data_1B9E
# 
_entry.id   1B9E 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1B9E         
RCSB  RCSB000075   
WWPDB D_1000000075 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1B9E 
_pdbx_database_status.recvd_initial_deposition_date   1998-11-12 
_pdbx_database_status.deposit_site                    BNL 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Wang, D.C.' 1 
'Zeng, Z.H.' 2 
'Yao, Z.P.'  3 
'Li, H.M.'   4 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 
'Structure of an insulin dimer in an orthorhombic crystal: the structure analysis of a human insulin mutant (B9 Ser-->Glu).' 
'Acta Crystallogr.,Sect.D'    55 1524 1532 1999 ABCRE6 DK 0907-4449 0766 ? 10489447 10.1107/S0907444999008562 
1       'Protein Engineering of Insulin: [B9 Glutamic Acid Human Insulin]' 'Acta Biochem.Biophys.Sinica' 28 245  ?    1996 ?      
?  ?         ?    ? ?        ?                         
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Yao, Z.P.'   1  
primary 'Zeng, Z.H.'  2  
primary 'Li, H.M.'    3  
primary 'Zhang, Y.'   4  
primary 'Feng, Y.M.'  5  
primary 'Wang, D.C.'  6  
1       'Liu, B.'     7  
1       'Liang, Z.H.' 8  
1       'Tang, Y.H.'  9  
1       'Zhang, X.T.' 10 
1       'Zhu, S.Q.'   11 
1       'Feng, Y.M.'  12 
# 
_cell.entry_id           1B9E 
_cell.length_a           44.560 
_cell.length_b           46.390 
_cell.length_c           51.850 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1B9E 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'PROTEIN (INSULIN)' 2383.698 2  ? ?   ? ? 
2 polymer man 'PROTEIN (INSULIN)' 3475.989 2  ? S9E ? ? 
3 water   nat water               18.015   45 ? ?   ? ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no GIVEQCCTSICSLYQLENYCN          GIVEQCCTSICSLYQLENYCN          A,C ? 
2 'polypeptide(L)' no no FVNQHLCGEHLVEALYLVCGERGFFYTPKT FVNQHLCGEHLVEALYLVCGERGFFYTPKT B,D ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  GLY n 
1 2  ILE n 
1 3  VAL n 
1 4  GLU n 
1 5  GLN n 
1 6  CYS n 
1 7  CYS n 
1 8  THR n 
1 9  SER n 
1 10 ILE n 
1 11 CYS n 
1 12 SER n 
1 13 LEU n 
1 14 TYR n 
1 15 GLN n 
1 16 LEU n 
1 17 GLU n 
1 18 ASN n 
1 19 TYR n 
1 20 CYS n 
1 21 ASN n 
2 1  PHE n 
2 2  VAL n 
2 3  ASN n 
2 4  GLN n 
2 5  HIS n 
2 6  LEU n 
2 7  CYS n 
2 8  GLY n 
2 9  GLU n 
2 10 HIS n 
2 11 LEU n 
2 12 VAL n 
2 13 GLU n 
2 14 ALA n 
2 15 LEU n 
2 16 TYR n 
2 17 LEU n 
2 18 VAL n 
2 19 CYS n 
2 20 GLY n 
2 21 GLU n 
2 22 ARG n 
2 23 GLY n 
2 24 PHE n 
2 25 PHE n 
2 26 TYR n 
2 27 THR n 
2 28 PRO n 
2 29 LYS n 
2 30 THR n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? human Homo ? ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? 
;baker's yeast
;
'Saccharomyces cerevisiae' 4932 Saccharomyces ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample ? ? ? human Homo ? ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? 
;baker's yeast
;
'Saccharomyces cerevisiae' 4932 Saccharomyces ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
_struct_ref.pdbx_seq_one_letter_code 
1 UNP INS_HUMAN P01308 1 90 ? ? 
2 UNP INS_HUMAN P01308 2 25 ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1B9E A 1 ? 21 ? P01308 90 ? 110 ? 1 21 
2 2 1B9E B 1 ? 30 ? P01308 25 ? 54  ? 1 30 
3 1 1B9E C 1 ? 21 ? P01308 90 ? 110 ? 1 21 
4 2 1B9E D 1 ? 30 ? P01308 25 ? 54  ? 1 30 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
2 1B9E GLU B 9 ? UNP P01308 SER 33 ENGINEERED 9 1 
4 1B9E GLU D 9 ? UNP P01308 SER 33 ENGINEERED 9 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1B9E 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.3 
_exptl_crystal.density_percent_sol   46.19 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              3.5 
_exptl_crystal_grow.pdbx_details    
;HANGING DROP, 0.1M AMMONIA CITRATE, 0.12% CHROMIUM DICHLORIDE (W/V), 10% 
ACETONE (V/V), 4% DIMETHYL FORMAMIDE (V/V), PH 3.8, pH 3.5, VAPOR DIFFUSION, HANGING DROP
;
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           293.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   1995-08-03 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        RIGAKU 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1B9E 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             27.3 
_reflns.d_resolution_high            2.5 
_reflns.number_obs                   3538 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         88.43 
_reflns.pdbx_Rmerge_I_obs            0.0854 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        15.98 
_reflns.B_iso_Wilson_estimate        28.83 
_reflns.pdbx_redundancy              3.83 
_reflns.R_free_details               ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.50 
_reflns_shell.d_res_low              2.55 
_reflns_shell.percent_possible_all   88.4 
_reflns_shell.Rmerge_I_obs           0.389 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    3.07 
_reflns_shell.pdbx_redundancy        3.8 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1B9E 
_refine.ls_number_reflns_obs                     3170 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             6.5 
_refine.ls_d_res_high                            2.5 
_refine.ls_percent_reflns_obs                    84.7 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.165 
_refine.ls_R_factor_R_free                       0.264 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  156 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               24.35 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      '2ZN INSULIN DIMER' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        816 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             45 
_refine_hist.number_atoms_total               861 
_refine_hist.d_res_high                       2.5 
_refine_hist.d_res_low                        6.5 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d                0.013 ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg             1.637 ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d      24.48 ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d      1.422 ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   10 
_refine_ls_shell.d_res_high                       2.50 
_refine_ls_shell.d_res_low                        2.58 
_refine_ls_shell.number_reflns_R_work             315 
_refine_ls_shell.R_factor_R_work                  0.244 
_refine_ls_shell.percent_reflns_obs               84.7 
_refine_ls_shell.R_factor_R_free                  0.304 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            5 
_refine_ls_shell.number_reflns_R_free             15 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct_ncs_oper.id             1 
_struct_ncs_oper.code           given 
_struct_ncs_oper.details        ? 
_struct_ncs_oper.matrix[1][1]   -0.990949 
_struct_ncs_oper.matrix[1][2]   -0.078334 
_struct_ncs_oper.matrix[1][3]   0.109014 
_struct_ncs_oper.matrix[2][1]   -0.079595 
_struct_ncs_oper.matrix[2][2]   0.996801 
_struct_ncs_oper.matrix[2][3]   -0.007253 
_struct_ncs_oper.matrix[3][1]   -0.108098 
_struct_ncs_oper.matrix[3][2]   -0.015864 
_struct_ncs_oper.matrix[3][3]   -0.994014 
_struct_ncs_oper.vector[1]      20.69410 
_struct_ncs_oper.vector[2]      0.89640 
_struct_ncs_oper.vector[3]      1.08840 
# 
_struct.entry_id                  1B9E 
_struct.title                     'HUMAN INSULIN MUTANT SERB9GLU' 
_struct.pdbx_descriptor           'HUMAN INSULIN' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1B9E 
_struct_keywords.pdbx_keywords   'HORMONE/GROWTH FACTOR' 
_struct_keywords.text            'HORMONE, FAST-ACTING INSULIN, HORMONE-GROWTH FACTOR COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 1 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
G N N 3 ? 
H N N 3 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ILE A 2  ? CYS A 6  ? ILE A 2  CYS A 6  1 ? 5  
HELX_P HELX_P2 2 LEU A 13 ? TYR A 19 ? LEU A 13 TYR A 19 1 ? 7  
HELX_P HELX_P3 3 GLY B 8  ? ARG B 22 ? GLY B 8  ARG B 22 1 ? 15 
HELX_P HELX_P4 4 ILE C 2  ? CYS C 6  ? ILE C 2  CYS C 6  1 ? 5  
HELX_P HELX_P5 5 LEU C 13 ? TYR C 19 ? LEU C 13 TYR C 19 1 ? 7  
HELX_P HELX_P6 6 GLY D 8  ? ARG D 22 ? GLY D 8  ARG D 22 5 ? 15 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 6  SG ? ? ? 1_555 A CYS 11 SG ? ? A CYS 6  A CYS 11 1_555 ? ? ? ? ? ? ? 2.031 ? 
disulf2 disulf ? ? A CYS 7  SG ? ? ? 1_555 B CYS 7  SG ? ? A CYS 7  B CYS 7  1_555 ? ? ? ? ? ? ? 2.032 ? 
disulf3 disulf ? ? A CYS 20 SG ? ? ? 1_555 B CYS 19 SG ? ? A CYS 20 B CYS 19 1_555 ? ? ? ? ? ? ? 2.013 ? 
disulf4 disulf ? ? C CYS 6  SG ? ? ? 1_555 C CYS 11 SG ? ? C CYS 6  C CYS 11 1_555 ? ? ? ? ? ? ? 2.039 ? 
disulf5 disulf ? ? C CYS 7  SG ? ? ? 1_555 D CYS 7  SG ? ? C CYS 7  D CYS 7  1_555 ? ? ? ? ? ? ? 2.043 ? 
disulf6 disulf ? ? C CYS 20 SG ? ? ? 1_555 D CYS 19 SG ? ? C CYS 20 D CYS 19 1_555 ? ? ? ? ? ? ? 1.998 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   2 
_struct_sheet.details          ? 
# 
_struct_sheet_order.sheet_id     A 
_struct_sheet_order.range_id_1   1 
_struct_sheet_order.range_id_2   2 
_struct_sheet_order.offset       ? 
_struct_sheet_order.sense        anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 PHE B 24 ? TYR B 26 ? PHE B 24 TYR B 26 
A 2 PHE D 24 ? TYR D 26 ? PHE D 24 TYR D 26 
# 
_pdbx_struct_sheet_hbond.sheet_id                A 
_pdbx_struct_sheet_hbond.range_id_1              1 
_pdbx_struct_sheet_hbond.range_id_2              2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id   N 
_pdbx_struct_sheet_hbond.range_1_label_comp_id   TYR 
_pdbx_struct_sheet_hbond.range_1_label_asym_id   B 
_pdbx_struct_sheet_hbond.range_1_label_seq_id    26 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code    ? 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id    N 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id    TYR 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id    B 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id     26 
_pdbx_struct_sheet_hbond.range_2_label_atom_id   O 
_pdbx_struct_sheet_hbond.range_2_label_comp_id   PHE 
_pdbx_struct_sheet_hbond.range_2_label_asym_id   D 
_pdbx_struct_sheet_hbond.range_2_label_seq_id    24 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code    ? 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id    O 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id    PHE 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id    D 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id     24 
# 
_database_PDB_matrix.entry_id          1B9E 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1B9E 
_atom_sites.fract_transf_matrix[1][1]   0.022442 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.021556 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.019286 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1   N N   . GLY A 1 1  ? -5.201  9.673   -2.852  1.00 21.99 ? 1  GLY A N   1 
ATOM   2   C CA  . GLY A 1 1  ? -3.724  9.368   -2.711  1.00 21.30 ? 1  GLY A CA  1 
ATOM   3   C C   . GLY A 1 1  ? -3.320  8.030   -3.324  1.00 18.48 ? 1  GLY A C   1 
ATOM   4   O O   . GLY A 1 1  ? -4.164  7.323   -3.878  1.00 24.81 ? 1  GLY A O   1 
ATOM   5   N N   . ILE A 1 2  ? -2.065  7.644   -3.159  1.00 13.65 ? 2  ILE A N   1 
ATOM   6   C CA  . ILE A 1 2  ? -1.579  6.399   -3.716  1.00 12.18 ? 2  ILE A CA  1 
