data_1BA4
# 
_entry.id   1BA4 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1BA4         
WWPDB D_1000171513 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1BA4 
_pdbx_database_status.recvd_initial_deposition_date   1998-04-07 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Coles, M.'     1 
'Bicknell, W.'  2 
'Watson, A.A.'  3 
'Fairlie, D.P.' 4 
'Craik, D.J.'   5 
# 
_citation.id                        primary 
_citation.title                     
;Solution structure of amyloid beta-peptide(1-40) in a water-micelle environment. Is the membrane-spanning domain where we think it is?
;
_citation.journal_abbrev            Biochemistry 
_citation.journal_volume            37 
_citation.page_first                11064 
_citation.page_last                 11077 
_citation.year                      1998 
_citation.journal_id_ASTM           BICHAW 
_citation.country                   US 
_citation.journal_id_ISSN           0006-2960 
_citation.journal_id_CSD            0033 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   9693002 
_citation.pdbx_database_id_DOI      10.1021/bi972979f 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Coles, M.'     1 
primary 'Bicknell, W.'  2 
primary 'Watson, A.A.'  3 
primary 'Fairlie, D.P.' 4 
primary 'Craik, D.J.'   5 
# 
_cell.entry_id           1BA4 
_cell.length_a           1.000 
_cell.length_b           1.000 
_cell.length_c           1.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1BA4 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'AMYLOID BETA-PEPTIDE' 
_entity.formula_weight             4335.852 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              ABETA 
_entity.details                    ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV 
_entity_poly.pdbx_seq_one_letter_code_can   DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV 
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  ASP n 
1 2  ALA n 
1 3  GLU n 
1 4  PHE n 
1 5  ARG n 
1 6  HIS n 
1 7  ASP n 
1 8  SER n 
1 9  GLY n 
1 10 TYR n 
1 11 GLU n 
1 12 VAL n 
1 13 HIS n 
1 14 HIS n 
1 15 GLN n 
1 16 LYS n 
1 17 LEU n 
1 18 VAL n 
1 19 PHE n 
1 20 PHE n 
1 21 ALA n 
1 22 GLU n 
1 23 ASP n 
1 24 VAL n 
1 25 GLY n 
1 26 SER n 
1 27 ASN n 
1 28 LYS n 
1 29 GLY n 
1 30 ALA n 
1 31 ILE n 
1 32 ILE n 
1 33 GLY n 
1 34 LEU n 
1 35 MET n 
1 36 VAL n 
1 37 GLY n 
1 38 GLY n 
1 39 VAL n 
1 40 VAL n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      unidentified 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     32644 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    A4_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P05067 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   
;MLPGLALLLLAAWTARALEVPTDGNAGLLAEPQIAMFCGRLNMHMNVQNGKWDSDPSGTKTCIDTKEGILQYCQEVYPEL
QITNVVEANQPVTIQNWCKRGRKQCKTHPHFVIPYRCLVGEFVSDALLVPDKCKFLHQERMDVCETHLHWHTVAKETCSE
KSTNLHDYGMLLPCGIDKFRGVEFVCCPLAEESDNVDSADAEEDDSDVWWGGADTDYADGSEDKVVEVAEEEEVAEVEEE
EADDDEDDEDGDEVEEEAEEPYEEATERTTSIATTTTTTTESVEEVVREVCSEQAETGPCRAMISRWYFDVTEGKCAPFF
YGGCGGNRNNFDTEEYCMAVCGSAMSQSLLKTTQEPLARDPVKLPTTAASTPDAVDKYLETPGDENEHAHFQKAKERLEA
KHRERMSQVMREWEEAERQAKNLPKADKKAVIQHFQEKVESLEQEAANERQQLVETHMARVEAMLNDRRRLALENYITAL
QAVPPRPRHVFNMLKKYVRAEQKDRQHTLKHFEHVRMVDPKKAAQIRSQVMTHLRVIYERMNQSLSLLYNVPAVAEEIQD
EVDELLQKEQNYSDDVLANMISEPRISYGNDALMPSLTETKTTVELLPVNGEFSLDDLQPWHSFGADSVPANTENEVEPV
DARPAADRGLTTRPGSGLTNIKTEEISEVKMDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIATVIVITL
VMLKKKQYTSIHHGVVEVDAAVTPEERHLSKMQQNGYENPTYKFFEQMQN
;
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1BA4 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 40 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P05067 
_struct_ref_seq.db_align_beg                  672 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  711 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       40 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
_pdbx_nmr_exptl.solution_id 
1 1 NOESY 1 
2 1 TOCSY 1 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         298 
_pdbx_nmr_exptl_sample_conditions.pressure            ? 
_pdbx_nmr_exptl_sample_conditions.pH                  5.1 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      ? 
_pdbx_nmr_exptl_sample_conditions.pressure_units      . 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
loop_
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.field_strength 
1 AMX-500 Bruker 500 
2 DRX-500 Bruker 600 
3 AMX-600 Bruker 750 
4 DRX-750 Bruker 750 
# 
_pdbx_nmr_refine.entry_id           1BA4 
_pdbx_nmr_refine.method             'SIMULATED ANNEALING USING NOE DISTANCE CONSTRAINTS' 
_pdbx_nmr_refine.details            'REFINEMENT DETAILS CAN BE FOUND IN JOURNAL CITATION ABOVE.' 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.entry_id                             1BA4 
_pdbx_nmr_ensemble.conformers_calculated_total_number   50 
_pdbx_nmr_ensemble.conformers_submitted_total_number    10 
_pdbx_nmr_ensemble.conformer_selection_criteria         'LOW ENERGY, VIOLATIONS AND RMSD' 
# 
loop_
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
refinement           X-PLOR ? BRUNGER 1 
'structure solution' X-PLOR ? ?       2 
# 
_exptl.entry_id          1BA4 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_struct.entry_id                  1BA4 
_struct.title                     
;THE SOLUTION STRUCTURE OF AMYLOID BETA-PEPTIDE (1-40) IN A WATER-MICELLE ENVIRONMENT. IS THE MEMBRANE-SPANNING DOMAIN WHERE WE THINK IT IS? NMR, 10 STRUCTURES
;
_struct.pdbx_descriptor           'AMYLOID BETA-PEPTIDE' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1BA4 
_struct_keywords.pdbx_keywords   GLYCOPROTEIN 
_struct_keywords.text            
;GLYCOPROTEIN, AMYLOID BETA-PEPTIDE, ALZHEIMER'S DISEASE, SDS-MICELLES
;
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   Y 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id   1 
# 
_struct_conf.conf_type_id            HELX_P 
_struct_conf.id                      HELX_P1 
_struct_conf.pdbx_PDB_helix_id       1 
_struct_conf.beg_label_comp_id       GLN 
_struct_conf.beg_label_asym_id       A 
_struct_conf.beg_label_seq_id        15 
_struct_conf.pdbx_beg_PDB_ins_code   ? 
_struct_conf.end_label_comp_id       VAL 
_struct_conf.end_label_asym_id       A 
_struct_conf.end_label_seq_id        36 
_struct_conf.pdbx_end_PDB_ins_code   ? 
_struct_conf.beg_auth_comp_id        GLN 
_struct_conf.beg_auth_asym_id        A 
_struct_conf.beg_auth_seq_id         15 
_struct_conf.end_auth_comp_id        VAL 
_struct_conf.end_auth_asym_id        A 
_struct_conf.end_auth_seq_id         36 
_struct_conf.pdbx_PDB_helix_class    1 
_struct_conf.details                 ? 
_struct_conf.pdbx_PDB_helix_length   22 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_database_PDB_matrix.entry_id          1BA4 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1BA4 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1    N N    . ASP A 1 1  ? 1.324   -5.770  -9.642  1.00 0.00 ? 1  ASP A N    1  
ATOM 2    C CA   . ASP A 1 1  ? 2.139   -6.771  -10.393 1.00 0.00 ? 1  ASP A CA   1  
ATOM 3    C C    . ASP A 1 1  ? 1.242   -7.918  -10.889 1.00 0.00 ? 1  ASP A C    1  
ATOM 4    O O    . ASP A 1 1  ? 0.032   -7.850  -10.787 1.00 0.00 ? 1  ASP A O    1  
ATOM 5    C CB   . ASP A 1 1  ? 3.247   -7.330  -9.463  1.00 0.00 ? 1  ASP A CB   1  
ATOM 6    C CG   . ASP A 1 1  ? 2.613   -8.161  -8.330  1.00 0.00 ? 1  ASP A CG   1  
ATOM 7    O OD1  . ASP A 1 1  ? 2.229   -7.540  -7.352  1.00 0.00 ? 1  ASP A OD1  1  
ATOM 8    O OD2  . ASP A 1 1  ? 2.546   -9.367  -8.508  1.00 0.00 ? 1  ASP A OD2  1  
ATOM 9    H H1   . ASP A 1 1  ? 0.330   -6.074  -9.623  1.00 0.00 ? 1  ASP A H1   1  
ATOM 10   H H2   . ASP A 1 1  ? 1.680   -5.696  -8.668  1.00 0.00 ? 1  ASP A H2   1  
ATOM 11   H H3   . ASP A 1 1  ? 1.396   -4.845  -10.111 1.00 0.00 ? 1  ASP A H3   1  
ATOM 12   H HA   . ASP A 1 1  ? 2.584   -6.283  -11.248 1.00 0.00 ? 1  ASP A HA   1  
ATOM 13   H HB2  . ASP A 1 1  ? 3.930   -7.950  -10.025 1.00 0.00 ? 1  ASP A HB2  1  
ATOM 14   H HB3  . ASP A 1 1  ? 3.808   -6.514  -9.029  1.00 0.00 ? 1  ASP A HB3  1  
ATOM 15   N N    . ALA A 1 2  ? 1.870   -8.940  -11.418 1.00 0.00 ? 2  ALA A N    1  
ATOM 16   C CA   . ALA A 1 2  ? 1.108   -10.116 -11.931 1.00 0.00 ? 2  ALA A CA   1  
ATOM 17   C C    . ALA A 1 2  ? 0.841   -11.023 -10.735 1.00 0.00 ? 2  ALA A C    1  
ATOM 18   O O    . ALA A 1 2  ? 1.727   -11.721 -10.278 1.00 0.00 ? 2  ALA A O    1  
ATOM 19   C CB   . ALA A 1 2  ? 1.938   -10.883 -12.978 1.00 0.00 ? 2  ALA A CB   1  
ATOM 20   H H    . ALA A 1 2  ? 2.847   -8.934  -11.476 1.00 0.00 ? 2  ALA A H    1  
ATOM 21   H HA   . ALA A 1 2  ? 0.171   -9.788  -12.359 1.00 0.00 ? 2  ALA A HA   1  
ATOM 22   H HB1  . ALA A 1 2  ? 2.989   -10.827 -12.742 1.00 0.00 ? 2  ALA A HB1  1  
ATOM 23   H HB2  . ALA A 1 2  ? 1.647   -11.925 -12.987 1.00 0.00 ? 2  ALA A HB2  1  
ATOM 24   H HB3  . ALA A 1 2  ? 1.771   -10.474 -13.962 1.00 0.00 ? 2  ALA A HB3  1  
ATOM 25   N N    . GLU A 1 3  ? -0.376  -10.983 -10.259 1.00 0.00 ? 3  GLU A N    1  
ATOM 26   C CA   . GLU A 1 3  ? -0.754  -11.835 -9.091  1.00 0.00 ? 3  GLU A CA   1  
ATOM 27   C C    . GLU A 1 3  ? -0.620  -13.317 -9.489  1.00 0.00 ? 3  GLU A C    1  
ATOM 28   O O    . GLU A 1 3  ? -0.517  -14.183 -8.642  1.00 0.00 ? 3  GLU A O    1  
ATOM 29   C CB   . GLU A 1 3  ? -2.207  -11.485 -8.693  1.00 0.00 ? 3  GLU A CB   1  
ATOM 30   C CG   . GLU A 1 3  ? -2.209  -10.293 -7.700  1.00 0.00 ? 3  GLU A CG   1  
ATOM 31   C CD   . GLU A 1 3  ? -1.576  -9.042  -8.346  1.00 0.00 ? 3  GLU A CD   1  
ATOM 32   O OE1  . GLU A 1 3  ? -2.321  -8.326  -8.995  1.00 0.00 ? 3  GLU A OE1  1  
ATOM 33   O OE2  . GLU A 1 3  ? -0.383  -8.871  -8.156  1.00 0.00 ? 3  GLU A OE2  1  
ATOM 34   H H    . GLU A 1 3  ? -1.041  -10.392 -10.670 1.00 0.00 ? 3  GLU A H    1  
ATOM 35   H HA   . GLU A 1 3  ? -0.071  -11.636 -8.278  1.00 0.00 ? 3  GLU A HA   1  
ATOM 36   H HB2  . GLU A 1 3  ? -2.779  -11.224 -9.572  1.00 0.00 ? 3  GLU A HB2  1  
ATOM 37   H HB3  . GLU A 1 3  ? -2.677  -12.337 -8.224  1.00 0.00 ? 3  GLU A HB3  1  
ATOM 38   H HG2  . GLU A 1 3  ? -3.225  -10.065 -7.412  1.00 0.00 ? 3  GLU A HG2  1  
ATOM 39   H HG3  . GLU A 1 3  ? -1.654  -10.553 -6.809  1.00 0.00 ? 3  GLU A HG3  1  
ATOM 40   N N    . PHE A 1 4  ? -0.625  -13.535 -10.782 1.00 0.00 ? 4  PHE A N    1  
ATOM 41   C CA   . PHE A 1 4  ? -0.505  -14.890 -11.393 1.00 0.00 ? 4  PHE A CA   1  
ATOM 42   C C    . PHE A 1 4  ? -0.640  -14.710 -12.912 1.00 0.00 ? 4  PHE A C    1  
ATOM 43   O O    . PHE A 1 4  ? -1.733  -14.507 -13.401 1.00 0.00 ? 4  PHE A O    1  
ATOM 44   C CB   . PHE A 1 4  ? -1.633  -15.823 -10.881 1.00 0.00 ? 4  PHE A CB   1  
ATOM 45   C CG   . PHE A 1 4  ? -1.556  -17.148 -11.655 1.00 0.00 ? 4  PHE A CG   1  
ATOM 46   C CD1  . PHE A 1 4  ? -0.666  -18.128 -11.264 1.00 0.00 ? 4  PHE A CD1  1  
ATOM 47   C CD2  . PHE A 1 4  ? -2.371  -17.373 -12.749 1.00 0.00 ? 4  PHE A CD2  1  
ATOM 48   C CE1  . PHE A 1 4  ? -0.590  -19.319 -11.957 1.00 0.00 ? 4  PHE A CE1  1  
ATOM 49   C CE2  . PHE A 1 4  ? -2.297  -18.562 -13.443 1.00 0.00 ? 4  PHE A CE2  1  
ATOM 50   C CZ   . PHE A 1 4  ? -1.405  -19.537 -13.047 1.00 0.00 ? 4  PHE A CZ   1  
ATOM 51   H H    . PHE A 1 4  ? -0.714  -12.770 -11.387 1.00 0.00 ? 4  PHE A H    1  
ATOM 52   H HA   . PHE A 1 4  ? 0.471   -15.296 -11.165 1.00 0.00 ? 4  PHE A HA   1  
ATOM 53   H HB2  . PHE A 1 4  ? -1.512  -16.033 -9.829  1.00 0.00 ? 4  PHE A HB2  1  
ATOM 54   H HB3  . PHE A 1 4  ? -2.603  -15.374 -11.040 1.00 0.00 ? 4  PHE A HB3  1  
ATOM 55   H HD1  . PHE A 1 4  ? -0.022  -17.958 -10.413 1.00 0.00 ? 4  PHE A HD1  1  
ATOM 56   H HD2  . PHE A 1 4  ? -3.069  -16.611 -13.065 1.00 0.00 ? 4  PHE A HD2  1  
ATOM 57   H HE1  . PHE A 1 4  ? 0.108   -20.081 -11.645 1.00 0.00 ? 4  PHE A HE1  1  
ATOM 58   H HE2  . PHE A 1 4  ? -2.935  -18.731 -14.297 1.00 0.00 ? 4  PHE A HE2  1  
ATOM 59   H HZ   . PHE A 1 4  ? -1.346  -20.469 -13.589 1.00 0.00 ? 4  PHE A HZ   1  
ATOM 60   N N    . ARG A 1 5  ? 0.462   -14.780 -13.616 1.00 0.00 ? 5  ARG A N    1  
ATOM 61   C CA   . ARG A 1 5  ? 0.451   -14.621 -15.110 1.00 0.00 ? 5  ARG A CA   1  
ATOM 62   C C    . ARG A 1 5  ? -0.493  -13.484 -15.567 1.00 0.00 ? 5  ARG A C    1  
ATOM 63   O O    . ARG A 1 5  ? -1.450  -13.711 -16.283 1.00 0.00 ? 5  ARG A O    1  
ATOM 64   C CB   . ARG A 1 5  ? 0.022   -15.986 -15.727 1.00 0.00 ? 5  ARG A CB   1  
ATOM 65   C CG   . ARG A 1 5  ? 0.272   -16.001 -17.263 1.00 0.00 ? 5  ARG A CG   1  
ATOM 66   C CD   . ARG A 1 5  ? -1.046  -16.281 -18.015 1.00 0.00 ? 5  ARG A CD   1  
ATOM 67   N NE   . ARG A 1 5  ? -0.831  -15.965 -19.460 1.00 0.00 ? 5  ARG A NE   1  
ATOM 68   C CZ   . ARG A 1 5  ? -1.785  -16.124 -20.345 1.00 0.00 ? 5  ARG A CZ   1  
ATOM 69   N NH1  . ARG A 1 5  ? -2.959  -16.568 -19.983 1.00 0.00 ? 5  ARG A NH1  1  
ATOM 70   N NH2  . ARG A 1 5  ? -1.524  -15.826 -21.587 1.00 0.00 ? 5  ARG A NH2  1  
ATOM 71   H H    . ARG A 1 5  ? 1.309   -14.938 -13.152 1.00 0.00 ? 5  ARG A H    1  
ATOM 72   H HA   . ARG A 1 5  ? 1.454   -14.380 -15.430 1.00 0.00 ? 5  ARG A HA   1  
ATOM 73   H HB2  . ARG A 1 5  ? 0.602   -16.776 -15.271 1.00 0.00 ? 5  ARG A HB2  1  
ATOM 74   H HB3  . ARG A 1 5  ? -1.020  -16.171 -15.504 1.00 0.00 ? 5  ARG A HB3  1  
ATOM 75   H HG2  . ARG A 1 5  ? 0.685   -15.060 -17.598 1.00 0.00 ? 5  ARG A HG2  1  
ATOM 76   H HG3  . ARG A 1 5  ? 0.978   -16.784 -17.496 1.00 0.00 ? 5  ARG A HG3  1  
ATOM 77   H HD2  . ARG A 1 5  ? -1.316  -17.324 -17.921 1.00 0.00 ? 5  ARG A HD2  1  
ATOM 78   H HD3  . ARG A 1 5  ? -1.854  -15.669 -17.642 1.00 0.00 ? 5  ARG A HD3  1  
ATOM 79   H HE   . ARG A 1 5  ? 0.041   -15.630 -19.753 1.00 0.00 ? 5  ARG A HE   1  
ATOM 80   H HH11 . ARG A 1 5  ? -3.139  -16.791 -19.024 1.00 0.00 ? 5  ARG A HH11 1  
ATOM 81   H HH12 . ARG A 1 5  ? -3.679  -16.686 -20.666 1.00 0.00 ? 5  ARG A HH12 1  
ATOM 82   H HH21 . ARG A 1 5  ? -0.620  -15.484 -21.840 1.00 0.00 ? 5  ARG A HH21 1  
ATOM 83   H HH22 . ARG A 1 5  ? -2.230  -15.937 -22.288 1.00 0.00 ? 5  ARG A HH22 1  
ATOM 84   N N    . HIS A 1 6  ? -0.177  -12.293 -15.117 1.00 0.00 ? 6  HIS A N    1  
ATOM 85   C CA   . HIS A 1 6  ? -0.962  -11.051 -15.441 1.00 0.00 ? 6  HIS A CA   1  
ATOM 86   C C    . HIS A 1 6  ? -2.496  -11.247 -15.475 1.00 0.00 ? 6  HIS A C    1  
ATOM 87   O O    . HIS A 1 6  ? -3.194  -10.637 -16.264 1.00 0.00 ? 6  HIS A O    1  
ATOM 88   C CB   . HIS A 1 6  ? -0.450  -10.505 -16.814 1.00 0.00 ? 6  HIS A CB   1  
ATOM 89   C CG   . HIS A 1 6  ? -0.636  -11.547 -17.925 1.00 0.00 ? 6  HIS A CG   1  
ATOM 90   N ND1  . HIS A 1 6  ? -1.766  -11.861 -18.468 1.00 0.00 ? 6  HIS A ND1  1  
ATOM 91   C CD2  . HIS A 1 6  ? 0.288   -12.352 -18.570 1.00 0.00 ? 6  HIS A CD2  1  
ATOM 92   C CE1  . HIS A 1 6  ? -1.579  -12.774 -19.367 1.00 0.00 ? 6  HIS A CE1  1  
ATOM 93   N NE2  . HIS A 1 6  ? -0.316  -13.109 -19.465 1.00 0.00 ? 6  HIS A NE2  1  
ATOM 94   H H    . HIS A 1 6  ? 0.611   -12.211 -14.541 1.00 0.00 ? 6  HIS A H    1  
ATOM 95   H HA   . HIS A 1 6  ? -0.748  -10.324 -14.672 1.00 0.00 ? 6  HIS A HA   1  
ATOM 96   H HB2  . HIS A 1 6  ? -0.987  -9.609  -17.087 1.00 0.00 ? 6  HIS A HB2  1  
ATOM 97   H HB3  . HIS A 1 6  ? 0.599   -10.264 -16.740 1.00 0.00 ? 6  HIS A HB3  1  
ATOM 98   H HD1  . HIS A 1 6  ? -2.632  -11.469 -18.234 1.00 0.00 ? 6  HIS A HD1  1  
ATOM 99   H HD2  . HIS A 1 6  ? 1.349   -12.360 -18.370 1.00 0.00 ? 6  HIS A HD2  1  
ATOM 100  H HE1  . HIS A 1 6  ? -2.368  -13.205 -19.964 1.00 0.00 ? 6  HIS A HE1  1  
ATOM 101  N N    . ASP A 1 7  ? -2.970  -12.101 -14.604 1.00 0.00 ? 7  ASP A N    1  
ATOM 102  C CA   . ASP A 1 7  ? -4.428  -12.407 -14.505 1.00 0.00 ? 7  ASP A CA   1  
ATOM 103  C C    . ASP A 1 7  ? -5.272  -11.163 -14.200 1.00 0.00 ? 7  ASP A C    1  
ATOM 104  O O    . ASP A 1 7  ? -4.786  -10.203 -13.632 1.00 0.00 ? 7  ASP A O    1  
ATOM 105  C CB   . ASP A 1 7  ? -4.636  -13.444 -13.393 1.00 0.00 ? 7  ASP A CB   1  
ATOM 106  C CG   . ASP A 1 7  ? -4.264  -12.825 -12.025 1.00 0.00 ? 7  ASP A CG   1  
ATOM 107  O OD1  . ASP A 1 7  ? -3.076  -12.689 -11.783 1.00 0.00 ? 7  ASP A OD1  1  
ATOM 108  O OD2  . ASP A 1 7  ? -5.194  -12.520 -11.297 1.00 0.00 ? 7  ASP A OD2  1  
ATOM 109  H H    . ASP A 1 7  ? -2.366  -12.566 -13.993 1.00 0.00 ? 7  ASP A H    1  
ATOM 110  H HA   . ASP A 1 7  ? -4.752  -12.823 -15.448 1.00 0.00 ? 7  ASP A HA   1  
ATOM 111  H HB2  . ASP A 1 7  ? -5.669  -13.744 -13.380 1.00 0.00 ? 7  ASP A HB2  1  
ATOM 112  H HB3  . ASP A 1 7  ? -4.035  -14.321 -13.570 1.00 0.00 ? 7  ASP A HB3  1  
ATOM 113  N N    . SER A 1 8  ? -6.517  -11.235 -14.595 1.00 0.00 ? 8  SER A N    1  
ATOM 114  C CA   . SER A 1 8  ? -7.466  -10.107 -14.366 1.00 0.00 ? 8  SER A CA   1  
ATOM 115  C C    . SER A 1 8  ? -7.833  -10.058 -12.873 1.00 0.00 ? 8  SER A C    1  
ATOM 116  O O    . SER A 1 8  ? -7.717  -11.054 -12.182 1.00 0.00 ? 8  SER A O    1  
ATOM 117  C CB   . SER A 1 8  ? -8.726  -10.333 -15.222 1.00 0.00 ? 8  SER A CB   1  
ATOM 118  O OG   . SER A 1 8  ? -9.174  -11.635 -14.868 1.00 0.00 ? 8  SER A OG   1  
ATOM 119  H H    . SER A 1 8  ? -6.837  -12.041 -15.048 1.00 0.00 ? 8  SER A H    1  
ATOM 120  H HA   . SER A 1 8  ? -6.983  -9.185  -14.651 1.00 0.00 ? 8  SER A HA   1  
ATOM 121  H HB2  . SER A 1 8  ? -9.499  -9.613  -14.994 1.00 0.00 ? 8  SER A HB2  1  
ATOM 122  H HB3  . SER A 1 8  ? -8.495  -10.308 -16.277 1.00 0.00 ? 8  SER A HB3  1  
ATOM 123  H HG   . SER A 1 8  ? -9.152  -12.184 -15.656 1.00 0.00 ? 8  SER A HG   1  
ATOM 124  N N    . GLY A 1 9  ? -8.263  -8.908  -12.420 1.00 0.00 ? 9  GLY A N    1  
ATOM 125  C CA   . GLY A 1 9  ? -8.644  -8.759  -10.986 1.00 0.00 ? 9  GLY A CA   1  
ATOM 126  C C    . GLY A 1 9  ? -8.455  -7.313  -10.538 1.00 0.00 ? 9  GLY A C    1  
ATOM 127  O O    . GLY A 1 9  ? -7.427  -6.967  -9.985  1.00 0.00 ? 9  GLY A O    1  
ATOM 128  H H    . GLY A 1 9  ? -8.343  -8.136  -13.020 1.00 0.00 ? 9  GLY A H    1  
ATOM 129  H HA2  . GLY A 1 9  ? -9.679  -9.042  -10.863 1.00 0.00 ? 9  GLY A HA2  1  
ATOM 130  H HA3  . GLY A 1 9  ? -8.022  -9.398  -10.374 1.00 0.00 ? 9  GLY A HA3  1  
ATOM 131  N N    . TYR A 1 10 ? -9.461  -6.516  -10.799 1.00 0.00 ? 10 TYR A N    1  
ATOM 132  C CA   . TYR A 1 10 ? -9.436  -5.064  -10.419 1.00 0.00 ? 10 TYR A CA   1  
ATOM 133  C C    . TYR A 1 10 ? -9.131  -4.901  -8.912  1.00 0.00 ? 10 TYR A C    1  
ATOM 134  O O    . TYR A 1 10 ? -8.630  -3.881  -8.483  1.00 0.00 ? 10 TYR A O    1  
ATOM 135  C CB   . TYR A 1 10 ? -10.822 -4.441  -10.778 1.00 0.00 ? 10 TYR A CB   1  
ATOM 136  C CG   . TYR A 1 10 ? -11.790 -4.509  -9.577  1.00 0.00 ? 10 TYR A CG   1  
ATOM 137  C CD1  . TYR A 1 10 ? -12.308 -5.720  -9.156  1.00 0.00 ? 10 TYR A CD1  1  
ATOM 138  C CD2  . TYR A 1 10 ? -12.142 -3.359  -8.898  1.00 0.00 ? 10 TYR A CD2  1  
ATOM 139  C CE1  . TYR A 1 10 ? -13.162 -5.776  -8.074  1.00 0.00 ? 10 TYR A CE1  1  
ATOM 140  C CE2  . TYR A 1 10 ? -12.995 -3.416  -7.818  1.00 0.00 ? 10 TYR A CE2  1  
ATOM 141  C CZ   . TYR A 1 10 ? -13.510 -4.625  -7.399  1.00 0.00 ? 10 TYR A CZ   1  
ATOM 142  O OH   . TYR A 1 10 ? -14.359 -4.681  -6.313  1.00 0.00 ? 10 TYR A OH   1  
ATOM 143  H H    . TYR A 1 10 ? -10.246 -6.883  -11.256 1.00 0.00 ? 10 TYR A H    1  
ATOM 144  H HA   . TYR A 1 10 ? -8.656  -4.573  -10.985 1.00 0.00 ? 10 TYR A HA   1  
ATOM 145  H HB2  . TYR A 1 10 ? -10.691 -3.407  -11.063 1.00 0.00 ? 10 TYR A HB2  1  
ATOM 146  H HB3  . TYR A 1 10 ? -11.266 -4.971  -11.609 1.00 0.00 ? 10 TYR A HB3  1  
ATOM 147  H HD1  . TYR A 1 10 ? -12.045 -6.629  -9.676  1.00 0.00 ? 10 TYR A HD1  1  
ATOM 148  H HD2  . TYR A 1 10 ? -11.747 -2.405  -9.216  1.00 0.00 ? 10 TYR A HD2  1  
ATOM 149  H HE1  . TYR A 1 10 ? -13.560 -6.729  -7.755  1.00 0.00 ? 10 TYR A HE1  1  
ATOM 150  H HE2  . TYR A 1 10 ? -13.261 -2.508  -7.297  1.00 0.00 ? 10 TYR A HE2  1  
ATOM 151  H HH   . TYR A 1 10 ? -13.822 -4.717  -5.519  1.00 0.00 ? 10 TYR A HH   1  
ATOM 152  N N    . GLU A 1 11 ? -9.465  -5.944  -8.187  1.00 0.00 ? 11 GLU A N    1  
ATOM 153  C CA   . GLU A 1 11 ? -9.272  -6.029  -6.709  1.00 0.00 ? 11 GLU A CA   1  
ATOM 154  C C    . GLU A 1 11 ? -10.226 -5.079  -5.963  1.00 0.00 ? 11 GLU A C    1  
ATOM 155  O O    . GLU A 1 11 ? -11.231 -5.525  -5.443  1.00 0.00 ? 11 GLU A O    1  
ATOM 156  C CB   . GLU A 1 11 ? -7.778  -5.701  -6.388  1.00 0.00 ? 11 GLU A CB   1  
ATOM 157  C CG   . GLU A 1 11 ? -7.402  -6.237  -4.988  1.00 0.00 ? 11 GLU A CG   1  
ATOM 158  C CD   . GLU A 1 11 ? -6.286  -5.358  -4.394  1.00 0.00 ? 11 GLU A CD   1  
ATOM 159  O OE1  . GLU A 1 11 ? -6.613  -4.242  -4.024  1.00 0.00 ? 11 GLU A OE1  1  
ATOM 160  O OE2  . GLU A 1 11 ? -5.170  -5.849  -4.343  1.00 0.00 ? 11 GLU A OE2  1  
ATOM 161  H H    . GLU A 1 11 ? -9.868  -6.713  -8.642  1.00 0.00 ? 11 GLU A H    1  
ATOM 162  H HA   . GLU A 1 11 ? -9.492  -7.043  -6.407  1.00 0.00 ? 11 GLU A HA   1  
ATOM 163  H HB2  . GLU A 1 11 ? -7.147  -6.180  -7.122  1.00 0.00 ? 11 GLU A HB2  1  
ATOM 164  H HB3  . GLU A 1 11 ? -7.602  -4.638  -6.439  1.00 0.00 ? 11 GLU A HB3  1  
ATOM 165  H HG2  . GLU A 1 11 ? -8.253  -6.218  -4.322  1.00 0.00 ? 11 GLU A HG2  1  
ATOM 166  H HG3  . GLU A 1 11 ? -7.053  -7.256  -5.068  1.00 0.00 ? 11 GLU A HG3  1  
ATOM 167  N N    . VAL A 1 12 ? -9.899  -3.811  -5.929  1.00 0.00 ? 12 VAL A N    1  
ATOM 168  C CA   . VAL A 1 12 ? -10.749 -2.798  -5.231  1.00 0.00 ? 12 VAL A CA   1  
ATOM 169  C C    . VAL A 1 12 ? -10.823 -1.493  -6.044  1.00 0.00 ? 12 VAL A C    1  
ATOM 170  O O    . VAL A 1 12 ? -10.442 -1.449  -7.197  1.00 0.00 ? 12 VAL A O    1  
ATOM 171  C CB   . VAL A 1 12 ? -10.135 -2.535  -3.832  1.00 0.00 ? 12 VAL A CB   1  
ATOM 172  C CG1  . VAL A 1 12 ? -10.045 -3.853  -3.038  1.00 0.00 ? 12 VAL A CG1  1  
ATOM 173  C CG2  . VAL A 1 12 ? -8.721  -1.939  -3.993  1.00 0.00 ? 12 VAL A CG2  1  
ATOM 174  H H    . VAL A 1 12 ? -9.079  -3.508  -6.365  1.00 0.00 ? 12 VAL A H    1  
ATOM 175  H HA   . VAL A 1 12 ? -11.754 -3.180  -5.124  1.00 0.00 ? 12 VAL A HA   1  
ATOM 176  H HB   . VAL A 1 12 ? -10.757 -1.845  -3.281  1.00 0.00 ? 12 VAL A HB   1  
ATOM 177  H HG11 . VAL A 1 12 ? -10.988 -4.376  -3.076  1.00 0.00 ? 12 VAL A HG11 1  
ATOM 178  H HG12 . VAL A 1 12 ? -9.276  -4.488  -3.451  1.00 0.00 ? 12 VAL A HG12 1  
ATOM 179  H HG13 . VAL A 1 12 ? -9.804  -3.642  -2.007  1.00 0.00 ? 12 VAL A HG13 1  
ATOM 180  H HG21 . VAL A 1 12 ? -8.250  -2.291  -4.898  1.00 0.00 ? 12 VAL A HG21 1  
ATOM 181  H HG22 . VAL A 1 12 ? -8.790  -0.864  -4.042  1.00 0.00 ? 12 VAL A HG22 1  
ATOM 182  H HG23 . VAL A 1 12 ? -8.099  -2.216  -3.157  1.00 0.00 ? 12 VAL A HG23 1  
ATOM 183  N N    . HIS A 1 13 ? -11.316 -0.471  -5.388  1.00 0.00 ? 13 HIS A N    1  
ATOM 184  C CA   . HIS A 1 13 ? -11.466 0.879   -6.014  1.00 0.00 ? 13 HIS A CA   1  
ATOM 185  C C    . HIS A 1 13 ? -10.105 1.474   -6.401  1.00 0.00 ? 13 HIS A C    1  
ATOM 186  O O    . HIS A 1 13 ? -9.765  1.500   -7.568  1.00 0.00 ? 13 HIS A O    1  
ATOM 187  C CB   . HIS A 1 13 ? -12.205 1.800   -5.002  1.00 0.00 ? 13 HIS A CB   1  
ATOM 188  C CG   . HIS A 1 13 ? -13.553 2.229   -5.590  1.00 0.00 ? 13 HIS A CG   1  
ATOM 189  N ND1  . HIS A 1 13 ? -14.709 1.887   -5.122  1.00 0.00 ? 13 HIS A ND1  1  
ATOM 190  C CD2  . HIS A 1 13 ? -13.850 3.027   -6.683  1.00 0.00 ? 13 HIS A CD2  1  
ATOM 191  C CE1  . HIS A 1 13 ? -15.646 2.414   -5.845  1.00 0.00 ? 13 HIS A CE1  1  
ATOM 192  N NE2  . HIS A 1 13 ? -15.157 3.131   -6.827  1.00 0.00 ? 13 HIS A NE2  1  
ATOM 193  H H    . HIS A 1 13 ? -11.592 -0.606  -4.460  1.00 0.00 ? 13 HIS A H    1  
ATOM 194  H HA   . HIS A 1 13 ? -12.048 0.769   -6.914  1.00 0.00 ? 13 HIS A HA   1  
ATOM 195  H HB2  . HIS A 1 13 ? -12.388 1.276   -4.075  1.00 0.00 ? 13 HIS A HB2  1  
ATOM 196  H HB3  . HIS A 1 13 ? -11.634 2.690   -4.783  1.00 0.00 ? 13 HIS A HB3  1  
ATOM 197  H HD1  . HIS A 1 13 ? -14.853 1.316   -4.339  1.00 0.00 ? 13 HIS A HD1  1  
ATOM 198  H HD2  . HIS A 1 13 ? -13.119 3.495   -7.325  1.00 0.00 ? 13 HIS A HD2  1  
ATOM 199  H HE1  . HIS A 1 13 ? -16.701 2.278   -5.662  1.00 0.00 ? 13 HIS A HE1  1  
ATOM 200  N N    . HIS A 1 14 ? -9.370  1.932   -5.417  1.00 0.00 ? 14 HIS A N    1  
ATOM 201  C CA   . HIS A 1 14 ? -8.020  2.537   -5.680  1.00 0.00 ? 14 HIS A CA   1  
ATOM 202  C C    . HIS A 1 14 ? -6.959  2.010   -4.721  1.00 0.00 ? 14 HIS A C    1  
ATOM 203  O O    . HIS A 1 14 ? -5.790  2.325   -4.834  1.00 0.00 ? 14 HIS A O    1  
ATOM 204  C CB   . HIS A 1 14 ? -8.079  4.093   -5.557  1.00 0.00 ? 14 HIS A CB   1  
ATOM 205  C CG   . HIS A 1 14 ? -9.521  4.620   -5.566  1.00 0.00 ? 14 HIS A CG   1  
ATOM 206  N ND1  . HIS A 1 14 ? -10.185 4.987   -4.521  1.00 0.00 ? 14 HIS A ND1  1  
ATOM 207  C CD2  . HIS A 1 14 ? -10.401 4.814   -6.616  1.00 0.00 ? 14 HIS A CD2  1  
ATOM 208  C CE1  . HIS A 1 14 ? -11.368 5.378   -4.871  1.00 0.00 ? 14 HIS A CE1  1  
ATOM 209  N NE2  . HIS A 1 14 ? -11.546 5.286   -6.166  1.00 0.00 ? 14 HIS A NE2  1  
ATOM 210  H H    . HIS A 1 14 ? -9.717  1.875   -4.504  1.00 0.00 ? 14 HIS A H    1  
ATOM 211  H HA   . HIS A 1 14 ? -7.704  2.231   -6.657  1.00 0.00 ? 14 HIS A HA   1  
ATOM 212  H HB2  . HIS A 1 14 ? -7.589  4.427   -4.654  1.00 0.00 ? 14 HIS A HB2  1  
ATOM 213  H HB3  . HIS A 1 14 ? -7.563  4.533   -6.398  1.00 0.00 ? 14 HIS A HB3  1  
ATOM 214  H HD1  . HIS A 1 14 ? -9.842  4.974   -3.603  1.00 0.00 ? 14 HIS A HD1  1  
ATOM 215  H HD2  . HIS A 1 14 ? -10.182 4.608   -7.654  1.00 0.00 ? 14 HIS A HD2  1  
ATOM 216  H HE1  . HIS A 1 14 ? -12.117 5.735   -4.181  1.00 0.00 ? 14 HIS A HE1  1  
ATOM 217  N N    . GLN A 1 15 ? -7.393  1.206   -3.792  1.00 0.00 ? 15 GLN A N    1  
ATOM 218  C CA   . GLN A 1 15 ? -6.429  0.626   -2.800  1.00 0.00 ? 15 GLN A CA   1  
ATOM 219  C C    . GLN A 1 15 ? -5.471  -0.263  -3.613  1.00 0.00 ? 15 GLN A C    1  
ATOM 220  O O    . GLN A 1 15 ? -4.356  -0.523  -3.211  1.00 0.00 ? 15 GLN A O    1  
ATOM 221  C CB   . GLN A 1 15 ? -7.209  -0.206  -1.743  1.00 0.00 ? 15 GLN A CB   1  
ATOM 222  C CG   . GLN A 1 15 ? -7.011  0.411   -0.339  1.00 0.00 ? 15 GLN A CG   1  
ATOM 223  C CD   . GLN A 1 15 ? -5.691  -0.080  0.271   1.00 0.00 ? 15 GLN A CD   1  
ATOM 224  O OE1  . GLN A 1 15 ? -4.641  -0.013  -0.338  1.00 0.00 ? 15 GLN A OE1  1  
ATOM 225  N NE2  . GLN A 1 15 ? -5.699  -0.580  1.476   1.00 0.00 ? 15 GLN A NE2  1  
ATOM 226  H H    . GLN A 1 15 ? -8.348  1.002   -3.779  1.00 0.00 ? 15 GLN A H    1  
ATOM 227  H HA   . GLN A 1 15 ? -5.858  1.425   -2.347  1.00 0.00 ? 15 GLN A HA   1  
ATOM 228  H HB2  . GLN A 1 15 ? -8.264  -0.200  -1.970  1.00 0.00 ? 15 GLN A HB2  1  
ATOM 229  H HB3  . GLN A 1 15 ? -6.865  -1.231  -1.735  1.00 0.00 ? 15 GLN A HB3  1  
ATOM 230  H HG2  . GLN A 1 15 ? -6.993  1.490   -0.389  1.00 0.00 ? 15 GLN A HG2  1  
ATOM 231  H HG3  . GLN A 1 15 ? -7.823  0.109   0.306   1.00 0.00 ? 15 GLN A HG3  1  
ATOM 232  H HE21 . GLN A 1 15 ? -6.538  -0.636  1.977   1.00 0.00 ? 15 GLN A HE21 1  
ATOM 233  H HE22 . GLN A 1 15 ? -4.864  -0.899  1.877   1.00 0.00 ? 15 GLN A HE22 1  
ATOM 234  N N    . LYS A 1 16 ? -5.944  -0.702  -4.755  1.00 0.00 ? 16 LYS A N    1  
ATOM 235  C CA   . LYS A 1 16 ? -5.134  -1.561  -5.655  1.00 0.00 ? 16 LYS A CA   1  
ATOM 236  C C    . LYS A 1 16 ? -3.884  -0.768  -6.058  1.00 0.00 ? 16 LYS A C    1  
ATOM 237  O O    . LYS A 1 16 ? -2.789  -1.292  -6.067  1.00 0.00 ? 16 LYS A O    1  
ATOM 238  C CB   . LYS A 1 16 ? -6.001  -1.918  -6.890  1.00 0.00 ? 16 LYS A CB   1  
ATOM 239  C CG   . LYS A 1 16 ? -5.210  -2.766  -7.919  1.00 0.00 ? 16 LYS A CG   1  
ATOM 240  C CD   . LYS A 1 16 ? -4.572  -3.981  -7.214  1.00 0.00 ? 16 LYS A CD   1  
ATOM 241  C CE   . LYS A 1 16 ? -4.535  -5.202  -8.151  1.00 0.00 ? 16 LYS A CE   1  
ATOM 242  N NZ   . LYS A 1 16 ? -4.265  -6.439  -7.361  1.00 0.00 ? 16 LYS A NZ   1  
ATOM 243  H H    . LYS A 1 16 ? -6.851  -0.469  -5.032  1.00 0.00 ? 16 LYS A H    1  
ATOM 244  H HA   . LYS A 1 16 ? -4.832  -2.438  -5.111  1.00 0.00 ? 16 LYS A HA   1  
ATOM 245  H HB2  . LYS A 1 16 ? -6.870  -2.473  -6.570  1.00 0.00 ? 16 LYS A HB2  1  
ATOM 246  H HB3  . LYS A 1 16 ? -6.341  -1.011  -7.368  1.00 0.00 ? 16 LYS A HB3  1  
ATOM 247  H HG2  . LYS A 1 16 ? -5.888  -3.092  -8.695  1.00 0.00 ? 16 LYS A HG2  1  
ATOM 248  H HG3  . LYS A 1 16 ? -4.439  -2.160  -8.374  1.00 0.00 ? 16 LYS A HG3  1  
ATOM 249  H HD2  . LYS A 1 16 ? -3.573  -3.720  -6.900  1.00 0.00 ? 16 LYS A HD2  1  
ATOM 250  H HD3  . LYS A 1 16 ? -5.151  -4.221  -6.338  1.00 0.00 ? 16 LYS A HD3  1  
ATOM 251  H HE2  . LYS A 1 16 ? -5.483  -5.323  -8.657  1.00 0.00 ? 16 LYS A HE2  1  
ATOM 252  H HE3  . LYS A 1 16 ? -3.755  -5.084  -8.888  1.00 0.00 ? 16 LYS A HE3  1  
ATOM 253  H HZ1  . LYS A 1 16 ? -4.168  -6.197  -6.354  1.00 0.00 ? 16 LYS A HZ1  1  
ATOM 254  H HZ2  . LYS A 1 16 ? -5.054  -7.105  -7.480  1.00 0.00 ? 16 LYS A HZ2  1  
ATOM 255  H HZ3  . LYS A 1 16 ? -3.385  -6.879  -7.698  1.00 0.00 ? 16 LYS A HZ3  1  
ATOM 256  N N    . LEU A 1 17 ? -4.087  0.489   -6.368  1.00 0.00 ? 17 LEU A N    1  
ATOM 257  C CA   . LEU A 1 17 ? -2.947  1.357   -6.777  1.00 0.00 ? 17 LEU A CA   1  
ATOM 258  C C    . LEU A 1 17 ? -2.043  1.543   -5.550  1.00 0.00 ? 17 LEU A C    1  
ATOM 259  O O    . LEU A 1 17 ? -0.839  1.464   -5.655  1.00 0.00 ? 17 LEU A O    1  
ATOM 260  C CB   . LEU A 1 17 ? -3.560  2.697   -7.328  1.00 0.00 ? 17 LEU A CB   1  
ATOM 261  C CG   . LEU A 1 17 ? -3.485  3.886   -6.344  1.00 0.00 ? 17 LEU A CG   1  
ATOM 262  C CD1  . LEU A 1 17 ? -2.019  4.414   -6.225  1.00 0.00 ? 17 LEU A CD1  1  
ATOM 263  C CD2  . LEU A 1 17 ? -4.392  5.015   -6.872  1.00 0.00 ? 17 LEU A CD2  1  
ATOM 264  H H    . LEU A 1 17 ? -4.986  0.872   -6.324  1.00 0.00 ? 17 LEU A H    1  
ATOM 265  H HA   . LEU A 1 17 ? -2.393  0.860   -7.561  1.00 0.00 ? 17 LEU A HA   1  
ATOM 266  H HB2  . LEU A 1 17 ? -3.058  2.966   -8.245  1.00 0.00 ? 17 LEU A HB2  1  
ATOM 267  H HB3  . LEU A 1 17 ? -4.601  2.525   -7.568  1.00 0.00 ? 17 LEU A HB3  1  
ATOM 268  H HG   . LEU A 1 17 ? -3.865  3.550   -5.393  1.00 0.00 ? 17 LEU A HG   1  
ATOM 269  H HD11 . LEU A 1 17 ? -1.368  3.909   -6.923  1.00 0.00 ? 17 LEU A HD11 1  
ATOM 270  H HD12 . LEU A 1 17 ? -1.965  5.475   -6.422  1.00 0.00 ? 17 LEU A HD12 1  
ATOM 271  H HD13 . LEU A 1 17 ? -1.647  4.239   -5.227  1.00 0.00 ? 17 LEU A HD13 1  
ATOM 272  H HD21 . LEU A 1 17 ? -5.402  4.654   -6.984  1.00 0.00 ? 17 LEU A HD21 1  
ATOM 273  H HD22 . LEU A 1 17 ? -4.394  5.845   -6.180  1.00 0.00 ? 17 LEU A HD22 1  
ATOM 274  H HD23 . LEU A 1 17 ? -4.037  5.360   -7.832  1.00 0.00 ? 17 LEU A HD23 1  
ATOM 275  N N    . VAL A 1 18 ? -2.639  1.785   -4.409  1.00 0.00 ? 18 VAL A N    1  
ATOM 276  C CA   . VAL A 1 18 ? -1.848  1.976   -3.155  1.00 0.00 ? 18 VAL A CA   1  
ATOM 277  C C    . VAL A 1 18 ? -0.890  0.768   -2.992  1.00 0.00 ? 18 VAL A C    1  
ATOM 278  O O    . VAL A 1 18 ? 0.302   0.931   -2.817  1.00 0.00 ? 18 VAL A O    1  
ATOM 279  C CB   . VAL A 1 18 ? -2.889  2.107   -2.012  1.00 0.00 ? 18 VAL A CB   1  
ATOM 280  C CG1  . VAL A 1 18 ? -2.253  1.918   -0.637  1.00 0.00 ? 18 VAL A CG1  1  
ATOM 281  C CG2  . VAL A 1 18 ? -3.546  3.503   -2.086  1.00 0.00 ? 18 VAL A CG2  1  
ATOM 282  H H    . VAL A 1 18 ? -3.615  1.846   -4.380  1.00 0.00 ? 18 VAL A H    1  
ATOM 283  H HA   . VAL A 1 18 ? -1.261  2.878   -3.247  1.00 0.00 ? 18 VAL A HA   1  
ATOM 284  H HB   . VAL A 1 18 ? -3.659  1.367   -2.136  1.00 0.00 ? 18 VAL A HB   1  
ATOM 285  H HG11 . VAL A 1 18 ? -1.273  2.371   -0.609  1.00 0.00 ? 18 VAL A HG11 1  
ATOM 286  H HG12 . VAL A 1 18 ? -2.877  2.363   0.124   1.00 0.00 ? 18 VAL A HG12 1  
ATOM 287  H HG13 . VAL A 1 18 ? -2.170  0.861   -0.438  1.00 0.00 ? 18 VAL A HG13 1  
ATOM 288  H HG21 . VAL A 1 18 ? -4.020  3.642   -3.047  1.00 0.00 ? 18 VAL A HG21 1  
ATOM 289  H HG22 . VAL A 1 18 ? -4.299  3.602   -1.317  1.00 0.00 ? 18 VAL A HG22 1  
ATOM 290  H HG23 . VAL A 1 18 ? -2.805  4.278   -1.949  1.00 0.00 ? 18 VAL A HG23 1  
ATOM 291  N N    . PHE A 1 19 ? -1.443  -0.416  -3.065  1.00 0.00 ? 19 PHE A N    1  
ATOM 292  C CA   . PHE A 1 19 ? -0.627  -1.663  -2.930  1.00 0.00 ? 19 PHE A CA   1  
ATOM 293  C C    . PHE A 1 19 ? 0.466   -1.676  -4.003  1.00 0.00 ? 19 PHE A C    1  
ATOM 294  O O    . PHE A 1 19 ? 1.615   -1.950  -3.718  1.00 0.00 ? 19 PHE A O    1  
ATOM 295  C CB   . PHE A 1 19 ? -1.542  -2.895  -3.095  1.00 0.00 ? 19 PHE A CB   1  
ATOM 296  C CG   . PHE A 1 19 ? -2.616  -2.954  -1.989  1.00 0.00 ? 19 PHE A CG   1  
ATOM 297  C CD1  . PHE A 1 19 ? -2.320  -2.673  -0.664  1.00 0.00 ? 19 PHE A CD1  1  
ATOM 298  C CD2  . PHE A 1 19 ? -3.914  -3.299  -2.318  1.00 0.00 ? 19 PHE A CD2  1  
ATOM 299  C CE1  . PHE A 1 19 ? -3.301  -2.739  0.303   1.00 0.00 ? 19 PHE A CE1  1  
ATOM 300  C CE2  . PHE A 1 19 ? -4.894  -3.365  -1.350  1.00 0.00 ? 19 PHE A CE2  1  
ATOM 301  C CZ   . PHE A 1 19 ? -4.588  -3.084  -0.039  1.00 0.00 ? 19 PHE A CZ   1  
ATOM 302  H H    . PHE A 1 19 ? -2.405  -0.480  -3.205  1.00 0.00 ? 19 PHE A H    1  
ATOM 303  H HA   . PHE A 1 19 ? -0.149  -1.670  -1.968  1.00 0.00 ? 19 PHE A HA   1  
ATOM 304  H HB2  . PHE A 1 19 ? -2.032  -2.861  -4.058  1.00 0.00 ? 19 PHE A HB2  1  
ATOM 305  H HB3  . PHE A 1 19 ? -0.951  -3.798  -3.040  1.00 0.00 ? 19 PHE A HB3  1  
ATOM 306  H HD1  . PHE A 1 19 ? -1.316  -2.401  -0.375  1.00 0.00 ? 19 PHE A HD1  1  
ATOM 307  H HD2  . PHE A 1 19 ? -4.164  -3.521  -3.343  1.00 0.00 ? 19 PHE A HD2  1  
ATOM 308  H HE1  . PHE A 1 19 ? -3.059  -2.518  1.332   1.00 0.00 ? 19 PHE A HE1  1  
ATOM 309  H HE2  . PHE A 1 19 ? -5.903  -3.636  -1.618  1.00 0.00 ? 19 PHE A HE2  1  
ATOM 310  H HZ   . PHE A 1 19 ? -5.355  -3.137  0.720   1.00 0.00 ? 19 PHE A HZ   1  
ATOM 311  N N    . PHE A 1 20 ? 0.078   -1.373  -5.215  1.00 0.00 ? 20 PHE A N    1  
ATOM 312  C CA   . PHE A 1 20 ? 1.043   -1.340  -6.355  1.00 0.00 ? 20 PHE A CA   1  
ATOM 313  C C    . PHE A 1 20 ? 2.232   -0.445  -5.949  1.00 0.00 ? 20 PHE A C    1  
ATOM 314  O O    . PHE A 1 20 ? 3.369   -0.855  -6.042  1.00 0.00 ? 20 PHE A O    1  
ATOM 315  C CB   . PHE A 1 20 ? 0.259   -0.802  -7.600  1.00 0.00 ? 20 PHE A CB   1  
ATOM 316  C CG   . PHE A 1 20 ? 1.046   0.235   -8.420  1.00 0.00 ? 20 PHE A CG   1  
ATOM 317  C CD1  . PHE A 1 20 ? 2.092   -0.175  -9.221  1.00 0.00 ? 20 PHE A CD1  1  
ATOM 318  C CD2  . PHE A 1 20 ? 0.725   1.581   -8.375  1.00 0.00 ? 20 PHE A CD2  1  
ATOM 319  C CE1  . PHE A 1 20 ? 2.806   0.740   -9.963  1.00 0.00 ? 20 PHE A CE1  1  
ATOM 320  C CE2  . PHE A 1 20 ? 1.437   2.496   -9.115  1.00 0.00 ? 20 PHE A CE2  1  
ATOM 321  C CZ   . PHE A 1 20 ? 2.480   2.078   -9.912  1.00 0.00 ? 20 PHE A CZ   1  
ATOM 322  H H    . PHE A 1 20 ? -0.862  -1.169  -5.385  1.00 0.00 ? 20 PHE A H    1  
ATOM 323  H HA   . PHE A 1 20 ? 1.399   -2.343  -6.539  1.00 0.00 ? 20 PHE A HA   1  
ATOM 324  H HB2  . PHE A 1 20 ? 0.022   -1.634  -8.248  1.00 0.00 ? 20 PHE A HB2  1  
ATOM 325  H HB3  . PHE A 1 20 ? -0.673  -0.358  -7.288  1.00 0.00 ? 20 PHE A HB3  1  
ATOM 326  H HD1  . PHE A 1 20 ? 2.355   -1.221  -9.265  1.00 0.00 ? 20 PHE A HD1  1  
ATOM 327  H HD2  . PHE A 1 20 ? -0.089  1.931   -7.760  1.00 0.00 ? 20 PHE A HD2  1  
ATOM 328  H HE1  . PHE A 1 20 ? 3.621   0.401   -10.583 1.00 0.00 ? 20 PHE A HE1  1  
ATOM 329  H HE2  . PHE A 1 20 ? 1.172   3.542   -9.065  1.00 0.00 ? 20 PHE A HE2  1  
ATOM 330  H HZ   . PHE A 1 20 ? 3.041   2.796   -10.493 1.00 0.00 ? 20 PHE A HZ   1  
ATOM 331  N N    . ALA A 1 21 ? 1.933   0.748   -5.501  1.00 0.00 ? 21 ALA A N    1  
ATOM 332  C CA   . ALA A 1 21 ? 3.000   1.708   -5.073  1.00 0.00 ? 21 ALA A CA   1  
ATOM 333  C C    . ALA A 1 21 ? 3.939   1.042   -4.058  1.00 0.00 ? 21 ALA A C    1  
ATOM 334  O O    . ALA A 1 21 ? 5.140   1.140   -4.179  1.00 0.00 ? 21 ALA A O    1  
ATOM 335  C CB   . ALA A 1 21 ? 2.330   2.943   -4.449  1.00 0.00 ? 21 ALA A CB   1  
ATOM 336  H H    . ALA A 1 21 ? 0.992   1.006   -5.453  1.00 0.00 ? 21 ALA A H    1  
ATOM 337  H HA   . ALA A 1 21 ? 3.587   1.983   -5.937  1.00 0.00 ? 21 ALA A HA   1  
ATOM 338  H HB1  . ALA A 1 21 ? 1.489   3.251   -5.053  1.00 0.00 ? 21 ALA A HB1  1  
ATOM 339  H HB2  . ALA A 1 21 ? 1.980   2.726   -3.451  1.00 0.00 ? 21 ALA A HB2  1  
ATOM 340  H HB3  . ALA A 1 21 ? 3.037   3.758   -4.398  1.00 0.00 ? 21 ALA A HB3  1  
ATOM 341  N N    . GLU A 1 22 ? 3.379   0.380   -3.080  1.00 0.00 ? 22 GLU A N    1  
ATOM 342  C CA   . GLU A 1 22 ? 4.235   -0.307  -2.051  1.00 0.00 ? 22 GLU A CA   1  
ATOM 343  C C    . GLU A 1 22 ? 5.171   -1.306  -2.756  1.00 0.00 ? 22 GLU A C    1  
ATOM 344  O O    . GLU A 1 22 ? 6.365   -1.315  -2.525  1.00 0.00 ? 22 GLU A O    1  
ATOM 345  C CB   . GLU A 1 22 ? 3.338   -1.059  -1.051  1.00 0.00 ? 22 GLU A CB   1  
ATOM 346  C CG   . GLU A 1 22 ? 2.543   -0.058  -0.178  1.00 0.00 ? 22 GLU A CG   1  
ATOM 347  C CD   . GLU A 1 22 ? 1.159   -0.643  0.175   1.00 0.00 ? 22 GLU A CD   1  
ATOM 348  O OE1  . GLU A 1 22 ? 1.139   -1.738  0.714   1.00 0.00 ? 22 GLU A OE1  1  
ATOM 349  O OE2  . GLU A 1 22 ? 0.194   0.043   -0.113  1.00 0.00 ? 22 GLU A OE2  1  
ATOM 350  H H    . GLU A 1 22 ? 2.404   0.355   -3.038  1.00 0.00 ? 22 GLU A H    1  
ATOM 351  H HA   . GLU A 1 22 ? 4.843   0.437   -1.556  1.00 0.00 ? 22 GLU A HA   1  
ATOM 352  H HB2  . GLU A 1 22 ? 2.663   -1.711  -1.583  1.00 0.00 ? 22 GLU A HB2  1  
ATOM 353  H HB3  . GLU A 1 22 ? 3.955   -1.670  -0.407  1.00 0.00 ? 22 GLU A HB3  1  
ATOM 354  H HG2  . GLU A 1 22 ? 3.079   0.130   0.742   1.00 0.00 ? 22 GLU A HG2  1  
ATOM 355  H HG3  . GLU A 1 22 ? 2.412   0.881   -0.696  1.00 0.00 ? 22 GLU A HG3  1  
ATOM 356  N N    . ASP A 1 23 ? 4.581   -2.114  -3.603  1.00 0.00 ? 23 ASP A N    1  
ATOM 357  C CA   . ASP A 1 23 ? 5.333   -3.148  -4.384  1.00 0.00 ? 23 ASP A CA   1  
ATOM 358  C C    . ASP A 1 23 ? 6.542   -2.478  -5.041  1.00 0.00 ? 23 ASP A C    1  
ATOM 359  O O    . ASP A 1 23 ? 7.668   -2.898  -4.899  1.00 0.00 ? 23 ASP A O    1  
ATOM 360  C CB   . ASP A 1 23 ? 4.401   -3.733  -5.463  1.00 0.00 ? 23 ASP A CB   1  
ATOM 361  C CG   . ASP A 1 23 ? 4.917   -5.103  -5.944  1.00 0.00 ? 23 ASP A CG   1  
ATOM 362  O OD1  . ASP A 1 23 ? 5.944   -5.094  -6.606  1.00 0.00 ? 23 ASP A OD1  1  
ATOM 363  O OD2  . ASP A 1 23 ? 4.259   -6.080  -5.626  1.00 0.00 ? 23 ASP A OD2  1  
ATOM 364  H H    . ASP A 1 23 ? 3.615   -2.036  -3.727  1.00 0.00 ? 23 ASP A H    1  
ATOM 365  H HA   . ASP A 1 23 ? 5.676   -3.915  -3.708  1.00 0.00 ? 23 ASP A HA   1  
ATOM 366  H HB2  . ASP A 1 23 ? 3.397   -3.832  -5.080  1.00 0.00 ? 23 ASP A HB2  1  
ATOM 367  H HB3  . ASP A 1 23 ? 4.358   -3.068  -6.311  1.00 0.00 ? 23 ASP A HB3  1  
ATOM 368  N N    . VAL A 1 24 ? 6.225   -1.430  -5.744  1.00 0.00 ? 24 VAL A N    1  
ATOM 369  C CA   . VAL A 1 24 ? 7.213   -0.597  -6.485  1.00 0.00 ? 24 VAL A CA   1  
ATOM 370  C C    . VAL A 1 24 ? 8.337   -0.119  -5.550  1.00 0.00 ? 24 VAL A C    1  
ATOM 371  O O    . VAL A 1 24 ? 9.509   -0.312  -5.808  1.00 0.00 ? 24 VAL A O    1  
ATOM 372  C CB   . VAL A 1 24 ? 6.391   0.563   -7.090  1.00 0.00 ? 24 VAL A CB   1  
ATOM 373  C CG1  . VAL A 1 24 ? 7.247   1.562   -7.849  1.00 0.00 ? 24 VAL A CG1  1  
ATOM 374  C CG2  . VAL A 1 24 ? 5.309   -0.009  -8.026  1.00 0.00 ? 24 VAL A CG2  1  
ATOM 375  H H    . VAL A 1 24 ? 5.282   -1.180  -5.788  1.00 0.00 ? 24 VAL A H    1  
ATOM 376  H HA   . VAL A 1 24 ? 7.649   -1.197  -7.268  1.00 0.00 ? 24 VAL A HA   1  
ATOM 377  H HB   . VAL A 1 24 ? 5.898   1.102   -6.301  1.00 0.00 ? 24 VAL A HB   1  
ATOM 378  H HG11 . VAL A 1 24 ? 7.836   1.057   -8.597  1.00 0.00 ? 24 VAL A HG11 1  
ATOM 379  H HG12 . VAL A 1 24 ? 6.596   2.281   -8.327  1.00 0.00 ? 24 VAL A HG12 1  
ATOM 380  H HG13 . VAL A 1 24 ? 7.890   2.081   -7.156  1.00 0.00 ? 24 VAL A HG13 1  
ATOM 381  H HG21 . VAL A 1 24 ? 5.118   -1.052  -7.816  1.00 0.00 ? 24 VAL A HG21 1  
ATOM 382  H HG22 . VAL A 1 24 ? 4.396   0.544   -7.863  1.00 0.00 ? 24 VAL A HG22 1  
ATOM 383  H HG23 . VAL A 1 24 ? 5.603   0.083   -9.059  1.00 0.00 ? 24 VAL A HG23 1  
ATOM 384  N N    . GLY A 1 25 ? 7.911   0.488   -4.475  1.00 0.00 ? 25 GLY A N    1  
ATOM 385  C CA   . GLY A 1 25 ? 8.849   1.030   -3.443  1.00 0.00 ? 25 GLY A CA   1  
ATOM 386  C C    . GLY A 1 25 ? 9.887   -0.014  -3.023  1.00 0.00 ? 25 GLY A C    1  
ATOM 387  O O    . GLY A 1 25 ? 11.077  0.228   -3.086  1.00 0.00 ? 25 GLY A O    1  
ATOM 388  H H    . GLY A 1 25 ? 6.946   0.583   -4.357  1.00 0.00 ? 25 GLY A H    1  
ATOM 389  H HA2  . GLY A 1 25 ? 9.355   1.895   -3.847  1.00 0.00 ? 25 GLY A HA2  1  
ATOM 390  H HA3  . GLY A 1 25 ? 8.278   1.326   -2.576  1.00 0.00 ? 25 GLY A HA3  1  
ATOM 391  N N    . SER A 1 26 ? 9.388   -1.150  -2.609  1.00 0.00 ? 26 SER A N    1  
ATOM 392  C CA   . SER A 1 26 ? 10.294  -2.258  -2.169  1.00 0.00 ? 26 SER A CA   1  
ATOM 393  C C    . SER A 1 26 ? 11.151  -2.767  -3.338  1.00 0.00 ? 26 SER A C    1  
ATOM 394  O O    . SER A 1 26 ? 12.359  -2.853  -3.237  1.00 0.00 ? 26 SER A O    1  
ATOM 395  C CB   . SER A 1 26 ? 9.441   -3.416  -1.590  1.00 0.00 ? 26 SER A CB   1  
ATOM 396  O OG   . SER A 1 26 ? 8.384   -3.618  -2.515  1.00 0.00 ? 26 SER A OG   1  
ATOM 397  H H    . SER A 1 26 ? 8.416   -1.258  -2.593  1.00 0.00 ? 26 SER A H    1  
ATOM 398  H HA   . SER A 1 26 ? 10.947  -1.876  -1.404  1.00 0.00 ? 26 SER A HA   1  
ATOM 399  H HB2  . SER A 1 26 ? 10.016  -4.326  -1.496  1.00 0.00 ? 26 SER A HB2  1  
ATOM 400  H HB3  . SER A 1 26 ? 9.024   -3.147  -0.630  1.00 0.00 ? 26 SER A HB3  1  
ATOM 401  H HG   . SER A 1 26 ? 8.467   -4.503  -2.877  1.00 0.00 ? 26 SER A HG   1  
ATOM 402  N N    . ASN A 1 27 ? 10.484  -3.079  -4.419  1.00 0.00 ? 27 ASN A N    1  
ATOM 403  C CA   . ASN A 1 27 ? 11.127  -3.593  -5.667  1.00 0.00 ? 27 ASN A CA   1  
ATOM 404  C C    . ASN A 1 27 ? 12.415  -2.861  -6.022  1.00 0.00 ? 27 ASN A C    1  
ATOM 405  O O    . ASN A 1 27 ? 13.394  -3.487  -6.366  1.00 0.00 ? 27 ASN A O    1  
ATOM 406  C CB   . ASN A 1 27 ? 10.114  -3.453  -6.809  1.00 0.00 ? 27 ASN A CB   1  
ATOM 407  C CG   . ASN A 1 27 ? 9.284   -4.737  -6.949  1.00 0.00 ? 27 ASN A CG   1  
ATOM 408  O OD1  . ASN A 1 27 ? 9.119   -5.271  -8.028  1.00 0.00 ? 27 ASN A OD1  1  
ATOM 409  N ND2  . ASN A 1 27 ? 8.745   -5.262  -5.883  1.00 0.00 ? 27 ASN A ND2  1  
ATOM 410  H H    . ASN A 1 27 ? 9.517   -2.974  -4.425  1.00 0.00 ? 27 ASN A H    1  
ATOM 411  H HA   . ASN A 1 27 ? 11.390  -4.626  -5.503  1.00 0.00 ? 27 ASN A HA   1  
ATOM 412  H HB2  . ASN A 1 27 ? 9.440   -2.634  -6.616  1.00 0.00 ? 27 ASN A HB2  1  
ATOM 413  H HB3  . ASN A 1 27 ? 10.633  -3.248  -7.729  1.00 0.00 ? 27 ASN A HB3  1  
ATOM 414  H HD21 . ASN A 1 27 ? 8.876   -4.838  -5.010  1.00 0.00 ? 27 ASN A HD21 1  
ATOM 415  H HD22 . ASN A 1 27 ? 8.211   -6.081  -5.958  1.00 0.00 ? 27 ASN A HD22 1  
ATOM 416  N N    . LYS A 1 28 ? 12.362  -1.558  -5.939  1.00 0.00 ? 28 LYS A N    1  
ATOM 417  C CA   . LYS A 1 28 ? 13.537  -0.687  -6.245  1.00 0.00 ? 28 LYS A CA   1  
ATOM 418  C C    . LYS A 1 28 ? 14.876  -1.307  -5.790  1.00 0.00 ? 28 LYS A C    1  
ATOM 419  O O    . LYS A 1 28 ? 15.860  -1.212  -6.493  1.00 0.00 ? 28 LYS A O    1  
ATOM 420  C CB   . LYS A 1 28 ? 13.289  0.653   -5.548  1.00 0.00 ? 28 LYS A CB   1  
ATOM 421  C CG   . LYS A 1 28 ? 13.852  1.783   -6.418  1.00 0.00 ? 28 LYS A CG   1  
ATOM 422  C CD   . LYS A 1 28 ? 14.193  3.006   -5.541  1.00 0.00 ? 28 LYS A CD   1  
ATOM 423  C CE   . LYS A 1 28 ? 14.779  4.122   -6.425  1.00 0.00 ? 28 LYS A CE   1  
ATOM 424  N NZ   . LYS A 1 28 ? 13.731  4.662   -7.337  1.00 0.00 ? 28 LYS A NZ   1  
ATOM 425  H H    . LYS A 1 28 ? 11.521  -1.133  -5.683  1.00 0.00 ? 28 LYS A H    1  
ATOM 426  H HA   . LYS A 1 28 ? 13.579  -0.547  -7.318  1.00 0.00 ? 28 LYS A HA   1  
ATOM 427  H HB2  . LYS A 1 28 ? 12.223  0.796   -5.433  1.00 0.00 ? 28 LYS A HB2  1  
ATOM 428  H HB3  . LYS A 1 28 ? 13.740  0.645   -4.568  1.00 0.00 ? 28 LYS A HB3  1  
ATOM 429  H HG2  . LYS A 1 28 ? 14.739  1.437   -6.929  1.00 0.00 ? 28 LYS A HG2  1  
ATOM 430  H HG3  . LYS A 1 28 ? 13.105  2.043   -7.154  1.00 0.00 ? 28 LYS A HG3  1  
ATOM 431  H HD2  . LYS A 1 28 ? 13.303  3.364   -5.046  1.00 0.00 ? 28 LYS A HD2  1  
ATOM 432  H HD3  . LYS A 1 28 ? 14.918  2.728   -4.790  1.00 0.00 ? 28 LYS A HD3  1  
ATOM 433  H HE2  . LYS A 1 28 ? 15.145  4.929   -5.807  1.00 0.00 ? 28 LYS A HE2  1  
ATOM 434  H HE3  . LYS A 1 28 ? 15.597  3.744   -7.022  1.00 0.00 ? 28 LYS A HE3  1  
ATOM 435  H HZ1  . LYS A 1 28 ? 12.833  4.164   -7.170  1.00 0.00 ? 28 LYS A HZ1  1  
ATOM 436  H HZ2  . LYS A 1 28 ? 13.601  5.678   -7.154  1.00 0.00 ? 28 LYS A HZ2  1  
ATOM 437  H HZ3  . LYS A 1 28 ? 14.025  4.522   -8.324  1.00 0.00 ? 28 LYS A HZ3  1  
ATOM 438  N N    . GLY A 1 29 ? 14.884  -1.937  -4.639  1.00 0.00 ? 29 GLY A N    1  
ATOM 439  C CA   . GLY A 1 29 ? 16.143  -2.565  -4.130  1.00 0.00 ? 29 GLY A CA   1  
ATOM 440  C C    . GLY A 1 29 ? 16.602  -3.647  -5.120  1.00 0.00 ? 29 GLY A C    1  
ATOM 441  O O    . GLY A 1 29 ? 17.694  -3.592  -5.652  1.00 0.00 ? 29 GLY A O    1  
ATOM 442  H H    . GLY A 1 29 ? 14.065  -2.005  -4.109  1.00 0.00 ? 29 GLY A H    1  
ATOM 443  H HA2  . GLY A 1 29 ? 16.909  -1.811  -4.031  1.00 0.00 ? 29 GLY A HA2  1  
ATOM 444  H HA3  . GLY A 1 29 ? 15.948  -3.018  -3.169  1.00 0.00 ? 29 GLY A HA3  1  
ATOM 445  N N    . ALA A 1 30 ? 15.733  -4.602  -5.349  1.00 0.00 ? 30 ALA A N    1  
ATOM 446  C CA   . ALA A 1 30 ? 16.066  -5.716  -6.296  1.00 0.00 ? 30 ALA A CA   1  
ATOM 447  C C    . ALA A 1 30 ? 16.392  -5.149  -7.683  1.00 0.00 ? 30 ALA A C    1  
ATOM 448  O O    . ALA A 1 30 ? 17.307  -5.591  -8.343  1.00 0.00 ? 30 ALA A O    1  
ATOM 449  C CB   . ALA A 1 30 ? 14.863  -6.664  -6.386  1.00 0.00 ? 30 ALA A CB   1  
ATOM 450  H H    . ALA A 1 30 ? 14.862  -4.580  -4.898  1.00 0.00 ? 30 ALA A H    1  
ATOM 451  H HA   . ALA A 1 30 ? 16.939  -6.234  -5.927  1.00 0.00 ? 30 ALA A HA   1  
ATOM 452  H HB1  . ALA A 1 30 ? 14.636  -7.064  -5.409  1.00 0.00 ? 30 ALA A HB1  1  
ATOM 453  H HB2  . ALA A 1 30 ? 13.995  -6.136  -6.755  1.00 0.00 ? 30 ALA A HB2  1  
ATOM 454  H HB3  . ALA A 1 30 ? 15.084  -7.484  -7.054  1.00 0.00 ? 30 ALA A HB3  1  
ATOM 455  N N    . ILE A 1 31 ? 15.621  -4.172  -8.076  1.00 0.00 ? 31 ILE A N    1  
ATOM 456  C CA   . ILE A 1 31 ? 15.791  -3.497  -9.393  1.00 0.00 ? 31 ILE A CA   1  
ATOM 457  C C    . ILE A 1 31 ? 17.240  -3.013  -9.527  1.00 0.00 ? 31 ILE A C    1  
ATOM 458  O O    . ILE A 1 31 ? 17.905  -3.341  -10.489 1.00 0.00 ? 31 ILE A O    1  
ATOM 459  C CB   . ILE A 1 31 ? 14.733  -2.355  -9.410  1.00 0.00 ? 31 ILE A CB   1  
ATOM 460  C CG1  . ILE A 1 31 ? 13.349  -3.014  -9.677  1.00 0.00 ? 31 ILE A CG1  1  
ATOM 461  C CG2  . ILE A 1 31 ? 15.053  -1.276  -10.464 1.00 0.00 ? 31 ILE A CG2  1  
ATOM 462  C CD1  . ILE A 1 31 ? 12.198  -1.989  -9.621  1.00 0.00 ? 31 ILE A CD1  1  
ATOM 463  H H    . ILE A 1 31 ? 14.905  -3.873  -7.487  1.00 0.00 ? 31 ILE A H    1  
ATOM 464  H HA   . ILE A 1 31 ? 15.608  -4.219  -10.175 1.00 0.00 ? 31 ILE A HA   1  
ATOM 465  H HB   . ILE A 1 31 ? 14.712  -1.888  -8.441  1.00 0.00 ? 31 ILE A HB   1  
ATOM 466  H HG12 . ILE A 1 31 ? 13.366  -3.502  -10.637 1.00 0.00 ? 31 ILE A HG12 1  
ATOM 467  H HG13 . ILE A 1 31 ? 13.165  -3.771  -8.927  1.00 0.00 ? 31 ILE A HG13 1  
ATOM 468  H HG21 . ILE A 1 31 ? 16.026  -0.850  -10.272 1.00 0.00 ? 31 ILE A HG21 1  
ATOM 469  H HG22 . ILE A 1 31 ? 15.031  -1.695  -11.457 1.00 0.00 ? 31 ILE A HG22 1  
ATOM 470  H HG23 . ILE A 1 31 ? 14.327  -0.477  -10.401 1.00 0.00 ? 31 ILE A HG23 1  
ATOM 471  H HD11 . ILE A 1 31 ? 12.341  -1.201  -10.344 1.00 0.00 ? 31 ILE A HD11 1  
ATOM 472  H HD12 . ILE A 1 31 ? 11.265  -2.487  -9.844  1.00 0.00 ? 31 ILE A HD12 1  
ATOM 473  H HD13 . ILE A 1 31 ? 12.127  -1.554  -8.636  1.00 0.00 ? 31 ILE A HD13 1  
ATOM 474  N N    . ILE A 1 32 ? 17.701  -2.250  -8.568  1.00 0.00 ? 32 ILE A N    1  
ATOM 475  C CA   . ILE A 1 32 ? 19.109  -1.744  -8.621  1.00 0.00 ? 32 ILE A CA   1  
ATOM 476  C C    . ILE A 1 32 ? 20.060  -2.937  -8.774  1.00 0.00 ? 32 ILE A C    1  
ATOM 477  O O    . ILE A 1 32 ? 20.941  -2.923  -9.610  1.00 0.00 ? 32 ILE A O    1  
ATOM 478  C CB   . ILE A 1 32 ? 19.398  -0.961  -7.316  1.00 0.00 ? 32 ILE A CB   1  
ATOM 479  C CG1  . ILE A 1 32 ? 18.450  0.271   -7.264  1.00 0.00 ? 32 ILE A CG1  1  
ATOM 480  C CG2  . ILE A 1 32 ? 20.870  -0.477  -7.308  1.00 0.00 ? 32 ILE A CG2  1  
ATOM 481  C CD1  . ILE A 1 32 ? 18.278  0.755   -5.814  1.00 0.00 ? 32 ILE A CD1  1  
ATOM 482  H H    . ILE A 1 32 ? 17.123  -2.001  -7.819  1.00 0.00 ? 32 ILE A H    1  
ATOM 483  H HA   . ILE A 1 32 ? 19.214  -1.117  -9.490  1.00 0.00 ? 32 ILE A HA   1  
ATOM 484  H HB   . ILE A 1 32 ? 19.222  -1.604  -6.465  1.00 0.00 ? 32 ILE A HB   1  
ATOM 485  H HG12 . ILE A 1 32 ? 18.851  1.065   -7.873  1.00 0.00 ? 32 ILE A HG12 1  
ATOM 486  H HG13 . ILE A 1 32 ? 17.481  0.014   -7.665  1.00 0.00 ? 32 ILE A HG13 1  
ATOM 487  H HG21 . ILE A 1 32 ? 21.101  0.045   -8.225  1.00 0.00 ? 32 ILE A HG21 1  
ATOM 488  H HG22 . ILE A 1 32 ? 21.040  0.191   -6.477  1.00 0.00 ? 32 ILE A HG22 1  
ATOM 489  H HG23 . ILE A 1 32 ? 21.538  -1.319  -7.209  1.00 0.00 ? 32 ILE A HG23 1  
ATOM 490  H HD11 . ILE A 1 32 ? 18.008  -0.068  -5.170  1.00 0.00 ? 32 ILE A HD11 1  
ATOM 491  H HD12 . ILE A 1 32 ? 19.196  1.194   -5.452  1.00 0.00 ? 32 ILE A HD12 1  
ATOM 492  H HD13 . ILE A 1 32 ? 17.498  1.500   -5.768  1.00 0.00 ? 32 ILE A HD13 1  
ATOM 493  N N    . GLY A 1 33 ? 19.847  -3.942  -7.961  1.00 0.00 ? 33 GLY A N    1  
ATOM 494  C CA   . GLY A 1 33 ? 20.714  -5.161  -8.027  1.00 0.00 ? 33 GLY A CA   1  
ATOM 495  C C    . GLY A 1 33 ? 20.753  -5.696  -9.467  1.00 0.00 ? 33 GLY A C    1  
ATOM 496  O O    . GLY A 1 33 ? 21.809  -5.951  -10.007 1.00 0.00 ? 33 GLY A O    1  
ATOM 497  H H    . GLY A 1 33 ? 19.115  -3.881  -7.313  1.00 0.00 ? 33 GLY A H    1  
ATOM 498  H HA2  . GLY A 1 33 ? 21.718  -4.899  -7.721  1.00 0.00 ? 33 GLY A HA2  1  
ATOM 499  H HA3  . GLY A 1 33 ? 20.319  -5.922  -7.373  1.00 0.00 ? 33 GLY A HA3  1  
ATOM 500  N N    . LEU A 1 34 ? 19.592  -5.847  -10.052 1.00 0.00 ? 34 LEU A N    1  
ATOM 501  C CA   . LEU A 1 34 ? 19.496  -6.357  -11.456 1.00 0.00 ? 34 LEU A CA   1  
ATOM 502  C C    . LEU A 1 34 ? 20.284  -5.451  -12.417 1.00 0.00 ? 34 LEU A C    1  
ATOM 503  O O    . LEU A 1 34 ? 21.059  -5.943  -13.214 1.00 0.00 ? 34 LEU A O    1  
ATOM 504  C CB   . LEU A 1 34 ? 18.008  -6.405  -11.866 1.00 0.00 ? 34 LEU A CB   1  
ATOM 505  C CG   . LEU A 1 34 ? 17.266  -7.502  -11.047 1.00 0.00 ? 34 LEU A CG   1  
ATOM 506  C CD1  . LEU A 1 34 ? 15.757  -7.170  -10.982 1.00 0.00 ? 34 LEU A CD1  1  
ATOM 507  C CD2  . LEU A 1 34 ? 17.451  -8.875  -11.729 1.00 0.00 ? 34 LEU A CD2  1  
ATOM 508  H H    . LEU A 1 34 ? 18.778  -5.626  -9.559  1.00 0.00 ? 34 LEU A H    1  
