B GLU 68 ? OE1 ? B GLU 68 OE1 
4 1 Y 1 B GLU 68 ? OE2 ? B GLU 68 OE2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A HIS 1   ? A HIS 1   
2  1 Y 1 A SER 2   ? A SER 2   
3  1 Y 1 A ASP 3   ? A ASP 3   
4  1 Y 1 A PRO 4   ? A PRO 4   
5  1 Y 1 A ALA 5   ? A ALA 5   
6  1 Y 1 A ARG 6   ? A ARG 6   
7  1 Y 1 A ARG 7   ? A ARG 7   
8  1 Y 1 A ARG 117 ? A ARG 117 
9  1 Y 1 A GLY 118 ? A GLY 118 
10 1 Y 1 A ARG 119 ? A ARG 119 
11 1 Y 1 B GLY 1   ? B GLY 1   
12 1 Y 1 B VAL 2   ? B VAL 2   
13 1 Y 1 B SER 3   ? B SER 3   
14 1 Y 1 B GLU 4   ? B GLU 4   
15 1 Y 1 B THR 5   ? B THR 5   
16 1 Y 1 B ALA 6   ? B ALA 6   
17 1 Y 1 B PRO 7   ? B PRO 7   
18 1 Y 1 B ALA 8   ? B ALA 8   
19 1 Y 1 B SER 9   ? B SER 9   
20 1 Y 1 B ARG 10  ? B ARG 10  
21 1 Y 1 B ARG 11  ? B ARG 11  
22 1 Y 1 B ASP 64  ? B ASP 64  
23 1 Y 1 B ASN 65  ? B ASN 65  
24 1 Y 1 B ALA 66  ? B ALA 66  
25 1 Y 1 B GLU 67  ? B GLU 67  
# 
_pdbx_entity_nonpoly.entity_id   3 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 HOH 1  120 1  HOH HOH A . 
C 3 HOH 2  121 2  HOH HOH A . 
C 3 HOH 3  122 3  HOH HOH A . 
C 3 HOH 4  123 4  HOH HOH A . 
C 3 HOH 5  124 5  HOH HOH A . 
C 3 HOH 6  125 6  HOH HOH A . 
C 3 HOH 7  126 7  HOH HOH A . 
C 3 HOH 8  127 8  HOH HOH A . 
C 3 HOH 9  128 10 HOH HOH A . 
C 3 HOH 10 129 11 HOH HOH A . 
C 3 HOH 11 130 12 HOH HOH A . 
C 3 HOH 12 131 13 HOH HOH A . 
C 3 HOH 13 132 15 HOH HOH A . 
C 3 HOH 14 133 16 HOH HOH A . 
C 3 HOH 15 134 17 HOH HOH A . 
C 3 HOH 16 135 18 HOH HOH A . 
C 3 HOH 17 136 19 HOH HOH A . 
C 3 HOH 18 137 20 HOH HOH A . 
C 3 HOH 19 138 22 HOH HOH A . 
C 3 HOH 20 139 24 HOH HOH A . 
C 3 HOH 21 140 25 HOH HOH A . 
C 3 HOH 22 141 26 HOH HOH A . 
C 3 HOH 23 142 27 HOH HOH A . 
C 3 HOH 24 143 28 HOH HOH A . 
C 3 HOH 25 144 29 HOH HOH A . 
C 3 HOH 26 145 30 HOH HOH A . 
C 3 HOH 27 146 31 HOH HOH A . 
C 3 HOH 28 147 32 HOH HOH A . 
C 3 HOH 29 148 33 HOH HOH A . 
C 3 HOH 30 149 34 HOH HOH A . 
C 3 HOH 31 150 35 HOH HOH A . 
C 3 HOH 32 151 38 HOH HOH A . 
C 3 HOH 33 152 39 HOH HOH A . 
C 3 HOH 34 153 40 HOH HOH A . 
C 3 HOH 35 154 41 HOH HOH A . 
C 3 HOH 36 155 42 HOH HOH A . 
C 3 HOH 37 156 43 HOH HOH A . 
C 3 HOH 38 157 44 HOH HOH A . 
D 3 HOH 1  131 9  HOH HOH B . 
D 3 HOH 2  132 14 HOH HOH B . 
D 3 HOH 3  133 21 HOH HOH B . 
D 3 HOH 4  134 23 HOH HOH B . 
D 3 HOH 5  135 36 HOH HOH B . 
D 3 HOH 6  136 37 HOH HOH B . 
D 3 HOH 7  137 45 HOH HOH B . 
D 3 HOH 8  138 46 HOH HOH B . 
D 3 HOH 9  139 47 HOH HOH B . 
D 3 HOH 10 140 48 HOH HOH B . 
D 3 HOH 11 141 49 HOH HOH B . 
D 3 HOH 12 142 50 HOH HOH B . 
D 3 HOH 13 143 51 HOH HOH B . 
D 3 HOH 14 144 52 HOH HOH B . 
D 3 HOH 15 145 53 HOH HOH B . 
D 3 HOH 16 146 54 HOH HOH B . 
D 3 HOH 17 147 55 HOH HOH B . 
D 3 HOH 18 148 56 HOH HOH B . 
D 3 HOH 19 149 57 HOH HOH B . 
#