ATOM   7   C C   . ILE A 1 2  ? -2.254  5.174   -3.077  1.00 15.61 ? 2  ILE A C   1 
ATOM   8   O O   . ILE A 1 2  ? -2.629  4.249   -3.786  1.00 13.09 ? 2  ILE A O   1 
ATOM   9   C CB  . ILE A 1 2  ? -0.037  6.325   -3.601  1.00 12.48 ? 2  ILE A CB  1 
ATOM   10  C CG1 . ILE A 1 2  ? 0.494   5.122   -4.357  1.00 14.27 ? 2  ILE A CG1 1 
ATOM   11  C CG2 . ILE A 1 2  ? 0.397   6.250   -2.171  1.00 7.71  ? 2  ILE A CG2 1 
ATOM   12  C CD1 . ILE A 1 2  ? 1.946   5.193   -4.618  1.00 11.64 ? 2  ILE A CD1 1 
ATOM   13  N N   . VAL A 1 3  ? -2.487  5.202   -1.759  1.00 19.67 ? 3  VAL A N   1 
ATOM   14  C CA  . VAL A 1 3  ? -3.123  4.072   -1.065  1.00 21.16 ? 3  VAL A CA  1 
ATOM   15  C C   . VAL A 1 3  ? -4.531  3.814   -1.605  1.00 21.76 ? 3  VAL A C   1 
ATOM   16  O O   . VAL A 1 3  ? -4.954  2.670   -1.806  1.00 20.69 ? 3  VAL A O   1 
ATOM   17  C CB  . VAL A 1 3  ? -3.225  4.312   0.465   1.00 21.43 ? 3  VAL A CB  1 
ATOM   18  C CG1 . VAL A 1 3  ? -3.687  3.033   1.165   1.00 21.34 ? 3  VAL A CG1 1 
ATOM   19  C CG2 . VAL A 1 3  ? -1.885  4.782   1.039   1.00 19.65 ? 3  VAL A CG2 1 
ATOM   20  N N   . GLU A 1 4  ? -5.232  4.902   -1.886  1.00 19.71 ? 4  GLU A N   1 
ATOM   21  C CA  . GLU A 1 4  ? -6.588  4.828   -2.396  1.00 21.81 ? 4  GLU A CA  1 
ATOM   22  C C   . GLU A 1 4  ? -6.609  4.320   -3.822  1.00 22.43 ? 4  GLU A C   1 
ATOM   23  O O   . GLU A 1 4  ? -7.396  3.442   -4.175  1.00 27.85 ? 4  GLU A O   1 
ATOM   24  C CB  . GLU A 1 4  ? -7.265  6.216   -2.376  1.00 26.55 ? 4  GLU A CB  1 
ATOM   25  C CG  . GLU A 1 4  ? -7.585  6.818   -0.983  1.00 33.27 ? 4  GLU A CG  1 
ATOM   26  C CD  . GLU A 1 4  ? -6.432  7.622   -0.310  1.00 38.16 ? 4  GLU A CD  1 
ATOM   27  O OE1 . GLU A 1 4  ? -5.228  7.429   -0.623  1.00 34.87 ? 4  GLU A OE1 1 
ATOM   28  O OE2 . GLU A 1 4  ? -6.756  8.444   0.580   1.00 41.96 ? 4  GLU A OE2 1 
ATOM   29  N N   . GLN A 1 5  ? -5.746  4.866   -4.660  1.00 20.78 ? 5  GLN A N   1 
ATOM   30  C CA  . GLN A 1 5  ? -5.759  4.458   -6.064  1.00 16.74 ? 5  GLN A CA  1 
ATOM   31  C C   . GLN A 1 5  ? -5.113  3.120   -6.342  1.00 15.36 ? 5  GLN A C   1 
ATOM   32  O O   . GLN A 1 5  ? -5.508  2.436   -7.264  1.00 13.26 ? 5  GLN A O   1 
ATOM   33  C CB  . GLN A 1 5  ? -5.045  5.478   -6.940  1.00 20.93 ? 5  GLN A CB  1 
ATOM   34  C CG  . GLN A 1 5  ? -5.467  6.903   -6.812  1.00 27.95 ? 5  GLN A CG  1 
ATOM   35  C CD  . GLN A 1 5  ? -4.957  7.690   -7.976  1.00 32.19 ? 5  GLN A CD  1 
ATOM   36  O OE1 . GLN A 1 5  ? -3.748  7.749   -8.220  1.00 33.55 ? 5  GLN A OE1 1 
ATOM   37  N NE2 . GLN A 1 5  ? -5.876  8.223   -8.765  1.00 39.30 ? 5  GLN A NE2 1 
ATOM   38  N N   . CYS A 1 6  ? -4.054  2.802   -5.607  1.00 13.66 ? 6  CYS A N   1 
ATOM   39  C CA  . CYS A 1 6  ? -3.301  1.583   -5.819  1.00 13.86 ? 6  CYS A CA  1 
ATOM   40  C C   . CYS A 1 6  ? -3.559  0.386   -4.938  1.00 13.38 ? 6  CYS A C   1 
ATOM   41  O O   . CYS A 1 6  ? -3.333  -0.737  -5.369  1.00 14.74 ? 6  CYS A O   1 
ATOM   42  C CB  . CYS A 1 6  ? -1.808  1.894   -5.785  1.00 14.01 ? 6  CYS A CB  1 
ATOM   43  S SG  . CYS A 1 6  ? -1.283  2.972   -7.126  1.00 11.55 ? 6  CYS A SG  1 
ATOM   44  N N   . CYS A 1 7  ? -3.892  0.631   -3.679  1.00 16.35 ? 7  CYS A N   1 
ATOM   45  C CA  . CYS A 1 7  ? -4.186  -0.437  -2.728  1.00 21.22 ? 7  CYS A CA  1 
ATOM   46  C C   . CYS A 1 7  ? -5.696  -0.763  -2.686  1.00 22.76 ? 7  CYS A C   1 
ATOM   47  O O   . CYS A 1 7  ? -6.110  -1.910  -2.896  1.00 25.21 ? 7  CYS A O   1 
ATOM   48  C CB  . CYS A 1 7  ? -3.680  -0.060  -1.322  1.00 17.15 ? 7  CYS A CB  1 
ATOM   49  S SG  . CYS A 1 7  ? -4.060  -1.263  -0.007  1.00 15.80 ? 7  CYS A SG  1 
ATOM   50  N N   . THR A 1 8  ? -6.507  0.259   -2.427  1.00 24.05 ? 8  THR A N   1 
ATOM   51  C CA  . THR A 1 8  ? -7.944  0.101   -2.342  1.00 19.20 ? 8  THR A CA  1 
ATOM   52  C C   . THR A 1 8  ? -8.467  -0.225  -3.716  1.00 23.58 ? 8  THR A C   1 
ATOM   53  O O   . THR A 1 8  ? -9.269  -1.151  -3.895  1.00 28.41 ? 8  THR A O   1 
ATOM   54  C CB  . THR A 1 8  ? -8.583  1.369   -1.800  1.00 18.90 ? 8  THR A CB  1 
ATOM   55  O OG1 . THR A 1 8  ? -8.060  1.629   -0.493  1.00 19.63 ? 8  THR A OG1 1 
ATOM   56  C CG2 . THR A 1 8  ? -10.076 1.213   -1.680  1.00 16.02 ? 8  THR A CG2 1 
ATOM   57  N N   . SER A 1 9  ? -7.982  0.507   -4.706  1.00 21.49 ? 9  SER A N   1 
ATOM   58  C CA  . SER A 1 9  ? -8.387  0.260   -6.072  1.00 17.90 ? 9  SER A CA  1 
ATOM   59  C C   . SER A 1 9  ? -7.137  -0.228  -6.809  1.00 18.84 ? 9  SER A C   1 
ATOM   60  O O   . SER A 1 9  ? -6.120  -0.579  -6.181  1.00 13.97 ? 9  SER A O   1 
ATOM   61  C CB  . SER A 1 9  ? -8.941  1.551   -6.681  1.00 22.39 ? 9  SER A CB  1 
ATOM   62  O OG  . SER A 1 9  ? -9.440  1.347   -7.993  1.00 31.77 ? 9  SER A OG  1 
ATOM   63  N N   . ILE A 1 10 ? -7.205  -0.241  -8.140  1.00 20.26 ? 10 ILE A N   1 
ATOM   64  C CA  . ILE A 1 10 ? -6.088  -0.686  -8.956  1.00 17.32 ? 10 ILE A CA  1 
ATOM   65  C C   . ILE A 1 10 ? -5.577  0.481   -9.788  1.00 17.56 ? 10 ILE A C   1 
ATOM   66  O O   . ILE A 1 10 ? -6.376  1.210   -10.379 1.00 21.36 ? 10 ILE A O   1 
ATOM   67  C CB  . ILE A 1 10 ? -6.523  -1.847  -9.838  1.00 14.09 ? 10 ILE A CB  1 
ATOM   68  C CG1 . ILE A 1 10 ? -7.088  -2.948  -8.945  1.00 15.03 ? 10 ILE A CG1 1 
ATOM   69  C CG2 . ILE A 1 10 ? -5.336  -2.403  -10.661 1.00 12.60 ? 10 ILE A CG2 1 
ATOM   70  C CD1 . ILE A 1 10 ? -7.484  -4.183  -9.723  1.00 19.72 ? 10 ILE A CD1 1 
ATOM   71  N N   . CYS A 1 11 ? -4.267  0.708   -9.780  1.00 11.51 ? 11 CYS A N   1 
ATOM   72  C CA  . CYS A 1 11 ? -3.716  1.810   -10.555 1.00 16.82 ? 11 CYS A CA  1 
ATOM   73  C C   . CYS A 1 11 ? -2.968  1.352   -11.777 1.00 18.96 ? 11 CYS A C   1 
ATOM   74  O O   . CYS A 1 11 ? -2.541  0.198   -11.854 1.00 24.10 ? 11 CYS A O   1 
ATOM   75  C CB  . CYS A 1 11 ? -2.796  2.680   -9.709  1.00 17.76 ? 11 CYS A CB  1 
ATOM   76  S SG  . CYS A 1 11 ? -1.461  1.835   -8.799  1.00 22.04 ? 11 CYS A SG  1 
ATOM   77  N N   . SER A 1 12 ? -2.824  2.242   -12.747 1.00 17.53 ? 12 SER A N   1 
ATOM   78  C CA  . SER A 1 12 ? -2.094  1.906   -13.954 1.00 18.14 ? 12 SER A CA  1 
ATOM   79  C C   . SER A 1 12 ? -0.612  2.304   -13.723 1.00 20.93 ? 12 SER A C   1 
ATOM   80  O O   . SER A 1 12 ? -0.284  2.856   -12.673 1.00 26.86 ? 12 SER A O   1 
ATOM   81  C CB  . SER A 1 12 ? -2.718  2.655   -15.131 1.00 13.50 ? 12 SER A CB  1 
ATOM   82  O OG  . SER A 1 12 ? -2.681  4.036   -14.873 1.00 18.99 ? 12 SER A OG  1 
ATOM   83  N N   . LEU A 1 13 ? 0.284   2.014   -14.672 1.00 21.36 ? 13 LEU A N   1 
ATOM   84  C CA  . LEU A 1 13 ? 1.698   2.376   -14.548 1.00 17.00 ? 13 LEU A CA  1 
ATOM   85  C C   . LEU A 1 13 ? 1.890   3.900   -14.354 1.00 19.18 ? 13 LEU A C   1 
ATOM   86  O O   . LEU A 1 13 ? 2.646   4.318   -13.479 1.00 15.70 ? 13 LEU A O   1 
ATOM   87  C CB  . LEU A 1 13 ? 2.456   1.949   -15.797 1.00 15.61 ? 13 LEU A CB  1 
ATOM   88  C CG  . LEU A 1 13 ? 3.969   1.684   -15.690 1.00 19.65 ? 13 LEU A CG  1 
ATOM   89  C CD1 . LEU A 1 13 ? 4.694   2.274   -16.867 1.00 10.57 ? 13 LEU A CD1 1 
ATOM   90  C CD2 . LEU A 1 13 ? 4.564   2.160   -14.358 1.00 18.07 ? 13 LEU A CD2 1 
ATOM   91  N N   . TYR A 1 14 ? 1.178   4.706   -15.156 1.00 19.24 ? 14 TYR A N   1 
ATOM   92  C CA  . TYR A 1 14 ? 1.250   6.176   -15.114 1.00 17.68 ? 14 TYR A CA  1 
ATOM   93  C C   . TYR A 1 14 ? 0.719   6.855   -13.848 1.00 19.36 ? 14 TYR A C   1 
ATOM   94  O O   . TYR A 1 14 ? 1.158   7.962   -13.509 1.00 17.93 ? 14 TYR A O   1 
ATOM   95  C CB  . TYR A 1 14 ? 0.546   6.784   -16.329 1.00 16.91 ? 14 TYR A CB  1 
ATOM   96  C CG  . TYR A 1 14 ? 1.279   6.583   -17.614 1.00 15.25 ? 14 TYR A CG  1 
ATOM   97  C CD1 . TYR A 1 14 ? 2.618   6.190   -17.622 1.00 21.26 ? 14 TYR A CD1 1 
ATOM   98  C CD2 . TYR A 1 14 ? 0.640   6.751   -18.826 1.00 18.33 ? 14 TYR A CD2 1 
ATOM   99  C CE1 . TYR A 1 14 ? 3.310   5.967   -18.817 1.00 18.63 ? 14 TYR A CE1 1 
ATOM   100 C CE2 . TYR A 1 14 ? 1.318   6.525   -20.034 1.00 21.93 ? 14 TYR A CE2 1 
ATOM   101 C CZ  . TYR A 1 14 ? 2.644   6.133   -20.017 1.00 20.41 ? 14 TYR A CZ  1 
ATOM   102 O OH  . TYR A 1 14 ? 3.291   5.862   -21.193 1.00 24.44 ? 14 TYR A OH  1 
ATOM   103 N N   . GLN A 1 15 ? -0.290  6.256   -13.216 1.00 17.14 ? 15 GLN A N   1 
ATOM   104 C CA  . GLN A 1 15 ? -0.831  6.820   -11.987 1.00 15.94 ? 15 GLN A CA  1 
ATOM   105 C C   . GLN A 1 15 ? 0.233   6.657   -10.926 1.00 15.19 ? 15 GLN A C   1 
ATOM   106 O O   . GLN A 1 15 ? 0.539   7.596   -10.195 1.00 19.06 ? 15 GLN A O   1 
ATOM   107 C CB  . GLN A 1 15 ? -2.120  6.125   -11.583 1.00 9.25  ? 15 GLN A CB  1 
ATOM   108 C CG  . GLN A 1 15 ? -3.172  6.394   -12.584 1.00 11.54 ? 15 GLN A CG  1 
ATOM   109 C CD  . GLN A 1 15 ? -4.500  5.894   -12.128 1.00 20.92 ? 15 GLN A CD  1 
ATOM   110 O OE1 . GLN A 1 15 ? -4.656  4.710   -11.795 1.00 24.61 ? 15 GLN A OE1 1 
ATOM   111 N NE2 . GLN A 1 15 ? -5.490  6.782   -12.111 1.00 25.01 ? 15 GLN A NE2 1 
ATOM   112 N N   . LEU A 1 16 ? 0.869   5.493   -10.939 1.00 16.89 ? 16 LEU A N   1 
ATOM   113 C CA  . LEU A 1 16 ? 1.928   5.150   -10.012 1.00 13.03 ? 16 LEU A CA  1 
ATOM   114 C C   . LEU A 1 16 ? 3.107   6.070   -10.232 1.00 14.94 ? 16 LEU A C   1 
ATOM   115 O O   . LEU A 1 16 ? 3.616   6.657   -9.300  1.00 18.85 ? 16 LEU A O   1 
ATOM   116 C CB  . LEU A 1 16 ? 2.378   3.735   -10.296 1.00 14.41 ? 16 LEU A CB  1 
ATOM   117 C CG  . LEU A 1 16 ? 2.239   2.747   -9.162  1.00 20.48 ? 16 LEU A CG  1 
ATOM   118 C CD1 . LEU A 1 16 ? 2.931   1.461   -9.606  1.00 23.20 ? 16 LEU A CD1 1 
ATOM   119 C CD2 . LEU A 1 16 ? 2.881   3.311   -7.923  1.00 15.34 ? 16 LEU A CD2 1 
ATOM   120 N N   . GLU A 1 17 ? 3.527   6.217   -11.483 1.00 16.99 ? 17 GLU A N   1 
ATOM   121 C CA  . GLU A 1 17 ? 4.689   7.062   -11.840 1.00 18.99 ? 17 GLU A CA  1 
ATOM   122 C C   . GLU A 1 17 ? 4.490   8.517   -11.500 1.00 19.36 ? 17 GLU A C   1 
ATOM   123 O O   . GLU A 1 17 ? 5.445   9.275   -11.369 1.00 17.38 ? 17 GLU A O   1 
ATOM   124 C CB  . GLU A 1 17 ? 5.028   6.972   -13.343 1.00 20.30 ? 17 GLU A CB  1 
ATOM   125 C CG  . GLU A 1 17 ? 5.454   5.584   -13.813 1.00 14.98 ? 17 GLU A CG  1 
ATOM   126 C CD  . GLU A 1 17 ? 6.010   5.605   -15.192 1.00 14.75 ? 17 GLU A CD  1 
ATOM   127 O OE1 . GLU A 1 17 ? 5.565   6.428   -16.001 1.00 19.31 ? 17 GLU A OE1 1 
ATOM   128 O OE2 . GLU A 1 17 ? 6.921   4.820   -15.468 1.00 19.84 ? 17 GLU A OE2 1 
ATOM   129 N N   . ASN A 1 18 ? 3.233   8.916   -11.420 1.00 21.76 ? 18 ASN A N   1 
ATOM   130 C CA  . ASN A 1 18 ? 2.912   10.273  -11.095 1.00 17.07 ? 18 ASN A CA  1 
ATOM   131 C C   . ASN A 1 18 ? 3.267   10.570  -9.637  1.00 18.28 ? 18 ASN A C   1 
ATOM   132 O O   . ASN A 1 18 ? 3.249   11.730  -9.241  1.00 17.66 ? 18 ASN A O   1 
ATOM   133 C CB  . ASN A 1 18 ? 1.447   10.480  -11.340 1.00 22.69 ? 18 ASN A CB  1 
ATOM   134 C CG  . ASN A 1 18 ? 1.131   11.878  -11.797 1.00 29.62 ? 18 ASN A CG  1 
ATOM   135 O OD1 . ASN A 1 18 ? 1.810   12.437  -12.667 1.00 22.68 ? 18 ASN A OD1 1 
ATOM   136 N ND2 . ASN A 1 18 ? 0.097   12.474  -11.188 1.00 36.33 ? 18 ASN A ND2 1 
ATOM   137 N N   . TYR A 1 19 ? 3.563   9.536   -8.840  1.00 16.13 ? 19 TYR A N   1 
ATOM   138 C CA  . TYR A 1 19 ? 3.951   9.732   -7.435  1.00 17.87 ? 19 TYR A CA  1 