ATOM 509  H HA   . LEU A 1 34 ? 19.936  -7.343  -11.486 1.00 0.00 ? 34 LEU A HA   1  
ATOM 510  H HB2  . LEU A 1 34 ? 17.554  -5.442  -11.684 1.00 0.00 ? 34 LEU A HB2  1  
ATOM 511  H HB3  . LEU A 1 34 ? 17.930  -6.616  -12.923 1.00 0.00 ? 34 LEU A HB3  1  
ATOM 512  H HG   . LEU A 1 34 ? 17.657  -7.552  -10.043 1.00 0.00 ? 34 LEU A HG   1  
ATOM 513  H HD11 . LEU A 1 34 ? 15.394  -6.859  -11.951 1.00 0.00 ? 34 LEU A HD11 1  
ATOM 514  H HD12 . LEU A 1 34 ? 15.196  -8.035  -10.663 1.00 0.00 ? 34 LEU A HD12 1  
ATOM 515  H HD13 . LEU A 1 34 ? 15.585  -6.374  -10.274 1.00 0.00 ? 34 LEU A HD13 1  
ATOM 516  H HD21 . LEU A 1 34 ? 18.501  -9.122  -11.793 1.00 0.00 ? 34 LEU A HD21 1  
ATOM 517  H HD22 . LEU A 1 34 ? 16.954  -9.642  -11.154 1.00 0.00 ? 34 LEU A HD22 1  
ATOM 518  H HD23 . LEU A 1 34 ? 17.035  -8.863  -12.726 1.00 0.00 ? 34 LEU A HD23 1  
ATOM 519  N N    . MET A 1 35 ? 20.059  -4.162  -12.307 1.00 0.00 ? 35 MET A N    1  
ATOM 520  C CA   . MET A 1 35 ? 20.767  -3.169  -13.182 1.00 0.00 ? 35 MET A CA   1  
ATOM 521  C C    . MET A 1 35 ? 22.280  -3.414  -13.115 1.00 0.00 ? 35 MET A C    1  
ATOM 522  O O    . MET A 1 35 ? 22.946  -3.507  -14.128 1.00 0.00 ? 35 MET A O    1  
ATOM 523  C CB   . MET A 1 35 ? 20.444  -1.740  -12.694 1.00 0.00 ? 35 MET A CB   1  
ATOM 524  C CG   . MET A 1 35 ? 18.971  -1.386  -12.995 1.00 0.00 ? 35 MET A CG   1  
ATOM 525  S SD   . MET A 1 35 ? 18.115  -0.291  -11.835 1.00 0.00 ? 35 MET A SD   1  
ATOM 526  C CE   . MET A 1 35 ? 19.313  1.068   -11.797 1.00 0.00 ? 35 MET A CE   1  
ATOM 527  H H    . MET A 1 35 ? 19.413  -3.847  -11.642 1.00 0.00 ? 35 MET A H    1  
ATOM 528  H HA   . MET A 1 35 ? 20.438  -3.308  -14.199 1.00 0.00 ? 35 MET A HA   1  
ATOM 529  H HB2  . MET A 1 35 ? 20.624  -1.661  -11.633 1.00 0.00 ? 35 MET A HB2  1  
ATOM 530  H HB3  . MET A 1 35 ? 21.086  -1.032  -13.199 1.00 0.00 ? 35 MET A HB3  1  
ATOM 531  H HG2  . MET A 1 35 ? 18.931  -0.918  -13.968 1.00 0.00 ? 35 MET A HG2  1  
ATOM 532  H HG3  . MET A 1 35 ? 18.391  -2.295  -13.054 1.00 0.00 ? 35 MET A HG3  1  
ATOM 533  H HE1  . MET A 1 35 ? 19.613  1.319   -12.804 1.00 0.00 ? 35 MET A HE1  1  
ATOM 534  H HE2  . MET A 1 35 ? 18.858  1.930   -11.332 1.00 0.00 ? 35 MET A HE2  1  
ATOM 535  H HE3  . MET A 1 35 ? 20.179  0.769   -11.225 1.00 0.00 ? 35 MET A HE3  1  
ATOM 536  N N    . VAL A 1 36 ? 22.756  -3.511  -11.900 1.00 0.00 ? 36 VAL A N    1  
ATOM 537  C CA   . VAL A 1 36 ? 24.207  -3.757  -11.636 1.00 0.00 ? 36 VAL A CA   1  
ATOM 538  C C    . VAL A 1 36 ? 24.620  -5.072  -12.328 1.00 0.00 ? 36 VAL A C    1  
ATOM 539  O O    . VAL A 1 36 ? 25.569  -5.102  -13.089 1.00 0.00 ? 36 VAL A O    1  
ATOM 540  C CB   . VAL A 1 36 ? 24.406  -3.833  -10.089 1.00 0.00 ? 36 VAL A CB   1  
ATOM 541  C CG1  . VAL A 1 36 ? 25.815  -4.369  -9.742  1.00 0.00 ? 36 VAL A CG1  1  
ATOM 542  C CG2  . VAL A 1 36 ? 24.250  -2.416  -9.494  1.00 0.00 ? 36 VAL A CG2  1  
ATOM 543  H H    . VAL A 1 36 ? 22.137  -3.409  -11.151 1.00 0.00 ? 36 VAL A H    1  
ATOM 544  H HA   . VAL A 1 36 ? 24.782  -2.943  -12.056 1.00 0.00 ? 36 VAL A HA   1  
ATOM 545  H HB   . VAL A 1 36 ? 23.658  -4.476  -9.645  1.00 0.00 ? 36 VAL A HB   1  
ATOM 546  H HG11 . VAL A 1 36 ? 26.568  -3.868  -10.333 1.00 0.00 ? 36 VAL A HG11 1  
ATOM 547  H HG12 . VAL A 1 36 ? 26.032  -4.209  -8.696  1.00 0.00 ? 36 VAL A HG12 1  
ATOM 548  H HG13 . VAL A 1 36 ? 25.863  -5.428  -9.941  1.00 0.00 ? 36 VAL A HG13 1  
ATOM 549  H HG21 . VAL A 1 36 ? 23.315  -1.976  -9.808  1.00 0.00 ? 36 VAL A HG21 1  
ATOM 550  H HG22 . VAL A 1 36 ? 24.260  -2.466  -8.415  1.00 0.00 ? 36 VAL A HG22 1  
ATOM 551  H HG23 . VAL A 1 36 ? 25.058  -1.778  -9.818  1.00 0.00 ? 36 VAL A HG23 1  
ATOM 552  N N    . GLY A 1 37 ? 23.880  -6.111  -12.032 1.00 0.00 ? 37 GLY A N    1  
ATOM 553  C CA   . GLY A 1 37 ? 24.135  -7.462  -12.614 1.00 0.00 ? 37 GLY A CA   1  
ATOM 554  C C    . GLY A 1 37 ? 24.145  -8.500  -11.489 1.00 0.00 ? 37 GLY A C    1  
ATOM 555  O O    . GLY A 1 37 ? 24.701  -8.258  -10.436 1.00 0.00 ? 37 GLY A O    1  
ATOM 556  H H    . GLY A 1 37 ? 23.137  -6.007  -11.406 1.00 0.00 ? 37 GLY A H    1  
ATOM 557  H HA2  . GLY A 1 37 ? 23.345  -7.695  -13.312 1.00 0.00 ? 37 GLY A HA2  1  
ATOM 558  H HA3  . GLY A 1 37 ? 25.086  -7.481  -13.123 1.00 0.00 ? 37 GLY A HA3  1  
ATOM 559  N N    . GLY A 1 38 ? 23.527  -9.626  -11.747 1.00 0.00 ? 38 GLY A N    1  
ATOM 560  C CA   . GLY A 1 38 ? 23.466  -10.721 -10.728 1.00 0.00 ? 38 GLY A CA   1  
ATOM 561  C C    . GLY A 1 38 ? 24.878  -11.186 -10.347 1.00 0.00 ? 38 GLY A C    1  
ATOM 562  O O    . GLY A 1 38 ? 25.175  -11.389 -9.186  1.00 0.00 ? 38 GLY A O    1  
ATOM 563  H H    . GLY A 1 38 ? 23.098  -9.752  -12.618 1.00 0.00 ? 38 GLY A H    1  
ATOM 564  H HA2  . GLY A 1 38 ? 22.957  -10.359 -9.846  1.00 0.00 ? 38 GLY A HA2  1  
ATOM 565  H HA3  . GLY A 1 38 ? 22.920  -11.557 -11.141 1.00 0.00 ? 38 GLY A HA3  1  
ATOM 566  N N    . VAL A 1 39 ? 25.700  -11.332 -11.356 1.00 0.00 ? 39 VAL A N    1  
ATOM 567  C CA   . VAL A 1 39 ? 27.112  -11.778 -11.161 1.00 0.00 ? 39 VAL A CA   1  
ATOM 568  C C    . VAL A 1 39 ? 28.023  -10.534 -11.128 1.00 0.00 ? 39 VAL A C    1  
ATOM 569  O O    . VAL A 1 39 ? 29.157  -10.564 -11.569 1.00 0.00 ? 39 VAL A O    1  
ATOM 570  C CB   . VAL A 1 39 ? 27.508  -12.734 -12.338 1.00 0.00 ? 39 VAL A CB   1  
ATOM 571  C CG1  . VAL A 1 39 ? 28.711  -13.611 -11.913 1.00 0.00 ? 39 VAL A CG1  1  
ATOM 572  C CG2  . VAL A 1 39 ? 26.327  -13.672 -12.698 1.00 0.00 ? 39 VAL A CG2  1  
ATOM 573  H H    . VAL A 1 39 ? 25.388  -11.148 -12.261 1.00 0.00 ? 39 VAL A H    1  
ATOM 574  H HA   . VAL A 1 39 ? 27.186  -12.287 -10.216 1.00 0.00 ? 39 VAL A HA   1  
ATOM 575  H HB   . VAL A 1 39 ? 27.776  -12.155 -13.210 1.00 0.00 ? 39 VAL A HB   1  
ATOM 576  H HG11 . VAL A 1 39 ? 29.549  -12.995 -11.624 1.00 0.00 ? 39 VAL A HG11 1  
ATOM 577  H HG12 . VAL A 1 39 ? 28.440  -14.240 -11.077 1.00 0.00 ? 39 VAL A HG12 1  
ATOM 578  H HG13 . VAL A 1 39 ? 29.017  -14.241 -12.735 1.00 0.00 ? 39 VAL A HG13 1  
ATOM 579  H HG21 . VAL A 1 39 ? 25.926  -14.132 -11.808 1.00 0.00 ? 39 VAL A HG21 1  
ATOM 580  H HG22 . VAL A 1 39 ? 25.541  -13.113 -13.184 1.00 0.00 ? 39 VAL A HG22 1  
ATOM 581  H HG23 . VAL A 1 39 ? 26.658  -14.450 -13.372 1.00 0.00 ? 39 VAL A HG23 1  
ATOM 582  N N    . VAL A 1 40 ? 27.477  -9.471  -10.593 1.00 0.00 ? 40 VAL A N    1  
ATOM 583  C CA   . VAL A 1 40 ? 28.215  -8.172  -10.478 1.00 0.00 ? 40 VAL A CA   1  
ATOM 584  C C    . VAL A 1 40 ? 27.956  -7.566  -9.084  1.00 0.00 ? 40 VAL A C    1  
ATOM 585  O O    . VAL A 1 40 ? 26.810  -7.613  -8.667  1.00 0.00 ? 40 VAL A O    1  
ATOM 586  C CB   . VAL A 1 40 ? 27.718  -7.197  -11.586 1.00 0.00 ? 40 VAL A CB   1  
ATOM 587  C CG1  . VAL A 1 40 ? 28.569  -5.908  -11.572 1.00 0.00 ? 40 VAL A CG1  1  
ATOM 588  C CG2  . VAL A 1 40 ? 27.845  -7.861  -12.976 1.00 0.00 ? 40 VAL A CG2  1  
ATOM 589  O OXT  . VAL A 1 40 ? 28.922  -7.088  -8.512  1.00 0.00 ? 40 VAL A OXT  1  
ATOM 590  H H    . VAL A 1 40 ? 26.557  -9.524  -10.259 1.00 0.00 ? 40 VAL A H    1  
ATOM 591  H HA   . VAL A 1 40 ? 29.275  -8.354  -10.590 1.00 0.00 ? 40 VAL A HA   1  
ATOM 592  H HB   . VAL A 1 40 ? 26.684  -6.942  -11.407 1.00 0.00 ? 40 VAL A HB   1  
ATOM 593  H HG11 . VAL A 1 40 ? 29.614  -6.145  -11.716 1.00 0.00 ? 40 VAL A HG11 1  
ATOM 594  H HG12 . VAL A 1 40 ? 28.252  -5.244  -12.363 1.00 0.00 ? 40 VAL A HG12 1  
ATOM 595  H HG13 . VAL A 1 40 ? 28.457  -5.394  -10.629 1.00 0.00 ? 40 VAL A HG13 1  
ATOM 596  H HG21 . VAL A 1 40 ? 28.853  -8.217  -13.134 1.00 0.00 ? 40 VAL A HG21 1  
ATOM 597  H HG22 . VAL A 1 40 ? 27.164  -8.695  -13.056 1.00 0.00 ? 40 VAL A HG22 1  
ATOM 598  H HG23 . VAL A 1 40 ? 27.604  -7.148  -13.751 1.00 0.00 ? 40 VAL A HG23 1  
ATOM 599  N N    . ASP A 1 1  ? 17.549  4.484   -15.398 1.00 0.00 ? 1  ASP A N    2  
ATOM 600  C CA   . ASP A 1 1  ? 16.100  4.570   -15.733 1.00 0.00 ? 1  ASP A CA   2  
ATOM 601  C C    . ASP A 1 1  ? 15.628  6.025   -15.600 1.00 0.00 ? 1  ASP A C    2  
ATOM 602  O O    . ASP A 1 1  ? 15.873  6.665   -14.596 1.00 0.00 ? 1  ASP A O    2  
ATOM 603  C CB   . ASP A 1 1  ? 15.283  3.668   -14.772 1.00 0.00 ? 1  ASP A CB   2  
ATOM 604  C CG   . ASP A 1 1  ? 13.773  3.941   -14.930 1.00 0.00 ? 1  ASP A CG   2  
ATOM 605  O OD1  . ASP A 1 1  ? 13.242  3.478   -15.926 1.00 0.00 ? 1  ASP A OD1  2  
ATOM 606  O OD2  . ASP A 1 1  ? 13.235  4.595   -14.050 1.00 0.00 ? 1  ASP A OD2  2  
ATOM 607  H H1   . ASP A 1 1  ? 17.905  5.427   -15.147 1.00 0.00 ? 1  ASP A H1   2  
ATOM 608  H H2   . ASP A 1 1  ? 17.685  3.838   -14.594 1.00 0.00 ? 1  ASP A H2   2  
ATOM 609  H H3   . ASP A 1 1  ? 18.073  4.125   -16.221 1.00 0.00 ? 1  ASP A H3   2  
ATOM 610  H HA   . ASP A 1 1  ? 15.964  4.242   -16.754 1.00 0.00 ? 1  ASP A HA   2  
ATOM 611  H HB2  . ASP A 1 1  ? 15.475  2.628   -15.000 1.00 0.00 ? 1  ASP A HB2  2  
ATOM 612  H HB3  . ASP A 1 1  ? 15.575  3.853   -13.747 1.00 0.00 ? 1  ASP A HB3  2  
ATOM 613  N N    . ALA A 1 2  ? 14.960  6.488   -16.626 1.00 0.00 ? 2  ALA A N    2  
ATOM 614  C CA   . ALA A 1 2  ? 14.433  7.887   -16.644 1.00 0.00 ? 2  ALA A CA   2  
ATOM 615  C C    . ALA A 1 2  ? 12.973  7.840   -16.168 1.00 0.00 ? 2  ALA A C    2  
ATOM 616  O O    . ALA A 1 2  ? 12.047  8.207   -16.867 1.00 0.00 ? 2  ALA A O    2  
ATOM 617  C CB   . ALA A 1 2  ? 14.552  8.418   -18.080 1.00 0.00 ? 2  ALA A CB   2  
ATOM 618  H H    . ALA A 1 2  ? 14.802  5.908   -17.399 1.00 0.00 ? 2  ALA A H    2  
ATOM 619  H HA   . ALA A 1 2  ? 15.006  8.508   -15.971 1.00 0.00 ? 2  ALA A HA   2  
ATOM 620  H HB1  . ALA A 1 2  ? 14.259  7.654   -18.780 1.00 0.00 ? 2  ALA A HB1  2  
ATOM 621  H HB2  . ALA A 1 2  ? 13.924  9.287   -18.216 1.00 0.00 ? 2  ALA A HB2  2  
ATOM 622  H HB3  . ALA A 1 2  ? 15.578  8.694   -18.274 1.00 0.00 ? 2  ALA A HB3  2  
ATOM 623  N N    . GLU A 1 3  ? 12.845  7.370   -14.954 1.00 0.00 ? 3  GLU A N    2  
ATOM 624  C CA   . GLU A 1 3  ? 11.521  7.227   -14.272 1.00 0.00 ? 3  GLU A CA   2  
ATOM 625  C C    . GLU A 1 3  ? 10.512  6.426   -15.113 1.00 0.00 ? 3  GLU A C    2  
ATOM 626  O O    . GLU A 1 3  ? 9.331   6.716   -15.146 1.00 0.00 ? 3  GLU A O    2  
ATOM 627  C CB   . GLU A 1 3  ? 10.980  8.655   -13.956 1.00 0.00 ? 3  GLU A CB   2  
ATOM 628  C CG   . GLU A 1 3  ? 11.705  9.209   -12.709 1.00 0.00 ? 3  GLU A CG   2  
ATOM 629  C CD   . GLU A 1 3  ? 11.238  8.442   -11.454 1.00 0.00 ? 3  GLU A CD   2  
ATOM 630  O OE1  . GLU A 1 3  ? 10.179  8.798   -10.963 1.00 0.00 ? 3  GLU A OE1  2  
ATOM 631  O OE2  . GLU A 1 3  ? 11.960  7.542   -11.056 1.00 0.00 ? 3  GLU A OE2  2  
ATOM 632  H H    . GLU A 1 3  ? 13.657  7.101   -14.478 1.00 0.00 ? 3  GLU A H    2  
ATOM 633  H HA   . GLU A 1 3  ? 11.686  6.678   -13.361 1.00 0.00 ? 3  GLU A HA   2  
ATOM 634  H HB2  . GLU A 1 3  ? 11.157  9.314   -14.793 1.00 0.00 ? 3  GLU A HB2  2  
ATOM 635  H HB3  . GLU A 1 3  ? 9.917   8.630   -13.765 1.00 0.00 ? 3  GLU A HB3  2  
ATOM 636  H HG2  . GLU A 1 3  ? 12.775  9.105   -12.816 1.00 0.00 ? 3  GLU A HG2  2  
ATOM 637  H HG3  . GLU A 1 3  ? 11.474  10.257  -12.587 1.00 0.00 ? 3  GLU A HG3  2  
ATOM 638  N N    . PHE A 1 4  ? 11.037  5.427   -15.774 1.00 0.00 ? 4  PHE A N    2  
ATOM 639  C CA   . PHE A 1 4  ? 10.207  4.535   -16.641 1.00 0.00 ? 4  PHE A CA   2  
ATOM 640  C C    . PHE A 1 4  ? 10.149  3.122   -16.048 1.00 0.00 ? 4  PHE A C    2  
ATOM 641  O O    . PHE A 1 4  ? 9.958   2.150   -16.754 1.00 0.00 ? 4  PHE A O    2  
ATOM 642  C CB   . PHE A 1 4  ? 10.828  4.516   -18.058 1.00 0.00 ? 4  PHE A CB   2  
ATOM 643  C CG   . PHE A 1 4  ? 10.768  5.917   -18.699 1.00 0.00 ? 4  PHE A CG   2  
ATOM 644  C CD1  . PHE A 1 4  ? 9.631   6.707   -18.613 1.00 0.00 ? 4  PHE A CD1  2  
ATOM 645  C CD2  . PHE A 1 4  ? 11.870  6.407   -19.377 1.00 0.00 ? 4  PHE A CD2  2  
ATOM 646  C CE1  . PHE A 1 4  ? 9.598   7.956   -19.193 1.00 0.00 ? 4  PHE A CE1  2  
ATOM 647  C CE2  . PHE A 1 4  ? 11.837  7.658   -19.958 1.00 0.00 ? 4  PHE A CE2  2  
ATOM 648  C CZ   . PHE A 1 4  ? 10.702  8.434   -19.867 1.00 0.00 ? 4  PHE A CZ   2  
ATOM 649  H H    . PHE A 1 4  ? 11.998  5.260   -15.699 1.00 0.00 ? 4  PHE A H    2  
ATOM 650  H HA   . PHE A 1 4  ? 9.194   4.903   -16.667 1.00 0.00 ? 4  PHE A HA   2  
ATOM 651  H HB2  . PHE A 1 4  ? 11.859  4.203   -18.000 1.00 0.00 ? 4  PHE A HB2  2  
ATOM 652  H HB3  . PHE A 1 4  ? 10.294  3.826   -18.695 1.00 0.00 ? 4  PHE A HB3  2  
ATOM 653  H HD1  . PHE A 1 4  ? 8.755   6.349   -18.092 1.00 0.00 ? 4  PHE A HD1  2  
ATOM 654  H HD2  . PHE A 1 4  ? 12.765  5.807   -19.454 1.00 0.00 ? 4  PHE A HD2  2  
ATOM 655  H HE1  . PHE A 1 4  ? 8.705   8.561   -19.120 1.00 0.00 ? 4  PHE A HE1  2  
ATOM 656  H HE2  . PHE A 1 4  ? 12.703  8.031   -20.486 1.00 0.00 ? 4  PHE A HE2  2  
ATOM 657  H HZ   . PHE A 1 4  ? 10.676  9.414   -20.321 1.00 0.00 ? 4  PHE A HZ   2  
ATOM 658  N N    . ARG A 1 5  ? 10.320  3.068   -14.752 1.00 0.00 ? 5  ARG A N    2  
ATOM 659  C CA   . ARG A 1 5  ? 10.290  1.769   -14.008 1.00 0.00 ? 5  ARG A CA   2  
ATOM 660  C C    . ARG A 1 5  ? 9.076   1.828   -13.068 1.00 0.00 ? 5  ARG A C    2  
ATOM 661  O O    . ARG A 1 5  ? 9.166   1.494   -11.902 1.00 0.00 ? 5  ARG A O    2  
ATOM 662  C CB   . ARG A 1 5  ? 11.624  1.618   -13.219 1.00 0.00 ? 5  ARG A CB   2  
ATOM 663  C CG   . ARG A 1 5  ? 12.113  0.149   -13.237 1.00 0.00 ? 5  ARG A CG   2  
ATOM 664  C CD   . ARG A 1 5  ? 11.270  -0.716  -12.269 1.00 0.00 ? 5  ARG A CD   2  
ATOM 665  N NE   . ARG A 1 5  ? 11.699  -2.145  -12.397 1.00 0.00 ? 5  ARG A NE   2  
ATOM 666  C CZ   . ARG A 1 5  ? 12.792  -2.598  -11.832 1.00 0.00 ? 5  ARG A CZ   2  
ATOM 667  N NH1  . ARG A 1 5  ? 13.555  -1.808  -11.126 1.00 0.00 ? 5  ARG A NH1  2  
ATOM 668  N NH2  . ARG A 1 5  ? 13.093  -3.857  -11.994 1.00 0.00 ? 5  ARG A NH2  2  
ATOM 669  H H    . ARG A 1 5  ? 10.469  3.903   -14.263 1.00 0.00 ? 5  ARG A H    2  
ATOM 670  H HA   . ARG A 1 5  ? 10.150  0.950   -14.701 1.00 0.00 ? 5  ARG A HA   2  
ATOM 671  H HB2  . ARG A 1 5  ? 12.381  2.220   -13.690 1.00 0.00 ? 5  ARG A HB2  2  
ATOM 672  H HB3  . ARG A 1 5  ? 11.516  1.965   -12.205 1.00 0.00 ? 5  ARG A HB3  2  
ATOM 673  H HG2  . ARG A 1 5  ? 12.047  -0.251  -14.238 1.00 0.00 ? 5  ARG A HG2  2  
ATOM 674  H HG3  . ARG A 1 5  ? 13.149  0.125   -12.932 1.00 0.00 ? 5  ARG A HG3  2  
ATOM 675  H HD2  . ARG A 1 5  ? 11.391  -0.394  -11.244 1.00 0.00 ? 5  ARG A HD2  2  
ATOM 676  H HD3  . ARG A 1 5  ? 10.226  -0.658  -12.535 1.00 0.00 ? 5  ARG A HD3  2  
ATOM 677  H HE   . ARG A 1 5  ? 11.146  -2.761  -12.922 1.00 0.00 ? 5  ARG A HE   2  
ATOM 678  H HH11 . ARG A 1 5  ? 13.312  -0.846  -11.004 1.00 0.00 ? 5  ARG A HH11 2  
ATOM 679  H HH12 . ARG A 1 5  ? 14.386  -2.171  -10.705 1.00 0.00 ? 5  ARG A HH12 2  
ATOM 680  H HH21 . ARG A 1 5  ? 12.497  -4.448  -12.539 1.00 0.00 ? 5  ARG A HH21 2  
ATOM 681  H HH22 . ARG A 1 5  ? 13.919  -4.231  -11.576 1.00 0.00 ? 5  ARG A HH22 2  
ATOM 682  N N    . HIS A 1 6  ? 7.976   2.264   -13.643 1.00 0.00 ? 6  HIS A N    2  
ATOM 683  C CA   . HIS A 1 6  ? 6.654   2.416   -12.935 1.00 0.00 ? 6  HIS A CA   2  
ATOM 684  C C    . HIS A 1 6  ? 6.782   2.930   -11.487 1.00 0.00 ? 6  HIS A C    2  
ATOM 685  O O    . HIS A 1 6  ? 5.962   2.639   -10.636 1.00 0.00 ? 6  HIS A O    2  
ATOM 686  C CB   . HIS A 1 6  ? 5.924   1.036   -12.962 1.00 0.00 ? 6  HIS A CB   2  
ATOM 687  C CG   . HIS A 1 6  ? 6.774   -0.054  -12.300 1.00 0.00 ? 6  HIS A CG   2  
ATOM 688  N ND1  . HIS A 1 6  ? 7.099   -0.089  -11.051 1.00 0.00 ? 6  HIS A ND1  2  
ATOM 689  C CD2  . HIS A 1 6  ? 7.366   -1.185  -12.838 1.00 0.00 ? 6  HIS A CD2  2  
ATOM 690  C CE1  . HIS A 1 6  ? 7.823   -1.137  -10.817 1.00 0.00 ? 6  HIS A CE1  2  
ATOM 691  N NE2  . HIS A 1 6  ? 8.014   -1.847  -11.900 1.00 0.00 ? 6  HIS A NE2  2  
ATOM 692  H H    . HIS A 1 6  ? 8.020   2.505   -14.593 1.00 0.00 ? 6  HIS A H    2  
ATOM 693  H HA   . HIS A 1 6  ? 6.069   3.134   -13.487 1.00 0.00 ? 6  HIS A HA   2  
ATOM 694  H HB2  . HIS A 1 6  ? 4.980   1.103   -12.442 1.00 0.00 ? 6  HIS A HB2  2  
ATOM 695  H HB3  . HIS A 1 6  ? 5.728   0.748   -13.985 1.00 0.00 ? 6  HIS A HB3  2  
ATOM 696  H HD1  . HIS A 1 6  ? 6.836   0.578   -10.382 1.00 0.00 ? 6  HIS A HD1  2  
ATOM 697  H HD2  . HIS A 1 6  ? 7.303   -1.481  -13.875 1.00 0.00 ? 6  HIS A HD2  2  
ATOM 698  H HE1  . HIS A 1 6  ? 8.223   -1.393  -9.847  1.00 0.00 ? 6  HIS A HE1  2  
ATOM 699  N N    . ASP A 1 7  ? 7.828   3.692   -11.287 1.00 0.00 ? 7  ASP A N    2  
ATOM 700  C CA   . ASP A 1 7  ? 8.168   4.308   -9.962  1.00 0.00 ? 7  ASP A CA   2  
ATOM 701  C C    . ASP A 1 7  ? 6.938   4.904   -9.254  1.00 0.00 ? 7  ASP A C    2  
ATOM 702  O O    . ASP A 1 7  ? 6.309   5.823   -9.739  1.00 0.00 ? 7  ASP A O    2  
ATOM 703  C CB   . ASP A 1 7  ? 9.260   5.422   -10.174 1.00 0.00 ? 7  ASP A CB   2  
ATOM 704  C CG   . ASP A 1 7  ? 9.663   5.558   -11.660 1.00 0.00 ? 7  ASP A CG   2  
ATOM 705  O OD1  . ASP A 1 7  ? 10.541  4.812   -12.069 1.00 0.00 ? 7  ASP A OD1  2  
ATOM 706  O OD2  . ASP A 1 7  ? 9.062   6.401   -12.305 1.00 0.00 ? 7  ASP A OD2  2  
ATOM 707  H H    . ASP A 1 7  ? 8.412   3.858   -12.054 1.00 0.00 ? 7  ASP A H    2  
ATOM 708  H HA   . ASP A 1 7  ? 8.578   3.531   -9.334  1.00 0.00 ? 7  ASP A HA   2  
ATOM 709  H HB2  . ASP A 1 7  ? 8.901   6.380   -9.822  1.00 0.00 ? 7  ASP A HB2  2  
ATOM 710  H HB3  . ASP A 1 7  ? 10.141  5.172   -9.599  1.00 0.00 ? 7  ASP A HB3  2  
ATOM 711  N N    . SER A 1 8  ? 6.663   4.325   -8.111  1.00 0.00 ? 8  SER A N    2  
ATOM 712  C CA   . SER A 1 8  ? 5.519   4.721   -7.238  1.00 0.00 ? 8  SER A CA   2  
ATOM 713  C C    . SER A 1 8  ? 5.799   4.244   -5.802  1.00 0.00 ? 8  SER A C    2  
ATOM 714  O O    . SER A 1 8  ? 6.689   3.448   -5.564  1.00 0.00 ? 8  SER A O    2  
ATOM 715  C CB   . SER A 1 8  ? 4.222   4.063   -7.752  1.00 0.00 ? 8  SER A CB   2  
ATOM 716  O OG   . SER A 1 8  ? 3.875   4.810   -8.908  1.00 0.00 ? 8  SER A OG   2  
ATOM 717  H H    . SER A 1 8  ? 7.237   3.598   -7.808  1.00 0.00 ? 8  SER A H    2  
ATOM 718  H HA   . SER A 1 8  ? 5.441   5.796   -7.235  1.00 0.00 ? 8  SER A HA   2  
ATOM 719  H HB2  . SER A 1 8  ? 4.381   3.031   -8.026  1.00 0.00 ? 8  SER A HB2  2  
ATOM 720  H HB3  . SER A 1 8  ? 3.422   4.140   -7.031  1.00 0.00 ? 8  SER A HB3  2  
ATOM 721  H HG   . SER A 1 8  ? 3.014   5.205   -8.758  1.00 0.00 ? 8  SER A HG   2  
ATOM 722  N N    . GLY A 1 9  ? 5.012   4.754   -4.889  1.00 0.00 ? 9  GLY A N    2  
ATOM 723  C CA   . GLY A 1 9  ? 5.153   4.395   -3.444  1.00 0.00 ? 9  GLY A CA   2  
ATOM 724  C C    . GLY A 1 9  ? 4.479   5.485   -2.612  1.00 0.00 ? 9  GLY A C    2  
ATOM 725  O O    . GLY A 1 9  ? 5.138   6.239   -1.924  1.00 0.00 ? 9  GLY A O    2  
ATOM 726  H H    . GLY A 1 9  ? 4.313   5.385   -5.159  1.00 0.00 ? 9  GLY A H    2  
ATOM 727  H HA2  . GLY A 1 9  ? 4.670   3.450   -3.254  1.00 0.00 ? 9  GLY A HA2  2  
ATOM 728  H HA3  . GLY A 1 9  ? 6.201   4.335   -3.180  1.00 0.00 ? 9  GLY A HA3  2  
ATOM 729  N N    . TYR A 1 10 ? 3.173   5.528   -2.709  1.00 0.00 ? 10 TYR A N    2  
ATOM 730  C CA   . TYR A 1 10 ? 2.374   6.545   -1.953  1.00 0.00 ? 10 TYR A CA   2  
ATOM 731  C C    . TYR A 1 10 ? 0.899   6.123   -1.845  1.00 0.00 ? 10 TYR A C    2  
ATOM 732  O O    . TYR A 1 10 ? 0.468   5.174   -2.472  1.00 0.00 ? 10 TYR A O    2  
ATOM 733  C CB   . TYR A 1 10 ? 2.478   7.909   -2.684  1.00 0.00 ? 10 TYR A CB   2  
ATOM 734  C CG   . TYR A 1 10 ? 1.996   7.751   -4.138  1.00 0.00 ? 10 TYR A CG   2  
ATOM 735  C CD1  . TYR A 1 10 ? 2.879   7.392   -5.139  1.00 0.00 ? 10 TYR A CD1  2  
ATOM 736  C CD2  . TYR A 1 10 ? 0.669   7.961   -4.462  1.00 0.00 ? 10 TYR A CD2  2  
ATOM 737  C CE1  . TYR A 1 10 ? 2.444   7.244   -6.438  1.00 0.00 ? 10 TYR A CE1  2  
ATOM 738  C CE2  . TYR A 1 10 ? 0.235   7.812   -5.763  1.00 0.00 ? 10 TYR A CE2  2  
ATOM 739  C CZ   . TYR A 1 10 ? 1.119   7.453   -6.759  1.00 0.00 ? 10 TYR A CZ   2  
ATOM 740  O OH   . TYR A 1 10 ? 0.684   7.302   -8.059  1.00 0.00 ? 10 TYR A OH   2  
ATOM 741  H H    . TYR A 1 10 ? 2.709   4.884   -3.284  1.00 0.00 ? 10 TYR A H    2  
ATOM 742  H HA   . TYR A 1 10 ? 2.777   6.633   -0.954  1.00 0.00 ? 10 TYR A HA   2  
ATOM 743  H HB2  . TYR A 1 10 ? 1.868   8.650   -2.187  1.00 0.00 ? 10 TYR A HB2  2  
ATOM 744  H HB3  . TYR A 1 10 ? 3.502   8.255   -2.688  1.00 0.00 ? 10 TYR A HB3  2  
ATOM 745  H HD1  . TYR A 1 10 ? 3.920   7.228   -4.903  1.00 0.00 ? 10 TYR A HD1  2  
ATOM 746  H HD2  . TYR A 1 10 ? -0.036  8.243   -3.695  1.00 0.00 ? 10 TYR A HD2  2  
ATOM 747  H HE1  . TYR A 1 10 ? 3.145   6.963   -7.211  1.00 0.00 ? 10 TYR A HE1  2  
ATOM 748  H HE2  . TYR A 1 10 ? -0.805  7.981   -6.001  1.00 0.00 ? 10 TYR A HE2  2  
ATOM 749  H HH   . TYR A 1 10 ? 0.176   6.489   -8.109  1.00 0.00 ? 10 TYR A HH   2  
ATOM 750  N N    . GLU A 1 11 ? 0.179   6.866   -1.042  1.00 0.00 ? 11 GLU A N    2  
ATOM 751  C CA   . GLU A 1 11 ? -1.273  6.596   -0.822  1.00 0.00 ? 11 GLU A CA   2  
ATOM 752  C C    . GLU A 1 11 ? -2.086  7.302   -1.915  1.00 0.00 ? 11 GLU A C    2  
ATOM 753  O O    . GLU A 1 11 ? -2.029  8.510   -2.043  1.00 0.00 ? 11 GLU A O    2  
ATOM 754  C CB   . GLU A 1 11 ? -1.666  7.127   0.575   1.00 0.00 ? 11 GLU A CB   2  
ATOM 755  C CG   . GLU A 1 11 ? -3.191  6.947   0.832   1.00 0.00 ? 11 GLU A CG   2  
ATOM 756  C CD   . GLU A 1 11 ? -3.948  8.246   0.482   1.00 0.00 ? 11 GLU A CD   2  
ATOM 757  O OE1  . GLU A 1 11 ? -3.833  9.171   1.271   1.00 0.00 ? 11 GLU A OE1  2  
ATOM 758  O OE2  . GLU A 1 11 ? -4.600  8.247   -0.551  1.00 0.00 ? 11 GLU A OE2  2  
ATOM 759  H H    . GLU A 1 11 ? 0.604   7.615   -0.574  1.00 0.00 ? 11 GLU A H    2  
ATOM 760  H HA   . GLU A 1 11 ? -1.450  5.532   -0.868  1.00 0.00 ? 11 GLU A HA   2  
ATOM 761  H HB2  . GLU A 1 11 ? -1.116  6.575   1.324   1.00 0.00 ? 11 GLU A HB2  2  
ATOM 762  H HB3  . GLU A 1 11 ? -1.389  8.169   0.657   1.00 0.00 ? 11 GLU A HB3  2  
ATOM 763  H HG2  . GLU A 1 11 ? -3.585  6.132   0.242   1.00 0.00 ? 11 GLU A HG2  2  
ATOM 764  H HG3  . GLU A 1 11 ? -3.358  6.720   1.875   1.00 0.00 ? 11 GLU A HG3  2  
ATOM 765  N N    . VAL A 1 12 ? -2.817  6.520   -2.667  1.00 0.00 ? 12 VAL A N    2  
ATOM 766  C CA   . VAL A 1 12 ? -3.665  7.030   -3.766  1.00 0.00 ? 12 VAL A CA   2  
ATOM 767  C C    . VAL A 1 12 ? -5.110  6.783   -3.296  1.00 0.00 ? 12 VAL A C    2  
ATOM 768  O O    . VAL A 1 12 ? -5.357  6.148   -2.287  1.00 0.00 ? 12 VAL A O    2  
ATOM 769  C CB   . VAL A 1 12 ? -3.280  6.236   -5.080  1.00 0.00 ? 12 VAL A CB   2  
ATOM 770  C CG1  . VAL A 1 12 ? -2.596  4.894   -4.786  1.00 0.00 ? 12 VAL A CG1  2  
ATOM 771  C CG2  . VAL A 1 12 ? -4.477  5.900   -5.953  1.00 0.00 ? 12 VAL A CG2  2  
ATOM 772  H H    . VAL A 1 12 ? -2.846  5.553   -2.549  1.00 0.00 ? 12 VAL A H    2  
ATOM 773  H HA   . VAL A 1 12 ? -3.505  8.090   -3.900  1.00 0.00 ? 12 VAL A HA   2  
ATOM 774  H HB   . VAL A 1 12 ? -2.604  6.845   -5.661  1.00 0.00 ? 12 VAL A HB   2  
ATOM 775  H HG11 . VAL A 1 12 ? -1.821  4.989   -4.046  1.00 0.00 ? 12 VAL A HG11 2  
ATOM 776  H HG12 . VAL A 1 12 ? -3.340  4.191   -4.444  1.00 0.00 ? 12 VAL A HG12 2  
ATOM 777  H HG13 . VAL A 1 12 ? -2.159  4.523   -5.696  1.00 0.00 ? 12 VAL A HG13 2  
ATOM 778  H HG21 . VAL A 1 12 ? -5.039  6.785   -6.187  1.00 0.00 ? 12 VAL A HG21 2  
ATOM 779  H HG22 . VAL A 1 12 ? -4.125  5.450   -6.864  1.00 0.00 ? 12 VAL A HG22 2  
ATOM 780  H HG23 . VAL A 1 12 ? -5.098  5.188   -5.433  1.00 0.00 ? 12 VAL A HG23 2  
ATOM 781  N N    . HIS A 1 13 ? -6.015  7.300   -4.072  1.00 0.00 ? 13 HIS A N    2  
ATOM 782  C CA   . HIS A 1 13 ? -7.479  7.171   -3.782  1.00 0.00 ? 13 HIS A CA   2  
ATOM 783  C C    . HIS A 1 13 ? -8.039  5.832   -4.297  1.00 0.00 ? 13 HIS A C    2  
ATOM 784  O O    . HIS A 1 13 ? -9.204  5.719   -4.628  1.00 0.00 ? 13 HIS A O    2  
ATOM 785  C CB   . HIS A 1 13 ? -8.193  8.366   -4.447  1.00 0.00 ? 13 HIS A CB   2  
ATOM 786  C CG   . HIS A 1 13 ? -7.794  9.649   -3.706  1.00 0.00 ? 13 HIS A CG   2  
ATOM 787  N ND1  . HIS A 1 13 ? -8.621  10.464  -3.141  1.00 0.00 ? 13 HIS A ND1  2  
ATOM 788  C CD2  . HIS A 1 13 ? -6.548  10.211  -3.475  1.00 0.00 ? 13 HIS A CD2  2  
ATOM 789  C CE1  . HIS A 1 13 ? -7.968  11.445  -2.603  1.00 0.00 ? 13 HIS A CE1  2  
ATOM 790  N NE2  . HIS A 1 13 ? -6.676  11.328  -2.787  1.00 0.00 ? 13 HIS A NE2  2  
ATOM 791  H H    . HIS A 1 13 ? -5.690  7.773   -4.862  1.00 0.00 ? 13 HIS A H    2  
ATOM 792  H HA   . HIS A 1 13 ? -7.626  7.218   -2.713  1.00 0.00 ? 13 HIS A HA   2  
ATOM 793  H HB2  . HIS A 1 13 ? -7.905  8.455   -5.486  1.00 0.00 ? 13 HIS A HB2  2  
ATOM 794  H HB3  . HIS A 1 13 ? -9.265  8.252   -4.384  1.00 0.00 ? 13 HIS A HB3  2  
ATOM 795  H HD1  . HIS A 1 13 ? -9.594  10.355  -3.122  1.00 0.00 ? 13 HIS A HD1  2  
ATOM 796  H HD2  . HIS A 1 13 ? -5.610  9.793   -3.807  1.00 0.00 ? 13 HIS A HD2  2  
ATOM 797  H HE1  . HIS A 1 13 ? -8.432  12.261  -2.068  1.00 0.00 ? 13 HIS A HE1  2  
ATOM 798  N N    . HIS A 1 14 ? -7.169  4.854   -4.340  1.00 0.00 ? 14 HIS A N    2  
ATOM 799  C CA   . HIS A 1 14 ? -7.518  3.480   -4.810  1.00 0.00 ? 14 HIS A CA   2  
ATOM 800  C C    . HIS A 1 14 ? -6.593  2.505   -4.083  1.00 0.00 ? 14 HIS A C    2  
ATOM 801  O O    . HIS A 1 14 ? -5.409  2.460   -4.359  1.00 0.00 ? 14 HIS A O    2  
ATOM 802  C CB   . HIS A 1 14 ? -7.292  3.357   -6.328  1.00 0.00 ? 14 HIS A CB   2  
ATOM 803  C CG   . HIS A 1 14 ? -8.201  4.335   -7.049  1.00 0.00 ? 14 HIS A CG   2  
ATOM 804  N ND1  . HIS A 1 14 ? -9.472  4.222   -7.242  1.00 0.00 ? 14 HIS A ND1  2  
ATOM 805  C CD2  . HIS A 1 14 ? -7.862  5.521   -7.631  1.00 0.00 ? 14 HIS A CD2  2  
ATOM 806  C CE1  . HIS A 1 14 ? -9.896  5.258   -7.896  1.00 0.00 ? 14 HIS A CE1  2  
ATOM 807  N NE2  . HIS A 1 14 ? -8.923  6.097   -8.160  1.00 0.00 ? 14 HIS A NE2  2  
ATOM 808  H H    . HIS A 1 14 ? -6.250  5.026   -4.049  1.00 0.00 ? 14 HIS A H    2  
ATOM 809  H HA   . HIS A 1 14 ? -8.547  3.269   -4.571  1.00 0.00 ? 14 HIS A HA   2  
ATOM 810  H HB2  . HIS A 1 14 ? -6.266  3.585   -6.579  1.00 0.00 ? 14 HIS A HB2  2  
ATOM 811  H HB3  . HIS A 1 14 ? -7.516  2.375   -6.694  1.00 0.00 ? 14 HIS A HB3  2  
ATOM 812  H HD1  . HIS A 1 14 ? -10.028 3.472   -6.944  1.00 0.00 ? 14 HIS A HD1  2  
ATOM 813  H HD2  . HIS A 1 14 ? -6.855  5.887   -7.629  1.00 0.00 ? 14 HIS A HD2  2  
ATOM 814  H HE1  . HIS A 1 14 ? -10.924 5.411   -8.187  1.00 0.00 ? 14 HIS A HE1  2  
ATOM 815  N N    . GLN A 1 15 ? -7.141  1.742   -3.171  1.00 0.00 ? 15 GLN A N    2  
ATOM 816  C CA   . GLN A 1 15 ? -6.304  0.755   -2.412  1.00 0.00 ? 15 GLN A CA   2  
ATOM 817  C C    . GLN A 1 15 ? -5.580  -0.217  -3.368  1.00 0.00 ? 15 GLN A C    2  
ATOM 818  O O    . GLN A 1 15 ? -4.654  -0.903  -2.983  1.00 0.00 ? 15 GLN A O    2  
ATOM 819  C CB   . GLN A 1 15 ? -7.220  -0.044  -1.440  1.00 0.00 ? 15 GLN A CB   2  
ATOM 820  C CG   . GLN A 1 15 ? -6.798  0.217   0.028   1.00 0.00 ? 15 GLN A CG   2  
ATOM 821  C CD   . GLN A 1 15 ? -5.544  -0.600  0.374   1.00 0.00 ? 15 GLN A CD   2  
ATOM 822  O OE1  . GLN A 1 15 ? -4.506  -0.472  -0.244  1.00 0.00 ? 15 GLN A OE1  2  
ATOM 823  N NE2  . GLN A 1 15 ? -5.594  -1.453  1.360   1.00 0.00 ? 15 GLN A NE2  2  
ATOM 824  H H    . GLN A 1 15 ? -8.100  1.814   -2.985  1.00 0.00 ? 15 GLN A H    2  
ATOM 825  H HA   . GLN A 1 15 ? -5.562  1.309   -1.858  1.00 0.00 ? 15 GLN A HA   2  
ATOM 826  H HB2  . GLN A 1 15 ? -8.248  0.265   -1.567  1.00 0.00 ? 15 GLN A HB2  2  
ATOM 827  H HB3  . GLN A 1 15 ? -7.164  -1.103  -1.646  1.00 0.00 ? 15 GLN A HB3  2  
ATOM 828  H HG2  . GLN A 1 15 ? -6.585  1.265   0.186   1.00 0.00 ? 15 GLN A HG2  2  
ATOM 829  H HG3  . GLN A 1 15 ? -7.598  -0.075  0.693   1.00 0.00 ? 15 GLN A HG3  2  
ATOM 830  H HE21 . GLN A 1 15 ? -6.422  -1.568  1.871   1.00 0.00 ? 15 GLN A HE21 2  
ATOM 831  H HE22 . GLN A 1 15 ? -4.801  -1.980  1.589   1.00 0.00 ? 15 GLN A HE22 2  
ATOM 832  N N    . LYS A 1 16 ? -6.019  -0.225  -4.602  1.00 0.00 ? 16 LYS A N    2  
ATOM 833  C CA   . LYS A 1 16 ? -5.430  -1.108  -5.637  1.00 0.00 ? 16 LYS A CA   2  
ATOM 834  C C    . LYS A 1 16 ? -4.085  -0.510  -6.032  1.00 0.00 ? 16 LYS A C    2  
ATOM 835  O O    . LYS A 1 16 ? -3.047  -1.137  -5.937  1.00 0.00 ? 16 LYS A O    2  
ATOM 836  C CB   . LYS A 1 16 ? -6.422  -1.159  -6.835  1.00 0.00 ? 16 LYS A CB   2  
ATOM 837  C CG   . LYS A 1 16 ? -6.597  -2.607  -7.324  1.00 0.00 ? 16 LYS A CG   2  
ATOM 838  C CD   . LYS A 1 16 ? -5.213  -3.177  -7.682  1.00 0.00 ? 16 LYS A CD   2  
ATOM 839  C CE   . LYS A 1 16 ? -5.363  -4.378  -8.631  1.00 0.00 ? 16 LYS A CE   2  
ATOM 840  N NZ   . LYS A 1 16 ? -5.838  -3.919  -9.969  1.00 0.00 ? 16 LYS A NZ   2  
ATOM 841  H H    . LYS A 1 16 ? -6.743  0.370   -4.872  1.00 0.00 ? 16 LYS A H    2  
ATOM 842  H HA   . LYS A 1 16 ? -5.271  -2.082  -5.208  1.00 0.00 ? 16 LYS A HA   2  
ATOM 843  H HB2  . LYS A 1 16 ? -7.386  -0.781  -6.527  1.00 0.00 ? 16 LYS A HB2  2  
ATOM 844  H HB3  . LYS A 1 16 ? -6.070  -0.545  -7.651  1.00 0.00 ? 16 LYS A HB3  2  
ATOM 845  H HG2  . LYS A 1 16 ? -7.053  -3.204  -6.547  1.00 0.00 ? 16 LYS A HG2  2  
ATOM 846  H HG3  . LYS A 1 16 ? -7.246  -2.613  -8.188  1.00 0.00 ? 16 LYS A HG3  2  
ATOM 847  H HD2  . LYS A 1 16 ? -4.621  -2.399  -8.145  1.00 0.00 ? 16 LYS A HD2  2  
ATOM 848  H HD3  . LYS A 1 16 ? -4.724  -3.483  -6.769  1.00 0.00 ? 16 LYS A HD3  2  
ATOM 849  H HE2  . LYS A 1 16 ? -4.410  -4.871  -8.756  1.00 0.00 ? 16 LYS A HE2  2  
ATOM 850  H HE3  . LYS A 1 16 ? -6.074  -5.088  -8.235  1.00 0.00 ? 16 LYS A HE3  2  
ATOM 851  H HZ1  . LYS A 1 16 ? -5.961  -2.887  -9.959  1.00 0.00 ? 16 LYS A HZ1  2  
ATOM 852  H HZ2  . LYS A 1 16 ? -5.138  -4.178  -10.693 1.00 0.00 ? 16 LYS A HZ2  2  
ATOM 853  H HZ3  . LYS A 1 16 ? -6.747  -4.374  -10.187 1.00 0.00 ? 16 LYS A HZ3  2  
ATOM 854  N N    . LEU A 1 17 ? -4.160  0.721   -6.464  1.00 0.00 ? 17 LEU A N    2  
ATOM 855  C CA   . LEU A 1 17 ? -2.928  1.444   -6.884  1.00 0.00 ? 17 LEU A CA   2  
ATOM 856  C C    . LEU A 1 17 ? -1.985  1.493   -5.671  1.00 0.00 ? 17 LEU A C    2  
ATOM 857  O O    . LEU A 1 17 ? -0.791  1.371   -5.827  1.00 0.00 ? 17 LEU A O    2  
ATOM 858  C CB   . LEU A 1 17 ? -3.313  2.868   -7.344  1.00 0.00 ? 17 LEU A CB   2  
ATOM 859  C CG   . LEU A 1 17 ? -4.239  2.917   -8.620  1.00 0.00 ? 17 LEU A CG   2  
ATOM 860  C CD1  . LEU A 1 17 ? -3.773  4.065   -9.546  1.00 0.00 ? 17 LEU A CD1  2  
ATOM 861  C CD2  . LEU A 1 17 ? -4.253  1.606   -9.434  1.00 0.00 ? 17 LEU A CD2  2  
ATOM 862  H H    . LEU A 1 17 ? -5.034  1.160   -6.507  1.00 0.00 ? 17 LEU A H    2  
ATOM 863  H HA   . LEU A 1 17 ? -2.442  0.889   -7.673  1.00 0.00 ? 17 LEU A HA   2  
ATOM 864  H HB2  . LEU A 1 17 ? -3.843  3.339   -6.532  1.00 0.00 ? 17 LEU A HB2  2  
ATOM 865  H HB3  . LEU A 1 17 ? -2.406  3.424   -7.530  1.00 0.00 ? 17 LEU A HB3  2  
ATOM 866  H HG   . LEU A 1 17 ? -5.252  3.128   -8.314  1.00 0.00 ? 17 LEU A HG   2  
ATOM 867  H HD11 . LEU A 1 17 ? -3.814  5.009   -9.024  1.00 0.00 ? 17 LEU A HD11 2  
ATOM 868  H HD12 . LEU A 1 17 ? -2.759  3.895   -9.877  1.00 0.00 ? 17 LEU A HD12 2  
ATOM 869  H HD13 . LEU A 1 17 ? -4.415  4.125   -10.413 1.00 0.00 ? 17 LEU A HD13 2  
ATOM 870  H HD21 . LEU A 1 17 ? -3.249  1.316   -9.706  1.00 0.00 ? 17 LEU A HD21 2  
ATOM 871  H HD22 . LEU A 1 17 ? -4.710  0.815   -8.861  1.00 0.00 ? 17 LEU A HD22 2  
ATOM 872  H HD23 . LEU A 1 17 ? -4.832  1.747   -10.335 1.00 0.00 ? 17 LEU A HD23 2  
ATOM 873  N N    . VAL A 1 18 ? -2.542  1.664   -4.497  1.00 0.00 ? 18 VAL A N    2  
ATOM 874  C CA   . VAL A 1 18 ? -1.733  1.720   -3.239  1.00 0.00 ? 18 VAL A CA   2  
ATOM 875  C C    . VAL A 1 18 ? -0.840  0.463   -3.163  1.00 0.00 ? 18 VAL A C    2  
ATOM 876  O O    . VAL A 1 18 ? 0.359   0.566   -3.004  1.00 0.00 ? 18 VAL A O    2  
ATOM 877  C CB   . VAL A 1 18 ? -2.722  1.788   -2.035  1.00 0.00 ? 18 VAL A CB   2  
ATOM 878  C CG1  . VAL A 1 18 ? -2.038  1.372   -0.727  1.00 0.00 ? 18 VAL A CG1  2  
ATOM 879  C CG2  . VAL A 1 18 ? -3.277  3.215   -1.866  1.00 0.00 ? 18 VAL A CG2  2  
ATOM 880  H H    . VAL A 1 18 ? -3.510  1.766   -4.431  1.00 0.00 ? 18 VAL A H    2  
ATOM 881  H HA   . VAL A 1 18 ? -1.104  2.600   -3.268  1.00 0.00 ? 18 VAL A HA   2  
ATOM 882  H HB   . VAL A 1 18 ? -3.537  1.111   -2.220  1.00 0.00 ? 18 VAL A HB   2  
ATOM 883  H HG11 . VAL A 1 18 ? -1.035  1.771   -0.682  1.00 0.00 ? 18 VAL A HG11 2  
ATOM 884  H HG12 . VAL A 1 18 ? -2.601  1.727   0.122   1.00 0.00 ? 18 VAL A HG12 2  
ATOM 885  H HG13 . VAL A 1 18 ? -2.001  0.295   -0.686  1.00 0.00 ? 18 VAL A HG13 2  
ATOM 886  H HG21 . VAL A 1 18 ? -2.465  3.925   -1.893  1.00 0.00 ? 18 VAL A HG21 2  
ATOM 887  H HG22 . VAL A 1 18 ? -3.978  3.444   -2.652  1.00 0.00 ? 18 VAL A HG22 2  
ATOM 888  H HG23 . VAL A 1 18 ? -3.790  3.313   -0.922  1.00 0.00 ? 18 VAL A HG23 2  
ATOM 889  N N    . PHE A 1 19 ? -1.455  -0.687  -3.288  1.00 0.00 ? 19 PHE A N    2  
ATOM 890  C CA   . PHE A 1 19 ? -0.695  -1.978  -3.231  1.00 0.00 ? 19 PHE A CA   2  
ATOM 891  C C    . PHE A 1 19 ? 0.444   -1.972  -4.251  1.00 0.00 ? 19 PHE A C    2  
ATOM 892  O O    . PHE A 1 19 ? 1.579   -2.276  -3.931  1.00 0.00 ? 19 PHE A O    2  
ATOM 893  C CB   . PHE A 1 19 ? -1.643  -3.159  -3.538  1.00 0.00 ? 19 PHE A CB   2  
ATOM 894  C CG   . PHE A 1 19 ? -2.722  -3.349  -2.452  1.00 0.00 ? 19 PHE A CG   2  
ATOM 895  C CD1  . PHE A 1 19 ? -2.444  -3.200  -1.100  1.00 0.00 ? 19 PHE A CD1  2  
ATOM 896  C CD2  . PHE A 1 19 ? -4.010  -3.686  -2.831  1.00 0.00 ? 19 PHE A CD2  2  
ATOM 897  C CE1  . PHE A 1 19 ? -3.432  -3.385  -0.156  1.00 0.00 ? 19 PHE A CE1  2  
ATOM 898  C CE2  . PHE A 1 19 ? -4.998  -3.872  -1.886  1.00 0.00 ? 19 PHE A CE2  2  
ATOM 899  C CZ   . PHE A 1 19 ? -4.709  -3.721  -0.548  1.00 0.00 ? 19 PHE A CZ   2  
ATOM 900  H H    . PHE A 1 19 ? -2.421  -0.700  -3.421  1.00 0.00 ? 19 PHE A H    2  
ATOM 901  H HA   . PHE A 1 19 ? -0.259  -2.085  -2.256  1.00 0.00 ? 19 PHE A HA   2  
ATOM 902  H HB2  . PHE A 1 19 ? -2.131  -2.994  -4.487  1.00 0.00 ? 19 PHE A HB2  2  
ATOM 903  H HB3  . PHE A 1 19 ? -1.070  -4.073  -3.605  1.00 0.00 ? 19 PHE A HB3  2  
ATOM 904  H HD1  . PHE A 1 19 ? -1.449  -2.939  -0.772  1.00 0.00 ? 19 PHE A HD1  2  
ATOM 905  H HD2  . PHE A 1 19 ? -4.248  -3.806  -3.878  1.00 0.00 ? 19 PHE A HD2  2  
ATOM 906  H HE1  . PHE A 1 19 ? -3.203  -3.267  0.893   1.00 0.00 ? 19 PHE A HE1  2  
ATOM 907  H HE2  . PHE A 1 19 ? -5.998  -4.135  -2.196  1.00 0.00 ? 19 PHE A HE2  2  
ATOM 908  H HZ   . PHE A 1 19 ? -5.481  -3.867  0.192   1.00 0.00 ? 19 PHE A HZ   2  
ATOM 909  N N    . PHE A 1 20 ? 0.098   -1.613  -5.459  1.00 0.00 ? 20 PHE A N    2  
ATOM 910  C CA   . PHE A 1 20 ? 1.114   -1.565  -6.550  1.00 0.00 ? 20 PHE A CA   2  
ATOM 911  C C    . PHE A 1 20 ? 2.277   -0.649  -6.113  1.00 0.00 ? 20 PHE A C    2  
ATOM 912  O O    . PHE A 1 20 ? 3.421   -1.053  -6.100  1.00 0.00 ? 20 PHE A O    2  
ATOM 913  C CB   . PHE A 1 20 ? 0.380   -1.052  -7.831  1.00 0.00 ? 20 PHE A CB   2  
ATOM 914  C CG   . PHE A 1 20 ? 1.238   -0.071  -8.646  1.00 0.00 ? 20 PHE A CG   2  
ATOM 915  C CD1  . PHE A 1 20 ? 2.270   -0.535  -9.438  1.00 0.00 ? 20 PHE A CD1  2  
ATOM 916  C CD2  . PHE A 1 20 ? 0.991   1.288   -8.591  1.00 0.00 ? 20 PHE A CD2  2  
ATOM 917  C CE1  . PHE A 1 20 ? 3.041   0.346   -10.164 1.00 0.00 ? 20 PHE A CE1  2  
ATOM 918  C CE2  . PHE A 1 20 ? 1.759   2.169   -9.315  1.00 0.00 ? 20 PHE A CE2  2  
ATOM 919  C CZ   . PHE A 1 20 ? 2.788   1.700   -10.104 1.00 0.00 ? 20 PHE A CZ   2  
ATOM 920  H H    . PHE A 1 20 ? -0.835  -1.375  -5.641  1.00 0.00 ? 20 PHE A H    2  
ATOM 921  H HA   . PHE A 1 20 ? 1.494   -2.563  -6.714  1.00 0.00 ? 20 PHE A HA   2  
ATOM 922  H HB2  . PHE A 1 20 ? 0.140   -1.895  -8.461  1.00 0.00 ? 20 PHE A HB2  2  
ATOM 923  H HB3  . PHE A 1 20 ? -0.545  -0.562  -7.563  1.00 0.00 ? 20 PHE A HB3  2  
ATOM 924  H HD1  . PHE A 1 20 ? 2.478   -1.595  -9.491  1.00 0.00 ? 20 PHE A HD1  2  
ATOM 925  H HD2  . PHE A 1 20 ? 0.188   1.666   -7.979  1.00 0.00 ? 20 PHE A HD2  2  
ATOM 926  H HE1  . PHE A 1 20 ? 3.843   -0.034  -10.777 1.00 0.00 ? 20 PHE A HE1  2  
ATOM 927  H HE2  . PHE A 1 20 ? 1.548   3.226   -9.257  1.00 0.00 ? 20 PHE A HE2  2  
ATOM 928  H HZ   . PHE A 1 20 ? 3.391   2.392   -10.674 1.00 0.00 ? 20 PHE A HZ   2  
ATOM 929  N N    . ALA A 1 21 ? 1.930   0.559   -5.753  1.00 0.00 ? 21 ALA A N    2  
ATOM 930  C CA   . ALA A 1 21 ? 2.934   1.575   -5.305  1.00 0.00 ? 21 ALA A CA   2  
ATOM 931  C C    . ALA A 1 21 ? 3.838   1.021   -4.208  1.00 0.00 ? 21 ALA A C    2  
ATOM 932  O O    . ALA A 1 21 ? 5.033   1.193   -4.263  1.00 0.00 ? 21 ALA A O    2  
ATOM 933  C CB   . ALA A 1 21 ? 2.169   2.811   -4.803  1.00 0.00 ? 21 ALA A CB   2  
ATOM 934  H H    . ALA A 1 21 ? 0.984   0.802   -5.773  1.00 0.00 ? 21 ALA A H    2  
ATOM 935  H HA   . ALA A 1 21 ? 3.567   1.825   -6.148  1.00 0.00 ? 21 ALA A HA   2  
ATOM 936  H HB1  . ALA A 1 21 ? 1.328   3.019   -5.450  1.00 0.00 ? 21 ALA A HB1  2  
ATOM 937  H HB2  . ALA A 1 21 ? 1.801   2.649   -3.799  1.00 0.00 ? 21 ALA A HB2  2  
ATOM 938  H HB3  . ALA A 1 21 ? 2.814   3.674   -4.798  1.00 0.00 ? 21 ALA A HB3  2  
ATOM 939  N N    . GLU A 1 22 ? 3.259   0.369   -3.238  1.00 0.00 ? 22 GLU A N    2  
ATOM 940  C CA   . GLU A 1 22 ? 4.066   -0.214  -2.120  1.00 0.00 ? 22 GLU A CA   2  
ATOM 941  C C    . GLU A 1 22 ? 5.122   -1.170  -2.687  1.00 0.00 ? 22 GLU A C    2  
ATOM 942  O O    . GLU A 1 22 ? 6.289   -1.042  -2.379  1.00 0.00 ? 22 GLU A O    2  
ATOM 943  C CB   . GLU A 1 22 ? 3.131   -0.971  -1.166  1.00 0.00 ? 22 GLU A CB   2  
ATOM 944  C CG   . GLU A 1 22 ? 2.366   0.035   -0.288  1.00 0.00 ? 22 GLU A CG   2  
ATOM 945  C CD   . GLU A 1 22 ? 1.214   -0.705  0.411   1.00 0.00 ? 22 GLU A CD   2  
ATOM 946  O OE1  . GLU A 1 22 ? 0.168   -0.784  -0.211  1.00 0.00 ? 22 GLU A OE1  2  
ATOM 947  O OE2  . GLU A 1 22 ? 1.443   -1.150  1.524   1.00 0.00 ? 22 GLU A OE2  2  
ATOM 948  H H    . GLU A 1 22 ? 2.289   0.276   -3.251  1.00 0.00 ? 22 GLU A H    2  
ATOM 949  H HA   . GLU A 1 22 ? 4.580   0.591   -1.615  1.00 0.00 ? 22 GLU A HA   2  
ATOM 950  H HB2  . GLU A 1 22 ? 2.436   -1.570  -1.735  1.00 0.00 ? 22 GLU A HB2  2  
ATOM 951  H HB3  . GLU A 1 22 ? 3.709   -1.628  -0.532  1.00 0.00 ? 22 GLU A HB3  2  
ATOM 952  H HG2  . GLU A 1 22 ? 3.029   0.453   0.455   1.00 0.00 ? 22 GLU A HG2  2  
ATOM 953  H HG3  . GLU A 1 22 ? 1.961   0.841   -0.884  1.00 0.00 ? 22 GLU A HG3  2  
ATOM 954  N N    . ASP A 1 23 ? 4.672   -2.096  -3.500  1.00 0.00 ? 23 ASP A N    2  
ATOM 955  C CA   . ASP A 1 23 ? 5.594   -3.097  -4.131  1.00 0.00 ? 23 ASP A CA   2  
ATOM 956  C C    . ASP A 1 23 ? 6.770   -2.363  -4.785  1.00 0.00 ? 23 ASP A C    2  
ATOM 957  O O    . ASP A 1 23 ? 7.932   -2.638  -4.559  1.00 0.00 ? 23 ASP A O    2  
ATOM 958  C CB   . ASP A 1 23 ? 4.825   -3.883  -5.202  1.00 0.00 ? 23 ASP A CB   2  
ATOM 959  C CG   . ASP A 1 23 ? 5.608   -5.158  -5.555  1.00 0.00 ? 23 ASP A CG   2  
ATOM 960  O OD1  . ASP A 1 23 ? 6.513   -5.029  -6.366  1.00 0.00 ? 23 ASP A OD1  2  
ATOM 961  O OD2  . ASP A 1 23 ? 5.263   -6.186  -4.995  1.00 0.00 ? 23 ASP A OD2  2  
ATOM 962  H H    . ASP A 1 23 ? 3.714   -2.131  -3.695  1.00 0.00 ? 23 ASP A H    2  
ATOM 963  H HA   . ASP A 1 23 ? 5.971   -3.755  -3.364  1.00 0.00 ? 23 ASP A HA   2  
ATOM 964  H HB2  . ASP A 1 23 ? 3.835   -4.138  -4.858  1.00 0.00 ? 23 ASP A HB2  2  
ATOM 965  H HB3  . ASP A 1 23 ? 4.711   -3.285  -6.092  1.00 0.00 ? 23 ASP A HB3  2  
ATOM 966  N N    . VAL A 1 24 ? 6.379   -1.421  -5.591  1.00 0.00 ? 24 VAL A N    2  
ATOM 967  C CA   . VAL A 1 24 ? 7.330   -0.565  -6.348  1.00 0.00 ? 24 VAL A CA   2  
ATOM 968  C C    . VAL A 1 24 ? 8.336   0.108   -5.403  1.00 0.00 ? 24 VAL A C    2  
ATOM 969  O O    . VAL A 1 24 ? 9.532   0.050   -5.605  1.00 0.00 ? 24 VAL A O    2  
ATOM 970  C CB   . VAL A 1 24 ? 6.473   0.458   -7.102  1.00 0.00 ? 24 VAL A CB   2  
ATOM 971  C CG1  . VAL A 1 24 ? 7.343   1.340   -7.965  1.00 0.00 ? 24 VAL A CG1  2  
ATOM 972  C CG2  . VAL A 1 24 ? 5.431   -0.267  -7.982  1.00 0.00 ? 24 VAL A CG2  2  
ATOM 973  H H    . VAL A 1 24 ? 5.419   -1.273  -5.705  1.00 0.00 ? 24 VAL A H    2  
ATOM 974  H HA   . VAL A 1 24 ? 7.871   -1.187  -7.042  1.00 0.00 ? 24 VAL A HA   2  
ATOM 975  H HB   . VAL A 1 24 ? 5.952   1.085   -6.399  1.00 0.00 ? 24 VAL A HB   2  
ATOM 976  H HG11 . VAL A 1 24 ? 7.973   0.743   -8.602  1.00 0.00 ? 24 VAL A HG11 2  
ATOM 977  H HG12 . VAL A 1 24 ? 6.695   1.952   -8.566  1.00 0.00 ? 24 VAL A HG12 2  
ATOM 978  H HG13 . VAL A 1 24 ? 7.950   1.970   -7.333  1.00 0.00 ? 24 VAL A HG13 2  
ATOM 979  H HG21 . VAL A 1 24 ? 5.308   -1.299  -7.681  1.00 0.00 ? 24 VAL A HG21 2  
ATOM 980  H HG22 . VAL A 1 24 ? 4.482   0.233   -7.871  1.00 0.00 ? 24 VAL A HG22 2  
ATOM 981  H HG23 . VAL A 1 24 ? 5.716   -0.254  -9.019  1.00 0.00 ? 24 VAL A HG23 2  
ATOM 982  N N    . GLY A 1 25 ? 7.794   0.724   -4.390  1.00 0.00 ? 25 GLY A N    2  
ATOM 983  C CA   . GLY A 1 25 ? 8.607   1.439   -3.364  1.00 0.00 ? 25 GLY A CA   2  
ATOM 984  C C    . GLY A 1 25 ? 9.652   0.511   -2.743  1.00 0.00 ? 25 GLY A C    2  
ATOM 985  O O    . GLY A 1 25 ? 10.830  0.800   -2.783  1.00 0.00 ? 25 GLY A O    2  
ATOM 986  H H    . GLY A 1 25 ? 6.822   0.712   -4.310  1.00 0.00 ? 25 GLY A H    2  
ATOM 987  H HA2  . GLY A 1 25 ? 9.104   2.277   -3.833  1.00 0.00 ? 25 GLY A HA2  2  
ATOM 988  H HA3  . GLY A 1 25 ? 7.950   1.803   -2.588  1.00 0.00 ? 25 GLY A HA3  2  
ATOM 989  N N    . SER A 1 26 ? 9.193   -0.586  -2.194  1.00 0.00 ? 26 SER A N    2  
ATOM 990  C CA   . SER A 1 26 ? 10.138  -1.564  -1.556  1.00 0.00 ? 26 SER A CA   2  
ATOM 991  C C    . SER A 1 26 ? 11.240  -1.949  -2.550  1.00 0.00 ? 26 SER A C    2  
ATOM 992  O O    . SER A 1 26 ? 12.410  -1.937  -2.220  1.00 0.00 ? 26 SER A O    2  
ATOM 993  C CB   . SER A 1 26 ? 9.366   -2.840  -1.105  1.00 0.00 ? 26 SER A CB   2  
ATOM 994  O OG   . SER A 1 26 ? 8.299   -3.011  -2.025  1.00 0.00 ? 26 SER A OG   2  
ATOM 995  H H    . SER A 1 26 ? 8.230   -0.755  -2.212  1.00 0.00 ? 26 SER A H    2  
ATOM 996  H HA   . SER A 1 26 ? 10.595  -1.090  -0.706  1.00 0.00 ? 26 SER A HA   2  
ATOM 997  H HB2  . SER A 1 26 ? 9.995   -3.717  -1.123  1.00 0.00 ? 26 SER A HB2  2  
ATOM 998  H HB3  . SER A 1 26 ? 8.957   -2.707  -0.115  1.00 0.00 ? 26 SER A HB3  2  
ATOM 999  H HG   . SER A 1 26 ? 8.423   -3.848  -2.479  1.00 0.00 ? 26 SER A HG   2  
ATOM 1000 N N    . ASN A 1 27 ? 10.831  -2.275  -3.748  1.00 0.00 ? 27 ASN A N    2  
ATOM 1001 C CA   . ASN A 1 27 ? 11.797  -2.665  -4.818  1.00 0.00 ? 27 ASN A CA   2  
ATOM 1002 C C    . ASN A 1 27 ? 12.870  -1.592  -4.991  1.00 0.00 ? 27 ASN A C    2  
ATOM 1003 O O    . ASN A 1 27 ? 14.043  -1.854  -4.828  1.00 0.00 ? 27 ASN A O    2  
ATOM 1004 C CB   . ASN A 1 27 ? 11.023  -2.847  -6.132  1.00 0.00 ? 27 ASN A CB   2  
ATOM 1005 C CG   . ASN A 1 27 ? 10.625  -4.315  -6.321  1.00 0.00 ? 27 ASN A CG   2  
ATOM 1006 O OD1  . ASN A 1 27 ? 11.457  -5.176  -6.528  1.00 0.00 ? 27 ASN A OD1  2  
ATOM 1007 N ND2  . ASN A 1 27 ? 9.364   -4.643  -6.258  1.00 0.00 ? 27 ASN A ND2  2  
ATOM 1008 H H    . ASN A 1 27 ? 9.876   -2.272  -3.951  1.00 0.00 ? 27 ASN A H    2  
ATOM 1009 H HA   . ASN A 1 27 ? 12.300  -3.564  -4.499  1.00 0.00 ? 27 ASN A HA   2  
ATOM 1010 H HB2  . ASN A 1 27 ? 10.130  -2.241  -6.118  1.00 0.00 ? 27 ASN A HB2  2  
ATOM 1011 H HB3  . ASN A 1 27 ? 11.628  -2.528  -6.965  1.00 0.00 ? 27 ASN A HB3  2  
ATOM 1012 H HD21 . ASN A 1 27 ? 8.684   -3.957  -6.092  1.00 0.00 ? 27 ASN A HD21 2  
ATOM 1013 H HD22 . ASN A 1 27 ? 9.093   -5.577  -6.377  1.00 0.00 ? 27 ASN A HD22 2  
ATOM 1014 N N    . LYS A 1 28 ? 12.428  -0.408  -5.316  1.00 0.00 ? 28 LYS A N    2  
ATOM 1015 C CA   . LYS A 1 28 ? 13.349  0.753   -5.520  1.00 0.00 ? 28 LYS A CA   2  
ATOM 1016 C C    . LYS A 1 28 ? 14.284  0.873   -4.303  1.00 0.00 ? 28 LYS A C    2  
ATOM 1017 O O    . LYS A 1 28 ? 15.471  1.066   -4.457  1.00 0.00 ? 28 LYS A O    2  
ATOM 1018 C CB   . LYS A 1 28 ? 12.472  2.000   -5.692  1.00 0.00 ? 28 LYS A CB   2  
ATOM 1019 C CG   . LYS A 1 28 ? 11.771  1.970   -7.077  1.00 0.00 ? 28 LYS A CG   2  
ATOM 1020 C CD   . LYS A 1 28 ? 12.689  2.611   -8.149  1.00 0.00 ? 28 LYS A CD   2  
ATOM 1021 C CE   . LYS A 1 28 ? 12.256  2.163   -9.560  1.00 0.00 ? 28 LYS A CE   2  
ATOM 1022 N NZ   . LYS A 1 28 ? 10.838  2.542   -9.820  1.00 0.00 ? 28 LYS A NZ   2  
ATOM 1023 H H    . LYS A 1 28 ? 11.466  -0.283  -5.427  1.00 0.00 ? 28 LYS A H    2  
ATOM 1024 H HA   . LYS A 1 28 ? 13.961  0.579   -6.400  1.00 0.00 ? 28 LYS A HA   2  
ATOM 1025 H HB2  . LYS A 1 28 ? 11.713  1.996   -4.924  1.00 0.00 ? 28 LYS A HB2  2  
ATOM 1026 H HB3  . LYS A 1 28 ? 13.070  2.892   -5.587  1.00 0.00 ? 28 LYS A HB3  2  
ATOM 1027 H HG2  . LYS A 1 28 ? 11.530  0.953   -7.352  1.00 0.00 ? 28 LYS A HG2  2  
ATOM 1028 H HG3  . LYS A 1 28 ? 10.849  2.529   -7.016  1.00 0.00 ? 28 LYS A HG3  2  
ATOM 1029 H HD2  . LYS A 1 28 ? 12.627  3.688   -8.081  1.00 0.00 ? 28 LYS A HD2  2  
ATOM 1030 H HD3  . LYS A 1 28 ? 13.716  2.315   -7.987  1.00 0.00 ? 28 LYS A HD3  2  
ATOM 1031 H HE2  . LYS A 1 28 ? 12.878  2.644   -10.300 1.00 0.00 ? 28 LYS A HE2  2  
ATOM 1032 H HE3  . LYS A 1 28 ? 12.355  1.093   -9.664  1.00 0.00 ? 28 LYS A HE3  2  
ATOM 1033 H HZ1  . LYS A 1 28 ? 10.447  3.033   -8.990  1.00 0.00 ? 28 LYS A HZ1  2  
ATOM 1034 H HZ2  . LYS A 1 28 ? 10.793  3.173   -10.646 1.00 0.00 ? 28 LYS A HZ2  2  
ATOM 1035 H HZ3  . LYS A 1 28 ? 10.278  1.687   -10.010 1.00 0.00 ? 28 LYS A HZ3  2  
ATOM 1036 N N    . GLY A 1 29 ? 13.731  0.752   -3.122  1.00 0.00 ? 29 GLY A N    2  
ATOM 1037 C CA   . GLY A 1 29 ? 14.555  0.844   -1.878  1.00 0.00 ? 29 GLY A CA   2  
ATOM 1038 C C    . GLY A 1 29 ? 15.695  -0.183  -1.943  1.00 0.00 ? 29 GLY A C    2  
ATOM 1039 O O    . GLY A 1 29 ? 16.853  0.164   -1.820  1.00 0.00 ? 29 GLY A O    2  
ATOM 1040 H H    . GLY A 1 29 ? 12.769  0.606   -3.049  1.00 0.00 ? 29 GLY A H    2  
ATOM 1041 H HA2  . GLY A 1 29 ? 14.963  1.839   -1.787  1.00 0.00 ? 29 GLY A HA2  2  
ATOM 1042 H HA3  . GLY A 1 29 ? 13.929  0.630   -1.025  1.00 0.00 ? 29 GLY A HA3  2  
ATOM 1043 N N    . ALA A 1 30 ? 15.331  -1.426  -2.150  1.00 0.00 ? 30 ALA A N    2  
ATOM 1044 C CA   . ALA A 1 30 ? 16.365  -2.511  -2.232  1.00 0.00 ? 30 ALA A CA   2  
ATOM 1045 C C    . ALA A 1 30 ? 17.392  -2.190  -3.326  1.00 0.00 ? 30 ALA A C    2  
ATOM 1046 O O    . ALA A 1 30 ? 18.580  -2.293  -3.119  1.00 0.00 ? 30 ALA A O    2  
ATOM 1047 C CB   . ALA A 1 30 ? 15.662  -3.842  -2.541  1.00 0.00 ? 30 ALA A CB   2  
ATOM 1048 H H    . ALA A 1 30 ? 14.378  -1.642  -2.252  1.00 0.00 ? 30 ALA A H    2  
ATOM 1049 H HA   . ALA A 1 30 ? 16.888  -2.556  -1.286  1.00 0.00 ? 30 ALA A HA   2  
ATOM 1050 H HB1  . ALA A 1 30 ? 14.905  -4.039  -1.798  1.00 0.00 ? 30 ALA A HB1  2  
ATOM 1051 H HB2  . ALA A 1 30 ? 15.193  -3.804  -3.513  1.00 0.00 ? 30 ALA A HB2  2  
ATOM 1052 H HB3  . ALA A 1 30 ? 16.379  -4.650  -2.531  1.00 0.00 ? 30 ALA A HB3  2  
ATOM 1053 N N    . ILE A 1 31 ? 16.888  -1.804  -4.464  1.00 0.00 ? 31 ILE A N    2  
ATOM 1054 C CA   . ILE A 1 31 ? 17.718  -1.442  -5.646  1.00 0.00 ? 31 ILE A CA   2  
ATOM 1055 C C    . ILE A 1 31 ? 18.785  -0.419  -5.225  1.00 0.00 ? 31 ILE A C    2  
ATOM 1056 O O    . ILE A 1 31 ? 19.963  -0.625  -5.443  1.00 0.00 ? 31 ILE A O    2  
ATOM 1057 C CB   . ILE A 1 31 ? 16.689  -0.924  -6.698  1.00 0.00 ? 31 ILE A CB   2  
ATOM 1058 C CG1  . ILE A 1 31 ? 16.023  -2.160  -7.359  1.00 0.00 ? 31 ILE A CG1  2  
ATOM 1059 C CG2  . ILE A 1 31 ? 17.309  0.021   -7.742  1.00 0.00 ? 31 ILE A CG2  2  
ATOM 1060 C CD1  . ILE A 1 31 ? 14.920  -1.744  -8.349  1.00 0.00 ? 31 ILE A CD1  2  
ATOM 1061 H H    . ILE A 1 31 ? 15.920  -1.752  -4.558  1.00 0.00 ? 31 ILE A H    2  
ATOM 1062 H HA   . ILE A 1 31 ? 18.231  -2.333  -5.980  1.00 0.00 ? 31 ILE A HA   2  
ATOM 1063 H HB   . ILE A 1 31 ? 15.917  -0.377  -6.186  1.00 0.00 ? 31 ILE A HB   2  
ATOM 1064 H HG12 . ILE A 1 31 ? 16.776  -2.748  -7.858  1.00 0.00 ? 31 ILE A HG12 2  
ATOM 1065 H HG13 . ILE A 1 31 ? 15.578  -2.778  -6.593  1.00 0.00 ? 31 ILE A HG13 2  
ATOM 1066 H HG21 . ILE A 1 31 ? 18.097  -0.475  -8.284  1.00 0.00 ? 31 ILE A HG21 2  
ATOM 1067 H HG22 . ILE A 1 31 ? 16.545  0.343   -8.436  1.00 0.00 ? 31 ILE A HG22 2  
ATOM 1068 H HG23 . ILE A 1 31 ? 17.702  0.899   -7.251  1.00 0.00 ? 31 ILE A HG23 2  
ATOM 1069 H HD11 . ILE A 1 31 ? 14.308  -0.957  -7.937  1.00 0.00 ? 31 ILE A HD11 2  
ATOM 1070 H HD12 . ILE A 1 31 ? 15.366  -1.396  -9.269  1.00 0.00 ? 31 ILE A HD12 2  
ATOM 1071 H HD13 . ILE A 1 31 ? 14.289  -2.594  -8.568  1.00 0.00 ? 31 ILE A HD13 2  
ATOM 1072 N N    . ILE A 1 32 ? 18.345  0.657   -4.630  1.00 0.00 ? 32 ILE A N    2  
ATOM 1073 C CA   . ILE A 1 32 ? 19.297  1.717   -4.172  1.00 0.00 ? 32 ILE A CA   2  
ATOM 1074 C C    . ILE A 1 32 ? 20.337  1.085   -3.238  1.00 0.00 ? 32 ILE A C    2  
ATOM 1075 O O    . ILE A 1 32 ? 21.523  1.292   -3.401  1.00 0.00 ? 32 ILE A O    2  
ATOM 1076 C CB   . ILE A 1 32 ? 18.487  2.821   -3.440  1.00 0.00 ? 32 ILE A CB   2  
ATOM 1077 C CG1  . ILE A 1 32 ? 17.486  3.455   -4.445  1.00 0.00 ? 32 ILE A CG1  2  
ATOM 1078 C CG2  . ILE A 1 32 ? 19.447  3.915   -2.910  1.00 0.00 ? 32 ILE A CG2  2  
ATOM 1079 C CD1  . ILE A 1 32 ? 16.336  4.149   -3.690  1.00 0.00 ? 32 ILE A CD1  2  
ATOM 1080 H H    . ILE A 1 32 ? 17.385  0.773   -4.491  1.00 0.00 ? 32 ILE A H    2  
ATOM 1081 H HA   . ILE A 1 32 ? 19.814  2.107   -5.033  1.00 0.00 ? 32 ILE A HA   2  
ATOM 1082 H HB   . ILE A 1 32 ? 17.953  2.382   -2.610  1.00 0.00 ? 32 ILE A HB   2  
ATOM 1083 H HG12 . ILE A 1 32 ? 17.996  4.168   -5.070  1.00 0.00 ? 32 ILE A HG12 2  
ATOM 1084 H HG13 . ILE A 1 32 ? 17.070  2.698   -5.090  1.00 0.00 ? 32 ILE A HG13 2  
ATOM 1085 H HG21 . ILE A 1 32 ? 20.085  4.277   -3.703  1.00 0.00 ? 32 ILE A HG21 2  
ATOM 1086 H HG22 . ILE A 1 32 ? 18.885  4.746   -2.510  1.00 0.00 ? 32 ILE A HG22 2  
ATOM 1087 H HG23 . ILE A 1 32 ? 20.067  3.515   -2.121  1.00 0.00 ? 32 ILE A HG23 2  
ATOM 1088 H HD11 . ILE A 1 32 ? 15.937  3.499   -2.926  1.00 0.00 ? 32 ILE A HD11 2  
ATOM 1089 H HD12 . ILE A 1 32 ? 16.688  5.058   -3.227  1.00 0.00 ? 32 ILE A HD12 2  
ATOM 1090 H HD13 . ILE A 1 32 ? 15.543  4.396   -4.380  1.00 0.00 ? 32 ILE A HD13 2  
ATOM 1091 N N    . GLY A 1 33 ? 19.855  0.322   -2.289  1.00 0.00 ? 33 GLY A N    2  
ATOM 1092 C CA   . GLY A 1 33 ? 20.774  -0.352  -1.320  1.00 0.00 ? 33 GLY A CA   2  
ATOM 1093 C C    . GLY A 1 33 ? 21.842  -1.149  -2.080  1.00 0.00 ? 33 GLY A C    2  
ATOM 1094 O O    . GLY A 1 33 ? 23.017  -1.031  -1.801  1.00 0.00 ? 33 GLY A O    2  
ATOM 1095 H H    . GLY A 1 33 ? 18.886  0.198   -2.217  1.00 0.00 ? 33 GLY A H    2  
ATOM 1096 H HA2  . GLY A 1 33 ? 21.255  0.397   -0.707  1.00 0.00 ? 33 GLY A HA2  2  