ATOM   139 C C   . TYR A 1 19 ? 5.474   9.776   -7.226  1.00 17.27 ? 19 TYR A C   1 
ATOM   140 O O   . TYR A 1 19 ? 5.977   9.851   -6.103  1.00 18.56 ? 19 TYR A O   1 
ATOM   141 C CB  . TYR A 1 19 ? 3.311   8.684   -6.524  1.00 15.97 ? 19 TYR A CB  1 
ATOM   142 C CG  . TYR A 1 19 ? 1.806   8.769   -6.461  1.00 12.83 ? 19 TYR A CG  1 
ATOM   143 C CD1 . TYR A 1 19 ? 1.170   9.790   -5.776  1.00 14.70 ? 19 TYR A CD1 1 
ATOM   144 C CD2 . TYR A 1 19 ? 1.008   7.794   -7.069  1.00 20.50 ? 19 TYR A CD2 1 
ATOM   145 C CE1 . TYR A 1 19 ? -0.240  9.838   -5.693  1.00 14.46 ? 19 TYR A CE1 1 
ATOM   146 C CE2 . TYR A 1 19 ? -0.394  7.819   -6.993  1.00 15.56 ? 19 TYR A CE2 1 
ATOM   147 C CZ  . TYR A 1 19 ? -1.004  8.841   -6.301  1.00 17.44 ? 19 TYR A CZ  1 
ATOM   148 O OH  . TYR A 1 19 ? -2.375  8.830   -6.193  1.00 21.87 ? 19 TYR A OH  1 
ATOM   149 N N   . CYS A 1 20 ? 6.215   9.699   -8.317  1.00 22.22 ? 20 CYS A N   1 
ATOM   150 C CA  . CYS A 1 20 ? 7.672   9.772   -8.239  1.00 20.94 ? 20 CYS A CA  1 
ATOM   151 C C   . CYS A 1 20 ? 8.048   11.223  -8.116  1.00 22.47 ? 20 CYS A C   1 
ATOM   152 O O   . CYS A 1 20 ? 7.201   12.121  -8.239  1.00 22.79 ? 20 CYS A O   1 
ATOM   153 C CB  . CYS A 1 20 ? 8.354   9.171   -9.469  1.00 17.59 ? 20 CYS A CB  1 
ATOM   154 S SG  . CYS A 1 20 ? 7.940   7.427   -9.681  1.00 15.12 ? 20 CYS A SG  1 
ATOM   155 N N   . ASN A 1 21 ? 9.327   11.432  -7.850  1.00 26.24 ? 21 ASN A N   1 
ATOM   156 C CA  . ASN A 1 21 ? 9.892   12.748  -7.667  1.00 27.20 ? 21 ASN A CA  1 
ATOM   157 C C   . ASN A 1 21 ? 10.324  13.338  -9.020  1.00 28.90 ? 21 ASN A C   1 
ATOM   158 O O   . ASN A 1 21 ? 10.399  14.579  -9.125  1.00 33.66 ? 21 ASN A O   1 
ATOM   159 C CB  . ASN A 1 21 ? 11.064  12.618  -6.701  1.00 33.92 ? 21 ASN A CB  1 
ATOM   160 C CG  . ASN A 1 21 ? 11.286  13.851  -5.876  1.00 37.00 ? 21 ASN A CG  1 
ATOM   161 O OD1 . ASN A 1 21 ? 10.701  13.999  -4.807  1.00 41.03 ? 21 ASN A OD1 1 
ATOM   162 N ND2 . ASN A 1 21 ? 12.165  14.731  -6.346  1.00 39.84 ? 21 ASN A ND2 1 
ATOM   163 O OXT . ASN A 1 21 ? 10.551  12.565  -9.977  1.00 28.54 ? 21 ASN A OXT 1 
ATOM   164 N N   . PHE B 2 1  ? -9.004  -15.027 -6.542  1.00 19.03 ? 1  PHE B N   1 
ATOM   165 C CA  . PHE B 2 1  ? -8.180  -14.825 -7.766  1.00 19.70 ? 1  PHE B CA  1 
ATOM   166 C C   . PHE B 2 1  ? -6.887  -14.110 -7.389  1.00 20.83 ? 1  PHE B C   1 
ATOM   167 O O   . PHE B 2 1  ? -6.784  -13.583 -6.293  1.00 23.08 ? 1  PHE B O   1 
ATOM   168 C CB  . PHE B 2 1  ? -8.959  -13.994 -8.772  1.00 13.06 ? 1  PHE B CB  1 
ATOM   169 C CG  . PHE B 2 1  ? -8.960  -14.581 -10.149 1.00 22.15 ? 1  PHE B CG  1 
ATOM   170 C CD1 . PHE B 2 1  ? -9.240  -15.939 -10.336 1.00 20.29 ? 1  PHE B CD1 1 
ATOM   171 C CD2 . PHE B 2 1  ? -8.627  -13.805 -11.255 1.00 17.67 ? 1  PHE B CD2 1 
ATOM   172 C CE1 . PHE B 2 1  ? -9.184  -16.514 -11.593 1.00 16.67 ? 1  PHE B CE1 1 
ATOM   173 C CE2 . PHE B 2 1  ? -8.569  -14.375 -12.505 1.00 15.09 ? 1  PHE B CE2 1 
ATOM   174 C CZ  . PHE B 2 1  ? -8.849  -15.741 -12.674 1.00 19.08 ? 1  PHE B CZ  1 
ATOM   175 N N   . VAL B 2 2  ? -5.898  -14.112 -8.276  1.00 23.23 ? 2  VAL B N   1 
ATOM   176 C CA  . VAL B 2 2  ? -4.629  -13.432 -8.002  1.00 18.33 ? 2  VAL B CA  1 
ATOM   177 C C   . VAL B 2 2  ? -4.959  -11.999 -7.593  1.00 21.54 ? 2  VAL B C   1 
ATOM   178 O O   . VAL B 2 2  ? -6.053  -11.483 -7.900  1.00 21.03 ? 2  VAL B O   1 
ATOM   179 C CB  . VAL B 2 2  ? -3.665  -13.472 -9.261  1.00 19.35 ? 2  VAL B CB  1 
ATOM   180 C CG1 . VAL B 2 2  ? -4.364  -13.013 -10.528 1.00 4.30  ? 2  VAL B CG1 1 
ATOM   181 C CG2 . VAL B 2 2  ? -2.413  -12.640 -9.023  1.00 20.31 ? 2  VAL B CG2 1 
ATOM   182 N N   . ASN B 2 3  ? -4.053  -11.369 -6.864  1.00 26.77 ? 3  ASN B N   1 
ATOM   183 C CA  . ASN B 2 3  ? -4.309  -10.013 -6.433  1.00 31.41 ? 3  ASN B CA  1 
ATOM   184 C C   . ASN B 2 3  ? -3.542  -8.945  -7.204  1.00 31.79 ? 3  ASN B C   1 
ATOM   185 O O   . ASN B 2 3  ? -2.307  -9.038  -7.366  1.00 27.12 ? 3  ASN B O   1 
ATOM   186 C CB  . ASN B 2 3  ? -4.025  -9.894  -4.948  1.00 36.33 ? 3  ASN B CB  1 
ATOM   187 C CG  . ASN B 2 3  ? -4.383  -8.533  -4.396  1.00 36.22 ? 3  ASN B CG  1 
ATOM   188 O OD1 . ASN B 2 3  ? -5.501  -8.064  -4.545  1.00 39.19 ? 3  ASN B OD1 1 
ATOM   189 N ND2 . ASN B 2 3  ? -3.418  -7.878  -3.782  1.00 44.21 ? 3  ASN B ND2 1 
ATOM   190 N N   . GLN B 2 4  ? -4.285  -7.934  -7.665  1.00 30.35 ? 4  GLN B N   1 
ATOM   191 C CA  . GLN B 2 4  ? -3.713  -6.818  -8.421  1.00 30.46 ? 4  GLN B CA  1 
ATOM   192 C C   . GLN B 2 4  ? -3.509  -5.551  -7.596  1.00 26.51 ? 4  GLN B C   1 
ATOM   193 O O   . GLN B 2 4  ? -3.098  -4.543  -8.133  1.00 30.82 ? 4  GLN B O   1 
ATOM   194 C CB  . GLN B 2 4  ? -4.587  -6.468  -9.635  1.00 31.34 ? 4  GLN B CB  1 
ATOM   195 C CG  . GLN B 2 4  ? -5.107  -7.645  -10.440 1.00 30.65 ? 4  GLN B CG  1 
ATOM   196 C CD  . GLN B 2 4  ? -4.102  -8.240  -11.390 1.00 33.29 ? 4  GLN B CD  1 
ATOM   197 O OE1 . GLN B 2 4  ? -4.597  -9.045  -12.318 1.00 40.52 ? 4  GLN B OE1 1 
ATOM   198 N NE2 . GLN B 2 4  ? -2.905  -7.971  -11.317 1.00 32.23 ? 4  GLN B NE2 1 
ATOM   199 N N   . HIS B 2 5  ? -3.788  -5.594  -6.301  1.00 26.61 ? 5  HIS B N   1 
ATOM   200 C CA  . HIS B 2 5  ? -3.632  -4.416  -5.438  1.00 21.70 ? 5  HIS B CA  1 
ATOM   201 C C   . HIS B 2 5  ? -2.221  -4.340  -4.864  1.00 20.87 ? 5  HIS B C   1 
ATOM   202 O O   . HIS B 2 5  ? -1.625  -5.376  -4.535  1.00 26.55 ? 5  HIS B O   1 
ATOM   203 C CB  . HIS B 2 5  ? -4.629  -4.446  -4.277  1.00 19.88 ? 5  HIS B CB  1 
ATOM   204 C CG  . HIS B 2 5  ? -6.059  -4.484  -4.702  1.00 20.47 ? 5  HIS B CG  1 
ATOM   205 N ND1 . HIS B 2 5  ? -6.747  -3.357  -5.089  1.00 27.37 ? 5  HIS B ND1 1 
ATOM   206 C CD2 . HIS B 2 5  ? -6.929  -5.518  -4.829  1.00 23.42 ? 5  HIS B CD2 1 
ATOM   207 C CE1 . HIS B 2 5  ? -7.975  -3.693  -5.446  1.00 29.45 ? 5  HIS B CE1 1 
ATOM   208 N NE2 . HIS B 2 5  ? -8.111  -5.001  -5.299  1.00 26.29 ? 5  HIS B NE2 1 
ATOM   209 N N   . LEU B 2 6  ? -1.706  -3.115  -4.736  1.00 18.41 ? 6  LEU B N   1 
ATOM   210 C CA  . LEU B 2 6  ? -0.368  -2.812  -4.189  1.00 15.22 ? 6  LEU B CA  1 
ATOM   211 C C   . LEU B 2 6  ? -0.583  -2.096  -2.872  1.00 14.63 ? 6  LEU B C   1 
ATOM   212 O O   . LEU B 2 6  ? -0.977  -0.932  -2.852  1.00 15.78 ? 6  LEU B O   1 
ATOM   213 C CB  . LEU B 2 6  ? 0.350   -1.853  -5.104  1.00 14.05 ? 6  LEU B CB  1 
ATOM   214 C CG  . LEU B 2 6  ? 1.224   -2.270  -6.271  1.00 13.16 ? 6  LEU B CG  1 
ATOM   215 C CD1 . LEU B 2 6  ? 1.037   -3.721  -6.642  1.00 10.36 ? 6  LEU B CD1 1 
ATOM   216 C CD2 . LEU B 2 6  ? 0.940   -1.306  -7.426  1.00 7.54  ? 6  LEU B CD2 1 
ATOM   217 N N   . CYS B 2 7  ? -0.282  -2.783  -1.780  1.00 16.67 ? 7  CYS B N   1 
ATOM   218 C CA  . CYS B 2 7  ? -0.501  -2.260  -0.432  1.00 16.08 ? 7  CYS B CA  1 
ATOM   219 C C   . CYS B 2 7  ? 0.736   -2.406  0.457   1.00 16.34 ? 7  CYS B C   1 
ATOM   220 O O   . CYS B 2 7  ? 1.595   -3.261  0.218   1.00 18.03 ? 7  CYS B O   1 
ATOM   221 C CB  . CYS B 2 7  ? -1.634  -3.039  0.241   1.00 12.89 ? 7  CYS B CB  1 
ATOM   222 S SG  . CYS B 2 7  ? -3.224  -3.017  -0.600  1.00 16.53 ? 7  CYS B SG  1 
ATOM   223 N N   . GLY B 2 8  ? 0.785   -1.592  1.505   1.00 14.99 ? 8  GLY B N   1 
ATOM   224 C CA  . GLY B 2 8  ? 1.889   -1.616  2.430   1.00 15.24 ? 8  GLY B CA  1 
ATOM   225 C C   . GLY B 2 8  ? 3.267   -1.676  1.810   1.00 16.96 ? 8  GLY B C   1 
ATOM   226 O O   . GLY B 2 8  ? 3.623   -0.857  0.962   1.00 22.35 ? 8  GLY B O   1 
ATOM   227 N N   . GLU B 2 9  ? 4.034   -2.672  2.224   1.00 21.38 ? 9  GLU B N   1 
ATOM   228 C CA  . GLU B 2 9  ? 5.404   -2.881  1.758   1.00 26.85 ? 9  GLU B CA  1 
ATOM   229 C C   . GLU B 2 9  ? 5.518   -3.035  0.248   1.00 23.96 ? 9  GLU B C   1 
ATOM   230 O O   . GLU B 2 9  ? 6.472   -2.591  -0.369  1.00 23.04 ? 9  GLU B O   1 
ATOM   231 C CB  . GLU B 2 9  ? 5.995   -4.112  2.450   1.00 31.97 ? 9  GLU B CB  1 
ATOM   232 C CG  . GLU B 2 9  ? 7.145   -3.802  3.390   1.00 39.98 ? 9  GLU B CG  1 
ATOM   233 C CD  . GLU B 2 9  ? 8.448   -4.443  2.949   1.00 44.36 ? 9  GLU B CD  1 
ATOM   234 O OE1 . GLU B 2 9  ? 8.775   -4.360  1.743   1.00 43.50 ? 9  GLU B OE1 1 
ATOM   235 O OE2 . GLU B 2 9  ? 9.143   -5.041  3.808   1.00 48.27 ? 9  GLU B OE2 1 
ATOM   236 N N   . HIS B 2 10 ? 4.522   -3.665  -0.340  1.00 24.79 ? 10 HIS B N   1 
ATOM   237 C CA  . HIS B 2 10 ? 4.511   -3.879  -1.771  1.00 23.54 ? 10 HIS B CA  1 
ATOM   238 C C   . HIS B 2 10 ? 4.355   -2.603  -2.564  1.00 16.51 ? 10 HIS B C   1 
ATOM   239 O O   . HIS B 2 10 ? 4.855   -2.506  -3.673  1.00 16.28 ? 10 HIS B O   1 
ATOM   240 C CB  . HIS B 2 10 ? 3.413   -4.864  -2.115  1.00 27.40 ? 10 HIS B CB  1 
ATOM   241 C CG  . HIS B 2 10 ? 3.708   -6.249  -1.648  1.00 33.10 ? 10 HIS B CG  1 
ATOM   242 N ND1 . HIS B 2 10 ? 4.942   -6.836  -1.822  1.00 36.60 ? 10 HIS B ND1 1 
ATOM   243 C CD2 . HIS B 2 10 ? 2.938   -7.163  -1.015  1.00 33.46 ? 10 HIS B CD2 1 
ATOM   244 C CE1 . HIS B 2 10 ? 4.920   -8.057  -1.321  1.00 37.61 ? 10 HIS B CE1 1 
ATOM   245 N NE2 . HIS B 2 10 ? 3.715   -8.280  -0.827  1.00 38.92 ? 10 HIS B NE2 1 
ATOM   246 N N   . LEU B 2 11 ? 3.658   -1.628  -1.997  1.00 15.16 ? 11 LEU B N   1 
ATOM   247 C CA  . LEU B 2 11 ? 3.464   -0.342  -2.661  1.00 17.09 ? 11 LEU B CA  1 
ATOM   248 C C   . LEU B 2 11 ? 4.817   0.413   -2.735  1.00 18.47 ? 11 LEU B C   1 
ATOM   249 O O   . LEU B 2 11 ? 5.178   1.004   -3.753  1.00 19.80 ? 11 LEU B O   1 
ATOM   250 C CB  . LEU B 2 11 ? 2.422   0.474   -1.889  1.00 15.62 ? 11 LEU B CB  1 
ATOM   251 C CG  . LEU B 2 11 ? 1.834   1.701   -2.599  1.00 23.24 ? 11 LEU B CG  1 
ATOM   252 C CD1 . LEU B 2 11 ? 1.295   1.323   -4.004  1.00 14.40 ? 11 LEU B CD1 1 
ATOM   253 C CD2 . LEU B 2 11 ? 0.732   2.276   -1.742  1.00 18.67 ? 11 LEU B CD2 1 
ATOM   254 N N   . VAL B 2 12 ? 5.589   0.315   -1.659  1.00 21.13 ? 12 VAL B N   1 
ATOM   255 C CA  . VAL B 2 12 ? 6.893   0.941   -1.553  1.00 19.61 ? 12 VAL B CA  1 
ATOM   256 C C   . VAL B 2 12 ? 7.926   0.274   -2.499  1.00 21.26 ? 12 VAL B C   1 
ATOM   257 O O   . VAL B 2 12 ? 8.809   0.948   -3.049  1.00 19.35 ? 12 VAL B O   1 
ATOM   258 C CB  . VAL B 2 12 ? 7.347   0.925   -0.069  1.00 18.13 ? 12 VAL B CB  1 
ATOM   259 C CG1 . VAL B 2 12 ? 8.637   1.664   0.118   1.00 10.90 ? 12 VAL B CG1 1 
ATOM   260 C CG2 . VAL B 2 12 ? 6.253   1.533   0.791   1.00 12.14 ? 12 VAL B CG2 1 
ATOM   261 N N   . GLU B 2 13 ? 7.812   -1.036  -2.711  1.00 23.19 ? 13 GLU B N   1 
ATOM   262 C CA  . GLU B 2 13 ? 8.733   -1.749  -3.617  1.00 20.54 ? 13 GLU B CA  1 
ATOM   263 C C   . GLU B 2 13 ? 8.421   -1.345  -5.030  1.00 18.19 ? 13 GLU B C   1 
ATOM   264 O O   . GLU B 2 13 ? 9.334   -1.149  -5.819  1.00 21.51 ? 13 GLU B O   1 
ATOM   265 C CB  . GLU B 2 13 ? 8.604   -3.265  -3.472  1.00 23.72 ? 13 GLU B CB  1 
ATOM   266 C CG  . GLU B 2 13 ? 9.331   -3.814  -2.249  1.00 30.25 ? 13 GLU B CG  1 
ATOM   267 C CD  . GLU B 2 13 ? 8.777   -5.143  -1.765  1.00 40.18 ? 13 GLU B CD  1 
ATOM   268 O OE1 . GLU B 2 13 ? 7.749   -5.608  -2.327  1.00 47.98 ? 13 GLU B OE1 1 
ATOM   269 O OE2 . GLU B 2 13 ? 9.346   -5.706  -0.795  1.00 41.03 ? 13 GLU B OE2 1 
ATOM   270 N N   . ALA B 2 14 ? 7.128   -1.177  -5.321  1.00 15.93 ? 14 ALA B N   1 
ATOM   271 C CA  . ALA B 2 14 ? 6.643   -0.753  -6.633  1.00 12.92 ? 14 ALA B CA  1 
ATOM   272 C C   . ALA B 2 14 ? 7.139   0.639   -6.949  1.00 11.26 ? 14 ALA B C   1 
ATOM   273 O O   . ALA B 2 14 ? 7.525   0.937   -8.076  1.00 11.85 ? 14 ALA B O   1 
ATOM   274 C CB  . ALA B 2 14 ? 5.126   -0.775  -6.672  1.00 11.71 ? 14 ALA B CB  1 
ATOM   275 N N   . LEU B 2 15 ? 7.095   1.514   -5.963  1.00 13.50 ? 15 LEU B N   1 
ATOM   276 C CA  . LEU B 2 15 ? 7.574   2.884   -6.163  1.00 13.17 ? 15 LEU B CA  1 
ATOM   277 C C   . LEU B 2 15 ? 9.081   2.885   -6.385  1.00 13.82 ? 15 LEU B C   1 
ATOM   278 O O   . LEU B 2 15 ? 9.595   3.651   -7.195  1.00 17.31 ? 15 LEU B O   1 
ATOM   279 C CB  . LEU B 2 15 ? 7.219   3.749   -4.955  1.00 15.10 ? 15 LEU B CB  1 
ATOM   280 C CG  . LEU B 2 15 ? 5.830   4.352   -5.000  1.00 14.66 ? 15 LEU B CG  1 
ATOM   281 C CD1 . LEU B 2 15 ? 5.548   5.071   -3.700  1.00 16.86 ? 15 LEU B CD1 1 
ATOM   282 C CD2 . LEU B 2 15 ? 5.769   5.314   -6.190  1.00 15.28 ? 15 LEU B CD2 1 
ATOM   283 N N   . TYR B 2 16 ? 9.789   2.033   -5.656  1.00 11.97 ? 16 TYR B N   1 
ATOM   284 C CA  . TYR B 2 16 ? 11.216  1.924   -5.803  1.00 10.87 ? 16 TYR B CA  1 
ATOM   285 C C   . TYR B 2 16 ? 11.539  1.530   -7.248  1.00 13.99 ? 16 TYR B C   1 
ATOM   286 O O   . TYR B 2 16 ? 12.313  2.221   -7.932  1.00 17.89 ? 16 TYR B O   1 
ATOM   287 C CB  . TYR B 2 16 ? 11.743  0.877   -4.827  1.00 11.95 ? 16 TYR B CB  1 
ATOM   288 C CG  . TYR B 2 16 ? 13.211  0.536   -5.013  1.00 16.80 ? 16 TYR B CG  1 
ATOM   289 C CD1 . TYR B 2 16 ? 14.196  1.431   -4.653  1.00 17.54 ? 16 TYR B CD1 1 
ATOM   290 C CD2 . TYR B 2 16 ? 13.611  -0.706  -5.530  1.00 17.72 ? 16 TYR B CD2 1 
ATOM   291 C CE1 . TYR B 2 16 ? 15.527  1.112   -4.789  1.00 17.45 ? 16 TYR B CE1 1 
ATOM   292 C CE2 . TYR B 2 16 ? 14.951  -1.025  -5.673  1.00 13.61 ? 16 TYR B CE2 1 
ATOM   293 C CZ  . TYR B 2 16 ? 15.894  -0.109  -5.298  1.00 15.68 ? 16 TYR B CZ  1 
ATOM   294 O OH  . TYR B 2 16 ? 17.220  -0.397  -5.420  1.00 19.26 ? 16 TYR B OH  1 
ATOM   295 N N   . LEU B 2 17 ? 10.933  0.432   -7.702  1.00 13.11 ? 17 LEU B N   1 
ATOM   296 C CA  . LEU B 2 17 ? 11.119  -0.127  -9.052  1.00 12.22 ? 17 LEU B CA  1 
ATOM   297 C C   . LEU B 2 17 ? 10.812  0.842   -10.184 1.00 17.53 ? 17 LEU B C   1 
ATOM   298 O O   . LEU B 2 17 ? 11.614  1.074   -11.094 1.00 19.18 ? 17 LEU B O   1 
ATOM   299 C CB  . LEU B 2 17 ? 10.208  -1.338  -9.218  1.00 8.53  ? 17 LEU B CB  1 
ATOM   300 C CG  . LEU B 2 17 ? 10.104  -1.930  -10.608 1.00 12.88 ? 17 LEU B CG  1 
ATOM   301 C CD1 . LEU B 2 17 ? 11.491  -2.239  -11.123 1.00 14.88 ? 17 LEU B CD1 1 
ATOM   302 C CD2 . LEU B 2 17 ? 9.281   -3.197  -10.579 1.00 10.69 ? 17 LEU B CD2 1 
ATOM   303 N N   . VAL B 2 18 ? 9.616   1.390   -10.118 1.00 19.90 ? 18 VAL B N   1 
ATOM   304 C CA  . VAL B 2 18 ? 9.117   2.330   -11.100 1.00 20.21 ? 18 VAL B CA  1 
ATOM   305 C C   . VAL B 2 18 ? 9.798   3.711   -11.077 1.00 20.53 ? 18 VAL B C   1 
ATOM   306 O O   . VAL B 2 18 ? 10.121  4.254   -12.129 1.00 23.13 ? 18 VAL B O   1 
ATOM   307 C CB  . VAL B 2 18 ? 7.574   2.416   -10.954 1.00 19.82 ? 18 VAL B CB  1 
ATOM   308 C CG1 . VAL B 2 18 ? 7.049   3.765   -11.316 1.00 18.21 ? 18 VAL B CG1 1 
ATOM   309 C CG2 . VAL B 2 18 ? 6.924   1.332   -11.795 1.00 17.78 ? 18 VAL B CG2 1 
ATOM   310 N N   . CYS B 2 19 ? 10.021  4.285   -9.898  1.00 19.06 ? 19 CYS B N   1 
ATOM   311 C CA  . CYS B 2 19 ? 10.650  5.610   -9.810  1.00 18.63 ? 19 CYS B CA  1 
ATOM   312 C C   . CYS B 2 19 ? 12.128  5.647   -10.135 1.00 22.55 ? 19 CYS B C   1 
ATOM   313 O O   . CYS B 2 19 ? 12.660  6.696   -10.537 1.00 20.25 ? 19 CYS B O   1 
ATOM   314 C CB  . CYS B 2 19 ? 10.451  6.222   -8.439  1.00 12.79 ? 19 CYS B CB  1 
ATOM   315 S SG  . CYS B 2 19 ? 8.716   6.539   -8.049  1.00 14.92 ? 19 CYS B SG  1 
ATOM   316 N N   . GLY B 2 20 ? 12.807  4.531   -9.890  1.00 26.12 ? 20 GLY B N   1 
ATOM   317 C CA  . GLY B 2 20 ? 14.223  4.462   -10.177 1.00 29.87 ? 20 GLY B CA  1 
ATOM   318 C C   . GLY B 2 20 ? 15.025  5.585   -9.538  1.00 34.52 ? 20 GLY B C   1 
ATOM   319 O O   . GLY B 2 20 ? 14.851  5.886   -8.346  1.00 37.42 ? 20 GLY B O   1 
ATOM   320 N N   . GLU B 2 21 ? 15.870  6.226   -10.349 1.00 34.87 ? 21 GLU B N   1 
ATOM   321 C CA  . GLU B 2 21 ? 16.728  7.316   -9.909  1.00 32.10 ? 21 GLU B CA  1 
ATOM   322 C C   . GLU B 2 21 ? 15.981  8.595   -9.505  1.00 29.92 ? 21 GLU B C   1 
ATOM   323 O O   . GLU B 2 21 ? 16.547  9.472   -8.861  1.00 28.94 ? 21 GLU B O   1 
ATOM   324 C CB  . GLU B 2 21 ? 17.768  7.607   -10.994 1.00 35.72 ? 21 GLU B CB  1 
ATOM   325 C CG  . GLU B 2 21 ? 17.181  7.768   -12.399 1.00 43.15 ? 21 GLU B CG  1 
ATOM   326 C CD  . GLU B 2 21 ? 17.492  9.119   -13.034 1.00 46.40 ? 21 GLU B CD  1 
ATOM   327 O OE1 . GLU B 2 21 ? 18.503  9.750   -12.644 1.00 47.15 ? 21 GLU B OE1 1 
ATOM   328 O OE2 . GLU B 2 21 ? 16.715  9.546   -13.925 1.00 44.09 ? 21 GLU B OE2 1 
ATOM   329 N N   . ARG B 2 22 ? 14.714  8.705   -9.893  1.00 28.54 ? 22 ARG B N   1 
ATOM   330 C CA  . ARG B 2 22 ? 13.919  9.880   -9.563  1.00 24.37 ? 22 ARG B CA  1 
ATOM   331 C C   . ARG B 2 22 ? 13.662  9.932   -8.072  1.00 25.08 ? 22 ARG B C   1 
ATOM   332 O O   . ARG B 2 22 ? 13.633  11.000  -7.456  1.00 26.73 ? 22 ARG B O   1 
ATOM   333 C CB  . ARG B 2 22 ? 12.582  9.838   -10.276 1.00 21.78 ? 22 ARG B CB  1 
ATOM   334 C CG  . ARG B 2 22 ? 12.705  9.988   -11.753 1.00 30.11 ? 22 ARG B CG  1 
ATOM   335 C CD  . ARG B 2 22 ? 11.345  10.142  -12.357 1.00 33.91 ? 22 ARG B CD  1 
ATOM   336 N NE  . ARG B 2 22 ? 11.383  11.000  -13.539 1.00 34.74 ? 22 ARG B NE  1 
ATOM   337 C CZ  . ARG B 2 22 ? 11.799  10.624  -14.745 1.00 33.34 ? 22 ARG B CZ  1 
ATOM   338 N NH1 . ARG B 2 22 ? 12.228  9.387   -14.955 1.00 27.94 ? 22 ARG B NH1 1 
ATOM   339 N NH2 . ARG B 2 22 ? 11.786  11.497  -15.749 1.00 36.26 ? 22 ARG B NH2 1 
ATOM   340 N N   . GLY B 2 23 ? 13.501  8.768   -7.477  1.00 18.25 ? 23 GLY B N   1 
ATOM   341 C CA  . GLY B 2 23 ? 13.209  8.758   -6.070  1.00 19.58 ? 23 GLY B CA  1 
ATOM   342 C C   . GLY B 2 23 ? 11.739  9.078   -5.844  1.00 18.99 ? 23 GLY B C   1 
ATOM   343 O O   . GLY B 2 23 ? 10.991  9.279   -6.785  1.00 20.82 ? 23 GLY B O   1 
ATOM   344 N N   . PHE B 2 24 ? 11.314  9.154   -4.594  1.00 19.48 ? 24 PHE B N   1 
ATOM   345 C CA  . PHE B 2 24 ? 9.921   9.418   -4.290  1.00 18.88 ? 24 PHE B CA  1 
ATOM   346 C C   . PHE B 2 24 ? 9.798   9.665   -2.810  1.00 18.53 ? 24 PHE B C   1 
ATOM   347 O O   . PHE B 2 24 ? 10.717  9.394   -2.064  1.00 19.59 ? 24 PHE B O   1 
ATOM   348 C CB  . PHE B 2 24 ? 9.128   8.164   -4.589  1.00 11.11 ? 24 PHE B CB  1 
ATOM   349 C CG  . PHE B 2 24 ? 9.605   6.959   -3.811  1.00 18.03 ? 24 PHE B CG  1 
ATOM   350 C CD1 . PHE B 2 24 ? 10.737  6.248   -4.219  1.00 18.71 ? 24 PHE B CD1 1 
ATOM   351 C CD2 . PHE B 2 24 ? 8.906   6.507   -2.694  1.00 17.03 ? 24 PHE B CD2 1 
ATOM   352 C CE1 . PHE B 2 24 ? 11.146  5.109   -3.536  1.00 17.15 ? 24 PHE B CE1 1 
ATOM   353 C CE2 . PHE B 2 24 ? 9.314   5.368   -2.009  1.00 12.63 ? 24 PHE B CE2 1 
ATOM   354 C CZ  . PHE B 2 24 ? 10.430  4.668   -2.435  1.00 12.98 ? 24 PHE B CZ  1 
ATOM   355 N N   . PHE B 2 25 ? 8.636   10.124  -2.379  1.00 21.07 ? 25 PHE B N   1 
ATOM   356 C CA  . PHE B 2 25 ? 8.365   10.341  -0.963  1.00 19.03 ? 25 PHE B CA  1 
ATOM   357 C C   . PHE B 2 25 ? 7.228   9.369   -0.666  1.00 19.32 ? 25 PHE B C   1 
ATOM   358 O O   . PHE B 2 25 ? 6.426   9.050   -1.534  1.00 23.13 ? 25 PHE B O   1 
ATOM   359 C CB  . PHE B 2 25 ? 7.981   11.798  -0.710  1.00 20.32 ? 25 PHE B CB  1 
ATOM   360 C CG  . PHE B 2 25 ? 7.263   12.044  0.586   1.00 23.63 ? 25 PHE B CG  1 
ATOM   361 C CD1 . PHE B 2 25 ? 5.938   11.622  0.767   1.00 24.10 ? 25 PHE B CD1 1 
ATOM   362 C CD2 . PHE B 2 25 ? 7.878   12.774  1.602   1.00 29.12 ? 25 PHE B CD2 1 
ATOM   363 C CE1 . PHE B 2 25 ? 5.237   11.922  1.923   1.00 22.87 ? 25 PHE B CE1 1 
ATOM   364 C CE2 . PHE B 2 25 ? 7.181   13.087  2.780   1.00 30.73 ? 25 PHE B CE2 1 
ATOM   365 C CZ  . PHE B 2 25 ? 5.856   12.660  2.937   1.00 26.60 ? 25 PHE B CZ  1 
ATOM   366 N N   . TYR B 2 26 ? 7.193   8.855   0.544   1.00 18.44 ? 26 TYR B N   1 
ATOM   367 C CA  . TYR B 2 26 ? 6.170   7.910   0.940   1.00 19.54 ? 26 TYR B CA  1 
ATOM   368 C C   . TYR B 2 26 ? 5.802   8.134   2.407   1.00 20.28 ? 26 TYR B C   1 
ATOM   369 O O   . TYR B 2 26 ? 6.663   8.333   3.224   1.00 17.55 ? 26 TYR B O   1 
ATOM   370 C CB  . TYR B 2 26 ? 6.694   6.467   0.808   1.00 21.76 ? 26 TYR B CB  1 
ATOM   371 C CG  . TYR B 2 26 ? 5.640   5.438   1.200   1.00 23.81 ? 26 TYR B CG  1 
ATOM   372 C CD1 . TYR B 2 26 ? 4.592   5.127   0.323   1.00 25.25 ? 26 TYR B CD1 1 
ATOM   373 C CD2 . TYR B 2 26 ? 5.623   4.863   2.470   1.00 21.80 ? 26 TYR B CD2 1 
ATOM   374 C CE1 . TYR B 2 26 ? 3.552   4.289   0.703   1.00 24.69 ? 26 TYR B CE1 1 
ATOM   375 C CE2 . TYR B 2 26 ? 4.587   4.018   2.854   1.00 26.21 ? 26 TYR B CE2 1 
ATOM   376 C CZ  . TYR B 2 26 ? 3.554   3.744   1.965   1.00 25.90 ? 26 TYR B CZ  1 
ATOM   377 O OH  . TYR B 2 26 ? 2.489   2.962   2.342   1.00 32.26 ? 26 TYR B OH  1 
ATOM   378 N N   . THR B 2 27 ? 4.540   8.017   2.772   1.00 20.51 ? 27 THR B N   1 
ATOM   379 C CA  . THR B 2 27 ? 4.134   8.158   4.158   1.00 21.97 ? 27 THR B CA  1 
ATOM   380 C C   . THR B 2 27 ? 3.021   7.158   4.389   1.00 21.74 ? 27 THR B C   1 
ATOM   381 O O   . THR B 2 27 ? 1.971   7.248   3.772   1.00 20.25 ? 27 THR B O   1 
ATOM   382 C CB  . THR B 2 27 ? 3.645   9.576   4.480   1.00 26.42 ? 27 THR B CB  1 
ATOM   383 O OG1 . THR B 2 27 ? 4.752   10.475  4.364   1.00 39.13 ? 27 THR B OG1 1 
ATOM   384 C CG2 . THR B 2 27 ? 3.139   9.663   5.914   1.00 28.82 ? 27 THR B CG2 1 
ATOM   385 N N   . PRO B 2 28 ? 3.273   6.143   5.223   1.00 25.27 ? 28 PRO B N   1 
ATOM   386 C CA  . PRO B 2 28 ? 2.285   5.118   5.524   1.00 34.24 ? 28 PRO B CA  1 
ATOM   387 C C   . PRO B 2 28 ? 1.239   5.816   6.334   1.00 43.18 ? 28 PRO B C   1 
ATOM   388 O O   . PRO B 2 28 ? 1.403   5.990   7.559   1.00 49.54 ? 28 PRO B O   1 
ATOM   389 C CB  . PRO B 2 28 ? 3.042   4.134   6.433   1.00 32.32 ? 28 PRO B CB  1 
ATOM   390 C CG  . PRO B 2 28 ? 4.488   4.509   6.285   1.00 33.05 ? 28 PRO B CG  1 
ATOM   391 C CD  . PRO B 2 28 ? 4.441   5.991   6.101   1.00 33.56 ? 28 PRO B CD  1 
ATOM   392 N N   . LYS B 2 29 ? 0.232   6.339   5.662   1.00 46.77 ? 29 LYS B N   1 
ATOM   393 C CA  . LYS B 2 29 ? -0.812  6.981   6.411   1.00 50.42 ? 29 LYS B CA  1 
ATOM   394 C C   . LYS B 2 29 ? -2.127  6.455   5.892   1.00 52.62 ? 29 LYS B C   1 
ATOM   395 O O   . LYS B 2 29 ? -2.546  6.775   4.776   1.00 48.76 ? 29 LYS B O   1 
ATOM   396 C CB  . LYS B 2 29 ? -0.695  8.511   6.401   1.00 45.96 ? 29 LYS B CB  1 
ATOM   397 C CG  . LYS B 2 29 ? -1.625  9.161   7.411   1.00 46.14 ? 29 LYS B CG  1 
ATOM   398 C CD  . LYS B 2 29 ? -1.966  8.199   8.571   1.00 49.51 ? 29 LYS B CD  1 
ATOM   399 C CE  . LYS B 2 29 ? -2.260  8.909   9.892   1.00 49.71 ? 29 LYS B CE  1 
ATOM   400 N NZ  . LYS B 2 29 ? -1.019  9.120   10.685  1.00 39.68 ? 29 LYS B NZ  1 
ATOM   401 N N   . THR B 2 30 ? -2.672  5.543   6.702   1.00 57.02 ? 30 THR B N   1 
ATOM   402 C CA  . THR B 2 30 ? -3.936  4.828   6.478   1.00 60.66 ? 30 THR B CA  1 
ATOM   403 C C   . THR B 2 30 ? -3.999  4.145   5.103   1.00 59.76 ? 30 THR B C   1 
ATOM   404 O O   . THR B 2 30 ? -5.112  3.865   4.592   1.00 54.12 ? 30 THR B O   1 