ATOM 1097 H HA3  . GLY A 1 33 ? 20.206  -1.023  -0.695  1.00 0.00 ? 33 GLY A HA3  2  
ATOM 1098 N N    . LEU A 1 34 ? 21.402  -1.935  -3.030  1.00 0.00 ? 34 LEU A N    2  
ATOM 1099 C CA   . LEU A 1 34 ? 22.349  -2.758  -3.841  1.00 0.00 ? 34 LEU A CA   2  
ATOM 1100 C C    . LEU A 1 34 ? 23.380  -1.864  -4.532  1.00 0.00 ? 34 LEU A C    2  
ATOM 1101 O O    . LEU A 1 34 ? 24.557  -2.153  -4.474  1.00 0.00 ? 34 LEU A O    2  
ATOM 1102 C CB   . LEU A 1 34 ? 21.551  -3.554  -4.898  1.00 0.00 ? 34 LEU A CB   2  
ATOM 1103 C CG   . LEU A 1 34 ? 20.744  -4.689  -4.208  1.00 0.00 ? 34 LEU A CG   2  
ATOM 1104 C CD1  . LEU A 1 34 ? 19.549  -5.079  -5.103  1.00 0.00 ? 34 LEU A CD1  2  
ATOM 1105 C CD2  . LEU A 1 34 ? 21.654  -5.922  -4.005  1.00 0.00 ? 34 LEU A CD2  2  
ATOM 1106 H H    . LEU A 1 34 ? 20.443  -1.985  -3.206  1.00 0.00 ? 34 LEU A H    2  
ATOM 1107 H HA   . LEU A 1 34 ? 22.880  -3.417  -3.170  1.00 0.00 ? 34 LEU A HA   2  
ATOM 1108 H HB2  . LEU A 1 34 ? 20.878  -2.886  -5.413  1.00 0.00 ? 34 LEU A HB2  2  
ATOM 1109 H HB3  . LEU A 1 34 ? 22.229  -3.976  -5.626  1.00 0.00 ? 34 LEU A HB3  2  
ATOM 1110 H HG   . LEU A 1 34 ? 20.372  -4.355  -3.250  1.00 0.00 ? 34 LEU A HG   2  
ATOM 1111 H HD11 . LEU A 1 34 ? 19.873  -5.223  -6.125  1.00 0.00 ? 34 LEU A HD11 2  
ATOM 1112 H HD12 . LEU A 1 34 ? 19.097  -5.995  -4.749  1.00 0.00 ? 34 LEU A HD12 2  
ATOM 1113 H HD13 . LEU A 1 34 ? 18.802  -4.300  -5.081  1.00 0.00 ? 34 LEU A HD13 2  
ATOM 1114 H HD21 . LEU A 1 34 ? 22.056  -6.256  -4.949  1.00 0.00 ? 34 LEU A HD21 2  
ATOM 1115 H HD22 . LEU A 1 34 ? 22.474  -5.677  -3.345  1.00 0.00 ? 34 LEU A HD22 2  
ATOM 1116 H HD23 . LEU A 1 34 ? 21.089  -6.730  -3.564  1.00 0.00 ? 34 LEU A HD23 2  
ATOM 1117 N N    . MET A 1 35 ? 22.918  -0.812  -5.164  1.00 0.00 ? 35 MET A N    2  
ATOM 1118 C CA   . MET A 1 35 ? 23.856  0.122   -5.865  1.00 0.00 ? 35 MET A CA   2  
ATOM 1119 C C    . MET A 1 35 ? 24.959  0.558   -4.889  1.00 0.00 ? 35 MET A C    2  
ATOM 1120 O O    . MET A 1 35 ? 26.134  0.402   -5.163  1.00 0.00 ? 35 MET A O    2  
ATOM 1121 C CB   . MET A 1 35 ? 23.069  1.355   -6.361  1.00 0.00 ? 35 MET A CB   2  
ATOM 1122 C CG   . MET A 1 35 ? 22.219  0.974   -7.584  1.00 0.00 ? 35 MET A CG   2  
ATOM 1123 S SD   . MET A 1 35 ? 23.094  0.589   -9.123  1.00 0.00 ? 35 MET A SD   2  
ATOM 1124 C CE   . MET A 1 35 ? 23.653  2.262   -9.535  1.00 0.00 ? 35 MET A CE   2  
ATOM 1125 H H    . MET A 1 35 ? 21.953  -0.644  -5.179  1.00 0.00 ? 35 MET A H    2  
ATOM 1126 H HA   . MET A 1 35 ? 24.311  -0.398  -6.693  1.00 0.00 ? 35 MET A HA   2  
ATOM 1127 H HB2  . MET A 1 35 ? 22.424  1.726   -5.580  1.00 0.00 ? 35 MET A HB2  2  
ATOM 1128 H HB3  . MET A 1 35 ? 23.757  2.143   -6.634  1.00 0.00 ? 35 MET A HB3  2  
ATOM 1129 H HG2  . MET A 1 35 ? 21.617  0.113   -7.332  1.00 0.00 ? 35 MET A HG2  2  
ATOM 1130 H HG3  . MET A 1 35 ? 21.541  1.790   -7.788  1.00 0.00 ? 35 MET A HG3  2  
ATOM 1131 H HE1  . MET A 1 35 ? 22.833  2.957   -9.435  1.00 0.00 ? 35 MET A HE1  2  
ATOM 1132 H HE2  . MET A 1 35 ? 24.452  2.551   -8.868  1.00 0.00 ? 35 MET A HE2  2  
ATOM 1133 H HE3  . MET A 1 35 ? 24.015  2.278   -10.553 1.00 0.00 ? 35 MET A HE3  2  
ATOM 1134 N N    . VAL A 1 36 ? 24.507  1.075   -3.776  1.00 0.00 ? 36 VAL A N    2  
ATOM 1135 C CA   . VAL A 1 36 ? 25.413  1.564   -2.692  1.00 0.00 ? 36 VAL A CA   2  
ATOM 1136 C C    . VAL A 1 36 ? 26.419  0.466   -2.301  1.00 0.00 ? 36 VAL A C    2  
ATOM 1137 O O    . VAL A 1 36 ? 27.614  0.696   -2.307  1.00 0.00 ? 36 VAL A O    2  
ATOM 1138 C CB   . VAL A 1 36 ? 24.518  1.981   -1.481  1.00 0.00 ? 36 VAL A CB   2  
ATOM 1139 C CG1  . VAL A 1 36 ? 25.389  2.315   -0.246  1.00 0.00 ? 36 VAL A CG1  2  
ATOM 1140 C CG2  . VAL A 1 36 ? 23.695  3.234   -1.860  1.00 0.00 ? 36 VAL A CG2  2  
ATOM 1141 H H    . VAL A 1 36 ? 23.539  1.135   -3.657  1.00 0.00 ? 36 VAL A H    2  
ATOM 1142 H HA   . VAL A 1 36 ? 25.958  2.420   -3.063  1.00 0.00 ? 36 VAL A HA   2  
ATOM 1143 H HB   . VAL A 1 36 ? 23.833  1.182   -1.230  1.00 0.00 ? 36 VAL A HB   2  
ATOM 1144 H HG11 . VAL A 1 36 ? 26.185  2.992   -0.517  1.00 0.00 ? 36 VAL A HG11 2  
ATOM 1145 H HG12 . VAL A 1 36 ? 24.785  2.778   0.521   1.00 0.00 ? 36 VAL A HG12 2  
ATOM 1146 H HG13 . VAL A 1 36 ? 25.821  1.412   0.159   1.00 0.00 ? 36 VAL A HG13 2  
ATOM 1147 H HG21 . VAL A 1 36 ? 23.217  3.100   -2.819  1.00 0.00 ? 36 VAL A HG21 2  
ATOM 1148 H HG22 . VAL A 1 36 ? 22.930  3.411   -1.118  1.00 0.00 ? 36 VAL A HG22 2  
ATOM 1149 H HG23 . VAL A 1 36 ? 24.333  4.104   -1.913  1.00 0.00 ? 36 VAL A HG23 2  
ATOM 1150 N N    . GLY A 1 37 ? 25.895  -0.690  -1.978  1.00 0.00 ? 37 GLY A N    2  
ATOM 1151 C CA   . GLY A 1 37 ? 26.747  -1.851  -1.576  1.00 0.00 ? 37 GLY A CA   2  
ATOM 1152 C C    . GLY A 1 37 ? 26.722  -2.919  -2.672  1.00 0.00 ? 37 GLY A C    2  
ATOM 1153 O O    . GLY A 1 37 ? 26.278  -4.028  -2.444  1.00 0.00 ? 37 GLY A O    2  
ATOM 1154 H H    . GLY A 1 37 ? 24.922  -0.796  -1.999  1.00 0.00 ? 37 GLY A H    2  
ATOM 1155 H HA2  . GLY A 1 37 ? 27.767  -1.533  -1.414  1.00 0.00 ? 37 GLY A HA2  2  
ATOM 1156 H HA3  . GLY A 1 37 ? 26.355  -2.270  -0.661  1.00 0.00 ? 37 GLY A HA3  2  
ATOM 1157 N N    . GLY A 1 38 ? 27.199  -2.544  -3.833  1.00 0.00 ? 38 GLY A N    2  
ATOM 1158 C CA   . GLY A 1 38 ? 27.233  -3.491  -4.992  1.00 0.00 ? 38 GLY A CA   2  
ATOM 1159 C C    . GLY A 1 38 ? 28.258  -3.034  -6.029  1.00 0.00 ? 38 GLY A C    2  
ATOM 1160 O O    . GLY A 1 38 ? 28.973  -3.847  -6.584  1.00 0.00 ? 38 GLY A O    2  
ATOM 1161 H H    . GLY A 1 38 ? 27.536  -1.631  -3.946  1.00 0.00 ? 38 GLY A H    2  
ATOM 1162 H HA2  . GLY A 1 38 ? 27.504  -4.477  -4.641  1.00 0.00 ? 38 GLY A HA2  2  
ATOM 1163 H HA3  . GLY A 1 38 ? 26.260  -3.532  -5.456  1.00 0.00 ? 38 GLY A HA3  2  
ATOM 1164 N N    . VAL A 1 39 ? 28.302  -1.744  -6.259  1.00 0.00 ? 39 VAL A N    2  
ATOM 1165 C CA   . VAL A 1 39 ? 29.263  -1.166  -7.249  1.00 0.00 ? 39 VAL A CA   2  
ATOM 1166 C C    . VAL A 1 39 ? 30.628  -0.939  -6.564  1.00 0.00 ? 39 VAL A C    2  
ATOM 1167 O O    . VAL A 1 39 ? 31.386  -0.053  -6.911  1.00 0.00 ? 39 VAL A O    2  
ATOM 1168 C CB   . VAL A 1 39 ? 28.653  0.172   -7.790  1.00 0.00 ? 39 VAL A CB   2  
ATOM 1169 C CG1  . VAL A 1 39 ? 29.480  0.695   -8.993  1.00 0.00 ? 39 VAL A CG1  2  
ATOM 1170 C CG2  . VAL A 1 39 ? 27.200  -0.071  -8.276  1.00 0.00 ? 39 VAL A CG2  2  
ATOM 1171 H H    . VAL A 1 39 ? 27.703  -1.138  -5.784  1.00 0.00 ? 39 VAL A H    2  
ATOM 1172 H HA   . VAL A 1 39 ? 29.393  -1.875  -8.050  1.00 0.00 ? 39 VAL A HA   2  
ATOM 1173 H HB   . VAL A 1 39 ? 28.646  0.913   -7.003  1.00 0.00 ? 39 VAL A HB   2  
ATOM 1174 H HG11 . VAL A 1 39 ? 29.844  -0.128  -9.592  1.00 0.00 ? 39 VAL A HG11 2  
ATOM 1175 H HG12 . VAL A 1 39 ? 28.875  1.334   -9.620  1.00 0.00 ? 39 VAL A HG12 2  
ATOM 1176 H HG13 . VAL A 1 39 ? 30.325  1.270   -8.644  1.00 0.00 ? 39 VAL A HG13 2  
ATOM 1177 H HG21 . VAL A 1 39 ? 26.594  -0.488  -7.485  1.00 0.00 ? 39 VAL A HG21 2  
ATOM 1178 H HG22 . VAL A 1 39 ? 26.757  0.861   -8.592  1.00 0.00 ? 39 VAL A HG22 2  
ATOM 1179 H HG23 . VAL A 1 39 ? 27.194  -0.760  -9.109  1.00 0.00 ? 39 VAL A HG23 2  
ATOM 1180 N N    . VAL A 1 40 ? 30.890  -1.776  -5.594  1.00 0.00 ? 40 VAL A N    2  
ATOM 1181 C CA   . VAL A 1 40 ? 32.164  -1.714  -4.814  1.00 0.00 ? 40 VAL A CA   2  
ATOM 1182 C C    . VAL A 1 40 ? 33.356  -2.052  -5.734  1.00 0.00 ? 40 VAL A C    2  
ATOM 1183 O O    . VAL A 1 40 ? 34.308  -1.291  -5.691  1.00 0.00 ? 40 VAL A O    2  
ATOM 1184 C CB   . VAL A 1 40 ? 32.070  -2.730  -3.641  1.00 0.00 ? 40 VAL A CB   2  
ATOM 1185 C CG1  . VAL A 1 40 ? 33.350  -2.663  -2.775  1.00 0.00 ? 40 VAL A CG1  2  
ATOM 1186 C CG2  . VAL A 1 40 ? 30.844  -2.395  -2.760  1.00 0.00 ? 40 VAL A CG2  2  
ATOM 1187 O OXT  . VAL A 1 40 ? 33.246  -3.051  -6.428  1.00 0.00 ? 40 VAL A OXT  2  
ATOM 1188 H H    . VAL A 1 40 ? 30.229  -2.463  -5.375  1.00 0.00 ? 40 VAL A H    2  
ATOM 1189 H HA   . VAL A 1 40 ? 32.279  -0.711  -4.426  1.00 0.00 ? 40 VAL A HA   2  
ATOM 1190 H HB   . VAL A 1 40 ? 31.959  -3.730  -4.035  1.00 0.00 ? 40 VAL A HB   2  
ATOM 1191 H HG11 . VAL A 1 40 ? 33.548  -1.646  -2.470  1.00 0.00 ? 40 VAL A HG11 2  
ATOM 1192 H HG12 . VAL A 1 40 ? 33.236  -3.275  -1.892  1.00 0.00 ? 40 VAL A HG12 2  
ATOM 1193 H HG13 . VAL A 1 40 ? 34.197  -3.029  -3.337  1.00 0.00 ? 40 VAL A HG13 2  
ATOM 1194 H HG21 . VAL A 1 40 ? 30.883  -1.364  -2.435  1.00 0.00 ? 40 VAL A HG21 2  
ATOM 1195 H HG22 . VAL A 1 40 ? 29.931  -2.549  -3.317  1.00 0.00 ? 40 VAL A HG22 2  
ATOM 1196 H HG23 . VAL A 1 40 ? 30.824  -3.032  -1.887  1.00 0.00 ? 40 VAL A HG23 2  
ATOM 1197 N N    . ASP A 1 1  ? -21.379 -19.619 16.392  1.00 0.00 ? 1  ASP A N    3  
ATOM 1198 C CA   . ASP A 1 1  ? -20.275 -19.601 15.389  1.00 0.00 ? 1  ASP A CA   3  
ATOM 1199 C C    . ASP A 1 1  ? -20.847 -19.344 13.990  1.00 0.00 ? 1  ASP A C    3  
ATOM 1200 O O    . ASP A 1 1  ? -21.934 -19.787 13.674  1.00 0.00 ? 1  ASP A O    3  
ATOM 1201 C CB   . ASP A 1 1  ? -19.537 -20.952 15.390  1.00 0.00 ? 1  ASP A CB   3  
ATOM 1202 C CG   . ASP A 1 1  ? -18.887 -21.168 16.767  1.00 0.00 ? 1  ASP A CG   3  
ATOM 1203 O OD1  . ASP A 1 1  ? -19.579 -21.710 17.614  1.00 0.00 ? 1  ASP A OD1  3  
ATOM 1204 O OD2  . ASP A 1 1  ? -17.738 -20.777 16.896  1.00 0.00 ? 1  ASP A OD2  3  
ATOM 1205 H H1   . ASP A 1 1  ? -22.287 -19.450 15.913  1.00 0.00 ? 1  ASP A H1   3  
ATOM 1206 H H2   . ASP A 1 1  ? -21.404 -20.546 16.862  1.00 0.00 ? 1  ASP A H2   3  
ATOM 1207 H H3   . ASP A 1 1  ? -21.215 -18.876 17.100  1.00 0.00 ? 1  ASP A H3   3  
ATOM 1208 H HA   . ASP A 1 1  ? -19.595 -18.801 15.642  1.00 0.00 ? 1  ASP A HA   3  
ATOM 1209 H HB2  . ASP A 1 1  ? -20.230 -21.758 15.192  1.00 0.00 ? 1  ASP A HB2  3  
ATOM 1210 H HB3  . ASP A 1 1  ? -18.769 -20.961 14.628  1.00 0.00 ? 1  ASP A HB3  3  
ATOM 1211 N N    . ALA A 1 2  ? -20.087 -18.631 13.196  1.00 0.00 ? 2  ALA A N    3  
ATOM 1212 C CA   . ALA A 1 2  ? -20.511 -18.298 11.802  1.00 0.00 ? 2  ALA A CA   3  
ATOM 1213 C C    . ALA A 1 2  ? -19.291 -17.844 10.995  1.00 0.00 ? 2  ALA A C    3  
ATOM 1214 O O    . ALA A 1 2  ? -18.378 -17.245 11.533  1.00 0.00 ? 2  ALA A O    3  
ATOM 1215 C CB   . ALA A 1 2  ? -21.553 -17.168 11.844  1.00 0.00 ? 2  ALA A CB   3  
ATOM 1216 H H    . ALA A 1 2  ? -19.221 -18.308 13.518  1.00 0.00 ? 2  ALA A H    3  
ATOM 1217 H HA   . ALA A 1 2  ? -20.930 -19.181 11.340  1.00 0.00 ? 2  ALA A HA   3  
ATOM 1218 H HB1  . ALA A 1 2  ? -21.160 -16.317 12.380  1.00 0.00 ? 2  ALA A HB1  3  
ATOM 1219 H HB2  . ALA A 1 2  ? -21.808 -16.861 10.839  1.00 0.00 ? 2  ALA A HB2  3  
ATOM 1220 H HB3  . ALA A 1 2  ? -22.449 -17.509 12.339  1.00 0.00 ? 2  ALA A HB3  3  
ATOM 1221 N N    . GLU A 1 3  ? -19.321 -18.149 9.723   1.00 0.00 ? 3  GLU A N    3  
ATOM 1222 C CA   . GLU A 1 3  ? -18.197 -17.768 8.809   1.00 0.00 ? 3  GLU A CA   3  
ATOM 1223 C C    . GLU A 1 3  ? -18.054 -16.240 8.760   1.00 0.00 ? 3  GLU A C    3  
ATOM 1224 O O    . GLU A 1 3  ? -16.955 -15.718 8.754   1.00 0.00 ? 3  GLU A O    3  
ATOM 1225 C CB   . GLU A 1 3  ? -18.485 -18.296 7.391   1.00 0.00 ? 3  GLU A CB   3  
ATOM 1226 C CG   . GLU A 1 3  ? -18.697 -19.823 7.417   1.00 0.00 ? 3  GLU A CG   3  
ATOM 1227 C CD   . GLU A 1 3  ? -18.969 -20.308 5.981   1.00 0.00 ? 3  GLU A CD   3  
ATOM 1228 O OE1  . GLU A 1 3  ? -17.994 -20.626 5.319   1.00 0.00 ? 3  GLU A OE1  3  
ATOM 1229 O OE2  . GLU A 1 3  ? -20.136 -20.331 5.628   1.00 0.00 ? 3  GLU A OE2  3  
ATOM 1230 H H    . GLU A 1 3  ? -20.093 -18.633 9.367   1.00 0.00 ? 3  GLU A H    3  
ATOM 1231 H HA   . GLU A 1 3  ? -17.279 -18.195 9.186   1.00 0.00 ? 3  GLU A HA   3  
ATOM 1232 H HB2  . GLU A 1 3  ? -19.368 -17.813 6.994   1.00 0.00 ? 3  GLU A HB2  3  
ATOM 1233 H HB3  . GLU A 1 3  ? -17.646 -18.060 6.752   1.00 0.00 ? 3  GLU A HB3  3  
ATOM 1234 H HG2  . GLU A 1 3  ? -17.817 -20.321 7.802   1.00 0.00 ? 3  GLU A HG2  3  
ATOM 1235 H HG3  . GLU A 1 3  ? -19.543 -20.079 8.041   1.00 0.00 ? 3  GLU A HG3  3  
ATOM 1236 N N    . PHE A 1 4  ? -19.193 -15.591 8.727   1.00 0.00 ? 4  PHE A N    3  
ATOM 1237 C CA   . PHE A 1 4  ? -19.285 -14.101 8.677   1.00 0.00 ? 4  PHE A CA   3  
ATOM 1238 C C    . PHE A 1 4  ? -18.607 -13.547 7.418   1.00 0.00 ? 4  PHE A C    3  
ATOM 1239 O O    . PHE A 1 4  ? -17.401 -13.401 7.356   1.00 0.00 ? 4  PHE A O    3  
ATOM 1240 C CB   . PHE A 1 4  ? -18.620 -13.489 9.944   1.00 0.00 ? 4  PHE A CB   3  
ATOM 1241 C CG   . PHE A 1 4  ? -19.045 -12.013 10.040  1.00 0.00 ? 4  PHE A CG   3  
ATOM 1242 C CD1  . PHE A 1 4  ? -18.324 -11.026 9.390   1.00 0.00 ? 4  PHE A CD1  3  
ATOM 1243 C CD2  . PHE A 1 4  ? -20.161 -11.655 10.775  1.00 0.00 ? 4  PHE A CD2  3  
ATOM 1244 C CE1  . PHE A 1 4  ? -18.712 -9.705  9.473   1.00 0.00 ? 4  PHE A CE1  3  
ATOM 1245 C CE2  . PHE A 1 4  ? -20.550 -10.334 10.858  1.00 0.00 ? 4  PHE A CE2  3  
ATOM 1246 C CZ   . PHE A 1 4  ? -19.826 -9.358  10.207  1.00 0.00 ? 4  PHE A CZ   3  
ATOM 1247 H H    . PHE A 1 4  ? -20.027 -16.106 8.736   1.00 0.00 ? 4  PHE A H    3  
ATOM 1248 H HA   . PHE A 1 4  ? -20.332 -13.834 8.655   1.00 0.00 ? 4  PHE A HA   3  
ATOM 1249 H HB2  . PHE A 1 4  ? -18.953 -14.011 10.828  1.00 0.00 ? 4  PHE A HB2  3  
ATOM 1250 H HB3  . PHE A 1 4  ? -17.542 -13.543 9.892   1.00 0.00 ? 4  PHE A HB3  3  
ATOM 1251 H HD1  . PHE A 1 4  ? -17.448 -11.287 8.814   1.00 0.00 ? 4  PHE A HD1  3  
ATOM 1252 H HD2  . PHE A 1 4  ? -20.734 -12.414 11.289  1.00 0.00 ? 4  PHE A HD2  3  
ATOM 1253 H HE1  . PHE A 1 4  ? -18.144 -8.942  8.962   1.00 0.00 ? 4  PHE A HE1  3  
ATOM 1254 H HE2  . PHE A 1 4  ? -21.423 -10.065 11.434  1.00 0.00 ? 4  PHE A HE2  3  
ATOM 1255 H HZ   . PHE A 1 4  ? -20.132 -8.324  10.271  1.00 0.00 ? 4  PHE A HZ   3  
ATOM 1256 N N    . ARG A 1 5  ? -19.433 -13.262 6.446   1.00 0.00 ? 5  ARG A N    3  
ATOM 1257 C CA   . ARG A 1 5  ? -18.932 -12.710 5.150   1.00 0.00 ? 5  ARG A CA   3  
ATOM 1258 C C    . ARG A 1 5  ? -19.805 -11.538 4.690   1.00 0.00 ? 5  ARG A C    3  
ATOM 1259 O O    . ARG A 1 5  ? -19.907 -11.250 3.512   1.00 0.00 ? 5  ARG A O    3  
ATOM 1260 C CB   . ARG A 1 5  ? -18.941 -13.856 4.111   1.00 0.00 ? 5  ARG A CB   3  
ATOM 1261 C CG   . ARG A 1 5  ? -17.713 -13.721 3.174   1.00 0.00 ? 5  ARG A CG   3  
ATOM 1262 C CD   . ARG A 1 5  ? -17.437 -15.069 2.482   1.00 0.00 ? 5  ARG A CD   3  
ATOM 1263 N NE   . ARG A 1 5  ? -17.111 -16.084 3.534   1.00 0.00 ? 5  ARG A NE   3  
ATOM 1264 C CZ   . ARG A 1 5  ? -17.139 -17.371 3.288   1.00 0.00 ? 5  ARG A CZ   3  
ATOM 1265 N NH1  . ARG A 1 5  ? -17.455 -17.818 2.102   1.00 0.00 ? 5  ARG A NH1  3  
ATOM 1266 N NH2  . ARG A 1 5  ? -16.842 -18.182 4.263   1.00 0.00 ? 5  ARG A NH2  3  
ATOM 1267 H H    . ARG A 1 5  ? -20.392 -13.415 6.572   1.00 0.00 ? 5  ARG A H    3  
ATOM 1268 H HA   . ARG A 1 5  ? -17.936 -12.325 5.305   1.00 0.00 ? 5  ARG A HA   3  
ATOM 1269 H HB2  . ARG A 1 5  ? -18.908 -14.803 4.629   1.00 0.00 ? 5  ARG A HB2  3  
ATOM 1270 H HB3  . ARG A 1 5  ? -19.847 -13.826 3.524   1.00 0.00 ? 5  ARG A HB3  3  
ATOM 1271 H HG2  . ARG A 1 5  ? -17.912 -12.967 2.426   1.00 0.00 ? 5  ARG A HG2  3  
ATOM 1272 H HG3  . ARG A 1 5  ? -16.839 -13.422 3.734   1.00 0.00 ? 5  ARG A HG3  3  
ATOM 1273 H HD2  . ARG A 1 5  ? -18.306 -15.390 1.925   1.00 0.00 ? 5  ARG A HD2  3  
ATOM 1274 H HD3  . ARG A 1 5  ? -16.595 -14.979 1.811   1.00 0.00 ? 5  ARG A HD3  3  
ATOM 1275 H HE   . ARG A 1 5  ? -16.870 -15.778 4.433   1.00 0.00 ? 5  ARG A HE   3  
ATOM 1276 H HH11 . ARG A 1 5  ? -17.680 -17.180 1.365   1.00 0.00 ? 5  ARG A HH11 3  
ATOM 1277 H HH12 . ARG A 1 5  ? -17.470 -18.803 1.929   1.00 0.00 ? 5  ARG A HH12 3  
ATOM 1278 H HH21 . ARG A 1 5  ? -16.602 -17.816 5.162   1.00 0.00 ? 5  ARG A HH21 3  
ATOM 1279 H HH22 . ARG A 1 5  ? -16.853 -19.171 4.114   1.00 0.00 ? 5  ARG A HH22 3  
ATOM 1280 N N    . HIS A 1 6  ? -20.407 -10.896 5.660   1.00 0.00 ? 6  HIS A N    3  
ATOM 1281 C CA   . HIS A 1 6  ? -21.293 -9.726  5.391   1.00 0.00 ? 6  HIS A CA   3  
ATOM 1282 C C    . HIS A 1 6  ? -20.432 -8.451  5.369   1.00 0.00 ? 6  HIS A C    3  
ATOM 1283 O O    . HIS A 1 6  ? -20.793 -7.423  5.907   1.00 0.00 ? 6  HIS A O    3  
ATOM 1284 C CB   . HIS A 1 6  ? -22.365 -9.657  6.503   1.00 0.00 ? 6  HIS A CB   3  
ATOM 1285 C CG   . HIS A 1 6  ? -23.587 -8.854  6.022   1.00 0.00 ? 6  HIS A CG   3  
ATOM 1286 N ND1  . HIS A 1 6  ? -24.764 -8.928  6.552   1.00 0.00 ? 6  HIS A ND1  3  
ATOM 1287 C CD2  . HIS A 1 6  ? -23.737 -7.929  4.997   1.00 0.00 ? 6  HIS A CD2  3  
ATOM 1288 C CE1  . HIS A 1 6  ? -25.576 -8.135  5.931   1.00 0.00 ? 6  HIS A CE1  3  
ATOM 1289 N NE2  . HIS A 1 6  ? -24.981 -7.494  4.957   1.00 0.00 ? 6  HIS A NE2  3  
ATOM 1290 H H    . HIS A 1 6  ? -20.268 -11.190 6.581   1.00 0.00 ? 6  HIS A H    3  
ATOM 1291 H HA   . HIS A 1 6  ? -21.755 -9.862  4.427   1.00 0.00 ? 6  HIS A HA   3  
ATOM 1292 H HB2  . HIS A 1 6  ? -22.694 -10.653 6.761   1.00 0.00 ? 6  HIS A HB2  3  
ATOM 1293 H HB3  . HIS A 1 6  ? -21.967 -9.187  7.391   1.00 0.00 ? 6  HIS A HB3  3  
ATOM 1294 H HD1  . HIS A 1 6  ? -25.003 -9.499  7.311   1.00 0.00 ? 6  HIS A HD1  3  
ATOM 1295 H HD2  . HIS A 1 6  ? -22.952 -7.610  4.327   1.00 0.00 ? 6  HIS A HD2  3  
ATOM 1296 H HE1  . HIS A 1 6  ? -26.619 -8.017  6.185   1.00 0.00 ? 6  HIS A HE1  3  
ATOM 1297 N N    . ASP A 1 7  ? -19.300 -8.583  4.726   1.00 0.00 ? 7  ASP A N    3  
ATOM 1298 C CA   . ASP A 1 7  ? -18.323 -7.467  4.590   1.00 0.00 ? 7  ASP A CA   3  
ATOM 1299 C C    . ASP A 1 7  ? -18.842 -6.467  3.543   1.00 0.00 ? 7  ASP A C    3  
ATOM 1300 O O    . ASP A 1 7  ? -18.433 -6.469  2.397   1.00 0.00 ? 7  ASP A O    3  
ATOM 1301 C CB   . ASP A 1 7  ? -16.944 -8.068  4.171   1.00 0.00 ? 7  ASP A CB   3  
ATOM 1302 C CG   . ASP A 1 7  ? -17.125 -9.352  3.332   1.00 0.00 ? 7  ASP A CG   3  
ATOM 1303 O OD1  . ASP A 1 7  ? -17.481 -9.203  2.175   1.00 0.00 ? 7  ASP A OD1  3  
ATOM 1304 O OD2  . ASP A 1 7  ? -16.903 -10.411 3.897   1.00 0.00 ? 7  ASP A OD2  3  
ATOM 1305 H H    . ASP A 1 7  ? -19.078 -9.440  4.317   1.00 0.00 ? 7  ASP A H    3  
ATOM 1306 H HA   . ASP A 1 7  ? -18.233 -6.971  5.543   1.00 0.00 ? 7  ASP A HA   3  
ATOM 1307 H HB2  . ASP A 1 7  ? -16.389 -7.350  3.589   1.00 0.00 ? 7  ASP A HB2  3  
ATOM 1308 H HB3  . ASP A 1 7  ? -16.371 -8.301  5.058   1.00 0.00 ? 7  ASP A HB3  3  
ATOM 1309 N N    . SER A 1 8  ? -19.747 -5.636  3.996   1.00 0.00 ? 8  SER A N    3  
ATOM 1310 C CA   . SER A 1 8  ? -20.369 -4.596  3.127   1.00 0.00 ? 8  SER A CA   3  
ATOM 1311 C C    . SER A 1 8  ? -20.607 -3.323  3.946   1.00 0.00 ? 8  SER A C    3  
ATOM 1312 O O    . SER A 1 8  ? -21.149 -3.381  5.034   1.00 0.00 ? 8  SER A O    3  
ATOM 1313 C CB   . SER A 1 8  ? -21.706 -5.119  2.583   1.00 0.00 ? 8  SER A CB   3  
ATOM 1314 O OG   . SER A 1 8  ? -21.351 -6.272  1.833   1.00 0.00 ? 8  SER A OG   3  
ATOM 1315 H H    . SER A 1 8  ? -20.027 -5.696  4.930   1.00 0.00 ? 8  SER A H    3  
ATOM 1316 H HA   . SER A 1 8  ? -19.690 -4.368  2.321   1.00 0.00 ? 8  SER A HA   3  
ATOM 1317 H HB2  . SER A 1 8  ? -22.381 -5.400  3.378   1.00 0.00 ? 8  SER A HB2  3  
ATOM 1318 H HB3  . SER A 1 8  ? -22.179 -4.397  1.932   1.00 0.00 ? 8  SER A HB3  3  
ATOM 1319 H HG   . SER A 1 8  ? -21.594 -6.118  0.918   1.00 0.00 ? 8  SER A HG   3  
ATOM 1320 N N    . GLY A 1 9  ? -20.191 -2.214  3.391   1.00 0.00 ? 9  GLY A N    3  
ATOM 1321 C CA   . GLY A 1 9  ? -20.357 -0.895  4.075   1.00 0.00 ? 9  GLY A CA   3  
ATOM 1322 C C    . GLY A 1 9  ? -19.202 0.025   3.681   1.00 0.00 ? 9  GLY A C    3  
ATOM 1323 O O    . GLY A 1 9  ? -19.412 1.105   3.163   1.00 0.00 ? 9  GLY A O    3  
ATOM 1324 H H    . GLY A 1 9  ? -19.761 -2.245  2.511   1.00 0.00 ? 9  GLY A H    3  
ATOM 1325 H HA2  . GLY A 1 9  ? -21.295 -0.451  3.771   1.00 0.00 ? 9  GLY A HA2  3  
ATOM 1326 H HA3  . GLY A 1 9  ? -20.350 -1.032  5.147   1.00 0.00 ? 9  GLY A HA3  3  
ATOM 1327 N N    . TYR A 1 10 ? -18.007 -0.446  3.946   1.00 0.00 ? 10 TYR A N    3  
ATOM 1328 C CA   . TYR A 1 10 ? -16.779 0.340   3.617   1.00 0.00 ? 10 TYR A CA   3  
ATOM 1329 C C    . TYR A 1 10 ? -16.516 0.324   2.103   1.00 0.00 ? 10 TYR A C    3  
ATOM 1330 O O    . TYR A 1 10 ? -16.953 -0.566  1.397   1.00 0.00 ? 10 TYR A O    3  
ATOM 1331 C CB   . TYR A 1 10 ? -15.580 -0.279  4.377   1.00 0.00 ? 10 TYR A CB   3  
ATOM 1332 C CG   . TYR A 1 10 ? -14.260 0.399   3.953   1.00 0.00 ? 10 TYR A CG   3  
ATOM 1333 C CD1  . TYR A 1 10 ? -13.986 1.702   4.324   1.00 0.00 ? 10 TYR A CD1  3  
ATOM 1334 C CD2  . TYR A 1 10 ? -13.331 -0.285  3.190   1.00 0.00 ? 10 TYR A CD2  3  
ATOM 1335 C CE1  . TYR A 1 10 ? -12.808 2.309   3.940   1.00 0.00 ? 10 TYR A CE1  3  
ATOM 1336 C CE2  . TYR A 1 10 ? -12.154 0.323   2.806   1.00 0.00 ? 10 TYR A CE2  3  
ATOM 1337 C CZ   . TYR A 1 10 ? -11.885 1.625   3.179   1.00 0.00 ? 10 TYR A CZ   3  
ATOM 1338 O OH   . TYR A 1 10 ? -10.707 2.235   2.797   1.00 0.00 ? 10 TYR A OH   3  
ATOM 1339 H H    . TYR A 1 10 ? -17.917 -1.328  4.365   1.00 0.00 ? 10 TYR A H    3  
ATOM 1340 H HA   . TYR A 1 10 ? -16.925 1.362   3.937   1.00 0.00 ? 10 TYR A HA   3  
ATOM 1341 H HB2  . TYR A 1 10 ? -15.710 -0.145  5.441   1.00 0.00 ? 10 TYR A HB2  3  
ATOM 1342 H HB3  . TYR A 1 10 ? -15.519 -1.336  4.166   1.00 0.00 ? 10 TYR A HB3  3  
ATOM 1343 H HD1  . TYR A 1 10 ? -14.699 2.252   4.920   1.00 0.00 ? 10 TYR A HD1  3  
ATOM 1344 H HD2  . TYR A 1 10 ? -13.526 -1.304  2.888   1.00 0.00 ? 10 TYR A HD2  3  
ATOM 1345 H HE1  . TYR A 1 10 ? -12.610 3.328   4.238   1.00 0.00 ? 10 TYR A HE1  3  
ATOM 1346 H HE2  . TYR A 1 10 ? -11.440 -0.225  2.211   1.00 0.00 ? 10 TYR A HE2  3  
ATOM 1347 H HH   . TYR A 1 10 ? -10.703 2.301   1.839   1.00 0.00 ? 10 TYR A HH   3  
ATOM 1348 N N    . GLU A 1 11 ? -15.801 1.330   1.673   1.00 0.00 ? 11 GLU A N    3  
ATOM 1349 C CA   . GLU A 1 11 ? -15.434 1.495   0.234   1.00 0.00 ? 11 GLU A CA   3  
ATOM 1350 C C    . GLU A 1 11 ? -13.948 1.872   0.211   1.00 0.00 ? 11 GLU A C    3  
ATOM 1351 O O    . GLU A 1 11 ? -13.545 2.795   0.894   1.00 0.00 ? 11 GLU A O    3  
ATOM 1352 C CB   . GLU A 1 11 ? -16.313 2.613   -0.367  1.00 0.00 ? 11 GLU A CB   3  
ATOM 1353 C CG   . GLU A 1 11 ? -16.405 2.469   -1.903  1.00 0.00 ? 11 GLU A CG   3  
ATOM 1354 C CD   . GLU A 1 11 ? -15.089 2.931   -2.556  1.00 0.00 ? 11 GLU A CD   3  
ATOM 1355 O OE1  . GLU A 1 11 ? -14.865 4.130   -2.541  1.00 0.00 ? 11 GLU A OE1  3  
ATOM 1356 O OE2  . GLU A 1 11 ? -14.381 2.058   -3.033  1.00 0.00 ? 11 GLU A OE2  3  
ATOM 1357 H H    . GLU A 1 11 ? -15.493 2.000   2.318   1.00 0.00 ? 11 GLU A H    3  
ATOM 1358 H HA   . GLU A 1 11 ? -15.571 0.557   -0.286  1.00 0.00 ? 11 GLU A HA   3  
ATOM 1359 H HB2  . GLU A 1 11 ? -17.309 2.541   0.046   1.00 0.00 ? 11 GLU A HB2  3  
ATOM 1360 H HB3  . GLU A 1 11 ? -15.912 3.582   -0.106  1.00 0.00 ? 11 GLU A HB3  3  
ATOM 1361 H HG2  . GLU A 1 11 ? -16.606 1.442   -2.176  1.00 0.00 ? 11 GLU A HG2  3  
ATOM 1362 H HG3  . GLU A 1 11 ? -17.210 3.085   -2.275  1.00 0.00 ? 11 GLU A HG3  3  
ATOM 1363 N N    . VAL A 1 12 ? -13.179 1.155   -0.570  1.00 0.00 ? 12 VAL A N    3  
ATOM 1364 C CA   . VAL A 1 12 ? -11.719 1.425   -0.673  1.00 0.00 ? 12 VAL A CA   3  
ATOM 1365 C C    . VAL A 1 12 ? -11.392 2.819   -1.198  1.00 0.00 ? 12 VAL A C    3  
ATOM 1366 O O    . VAL A 1 12 ? -12.204 3.503   -1.789  1.00 0.00 ? 12 VAL A O    3  
ATOM 1367 C CB   . VAL A 1 12 ? -11.056 0.370   -1.608  1.00 0.00 ? 12 VAL A CB   3  
ATOM 1368 C CG1  . VAL A 1 12 ? -11.233 -1.038  -1.011  1.00 0.00 ? 12 VAL A CG1  3  
ATOM 1369 C CG2  . VAL A 1 12 ? -11.669 0.404   -3.028  1.00 0.00 ? 12 VAL A CG2  3  
ATOM 1370 H H    . VAL A 1 12 ? -13.549 0.430   -1.102  1.00 0.00 ? 12 VAL A H    3  
ATOM 1371 H HA   . VAL A 1 12 ? -11.296 1.333   0.314   1.00 0.00 ? 12 VAL A HA   3  
ATOM 1372 H HB   . VAL A 1 12 ? -9.999  0.582   -1.684  1.00 0.00 ? 12 VAL A HB   3  
ATOM 1373 H HG11 . VAL A 1 12 ? -10.979 -1.037  0.038   1.00 0.00 ? 12 VAL A HG11 3  
ATOM 1374 H HG12 . VAL A 1 12 ? -12.257 -1.366  -1.120  1.00 0.00 ? 12 VAL A HG12 3  
ATOM 1375 H HG13 . VAL A 1 12 ? -10.586 -1.734  -1.523  1.00 0.00 ? 12 VAL A HG13 3  
ATOM 1376 H HG21 . VAL A 1 12 ? -11.652 1.407   -3.426  1.00 0.00 ? 12 VAL A HG21 3  
ATOM 1377 H HG22 . VAL A 1 12 ? -11.099 -0.234  -3.686  1.00 0.00 ? 12 VAL A HG22 3  
ATOM 1378 H HG23 . VAL A 1 12 ? -12.691 0.053   -3.008  1.00 0.00 ? 12 VAL A HG23 3  
ATOM 1379 N N    . HIS A 1 13 ? -10.166 3.163   -0.936  1.00 0.00 ? 13 HIS A N    3  
ATOM 1380 C CA   . HIS A 1 13 ? -9.602  4.484   -1.350  1.00 0.00 ? 13 HIS A CA   3  
ATOM 1381 C C    . HIS A 1 13 ? -8.488  4.191   -2.359  1.00 0.00 ? 13 HIS A C    3  
ATOM 1382 O O    . HIS A 1 13 ? -7.321  4.439   -2.118  1.00 0.00 ? 13 HIS A O    3  
ATOM 1383 C CB   . HIS A 1 13 ? -9.048  5.204   -0.104  1.00 0.00 ? 13 HIS A CB   3  
ATOM 1384 C CG   . HIS A 1 13 ? -10.210 5.746   0.736   1.00 0.00 ? 13 HIS A CG   3  
ATOM 1385 N ND1  . HIS A 1 13 ? -10.375 6.986   1.060   1.00 0.00 ? 13 HIS A ND1  3  
ATOM 1386 C CD2  . HIS A 1 13 ? -11.289 5.099   1.311   1.00 0.00 ? 13 HIS A CD2  3  
ATOM 1387 C CE1  . HIS A 1 13 ? -11.451 7.112   1.771   1.00 0.00 ? 13 HIS A CE1  3  
ATOM 1388 N NE2  . HIS A 1 13 ? -12.052 5.961   1.951   1.00 0.00 ? 13 HIS A NE2  3  
ATOM 1389 H H    . HIS A 1 13 ? -9.623  2.508   -0.452  1.00 0.00 ? 13 HIS A H    3  
ATOM 1390 H HA   . HIS A 1 13 ? -10.365 5.080   -1.827  1.00 0.00 ? 13 HIS A HA   3  
ATOM 1391 H HB2  . HIS A 1 13 ? -8.465  4.525   0.498   1.00 0.00 ? 13 HIS A HB2  3  
ATOM 1392 H HB3  . HIS A 1 13 ? -8.426  6.035   -0.406  1.00 0.00 ? 13 HIS A HB3  3  
ATOM 1393 H HD1  . HIS A 1 13 ? -9.776  7.720   0.807   1.00 0.00 ? 13 HIS A HD1  3  
ATOM 1394 H HD2  . HIS A 1 13 ? -11.478 4.040   1.243   1.00 0.00 ? 13 HIS A HD2  3  
ATOM 1395 H HE1  . HIS A 1 13 ? -11.808 8.052   2.166   1.00 0.00 ? 13 HIS A HE1  3  
ATOM 1396 N N    . HIS A 1 14 ? -8.914  3.658   -3.478  1.00 0.00 ? 14 HIS A N    3  
ATOM 1397 C CA   . HIS A 1 14 ? -7.993  3.291   -4.598  1.00 0.00 ? 14 HIS A CA   3  
ATOM 1398 C C    . HIS A 1 14 ? -6.867  2.377   -4.083  1.00 0.00 ? 14 HIS A C    3  
ATOM 1399 O O    . HIS A 1 14 ? -5.753  2.386   -4.571  1.00 0.00 ? 14 HIS A O    3  
ATOM 1400 C CB   . HIS A 1 14 ? -7.425  4.596   -5.191  1.00 0.00 ? 14 HIS A CB   3  
ATOM 1401 C CG   . HIS A 1 14 ? -8.499  5.693   -5.227  1.00 0.00 ? 14 HIS A CG   3  
ATOM 1402 N ND1  . HIS A 1 14 ? -8.296  6.931   -4.919  1.00 0.00 ? 14 HIS A ND1  3  
ATOM 1403 C CD2  . HIS A 1 14 ? -9.842  5.643   -5.562  1.00 0.00 ? 14 HIS A CD2  3  
ATOM 1404 C CE1  . HIS A 1 14 ? -9.396  7.600   -5.045  1.00 0.00 ? 14 HIS A CE1  3  
ATOM 1405 N NE2  . HIS A 1 14 ? -10.386 6.839   -5.444  1.00 0.00 ? 14 HIS A NE2  3  
ATOM 1406 H H    . HIS A 1 14 ? -9.868  3.495   -3.591  1.00 0.00 ? 14 HIS A H    3  
ATOM 1407 H HA   . HIS A 1 14 ? -8.559  2.750   -5.342  1.00 0.00 ? 14 HIS A HA   3  
ATOM 1408 H HB2  . HIS A 1 14 ? -6.635  4.934   -4.545  1.00 0.00 ? 14 HIS A HB2  3  
ATOM 1409 H HB3  . HIS A 1 14 ? -7.044  4.437   -6.189  1.00 0.00 ? 14 HIS A HB3  3  
ATOM 1410 H HD1  . HIS A 1 14 ? -7.436  7.306   -4.634  1.00 0.00 ? 14 HIS A HD1  3  
ATOM 1411 H HD2  . HIS A 1 14 ? -10.368 4.754   -5.874  1.00 0.00 ? 14 HIS A HD2  3  
ATOM 1412 H HE1  . HIS A 1 14 ? -9.487  8.656   -4.843  1.00 0.00 ? 14 HIS A HE1  3  
ATOM 1413 N N    . GLN A 1 15 ? -7.217  1.600   -3.090  1.00 0.00 ? 15 GLN A N    3  
ATOM 1414 C CA   . GLN A 1 15 ? -6.252  0.648   -2.459  1.00 0.00 ? 15 GLN A CA   3  
ATOM 1415 C C    . GLN A 1 15 ? -5.487  -0.183  -3.496  1.00 0.00 ? 15 GLN A C    3  
ATOM 1416 O O    . GLN A 1 15 ? -4.344  -0.533  -3.288  1.00 0.00 ? 15 GLN A O    3  
ATOM 1417 C CB   . GLN A 1 15 ? -7.046  -0.261  -1.510  1.00 0.00 ? 15 GLN A CB   3  
ATOM 1418 C CG   . GLN A 1 15 ? -7.271  0.498   -0.183  1.00 0.00 ? 15 GLN A CG   3  
ATOM 1419 C CD   . GLN A 1 15 ? -8.359  -0.190  0.649   1.00 0.00 ? 15 GLN A CD   3  
ATOM 1420 O OE1  . GLN A 1 15 ? -9.205  0.458   1.231   1.00 0.00 ? 15 GLN A OE1  3  
ATOM 1421 N NE2  . GLN A 1 15 ? -8.378  -1.492  0.734   1.00 0.00 ? 15 GLN A NE2  3  
ATOM 1422 H H    . GLN A 1 15 ? -8.136  1.646   -2.754  1.00 0.00 ? 15 GLN A H    3  
ATOM 1423 H HA   . GLN A 1 15 ? -5.533  1.225   -1.900  1.00 0.00 ? 15 GLN A HA   3  
ATOM 1424 H HB2  . GLN A 1 15 ? -7.994  -0.525  -1.959  1.00 0.00 ? 15 GLN A HB2  3  
ATOM 1425 H HB3  . GLN A 1 15 ? -6.494  -1.166  -1.316  1.00 0.00 ? 15 GLN A HB3  3  
ATOM 1426 H HG2  . GLN A 1 15 ? -6.357  0.513   0.394   1.00 0.00 ? 15 GLN A HG2  3  
ATOM 1427 H HG3  . GLN A 1 15 ? -7.578  1.516   -0.376  1.00 0.00 ? 15 GLN A HG3  3  
ATOM 1428 H HE21 . GLN A 1 15 ? -7.699  -2.024  0.270   1.00 0.00 ? 15 GLN A HE21 3  
ATOM 1429 H HE22 . GLN A 1 15 ? -9.072  -1.937  1.263   1.00 0.00 ? 15 GLN A HE22 3  
ATOM 1430 N N    . LYS A 1 16 ? -6.140  -0.472  -4.591  1.00 0.00 ? 16 LYS A N    3  
ATOM 1431 C CA   . LYS A 1 16 ? -5.490  -1.275  -5.673  1.00 0.00 ? 16 LYS A CA   3  
ATOM 1432 C C    . LYS A 1 16 ? -4.145  -0.645  -6.082  1.00 0.00 ? 16 LYS A C    3  
ATOM 1433 O O    . LYS A 1 16 ? -3.113  -1.292  -6.079  1.00 0.00 ? 16 LYS A O    3  
ATOM 1434 C CB   . LYS A 1 16 ? -6.454  -1.347  -6.897  1.00 0.00 ? 16 LYS A CB   3  
ATOM 1435 C CG   . LYS A 1 16 ? -7.057  0.046   -7.272  1.00 0.00 ? 16 LYS A CG   3  
ATOM 1436 C CD   . LYS A 1 16 ? -6.424  0.576   -8.582  1.00 0.00 ? 16 LYS A CD   3  
ATOM 1437 C CE   . LYS A 1 16 ? -7.177  0.005   -9.798  1.00 0.00 ? 16 LYS A CE   3  
ATOM 1438 N NZ   . LYS A 1 16 ? -6.451  0.351   -11.052 1.00 0.00 ? 16 LYS A NZ   3  
ATOM 1439 H H    . LYS A 1 16 ? -7.061  -0.156  -4.694  1.00 0.00 ? 16 LYS A H    3  
ATOM 1440 H HA   . LYS A 1 16 ? -5.304  -2.266  -5.301  1.00 0.00 ? 16 LYS A HA   3  
ATOM 1441 H HB2  . LYS A 1 16 ? -5.926  -1.771  -7.739  1.00 0.00 ? 16 LYS A HB2  3  
ATOM 1442 H HB3  . LYS A 1 16 ? -7.265  -2.015  -6.648  1.00 0.00 ? 16 LYS A HB3  3  
ATOM 1443 H HG2  . LYS A 1 16 ? -8.126  -0.057  -7.402  1.00 0.00 ? 16 LYS A HG2  3  
ATOM 1444 H HG3  . LYS A 1 16 ? -6.894  0.769   -6.489  1.00 0.00 ? 16 LYS A HG3  3  
ATOM 1445 H HD2  . LYS A 1 16 ? -6.487  1.654   -8.598  1.00 0.00 ? 16 LYS A HD2  3  
ATOM 1446 H HD3  . LYS A 1 16 ? -5.382  0.296   -8.639  1.00 0.00 ? 16 LYS A HD3  3  
ATOM 1447 H HE2  . LYS A 1 16 ? -7.251  -1.071  -9.730  1.00 0.00 ? 16 LYS A HE2  3  
ATOM 1448 H HE3  . LYS A 1 16 ? -8.173  0.422   -9.850  1.00 0.00 ? 16 LYS A HE3  3  
ATOM 1449 H HZ1  . LYS A 1 16 ? -5.598  0.899   -10.822 1.00 0.00 ? 16 LYS A HZ1  3  
ATOM 1450 H HZ2  . LYS A 1 16 ? -6.178  -0.523  -11.546 1.00 0.00 ? 16 LYS A HZ2  3  
ATOM 1451 H HZ3  . LYS A 1 16 ? -7.071  0.917   -11.666 1.00 0.00 ? 16 LYS A HZ3  3  
ATOM 1452 N N    . LEU A 1 17 ? -4.192  0.621   -6.408  1.00 0.00 ? 17 LEU A N    3  
ATOM 1453 C CA   . LEU A 1 17 ? -2.946  1.326   -6.820  1.00 0.00 ? 17 LEU A CA   3  
ATOM 1454 C C    . LEU A 1 17 ? -2.013  1.451   -5.609  1.00 0.00 ? 17 LEU A C    3  
ATOM 1455 O O    . LEU A 1 17 ? -0.816  1.352   -5.759  1.00 0.00 ? 17 LEU A O    3  
ATOM 1456 C CB   . LEU A 1 17 ? -3.345  2.719   -7.416  1.00 0.00 ? 17 LEU A CB   3  
ATOM 1457 C CG   . LEU A 1 17 ? -3.372  3.877   -6.376  1.00 0.00 ? 17 LEU A CG   3  
ATOM 1458 C CD1  . LEU A 1 17 ? -1.927  4.392   -6.093  1.00 0.00 ? 17 LEU A CD1  3  
ATOM 1459 C CD2  . LEU A 1 17 ? -4.212  5.035   -6.955  1.00 0.00 ? 17 LEU A CD2  3  
ATOM 1460 H H    . LEU A 1 17 ? -5.043  1.100   -6.373  1.00 0.00 ? 17 LEU A H    3  
ATOM 1461 H HA   . LEU A 1 17 ? -2.453  0.740   -7.584  1.00 0.00 ? 17 LEU A HA   3  
ATOM 1462 H HB2  . LEU A 1 17 ? -2.648  2.966   -8.205  1.00 0.00 ? 17 LEU A HB2  3  
ATOM 1463 H HB3  . LEU A 1 17 ? -4.322  2.625   -7.867  1.00 0.00 ? 17 LEU A HB3  3  
ATOM 1464 H HG   . LEU A 1 17 ? -3.833  3.536   -5.463  1.00 0.00 ? 17 LEU A HG   3  
ATOM 1465 H HD11 . LEU A 1 17 ? -1.210  3.919   -6.749  1.00 0.00 ? 17 LEU A HD11 3  
ATOM 1466 H HD12 . LEU A 1 17 ? -1.858  5.461   -6.233  1.00 0.00 ? 17 LEU A HD12 3  
ATOM 1467 H HD13 . LEU A 1 17 ? -1.653  4.168   -5.073  1.00 0.00 ? 17 LEU A HD13 3  
ATOM 1468 H HD21 . LEU A 1 17 ? -5.169  4.670   -7.298  1.00 0.00 ? 17 LEU A HD21 3  
ATOM 1469 H HD22 . LEU A 1 17 ? -4.379  5.786   -6.197  1.00 0.00 ? 17 LEU A HD22 3  
ATOM 1470 H HD23 . LEU A 1 17 ? -3.697  5.489   -7.790  1.00 0.00 ? 17 LEU A HD23 3  
ATOM 1471 N N    . VAL A 1 18 ? -2.569  1.664   -4.441  1.00 0.00 ? 18 VAL A N    3  
ATOM 1472 C CA   . VAL A 1 18 ? -1.722  1.794   -3.214  1.00 0.00 ? 18 VAL A CA   3  
ATOM 1473 C C    . VAL A 1 18 ? -0.812  0.551   -3.123  1.00 0.00 ? 18 VAL A C    3  
ATOM 1474 O O    . VAL A 1 18 ? 0.383   0.670   -2.948  1.00 0.00 ? 18 VAL A O    3  
ATOM 1475 C CB   . VAL A 1 18 ? -2.673  1.913   -1.994  1.00 0.00 ? 18 VAL A CB   3  
ATOM 1476 C CG1  . VAL A 1 18 ? -1.865  1.996   -0.691  1.00 0.00 ? 18 VAL A CG1  3  
ATOM 1477 C CG2  . VAL A 1 18 ? -3.534  3.194   -2.134  1.00 0.00 ? 18 VAL A CG2  3  
ATOM 1478 H H    . VAL A 1 18 ? -3.540  1.745   -4.364  1.00 0.00 ? 18 VAL A H    3  
ATOM 1479 H HA   . VAL A 1 18 ? -1.106  2.677   -3.306  1.00 0.00 ? 18 VAL A HA   3  
ATOM 1480 H HB   . VAL A 1 18 ? -3.317  1.050   -1.941  1.00 0.00 ? 18 VAL A HB   3  
ATOM 1481 H HG11 . VAL A 1 18 ? -0.814  2.136   -0.900  1.00 0.00 ? 18 VAL A HG11 3  
ATOM 1482 H HG12 . VAL A 1 18 ? -2.210  2.816   -0.079  1.00 0.00 ? 18 VAL A HG12 3  
ATOM 1483 H HG13 . VAL A 1 18 ? -1.998  1.077   -0.143  1.00 0.00 ? 18 VAL A HG13 3  
ATOM 1484 H HG21 . VAL A 1 18 ? -4.051  3.207   -3.080  1.00 0.00 ? 18 VAL A HG21 3  
ATOM 1485 H HG22 . VAL A 1 18 ? -4.268  3.234   -1.342  1.00 0.00 ? 18 VAL A HG22 3  
ATOM 1486 H HG23 . VAL A 1 18 ? -2.910  4.074   -2.073  1.00 0.00 ? 18 VAL A HG23 3  
ATOM 1487 N N    . PHE A 1 19 ? -1.406  -0.609  -3.252  1.00 0.00 ? 19 PHE A N    3  
ATOM 1488 C CA   . PHE A 1 19 ? -0.635  -1.893  -3.187  1.00 0.00 ? 19 PHE A CA   3  
ATOM 1489 C C    . PHE A 1 19 ? 0.476   -1.858  -4.235  1.00 0.00 ? 19 PHE A C    3  
ATOM 1490 O O    . PHE A 1 19 ? 1.623   -2.134  -3.940  1.00 0.00 ? 19 PHE A O    3  
ATOM 1491 C CB   . PHE A 1 19 ? -1.579  -3.084  -3.469  1.00 0.00 ? 19 PHE A CB   3  
ATOM 1492 C CG   . PHE A 1 19 ? -2.782  -3.103  -2.505  1.00 0.00 ? 19 PHE A CG   3  
ATOM 1493 C CD1  . PHE A 1 19 ? -2.651  -2.769  -1.165  1.00 0.00 ? 19 PHE A CD1  3  
ATOM 1494 C CD2  . PHE A 1 19 ? -4.030  -3.465  -2.980  1.00 0.00 ? 19 PHE A CD2  3  
ATOM 1495 C CE1  . PHE A 1 19 ? -3.743  -2.798  -0.324  1.00 0.00 ? 19 PHE A CE1  3  
ATOM 1496 C CE2  . PHE A 1 19 ? -5.122  -3.495  -2.137  1.00 0.00 ? 19 PHE A CE2  3  
ATOM 1497 C CZ   . PHE A 1 19 ? -4.979  -3.161  -0.808  1.00 0.00 ? 19 PHE A CZ   3  
ATOM 1498 H H    . PHE A 1 19 ? -2.370  -0.627  -3.389  1.00 0.00 ? 19 PHE A H    3  
ATOM 1499 H HA   . PHE A 1 19 ? -0.181  -1.990  -2.218  1.00 0.00 ? 19 PHE A HA   3  
ATOM 1500 H HB2  . PHE A 1 19 ? -1.944  -3.029  -4.484  1.00 0.00 ? 19 PHE A HB2  3  
ATOM 1501 H HB3  . PHE A 1 19 ? -1.035  -4.010  -3.351  1.00 0.00 ? 19 PHE A HB3  3  
ATOM 1502 H HD1  . PHE A 1 19 ? -1.689  -2.484  -0.767  1.00 0.00 ? 19 PHE A HD1  3  
ATOM 1503 H HD2  . PHE A 1 19 ? -4.154  -3.731  -4.019  1.00 0.00 ? 19 PHE A HD2  3  
ATOM 1504 H HE1  . PHE A 1 19 ? -3.628  -2.535  0.718   1.00 0.00 ? 19 PHE A HE1  3  
ATOM 1505 H HE2  . PHE A 1 19 ? -6.092  -3.779  -2.521  1.00 0.00 ? 19 PHE A HE2  3  
ATOM 1506 H HZ   . PHE A 1 19 ? -5.835  -3.183  -0.149  1.00 0.00 ? 19 PHE A HZ   3  
ATOM 1507 N N    . PHE A 1 20 ? 0.097   -1.509  -5.438  1.00 0.00 ? 20 PHE A N    3  
ATOM 1508 C CA   . PHE A 1 20 ? 1.088   -1.430  -6.555  1.00 0.00 ? 20 PHE A CA   3  
ATOM 1509 C C    . PHE A 1 20 ? 2.272   -0.544  -6.109  1.00 0.00 ? 20 PHE A C    3  
ATOM 1510 O O    . PHE A 1 20 ? 3.409   -0.966  -6.129  1.00 0.00 ? 20 PHE A O    3  
ATOM 1511 C CB   . PHE A 1 20 ? 0.333   -0.857  -7.807  1.00 0.00 ? 20 PHE A CB   3  
ATOM 1512 C CG   . PHE A 1 20 ? 1.100   0.266   -8.534  1.00 0.00 ? 20 PHE A CG   3  
ATOM 1513 C CD1  . PHE A 1 20 ? 2.248   -0.023  -9.249  1.00 0.00 ? 20 PHE A CD1  3  
ATOM 1514 C CD2  . PHE A 1 20 ? 0.658   1.577   -8.487  1.00 0.00 ? 20 PHE A CD2  3  
ATOM 1515 C CE1  . PHE A 1 20 ? 2.936   0.977   -9.902  1.00 0.00 ? 20 PHE A CE1  3  
ATOM 1516 C CE2  . PHE A 1 20 ? 1.345   2.576   -9.138  1.00 0.00 ? 20 PHE A CE2  3  
ATOM 1517 C CZ   . PHE A 1 20 ? 2.487   2.278   -9.849  1.00 0.00 ? 20 PHE A CZ   3  
ATOM 1518 H H    . PHE A 1 20 ? -0.845  -1.301  -5.601  1.00 0.00 ? 20 PHE A H    3  
ATOM 1519 H HA   . PHE A 1 20 ? 1.454   -2.425  -6.764  1.00 0.00 ? 20 PHE A HA   3  
ATOM 1520 H HB2  . PHE A 1 20 ? 0.167   -1.659  -8.511  1.00 0.00 ? 20 PHE A HB2  3  
ATOM 1521 H HB3  . PHE A 1 20 ? -0.633  -0.478  -7.511  1.00 0.00 ? 20 PHE A HB3  3  
ATOM 1522 H HD1  . PHE A 1 20 ? 2.613   -1.038  -9.298  1.00 0.00 ? 20 PHE A HD1  3  
ATOM 1523 H HD2  . PHE A 1 20 ? -0.234  1.835   -7.940  1.00 0.00 ? 20 PHE A HD2  3  
ATOM 1524 H HE1  . PHE A 1 20 ? 3.829   0.733   -10.456 1.00 0.00 ? 20 PHE A HE1  3  
ATOM 1525 H HE2  . PHE A 1 20 ? 0.983   3.592   -9.088  1.00 0.00 ? 20 PHE A HE2  3  
ATOM 1526 H HZ   . PHE A 1 20 ? 3.028   3.060   -10.361 1.00 0.00 ? 20 PHE A HZ   3  
ATOM 1527 N N    . ALA A 1 21 ? 1.955   0.658   -5.702  1.00 0.00 ? 21 ALA A N    3  
ATOM 1528 C CA   . ALA A 1 21 ? 2.991   1.636   -5.241  1.00 0.00 ? 21 ALA A CA   3  
ATOM 1529 C C    . ALA A 1 21 ? 3.888   1.038   -4.153  1.00 0.00 ? 21 ALA A C    3  
ATOM 1530 O O    . ALA A 1 21 ? 5.092   1.157   -4.208  1.00 0.00 ? 21 ALA A O    3  
ATOM 1531 C CB   . ALA A 1 21 ? 2.272   2.885   -4.708  1.00 0.00 ? 21 ALA A CB   3  
ATOM 1532 H H    . ALA A 1 21 ? 1.013   0.913   -5.700  1.00 0.00 ? 21 ALA A H    3  
ATOM 1533 H HA   . ALA A 1 21 ? 3.617   1.895   -6.083  1.00 0.00 ? 21 ALA A HA   3  
ATOM 1534 H HB1  . ALA A 1 21 ? 1.448   3.142   -5.357  1.00 0.00 ? 21 ALA A HB1  3  
ATOM 1535 H HB2  . ALA A 1 21 ? 1.889   2.710   -3.713  1.00 0.00 ? 21 ALA A HB2  3  
ATOM 1536 H HB3  . ALA A 1 21 ? 2.958   3.719   -4.674  1.00 0.00 ? 21 ALA A HB3  3  
ATOM 1537 N N    . GLU A 1 22 ? 3.284   0.406   -3.186  1.00 0.00 ? 22 GLU A N    3  
ATOM 1538 C CA   . GLU A 1 22 ? 4.073   -0.218  -2.077  1.00 0.00 ? 22 GLU A CA   3  
ATOM 1539 C C    . GLU A 1 22 ? 5.084   -1.205  -2.672  1.00 0.00 ? 22 GLU A C    3  
ATOM 1540 O O    . GLU A 1 22 ? 6.251   -1.158  -2.343  1.00 0.00 ? 22 GLU A O    3  
ATOM 1541 C CB   . GLU A 1 22 ? 3.109   -0.950  -1.123  1.00 0.00 ? 22 GLU A CB   3  
ATOM 1542 C CG   . GLU A 1 22 ? 2.311   0.089   -0.305  1.00 0.00 ? 22 GLU A CG   3  
ATOM 1543 C CD   . GLU A 1 22 ? 1.085   -0.598  0.322   1.00 0.00 ? 22 GLU A CD   3  
ATOM 1544 O OE1  . GLU A 1 22 ? 1.273   -1.208  1.363   1.00 0.00 ? 22 GLU A OE1  3  
ATOM 1545 O OE2  . GLU A 1 22 ? 0.027   -0.475  -0.273  1.00 0.00 ? 22 GLU A OE2  3  
ATOM 1546 H H    . GLU A 1 22 ? 2.311   0.355   -3.196  1.00 0.00 ? 22 GLU A H    3  
ATOM 1547 H HA   . GLU A 1 22 ? 4.626   0.561   -1.571  1.00 0.00 ? 22 GLU A HA   3  
ATOM 1548 H HB2  . GLU A 1 22 ? 2.433   -1.573  -1.688  1.00 0.00 ? 22 GLU A HB2  3  
ATOM 1549 H HB3  . GLU A 1 22 ? 3.670   -1.579  -0.446  1.00 0.00 ? 22 GLU A HB3  3  
ATOM 1550 H HG2  . GLU A 1 22 ? 2.929   0.494   0.483   1.00 0.00 ? 22 GLU A HG2  3  
ATOM 1551 H HG3  . GLU A 1 22 ? 1.979   0.901   -0.936  1.00 0.00 ? 22 GLU A HG3  3  
ATOM 1552 N N    . ASP A 1 23 ? 4.606   -2.066  -3.536  1.00 0.00 ? 23 ASP A N    3  
ATOM 1553 C CA   . ASP A 1 23 ? 5.494   -3.077  -4.190  1.00 0.00 ? 23 ASP A CA   3  
ATOM 1554 C C    . ASP A 1 23 ? 6.690   -2.361  -4.826  1.00 0.00 ? 23 ASP A C    3  
ATOM 1555 O O    . ASP A 1 23 ? 7.836   -2.676  -4.583  1.00 0.00 ? 23 ASP A O    3  
ATOM 1556 C CB   . ASP A 1 23 ? 4.704   -3.814  -5.279  1.00 0.00 ? 23 ASP A CB   3  
ATOM 1557 C CG   . ASP A 1 23 ? 5.398   -5.153  -5.585  1.00 0.00 ? 23 ASP A CG   3  
ATOM 1558 O OD1  . ASP A 1 23 ? 6.409   -5.098  -6.268  1.00 0.00 ? 23 ASP A OD1  3  
ATOM 1559 O OD2  . ASP A 1 23 ? 4.881   -6.153  -5.116  1.00 0.00 ? 23 ASP A OD2  3  
ATOM 1560 H H    . ASP A 1 23 ? 3.654   -2.050  -3.752  1.00 0.00 ? 23 ASP A H    3  
ATOM 1561 H HA   . ASP A 1 23 ? 5.852   -3.763  -3.439  1.00 0.00 ? 23 ASP A HA   3  
ATOM 1562 H HB2  . ASP A 1 23 ? 3.685   -3.981  -4.968  1.00 0.00 ? 23 ASP A HB2  3  
ATOM 1563 H HB3  . ASP A 1 23 ? 4.672   -3.220  -6.180  1.00 0.00 ? 23 ASP A HB3  3  
ATOM 1564 N N    . VAL A 1 24 ? 6.339   -1.398  -5.631  1.00 0.00 ? 24 VAL A N    3  
ATOM 1565 C CA   . VAL A 1 24 ? 7.318   -0.553  -6.373  1.00 0.00 ? 24 VAL A CA   3  
ATOM 1566 C C    . VAL A 1 24 ? 8.387   -0.029  -5.404  1.00 0.00 ? 24 VAL A C    3  
ATOM 1567 O O    . VAL A 1 24 ? 9.572   -0.172  -5.637  1.00 0.00 ? 24 VAL A O    3  
ATOM 1568 C CB   . VAL A 1 24 ? 6.481   0.568   -7.030  1.00 0.00 ? 24 VAL A CB   3  
ATOM 1569 C CG1  . VAL A 1 24 ? 7.332   1.534   -7.835  1.00 0.00 ? 24 VAL A CG1  3  
ATOM 1570 C CG2  . VAL A 1 24 ? 5.419   -0.066  -7.951  1.00 0.00 ? 24 VAL A CG2  3  
ATOM 1571 H H    . VAL A 1 24 ? 5.384   -1.223  -5.751  1.00 0.00 ? 24 VAL A H    3  
ATOM 1572 H HA   . VAL A 1 24 ? 7.799   -1.162  -7.122  1.00 0.00 ? 24 VAL A HA   3  
ATOM 1573 H HB   . VAL A 1 24 ? 5.978   1.141   -6.271  1.00 0.00 ? 24 VAL A HB   3  
ATOM 1574 H HG11 . VAL A 1 24 ? 8.033   0.991   -8.449  1.00 0.00 ? 24 VAL A HG11 3  
ATOM 1575 H HG12 . VAL A 1 24 ? 6.688   2.132   -8.462  1.00 0.00 ? 24 VAL A HG12 3  
ATOM 1576 H HG13 . VAL A 1 24 ? 7.859   2.186   -7.157  1.00 0.00 ? 24 VAL A HG13 3  
ATOM 1577 H HG21 . VAL A 1 24 ? 5.275   -1.113  -7.726  1.00 0.00 ? 24 VAL A HG21 3  
ATOM 1578 H HG22 . VAL A 1 24 ? 4.484   0.448   -7.793  1.00 0.00 ? 24 VAL A HG22 3  
ATOM 1579 H HG23 . VAL A 1 24 ? 5.700   0.021   -8.989  1.00 0.00 ? 24 VAL A HG23 3  
ATOM 1580 N N    . GLY A 1 25 ? 7.904   0.556   -4.341  1.00 0.00 ? 25 GLY A N    3  
ATOM 1581 C CA   . GLY A 1 25 ? 8.795   1.126   -3.280  1.00 0.00 ? 25 GLY A CA   3  
ATOM 1582 C C    . GLY A 1 25 ? 9.745   0.045   -2.747  1.00 0.00 ? 25 GLY A C    3  
ATOM 1583 O O    . GLY A 1 25 ? 10.947  0.212   -2.743  1.00 0.00 ? 25 GLY A O    3  
ATOM 1584 H H    . GLY A 1 25 ? 6.931   0.617   -4.254  1.00 0.00 ? 25 GLY A H    3  
ATOM 1585 H HA2  . GLY A 1 25 ? 9.368   1.943   -3.693  1.00 0.00 ? 25 GLY A HA2  3  
ATOM 1586 H HA3  . GLY A 1 25 ? 8.183   1.492   -2.469  1.00 0.00 ? 25 GLY A HA3  3  
ATOM 1587 N N    . SER A 1 26 ? 9.166   -1.044  -2.314  1.00 0.00 ? 26 SER A N    3  
ATOM 1588 C CA   . SER A 1 26 ? 9.965   -2.187  -1.766  1.00 0.00 ? 26 SER A CA   3  
ATOM 1589 C C    . SER A 1 26 ? 11.094  -2.570  -2.733  1.00 0.00 ? 26 SER A C    3  
ATOM 1590 O O    . SER A 1 26 ? 12.248  -2.659  -2.364  1.00 0.00 ? 26 SER A O    3  
ATOM 1591 C CB   . SER A 1 26 ? 9.031   -3.397  -1.551  1.00 0.00 ? 26 SER A CB   3  
ATOM 1592 O OG   . SER A 1 26 ? 7.942   -2.879  -0.800  1.00 0.00 ? 26 SER A OG   3  
ATOM 1593 H H    . SER A 1 26 ? 8.191   -1.104  -2.350  1.00 0.00 ? 26 SER A H    3  
ATOM 1594 H HA   . SER A 1 26 ? 10.401  -1.885  -0.829  1.00 0.00 ? 26 SER A HA   3  
ATOM 1595 H HB2  . SER A 1 26 ? 8.664   -3.798  -2.484  1.00 0.00 ? 26 SER A HB2  3  
ATOM 1596 H HB3  . SER A 1 26 ? 9.519   -4.174  -0.981  1.00 0.00 ? 26 SER A HB3  3  
ATOM 1597 H HG   . SER A 1 26 ? 7.143   -2.995  -1.318  1.00 0.00 ? 26 SER A HG   3  
ATOM 1598 N N    . ASN A 1 27 ? 10.706  -2.778  -3.961  1.00 0.00 ? 27 ASN A N    3  
ATOM 1599 C CA   . ASN A 1 27 ? 11.661  -3.158  -5.037  1.00 0.00 ? 27 ASN A CA   3  
ATOM 1600 C C    . ASN A 1 27 ? 12.838  -2.191  -5.175  1.00 0.00 ? 27 ASN A C    3  
ATOM 1601 O O    . ASN A 1 27 ? 13.969  -2.589  -4.976  1.00 0.00 ? 27 ASN A O    3  
ATOM 1602 C CB   . ASN A 1 27 ? 10.865  -3.238  -6.352  1.00 0.00 ? 27 ASN A CB   3  
ATOM 1603 C CG   . ASN A 1 27 ? 10.105  -4.571  -6.432  1.00 0.00 ? 27 ASN A CG   3  
ATOM 1604 O OD1  . ASN A 1 27 ? 10.250  -5.326  -7.372  1.00 0.00 ? 27 ASN A OD1  3  
ATOM 1605 N ND2  . ASN A 1 27 ? 9.285   -4.896  -5.470  1.00 0.00 ? 27 ASN A ND2  3  
ATOM 1606 H H    . ASN A 1 27 ? 9.760   -2.688  -4.179  1.00 0.00 ? 27 ASN A H    3  
ATOM 1607 H HA   . ASN A 1 27 ? 12.086  -4.110  -4.767  1.00 0.00 ? 27 ASN A HA   3  
ATOM 1608 H HB2  . ASN A 1 27 ? 10.146  -2.435  -6.403  1.00 0.00 ? 27 ASN A HB2  3  
ATOM 1609 H HB3  . ASN A 1 27 ? 11.526  -3.152  -7.196  1.00 0.00 ? 27 ASN A HB3  3  
ATOM 1610 H HD21 . ASN A 1 27 ? 9.164   -4.297  -4.705  1.00 0.00 ? 27 ASN A HD21 3  
ATOM 1611 H HD22 . ASN A 1 27 ? 8.789   -5.741  -5.514  1.00 0.00 ? 27 ASN A HD22 3  
ATOM 1612 N N    . LYS A 1 28 ? 12.563  -0.954  -5.504  1.00 0.00 ? 28 LYS A N    3  
ATOM 1613 C CA   . LYS A 1 28 ? 13.680  0.034   -5.654  1.00 0.00 ? 28 LYS A CA   3  
ATOM 1614 C C    . LYS A 1 28 ? 14.503  0.064   -4.360  1.00 0.00 ? 28 LYS A C    3  
ATOM 1615 O O    . LYS A 1 28 ? 15.708  0.180   -4.418  1.00 0.00 ? 28 LYS A O    3  
ATOM 1616 C CB   . LYS A 1 28 ? 13.090  1.438   -5.972  1.00 0.00 ? 28 LYS A CB   3  
ATOM 1617 C CG   . LYS A 1 28 ? 12.116  1.938   -4.885  1.00 0.00 ? 28 LYS A CG   3  
ATOM 1618 C CD   . LYS A 1 28 ? 11.545  3.321   -5.275  1.00 0.00 ? 28 LYS A CD   3  
ATOM 1619 C CE   . LYS A 1 28 ? 10.379  3.148   -6.267  1.00 0.00 ? 28 LYS A CE   3  
ATOM 1620 N NZ   . LYS A 1 28 ? 9.709   4.458   -6.503  1.00 0.00 ? 28 LYS A NZ   3  
ATOM 1621 H H    . LYS A 1 28 ? 11.630  -0.695  -5.640  1.00 0.00 ? 28 LYS A H    3  
ATOM 1622 H HA   . LYS A 1 28 ? 14.329  -0.284  -6.465  1.00 0.00 ? 28 LYS A HA   3  
ATOM 1623 H HB2  . LYS A 1 28 ? 13.901  2.143   -6.083  1.00 0.00 ? 28 LYS A HB2  3  
ATOM 1624 H HB3  . LYS A 1 28 ? 12.567  1.374   -6.916  1.00 0.00 ? 28 LYS A HB3  3  
ATOM 1625 H HG2  . LYS A 1 28 ? 11.309  1.233   -4.788  1.00 0.00 ? 28 LYS A HG2  3  
ATOM 1626 H HG3  . LYS A 1 28 ? 12.623  2.020   -3.935  1.00 0.00 ? 28 LYS A HG3  3  
ATOM 1627 H HD2  . LYS A 1 28 ? 11.183  3.819   -4.388  1.00 0.00 ? 28 LYS A HD2  3  
ATOM 1628 H HD3  . LYS A 1 28 ? 12.316  3.937   -5.719  1.00 0.00 ? 28 LYS A HD3  3  
ATOM 1629 H HE2  . LYS A 1 28 ? 10.735  2.769   -7.214  1.00 0.00 ? 28 LYS A HE2  3  
ATOM 1630 H HE3  . LYS A 1 28 ? 9.648   2.462   -5.868  1.00 0.00 ? 28 LYS A HE3  3  
ATOM 1631 H HZ1  . LYS A 1 28 ? 10.181  5.198   -5.945  1.00 0.00 ? 28 LYS A HZ1  3  
ATOM 1632 H HZ2  . LYS A 1 28 ? 9.765   4.698   -7.513  1.00 0.00 ? 28 LYS A HZ2  3  
ATOM 1633 H HZ3  . LYS A 1 28 ? 8.711   4.391   -6.217  1.00 0.00 ? 28 LYS A HZ3  3  
ATOM 1634 N N    . GLY A 1 29 ? 13.853  -0.048  -3.228  1.00 0.00 ? 29 GLY A N    3  
ATOM 1635 C CA   . GLY A 1 29 ? 14.583  -0.036  -1.927  1.00 0.00 ? 29 GLY A CA   3  
ATOM 1636 C C    . GLY A 1 29 ? 15.626  -1.164  -1.922  1.00 0.00 ? 29 GLY A C    3  
ATOM 1637 O O    . GLY A 1 29 ? 16.801  -0.917  -1.738  1.00 0.00 ? 29 GLY A O    3  
ATOM 1638 H H    . GLY A 1 29 ? 12.879  -0.133  -3.217  1.00 0.00 ? 29 GLY A H    3  
ATOM 1639 H HA2  . GLY A 1 29 ? 15.075  0.918   -1.796  1.00 0.00 ? 29 GLY A HA2  3  
ATOM 1640 H HA3  . GLY A 1 29 ? 13.879  -0.198  -1.124  1.00 0.00 ? 29 GLY A HA3  3  
ATOM 1641 N N    . ALA A 1 30 ? 15.170  -2.376  -2.137  1.00 0.00 ? 30 ALA A N    3  
ATOM 1642 C CA   . ALA A 1 30 ? 16.108  -3.550  -2.152  1.00 0.00 ? 30 ALA A CA   3  
ATOM 1643 C C    . ALA A 1 30 ? 17.235  -3.335  -3.172  1.00 0.00 ? 30 ALA A C    3  
ATOM 1644 O O    . ALA A 1 30 ? 18.396  -3.561  -2.898  1.00 0.00 ? 30 ALA A O    3  
ATOM 1645 C CB   . ALA A 1 30 ? 15.310  -4.811  -2.509  1.00 0.00 ? 30 ALA A CB   3  
ATOM 1646 H H    . ALA A 1 30 ? 14.210  -2.510  -2.291  1.00 0.00 ? 30 ALA A H    3  
ATOM 1647 H HA   . ALA A 1 30 ? 16.554  -3.644  -1.172  1.00 0.00 ? 30 ALA A HA   3  
ATOM 1648 H HB1  . ALA A 1 30 ? 14.523  -4.965  -1.784  1.00 0.00 ? 30 ALA A HB1  3  
ATOM 1649 H HB2  . ALA A 1 30 ? 14.863  -4.708  -3.486  1.00 0.00 ? 30 ALA A HB2  3  
ATOM 1650 H HB3  . ALA A 1 30 ? 15.958  -5.675  -2.508  1.00 0.00 ? 30 ALA A HB3  3  
ATOM 1651 N N    . ILE A 1 31 ? 16.838  -2.895  -4.335  1.00 0.00 ? 31 ILE A N    3  
ATOM 1652 C CA   . ILE A 1 31 ? 17.782  -2.621  -5.451  1.00 0.00 ? 31 ILE A CA   3  
ATOM 1653 C C    . ILE A 1 31 ? 18.884  -1.672  -4.962  1.00 0.00 ? 31 ILE A C    3  
ATOM 1654 O O    . ILE A 1 31 ? 20.055  -1.985  -5.031  1.00 0.00 ? 31 ILE A O    3  
ATOM 1655 C CB   . ILE A 1 31 ? 16.882  -2.049  -6.586  1.00 0.00 ? 31 ILE A CB   3  
ATOM 1656 C CG1  . ILE A 1 31 ? 16.149  -3.243  -7.254  1.00 0.00 ? 31 ILE A CG1  3  
ATOM 1657 C CG2  . ILE A 1 31 ? 17.661  -1.211  -7.614  1.00 0.00 ? 31 ILE A CG2  3  
ATOM 1658 C CD1  . ILE A 1 31 ? 15.127  -2.765  -8.304  1.00 0.00 ? 31 ILE A CD1  3  
ATOM 1659 H H    . ILE A 1 31 ? 15.888  -2.739  -4.496  1.00 0.00 ? 31 ILE A H    3  
ATOM 1660 H HA   . ILE A 1 31 ? 18.256  -3.554  -5.723  1.00 0.00 ? 31 ILE A HA   3  
ATOM 1661 H HB   . ILE A 1 31 ? 16.138  -1.408  -6.142  1.00 0.00 ? 31 ILE A HB   3  
ATOM 1662 H HG12 . ILE A 1 31 ? 16.874  -3.901  -7.703  1.00 0.00 ? 31 ILE A HG12 3  
ATOM 1663 H HG13 . ILE A 1 31 ? 15.622  -3.804  -6.496  1.00 0.00 ? 31 ILE A HG13 3  
ATOM 1664 H HG21 . ILE A 1 31 ? 18.453  -1.792  -8.058  1.00 0.00 ? 31 ILE A HG21 3  
ATOM 1665 H HG22 . ILE A 1 31 ? 16.989  -0.874  -8.390  1.00 0.00 ? 31 ILE A HG22 3  
ATOM 1666 H HG23 . ILE A 1 31 ? 18.075  -0.340  -7.131  1.00 0.00 ? 31 ILE A HG23 3  
ATOM 1667 H HD11 . ILE A 1 31 ? 14.601  -1.889  -7.956  1.00 0.00 ? 31 ILE A HD11 3  
ATOM 1668 H HD12 . ILE A 1 31 ? 15.629  -2.528  -9.231  1.00 0.00 ? 31 ILE A HD12 3  
ATOM 1669 H HD13 . ILE A 1 31 ? 14.406  -3.546  -8.493  1.00 0.00 ? 31 ILE A HD13 3  
ATOM 1670 N N    . ILE A 1 32 ? 18.489  -0.530  -4.468  1.00 0.00 ? 32 ILE A N    3  
ATOM 1671 C CA   . ILE A 1 32 ? 19.489  0.456   -3.962  1.00 0.00 ? 32 ILE A CA   3  
ATOM 1672 C C    . ILE A 1 32 ? 20.357  -0.222  -2.899  1.00 0.00 ? 32 ILE A C    3  
ATOM 1673 O O    . ILE A 1 32 ? 21.553  -0.034  -2.872  1.00 0.00 ? 32 ILE A O    3  
ATOM 1674 C CB   . ILE A 1 32 ? 18.725  1.667   -3.370  1.00 0.00 ? 32 ILE A CB   3  
ATOM 1675 C CG1  . ILE A 1 32 ? 17.897  2.332   -4.506  1.00 0.00 ? 32 ILE A CG1  3  
ATOM 1676 C CG2  . ILE A 1 32 ? 19.733  2.695   -2.798  1.00 0.00 ? 32 ILE A CG2  3  
ATOM 1677 C CD1  . ILE A 1 32 ? 16.733  3.146   -3.912  1.00 0.00 ? 32 ILE A CD1  3  
ATOM 1678 H H    . ILE A 1 32 ? 17.538  -0.319  -4.432  1.00 0.00 ? 32 ILE A H    3  
ATOM 1679 H HA   . ILE A 1 32 ? 20.129  0.743   -4.780  1.00 0.00 ? 32 ILE A HA   3  
ATOM 1680 H HB   . ILE A 1 32 ? 18.069  1.327   -2.582  1.00 0.00 ? 32 ILE A HB   3  
ATOM 1681 H HG12 . ILE A 1 32 ? 18.533  2.973   -5.095  1.00 0.00 ? 32 ILE A HG12 3  
ATOM 1682 H HG13 . ILE A 1 32 ? 17.494  1.579   -5.165  1.00 0.00 ? 32 ILE A HG13 3  
ATOM 1683 H HG21 . ILE A 1 32 ? 20.499  2.918   -3.526  1.00 0.00 ? 32 ILE A HG21 3  
ATOM 1684 H HG22 . ILE A 1 32 ? 19.227  3.613   -2.537  1.00 0.00 ? 32 ILE A HG22 3  