ATOM   405 C CB  . THR B 2 30 ? -5.176  5.732   6.749   1.00 63.70 ? 30 THR B CB  1 
ATOM   406 O OG1 . THR B 2 30 ? -4.796  6.838   7.588   1.00 66.43 ? 30 THR B OG1 1 
ATOM   407 C CG2 . THR B 2 30 ? -6.264  4.927   7.475   1.00 62.74 ? 30 THR B CG2 1 
ATOM   408 O OXT . THR B 2 30 ? -2.892  3.853   4.582   1.00 61.35 ? 30 THR B OXT 1 
ATOM   409 N N   . GLY C 1 1  ? 25.262  10.896  0.927   1.00 23.38 ? 1  GLY C N   1 
ATOM   410 C CA  . GLY C 1 1  ? 23.853  10.368  0.887   1.00 20.78 ? 1  GLY C CA  1 
ATOM   411 C C   . GLY C 1 1  ? 23.638  9.021   1.580   1.00 20.43 ? 1  GLY C C   1 
ATOM   412 O O   . GLY C 1 1  ? 24.596  8.399   2.111   1.00 21.78 ? 1  GLY C O   1 
ATOM   413 N N   . ILE C 1 2  ? 22.389  8.549   1.549   1.00 14.42 ? 2  ILE C N   1 
ATOM   414 C CA  . ILE C 1 2  ? 22.038  7.273   2.167   1.00 14.58 ? 2  ILE C CA  1 
ATOM   415 C C   . ILE C 1 2  ? 22.709  6.048   1.539   1.00 17.55 ? 2  ILE C C   1 
ATOM   416 O O   . ILE C 1 2  ? 23.130  5.135   2.242   1.00 17.17 ? 2  ILE C O   1 
ATOM   417 C CB  . ILE C 1 2  ? 20.524  7.060   2.204   1.00 12.86 ? 2  ILE C CB  1 
ATOM   418 C CG1 . ILE C 1 2  ? 20.194  5.805   3.024   1.00 13.18 ? 2  ILE C CG1 1 
ATOM   419 C CG2 . ILE C 1 2  ? 19.990  6.944   0.828   1.00 9.65  ? 2  ILE C CG2 1 
ATOM   420 C CD1 . ILE C 1 2  ? 18.835  5.823   3.594   1.00 11.61 ? 2  ILE C CD1 1 
ATOM   421 N N   . VAL C 1 3  ? 22.812  6.037   0.213   1.00 21.30 ? 3  VAL C N   1 
ATOM   422 C CA  . VAL C 1 3  ? 23.461  4.943   -0.513  1.00 19.61 ? 3  VAL C CA  1 
ATOM   423 C C   . VAL C 1 3  ? 24.916  4.817   -0.078  1.00 17.71 ? 3  VAL C C   1 
ATOM   424 O O   . VAL C 1 3  ? 25.344  3.737   0.301   1.00 21.07 ? 3  VAL C O   1 
ATOM   425 C CB  . VAL C 1 3  ? 23.416  5.150   -2.055  1.00 19.80 ? 3  VAL C CB  1 
ATOM   426 C CG1 . VAL C 1 3  ? 23.778  3.879   -2.757  1.00 11.79 ? 3  VAL C CG1 1 
ATOM   427 C CG2 . VAL C 1 3  ? 22.038  5.630   -2.498  1.00 18.69 ? 3  VAL C CG2 1 
ATOM   428 N N   . GLU C 1 4  ? 25.666  5.912   -0.074  1.00 15.12 ? 4  GLU C N   1 
ATOM   429 C CA  . GLU C 1 4  ? 27.047  5.812   0.349   1.00 18.05 ? 4  GLU C CA  1 
ATOM   430 C C   . GLU C 1 4  ? 27.198  5.546   1.853   1.00 19.67 ? 4  GLU C C   1 
ATOM   431 O O   . GLU C 1 4  ? 28.038  4.760   2.243   1.00 21.16 ? 4  GLU C O   1 
ATOM   432 C CB  . GLU C 1 4  ? 27.893  6.989   -0.157  1.00 16.80 ? 4  GLU C CB  1 
ATOM   433 C CG  . GLU C 1 4  ? 27.853  8.247   0.657   1.00 24.21 ? 4  GLU C CG  1 
ATOM   434 C CD  . GLU C 1 4  ? 28.840  8.212   1.787   1.00 32.37 ? 4  GLU C CD  1 
ATOM   435 O OE1 . GLU C 1 4  ? 29.887  7.526   1.605   1.00 32.14 ? 4  GLU C OE1 1 
ATOM   436 O OE2 . GLU C 1 4  ? 28.563  8.857   2.845   1.00 34.49 ? 4  GLU C OE2 1 
ATOM   437 N N   . GLN C 1 5  ? 26.344  6.119   2.694   1.00 18.33 ? 5  GLN C N   1 
ATOM   438 C CA  . GLN C 1 5  ? 26.465  5.884   4.123   1.00 18.77 ? 5  GLN C CA  1 
ATOM   439 C C   . GLN C 1 5  ? 26.081  4.477   4.578   1.00 16.41 ? 5  GLN C C   1 
ATOM   440 O O   . GLN C 1 5  ? 26.688  3.907   5.503   1.00 15.72 ? 5  GLN C O   1 
ATOM   441 C CB  . GLN C 1 5  ? 25.589  6.873   4.876   1.00 20.18 ? 5  GLN C CB  1 
ATOM   442 C CG  . GLN C 1 5  ? 26.041  8.321   4.835   1.00 27.97 ? 5  GLN C CG  1 
ATOM   443 C CD  . GLN C 1 5  ? 25.731  9.064   6.160   1.00 33.31 ? 5  GLN C CD  1 
ATOM   444 O OE1 . GLN C 1 5  ? 24.564  9.227   6.534   1.00 33.96 ? 5  GLN C OE1 1 
ATOM   445 N NE2 . GLN C 1 5  ? 26.779  9.504   6.873   1.00 33.80 ? 5  GLN C NE2 1 
ATOM   446 N N   . CYS C 1 6  ? 25.044  3.951   3.933   1.00 16.31 ? 6  CYS C N   1 
ATOM   447 C CA  . CYS C 1 6  ? 24.439  2.653   4.261   1.00 14.48 ? 6  CYS C CA  1 
ATOM   448 C C   . CYS C 1 6  ? 24.671  1.471   3.352   1.00 15.05 ? 6  CYS C C   1 
ATOM   449 O O   . CYS C 1 6  ? 24.571  0.326   3.788   1.00 18.33 ? 6  CYS C O   1 
ATOM   450 C CB  . CYS C 1 6  ? 22.934  2.835   4.435   1.00 11.45 ? 6  CYS C CB  1 
ATOM   451 S SG  . CYS C 1 6  ? 22.473  3.951   5.800   1.00 16.68 ? 6  CYS C SG  1 
ATOM   452 N N   . CYS C 1 7  ? 24.902  1.730   2.075   1.00 17.60 ? 7  CYS C N   1 
ATOM   453 C CA  . CYS C 1 7  ? 25.152  0.658   1.134   1.00 16.51 ? 7  CYS C CA  1 
ATOM   454 C C   . CYS C 1 7  ? 26.635  0.471   0.914   1.00 19.23 ? 7  CYS C C   1 
ATOM   455 O O   . CYS C 1 7  ? 27.138  -0.638  1.033   1.00 25.91 ? 7  CYS C O   1 
ATOM   456 C CB  . CYS C 1 7  ? 24.486  0.976   -0.183  1.00 14.41 ? 7  CYS C CB  1 
ATOM   457 S SG  . CYS C 1 7  ? 24.882  -0.248  -1.444  1.00 17.34 ? 7  CYS C SG  1 
ATOM   458 N N   . THR C 1 8  ? 27.334  1.563   0.596   1.00 22.33 ? 8  THR C N   1 
ATOM   459 C CA  . THR C 1 8  ? 28.775  1.553   0.323   1.00 20.90 ? 8  THR C CA  1 
ATOM   460 C C   . THR C 1 8  ? 29.561  1.385   1.598   1.00 22.49 ? 8  THR C C   1 
ATOM   461 O O   . THR C 1 8  ? 30.628  0.732   1.640   1.00 26.58 ? 8  THR C O   1 
ATOM   462 C CB  . THR C 1 8  ? 29.187  2.840   -0.361  1.00 18.58 ? 8  THR C CB  1 
ATOM   463 O OG1 . THR C 1 8  ? 28.388  3.009   -1.541  1.00 18.32 ? 8  THR C OG1 1 
ATOM   464 C CG2 . THR C 1 8  ? 30.640  2.780   -0.743  1.00 13.21 ? 8  THR C CG2 1 
ATOM   465 N N   . SER C 1 9  ? 29.027  2.011   2.631   1.00 18.03 ? 9  SER C N   1 
ATOM   466 C CA  . SER C 1 9  ? 29.589  1.936   3.956   1.00 17.67 ? 9  SER C CA  1 
ATOM   467 C C   . SER C 1 9  ? 28.493  1.348   4.846   1.00 16.09 ? 9  SER C C   1 
ATOM   468 O O   . SER C 1 9  ? 27.464  0.910   4.350   1.00 18.82 ? 9  SER C O   1 
ATOM   469 C CB  . SER C 1 9  ? 29.987  3.317   4.420   1.00 12.93 ? 9  SER C CB  1 
ATOM   470 O OG  . SER C 1 9  ? 30.780  3.199   5.570   1.00 33.82 ? 9  SER C OG  1 
ATOM   471 N N   . ILE C 1 10 ? 28.717  1.305   6.146   1.00 17.10 ? 10 ILE C N   1 
ATOM   472 C CA  . ILE C 1 10 ? 27.740  0.755   7.065   1.00 16.26 ? 10 ILE C CA  1 
ATOM   473 C C   . ILE C 1 10 ? 27.260  1.894   7.937   1.00 17.37 ? 10 ILE C C   1 
ATOM   474 O O   . ILE C 1 10 ? 28.048  2.730   8.371   1.00 19.31 ? 10 ILE C O   1 
ATOM   475 C CB  . ILE C 1 10 ? 28.350  -0.412  7.912   1.00 15.45 ? 10 ILE C CB  1 
ATOM   476 C CG1 . ILE C 1 10 ? 28.789  -1.541  6.971   1.00 15.48 ? 10 ILE C CG1 1 
ATOM   477 C CG2 . ILE C 1 10 ? 27.296  -0.992  8.896   1.00 17.95 ? 10 ILE C CG2 1 
ATOM   478 C CD1 . ILE C 1 10 ? 29.326  -2.769  7.641   1.00 9.02  ? 10 ILE C CD1 1 
ATOM   479 N N   . CYS C 1 11 ? 25.953  1.966   8.138   1.00 19.71 ? 11 CYS C N   1 
ATOM   480 C CA  . CYS C 1 11 ? 25.380  3.031   8.941   1.00 20.45 ? 11 CYS C CA  1 
ATOM   481 C C   . CYS C 1 11 ? 24.800  2.503   10.224  1.00 19.96 ? 11 CYS C C   1 
ATOM   482 O O   . CYS C 1 11 ? 24.461  1.320   10.301  1.00 22.18 ? 11 CYS C O   1 
ATOM   483 C CB  . CYS C 1 11 ? 24.294  3.811   8.172   1.00 19.59 ? 11 CYS C CB  1 
ATOM   484 S SG  . CYS C 1 11 ? 22.831  2.919   7.522   1.00 19.63 ? 11 CYS C SG  1 
ATOM   485 N N   . SER C 1 12 ? 24.716  3.383   11.226  1.00 15.03 ? 12 SER C N   1 
ATOM   486 C CA  . SER C 1 12 ? 24.158  3.051   12.516  1.00 13.46 ? 12 SER C CA  1 
ATOM   487 C C   . SER C 1 12 ? 22.644  3.337   12.429  1.00 18.07 ? 12 SER C C   1 
ATOM   488 O O   . SER C 1 12 ? 22.175  3.853   11.414  1.00 26.38 ? 12 SER C O   1 
ATOM   489 C CB  . SER C 1 12 ? 24.815  3.925   13.560  1.00 11.56 ? 12 SER C CB  1 
ATOM   490 O OG  . SER C 1 12 ? 24.549  5.298   13.304  1.00 14.28 ? 12 SER C OG  1 
ATOM   491 N N   . LEU C 1 13 ? 21.877  2.997   13.463  1.00 17.87 ? 13 LEU C N   1 
ATOM   492 C CA  . LEU C 1 13 ? 20.426  3.237   13.479  1.00 16.21 ? 13 LEU C CA  1 
ATOM   493 C C   . LEU C 1 13 ? 20.082  4.731   13.310  1.00 14.77 ? 13 LEU C C   1 
ATOM   494 O O   . LEU C 1 13 ? 19.180  5.083   12.564  1.00 15.32 ? 13 LEU C O   1 
ATOM   495 C CB  . LEU C 1 13 ? 19.840  2.721   14.798  1.00 16.73 ? 13 LEU C CB  1 
ATOM   496 C CG  . LEU C 1 13 ? 18.383  2.267   14.892  1.00 14.99 ? 13 LEU C CG  1 
ATOM   497 C CD1 . LEU C 1 13 ? 17.758  2.805   16.145  1.00 8.37  ? 13 LEU C CD1 1 
ATOM   498 C CD2 . LEU C 1 13 ? 17.608  2.698   13.661  1.00 19.60 ? 13 LEU C CD2 1 
ATOM   499 N N   . TYR C 1 14 ? 20.845  5.595   13.970  1.00 14.65 ? 14 TYR C N   1 
ATOM   500 C CA  . TYR C 1 14 ? 20.655  7.055   13.934  1.00 16.43 ? 14 TYR C CA  1 
ATOM   501 C C   . TYR C 1 14 ? 20.977  7.744   12.610  1.00 19.15 ? 14 TYR C C   1 
ATOM   502 O O   . TYR C 1 14 ? 20.337  8.758   12.269  1.00 22.00 ? 14 TYR C O   1 
ATOM   503 C CB  . TYR C 1 14 ? 21.428  7.728   15.076  1.00 15.23 ? 14 TYR C CB  1 
ATOM   504 C CG  . TYR C 1 14 ? 20.889  7.400   16.449  1.00 12.58 ? 14 TYR C CG  1 
ATOM   505 C CD1 . TYR C 1 14 ? 19.580  6.936   16.610  1.00 16.20 ? 14 TYR C CD1 1 
ATOM   506 C CD2 . TYR C 1 14 ? 21.665  7.591   17.580  1.00 17.82 ? 14 TYR C CD2 1 
ATOM   507 C CE1 . TYR C 1 14 ? 19.059  6.682   17.845  1.00 17.44 ? 14 TYR C CE1 1 
ATOM   508 C CE2 . TYR C 1 14 ? 21.156  7.340   18.852  1.00 21.86 ? 14 TYR C CE2 1 
ATOM   509 C CZ  . TYR C 1 14 ? 19.847  6.884   18.976  1.00 22.85 ? 14 TYR C CZ  1 
ATOM   510 O OH  . TYR C 1 14 ? 19.329  6.622   20.230  1.00 23.86 ? 14 TYR C OH  1 
ATOM   511 N N   . GLN C 1 15 ? 21.957  7.212   11.872  1.00 17.05 ? 15 GLN C N   1 
ATOM   512 C CA  . GLN C 1 15 ? 22.323  7.768   10.572  1.00 14.17 ? 15 GLN C CA  1 
ATOM   513 C C   . GLN C 1 15 ? 21.231  7.435   9.599   1.00 12.50 ? 15 GLN C C   1 
ATOM   514 O O   . GLN C 1 15 ? 20.925  8.219   8.729   1.00 14.33 ? 15 GLN C O   1 
ATOM   515 C CB  . GLN C 1 15 ? 23.659  7.236   10.086  1.00 10.37 ? 15 GLN C CB  1 
ATOM   516 C CG  . GLN C 1 15 ? 24.770  7.640   11.000  1.00 13.76 ? 15 GLN C CG  1 
ATOM   517 C CD  . GLN C 1 15 ? 26.140  7.187   10.533  1.00 16.93 ? 15 GLN C CD  1 
ATOM   518 O OE1 . GLN C 1 15 ? 26.382  6.006   10.320  1.00 19.58 ? 15 GLN C OE1 1 
ATOM   519 N NE2 . GLN C 1 15 ? 27.044  8.130   10.391  1.00 14.28 ? 15 GLN C NE2 1 
ATOM   520 N N   . LEU C 1 16 ? 20.651  6.255   9.773   1.00 15.25 ? 16 LEU C N   1 
ATOM   521 C CA  . LEU C 1 16 ? 19.531  5.782   8.975   1.00 15.30 ? 16 LEU C CA  1 
ATOM   522 C C   . LEU C 1 16 ? 18.260  6.599   9.302   1.00 17.59 ? 16 LEU C C   1 
ATOM   523 O O   . LEU C 1 16 ? 17.550  7.057   8.397   1.00 15.33 ? 16 LEU C O   1 
ATOM   524 C CB  . LEU C 1 16 ? 19.263  4.336   9.319   1.00 14.33 ? 16 LEU C CB  1 
ATOM   525 C CG  . LEU C 1 16 ? 19.108  3.355   8.165   1.00 19.74 ? 16 LEU C CG  1 
ATOM   526 C CD1 . LEU C 1 16 ? 18.459  2.142   8.752   1.00 17.63 ? 16 LEU C CD1 1 
ATOM   527 C CD2 . LEU C 1 16 ? 18.249  3.906   7.015   1.00 15.59 ? 16 LEU C CD2 1 
ATOM   528 N N   . GLU C 1 17 ? 17.988  6.766   10.602  1.00 19.02 ? 17 GLU C N   1 
ATOM   529 C CA  . GLU C 1 17 ? 16.841  7.529   11.092  1.00 18.02 ? 17 GLU C CA  1 
ATOM   530 C C   . GLU C 1 17 ? 16.949  8.999   10.680  1.00 18.58 ? 17 GLU C C   1 
ATOM   531 O O   . GLU C 1 17 ? 15.962  9.722   10.659  1.00 21.42 ? 17 GLU C O   1 
ATOM   532 C CB  . GLU C 1 17 ? 16.778  7.428   12.606  1.00 15.65 ? 17 GLU C CB  1 
ATOM   533 C CG  . GLU C 1 17 ? 15.833  6.390   13.095  1.00 21.80 ? 17 GLU C CG  1 
ATOM   534 C CD  . GLU C 1 17 ? 16.149  5.901   14.481  1.00 23.92 ? 17 GLU C CD  1 
ATOM   535 O OE1 . GLU C 1 17 ? 16.812  6.620   15.254  1.00 29.71 ? 17 GLU C OE1 1 
ATOM   536 O OE2 . GLU C 1 17 ? 15.731  4.772   14.806  1.00 25.45 ? 17 GLU C OE2 1 
ATOM   537 N N   . ASN C 1 18 ? 18.156  9.452   10.373  1.00 18.83 ? 18 ASN C N   1 