ATOM 1685 H HG23 . ILE A 1 32 ? 20.201  2.300   -1.910  1.00 0.00 ? 32 ILE A HG23 3  
ATOM 1686 H HD11 . ILE A 1 32 ? 16.169  2.545   -3.213  1.00 0.00 ? 32 ILE A HD11 3  
ATOM 1687 H HD12 . ILE A 1 32 ? 17.110  4.018   -3.398  1.00 0.00 ? 32 ILE A HD12 3  
ATOM 1688 H HD13 . ILE A 1 32 ? 16.073  3.470   -4.702  1.00 0.00 ? 32 ILE A HD13 3  
ATOM 1689 N N    . GLY A 1 33 ? 19.726  -1.000  -2.060  1.00 0.00 ? 33 GLY A N    3  
ATOM 1690 C CA   . GLY A 1 33 ? 20.461  -1.718  -0.981  1.00 0.00 ? 33 GLY A CA   3  
ATOM 1691 C C    . GLY A 1 33 ? 21.609  -2.559  -1.547  1.00 0.00 ? 33 GLY A C    3  
ATOM 1692 O O    . GLY A 1 33 ? 22.736  -2.411  -1.116  1.00 0.00 ? 33 GLY A O    3  
ATOM 1693 H H    . GLY A 1 33 ? 18.759  -1.109  -2.139  1.00 0.00 ? 33 GLY A H    3  
ATOM 1694 H HA2  . GLY A 1 33 ? 20.863  -0.991  -0.289  1.00 0.00 ? 33 GLY A HA2  3  
ATOM 1695 H HA3  . GLY A 1 33 ? 19.775  -2.367  -0.459  1.00 0.00 ? 33 GLY A HA3  3  
ATOM 1696 N N    . LEU A 1 34 ? 21.316  -3.410  -2.501  1.00 0.00 ? 34 LEU A N    3  
ATOM 1697 C CA   . LEU A 1 34 ? 22.413  -4.252  -3.076  1.00 0.00 ? 34 LEU A CA   3  
ATOM 1698 C C    . LEU A 1 34 ? 23.500  -3.380  -3.731  1.00 0.00 ? 34 LEU A C    3  
ATOM 1699 O O    . LEU A 1 34 ? 24.674  -3.684  -3.627  1.00 0.00 ? 34 LEU A O    3  
ATOM 1700 C CB   . LEU A 1 34 ? 21.769  -5.266  -4.092  1.00 0.00 ? 34 LEU A CB   3  
ATOM 1701 C CG   . LEU A 1 34 ? 21.580  -4.709  -5.533  1.00 0.00 ? 34 LEU A CG   3  
ATOM 1702 C CD1  . LEU A 1 34 ? 22.801  -5.066  -6.418  1.00 0.00 ? 34 LEU A CD1  3  
ATOM 1703 C CD2  . LEU A 1 34 ? 20.312  -5.332  -6.158  1.00 0.00 ? 34 LEU A CD2  3  
ATOM 1704 H H    . LEU A 1 34 ? 20.391  -3.480  -2.821  1.00 0.00 ? 34 LEU A H    3  
ATOM 1705 H HA   . LEU A 1 34 ? 22.867  -4.799  -2.263  1.00 0.00 ? 34 LEU A HA   3  
ATOM 1706 H HB2  . LEU A 1 34 ? 22.386  -6.153  -4.130  1.00 0.00 ? 34 LEU A HB2  3  
ATOM 1707 H HB3  . LEU A 1 34 ? 20.808  -5.561  -3.695  1.00 0.00 ? 34 LEU A HB3  3  
ATOM 1708 H HG   . LEU A 1 34 ? 21.462  -3.643  -5.501  1.00 0.00 ? 34 LEU A HG   3  
ATOM 1709 H HD11 . LEU A 1 34 ? 22.980  -6.132  -6.405  1.00 0.00 ? 34 LEU A HD11 3  
ATOM 1710 H HD12 . LEU A 1 34 ? 22.619  -4.759  -7.436  1.00 0.00 ? 34 LEU A HD12 3  
ATOM 1711 H HD13 . LEU A 1 34 ? 23.687  -4.562  -6.064  1.00 0.00 ? 34 LEU A HD13 3  
ATOM 1712 H HD21 . LEU A 1 34 ? 19.492  -5.300  -5.457  1.00 0.00 ? 34 LEU A HD21 3  
ATOM 1713 H HD22 . LEU A 1 34 ? 20.030  -4.783  -7.045  1.00 0.00 ? 34 LEU A HD22 3  
ATOM 1714 H HD23 . LEU A 1 34 ? 20.490  -6.362  -6.431  1.00 0.00 ? 34 LEU A HD23 3  
ATOM 1715 N N    . MET A 1 35 ? 23.089  -2.320  -4.386  1.00 0.00 ? 35 MET A N    3  
ATOM 1716 C CA   . MET A 1 35 ? 24.080  -1.413  -5.047  1.00 0.00 ? 35 MET A CA   3  
ATOM 1717 C C    . MET A 1 35 ? 25.025  -0.847  -3.972  1.00 0.00 ? 35 MET A C    3  
ATOM 1718 O O    . MET A 1 35 ? 26.231  -0.942  -4.082  1.00 0.00 ? 35 MET A O    3  
ATOM 1719 C CB   . MET A 1 35 ? 23.318  -0.271  -5.752  1.00 0.00 ? 35 MET A CB   3  
ATOM 1720 C CG   . MET A 1 35 ? 22.532  -0.815  -6.967  1.00 0.00 ? 35 MET A CG   3  
ATOM 1721 S SD   . MET A 1 35 ? 20.919  -0.075  -7.326  1.00 0.00 ? 35 MET A SD   3  
ATOM 1722 C CE   . MET A 1 35 ? 21.418  1.665   -7.367  1.00 0.00 ? 35 MET A CE   3  
ATOM 1723 H H    . MET A 1 35 ? 22.130  -2.123  -4.454  1.00 0.00 ? 35 MET A H    3  
ATOM 1724 H HA   . MET A 1 35 ? 24.658  -1.981  -5.757  1.00 0.00 ? 35 MET A HA   3  
ATOM 1725 H HB2  . MET A 1 35 ? 22.633  0.197   -5.062  1.00 0.00 ? 35 MET A HB2  3  
ATOM 1726 H HB3  . MET A 1 35 ? 24.022  0.477   -6.090  1.00 0.00 ? 35 MET A HB3  3  
ATOM 1727 H HG2  . MET A 1 35 ? 23.148  -0.690  -7.846  1.00 0.00 ? 35 MET A HG2  3  
ATOM 1728 H HG3  . MET A 1 35 ? 22.369  -1.876  -6.841  1.00 0.00 ? 35 MET A HG3  3  
ATOM 1729 H HE1  . MET A 1 35 ? 22.338  1.767   -7.924  1.00 0.00 ? 35 MET A HE1  3  
ATOM 1730 H HE2  . MET A 1 35 ? 20.645  2.247   -7.845  1.00 0.00 ? 35 MET A HE2  3  
ATOM 1731 H HE3  . MET A 1 35 ? 21.564  2.022   -6.359  1.00 0.00 ? 35 MET A HE3  3  
ATOM 1732 N N    . VAL A 1 36 ? 24.415  -0.283  -2.961  1.00 0.00 ? 36 VAL A N    3  
ATOM 1733 C CA   . VAL A 1 36 ? 25.140  0.329   -1.805  1.00 0.00 ? 36 VAL A CA   3  
ATOM 1734 C C    . VAL A 1 36 ? 26.110  -0.686  -1.176  1.00 0.00 ? 36 VAL A C    3  
ATOM 1735 O O    . VAL A 1 36 ? 27.253  -0.356  -0.922  1.00 0.00 ? 36 VAL A O    3  
ATOM 1736 C CB   . VAL A 1 36 ? 24.068  0.807   -0.776  1.00 0.00 ? 36 VAL A CB   3  
ATOM 1737 C CG1  . VAL A 1 36 ? 24.727  1.186   0.573   1.00 0.00 ? 36 VAL A CG1  3  
ATOM 1738 C CG2  . VAL A 1 36 ? 23.347  2.055   -1.340  1.00 0.00 ? 36 VAL A CG2  3  
ATOM 1739 H H    . VAL A 1 36 ? 23.442  -0.261  -2.964  1.00 0.00 ? 36 VAL A H    3  
ATOM 1740 H HA   . VAL A 1 36 ? 25.710  1.173   -2.167  1.00 0.00 ? 36 VAL A HA   3  
ATOM 1741 H HB   . VAL A 1 36 ? 23.339  0.024   -0.610  1.00 0.00 ? 36 VAL A HB   3  
ATOM 1742 H HG11 . VAL A 1 36 ? 25.584  1.824   0.408   1.00 0.00 ? 36 VAL A HG11 3  
ATOM 1743 H HG12 . VAL A 1 36 ? 24.020  1.711   1.200   1.00 0.00 ? 36 VAL A HG12 3  
ATOM 1744 H HG13 . VAL A 1 36 ? 25.050  0.297   1.094   1.00 0.00 ? 36 VAL A HG13 3  
ATOM 1745 H HG21 . VAL A 1 36 ? 23.081  1.907   -2.376  1.00 0.00 ? 36 VAL A HG21 3  
ATOM 1746 H HG22 . VAL A 1 36 ? 22.446  2.244   -0.776  1.00 0.00 ? 36 VAL A HG22 3  
ATOM 1747 H HG23 . VAL A 1 36 ? 23.988  2.922   -1.271  1.00 0.00 ? 36 VAL A HG23 3  
ATOM 1748 N N    . GLY A 1 37 ? 25.617  -1.881  -0.947  1.00 0.00 ? 37 GLY A N    3  
ATOM 1749 C CA   . GLY A 1 37 ? 26.440  -2.978  -0.342  1.00 0.00 ? 37 GLY A CA   3  
ATOM 1750 C C    . GLY A 1 37 ? 27.822  -3.129  -1.000  1.00 0.00 ? 37 GLY A C    3  
ATOM 1751 O O    . GLY A 1 37 ? 28.757  -3.578  -0.367  1.00 0.00 ? 37 GLY A O    3  
ATOM 1752 H H    . GLY A 1 37 ? 24.681  -2.061  -1.167  1.00 0.00 ? 37 GLY A H    3  
ATOM 1753 H HA2  . GLY A 1 37 ? 26.574  -2.770  0.711   1.00 0.00 ? 37 GLY A HA2  3  
ATOM 1754 H HA3  . GLY A 1 37 ? 25.902  -3.908  -0.448  1.00 0.00 ? 37 GLY A HA3  3  
ATOM 1755 N N    . GLY A 1 38 ? 27.905  -2.749  -2.252  1.00 0.00 ? 38 GLY A N    3  
ATOM 1756 C CA   . GLY A 1 38 ? 29.190  -2.843  -3.003  1.00 0.00 ? 38 GLY A CA   3  
ATOM 1757 C C    . GLY A 1 38 ? 29.367  -4.249  -3.565  1.00 0.00 ? 38 GLY A C    3  
ATOM 1758 O O    . GLY A 1 38 ? 30.478  -4.732  -3.679  1.00 0.00 ? 38 GLY A O    3  
ATOM 1759 H H    . GLY A 1 38 ? 27.115  -2.403  -2.713  1.00 0.00 ? 38 GLY A H    3  
ATOM 1760 H HA2  . GLY A 1 38 ? 29.169  -2.137  -3.821  1.00 0.00 ? 38 GLY A HA2  3  
ATOM 1761 H HA3  . GLY A 1 38 ? 30.015  -2.608  -2.347  1.00 0.00 ? 38 GLY A HA3  3  
ATOM 1762 N N    . VAL A 1 39 ? 28.260  -4.865  -3.902  1.00 0.00 ? 39 VAL A N    3  
ATOM 1763 C CA   . VAL A 1 39 ? 28.290  -6.248  -4.466  1.00 0.00 ? 39 VAL A CA   3  
ATOM 1764 C C    . VAL A 1 39 ? 28.548  -6.192  -5.986  1.00 0.00 ? 39 VAL A C    3  
ATOM 1765 O O    . VAL A 1 39 ? 28.212  -7.096  -6.726  1.00 0.00 ? 39 VAL A O    3  
ATOM 1766 C CB   . VAL A 1 39 ? 26.922  -6.946  -4.154  1.00 0.00 ? 39 VAL A CB   3  
ATOM 1767 C CG1  . VAL A 1 39 ? 27.114  -8.481  -4.161  1.00 0.00 ? 39 VAL A CG1  3  
ATOM 1768 C CG2  . VAL A 1 39 ? 26.407  -6.535  -2.749  1.00 0.00 ? 39 VAL A CG2  3  
ATOM 1769 H H    . VAL A 1 39 ? 27.395  -4.426  -3.787  1.00 0.00 ? 39 VAL A H    3  
ATOM 1770 H HA   . VAL A 1 39 ? 29.108  -6.775  -4.006  1.00 0.00 ? 39 VAL A HA   3  
ATOM 1771 H HB   . VAL A 1 39 ? 26.188  -6.672  -4.898  1.00 0.00 ? 39 VAL A HB   3  
ATOM 1772 H HG11 . VAL A 1 39 ? 27.861  -8.770  -3.435  1.00 0.00 ? 39 VAL A HG11 3  
ATOM 1773 H HG12 . VAL A 1 39 ? 26.185  -8.972  -3.914  1.00 0.00 ? 39 VAL A HG12 3  
ATOM 1774 H HG13 . VAL A 1 39 ? 27.431  -8.822  -5.136  1.00 0.00 ? 39 VAL A HG13 3  
ATOM 1775 H HG21 . VAL A 1 39 ? 27.190  -6.650  -2.013  1.00 0.00 ? 39 VAL A HG21 3  
ATOM 1776 H HG22 . VAL A 1 39 ? 26.088  -5.503  -2.755  1.00 0.00 ? 39 VAL A HG22 3  
ATOM 1777 H HG23 . VAL A 1 39 ? 25.566  -7.148  -2.461  1.00 0.00 ? 39 VAL A HG23 3  
ATOM 1778 N N    . VAL A 1 40 ? 29.151  -5.103  -6.390  1.00 0.00 ? 40 VAL A N    3  
ATOM 1779 C CA   . VAL A 1 40 ? 29.486  -4.869  -7.828  1.00 0.00 ? 40 VAL A CA   3  
ATOM 1780 C C    . VAL A 1 40 ? 30.583  -5.856  -8.277  1.00 0.00 ? 40 VAL A C    3  
ATOM 1781 O O    . VAL A 1 40 ? 31.547  -5.976  -7.537  1.00 0.00 ? 40 VAL A O    3  
ATOM 1782 C CB   . VAL A 1 40 ? 29.974  -3.402  -7.990  1.00 0.00 ? 40 VAL A CB   3  
ATOM 1783 C CG1  . VAL A 1 40 ? 30.223  -3.088  -9.484  1.00 0.00 ? 40 VAL A CG1  3  
ATOM 1784 C CG2  . VAL A 1 40 ? 28.902  -2.434  -7.442  1.00 0.00 ? 40 VAL A CG2  3  
ATOM 1785 O OXT  . VAL A 1 40 ? 30.394  -6.435  -9.334  1.00 0.00 ? 40 VAL A OXT  3  
ATOM 1786 H H    . VAL A 1 40 ? 29.386  -4.425  -5.725  1.00 0.00 ? 40 VAL A H    3  
ATOM 1787 H HA   . VAL A 1 40 ? 28.593  -5.029  -8.419  1.00 0.00 ? 40 VAL A HA   3  
ATOM 1788 H HB   . VAL A 1 40 ? 30.892  -3.262  -7.438  1.00 0.00 ? 40 VAL A HB   3  
ATOM 1789 H HG11 . VAL A 1 40 ? 29.355  -3.342  -10.075 1.00 0.00 ? 40 VAL A HG11 3  
ATOM 1790 H HG12 . VAL A 1 40 ? 30.436  -2.036  -9.612  1.00 0.00 ? 40 VAL A HG12 3  
ATOM 1791 H HG13 . VAL A 1 40 ? 31.069  -3.654  -9.847  1.00 0.00 ? 40 VAL A HG13 3  
ATOM 1792 H HG21 . VAL A 1 40 ? 27.943  -2.638  -7.894  1.00 0.00 ? 40 VAL A HG21 3  
ATOM 1793 H HG22 . VAL A 1 40 ? 28.812  -2.546  -6.370  1.00 0.00 ? 40 VAL A HG22 3  
ATOM 1794 H HG23 . VAL A 1 40 ? 29.177  -1.412  -7.656  1.00 0.00 ? 40 VAL A HG23 3  
ATOM 1795 N N    . ASP A 1 1  ? -10.526 -6.198  -19.073 1.00 0.00 ? 1  ASP A N    4  
ATOM 1796 C CA   . ASP A 1 1  ? -11.042 -6.769  -17.794 1.00 0.00 ? 1  ASP A CA   4  
ATOM 1797 C C    . ASP A 1 1  ? -11.422 -8.248  -17.973 1.00 0.00 ? 1  ASP A C    4  
ATOM 1798 O O    . ASP A 1 1  ? -11.437 -8.759  -19.077 1.00 0.00 ? 1  ASP A O    4  
ATOM 1799 C CB   . ASP A 1 1  ? -12.285 -5.970  -17.329 1.00 0.00 ? 1  ASP A CB   4  
ATOM 1800 C CG   . ASP A 1 1  ? -13.440 -6.155  -18.333 1.00 0.00 ? 1  ASP A CG   4  
ATOM 1801 O OD1  . ASP A 1 1  ? -13.400 -5.466  -19.340 1.00 0.00 ? 1  ASP A OD1  4  
ATOM 1802 O OD2  . ASP A 1 1  ? -14.294 -6.974  -18.037 1.00 0.00 ? 1  ASP A OD2  4  
ATOM 1803 H H1   . ASP A 1 1  ? -10.537 -6.930  -19.811 1.00 0.00 ? 1  ASP A H1   4  
ATOM 1804 H H2   . ASP A 1 1  ? -11.131 -5.404  -19.366 1.00 0.00 ? 1  ASP A H2   4  
ATOM 1805 H H3   . ASP A 1 1  ? -9.553  -5.860  -18.934 1.00 0.00 ? 1  ASP A H3   4  
ATOM 1806 H HA   . ASP A 1 1  ? -10.262 -6.700  -17.051 1.00 0.00 ? 1  ASP A HA   4  
ATOM 1807 H HB2  . ASP A 1 1  ? -12.601 -6.309  -16.352 1.00 0.00 ? 1  ASP A HB2  4  
ATOM 1808 H HB3  . ASP A 1 1  ? -12.042 -4.919  -17.262 1.00 0.00 ? 1  ASP A HB3  4  
ATOM 1809 N N    . ALA A 1 2  ? -11.718 -8.879  -16.864 1.00 0.00 ? 2  ALA A N    4  
ATOM 1810 C CA   . ALA A 1 2  ? -12.111 -10.325 -16.860 1.00 0.00 ? 2  ALA A CA   4  
ATOM 1811 C C    . ALA A 1 2  ? -13.468 -10.487 -16.156 1.00 0.00 ? 2  ALA A C    4  
ATOM 1812 O O    . ALA A 1 2  ? -13.726 -11.476 -15.495 1.00 0.00 ? 2  ALA A O    4  
ATOM 1813 C CB   . ALA A 1 2  ? -11.015 -11.115 -16.129 1.00 0.00 ? 2  ALA A CB   4  
ATOM 1814 H H    . ALA A 1 2  ? -11.683 -8.392  -16.015 1.00 0.00 ? 2  ALA A H    4  
ATOM 1815 H HA   . ALA A 1 2  ? -12.211 -10.681 -17.875 1.00 0.00 ? 2  ALA A HA   4  
ATOM 1816 H HB1  . ALA A 1 2  ? -10.059 -10.930 -16.594 1.00 0.00 ? 2  ALA A HB1  4  
ATOM 1817 H HB2  . ALA A 1 2  ? -10.965 -10.812 -15.093 1.00 0.00 ? 2  ALA A HB2  4  
ATOM 1818 H HB3  . ALA A 1 2  ? -11.228 -12.172 -16.175 1.00 0.00 ? 2  ALA A HB3  4  
ATOM 1819 N N    . GLU A 1 3  ? -14.293 -9.485  -16.338 1.00 0.00 ? 3  GLU A N    4  
ATOM 1820 C CA   . GLU A 1 3  ? -15.664 -9.450  -15.736 1.00 0.00 ? 3  GLU A CA   4  
ATOM 1821 C C    . GLU A 1 3  ? -15.575 -9.634  -14.208 1.00 0.00 ? 3  GLU A C    4  
ATOM 1822 O O    . GLU A 1 3  ? -15.991 -10.632 -13.651 1.00 0.00 ? 3  GLU A O    4  
ATOM 1823 C CB   . GLU A 1 3  ? -16.523 -10.578 -16.397 1.00 0.00 ? 3  GLU A CB   4  
ATOM 1824 C CG   . GLU A 1 3  ? -18.017 -10.173 -16.418 1.00 0.00 ? 3  GLU A CG   4  
ATOM 1825 C CD   . GLU A 1 3  ? -18.557 -10.048 -14.979 1.00 0.00 ? 3  GLU A CD   4  
ATOM 1826 O OE1  . GLU A 1 3  ? -18.886 -11.087 -14.430 1.00 0.00 ? 3  GLU A OE1  4  
ATOM 1827 O OE2  . GLU A 1 3  ? -18.607 -8.923  -14.508 1.00 0.00 ? 3  GLU A OE2  4  
ATOM 1828 H H    . GLU A 1 3  ? -13.992 -8.734  -16.890 1.00 0.00 ? 3  GLU A H    4  
ATOM 1829 H HA   . GLU A 1 3  ? -16.094 -8.480  -15.941 1.00 0.00 ? 3  GLU A HA   4  
ATOM 1830 H HB2  . GLU A 1 3  ? -16.195 -10.724 -17.416 1.00 0.00 ? 3  GLU A HB2  4  
ATOM 1831 H HB3  . GLU A 1 3  ? -16.404 -11.515 -15.872 1.00 0.00 ? 3  GLU A HB3  4  
ATOM 1832 H HG2  . GLU A 1 3  ? -18.143 -9.230  -16.930 1.00 0.00 ? 3  GLU A HG2  4  
ATOM 1833 H HG3  . GLU A 1 3  ? -18.590 -10.925 -16.942 1.00 0.00 ? 3  GLU A HG3  4  
ATOM 1834 N N    . PHE A 1 4  ? -15.016 -8.629  -13.584 1.00 0.00 ? 4  PHE A N    4  
ATOM 1835 C CA   . PHE A 1 4  ? -14.844 -8.634  -12.101 1.00 0.00 ? 4  PHE A CA   4  
ATOM 1836 C C    . PHE A 1 4  ? -14.577 -7.190  -11.653 1.00 0.00 ? 4  PHE A C    4  
ATOM 1837 O O    . PHE A 1 4  ? -13.451 -6.731  -11.645 1.00 0.00 ? 4  PHE A O    4  
ATOM 1838 C CB   . PHE A 1 4  ? -13.655 -9.561  -11.746 1.00 0.00 ? 4  PHE A CB   4  
ATOM 1839 C CG   . PHE A 1 4  ? -13.489 -9.648  -10.219 1.00 0.00 ? 4  PHE A CG   4  
ATOM 1840 C CD1  . PHE A 1 4  ? -14.338 -10.438 -9.464  1.00 0.00 ? 4  PHE A CD1  4  
ATOM 1841 C CD2  . PHE A 1 4  ? -12.488 -8.938  -9.581  1.00 0.00 ? 4  PHE A CD2  4  
ATOM 1842 C CE1  . PHE A 1 4  ? -14.187 -10.515 -8.094  1.00 0.00 ? 4  PHE A CE1  4  
ATOM 1843 C CE2  . PHE A 1 4  ? -12.337 -9.014  -8.213  1.00 0.00 ? 4  PHE A CE2  4  
ATOM 1844 C CZ   . PHE A 1 4  ? -13.188 -9.803  -7.469  1.00 0.00 ? 4  PHE A CZ   4  
ATOM 1845 H H    . PHE A 1 4  ? -14.703 -7.858  -14.099 1.00 0.00 ? 4  PHE A H    4  
ATOM 1846 H HA   . PHE A 1 4  ? -15.755 -8.987  -11.639 1.00 0.00 ? 4  PHE A HA   4  
ATOM 1847 H HB2  . PHE A 1 4  ? -13.832 -10.555 -12.129 1.00 0.00 ? 4  PHE A HB2  4  
ATOM 1848 H HB3  . PHE A 1 4  ? -12.742 -9.182  -12.182 1.00 0.00 ? 4  PHE A HB3  4  
ATOM 1849 H HD1  . PHE A 1 4  ? -15.125 -10.999 -9.946  1.00 0.00 ? 4  PHE A HD1  4  
ATOM 1850 H HD2  . PHE A 1 4  ? -11.817 -8.318  -10.157 1.00 0.00 ? 4  PHE A HD2  4  
ATOM 1851 H HE1  . PHE A 1 4  ? -14.854 -11.133 -7.512  1.00 0.00 ? 4  PHE A HE1  4  
ATOM 1852 H HE2  . PHE A 1 4  ? -11.553 -8.456  -7.724  1.00 0.00 ? 4  PHE A HE2  4  
ATOM 1853 H HZ   . PHE A 1 4  ? -13.069 -9.864  -6.396  1.00 0.00 ? 4  PHE A HZ   4  
ATOM 1854 N N    . ARG A 1 5  ? -15.642 -6.518  -11.299 1.00 0.00 ? 5  ARG A N    4  
ATOM 1855 C CA   . ARG A 1 5  ? -15.538 -5.096  -10.839 1.00 0.00 ? 5  ARG A CA   4  
ATOM 1856 C C    . ARG A 1 5  ? -16.746 -4.721  -9.964  1.00 0.00 ? 5  ARG A C    4  
ATOM 1857 O O    . ARG A 1 5  ? -17.143 -3.573  -9.888  1.00 0.00 ? 5  ARG A O    4  
ATOM 1858 C CB   . ARG A 1 5  ? -15.455 -4.188  -12.103 1.00 0.00 ? 5  ARG A CB   4  
ATOM 1859 C CG   . ARG A 1 5  ? -14.219 -3.270  -11.998 1.00 0.00 ? 5  ARG A CG   4  
ATOM 1860 C CD   . ARG A 1 5  ? -14.188 -2.306  -13.196 1.00 0.00 ? 5  ARG A CD   4  
ATOM 1861 N NE   . ARG A 1 5  ? -15.298 -1.315  -13.031 1.00 0.00 ? 5  ARG A NE   4  
ATOM 1862 C CZ   . ARG A 1 5  ? -15.558 -0.416  -13.949 1.00 0.00 ? 5  ARG A CZ   4  
ATOM 1863 N NH1  . ARG A 1 5  ? -14.849 -0.361  -15.046 1.00 0.00 ? 5  ARG A NH1  4  
ATOM 1864 N NH2  . ARG A 1 5  ? -16.540 0.413   -13.731 1.00 0.00 ? 5  ARG A NH2  4  
ATOM 1865 H H    . ARG A 1 5  ? -16.518 -6.955  -11.336 1.00 0.00 ? 5  ARG A H    4  
ATOM 1866 H HA   . ARG A 1 5  ? -14.656 -5.004  -10.225 1.00 0.00 ? 5  ARG A HA   4  
ATOM 1867 H HB2  . ARG A 1 5  ? -15.361 -4.800  -12.990 1.00 0.00 ? 5  ARG A HB2  4  
ATOM 1868 H HB3  . ARG A 1 5  ? -16.348 -3.589  -12.207 1.00 0.00 ? 5  ARG A HB3  4  
ATOM 1869 H HG2  . ARG A 1 5  ? -14.258 -2.707  -11.077 1.00 0.00 ? 5  ARG A HG2  4  
ATOM 1870 H HG3  . ARG A 1 5  ? -13.321 -3.870  -11.997 1.00 0.00 ? 5  ARG A HG3  4  
ATOM 1871 H HD2  . ARG A 1 5  ? -13.247 -1.778  -13.226 1.00 0.00 ? 5  ARG A HD2  4  
ATOM 1872 H HD3  . ARG A 1 5  ? -14.326 -2.844  -14.123 1.00 0.00 ? 5  ARG A HD3  4  
ATOM 1873 H HE   . ARG A 1 5  ? -15.842 -1.338  -12.216 1.00 0.00 ? 5  ARG A HE   4  
ATOM 1874 H HH11 . ARG A 1 5  ? -14.100 -1.006  -15.194 1.00 0.00 ? 5  ARG A HH11 4  
ATOM 1875 H HH12 . ARG A 1 5  ? -15.056 0.329   -15.739 1.00 0.00 ? 5  ARG A HH12 4  
ATOM 1876 H HH21 . ARG A 1 5  ? -17.068 0.351   -12.885 1.00 0.00 ? 5  ARG A HH21 4  
ATOM 1877 H HH22 . ARG A 1 5  ? -16.765 1.112   -14.412 1.00 0.00 ? 5  ARG A HH22 4  
ATOM 1878 N N    . HIS A 1 6  ? -17.287 -5.725  -9.324  1.00 0.00 ? 6  HIS A N    4  
ATOM 1879 C CA   . HIS A 1 6  ? -18.469 -5.543  -8.429  1.00 0.00 ? 6  HIS A CA   4  
ATOM 1880 C C    . HIS A 1 6  ? -18.561 -6.756  -7.489  1.00 0.00 ? 6  HIS A C    4  
ATOM 1881 O O    . HIS A 1 6  ? -19.603 -7.360  -7.318  1.00 0.00 ? 6  HIS A O    4  
ATOM 1882 C CB   . HIS A 1 6  ? -19.739 -5.415  -9.312  1.00 0.00 ? 6  HIS A CB   4  
ATOM 1883 C CG   . HIS A 1 6  ? -20.837 -4.683  -8.530  1.00 0.00 ? 6  HIS A CG   4  
ATOM 1884 N ND1  . HIS A 1 6  ? -21.249 -4.997  -7.345  1.00 0.00 ? 6  HIS A ND1  4  
ATOM 1885 C CD2  . HIS A 1 6  ? -21.604 -3.583  -8.875  1.00 0.00 ? 6  HIS A CD2  4  
ATOM 1886 C CE1  . HIS A 1 6  ? -22.182 -4.181  -6.976  1.00 0.00 ? 6  HIS A CE1  4  
ATOM 1887 N NE2  . HIS A 1 6  ? -22.436 -3.284  -7.896  1.00 0.00 ? 6  HIS A NE2  4  
ATOM 1888 H H    . HIS A 1 6  ? -16.904 -6.617  -9.434  1.00 0.00 ? 6  HIS A H    4  
ATOM 1889 H HA   . HIS A 1 6  ? -18.311 -4.658  -7.831  1.00 0.00 ? 6  HIS A HA   4  
ATOM 1890 H HB2  . HIS A 1 6  ? -19.520 -4.848  -10.205 1.00 0.00 ? 6  HIS A HB2  4  
ATOM 1891 H HB3  . HIS A 1 6  ? -20.107 -6.388  -9.603  1.00 0.00 ? 6  HIS A HB3  4  
ATOM 1892 H HD1  . HIS A 1 6  ? -20.906 -5.742  -6.808  1.00 0.00 ? 6  HIS A HD1  4  
ATOM 1893 H HD2  . HIS A 1 6  ? -21.532 -3.048  -9.810  1.00 0.00 ? 6  HIS A HD2  4  
ATOM 1894 H HE1  . HIS A 1 6  ? -22.690 -4.232  -6.023  1.00 0.00 ? 6  HIS A HE1  4  
ATOM 1895 N N    . ASP A 1 7  ? -17.434 -7.069  -6.902  1.00 0.00 ? 7  ASP A N    4  
ATOM 1896 C CA   . ASP A 1 7  ? -17.338 -8.215  -5.959  1.00 0.00 ? 7  ASP A CA   4  
ATOM 1897 C C    . ASP A 1 7  ? -18.181 -7.978  -4.698  1.00 0.00 ? 7  ASP A C    4  
ATOM 1898 O O    . ASP A 1 7  ? -18.213 -6.880  -4.177  1.00 0.00 ? 7  ASP A O    4  
ATOM 1899 C CB   . ASP A 1 7  ? -15.859 -8.396  -5.596  1.00 0.00 ? 7  ASP A CB   4  
ATOM 1900 C CG   . ASP A 1 7  ? -15.318 -7.141  -4.882  1.00 0.00 ? 7  ASP A CG   4  
ATOM 1901 O OD1  . ASP A 1 7  ? -14.894 -6.253  -5.604  1.00 0.00 ? 7  ASP A OD1  4  
ATOM 1902 O OD2  . ASP A 1 7  ? -15.361 -7.139  -3.661  1.00 0.00 ? 7  ASP A OD2  4  
ATOM 1903 H H    . ASP A 1 7  ? -16.626 -6.547  -7.077  1.00 0.00 ? 7  ASP A H    4  
ATOM 1904 H HA   . ASP A 1 7  ? -17.696 -9.102  -6.462  1.00 0.00 ? 7  ASP A HA   4  
ATOM 1905 H HB2  . ASP A 1 7  ? -15.740 -9.252  -4.955  1.00 0.00 ? 7  ASP A HB2  4  
ATOM 1906 H HB3  . ASP A 1 7  ? -15.288 -8.558  -6.498  1.00 0.00 ? 7  ASP A HB3  4  
ATOM 1907 N N    . SER A 1 8  ? -18.832 -9.024  -4.252  1.00 0.00 ? 8  SER A N    4  
ATOM 1908 C CA   . SER A 1 8  ? -19.689 -8.938  -3.033  1.00 0.00 ? 8  SER A CA   4  
ATOM 1909 C C    . SER A 1 8  ? -18.788 -8.773  -1.793  1.00 0.00 ? 8  SER A C    4  
ATOM 1910 O O    . SER A 1 8  ? -18.485 -9.723  -1.095  1.00 0.00 ? 8  SER A O    4  
ATOM 1911 C CB   . SER A 1 8  ? -20.531 -10.230 -2.952  1.00 0.00 ? 8  SER A CB   4  
ATOM 1912 O OG   . SER A 1 8  ? -21.398 -10.012 -1.848  1.00 0.00 ? 8  SER A OG   4  
ATOM 1913 H H    . SER A 1 8  ? -18.759 -9.877  -4.726  1.00 0.00 ? 8  SER A H    4  
ATOM 1914 H HA   . SER A 1 8  ? -20.335 -8.077  -3.125  1.00 0.00 ? 8  SER A HA   4  
ATOM 1915 H HB2  . SER A 1 8  ? -21.121 -10.373 -3.846  1.00 0.00 ? 8  SER A HB2  4  
ATOM 1916 H HB3  . SER A 1 8  ? -19.920 -11.101 -2.769  1.00 0.00 ? 8  SER A HB3  4  
ATOM 1917 H HG   . SER A 1 8  ? -21.215 -10.686 -1.189  1.00 0.00 ? 8  SER A HG   4  
ATOM 1918 N N    . GLY A 1 9  ? -18.389 -7.547  -1.572  1.00 0.00 ? 9  GLY A N    4  
ATOM 1919 C CA   . GLY A 1 9  ? -17.509 -7.208  -0.414  1.00 0.00 ? 9  GLY A CA   4  
ATOM 1920 C C    . GLY A 1 9  ? -16.697 -5.937  -0.696  1.00 0.00 ? 9  GLY A C    4  
ATOM 1921 O O    . GLY A 1 9  ? -15.975 -5.480  0.169   1.00 0.00 ? 9  GLY A O    4  
ATOM 1922 H H    . GLY A 1 9  ? -18.675 -6.834  -2.178  1.00 0.00 ? 9  GLY A H    4  
ATOM 1923 H HA2  . GLY A 1 9  ? -18.124 -7.047  0.458   1.00 0.00 ? 9  GLY A HA2  4  
ATOM 1924 H HA3  . GLY A 1 9  ? -16.825 -8.023  -0.229  1.00 0.00 ? 9  GLY A HA3  4  
ATOM 1925 N N    . TYR A 1 10 ? -16.829 -5.402  -1.889  1.00 0.00 ? 10 TYR A N    4  
ATOM 1926 C CA   . TYR A 1 10 ? -16.082 -4.161  -2.263  1.00 0.00 ? 10 TYR A CA   4  
ATOM 1927 C C    . TYR A 1 10 ? -16.377 -3.023  -1.276  1.00 0.00 ? 10 TYR A C    4  
ATOM 1928 O O    . TYR A 1 10 ? -17.493 -2.860  -0.822  1.00 0.00 ? 10 TYR A O    4  
ATOM 1929 C CB   . TYR A 1 10 ? -16.491 -3.723  -3.685  1.00 0.00 ? 10 TYR A CB   4  
ATOM 1930 C CG   . TYR A 1 10 ? -15.609 -2.537  -4.130  1.00 0.00 ? 10 TYR A CG   4  
ATOM 1931 C CD1  . TYR A 1 10 ? -15.955 -1.238  -3.795  1.00 0.00 ? 10 TYR A CD1  4  
ATOM 1932 C CD2  . TYR A 1 10 ? -14.460 -2.747  -4.867  1.00 0.00 ? 10 TYR A CD2  4  
ATOM 1933 C CE1  . TYR A 1 10 ? -15.168 -0.177  -4.189  1.00 0.00 ? 10 TYR A CE1  4  
ATOM 1934 C CE2  . TYR A 1 10 ? -13.674 -1.684  -5.260  1.00 0.00 ? 10 TYR A CE2  4  
ATOM 1935 C CZ   . TYR A 1 10 ? -14.022 -0.392  -4.924  1.00 0.00 ? 10 TYR A CZ   4  
ATOM 1936 O OH   . TYR A 1 10 ? -13.234 0.671   -5.316  1.00 0.00 ? 10 TYR A OH   4  
ATOM 1937 H H    . TYR A 1 10 ? -17.418 -5.817  -2.552  1.00 0.00 ? 10 TYR A H    4  
ATOM 1938 H HA   . TYR A 1 10 ? -15.023 -4.383  -2.240  1.00 0.00 ? 10 TYR A HA   4  
ATOM 1939 H HB2  . TYR A 1 10 ? -16.366 -4.538  -4.380  1.00 0.00 ? 10 TYR A HB2  4  
ATOM 1940 H HB3  . TYR A 1 10 ? -17.527 -3.416  -3.698  1.00 0.00 ? 10 TYR A HB3  4  
ATOM 1941 H HD1  . TYR A 1 10 ? -16.848 -1.048  -3.219  1.00 0.00 ? 10 TYR A HD1  4  
ATOM 1942 H HD2  . TYR A 1 10 ? -14.168 -3.750  -5.139  1.00 0.00 ? 10 TYR A HD2  4  
ATOM 1943 H HE1  . TYR A 1 10 ? -15.452 0.830   -3.918  1.00 0.00 ? 10 TYR A HE1  4  
ATOM 1944 H HE2  . TYR A 1 10 ? -12.779 -1.864  -5.836  1.00 0.00 ? 10 TYR A HE2  4  
ATOM 1945 H HH   . TYR A 1 10 ? -12.819 1.039   -4.532  1.00 0.00 ? 10 TYR A HH   4  
ATOM 1946 N N    . GLU A 1 11 ? -15.343 -2.278  -0.989  1.00 0.00 ? 11 GLU A N    4  
ATOM 1947 C CA   . GLU A 1 11 ? -15.447 -1.124  -0.045  1.00 0.00 ? 11 GLU A CA   4  
ATOM 1948 C C    . GLU A 1 11 ? -14.201 -0.232  -0.149  1.00 0.00 ? 11 GLU A C    4  
ATOM 1949 O O    . GLU A 1 11 ? -14.147 0.819   0.460   1.00 0.00 ? 11 GLU A O    4  
ATOM 1950 C CB   . GLU A 1 11 ? -15.593 -1.662  1.403   1.00 0.00 ? 11 GLU A CB   4  
ATOM 1951 C CG   . GLU A 1 11 ? -14.446 -2.646  1.742   1.00 0.00 ? 11 GLU A CG   4  
ATOM 1952 C CD   . GLU A 1 11 ? -14.824 -3.445  3.000   1.00 0.00 ? 11 GLU A CD   4  
ATOM 1953 O OE1  . GLU A 1 11 ? -15.476 -4.463  2.822   1.00 0.00 ? 11 GLU A OE1  4  
ATOM 1954 O OE2  . GLU A 1 11 ? -14.443 -2.995  4.068   1.00 0.00 ? 11 GLU A OE2  4  
ATOM 1955 H H    . GLU A 1 11 ? -14.480 -2.483  -1.403  1.00 0.00 ? 11 GLU A H    4  
ATOM 1956 H HA   . GLU A 1 11 ? -16.313 -0.534  -0.310  1.00 0.00 ? 11 GLU A HA   4  
ATOM 1957 H HB2  . GLU A 1 11 ? -15.574 -0.837  2.101   1.00 0.00 ? 11 GLU A HB2  4  
ATOM 1958 H HB3  . GLU A 1 11 ? -16.545 -2.163  1.503   1.00 0.00 ? 11 GLU A HB3  4  
ATOM 1959 H HG2  . GLU A 1 11 ? -14.272 -3.336  0.929   1.00 0.00 ? 11 GLU A HG2  4  
ATOM 1960 H HG3  . GLU A 1 11 ? -13.532 -2.099  1.930   1.00 0.00 ? 11 GLU A HG3  4  
ATOM 1961 N N    . VAL A 1 12 ? -13.238 -0.676  -0.919  1.00 0.00 ? 12 VAL A N    4  
ATOM 1962 C CA   . VAL A 1 12 ? -11.980 0.096   -1.101  1.00 0.00 ? 12 VAL A CA   4  
ATOM 1963 C C    . VAL A 1 12 ? -12.180 1.318   -2.003  1.00 0.00 ? 12 VAL A C    4  
ATOM 1964 O O    . VAL A 1 12 ? -13.265 1.607   -2.471  1.00 0.00 ? 12 VAL A O    4  
ATOM 1965 C CB   . VAL A 1 12 ? -10.885 -0.838  -1.713  1.00 0.00 ? 12 VAL A CB   4  
ATOM 1966 C CG1  . VAL A 1 12 ? -10.509 -1.949  -0.717  1.00 0.00 ? 12 VAL A CG1  4  
ATOM 1967 C CG2  . VAL A 1 12 ? -11.365 -1.477  -3.032  1.00 0.00 ? 12 VAL A CG2  4  
ATOM 1968 H H    . VAL A 1 12 ? -13.329 -1.524  -1.391  1.00 0.00 ? 12 VAL A H    4  
ATOM 1969 H HA   . VAL A 1 12 ? -11.653 0.441   -0.133  1.00 0.00 ? 12 VAL A HA   4  
ATOM 1970 H HB   . VAL A 1 12 ? -10.002 -0.256  -1.921  1.00 0.00 ? 12 VAL A HB   4  
ATOM 1971 H HG11 . VAL A 1 12 ? -10.157 -1.513  0.206   1.00 0.00 ? 12 VAL A HG11 4  
ATOM 1972 H HG12 . VAL A 1 12 ? -11.363 -2.575  -0.508  1.00 0.00 ? 12 VAL A HG12 4  
ATOM 1973 H HG13 . VAL A 1 12 ? -9.720  -2.561  -1.130  1.00 0.00 ? 12 VAL A HG13 4  
ATOM 1974 H HG21 . VAL A 1 12 ? -12.255 -2.070  -2.873  1.00 0.00 ? 12 VAL A HG21 4  
ATOM 1975 H HG22 . VAL A 1 12 ? -11.581 -0.706  -3.756  1.00 0.00 ? 12 VAL A HG22 4  
ATOM 1976 H HG23 . VAL A 1 12 ? -10.594 -2.116  -3.436  1.00 0.00 ? 12 VAL A HG23 4  
ATOM 1977 N N    . HIS A 1 13 ? -11.078 1.986   -2.195  1.00 0.00 ? 13 HIS A N    4  
ATOM 1978 C CA   . HIS A 1 13 ? -11.010 3.214   -3.036  1.00 0.00 ? 13 HIS A CA   4  
ATOM 1979 C C    . HIS A 1 13 ? -9.576  3.279   -3.570  1.00 0.00 ? 13 HIS A C    4  
ATOM 1980 O O    . HIS A 1 13 ? -8.690  3.846   -2.959  1.00 0.00 ? 13 HIS A O    4  
ATOM 1981 C CB   . HIS A 1 13 ? -11.340 4.440   -2.159  1.00 0.00 ? 13 HIS A CB   4  
ATOM 1982 C CG   . HIS A 1 13 ? -11.287 5.716   -3.003  1.00 0.00 ? 13 HIS A CG   4  
ATOM 1983 N ND1  . HIS A 1 13 ? -10.298 6.547   -3.027  1.00 0.00 ? 13 HIS A ND1  4  
ATOM 1984 C CD2  . HIS A 1 13 ? -12.212 6.258   -3.878  1.00 0.00 ? 13 HIS A CD2  4  
ATOM 1985 C CE1  . HIS A 1 13 ? -10.569 7.521   -3.835  1.00 0.00 ? 13 HIS A CE1  4  
ATOM 1986 N NE2  . HIS A 1 13 ? -11.750 7.382   -4.387  1.00 0.00 ? 13 HIS A NE2  4  
ATOM 1987 H H    . HIS A 1 13 ? -10.271 1.647   -1.761  1.00 0.00 ? 13 HIS A H    4  
ATOM 1988 H HA   . HIS A 1 13 ? -11.700 3.127   -3.864  1.00 0.00 ? 13 HIS A HA   4  
ATOM 1989 H HB2  . HIS A 1 13 ? -12.335 4.343   -1.752  1.00 0.00 ? 13 HIS A HB2  4  
ATOM 1990 H HB3  . HIS A 1 13 ? -10.631 4.529   -1.350  1.00 0.00 ? 13 HIS A HB3  4  
ATOM 1991 H HD1  . HIS A 1 13 ? -9.469  6.453   -2.511  1.00 0.00 ? 13 HIS A HD1  4  
ATOM 1992 H HD2  . HIS A 1 13 ? -13.173 5.823   -4.109  1.00 0.00 ? 13 HIS A HD2  4  
ATOM 1993 H HE1  . HIS A 1 13 ? -9.902  8.348   -4.032  1.00 0.00 ? 13 HIS A HE1  4  
ATOM 1994 N N    . HIS A 1 14 ? -9.416  2.671   -4.717  1.00 0.00 ? 14 HIS A N    4  
ATOM 1995 C CA   . HIS A 1 14 ? -8.104  2.604   -5.427  1.00 0.00 ? 14 HIS A CA   4  
ATOM 1996 C C    . HIS A 1 14 ? -7.011  1.948   -4.569  1.00 0.00 ? 14 HIS A C    4  
ATOM 1997 O O    . HIS A 1 14 ? -5.831  2.210   -4.718  1.00 0.00 ? 14 HIS A O    4  
ATOM 1998 C CB   . HIS A 1 14 ? -7.706  4.037   -5.826  1.00 0.00 ? 14 HIS A CB   4  
ATOM 1999 C CG   . HIS A 1 14 ? -8.917  4.792   -6.393  1.00 0.00 ? 14 HIS A CG   4  
ATOM 2000 N ND1  . HIS A 1 14 ? -9.161  6.046   -6.200  1.00 0.00 ? 14 HIS A ND1  4  
ATOM 2001 C CD2  . HIS A 1 14 ? -9.969  4.359   -7.184  1.00 0.00 ? 14 HIS A CD2  4  
ATOM 2002 C CE1  . HIS A 1 14 ? -10.255 6.375   -6.807  1.00 0.00 ? 14 HIS A CE1  4  
ATOM 2003 N NE2  . HIS A 1 14 ? -10.792 5.358   -7.432  1.00 0.00 ? 14 HIS A NE2  4  
ATOM 2004 H H    . HIS A 1 14 ? -10.187 2.244   -5.132  1.00 0.00 ? 14 HIS A H    4  
ATOM 2005 H HA   . HIS A 1 14 ? -8.237  1.992   -6.305  1.00 0.00 ? 14 HIS A HA   4  
ATOM 2006 H HB2  . HIS A 1 14 ? -7.367  4.553   -4.946  1.00 0.00 ? 14 HIS A HB2  4  
ATOM 2007 H HB3  . HIS A 1 14 ? -6.922  4.023   -6.568  1.00 0.00 ? 14 HIS A HB3  4  
ATOM 2008 H HD1  . HIS A 1 14 ? -8.602  6.654   -5.674  1.00 0.00 ? 14 HIS A HD1  4  
ATOM 2009 H HD2  . HIS A 1 14 ? -10.096 3.349   -7.542  1.00 0.00 ? 14 HIS A HD2  4  
ATOM 2010 H HE1  . HIS A 1 14 ? -10.675 7.369   -6.795  1.00 0.00 ? 14 HIS A HE1  4  
ATOM 2011 N N    . GLN A 1 15 ? -7.448  1.091   -3.679  1.00 0.00 ? 15 GLN A N    4  
ATOM 2012 C CA   . GLN A 1 15 ? -6.501  0.368   -2.772  1.00 0.00 ? 15 GLN A CA   4  
ATOM 2013 C C    . GLN A 1 15 ? -5.489  -0.360  -3.664  1.00 0.00 ? 15 GLN A C    4  
ATOM 2014 O O    . GLN A 1 15 ? -4.326  -0.475  -3.337  1.00 0.00 ? 15 GLN A O    4  
ATOM 2015 C CB   . GLN A 1 15 ? -7.317  -0.621  -1.917  1.00 0.00 ? 15 GLN A CB   4  
ATOM 2016 C CG   . GLN A 1 15 ? -6.395  -1.581  -1.136  1.00 0.00 ? 15 GLN A CG   4  
ATOM 2017 C CD   . GLN A 1 15 ? -6.294  -2.922  -1.880  1.00 0.00 ? 15 GLN A CD   4  
ATOM 2018 O OE1  . GLN A 1 15 ? -7.178  -3.753  -1.805  1.00 0.00 ? 15 GLN A OE1  4  
ATOM 2019 N NE2  . GLN A 1 15 ? -5.239  -3.173  -2.605  1.00 0.00 ? 15 GLN A NE2  4  
ATOM 2020 H H    . GLN A 1 15 ? -8.409  0.922   -3.609  1.00 0.00 ? 15 GLN A H    4  
ATOM 2021 H HA   . GLN A 1 15 ? -5.977  1.084   -2.156  1.00 0.00 ? 15 GLN A HA   4  
ATOM 2022 H HB2  . GLN A 1 15 ? -7.907  -0.058  -1.208  1.00 0.00 ? 15 GLN A HB2  4  
ATOM 2023 H HB3  . GLN A 1 15 ? -7.992  -1.179  -2.552  1.00 0.00 ? 15 GLN A HB3  4  
ATOM 2024 H HG2  . GLN A 1 15 ? -5.407  -1.158  -1.027  1.00 0.00 ? 15 GLN A HG2  4  
ATOM 2025 H HG3  . GLN A 1 15 ? -6.809  -1.760  -0.155  1.00 0.00 ? 15 GLN A HG3  4  
ATOM 2026 H HE21 . GLN A 1 15 ? -4.521  -2.509  -2.671  1.00 0.00 ? 15 GLN A HE21 4  
ATOM 2027 H HE22 . GLN A 1 15 ? -5.164  -4.025  -3.083  1.00 0.00 ? 15 GLN A HE22 4  
ATOM 2028 N N    . LYS A 1 16 ? -5.979  -0.830  -4.779  1.00 0.00 ? 16 LYS A N    4  
ATOM 2029 C CA   . LYS A 1 16 ? -5.119  -1.557  -5.750  1.00 0.00 ? 16 LYS A CA   4  
ATOM 2030 C C    . LYS A 1 16 ? -3.868  -0.740  -6.107  1.00 0.00 ? 16 LYS A C    4  
ATOM 2031 O O    . LYS A 1 16 ? -2.767  -1.247  -6.037  1.00 0.00 ? 16 LYS A O    4  
ATOM 2032 C CB   . LYS A 1 16 ? -5.960  -1.847  -7.019  1.00 0.00 ? 16 LYS A CB   4  
ATOM 2033 C CG   . LYS A 1 16 ? -5.133  -2.613  -8.084  1.00 0.00 ? 16 LYS A CG   4  
ATOM 2034 C CD   . LYS A 1 16 ? -4.493  -3.874  -7.459  1.00 0.00 ? 16 LYS A CD   4  
ATOM 2035 C CE   . LYS A 1 16 ? -4.111  -4.875  -8.563  1.00 0.00 ? 16 LYS A CE   4  
ATOM 2036 N NZ   . LYS A 1 16 ? -5.337  -5.486  -9.152  1.00 0.00 ? 16 LYS A NZ   4  
ATOM 2037 H H    . LYS A 1 16 ? -6.930  -0.705  -4.975  1.00 0.00 ? 16 LYS A H    4  
ATOM 2038 H HA   . LYS A 1 16 ? -4.803  -2.473  -5.286  1.00 0.00 ? 16 LYS A HA   4  
ATOM 2039 H HB2  . LYS A 1 16 ? -6.823  -2.435  -6.746  1.00 0.00 ? 16 LYS A HB2  4  
ATOM 2040 H HB3  . LYS A 1 16 ? -6.307  -0.914  -7.441  1.00 0.00 ? 16 LYS A HB3  4  
ATOM 2041 H HG2  . LYS A 1 16 ? -5.788  -2.893  -8.897  1.00 0.00 ? 16 LYS A HG2  4  
ATOM 2042 H HG3  . LYS A 1 16 ? -4.360  -1.970  -8.480  1.00 0.00 ? 16 LYS A HG3  4  
ATOM 2043 H HD2  . LYS A 1 16 ? -3.606  -3.587  -6.911  1.00 0.00 ? 16 LYS A HD2  4  
ATOM 2044 H HD3  . LYS A 1 16 ? -5.187  -4.332  -6.768  1.00 0.00 ? 16 LYS A HD3  4  
ATOM 2045 H HE2  . LYS A 1 16 ? -3.558  -4.382  -9.349  1.00 0.00 ? 16 LYS A HE2  4  
ATOM 2046 H HE3  . LYS A 1 16 ? -3.499  -5.664  -8.148  1.00 0.00 ? 16 LYS A HE3  4  
ATOM 2047 H HZ1  . LYS A 1 16 ? -6.180  -5.096  -8.682  1.00 0.00 ? 16 LYS A HZ1  4  
ATOM 2048 H HZ2  . LYS A 1 16 ? -5.378  -5.271  -10.168 1.00 0.00 ? 16 LYS A HZ2  4  
ATOM 2049 H HZ3  . LYS A 1 16 ? -5.312  -6.516  -9.016  1.00 0.00 ? 16 LYS A HZ3  4  
ATOM 2050 N N    . LEU A 1 17 ? -4.059  0.505   -6.464  1.00 0.00 ? 17 LEU A N    4  
ATOM 2051 C CA   . LEU A 1 17 ? -2.880  1.347   -6.826  1.00 0.00 ? 17 LEU A CA   4  
ATOM 2052 C C    . LEU A 1 17 ? -2.016  1.568   -5.574  1.00 0.00 ? 17 LEU A C    4  
ATOM 2053 O O    . LEU A 1 17 ? -0.809  1.506   -5.647  1.00 0.00 ? 17 LEU A O    4  
ATOM 2054 C CB   . LEU A 1 17 ? -3.420  2.684   -7.452  1.00 0.00 ? 17 LEU A CB   4  
ATOM 2055 C CG   . LEU A 1 17 ? -3.495  3.880   -6.473  1.00 0.00 ? 17 LEU A CG   4  
ATOM 2056 C CD1  . LEU A 1 17 ? -2.065  4.431   -6.158  1.00 0.00 ? 17 LEU A CD1  4  
ATOM 2057 C CD2  . LEU A 1 17 ? -4.315  5.002   -7.144  1.00 0.00 ? 17 LEU A CD2  4  
ATOM 2058 H H    . LEU A 1 17 ? -4.962  0.881   -6.486  1.00 0.00 ? 17 LEU A H    4  
ATOM 2059 H HA   . LEU A 1 17 ? -2.300  0.823   -7.572  1.00 0.00 ? 17 LEU A HA   4  
ATOM 2060 H HB2  . LEU A 1 17 ? -2.788  2.953   -8.286  1.00 0.00 ? 17 LEU A HB2  4  
ATOM 2061 H HB3  . LEU A 1 17 ? -4.410  2.497   -7.844  1.00 0.00 ? 17 LEU A HB3  4  
ATOM 2062 H HG   . LEU A 1 17 ? -3.998  3.552   -5.577  1.00 0.00 ? 17 LEU A HG   4  
ATOM 2063 H HD11 . LEU A 1 17 ? -1.321  3.958   -6.782  1.00 0.00 ? 17 LEU A HD11 4  
ATOM 2064 H HD12 . LEU A 1 17 ? -2.009  5.497   -6.322  1.00 0.00 ? 17 LEU A HD12 4  
ATOM 2065 H HD13 . LEU A 1 17 ? -1.817  4.238   -5.125  1.00 0.00 ? 17 LEU A HD13 4  
ATOM 2066 H HD21 . LEU A 1 17 ? -5.190  4.595   -7.630  1.00 0.00 ? 17 LEU A HD21 4  
ATOM 2067 H HD22 . LEU A 1 17 ? -4.631  5.719   -6.402  1.00 0.00 ? 17 LEU A HD22 4  
ATOM 2068 H HD23 . LEU A 1 17 ? -3.719  5.509   -7.890  1.00 0.00 ? 17 LEU A HD23 4  
ATOM 2069 N N    . VAL A 1 18 ? -2.642  1.818   -4.451  1.00 0.00 ? 18 VAL A N    4  
ATOM 2070 C CA   . VAL A 1 18 ? -1.876  2.041   -3.183  1.00 0.00 ? 18 VAL A CA   4  
ATOM 2071 C C    . VAL A 1 18 ? -0.906  0.848   -2.985  1.00 0.00 ? 18 VAL A C    4  
ATOM 2072 O O    . VAL A 1 18 ? 0.281   1.015   -2.779  1.00 0.00 ? 18 VAL A O    4  
ATOM 2073 C CB   . VAL A 1 18 ? -2.943  2.174   -2.061  1.00 0.00 ? 18 VAL A CB   4  
ATOM 2074 C CG1  . VAL A 1 18 ? -2.327  2.046   -0.670  1.00 0.00 ? 18 VAL A CG1  4  
ATOM 2075 C CG2  . VAL A 1 18 ? -3.642  3.548   -2.191  1.00 0.00 ? 18 VAL A CG2  4  
ATOM 2076 H H    . VAL A 1 18 ? -3.619  1.868   -4.438  1.00 0.00 ? 18 VAL A H    4  
ATOM 2077 H HA   . VAL A 1 18 ? -1.293  2.949   -3.279  1.00 0.00 ? 18 VAL A HA   4  
ATOM 2078 H HB   . VAL A 1 18 ? -3.689  1.405   -2.171  1.00 0.00 ? 18 VAL A HB   4  
ATOM 2079 H HG11 . VAL A 1 18 ? -1.356  2.515   -0.643  1.00 0.00 ? 18 VAL A HG11 4  
ATOM 2080 H HG12 . VAL A 1 18 ? -2.972  2.510   0.061   1.00 0.00 ? 18 VAL A HG12 4  
ATOM 2081 H HG13 . VAL A 1 18 ? -2.230  1.000   -0.427  1.00 0.00 ? 18 VAL A HG13 4  
ATOM 2082 H HG21 . VAL A 1 18 ? -4.084  3.651   -3.171  1.00 0.00 ? 18 VAL A HG21 4  
ATOM 2083 H HG22 . VAL A 1 18 ? -4.424  3.636   -1.451  1.00 0.00 ? 18 VAL A HG22 4  
ATOM 2084 H HG23 . VAL A 1 18 ? -2.931  4.348   -2.044  1.00 0.00 ? 18 VAL A HG23 4  
ATOM 2085 N N    . PHE A 1 19 ? -1.458  -0.335  -3.069  1.00 0.00 ? 19 PHE A N    4  
ATOM 2086 C CA   . PHE A 1 19 ? -0.671  -1.596  -2.908  1.00 0.00 ? 19 PHE A CA   4  
ATOM 2087 C C    . PHE A 1 19 ? 0.451   -1.620  -3.951  1.00 0.00 ? 19 PHE A C    4  
ATOM 2088 O O    . PHE A 1 19 ? 1.595   -1.878  -3.636  1.00 0.00 ? 19 PHE A O    4  
ATOM 2089 C CB   . PHE A 1 19 ? -1.625  -2.794  -3.100  1.00 0.00 ? 19 PHE A CB   4  
ATOM 2090 C CG   . PHE A 1 19 ? -2.354  -3.143  -1.783  1.00 0.00 ? 19 PHE A CG   4  
ATOM 2091 C CD1  . PHE A 1 19 ? -2.758  -2.165  -0.885  1.00 0.00 ? 19 PHE A CD1  4  
ATOM 2092 C CD2  . PHE A 1 19 ? -2.620  -4.467  -1.485  1.00 0.00 ? 19 PHE A CD2  4  
ATOM 2093 C CE1  . PHE A 1 19 ? -3.410  -2.508  0.281   1.00 0.00 ? 19 PHE A CE1  4  
ATOM 2094 C CE2  . PHE A 1 19 ? -3.273  -4.809  -0.319  1.00 0.00 ? 19 PHE A CE2  4  
ATOM 2095 C CZ   . PHE A 1 19 ? -3.668  -3.830  0.565   1.00 0.00 ? 19 PHE A CZ   4  
ATOM 2096 H H    . PHE A 1 19 ? -2.416  -0.390  -3.238  1.00 0.00 ? 19 PHE A H    4  
ATOM 2097 H HA   . PHE A 1 19 ? -0.226  -1.615  -1.929  1.00 0.00 ? 19 PHE A HA   4  
ATOM 2098 H HB2  . PHE A 1 19 ? -2.368  -2.563  -3.850  1.00 0.00 ? 19 PHE A HB2  4  
ATOM 2099 H HB3  . PHE A 1 19 ? -1.068  -3.660  -3.426  1.00 0.00 ? 19 PHE A HB3  4  
ATOM 2100 H HD1  . PHE A 1 19 ? -2.567  -1.123  -1.088  1.00 0.00 ? 19 PHE A HD1  4  
ATOM 2101 H HD2  . PHE A 1 19 ? -2.315  -5.245  -2.170  1.00 0.00 ? 19 PHE A HD2  4  
ATOM 2102 H HE1  . PHE A 1 19 ? -3.719  -1.738  0.972   1.00 0.00 ? 19 PHE A HE1  4  
ATOM 2103 H HE2  . PHE A 1 19 ? -3.474  -5.848  -0.099  1.00 0.00 ? 19 PHE A HE2  4  
ATOM 2104 H HZ   . PHE A 1 19 ? -4.179  -4.099  1.478   1.00 0.00 ? 19 PHE A HZ   4  
ATOM 2105 N N    . PHE A 1 20 ? 0.079   -1.344  -5.175  1.00 0.00 ? 20 PHE A N    4  
ATOM 2106 C CA   . PHE A 1 20 ? 1.059   -1.320  -6.300  1.00 0.00 ? 20 PHE A CA   4  
ATOM 2107 C C    . PHE A 1 20 ? 2.248   -0.433  -5.887  1.00 0.00 ? 20 PHE A C    4  
ATOM 2108 O O    . PHE A 1 20 ? 3.378   -0.857  -5.971  1.00 0.00 ? 20 PHE A O    4  
ATOM 2109 C CB   . PHE A 1 20 ? 0.292   -0.788  -7.553  1.00 0.00 ? 20 PHE A CB   4  
ATOM 2110 C CG   . PHE A 1 20 ? 1.110   0.213   -8.387  1.00 0.00 ? 20 PHE A CG   4  
ATOM 2111 C CD1  . PHE A 1 20 ? 2.118   -0.246  -9.206  1.00 0.00 ? 20 PHE A CD1  4  
ATOM 2112 C CD2  . PHE A 1 20 ? 0.852   1.573   -8.334  1.00 0.00 ? 20 PHE A CD2  4  
ATOM 2113 C CE1  . PHE A 1 20 ? 2.861   0.632   -9.961  1.00 0.00 ? 20 PHE A CE1  4  
ATOM 2114 C CE2  . PHE A 1 20 ? 1.595   2.452   -9.088  1.00 0.00 ? 20 PHE A CE2  4  
ATOM 2115 C CZ   . PHE A 1 20 ? 2.602   1.984   -9.904  1.00 0.00 ? 20 PHE A CZ   4  
ATOM 2116 H H    . PHE A 1 20 ? -0.859  -1.154  -5.364  1.00 0.00 ? 20 PHE A H    4  
ATOM 2117 H HA   . PHE A 1 20 ? 1.412   -2.326  -6.475  1.00 0.00 ? 20 PHE A HA   4  
ATOM 2118 H HB2  . PHE A 1 20 ? 0.037   -1.625  -8.187  1.00 0.00 ? 20 PHE A HB2  4  
ATOM 2119 H HB3  . PHE A 1 20 ? -0.626  -0.316  -7.250  1.00 0.00 ? 20 PHE A HB3  4  
ATOM 2120 H HD1  . PHE A 1 20 ? 2.327   -1.304  -9.255  1.00 0.00 ? 20 PHE A HD1  4  
ATOM 2121 H HD2  . PHE A 1 20 ? 0.067   1.963   -7.705  1.00 0.00 ? 20 PHE A HD2  4  
ATOM 2122 H HE1  . PHE A 1 20 ? 3.647   0.254   -10.596 1.00 0.00 ? 20 PHE A HE1  4  
ATOM 2123 H HE2  . PHE A 1 20 ? 1.382   3.509   -9.032  1.00 0.00 ? 20 PHE A HE2  4  
ATOM 2124 H HZ   . PHE A 1 20 ? 3.185   2.674   -10.496 1.00 0.00 ? 20 PHE A HZ   4  
ATOM 2125 N N    . ALA A 1 21 ? 1.965   0.766   -5.444  1.00 0.00 ? 21 ALA A N    4  
ATOM 2126 C CA   . ALA A 1 21 ? 3.047   1.713   -5.010  1.00 0.00 ? 21 ALA A CA   4  
ATOM 2127 C C    . ALA A 1 21 ? 3.993   1.031   -4.007  1.00 0.00 ? 21 ALA A C    4  
ATOM 2128 O O    . ALA A 1 21 ? 5.197   1.073   -4.153  1.00 0.00 ? 21 ALA A O    4  
ATOM 2129 C CB   . ALA A 1 21 ? 2.381   2.944   -4.370  1.00 0.00 ? 21 ALA A CB   4  
ATOM 2130 H H    . ALA A 1 21 ? 1.029   1.039   -5.404  1.00 0.00 ? 21 ALA A H    4  
ATOM 2131 H HA   . ALA A 1 21 ? 3.630   1.998   -5.875  1.00 0.00 ? 21 ALA A HA   4  
ATOM 2132 H HB1  . ALA A 1 21 ? 1.529   3.249   -4.960  1.00 0.00 ? 21 ALA A HB1  4  
ATOM 2133 H HB2  . ALA A 1 21 ? 2.043   2.719   -3.369  1.00 0.00 ? 21 ALA A HB2  4  
ATOM 2134 H HB3  . ALA A 1 21 ? 3.083   3.763   -4.324  1.00 0.00 ? 21 ALA A HB3  4  
ATOM 2135 N N    . GLU A 1 22 ? 3.428   0.409   -3.006  1.00 0.00 ? 22 GLU A N    4  
ATOM 2136 C CA   . GLU A 1 22 ? 4.279   -0.291  -1.983  1.00 0.00 ? 22 GLU A CA   4  
ATOM 2137 C C    . GLU A 1 22 ? 5.186   -1.305  -2.704  1.00 0.00 ? 22 GLU A C    4  
ATOM 2138 O O    . GLU A 1 22 ? 6.380   -1.365  -2.476  1.00 0.00 ? 22 GLU A O    4  
ATOM 2139 C CB   . GLU A 1 22 ? 3.373   -1.029  -0.975  1.00 0.00 ? 22 GLU A CB   4  
ATOM 2140 C CG   . GLU A 1 22 ? 2.530   -0.016  -0.154  1.00 0.00 ? 22 GLU A CG   4  
ATOM 2141 C CD   . GLU A 1 22 ? 1.126   -0.587  0.144   1.00 0.00 ? 22 GLU A CD   4  
ATOM 2142 O OE1  . GLU A 1 22 ? 1.062   -1.716  0.605   1.00 0.00 ? 22 GLU A OE1  4  
ATOM 2143 O OE2  . GLU A 1 22 ? 0.182   0.144   -0.107  1.00 0.00 ? 22 GLU A OE2  4  
ATOM 2144 H H    . GLU A 1 22 ? 2.453   0.423   -2.944  1.00 0.00 ? 22 GLU A H    4  
ATOM 2145 H HA   . GLU A 1 22 ? 4.912   0.440   -1.500  1.00 0.00 ? 22 GLU A HA   4  
ATOM 2146 H HB2  . GLU A 1 22 ? 2.731   -1.716  -1.503  1.00 0.00 ? 22 GLU A HB2  4  
ATOM 2147 H HB3  . GLU A 1 22 ? 3.990   -1.601  -0.296  1.00 0.00 ? 22 GLU A HB3  4  
ATOM 2148 H HG2  . GLU A 1 22 ? 3.022   0.185   0.787   1.00 0.00 ? 22 GLU A HG2  4  
ATOM 2149 H HG3  . GLU A 1 22 ? 2.427   0.916   -0.691  1.00 0.00 ? 22 GLU A HG3  4  
ATOM 2150 N N    . ASP A 1 23 ? 4.568   -2.071  -3.566  1.00 0.00 ? 23 ASP A N    4  
ATOM 2151 C CA   . ASP A 1 23 ? 5.289   -3.107  -4.361  1.00 0.00 ? 23 ASP A CA   4  
ATOM 2152 C C    . ASP A 1 23 ? 6.482   -2.460  -5.075  1.00 0.00 ? 23 ASP A C    4  
ATOM 2153 O O    . ASP A 1 23 ? 7.600   -2.916  -4.984  1.00 0.00 ? 23 ASP A O    4  
ATOM 2154 C CB   . ASP A 1 23 ? 4.305   -3.695  -5.379  1.00 0.00 ? 23 ASP A CB   4  
ATOM 2155 C CG   . ASP A 1 23 ? 4.666   -5.161  -5.658  1.00 0.00 ? 23 ASP A CG   4  
ATOM 2156 O OD1  . ASP A 1 23 ? 5.518   -5.355  -6.510  1.00 0.00 ? 23 ASP A OD1  4  
ATOM 2157 O OD2  . ASP A 1 23 ? 4.072   -6.003  -5.005  1.00 0.00 ? 23 ASP A OD2  4  
ATOM 2158 H H    . ASP A 1 23 ? 3.606   -1.966  -3.693  1.00 0.00 ? 23 ASP A H    4  
ATOM 2159 H HA   . ASP A 1 23 ? 5.654   -3.865  -3.686  1.00 0.00 ? 23 ASP A HA   4  
ATOM 2160 H HB2  . ASP A 1 23 ? 3.295   -3.633  -5.005  1.00 0.00 ? 23 ASP A HB2  4  
ATOM 2161 H HB3  . ASP A 1 23 ? 4.342   -3.132  -6.297  1.00 0.00 ? 23 ASP A HB3  4  
ATOM 2162 N N    . VAL A 1 24 ? 6.178   -1.397  -5.766  1.00 0.00 ? 24 VAL A N    4  
ATOM 2163 C CA   . VAL A 1 24 ? 7.169   -0.594  -6.544  1.00 0.00 ? 24 VAL A CA   4  
ATOM 2164 C C    . VAL A 1 24 ? 8.367   -0.251  -5.651  1.00 0.00 ? 24 VAL A C    4  
ATOM 2165 O O    . VAL A 1 24 ? 9.510   -0.437  -6.022  1.00 0.00 ? 24 VAL A O    4  
ATOM 2166 C CB   . VAL A 1 24 ? 6.405   0.657   -7.038  1.00 0.00 ? 24 VAL A CB   4  
ATOM 2167 C CG1  . VAL A 1 24 ? 7.286   1.593   -7.842  1.00 0.00 ? 24 VAL A CG1  4  
ATOM 2168 C CG2  . VAL A 1 24 ? 5.214   0.212   -7.906  1.00 0.00 ? 24 VAL A CG2  4  
ATOM 2169 H H    . VAL A 1 24 ? 5.244   -1.119  -5.773  1.00 0.00 ? 24 VAL A H    4  
ATOM 2170 H HA   . VAL A 1 24 ? 7.513   -1.184  -7.378  1.00 0.00 ? 24 VAL A HA   4  
ATOM 2171 H HB   . VAL A 1 24 ? 6.035   1.219   -6.199  1.00 0.00 ? 24 VAL A HB   4  
ATOM 2172 H HG11 . VAL A 1 24 ? 7.720   1.067   -8.678  1.00 0.00 ? 24 VAL A HG11 4  
ATOM 2173 H HG12 . VAL A 1 24 ? 6.675   2.408   -8.206  1.00 0.00 ? 24 VAL A HG12 4  
ATOM 2174 H HG13 . VAL A 1 24 ? 8.061   1.994   -7.207  1.00 0.00 ? 24 VAL A HG13 4  
ATOM 2175 H HG21 . VAL A 1 24 ? 4.994   -0.836  -7.762  1.00 0.00 ? 24 VAL A HG21 4  
ATOM 2176 H HG22 . VAL A 1 24 ? 4.344   0.785   -7.622  1.00 0.00 ? 24 VAL A HG22 4  
ATOM 2177 H HG23 . VAL A 1 24 ? 5.420   0.373   -8.951  1.00 0.00 ? 24 VAL A HG23 4  
ATOM 2178 N N    . GLY A 1 25 ? 8.050   0.243   -4.483  1.00 0.00 ? 25 GLY A N    4  
ATOM 2179 C CA   . GLY A 1 25 ? 9.122   0.615   -3.502  1.00 0.00 ? 25 GLY A CA   4  
ATOM 2180 C C    . GLY A 1 25 ? 10.027  -0.609  -3.259  1.00 0.00 ? 25 GLY A C    4  
ATOM 2181 O O    . GLY A 1 25 ? 11.229  -0.561  -3.437  1.00 0.00 ? 25 GLY A O    4  
ATOM 2182 H H    . GLY A 1 25 ? 7.098   0.368   -4.279  1.00 0.00 ? 25 GLY A H    4  
ATOM 2183 H HA2  . GLY A 1 25 ? 9.710   1.430   -3.900  1.00 0.00 ? 25 GLY A HA2  4  
ATOM 2184 H HA3  . GLY A 1 25 ? 8.665   0.913   -2.571  1.00 0.00 ? 25 GLY A HA3  4  
ATOM 2185 N N    . SER A 1 26 ? 9.390   -1.684  -2.862  1.00 0.00 ? 26 SER A N    4  
ATOM 2186 C CA   . SER A 1 26 ? 10.115  -2.969  -2.580  1.00 0.00 ? 26 SER A CA   4  
ATOM 2187 C C    . SER A 1 26 ? 11.002  -3.366  -3.775  1.00 0.00 ? 26 SER A C    4  
ATOM 2188 O O    . SER A 1 26 ? 12.162  -3.705  -3.632  1.00 0.00 ? 26 SER A O    4  
ATOM 2189 C CB   . SER A 1 26 ? 9.082   -4.087  -2.311  1.00 0.00 ? 26 SER A CB   4  
ATOM 2190 O OG   . SER A 1 26 ? 8.109   -3.490  -1.464  1.00 0.00 ? 26 SER A OG   4  
ATOM 2191 H H    . SER A 1 26 ? 8.419   -1.632  -2.746  1.00 0.00 ? 26 SER A H    4  
ATOM 2192 H HA   . SER A 1 26 ? 10.743  -2.826  -1.716  1.00 0.00 ? 26 SER A HA   4  
ATOM 2193 H HB2  . SER A 1 26 ? 8.606   -4.428  -3.218  1.00 0.00 ? 26 SER A HB2  4  
ATOM 2194 H HB3  . SER A 1 26 ? 9.535   -4.922  -1.798  1.00 0.00 ? 26 SER A HB3  4  
ATOM 2195 H HG   . SER A 1 26 ? 7.272   -3.480  -1.935  1.00 0.00 ? 26 SER A HG   4  
ATOM 2196 N N    . ASN A 1 27 ? 10.399  -3.304  -4.933  1.00 0.00 ? 27 ASN A N    4  
ATOM 2197 C CA   . ASN A 1 27 ? 11.081  -3.643  -6.212  1.00 0.00 ? 27 ASN A CA   4  
ATOM 2198 C C    . ASN A 1 27 ? 12.394  -2.889  -6.333  1.00 0.00 ? 27 ASN A C    4  
ATOM 2199 O O    . ASN A 1 27 ? 13.417  -3.513  -6.478  1.00 0.00 ? 27 ASN A O    4  
ATOM 2200 C CB   . ASN A 1 27 ? 10.146  -3.281  -7.379  1.00 0.00 ? 27 ASN A CB   4  
ATOM 2201 C CG   . ASN A 1 27 ? 9.264   -4.480  -7.732  1.00 0.00 ? 27 ASN A CG   4  
ATOM 2202 O OD1  . ASN A 1 27 ? 9.727   -5.485  -8.235  1.00 0.00 ? 27 ASN A OD1  4  
ATOM 2203 N ND2  . ASN A 1 27 ? 7.987   -4.412  -7.484  1.00 0.00 ? 27 ASN A ND2  4  
ATOM 2204 H H    . ASN A 1 27 ? 9.467   -3.033  -4.958  1.00 0.00 ? 27 ASN A H    4  
ATOM 2205 H HA   . ASN A 1 27 ? 11.315  -4.694  -6.197  1.00 0.00 ? 27 ASN A HA   4  
ATOM 2206 H HB2  . ASN A 1 27 ? 9.504   -2.457  -7.114  1.00 0.00 ? 27 ASN A HB2  4  
ATOM 2207 H HB3  . ASN A 1 27 ? 10.721  -2.997  -8.244  1.00 0.00 ? 27 ASN A HB3  4  
ATOM 2208 H HD21 . ASN A 1 27 ? 7.606   -3.605  -7.079  1.00 0.00 ? 27 ASN A HD21 4  
ATOM 2209 H HD22 . ASN A 1 27 ? 7.405   -5.169  -7.703  1.00 0.00 ? 27 ASN A HD22 4  
ATOM 2210 N N    . LYS A 1 28 ? 12.348  -1.583  -6.272  1.00 0.00 ? 28 LYS A N    4  
ATOM 2211 C CA   . LYS A 1 28 ? 13.598  -0.758  -6.378  1.00 0.00 ? 28 LYS A CA   4  
ATOM 2212 C C    . LYS A 1 28 ? 14.701  -1.345  -5.474  1.00 0.00 ? 28 LYS A C    4  
ATOM 2213 O O    . LYS A 1 28 ? 15.829  -1.506  -5.895  1.00 0.00 ? 28 LYS A O    4  
ATOM 2214 C CB   . LYS A 1 28 ? 13.244  0.684   -5.955  1.00 0.00 ? 28 LYS A CB   4  
ATOM 2215 C CG   . LYS A 1 28 ? 13.767  1.682   -7.003  1.00 0.00 ? 28 LYS A CG   4  
ATOM 2216 C CD   . LYS A 1 28 ? 15.309  1.829   -6.881  1.00 0.00 ? 28 LYS A CD   4  
ATOM 2217 C CE   . LYS A 1 28 ? 15.991  1.276   -8.145  1.00 0.00 ? 28 LYS A CE   4  
ATOM 2218 N NZ   . LYS A 1 28 ? 17.472  1.327   -7.988  1.00 0.00 ? 28 LYS A NZ   4  
ATOM 2219 H H    . LYS A 1 28 ? 11.480  -1.151  -6.160  1.00 0.00 ? 28 LYS A H    4  
ATOM 2220 H HA   . LYS A 1 28 ? 13.955  -0.803  -7.403  1.00 0.00 ? 28 LYS A HA   4  
ATOM 2221 H HB2  . LYS A 1 28 ? 12.170  0.788   -5.890  1.00 0.00 ? 28 LYS A HB2  4  
ATOM 2222 H HB3  . LYS A 1 28 ? 13.659  0.911   -4.983  1.00 0.00 ? 28 LYS A HB3  4  
ATOM 2223 H HG2  . LYS A 1 28 ? 13.481  1.346   -7.990  1.00 0.00 ? 28 LYS A HG2  4  
ATOM 2224 H HG3  . LYS A 1 28 ? 13.298  2.639   -6.826  1.00 0.00 ? 28 LYS A HG3  4  
ATOM 2225 H HD2  . LYS A 1 28 ? 15.558  2.872   -6.765  1.00 0.00 ? 28 LYS A HD2  4  
ATOM 2226 H HD3  . LYS A 1 28 ? 15.674  1.294   -6.016  1.00 0.00 ? 28 LYS A HD3  4  
ATOM 2227 H HE2  . LYS A 1 28 ? 15.701  0.250   -8.311  1.00 0.00 ? 28 LYS A HE2  4  
ATOM 2228 H HE3  . LYS A 1 28 ? 15.717  1.864   -9.007  1.00 0.00 ? 28 LYS A HE3  4  
ATOM 2229 H HZ1  . LYS A 1 28 ? 17.712  1.731   -7.060  1.00 0.00 ? 28 LYS A HZ1  4  
ATOM 2230 H HZ2  . LYS A 1 28 ? 17.859  0.364   -8.058  1.00 0.00 ? 28 LYS A HZ2  4  
ATOM 2231 H HZ3  . LYS A 1 28 ? 17.880  1.919   -8.740  1.00 0.00 ? 28 LYS A HZ3  4  
ATOM 2232 N N    . GLY A 1 29 ? 14.341  -1.658  -4.255  1.00 0.00 ? 29 GLY A N    4  
ATOM 2233 C CA   . GLY A 1 29 ? 15.338  -2.242  -3.302  1.00 0.00 ? 29 GLY A CA   4  
ATOM 2234 C C    . GLY A 1 29 ? 15.953  -3.518  -3.909  1.00 0.00 ? 29 GLY A C    4  
ATOM 2235 O O    . GLY A 1 29 ? 17.156  -3.637  -4.059  1.00 0.00 ? 29 GLY A O    4  
ATOM 2236 H H    . GLY A 1 29 ? 13.417  -1.501  -3.974  1.00 0.00 ? 29 GLY A H    4  
ATOM 2237 H HA2  . GLY A 1 29 ? 16.117  -1.519  -3.107  1.00 0.00 ? 29 GLY A HA2  4  
ATOM 2238 H HA3  . GLY A 1 29 ? 14.837  -2.494  -2.379  1.00 0.00 ? 29 GLY A HA3  4  
ATOM 2239 N N    . ALA A 1 30 ? 15.089  -4.440  -4.256  1.00 0.00 ? 30 ALA A N    4  
ATOM 2240 C CA   . ALA A 1 30 ? 15.557  -5.733  -4.860  1.00 0.00 ? 30 ALA A CA   4  
ATOM 2241 C C    . ALA A 1 30 ? 16.414  -5.482  -6.110  1.00 0.00 ? 30 ALA A C    4  
ATOM 2242 O O    . ALA A 1 30 ? 17.453  -6.080  -6.292  1.00 0.00 ? 30 ALA A O    4  
ATOM 2243 C CB   . ALA A 1 30 ? 14.328  -6.575  -5.227  1.00 0.00 ? 30 ALA A CB   4  
ATOM 2244 H H    . ALA A 1 30 ? 14.132  -4.269  -4.116  1.00 0.00 ? 30 ALA A H    4  
ATOM 2245 H HA   . ALA A 1 30 ? 16.169  -6.246  -4.133  1.00 0.00 ? 30 ALA A HA   4  
ATOM 2246 H HB1  . ALA A 1 30 ? 13.705  -6.717  -4.356  1.00 0.00 ? 30 ALA A HB1  4  
ATOM 2247 H HB2  . ALA A 1 30 ? 13.747  -6.081  -5.993  1.00 0.00 ? 30 ALA A HB2  4  
ATOM 2248 H HB3  . ALA A 1 30 ? 14.639  -7.542  -5.594  1.00 0.00 ? 30 ALA A HB3  4  
ATOM 2249 N N    . ILE A 1 31 ? 15.939  -4.591  -6.936  1.00 0.00 ? 31 ILE A N    4  
ATOM 2250 C CA   . ILE A 1 31 ? 16.606  -4.189  -8.202  1.00 0.00 ? 31 ILE A CA   4  
ATOM 2251 C C    . ILE A 1 31 ? 18.058  -3.822  -7.893  1.00 0.00 ? 31 ILE A C    4  
ATOM 2252 O O    . ILE A 1 31 ? 18.959  -4.349  -8.513  1.00 0.00 ? 31 ILE A O    4  
ATOM 2253 C CB   . ILE A 1 31 ? 15.737  -3.018  -8.755  1.00 0.00 ? 31 ILE A CB   4  
ATOM 2254 C CG1  . ILE A 1 31 ? 14.517  -3.649  -9.477  1.00 0.00 ? 31 ILE A CG1  4  
ATOM 2255 C CG2  . ILE A 1 31 ? 16.522  -2.076  -9.684  1.00 0.00 ? 31 ILE A CG2  4  
ATOM 2256 C CD1  . ILE A 1 31 ? 13.540  -2.575  -9.995  1.00 0.00 ? 31 ILE A CD1  4  
ATOM 2257 H H    . ILE A 1 31 ? 15.098  -4.162  -6.723  1.00 0.00 ? 31 ILE A H    4  
ATOM 2258 H HA   . ILE A 1 31 ? 16.606  -5.036  -8.873  1.00 0.00 ? 31 ILE A HA   4  
ATOM 2259 H HB   . ILE A 1 31 ? 15.366  -2.433  -7.933  1.00 0.00 ? 31 ILE A HB   4  
ATOM 2260 H HG12 . ILE A 1 31 ? 14.866  -4.266  -10.288 1.00 0.00 ? 31 ILE A HG12 4  
ATOM 2261 H HG13 . ILE A 1 31 ? 13.987  -4.289  -8.786  1.00 0.00 ? 31 ILE A HG13 4  
ATOM 2262 H HG21 . ILE A 1 31 ? 16.960  -2.624  -10.501 1.00 0.00 ? 31 ILE A HG21 4  
ATOM 2263 H HG22 . ILE A 1 31 ? 15.860  -1.317  -10.076 1.00 0.00 ? 31 ILE A HG22 4  
ATOM 2264 H HG23 . ILE A 1 31 ? 17.299  -1.579  -9.121  1.00 0.00 ? 31 ILE A HG23 4  
ATOM 2265 H HD11 . ILE A 1 31 ? 13.441  -1.771  -9.282  1.00 0.00 ? 31 ILE A HD11 4  
ATOM 2266 H HD12 . ILE A 1 31 ? 13.894  -2.171  -10.932 1.00 0.00 ? 31 ILE A HD12 4  
ATOM 2267 H HD13 . ILE A 1 31 ? 12.568  -3.016  -10.155 1.00 0.00 ? 31 ILE A HD13 4  
ATOM 2268 N N    . ILE A 1 32 ? 18.261  -2.938  -6.950  1.00 0.00 ? 32 ILE A N    4  
ATOM 2269 C CA   . ILE A 1 32 ? 19.662  -2.537  -6.592  1.00 0.00 ? 32 ILE A CA   4  
ATOM 2270 C C    . ILE A 1 32 ? 20.470  -3.806  -6.279  1.00 0.00 ? 32 ILE A C    4  
ATOM 2271 O O    . ILE A 1 32 ? 21.564  -3.986  -6.779  1.00 0.00 ? 32 ILE A O    4  
ATOM 2272 C CB   . ILE A 1 32 ? 19.619  -1.596  -5.359  1.00 0.00 ? 32 ILE A CB   4  
ATOM 2273 C CG1  . ILE A 1 32 ? 18.825  -0.314  -5.731  1.00 0.00 ? 32 ILE A CG1  4  
ATOM 2274 C CG2  . ILE A 1 32 ? 21.064  -1.205  -4.951  1.00 0.00 ? 32 ILE A CG2  4  
ATOM 2275 C CD1  . ILE A 1 32 ? 18.382  0.433   -4.461  1.00 0.00 ? 32 ILE A CD1  4  
ATOM 2276 H H    . ILE A 1 32 ? 17.494  -2.537  -6.492  1.00 0.00 ? 32 ILE A H    4  
ATOM 2277 H HA   . ILE A 1 32 ? 20.109  -2.061  -7.449  1.00 0.00 ? 32 ILE A HA   4  
ATOM 2278 H HB   . ILE A 1 32 ? 19.138  -2.102  -4.534  1.00 0.00 ? 32 ILE A HB   4  
ATOM 2279 H HG12 . ILE A 1 32 ? 19.438  0.332   -6.341  1.00 0.00 ? 32 ILE A HG12 4  
ATOM 2280 H HG13 . ILE A 1 32 ? 17.950  -0.573  -6.304  1.00 0.00 ? 32 ILE A HG13 4  
ATOM 2281 H HG21 . ILE A 1 32 ? 21.603  -0.814  -5.803  1.00 0.00 ? 32 ILE A HG21 4  
ATOM 2282 H HG22 . ILE A 1 32 ? 21.048  -0.453  -4.177  1.00 0.00 ? 32 ILE A HG22 4  
ATOM 2283 H HG23 . ILE A 1 32 ? 21.592  -2.069  -4.576  1.00 0.00 ? 32 ILE A HG23 4  
ATOM 2284 H HD11 . ILE A 1 32 ? 17.939  -0.253  -3.754  1.00 0.00 ? 32 ILE A HD11 4  
ATOM 2285 H HD12 . ILE A 1 32 ? 19.229  0.915   -3.997  1.00 0.00 ? 32 ILE A HD12 4  
ATOM 2286 H HD13 . ILE A 1 32 ? 17.653  1.186   -4.715  1.00 0.00 ? 32 ILE A HD13 4  
ATOM 2287 N N    . GLY A 1 33 ? 19.900  -4.656  -5.462  1.00 0.00 ? 33 GLY A N    4  
ATOM 2288 C CA   . GLY A 1 33 ? 20.600  -5.929  -5.093  1.00 0.00 ? 33 GLY A CA   4  
ATOM 2289 C C    . GLY A 1 33 ? 20.987  -6.704  -6.363  1.00 0.00 ? 33 GLY A C    4  
ATOM 2290 O O    . GLY A 1 33 ? 22.122  -7.095  -6.536  1.00 0.00 ? 33 GLY A O    4  
ATOM 2291 H H    . GLY A 1 33 ? 19.015  -4.444  -5.099  1.00 0.00 ? 33 GLY A H    4  
ATOM 2292 H HA2  . GLY A 1 33 ? 21.496  -5.693  -4.533  1.00 0.00 ? 33 GLY A HA2  4  
ATOM 2293 H HA3  . GLY A 1 33 ? 19.944  -6.537  -4.490  1.00 0.00 ? 33 GLY A HA3  4  
ATOM 2294 N N    . LEU A 1 34 ? 20.024  -6.899  -7.226  1.00 0.00 ? 34 LEU A N    4  
ATOM 2295 C CA   . LEU A 1 34 ? 20.264  -7.638  -8.507  1.00 0.00 ? 34 LEU A CA   4  
ATOM 2296 C C    . LEU A 1 34 ? 21.402  -6.984  -9.305  1.00 0.00 ? 34 LEU A C    4  
ATOM 2297 O O    . LEU A 1 34 ? 22.269  -7.666  -9.813  1.00 0.00 ? 34 LEU A O    4  
ATOM 2298 C CB   . LEU A 1 34 ? 18.962  -7.632  -9.336  1.00 0.00 ? 34 LEU A CB   4  
ATOM 2299 C CG   . LEU A 1 34 ? 17.910  -8.569  -8.673  1.00 0.00 ? 34 LEU A CG   4  
ATOM 2300 C CD1  . LEU A 1 34 ? 16.488  -8.063  -9.000  1.00 0.00 ? 34 LEU A CD1  4  
ATOM 2301 C CD2  . LEU A 1 34 ? 18.074  -10.006 -9.220  1.00 0.00 ? 34 LEU A CD2  4  
ATOM 2302 H H    . LEU A 1 34 ? 19.135  -6.556  -7.019  1.00 0.00 ? 34 LEU A H    4  
ATOM 2303 H HA   . LEU A 1 34 ? 20.562  -8.648  -8.264  1.00 0.00 ? 34 LEU A HA   4  
ATOM 2304 H HB2  . LEU A 1 34 ? 18.576  -6.625  -9.388  1.00 0.00 ? 34 LEU A HB2  4  
ATOM 2305 H HB3  . LEU A 1 34 ? 19.168  -7.964  -10.344 1.00 0.00 ? 34 LEU A HB3  4  
ATOM 2306 H HG   . LEU A 1 34 ? 18.039  -8.579  -7.600  1.00 0.00 ? 34 LEU A HG   4  
ATOM 2307 H HD11 . LEU A 1 34 ? 16.401  -7.834  -10.053 1.00 0.00 ? 34 LEU A HD11 4  
ATOM 2308 H HD12 . LEU A 1 34 ? 15.755  -8.815  -8.747  1.00 0.00 ? 34 LEU A HD12 4  
ATOM 2309 H HD13 . LEU A 1 34 ? 16.274  -7.173  -8.431  1.00 0.00 ? 34 LEU A HD13 4  
ATOM 2310 H HD21 . LEU A 1 34 ? 19.080  -10.361 -9.045  1.00 0.00 ? 34 LEU A HD21 4  
ATOM 2311 H HD22 . LEU A 1 34 ? 17.384  -10.672 -8.723  1.00 0.00 ? 34 LEU A HD22 4  
ATOM 2312 H HD23 . LEU A 1 34 ? 17.877  -10.030 -10.282 1.00 0.00 ? 34 LEU A HD23 4  
ATOM 2313 N N    . MET A 1 35 ? 21.364  -5.676  -9.395  1.00 0.00 ? 35 MET A N    4  
ATOM 2314 C CA   . MET A 1 35 ? 22.426  -4.936  -10.145 1.00 0.00 ? 35 MET A CA   4  
ATOM 2315 C C    . MET A 1 35 ? 23.795  -5.316  -9.578  1.00 0.00 ? 35 MET A C    4  
ATOM 2316 O O    . MET A 1 35 ? 24.678  -5.727  -10.306 1.00 0.00 ? 35 MET A O    4  
ATOM 2317 C CB   . MET A 1 35 ? 22.189  -3.417  -10.003 1.00 0.00 ? 35 MET A CB   4  
ATOM 2318 C CG   . MET A 1 35 ? 20.963  -3.004  -10.839 1.00 0.00 ? 35 MET A CG   4  
ATOM 2319 S SD   . MET A 1 35 ? 20.401  -1.288  -10.697 1.00 0.00 ? 35 MET A SD   4  
ATOM 2320 C CE   . MET A 1 35 ? 21.389  -0.582  -12.040 1.00 0.00 ? 35 MET A CE   4  
ATOM 2321 H H    . MET A 1 35 ? 20.632  -5.182  -8.975  1.00 0.00 ? 35 MET A H    4  
ATOM 2322 H HA   . MET A 1 35 ? 22.381  -5.231  -11.174 1.00 0.00 ? 35 MET A HA   4  
ATOM 2323 H HB2  . MET A 1 35 ? 22.028  -3.155  -8.969  1.00 0.00 ? 35 MET A HB2  4  
ATOM 2324 H HB3  . MET A 1 35 ? 23.056  -2.880  -10.360 1.00 0.00 ? 35 MET A HB3  4  
ATOM 2325 H HG2  . MET A 1 35 ? 21.182  -3.192  -11.880 1.00 0.00 ? 35 MET A HG2  4  
ATOM 2326 H HG3  . MET A 1 35 ? 20.130  -3.635  -10.569 1.00 0.00 ? 35 MET A HG3  4  
ATOM 2327 H HE1  . MET A 1 35 ? 22.430  -0.830  -11.894 1.00 0.00 ? 35 MET A HE1  4  
ATOM 2328 H HE2  . MET A 1 35 ? 21.053  -0.982  -12.986 1.00 0.00 ? 35 MET A HE2  4  
ATOM 2329 H HE3  . MET A 1 35 ? 21.272  0.492   -12.043 1.00 0.00 ? 35 MET A HE3  4  
ATOM 2330 N N    . VAL A 1 36 ? 23.905  -5.166  -8.284  1.00 0.00 ? 36 VAL A N    4  
ATOM 2331 C CA   . VAL A 1 36 ? 25.168  -5.491  -7.552  1.00 0.00 ? 36 VAL A CA   4  
ATOM 2332 C C    . VAL A 1 36 ? 25.596  -6.939  -7.871  1.00 0.00 ? 36 VAL A C    4  
ATOM 2333 O O    . VAL A 1 36 ? 26.736  -7.185  -8.213  1.00 0.00 ? 36 VAL A O    4  
ATOM 2334 C CB   . VAL A 1 36 ? 24.899  -5.298  -6.028  1.00 0.00 ? 36 VAL A CB   4  
ATOM 2335 C CG1  . VAL A 1 36 ? 26.075  -5.854  -5.188  1.00 0.00 ? 36 VAL A CG1  4  
ATOM 2336 C CG2  . VAL A 1 36 ? 24.749  -3.790  -5.730  1.00 0.00 ? 36 VAL A CG2  4  
ATOM 2337 H H    . VAL A 1 36 ? 23.133  -4.825  -7.790  1.00 0.00 ? 36 VAL A H    4  
ATOM 2338 H HA   . VAL A 1 36 ? 25.944  -4.819  -7.889  1.00 0.00 ? 36 VAL A HA   4  
ATOM 2339 H HB   . VAL A 1 36 ? 23.985  -5.800  -5.741  1.00 0.00 ? 36 VAL A HB   4  
ATOM 2340 H HG11 . VAL A 1 36 ? 27.018  -5.498  -5.578  1.00 0.00 ? 36 VAL A HG11 4  
ATOM 2341 H HG12 . VAL A 1 36 ? 25.982  -5.538  -4.159  1.00 0.00 ? 36 VAL A HG12 4  
ATOM 2342 H HG13 . VAL A 1 36 ? 26.071  -6.934  -5.215  1.00 0.00 ? 36 VAL A HG13 4  
ATOM 2343 H HG21 . VAL A 1 36 ? 24.006  -3.349  -6.379  1.00 0.00 ? 36 VAL A HG21 4  
ATOM 2344 H HG22 . VAL A 1 36 ? 24.439  -3.644  -4.706  1.00 0.00 ? 36 VAL A HG22 4  
ATOM 2345 H HG23 . VAL A 1 36 ? 25.688  -3.279  -5.885  1.00 0.00 ? 36 VAL A HG23 4  
ATOM 2346 N N    . GLY A 1 37 ? 24.654  -7.842  -7.745  1.00 0.00 ? 37 GLY A N    4  
ATOM 2347 C CA   . GLY A 1 37 ? 24.899  -9.290  -8.019  1.00 0.00 ? 37 GLY A CA   4  
ATOM 2348 C C    . GLY A 1 37 ? 25.533  -9.536  -9.395  1.00 0.00 ? 37 GLY A C    4  
ATOM 2349 O O    . GLY A 1 37 ? 26.594  -10.124 -9.480  1.00 0.00 ? 37 GLY A O    4  
ATOM 2350 H H    . GLY A 1 37 ? 23.764  -7.558  -7.457  1.00 0.00 ? 37 GLY A H    4  
ATOM 2351 H HA2  . GLY A 1 37 ? 25.554  -9.681  -7.252  1.00 0.00 ? 37 GLY A HA2  4  
ATOM 2352 H HA3  . GLY A 1 37 ? 23.956  -9.814  -7.972  1.00 0.00 ? 37 GLY A HA3  4  
ATOM 2353 N N    . GLY A 1 38 ? 24.870  -9.080  -10.429 1.00 0.00 ? 38 GLY A N    4  
ATOM 2354 C CA   . GLY A 1 38 ? 25.415  -9.277  -11.809 1.00 0.00 ? 38 GLY A CA   4  
ATOM 2355 C C    . GLY A 1 38 ? 24.691  -8.452  -12.877 1.00 0.00 ? 38 GLY A C    4  
ATOM 2356 O O    . GLY A 1 38 ? 25.148  -8.390  -14.003 1.00 0.00 ? 38 GLY A O    4  
ATOM 2357 H H    . GLY A 1 38 ? 24.020  -8.614  -10.291 1.00 0.00 ? 38 GLY A H    4  
ATOM 2358 H HA2  . GLY A 1 38 ? 26.459  -8.999  -11.816 1.00 0.00 ? 38 GLY A HA2  4  
ATOM 2359 H HA3  . GLY A 1 38 ? 25.331  -10.323 -12.068 1.00 0.00 ? 38 GLY A HA3  4  
ATOM 2360 N N    . VAL A 1 39 ? 23.593  -7.839  -12.510 1.00 0.00 ? 39 VAL A N    4  
ATOM 2361 C CA   . VAL A 1 39 ? 22.811  -7.009  -13.478 1.00 0.00 ? 39 VAL A CA   4  
ATOM 2362 C C    . VAL A 1 39 ? 23.293  -5.547  -13.385 1.00 0.00 ? 39 VAL A C    4  
ATOM 2363 O O    . VAL A 1 39 ? 22.529  -4.615  -13.550 1.00 0.00 ? 39 VAL A O    4  
ATOM 2364 C CB   . VAL A 1 39 ? 21.286  -7.127  -13.124 1.00 0.00 ? 39 VAL A CB   4  
ATOM 2365 C CG1  . VAL A 1 39 ? 20.431  -6.669  -14.331 1.00 0.00 ? 39 VAL A CG1  4  
ATOM 2366 C CG2  . VAL A 1 39 ? 20.917  -8.598  -12.801 1.00 0.00 ? 39 VAL A CG2  4  
ATOM 2367 H H    . VAL A 1 39 ? 23.271  -7.914  -11.593 1.00 0.00 ? 39 VAL A H    4  
ATOM 2368 H HA   . VAL A 1 39 ? 22.995  -7.373  -14.474 1.00 0.00 ? 39 VAL A HA   4  
ATOM 2369 H HB   . VAL A 1 39 ? 21.051  -6.513  -12.267 1.00 0.00 ? 39 VAL A HB   4  
ATOM 2370 H HG11 . VAL A 1 39 ? 20.699  -7.229  -15.216 1.00 0.00 ? 39 VAL A HG11 4  
ATOM 2371 H HG12 . VAL A 1 39 ? 19.383  -6.830  -14.125 1.00 0.00 ? 39 VAL A HG12 4  
ATOM 2372 H HG13 . VAL A 1 39 ? 20.580  -5.619  -14.530 1.00 0.00 ? 39 VAL A HG13 4  
ATOM 2373 H HG21 . VAL A 1 39 ? 21.254  -9.252  -13.592 1.00 0.00 ? 39 VAL A HG21 4  
ATOM 2374 H HG22 . VAL A 1 39 ? 21.377  -8.909  -11.874 1.00 0.00 ? 39 VAL A HG22 4  
ATOM 2375 H HG23 . VAL A 1 39 ? 19.846  -8.698  -12.699 1.00 0.00 ? 39 VAL A HG23 4  
ATOM 2376 N N    . VAL A 1 40 ? 24.569  -5.410  -13.119 1.00 0.00 ? 40 VAL A N    4  
ATOM 2377 C CA   . VAL A 1 40 ? 25.221  -4.065  -12.988 1.00 0.00 ? 40 VAL A CA   4  
ATOM 2378 C C    . VAL A 1 40 ? 24.797  -3.114  -14.129 1.00 0.00 ? 40 VAL A C    4  
ATOM 2379 O O    . VAL A 1 40 ? 24.322  -2.042  -13.787 1.00 0.00 ? 40 VAL A O    4  
ATOM 2380 C CB   . VAL A 1 40 ? 26.771  -4.258  -12.997 1.00 0.00 ? 40 VAL A CB   4  
ATOM 2381 C CG1  . VAL A 1 40 ? 27.469  -2.896  -12.772 1.00 0.00 ? 40 VAL A CG1  4  
ATOM 2382 C CG2  . VAL A 1 40 ? 27.207  -5.226  -11.870 1.00 0.00 ? 40 VAL A CG2  4  
ATOM 2383 O OXT  . VAL A 1 40 ? 24.969  -3.511  -15.270 1.00 0.00 ? 40 VAL A OXT  4  
ATOM 2384 H H    . VAL A 1 40 ? 25.109  -6.217  -13.001 1.00 0.00 ? 40 VAL A H    4  
ATOM 2385 H HA   . VAL A 1 40 ? 24.917  -3.641  -12.042 1.00 0.00 ? 40 VAL A HA   4  
ATOM 2386 H HB   . VAL A 1 40 ? 27.080  -4.664  -13.950 1.00 0.00 ? 40 VAL A HB   4  
ATOM 2387 H HG11 . VAL A 1 40 ? 27.073  -2.411  -11.891 1.00 0.00 ? 40 VAL A HG11 4  
ATOM 2388 H HG12 . VAL A 1 40 ? 28.531  -3.040  -12.643 1.00 0.00 ? 40 VAL A HG12 4  
ATOM 2389 H HG13 . VAL A 1 40 ? 27.310  -2.253  -13.625 1.00 0.00 ? 40 VAL A HG13 4  
ATOM 2390 H HG21 . VAL A 1 40 ? 26.735  -6.190  -11.991 1.00 0.00 ? 40 VAL A HG21 4  
ATOM 2391 H HG22 . VAL A 1 40 ? 28.277  -5.365  -11.903 1.00 0.00 ? 40 VAL A HG22 4  
ATOM 2392 H HG23 . VAL A 1 40 ? 26.942  -4.824  -10.903 1.00 0.00 ? 40 VAL A HG23 4  
ATOM 2393 N N    . ASP A 1 1  ? -19.098 -10.001 9.186   1.00 0.00 ? 1  ASP A N    5  
ATOM 2394 C CA   . ASP A 1 1  ? -18.042 -11.008 8.886   1.00 0.00 ? 1  ASP A CA   5  
ATOM 2395 C C    . ASP A 1 1  ? -16.814 -10.756 9.781   1.00 0.00 ? 1  ASP A C    5  
ATOM 2396 O O    . ASP A 1 1  ? -16.927 -10.162 10.836  1.00 0.00 ? 1  ASP A O    5  
ATOM 2397 C CB   . ASP A 1 1  ? -17.668 -10.906 7.378   1.00 0.00 ? 1  ASP A CB   5  
ATOM 2398 C CG   . ASP A 1 1  ? -16.993 -9.557  7.074   1.00 0.00 ? 1  ASP A CG   5  
ATOM 2399 O OD1  . ASP A 1 1  ? -17.729 -8.593  6.942   1.00 0.00 ? 1  ASP A OD1  5  
ATOM 2400 O OD2  . ASP A 1 1  ? -15.777 -9.566  6.995   1.00 0.00 ? 1  ASP A OD2  5  
ATOM 2401 H H1   . ASP A 1 1  ? -18.771 -9.373  9.948   1.00 0.00 ? 1  ASP A H1   5  
ATOM 2402 H H2   . ASP A 1 1  ? -19.292 -9.436  8.335   1.00 0.00 ? 1  ASP A H2   5  
ATOM 2403 H H3   . ASP A 1 1  ? -19.964 -10.489 9.487   1.00 0.00 ? 1  ASP A H3   5  
ATOM 2404 H HA   . ASP A 1 1  ? -18.427 -11.992 9.103   1.00 0.00 ? 1  ASP A HA   5  
ATOM 2405 H HB2  . ASP A 1 1  ? -17.000 -11.712 7.108   1.00 0.00 ? 1  ASP A HB2  5  
ATOM 2406 H HB3  . ASP A 1 1  ? -18.561 -10.992 6.775   1.00 0.00 ? 1  ASP A HB3  5  
ATOM 2407 N N    . ALA A 1 2  ? -15.675 -11.220 9.334   1.00 0.00 ? 2  ALA A N    5  
ATOM 2408 C CA   . ALA A 1 2  ? -14.414 -11.037 10.109  1.00 0.00 ? 2  ALA A CA   5  
ATOM 2409 C C    . ALA A 1 2  ? -13.941 -9.581  9.976   1.00 0.00 ? 2  ALA A C    5  
ATOM 2410 O O    . ALA A 1 2  ? -13.312 -9.205  9.006   1.00 0.00 ? 2  ALA A O    5  
ATOM 2411 C CB   . ALA A 1 2  ? -13.358 -12.006 9.555   1.00 0.00 ? 2  ALA A CB   5  
ATOM 2412 H H    . ALA A 1 2  ? -15.650 -11.694 8.477   1.00 0.00 ? 2  ALA A H    5  
ATOM 2413 H HA   . ALA A 1 2  ? -14.599 -11.259 11.150  1.00 0.00 ? 2  ALA A HA   5  
ATOM 2414 H HB1  . ALA A 1 2  ? -13.298 -11.919 8.481   1.00 0.00 ? 2  ALA A HB1  5  
ATOM 2415 H HB2  . ALA A 1 2  ? -12.390 -11.785 9.983   1.00 0.00 ? 2  ALA A HB2  5  
ATOM 2416 H HB3  . ALA A 1 2  ? -13.622 -13.024 9.804   1.00 0.00 ? 2  ALA A HB3  5  
ATOM 2417 N N    . GLU A 1 3  ? -14.269 -8.799  10.971  1.00 0.00 ? 3  GLU A N    5  
ATOM 2418 C CA   . GLU A 1 3  ? -13.874 -7.357  10.976  1.00 0.00 ? 3  GLU A CA   5  
ATOM 2419 C C    . GLU A 1 3  ? -12.508 -7.213  11.661  1.00 0.00 ? 3  GLU A C    5  
ATOM 2420 O O    . GLU A 1 3  ? -12.335 -6.545  12.662  1.00 0.00 ? 3  GLU A O    5  
ATOM 2421 C CB   . GLU A 1 3  ? -15.007 -6.578  11.706  1.00 0.00 ? 3  GLU A CB   5  
ATOM 2422 C CG   . GLU A 1 3  ? -15.979 -5.957  10.663  1.00 0.00 ? 3  GLU A CG   5  
ATOM 2423 C CD   . GLU A 1 3  ? -16.490 -7.019  9.662   1.00 0.00 ? 3  GLU A CD   5  
ATOM 2424 O OE1  . GLU A 1 3  ? -17.512 -7.613  9.967   1.00 0.00 ? 3  GLU A OE1  5  
ATOM 2425 O OE2  . GLU A 1 3  ? -15.831 -7.181  8.648   1.00 0.00 ? 3  GLU A OE2  5  
ATOM 2426 H H    . GLU A 1 3  ? -14.780 -9.163  11.723  1.00 0.00 ? 3  GLU A H    5  
ATOM 2427 H HA   . GLU A 1 3  ? -13.764 -7.006  9.961   1.00 0.00 ? 3  GLU A HA   5  
ATOM 2428 H HB2  . GLU A 1 3  ? -15.558 -7.242  12.356  1.00 0.00 ? 3  GLU A HB2  5  
ATOM 2429 H HB3  . GLU A 1 3  ? -14.599 -5.780  12.307  1.00 0.00 ? 3  GLU A HB3  5  
ATOM 2430 H HG2  . GLU A 1 3  ? -16.827 -5.521  11.173  1.00 0.00 ? 3  GLU A HG2  5  
ATOM 2431 H HG3  . GLU A 1 3  ? -15.473 -5.171  10.118  1.00 0.00 ? 3  GLU A HG3  5  
ATOM 2432 N N    . PHE A 1 4  ? -11.574 -7.888  11.041  1.00 0.00 ? 4  PHE A N    5  
ATOM 2433 C CA   . PHE A 1 4  ? -10.153 -7.921  11.494  1.00 0.00 ? 4  PHE A CA   5  
ATOM 2434 C C    . PHE A 1 4  ? -9.327  -8.047  10.205  1.00 0.00 ? 4  PHE A C    5  
ATOM 2435 O O    . PHE A 1 4  ? -8.578  -8.985  10.011  1.00 0.00 ? 4  PHE A O    5  
ATOM 2436 C CB   . PHE A 1 4  ? -9.939  -9.146  12.416  1.00 0.00 ? 4  PHE A CB   5  
ATOM 2437 C CG   . PHE A 1 4  ? -10.830 -9.024  13.661  1.00 0.00 ? 4  PHE A CG   5  
ATOM 2438 C CD1  . PHE A 1 4  ? -10.417 -8.288  14.758  1.00 0.00 ? 4  PHE A CD1  5  
ATOM 2439 C CD2  . PHE A 1 4  ? -12.063 -9.649  13.695  1.00 0.00 ? 4  PHE A CD2  5  
ATOM 2440 C CE1  . PHE A 1 4  ? -11.224 -8.181  15.872  1.00 0.00 ? 4  PHE A CE1  5  
ATOM 2441 C CE2  . PHE A 1 4  ? -12.870 -9.542  14.808  1.00 0.00 ? 4  PHE A CE2  5  
ATOM 2442 C CZ   . PHE A 1 4  ? -12.452 -8.808  15.896  1.00 0.00 ? 4  PHE A CZ   5  
ATOM 2443 H H    . PHE A 1 4  ? -11.819 -8.398  10.241  1.00 0.00 ? 4  PHE A H    5  
ATOM 2444 H HA   . PHE A 1 4  ? -9.900  -6.997  11.994  1.00 0.00 ? 4  PHE A HA   5  
ATOM 2445 H HB2  . PHE A 1 4  ? -10.188 -10.059 11.893  1.00 0.00 ? 4  PHE A HB2  5  
ATOM 2446 H HB3  . PHE A 1 4  ? -8.907  -9.193  12.730  1.00 0.00 ? 4  PHE A HB3  5  
ATOM 2447 H HD1  . PHE A 1 4  ? -9.457  -7.793  14.746  1.00 0.00 ? 4  PHE A HD1  5  
ATOM 2448 H HD2  . PHE A 1 4  ? -12.399 -10.226 12.846  1.00 0.00 ? 4  PHE A HD2  5  
ATOM 2449 H HE1  . PHE A 1 4  ? -10.896 -7.606  16.724  1.00 0.00 ? 4  PHE A HE1  5  
ATOM 2450 H HE2  . PHE A 1 4  ? -13.832 -10.034 14.826  1.00 0.00 ? 4  PHE A HE2  5  
ATOM 2451 H HZ   . PHE A 1 4  ? -13.084 -8.725  16.767  1.00 0.00 ? 4  PHE A HZ   5  
ATOM 2452 N N    . ARG A 1 5  ? -9.519  -7.061  9.361   1.00 0.00 ? 5  ARG A N    5  
ATOM 2453 C CA   . ARG A 1 5  ? -8.820  -6.978  8.037   1.00 0.00 ? 5  ARG A CA   5  
ATOM 2454 C C    . ARG A 1 5  ? -9.125  -8.208  7.157   1.00 0.00 ? 5  ARG A C    5  
ATOM 2455 O O    . ARG A 1 5  ? -8.266  -8.708  6.455   1.00 0.00 ? 5  ARG A O    5  
ATOM 2456 C CB   . ARG A 1 5  ? -7.283  -6.864  8.270   1.00 0.00 ? 5  ARG A CB   5  
ATOM 2457 C CG   . ARG A 1 5  ? -6.965  -5.641  9.156   1.00 0.00 ? 5  ARG A CG   5  
ATOM 2458 C CD   . ARG A 1 5  ? -5.443  -5.584  9.391   1.00 0.00 ? 5  ARG A CD   5  
ATOM 2459 N NE   . ARG A 1 5  ? -5.108  -4.297  10.081  1.00 0.00 ? 5  ARG A NE   5  
ATOM 2460 C CZ   . ARG A 1 5  ? -4.994  -3.167  9.428   1.00 0.00 ? 5  ARG A CZ   5  
ATOM 2461 N NH1  . ARG A 1 5  ? -5.176  -3.121  8.135   1.00 0.00 ? 5  ARG A NH1  5  
ATOM 2462 N NH2  . ARG A 1 5  ? -4.695  -2.094  10.108  1.00 0.00 ? 5  ARG A NH2  5  
ATOM 2463 H H    . ARG A 1 5  ? -10.146 -6.350  9.608   1.00 0.00 ? 5  ARG A H    5  
ATOM 2464 H HA   . ARG A 1 5  ? -9.181  -6.100  7.521   1.00 0.00 ? 5  ARG A HA   5  
ATOM 2465 H HB2  . ARG A 1 5  ? -6.904  -7.764  8.731   1.00 0.00 ? 5  ARG A HB2  5  
ATOM 2466 H HB3  . ARG A 1 5  ? -6.792  -6.740  7.315   1.00 0.00 ? 5  ARG A HB3  5  
ATOM 2467 H HG2  . ARG A 1 5  ? -7.301  -4.738  8.667   1.00 0.00 ? 5  ARG A HG2  5  
ATOM 2468 H HG3  . ARG A 1 5  ? -7.470  -5.727  10.107  1.00 0.00 ? 5  ARG A HG3  5  
ATOM 2469 H HD2  . ARG A 1 5  ? -5.138  -6.400  10.030  1.00 0.00 ? 5  ARG A HD2  5  
ATOM 2470 H HD3  . ARG A 1 5  ? -4.897  -5.646  8.460   1.00 0.00 ? 5  ARG A HD3  5  
ATOM 2471 H HE   . ARG A 1 5  ? -4.966  -4.302  11.052  1.00 0.00 ? 5  ARG A HE   5  
ATOM 2472 H HH11 . ARG A 1 5  ? -5.409  -3.952  7.628   1.00 0.00 ? 5  ARG A HH11 5  
ATOM 2473 H HH12 . ARG A 1 5  ? -5.082  -2.253  7.648   1.00 0.00 ? 5  ARG A HH12 5  
ATOM 2474 H HH21 . ARG A 1 5  ? -4.561  -2.149  11.097  1.00 0.00 ? 5  ARG A HH21 5  
ATOM 2475 H HH22 . ARG A 1 5  ? -4.600  -1.215  9.639   1.00 0.00 ? 5  ARG A HH22 5  
ATOM 2476 N N    . HIS A 1 6  ? -10.355 -8.657  7.227   1.00 0.00 ? 6  HIS A N    5  
ATOM 2477 C CA   . HIS A 1 6  ? -10.795 -9.838  6.431   1.00 0.00 ? 6  HIS A CA   5  
ATOM 2478 C C    . HIS A 1 6  ? -12.267 -9.640  6.036   1.00 0.00 ? 6  HIS A C    5  
ATOM 2479 O O    . HIS A 1 6  ? -13.161 -10.247 6.593   1.00 0.00 ? 6  HIS A O    5  
ATOM 2480 C CB   . HIS A 1 6  ? -10.591 -11.108 7.308   1.00 0.00 ? 6  HIS A CB   5  
ATOM 2481 C CG   . HIS A 1 6  ? -11.189 -12.360 6.637   1.00 0.00 ? 6  HIS A CG   5  
ATOM 2482 N ND1  . HIS A 1 6  ? -11.625 -12.429 5.421   1.00 0.00 ? 6  HIS A ND1  5  
ATOM 2483 C CD2  . HIS A 1 6  ? -11.396 -13.633 7.141   1.00 0.00 ? 6  HIS A CD2  5  
ATOM 2484 C CE1  . HIS A 1 6  ? -12.063 -13.622 5.179   1.00 0.00 ? 6  HIS A CE1  5  
ATOM 2485 N NE2  . HIS A 1 6  ? -11.940 -14.405 6.221   1.00 0.00 ? 6  HIS A NE2  5  
ATOM 2486 H H    . HIS A 1 6  ? -11.009 -8.222  7.807   1.00 0.00 ? 6  HIS A H    5  
ATOM 2487 H HA   . HIS A 1 6  ? -10.204 -9.895  5.533   1.00 0.00 ? 6  HIS A HA   5  
ATOM 2488 H HB2  . HIS A 1 6  ? -9.535  -11.275 7.459   1.00 0.00 ? 6  HIS A HB2  5  
ATOM 2489 H HB3  . HIS A 1 6  ? -11.059 -10.971 8.270   1.00 0.00 ? 6  HIS A HB3  5  
ATOM 2490 H HD1  . HIS A 1 6  ? -11.625 -11.689 4.779   1.00 0.00 ? 6  HIS A HD1  5  
ATOM 2491 H HD2  . HIS A 1 6  ? -11.149 -13.950 8.144   1.00 0.00 ? 6  HIS A HD2  5  
ATOM 2492 H HE1  . HIS A 1 6  ? -12.479 -13.934 4.231   1.00 0.00 ? 6  HIS A HE1  5  
ATOM 2493 N N    . ASP A 1 7  ? -12.460 -8.781  5.069   1.00 0.00 ? 7  ASP A N    5  
ATOM 2494 C CA   . ASP A 1 7  ? -13.821 -8.458  4.549   1.00 0.00 ? 7  ASP A CA   5  
ATOM 2495 C C    . ASP A 1 7  ? -14.480 -9.676  3.863   1.00 0.00 ? 7  ASP A C    5  
ATOM 2496 O O    . ASP A 1 7  ? -14.111 -10.809 4.110   1.00 0.00 ? 7  ASP A O    5  
ATOM 2497 C CB   . ASP A 1 7  ? -13.656 -7.279  3.570   1.00 0.00 ? 7  ASP A CB   5  
ATOM 2498 C CG   . ASP A 1 7  ? -12.769 -7.707  2.383   1.00 0.00 ? 7  ASP A CG   5  
ATOM 2499 O OD1  . ASP A 1 7  ? -13.338 -8.195  1.419   1.00 0.00 ? 7  ASP A OD1  5  
ATOM 2500 O OD2  . ASP A 1 7  ? -11.570 -7.521  2.510   1.00 0.00 ? 7  ASP A OD2  5  
ATOM 2501 H H    . ASP A 1 7  ? -11.697 -8.325  4.662   1.00 0.00 ? 7  ASP A H    5  
ATOM 2502 H HA   . ASP A 1 7  ? -14.440 -8.143  5.374   1.00 0.00 ? 7  ASP A HA   5  
ATOM 2503 H HB2  . ASP A 1 7  ? -14.618 -6.966  3.205   1.00 0.00 ? 7  ASP A HB2  5  
ATOM 2504 H HB3  . ASP A 1 7  ? -13.195 -6.442  4.074   1.00 0.00 ? 7  ASP A HB3  5  
ATOM 2505 N N    . SER A 1 8  ? -15.441 -9.397  3.018   1.00 0.00 ? 8  SER A N    5  
ATOM 2506 C CA   . SER A 1 8  ? -16.170 -10.464 2.279   1.00 0.00 ? 8  SER A CA   5  
ATOM 2507 C C    . SER A 1 8  ? -16.585 -9.911  0.902   1.00 0.00 ? 8  SER A C    5  
ATOM 2508 O O    . SER A 1 8  ? -17.752 -9.721  0.615   1.00 0.00 ? 8  SER A O    5  
ATOM 2509 C CB   . SER A 1 8  ? -17.395 -10.877 3.128   1.00 0.00 ? 8  SER A CB   5  
ATOM 2510 O OG   . SER A 1 8  ? -17.896 -12.035 2.474   1.00 0.00 ? 8  SER A OG   5  
ATOM 2511 H H    . SER A 1 8  ? -15.691 -8.466  2.863   1.00 0.00 ? 8  SER A H    5  
ATOM 2512 H HA   . SER A 1 8  ? -15.504 -11.299 2.127   1.00 0.00 ? 8  SER A HA   5  
ATOM 2513 H HB2  . SER A 1 8  ? -17.105 -11.137 4.136   1.00 0.00 ? 8  SER A HB2  5  
ATOM 2514 H HB3  . SER A 1 8  ? -18.158 -10.112 3.148   1.00 0.00 ? 8  SER A HB3  5  
ATOM 2515 H HG   . SER A 1 8  ? -18.787 -11.842 2.170   1.00 0.00 ? 8  SER A HG   5  
ATOM 2516 N N    . GLY A 1 9  ? -15.586 -9.668  0.089   1.00 0.00 ? 9  GLY A N    5  
ATOM 2517 C CA   . GLY A 1 9  ? -15.817 -9.126  -1.289  1.00 0.00 ? 9  GLY A CA   5  
ATOM 2518 C C    . GLY A 1 9  ? -16.152 -7.629  -1.240  1.00 0.00 ? 9  GLY A C    5  
ATOM 2519 O O    . GLY A 1 9  ? -16.974 -7.150  -1.997  1.00 0.00 ? 9  GLY A O    5  
ATOM 2520 H H    . GLY A 1 9  ? -14.670 -9.844  0.387   1.00 0.00 ? 9  GLY A H    5  
ATOM 2521 H HA2  . GLY A 1 9  ? -14.918 -9.263  -1.872  1.00 0.00 ? 9  GLY A HA2  5  
ATOM 2522 H HA3  . GLY A 1 9  ? -16.630 -9.662  -1.757  1.00 0.00 ? 9  GLY A HA3  5  
ATOM 2523 N N    . TYR A 1 10 ? -15.494 -6.940  -0.344  1.00 0.00 ? 10 TYR A N    5  
ATOM 2524 C CA   . TYR A 1 10 ? -15.712 -5.471  -0.175  1.00 0.00 ? 10 TYR A CA   5  
ATOM 2525 C C    . TYR A 1 10 ? -15.061 -4.694  -1.332  1.00 0.00 ? 10 TYR A C    5  
ATOM 2526 O O    . TYR A 1 10 ? -13.928 -4.952  -1.690  1.00 0.00 ? 10 TYR A O    5  
ATOM 2527 C CB   . TYR A 1 10 ? -15.102 -5.055  1.186   1.00 0.00 ? 10 TYR A CB   5  
ATOM 2528 C CG   . TYR A 1 10 ? -14.870 -3.533  1.262   1.00 0.00 ? 10 TYR A CG   5  
ATOM 2529 C CD1  . TYR A 1 10 ? -15.929 -2.663  1.430   1.00 0.00 ? 10 TYR A CD1  5  
ATOM 2530 C CD2  . TYR A 1 10 ? -13.590 -3.019  1.162   1.00 0.00 ? 10 TYR A CD2  5  
ATOM 2531 C CE1  . TYR A 1 10 ? -15.713 -1.302  1.498   1.00 0.00 ? 10 TYR A CE1  5  
ATOM 2532 C CE2  . TYR A 1 10 ? -13.375 -1.659  1.230   1.00 0.00 ? 10 TYR A CE2  5  
ATOM 2533 C CZ   . TYR A 1 10 ? -14.435 -0.792  1.398   1.00 0.00 ? 10 TYR A CZ   5  
ATOM 2534 O OH   . TYR A 1 10 ? -14.217 0.568   1.464   1.00 0.00 ? 10 TYR A OH   5  
ATOM 2535 H H    . TYR A 1 10 ? -14.847 -7.398  0.230   1.00 0.00 ? 10 TYR A H    5  
ATOM 2536 H HA   . TYR A 1 10 ? -16.775 -5.275  -0.169  1.00 0.00 ? 10 TYR A HA   5  
ATOM 2537 H HB2  . TYR A 1 10 ? -15.770 -5.342  1.985   1.00 0.00 ? 10 TYR A HB2  5  
ATOM 2538 H HB3  . TYR A 1 10 ? -14.157 -5.555  1.331   1.00 0.00 ? 10 TYR A HB3  5  
ATOM 2539 H HD1  . TYR A 1 10 ? -16.936 -3.048  1.509   1.00 0.00 ? 10 TYR A HD1  5  
ATOM 2540 H HD2  . TYR A 1 10 ? -12.751 -3.686  1.030   1.00 0.00 ? 10 TYR A HD2  5  
ATOM 2541 H HE1  . TYR A 1 10 ? -16.549 -0.632  1.629   1.00 0.00 ? 10 TYR A HE1  5  
ATOM 2542 H HE2  . TYR A 1 10 ? -12.370 -1.272  1.150   1.00 0.00 ? 10 TYR A HE2  5  
ATOM 2543 H HH   . TYR A 1 10 ? -14.029 0.789   2.379   1.00 0.00 ? 10 TYR A HH   5  
ATOM 2544 N N    . GLU A 1 11 ? -15.809 -3.766  -1.874  1.00 0.00 ? 11 GLU A N    5  
ATOM 2545 C CA   . GLU A 1 11 ? -15.297 -2.934  -3.007  1.00 0.00 ? 11 GLU A CA   5  
ATOM 2546 C C    . GLU A 1 11 ? -14.370 -1.857  -2.435  1.00 0.00 ? 11 GLU A C    5  
ATOM 2547 O O    . GLU A 1 11 ? -14.711 -1.198  -1.472  1.00 0.00 ? 11 GLU A O    5  
ATOM 2548 C CB   . GLU A 1 11 ? -16.498 -2.285  -3.741  1.00 0.00 ? 11 GLU A CB   5  
ATOM 2549 C CG   . GLU A 1 11 ? -16.012 -1.290  -4.840  1.00 0.00 ? 11 GLU A CG   5  
ATOM 2550 C CD   . GLU A 1 11 ? -16.257 0.164   -4.381  1.00 0.00 ? 11 GLU A CD   5  
ATOM 2551 O OE1  . GLU A 1 11 ? -15.436 0.651   -3.619  1.00 0.00 ? 11 GLU A OE1  5  
ATOM 2552 O OE2  . GLU A 1 11 ? -17.255 0.710   -4.820  1.00 0.00 ? 11 GLU A OE2  5  
ATOM 2553 H H    . GLU A 1 11 ? -16.715 -3.613  -1.533  1.00 0.00 ? 11 GLU A H    5  
ATOM 2554 H HA   . GLU A 1 11 ? -14.740 -3.565  -3.686  1.00 0.00 ? 11 GLU A HA   5  
ATOM 2555 H HB2  . GLU A 1 11 ? -17.078 -3.067  -4.212  1.00 0.00 ? 11 GLU A HB2  5  
ATOM 2556 H HB3  . GLU A 1 11 ? -17.131 -1.780  -3.026  1.00 0.00 ? 11 GLU A HB3  5  
ATOM 2557 H HG2  . GLU A 1 11 ? -14.961 -1.419  -5.052  1.00 0.00 ? 11 GLU A HG2  5  
ATOM 2558 H HG3  . GLU A 1 11 ? -16.561 -1.467  -5.755  1.00 0.00 ? 11 GLU A HG3  5  
ATOM 2559 N N    . VAL A 1 12 ? -13.229 -1.715  -3.058  1.00 0.00 ? 12 VAL A N    5  
ATOM 2560 C CA   . VAL A 1 12 ? -12.221 -0.711  -2.624  1.00 0.00 ? 12 VAL A CA   5  
ATOM 2561 C C    . VAL A 1 12 ? -12.261 0.492   -3.564  1.00 0.00 ? 12 VAL A C    5  
ATOM 2562 O O    . VAL A 1 12 ? -12.812 0.445   -4.646  1.00 0.00 ? 12 VAL A O    5  
ATOM 2563 C CB   . VAL A 1 12 ? -10.812 -1.348  -2.649  1.00 0.00 ? 12 VAL A CB   5  
ATOM 2564 C CG1  . VAL A 1 12 ? -10.697 -2.390  -1.518  1.00 0.00 ? 12 VAL A CG1  5  
ATOM 2565 C CG2  . VAL A 1 12 ? -10.523 -2.018  -4.010  1.00 0.00 ? 12 VAL A CG2  5  
ATOM 2566 H H    . VAL A 1 12 ? -13.018 -2.274  -3.830  1.00 0.00 ? 12 VAL A H    5  
ATOM 2567 H HA   . VAL A 1 12 ? -12.452 -0.375  -1.622  1.00 0.00 ? 12 VAL A HA   5  
ATOM 2568 H HB   . VAL A 1 12 ? -10.083 -0.570  -2.492  1.00 0.00 ? 12 VAL A HB   5  
ATOM 2569 H HG11 . VAL A 1 12 ? -11.438 -3.166  -1.643  1.00 0.00 ? 12 VAL A HG11 5  
ATOM 2570 H HG12 . VAL A 1 12 ? -9.714  -2.838  -1.523  1.00 0.00 ? 12 VAL A HG12 5  
ATOM 2571 H HG13 . VAL A 1 12 ? -10.853 -1.911  -0.562  1.00 0.00 ? 12 VAL A HG13 5  
ATOM 2572 H HG21 . VAL A 1 12 ? -10.689 -1.316  -4.814  1.00 0.00 ? 12 VAL A HG21 5  
ATOM 2573 H HG22 . VAL A 1 12 ? -9.494  -2.343  -4.047  1.00 0.00 ? 12 VAL A HG22 5  
ATOM 2574 H HG23 . VAL A 1 12 ? -11.164 -2.874  -4.156  1.00 0.00 ? 12 VAL A HG23 5  
ATOM 2575 N N    . HIS A 1 13 ? -11.650 1.536   -3.084  1.00 0.00 ? 13 HIS A N    5  
ATOM 2576 C CA   . HIS A 1 13 ? -11.575 2.817   -3.846  1.00 0.00 ? 13 HIS A CA   5  
ATOM 2577 C C    . HIS A 1 13 ? -10.365 2.778   -4.781  1.00 0.00 ? 13 HIS A C    5  
ATOM 2578 O O    . HIS A 1 13 ? -10.510 2.538   -5.965  1.00 0.00 ? 13 HIS A O    5  
ATOM 2579 C CB   . HIS A 1 13 ? -11.468 3.987   -2.828  1.00 0.00 ? 13 HIS A CB   5  
ATOM 2580 C CG   . HIS A 1 13 ? -12.786 4.763   -2.819  1.00 0.00 ? 13 HIS A CG   5  
ATOM 2581 N ND1  . HIS A 1 13 ? -12.973 5.915   -3.375  1.00 0.00 ? 13 HIS A ND1  5  
ATOM 2582 C CD2  . HIS A 1 13 ? -14.012 4.451   -2.256  1.00 0.00 ? 13 HIS A CD2  5  
ATOM 2583 C CE1  . HIS A 1 13 ? -14.197 6.295   -3.185  1.00 0.00 ? 13 HIS A CE1  5  
ATOM 2584 N NE2  . HIS A 1 13 ? -14.879 5.415   -2.493  1.00 0.00 ? 13 HIS A NE2  5  
ATOM 2585 H H    . HIS A 1 13 ? -11.234 1.444   -2.204  1.00 0.00 ? 13 HIS A H    5  
ATOM 2586 H HA   . HIS A 1 13 ? -12.465 2.923   -4.447  1.00 0.00 ? 13 HIS A HA   5  
ATOM 2587 H HB2  . HIS A 1 13 ? -11.285 3.612   -1.831  1.00 0.00 ? 13 HIS A HB2  5  
ATOM 2588 H HB3  . HIS A 1 13 ? -10.674 4.670   -3.089  1.00 0.00 ? 13 HIS A HB3  5  
ATOM 2589 H HD1  . HIS A 1 13 ? -12.294 6.423   -3.866  1.00 0.00 ? 13 HIS A HD1  5  
ATOM 2590 H HD2  . HIS A 1 13 ? -14.227 3.547   -1.705  1.00 0.00 ? 13 HIS A HD2  5  
ATOM 2591 H HE1  . HIS A 1 13 ? -14.607 7.225   -3.550  1.00 0.00 ? 13 HIS A HE1  5  
ATOM 2592 N N    . HIS A 1 14 ? -9.210  3.014   -4.217  1.00 0.00 ? 14 HIS A N    5  
ATOM 2593 C CA   . HIS A 1 14 ? -7.938  3.010   -5.010  1.00 0.00 ? 14 HIS A CA   5  
ATOM 2594 C C    . HIS A 1 14 ? -6.867  2.204   -4.269  1.00 0.00 ? 14 HIS A C    5  
ATOM 2595 O O    . HIS A 1 14 ? -5.682  2.346   -4.500  1.00 0.00 ? 14 HIS A O    5  
ATOM 2596 C CB   . HIS A 1 14 ? -7.457  4.477   -5.225  1.00 0.00 ? 14 HIS A CB   5  
ATOM 2597 C CG   . HIS A 1 14 ? -8.639  5.456   -5.165  1.00 0.00 ? 14 HIS A CG   5  
ATOM 2598 N ND1  . HIS A 1 14 ? -8.857  6.304   -4.214  1.00 0.00 ? 14 HIS A ND1  5  
ATOM 2599 C CD2  . HIS A 1 14 ? -9.690  5.653   -6.045  1.00 0.00 ? 14 HIS A CD2  5  
ATOM 2600 C CE1  . HIS A 1 14 ? -9.937  6.972   -4.465  1.00 0.00 ? 14 HIS A CE1  5  
ATOM 2601 N NE2  . HIS A 1 14 ? -10.488 6.601   -5.594  1.00 0.00 ? 14 HIS A NE2  5  
ATOM 2602 H H    . HIS A 1 14 ? -9.185  3.199   -3.257  1.00 0.00 ? 14 HIS A H    5  
ATOM 2603 H HA   . HIS A 1 14 ? -8.114  2.515   -5.951  1.00 0.00 ? 14 HIS A HA   5  
ATOM 2604 H HB2  . HIS A 1 14 ? -6.730  4.762   -4.476  1.00 0.00 ? 14 HIS A HB2  5  
ATOM 2605 H HB3  . HIS A 1 14 ? -6.998  4.565   -6.198  1.00 0.00 ? 14 HIS A HB3  5  
ATOM 2606 H HD1  . HIS A 1 14 ? -8.291  6.422   -3.424  1.00 0.00 ? 14 HIS A HD1  5  
ATOM 2607 H HD2  . HIS A 1 14 ? -9.832  5.109   -6.966  1.00 0.00 ? 14 HIS A HD2  5  
ATOM 2608 H HE1  . HIS A 1 14 ? -10.335 7.742   -3.821  1.00 0.00 ? 14 HIS A HE1  5  
ATOM 2609 N N    . GLN A 1 15 ? -7.330  1.357   -3.388  1.00 0.00 ? 15 GLN A N    5  
ATOM 2610 C CA   . GLN A 1 15 ? -6.404  0.498   -2.584  1.00 0.00 ? 15 GLN A CA   5  
ATOM 2611 C C    . GLN A 1 15 ? -5.515  -0.298  -3.550  1.00 0.00 ? 15 GLN A C    5  
ATOM 2612 O O    . GLN A 1 15 ? -4.373  -0.591  -3.262  1.00 0.00 ? 15 GLN A O    5  
ATOM 2613 C CB   . GLN A 1 15 ? -7.242  -0.451  -1.709  1.00 0.00 ? 15 GLN A CB   5  
ATOM 2614 C CG   . GLN A 1 15 ? -7.726  0.276   -0.429  1.00 0.00 ? 15 GLN A CG   5  
ATOM 2615 C CD   . GLN A 1 15 ? -8.928  1.185   -0.733  1.00 0.00 ? 15 GLN A CD   5  
ATOM 2616 O OE1  . GLN A 1 15 ? -10.066 0.827   -0.504  1.00 0.00 ? 15 GLN A OE1  5  
ATOM 2617 N NE2  . GLN A 1 15 ? -8.722  2.366   -1.247  1.00 0.00 ? 15 GLN A NE2  5  
ATOM 2618 H H    . GLN A 1 15 ? -8.300  1.292   -3.265  1.00 0.00 ? 15 GLN A H    5  
ATOM 2619 H HA   . GLN A 1 15 ? -5.775  1.134   -1.980  1.00 0.00 ? 15 GLN A HA   5  
ATOM 2620 H HB2  . GLN A 1 15 ? -8.078  -0.825  -2.276  1.00 0.00 ? 15 GLN A HB2  5  
ATOM 2621 H HB3  . GLN A 1 15 ? -6.638  -1.294  -1.415  1.00 0.00 ? 15 GLN A HB3  5  
ATOM 2622 H HG2  . GLN A 1 15 ? -8.026  -0.456  0.307   1.00 0.00 ? 15 GLN A HG2  5  
ATOM 2623 H HG3  . GLN A 1 15 ? -6.932  0.878   -0.009  1.00 0.00 ? 15 GLN A HG3  5  
ATOM 2624 H HE21 . GLN A 1 15 ? -7.808  2.667   -1.436  1.00 0.00 ? 15 GLN A HE21 5  
ATOM 2625 H HE22 . GLN A 1 15 ? -9.481  2.953   -1.444  1.00 0.00 ? 15 GLN A HE22 5  
ATOM 2626 N N    . LYS A 1 16 ? -6.084  -0.613  -4.685  1.00 0.00 ? 16 LYS A N    5  
ATOM 2627 C CA   . LYS A 1 16 ? -5.346  -1.382  -5.731  1.00 0.00 ? 16 LYS A CA   5  
ATOM 2628 C C    . LYS A 1 16 ? -4.034  -0.673  -6.103  1.00 0.00 ? 16 LYS A C    5  
ATOM 2629 O O    . LYS A 1 16 ? -2.971  -1.263  -6.048  1.00 0.00 ? 16 LYS A O    5  
ATOM 2630 C CB   . LYS A 1 16 ? -6.254  -1.533  -6.989  1.00 0.00 ? 16 LYS A CB   5  
ATOM 2631 C CG   . LYS A 1 16 ? -6.971  -0.199  -7.369  1.00 0.00 ? 16 LYS A CG   5  
ATOM 2632 C CD   . LYS A 1 16 ? -6.372  0.390   -8.667  1.00 0.00 ? 16 LYS A CD   5  
ATOM 2633 C CE   . LYS A 1 16 ? -6.839  1.851   -8.823  1.00 0.00 ? 16 LYS A CE   5  
ATOM 2634 N NZ   . LYS A 1 16 ? -6.037  2.536   -9.875  1.00 0.00 ? 16 LYS A NZ   5  
ATOM 2635 H H    . LYS A 1 16 ? -7.009  -0.337  -4.844  1.00 0.00 ? 16 LYS A H    5  
ATOM 2636 H HA   . LYS A 1 16 ? -5.107  -2.354  -5.335  1.00 0.00 ? 16 LYS A HA   5  
ATOM 2637 H HB2  . LYS A 1 16 ? -5.662  -1.895  -7.818  1.00 0.00 ? 16 LYS A HB2  5  
ATOM 2638 H HB3  . LYS A 1 16 ? -7.007  -2.278  -6.775  1.00 0.00 ? 16 LYS A HB3  5  
ATOM 2639 H HG2  . LYS A 1 16 ? -8.020  -0.399  -7.530  1.00 0.00 ? 16 LYS A HG2  5  
ATOM 2640 H HG3  . LYS A 1 16 ? -6.889  0.529   -6.578  1.00 0.00 ? 16 LYS A HG3  5  
ATOM 2641 H HD2  . LYS A 1 16 ? -5.293  0.355   -8.637  1.00 0.00 ? 16 LYS A HD2  5  
ATOM 2642 H HD3  . LYS A 1 16 ? -6.708  -0.187  -9.517  1.00 0.00 ? 16 LYS A HD3  5  
ATOM 2643 H HE2  . LYS A 1 16 ? -7.881  1.882   -9.108  1.00 0.00 ? 16 LYS A HE2  5  
ATOM 2644 H HE3  . LYS A 1 16 ? -6.714  2.390   -7.895  1.00 0.00 ? 16 LYS A HE3  5  
ATOM 2645 H HZ1  . LYS A 1 16 ? -5.341  1.873   -10.270 1.00 0.00 ? 16 LYS A HZ1  5  
ATOM 2646 H HZ2  . LYS A 1 16 ? -6.669  2.868   -10.631 1.00 0.00 ? 16 LYS A HZ2  5  
ATOM 2647 H HZ3  . LYS A 1 16 ? -5.542  3.350   -9.456  1.00 0.00 ? 16 LYS A HZ3  5  
ATOM 2648 N N    . LEU A 1 17 ? -4.137  0.583   -6.459  1.00 0.00 ? 17 LEU A N    5  
ATOM 2649 C CA   . LEU A 1 17 ? -2.910  1.341   -6.839  1.00 0.00 ? 17 LEU A CA   5  
ATOM 2650 C C    . LEU A 1 17 ? -2.014  1.505   -5.606  1.00 0.00 ? 17 LEU A C    5  
ATOM 2651 O O    . LEU A 1 17 ? -0.811  1.421   -5.715  1.00 0.00 ? 17 LEU A O    5  
ATOM 2652 C CB   . LEU A 1 17 ? -3.356  2.715   -7.449  1.00 0.00 ? 17 LEU A CB   5  
ATOM 2653 C CG   . LEU A 1 17 ? -3.423  3.883   -6.430  1.00 0.00 ? 17 LEU A CG   5  
ATOM 2654 C CD1  . LEU A 1 17 ? -1.993  4.431   -6.126  1.00 0.00 ? 17 LEU A CD1  5  
ATOM 2655 C CD2  . LEU A 1 17 ? -4.273  5.014   -7.045  1.00 0.00 ? 17 LEU A CD2  5  
ATOM 2656 H H    . LEU A 1 17 ? -5.012  1.019   -6.469  1.00 0.00 ? 17 LEU A H    5  
ATOM 2657 H HA   . LEU A 1 17 ? -2.378  0.778   -7.591  1.00 0.00 ? 17 LEU A HA   5  
ATOM 2658 H HB2  . LEU A 1 17 ? -2.675  2.977   -8.245  1.00 0.00 ? 17 LEU A HB2  5  
ATOM 2659 H HB3  . LEU A 1 17 ? -4.333  2.583   -7.890  1.00 0.00 ? 17 LEU A HB3  5  
ATOM 2660 H HG   . LEU A 1 17 ? -3.900  3.538   -5.527  1.00 0.00 ? 17 LEU A HG   5  
ATOM 2661 H HD11 . LEU A 1 17 ? -1.255  3.974   -6.770  1.00 0.00 ? 17 LEU A HD11 5  
ATOM 2662 H HD12 . LEU A 1 17 ? -1.945  5.501   -6.263  1.00 0.00 ? 17 LEU A HD12 5  
ATOM 2663 H HD13 . LEU A 1 17 ? -1.729  4.211   -5.102  1.00 0.00 ? 17 LEU A HD13 5  
ATOM 2664 H HD21 . LEU A 1 17 ? -5.206  4.620   -7.418  1.00 0.00 ? 17 LEU A HD21 5  
ATOM 2665 H HD22 . LEU A 1 17 ? -4.485  5.764   -6.299  1.00 0.00 ? 17 LEU A HD22 5  
ATOM 2666 H HD23 . LEU A 1 17 ? -3.742  5.476   -7.865  1.00 0.00 ? 17 LEU A HD23 5  
ATOM 2667 N N    . VAL A 1 18 ? -2.606  1.733   -4.460  1.00 0.00 ? 18 VAL A N    5  
ATOM 2668 C CA   . VAL A 1 18 ? -1.802  1.897   -3.210  1.00 0.00 ? 18 VAL A CA   5  
ATOM 2669 C C    . VAL A 1 18 ? -0.860  0.678   -3.083  1.00 0.00 ? 18 VAL A C    5  
ATOM 2670 O O    . VAL A 1 18 ? 0.336   0.825   -2.940  1.00 0.00 ? 18 VAL A O    5  
ATOM 2671 C CB   . VAL A 1 18 ? -2.803  2.000   -2.031  1.00 0.00 ? 18 VAL A CB   5  
ATOM 2672 C CG1  . VAL A 1 18 ? -2.078  1.863   -0.692  1.00 0.00 ? 18 VAL A CG1  5  
ATOM 2673 C CG2  . VAL A 1 18 ? -3.520  3.369   -2.087  1.00 0.00 ? 18 VAL A CG2  5  
ATOM 2674 H H    . VAL A 1 18 ? -3.579  1.804   -4.413  1.00 0.00 ? 18 VAL A H    5  
ATOM 2675 H HA   . VAL A 1 18 ? -1.205  2.796   -3.289  1.00 0.00 ? 18 VAL A HA   5  
ATOM 2676 H HB   . VAL A 1 18 ? -3.539  1.218   -2.103  1.00 0.00 ? 18 VAL A HB   5  
ATOM 2677 H HG11 . VAL A 1 18 ? -1.205  2.498   -0.675  1.00 0.00 ? 18 VAL A HG11 5  
ATOM 2678 H HG12 . VAL A 1 18 ? -2.742  2.145   0.112   1.00 0.00 ? 18 VAL A HG12 5  
ATOM 2679 H HG13 . VAL A 1 18 ? -1.776  0.836   -0.552  1.00 0.00 ? 18 VAL A HG13 5  
ATOM 2680 H HG21 . VAL A 1 18 ? -3.946  3.533   -3.067  1.00 0.00 ? 18 VAL A HG21 5  
ATOM 2681 H HG22 . VAL A 1 18 ? -4.317  3.400   -1.358  1.00 0.00 ? 18 VAL A HG22 5  
ATOM 2682 H HG23 . VAL A 1 18 ? -2.825  4.169   -1.877  1.00 0.00 ? 18 VAL A HG23 5  
ATOM 2683 N N    . PHE A 1 19 ? -1.434  -0.496  -3.153  1.00 0.00 ? 19 PHE A N    5  
ATOM 2684 C CA   . PHE A 1 19 ? -0.637  -1.759  -3.048  1.00 0.00 ? 19 PHE A CA   5  
ATOM 2685 C C    . PHE A 1 19 ? 0.484   -1.736  -4.088  1.00 0.00 ? 19 PHE A C    5  
ATOM 2686 O O    . PHE A 1 19 ? 1.632   -1.983  -3.774  1.00 0.00 ? 19 PHE A O    5  
ATOM 2687 C CB   . PHE A 1 19 ? -1.553  -2.976  -3.302  1.00 0.00 ? 19 PHE A CB   5  
ATOM 2688 C CG   . PHE A 1 19 ? -2.771  -3.001  -2.356  1.00 0.00 ? 19 PHE A CG   5  
ATOM 2689 C CD1  . PHE A 1 19 ? -2.709  -2.514  -1.059  1.00 0.00 ? 19 PHE A CD1  5  
ATOM 2690 C CD2  . PHE A 1 19 ? -3.967  -3.533  -2.809  1.00 0.00 ? 19 PHE A CD2  5  
ATOM 2691 C CE1  . PHE A 1 19 ? -3.816  -2.558  -0.239  1.00 0.00 ? 19 PHE A CE1  5  
ATOM 2692 C CE2  . PHE A 1 19 ? -5.074  -3.576  -1.988  1.00 0.00 ? 19 PHE A CE2  5  
ATOM 2693 C CZ   . PHE A 1 19 ? -4.999  -3.088  -0.702  1.00 0.00 ? 19 PHE A CZ   5  
ATOM 2694 H H    . PHE A 1 19 ? -2.400  -0.542  -3.275  1.00 0.00 ? 19 PHE A H    5  
ATOM 2695 H HA   . PHE A 1 19 ? -0.191  -1.811  -2.069  1.00 0.00 ? 19 PHE A HA   5  
ATOM 2696 H HB2  . PHE A 1 19 ? -1.908  -2.958  -4.322  1.00 0.00 ? 19 PHE A HB2  5  
ATOM 2697 H HB3  . PHE A 1 19 ? -0.991  -3.886  -3.151  1.00 0.00 ? 19 PHE A HB3  5  
ATOM 2698 H HD1  . PHE A 1 19 ? -1.790  -2.094  -0.678  1.00 0.00 ? 19 PHE A HD1  5  
ATOM 2699 H HD2  . PHE A 1 19 ? -4.036  -3.918  -3.815  1.00 0.00 ? 19 PHE A HD2  5  
ATOM 2700 H HE1  . PHE A 1 19 ? -3.756  -2.175  0.769   1.00 0.00 ? 19 PHE A HE1  5  
ATOM 2701 H HE2  . PHE A 1 19 ? -6.001  -3.993  -2.353  1.00 0.00 ? 19 PHE A HE2  5  
ATOM 2702 H HZ   . PHE A 1 19 ? -5.865  -3.123  -0.058  1.00 0.00 ? 19 PHE A HZ   5  
ATOM 2703 N N    . PHE A 1 20 ? 0.107   -1.430  -5.303  1.00 0.00 ? 20 PHE A N    5  
ATOM 2704 C CA   . PHE A 1 20 ? 1.093   -1.365  -6.422  1.00 0.00 ? 20 PHE A CA   5  
ATOM 2705 C C    . PHE A 1 20 ? 2.270   -0.468  -5.992  1.00 0.00 ? 20 PHE A C    5  
ATOM 2706 O O    . PHE A 1 20 ? 3.407   -0.887  -6.038  1.00 0.00 ? 20 PHE A O    5  
ATOM 2707 C CB   . PHE A 1 20 ? 0.323   -0.820  -7.674  1.00 0.00 ? 20 PHE A CB   5  
ATOM 2708 C CG   . PHE A 1 20 ? 1.099   0.253   -8.460  1.00 0.00 ? 20 PHE A CG   5  
ATOM 2709 C CD1  . PHE A 1 20 ? 2.202   -0.103  -9.210  1.00 0.00 ? 20 PHE A CD1  5  
ATOM 2710 C CD2  . PHE A 1 20 ? 0.711   1.583   -8.434  1.00 0.00 ? 20 PHE A CD2  5  
ATOM 2711 C CE1  . PHE A 1 20 ? 2.904   0.846   -9.918  1.00 0.00 ? 20 PHE A CE1  5  
ATOM 2712 C CE2  . PHE A 1 20 ? 1.411   2.533   -9.141  1.00 0.00 ? 20 PHE A CE2  5  
ATOM 2713 C CZ   . PHE A 1 20 ? 2.511   2.166   -9.886  1.00 0.00 ? 20 PHE A CZ   5  
ATOM 2714 H H    . PHE A 1 20 ? -0.837  -1.246  -5.481  1.00 0.00 ? 20 PHE A H    5  
ATOM 2715 H HA   . PHE A 1 20 ? 1.461   -2.362  -6.617  1.00 0.00 ? 20 PHE A HA   5  
ATOM 2716 H HB2  . PHE A 1 20 ? 0.122   -1.644  -8.343  1.00 0.00 ? 20 PHE A HB2  5  
ATOM 2717 H HB3  . PHE A 1 20 ? -0.626  -0.408  -7.372  1.00 0.00 ? 20 PHE A HB3  5  
ATOM 2718 H HD1  . PHE A 1 20 ? 2.519   -1.134  -9.240  1.00 0.00 ? 20 PHE A HD1  5  
ATOM 2719 H HD2  . PHE A 1 20 ? -0.148  1.893   -7.861  1.00 0.00 ? 20 PHE A HD2  5  
ATOM 2720 H HE1  . PHE A 1 20 ? 3.762   0.548   -10.499 1.00 0.00 ? 20 PHE A HE1  5  
ATOM 2721 H HE2  . PHE A 1 20 ? 1.092   3.563   -9.106  1.00 0.00 ? 20 PHE A HE2  5  
ATOM 2722 H HZ   . PHE A 1 20 ? 3.062   2.910   -10.443 1.00 0.00 ? 20 PHE A HZ   5  
ATOM 2723 N N    . ALA A 1 21 ? 1.968   0.734   -5.571  1.00 0.00 ? 21 ALA A N    5  
ATOM 2724 C CA   . ALA A 1 21 ? 3.036   1.691   -5.128  1.00 0.00 ? 21 ALA A CA   5  
ATOM 2725 C C    . ALA A 1 21 ? 3.947   1.049   -4.073  1.00 0.00 ? 21 ALA A C    5  
ATOM 2726 O O    . ALA A 1 21 ? 5.154   1.128   -4.169  1.00 0.00 ? 21 ALA A O    5  
ATOM 2727 C CB   . ALA A 1 21 ? 2.357   2.946   -4.556  1.00 0.00 ? 21 ALA A CB   5  
ATOM 2728 H H    . ALA A 1 21 ? 1.027   0.997   -5.549  1.00 0.00 ? 21 ALA A H    5  
ATOM 2729 H HA   . ALA A 1 21 ? 3.645   1.948   -5.983  1.00 0.00 ? 21 ALA A HA   5  
ATOM 2730 H HB1  . ALA A 1 21 ? 1.685   2.685   -3.754  1.00 0.00 ? 21 ALA A HB1  5  
ATOM 2731 H HB2  . ALA A 1 21 ? 3.100   3.633   -4.180  1.00 0.00 ? 21 ALA A HB2  5  
ATOM 2732 H HB3  . ALA A 1 21 ? 1.790   3.439   -5.332  1.00 0.00 ? 21 ALA A HB3  5  
ATOM 2733 N N    . GLU A 1 22 ? 3.358   0.426   -3.088  1.00 0.00 ? 22 GLU A N    5  
ATOM 2734 C CA   . GLU A 1 22 ? 4.187   -0.231  -2.022  1.00 0.00 ? 22 GLU A CA   5  
ATOM 2735 C C    . GLU A 1 22 ? 5.141   -1.240  -2.680  1.00 0.00 ? 22 GLU A C    5  
ATOM 2736 O O    . GLU A 1 22 ? 6.322   -1.246  -2.398  1.00 0.00 ? 22 GLU A O    5  
ATOM 2737 C CB   . GLU A 1 22 ? 3.273   -0.975  -1.007  1.00 0.00 ? 22 GLU A CB   5  
ATOM 2738 C CG   . GLU A 1 22 ? 2.138   -0.082  -0.426  1.00 0.00 ? 22 GLU A CG   5  
ATOM 2739 C CD   . GLU A 1 22 ? 2.544   1.403   -0.341  1.00 0.00 ? 22 GLU A CD   5  
ATOM 2740 O OE1  . GLU A 1 22 ? 3.337   1.694   0.539   1.00 0.00 ? 22 GLU A OE1  5  
ATOM 2741 O OE2  . GLU A 1 22 ? 2.043   2.162   -1.156  1.00 0.00 ? 22 GLU A OE2  5  
ATOM 2742 H H    . GLU A 1 22 ? 2.382   0.411   -3.065  1.00 0.00 ? 22 GLU A H    5  
ATOM 2743 H HA   . GLU A 1 22 ? 4.789   0.526   -1.539  1.00 0.00 ? 22 GLU A HA   5  
ATOM 2744 H HB2  . GLU A 1 22 ? 2.827   -1.836  -1.485  1.00 0.00 ? 22 GLU A HB2  5  
ATOM 2745 H HB3  . GLU A 1 22 ? 3.883   -1.328  -0.188  1.00 0.00 ? 22 GLU A HB3  5  
ATOM 2746 H HG2  . GLU A 1 22 ? 1.251   -0.179  -1.033  1.00 0.00 ? 22 GLU A HG2  5  
ATOM 2747 H HG3  . GLU A 1 22 ? 1.892   -0.427  0.569   1.00 0.00 ? 22 GLU A HG3  5  
ATOM 2748 N N    . ASP A 1 23 ? 4.587   -2.056  -3.542  1.00 0.00 ? 23 ASP A N    5  
ATOM 2749 C CA   . ASP A 1 23 ? 5.380   -3.094  -4.274  1.00 0.00 ? 23 ASP A CA   5  
ATOM 2750 C C    . ASP A 1 23 ? 6.591   -2.447  -4.951  1.00 0.00 ? 23 ASP A C    5  
ATOM 2751 O O    . ASP A 1 23 ? 7.712   -2.883  -4.802  1.00 0.00 ? 23 ASP A O    5  
ATOM 2752 C CB   . ASP A 1 23 ? 4.489   -3.744  -5.339  1.00 0.00 ? 23 ASP A CB   5  
ATOM 2753 C CG   . ASP A 1 23 ? 5.088   -5.100  -5.744  1.00 0.00 ? 23 ASP A CG   5  
ATOM 2754 O OD1  . ASP A 1 23 ? 5.917   -5.080  -6.640  1.00 0.00 ? 23 ASP A OD1  5  
ATOM 2755 O OD2  . ASP A 1 23 ? 4.687   -6.078  -5.135  1.00 0.00 ? 23 ASP A OD2  5  
ATOM 2756 H H    . ASP A 1 23 ? 3.629   -1.984  -3.708  1.00 0.00 ? 23 ASP A H    5  
ATOM 2757 H HA   . ASP A 1 23 ? 5.726   -3.828  -3.562  1.00 0.00 ? 23 ASP A HA   5  
ATOM 2758 H HB2  . ASP A 1 23 ? 3.483   -3.877  -4.974  1.00 0.00 ? 23 ASP A HB2  5  
ATOM 2759 H HB3  . ASP A 1 23 ? 4.434   -3.112  -6.212  1.00 0.00 ? 23 ASP A HB3  5  
ATOM 2760 N N    . VAL A 1 24 ? 6.271   -1.411  -5.677  1.00 0.00 ? 24 VAL A N    5  
ATOM 2761 C CA   . VAL A 1 24 ? 7.251   -0.592  -6.446  1.00 0.00 ? 24 VAL A CA   5  
ATOM 2762 C C    . VAL A 1 24 ? 8.391   -0.126  -5.537  1.00 0.00 ? 24 VAL A C    5  
ATOM 2763 O O    . VAL A 1 24 ? 9.555   -0.284  -5.849  1.00 0.00 ? 24 VAL A O    5  
ATOM 2764 C CB   . VAL A 1 24 ? 6.441   0.579   -7.042  1.00 0.00 ? 24 VAL A CB   5  
ATOM 2765 C CG1  . VAL A 1 24 ? 7.303   1.526   -7.860  1.00 0.00 ? 24 VAL A CG1  5  
ATOM 2766 C CG2  . VAL A 1 24 ? 5.322   0.013   -7.936  1.00 0.00 ? 24 VAL A CG2  5  
ATOM 2767 H H    . VAL A 1 24 ? 5.328   -1.164  -5.721  1.00 0.00 ? 24 VAL A H    5  
ATOM 2768 H HA   . VAL A 1 24 ? 7.665   -1.194  -7.236  1.00 0.00 ? 24 VAL A HA   5  
ATOM 2769 H HB   . VAL A 1 24 ? 5.993   1.156   -6.252  1.00 0.00 ? 24 VAL A HB   5  
ATOM 2770 H HG11 . VAL A 1 24 ? 7.832   0.979   -8.624  1.00 0.00 ? 24 VAL A HG11 5  
ATOM 2771 H HG12 . VAL A 1 24 ? 6.662   2.264   -8.323  1.00 0.00 ? 24 VAL A HG12 5  
ATOM 2772 H HG13 . VAL A 1 24 ? 8.002   2.028   -7.210  1.00 0.00 ? 24 VAL A HG13 5  
ATOM 2773 H HG21 . VAL A 1 24 ? 5.146   -1.032  -7.729  1.00 0.00 ? 24 VAL A HG21 5  
ATOM 2774 H HG22 . VAL A 1 24 ? 4.416   0.561   -7.733  1.00 0.00 ? 24 VAL A HG22 5  
ATOM 2775 H HG23 . VAL A 1 24 ? 5.573   0.113   -8.980  1.00 0.00 ? 24 VAL A HG23 5  
ATOM 2776 N N    . GLY A 1 25 ? 8.000   0.438   -4.428  1.00 0.00 ? 25 GLY A N    5  
ATOM 2777 C CA   . GLY A 1 25 ? 9.000   0.942   -3.437  1.00 0.00 ? 25 GLY A CA   5  
ATOM 2778 C C    . GLY A 1 25 ? 9.892   -0.195  -2.908  1.00 0.00 ? 25 GLY A C    5  
ATOM 2779 O O    . GLY A 1 25 ? 11.105  -0.132  -2.980  1.00 0.00 ? 25 GLY A O    5  
ATOM 2780 H H    . GLY A 1 25 ? 7.036   0.525   -4.269  1.00 0.00 ? 25 GLY A H    5  
ATOM 2781 H HA2  . GLY A 1 25 ? 9.617   1.693   -3.908  1.00 0.00 ? 25 GLY A HA2  5  
ATOM 2782 H HA3  . GLY A 1 25 ? 8.471   1.387   -2.607  1.00 0.00 ? 25 GLY A HA3  5  
ATOM 2783 N N    . SER A 1 26 ? 9.247   -1.211  -2.394  1.00 0.00 ? 26 SER A N    5  
ATOM 2784 C CA   . SER A 1 26 ? 9.957   -2.400  -1.831  1.00 0.00 ? 26 SER A CA   5  
ATOM 2785 C C    . SER A 1 26 ? 10.522  -3.360  -2.894  1.00 0.00 ? 26 SER A C    5  
ATOM 2786 O O    . SER A 1 26 ? 11.207  -4.308  -2.554  1.00 0.00 ? 26 SER A O    5  
ATOM 2787 C CB   . SER A 1 26 ? 8.967   -3.148  -0.923  1.00 0.00 ? 26 SER A CB   5  
ATOM 2788 O OG   . SER A 1 26 ? 9.789   -3.958  -0.092  1.00 0.00 ? 26 SER A OG   5  
ATOM 2789 H H    . SER A 1 26 ? 8.272   -1.194  -2.379  1.00 0.00 ? 26 SER A H    5  
ATOM 2790 H HA   . SER A 1 26 ? 10.778  -2.036  -1.231  1.00 0.00 ? 26 SER A HA   5  
ATOM 2791 H HB2  . SER A 1 26 ? 8.399   -2.466  -0.306  1.00 0.00 ? 26 SER A HB2  5  
ATOM 2792 H HB3  . SER A 1 26 ? 8.297   -3.776  -1.493  1.00 0.00 ? 26 SER A HB3  5  
ATOM 2793 H HG   . SER A 1 26 ? 9.564   -4.877  -0.252  1.00 0.00 ? 26 SER A HG   5  
ATOM 2794 N N    . ASN A 1 27 ? 10.237  -3.109  -4.150  1.00 0.00 ? 27 ASN A N    5  
ATOM 2795 C CA   . ASN A 1 27 ? 10.756  -4.010  -5.223  1.00 0.00 ? 27 ASN A CA   5  
ATOM 2796 C C    . ASN A 1 27 ? 12.273  -4.069  -5.167  1.00 0.00 ? 27 ASN A C    5  
ATOM 2797 O O    . ASN A 1 27 ? 12.828  -5.143  -5.102  1.00 0.00 ? 27 ASN A O    5  
ATOM 2798 C CB   . ASN A 1 27 ? 10.294  -3.484  -6.603  1.00 0.00 ? 27 ASN A CB   5  
ATOM 2799 C CG   . ASN A 1 27 ? 9.035   -4.233  -7.076  1.00 0.00 ? 27 ASN A CG   5  
ATOM 2800 O OD1  . ASN A 1 27 ? 8.826   -5.395  -6.788  1.00 0.00 ? 27 ASN A OD1  5  
ATOM 2801 N ND2  . ASN A 1 27 ? 8.167   -3.598  -7.813  1.00 0.00 ? 27 ASN A ND2  5  
ATOM 2802 H H    . ASN A 1 27 ? 9.688   -2.336  -4.394  1.00 0.00 ? 27 ASN A H    5  
ATOM 2803 H HA   . ASN A 1 27 ? 10.389  -5.002  -5.025  1.00 0.00 ? 27 ASN A HA   5  
ATOM 2804 H HB2  . ASN A 1 27 ? 10.067  -2.433  -6.547  1.00 0.00 ? 27 ASN A HB2  5  
ATOM 2805 H HB3  . ASN A 1 27 ? 11.071  -3.623  -7.337  1.00 0.00 ? 27 ASN A HB3  5  
ATOM 2806 H HD21 . ASN A 1 27 ? 8.326   -2.664  -8.060  1.00 0.00 ? 27 ASN A HD21 5  
ATOM 2807 H HD22 . ASN A 1 27 ? 7.357   -4.057  -8.117  1.00 0.00 ? 27 ASN A HD22 5  
ATOM 2808 N N    . LYS A 1 28 ? 12.906  -2.925  -5.185  1.00 0.00 ? 28 LYS A N    5  
ATOM 2809 C CA   . LYS A 1 28 ? 14.400  -2.877  -5.127  1.00 0.00 ? 28 LYS A CA   5  
ATOM 2810 C C    . LYS A 1 28 ? 14.891  -3.740  -3.950  1.00 0.00 ? 28 LYS A C    5  
ATOM 2811 O O    . LYS A 1 28 ? 15.867  -4.451  -4.072  1.00 0.00 ? 28 LYS A O    5  
ATOM 2812 C CB   . LYS A 1 28 ? 14.831  -1.406  -4.944  1.00 0.00 ? 28 LYS A CB   5  
ATOM 2813 C CG   . LYS A 1 28 ? 15.922  -1.052  -5.969  1.00 0.00 ? 28 LYS A CG   5  
ATOM 2814 C CD   . LYS A 1 28 ? 17.263  -1.687  -5.538  1.00 0.00 ? 28 LYS A CD   5  
ATOM 2815 C CE   . LYS A 1 28 ? 18.370  -1.293  -6.526  1.00 0.00 ? 28 LYS A CE   5  
ATOM 2816 N NZ   . LYS A 1 28 ? 19.622  -2.035  -6.199  1.00 0.00 ? 28 LYS A NZ   5  
ATOM 2817 H H    . LYS A 1 28 ? 12.386  -2.098  -5.242  1.00 0.00 ? 28 LYS A H    5  
ATOM 2818 H HA   . LYS A 1 28 ? 14.801  -3.301  -6.042  1.00 0.00 ? 28 LYS A HA   5  
ATOM 2819 H HB2  . LYS A 1 28 ? 13.984  -0.756  -5.107  1.00 0.00 ? 28 LYS A HB2  5  
ATOM 2820 H HB3  . LYS A 1 28 ? 15.197  -1.234  -3.942  1.00 0.00 ? 28 LYS A HB3  5  
ATOM 2821 H HG2  . LYS A 1 28 ? 15.628  -1.413  -6.945  1.00 0.00 ? 28 LYS A HG2  5  
ATOM 2822 H HG3  . LYS A 1 28 ? 16.015  0.021   -6.016  1.00 0.00 ? 28 LYS A HG3  5  
ATOM 2823 H HD2  . LYS A 1 28 ? 17.527  -1.344  -4.548  1.00 0.00 ? 28 LYS A HD2  5  
ATOM 2824 H HD3  . LYS A 1 28 ? 17.172  -2.762  -5.518  1.00 0.00 ? 28 LYS A HD3  5  
ATOM 2825 H HE2  . LYS A 1 28 ? 18.080  -1.539  -7.537  1.00 0.00 ? 28 LYS A HE2  5  
ATOM 2826 H HE3  . LYS A 1 28 ? 18.571  -0.234  -6.463  1.00 0.00 ? 28 LYS A HE3  5  
ATOM 2827 H HZ1  . LYS A 1 28 ? 19.459  -2.653  -5.378  1.00 0.00 ? 28 LYS A HZ1  5  
ATOM 2828 H HZ2  . LYS A 1 28 ? 19.902  -2.614  -7.016  1.00 0.00 ? 28 LYS A HZ2  5  
ATOM 2829 H HZ3  . LYS A 1 28 ? 20.379  -1.358  -5.977  1.00 0.00 ? 28 LYS A HZ3  5  
ATOM 2830 N N    . GLY A 1 29 ? 14.193  -3.665  -2.844  1.00 0.00 ? 29 GLY A N    5  
ATOM 2831 C CA   . GLY A 1 29 ? 14.585  -4.464  -1.643  1.00 0.00 ? 29 GLY A CA   5  
ATOM 2832 C C    . GLY A 1 29 ? 14.592  -5.959  -1.998  1.00 0.00 ? 29 GLY A C    5  
ATOM 2833 O O    . GLY A 1 29 ? 15.601  -6.628  -1.884  1.00 0.00 ? 29 GLY A O    5  
ATOM 2834 H H    . GLY A 1 29 ? 13.408  -3.080  -2.804  1.00 0.00 ? 29 GLY A H    5  
ATOM 2835 H HA2  . GLY A 1 29 ? 15.570  -4.163  -1.315  1.00 0.00 ? 29 GLY A HA2  5  
ATOM 2836 H HA3  . GLY A 1 29 ? 13.869  -4.288  -0.852  1.00 0.00 ? 29 GLY A HA3  5  
ATOM 2837 N N    . ALA A 1 30 ? 13.452  -6.437  -2.434  1.00 0.00 ? 30 ALA A N    5  
ATOM 2838 C CA   . ALA A 1 30 ? 13.330  -7.885  -2.814  1.00 0.00 ? 30 ALA A CA   5  
ATOM 2839 C C    . ALA A 1 30 ? 14.381  -8.266  -3.868  1.00 0.00 ? 30 ALA A C    5  
ATOM 2840 O O    . ALA A 1 30 ? 15.019  -9.294  -3.784  1.00 0.00 ? 30 ALA A O    5  
ATOM 2841 C CB   . ALA A 1 30 ? 11.920  -8.131  -3.366  1.00 0.00 ? 30 ALA A CB   5  
ATOM 2842 H H    . ALA A 1 30 ? 12.683  -5.831  -2.510  1.00 0.00 ? 30 ALA A H    5  
ATOM 2843 H HA   . ALA A 1 30 ? 13.509  -8.485  -1.932  1.00 0.00 ? 30 ALA A HA   5  
ATOM 2844 H HB1  . ALA A 1 30 ? 11.182  -7.838  -2.634  1.00 0.00 ? 30 ALA A HB1  5  
ATOM 2845 H HB2  . ALA A 1 30 ? 11.762  -7.552  -4.264  1.00 0.00 ? 30 ALA A HB2  5  
ATOM 2846 H HB3  . ALA A 1 30 ? 11.787  -9.178  -3.594  1.00 0.00 ? 30 ALA A HB3  5  
ATOM 2847 N N    . ILE A 1 31 ? 14.523  -7.403  -4.836  1.00 0.00 ? 31 ILE A N    5  
ATOM 2848 C CA   . ILE A 1 31 ? 15.487  -7.581  -5.952  1.00 0.00 ? 31 ILE A CA   5  
ATOM 2849 C C    . ILE A 1 31 ? 16.877  -7.843  -5.369  1.00 0.00 ? 31 ILE A C    5  
ATOM 2850 O O    . ILE A 1 31 ? 17.493  -8.841  -5.681  1.00 0.00 ? 31 ILE A O    5  
ATOM 2851 C CB   . ILE A 1 31 ? 15.372  -6.275  -6.792  1.00 0.00 ? 31 ILE A CB   5  
ATOM 2852 C CG1  . ILE A 1 31 ? 14.102  -6.400  -7.677  1.00 0.00 ? 31 ILE A CG1  5  
ATOM 2853 C CG2  . ILE A 1 31 ? 16.626  -5.990  -7.640  1.00 0.00 ? 31 ILE A CG2  5  
ATOM 2854 C CD1  . ILE A 1 31 ? 13.833  -5.106  -8.471  1.00 0.00 ? 31 ILE A CD1  5  
ATOM 2855 H H    . ILE A 1 31 ? 13.973  -6.601  -4.848  1.00 0.00 ? 31 ILE A H    5  
ATOM 2856 H HA   . ILE A 1 31 ? 15.195  -8.455  -6.512  1.00 0.00 ? 31 ILE A HA   5  
ATOM 2857 H HB   . ILE A 1 31 ? 15.233  -5.443  -6.123  1.00 0.00 ? 31 ILE A HB   5  
ATOM 2858 H HG12 . ILE A 1 31 ? 14.216  -7.236  -8.345  1.00 0.00 ? 31 ILE A HG12 5  
ATOM 2859 H HG13 . ILE A 1 31 ? 13.246  -6.600  -7.049  1.00 0.00 ? 31 ILE A HG13 5  
ATOM 2860 H HG21 . ILE A 1 31 ? 16.813  -6.800  -8.326  1.00 0.00 ? 31 ILE A HG21 5  