ATOM   538 C CA  . ASN C 1 18 ? 18.323  10.828  9.949   1.00 20.58 ? 18 ASN C CA  1 
ATOM   539 C C   . ASN C 1 18 ? 17.736  11.084  8.549   1.00 20.51 ? 18 ASN C C   1 
ATOM   540 O O   . ASN C 1 18 ? 17.623  12.238  8.097   1.00 21.22 ? 18 ASN C O   1 
ATOM   541 C CB  . ASN C 1 18 ? 19.785  11.241  9.999   1.00 19.54 ? 18 ASN C CB  1 
ATOM   542 C CG  . ASN C 1 18 ? 19.950  12.703  10.311  1.00 23.05 ? 18 ASN C CG  1 
ATOM   543 O OD1 . ASN C 1 18 ? 19.195  13.273  11.115  1.00 25.16 ? 18 ASN C OD1 1 
ATOM   544 N ND2 . ASN C 1 18 ? 20.921  13.333  9.675   1.00 21.78 ? 18 ASN C ND2 1 
ATOM   545 N N   . TYR C 1 19 ? 17.369  10.014  7.851   1.00 17.31 ? 19 TYR C N   1 
ATOM   546 C CA  . TYR C 1 19 ? 16.774  10.157  6.523   1.00 15.21 ? 19 TYR C CA  1 
ATOM   547 C C   . TYR C 1 19 ? 15.233  10.060  6.559   1.00 17.76 ? 19 TYR C C   1 
ATOM   548 O O   . TYR C 1 19 ? 14.534  10.042  5.520   1.00 15.55 ? 19 TYR C O   1 
ATOM   549 C CB  . TYR C 1 19 ? 17.383  9.149   5.543   1.00 16.61 ? 19 TYR C CB  1 
ATOM   550 C CG  . TYR C 1 19 ? 18.862  9.370   5.273   1.00 14.66 ? 19 TYR C CG  1 
ATOM   551 C CD1 . TYR C 1 19 ? 19.300  10.384  4.431   1.00 12.26 ? 19 TYR C CD1 1 
ATOM   552 C CD2 . TYR C 1 19 ? 19.814  8.530   5.831   1.00 14.59 ? 19 TYR C CD2 1 
ATOM   553 C CE1 . TYR C 1 19 ? 20.664  10.545  4.149   1.00 15.70 ? 19 TYR C CE1 1 
ATOM   554 C CE2 . TYR C 1 19 ? 21.156  8.679   5.558   1.00 13.78 ? 19 TYR C CE2 1 
ATOM   555 C CZ  . TYR C 1 19 ? 21.578  9.687   4.719   1.00 16.53 ? 19 TYR C CZ  1 
ATOM   556 O OH  . TYR C 1 19 ? 22.923  9.837   4.466   1.00 24.16 ? 19 TYR C OH  1 
ATOM   557 N N   . CYS C 1 20 ? 14.693  9.995   7.768   1.00 21.42 ? 20 CYS C N   1 
ATOM   558 C CA  . CYS C 1 20 ? 13.252  9.952   7.919   1.00 21.69 ? 20 CYS C CA  1 
ATOM   559 C C   . CYS C 1 20 ? 12.702  11.374  7.754   1.00 20.44 ? 20 CYS C C   1 
ATOM   560 O O   . CYS C 1 20 ? 13.443  12.347  7.787   1.00 22.82 ? 20 CYS C O   1 
ATOM   561 C CB  . CYS C 1 20 ? 12.881  9.397   9.288   1.00 16.72 ? 20 CYS C CB  1 
ATOM   562 S SG  . CYS C 1 20 ? 13.304  7.645   9.491   1.00 10.23 ? 20 CYS C SG  1 
ATOM   563 N N   . ASN C 1 21 ? 11.408  11.475  7.532   1.00 23.70 ? 21 ASN C N   1 
ATOM   564 C CA  . ASN C 1 21 ? 10.755  12.762  7.384   1.00 30.51 ? 21 ASN C CA  1 
ATOM   565 C C   . ASN C 1 21 ? 10.454  13.373  8.782   1.00 31.12 ? 21 ASN C C   1 
ATOM   566 O O   . ASN C 1 21 ? 10.071  14.563  8.812   1.00 37.49 ? 21 ASN C O   1 
ATOM   567 C CB  . ASN C 1 21 ? 9.457   12.568  6.595   1.00 34.72 ? 21 ASN C CB  1 
ATOM   568 C CG  . ASN C 1 21 ? 9.051   13.803  5.861   1.00 38.21 ? 21 ASN C CG  1 
ATOM   569 O OD1 . ASN C 1 21 ? 9.579   14.085  4.796   1.00 45.66 ? 21 ASN C OD1 1 
ATOM   570 N ND2 . ASN C 1 21 ? 8.133   14.566  6.428   1.00 41.30 ? 21 ASN C ND2 1 
ATOM   571 O OXT . ASN C 1 21 ? 10.586  12.675  9.828   1.00 30.14 ? 21 ASN C OXT 1 
ATOM   572 N N   . PHE D 2 1  ? 27.251  -13.961 10.864  1.00 49.03 ? 1  PHE D N   1 
ATOM   573 C CA  . PHE D 2 1  ? 28.217  -13.337 9.921   1.00 48.75 ? 1  PHE D CA  1 
ATOM   574 C C   . PHE D 2 1  ? 27.468  -13.215 8.606   1.00 48.55 ? 1  PHE D C   1 
ATOM   575 O O   . PHE D 2 1  ? 27.414  -14.156 7.822   1.00 46.18 ? 1  PHE D O   1 
ATOM   576 C CB  . PHE D 2 1  ? 29.491  -14.197 9.747   1.00 50.16 ? 1  PHE D CB  1 
ATOM   577 C CG  . PHE D 2 1  ? 30.361  -14.314 11.009  1.00 48.85 ? 1  PHE D CG  1 
ATOM   578 C CD1 . PHE D 2 1  ? 30.201  -13.446 12.096  1.00 45.27 ? 1  PHE D CD1 1 
ATOM   579 C CD2 . PHE D 2 1  ? 31.345  -15.309 11.103  1.00 50.83 ? 1  PHE D CD2 1 
ATOM   580 C CE1 . PHE D 2 1  ? 31.001  -13.565 13.252  1.00 35.59 ? 1  PHE D CE1 1 
ATOM   581 C CE2 . PHE D 2 1  ? 32.144  -15.436 12.251  1.00 42.43 ? 1  PHE D CE2 1 
ATOM   582 C CZ  . PHE D 2 1  ? 31.966  -14.559 13.324  1.00 39.32 ? 1  PHE D CZ  1 
ATOM   583 N N   . VAL D 2 2  ? 26.774  -12.091 8.455   1.00 47.99 ? 2  VAL D N   1 
ATOM   584 C CA  . VAL D 2 2  ? 26.002  -11.791 7.257   1.00 46.87 ? 2  VAL D CA  1 
ATOM   585 C C   . VAL D 2 2  ? 26.416  -10.394 6.759   1.00 46.68 ? 2  VAL D C   1 
ATOM   586 O O   . VAL D 2 2  ? 27.094  -9.635  7.485   1.00 46.17 ? 2  VAL D O   1 
ATOM   587 C CB  . VAL D 2 2  ? 24.434  -11.858 7.523   1.00 46.49 ? 2  VAL D CB  1 
ATOM   588 C CG1 . VAL D 2 2  ? 24.000  -10.902 8.641   1.00 39.10 ? 2  VAL D CG1 1 
ATOM   589 C CG2 . VAL D 2 2  ? 23.649  -11.571 6.226   1.00 47.28 ? 2  VAL D CG2 1 
ATOM   590 N N   . ASN D 2 3  ? 26.101  -10.099 5.497   1.00 38.18 ? 3  ASN D N   1 
ATOM   591 C CA  . ASN D 2 3  ? 26.426  -8.797  4.951   1.00 38.24 ? 3  ASN D CA  1 
ATOM   592 C C   . ASN D 2 3  ? 25.636  -7.739  5.748   1.00 35.72 ? 3  ASN D C   1 
ATOM   593 O O   . ASN D 2 3  ? 24.450  -7.903  6.031   1.00 34.36 ? 3  ASN D O   1 
ATOM   594 C CB  . ASN D 2 3  ? 26.098  -8.734  3.455   1.00 39.41 ? 3  ASN D CB  1 
ATOM   595 C CG  . ASN D 2 3  ? 26.300  -7.359  2.885   1.00 36.02 ? 3  ASN D CG  1 
ATOM   596 O OD1 . ASN D 2 3  ? 27.380  -6.782  3.013   1.00 32.83 ? 3  ASN D OD1 1 
ATOM   597 N ND2 . ASN D 2 3  ? 25.232  -6.786  2.313   1.00 46.06 ? 3  ASN D ND2 1 
ATOM   598 N N   . GLN D 2 4  ? 26.324  -6.674  6.134   1.00 35.29 ? 4  GLN D N   1 
ATOM   599 C CA  . GLN D 2 4  ? 25.731  -5.603  6.916   1.00 30.92 ? 4  GLN D CA  1 
ATOM   600 C C   . GLN D 2 4  ? 25.376  -4.371  6.076   1.00 29.23 ? 4  GLN D C   1 
ATOM   601 O O   . GLN D 2 4  ? 24.991  -3.344  6.626   1.00 30.60 ? 4  GLN D O   1 
ATOM   602 C CB  . GLN D 2 4  ? 26.712  -5.193  8.009   1.00 31.00 ? 4  GLN D CB  1 
ATOM   603 C CG  . GLN D 2 4  ? 27.450  -6.361  8.657   1.00 35.79 ? 4  GLN D CG  1 
ATOM   604 C CD  . GLN D 2 4  ? 26.659  -7.036  9.770   1.00 40.99 ? 4  GLN D CD  1 
ATOM   605 O OE1 . GLN D 2 4  ? 25.425  -6.943  9.828   1.00 43.89 ? 4  GLN D OE1 1 
ATOM   606 N NE2 . GLN D 2 4  ? 27.371  -7.715  10.677  1.00 40.68 ? 4  GLN D NE2 1 
ATOM   607 N N   . HIS D 2 5  ? 25.545  -4.445  4.758   1.00 27.29 ? 5  HIS D N   1 
ATOM   608 C CA  . HIS D 2 5  ? 25.240  -3.308  3.886   1.00 24.51 ? 5  HIS D CA  1 
ATOM   609 C C   . HIS D 2 5  ? 23.777  -3.348  3.466   1.00 23.03 ? 5  HIS D C   1 
ATOM   610 O O   . HIS D 2 5  ? 23.212  -4.440  3.277   1.00 23.99 ? 5  HIS D O   1 
ATOM   611 C CB  . HIS D 2 5  ? 26.154  -3.292  2.641   1.00 25.90 ? 5  HIS D CB  1 
ATOM   612 C CG  . HIS D 2 5  ? 27.623  -3.195  2.959   1.00 23.67 ? 5  HIS D CG  1 
ATOM   613 N ND1 . HIS D 2 5  ? 28.252  -1.999  3.231   1.00 25.81 ? 5  HIS D ND1 1 
ATOM   614 C CD2 . HIS D 2 5  ? 28.570  -4.154  3.105   1.00 22.78 ? 5  HIS D CD2 1 
ATOM   615 C CE1 . HIS D 2 5  ? 29.517  -2.222  3.537   1.00 24.47 ? 5  HIS D CE1 1 
ATOM   616 N NE2 . HIS D 2 5  ? 29.735  -3.522  3.467   1.00 23.39 ? 5  HIS D NE2 1 
ATOM   617 N N   . LEU D 2 6  ? 23.178  -2.158  3.363   1.00 16.61 ? 6  LEU D N   1 
ATOM   618 C CA  . LEU D 2 6  ? 21.783  -1.969  2.990   1.00 14.20 ? 6  LEU D CA  1 
ATOM   619 C C   . LEU D 2 6  ? 21.818  -1.291  1.634   1.00 13.28 ? 6  LEU D C   1 
ATOM   620 O O   . LEU D 2 6  ? 22.087  -0.105  1.576   1.00 14.68 ? 6  LEU D O   1 
ATOM   621 C CB  . LEU D 2 6  ? 21.110  -1.016  3.979   1.00 12.30 ? 6  LEU D CB  1 
ATOM   622 C CG  . LEU D 2 6  ? 20.373  -1.450  5.236   1.00 13.50 ? 6  LEU D CG  1 
ATOM   623 C CD1 . LEU D 2 6  ? 20.572  -2.916  5.598   1.00 5.06  ? 6  LEU D CD1 1 
ATOM   624 C CD2 . LEU D 2 6  ? 20.815  -0.515  6.335   1.00 9.09  ? 6  LEU D CD2 1 
ATOM   625 N N   . CYS D 2 7  ? 21.416  -2.013  0.587   1.00 13.07 ? 7  CYS D N   1 
ATOM   626 C CA  . CYS D 2 7  ? 21.461  -1.535  -0.774  1.00 12.44 ? 7  CYS D CA  1 
ATOM   627 C C   . CYS D 2 7  ? 20.193  -1.849  -1.500  1.00 18.15 ? 7  CYS D C   1 
ATOM   628 O O   . CYS D 2 7  ? 19.528  -2.860  -1.221  1.00 19.52 ? 7  CYS D O   1 
ATOM   629 C CB  . CYS D 2 7  ? 22.605  -2.209  -1.522  1.00 10.46 ? 7  CYS D CB  1 
ATOM   630 S SG  . CYS D 2 7  ? 24.216  -2.028  -0.695  1.00 19.29 ? 7  CYS D SG  1 
ATOM   631 N N   . GLY D 2 8  ? 19.878  -0.972  -2.446  1.00 19.34 ? 8  GLY D N   1 
ATOM   632 C CA  . GLY D 2 8  ? 18.685  -1.110  -3.245  1.00 21.08 ? 8  GLY D CA  1 
ATOM   633 C C   . GLY D 2 8  ? 17.395  -1.284  -2.490  1.00 21.26 ? 8  GLY D C   1 
ATOM   634 O O   . GLY D 2 8  ? 17.094  -0.569  -1.537  1.00 26.46 ? 8  GLY D O   1 
ATOM   635 N N   . GLU D 2 9  ? 16.629  -2.271  -2.928  1.00 26.16 ? 9  GLU D N   1 
ATOM   636 C CA  . GLU D 2 9  ? 15.343  -2.592  -2.333  1.00 26.96 ? 9  GLU D CA  1 
ATOM   637 C C   . GLU D 2 9  ? 15.443  -2.722  -0.834  1.00 24.26 ? 9  GLU D C   1 
ATOM   638 O O   . GLU D 2 9  ? 14.523  -2.357  -0.123  1.00 24.71 ? 9  GLU D O   1 
ATOM   639 C CB  . GLU D 2 9  ? 14.829  -3.909  -2.901  1.00 30.85 ? 9  GLU D CB  1 
ATOM   640 C CG  . GLU D 2 9  ? 13.607  -3.784  -3.791  1.00 41.88 ? 9  GLU D CG  1 
ATOM   641 C CD  . GLU D 2 9  ? 12.431  -4.542  -3.221  1.00 47.17 ? 9  GLU D CD  1 
ATOM   642 O OE1 . GLU D 2 9  ? 12.329  -4.582  -1.969  1.00 48.48 ? 9  GLU D OE1 1 
ATOM   643 O OE2 . GLU D 2 9  ? 11.625  -5.100  -4.012  1.00 48.61 ? 9  GLU D OE2 1 
ATOM   644 N N   . HIS D 2 10 ? 16.576  -3.221  -0.359  1.00 22.14 ? 10 HIS D N   1 
ATOM   645 C CA  . HIS D 2 10 ? 16.764  -3.423  1.063   1.00 22.14 ? 10 HIS D CA  1 
ATOM   646 C C   . HIS D 2 10 ? 16.898  -2.135  1.831   1.00 18.86 ? 10 HIS D C   1 
ATOM   647 O O   . HIS D 2 10 ? 16.479  -2.033  2.989   1.00 21.86 ? 10 HIS D O   1 
ATOM   648 C CB  . HIS D 2 10 ? 17.952  -4.337  1.307   1.00 23.71 ? 10 HIS D CB  1 
ATOM   649 C CG  . HIS D 2 10 ? 17.706  -5.756  0.886   1.00 32.22 ? 10 HIS D CG  1 
ATOM   650 N ND1 . HIS D 2 10 ? 16.512  -6.405  1.124   1.00 34.91 ? 10 HIS D ND1 1 
ATOM   651 C CD2 . HIS D 2 10 ? 18.495  -6.648  0.241   1.00 31.73 ? 10 HIS D CD2 1 
ATOM   652 C CE1 . HIS D 2 10 ? 16.577  -7.632  0.642   1.00 33.22 ? 10 HIS D CE1 1 
ATOM   653 N NE2 . HIS D 2 10 ? 17.769  -7.805  0.102   1.00 33.10 ? 10 HIS D NE2 1 
ATOM   654 N N   . LEU D 2 11 ? 17.425  -1.128  1.165   1.00 17.53 ? 11 LEU D N   1 
ATOM   655 C CA  . LEU D 2 11 ? 17.603  0.159   1.789   1.00 17.90 ? 11 LEU D CA  1 
ATOM   656 C C   . LEU D 2 11 ? 16.217  0.757   2.036   1.00 18.42 ? 11 LEU D C   1 
ATOM   657 O O   . LEU D 2 11 ? 15.914  1.247   3.130   1.00 20.14 ? 11 LEU D O   1 
ATOM   658 C CB  . LEU D 2 11 ? 18.474  1.028   0.894   1.00 14.65 ? 11 LEU D CB  1 
ATOM   659 C CG  . LEU D 2 11 ? 19.075  2.281   1.507   1.00 23.48 ? 11 LEU D CG  1 
ATOM   660 C CD1 . LEU D 2 11 ? 19.788  1.965   2.836   1.00 21.50 ? 11 LEU D CD1 1 
ATOM   661 C CD2 . LEU D 2 11 ? 20.032  2.875   0.526   1.00 16.88 ? 11 LEU D CD2 1 
ATOM   662 N N   . VAL D 2 12 ? 15.346  0.602   1.048   1.00 22.18 ? 12 VAL D N   1 
ATOM   663 C CA  . VAL D 2 12 ? 13.951  1.103   1.102   1.00 23.78 ? 12 VAL D CA  1 
ATOM   664 C C   . VAL D 2 12 ? 13.077  0.385   2.173   1.00 24.46 ? 12 VAL D C   1 
ATOM   665 O O   . VAL D 2 12 ? 12.195  0.998   2.793   1.00 23.68 ? 12 VAL D O   1 
ATOM   666 C CB  . VAL D 2 12 ? 13.287  1.027   -0.330  1.00 17.91 ? 12 VAL D CB  1 
ATOM   667 C CG1 . VAL D 2 12 ? 11.955  1.599   -0.313  1.00 12.23 ? 12 VAL D CG1 1 
ATOM   668 C CG2 . VAL D 2 12 ? 14.136  1.782   -1.331  1.00 16.87 ? 12 VAL D CG2 1 
ATOM   669 N N   . GLU D 2 13 ? 13.318  -0.910  2.388   1.00 23.44 ? 13 GLU D N   1 