ATOM 2861 H HG22 . ILE A 1 31 ? 16.484  -5.077  -8.199  1.00 0.00 ? 31 ILE A HG22 5  
ATOM 2862 H HG23 . ILE A 1 31 ? 17.482  -5.856  -6.995  1.00 0.00 ? 31 ILE A HG23 5  
ATOM 2863 H HD11 . ILE A 1 31 ? 13.998  -4.237  -7.853  1.00 0.00 ? 31 ILE A HD11 5  
ATOM 2864 H HD12 . ILE A 1 31 ? 14.484  -5.054  -9.331  1.00 0.00 ? 31 ILE A HD12 5  
ATOM 2865 H HD13 . ILE A 1 31 ? 12.808  -5.096  -8.813  1.00 0.00 ? 31 ILE A HD13 5  
ATOM 2866 N N    . ILE A 1 32 ? 17.341  -6.950  -4.536  1.00 0.00 ? 32 ILE A N    5  
ATOM 2867 C CA   . ILE A 1 32 ? 18.689  -7.139  -3.922  1.00 0.00 ? 32 ILE A CA   5  
ATOM 2868 C C    . ILE A 1 32 ? 18.736  -8.501  -3.218  1.00 0.00 ? 32 ILE A C    5  
ATOM 2869 O O    . ILE A 1 32 ? 19.673  -9.254  -3.385  1.00 0.00 ? 32 ILE A O    5  
ATOM 2870 C CB   . ILE A 1 32 ? 18.943  -5.987  -2.916  1.00 0.00 ? 32 ILE A CB   5  
ATOM 2871 C CG1  . ILE A 1 32 ? 18.958  -4.643  -3.697  1.00 0.00 ? 32 ILE A CG1  5  
ATOM 2872 C CG2  . ILE A 1 32 ? 20.314  -6.195  -2.220  1.00 0.00 ? 32 ILE A CG2  5  
ATOM 2873 C CD1  . ILE A 1 32 ? 18.690  -3.462  -2.743  1.00 0.00 ? 32 ILE A CD1  5  
ATOM 2874 H H    . ILE A 1 32 ? 16.812  -6.157  -4.320  1.00 0.00 ? 32 ILE A H    5  
ATOM 2875 H HA   . ILE A 1 32 ? 19.418  -7.149  -4.712  1.00 0.00 ? 32 ILE A HA   5  
ATOM 2876 H HB   . ILE A 1 32 ? 18.158  -5.975  -2.173  1.00 0.00 ? 32 ILE A HB   5  
ATOM 2877 H HG12 . ILE A 1 32 ? 19.908  -4.515  -4.187  1.00 0.00 ? 32 ILE A HG12 5  
ATOM 2878 H HG13 . ILE A 1 32 ? 18.198  -4.653  -4.461  1.00 0.00 ? 32 ILE A HG13 5  
ATOM 2879 H HG21 . ILE A 1 32 ? 21.080  -6.407  -2.952  1.00 0.00 ? 32 ILE A HG21 5  
ATOM 2880 H HG22 . ILE A 1 32 ? 20.600  -5.313  -1.666  1.00 0.00 ? 32 ILE A HG22 5  
ATOM 2881 H HG23 . ILE A 1 32 ? 20.256  -7.024  -1.530  1.00 0.00 ? 32 ILE A HG23 5  
ATOM 2882 H HD11 . ILE A 1 32 ? 19.247  -3.573  -1.824  1.00 0.00 ? 32 ILE A HD11 5  
ATOM 2883 H HD12 . ILE A 1 32 ? 18.989  -2.537  -3.214  1.00 0.00 ? 32 ILE A HD12 5  
ATOM 2884 H HD13 . ILE A 1 32 ? 17.638  -3.404  -2.505  1.00 0.00 ? 32 ILE A HD13 5  
ATOM 2885 N N    . GLY A 1 33 ? 17.713  -8.783  -2.458  1.00 0.00 ? 33 GLY A N    5  
ATOM 2886 C CA   . GLY A 1 33 ? 17.659  -10.083 -1.727  1.00 0.00 ? 33 GLY A CA   5  
ATOM 2887 C C    . GLY A 1 33 ? 17.841  -11.279 -2.671  1.00 0.00 ? 33 GLY A C    5  
ATOM 2888 O O    . GLY A 1 33 ? 18.649  -12.147 -2.405  1.00 0.00 ? 33 GLY A O    5  
ATOM 2889 H H    . GLY A 1 33 ? 16.983  -8.136  -2.372  1.00 0.00 ? 33 GLY A H    5  
ATOM 2890 H HA2  . GLY A 1 33 ? 18.450  -10.099 -0.989  1.00 0.00 ? 33 GLY A HA2  5  
ATOM 2891 H HA3  . GLY A 1 33 ? 16.707  -10.171 -1.230  1.00 0.00 ? 33 GLY A HA3  5  
ATOM 2892 N N    . LEU A 1 34 ? 17.103  -11.298 -3.754  1.00 0.00 ? 34 LEU A N    5  
ATOM 2893 C CA   . LEU A 1 34 ? 17.241  -12.444 -4.699  1.00 0.00 ? 34 LEU A CA   5  
ATOM 2894 C C    . LEU A 1 34 ? 18.570  -12.471 -5.465  1.00 0.00 ? 34 LEU A C    5  
ATOM 2895 O O    . LEU A 1 34 ? 19.102  -13.549 -5.646  1.00 0.00 ? 34 LEU A O    5  
ATOM 2896 C CB   . LEU A 1 34 ? 16.009  -12.414 -5.673  1.00 0.00 ? 34 LEU A CB   5  
ATOM 2897 C CG   . LEU A 1 34 ? 16.199  -11.549 -6.950  1.00 0.00 ? 34 LEU A CG   5  
ATOM 2898 C CD1  . LEU A 1 34 ? 16.732  -12.419 -8.113  1.00 0.00 ? 34 LEU A CD1  5  
ATOM 2899 C CD2  . LEU A 1 34 ? 14.830  -10.965 -7.367  1.00 0.00 ? 34 LEU A CD2  5  
ATOM 2900 H H    . LEU A 1 34 ? 16.473  -10.571 -3.933  1.00 0.00 ? 34 LEU A H    5  
ATOM 2901 H HA   . LEU A 1 34 ? 17.196  -13.343 -4.108  1.00 0.00 ? 34 LEU A HA   5  
ATOM 2902 H HB2  . LEU A 1 34 ? 15.775  -13.430 -5.958  1.00 0.00 ? 34 LEU A HB2  5  
ATOM 2903 H HB3  . LEU A 1 34 ? 15.165  -12.033 -5.120  1.00 0.00 ? 34 LEU A HB3  5  
ATOM 2904 H HG   . LEU A 1 34 ? 16.881  -10.741 -6.757  1.00 0.00 ? 34 LEU A HG   5  
ATOM 2905 H HD11 . LEU A 1 34 ? 16.035  -13.214 -8.338  1.00 0.00 ? 34 LEU A HD11 5  
ATOM 2906 H HD12 . LEU A 1 34 ? 16.860  -11.811 -8.996  1.00 0.00 ? 34 LEU A HD12 5  
ATOM 2907 H HD13 . LEU A 1 34 ? 17.685  -12.858 -7.860  1.00 0.00 ? 34 LEU A HD13 5  
ATOM 2908 H HD21 . LEU A 1 34 ? 14.361  -10.470 -6.529  1.00 0.00 ? 34 LEU A HD21 5  
ATOM 2909 H HD22 . LEU A 1 34 ? 14.961  -10.246 -8.162  1.00 0.00 ? 34 LEU A HD22 5  
ATOM 2910 H HD23 . LEU A 1 34 ? 14.173  -11.750 -7.713  1.00 0.00 ? 34 LEU A HD23 5  
ATOM 2911 N N    . MET A 1 35 ? 19.095  -11.348 -5.901  1.00 0.00 ? 35 MET A N    5  
ATOM 2912 C CA   . MET A 1 35 ? 20.399  -11.428 -6.640  1.00 0.00 ? 35 MET A CA   5  
ATOM 2913 C C    . MET A 1 35 ? 21.492  -11.904 -5.667  1.00 0.00 ? 35 MET A C    5  
ATOM 2914 O O    . MET A 1 35 ? 22.406  -12.606 -6.053  1.00 0.00 ? 35 MET A O    5  
ATOM 2915 C CB   . MET A 1 35 ? 20.761  -10.031 -7.232  1.00 0.00 ? 35 MET A CB   5  
ATOM 2916 C CG   . MET A 1 35 ? 20.854  -8.945  -6.164  1.00 0.00 ? 35 MET A CG   5  
ATOM 2917 S SD   . MET A 1 35 ? 21.307  -7.281  -6.718  1.00 0.00 ? 35 MET A SD   5  
ATOM 2918 C CE   . MET A 1 35 ? 22.801  -7.064  -5.717  1.00 0.00 ? 35 MET A CE   5  
ATOM 2919 H H    . MET A 1 35 ? 18.645  -10.488 -5.751  1.00 0.00 ? 35 MET A H    5  
ATOM 2920 H HA   . MET A 1 35 ? 20.305  -12.149 -7.436  1.00 0.00 ? 35 MET A HA   5  
ATOM 2921 H HB2  . MET A 1 35 ? 21.707  -10.098 -7.751  1.00 0.00 ? 35 MET A HB2  5  
ATOM 2922 H HB3  . MET A 1 35 ? 20.005  -9.748  -7.949  1.00 0.00 ? 35 MET A HB3  5  
ATOM 2923 H HG2  . MET A 1 35 ? 19.884  -8.876  -5.708  1.00 0.00 ? 35 MET A HG2  5  
ATOM 2924 H HG3  . MET A 1 35 ? 21.558  -9.250  -5.406  1.00 0.00 ? 35 MET A HG3  5  
ATOM 2925 H HE1  . MET A 1 35 ? 22.556  -7.175  -4.672  1.00 0.00 ? 35 MET A HE1  5  
ATOM 2926 H HE2  . MET A 1 35 ? 23.534  -7.807  -5.997  1.00 0.00 ? 35 MET A HE2  5  
ATOM 2927 H HE3  . MET A 1 35 ? 23.208  -6.079  -5.888  1.00 0.00 ? 35 MET A HE3  5  
ATOM 2928 N N    . VAL A 1 36 ? 21.349  -11.496 -4.430  1.00 0.00 ? 36 VAL A N    5  
ATOM 2929 C CA   . VAL A 1 36 ? 22.316  -11.873 -3.355  1.00 0.00 ? 36 VAL A CA   5  
ATOM 2930 C C    . VAL A 1 36 ? 22.232  -13.397 -3.128  1.00 0.00 ? 36 VAL A C    5  
ATOM 2931 O O    . VAL A 1 36 ? 23.216  -14.094 -3.281  1.00 0.00 ? 36 VAL A O    5  
ATOM 2932 C CB   . VAL A 1 36 ? 21.937  -11.070 -2.065  1.00 0.00 ? 36 VAL A CB   5  
ATOM 2933 C CG1  . VAL A 1 36 ? 22.593  -11.691 -0.807  1.00 0.00 ? 36 VAL A CG1  5  
ATOM 2934 C CG2  . VAL A 1 36 ? 22.443  -9.615  -2.214  1.00 0.00 ? 36 VAL A CG2  5  
ATOM 2935 H H    . VAL A 1 36 ? 20.595  -10.920 -4.199  1.00 0.00 ? 36 VAL A H    5  
ATOM 2936 H HA   . VAL A 1 36 ? 23.315  -11.621 -3.680  1.00 0.00 ? 36 VAL A HA   5  
ATOM 2937 H HB   . VAL A 1 36 ? 20.862  -11.057 -1.935  1.00 0.00 ? 36 VAL A HB   5  
ATOM 2938 H HG11 . VAL A 1 36 ? 23.638  -11.899 -0.988  1.00 0.00 ? 36 VAL A HG11 5  
ATOM 2939 H HG12 . VAL A 1 36 ? 22.517  -11.008 0.029   1.00 0.00 ? 36 VAL A HG12 5  
ATOM 2940 H HG13 . VAL A 1 36 ? 22.093  -12.611 -0.542  1.00 0.00 ? 36 VAL A HG13 5  
ATOM 2941 H HG21 . VAL A 1 36 ? 22.189  -9.223  -3.188  1.00 0.00 ? 36 VAL A HG21 5  
ATOM 2942 H HG22 . VAL A 1 36 ? 21.988  -8.989  -1.460  1.00 0.00 ? 36 VAL A HG22 5  
ATOM 2943 H HG23 . VAL A 1 36 ? 23.516  -9.574  -2.097  1.00 0.00 ? 36 VAL A HG23 5  
ATOM 2944 N N    . GLY A 1 37 ? 21.057  -13.862 -2.774  1.00 0.00 ? 37 GLY A N    5  
ATOM 2945 C CA   . GLY A 1 37 ? 20.847  -15.321 -2.525  1.00 0.00 ? 37 GLY A CA   5  
ATOM 2946 C C    . GLY A 1 37 ? 20.612  -16.056 -3.848  1.00 0.00 ? 37 GLY A C    5  
ATOM 2947 O O    . GLY A 1 37 ? 21.491  -16.728 -4.353  1.00 0.00 ? 37 GLY A O    5  
ATOM 2948 H H    . GLY A 1 37 ? 20.301  -13.252 -2.668  1.00 0.00 ? 37 GLY A H    5  
ATOM 2949 H HA2  . GLY A 1 37 ? 21.713  -15.735 -2.029  1.00 0.00 ? 37 GLY A HA2  5  
ATOM 2950 H HA3  . GLY A 1 37 ? 19.981  -15.445 -1.891  1.00 0.00 ? 37 GLY A HA3  5  
ATOM 2951 N N    . GLY A 1 38 ? 19.420  -15.897 -4.366  1.00 0.00 ? 38 GLY A N    5  
ATOM 2952 C CA   . GLY A 1 38 ? 19.039  -16.552 -5.655  1.00 0.00 ? 38 GLY A CA   5  
ATOM 2953 C C    . GLY A 1 38 ? 17.600  -16.168 -6.008  1.00 0.00 ? 38 GLY A C    5  
ATOM 2954 O O    . GLY A 1 38 ? 17.360  -15.447 -6.959  1.00 0.00 ? 38 GLY A O    5  
ATOM 2955 H H    . GLY A 1 38 ? 18.768  -15.335 -3.898  1.00 0.00 ? 38 GLY A H    5  
ATOM 2956 H HA2  . GLY A 1 38 ? 19.704  -16.219 -6.439  1.00 0.00 ? 38 GLY A HA2  5  
ATOM 2957 H HA3  . GLY A 1 38 ? 19.108  -17.625 -5.548  1.00 0.00 ? 38 GLY A HA3  5  
ATOM 2958 N N    . VAL A 1 39 ? 16.690  -16.672 -5.214  1.00 0.00 ? 39 VAL A N    5  
ATOM 2959 C CA   . VAL A 1 39 ? 15.233  -16.409 -5.397  1.00 0.00 ? 39 VAL A CA   5  
ATOM 2960 C C    . VAL A 1 39 ? 14.703  -16.024 -4.006  1.00 0.00 ? 39 VAL A C    5  
ATOM 2961 O O    . VAL A 1 39 ? 13.802  -16.634 -3.462  1.00 0.00 ? 39 VAL A O    5  
ATOM 2962 C CB   . VAL A 1 39 ? 14.552  -17.705 -5.945  1.00 0.00 ? 39 VAL A CB   5  
ATOM 2963 C CG1  . VAL A 1 39 ? 13.103  -17.381 -6.386  1.00 0.00 ? 39 VAL A CG1  5  
ATOM 2964 C CG2  . VAL A 1 39 ? 15.330  -18.231 -7.175  1.00 0.00 ? 39 VAL A CG2  5  
ATOM 2965 H H    . VAL A 1 39 ? 16.966  -17.241 -4.471  1.00 0.00 ? 39 VAL A H    5  
ATOM 2966 H HA   . VAL A 1 39 ? 15.102  -15.577 -6.067  1.00 0.00 ? 39 VAL A HA   5  
ATOM 2967 H HB   . VAL A 1 39 ? 14.539  -18.466 -5.179  1.00 0.00 ? 39 VAL A HB   5  
ATOM 2968 H HG11 . VAL A 1 39 ? 13.100  -16.589 -7.119  1.00 0.00 ? 39 VAL A HG11 5  
ATOM 2969 H HG12 . VAL A 1 39 ? 12.645  -18.258 -6.823  1.00 0.00 ? 39 VAL A HG12 5  
ATOM 2970 H HG13 . VAL A 1 39 ? 12.509  -17.072 -5.540  1.00 0.00 ? 39 VAL A HG13 5  
ATOM 2971 H HG21 . VAL A 1 39 ? 15.493  -17.436 -7.888  1.00 0.00 ? 39 VAL A HG21 5  
ATOM 2972 H HG22 . VAL A 1 39 ? 16.288  -18.624 -6.868  1.00 0.00 ? 39 VAL A HG22 5  
ATOM 2973 H HG23 . VAL A 1 39 ? 14.775  -19.021 -7.659  1.00 0.00 ? 39 VAL A HG23 5  
ATOM 2974 N N    . VAL A 1 40 ? 15.329  -14.991 -3.500  1.00 0.00 ? 40 VAL A N    5  
ATOM 2975 C CA   . VAL A 1 40 ? 15.039  -14.388 -2.162  1.00 0.00 ? 40 VAL A CA   5  
ATOM 2976 C C    . VAL A 1 40 ? 15.277  -15.425 -1.039  1.00 0.00 ? 40 VAL A C    5  
ATOM 2977 O O    . VAL A 1 40 ? 14.400  -16.242 -0.802  1.00 0.00 ? 40 VAL A O    5  
ATOM 2978 C CB   . VAL A 1 40 ? 13.559  -13.867 -2.167  1.00 0.00 ? 40 VAL A CB   5  
ATOM 2979 C CG1  . VAL A 1 40 ? 13.198  -13.266 -0.786  1.00 0.00 ? 40 VAL A CG1  5  
ATOM 2980 C CG2  . VAL A 1 40 ? 13.407  -12.767 -3.239  1.00 0.00 ? 40 VAL A CG2  5  
ATOM 2981 O OXT  . VAL A 1 40 ? 16.352  -15.337 -0.470  1.00 0.00 ? 40 VAL A OXT  5  
ATOM 2982 H H    . VAL A 1 40 ? 16.034  -14.592 -4.042  1.00 0.00 ? 40 VAL A H    5  
ATOM 2983 H HA   . VAL A 1 40 ? 15.710  -13.553 -2.018  1.00 0.00 ? 40 VAL A HA   5  
ATOM 2984 H HB   . VAL A 1 40 ? 12.893  -14.679 -2.405  1.00 0.00 ? 40 VAL A HB   5  
ATOM 2985 H HG11 . VAL A 1 40 ? 13.973  -12.588 -0.458  1.00 0.00 ? 40 VAL A HG11 5  
ATOM 2986 H HG12 . VAL A 1 40 ? 12.265  -12.724 -0.844  1.00 0.00 ? 40 VAL A HG12 5  
ATOM 2987 H HG13 . VAL A 1 40 ? 13.091  -14.050 -0.052  1.00 0.00 ? 40 VAL A HG13 5  
ATOM 2988 H HG21 . VAL A 1 40 ? 14.169  -12.011 -3.112  1.00 0.00 ? 40 VAL A HG21 5  
ATOM 2989 H HG22 . VAL A 1 40 ? 13.500  -13.200 -4.224  1.00 0.00 ? 40 VAL A HG22 5  
ATOM 2990 H HG23 . VAL A 1 40 ? 12.437  -12.299 -3.162  1.00 0.00 ? 40 VAL A HG23 5  
ATOM 2991 N N    . ASP A 1 1  ? -5.709  -13.409 1.653   1.00 0.00 ? 1  ASP A N    6  
ATOM 2992 C CA   . ASP A 1 1  ? -6.803  -14.149 0.960   1.00 0.00 ? 1  ASP A CA   6  
ATOM 2993 C C    . ASP A 1 1  ? -6.849  -13.761 -0.530  1.00 0.00 ? 1  ASP A C    6  
ATOM 2994 O O    . ASP A 1 1  ? -5.980  -13.068 -1.022  1.00 0.00 ? 1  ASP A O    6  
ATOM 2995 C CB   . ASP A 1 1  ? -8.159  -13.817 1.638   1.00 0.00 ? 1  ASP A CB   6  
ATOM 2996 C CG   . ASP A 1 1  ? -8.479  -12.319 1.471   1.00 0.00 ? 1  ASP A CG   6  
ATOM 2997 O OD1  . ASP A 1 1  ? -7.970  -11.563 2.282   1.00 0.00 ? 1  ASP A OD1  6  
ATOM 2998 O OD2  . ASP A 1 1  ? -9.210  -12.017 0.540   1.00 0.00 ? 1  ASP A OD2  6  
ATOM 2999 H H1   . ASP A 1 1  ? -5.226  -12.788 0.973   1.00 0.00 ? 1  ASP A H1   6  
ATOM 3000 H H2   . ASP A 1 1  ? -6.109  -12.833 2.422   1.00 0.00 ? 1  ASP A H2   6  
ATOM 3001 H H3   . ASP A 1 1  ? -5.027  -14.089 2.044   1.00 0.00 ? 1  ASP A H3   6  
ATOM 3002 H HA   . ASP A 1 1  ? -6.604  -15.208 1.036   1.00 0.00 ? 1  ASP A HA   6  
ATOM 3003 H HB2  . ASP A 1 1  ? -8.954  -14.403 1.197   1.00 0.00 ? 1  ASP A HB2  6  
ATOM 3004 H HB3  . ASP A 1 1  ? -8.111  -14.053 2.692   1.00 0.00 ? 1  ASP A HB3  6  
ATOM 3005 N N    . ALA A 1 2  ? -7.878  -14.234 -1.190  1.00 0.00 ? 2  ALA A N    6  
ATOM 3006 C CA   . ALA A 1 2  ? -8.106  -13.969 -2.648  1.00 0.00 ? 2  ALA A CA   6  
ATOM 3007 C C    . ALA A 1 2  ? -6.892  -14.264 -3.545  1.00 0.00 ? 2  ALA A C    6  
ATOM 3008 O O    . ALA A 1 2  ? -6.739  -13.691 -4.607  1.00 0.00 ? 2  ALA A O    6  
ATOM 3009 C CB   . ALA A 1 2  ? -8.539  -12.493 -2.804  1.00 0.00 ? 2  ALA A CB   6  
ATOM 3010 H H    . ALA A 1 2  ? -8.526  -14.786 -0.708  1.00 0.00 ? 2  ALA A H    6  
ATOM 3011 H HA   . ALA A 1 2  ? -8.906  -14.615 -2.966  1.00 0.00 ? 2  ALA A HA   6  
ATOM 3012 H HB1  . ALA A 1 2  ? -9.401  -12.296 -2.185  1.00 0.00 ? 2  ALA A HB1  6  
ATOM 3013 H HB2  . ALA A 1 2  ? -7.737  -11.832 -2.510  1.00 0.00 ? 2  ALA A HB2  6  
ATOM 3014 H HB3  . ALA A 1 2  ? -8.801  -12.289 -3.832  1.00 0.00 ? 2  ALA A HB3  6  
ATOM 3015 N N    . GLU A 1 3  ? -6.069  -15.164 -3.078  1.00 0.00 ? 3  GLU A N    6  
ATOM 3016 C CA   . GLU A 1 3  ? -4.837  -15.571 -3.829  1.00 0.00 ? 3  GLU A CA   6  
ATOM 3017 C C    . GLU A 1 3  ? -5.114  -16.931 -4.490  1.00 0.00 ? 3  GLU A C    6  
ATOM 3018 O O    . GLU A 1 3  ? -4.338  -17.864 -4.413  1.00 0.00 ? 3  GLU A O    6  
ATOM 3019 C CB   . GLU A 1 3  ? -3.654  -15.650 -2.825  1.00 0.00 ? 3  GLU A CB   6  
ATOM 3020 C CG   . GLU A 1 3  ? -3.951  -16.644 -1.671  1.00 0.00 ? 3  GLU A CG   6  
ATOM 3021 C CD   . GLU A 1 3  ? -3.389  -16.082 -0.354  1.00 0.00 ? 3  GLU A CD   6  
ATOM 3022 O OE1  . GLU A 1 3  ? -4.034  -15.190 0.170   1.00 0.00 ? 3  GLU A OE1  6  
ATOM 3023 O OE2  . GLU A 1 3  ? -2.349  -16.574 0.053   1.00 0.00 ? 3  GLU A OE2  6  
ATOM 3024 H H    . GLU A 1 3  ? -6.276  -15.576 -2.213  1.00 0.00 ? 3  GLU A H    6  
ATOM 3025 H HA   . GLU A 1 3  ? -4.619  -14.847 -4.600  1.00 0.00 ? 3  GLU A HA   6  
ATOM 3026 H HB2  . GLU A 1 3  ? -2.760  -15.963 -3.345  1.00 0.00 ? 3  GLU A HB2  6  
ATOM 3027 H HB3  . GLU A 1 3  ? -3.482  -14.658 -2.430  1.00 0.00 ? 3  GLU A HB3  6  
ATOM 3028 H HG2  . GLU A 1 3  ? -5.012  -16.807 -1.552  1.00 0.00 ? 3  GLU A HG2  6  
ATOM 3029 H HG3  . GLU A 1 3  ? -3.485  -17.595 -1.880  1.00 0.00 ? 3  GLU A HG3  6  
ATOM 3030 N N    . PHE A 1 4  ? -6.255  -16.966 -5.128  1.00 0.00 ? 4  PHE A N    6  
ATOM 3031 C CA   . PHE A 1 4  ? -6.740  -18.184 -5.845  1.00 0.00 ? 4  PHE A CA   6  
ATOM 3032 C C    . PHE A 1 4  ? -6.985  -17.795 -7.311  1.00 0.00 ? 4  PHE A C    6  
ATOM 3033 O O    . PHE A 1 4  ? -8.105  -17.627 -7.755  1.00 0.00 ? 4  PHE A O    6  
ATOM 3034 C CB   . PHE A 1 4  ? -8.052  -18.680 -5.147  1.00 0.00 ? 4  PHE A CB   6  
ATOM 3035 C CG   . PHE A 1 4  ? -8.028  -18.333 -3.643  1.00 0.00 ? 4  PHE A CG   6  
ATOM 3036 C CD1  . PHE A 1 4  ? -7.085  -18.903 -2.806  1.00 0.00 ? 4  PHE A CD1  6  
ATOM 3037 C CD2  . PHE A 1 4  ? -8.944  -17.442 -3.111  1.00 0.00 ? 4  PHE A CD2  6  
ATOM 3038 C CE1  . PHE A 1 4  ? -7.056  -18.588 -1.464  1.00 0.00 ? 4  PHE A CE1  6  
ATOM 3039 C CE2  . PHE A 1 4  ? -8.915  -17.127 -1.768  1.00 0.00 ? 4  PHE A CE2  6  
ATOM 3040 C CZ   . PHE A 1 4  ? -7.972  -17.700 -0.943  1.00 0.00 ? 4  PHE A CZ   6  
ATOM 3041 H H    . PHE A 1 4  ? -6.806  -16.160 -5.136  1.00 0.00 ? 4  PHE A H    6  
ATOM 3042 H HA   . PHE A 1 4  ? -5.987  -18.958 -5.809  1.00 0.00 ? 4  PHE A HA   6  
ATOM 3043 H HB2  . PHE A 1 4  ? -8.929  -18.231 -5.592  1.00 0.00 ? 4  PHE A HB2  6  
ATOM 3044 H HB3  . PHE A 1 4  ? -8.131  -19.753 -5.249  1.00 0.00 ? 4  PHE A HB3  6  
ATOM 3045 H HD1  . PHE A 1 4  ? -6.363  -19.603 -3.205  1.00 0.00 ? 4  PHE A HD1  6  
ATOM 3046 H HD2  . PHE A 1 4  ? -9.688  -16.988 -3.746  1.00 0.00 ? 4  PHE A HD2  6  
ATOM 3047 H HE1  . PHE A 1 4  ? -6.316  -19.039 -0.820  1.00 0.00 ? 4  PHE A HE1  6  
ATOM 3048 H HE2  . PHE A 1 4  ? -9.634  -16.430 -1.362  1.00 0.00 ? 4  PHE A HE2  6  
ATOM 3049 H HZ   . PHE A 1 4  ? -7.949  -17.452 0.108   1.00 0.00 ? 4  PHE A HZ   6  
ATOM 3050 N N    . ARG A 1 5  ? -5.887  -17.662 -8.013  1.00 0.00 ? 5  ARG A N    6  
ATOM 3051 C CA   . ARG A 1 5  ? -5.894  -17.287 -9.463  1.00 0.00 ? 5  ARG A CA   6  
ATOM 3052 C C    . ARG A 1 5  ? -6.709  -16.009 -9.719  1.00 0.00 ? 5  ARG A C    6  
ATOM 3053 O O    . ARG A 1 5  ? -7.798  -16.046 -10.262 1.00 0.00 ? 5  ARG A O    6  
ATOM 3054 C CB   . ARG A 1 5  ? -6.476  -18.479 -10.292 1.00 0.00 ? 5  ARG A CB   6  
ATOM 3055 C CG   . ARG A 1 5  ? -5.459  -19.651 -10.364 1.00 0.00 ? 5  ARG A CG   6  
ATOM 3056 C CD   . ARG A 1 5  ? -4.126  -19.226 -11.031 1.00 0.00 ? 5  ARG A CD   6  
ATOM 3057 N NE   . ARG A 1 5  ? -4.420  -18.368 -12.225 1.00 0.00 ? 5  ARG A NE   6  
ATOM 3058 C CZ   . ARG A 1 5  ? -3.537  -17.526 -12.707 1.00 0.00 ? 5  ARG A CZ   6  
ATOM 3059 N NH1  . ARG A 1 5  ? -2.357  -17.405 -12.159 1.00 0.00 ? 5  ARG A NH1  6  
ATOM 3060 N NH2  . ARG A 1 5  ? -3.875  -16.818 -13.748 1.00 0.00 ? 5  ARG A NH2  6  
ATOM 3061 H H    . ARG A 1 5  ? -5.028  -17.814 -7.567  1.00 0.00 ? 5  ARG A H    6  
ATOM 3062 H HA   . ARG A 1 5  ? -4.876  -17.087 -9.762  1.00 0.00 ? 5  ARG A HA   6  
ATOM 3063 H HB2  . ARG A 1 5  ? -7.385  -18.836 -9.833  1.00 0.00 ? 5  ARG A HB2  6  
ATOM 3064 H HB3  . ARG A 1 5  ? -6.717  -18.149 -11.291 1.00 0.00 ? 5  ARG A HB3  6  
ATOM 3065 H HG2  . ARG A 1 5  ? -5.260  -20.013 -9.367  1.00 0.00 ? 5  ARG A HG2  6  
ATOM 3066 H HG3  . ARG A 1 5  ? -5.896  -20.459 -10.934 1.00 0.00 ? 5  ARG A HG3  6  
ATOM 3067 H HD2  . ARG A 1 5  ? -3.521  -18.676 -10.324 1.00 0.00 ? 5  ARG A HD2  6  
ATOM 3068 H HD3  . ARG A 1 5  ? -3.580  -20.098 -11.357 1.00 0.00 ? 5  ARG A HD3  6  
ATOM 3069 H HE   . ARG A 1 5  ? -5.295  -18.437 -12.659 1.00 0.00 ? 5  ARG A HE   6  
ATOM 3070 H HH11 . ARG A 1 5  ? -2.111  -17.955 -11.361 1.00 0.00 ? 5  ARG A HH11 6  
ATOM 3071 H HH12 . ARG A 1 5  ? -1.696  -16.757 -12.538 1.00 0.00 ? 5  ARG A HH12 6  
ATOM 3072 H HH21 . ARG A 1 5  ? -4.782  -16.926 -14.154 1.00 0.00 ? 5  ARG A HH21 6  
ATOM 3073 H HH22 . ARG A 1 5  ? -3.227  -16.165 -14.141 1.00 0.00 ? 5  ARG A HH22 6  
ATOM 3074 N N    . HIS A 1 6  ? -6.119  -14.914 -9.300  1.00 0.00 ? 6  HIS A N    6  
ATOM 3075 C CA   . HIS A 1 6  ? -6.710  -13.540 -9.437  1.00 0.00 ? 6  HIS A CA   6  
ATOM 3076 C C    . HIS A 1 6  ? -8.249  -13.471 -9.311  1.00 0.00 ? 6  HIS A C    6  
ATOM 3077 O O    . HIS A 1 6  ? -8.908  -12.733 -10.021 1.00 0.00 ? 6  HIS A O    6  
ATOM 3078 C CB   . HIS A 1 6  ? -6.243  -12.966 -10.811 1.00 0.00 ? 6  HIS A CB   6  
ATOM 3079 C CG   . HIS A 1 6  ? -6.755  -13.835 -11.969 1.00 0.00 ? 6  HIS A CG   6  
ATOM 3080 N ND1  . HIS A 1 6  ? -6.180  -14.907 -12.407 1.00 0.00 ? 6  HIS A ND1  6  
ATOM 3081 C CD2  . HIS A 1 6  ? -7.877  -13.698 -12.770 1.00 0.00 ? 6  HIS A CD2  6  
ATOM 3082 C CE1  . HIS A 1 6  ? -6.867  -15.402 -13.386 1.00 0.00 ? 6  HIS A CE1  6  
ATOM 3083 N NE2  . HIS A 1 6  ? -7.931  -14.681 -13.645 1.00 0.00 ? 6  HIS A NE2  6  
ATOM 3084 H H    . HIS A 1 6  ? -5.241  -15.000 -8.873  1.00 0.00 ? 6  HIS A H    6  
ATOM 3085 H HA   . HIS A 1 6  ? -6.293  -12.927 -8.651  1.00 0.00 ? 6  HIS A HA   6  
ATOM 3086 H HB2  . HIS A 1 6  ? -6.611  -11.959 -10.942 1.00 0.00 ? 6  HIS A HB2  6  
ATOM 3087 H HB3  . HIS A 1 6  ? -5.163  -12.945 -10.850 1.00 0.00 ? 6  HIS A HB3  6  
ATOM 3088 H HD1  . HIS A 1 6  ? -5.350  -15.288 -12.051 1.00 0.00 ? 6  HIS A HD1  6  
ATOM 3089 H HD2  . HIS A 1 6  ? -8.603  -12.902 -12.688 1.00 0.00 ? 6  HIS A HD2  6  
ATOM 3090 H HE1  . HIS A 1 6  ? -6.600  -16.298 -13.925 1.00 0.00 ? 6  HIS A HE1  6  
ATOM 3091 N N    . ASP A 1 7  ? -8.776  -14.248 -8.399  1.00 0.00 ? 7  ASP A N    6  
ATOM 3092 C CA   . ASP A 1 7  ? -10.249 -14.284 -8.165  1.00 0.00 ? 7  ASP A CA   6  
ATOM 3093 C C    . ASP A 1 7  ? -10.770 -12.930 -7.664  1.00 0.00 ? 7  ASP A C    6  
ATOM 3094 O O    . ASP A 1 7  ? -9.996  -12.098 -7.232  1.00 0.00 ? 7  ASP A O    6  
ATOM 3095 C CB   . ASP A 1 7  ? -10.542 -15.377 -7.134  1.00 0.00 ? 7  ASP A CB   6  
ATOM 3096 C CG   . ASP A 1 7  ? -9.806  -15.056 -5.822  1.00 0.00 ? 7  ASP A CG   6  
ATOM 3097 O OD1  . ASP A 1 7  ? -10.402 -14.370 -5.009  1.00 0.00 ? 7  ASP A OD1  6  
ATOM 3098 O OD2  . ASP A 1 7  ? -8.683  -15.516 -5.714  1.00 0.00 ? 7  ASP A OD2  6  
ATOM 3099 H H    . ASP A 1 7  ? -8.208  -14.824 -7.849  1.00 0.00 ? 7  ASP A H    6  
ATOM 3100 H HA   . ASP A 1 7  ? -10.737 -14.524 -9.099  1.00 0.00 ? 7  ASP A HA   6  
ATOM 3101 H HB2  . ASP A 1 7  ? -11.600 -15.424 -6.944  1.00 0.00 ? 7  ASP A HB2  6  
ATOM 3102 H HB3  . ASP A 1 7  ? -10.218 -16.338 -7.505  1.00 0.00 ? 7  ASP A HB3  6  
ATOM 3103 N N    . SER A 1 8  ? -12.071 -12.774 -7.742  1.00 0.00 ? 8  SER A N    6  
ATOM 3104 C CA   . SER A 1 8  ? -12.773 -11.523 -7.302  1.00 0.00 ? 8  SER A CA   6  
ATOM 3105 C C    . SER A 1 8  ? -12.111 -10.231 -7.830  1.00 0.00 ? 8  SER A C    6  
ATOM 3106 O O    . SER A 1 8  ? -11.371 -10.265 -8.795  1.00 0.00 ? 8  SER A O    6  
ATOM 3107 C CB   . SER A 1 8  ? -12.829 -11.543 -5.738  1.00 0.00 ? 8  SER A CB   6  
ATOM 3108 O OG   . SER A 1 8  ? -11.515 -11.251 -5.281  1.00 0.00 ? 8  SER A OG   6  
ATOM 3109 H H    . SER A 1 8  ? -12.605 -13.510 -8.107  1.00 0.00 ? 8  SER A H    6  
ATOM 3110 H HA   . SER A 1 8  ? -13.783 -11.557 -7.685  1.00 0.00 ? 8  SER A HA   6  
ATOM 3111 H HB2  . SER A 1 8  ? -13.509 -10.795 -5.361  1.00 0.00 ? 8  SER A HB2  6  
ATOM 3112 H HB3  . SER A 1 8  ? -13.122 -12.516 -5.373  1.00 0.00 ? 8  SER A HB3  6  
ATOM 3113 H HG   . SER A 1 8  ? -11.174 -12.033 -4.839  1.00 0.00 ? 8  SER A HG   6  
ATOM 3114 N N    . GLY A 1 9  ? -12.402 -9.129  -7.183  1.00 0.00 ? 9  GLY A N    6  
ATOM 3115 C CA   . GLY A 1 9  ? -11.818 -7.820  -7.605  1.00 0.00 ? 9  GLY A CA   6  
ATOM 3116 C C    . GLY A 1 9  ? -12.386 -6.687  -6.749  1.00 0.00 ? 9  GLY A C    6  
ATOM 3117 O O    . GLY A 1 9  ? -11.661 -6.056  -6.005  1.00 0.00 ? 9  GLY A O    6  
ATOM 3118 H H    . GLY A 1 9  ? -13.009 -9.164  -6.415  1.00 0.00 ? 9  GLY A H    6  
ATOM 3119 H HA2  . GLY A 1 9  ? -10.744 -7.855  -7.489  1.00 0.00 ? 9  GLY A HA2  6  
ATOM 3120 H HA3  . GLY A 1 9  ? -12.064 -7.639  -8.643  1.00 0.00 ? 9  GLY A HA3  6  
ATOM 3121 N N    . TYR A 1 10 ? -13.674 -6.481  -6.898  1.00 0.00 ? 10 TYR A N    6  
ATOM 3122 C CA   . TYR A 1 10 ? -14.439 -5.421  -6.158  1.00 0.00 ? 10 TYR A CA   6  
ATOM 3123 C C    . TYR A 1 10 ? -13.955 -3.991  -6.476  1.00 0.00 ? 10 TYR A C    6  
ATOM 3124 O O    . TYR A 1 10 ? -12.775 -3.728  -6.603  1.00 0.00 ? 10 TYR A O    6  
ATOM 3125 C CB   . TYR A 1 10 ? -14.329 -5.689  -4.622  1.00 0.00 ? 10 TYR A CB   6  
ATOM 3126 C CG   . TYR A 1 10 ? -14.947 -4.520  -3.829  1.00 0.00 ? 10 TYR A CG   6  
ATOM 3127 C CD1  . TYR A 1 10 ? -16.291 -4.215  -3.949  1.00 0.00 ? 10 TYR A CD1  6  
ATOM 3128 C CD2  . TYR A 1 10 ? -14.162 -3.756  -2.988  1.00 0.00 ? 10 TYR A CD2  6  
ATOM 3129 C CE1  . TYR A 1 10 ? -16.836 -3.165  -3.241  1.00 0.00 ? 10 TYR A CE1  6  
ATOM 3130 C CE2  . TYR A 1 10 ? -14.707 -2.706  -2.281  1.00 0.00 ? 10 TYR A CE2  6  
ATOM 3131 C CZ   . TYR A 1 10 ? -16.047 -2.403  -2.403  1.00 0.00 ? 10 TYR A CZ   6  
ATOM 3132 O OH   . TYR A 1 10 ? -16.593 -1.352  -1.696  1.00 0.00 ? 10 TYR A OH   6  
ATOM 3133 H H    . TYR A 1 10 ? -14.163 -7.052  -7.525  1.00 0.00 ? 10 TYR A H    6  
ATOM 3134 H HA   . TYR A 1 10 ? -15.474 -5.503  -6.454  1.00 0.00 ? 10 TYR A HA   6  
ATOM 3135 H HB2  . TYR A 1 10 ? -14.867 -6.593  -4.373  1.00 0.00 ? 10 TYR A HB2  6  
ATOM 3136 H HB3  . TYR A 1 10 ? -13.300 -5.808  -4.317  1.00 0.00 ? 10 TYR A HB3  6  
ATOM 3137 H HD1  . TYR A 1 10 ? -16.921 -4.802  -4.601  1.00 0.00 ? 10 TYR A HD1  6  
ATOM 3138 H HD2  . TYR A 1 10 ? -13.112 -3.981  -2.882  1.00 0.00 ? 10 TYR A HD2  6  
ATOM 3139 H HE1  . TYR A 1 10 ? -17.886 -2.938  -3.346  1.00 0.00 ? 10 TYR A HE1  6  
ATOM 3140 H HE2  . TYR A 1 10 ? -14.079 -2.118  -1.628  1.00 0.00 ? 10 TYR A HE2  6  
ATOM 3141 H HH   . TYR A 1 10 ? -16.289 -1.417  -0.788  1.00 0.00 ? 10 TYR A HH   6  
ATOM 3142 N N    . GLU A 1 11 ? -14.913 -3.106  -6.592  1.00 0.00 ? 11 GLU A N    6  
ATOM 3143 C CA   . GLU A 1 11 ? -14.611 -1.675  -6.898  1.00 0.00 ? 11 GLU A CA   6  
ATOM 3144 C C    . GLU A 1 11 ? -14.116 -0.970  -5.629  1.00 0.00 ? 11 GLU A C    6  
ATOM 3145 O O    . GLU A 1 11 ? -14.862 -0.805  -4.682  1.00 0.00 ? 11 GLU A O    6  
ATOM 3146 C CB   . GLU A 1 11 ? -15.890 -0.996  -7.418  1.00 0.00 ? 11 GLU A CB   6  
ATOM 3147 C CG   . GLU A 1 11 ? -16.298 -1.632  -8.761  1.00 0.00 ? 11 GLU A CG   6  
ATOM 3148 C CD   . GLU A 1 11 ? -17.539 -0.903  -9.303  1.00 0.00 ? 11 GLU A CD   6  
ATOM 3149 O OE1  . GLU A 1 11 ? -18.623 -1.320  -8.926  1.00 0.00 ? 11 GLU A OE1  6  
ATOM 3150 O OE2  . GLU A 1 11 ? -17.335 0.029   -10.064 1.00 0.00 ? 11 GLU A OE2  6  
ATOM 3151 H H    . GLU A 1 11 ? -15.844 -3.386  -6.475  1.00 0.00 ? 11 GLU A H    6  
ATOM 3152 H HA   . GLU A 1 11 ? -13.837 -1.630  -7.653  1.00 0.00 ? 11 GLU A HA   6  
ATOM 3153 H HB2  . GLU A 1 11 ? -16.688 -1.117  -6.700  1.00 0.00 ? 11 GLU A HB2  6  
ATOM 3154 H HB3  . GLU A 1 11 ? -15.710 0.060   -7.557  1.00 0.00 ? 11 GLU A HB3  6  
ATOM 3155 H HG2  . GLU A 1 11 ? -15.493 -1.547  -9.478  1.00 0.00 ? 11 GLU A HG2  6  
ATOM 3156 H HG3  . GLU A 1 11 ? -16.532 -2.678  -8.626  1.00 0.00 ? 11 GLU A HG3  6  
ATOM 3157 N N    . VAL A 1 12 ? -12.867 -0.579  -5.659  1.00 0.00 ? 12 VAL A N    6  
ATOM 3158 C CA   . VAL A 1 12 ? -12.233 0.122   -4.506  1.00 0.00 ? 12 VAL A CA   6  
ATOM 3159 C C    . VAL A 1 12 ? -11.968 1.580   -4.888  1.00 0.00 ? 12 VAL A C    6  
ATOM 3160 O O    . VAL A 1 12 ? -12.170 1.988   -6.016  1.00 0.00 ? 12 VAL A O    6  
ATOM 3161 C CB   . VAL A 1 12 ? -10.894 -0.583  -4.143  1.00 0.00 ? 12 VAL A CB   6  
ATOM 3162 C CG1  . VAL A 1 12 ? -11.186 -1.984  -3.577  1.00 0.00 ? 12 VAL A CG1  6  
ATOM 3163 C CG2  . VAL A 1 12 ? -9.968  -0.711  -5.379  1.00 0.00 ? 12 VAL A CG2  6  
ATOM 3164 H H    . VAL A 1 12 ? -12.320 -0.740  -6.451  1.00 0.00 ? 12 VAL A H    6  
ATOM 3165 H HA   . VAL A 1 12 ? -12.899 0.107   -3.655  1.00 0.00 ? 12 VAL A HA   6  
ATOM 3166 H HB   . VAL A 1 12 ? -10.385 -0.006  -3.388  1.00 0.00 ? 12 VAL A HB   6  
ATOM 3167 H HG11 . VAL A 1 12 ? -11.807 -1.901  -2.697  1.00 0.00 ? 12 VAL A HG11 6  
ATOM 3168 H HG12 . VAL A 1 12 ? -11.697 -2.589  -4.312  1.00 0.00 ? 12 VAL A HG12 6  
ATOM 3169 H HG13 . VAL A 1 12 ? -10.263 -2.472  -3.304  1.00 0.00 ? 12 VAL A HG13 6  
ATOM 3170 H HG21 . VAL A 1 12 ? -9.769  0.262   -5.803  1.00 0.00 ? 12 VAL A HG21 6  
ATOM 3171 H HG22 . VAL A 1 12 ? -9.027  -1.156  -5.088  1.00 0.00 ? 12 VAL A HG22 6  
ATOM 3172 H HG23 . VAL A 1 12 ? -10.423 -1.336  -6.134  1.00 0.00 ? 12 VAL A HG23 6  
ATOM 3173 N N    . HIS A 1 13 ? -11.517 2.314   -3.908  1.00 0.00 ? 13 HIS A N    6  
ATOM 3174 C CA   . HIS A 1 13 ? -11.203 3.759   -4.107  1.00 0.00 ? 13 HIS A CA   6  
ATOM 3175 C C    . HIS A 1 13 ? -9.886  3.834   -4.885  1.00 0.00 ? 13 HIS A C    6  
ATOM 3176 O O    . HIS A 1 13 ? -9.874  4.150   -6.059  1.00 0.00 ? 13 HIS A O    6  
ATOM 3177 C CB   . HIS A 1 13 ? -11.082 4.436   -2.713  1.00 0.00 ? 13 HIS A CB   6  
ATOM 3178 C CG   . HIS A 1 13 ? -12.211 5.457   -2.551  1.00 0.00 ? 13 HIS A CG   6  
ATOM 3179 N ND1  . HIS A 1 13 ? -12.088 6.736   -2.696  1.00 0.00 ? 13 HIS A ND1  6  
ATOM 3180 C CD2  . HIS A 1 13 ? -13.547 5.278   -2.232  1.00 0.00 ? 13 HIS A CD2  6  
ATOM 3181 C CE1  . HIS A 1 13 ? -13.228 7.311   -2.492  1.00 0.00 ? 13 HIS A CE1  6  
ATOM 3182 N NE2  . HIS A 1 13 ? -14.165 6.442   -2.200  1.00 0.00 ? 13 HIS A NE2  6  
ATOM 3183 H H    . HIS A 1 13 ? -11.389 1.886   -3.039  1.00 0.00 ? 13 HIS A H    6  
ATOM 3184 H HA   . HIS A 1 13 ? -11.980 4.215   -4.699  1.00 0.00 ? 13 HIS A HA   6  
ATOM 3185 H HB2  . HIS A 1 13 ? -11.170 3.703   -1.924  1.00 0.00 ? 13 HIS A HB2  6  
ATOM 3186 H HB3  . HIS A 1 13 ? -10.139 4.948   -2.601  1.00 0.00 ? 13 HIS A HB3  6  
ATOM 3187 H HD1  . HIS A 1 13 ? -11.256 7.200   -2.926  1.00 0.00 ? 13 HIS A HD1  6  
ATOM 3188 H HD2  . HIS A 1 13 ? -14.013 4.323   -2.039  1.00 0.00 ? 13 HIS A HD2  6  
ATOM 3189 H HE1  . HIS A 1 13 ? -13.389 8.377   -2.554  1.00 0.00 ? 13 HIS A HE1  6  
ATOM 3190 N N    . HIS A 1 14 ? -8.819  3.535   -4.194  1.00 0.00 ? 14 HIS A N    6  
ATOM 3191 C CA   . HIS A 1 14 ? -7.452  3.554   -4.805  1.00 0.00 ? 14 HIS A CA   6  
ATOM 3192 C C    . HIS A 1 14 ? -6.580  2.493   -4.125  1.00 0.00 ? 14 HIS A C    6  
ATOM 3193 O O    . HIS A 1 14 ? -5.375  2.477   -4.259  1.00 0.00 ? 14 HIS A O    6  
ATOM 3194 C CB   . HIS A 1 14 ? -6.791  4.960   -4.625  1.00 0.00 ? 14 HIS A CB   6  
ATOM 3195 C CG   . HIS A 1 14 ? -7.762  5.998   -4.047  1.00 0.00 ? 14 HIS A CG   6  
ATOM 3196 N ND1  . HIS A 1 14 ? -7.831  6.335   -2.801  1.00 0.00 ? 14 HIS A ND1  6  
ATOM 3197 C CD2  . HIS A 1 14 ? -8.729  6.771   -4.663  1.00 0.00 ? 14 HIS A CD2  6  
ATOM 3198 C CE1  . HIS A 1 14 ? -8.751  7.233   -2.643  1.00 0.00 ? 14 HIS A CE1  6  
ATOM 3199 N NE2  . HIS A 1 14 ? -9.335  7.534   -3.777  1.00 0.00 ? 14 HIS A NE2  6  
ATOM 3200 H H    . HIS A 1 14 ? -8.923  3.296   -3.252  1.00 0.00 ? 14 HIS A H    6  
ATOM 3201 H HA   . HIS A 1 14 ? -7.538  3.278   -5.842  1.00 0.00 ? 14 HIS A HA   6  
ATOM 3202 H HB2  . HIS A 1 14 ? -5.938  4.897   -3.966  1.00 0.00 ? 14 HIS A HB2  6  
ATOM 3203 H HB3  . HIS A 1 14 ? -6.454  5.320   -5.586  1.00 0.00 ? 14 HIS A HB3  6  
ATOM 3204 H HD1  . HIS A 1 14 ? -7.272  5.967   -2.086  1.00 0.00 ? 14 HIS A HD1  6  
ATOM 3205 H HD2  . HIS A 1 14 ? -8.954  6.748   -5.719  1.00 0.00 ? 14 HIS A HD2  6  
ATOM 3206 H HE1  . HIS A 1 14 ? -9.004  7.679   -1.693  1.00 0.00 ? 14 HIS A HE1  6  
ATOM 3207 N N    . GLN A 1 15 ? -7.231  1.617   -3.411  1.00 0.00 ? 15 GLN A N    6  
ATOM 3208 C CA   . GLN A 1 15 ? -6.519  0.520   -2.681  1.00 0.00 ? 15 GLN A CA   6  
ATOM 3209 C C    . GLN A 1 15 ? -5.602  -0.246  -3.641  1.00 0.00 ? 15 GLN A C    6  
ATOM 3210 O O    . GLN A 1 15 ? -4.465  -0.542  -3.331  1.00 0.00 ? 15 GLN A O    6  
ATOM 3211 C CB   . GLN A 1 15 ? -7.580  -0.415  -2.069  1.00 0.00 ? 15 GLN A CB   6  
ATOM 3212 C CG   . GLN A 1 15 ? -8.168  0.213   -0.781  1.00 0.00 ? 15 GLN A CG   6  
ATOM 3213 C CD   . GLN A 1 15 ? -9.071  1.411   -1.122  1.00 0.00 ? 15 GLN A CD   6  
ATOM 3214 O OE1  . GLN A 1 15 ? -10.261 1.275   -1.323  1.00 0.00 ? 15 GLN A OE1  6  
ATOM 3215 N NE2  . GLN A 1 15 ? -8.545  2.604   -1.196  1.00 0.00 ? 15 GLN A NE2  6  
ATOM 3216 H H    . GLN A 1 15 ? -8.206  1.691   -3.367  1.00 0.00 ? 15 GLN A H    6  
ATOM 3217 H HA   . GLN A 1 15 ? -5.905  0.964   -1.912  1.00 0.00 ? 15 GLN A HA   6  
ATOM 3218 H HB2  . GLN A 1 15 ? -8.365  -0.595  -2.787  1.00 0.00 ? 15 GLN A HB2  6  
ATOM 3219 H HB3  . GLN A 1 15 ? -7.132  -1.364  -1.823  1.00 0.00 ? 15 GLN A HB3  6  
ATOM 3220 H HG2  . GLN A 1 15 ? -8.759  -0.524  -0.257  1.00 0.00 ? 15 GLN A HG2  6  
ATOM 3221 H HG3  . GLN A 1 15 ? -7.376  0.545   -0.125  1.00 0.00 ? 15 GLN A HG3  6  
ATOM 3222 H HE21 . GLN A 1 15 ? -7.585  2.727   -1.036  1.00 0.00 ? 15 GLN A HE21 6  
ATOM 3223 H HE22 . GLN A 1 15 ? -9.109  3.374   -1.412  1.00 0.00 ? 15 GLN A HE22 6  
ATOM 3224 N N    . LYS A 1 16 ? -6.137  -0.533  -4.798  1.00 0.00 ? 16 LYS A N    6  
ATOM 3225 C CA   . LYS A 1 16 ? -5.368  -1.271  -5.835  1.00 0.00 ? 16 LYS A CA   6  
ATOM 3226 C C    . LYS A 1 16 ? -4.025  -0.593  -6.131  1.00 0.00 ? 16 LYS A C    6  
ATOM 3227 O O    . LYS A 1 16 ? -2.981  -1.207  -6.017  1.00 0.00 ? 16 LYS A O    6  
ATOM 3228 C CB   . LYS A 1 16 ? -6.230  -1.346  -7.127  1.00 0.00 ? 16 LYS A CB   6  
ATOM 3229 C CG   . LYS A 1 16 ? -6.721  -2.789  -7.364  1.00 0.00 ? 16 LYS A CG   6  
ATOM 3230 C CD   . LYS A 1 16 ? -5.501  -3.726  -7.529  1.00 0.00 ? 16 LYS A CD   6  
ATOM 3231 C CE   . LYS A 1 16 ? -5.879  -4.943  -8.393  1.00 0.00 ? 16 LYS A CE   6  
ATOM 3232 N NZ   . LYS A 1 16 ? -6.031  -4.535  -9.818  1.00 0.00 ? 16 LYS A NZ   6  
ATOM 3233 H H    . LYS A 1 16 ? -7.055  -0.262  -4.987  1.00 0.00 ? 16 LYS A H    6  
ATOM 3234 H HA   . LYS A 1 16 ? -5.161  -2.250  -5.444  1.00 0.00 ? 16 LYS A HA   6  
ATOM 3235 H HB2  . LYS A 1 16 ? -7.090  -0.696  -7.035  1.00 0.00 ? 16 LYS A HB2  6  
ATOM 3236 H HB3  . LYS A 1 16 ? -5.660  -1.020  -7.986  1.00 0.00 ? 16 LYS A HB3  6  
ATOM 3237 H HG2  . LYS A 1 16 ? -7.319  -3.115  -6.525  1.00 0.00 ? 16 LYS A HG2  6  
ATOM 3238 H HG3  . LYS A 1 16 ? -7.336  -2.812  -8.252  1.00 0.00 ? 16 LYS A HG3  6  
ATOM 3239 H HD2  . LYS A 1 16 ? -4.683  -3.185  -7.984  1.00 0.00 ? 16 LYS A HD2  6  
ATOM 3240 H HD3  . LYS A 1 16 ? -5.185  -4.062  -6.551  1.00 0.00 ? 16 LYS A HD3  6  
ATOM 3241 H HE2  . LYS A 1 16 ? -5.104  -5.694  -8.331  1.00 0.00 ? 16 LYS A HE2  6  
ATOM 3242 H HE3  . LYS A 1 16 ? -6.809  -5.375  -8.054  1.00 0.00 ? 16 LYS A HE3  6  
ATOM 3243 H HZ1  . LYS A 1 16 ? -7.000  -4.742  -10.135 1.00 0.00 ? 16 LYS A HZ1  6  
ATOM 3244 H HZ2  . LYS A 1 16 ? -5.847  -3.516  -9.911  1.00 0.00 ? 16 LYS A HZ2  6  
ATOM 3245 H HZ3  . LYS A 1 16 ? -5.354  -5.064  -10.405 1.00 0.00 ? 16 LYS A HZ3  6  
ATOM 3246 N N    . LEU A 1 17 ? -4.085  0.664   -6.490  1.00 0.00 ? 17 LEU A N    6  
ATOM 3247 C CA   . LEU A 1 17 ? -2.823  1.392   -6.801  1.00 0.00 ? 17 LEU A CA   6  
ATOM 3248 C C    . LEU A 1 17 ? -1.953  1.500   -5.540  1.00 0.00 ? 17 LEU A C    6  
ATOM 3249 O O    . LEU A 1 17 ? -0.754  1.387   -5.635  1.00 0.00 ? 17 LEU A O    6  
ATOM 3250 C CB   . LEU A 1 17 ? -3.212  2.792   -7.395  1.00 0.00 ? 17 LEU A CB   6  
ATOM 3251 C CG   . LEU A 1 17 ? -3.230  3.944   -6.363  1.00 0.00 ? 17 LEU A CG   6  
ATOM 3252 C CD1  . LEU A 1 17 ? -1.777  4.415   -6.036  1.00 0.00 ? 17 LEU A CD1  6  
ATOM 3253 C CD2  . LEU A 1 17 ? -4.015  5.124   -6.972  1.00 0.00 ? 17 LEU A CD2  6  
ATOM 3254 H H    . LEU A 1 17 ? -4.949  1.121   -6.547  1.00 0.00 ? 17 LEU A H    6  
ATOM 3255 H HA   . LEU A 1 17 ? -2.285  0.834   -7.552  1.00 0.00 ? 17 LEU A HA   6  
ATOM 3256 H HB2  . LEU A 1 17 ? -2.517  3.035   -8.186  1.00 0.00 ? 17 LEU A HB2  6  
ATOM 3257 H HB3  . LEU A 1 17 ? -4.192  2.709   -7.842  1.00 0.00 ? 17 LEU A HB3  6  
ATOM 3258 H HG   . LEU A 1 17 ? -3.737  3.603   -5.476  1.00 0.00 ? 17 LEU A HG   6  
ATOM 3259 H HD11 . LEU A 1 17 ? -1.058  3.931   -6.680  1.00 0.00 ? 17 LEU A HD11 6  
ATOM 3260 H HD12 . LEU A 1 17 ? -1.676  5.484   -6.159  1.00 0.00 ? 17 LEU A HD12 6  
ATOM 3261 H HD13 . LEU A 1 17 ? -1.536  4.169   -5.012  1.00 0.00 ? 17 LEU A HD13 6  
ATOM 3262 H HD21 . LEU A 1 17 ? -5.001  4.798   -7.271  1.00 0.00 ? 17 LEU A HD21 6  
ATOM 3263 H HD22 . LEU A 1 17 ? -4.115  5.915   -6.245  1.00 0.00 ? 17 LEU A HD22 6  
ATOM 3264 H HD23 . LEU A 1 17 ? -3.498  5.507   -7.839  1.00 0.00 ? 17 LEU A HD23 6  
ATOM 3265 N N    . VAL A 1 18 ? -2.549  1.711   -4.395  1.00 0.00 ? 18 VAL A N    6  
ATOM 3266 C CA   . VAL A 1 18 ? -1.767  1.821   -3.125  1.00 0.00 ? 18 VAL A CA   6  
ATOM 3267 C C    . VAL A 1 18 ? -0.844  0.587   -2.988  1.00 0.00 ? 18 VAL A C    6  
ATOM 3268 O O    . VAL A 1 18 ? 0.351   0.716   -2.798  1.00 0.00 ? 18 VAL A O    6  
ATOM 3269 C CB   . VAL A 1 18 ? -2.803  1.927   -1.968  1.00 0.00 ? 18 VAL A CB   6  
ATOM 3270 C CG1  . VAL A 1 18 ? -2.167  1.603   -0.611  1.00 0.00 ? 18 VAL A CG1  6  
ATOM 3271 C CG2  . VAL A 1 18 ? -3.387  3.357   -1.928  1.00 0.00 ? 18 VAL A CG2  6  
ATOM 3272 H H    . VAL A 1 18 ? -3.518  1.810   -4.353  1.00 0.00 ? 18 VAL A H    6  
ATOM 3273 H HA   . VAL A 1 18 ? -1.154  2.712   -3.169  1.00 0.00 ? 18 VAL A HA   6  
ATOM 3274 H HB   . VAL A 1 18 ? -3.612  1.235   -2.136  1.00 0.00 ? 18 VAL A HB   6  
ATOM 3275 H HG11 . VAL A 1 18 ? -1.244  2.149   -0.493  1.00 0.00 ? 18 VAL A HG11 6  
ATOM 3276 H HG12 . VAL A 1 18 ? -2.847  1.874   0.184   1.00 0.00 ? 18 VAL A HG12 6  
ATOM 3277 H HG13 . VAL A 1 18 ? -1.968  0.544   -0.549  1.00 0.00 ? 18 VAL A HG13 6  
ATOM 3278 H HG21 . VAL A 1 18 ? -3.596  3.709   -2.927  1.00 0.00 ? 18 VAL A HG21 6  
ATOM 3279 H HG22 . VAL A 1 18 ? -4.307  3.361   -1.362  1.00 0.00 ? 18 VAL A HG22 6  
ATOM 3280 H HG23 . VAL A 1 18 ? -2.689  4.037   -1.462  1.00 0.00 ? 18 VAL A HG23 6  
ATOM 3281 N N    . PHE A 1 19 ? -1.432  -0.577  -3.101  1.00 0.00 ? 19 PHE A N    6  
ATOM 3282 C CA   . PHE A 1 19 ? -0.646  -1.850  -2.989  1.00 0.00 ? 19 PHE A CA   6  
ATOM 3283 C C    . PHE A 1 19 ? 0.468   -1.856  -4.038  1.00 0.00 ? 19 PHE A C    6  
ATOM 3284 O O    . PHE A 1 19 ? 1.616   -2.127  -3.743  1.00 0.00 ? 19 PHE A O    6  
ATOM 3285 C CB   . PHE A 1 19 ? -1.581  -3.061  -3.221  1.00 0.00 ? 19 PHE A CB   6  
ATOM 3286 C CG   . PHE A 1 19 ? -2.857  -2.977  -2.360  1.00 0.00 ? 19 PHE A CG   6  
ATOM 3287 C CD1  . PHE A 1 19 ? -2.833  -2.467  -1.071  1.00 0.00 ? 19 PHE A CD1  6  
ATOM 3288 C CD2  . PHE A 1 19 ? -4.061  -3.420  -2.878  1.00 0.00 ? 19 PHE A CD2  6  
ATOM 3289 C CE1  . PHE A 1 19 ? -3.986  -2.403  -0.319  1.00 0.00 ? 19 PHE A CE1  6  
ATOM 3290 C CE2  . PHE A 1 19 ? -5.216  -3.357  -2.126  1.00 0.00 ? 19 PHE A CE2  6  
ATOM 3291 C CZ   . PHE A 1 19 ? -5.178  -2.847  -0.846  1.00 0.00 ? 19 PHE A CZ   6  
ATOM 3292 H H    . PHE A 1 19 ? -2.394  -0.604  -3.259  1.00 0.00 ? 19 PHE A H    6  
ATOM 3293 H HA   . PHE A 1 19 ? -0.196  -1.898  -2.013  1.00 0.00 ? 19 PHE A HA   6  
ATOM 3294 H HB2  . PHE A 1 19 ? -1.867  -3.109  -4.262  1.00 0.00 ? 19 PHE A HB2  6  
ATOM 3295 H HB3  . PHE A 1 19 ? -1.059  -3.972  -2.966  1.00 0.00 ? 19 PHE A HB3  6  
ATOM 3296 H HD1  . PHE A 1 19 ? -1.906  -2.115  -0.642  1.00 0.00 ? 19 PHE A HD1  6  
ATOM 3297 H HD2  . PHE A 1 19 ? -4.101  -3.821  -3.880  1.00 0.00 ? 19 PHE A HD2  6  
ATOM 3298 H HE1  . PHE A 1 19 ? -3.956  -2.004  0.683   1.00 0.00 ? 19 PHE A HE1  6  
ATOM 3299 H HE2  . PHE A 1 19 ? -6.150  -3.706  -2.540  1.00 0.00 ? 19 PHE A HE2  6  
ATOM 3300 H HZ   . PHE A 1 19 ? -6.082  -2.798  -0.256  1.00 0.00 ? 19 PHE A HZ   6  
ATOM 3301 N N    . PHE A 1 20 ? 0.078   -1.547  -5.247  1.00 0.00 ? 20 PHE A N    6  
ATOM 3302 C CA   . PHE A 1 20 ? 1.046   -1.505  -6.379  1.00 0.00 ? 20 PHE A CA   6  
ATOM 3303 C C    . PHE A 1 20 ? 2.240   -0.607  -5.988  1.00 0.00 ? 20 PHE A C    6  
ATOM 3304 O O    . PHE A 1 20 ? 3.372   -1.036  -6.026  1.00 0.00 ? 20 PHE A O    6  
ATOM 3305 C CB   . PHE A 1 20 ? 0.245   -0.982  -7.620  1.00 0.00 ? 20 PHE A CB   6  
ATOM 3306 C CG   . PHE A 1 20 ? 1.024   0.041   -8.461  1.00 0.00 ? 20 PHE A CG   6  
ATOM 3307 C CD1  . PHE A 1 20 ? 2.059   -0.384  -9.268  1.00 0.00 ? 20 PHE A CD1  6  
ATOM 3308 C CD2  . PHE A 1 20 ? 0.710   1.388   -8.427  1.00 0.00 ? 20 PHE A CD2  6  
ATOM 3309 C CE1  . PHE A 1 20 ? 2.770   0.517   -10.029 1.00 0.00 ? 20 PHE A CE1  6  
ATOM 3310 C CE2  . PHE A 1 20 ? 1.419   2.291   -9.186  1.00 0.00 ? 20 PHE A CE2  6  
ATOM 3311 C CZ   . PHE A 1 20 ? 2.452   1.857   -9.989  1.00 0.00 ? 20 PHE A CZ   6  
ATOM 3312 H H    . PHE A 1 20 ? -0.864  -1.341  -5.412  1.00 0.00 ? 20 PHE A H    6  
ATOM 3313 H HA   . PHE A 1 20 ? 1.405   -2.508  -6.565  1.00 0.00 ? 20 PHE A HA   6  
ATOM 3314 H HB2  . PHE A 1 20 ? -0.002  -1.821  -8.255  1.00 0.00 ? 20 PHE A HB2  6  
ATOM 3315 H HB3  . PHE A 1 20 ? -0.680  -0.531  -7.300  1.00 0.00 ? 20 PHE A HB3  6  
ATOM 3316 H HD1  . PHE A 1 20 ? 2.312   -1.432  -9.302  1.00 0.00 ? 20 PHE A HD1  6  
ATOM 3317 H HD2  . PHE A 1 20 ? -0.098  1.748   -7.808  1.00 0.00 ? 20 PHE A HD2  6  
ATOM 3318 H HE1  . PHE A 1 20 ? 3.576   0.166   -10.653 1.00 0.00 ? 20 PHE A HE1  6  
ATOM 3319 H HE2  . PHE A 1 20 ? 1.161   3.338   -9.145  1.00 0.00 ? 20 PHE A HE2  6  
ATOM 3320 H HZ   . PHE A 1 20 ? 3.010   2.564   -10.584 1.00 0.00 ? 20 PHE A HZ   6  
ATOM 3321 N N    . ALA A 1 21 ? 1.945   0.609   -5.608  1.00 0.00 ? 21 ALA A N    6  
ATOM 3322 C CA   . ALA A 1 21 ? 2.997   1.595   -5.201  1.00 0.00 ? 21 ALA A CA   6  
ATOM 3323 C C    . ALA A 1 21 ? 3.926   1.011   -4.135  1.00 0.00 ? 21 ALA A C    6  
ATOM 3324 O O    . ALA A 1 21 ? 5.128   1.116   -4.243  1.00 0.00 ? 21 ALA A O    6  
ATOM 3325 C CB   . ALA A 1 21 ? 2.301   2.855   -4.665  1.00 0.00 ? 21 ALA A CB   6  
ATOM 3326 H H    . ALA A 1 21 ? 1.008   0.873   -5.589  1.00 0.00 ? 21 ALA A H    6  
ATOM 3327 H HA   . ALA A 1 21 ? 3.594   1.838   -6.067  1.00 0.00 ? 21 ALA A HA   6  
ATOM 3328 H HB1  . ALA A 1 21 ? 1.618   3.240   -5.408  1.00 0.00 ? 21 ALA A HB1  6  
ATOM 3329 H HB2  . ALA A 1 21 ? 1.745   2.627   -3.768  1.00 0.00 ? 21 ALA A HB2  6  
ATOM 3330 H HB3  . ALA A 1 21 ? 3.034   3.615   -4.439  1.00 0.00 ? 21 ALA A HB3  6  
ATOM 3331 N N    . GLU A 1 22 ? 3.356   0.409   -3.128  1.00 0.00 ? 22 GLU A N    6  
ATOM 3332 C CA   . GLU A 1 22 ? 4.181   -0.200  -2.039  1.00 0.00 ? 22 GLU A CA   6  
ATOM 3333 C C    . GLU A 1 22 ? 5.178   -1.193  -2.670  1.00 0.00 ? 22 GLU A C    6  
ATOM 3334 O O    . GLU A 1 22 ? 6.364   -1.143  -2.401  1.00 0.00 ? 22 GLU A O    6  
ATOM 3335 C CB   . GLU A 1 22 ? 3.179   -0.869  -1.051  1.00 0.00 ? 22 GLU A CB   6  
ATOM 3336 C CG   . GLU A 1 22 ? 3.803   -2.040  -0.250  1.00 0.00 ? 22 GLU A CG   6  
ATOM 3337 C CD   . GLU A 1 22 ? 3.803   -3.354  -1.066  1.00 0.00 ? 22 GLU A CD   6  
ATOM 3338 O OE1  . GLU A 1 22 ? 2.754   -3.693  -1.593  1.00 0.00 ? 22 GLU A OE1  6  
ATOM 3339 O OE2  . GLU A 1 22 ? 4.864   -3.954  -1.117  1.00 0.00 ? 22 GLU A OE2  6  
ATOM 3340 H H    . GLU A 1 22 ? 2.382   0.367   -3.093  1.00 0.00 ? 22 GLU A H    6  
ATOM 3341 H HA   . GLU A 1 22 ? 4.748   0.588   -1.562  1.00 0.00 ? 22 GLU A HA   6  
ATOM 3342 H HB2  . GLU A 1 22 ? 2.850   -0.119  -0.347  1.00 0.00 ? 22 GLU A HB2  6  
ATOM 3343 H HB3  . GLU A 1 22 ? 2.307   -1.211  -1.586  1.00 0.00 ? 22 GLU A HB3  6  
ATOM 3344 H HG2  . GLU A 1 22 ? 4.815   -1.788  0.030   1.00 0.00 ? 22 GLU A HG2  6  
ATOM 3345 H HG3  . GLU A 1 22 ? 3.227   -2.199  0.649   1.00 0.00 ? 22 GLU A HG3  6  
ATOM 3346 N N    . ASP A 1 23 ? 4.658   -2.065  -3.497  1.00 0.00 ? 23 ASP A N    6  
ATOM 3347 C CA   . ASP A 1 23 ? 5.509   -3.086  -4.186  1.00 0.00 ? 23 ASP A CA   6  
ATOM 3348 C C    . ASP A 1 23 ? 6.665   -2.382  -4.903  1.00 0.00 ? 23 ASP A C    6  
ATOM 3349 O O    . ASP A 1 23 ? 7.824   -2.702  -4.738  1.00 0.00 ? 23 ASP A O    6  
ATOM 3350 C CB   . ASP A 1 23 ? 4.647   -3.837  -5.205  1.00 0.00 ? 23 ASP A CB   6  
ATOM 3351 C CG   . ASP A 1 23 ? 5.300   -5.195  -5.510  1.00 0.00 ? 23 ASP A CG   6  
ATOM 3352 O OD1  . ASP A 1 23 ? 6.113   -5.211  -6.421  1.00 0.00 ? 23 ASP A OD1  6  
ATOM 3353 O OD2  . ASP A 1 23 ? 4.950   -6.135  -4.817  1.00 0.00 ? 23 ASP A OD2  6  
ATOM 3354 H H    . ASP A 1 23 ? 3.695   -2.052  -3.662  1.00 0.00 ? 23 ASP A H    6  
ATOM 3355 H HA   . ASP A 1 23 ? 5.914   -3.759  -3.449  1.00 0.00 ? 23 ASP A HA   6  
ATOM 3356 H HB2  . ASP A 1 23 ? 3.649   -3.984  -4.826  1.00 0.00 ? 23 ASP A HB2  6  
ATOM 3357 H HB3  . ASP A 1 23 ? 4.566   -3.268  -6.118  1.00 0.00 ? 23 ASP A HB3  6  
ATOM 3358 N N    . VAL A 1 24 ? 6.261   -1.419  -5.684  1.00 0.00 ? 24 VAL A N    6  
ATOM 3359 C CA   . VAL A 1 24 ? 7.180   -0.577  -6.496  1.00 0.00 ? 24 VAL A CA   6  
ATOM 3360 C C    . VAL A 1 24 ? 8.299   0.009   -5.636  1.00 0.00 ? 24 VAL A C    6  
ATOM 3361 O O    . VAL A 1 24 ? 9.452   -0.087  -5.995  1.00 0.00 ? 24 VAL A O    6  
ATOM 3362 C CB   . VAL A 1 24 ? 6.319   0.527   -7.143  1.00 0.00 ? 24 VAL A CB   6  
ATOM 3363 C CG1  . VAL A 1 24 ? 7.160   1.447   -8.023  1.00 0.00 ? 24 VAL A CG1  6  
ATOM 3364 C CG2  . VAL A 1 24 ? 5.210   -0.125  -7.990  1.00 0.00 ? 24 VAL A CG2  6  
ATOM 3365 H H    . VAL A 1 24 ? 5.303   -1.242  -5.742  1.00 0.00 ? 24 VAL A H    6  
ATOM 3366 H HA   . VAL A 1 24 ? 7.620   -1.196  -7.261  1.00 0.00 ? 24 VAL A HA   6  
ATOM 3367 H HB   . VAL A 1 24 ? 5.863   1.133   -6.381  1.00 0.00 ? 24 VAL A HB   6  
ATOM 3368 H HG11 . VAL A 1 24 ? 7.727   0.865   -8.732  1.00 0.00 ? 24 VAL A HG11 6  
ATOM 3369 H HG12 . VAL A 1 24 ? 6.505   2.122   -8.554  1.00 0.00 ? 24 VAL A HG12 6  
ATOM 3370 H HG13 . VAL A 1 24 ? 7.829   2.023   -7.403  1.00 0.00 ? 24 VAL A HG13 6  
ATOM 3371 H HG21 . VAL A 1 24 ? 5.089   -1.169  -7.739  1.00 0.00 ? 24 VAL A HG21 6  
ATOM 3372 H HG22 . VAL A 1 24 ? 4.282   0.386   -7.788  1.00 0.00 ? 24 VAL A HG22 6  
ATOM 3373 H HG23 . VAL A 1 24 ? 5.433   -0.056  -9.042  1.00 0.00 ? 24 VAL A HG23 6  
ATOM 3374 N N    . GLY A 1 25 ? 7.904   0.587   -4.533  1.00 0.00 ? 25 GLY A N    6  
ATOM 3375 C CA   . GLY A 1 25 ? 8.861   1.217   -3.564  1.00 0.00 ? 25 GLY A CA   6  
ATOM 3376 C C    . GLY A 1 25 ? 10.107  0.352   -3.336  1.00 0.00 ? 25 GLY A C    6  
ATOM 3377 O O    . GLY A 1 25 ? 11.221  0.837   -3.341  1.00 0.00 ? 25 GLY A O    6  
ATOM 3378 H H    . GLY A 1 25 ? 6.944   0.598   -4.355  1.00 0.00 ? 25 GLY A H    6  
ATOM 3379 H HA2  . GLY A 1 25 ? 9.159   2.181   -3.947  1.00 0.00 ? 25 GLY A HA2  6  
ATOM 3380 H HA3  . GLY A 1 25 ? 8.355   1.354   -2.620  1.00 0.00 ? 25 GLY A HA3  6  
ATOM 3381 N N    . SER A 1 26 ? 9.856   -0.915  -3.142  1.00 0.00 ? 26 SER A N    6  
ATOM 3382 C CA   . SER A 1 26 ? 10.961  -1.896  -2.906  1.00 0.00 ? 26 SER A CA   6  
ATOM 3383 C C    . SER A 1 26 ? 11.604  -2.364  -4.224  1.00 0.00 ? 26 SER A C    6  
ATOM 3384 O O    . SER A 1 26 ? 12.808  -2.340  -4.396  1.00 0.00 ? 26 SER A O    6  
ATOM 3385 C CB   . SER A 1 26 ? 10.381  -3.100  -2.140  1.00 0.00 ? 26 SER A CB   6  
ATOM 3386 O OG   . SER A 1 26 ? 11.505  -3.896  -1.783  1.00 0.00 ? 26 SER A OG   6  
ATOM 3387 H H    . SER A 1 26 ? 8.922   -1.206  -3.149  1.00 0.00 ? 26 SER A H    6  
ATOM 3388 H HA   . SER A 1 26 ? 11.712  -1.417  -2.304  1.00 0.00 ? 26 SER A HA   6  
ATOM 3389 H HB2  . SER A 1 26 ? 9.870   -2.786  -1.242  1.00 0.00 ? 26 SER A HB2  6  
ATOM 3390 H HB3  . SER A 1 26 ? 9.711   -3.681  -2.759  1.00 0.00 ? 26 SER A HB3  6  
ATOM 3391 H HG   . SER A 1 26 ? 12.302  -3.482  -2.119  1.00 0.00 ? 26 SER A HG   6  
ATOM 3392 N N    . ASN A 1 27 ? 10.750  -2.778  -5.119  1.00 0.00 ? 27 ASN A N    6  
ATOM 3393 C CA   . ASN A 1 27 ? 11.156  -3.280  -6.465  1.00 0.00 ? 27 ASN A CA   6  
ATOM 3394 C C    . ASN A 1 27 ? 12.107  -2.374  -7.242  1.00 0.00 ? 27 ASN A C    6  
ATOM 3395 O O    . ASN A 1 27 ? 13.110  -2.822  -7.756  1.00 0.00 ? 27 ASN A O    6  
ATOM 3396 C CB   . ASN A 1 27 ? 9.876   -3.499  -7.273  1.00 0.00 ? 27 ASN A CB   6  
ATOM 3397 C CG   . ASN A 1 27 ? 9.210   -4.822  -6.876  1.00 0.00 ? 27 ASN A CG   6  
ATOM 3398 O OD1  . ASN A 1 27 ? 8.999   -5.104  -5.712  1.00 0.00 ? 27 ASN A OD1  6  
ATOM 3399 N ND2  . ASN A 1 27 ? 8.860   -5.664  -7.809  1.00 0.00 ? 27 ASN A ND2  6  
ATOM 3400 H H    . ASN A 1 27 ? 9.798   -2.759  -4.906  1.00 0.00 ? 27 ASN A H    6  
ATOM 3401 H HA   . ASN A 1 27 ? 11.687  -4.209  -6.316  1.00 0.00 ? 27 ASN A HA   6  
ATOM 3402 H HB2  . ASN A 1 27 ? 9.181   -2.698  -7.074  1.00 0.00 ? 27 ASN A HB2  6  
ATOM 3403 H HB3  . ASN A 1 27 ? 10.098  -3.495  -8.326  1.00 0.00 ? 27 ASN A HB3  6  
ATOM 3404 H HD21 . ASN A 1 27 ? 9.025   -5.449  -8.750  1.00 0.00 ? 27 ASN A HD21 6  
ATOM 3405 H HD22 . ASN A 1 27 ? 8.431   -6.511  -7.566  1.00 0.00 ? 27 ASN A HD22 6  
ATOM 3406 N N    . LYS A 1 28 ? 11.760  -1.118  -7.305  1.00 0.00 ? 28 LYS A N    6  
ATOM 3407 C CA   . LYS A 1 28 ? 12.586  -0.115  -8.035  1.00 0.00 ? 28 LYS A CA   6  
ATOM 3408 C C    . LYS A 1 28 ? 14.056  -0.204  -7.607  1.00 0.00 ? 28 LYS A C    6  
ATOM 3409 O O    . LYS A 1 28 ? 14.932  -0.031  -8.424  1.00 0.00 ? 28 LYS A O    6  
ATOM 3410 C CB   . LYS A 1 28 ? 11.984  1.273   -7.746  1.00 0.00 ? 28 LYS A CB   6  
ATOM 3411 C CG   . LYS A 1 28 ? 12.199  1.694   -6.269  1.00 0.00 ? 28 LYS A CG   6  
ATOM 3412 C CD   . LYS A 1 28 ? 11.182  2.787   -5.871  1.00 0.00 ? 28 LYS A CD   6  
ATOM 3413 C CE   . LYS A 1 28 ? 11.503  4.109   -6.595  1.00 0.00 ? 28 LYS A CE   6  
ATOM 3414 N NZ   . LYS A 1 28 ? 10.727  5.224   -5.983  1.00 0.00 ? 28 LYS A NZ   6  
ATOM 3415 H H    . LYS A 1 28 ? 10.943  -0.830  -6.861  1.00 0.00 ? 28 LYS A H    6  
ATOM 3416 H HA   . LYS A 1 28 ? 12.521  -0.313  -9.098  1.00 0.00 ? 28 LYS A HA   6  
ATOM 3417 H HB2  . LYS A 1 28 ? 12.436  1.994   -8.410  1.00 0.00 ? 28 LYS A HB2  6  
ATOM 3418 H HB3  . LYS A 1 28 ? 10.926  1.226   -7.964  1.00 0.00 ? 28 LYS A HB3  6  
ATOM 3419 H HG2  . LYS A 1 28 ? 12.065  0.836   -5.627  1.00 0.00 ? 28 LYS A HG2  6  
ATOM 3420 H HG3  . LYS A 1 28 ? 13.205  2.064   -6.136  1.00 0.00 ? 28 LYS A HG3  6  
ATOM 3421 H HD2  . LYS A 1 28 ? 10.178  2.472   -6.117  1.00 0.00 ? 28 LYS A HD2  6  
ATOM 3422 H HD3  . LYS A 1 28 ? 11.237  2.948   -4.804  1.00 0.00 ? 28 LYS A HD3  6  
ATOM 3423 H HE2  . LYS A 1 28 ? 12.556  4.340   -6.513  1.00 0.00 ? 28 LYS A HE2  6  
ATOM 3424 H HE3  . LYS A 1 28 ? 11.237  4.039   -7.639  1.00 0.00 ? 28 LYS A HE3  6  
ATOM 3425 H HZ1  . LYS A 1 28 ? 10.144  4.857   -5.203  1.00 0.00 ? 28 LYS A HZ1  6  
ATOM 3426 H HZ2  . LYS A 1 28 ? 11.384  5.942   -5.615  1.00 0.00 ? 28 LYS A HZ2  6  
ATOM 3427 H HZ3  . LYS A 1 28 ? 10.112  5.653   -6.703  1.00 0.00 ? 28 LYS A HZ3  6  
ATOM 3428 N N    . GLY A 1 29 ? 14.297  -0.483  -6.349  1.00 0.00 ? 29 GLY A N    6  
ATOM 3429 C CA   . GLY A 1 29 ? 15.706  -0.588  -5.861  1.00 0.00 ? 29 GLY A CA   6  
ATOM 3430 C C    . GLY A 1 29 ? 16.442  -1.659  -6.680  1.00 0.00 ? 29 GLY A C    6  
ATOM 3431 O O    . GLY A 1 29 ? 17.452  -1.394  -7.307  1.00 0.00 ? 29 GLY A O    6  
ATOM 3432 H H    . GLY A 1 29 ? 13.553  -0.624  -5.730  1.00 0.00 ? 29 GLY A H    6  
ATOM 3433 H HA2  . GLY A 1 29 ? 16.201  0.365   -5.978  1.00 0.00 ? 29 GLY A HA2  6  
ATOM 3434 H HA3  . GLY A 1 29 ? 15.701  -0.872  -4.820  1.00 0.00 ? 29 GLY A HA3  6  
ATOM 3435 N N    . ALA A 1 30 ? 15.895  -2.850  -6.659  1.00 0.00 ? 30 ALA A N    6  
ATOM 3436 C CA   . ALA A 1 30 ? 16.529  -3.977  -7.420  1.00 0.00 ? 30 ALA A CA   6  
ATOM 3437 C C    . ALA A 1 30 ? 16.588  -3.658  -8.919  1.00 0.00 ? 30 ALA A C    6  
ATOM 3438 O O    . ALA A 1 30 ? 17.589  -3.878  -9.569  1.00 0.00 ? 30 ALA A O    6  
ATOM 3439 C CB   . ALA A 1 30 ? 15.706  -5.251  -7.188  1.00 0.00 ? 30 ALA A CB   6  
ATOM 3440 H H    . ALA A 1 30 ? 15.067  -2.991  -6.146  1.00 0.00 ? 30 ALA A H    6  
ATOM 3441 H HA   . ALA A 1 30 ? 17.542  -4.102  -7.065  1.00 0.00 ? 30 ALA A HA   6  
ATOM 3442 H HB1  . ALA A 1 30 ? 14.683  -5.098  -7.501  1.00 0.00 ? 30 ALA A HB1  6  
ATOM 3443 H HB2  . ALA A 1 30 ? 16.125  -6.072  -7.751  1.00 0.00 ? 30 ALA A HB2  6  
ATOM 3444 H HB3  . ALA A 1 30 ? 15.714  -5.509  -6.139  1.00 0.00 ? 30 ALA A HB3  6  
ATOM 3445 N N    . ILE A 1 31 ? 15.498  -3.141  -9.416  1.00 0.00 ? 31 ILE A N    6  
ATOM 3446 C CA   . ILE A 1 31 ? 15.369  -2.766  -10.852 1.00 0.00 ? 31 ILE A CA   6  
ATOM 3447 C C    . ILE A 1 31 ? 16.510  -1.832  -11.266 1.00 0.00 ? 31 ILE A C    6  
ATOM 3448 O O    . ILE A 1 31 ? 17.156  -2.063  -12.265 1.00 0.00 ? 31 ILE A O    6  
ATOM 3449 C CB   . ILE A 1 31 ? 13.963  -2.126  -10.983 1.00 0.00 ? 31 ILE A CB   6  
ATOM 3450 C CG1  . ILE A 1 31 ? 12.916  -3.274  -10.922 1.00 0.00 ? 31 ILE A CG1  6  
ATOM 3451 C CG2  . ILE A 1 31 ? 13.808  -1.300  -12.274 1.00 0.00 ? 31 ILE A CG2  6  
ATOM 3452 C CD1  . ILE A 1 31 ? 11.478  -2.723  -10.856 1.00 0.00 ? 31 ILE A CD1  6  
ATOM 3453 H H    . ILE A 1 31 ? 14.729  -2.994  -8.833  1.00 0.00 ? 31 ILE A H    6  
ATOM 3454 H HA   . ILE A 1 31 ? 15.466  -3.668  -11.437 1.00 0.00 ? 31 ILE A HA   6  
ATOM 3455 H HB   . ILE A 1 31 ? 13.815  -1.470  -10.142 1.00 0.00 ? 31 ILE A HB   6  
ATOM 3456 H HG12 . ILE A 1 31 ? 13.033  -3.909  -11.786 1.00 0.00 ? 31 ILE A HG12 6  
ATOM 3457 H HG13 . ILE A 1 31 ? 13.092  -3.879  -10.046 1.00 0.00 ? 31 ILE A HG13 6  
ATOM 3458 H HG21 . ILE A 1 31 ? 13.979  -1.915  -13.143 1.00 0.00 ? 31 ILE A HG21 6  
ATOM 3459 H HG22 . ILE A 1 31 ? 12.812  -0.885  -12.323 1.00 0.00 ? 31 ILE A HG22 6  
ATOM 3460 H HG23 . ILE A 1 31 ? 14.510  -0.479  -12.271 1.00 0.00 ? 31 ILE A HG23 6  
ATOM 3461 H HD11 . ILE A 1 31 ? 11.406  -1.932  -10.125 1.00 0.00 ? 31 ILE A HD11 6  
ATOM 3462 H HD12 . ILE A 1 31 ? 11.176  -2.340  -11.820 1.00 0.00 ? 31 ILE A HD12 6  
ATOM 3463 H HD13 . ILE A 1 31 ? 10.802  -3.516  -10.575 1.00 0.00 ? 31 ILE A HD13 6  
ATOM 3464 N N    . ILE A 1 32 ? 16.744  -0.798  -10.505 1.00 0.00 ? 32 ILE A N    6  
ATOM 3465 C CA   . ILE A 1 32 ? 17.849  0.138   -10.857 1.00 0.00 ? 32 ILE A CA   6  
ATOM 3466 C C    . ILE A 1 32 ? 19.158  -0.653  -10.901 1.00 0.00 ? 32 ILE A C    6  
ATOM 3467 O O    . ILE A 1 32 ? 19.924  -0.512  -11.830 1.00 0.00 ? 32 ILE A O    6  
ATOM 3468 C CB   . ILE A 1 32 ? 17.903  1.256   -9.788  1.00 0.00 ? 32 ILE A CB   6  
ATOM 3469 C CG1  . ILE A 1 32 ? 16.574  2.053   -9.855  1.00 0.00 ? 32 ILE A CG1  6  
ATOM 3470 C CG2  . ILE A 1 32 ? 19.090  2.211   -10.081 1.00 0.00 ? 32 ILE A CG2  6  
ATOM 3471 C CD1  . ILE A 1 32 ? 16.312  2.776   -8.521  1.00 0.00 ? 32 ILE A CD1  6  
ATOM 3472 H H    . ILE A 1 32 ? 16.198  -0.627  -9.715  1.00 0.00 ? 32 ILE A H    6  
ATOM 3473 H HA   . ILE A 1 32 ? 17.664  0.526   -11.845 1.00 0.00 ? 32 ILE A HA   6  
ATOM 3474 H HB   . ILE A 1 32 ? 18.027  0.813   -8.809  1.00 0.00 ? 32 ILE A HB   6  
ATOM 3475 H HG12 . ILE A 1 32 ? 16.618  2.766   -10.660 1.00 0.00 ? 32 ILE A HG12 6  
ATOM 3476 H HG13 . ILE A 1 32 ? 15.752  1.387   -10.064 1.00 0.00 ? 32 ILE A HG13 6  
ATOM 3477 H HG21 . ILE A 1 32 ? 19.066  2.536   -11.111 1.00 0.00 ? 32 ILE A HG21 6  
ATOM 3478 H HG22 . ILE A 1 32 ? 19.038  3.080   -9.442  1.00 0.00 ? 32 ILE A HG22 6  
ATOM 3479 H HG23 . ILE A 1 32 ? 20.027  1.707   -9.897  1.00 0.00 ? 32 ILE A HG23 6  
ATOM 3480 H HD11 . ILE A 1 32 ? 16.427  2.093   -7.692  1.00 0.00 ? 32 ILE A HD11 6  
ATOM 3481 H HD12 . ILE A 1 32 ? 17.002  3.596   -8.397  1.00 0.00 ? 32 ILE A HD12 6  
ATOM 3482 H HD13 . ILE A 1 32 ? 15.304  3.166   -8.509  1.00 0.00 ? 32 ILE A HD13 6  
ATOM 3483 N N    . GLY A 1 33 ? 19.374  -1.472  -9.905  1.00 0.00 ? 33 GLY A N    6  
ATOM 3484 C CA   . GLY A 1 33 ? 20.628  -2.286  -9.864  1.00 0.00 ? 33 GLY A CA   6  
ATOM 3485 C C    . GLY A 1 33 ? 20.812  -3.111  -11.146 1.00 0.00 ? 33 GLY A C    6  
ATOM 3486 O O    . GLY A 1 33 ? 21.840  -3.023  -11.789 1.00 0.00 ? 33 GLY A O    6  
ATOM 3487 H H    . GLY A 1 33 ? 18.710  -1.547  -9.189  1.00 0.00 ? 33 GLY A H    6  
ATOM 3488 H HA2  . GLY A 1 33 ? 21.472  -1.617  -9.757  1.00 0.00 ? 33 GLY A HA2  6  
ATOM 3489 H HA3  . GLY A 1 33 ? 20.591  -2.954  -9.020  1.00 0.00 ? 33 GLY A HA3  6  
ATOM 3490 N N    . LEU A 1 34 ? 19.814  -3.885  -11.497 1.00 0.00 ? 34 LEU A N    6  
ATOM 3491 C CA   . LEU A 1 34 ? 19.949  -4.712  -12.741 1.00 0.00 ? 34 LEU A CA   6  
ATOM 3492 C C    . LEU A 1 34 ? 20.040  -3.843  -14.005 1.00 0.00 ? 34 LEU A C    6  
ATOM 3493 O O    . LEU A 1 34 ? 20.773  -4.186  -14.915 1.00 0.00 ? 34 LEU A O    6  
ATOM 3494 C CB   . LEU A 1 34 ? 18.739  -5.711  -12.863 1.00 0.00 ? 34 LEU A CB   6  
ATOM 3495 C CG   . LEU A 1 34 ? 17.352  -5.092  -12.578 1.00 0.00 ? 34 LEU A CG   6  
ATOM 3496 C CD1  . LEU A 1 34 ? 16.659  -4.681  -13.899 1.00 0.00 ? 34 LEU A CD1  6  
ATOM 3497 C CD2  . LEU A 1 34 ? 16.469  -6.138  -11.856 1.00 0.00 ? 34 LEU A CD2  6  
ATOM 3498 H H    . LEU A 1 34 ? 19.006  -3.907  -10.943 1.00 0.00 ? 34 LEU A H    6  
ATOM 3499 H HA   . LEU A 1 34 ? 20.859  -5.282  -12.660 1.00 0.00 ? 34 LEU A HA   6  
ATOM 3500 H HB2  . LEU A 1 34 ? 18.734  -6.148  -13.850 1.00 0.00 ? 34 LEU A HB2  6  
ATOM 3501 H HB3  . LEU A 1 34 ? 18.908  -6.506  -12.153 1.00 0.00 ? 34 LEU A HB3  6  
ATOM 3502 H HG   . LEU A 1 34 ? 17.468  -4.243  -11.933 1.00 0.00 ? 34 LEU A HG   6  
ATOM 3503 H HD11 . LEU A 1 34 ? 17.285  -4.015  -14.471 1.00 0.00 ? 34 LEU A HD11 6  
ATOM 3504 H HD12 . LEU A 1 34 ? 16.447  -5.554  -14.500 1.00 0.00 ? 34 LEU A HD12 6  
ATOM 3505 H HD13 . LEU A 1 34 ? 15.728  -4.175  -13.686 1.00 0.00 ? 34 LEU A HD13 6  
ATOM 3506 H HD21 . LEU A 1 34 ? 16.512  -7.087  -12.370 1.00 0.00 ? 34 LEU A HD21 6  
ATOM 3507 H HD22 . LEU A 1 34 ? 16.816  -6.275  -10.842 1.00 0.00 ? 34 LEU A HD22 6  
ATOM 3508 H HD23 . LEU A 1 34 ? 15.440  -5.811  -11.825 1.00 0.00 ? 34 LEU A HD23 6  
ATOM 3509 N N    . MET A 1 35 ? 19.311  -2.752  -14.038 1.00 0.00 ? 35 MET A N    6  
ATOM 3510 C CA   . MET A 1 35 ? 19.338  -1.841  -15.223 1.00 0.00 ? 35 MET A CA   6  
ATOM 3511 C C    . MET A 1 35 ? 20.767  -1.310  -15.414 1.00 0.00 ? 35 MET A C    6  
ATOM 3512 O O    . MET A 1 35 ? 21.290  -1.292  -16.511 1.00 0.00 ? 35 MET A O    6  
ATOM 3513 C CB   . MET A 1 35 ? 18.349  -0.690  -14.963 1.00 0.00 ? 35 MET A CB   6  
ATOM 3514 C CG   . MET A 1 35 ? 18.160  0.145   -16.238 1.00 0.00 ? 35 MET A CG   6  
ATOM 3515 S SD   . MET A 1 35 ? 17.583  -0.711  -17.725 1.00 0.00 ? 35 MET A SD   6  
ATOM 3516 C CE   . MET A 1 35 ? 17.449  0.733   -18.810 1.00 0.00 ? 35 MET A CE   6  
ATOM 3517 H H    . MET A 1 35 ? 18.728  -2.515  -13.291 1.00 0.00 ? 35 MET A H    6  
ATOM 3518 H HA   . MET A 1 35 ? 19.054  -2.404  -16.098 1.00 0.00 ? 35 MET A HA   6  
ATOM 3519 H HB2  . MET A 1 35 ? 17.394  -1.098  -14.667 1.00 0.00 ? 35 MET A HB2  6  
ATOM 3520 H HB3  . MET A 1 35 ? 18.713  -0.060  -14.165 1.00 0.00 ? 35 MET A HB3  6  
ATOM 3521 H HG2  . MET A 1 35 ? 17.449  0.926   -16.013 1.00 0.00 ? 35 MET A HG2  6  
ATOM 3522 H HG3  . MET A 1 35 ? 19.101  0.621   -16.474 1.00 0.00 ? 35 MET A HG3  6  
ATOM 3523 H HE1  . MET A 1 35 ? 18.408  1.225   -18.876 1.00 0.00 ? 35 MET A HE1  6  
ATOM 3524 H HE2  . MET A 1 35 ? 17.142  0.412   -19.795 1.00 0.00 ? 35 MET A HE2  6  
ATOM 3525 H HE3  . MET A 1 35 ? 16.717  1.418   -18.410 1.00 0.00 ? 35 MET A HE3  6  
ATOM 3526 N N    . VAL A 1 36 ? 21.335  -0.894  -14.311 1.00 0.00 ? 36 VAL A N    6  
ATOM 3527 C CA   . VAL A 1 36 ? 22.722  -0.345  -14.275 1.00 0.00 ? 36 VAL A CA   6  
ATOM 3528 C C    . VAL A 1 36 ? 23.679  -1.397  -14.857 1.00 0.00 ? 36 VAL A C    6  
ATOM 3529 O O    . VAL A 1 36 ? 24.420  -1.105  -15.776 1.00 0.00 ? 36 VAL A O    6  
ATOM 3530 C CB   . VAL A 1 36 ? 23.054  -0.004  -12.784 1.00 0.00 ? 36 VAL A CB   6  
ATOM 3531 C CG1  . VAL A 1 36 ? 24.579  0.159   -12.572 1.00 0.00 ? 36 VAL A CG1  6  
ATOM 3532 C CG2  . VAL A 1 36 ? 22.360  1.328   -12.413 1.00 0.00 ? 36 VAL A CG2  6  
ATOM 3533 H H    . VAL A 1 36 ? 20.830  -0.937  -13.478 1.00 0.00 ? 36 VAL A H    6  
ATOM 3534 H HA   . VAL A 1 36 ? 22.760  0.544   -14.889 1.00 0.00 ? 36 VAL A HA   6  
ATOM 3535 H HB   . VAL A 1 36 ? 22.680  -0.779  -12.127 1.00 0.00 ? 36 VAL A HB   6  
ATOM 3536 H HG11 . VAL A 1 36 ? 25.004  0.791   -13.339 1.00 0.00 ? 36 VAL A HG11 6  
ATOM 3537 H HG12 . VAL A 1 36 ? 24.775  0.605   -11.607 1.00 0.00 ? 36 VAL A HG12 6  
ATOM 3538 H HG13 . VAL A 1 36 ? 25.064  -0.806  -12.606 1.00 0.00 ? 36 VAL A HG13 6  
ATOM 3539 H HG21 . VAL A 1 36 ? 21.339  1.336   -12.768 1.00 0.00 ? 36 VAL A HG21 6  
ATOM 3540 H HG22 . VAL A 1 36 ? 22.353  1.450   -11.340 1.00 0.00 ? 36 VAL A HG22 6  
ATOM 3541 H HG23 . VAL A 1 36 ? 22.883  2.163   -12.856 1.00 0.00 ? 36 VAL A HG23 6  
ATOM 3542 N N    . GLY A 1 37 ? 23.631  -2.583  -14.304 1.00 0.00 ? 37 GLY A N    6  
ATOM 3543 C CA   . GLY A 1 37 ? 24.524  -3.672  -14.809 1.00 0.00 ? 37 GLY A CA   6  
ATOM 3544 C C    . GLY A 1 37 ? 24.266  -5.018  -14.128 1.00 0.00 ? 37 GLY A C    6  
ATOM 3545 O O    . GLY A 1 37 ? 24.649  -6.047  -14.651 1.00 0.00 ? 37 GLY A O    6  
ATOM 3546 H H    . GLY A 1 37 ? 23.015  -2.753  -13.561 1.00 0.00 ? 37 GLY A H    6  
ATOM 3547 H HA2  . GLY A 1 37 ? 24.370  -3.786  -15.873 1.00 0.00 ? 37 GLY A HA2  6  
ATOM 3548 H HA3  . GLY A 1 37 ? 25.551  -3.388  -14.632 1.00 0.00 ? 37 GLY A HA3  6  
ATOM 3549 N N    . GLY A 1 38 ? 23.627  -4.981  -12.986 1.00 0.00 ? 38 GLY A N    6  
ATOM 3550 C CA   . GLY A 1 38 ? 23.323  -6.238  -12.230 1.00 0.00 ? 38 GLY A CA   6  
ATOM 3551 C C    . GLY A 1 38 ? 24.582  -6.890  -11.632 1.00 0.00 ? 38 GLY A C    6  
ATOM 3552 O O    . GLY A 1 38 ? 24.480  -7.894  -10.954 1.00 0.00 ? 38 GLY A O    6  
ATOM 3553 H H    . GLY A 1 38 ? 23.331  -4.125  -12.616 1.00 0.00 ? 38 GLY A H    6  
ATOM 3554 H HA2  . GLY A 1 38 ? 22.648  -5.995  -11.423 1.00 0.00 ? 38 GLY A HA2  6  
ATOM 3555 H HA3  . GLY A 1 38 ? 22.840  -6.943  -12.891 1.00 0.00 ? 38 GLY A HA3  6  
ATOM 3556 N N    . VAL A 1 39 ? 25.725  -6.303  -11.896 1.00 0.00 ? 39 VAL A N    6  
ATOM 3557 C CA   . VAL A 1 39 ? 27.021  -6.838  -11.374 1.00 0.00 ? 39 VAL A CA   6  
ATOM 3558 C C    . VAL A 1 39 ? 27.327  -6.172  -10.020 1.00 0.00 ? 39 VAL A C    6  
ATOM 3559 O O    . VAL A 1 39 ? 28.468  -5.961  -9.653  1.00 0.00 ? 39 VAL A O    6  
ATOM 3560 C CB   . VAL A 1 39 ? 28.159  -6.534  -12.413 1.00 0.00 ? 39 VAL A CB   6  
ATOM 3561 C CG1  . VAL A 1 39 ? 29.317  -7.540  -12.213 1.00 0.00 ? 39 VAL A CG1  6  
ATOM 3562 C CG2  . VAL A 1 39 ? 27.639  -6.672  -13.866 1.00 0.00 ? 39 VAL A CG2  6  
ATOM 3563 H H    . VAL A 1 39 ? 25.741  -5.497  -12.443 1.00 0.00 ? 39 VAL A H    6  
ATOM 3564 H HA   . VAL A 1 39 ? 26.916  -7.899  -11.222 1.00 0.00 ? 39 VAL A HA   6  
ATOM 3565 H HB   . VAL A 1 39 ? 28.528  -5.530  -12.270 1.00 0.00 ? 39 VAL A HB   6  
ATOM 3566 H HG11 . VAL A 1 39 ? 29.716  -7.466  -11.212 1.00 0.00 ? 39 VAL A HG11 6  
ATOM 3567 H HG12 . VAL A 1 39 ? 28.970  -8.551  -12.374 1.00 0.00 ? 39 VAL A HG12 6  
ATOM 3568 H HG13 . VAL A 1 39 ? 30.112  -7.333  -12.914 1.00 0.00 ? 39 VAL A HG13 6  
ATOM 3569 H HG21 . VAL A 1 39 ? 27.002  -7.540  -13.962 1.00 0.00 ? 39 VAL A HG21 6  
ATOM 3570 H HG22 . VAL A 1 39 ? 27.076  -5.792  -14.138 1.00 0.00 ? 39 VAL A HG22 6  
ATOM 3571 H HG23 . VAL A 1 39 ? 28.465  -6.771  -14.555 1.00 0.00 ? 39 VAL A HG23 6  
ATOM 3572 N N    . VAL A 1 40 ? 26.267  -5.864  -9.318  1.00 0.00 ? 40 VAL A N    6  
ATOM 3573 C CA   . VAL A 1 40 ? 26.381  -5.211  -7.979  1.00 0.00 ? 40 VAL A CA   6  
ATOM 3574 C C    . VAL A 1 40 ? 26.982  -6.201  -6.960  1.00 0.00 ? 40 VAL A C    6  
ATOM 3575 O O    . VAL A 1 40 ? 27.902  -5.783  -6.276  1.00 0.00 ? 40 VAL A O    6  
ATOM 3576 C CB   . VAL A 1 40 ? 24.961  -4.753  -7.535  1.00 0.00 ? 40 VAL A CB   6  
ATOM 3577 C CG1  . VAL A 1 40 ? 25.053  -3.991  -6.195  1.00 0.00 ? 40 VAL A CG1  6  
ATOM 3578 C CG2  . VAL A 1 40 ? 24.355  -3.815  -8.610  1.00 0.00 ? 40 VAL A CG2  6  
ATOM 3579 O OXT  . VAL A 1 40 ? 26.489  -7.317  -6.925  1.00 0.00 ? 40 VAL A OXT  6  
ATOM 3580 H H    . VAL A 1 40 ? 25.382  -6.068  -9.680  1.00 0.00 ? 40 VAL A H    6  
ATOM 3581 H HA   . VAL A 1 40 ? 27.033  -4.352  -8.072  1.00 0.00 ? 40 VAL A HA   6  
ATOM 3582 H HB   . VAL A 1 40 ? 24.320  -5.614  -7.413  1.00 0.00 ? 40 VAL A HB   6  
ATOM 3583 H HG11 . VAL A 1 40 ? 25.789  -3.202  -6.257  1.00 0.00 ? 40 VAL A HG11 6  
ATOM 3584 H HG12 . VAL A 1 40 ? 24.096  -3.555  -5.949  1.00 0.00 ? 40 VAL A HG12 6  
ATOM 3585 H HG13 . VAL A 1 40 ? 25.335  -4.668  -5.402  1.00 0.00 ? 40 VAL A HG13 6  
ATOM 3586 H HG21 . VAL A 1 40 ? 25.018  -2.984  -8.802  1.00 0.00 ? 40 VAL A HG21 6  
ATOM 3587 H HG22 . VAL A 1 40 ? 24.197  -4.354  -9.533  1.00 0.00 ? 40 VAL A HG22 6  
ATOM 3588 H HG23 . VAL A 1 40 ? 23.403  -3.430  -8.274  1.00 0.00 ? 40 VAL A HG23 6  
ATOM 3589 N N    . ASP A 1 1  ? -29.201 1.072   -22.932 1.00 0.00 ? 1  ASP A N    7  
ATOM 3590 C CA   . ASP A 1 1  ? -30.019 0.383   -21.891 1.00 0.00 ? 1  ASP A CA   7  
ATOM 3591 C C    . ASP A 1 1  ? -29.365 0.538   -20.511 1.00 0.00 ? 1  ASP A C    7  
ATOM 3592 O O    . ASP A 1 1  ? -28.186 0.821   -20.406 1.00 0.00 ? 1  ASP A O    7  
ATOM 3593 C CB   . ASP A 1 1  ? -30.141 -1.115  -22.223 1.00 0.00 ? 1  ASP A CB   7  
ATOM 3594 C CG   . ASP A 1 1  ? -30.890 -1.274  -23.558 1.00 0.00 ? 1  ASP A CG   7  
ATOM 3595 O OD1  . ASP A 1 1  ? -30.204 -1.275  -24.568 1.00 0.00 ? 1  ASP A OD1  7  
ATOM 3596 O OD2  . ASP A 1 1  ? -32.104 -1.385  -23.492 1.00 0.00 ? 1  ASP A OD2  7  
ATOM 3597 H H1   . ASP A 1 1  ? -28.370 1.511   -22.489 1.00 0.00 ? 1  ASP A H1   7  
ATOM 3598 H H2   . ASP A 1 1  ? -28.890 0.380   -23.644 1.00 0.00 ? 1  ASP A H2   7  
ATOM 3599 H H3   . ASP A 1 1  ? -29.776 1.805   -23.392 1.00 0.00 ? 1  ASP A H3   7  
ATOM 3600 H HA   . ASP A 1 1  ? -30.997 0.840   -21.864 1.00 0.00 ? 1  ASP A HA   7  
ATOM 3601 H HB2  . ASP A 1 1  ? -29.160 -1.563  -22.308 1.00 0.00 ? 1  ASP A HB2  7  
ATOM 3602 H HB3  . ASP A 1 1  ? -30.690 -1.626  -21.444 1.00 0.00 ? 1  ASP A HB3  7  
ATOM 3603 N N    . ALA A 1 2  ? -30.166 0.343   -19.494 1.00 0.00 ? 2  ALA A N    7  
ATOM 3604 C CA   . ALA A 1 2  ? -29.682 0.457   -18.083 1.00 0.00 ? 2  ALA A CA   7  
ATOM 3605 C C    . ALA A 1 2  ? -30.623 -0.331  -17.166 1.00 0.00 ? 2  ALA A C    7  
ATOM 3606 O O    . ALA A 1 2  ? -31.828 -0.237  -17.292 1.00 0.00 ? 2  ALA A O    7  
ATOM 3607 C CB   . ALA A 1 2  ? -29.666 1.941   -17.673 1.00 0.00 ? 2  ALA A CB   7  
ATOM 3608 H H    . ALA A 1 2  ? -31.104 0.116   -19.660 1.00 0.00 ? 2  ALA A H    7  
ATOM 3609 H HA   . ALA A 1 2  ? -28.687 0.035   -18.013 1.00 0.00 ? 2  ALA A HA   7  
ATOM 3610 H HB1  . ALA A 1 2  ? -29.258 2.541   -18.472 1.00 0.00 ? 2  ALA A HB1  7  
ATOM 3611 H HB2  . ALA A 1 2  ? -30.668 2.283   -17.461 1.00 0.00 ? 2  ALA A HB2  7  
ATOM 3612 H HB3  . ALA A 1 2  ? -29.056 2.081   -16.793 1.00 0.00 ? 2  ALA A HB3  7  
ATOM 3613 N N    . GLU A 1 3  ? -30.042 -1.085  -16.268 1.00 0.00 ? 3  GLU A N    7  
ATOM 3614 C CA   . GLU A 1 3  ? -30.853 -1.905  -15.311 1.00 0.00 ? 3  GLU A CA   7  
ATOM 3615 C C    . GLU A 1 3  ? -31.516 -1.006  -14.260 1.00 0.00 ? 3  GLU A C    7  
ATOM 3616 O O    . GLU A 1 3  ? -32.459 -1.409  -13.607 1.00 0.00 ? 3  GLU A O    7  
ATOM 3617 C CB   . GLU A 1 3  ? -29.945 -2.925  -14.596 1.00 0.00 ? 3  GLU A CB   7  
ATOM 3618 C CG   . GLU A 1 3  ? -29.098 -3.717  -15.621 1.00 0.00 ? 3  GLU A CG   7  
ATOM 3619 C CD   . GLU A 1 3  ? -27.670 -3.141  -15.672 1.00 0.00 ? 3  GLU A CD   7  
ATOM 3620 O OE1  . GLU A 1 3  ? -26.919 -3.491  -14.776 1.00 0.00 ? 3  GLU A OE1  7  
ATOM 3621 O OE2  . GLU A 1 3  ? -27.411 -2.388  -16.598 1.00 0.00 ? 3  GLU A OE2  7  
ATOM 3622 H H    . GLU A 1 3  ? -29.065 -1.113  -16.219 1.00 0.00 ? 3  GLU A H    7  
ATOM 3623 H HA   . GLU A 1 3  ? -31.625 -2.423  -15.863 1.00 0.00 ? 3  GLU A HA   7  
ATOM 3624 H HB2  . GLU A 1 3  ? -29.306 -2.412  -13.891 1.00 0.00 ? 3  GLU A HB2  7  
ATOM 3625 H HB3  . GLU A 1 3  ? -30.561 -3.617  -14.041 1.00 0.00 ? 3  GLU A HB3  7  
ATOM 3626 H HG2  . GLU A 1 3  ? -29.043 -4.754  -15.322 1.00 0.00 ? 3  GLU A HG2  7  
ATOM 3627 H HG3  . GLU A 1 3  ? -29.537 -3.673  -16.609 1.00 0.00 ? 3  GLU A HG3  7  
ATOM 3628 N N    . PHE A 1 4  ? -30.989 0.189   -14.138 1.00 0.00 ? 4  PHE A N    7  
ATOM 3629 C CA   . PHE A 1 4  ? -31.503 1.198   -13.161 1.00 0.00 ? 4  PHE A CA   7  
ATOM 3630 C C    . PHE A 1 4  ? -31.455 0.645   -11.725 1.00 0.00 ? 4  PHE A C    7  
ATOM 3631 O O    . PHE A 1 4  ? -32.136 1.115   -10.835 1.00 0.00 ? 4  PHE A O    7  
ATOM 3632 C CB   . PHE A 1 4  ? -32.960 1.574   -13.561 1.00 0.00 ? 4  PHE A CB   7  
ATOM 3633 C CG   . PHE A 1 4  ? -33.147 3.089   -13.389 1.00 0.00 ? 4  PHE A CG   7  
ATOM 3634 C CD1  . PHE A 1 4  ? -32.796 3.955   -14.409 1.00 0.00 ? 4  PHE A CD1  7  
ATOM 3635 C CD2  . PHE A 1 4  ? -33.664 3.605   -12.215 1.00 0.00 ? 4  PHE A CD2  7  
ATOM 3636 C CE1  . PHE A 1 4  ? -32.960 5.316   -14.258 1.00 0.00 ? 4  PHE A CE1  7  
ATOM 3637 C CE2  . PHE A 1 4  ? -33.828 4.967   -12.063 1.00 0.00 ? 4  PHE A CE2  7  
ATOM 3638 C CZ   . PHE A 1 4  ? -33.477 5.822   -13.084 1.00 0.00 ? 4  PHE A CZ   7  
ATOM 3639 H H    . PHE A 1 4  ? -30.231 0.429   -14.709 1.00 0.00 ? 4  PHE A H    7  
ATOM 3640 H HA   . PHE A 1 4  ? -30.851 2.054   -13.210 1.00 0.00 ? 4  PHE A HA   7  
ATOM 3641 H HB2  . PHE A 1 4  ? -33.144 1.319   -14.594 1.00 0.00 ? 4  PHE A HB2  7  
ATOM 3642 H HB3  . PHE A 1 4  ? -33.683 1.054   -12.948 1.00 0.00 ? 4  PHE A HB3  7  
ATOM 3643 H HD1  . PHE A 1 4  ? -32.391 3.565   -15.333 1.00 0.00 ? 4  PHE A HD1  7  
ATOM 3644 H HD2  . PHE A 1 4  ? -33.943 2.943   -11.409 1.00 0.00 ? 4  PHE A HD2  7  
ATOM 3645 H HE1  . PHE A 1 4  ? -32.683 5.984   -15.060 1.00 0.00 ? 4  PHE A HE1  7  
ATOM 3646 H HE2  . PHE A 1 4  ? -34.232 5.362   -11.143 1.00 0.00 ? 4  PHE A HE2  7  
ATOM 3647 H HZ   . PHE A 1 4  ? -33.604 6.889   -12.966 1.00 0.00 ? 4  PHE A HZ   7  
ATOM 3648 N N    . ARG A 1 5  ? -30.619 -0.350  -11.574 1.00 0.00 ? 5  ARG A N    7  
ATOM 3649 C CA   . ARG A 1 5  ? -30.411 -1.041  -10.264 1.00 0.00 ? 5  ARG A CA   7  
ATOM 3650 C C    . ARG A 1 5  ? -28.934 -1.467  -10.186 1.00 0.00 ? 5  ARG A C    7  
ATOM 3651 O O    . ARG A 1 5  ? -28.600 -2.526  -9.687  1.00 0.00 ? 5  ARG A O    7  
ATOM 3652 C CB   . ARG A 1 5  ? -31.345 -2.280  -10.195 1.00 0.00 ? 5  ARG A CB   7  
ATOM 3653 C CG   . ARG A 1 5  ? -32.826 -1.842  -10.140 1.00 0.00 ? 5  ARG A CG   7  
ATOM 3654 C CD   . ARG A 1 5  ? -33.728 -3.083  -9.993  1.00 0.00 ? 5  ARG A CD   7  
ATOM 3655 N NE   . ARG A 1 5  ? -35.132 -2.676  -10.318 1.00 0.00 ? 5  ARG A NE   7  
ATOM 3656 C CZ   . ARG A 1 5  ? -36.102 -3.554  -10.384 1.00 0.00 ? 5  ARG A CZ   7  
ATOM 3657 N NH1  . ARG A 1 5  ? -35.872 -4.821  -10.164 1.00 0.00 ? 5  ARG A NH1  7  
ATOM 3658 N NH2  . ARG A 1 5  ? -37.299 -3.119  -10.674 1.00 0.00 ? 5  ARG A NH2  7  
ATOM 3659 H H    . ARG A 1 5  ? -30.111 -0.646  -12.357 1.00 0.00 ? 5  ARG A H    7  
ATOM 3660 H HA   . ARG A 1 5  ? -30.617 -0.354  -9.455  1.00 0.00 ? 5  ARG A HA   7  
ATOM 3661 H HB2  . ARG A 1 5  ? -31.182 -2.904  -11.061 1.00 0.00 ? 5  ARG A HB2  7  
ATOM 3662 H HB3  . ARG A 1 5  ? -31.115 -2.857  -9.309  1.00 0.00 ? 5  ARG A HB3  7  
ATOM 3663 H HG2  . ARG A 1 5  ? -32.985 -1.178  -9.303  1.00 0.00 ? 5  ARG A HG2  7  
ATOM 3664 H HG3  . ARG A 1 5  ? -33.091 -1.321  -11.050 1.00 0.00 ? 5  ARG A HG3  7  
ATOM 3665 H HD2  . ARG A 1 5  ? -33.422 -3.863  -10.677 1.00 0.00 ? 5  ARG A HD2  7  
ATOM 3666 H HD3  . ARG A 1 5  ? -33.698 -3.459  -8.980  1.00 0.00 ? 5  ARG A HD3  7  
ATOM 3667 H HE   . ARG A 1 5  ? -35.330 -1.731  -10.487 1.00 0.00 ? 5  ARG A HE   7  
ATOM 3668 H HH11 . ARG A 1 5  ? -34.949 -5.135  -9.944  1.00 0.00 ? 5  ARG A HH11 7  
ATOM 3669 H HH12 . ARG A 1 5  ? -36.622 -5.481  -10.217 1.00 0.00 ? 5  ARG A HH12 7  
ATOM 3670 H HH21 . ARG A 1 5  ? -37.446 -2.143  -10.838 1.00 0.00 ? 5  ARG A HH21 7  
ATOM 3671 H HH22 . ARG A 1 5  ? -38.065 -3.758  -10.733 1.00 0.00 ? 5  ARG A HH22 7  
ATOM 3672 N N    . HIS A 1 6  ? -28.092 -0.605  -10.696 1.00 0.00 ? 6  HIS A N    7  
ATOM 3673 C CA   . HIS A 1 6  ? -26.616 -0.850  -10.710 1.00 0.00 ? 6  HIS A CA   7  
ATOM 3674 C C    . HIS A 1 6  ? -25.869 0.493   -10.752 1.00 0.00 ? 6  HIS A C    7  
ATOM 3675 O O    . HIS A 1 6  ? -24.703 0.572   -11.085 1.00 0.00 ? 6  HIS A O    7  
ATOM 3676 C CB   . HIS A 1 6  ? -26.280 -1.705  -11.953 1.00 0.00 ? 6  HIS A CB   7  
ATOM 3677 C CG   . HIS A 1 6  ? -26.595 -0.909  -13.230 1.00 0.00 ? 6  HIS A CG   7  
ATOM 3678 N ND1  . HIS A 1 6  ? -27.740 -0.380  -13.522 1.00 0.00 ? 6  HIS A ND1  7  
ATOM 3679 C CD2  . HIS A 1 6  ? -25.786 -0.583  -14.305 1.00 0.00 ? 6  HIS A CD2  7  
ATOM 3680 C CE1  . HIS A 1 6  ? -27.661 0.221   -14.666 1.00 0.00 ? 6  HIS A CE1  7  
ATOM 3681 N NE2  . HIS A 1 6  ? -26.465 0.120   -15.190 1.00 0.00 ? 6  HIS A NE2  7  
ATOM 3682 H H    . HIS A 1 6  ? -28.431 0.227   -11.081 1.00 0.00 ? 6  HIS A H    7  
ATOM 3683 H HA   . HIS A 1 6  ? -26.350 -1.348  -9.796  1.00 0.00 ? 6  HIS A HA   7  
ATOM 3684 H HB2  . HIS A 1 6  ? -25.232 -1.968  -11.955 1.00 0.00 ? 6  HIS A HB2  7  
ATOM 3685 H HB3  . HIS A 1 6  ? -26.867 -2.612  -11.956 1.00 0.00 ? 6  HIS A HB3  7  
ATOM 3686 H HD1  . HIS A 1 6  ? -28.543 -0.426  -12.962 1.00 0.00 ? 6  HIS A HD1  7  
ATOM 3687 H HD2  . HIS A 1 6  ? -24.747 -0.864  -14.405 1.00 0.00 ? 6  HIS A HD2  7  
ATOM 3688 H HE1  . HIS A 1 6  ? -28.479 0.744   -15.135 1.00 0.00 ? 6  HIS A HE1  7  
ATOM 3689 N N    . ASP A 1 7  ? -26.610 1.504   -10.392 1.00 0.00 ? 7  ASP A N    7  
ATOM 3690 C CA   . ASP A 1 7  ? -26.122 2.909   -10.352 1.00 0.00 ? 7  ASP A CA   7  
ATOM 3691 C C    . ASP A 1 7  ? -25.709 3.266   -8.923  1.00 0.00 ? 7  ASP A C    7  
ATOM 3692 O O    . ASP A 1 7  ? -26.490 3.119   -8.003  1.00 0.00 ? 7  ASP A O    7  
ATOM 3693 C CB   . ASP A 1 7  ? -27.259 3.849   -10.841 1.00 0.00 ? 7  ASP A CB   7  
ATOM 3694 C CG   . ASP A 1 7  ? -28.648 3.220   -10.590 1.00 0.00 ? 7  ASP A CG   7  
ATOM 3695 O OD1  . ASP A 1 7  ? -29.047 2.438   -11.437 1.00 0.00 ? 7  ASP A OD1  7  
ATOM 3696 O OD2  . ASP A 1 7  ? -29.225 3.554   -9.568  1.00 0.00 ? 7  ASP A OD2  7  
ATOM 3697 H H    . ASP A 1 7  ? -27.534 1.328   -10.134 1.00 0.00 ? 7  ASP A H    7  
ATOM 3698 H HA   . ASP A 1 7  ? -25.270 2.997   -11.006 1.00 0.00 ? 7  ASP A HA   7  
ATOM 3699 H HB2  . ASP A 1 7  ? -27.204 4.791   -10.319 1.00 0.00 ? 7  ASP A HB2  7  
ATOM 3700 H HB3  . ASP A 1 7  ? -27.144 4.039   -11.899 1.00 0.00 ? 7  ASP A HB3  7  
ATOM 3701 N N    . SER A 1 8  ? -24.487 3.727   -8.791  1.00 0.00 ? 8  SER A N    7  
ATOM 3702 C CA   . SER A 1 8  ? -23.931 4.121   -7.458  1.00 0.00 ? 8  SER A CA   7  
ATOM 3703 C C    . SER A 1 8  ? -23.983 2.926   -6.484  1.00 0.00 ? 8  SER A C    7  
ATOM 3704 O O    . SER A 1 8  ? -24.327 3.065   -5.326  1.00 0.00 ? 8  SER A O    7  
ATOM 3705 C CB   . SER A 1 8  ? -24.761 5.319   -6.917  1.00 0.00 ? 8  SER A CB   7  
ATOM 3706 O OG   . SER A 1 8  ? -23.941 5.876   -5.899  1.00 0.00 ? 8  SER A OG   7  
ATOM 3707 H H    . SER A 1 8  ? -23.922 3.814   -9.587  1.00 0.00 ? 8  SER A H    7  
ATOM 3708 H HA   . SER A 1 8  ? -22.900 4.412   -7.592  1.00 0.00 ? 8  SER A HA   7  
ATOM 3709 H HB2  . SER A 1 8  ? -24.932 6.060   -7.684  1.00 0.00 ? 8  SER A HB2  7  
ATOM 3710 H HB3  . SER A 1 8  ? -25.704 5.008   -6.489  1.00 0.00 ? 8  SER A HB3  7  
ATOM 3711 H HG   . SER A 1 8  ? -24.397 5.771   -5.062  1.00 0.00 ? 8  SER A HG   7  
ATOM 3712 N N    . GLY A 1 9  ? -23.628 1.777   -7.008  1.00 0.00 ? 9  GLY A N    7  
ATOM 3713 C CA   . GLY A 1 9  ? -23.626 0.526   -6.192  1.00 0.00 ? 9  GLY A CA   7  
ATOM 3714 C C    . GLY A 1 9  ? -22.493 0.579   -5.169  1.00 0.00 ? 9  GLY A C    7  
ATOM 3715 O O    . GLY A 1 9  ? -22.731 0.694   -3.982  1.00 0.00 ? 9  GLY A O    7  
ATOM 3716 H H    . GLY A 1 9  ? -23.357 1.737   -7.948  1.00 0.00 ? 9  GLY A H    7  
ATOM 3717 H HA2  . GLY A 1 9  ? -24.573 0.426   -5.682  1.00 0.00 ? 9  GLY A HA2  7  
ATOM 3718 H HA3  . GLY A 1 9  ? -23.478 -0.320  -6.846  1.00 0.00 ? 9  GLY A HA3  7  
ATOM 3719 N N    . TYR A 1 10 ? -21.289 0.496   -5.677  1.00 0.00 ? 10 TYR A N    7  
ATOM 3720 C CA   . TYR A 1 10 ? -20.077 0.535   -4.801  1.00 0.00 ? 10 TYR A CA   7  
ATOM 3721 C C    . TYR A 1 10 ? -18.803 0.706   -5.637  1.00 0.00 ? 10 TYR A C    7  
ATOM 3722 O O    . TYR A 1 10 ? -18.749 0.343   -6.796  1.00 0.00 ? 10 TYR A O    7  
ATOM 3723 C CB   . TYR A 1 10 ? -19.974 -0.783  -3.977  1.00 0.00 ? 10 TYR A CB   7  
ATOM 3724 C CG   . TYR A 1 10 ? -18.644 -0.782  -3.195  1.00 0.00 ? 10 TYR A CG   7  
ATOM 3725 C CD1  . TYR A 1 10 ? -18.501 -0.019  -2.050  1.00 0.00 ? 10 TYR A CD1  7  
ATOM 3726 C CD2  . TYR A 1 10 ? -17.568 -1.534  -3.634  1.00 0.00 ? 10 TYR A CD2  7  
ATOM 3727 C CE1  . TYR A 1 10 ? -17.306 -0.006  -1.362  1.00 0.00 ? 10 TYR A CE1  7  
ATOM 3728 C CE2  . TYR A 1 10 ? -16.375 -1.520  -2.944  1.00 0.00 ? 10 TYR A CE2  7  
ATOM 3729 C CZ   . TYR A 1 10 ? -16.235 -0.756  -1.804  1.00 0.00 ? 10 TYR A CZ   7  
ATOM 3730 O OH   . TYR A 1 10 ? -15.040 -0.740  -1.116  1.00 0.00 ? 10 TYR A OH   7  
ATOM 3731 H H    . TYR A 1 10 ? -21.185 0.409   -6.648  1.00 0.00 ? 10 TYR A H    7  
ATOM 3732 H HA   . TYR A 1 10 ? -20.166 1.380   -4.132  1.00 0.00 ? 10 TYR A HA   7  
ATOM 3733 H HB2  . TYR A 1 10 ? -20.791 -0.856  -3.275  1.00 0.00 ? 10 TYR A HB2  7  
ATOM 3734 H HB3  . TYR A 1 10 ? -20.000 -1.640  -4.634  1.00 0.00 ? 10 TYR A HB3  7  
ATOM 3735 H HD1  . TYR A 1 10 ? -19.330 0.574   -1.692  1.00 0.00 ? 10 TYR A HD1  7  
ATOM 3736 H HD2  . TYR A 1 10 ? -17.662 -2.137  -4.526  1.00 0.00 ? 10 TYR A HD2  7  
ATOM 3737 H HE1  . TYR A 1 10 ? -17.208 0.596   -0.469  1.00 0.00 ? 10 TYR A HE1  7  
ATOM 3738 H HE2  . TYR A 1 10 ? -15.544 -2.112  -3.299  1.00 0.00 ? 10 TYR A HE2  7  
ATOM 3739 H HH   . TYR A 1 10 ? -14.476 -0.074  -1.516  1.00 0.00 ? 10 TYR A HH   7  
ATOM 3740 N N    . GLU A 1 11 ? -17.816 1.264   -4.985  1.00 0.00 ? 11 GLU A N    7  
ATOM 3741 C CA   . GLU A 1 11 ? -16.487 1.517   -5.614  1.00 0.00 ? 11 GLU A CA   7  
ATOM 3742 C C    . GLU A 1 11 ? -15.488 1.823   -4.491  1.00 0.00 ? 11 GLU A C    7  
ATOM 3743 O O    . GLU A 1 11 ? -15.839 2.445   -3.506  1.00 0.00 ? 11 GLU A O    7  
ATOM 3744 C CB   . GLU A 1 11 ? -16.600 2.723   -6.578  1.00 0.00 ? 11 GLU A CB   7  
ATOM 3745 C CG   . GLU A 1 11 ? -15.453 2.688   -7.623  1.00 0.00 ? 11 GLU A CG   7  
ATOM 3746 C CD   . GLU A 1 11 ? -14.208 3.426   -7.092  1.00 0.00 ? 11 GLU A CD   7  
ATOM 3747 O OE1  . GLU A 1 11 ? -14.330 4.621   -6.870  1.00 0.00 ? 11 GLU A OE1  7  
ATOM 3748 O OE2  . GLU A 1 11 ? -13.200 2.757   -6.936  1.00 0.00 ? 11 GLU A OE2  7  
ATOM 3749 H H    . GLU A 1 11 ? -17.953 1.523   -4.050  1.00 0.00 ? 11 GLU A H    7  
ATOM 3750 H HA   . GLU A 1 11 ? -16.174 0.622   -6.134  1.00 0.00 ? 11 GLU A HA   7  
ATOM 3751 H HB2  . GLU A 1 11 ? -17.544 2.681   -7.101  1.00 0.00 ? 11 GLU A HB2  7  
ATOM 3752 H HB3  . GLU A 1 11 ? -16.575 3.648   -6.016  1.00 0.00 ? 11 GLU A HB3  7  
ATOM 3753 H HG2  . GLU A 1 11 ? -15.191 1.667   -7.861  1.00 0.00 ? 11 GLU A HG2  7  
ATOM 3754 H HG3  . GLU A 1 11 ? -15.776 3.174   -8.531  1.00 0.00 ? 11 GLU A HG3  7  
ATOM 3755 N N    . VAL A 1 12 ? -14.271 1.375   -4.670  1.00 0.00 ? 12 VAL A N    7  
ATOM 3756 C CA   . VAL A 1 12 ? -13.205 1.611   -3.647  1.00 0.00 ? 12 VAL A CA   7  
ATOM 3757 C C    . VAL A 1 12 ? -12.695 3.056   -3.804  1.00 0.00 ? 12 VAL A C    7  
ATOM 3758 O O    . VAL A 1 12 ? -13.419 3.927   -4.246  1.00 0.00 ? 12 VAL A O    7  
ATOM 3759 C CB   . VAL A 1 12 ? -12.052 0.565   -3.875  1.00 0.00 ? 12 VAL A CB   7  
ATOM 3760 C CG1  . VAL A 1 12 ? -12.591 -0.866  -3.672  1.00 0.00 ? 12 VAL A CG1  7  
ATOM 3761 C CG2  . VAL A 1 12 ? -11.451 0.682   -5.297  1.00 0.00 ? 12 VAL A CG2  7  
ATOM 3762 H H    . VAL A 1 12 ? -14.051 0.880   -5.486  1.00 0.00 ? 12 VAL A H    7  
ATOM 3763 H HA   . VAL A 1 12 ? -13.613 1.501   -2.654  1.00 0.00 ? 12 VAL A HA   7  
ATOM 3764 H HB   . VAL A 1 12 ? -11.269 0.727   -3.148  1.00 0.00 ? 12 VAL A HB   7  
ATOM 3765 H HG11 . VAL A 1 12 ? -13.410 -1.066  -4.348  1.00 0.00 ? 12 VAL A HG11 7  
ATOM 3766 H HG12 . VAL A 1 12 ? -11.805 -1.584  -3.860  1.00 0.00 ? 12 VAL A HG12 7  
ATOM 3767 H HG13 . VAL A 1 12 ? -12.935 -0.993  -2.657  1.00 0.00 ? 12 VAL A HG13 7  
ATOM 3768 H HG21 . VAL A 1 12 ? -11.115 1.690   -5.485  1.00 0.00 ? 12 VAL A HG21 7  
ATOM 3769 H HG22 . VAL A 1 12 ? -10.604 0.017   -5.393  1.00 0.00 ? 12 VAL A HG22 7  
ATOM 3770 H HG23 . VAL A 1 12 ? -12.184 0.414   -6.045  1.00 0.00 ? 12 VAL A HG23 7  
ATOM 3771 N N    . HIS A 1 13 ? -11.463 3.263   -3.429  1.00 0.00 ? 13 HIS A N    7  
ATOM 3772 C CA   . HIS A 1 13 ? -10.829 4.611   -3.525  1.00 0.00 ? 13 HIS A CA   7  
ATOM 3773 C C    . HIS A 1 13 ? -9.611  4.458   -4.436  1.00 0.00 ? 13 HIS A C    7  
ATOM 3774 O O    . HIS A 1 13 ? -9.686  4.741   -5.616  1.00 0.00 ? 13 HIS A O    7  
ATOM 3775 C CB   . HIS A 1 13 ? -10.443 5.055   -2.105  1.00 0.00 ? 13 HIS A CB   7  
ATOM 3776 C CG   . HIS A 1 13 ? -11.723 5.520   -1.409  1.00 0.00 ? 13 HIS A CG   7  
ATOM 3777 N ND1  . HIS A 1 13 ? -12.620 4.740   -0.905  1.00 0.00 ? 13 HIS A ND1  7  
ATOM 3778 C CD2  . HIS A 1 13 ? -12.200 6.795   -1.172  1.00 0.00 ? 13 HIS A CD2  7  
ATOM 3779 C CE1  . HIS A 1 13 ? -13.576 5.452   -0.397  1.00 0.00 ? 13 HIS A CE1  7  
ATOM 3780 N NE2  . HIS A 1 13 ? -13.356 6.735   -0.540  1.00 0.00 ? 13 HIS A NE2  7  
ATOM 3781 H H    . HIS A 1 13 ? -10.948 2.511   -3.075  1.00 0.00 ? 13 HIS A H    7  
ATOM 3782 H HA   . HIS A 1 13 ? -11.507 5.324   -3.967  1.00 0.00 ? 13 HIS A HA   7  
ATOM 3783 H HB2  . HIS A 1 13 ? -10.017 4.235   -1.544  1.00 0.00 ? 13 HIS A HB2  7  
ATOM 3784 H HB3  . HIS A 1 13 ? -9.740  5.874   -2.132  1.00 0.00 ? 13 HIS A HB3  7  
ATOM 3785 H HD1  . HIS A 1 13 ? -12.583 3.761   -0.909  1.00 0.00 ? 13 HIS A HD1  7  
ATOM 3786 H HD2  . HIS A 1 13 ? -11.698 7.705   -1.466  1.00 0.00 ? 13 HIS A HD2  7  
ATOM 3787 H HE1  . HIS A 1 13 ? -14.448 5.036   0.087   1.00 0.00 ? 13 HIS A HE1  7  
ATOM 3788 N N    . HIS A 1 14 ? -8.525  4.013   -3.860  1.00 0.00 ? 14 HIS A N    7  
ATOM 3789 C CA   . HIS A 1 14 ? -7.262  3.812   -4.635  1.00 0.00 ? 14 HIS A CA   7  
ATOM 3790 C C    . HIS A 1 14 ? -6.463  2.652   -4.034  1.00 0.00 ? 14 HIS A C    7  
ATOM 3791 O O    . HIS A 1 14 ? -5.287  2.503   -4.294  1.00 0.00 ? 14 HIS A O    7  
ATOM 3792 C CB   . HIS A 1 14 ? -6.395  5.117   -4.601  1.00 0.00 ? 14 HIS A CB   7  
ATOM 3793 C CG   . HIS A 1 14 ? -7.124  6.297   -3.942  1.00 0.00 ? 14 HIS A CG   7  
ATOM 3794 N ND1  . HIS A 1 14 ? -6.973  6.662   -2.713  1.00 0.00 ? 14 HIS A ND1  7  
ATOM 3795 C CD2  . HIS A 1 14 ? -8.049  7.191   -4.454  1.00 0.00 ? 14 HIS A CD2  7  
ATOM 3796 C CE1  . HIS A 1 14 ? -7.726  7.686   -2.466  1.00 0.00 ? 14 HIS A CE1  7  
ATOM 3797 N NE2  . HIS A 1 14 ? -8.414  8.049   -3.521  1.00 0.00 ? 14 HIS A NE2  7  
ATOM 3798 H H    . HIS A 1 14 ? -8.542  3.810   -2.903  1.00 0.00 ? 14 HIS A H    7  
ATOM 3799 H HA   . HIS A 1 14 ? -7.520  3.531   -5.641  1.00 0.00 ? 14 HIS A HA   7  
ATOM 3800 H HB2  . HIS A 1 14 ? -5.481  4.950   -4.052  1.00 0.00 ? 14 HIS A HB2  7  
ATOM 3801 H HB3  . HIS A 1 14 ? -6.140  5.404   -5.610  1.00 0.00 ? 14 HIS A HB3  7  
ATOM 3802 H HD1  . HIS A 1 14 ? -6.379  6.230   -2.066  1.00 0.00 ? 14 HIS A HD1  7  
ATOM 3803 H HD2  . HIS A 1 14 ? -8.419  7.183   -5.468  1.00 0.00 ? 14 HIS A HD2  7  
ATOM 3804 H HE1  . HIS A 1 14 ? -7.781  8.181   -1.507  1.00 0.00 ? 14 HIS A HE1  7  
ATOM 3805 N N    . GLN A 1 15 ? -7.129  1.849   -3.246  1.00 0.00 ? 15 GLN A N    7  
ATOM 3806 C CA   . GLN A 1 15 ? -6.464  0.675   -2.588  1.00 0.00 ? 15 GLN A CA   7  
ATOM 3807 C C    . GLN A 1 15 ? -5.621  -0.128  -3.591  1.00 0.00 ? 15 GLN A C    7  
ATOM 3808 O O    . GLN A 1 15 ? -4.492  -0.487  -3.322  1.00 0.00 ? 15 GLN A O    7  
ATOM 3809 C CB   . GLN A 1 15 ? -7.555  -0.225  -1.972  1.00 0.00 ? 15 GLN A CB   7  
ATOM 3810 C CG   . GLN A 1 15 ? -6.905  -1.225  -0.991  1.00 0.00 ? 15 GLN A CG   7  
ATOM 3811 C CD   . GLN A 1 15 ? -7.972  -2.186  -0.456  1.00 0.00 ? 15 GLN A CD   7  
ATOM 3812 O OE1  . GLN A 1 15 ? -7.936  -3.374  -0.705  1.00 0.00 ? 15 GLN A OE1  7  
ATOM 3813 N NE2  . GLN A 1 15 ? -8.938  -1.710  0.283   1.00 0.00 ? 15 GLN A NE2  7  
ATOM 3814 H H    . GLN A 1 15 ? -8.080  2.031   -3.100  1.00 0.00 ? 15 GLN A H    7  
ATOM 3815 H HA   . GLN A 1 15 ? -5.807  1.052   -1.820  1.00 0.00 ? 15 GLN A HA   7  
ATOM 3816 H HB2  . GLN A 1 15 ? -8.267  0.391   -1.442  1.00 0.00 ? 15 GLN A HB2  7  
ATOM 3817 H HB3  . GLN A 1 15 ? -8.078  -0.757  -2.753  1.00 0.00 ? 15 GLN A HB3  7  
ATOM 3818 H HG2  . GLN A 1 15 ? -6.139  -1.801  -1.490  1.00 0.00 ? 15 GLN A HG2  7  
ATOM 3819 H HG3  . GLN A 1 15 ? -6.461  -0.700  -0.158  1.00 0.00 ? 15 GLN A HG3  7  
ATOM 3820 H HE21 . GLN A 1 15 ? -8.972  -0.753  0.487   1.00 0.00 ? 15 GLN A HE21 7  
ATOM 3821 H HE22 . GLN A 1 15 ? -9.629  -2.311  0.632   1.00 0.00 ? 15 GLN A HE22 7  
ATOM 3822 N N    . LYS A 1 16 ? -6.214  -0.372  -4.728  1.00 0.00 ? 16 LYS A N    7  
ATOM 3823 C CA   . LYS A 1 16 ? -5.523  -1.140  -5.808  1.00 0.00 ? 16 LYS A CA   7  
ATOM 3824 C C    . LYS A 1 16 ? -4.137  -0.556  -6.137  1.00 0.00 ? 16 LYS A C    7  
ATOM 3825 O O    . LYS A 1 16 ? -3.126  -1.218  -5.987  1.00 0.00 ? 16 LYS A O    7  
ATOM 3826 C CB   . LYS A 1 16 ? -6.422  -1.137  -7.083  1.00 0.00 ? 16 LYS A CB   7  
ATOM 3827 C CG   . LYS A 1 16 ? -7.034  0.271   -7.376  1.00 0.00 ? 16 LYS A CG   7  
ATOM 3828 C CD   . LYS A 1 16 ? -6.425  0.865   -8.667  1.00 0.00 ? 16 LYS A CD   7  
ATOM 3829 C CE   . LYS A 1 16 ? -6.737  2.373   -8.729  1.00 0.00 ? 16 LYS A CE   7  
ATOM 3830 N NZ   . LYS A 1 16 ? -5.946  3.014   -9.818  1.00 0.00 ? 16 LYS A NZ   7  
ATOM 3831 H H    . LYS A 1 16 ? -7.128  -0.043  -4.863  1.00 0.00 ? 16 LYS A H    7  
ATOM 3832 H HA   . LYS A 1 16 ? -5.389  -2.152  -5.471  1.00 0.00 ? 16 LYS A HA   7  
ATOM 3833 H HB2  . LYS A 1 16 ? -5.844  -1.484  -7.929  1.00 0.00 ? 16 LYS A HB2  7  
ATOM 3834 H HB3  . LYS A 1 16 ? -7.229  -1.840  -6.930  1.00 0.00 ? 16 LYS A HB3  7  
ATOM 3835 H HG2  . LYS A 1 16 ? -8.102  0.169   -7.507  1.00 0.00 ? 16 LYS A HG2  7  
ATOM 3836 H HG3  . LYS A 1 16 ? -6.865  0.951   -6.555  1.00 0.00 ? 16 LYS A HG3  7  
ATOM 3837 H HD2  . LYS A 1 16 ? -5.355  0.716   -8.684  1.00 0.00 ? 16 LYS A HD2  7  
ATOM 3838 H HD3  . LYS A 1 16 ? -6.847  0.371   -9.530  1.00 0.00 ? 16 LYS A HD3  7  
ATOM 3839 H HE2  . LYS A 1 16 ? -7.787  2.532   -8.928  1.00 0.00 ? 16 LYS A HE2  7  
ATOM 3840 H HE3  . LYS A 1 16 ? -6.481  2.853   -7.796  1.00 0.00 ? 16 LYS A HE3  7  
ATOM 3841 H HZ1  . LYS A 1 16 ? -5.356  2.297   -10.289 1.00 0.00 ? 16 LYS A HZ1  7  
ATOM 3842 H HZ2  . LYS A 1 16 ? -6.593  3.439   -10.513 1.00 0.00 ? 16 LYS A HZ2  7  
ATOM 3843 H HZ3  . LYS A 1 16 ? -5.336  3.752   -9.413  1.00 0.00 ? 16 LYS A HZ3  7  
ATOM 3844 N N    . LEU A 1 17 ? -4.123  0.680   -6.567  1.00 0.00 ? 17 LEU A N    7  
ATOM 3845 C CA   . LEU A 1 17 ? -2.824  1.320   -6.914  1.00 0.00 ? 17 LEU A CA   7  
ATOM 3846 C C    . LEU A 1 17 ? -1.941  1.444   -5.670  1.00 0.00 ? 17 LEU A C    7  
ATOM 3847 O O    . LEU A 1 17 ? -0.748  1.294   -5.774  1.00 0.00 ? 17 LEU A O    7  
ATOM 3848 C CB   . LEU A 1 17 ? -3.125  2.710   -7.571  1.00 0.00 ? 17 LEU A CB   7  
ATOM 3849 C CG   . LEU A 1 17 ? -3.175  3.896   -6.577  1.00 0.00 ? 17 LEU A CG   7  
ATOM 3850 C CD1  . LEU A 1 17 ? -1.731  4.366   -6.213  1.00 0.00 ? 17 LEU A CD1  7  
ATOM 3851 C CD2  . LEU A 1 17 ? -3.927  5.058   -7.254  1.00 0.00 ? 17 LEU A CD2  7  
ATOM 3852 H H    . LEU A 1 17 ? -4.962  1.176   -6.651  1.00 0.00 ? 17 LEU A H    7  
ATOM 3853 H HA   . LEU A 1 17 ? -2.320  0.694   -7.636  1.00 0.00 ? 17 LEU A HA   7  
ATOM 3854 H HB2  . LEU A 1 17 ? -2.371  2.906   -8.321  1.00 0.00 ? 17 LEU A HB2  7  
ATOM 3855 H HB3  . LEU A 1 17 ? -4.072  2.639   -8.082  1.00 0.00 ? 17 LEU A HB3  7  
ATOM 3856 H HG   . LEU A 1 17 ? -3.712  3.596   -5.690  1.00 0.00 ? 17 LEU A HG   7  
ATOM 3857 H HD11 . LEU A 1 17 ? -0.989  3.840   -6.798  1.00 0.00 ? 17 LEU A HD11 7  
ATOM 3858 H HD12 . LEU A 1 17 ? -1.608  5.424   -6.388  1.00 0.00 ? 17 LEU A HD12 7  
ATOM 3859 H HD13 . LEU A 1 17 ? -1.538  4.171   -5.169  1.00 0.00 ? 17 LEU A HD13 7  
ATOM 3860 H HD21 . LEU A 1 17 ? -3.422  5.351   -8.163  1.00 0.00 ? 17 LEU A HD21 7  
ATOM 3861 H HD22 . LEU A 1 17 ? -4.934  4.757   -7.499  1.00 0.00 ? 17 LEU A HD22 7  
ATOM 3862 H HD23 . LEU A 1 17 ? -3.970  5.908   -6.588  1.00 0.00 ? 17 LEU A HD23 7  
ATOM 3863 N N    . VAL A 1 18 ? -2.512  1.708   -4.523  1.00 0.00 ? 18 VAL A N    7  
ATOM 3864 C CA   . VAL A 1 18 ? -1.702  1.835   -3.274  1.00 0.00 ? 18 VAL A CA   7  
ATOM 3865 C C    . VAL A 1 18 ? -0.838  0.566   -3.117  1.00 0.00 ? 18 VAL A C    7  
ATOM 3866 O O    . VAL A 1 18 ? 0.369   0.644   -3.022  1.00 0.00 ? 18 VAL A O    7  
ATOM 3867 C CB   . VAL A 1 18 ? -2.705  2.021   -2.102  1.00 0.00 ? 18 VAL A CB   7  
ATOM 3868 C CG1  . VAL A 1 18 ? -2.024  1.792   -0.748  1.00 0.00 ? 18 VAL A CG1  7  
ATOM 3869 C CG2  . VAL A 1 18 ? -3.291  3.452   -2.143  1.00 0.00 ? 18 VAL A CG2  7  
ATOM 3870 H H    . VAL A 1 18 ? -3.476  1.837   -4.465  1.00 0.00 ? 18 VAL A H    7  
ATOM 3871 H HA   . VAL A 1 18 ? -1.053  2.694   -3.361  1.00 0.00 ? 18 VAL A HA   7  
ATOM 3872 H HB   . VAL A 1 18 ? -3.513  1.316   -2.201  1.00 0.00 ? 18 VAL A HB   7  
ATOM 3873 H HG11 . VAL A 1 18 ? -1.048  2.251   -0.737  1.00 0.00 ? 18 VAL A HG11 7  
ATOM 3874 H HG12 . VAL A 1 18 ? -2.625  2.214   0.043   1.00 0.00 ? 18 VAL A HG12 7  
ATOM 3875 H HG13 . VAL A 1 18 ? -1.923  0.730   -0.578  1.00 0.00 ? 18 VAL A HG13 7  
ATOM 3876 H HG21 . VAL A 1 18 ? -3.453  3.769   -3.162  1.00 0.00 ? 18 VAL A HG21 7  
ATOM 3877 H HG22 . VAL A 1 18 ? -4.238  3.472   -1.623  1.00 0.00 ? 18 VAL A HG22 7  
ATOM 3878 H HG23 . VAL A 1 18 ? -2.620  4.153   -1.668  1.00 0.00 ? 18 VAL A HG23 7  
ATOM 3879 N N    . PHE A 1 19 ? -1.484  -0.572  -3.107  1.00 0.00 ? 19 PHE A N    7  
ATOM 3880 C CA   . PHE A 1 19 ? -0.764  -1.880  -2.963  1.00 0.00 ? 19 PHE A CA   7  
ATOM 3881 C C    . PHE A 1 19 ? 0.381   -1.943  -3.987  1.00 0.00 ? 19 PHE A C    7  
ATOM 3882 O O    . PHE A 1 19 ? 1.517   -2.242  -3.666  1.00 0.00 ? 19 PHE A O    7  
ATOM 3883 C CB   . PHE A 1 19 ? -1.781  -3.020  -3.196  1.00 0.00 ? 19 PHE A CB   7  
ATOM 3884 C CG   . PHE A 1 19 ? -2.582  -3.327  -1.911  1.00 0.00 ? 19 PHE A CG   7  
ATOM 3885 C CD1  . PHE A 1 19 ? -3.141  -2.319  -1.137  1.00 0.00 ? 19 PHE A CD1  7  
ATOM 3886 C CD2  . PHE A 1 19 ? -2.756  -4.641  -1.511  1.00 0.00 ? 19 PHE A CD2  7  
ATOM 3887 C CE1  . PHE A 1 19 ? -3.854  -2.620  0.004   1.00 0.00 ? 19 PHE A CE1  7  
ATOM 3888 C CE2  . PHE A 1 19 ? -3.471  -4.942  -0.369  1.00 0.00 ? 19 PHE A CE2  7  
ATOM 3889 C CZ   . PHE A 1 19 ? -4.020  -3.932  0.389   1.00 0.00 ? 19 PHE A CZ   7  
ATOM 3890 H H    . PHE A 1 19 ? -2.456  -0.562  -3.199  1.00 0.00 ? 19 PHE A H    7  
ATOM 3891 H HA   . PHE A 1 19 ? -0.343  -1.939  -1.973  1.00 0.00 ? 19 PHE A HA   7  
ATOM 3892 H HB2  . PHE A 1 19 ? -2.478  -2.743  -3.973  1.00 0.00 ? 19 PHE A HB2  7  
ATOM 3893 H HB3  . PHE A 1 19 ? -1.263  -3.917  -3.506  1.00 0.00 ? 19 PHE A HB3  7  
ATOM 3894 H HD1  . PHE A 1 19 ? -3.023  -1.284  -1.419  1.00 0.00 ? 19 PHE A HD1  7  
ATOM 3895 H HD2  . PHE A 1 19 ? -2.330  -5.443  -2.096  1.00 0.00 ? 19 PHE A HD2  7  
ATOM 3896 H HE1  . PHE A 1 19 ? -4.283  -1.826  0.596   1.00 0.00 ? 19 PHE A HE1  7  
ATOM 3897 H HE2  . PHE A 1 19 ? -3.600  -5.971  -0.069  1.00 0.00 ? 19 PHE A HE2  7  
ATOM 3898 H HZ   . PHE A 1 19 ? -4.580  -4.167  1.283   1.00 0.00 ? 19 PHE A HZ   7  
ATOM 3899 N N    . PHE A 1 20 ? 0.024   -1.642  -5.210  1.00 0.00 ? 20 PHE A N    7  
ATOM 3900 C CA   . PHE A 1 20 ? 1.018   -1.650  -6.326  1.00 0.00 ? 20 PHE A CA   7  
ATOM 3901 C C    . PHE A 1 20 ? 2.210   -0.746  -5.931  1.00 0.00 ? 20 PHE A C    7  
ATOM 3902 O O    . PHE A 1 20 ? 3.351   -1.157  -5.975  1.00 0.00 ? 20 PHE A O    7  
ATOM 3903 C CB   . PHE A 1 20 ? 0.240   -1.162  -7.597  1.00 0.00 ? 20 PHE A CB   7  
ATOM 3904 C CG   . PHE A 1 20 ? 1.021   -0.166  -8.471  1.00 0.00 ? 20 PHE A CG   7  
ATOM 3905 C CD1  . PHE A 1 20 ? 2.101   -0.604  -9.207  1.00 0.00 ? 20 PHE A CD1  7  
ATOM 3906 C CD2  . PHE A 1 20 ? 0.658   1.169   -8.540  1.00 0.00 ? 20 PHE A CD2  7  
ATOM 3907 C CE1  . PHE A 1 20 ? 2.810   0.271   -10.000 1.00 0.00 ? 20 PHE A CE1  7  
ATOM 3908 C CE2  . PHE A 1 20 ? 1.365   2.046   -9.331  1.00 0.00 ? 20 PHE A CE2  7  
ATOM 3909 C CZ   . PHE A 1 20 ? 2.444   1.599   -10.063 1.00 0.00 ? 20 PHE A CZ   7  
ATOM 3910 H H    . PHE A 1 20 ? -0.909  -1.412  -5.395  1.00 0.00 ? 20 PHE A H    7  
ATOM 3911 H HA   . PHE A 1 20 ? 1.373   -2.661  -6.471  1.00 0.00 ? 20 PHE A HA   7  
ATOM 3912 H HB2  . PHE A 1 20 ? 0.004   -2.023  -8.205  1.00 0.00 ? 20 PHE A HB2  7  
ATOM 3913 H HB3  . PHE A 1 20 ? -0.693  -0.705  -7.305  1.00 0.00 ? 20 PHE A HB3  7  
ATOM 3914 H HD1  . PHE A 1 20 ? 2.393   -1.641  -9.160  1.00 0.00 ? 20 PHE A HD1  7  
ATOM 3915 H HD2  . PHE A 1 20 ? -0.186  1.540   -7.979  1.00 0.00 ? 20 PHE A HD2  7  
ATOM 3916 H HE1  . PHE A 1 20 ? 3.651   -0.090  -10.570 1.00 0.00 ? 20 PHE A HE1  7  
ATOM 3917 H HE2  . PHE A 1 20 ? 1.069   3.083   -9.371  1.00 0.00 ? 20 PHE A HE2  7  
ATOM 3918 H HZ   . PHE A 1 20 ? 2.999   2.284   -10.685 1.00 0.00 ? 20 PHE A HZ   7  
ATOM 3919 N N    . ALA A 1 21 ? 1.898   0.463   -5.544  1.00 0.00 ? 21 ALA A N    7  
ATOM 3920 C CA   . ALA A 1 21 ? 2.926   1.466   -5.126  1.00 0.00 ? 21 ALA A CA   7  
ATOM 3921 C C    . ALA A 1 21 ? 3.872   0.894   -4.072  1.00 0.00 ? 21 ALA A C    7  
ATOM 3922 O O    . ALA A 1 21 ? 5.062   1.068   -4.181  1.00 0.00 ? 21 ALA A O    7  
ATOM 3923 C CB   . ALA A 1 21 ? 2.207   2.709   -4.571  1.00 0.00 ? 21 ALA A CB   7  
ATOM 3924 H H    . ALA A 1 21 ? 0.960   0.717   -5.530  1.00 0.00 ? 21 ALA A H    7  
ATOM 3925 H HA   . ALA A 1 21 ? 3.516   1.734   -5.991  1.00 0.00 ? 21 ALA A HA   7  
ATOM 3926 H HB1  . ALA A 1 21 ? 1.349   2.946   -5.182  1.00 0.00 ? 21 ALA A HB1  7  
ATOM 3927 H HB2  . ALA A 1 21 ? 1.877   2.541   -3.557  1.00 0.00 ? 21 ALA A HB2  7  
ATOM 3928 H HB3  . ALA A 1 21 ? 2.881   3.553   -4.579  1.00 0.00 ? 21 ALA A HB3  7  
ATOM 3929 N N    . GLU A 1 22 ? 3.343   0.232   -3.077  1.00 0.00 ? 22 GLU A N    7  
ATOM 3930 C CA   . GLU A 1 22 ? 4.230   -0.359  -2.016  1.00 0.00 ? 22 GLU A CA   7  
ATOM 3931 C C    . GLU A 1 22 ? 5.278   -1.264  -2.686  1.00 0.00 ? 22 GLU A C    7  
ATOM 3932 O O    . GLU A 1 22 ? 6.465   -1.139  -2.442  1.00 0.00 ? 22 GLU A O    7  
ATOM 3933 C CB   . GLU A 1 22 ? 3.379   -1.193  -1.026  1.00 0.00 ? 22 GLU A CB   7  
ATOM 3934 C CG   . GLU A 1 22 ? 2.841   -0.292  0.106   1.00 0.00 ? 22 GLU A CG   7  
ATOM 3935 C CD   . GLU A 1 22 ? 1.611   0.480   -0.395  1.00 0.00 ? 22 GLU A CD   7  
ATOM 3936 O OE1  . GLU A 1 22 ? 0.537   -0.094  -0.299  1.00 0.00 ? 22 GLU A OE1  7  
ATOM 3937 O OE2  . GLU A 1 22 ? 1.811   1.596   -0.848  1.00 0.00 ? 22 GLU A OE2  7  
ATOM 3938 H H    . GLU A 1 22 ? 2.371   0.147   -3.049  1.00 0.00 ? 22 GLU A H    7  
ATOM 3939 H HA   . GLU A 1 22 ? 4.752   0.446   -1.518  1.00 0.00 ? 22 GLU A HA   7  
ATOM 3940 H HB2  . GLU A 1 22 ? 2.557   -1.663  -1.544  1.00 0.00 ? 22 GLU A HB2  7  
ATOM 3941 H HB3  . GLU A 1 22 ? 3.988   -1.970  -0.586  1.00 0.00 ? 22 GLU A HB3  7  
ATOM 3942 H HG2  . GLU A 1 22 ? 2.553   -0.901  0.951   1.00 0.00 ? 22 GLU A HG2  7  
ATOM 3943 H HG3  . GLU A 1 22 ? 3.597   0.408   0.434   1.00 0.00 ? 22 GLU A HG3  7  
ATOM 3944 N N    . ASP A 1 23 ? 4.794   -2.149  -3.524  1.00 0.00 ? 23 ASP A N    7  
ATOM 3945 C CA   . ASP A 1 23 ? 5.701   -3.094  -4.254  1.00 0.00 ? 23 ASP A CA   7  
ATOM 3946 C C    . ASP A 1 23 ? 6.819   -2.296  -4.948  1.00 0.00 ? 23 ASP A C    7  
ATOM 3947 O O    . ASP A 1 23 ? 7.999   -2.553  -4.812  1.00 0.00 ? 23 ASP A O    7  
ATOM 3948 C CB   . ASP A 1 23 ? 4.875   -3.855  -5.300  1.00 0.00 ? 23 ASP A CB   7  
ATOM 3949 C CG   . ASP A 1 23 ? 5.625   -5.131  -5.714  1.00 0.00 ? 23 ASP A CG   7  
ATOM 3950 O OD1  . ASP A 1 23 ? 6.509   -4.992  -6.544  1.00 0.00 ? 23 ASP A OD1  7  
ATOM 3951 O OD2  . ASP A 1 23 ? 5.274   -6.170  -5.178  1.00 0.00 ? 23 ASP A OD2  7  
ATOM 3952 H H    . ASP A 1 23 ? 3.826   -2.188  -3.666  1.00 0.00 ? 23 ASP A H    7  
ATOM 3953 H HA   . ASP A 1 23 ? 6.141   -3.773  -3.541  1.00 0.00 ? 23 ASP A HA   7  
ATOM 3954 H HB2  . ASP A 1 23 ? 3.905   -4.109  -4.902  1.00 0.00 ? 23 ASP A HB2  7  
ATOM 3955 H HB3  . ASP A 1 23 ? 4.717   -3.239  -6.173  1.00 0.00 ? 23 ASP A HB3  7  
ATOM 3956 N N    . VAL A 1 24 ? 6.352   -1.324  -5.683  1.00 0.00 ? 24 VAL A N    7  
ATOM 3957 C CA   . VAL A 1 24 ? 7.224   -0.400  -6.460  1.00 0.00 ? 24 VAL A CA   7  
ATOM 3958 C C    . VAL A 1 24 ? 8.277   0.240   -5.551  1.00 0.00 ? 24 VAL A C    7  
ATOM 3959 O O    . VAL A 1 24 ? 9.443   0.249   -5.876  1.00 0.00 ? 24 VAL A O    7  
ATOM 3960 C CB   . VAL A 1 24 ? 6.293   0.655   -7.099  1.00 0.00 ? 24 VAL A CB   7  
ATOM 3961 C CG1  . VAL A 1 24 ? 7.063   1.588   -8.026  1.00 0.00 ? 24 VAL A CG1  7  
ATOM 3962 C CG2  . VAL A 1 24 ? 5.185   -0.053  -7.907  1.00 0.00 ? 24 VAL A CG2  7  
ATOM 3963 H H    . VAL A 1 24 ? 5.383   -1.204  -5.726  1.00 0.00 ? 24 VAL A H    7  
ATOM 3964 H HA   . VAL A 1 24 ? 7.733   -0.967  -7.224  1.00 0.00 ? 24 VAL A HA   7  
ATOM 3965 H HB   . VAL A 1 24 ? 5.838   1.257   -6.330  1.00 0.00 ? 24 VAL A HB   7  
ATOM 3966 H HG11 . VAL A 1 24 ? 7.832   2.100   -7.471  1.00 0.00 ? 24 VAL A HG11 7  
ATOM 3967 H HG12 . VAL A 1 24 ? 7.509   1.025   -8.830  1.00 0.00 ? 24 VAL A HG12 7  
ATOM 3968 H HG13 . VAL A 1 24 ? 6.379   2.319   -8.433  1.00 0.00 ? 24 VAL A HG13 7  
ATOM 3969 H HG21 . VAL A 1 24 ? 5.134   -1.107  -7.674  1.00 0.00 ? 24 VAL A HG21 7  
ATOM 3970 H HG22 . VAL A 1 24 ? 4.237   0.397   -7.661  1.00 0.00 ? 24 VAL A HG22 7  
ATOM 3971 H HG23 . VAL A 1 24 ? 5.359   0.047   -8.967  1.00 0.00 ? 24 VAL A HG23 7  
ATOM 3972 N N    . GLY A 1 25 ? 7.825   0.752   -4.438  1.00 0.00 ? 25 GLY A N    7  
ATOM 3973 C CA   . GLY A 1 25 ? 8.711   1.418   -3.429  1.00 0.00 ? 25 GLY A CA   7  
ATOM 3974 C C    . GLY A 1 25 ? 9.947   0.562   -3.136  1.00 0.00 ? 25 GLY A C    7  
ATOM 3975 O O    . GLY A 1 25 ? 11.066  1.035   -3.182  1.00 0.00 ? 25 GLY A O    7  
ATOM 3976 H H    . GLY A 1 25 ? 6.867   0.693   -4.281  1.00 0.00 ? 25 GLY A H    7  
ATOM 3977 H HA2  . GLY A 1 25 ? 9.019   2.381   -3.807  1.00 0.00 ? 25 GLY A HA2  7  
ATOM 3978 H HA3  . GLY A 1 25 ? 8.154   1.556   -2.514  1.00 0.00 ? 25 GLY A HA3  7  
ATOM 3979 N N    . SER A 1 26 ? 9.685   -0.687  -2.842  1.00 0.00 ? 26 SER A N    7  
ATOM 3980 C CA   . SER A 1 26 ? 10.783  -1.666  -2.532  1.00 0.00 ? 26 SER A CA   7  
ATOM 3981 C C    . SER A 1 26 ? 11.908  -1.543  -3.582  1.00 0.00 ? 26 SER A C    7  
ATOM 3982 O O    . SER A 1 26 ? 13.062  -1.315  -3.272  1.00 0.00 ? 26 SER A O    7  
ATOM 3983 C CB   . SER A 1 26 ? 10.207  -3.101  -2.550  1.00 0.00 ? 26 SER A CB   7  
ATOM 3984 O OG   . SER A 1 26 ? 8.939   -2.998  -1.914  1.00 0.00 ? 26 SER A OG   7  
ATOM 3985 H H    . SER A 1 26 ? 8.744   -0.964  -2.826  1.00 0.00 ? 26 SER A H    7  
ATOM 3986 H HA   . SER A 1 26 ? 11.186  -1.440  -1.558  1.00 0.00 ? 26 SER A HA   7  
ATOM 3987 H HB2  . SER A 1 26 ? 10.072  -3.473  -3.555  1.00 0.00 ? 26 SER A HB2  7  
ATOM 3988 H HB3  . SER A 1 26 ? 10.832  -3.779  -1.988  1.00 0.00 ? 26 SER A HB3  7  
ATOM 3989 H HG   . SER A 1 26 ? 8.263   -3.199  -2.566  1.00 0.00 ? 26 SER A HG   7  
ATOM 3990 N N    . ASN A 1 27 ? 11.499  -1.697  -4.812  1.00 0.00 ? 27 ASN A N    7  
ATOM 3991 C CA   . ASN A 1 27 ? 12.434  -1.612  -5.978  1.00 0.00 ? 27 ASN A CA   7  
ATOM 3992 C C    . ASN A 1 27 ? 13.068  -0.226  -6.088  1.00 0.00 ? 27 ASN A C    7  
ATOM 3993 O O    . ASN A 1 27 ? 14.265  -0.089  -6.233  1.00 0.00 ? 27 ASN A O    7  
ATOM 3994 C CB   . ASN A 1 27 ? 11.634  -1.930  -7.248  1.00 0.00 ? 27 ASN A CB   7  
ATOM 3995 C CG   . ASN A 1 27 ? 11.910  -3.374  -7.676  1.00 0.00 ? 27 ASN A CG   7  
ATOM 3996 O OD1  . ASN A 1 27 ? 11.235  -4.297  -7.267  1.00 0.00 ? 27 ASN A OD1  7  
ATOM 3997 N ND2  . ASN A 1 27 ? 12.895  -3.612  -8.498  1.00 0.00 ? 27 ASN A ND2  7  
ATOM 3998 H H    . ASN A 1 27 ? 10.549  -1.877  -4.957  1.00 0.00 ? 27 ASN A H    7  
ATOM 3999 H HA   . ASN A 1 27 ? 13.239  -2.309  -5.810  1.00 0.00 ? 27 ASN A HA   7  
ATOM 4000 H HB2  . ASN A 1 27 ? 10.577  -1.819  -7.052  1.00 0.00 ? 27 ASN A HB2  7  
ATOM 4001 H HB3  . ASN A 1 27 ? 11.894  -1.258  -8.051  1.00 0.00 ? 27 ASN A HB3  7  
ATOM 4002 H HD21 . ASN A 1 27 ? 13.445  -2.872  -8.831  1.00 0.00 ? 27 ASN A HD21 7  
ATOM 4003 H HD22 . ASN A 1 27 ? 13.085  -4.529  -8.782  1.00 0.00 ? 27 ASN A HD22 7  
ATOM 4004 N N    . LYS A 1 28 ? 12.218  0.760   -6.018  1.00 0.00 ? 28 LYS A N    7  
ATOM 4005 C CA   . LYS A 1 28 ? 12.615  2.198   -6.099  1.00 0.00 ? 28 LYS A CA   7  
ATOM 4006 C C    . LYS A 1 28 ? 13.849  2.449   -5.225  1.00 0.00 ? 28 LYS A C    7  
ATOM 4007 O O    . LYS A 1 28 ? 14.785  3.069   -5.673  1.00 0.00 ? 28 LYS A O    7  
ATOM 4008 C CB   . LYS A 1 28 ? 11.418  3.037   -5.622  1.00 0.00 ? 28 LYS A CB   7  
ATOM 4009 C CG   . LYS A 1 28 ? 10.843  3.886   -6.778  1.00 0.00 ? 28 LYS A CG   7  
ATOM 4010 C CD   . LYS A 1 28 ? 9.392   4.299   -6.438  1.00 0.00 ? 28 LYS A CD   7  
ATOM 4011 C CE   . LYS A 1 28 ? 9.390   5.428   -5.391  1.00 0.00 ? 28 LYS A CE   7  
ATOM 4012 N NZ   . LYS A 1 28 ? 7.997   5.684   -4.927  1.00 0.00 ? 28 LYS A NZ   7  
ATOM 4013 H H    . LYS A 1 28 ? 11.278  0.539   -5.913  1.00 0.00 ? 28 LYS A H    7  
ATOM 4014 H HA   . LYS A 1 28 ? 12.870  2.435   -7.126  1.00 0.00 ? 28 LYS A HA   7  
ATOM 4015 H HB2  . LYS A 1 28 ? 10.652  2.366   -5.267  1.00 0.00 ? 28 LYS A HB2  7  
ATOM 4016 H HB3  . LYS A 1 28 ? 11.714  3.677   -4.806  1.00 0.00 ? 28 LYS A HB3  7  
ATOM 4017 H HG2  . LYS A 1 28 ? 11.456  4.762   -6.931  1.00 0.00 ? 28 LYS A HG2  7  
ATOM 4018 H HG3  . LYS A 1 28 ? 10.837  3.307   -7.692  1.00 0.00 ? 28 LYS A HG3  7  
ATOM 4019 H HD2  . LYS A 1 28 ? 8.898   4.642   -7.336  1.00 0.00 ? 28 LYS A HD2  7  
ATOM 4020 H HD3  . LYS A 1 28 ? 8.845   3.451   -6.053  1.00 0.00 ? 28 LYS A HD3  7  
ATOM 4021 H HE2  . LYS A 1 28 ? 9.989   5.157   -4.532  1.00 0.00 ? 28 LYS A HE2  7  
ATOM 4022 H HE3  . LYS A 1 28 ? 9.783   6.339   -5.820  1.00 0.00 ? 28 LYS A HE3  7  
ATOM 4023 H HZ1  . LYS A 1 28 ? 7.341   5.042   -5.417  1.00 0.00 ? 28 LYS A HZ1  7  
ATOM 4024 H HZ2  . LYS A 1 28 ? 7.938   5.522   -3.902  1.00 0.00 ? 28 LYS A HZ2  7  
ATOM 4025 H HZ3  . LYS A 1 28 ? 7.737   6.669   -5.137  1.00 0.00 ? 28 LYS A HZ3  7  
ATOM 4026 N N    . GLY A 1 29 ? 13.826  1.961   -4.010  1.00 0.00 ? 29 GLY A N    7  
ATOM 4027 C CA   . GLY A 1 29 ? 14.990  2.152   -3.088  1.00 0.00 ? 29 GLY A CA   7  
ATOM 4028 C C    . GLY A 1 29 ? 16.295  1.761   -3.799  1.00 0.00 ? 29 GLY A C    7  
ATOM 4029 O O    . GLY A 1 29 ? 17.222  2.545   -3.895  1.00 0.00 ? 29 GLY A O    7  
ATOM 4030 H H    . GLY A 1 29 ? 13.035  1.473   -3.709  1.00 0.00 ? 29 GLY A H    7  
ATOM 4031 H HA2  . GLY A 1 29 ? 15.039  3.187   -2.784  1.00 0.00 ? 29 GLY A HA2  7  
ATOM 4032 H HA3  . GLY A 1 29 ? 14.858  1.525   -2.218  1.00 0.00 ? 29 GLY A HA3  7  
ATOM 4033 N N    . ALA A 1 30 ? 16.319  0.550   -4.298  1.00 0.00 ? 30 ALA A N    7  
ATOM 4034 C CA   . ALA A 1 30 ? 17.550  0.067   -5.012  1.00 0.00 ? 30 ALA A CA   7  
ATOM 4035 C C    . ALA A 1 30 ? 17.830  0.912   -6.265  1.00 0.00 ? 30 ALA A C    7  
ATOM 4036 O O    . ALA A 1 30 ? 18.937  1.349   -6.502  1.00 0.00 ? 30 ALA A O    7  