ATOM   670 C CA  . GLU D 2 13 ? 12.573  -1.658  3.396   1.00 21.13 ? 13 GLU D CA  1 
ATOM   671 C C   . GLU D 2 13 ? 13.026  -1.164  4.767   1.00 21.51 ? 13 GLU D C   1 
ATOM   672 O O   . GLU D 2 13 ? 12.203  -0.951  5.659   1.00 27.35 ? 13 GLU D O   1 
ATOM   673 C CB  . GLU D 2 13 ? 12.827  -3.164  3.279   1.00 21.70 ? 13 GLU D CB  1 
ATOM   674 C CG  . GLU D 2 13 ? 12.044  -3.843  2.179   1.00 29.96 ? 13 GLU D CG  1 
ATOM   675 C CD  . GLU D 2 13 ? 12.746  -5.090  1.613   1.00 36.72 ? 13 GLU D CD  1 
ATOM   676 O OE1 . GLU D 2 13 ? 13.849  -5.451  2.079   1.00 34.68 ? 13 GLU D OE1 1 
ATOM   677 O OE2 . GLU D 2 13 ? 12.194  -5.697  0.671   1.00 39.00 ? 13 GLU D OE2 1 
ATOM   678 N N   . ALA D 2 14 ? 14.326  -0.937  4.927   1.00 17.08 ? 14 ALA D N   1 
ATOM   679 C CA  . ALA D 2 14 ? 14.841  -0.455  6.197   1.00 11.80 ? 14 ALA D CA  1 
ATOM   680 C C   . ALA D 2 14 ? 14.204  0.872   6.535   1.00 12.83 ? 14 ALA D C   1 
ATOM   681 O O   . ALA D 2 14 ? 13.753  1.068   7.656   1.00 14.06 ? 14 ALA D O   1 
ATOM   682 C CB  . ALA D 2 14 ? 16.348  -0.300  6.137   1.00 12.83 ? 14 ALA D CB  1 
ATOM   683 N N   . LEU D 2 15 ? 14.136  1.776   5.559   1.00 14.80 ? 15 LEU D N   1 
ATOM   684 C CA  . LEU D 2 15 ? 13.578  3.095   5.800   1.00 10.41 ? 15 LEU D CA  1 
ATOM   685 C C   . LEU D 2 15 ? 12.133  2.969   6.195   1.00 12.94 ? 15 LEU D C   1 
ATOM   686 O O   . LEU D 2 15 ? 11.661  3.652   7.084   1.00 11.83 ? 15 LEU D O   1 
ATOM   687 C CB  . LEU D 2 15 ? 13.718  4.001   4.566   1.00 11.58 ? 15 LEU D CB  1 
ATOM   688 C CG  . LEU D 2 15 ? 15.036  4.771   4.402   1.00 16.32 ? 15 LEU D CG  1 
ATOM   689 C CD1 . LEU D 2 15 ? 15.038  5.523   3.055   1.00 15.94 ? 15 LEU D CD1 1 
ATOM   690 C CD2 . LEU D 2 15 ? 15.253  5.751   5.541   1.00 12.85 ? 15 LEU D CD2 1 
ATOM   691 N N   . TYR D 2 16 ? 11.427  2.092   5.513   1.00 15.15 ? 16 TYR D N   1 
ATOM   692 C CA  . TYR D 2 16 ? 10.024  1.874   5.780   1.00 12.78 ? 16 TYR D CA  1 
ATOM   693 C C   . TYR D 2 16 ? 9.880   1.457   7.225   1.00 14.83 ? 16 TYR D C   1 
ATOM   694 O O   . TYR D 2 16 ? 9.148   2.095   7.980   1.00 19.24 ? 16 TYR D O   1 
ATOM   695 C CB  . TYR D 2 16 ? 9.475   0.805   4.805   1.00 13.60 ? 16 TYR D CB  1 
ATOM   696 C CG  . TYR D 2 16 ? 8.043   0.341   5.040   1.00 17.35 ? 16 TYR D CG  1 
ATOM   697 C CD1 . TYR D 2 16 ? 6.953   1.146   4.709   1.00 20.91 ? 16 TYR D CD1 1 
ATOM   698 C CD2 . TYR D 2 16 ? 7.781   -0.909  5.581   1.00 20.15 ? 16 TYR D CD2 1 
ATOM   699 C CE1 . TYR D 2 16 ? 5.641   0.719   4.907   1.00 14.51 ? 16 TYR D CE1 1 
ATOM   700 C CE2 . TYR D 2 16 ? 6.485   -1.339  5.786   1.00 19.93 ? 16 TYR D CE2 1 
ATOM   701 C CZ  . TYR D 2 16 ? 5.414   -0.526  5.445   1.00 21.25 ? 16 TYR D CZ  1 
ATOM   702 O OH  . TYR D 2 16 ? 4.110   -0.978  5.639   1.00 23.34 ? 16 TYR D OH  1 
ATOM   703 N N   . LEU D 2 17 ? 10.622  0.427   7.628   1.00 15.17 ? 17 LEU D N   1 
ATOM   704 C CA  . LEU D 2 17 ? 10.558  -0.098  8.997   1.00 12.45 ? 17 LEU D CA  1 
ATOM   705 C C   . LEU D 2 17 ? 10.899  0.961   10.049  1.00 18.64 ? 17 LEU D C   1 
ATOM   706 O O   . LEU D 2 17 ? 10.093  1.273   10.932  1.00 19.52 ? 17 LEU D O   1 
ATOM   707 C CB  . LEU D 2 17 ? 11.526  -1.267  9.124   1.00 6.73  ? 17 LEU D CB  1 
ATOM   708 C CG  . LEU D 2 17 ? 11.907  -1.766  10.509  1.00 9.50  ? 17 LEU D CG  1 
ATOM   709 C CD1 . LEU D 2 17 ? 10.644  -2.134  11.244  1.00 9.48  ? 17 LEU D CD1 1 
ATOM   710 C CD2 . LEU D 2 17 ? 12.828  -2.959  10.401  1.00 4.05  ? 17 LEU D CD2 1 
ATOM   711 N N   . VAL D 2 18 ? 12.108  1.503   9.927   1.00 20.74 ? 18 VAL D N   1 
ATOM   712 C CA  . VAL D 2 18 ? 12.673  2.488   10.831  1.00 19.54 ? 18 VAL D CA  1 
ATOM   713 C C   . VAL D 2 18 ? 11.939  3.838   10.919  1.00 20.48 ? 18 VAL D C   1 
ATOM   714 O O   . VAL D 2 18 ? 11.778  4.366   12.005  1.00 25.38 ? 18 VAL D O   1 
ATOM   715 C CB  . VAL D 2 18 ? 14.205  2.604   10.524  1.00 22.91 ? 18 VAL D CB  1 
ATOM   716 C CG1 . VAL D 2 18 ? 14.729  4.016   10.703  1.00 25.52 ? 18 VAL D CG1 1 
ATOM   717 C CG2 . VAL D 2 18 ? 14.977  1.612   11.404  1.00 13.50 ? 18 VAL D CG2 1 
ATOM   718 N N   . CYS D 2 19 ? 11.475  4.386   9.806   1.00 20.11 ? 19 CYS D N   1 
ATOM   719 C CA  . CYS D 2 19 ? 10.770  5.659   9.835   1.00 19.00 ? 19 CYS D CA  1 
ATOM   720 C C   . CYS D 2 19 ? 9.336   5.559   10.269  1.00 21.62 ? 19 CYS D C   1 
ATOM   721 O O   . CYS D 2 19 ? 8.774   6.549   10.735  1.00 23.36 ? 19 CYS D O   1 
ATOM   722 C CB  . CYS D 2 19 ? 10.779  6.340   8.484   1.00 18.25 ? 19 CYS D CB  1 
ATOM   723 S SG  . CYS D 2 19 ? 12.425  6.777   7.921   1.00 17.44 ? 19 CYS D SG  1 
ATOM   724 N N   . GLY D 2 20 ? 8.710   4.407   10.054  1.00 23.89 ? 20 GLY D N   1 
ATOM   725 C CA  . GLY D 2 20 ? 7.324   4.243   10.450  1.00 22.93 ? 20 GLY D CA  1 
ATOM   726 C C   . GLY D 2 20 ? 6.416   5.328   9.917   1.00 25.93 ? 20 GLY D C   1 
ATOM   727 O O   . GLY D 2 20 ? 6.519   5.712   8.761   1.00 26.84 ? 20 GLY D O   1 
ATOM   728 N N   . GLU D 2 21 ? 5.595   5.888   10.802  1.00 31.92 ? 21 GLU D N   1 
ATOM   729 C CA  . GLU D 2 21 ? 4.612   6.939   10.471  1.00 32.34 ? 21 GLU D CA  1 
ATOM   730 C C   . GLU D 2 21 ? 5.204   8.281   10.087  1.00 30.45 ? 21 GLU D C   1 
ATOM   731 O O   . GLU D 2 21 ? 4.477   9.182   9.703   1.00 34.05 ? 21 GLU D O   1 
ATOM   732 C CB  . GLU D 2 21 ? 3.634   7.153   11.641  1.00 38.38 ? 21 GLU D CB  1 
ATOM   733 C CG  . GLU D 2 21 ? 4.327   7.408   13.028  1.00 46.29 ? 21 GLU D CG  1 
ATOM   734 C CD  . GLU D 2 21 ? 3.965   8.768   13.669  1.00 48.96 ? 21 GLU D CD  1 
ATOM   735 O OE1 . GLU D 2 21 ? 2.956   9.376   13.242  1.00 50.13 ? 21 GLU D OE1 1 
ATOM   736 O OE2 . GLU D 2 21 ? 4.696   9.233   14.589  1.00 45.66 ? 21 GLU D OE2 1 
ATOM   737 N N   . ARG D 2 22 ? 6.501   8.450   10.284  1.00 25.39 ? 22 ARG D N   1 
ATOM   738 C CA  . ARG D 2 22 ? 7.160   9.685   9.921   1.00 23.87 ? 22 ARG D CA  1 
ATOM   739 C C   . ARG D 2 22 ? 7.237   9.764   8.401   1.00 24.07 ? 22 ARG D C   1 
ATOM   740 O O   . ARG D 2 22 ? 7.154   10.843  7.813   1.00 27.11 ? 22 ARG D O   1 
ATOM   741 C CB  . ARG D 2 22 ? 8.590   9.702   10.481  1.00 29.84 ? 22 ARG D CB  1 
ATOM   742 C CG  . ARG D 2 22 ? 8.708   9.543   11.995  1.00 37.19 ? 22 ARG D CG  1 
ATOM   743 C CD  . ARG D 2 22 ? 8.101   10.749  12.709  1.00 47.24 ? 22 ARG D CD  1 
ATOM   744 N NE  . ARG D 2 22 ? 9.007   11.901  12.773  1.00 51.85 ? 22 ARG D NE  1 
ATOM   745 C CZ  . ARG D 2 22 ? 8.789   12.989  13.517  1.00 53.69 ? 22 ARG D CZ  1 
ATOM   746 N NH1 . ARG D 2 22 ? 7.684   13.095  14.251  1.00 50.20 ? 22 ARG D NH1 1 
ATOM   747 N NH2 . ARG D 2 22 ? 9.723   13.933  13.601  1.00 57.88 ? 22 ARG D NH2 1 
ATOM   748 N N   . GLY D 2 23 ? 7.437   8.619   7.761   1.00 20.26 ? 23 GLY D N   1 
ATOM   749 C CA  . GLY D 2 23 ? 7.565   8.631   6.316   1.00 23.61 ? 23 GLY D CA  1 
ATOM   750 C C   . GLY D 2 23 ? 8.958   9.059   5.888   1.00 20.10 ? 23 GLY D C   1 
ATOM   751 O O   . GLY D 2 23 ? 9.809   9.367   6.726   1.00 19.74 ? 23 GLY D O   1 
ATOM   752 N N   . PHE D 2 24 ? 9.212   9.065   4.589   1.00 18.26 ? 24 PHE D N   1 
ATOM   753 C CA  . PHE D 2 24 ? 10.536  9.429   4.113   1.00 16.37 ? 24 PHE D CA  1 
ATOM   754 C C   . PHE D 2 24 ? 10.558  9.797   2.654   1.00 16.67 ? 24 PHE D C   1 
ATOM   755 O O   . PHE D 2 24 ? 9.592   9.590   1.904   1.00 17.04 ? 24 PHE D O   1 
ATOM   756 C CB  . PHE D 2 24 ? 11.500  8.271   4.311   1.00 10.15 ? 24 PHE D CB  1 
ATOM   757 C CG  . PHE D 2 24 ? 11.050  6.998   3.631   1.00 18.73 ? 24 PHE D CG  1 
ATOM   758 C CD1 . PHE D 2 24 ? 10.039  6.212   4.188   1.00 17.35 ? 24 PHE D CD1 1 
ATOM   759 C CD2 . PHE D 2 24 ? 11.654  6.575   2.440   1.00 19.26 ? 24 PHE D CD2 1 
ATOM   760 C CE1 . PHE D 2 24 ? 9.646   5.025   3.568   1.00 20.81 ? 24 PHE D CE1 1 
ATOM   761 C CE2 . PHE D 2 24 ? 11.273  5.388   1.806   1.00 17.97 ? 24 PHE D CE2 1 
ATOM   762 C CZ  . PHE D 2 24 ? 10.271  4.611   2.366   1.00 21.01 ? 24 PHE D CZ  1 
ATOM   763 N N   . PHE D 2 25 ? 11.735  10.253  2.263   1.00 17.95 ? 25 PHE D N   1 
ATOM   764 C CA  . PHE D 2 25 ? 12.053  10.673  0.925   1.00 22.33 ? 25 PHE D CA  1 
ATOM   765 C C   . PHE D 2 25 ? 13.063  9.643   0.455   1.00 22.95 ? 25 PHE D C   1 
ATOM   766 O O   . PHE D 2 25 ? 13.951  9.303   1.223   1.00 25.43 ? 25 PHE D O   1 
ATOM   767 C CB  . PHE D 2 25 ? 12.770  12.028  1.021   1.00 25.96 ? 25 PHE D CB  1 
ATOM   768 C CG  . PHE D 2 25 ? 12.306  13.002  0.028   1.00 33.10 ? 25 PHE D CG  1 
ATOM   769 C CD1 . PHE D 2 25 ? 12.778  12.946  -1.270  1.00 35.77 ? 25 PHE D CD1 1 
ATOM   770 C CD2 . PHE D 2 25 ? 11.287  13.890  0.349   1.00 37.52 ? 25 PHE D CD2 1 
ATOM   771 C CE1 . PHE D 2 25 ? 12.238  13.747  -2.245  1.00 44.03 ? 25 PHE D CE1 1 
ATOM   772 C CE2 . PHE D 2 25 ? 10.726  14.707  -0.614  1.00 40.44 ? 25 PHE D CE2 1 
ATOM   773 C CZ  . PHE D 2 25 ? 11.196  14.638  -1.918  1.00 46.47 ? 25 PHE D CZ  1 
ATOM   774 N N   . TYR D 2 26 ? 12.925  9.074   -0.735  1.00 24.33 ? 26 TYR D N   1 
ATOM   775 C CA  . TYR D 2 26 ? 13.950  8.152   -1.147  1.00 23.11 ? 26 TYR D CA  1 
ATOM   776 C C   . TYR D 2 26 ? 14.442  8.713   -2.429  1.00 24.86 ? 26 TYR D C   1 
ATOM   777 O O   . TYR D 2 26 ? 13.706  8.801   -3.404  1.00 25.52 ? 26 TYR D O   1 
ATOM   778 C CB  . TYR D 2 26 ? 13.494  6.699   -1.254  1.00 25.82 ? 26 TYR D CB  1 
ATOM   779 C CG  . TYR D 2 26 ? 14.617  5.795   -1.742  1.00 29.13 ? 26 TYR D CG  1 
ATOM   780 C CD1 . TYR D 2 26 ? 15.779  5.591   -0.971  1.00 25.64 ? 26 TYR D CD1 1 
ATOM   781 C CD2 . TYR D 2 26 ? 14.575  5.244   -3.025  1.00 29.54 ? 26 TYR D CD2 1 
ATOM   782 C CE1 . TYR D 2 26 ? 16.871  4.873   -1.479  1.00 26.70 ? 26 TYR D CE1 1 
ATOM   783 C CE2 . TYR D 2 26 ? 15.662  4.530   -3.543  1.00 32.11 ? 26 TYR D CE2 1 
ATOM   784 C CZ  . TYR D 2 26 ? 16.804  4.350   -2.770  1.00 29.27 ? 26 TYR D CZ  1 
ATOM   785 O OH  . TYR D 2 26 ? 17.862  3.672   -3.321  1.00 30.82 ? 26 TYR D OH  1 
ATOM   786 N N   . THR D 2 27 ? 15.629  9.301   -2.278  1.00 26.73 ? 27 THR D N   1 
ATOM   787 C CA  . THR D 2 27 ? 16.399  9.969   -3.315  1.00 27.54 ? 27 THR D CA  1 
ATOM   788 C C   . THR D 2 27 ? 17.718  9.222   -3.473  1.00 30.44 ? 27 THR D C   1 
ATOM   789 O O   . THR D 2 27 ? 18.710  9.546   -2.835  1.00 30.08 ? 27 THR D O   1 
ATOM   790 C CB  . THR D 2 27 ? 16.727  11.410  -2.882  1.00 33.05 ? 27 THR D CB  1 
ATOM   791 O OG1 . THR D 2 27 ? 17.392  11.404  -1.599  1.00 36.02 ? 27 THR D OG1 1 
ATOM   792 C CG2 . THR D 2 27 ? 15.450  12.247  -2.797  1.00 35.35 ? 27 THR D CG2 1 
ATOM   793 N N   . PRO D 2 28 ? 17.754  8.228   -4.352  1.00 33.63 ? 28 PRO D N   1 
ATOM   794 C CA  . PRO D 2 28 ? 18.976  7.457   -4.561  1.00 36.07 ? 28 PRO D CA  1 
ATOM   795 C C   . PRO D 2 28 ? 20.189  8.211   -5.113  1.00 37.32 ? 28 PRO D C   1 
ATOM   796 O O   . PRO D 2 28 ? 21.318  7.878   -4.763  1.00 38.14 ? 28 PRO D O   1 
ATOM   797 C CB  . PRO D 2 28 ? 18.509  6.340   -5.506  1.00 39.99 ? 28 PRO D CB  1 
ATOM   798 C CG  . PRO D 2 28 ? 17.379  6.996   -6.281  1.00 36.76 ? 28 PRO D CG  1 
ATOM   799 C CD  . PRO D 2 28 ? 16.650  7.716   -5.186  1.00 38.31 ? 28 PRO D CD  1 
ATOM   800 N N   . LYS D 2 29 ? 19.972  9.215   -5.963  1.00 41.78 ? 29 LYS D N   1 
ATOM   801 C CA  . LYS D 2 29 ? 21.102  9.946   -6.568  1.00 47.13 ? 29 LYS D CA  1 
ATOM   802 C C   . LYS D 2 29 ? 21.961  10.696  -5.566  1.00 48.80 ? 29 LYS D C   1 
ATOM   803 O O   . LYS D 2 29 ? 23.188  10.730  -5.715  1.00 49.94 ? 29 LYS D O   1 
ATOM   804 C CB  . LYS D 2 29 ? 20.650  10.888  -7.693  1.00 45.80 ? 29 LYS D CB  1 
ATOM   805 C CG  . LYS D 2 29 ? 21.743  11.252  -8.743  1.00 49.87 ? 29 LYS D CG  1 
ATOM   806 C CD  . LYS D 2 29 ? 22.995  11.952  -8.160  1.00 43.53 ? 29 LYS D CD  1 
ATOM   807 C CE  . LYS D 2 29 ? 23.824  12.716  -9.203  1.00 43.05 ? 29 LYS D CE  1 
ATOM   808 N NZ  . LYS D 2 29 ? 23.571  14.209  -9.253  1.00 39.77 ? 29 LYS D NZ  1 
ATOM   809 N N   . THR D 2 30 ? 21.331  11.332  -4.583  1.00 48.17 ? 30 THR D N   1 
ATOM   810 C CA  . THR D 2 30 ? 22.100  12.035  -3.571  1.00 49.08 ? 30 THR D CA  1 
ATOM   811 C C   . THR D 2 30 ? 22.675  11.020  -2.574  1.00 50.01 ? 30 THR D C   1 
ATOM   812 O O   . THR D 2 30 ? 21.901  10.153  -2.125  1.00 53.21 ? 30 THR D O   1 
ATOM   813 C CB  . THR D 2 30 ? 21.258  13.104  -2.873  1.00 44.33 ? 30 THR D CB  1 
ATOM   814 O OG1 . THR D 2 30 ? 21.168  14.251  -3.728  1.00 46.61 ? 30 THR D OG1 1 
ATOM   815 C CG2 . THR D 2 30 ? 21.901  13.537  -1.591  1.00 43.55 ? 30 THR D CG2 1 
ATOM   816 O OXT . THR D 2 30 ? 23.899  11.060  -2.286  1.00 53.01 ? 30 THR D OXT 1 
HETATM 817 O O   . HOH E 3 .  ? 0.311   12.642  -8.518  1.00 11.93 ? 22 HOH A O   1 
HETATM 818 O O   . HOH E 3 .  ? -1.327  10.052  -1.152  1.00 10.12 ? 23 HOH A O   1 
HETATM 819 O O   . HOH E 3 .  ? -0.215  3.785   -17.525 1.00 38.72 ? 24 HOH A O   1 
HETATM 820 O O   . HOH E 3 .  ? -0.183  0.117   -16.447 1.00 24.99 ? 25 HOH A O   1 
HETATM 821 O O   . HOH E 3 .  ? -1.101  -1.431  -10.242 1.00 17.74 ? 26 HOH A O   1 
HETATM 822 O O   . HOH E 3 .  ? 6.312   5.257   -21.310 1.00 28.00 ? 27 HOH A O   1 
HETATM 823 O O   . HOH E 3 .  ? -5.743  2.079   -13.280 1.00 46.85 ? 28 HOH A O   1 
HETATM 824 O O   . HOH E 3 .  ? -7.744  3.692   -9.379  1.00 24.53 ? 29 HOH A O   1 
HETATM 825 O O   . HOH E 3 .  ? 6.936   11.478  -4.307  1.00 19.96 ? 30 HOH A O   1 
HETATM 826 O O   . HOH E 3 .  ? 7.211   3.980   -18.396 1.00 16.18 ? 31 HOH A O   1 
HETATM 827 O O   . HOH F 3 .  ? -2.367  -12.985 -5.518  1.00 18.33 ? 31 HOH B O   1 
HETATM 828 O O   . HOH F 3 .  ? 1.892   1.520   4.730   1.00 29.34 ? 32 HOH B O   1 
HETATM 829 O O   . HOH F 3 .  ? 13.527  4.818   -6.248  1.00 23.05 ? 33 HOH B O   1 
HETATM 830 O O   . HOH F 3 .  ? -2.930  -1.633  -8.332  1.00 24.49 ? 34 HOH B O   1 
HETATM 831 O O   . HOH F 3 .  ? -0.652  -4.569  -9.228  1.00 15.58 ? 35 HOH B O   1 
HETATM 832 O O   . HOH F 3 .  ? -5.207  -6.229  -0.958  1.00 26.73 ? 36 HOH B O   1 
HETATM 833 O O   . HOH F 3 .  ? -0.079  0.826   1.781   1.00 31.33 ? 37 HOH B O   1 
HETATM 834 O O   . HOH F 3 .  ? 9.531   -7.394  5.438   1.00 46.36 ? 38 HOH B O   1 
HETATM 835 O O   . HOH F 3 .  ? 5.613   -4.744  -5.602  1.00 34.26 ? 39 HOH B O   1 
HETATM 836 O O   . HOH F 3 .  ? 0.170   -8.068  -3.514  1.00 47.53 ? 40 HOH B O   1 
HETATM 837 O O   . HOH F 3 .  ? -9.926  -3.655  -7.600  1.00 34.45 ? 41 HOH B O   1 
HETATM 838 O O   . HOH F 3 .  ? 2.937   -4.446  4.226   1.00 36.39 ? 42 HOH B O   1 
HETATM 839 O O   . HOH F 3 .  ? 12.327  6.675   -13.516 1.00 19.06 ? 43 HOH B O   1 
HETATM 840 O O   . HOH F 3 .  ? 10.561  14.156  -16.775 1.00 50.26 ? 44 HOH B O   1 
HETATM 841 O O   . HOH F 3 .  ? -0.354  -3.082  4.666   1.00 32.52 ? 45 HOH B O   1 
HETATM 842 O O   . HOH F 3 .  ? 10.440  -3.559  -7.498  1.00 46.26 ? 46 HOH B O   1 
HETATM 843 O O   . HOH F 3 .  ? 18.836  11.377  -10.291 1.00 41.06 ? 47 HOH B O   1 
HETATM 844 O O   . HOH G 3 .  ? 26.755  11.096  2.892   1.00 27.95 ? 22 HOH C O   1 
HETATM 845 O O   . HOH G 3 .  ? 19.346  8.381   22.386  1.00 39.91 ? 24 HOH C O   1 
HETATM 846 O O   . HOH G 3 .  ? 28.120  5.799   7.631   1.00 15.60 ? 28 HOH C O   1 
HETATM 847 O O   . HOH H 3 .  ? 20.239  10.823  0.127   1.00 8.59  ? 31 HOH D O   1 
HETATM 848 O O   . HOH H 3 .  ? 29.265  -6.510  5.924   1.00 20.07 ? 32 HOH D O   1 
HETATM 849 O O   . HOH H 3 .  ? 7.177   3.616   7.206   1.00 19.54 ? 33 HOH D O   1 
HETATM 850 O O   . HOH H 3 .  ? 24.552  -0.564  7.113   1.00 19.07 ? 34 HOH D O   1 
HETATM 851 O O   . HOH H 3 .  ? 28.071  -5.057  10.952  1.00 18.32 ? 35 HOH D O   1 
HETATM 852 O O   . HOH H 3 .  ? 17.385  -4.948  -4.568  1.00 30.35 ? 36 HOH D O   1 
HETATM 853 O O   . HOH H 3 .  ? 21.791  0.738   -3.329  1.00 52.56 ? 37 HOH D O   1 
HETATM 854 O O   . HOH H 3 .  ? 13.100  12.926  3.928   1.00 23.85 ? 38 HOH D O   1 
HETATM 855 O O   . HOH H 3 .  ? 17.542  9.536   0.241   1.00 52.41 ? 39 HOH D O   1 
HETATM 856 O O   . HOH H 3 .  ? 13.842  15.343  5.100   1.00 20.44 ? 40 HOH D O   1 
HETATM 857 O O   . HOH H 3 .  ? 25.108  13.174  -0.938  1.00 19.81 ? 41 HOH D O   1 
HETATM 858 O O   . HOH H 3 .  ? 21.580  -4.624  -4.385  1.00 28.92 ? 42 HOH D O   1 
HETATM 859 O O   . HOH H 3 .  ? 22.622  6.286   -6.724  1.00 51.04 ? 43 HOH D O   1 
HETATM 860 O O   . HOH H 3 .  ? 32.250  -1.680  4.527   1.00 45.77 ? 44 HOH D O   1 
HETATM 861 O O   . HOH H 3 .  ? 10.310  10.496  15.992  1.00 36.37 ? 45 HOH D O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  GLY 1  1  1  GLY GLY A . n 
A 1 2  ILE 2  2  2  ILE ILE A . n 
A 1 3  VAL 3  3  3  VAL VAL A . n 
A 1 4  GLU 4  4  4  GLU GLU A . n 
A 1 5  GLN 5  5  5  GLN GLN A . n 
A 1 6  CYS 6  6  6  CYS CYS A . n 
A 1 7  CYS 7  7  7  CYS CYS A . n 
A 1 8  THR 8  8  8  THR THR A . n 
A 1 9  SER 9  9  9  SER SER A . n 
A 1 10 ILE 10 10 10 ILE ILE A . n 
A 1 11 CYS 11 11 11 CYS CYS A . n 
A 1 12 SER 12 12 12 SER SER A . n 
A 1 13 LEU 13 13 13 LEU LEU A . n 
A 1 14 TYR 14 14 14 TYR TYR A . n 
A 1 15 GLN 15 15 15 GLN GLN A . n 
A 1 16 LEU 16 16 16 LEU LEU A . n 
A 1 17 GLU 17 17 17 GLU GLU A . n 
A 1 18 ASN 18 18 18 ASN ASN A . n 
A 1 19 TYR 19 19 19 TYR TYR A . n 
A 1 20 CYS 20 20 20 CYS CYS A . n 
A 1 21 ASN 21 21 21 ASN ASN A . n 
B 2 1  PHE 1  1  1  PHE PHE B . n 
B 2 2  VAL 2  2  2  VAL VAL B . n 
B 2 3  ASN 3  3  3  ASN ASN B . n 
B 2 4  GLN 4  4  4  GLN GLN B . n 
B 2 5  HIS 5  5  5  HIS HIS B . n 
B 2 6  LEU 6  6  6  LEU LEU B . n 
B 2 7  CYS 7  7  7  CYS CYS B . n 
B 2 8  GLY 8  8  8  GLY GLY B . n 
B 2 9  GLU 9  9  9  GLU GLU B . n 
B 2 10 HIS 10 10 10 HIS HIS B . n 
B 2 11 LEU 11 11 11 LEU LEU B . n 
B 2 12 VAL 12 12 12 VAL VAL B . n 
B 2 13 GLU 13 13 13 GLU GLU B . n 
B 2 14 ALA 14 14 14 ALA ALA B . n 
B 2 15 LEU 15 15 15 LEU LEU B . n 
B 2 16 TYR 16 16 16 TYR TYR B . n 
B 2 17 LEU 17 17 17 LEU LEU B . n 
B 2 18 VAL 18 18 18 VAL VAL B . n 
B 2 19 CYS 19 19 19 CYS CYS B . n 
B 2 20 GLY 20 20 20 GLY GLY B . n 
B 2 21 GLU 21 21 21 GLU GLU B . n 
B 2 22 ARG 22 22 22 ARG ARG B . n 
B 2 23 GLY 23 23 23 GLY GLY B . n 
B 2 24 PHE 24 24 24 PHE PHE B . n 
B 2 25 PHE 25 25 25 PHE PHE B . n 
B 2 26 TYR 26 26 26 TYR TYR B . n 
B 2 27 THR 27 27 27 THR THR B . n 
B 2 28 PRO 28 28 28 PRO PRO B . n 
B 2 29 LYS 29 29 29 LYS LYS B . n 
B 2 30 THR 30 30 30 THR THR B . n 
C 1 1  GLY 1  1  1  GLY GLY C . n 
C 1 2  ILE 2  2  2  ILE ILE C . n 
C 1 3  VAL 3  3  3  VAL VAL C . n 
C 1 4  GLU 4  4  4  GLU GLU C . n 
C 1 5  GLN 5  5  5  GLN GLN C . n 
C 1 6  CYS 6  6  6  CYS CYS C . n 
C 1 7  CYS 7  7  7  CYS CYS C . n 
C 1 8  THR 8  8  8  THR THR C . n 
C 1 9  SER 9  9  9  SER SER C . n 
C 1 10 ILE 10 10 10 ILE ILE C . n 
C 1 11 CYS 11 11 11 CYS CYS C . n 
C 1 12 SER 12 12 12 SER SER C . n 
C 1 13 LEU 13 13 13 LEU LEU C . n 
C 1 14 TYR 14 14 14 TYR TYR C . n 
C 1 15 GLN 15 15 15 GLN GLN C . n 
C 1 16 LEU 16 16 16 LEU LEU C . n 
C 1 17 GLU 17 17 17 GLU GLU C . n 
C 1 18 ASN 18 18 18 ASN ASN C . n 
C 1 19 TYR 19 19 19 TYR TYR C . n 
C 1 20 CYS 20 20 20 CYS CYS C . n 
C 1 21 ASN 21 21 21 ASN ASN C . n 
D 2 1  PHE 1  1  1  PHE PHE D . n 
D 2 2  VAL 2  2  2  VAL VAL D . n 
D 2 3  ASN 3  3  3  ASN ASN D . n 
D 2 4  GLN 4  4  4  GLN GLN D . n 
D 2 5  HIS 5  5  5  HIS HIS D . n 
D 2 6  LEU 6  6  6  LEU LEU D . n 
D 2 7  CYS 7  7  7  CYS CYS D . n 
D 2 8  GLY 8  8  8  GLY GLY D . n 
D 2 9  GLU 9  9  9  GLU GLU D . n 
D 2 10 HIS 10 10 10 HIS HIS D . n 
D 2 11 LEU 11 11 11 LEU LEU D . n 
D 2 12 VAL 12 12 12 VAL VAL D . n 
D 2 13 GLU 13 13 13 GLU GLU D . n 
D 2 14 ALA 14 14 14 ALA ALA D . n 
D 2 15 LEU 15 15 15 LEU LEU D . n 
D 2 16 TYR 16 16 16 TYR TYR D . n 
D 2 17 LEU 17 17 17 LEU LEU D . n 
D 2 18 VAL 18 18 18 VAL VAL D . n 
D 2 19 CYS 19 19 19 CYS CYS D . n 
D 2 20 GLY 20 20 20 GLY GLY D . n 
D 2 21 GLU 21 21 21 GLU GLU D . n 
D 2 22 ARG 22 22 22 ARG ARG D . n 
D 2 23 GLY 23 23 23 GLY GLY D . n 
D 2 24 PHE 24 24 24 PHE PHE D . n 
D 2 25 PHE 25 25 25 PHE PHE D . n 
D 2 26 TYR 26 26 26 TYR TYR D . n 
D 2 27 THR 27 27 27 THR THR D . n 
D 2 28 PRO 28 28 28 PRO PRO D . n 
D 2 29 LYS 29 29 29 LYS LYS D . n 
D 2 30 THR 30 30 30 THR THR D . n 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA tetrameric 4 
2 software_defined_assembly            PISA tetrameric 4 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,B,C,D,E,F,G,H 
2 1 A,B,E,F         
2 2 C,D,G,H         
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 3720 ? 
1 MORE         -37  ? 
1 'SSA (A^2)'  6910 ? 
2 'ABSA (A^2)' 3740 ? 
2 MORE         -39  ? 
2 'SSA (A^2)'  6880 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z           1.0000000000  0.0000000000 0.0000000000 0.0000000000  0.0000000000 
1.0000000000  0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000   
2 'crystal symmetry operation' 2_554 -x+1/2,-y,z-1/2 -1.0000000000 0.0000000000 0.0000000000 22.2800000000 0.0000000000 
-1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 -25.9250000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1999-11-17 
2 'Structure model' 1 1 2008-04-26 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
DENZO  'data reduction' .   ? 1 
X-PLOR 'model building' .   ? 2 
X-PLOR refinement       3.1 ? 3 
X-PLOR phasing          .   ? 4 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 SER A 9  ? ? -114.32 -165.99 
2 1 PRO B 28 ? ? -69.45  91.28   
# 
_pdbx_entity_nonpoly.entity_id   3 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 3 HOH 1  22 1  HOH HOH A . 
E 3 HOH 2  23 3  HOH HOH A . 
E 3 HOH 3  24 7  HOH HOH A . 
E 3 HOH 4  25 10 HOH HOH A . 
E 3 HOH 5  26 11 HOH HOH A . 
E 3 HOH 6  27 12 HOH HOH A . 
E 3 HOH 7  28 13 HOH HOH A . 
E 3 HOH 8  29 15 HOH HOH A . 
E 3 HOH 9  30 23 HOH HOH A . 
E 3 HOH 10 31 33 HOH HOH A . 
F 3 HOH 1  31 2  HOH HOH B . 
F 3 HOH 2  32 8  HOH HOH B . 
F 3 HOH 3  33 14 HOH HOH B . 
F 3 HOH 4  34 16 HOH HOH B . 
F 3 HOH 5  35 18 HOH HOH B . 
F 3 HOH 6  36 20 HOH HOH B . 
F 3 HOH 7  37 21 HOH HOH B . 
F 3 HOH 8  38 26 HOH HOH B . 
F 3 HOH 9  39 30 HOH HOH B . 
F 3 HOH 10 40 31 HOH HOH B . 
F 3 HOH 11 41 34 HOH HOH B . 
F 3 HOH 12 42 36 HOH HOH B . 
F 3 HOH 13 43 37 HOH HOH B . 
F 3 HOH 14 44 38 HOH HOH B . 
F 3 HOH 15 45 39 HOH HOH B . 
F 3 HOH 16 46 41 HOH HOH B . 
F 3 HOH 17 47 42 HOH HOH B . 
G 3 HOH 1  22 22 HOH HOH C . 
G 3 HOH 2  24 24 HOH HOH C . 
G 3 HOH 3  28 28 HOH HOH C . 
H 3 HOH 1  31 4  HOH HOH D . 
H 3 HOH 2  32 5  HOH HOH D . 
H 3 HOH 3  33 6  HOH HOH D . 
H 3 HOH 4  34 9  HOH HOH D . 
H 3 HOH 5  35 17 HOH HOH D . 
H 3 HOH 6  36 19 HOH HOH D . 
H 3 HOH 7  37 25 HOH HOH D . 
H 3 HOH 8  38 27 HOH HOH D . 
H 3 HOH 9  39 29 HOH HOH D . 
H 3 HOH 10 40 32 HOH HOH D . 
H 3 HOH 11 41 35 HOH HOH D . 
H 3 HOH 12 42 40 HOH HOH D . 
H 3 HOH 13 43 43 HOH HOH D . 
H 3 HOH 14 44 44 HOH HOH D . 
H 3 HOH 15 45 45 HOH HOH D . 
#