ATOM 4037 C CB   . ALA A 1 30 ? 17.345  -1.402  -5.406  1.00 0.00 ? 30 ALA A CB   7  
ATOM 4038 H H    . ALA A 1 30 ? 15.526  -0.025  -4.200  1.00 0.00 ? 30 ALA A H    7  
ATOM 4039 H HA   . ALA A 1 30 ? 18.395  0.167   -4.345  1.00 0.00 ? 30 ALA A HA   7  
ATOM 4040 H HB1  . ALA A 1 30 ? 17.124  -1.991  -4.528  1.00 0.00 ? 30 ALA A HB1  7  
ATOM 4041 H HB2  . ALA A 1 30 ? 16.524  -1.496  -6.102  1.00 0.00 ? 30 ALA A HB2  7  
ATOM 4042 H HB3  . ALA A 1 30 ? 18.241  -1.792  -5.867  1.00 0.00 ? 30 ALA A HB3  7  
ATOM 4043 N N    . ILE A 1 31 ? 16.793  1.114   -7.032  1.00 0.00 ? 31 ILE A N    7  
ATOM 4044 C CA   . ILE A 1 31 ? 16.854  1.910   -8.294  1.00 0.00 ? 31 ILE A CA   7  
ATOM 4045 C C    . ILE A 1 31 ? 17.559  3.251   -8.036  1.00 0.00 ? 31 ILE A C    7  
ATOM 4046 O O    . ILE A 1 31 ? 18.465  3.629   -8.751  1.00 0.00 ? 31 ILE A O    7  
ATOM 4047 C CB   . ILE A 1 31 ? 15.378  2.049   -8.756  1.00 0.00 ? 31 ILE A CB   7  
ATOM 4048 C CG1  . ILE A 1 31 ? 14.945  0.685   -9.367  1.00 0.00 ? 31 ILE A CG1  7  
ATOM 4049 C CG2  . ILE A 1 31 ? 15.177  3.199   -9.758  1.00 0.00 ? 31 ILE A CG2  7  
ATOM 4050 C CD1  . ILE A 1 31 ? 13.440  0.671   -9.701  1.00 0.00 ? 31 ILE A CD1  7  
ATOM 4051 H H    . ILE A 1 31 ? 15.937  0.728   -6.769  1.00 0.00 ? 31 ILE A H    7  
ATOM 4052 H HA   . ILE A 1 31 ? 17.443  1.361   -9.014  1.00 0.00 ? 31 ILE A HA   7  
ATOM 4053 H HB   . ILE A 1 31 ? 14.766  2.249   -7.895  1.00 0.00 ? 31 ILE A HB   7  
ATOM 4054 H HG12 . ILE A 1 31 ? 15.526  0.487   -10.253 1.00 0.00 ? 31 ILE A HG12 7  
ATOM 4055 H HG13 . ILE A 1 31 ? 15.144  -0.106  -8.659  1.00 0.00 ? 31 ILE A HG13 7  
ATOM 4056 H HG21 . ILE A 1 31 ? 15.781  3.047   -10.639 1.00 0.00 ? 31 ILE A HG21 7  
ATOM 4057 H HG22 . ILE A 1 31 ? 14.136  3.254   -10.045 1.00 0.00 ? 31 ILE A HG22 7  
ATOM 4058 H HG23 . ILE A 1 31 ? 15.444  4.139   -9.296  1.00 0.00 ? 31 ILE A HG23 7  
ATOM 4059 H HD11 . ILE A 1 31 ? 12.863  1.063   -8.877  1.00 0.00 ? 31 ILE A HD11 7  
ATOM 4060 H HD12 . ILE A 1 31 ? 13.244  1.264   -10.582 1.00 0.00 ? 31 ILE A HD12 7  
ATOM 4061 H HD13 . ILE A 1 31 ? 13.122  -0.343  -9.893  1.00 0.00 ? 31 ILE A HD13 7  
ATOM 4062 N N    . ILE A 1 32 ? 17.119  3.933   -7.012  1.00 0.00 ? 32 ILE A N    7  
ATOM 4063 C CA   . ILE A 1 32 ? 17.717  5.246   -6.643  1.00 0.00 ? 32 ILE A CA   7  
ATOM 4064 C C    . ILE A 1 32 ? 19.208  5.026   -6.391  1.00 0.00 ? 32 ILE A C    7  
ATOM 4065 O O    . ILE A 1 32 ? 20.031  5.713   -6.958  1.00 0.00 ? 32 ILE A O    7  
ATOM 4066 C CB   . ILE A 1 32 ? 16.989  5.768   -5.381  1.00 0.00 ? 32 ILE A CB   7  
ATOM 4067 C CG1  . ILE A 1 32 ? 15.505  6.037   -5.759  1.00 0.00 ? 32 ILE A CG1  7  
ATOM 4068 C CG2  . ILE A 1 32 ? 17.645  7.086   -4.902  1.00 0.00 ? 32 ILE A CG2  7  
ATOM 4069 C CD1  . ILE A 1 32 ? 14.623  6.051   -4.497  1.00 0.00 ? 32 ILE A CD1  7  
ATOM 4070 H H    . ILE A 1 32 ? 16.380  3.582   -6.485  1.00 0.00 ? 32 ILE A H    7  
ATOM 4071 H HA   . ILE A 1 32 ? 17.602  5.921   -7.474  1.00 0.00 ? 32 ILE A HA   7  
ATOM 4072 H HB   . ILE A 1 32 ? 17.047  5.028   -4.596  1.00 0.00 ? 32 ILE A HB   7  
ATOM 4073 H HG12 . ILE A 1 32 ? 15.426  6.979   -6.276  1.00 0.00 ? 32 ILE A HG12 7  
ATOM 4074 H HG13 . ILE A 1 32 ? 15.146  5.272   -6.428  1.00 0.00 ? 32 ILE A HG13 7  
ATOM 4075 H HG21 . ILE A 1 32 ? 17.731  7.785   -5.721  1.00 0.00 ? 32 ILE A HG21 7  
ATOM 4076 H HG22 . ILE A 1 32 ? 17.054  7.539   -4.119  1.00 0.00 ? 32 ILE A HG22 7  
ATOM 4077 H HG23 . ILE A 1 32 ? 18.633  6.888   -4.511  1.00 0.00 ? 32 ILE A HG23 7  
ATOM 4078 H HD11 . ILE A 1 32 ? 14.854  5.207   -3.865  1.00 0.00 ? 32 ILE A HD11 7  
ATOM 4079 H HD12 . ILE A 1 32 ? 14.782  6.961   -3.940  1.00 0.00 ? 32 ILE A HD12 7  
ATOM 4080 H HD13 . ILE A 1 32 ? 13.582  5.994   -4.780  1.00 0.00 ? 32 ILE A HD13 7  
ATOM 4081 N N    . GLY A 1 33 ? 19.515  4.068   -5.556  1.00 0.00 ? 33 GLY A N    7  
ATOM 4082 C CA   . GLY A 1 33 ? 20.949  3.770   -5.245  1.00 0.00 ? 33 GLY A CA   7  
ATOM 4083 C C    . GLY A 1 33 ? 21.767  3.624   -6.542  1.00 0.00 ? 33 GLY A C    7  
ATOM 4084 O O    . GLY A 1 33 ? 22.880  4.105   -6.627  1.00 0.00 ? 33 GLY A O    7  
ATOM 4085 H H    . GLY A 1 33 ? 18.796  3.552   -5.137  1.00 0.00 ? 33 GLY A H    7  
ATOM 4086 H HA2  . GLY A 1 33 ? 21.358  4.580   -4.657  1.00 0.00 ? 33 GLY A HA2  7  
ATOM 4087 H HA3  . GLY A 1 33 ? 21.007  2.849   -4.685  1.00 0.00 ? 33 GLY A HA3  7  
ATOM 4088 N N    . LEU A 1 34 ? 21.179  2.965   -7.508  1.00 0.00 ? 34 LEU A N    7  
ATOM 4089 C CA   . LEU A 1 34 ? 21.854  2.751   -8.822  1.00 0.00 ? 34 LEU A CA   7  
ATOM 4090 C C    . LEU A 1 34 ? 22.048  4.045   -9.623  1.00 0.00 ? 34 LEU A C    7  
ATOM 4091 O O    . LEU A 1 34 ? 23.161  4.333   -10.021 1.00 0.00 ? 34 LEU A O    7  
ATOM 4092 C CB   . LEU A 1 34 ? 21.016  1.741   -9.645  1.00 0.00 ? 34 LEU A CB   7  
ATOM 4093 C CG   . LEU A 1 34 ? 21.172  0.313   -9.047  1.00 0.00 ? 34 LEU A CG   7  
ATOM 4094 C CD1  . LEU A 1 34 ? 19.882  -0.500  -9.289  1.00 0.00 ? 34 LEU A CD1  7  
ATOM 4095 C CD2  . LEU A 1 34 ? 22.359  -0.406  -9.729  1.00 0.00 ? 34 LEU A CD2  7  
ATOM 4096 H H    . LEU A 1 34 ? 20.283  2.599   -7.360  1.00 0.00 ? 34 LEU A H    7  
ATOM 4097 H HA   . LEU A 1 34 ? 22.836  2.353   -8.626  1.00 0.00 ? 34 LEU A HA   7  
ATOM 4098 H HB2  . LEU A 1 34 ? 19.978  2.033   -9.624  1.00 0.00 ? 34 LEU A HB2  7  
ATOM 4099 H HB3  . LEU A 1 34 ? 21.342  1.748   -10.676 1.00 0.00 ? 34 LEU A HB3  7  
ATOM 4100 H HG   . LEU A 1 34 ? 21.346  0.369   -7.983  1.00 0.00 ? 34 LEU A HG   7  
ATOM 4101 H HD11 . LEU A 1 34 ? 19.594  -0.455  -10.329 1.00 0.00 ? 34 LEU A HD11 7  
ATOM 4102 H HD12 . LEU A 1 34 ? 20.037  -1.534  -9.016  1.00 0.00 ? 34 LEU A HD12 7  
ATOM 4103 H HD13 . LEU A 1 34 ? 19.079  -0.104  -8.686  1.00 0.00 ? 34 LEU A HD13 7  
ATOM 4104 H HD21 . LEU A 1 34 ? 23.212  0.252   -9.791  1.00 0.00 ? 34 LEU A HD21 7  
ATOM 4105 H HD22 . LEU A 1 34 ? 22.638  -1.278  -9.157  1.00 0.00 ? 34 LEU A HD22 7  
ATOM 4106 H HD23 . LEU A 1 34 ? 22.090  -0.717  -10.728 1.00 0.00 ? 34 LEU A HD23 7  
ATOM 4107 N N    . MET A 1 35 ? 20.988  4.789   -9.843  1.00 0.00 ? 35 MET A N    7  
ATOM 4108 C CA   . MET A 1 35 ? 21.137  6.066   -10.626 1.00 0.00 ? 35 MET A CA   7  
ATOM 4109 C C    . MET A 1 35 ? 22.100  7.030   -9.918  1.00 0.00 ? 35 MET A C    7  
ATOM 4110 O O    . MET A 1 35 ? 22.846  7.743   -10.559 1.00 0.00 ? 35 MET A O    7  
ATOM 4111 C CB   . MET A 1 35 ? 19.741  6.742   -10.812 1.00 0.00 ? 35 MET A CB   7  
ATOM 4112 C CG   . MET A 1 35 ? 19.006  6.953   -9.489  1.00 0.00 ? 35 MET A CG   7  
ATOM 4113 S SD   . MET A 1 35 ? 17.376  7.739   -9.563  1.00 0.00 ? 35 MET A SD   7  
ATOM 4114 C CE   . MET A 1 35 ? 17.749  9.232   -8.607  1.00 0.00 ? 35 MET A CE   7  
ATOM 4115 H H    . MET A 1 35 ? 20.119  4.502   -9.491  1.00 0.00 ? 35 MET A H    7  
ATOM 4116 H HA   . MET A 1 35 ? 21.550  5.823   -11.592 1.00 0.00 ? 35 MET A HA   7  
ATOM 4117 H HB2  . MET A 1 35 ? 19.865  7.699   -11.297 1.00 0.00 ? 35 MET A HB2  7  
ATOM 4118 H HB3  . MET A 1 35 ? 19.131  6.118   -11.448 1.00 0.00 ? 35 MET A HB3  7  
ATOM 4119 H HG2  . MET A 1 35 ? 18.868  5.981   -9.054  1.00 0.00 ? 35 MET A HG2  7  
ATOM 4120 H HG3  . MET A 1 35 ? 19.630  7.530   -8.825  1.00 0.00 ? 35 MET A HG3  7  
ATOM 4121 H HE1  . MET A 1 35 ? 18.549  9.777   -9.087  1.00 0.00 ? 35 MET A HE1  7  
ATOM 4122 H HE2  . MET A 1 35 ? 16.868  9.855   -8.556  1.00 0.00 ? 35 MET A HE2  7  
ATOM 4123 H HE3  . MET A 1 35 ? 18.051  8.957   -7.607  1.00 0.00 ? 35 MET A HE3  7  
ATOM 4124 N N    . VAL A 1 36 ? 22.044  7.012   -8.610  1.00 0.00 ? 36 VAL A N    7  
ATOM 4125 C CA   . VAL A 1 36 ? 22.919  7.883   -7.773  1.00 0.00 ? 36 VAL A CA   7  
ATOM 4126 C C    . VAL A 1 36 ? 24.382  7.472   -8.019  1.00 0.00 ? 36 VAL A C    7  
ATOM 4127 O O    . VAL A 1 36 ? 25.215  8.314   -8.296  1.00 0.00 ? 36 VAL A O    7  
ATOM 4128 C CB   . VAL A 1 36 ? 22.512  7.685   -6.280  1.00 0.00 ? 36 VAL A CB   7  
ATOM 4129 C CG1  . VAL A 1 36 ? 23.592  8.253   -5.327  1.00 0.00 ? 36 VAL A CG1  7  
ATOM 4130 C CG2  . VAL A 1 36 ? 21.180  8.424   -6.015  1.00 0.00 ? 36 VAL A CG2  7  
ATOM 4131 H H    . VAL A 1 36 ? 21.408  6.422   -8.164  1.00 0.00 ? 36 VAL A H    7  
ATOM 4132 H HA   . VAL A 1 36 ? 22.784  8.912   -8.074  1.00 0.00 ? 36 VAL A HA   7  
ATOM 4133 H HB   . VAL A 1 36 ? 22.379  6.631   -6.073  1.00 0.00 ? 36 VAL A HB   7  
ATOM 4134 H HG11 . VAL A 1 36 ? 23.886  9.246   -5.637  1.00 0.00 ? 36 VAL A HG11 7  
ATOM 4135 H HG12 . VAL A 1 36 ? 23.210  8.303   -4.318  1.00 0.00 ? 36 VAL A HG12 7  
ATOM 4136 H HG13 . VAL A 1 36 ? 24.464  7.616   -5.330  1.00 0.00 ? 36 VAL A HG13 7  
ATOM 4137 H HG21 . VAL A 1 36 ? 20.457  8.192   -6.781  1.00 0.00 ? 36 VAL A HG21 7  
ATOM 4138 H HG22 . VAL A 1 36 ? 20.777  8.123   -5.059  1.00 0.00 ? 36 VAL A HG22 7  
ATOM 4139 H HG23 . VAL A 1 36 ? 21.338  9.493   -6.004  1.00 0.00 ? 36 VAL A HG23 7  
ATOM 4140 N N    . GLY A 1 37 ? 24.638  6.191   -7.911  1.00 0.00 ? 37 GLY A N    7  
ATOM 4141 C CA   . GLY A 1 37 ? 26.016  5.654   -8.126  1.00 0.00 ? 37 GLY A CA   7  
ATOM 4142 C C    . GLY A 1 37 ? 26.645  5.301   -6.777  1.00 0.00 ? 37 GLY A C    7  
ATOM 4143 O O    . GLY A 1 37 ? 27.812  5.553   -6.552  1.00 0.00 ? 37 GLY A O    7  
ATOM 4144 H H    . GLY A 1 37 ? 23.925  5.560   -7.678  1.00 0.00 ? 37 GLY A H    7  
ATOM 4145 H HA2  . GLY A 1 37 ? 25.954  4.760   -8.730  1.00 0.00 ? 37 GLY A HA2  7  
ATOM 4146 H HA3  . GLY A 1 37 ? 26.629  6.385   -8.632  1.00 0.00 ? 37 GLY A HA3  7  
ATOM 4147 N N    . GLY A 1 38 ? 25.832  4.726   -5.926  1.00 0.00 ? 38 GLY A N    7  
ATOM 4148 C CA   . GLY A 1 38 ? 26.287  4.315   -4.560  1.00 0.00 ? 38 GLY A CA   7  
ATOM 4149 C C    . GLY A 1 38 ? 25.852  2.872   -4.292  1.00 0.00 ? 38 GLY A C    7  
ATOM 4150 O O    . GLY A 1 38 ? 26.538  2.138   -3.608  1.00 0.00 ? 38 GLY A O    7  
ATOM 4151 H H    . GLY A 1 38 ? 24.904  4.558   -6.186  1.00 0.00 ? 38 GLY A H    7  
ATOM 4152 H HA2  . GLY A 1 38 ? 27.362  4.381   -4.486  1.00 0.00 ? 38 GLY A HA2  7  
ATOM 4153 H HA3  . GLY A 1 38 ? 25.832  4.965   -3.827  1.00 0.00 ? 38 GLY A HA3  7  
ATOM 4154 N N    . VAL A 1 39 ? 24.718  2.529   -4.857  1.00 0.00 ? 39 VAL A N    7  
ATOM 4155 C CA   . VAL A 1 39 ? 24.097  1.172   -4.733  1.00 0.00 ? 39 VAL A CA   7  
ATOM 4156 C C    . VAL A 1 39 ? 24.203  0.631   -3.289  1.00 0.00 ? 39 VAL A C    7  
ATOM 4157 O O    . VAL A 1 39 ? 24.388  -0.546  -3.044  1.00 0.00 ? 39 VAL A O    7  
ATOM 4158 C CB   . VAL A 1 39 ? 24.830  0.310   -5.795  1.00 0.00 ? 39 VAL A CB   7  
ATOM 4159 C CG1  . VAL A 1 39 ? 24.440  -1.192  -5.730  1.00 0.00 ? 39 VAL A CG1  7  
ATOM 4160 C CG2  . VAL A 1 39 ? 24.480  0.846   -7.199  1.00 0.00 ? 39 VAL A CG2  7  
ATOM 4161 H H    . VAL A 1 39 ? 24.250  3.187   -5.397  1.00 0.00 ? 39 VAL A H    7  
ATOM 4162 H HA   . VAL A 1 39 ? 23.050  1.257   -4.985  1.00 0.00 ? 39 VAL A HA   7  
ATOM 4163 H HB   . VAL A 1 39 ? 25.882  0.471   -5.642  1.00 0.00 ? 39 VAL A HB   7  
ATOM 4164 H HG11 . VAL A 1 39 ? 23.438  -1.307  -5.343  1.00 0.00 ? 39 VAL A HG11 7  
ATOM 4165 H HG12 . VAL A 1 39 ? 24.484  -1.644  -6.710  1.00 0.00 ? 39 VAL A HG12 7  
ATOM 4166 H HG13 . VAL A 1 39 ? 25.126  -1.722  -5.085  1.00 0.00 ? 39 VAL A HG13 7  
ATOM 4167 H HG21 . VAL A 1 39 ? 24.757  1.887   -7.290  1.00 0.00 ? 39 VAL A HG21 7  
ATOM 4168 H HG22 . VAL A 1 39 ? 25.005  0.285   -7.957  1.00 0.00 ? 39 VAL A HG22 7  
ATOM 4169 H HG23 . VAL A 1 39 ? 23.419  0.750   -7.364  1.00 0.00 ? 39 VAL A HG23 7  
ATOM 4170 N N    . VAL A 1 40 ? 24.073  1.547   -2.365  1.00 0.00 ? 40 VAL A N    7  
ATOM 4171 C CA   . VAL A 1 40 ? 24.150  1.188   -0.916  1.00 0.00 ? 40 VAL A CA   7  
ATOM 4172 C C    . VAL A 1 40 ? 22.881  0.417   -0.501  1.00 0.00 ? 40 VAL A C    7  
ATOM 4173 O O    . VAL A 1 40 ? 23.055  -0.609  0.136   1.00 0.00 ? 40 VAL A O    7  
ATOM 4174 C CB   . VAL A 1 40 ? 24.291  2.493   -0.082  1.00 0.00 ? 40 VAL A CB   7  
ATOM 4175 C CG1  . VAL A 1 40 ? 24.564  2.133   1.397   1.00 0.00 ? 40 VAL A CG1  7  
ATOM 4176 C CG2  . VAL A 1 40 ? 25.473  3.334   -0.621  1.00 0.00 ? 40 VAL A CG2  7  
ATOM 4177 O OXT  . VAL A 1 40 ? 21.811  0.894   -0.845  1.00 0.00 ? 40 VAL A OXT  7  
ATOM 4178 H H    . VAL A 1 40 ? 23.925  2.478   -2.635  1.00 0.00 ? 40 VAL A H    7  
ATOM 4179 H HA   . VAL A 1 40 ? 25.019  0.561   -0.764  1.00 0.00 ? 40 VAL A HA   7  
ATOM 4180 H HB   . VAL A 1 40 ? 23.381  3.073   -0.150  1.00 0.00 ? 40 VAL A HB   7  
ATOM 4181 H HG11 . VAL A 1 40 ? 25.421  1.478   1.475   1.00 0.00 ? 40 VAL A HG11 7  
ATOM 4182 H HG12 . VAL A 1 40 ? 24.759  3.028   1.969   1.00 0.00 ? 40 VAL A HG12 7  
ATOM 4183 H HG13 . VAL A 1 40 ? 23.706  1.634   1.825   1.00 0.00 ? 40 VAL A HG13 7  
ATOM 4184 H HG21 . VAL A 1 40 ? 26.351  2.716   -0.748  1.00 0.00 ? 40 VAL A HG21 7  
ATOM 4185 H HG22 . VAL A 1 40 ? 25.213  3.766   -1.576  1.00 0.00 ? 40 VAL A HG22 7  
ATOM 4186 H HG23 . VAL A 1 40 ? 25.708  4.134   0.064   1.00 0.00 ? 40 VAL A HG23 7  
ATOM 4187 N N    . ASP A 1 1  ? -13.105 -13.399 -26.170 1.00 0.00 ? 1  ASP A N    8  
ATOM 4188 C CA   . ASP A 1 1  ? -13.834 -12.519 -25.207 1.00 0.00 ? 1  ASP A CA   8  
ATOM 4189 C C    . ASP A 1 1  ? -12.847 -11.804 -24.274 1.00 0.00 ? 1  ASP A C    8  
ATOM 4190 O O    . ASP A 1 1  ? -11.733 -12.254 -24.086 1.00 0.00 ? 1  ASP A O    8  
ATOM 4191 C CB   . ASP A 1 1  ? -14.813 -13.354 -24.351 1.00 0.00 ? 1  ASP A CB   8  
ATOM 4192 C CG   . ASP A 1 1  ? -14.094 -14.590 -23.774 1.00 0.00 ? 1  ASP A CG   8  
ATOM 4193 O OD1  . ASP A 1 1  ? -13.341 -14.397 -22.835 1.00 0.00 ? 1  ASP A OD1  8  
ATOM 4194 O OD2  . ASP A 1 1  ? -14.339 -15.659 -24.308 1.00 0.00 ? 1  ASP A OD2  8  
ATOM 4195 H H1   . ASP A 1 1  ? -12.082 -13.341 -25.992 1.00 0.00 ? 1  ASP A H1   8  
ATOM 4196 H H2   . ASP A 1 1  ? -13.419 -14.383 -26.048 1.00 0.00 ? 1  ASP A H2   8  
ATOM 4197 H H3   . ASP A 1 1  ? -13.304 -13.090 -27.142 1.00 0.00 ? 1  ASP A H3   8  
ATOM 4198 H HA   . ASP A 1 1  ? -14.382 -11.777 -25.770 1.00 0.00 ? 1  ASP A HA   8  
ATOM 4199 H HB2  . ASP A 1 1  ? -15.200 -12.760 -23.536 1.00 0.00 ? 1  ASP A HB2  8  
ATOM 4200 H HB3  . ASP A 1 1  ? -15.644 -13.677 -24.963 1.00 0.00 ? 1  ASP A HB3  8  
ATOM 4201 N N    . ALA A 1 2  ? -13.295 -10.708 -23.714 1.00 0.00 ? 2  ALA A N    8  
ATOM 4202 C CA   . ALA A 1 2  ? -12.438 -9.911  -22.784 1.00 0.00 ? 2  ALA A CA   8  
ATOM 4203 C C    . ALA A 1 2  ? -12.655 -10.371 -21.334 1.00 0.00 ? 2  ALA A C    8  
ATOM 4204 O O    . ALA A 1 2  ? -13.279 -9.696  -20.536 1.00 0.00 ? 2  ALA A O    8  
ATOM 4205 C CB   . ALA A 1 2  ? -12.802 -8.433  -22.948 1.00 0.00 ? 2  ALA A CB   8  
ATOM 4206 H H    . ALA A 1 2  ? -14.207 -10.403 -23.909 1.00 0.00 ? 2  ALA A H    8  
ATOM 4207 H HA   . ALA A 1 2  ? -11.400 -10.059 -23.044 1.00 0.00 ? 2  ALA A HA   8  
ATOM 4208 H HB1  . ALA A 1 2  ? -13.863 -8.295  -22.804 1.00 0.00 ? 2  ALA A HB1  8  
ATOM 4209 H HB2  . ALA A 1 2  ? -12.267 -7.839  -22.221 1.00 0.00 ? 2  ALA A HB2  8  
ATOM 4210 H HB3  . ALA A 1 2  ? -12.531 -8.099  -23.938 1.00 0.00 ? 2  ALA A HB3  8  
ATOM 4211 N N    . GLU A 1 3  ? -12.116 -11.529 -21.051 1.00 0.00 ? 3  GLU A N    8  
ATOM 4212 C CA   . GLU A 1 3  ? -12.228 -12.134 -19.683 1.00 0.00 ? 3  GLU A CA   8  
ATOM 4213 C C    . GLU A 1 3  ? -10.834 -12.565 -19.196 1.00 0.00 ? 3  GLU A C    8  
ATOM 4214 O O    . GLU A 1 3  ? -10.637 -13.665 -18.712 1.00 0.00 ? 3  GLU A O    8  
ATOM 4215 C CB   . GLU A 1 3  ? -13.183 -13.350 -19.755 1.00 0.00 ? 3  GLU A CB   8  
ATOM 4216 C CG   . GLU A 1 3  ? -14.585 -12.887 -20.212 1.00 0.00 ? 3  GLU A CG   8  
ATOM 4217 C CD   . GLU A 1 3  ? -15.536 -14.096 -20.304 1.00 0.00 ? 3  GLU A CD   8  
ATOM 4218 O OE1  . GLU A 1 3  ? -15.798 -14.668 -19.256 1.00 0.00 ? 3  GLU A OE1  8  
ATOM 4219 O OE2  . GLU A 1 3  ? -15.951 -14.385 -21.414 1.00 0.00 ? 3  GLU A OE2  8  
ATOM 4220 H H    . GLU A 1 3  ? -11.631 -12.004 -21.757 1.00 0.00 ? 3  GLU A H    8  
ATOM 4221 H HA   . GLU A 1 3  ? -12.614 -11.402 -18.988 1.00 0.00 ? 3  GLU A HA   8  
ATOM 4222 H HB2  . GLU A 1 3  ? -12.788 -14.087 -20.435 1.00 0.00 ? 3  GLU A HB2  8  
ATOM 4223 H HB3  . GLU A 1 3  ? -13.260 -13.799 -18.776 1.00 0.00 ? 3  GLU A HB3  8  
ATOM 4224 H HG2  . GLU A 1 3  ? -14.991 -12.183 -19.500 1.00 0.00 ? 3  GLU A HG2  8  
ATOM 4225 H HG3  . GLU A 1 3  ? -14.528 -12.404 -21.177 1.00 0.00 ? 3  GLU A HG3  8  
ATOM 4226 N N    . PHE A 1 4  ? -9.904  -11.657 -19.344 1.00 0.00 ? 4  PHE A N    8  
ATOM 4227 C CA   . PHE A 1 4  ? -8.490  -11.905 -18.924 1.00 0.00 ? 4  PHE A CA   8  
ATOM 4228 C C    . PHE A 1 4  ? -8.316  -11.333 -17.511 1.00 0.00 ? 4  PHE A C    8  
ATOM 4229 O O    . PHE A 1 4  ? -7.628  -10.355 -17.290 1.00 0.00 ? 4  PHE A O    8  
ATOM 4230 C CB   . PHE A 1 4  ? -7.519  -11.215 -19.947 1.00 0.00 ? 4  PHE A CB   8  
ATOM 4231 C CG   . PHE A 1 4  ? -8.181  -10.035 -20.694 1.00 0.00 ? 4  PHE A CG   8  
ATOM 4232 C CD1  . PHE A 1 4  ? -8.532  -8.874  -20.027 1.00 0.00 ? 4  PHE A CD1  8  
ATOM 4233 C CD2  . PHE A 1 4  ? -8.431  -10.125 -22.053 1.00 0.00 ? 4  PHE A CD2  8  
ATOM 4234 C CE1  . PHE A 1 4  ? -9.122  -7.828  -20.703 1.00 0.00 ? 4  PHE A CE1  8  
ATOM 4235 C CE2  . PHE A 1 4  ? -9.022  -9.078  -22.728 1.00 0.00 ? 4  PHE A CE2  8  
ATOM 4236 C CZ   . PHE A 1 4  ? -9.368  -7.928  -22.054 1.00 0.00 ? 4  PHE A CZ   8  
ATOM 4237 H H    . PHE A 1 4  ? -10.142 -10.794 -19.735 1.00 0.00 ? 4  PHE A H    8  
ATOM 4238 H HA   . PHE A 1 4  ? -8.298  -12.968 -18.899 1.00 0.00 ? 4  PHE A HA   8  
ATOM 4239 H HB2  . PHE A 1 4  ? -6.628  -10.855 -19.454 1.00 0.00 ? 4  PHE A HB2  8  
ATOM 4240 H HB3  . PHE A 1 4  ? -7.212  -11.952 -20.675 1.00 0.00 ? 4  PHE A HB3  8  
ATOM 4241 H HD1  . PHE A 1 4  ? -8.345  -8.778  -18.969 1.00 0.00 ? 4  PHE A HD1  8  
ATOM 4242 H HD2  . PHE A 1 4  ? -8.165  -11.022 -22.593 1.00 0.00 ? 4  PHE A HD2  8  
ATOM 4243 H HE1  . PHE A 1 4  ? -9.393  -6.926  -20.173 1.00 0.00 ? 4  PHE A HE1  8  
ATOM 4244 H HE2  . PHE A 1 4  ? -9.213  -9.159  -23.788 1.00 0.00 ? 4  PHE A HE2  8  
ATOM 4245 H HZ   . PHE A 1 4  ? -9.830  -7.108  -22.584 1.00 0.00 ? 4  PHE A HZ   8  
ATOM 4246 N N    . ARG A 1 5  ? -8.978  -11.996 -16.595 1.00 0.00 ? 5  ARG A N    8  
ATOM 4247 C CA   . ARG A 1 5  ? -8.960  -11.624 -15.143 1.00 0.00 ? 5  ARG A CA   8  
ATOM 4248 C C    . ARG A 1 5  ? -9.606  -10.240 -14.949 1.00 0.00 ? 5  ARG A C    8  
ATOM 4249 O O    . ARG A 1 5  ? -8.931  -9.231  -14.856 1.00 0.00 ? 5  ARG A O    8  
ATOM 4250 C CB   . ARG A 1 5  ? -7.479  -11.625 -14.632 1.00 0.00 ? 5  ARG A CB   8  
ATOM 4251 C CG   . ARG A 1 5  ? -7.443  -11.438 -13.092 1.00 0.00 ? 5  ARG A CG   8  
ATOM 4252 C CD   . ARG A 1 5  ? -6.049  -10.932 -12.653 1.00 0.00 ? 5  ARG A CD   8  
ATOM 4253 N NE   . ARG A 1 5  ? -6.215  -10.082 -11.434 1.00 0.00 ? 5  ARG A NE   8  
ATOM 4254 C CZ   . ARG A 1 5  ? -5.296  -9.227  -11.060 1.00 0.00 ? 5  ARG A CZ   8  
ATOM 4255 N NH1  . ARG A 1 5  ? -4.190  -9.093  -11.745 1.00 0.00 ? 5  ARG A NH1  8  
ATOM 4256 N NH2  . ARG A 1 5  ? -5.525  -8.520  -9.989  1.00 0.00 ? 5  ARG A NH2  8  
ATOM 4257 H H    . ARG A 1 5  ? -9.508  -12.768 -16.886 1.00 0.00 ? 5  ARG A H    8  
ATOM 4258 H HA   . ARG A 1 5  ? -9.535  -12.357 -14.595 1.00 0.00 ? 5  ARG A HA   8  
ATOM 4259 H HB2  . ARG A 1 5  ? -7.018  -12.570 -14.885 1.00 0.00 ? 5  ARG A HB2  8  
ATOM 4260 H HB3  . ARG A 1 5  ? -6.916  -10.836 -15.108 1.00 0.00 ? 5  ARG A HB3  8  
ATOM 4261 H HG2  . ARG A 1 5  ? -8.196  -10.727 -12.788 1.00 0.00 ? 5  ARG A HG2  8  
ATOM 4262 H HG3  . ARG A 1 5  ? -7.653  -12.381 -12.610 1.00 0.00 ? 5  ARG A HG3  8  
ATOM 4263 H HD2  . ARG A 1 5  ? -5.403  -11.764 -12.413 1.00 0.00 ? 5  ARG A HD2  8  
ATOM 4264 H HD3  . ARG A 1 5  ? -5.593  -10.340 -13.433 1.00 0.00 ? 5  ARG A HD3  8  
ATOM 4265 H HE   . ARG A 1 5  ? -7.033  -10.162 -10.902 1.00 0.00 ? 5  ARG A HE   8  
ATOM 4266 H HH11 . ARG A 1 5  ? -4.036  -9.650  -12.560 1.00 0.00 ? 5  ARG A HH11 8  
ATOM 4267 H HH12 . ARG A 1 5  ? -3.497  -8.434  -11.457 1.00 0.00 ? 5  ARG A HH12 8  
ATOM 4268 H HH21 . ARG A 1 5  ? -6.381  -8.645  -9.486  1.00 0.00 ? 5  ARG A HH21 8  
ATOM 4269 H HH22 . ARG A 1 5  ? -4.849  -7.856  -9.670  1.00 0.00 ? 5  ARG A HH22 8  
ATOM 4270 N N    . HIS A 1 6  ? -10.915 -10.256 -14.900 1.00 0.00 ? 6  HIS A N    8  
ATOM 4271 C CA   . HIS A 1 6  ? -11.705 -9.002  -14.714 1.00 0.00 ? 6  HIS A CA   8  
ATOM 4272 C C    . HIS A 1 6  ? -11.898 -8.730  -13.210 1.00 0.00 ? 6  HIS A C    8  
ATOM 4273 O O    . HIS A 1 6  ? -12.990 -8.469  -12.740 1.00 0.00 ? 6  HIS A O    8  
ATOM 4274 C CB   . HIS A 1 6  ? -13.064 -9.181  -15.435 1.00 0.00 ? 6  HIS A CB   8  
ATOM 4275 C CG   . HIS A 1 6  ? -13.718 -7.805  -15.628 1.00 0.00 ? 6  HIS A CG   8  
ATOM 4276 N ND1  . HIS A 1 6  ? -13.359 -6.933  -16.512 1.00 0.00 ? 6  HIS A ND1  8  
ATOM 4277 C CD2  . HIS A 1 6  ? -14.769 -7.202  -14.958 1.00 0.00 ? 6  HIS A CD2  8  
ATOM 4278 C CE1  . HIS A 1 6  ? -14.108 -5.881  -16.412 1.00 0.00 ? 6  HIS A CE1  8  
ATOM 4279 N NE2  . HIS A 1 6  ? -14.998 -6.004  -15.459 1.00 0.00 ? 6  HIS A NE2  8  
ATOM 4280 H H    . HIS A 1 6  ? -11.391 -11.104 -14.985 1.00 0.00 ? 6  HIS A H    8  
ATOM 4281 H HA   . HIS A 1 6  ? -11.157 -8.184  -15.154 1.00 0.00 ? 6  HIS A HA   8  
ATOM 4282 H HB2  . HIS A 1 6  ? -12.918 -9.632  -16.407 1.00 0.00 ? 6  HIS A HB2  8  
ATOM 4283 H HB3  . HIS A 1 6  ? -13.728 -9.808  -14.857 1.00 0.00 ? 6  HIS A HB3  8  
ATOM 4284 H HD1  . HIS A 1 6  ? -12.633 -7.049  -17.157 1.00 0.00 ? 6  HIS A HD1  8  
ATOM 4285 H HD2  . HIS A 1 6  ? -15.322 -7.647  -14.144 1.00 0.00 ? 6  HIS A HD2  8  
ATOM 4286 H HE1  . HIS A 1 6  ? -14.009 -5.005  -17.038 1.00 0.00 ? 6  HIS A HE1  8  
ATOM 4287 N N    . ASP A 1 7  ? -10.801 -8.804  -12.499 1.00 0.00 ? 7  ASP A N    8  
ATOM 4288 C CA   . ASP A 1 7  ? -10.795 -8.571  -11.027 1.00 0.00 ? 7  ASP A CA   8  
ATOM 4289 C C    . ASP A 1 7  ? -11.199 -7.130  -10.672 1.00 0.00 ? 7  ASP A C    8  
ATOM 4290 O O    . ASP A 1 7  ? -11.372 -6.302  -11.546 1.00 0.00 ? 7  ASP A O    8  
ATOM 4291 C CB   . ASP A 1 7  ? -9.380  -8.887  -10.521 1.00 0.00 ? 7  ASP A CB   8  
ATOM 4292 C CG   . ASP A 1 7  ? -8.373  -7.867  -11.090 1.00 0.00 ? 7  ASP A CG   8  
ATOM 4293 O OD1  . ASP A 1 7  ? -8.027  -8.027  -12.251 1.00 0.00 ? 7  ASP A OD1  8  
ATOM 4294 O OD2  . ASP A 1 7  ? -8.009  -6.983  -10.331 1.00 0.00 ? 7  ASP A OD2  8  
ATOM 4295 H H    . ASP A 1 7  ? -9.951  -9.019  -12.931 1.00 0.00 ? 7  ASP A H    8  
ATOM 4296 H HA   . ASP A 1 7  ? -11.501 -9.251  -10.572 1.00 0.00 ? 7  ASP A HA   8  
ATOM 4297 H HB2  . ASP A 1 7  ? -9.362  -8.853  -9.445  1.00 0.00 ? 7  ASP A HB2  8  
ATOM 4298 H HB3  . ASP A 1 7  ? -9.090  -9.879  -10.836 1.00 0.00 ? 7  ASP A HB3  8  
ATOM 4299 N N    . SER A 1 8  ? -11.333 -6.885  -9.391  1.00 0.00 ? 8  SER A N    8  
ATOM 4300 C CA   . SER A 1 8  ? -11.723 -5.530  -8.881  1.00 0.00 ? 8  SER A CA   8  
ATOM 4301 C C    . SER A 1 8  ? -13.069 -5.073  -9.478  1.00 0.00 ? 8  SER A C    8  
ATOM 4302 O O    . SER A 1 8  ? -13.260 -3.910  -9.780  1.00 0.00 ? 8  SER A O    8  
ATOM 4303 C CB   . SER A 1 8  ? -10.591 -4.529  -9.240  1.00 0.00 ? 8  SER A CB   8  
ATOM 4304 O OG   . SER A 1 8  ? -10.827 -3.412  -8.394  1.00 0.00 ? 8  SER A OG   8  
ATOM 4305 H H    . SER A 1 8  ? -11.174 -7.609  -8.750  1.00 0.00 ? 8  SER A H    8  
ATOM 4306 H HA   . SER A 1 8  ? -11.831 -5.595  -7.808  1.00 0.00 ? 8  SER A HA   8  
ATOM 4307 H HB2  . SER A 1 8  ? -9.617  -4.943  -9.023  1.00 0.00 ? 8  SER A HB2  8  
ATOM 4308 H HB3  . SER A 1 8  ? -10.640 -4.215  -10.271 1.00 0.00 ? 8  SER A HB3  8  
ATOM 4309 H HG   . SER A 1 8  ? -11.014 -2.654  -8.953  1.00 0.00 ? 8  SER A HG   8  
ATOM 4310 N N    . GLY A 1 9  ? -13.962 -6.022  -9.628  1.00 0.00 ? 9  GLY A N    8  
ATOM 4311 C CA   . GLY A 1 9  ? -15.319 -5.731  -10.192 1.00 0.00 ? 9  GLY A CA   8  
ATOM 4312 C C    . GLY A 1 9  ? -16.023 -4.674  -9.336  1.00 0.00 ? 9  GLY A C    8  
ATOM 4313 O O    . GLY A 1 9  ? -16.667 -3.777  -9.847  1.00 0.00 ? 9  GLY A O    8  
ATOM 4314 H H    . GLY A 1 9  ? -13.738 -6.939  -9.364  1.00 0.00 ? 9  GLY A H    8  
ATOM 4315 H HA2  . GLY A 1 9  ? -15.212 -5.366  -11.204 1.00 0.00 ? 9  GLY A HA2  8  
ATOM 4316 H HA3  . GLY A 1 9  ? -15.905 -6.639  -10.194 1.00 0.00 ? 9  GLY A HA3  8  
ATOM 4317 N N    . TYR A 1 10 ? -15.863 -4.828  -8.045  1.00 0.00 ? 10 TYR A N    8  
ATOM 4318 C CA   . TYR A 1 10 ? -16.477 -3.885  -7.061  1.00 0.00 ? 10 TYR A CA   8  
ATOM 4319 C C    . TYR A 1 10 ? -15.815 -2.506  -7.222  1.00 0.00 ? 10 TYR A C    8  
ATOM 4320 O O    . TYR A 1 10 ? -16.454 -1.488  -7.040  1.00 0.00 ? 10 TYR A O    8  
ATOM 4321 C CB   . TYR A 1 10 ? -16.249 -4.464  -5.639  1.00 0.00 ? 10 TYR A CB   8  
ATOM 4322 C CG   . TYR A 1 10 ? -16.288 -3.362  -4.562  1.00 0.00 ? 10 TYR A CG   8  
ATOM 4323 C CD1  . TYR A 1 10 ? -17.490 -2.952  -4.015  1.00 0.00 ? 10 TYR A CD1  8  
ATOM 4324 C CD2  . TYR A 1 10 ? -15.118 -2.766  -4.126  1.00 0.00 ? 10 TYR A CD2  8  
ATOM 4325 C CE1  . TYR A 1 10 ? -17.519 -1.964  -3.052  1.00 0.00 ? 10 TYR A CE1  8  
ATOM 4326 C CE2  . TYR A 1 10 ? -15.151 -1.779  -3.164  1.00 0.00 ? 10 TYR A CE2  8  
ATOM 4327 C CZ   . TYR A 1 10 ? -16.351 -1.372  -2.621  1.00 0.00 ? 10 TYR A CZ   8  
ATOM 4328 O OH   . TYR A 1 10 ? -16.382 -0.384  -1.658  1.00 0.00 ? 10 TYR A OH   8  
ATOM 4329 H H    . TYR A 1 10 ? -15.325 -5.578  -7.718  1.00 0.00 ? 10 TYR A H    8  
ATOM 4330 H HA   . TYR A 1 10 ? -17.535 -3.799  -7.269  1.00 0.00 ? 10 TYR A HA   8  
ATOM 4331 H HB2  . TYR A 1 10 ? -17.017 -5.193  -5.419  1.00 0.00 ? 10 TYR A HB2  8  
ATOM 4332 H HB3  . TYR A 1 10 ? -15.288 -4.957  -5.595  1.00 0.00 ? 10 TYR A HB3  8  
ATOM 4333 H HD1  . TYR A 1 10 ? -18.413 -3.406  -4.343  1.00 0.00 ? 10 TYR A HD1  8  
ATOM 4334 H HD2  . TYR A 1 10 ? -14.169 -3.073  -4.542  1.00 0.00 ? 10 TYR A HD2  8  
ATOM 4335 H HE1  . TYR A 1 10 ? -18.465 -1.654  -2.634  1.00 0.00 ? 10 TYR A HE1  8  
ATOM 4336 H HE2  . TYR A 1 10 ? -14.231 -1.323  -2.832  1.00 0.00 ? 10 TYR A HE2  8  
ATOM 4337 H HH   . TYR A 1 10 ? -16.664 -0.785  -0.833  1.00 0.00 ? 10 TYR A HH   8  
ATOM 4338 N N    . GLU A 1 11 ? -14.548 -2.549  -7.560  1.00 0.00 ? 11 GLU A N    8  
ATOM 4339 C CA   . GLU A 1 11 ? -13.716 -1.323  -7.767  1.00 0.00 ? 11 GLU A CA   8  
ATOM 4340 C C    . GLU A 1 11 ? -13.593 -0.509  -6.470  1.00 0.00 ? 11 GLU A C    8  
ATOM 4341 O O    . GLU A 1 11 ? -14.526 0.133   -6.028  1.00 0.00 ? 11 GLU A O    8  
ATOM 4342 C CB   . GLU A 1 11 ? -14.353 -0.451  -8.884  1.00 0.00 ? 11 GLU A CB   8  
ATOM 4343 C CG   . GLU A 1 11 ? -13.287 0.519   -9.444  1.00 0.00 ? 11 GLU A CG   8  
ATOM 4344 C CD   . GLU A 1 11 ? -13.965 1.834   -9.861  1.00 0.00 ? 11 GLU A CD   8  
ATOM 4345 O OE1  . GLU A 1 11 ? -14.052 2.695   -8.999  1.00 0.00 ? 11 GLU A OE1  8  
ATOM 4346 O OE2  . GLU A 1 11 ? -14.358 1.903   -11.014 1.00 0.00 ? 11 GLU A OE2  8  
ATOM 4347 H H    . GLU A 1 11 ? -14.127 -3.424  -7.684  1.00 0.00 ? 11 GLU A H    8  
ATOM 4348 H HA   . GLU A 1 11 ? -12.730 -1.641  -8.073  1.00 0.00 ? 11 GLU A HA   8  
ATOM 4349 H HB2  . GLU A 1 11 ? -14.702 -1.090  -9.682  1.00 0.00 ? 11 GLU A HB2  8  
ATOM 4350 H HB3  . GLU A 1 11 ? -15.197 0.101   -8.497  1.00 0.00 ? 11 GLU A HB3  8  
ATOM 4351 H HG2  . GLU A 1 11 ? -12.529 0.736   -8.703  1.00 0.00 ? 11 GLU A HG2  8  
ATOM 4352 H HG3  . GLU A 1 11 ? -12.806 0.077   -10.306 1.00 0.00 ? 11 GLU A HG3  8  
ATOM 4353 N N    . VAL A 1 12 ? -12.418 -0.572  -5.900  1.00 0.00 ? 12 VAL A N    8  
ATOM 4354 C CA   . VAL A 1 12 ? -12.122 0.156   -4.636  1.00 0.00 ? 12 VAL A CA   8  
ATOM 4355 C C    . VAL A 1 12 ? -11.874 1.639   -4.937  1.00 0.00 ? 12 VAL A C    8  
ATOM 4356 O O    . VAL A 1 12 ? -12.067 2.103   -6.044  1.00 0.00 ? 12 VAL A O    8  
ATOM 4357 C CB   . VAL A 1 12 ? -10.867 -0.489  -3.974  1.00 0.00 ? 12 VAL A CB   8  
ATOM 4358 C CG1  . VAL A 1 12 ? -11.147 -1.973  -3.660  1.00 0.00 ? 12 VAL A CG1  8  
ATOM 4359 C CG2  . VAL A 1 12 ? -9.633  -0.385  -4.914  1.00 0.00 ? 12 VAL A CG2  8  
ATOM 4360 H H    . VAL A 1 12 ? -11.705 -1.104  -6.303  1.00 0.00 ? 12 VAL A H    8  
ATOM 4361 H HA   . VAL A 1 12 ? -12.972 0.077   -3.975  1.00 0.00 ? 12 VAL A HA   8  
ATOM 4362 H HB   . VAL A 1 12 ? -10.653 0.021   -3.046  1.00 0.00 ? 12 VAL A HB   8  
ATOM 4363 H HG11 . VAL A 1 12 ? -12.035 -2.064  -3.052  1.00 0.00 ? 12 VAL A HG11 8  
ATOM 4364 H HG12 . VAL A 1 12 ? -11.289 -2.534  -4.572  1.00 0.00 ? 12 VAL A HG12 8  
ATOM 4365 H HG13 . VAL A 1 12 ? -10.315 -2.398  -3.117  1.00 0.00 ? 12 VAL A HG13 8  
ATOM 4366 H HG21 . VAL A 1 12 ? -9.899  -0.610  -5.936  1.00 0.00 ? 12 VAL A HG21 8  
ATOM 4367 H HG22 . VAL A 1 12 ? -9.226  0.615   -4.875  1.00 0.00 ? 12 VAL A HG22 8  
ATOM 4368 H HG23 . VAL A 1 12 ? -8.866  -1.079  -4.602  1.00 0.00 ? 12 VAL A HG23 8  
ATOM 4369 N N    . HIS A 1 13 ? -11.448 2.327   -3.913  1.00 0.00 ? 13 HIS A N    8  
ATOM 4370 C CA   . HIS A 1 13 ? -11.152 3.787   -4.030  1.00 0.00 ? 13 HIS A CA   8  
ATOM 4371 C C    . HIS A 1 13 ? -9.836  3.906   -4.802  1.00 0.00 ? 13 HIS A C    8  
ATOM 4372 O O    . HIS A 1 13 ? -9.821  4.277   -5.960  1.00 0.00 ? 13 HIS A O    8  
ATOM 4373 C CB   . HIS A 1 13 ? -11.031 4.386   -2.602  1.00 0.00 ? 13 HIS A CB   8  
ATOM 4374 C CG   . HIS A 1 13 ? -12.189 5.355   -2.357  1.00 0.00 ? 13 HIS A CG   8  
ATOM 4375 N ND1  . HIS A 1 13 ? -13.142 5.171   -1.505  1.00 0.00 ? 13 HIS A ND1  8  
ATOM 4376 C CD2  . HIS A 1 13 ? -12.484 6.574   -2.943  1.00 0.00 ? 13 HIS A CD2  8  
ATOM 4377 C CE1  . HIS A 1 13 ? -13.961 6.173   -1.544  1.00 0.00 ? 13 HIS A CE1  8  
ATOM 4378 N NE2  . HIS A 1 13 ? -13.590 7.070   -2.425  1.00 0.00 ? 13 HIS A NE2  8  
ATOM 4379 H H    . HIS A 1 13 ? -11.324 1.857   -3.065  1.00 0.00 ? 13 HIS A H    8  
ATOM 4380 H HA   . HIS A 1 13 ? -11.936 4.265   -4.596  1.00 0.00 ? 13 HIS A HA   8  
ATOM 4381 H HB2  . HIS A 1 13 ? -11.074 3.603   -1.857  1.00 0.00 ? 13 HIS A HB2  8  
ATOM 4382 H HB3  . HIS A 1 13 ? -10.106 4.926   -2.477  1.00 0.00 ? 13 HIS A HB3  8  
ATOM 4383 H HD1  . HIS A 1 13 ? -13.232 4.392   -0.917  1.00 0.00 ? 13 HIS A HD1  8  
ATOM 4384 H HD2  . HIS A 1 13 ? -11.895 7.050   -3.713  1.00 0.00 ? 13 HIS A HD2  8  
ATOM 4385 H HE1  . HIS A 1 13 ? -14.843 6.261   -0.926  1.00 0.00 ? 13 HIS A HE1  8  
ATOM 4386 N N    . HIS A 1 14 ? -8.774  3.580   -4.115  1.00 0.00 ? 14 HIS A N    8  
ATOM 4387 C CA   . HIS A 1 14 ? -7.402  3.630   -4.705  1.00 0.00 ? 14 HIS A CA   8  
ATOM 4388 C C    . HIS A 1 14 ? -6.538  2.538   -4.060  1.00 0.00 ? 14 HIS A C    8  
ATOM 4389 O O    . HIS A 1 14 ? -5.336  2.498   -4.222  1.00 0.00 ? 14 HIS A O    8  
ATOM 4390 C CB   . HIS A 1 14 ? -6.746  5.032   -4.455  1.00 0.00 ? 14 HIS A CB   8  
ATOM 4391 C CG   . HIS A 1 14 ? -7.718  6.036   -3.817  1.00 0.00 ? 14 HIS A CG   8  
ATOM 4392 N ND1  . HIS A 1 14 ? -7.780  6.309   -2.554  1.00 0.00 ? 14 HIS A ND1  8  
ATOM 4393 C CD2  . HIS A 1 14 ? -8.692  6.837   -4.386  1.00 0.00 ? 14 HIS A CD2  8  
ATOM 4394 C CE1  . HIS A 1 14 ? -8.702  7.194   -2.344  1.00 0.00 ? 14 HIS A CE1  8  
ATOM 4395 N NE2  . HIS A 1 14 ? -9.294  7.552   -3.456  1.00 0.00 ? 14 HIS A NE2  8  
ATOM 4396 H H    . HIS A 1 14 ? -8.884  3.300   -3.186  1.00 0.00 ? 14 HIS A H    8  
ATOM 4397 H HA   . HIS A 1 14 ? -7.474  3.396   -5.753  1.00 0.00 ? 14 HIS A HA   8  
ATOM 4398 H HB2  . HIS A 1 14 ? -5.887  4.934   -3.809  1.00 0.00 ? 14 HIS A HB2  8  
ATOM 4399 H HB3  . HIS A 1 14 ? -6.415  5.440   -5.397  1.00 0.00 ? 14 HIS A HB3  8  
ATOM 4400 H HD1  . HIS A 1 14 ? -7.214  5.907   -1.862  1.00 0.00 ? 14 HIS A HD1  8  
ATOM 4401 H HD2  . HIS A 1 14 ? -8.926  6.871   -5.440  1.00 0.00 ? 14 HIS A HD2  8  
ATOM 4402 H HE1  . HIS A 1 14 ? -8.950  7.590   -1.371  1.00 0.00 ? 14 HIS A HE1  8  
ATOM 4403 N N    . GLN A 1 15 ? -7.189  1.664   -3.342  1.00 0.00 ? 15 GLN A N    8  
ATOM 4404 C CA   . GLN A 1 15 ? -6.487  0.536   -2.645  1.00 0.00 ? 15 GLN A CA   8  
ATOM 4405 C C    . GLN A 1 15 ? -5.589  -0.217  -3.635  1.00 0.00 ? 15 GLN A C    8  
ATOM 4406 O O    . GLN A 1 15 ? -4.444  -0.516  -3.354  1.00 0.00 ? 15 GLN A O    8  
ATOM 4407 C CB   . GLN A 1 15 ? -7.558  -0.400  -2.053  1.00 0.00 ? 15 GLN A CB   8  
ATOM 4408 C CG   . GLN A 1 15 ? -7.717  -0.134  -0.545  1.00 0.00 ? 15 GLN A CG   8  
ATOM 4409 C CD   . GLN A 1 15 ? -9.067  -0.698  -0.083  1.00 0.00 ? 15 GLN A CD   8  
ATOM 4410 O OE1  . GLN A 1 15 ? -9.957  0.028   0.313   1.00 0.00 ? 15 GLN A OE1  8  
ATOM 4411 N NE2  . GLN A 1 15 ? -9.258  -1.989  -0.118  1.00 0.00 ? 15 GLN A NE2  8  
ATOM 4412 H H    . GLN A 1 15 ? -8.160  1.760   -3.274  1.00 0.00 ? 15 GLN A H    8  
ATOM 4413 H HA   . GLN A 1 15 ? -5.857  0.952   -1.873  1.00 0.00 ? 15 GLN A HA   8  
ATOM 4414 H HB2  . GLN A 1 15 ? -8.500  -0.209  -2.541  1.00 0.00 ? 15 GLN A HB2  8  
ATOM 4415 H HB3  . GLN A 1 15 ? -7.300  -1.434  -2.219  1.00 0.00 ? 15 GLN A HB3  8  
ATOM 4416 H HG2  . GLN A 1 15 ? -6.928  -0.620  0.009   1.00 0.00 ? 15 GLN A HG2  8  
ATOM 4417 H HG3  . GLN A 1 15 ? -7.693  0.925   -0.336  1.00 0.00 ? 15 GLN A HG3  8  
ATOM 4418 H HE21 . GLN A 1 15 ? -8.546  -2.582  -0.438  1.00 0.00 ? 15 GLN A HE21 8  
ATOM 4419 H HE22 . GLN A 1 15 ? -10.115 -2.364  0.176   1.00 0.00 ? 15 GLN A HE22 8  
ATOM 4420 N N    . LYS A 1 16 ? -6.153  -0.490  -4.779  1.00 0.00 ? 16 LYS A N    8  
ATOM 4421 C CA   . LYS A 1 16 ? -5.426  -1.211  -5.857  1.00 0.00 ? 16 LYS A CA   8  
ATOM 4422 C C    . LYS A 1 16 ? -4.064  -0.567  -6.137  1.00 0.00 ? 16 LYS A C    8  
ATOM 4423 O O    . LYS A 1 16 ? -3.032  -1.204  -6.036  1.00 0.00 ? 16 LYS A O    8  
ATOM 4424 C CB   . LYS A 1 16 ? -6.314  -1.188  -7.125  1.00 0.00 ? 16 LYS A CB   8  
ATOM 4425 C CG   . LYS A 1 16 ? -6.984  -2.557  -7.324  1.00 0.00 ? 16 LYS A CG   8  
ATOM 4426 C CD   . LYS A 1 16 ? -5.916  -3.568  -7.781  1.00 0.00 ? 16 LYS A CD   8  
ATOM 4427 C CE   . LYS A 1 16 ? -6.615  -4.837  -8.312  1.00 0.00 ? 16 LYS A CE   8  
ATOM 4428 N NZ   . LYS A 1 16 ? -5.639  -5.708  -9.028  1.00 0.00 ? 16 LYS A NZ   8  
ATOM 4429 H H    . LYS A 1 16 ? -7.077  -0.219  -4.940  1.00 0.00 ? 16 LYS A H    8  
ATOM 4430 H HA   . LYS A 1 16 ? -5.253  -2.218  -5.518  1.00 0.00 ? 16 LYS A HA   8  
ATOM 4431 H HB2  . LYS A 1 16 ? -7.082  -0.434  -7.020  1.00 0.00 ? 16 LYS A HB2  8  
ATOM 4432 H HB3  . LYS A 1 16 ? -5.725  -0.938  -7.996  1.00 0.00 ? 16 LYS A HB3  8  
ATOM 4433 H HG2  . LYS A 1 16 ? -7.436  -2.888  -6.400  1.00 0.00 ? 16 LYS A HG2  8  
ATOM 4434 H HG3  . LYS A 1 16 ? -7.758  -2.467  -8.073  1.00 0.00 ? 16 LYS A HG3  8  
ATOM 4435 H HD2  . LYS A 1 16 ? -5.306  -3.115  -8.549  1.00 0.00 ? 16 LYS A HD2  8  
ATOM 4436 H HD3  . LYS A 1 16 ? -5.281  -3.809  -6.941  1.00 0.00 ? 16 LYS A HD3  8  
ATOM 4437 H HE2  . LYS A 1 16 ? -7.041  -5.400  -7.494  1.00 0.00 ? 16 LYS A HE2  8  
ATOM 4438 H HE3  . LYS A 1 16 ? -7.400  -4.571  -9.003  1.00 0.00 ? 16 LYS A HE3  8  
ATOM 4439 H HZ1  . LYS A 1 16 ? -4.698  -5.264  -9.014  1.00 0.00 ? 16 LYS A HZ1  8  
ATOM 4440 H HZ2  . LYS A 1 16 ? -5.595  -6.634  -8.559  1.00 0.00 ? 16 LYS A HZ2  8  
ATOM 4441 H HZ3  . LYS A 1 16 ? -5.950  -5.834  -10.013 1.00 0.00 ? 16 LYS A HZ3  8  
ATOM 4442 N N    . LEU A 1 17 ? -4.106  0.698   -6.467  1.00 0.00 ? 17 LEU A N    8  
ATOM 4443 C CA   . LEU A 1 17 ? -2.840  1.420   -6.767  1.00 0.00 ? 17 LEU A CA   8  
ATOM 4444 C C    . LEU A 1 17 ? -1.959  1.493   -5.514  1.00 0.00 ? 17 LEU A C    8  
ATOM 4445 O O    . LEU A 1 17 ? -0.764  1.369   -5.628  1.00 0.00 ? 17 LEU A O    8  
ATOM 4446 C CB   . LEU A 1 17 ? -3.226  2.834   -7.329  1.00 0.00 ? 17 LEU A CB   8  
ATOM 4447 C CG   . LEU A 1 17 ? -3.200  3.967   -6.277  1.00 0.00 ? 17 LEU A CG   8  
ATOM 4448 C CD1  . LEU A 1 17 ? -1.732  4.408   -5.985  1.00 0.00 ? 17 LEU A CD1  8  
ATOM 4449 C CD2  . LEU A 1 17 ? -3.991  5.165   -6.835  1.00 0.00 ? 17 LEU A CD2  8  
ATOM 4450 H H    . LEU A 1 17 ? -4.963  1.169   -6.510  1.00 0.00 ? 17 LEU A H    8  
ATOM 4451 H HA   . LEU A 1 17 ? -2.314  0.869   -7.532  1.00 0.00 ? 17 LEU A HA   8  
ATOM 4452 H HB2  . LEU A 1 17 ? -2.553  3.085   -8.134  1.00 0.00 ? 17 LEU A HB2  8  
ATOM 4453 H HB3  . LEU A 1 17 ? -4.222  2.773   -7.746  1.00 0.00 ? 17 LEU A HB3  8  
ATOM 4454 H HG   . LEU A 1 17 ? -3.682  3.610   -5.382  1.00 0.00 ? 17 LEU A HG   8  
ATOM 4455 H HD11 . LEU A 1 17 ? -1.036  3.905   -6.641  1.00 0.00 ? 17 LEU A HD11 8  
ATOM 4456 H HD12 . LEU A 1 17 ? -1.610  5.473   -6.118  1.00 0.00 ? 17 LEU A HD12 8  
ATOM 4457 H HD13 . LEU A 1 17 ? -1.474  4.162   -4.966  1.00 0.00 ? 17 LEU A HD13 8  
ATOM 4458 H HD21 . LEU A 1 17 ? -4.995  4.860   -7.089  1.00 0.00 ? 17 LEU A HD21 8  
ATOM 4459 H HD22 . LEU A 1 17 ? -4.041  5.952   -6.097  1.00 0.00 ? 17 LEU A HD22 8  
ATOM 4460 H HD23 . LEU A 1 17 ? -3.509  5.547   -7.724  1.00 0.00 ? 17 LEU A HD23 8  
ATOM 4461 N N    . VAL A 1 18 ? -2.536  1.688   -4.356  1.00 0.00 ? 18 VAL A N    8  
ATOM 4462 C CA   . VAL A 1 18 ? -1.737  1.766   -3.095  1.00 0.00 ? 18 VAL A CA   8  
ATOM 4463 C C    . VAL A 1 18 ? -0.833  0.518   -2.985  1.00 0.00 ? 18 VAL A C    8  
ATOM 4464 O O    . VAL A 1 18 ? 0.363   0.627   -2.800  1.00 0.00 ? 18 VAL A O    8  
ATOM 4465 C CB   . VAL A 1 18 ? -2.755  1.874   -1.922  1.00 0.00 ? 18 VAL A CB   8  
ATOM 4466 C CG1  . VAL A 1 18 ? -2.105  1.523   -0.580  1.00 0.00 ? 18 VAL A CG1  8  
ATOM 4467 C CG2  . VAL A 1 18 ? -3.311  3.314   -1.858  1.00 0.00 ? 18 VAL A CG2  8  
ATOM 4468 H H    . VAL A 1 18 ? -3.503  1.794   -4.304  1.00 0.00 ? 18 VAL A H    8  
ATOM 4469 H HA   . VAL A 1 18 ? -1.110  2.647   -3.134  1.00 0.00 ? 18 VAL A HA   8  
ATOM 4470 H HB   . VAL A 1 18 ? -3.578  1.199   -2.084  1.00 0.00 ? 18 VAL A HB   8  
ATOM 4471 H HG11 . VAL A 1 18 ? -1.171  2.054   -0.470  1.00 0.00 ? 18 VAL A HG11 8  
ATOM 4472 H HG12 . VAL A 1 18 ? -2.767  1.792   0.230   1.00 0.00 ? 18 VAL A HG12 8  
ATOM 4473 H HG13 . VAL A 1 18 ? -1.919  0.460   -0.537  1.00 0.00 ? 18 VAL A HG13 8  
ATOM 4474 H HG21 . VAL A 1 18 ? -3.581  3.660   -2.845  1.00 0.00 ? 18 VAL A HG21 8  
ATOM 4475 H HG22 . VAL A 1 18 ? -4.191  3.341   -1.233  1.00 0.00 ? 18 VAL A HG22 8  
ATOM 4476 H HG23 . VAL A 1 18 ? -2.572  3.986   -1.447  1.00 0.00 ? 18 VAL A HG23 8  
ATOM 4477 N N    . PHE A 1 19 ? -1.441  -0.633  -3.116  1.00 0.00 ? 19 PHE A N    8  
ATOM 4478 C CA   . PHE A 1 19 ? -0.680  -1.924  -3.032  1.00 0.00 ? 19 PHE A CA   8  
ATOM 4479 C C    . PHE A 1 19 ? 0.457   -1.914  -4.057  1.00 0.00 ? 19 PHE A C    8  
ATOM 4480 O O    . PHE A 1 19 ? 1.603   -2.177  -3.746  1.00 0.00 ? 19 PHE A O    8  
ATOM 4481 C CB   . PHE A 1 19 ? -1.619  -3.119  -3.332  1.00 0.00 ? 19 PHE A CB   8  
ATOM 4482 C CG   . PHE A 1 19 ? -2.956  -3.038  -2.567  1.00 0.00 ? 19 PHE A CG   8  
ATOM 4483 C CD1  . PHE A 1 19 ? -3.040  -2.496  -1.295  1.00 0.00 ? 19 PHE A CD1  8  
ATOM 4484 C CD2  . PHE A 1 19 ? -4.107  -3.524  -3.162  1.00 0.00 ? 19 PHE A CD2  8  
ATOM 4485 C CE1  . PHE A 1 19 ? -4.249  -2.442  -0.634  1.00 0.00 ? 19 PHE A CE1  8  
ATOM 4486 C CE2  . PHE A 1 19 ? -5.316  -3.470  -2.501  1.00 0.00 ? 19 PHE A CE2  8  
ATOM 4487 C CZ   . PHE A 1 19 ? -5.388  -2.929  -1.237  1.00 0.00 ? 19 PHE A CZ   8  
ATOM 4488 H H    . PHE A 1 19 ? -2.404  -0.639  -3.269  1.00 0.00 ? 19 PHE A H    8  
ATOM 4489 H HA   . PHE A 1 19 ? -0.254  -2.014  -2.046  1.00 0.00 ? 19 PHE A HA   8  
ATOM 4490 H HB2  . PHE A 1 19 ? -1.833  -3.158  -4.392  1.00 0.00 ? 19 PHE A HB2  8  
ATOM 4491 H HB3  . PHE A 1 19 ? -1.125  -4.039  -3.053  1.00 0.00 ? 19 PHE A HB3  8  
ATOM 4492 H HD1  . PHE A 1 19 ? -2.156  -2.110  -0.808  1.00 0.00 ? 19 PHE A HD1  8  
ATOM 4493 H HD2  . PHE A 1 19 ? -4.062  -3.951  -4.154  1.00 0.00 ? 19 PHE A HD2  8  
ATOM 4494 H HE1  . PHE A 1 19 ? -4.304  -2.016  0.358   1.00 0.00 ? 19 PHE A HE1  8  
ATOM 4495 H HE2  . PHE A 1 19 ? -6.207  -3.853  -2.977  1.00 0.00 ? 19 PHE A HE2  8  
ATOM 4496 H HZ   . PHE A 1 19 ? -6.334  -2.889  -0.719  1.00 0.00 ? 19 PHE A HZ   8  
ATOM 4497 N N    . PHE A 1 20 ? 0.078   -1.596  -5.266  1.00 0.00 ? 20 PHE A N    8  
ATOM 4498 C CA   . PHE A 1 20 ? 1.050   -1.534  -6.394  1.00 0.00 ? 20 PHE A CA   8  
ATOM 4499 C C    . PHE A 1 20 ? 2.234   -0.614  -6.017  1.00 0.00 ? 20 PHE A C    8  
ATOM 4500 O O    . PHE A 1 20 ? 3.378   -1.016  -6.060  1.00 0.00 ? 20 PHE A O    8  
ATOM 4501 C CB   . PHE A 1 20 ? 0.232   -1.041  -7.635  1.00 0.00 ? 20 PHE A CB   8  
ATOM 4502 C CG   . PHE A 1 20 ? 0.967   0.014   -8.474  1.00 0.00 ? 20 PHE A CG   8  
ATOM 4503 C CD1  . PHE A 1 20 ? 2.042   -0.360  -9.251  1.00 0.00 ? 20 PHE A CD1  8  
ATOM 4504 C CD2  . PHE A 1 20 ? 0.569   1.338   -8.465  1.00 0.00 ? 20 PHE A CD2  8  
ATOM 4505 C CE1  . PHE A 1 20 ? 2.713   0.573   -10.010 1.00 0.00 ? 20 PHE A CE1  8  
ATOM 4506 C CE2  . PHE A 1 20 ? 1.239   2.273   -9.222  1.00 0.00 ? 20 PHE A CE2  8  
ATOM 4507 C CZ   . PHE A 1 20 ? 2.313   1.892   -9.997  1.00 0.00 ? 20 PHE A CZ   8  
ATOM 4508 H H    . PHE A 1 20 ? -0.867  -1.393  -5.433  1.00 0.00 ? 20 PHE A H    8  
ATOM 4509 H HA   . PHE A 1 20 ? 1.428   -2.530  -6.576  1.00 0.00 ? 20 PHE A HA   8  
ATOM 4510 H HB2  . PHE A 1 20 ? 0.019   -1.888  -8.271  1.00 0.00 ? 20 PHE A HB2  8  
ATOM 4511 H HB3  . PHE A 1 20 ? -0.713  -0.626  -7.318  1.00 0.00 ? 20 PHE A HB3  8  
ATOM 4512 H HD1  . PHE A 1 20 ? 2.356   -1.394  -9.261  1.00 0.00 ? 20 PHE A HD1  8  
ATOM 4513 H HD2  . PHE A 1 20 ? -0.271  1.651   -7.867  1.00 0.00 ? 20 PHE A HD2  8  
ATOM 4514 H HE1  . PHE A 1 20 ? 3.554   0.266   -10.614 1.00 0.00 ? 20 PHE A HE1  8  
ATOM 4515 H HE2  . PHE A 1 20 ? 0.916   3.302   -9.203  1.00 0.00 ? 20 PHE A HE2  8  
ATOM 4516 H HZ   . PHE A 1 20 ? 2.839   2.625   -10.591 1.00 0.00 ? 20 PHE A HZ   8  
ATOM 4517 N N    . ALA A 1 21 ? 1.912   0.597   -5.645  1.00 0.00 ? 21 ALA A N    8  
ATOM 4518 C CA   . ALA A 1 21 ? 2.931   1.616   -5.249  1.00 0.00 ? 21 ALA A CA   8  
ATOM 4519 C C    . ALA A 1 21 ? 3.879   1.065   -4.190  1.00 0.00 ? 21 ALA A C    8  
ATOM 4520 O O    . ALA A 1 21 ? 5.072   1.223   -4.304  1.00 0.00 ? 21 ALA A O    8  
ATOM 4521 C CB   . ALA A 1 21 ? 2.199   2.855   -4.714  1.00 0.00 ? 21 ALA A CB   8  
ATOM 4522 H H    . ALA A 1 21 ? 0.970   0.838   -5.621  1.00 0.00 ? 21 ALA A H    8  
ATOM 4523 H HA   . ALA A 1 21 ? 3.518   1.870   -6.121  1.00 0.00 ? 21 ALA A HA   8  
ATOM 4524 H HB1  . ALA A 1 21 ? 1.474   3.198   -5.439  1.00 0.00 ? 21 ALA A HB1  8  
ATOM 4525 H HB2  . ALA A 1 21 ? 1.682   2.620   -3.795  1.00 0.00 ? 21 ALA A HB2  8  
ATOM 4526 H HB3  . ALA A 1 21 ? 2.903   3.651   -4.523  1.00 0.00 ? 21 ALA A HB3  8  
ATOM 4527 N N    . GLU A 1 22 ? 3.340   0.431   -3.185  1.00 0.00 ? 22 GLU A N    8  
ATOM 4528 C CA   . GLU A 1 22 ? 4.200   -0.146  -2.106  1.00 0.00 ? 22 GLU A CA   8  
ATOM 4529 C C    . GLU A 1 22 ? 5.202   -1.134  -2.732  1.00 0.00 ? 22 GLU A C    8  
ATOM 4530 O O    . GLU A 1 22 ? 6.396   -1.028  -2.523  1.00 0.00 ? 22 GLU A O    8  
ATOM 4531 C CB   . GLU A 1 22 ? 3.261   -0.839  -1.087  1.00 0.00 ? 22 GLU A CB   8  
ATOM 4532 C CG   . GLU A 1 22 ? 4.041   -1.741  -0.097  1.00 0.00 ? 22 GLU A CG   8  
ATOM 4533 C CD   . GLU A 1 22 ? 4.402   -3.102  -0.740  1.00 0.00 ? 22 GLU A CD   8  
ATOM 4534 O OE1  . GLU A 1 22 ? 3.485   -3.758  -1.210  1.00 0.00 ? 22 GLU A OE1  8  
ATOM 4535 O OE2  . GLU A 1 22 ? 5.583   -3.411  -0.726  1.00 0.00 ? 22 GLU A OE2  8  
ATOM 4536 H H    . GLU A 1 22 ? 2.371   0.346   -3.141  1.00 0.00 ? 22 GLU A H    8  
ATOM 4537 H HA   . GLU A 1 22 ? 4.756   0.658   -1.646  1.00 0.00 ? 22 GLU A HA   8  
ATOM 4538 H HB2  . GLU A 1 22 ? 2.746   -0.076  -0.523  1.00 0.00 ? 22 GLU A HB2  8  
ATOM 4539 H HB3  . GLU A 1 22 ? 2.516   -1.422  -1.609  1.00 0.00 ? 22 GLU A HB3  8  
ATOM 4540 H HG2  . GLU A 1 22 ? 4.943   -1.236  0.217   1.00 0.00 ? 22 GLU A HG2  8  
ATOM 4541 H HG3  . GLU A 1 22 ? 3.427   -1.923  0.771   1.00 0.00 ? 22 GLU A HG3  8  
ATOM 4542 N N    . ASP A 1 23 ? 4.672   -2.066  -3.487  1.00 0.00 ? 23 ASP A N    8  
ATOM 4543 C CA   . ASP A 1 23 ? 5.517   -3.099  -4.166  1.00 0.00 ? 23 ASP A CA   8  
ATOM 4544 C C    . ASP A 1 23 ? 6.698   -2.420  -4.860  1.00 0.00 ? 23 ASP A C    8  
ATOM 4545 O O    . ASP A 1 23 ? 7.846   -2.759  -4.662  1.00 0.00 ? 23 ASP A O    8  
ATOM 4546 C CB   . ASP A 1 23 ? 4.676   -3.842  -5.213  1.00 0.00 ? 23 ASP A CB   8  
ATOM 4547 C CG   . ASP A 1 23 ? 5.431   -5.110  -5.644  1.00 0.00 ? 23 ASP A CG   8  
ATOM 4548 O OD1  . ASP A 1 23 ? 5.231   -6.119  -4.988  1.00 0.00 ? 23 ASP A OD1  8  
ATOM 4549 O OD2  . ASP A 1 23 ? 6.172   -4.992  -6.607  1.00 0.00 ? 23 ASP A OD2  8  
ATOM 4550 H H    . ASP A 1 23 ? 3.702   -2.082  -3.607  1.00 0.00 ? 23 ASP A H    8  
ATOM 4551 H HA   . ASP A 1 23 ? 5.892   -3.785  -3.420  1.00 0.00 ? 23 ASP A HA   8  
ATOM 4552 H HB2  . ASP A 1 23 ? 3.704   -4.100  -4.824  1.00 0.00 ? 23 ASP A HB2  8  
ATOM 4553 H HB3  . ASP A 1 23 ? 4.522   -3.213  -6.078  1.00 0.00 ? 23 ASP A HB3  8  
ATOM 4554 N N    . VAL A 1 24 ? 6.319   -1.463  -5.657  1.00 0.00 ? 24 VAL A N    8  
ATOM 4555 C CA   . VAL A 1 24 ? 7.250   -0.626  -6.465  1.00 0.00 ? 24 VAL A CA   8  
ATOM 4556 C C    . VAL A 1 24 ? 8.305   0.035   -5.570  1.00 0.00 ? 24 VAL A C    8  
ATOM 4557 O O    . VAL A 1 24 ? 9.492   -0.077  -5.801  1.00 0.00 ? 24 VAL A O    8  
ATOM 4558 C CB   . VAL A 1 24 ? 6.346   0.395   -7.193  1.00 0.00 ? 24 VAL A CB   8  
ATOM 4559 C CG1  . VAL A 1 24 ? 7.126   1.384   -8.047  1.00 0.00 ? 24 VAL A CG1  8  
ATOM 4560 C CG2  . VAL A 1 24 ? 5.329   -0.358  -8.074  1.00 0.00 ? 24 VAL A CG2  8  
ATOM 4561 H H    . VAL A 1 24 ? 5.360   -1.283  -5.730  1.00 0.00 ? 24 VAL A H    8  
ATOM 4562 H HA   . VAL A 1 24 ? 7.754   -1.266  -7.174  1.00 0.00 ? 24 VAL A HA   8  
ATOM 4563 H HB   . VAL A 1 24 ? 5.797   0.965   -6.463  1.00 0.00 ? 24 VAL A HB   8  
ATOM 4564 H HG11 . VAL A 1 24 ? 7.883   1.872   -7.452  1.00 0.00 ? 24 VAL A HG11 8  
ATOM 4565 H HG12 . VAL A 1 24 ? 7.583   0.870   -8.876  1.00 0.00 ? 24 VAL A HG12 8  
ATOM 4566 H HG13 . VAL A 1 24 ? 6.442   2.131   -8.424  1.00 0.00 ? 24 VAL A HG13 8  
ATOM 4567 H HG21 . VAL A 1 24 ? 5.195   -1.376  -7.734  1.00 0.00 ? 24 VAL A HG21 8  
ATOM 4568 H HG22 . VAL A 1 24 ? 4.380   0.147   -8.004  1.00 0.00 ? 24 VAL A HG22 8  
ATOM 4569 H HG23 . VAL A 1 24 ? 5.648   -0.383  -9.102  1.00 0.00 ? 24 VAL A HG23 8  
ATOM 4570 N N    . GLY A 1 25 ? 7.816   0.708   -4.562  1.00 0.00 ? 25 GLY A N    8  
ATOM 4571 C CA   . GLY A 1 25 ? 8.691   1.423   -3.577  1.00 0.00 ? 25 GLY A CA   8  
ATOM 4572 C C    . GLY A 1 25 ? 9.856   0.524   -3.167  1.00 0.00 ? 25 GLY A C    8  
ATOM 4573 O O    . GLY A 1 25 ? 11.001  0.929   -3.179  1.00 0.00 ? 25 GLY A O    8  
ATOM 4574 H H    . GLY A 1 25 ? 6.846   0.733   -4.462  1.00 0.00 ? 25 GLY A H    8  
ATOM 4575 H HA2  . GLY A 1 25 ? 9.071   2.327   -4.031  1.00 0.00 ? 25 GLY A HA2  8  
ATOM 4576 H HA3  . GLY A 1 25 ? 8.107   1.673   -2.703  1.00 0.00 ? 25 GLY A HA3  8  
ATOM 4577 N N    . SER A 1 26 ? 9.498   -0.681  -2.815  1.00 0.00 ? 26 SER A N    8  
ATOM 4578 C CA   . SER A 1 26 ? 10.512  -1.688  -2.394  1.00 0.00 ? 26 SER A CA   8  
ATOM 4579 C C    . SER A 1 26 ? 11.363  -2.144  -3.596  1.00 0.00 ? 26 SER A C    8  
ATOM 4580 O O    . SER A 1 26 ? 12.550  -1.892  -3.671  1.00 0.00 ? 26 SER A O    8  
ATOM 4581 C CB   . SER A 1 26 ? 9.760   -2.881  -1.767  1.00 0.00 ? 26 SER A CB   8  
ATOM 4582 O OG   . SER A 1 26 ? 10.787  -3.725  -1.266  1.00 0.00 ? 26 SER A OG   8  
ATOM 4583 H H    . SER A 1 26 ? 8.546   -0.909  -2.827  1.00 0.00 ? 26 SER A H    8  
ATOM 4584 H HA   . SER A 1 26 ? 11.155  -1.237  -1.660  1.00 0.00 ? 26 SER A HA   8  
ATOM 4585 H HB2  . SER A 1 26 ? 9.131   -2.560  -0.949  1.00 0.00 ? 26 SER A HB2  8  
ATOM 4586 H HB3  . SER A 1 26 ? 9.173   -3.424  -2.493  1.00 0.00 ? 26 SER A HB3  8  
ATOM 4587 H HG   . SER A 1 26 ? 10.660  -3.818  -0.320  1.00 0.00 ? 26 SER A HG   8  
ATOM 4588 N N    . ASN A 1 27 ? 10.704  -2.794  -4.516  1.00 0.00 ? 27 ASN A N    8  
ATOM 4589 C CA   . ASN A 1 27 ? 11.352  -3.323  -5.748  1.00 0.00 ? 27 ASN A CA   8  
ATOM 4590 C C    . ASN A 1 27 ? 11.965  -2.239  -6.626  1.00 0.00 ? 27 ASN A C    8  
ATOM 4591 O O    . ASN A 1 27 ? 13.173  -2.108  -6.666  1.00 0.00 ? 27 ASN A O    8  
ATOM 4592 C CB   . ASN A 1 27 ? 10.277  -4.113  -6.518  1.00 0.00 ? 27 ASN A CB   8  
ATOM 4593 C CG   . ASN A 1 27 ? 9.906   -5.380  -5.736  1.00 0.00 ? 27 ASN A CG   8  
ATOM 4594 O OD1  . ASN A 1 27 ? 10.700  -6.287  -5.587  1.00 0.00 ? 27 ASN A OD1  8  
ATOM 4595 N ND2  . ASN A 1 27 ? 8.711   -5.484  -5.220  1.00 0.00 ? 27 ASN A ND2  8  
ATOM 4596 H H    . ASN A 1 27 ? 9.748   -2.932  -4.404  1.00 0.00 ? 27 ASN A H    8  
ATOM 4597 H HA   . ASN A 1 27 ? 12.166  -3.954  -5.436  1.00 0.00 ? 27 ASN A HA   8  
ATOM 4598 H HB2  . ASN A 1 27 ? 9.388   -3.509  -6.641  1.00 0.00 ? 27 ASN A HB2  8  
ATOM 4599 H HB3  . ASN A 1 27 ? 10.638  -4.391  -7.493  1.00 0.00 ? 27 ASN A HB3  8  
ATOM 4600 H HD21 . ASN A 1 27 ? 8.061   -4.759  -5.335  1.00 0.00 ? 27 ASN A HD21 8  
ATOM 4601 H HD22 . ASN A 1 27 ? 8.463   -6.287  -4.716  1.00 0.00 ? 27 ASN A HD22 8  
ATOM 4602 N N    . LYS A 1 28 ? 11.132  -1.495  -7.307  1.00 0.00 ? 28 LYS A N    8  
ATOM 4603 C CA   . LYS A 1 28 ? 11.632  -0.400  -8.197  1.00 0.00 ? 28 LYS A CA   8  
ATOM 4604 C C    . LYS A 1 28 ? 12.651  0.445   -7.428  1.00 0.00 ? 28 LYS A C    8  
ATOM 4605 O O    . LYS A 1 28 ? 13.617  0.897   -7.998  1.00 0.00 ? 28 LYS A O    8  
ATOM 4606 C CB   . LYS A 1 28 ? 10.441  0.473   -8.641  1.00 0.00 ? 28 LYS A CB   8  
ATOM 4607 C CG   . LYS A 1 28 ? 10.505  0.673   -10.169 1.00 0.00 ? 28 LYS A CG   8  
ATOM 4608 C CD   . LYS A 1 28 ? 9.789   1.989   -10.571 1.00 0.00 ? 28 LYS A CD   8  
ATOM 4609 C CE   . LYS A 1 28 ? 9.034   1.794   -11.900 1.00 0.00 ? 28 LYS A CE   8  
ATOM 4610 N NZ   . LYS A 1 28 ? 7.915   0.825   -11.723 1.00 0.00 ? 28 LYS A NZ   8  
ATOM 4611 H H    . LYS A 1 28 ? 10.172  -1.663  -7.230  1.00 0.00 ? 28 LYS A H    8  
ATOM 4612 H HA   . LYS A 1 28 ? 12.132  -0.846  -9.049  1.00 0.00 ? 28 LYS A HA   8  
ATOM 4613 H HB2  . LYS A 1 28 ? 9.517   -0.027  -8.395  1.00 0.00 ? 28 LYS A HB2  8  
ATOM 4614 H HB3  . LYS A 1 28 ? 10.458  1.427   -8.131  1.00 0.00 ? 28 LYS A HB3  8  
ATOM 4615 H HG2  . LYS A 1 28 ? 11.535  0.719   -10.490 1.00 0.00 ? 28 LYS A HG2  8  
ATOM 4616 H HG3  . LYS A 1 28 ? 10.039  -0.180  -10.640 1.00 0.00 ? 28 LYS A HG3  8  
ATOM 4617 H HD2  . LYS A 1 28 ? 9.090   2.296   -9.806  1.00 0.00 ? 28 LYS A HD2  8  
ATOM 4618 H HD3  . LYS A 1 28 ? 10.523  2.773   -10.692 1.00 0.00 ? 28 LYS A HD3  8  
ATOM 4619 H HE2  . LYS A 1 28 ? 8.623   2.736   -12.230 1.00 0.00 ? 28 LYS A HE2  8  
ATOM 4620 H HE3  . LYS A 1 28 ? 9.702   1.419   -12.663 1.00 0.00 ? 28 LYS A HE3  8  
ATOM 4621 H HZ1  . LYS A 1 28 ? 7.893   0.491   -10.739 1.00 0.00 ? 28 LYS A HZ1  8  
ATOM 4622 H HZ2  . LYS A 1 28 ? 7.013   1.290   -11.949 1.00 0.00 ? 28 LYS A HZ2  8  
ATOM 4623 H HZ3  . LYS A 1 28 ? 8.054   0.014   -12.359 1.00 0.00 ? 28 LYS A HZ3  8  
ATOM 4624 N N    . GLY A 1 29 ? 12.416  0.627   -6.153  1.00 0.00 ? 29 GLY A N    8  
ATOM 4625 C CA   . GLY A 1 29 ? 13.355  1.432   -5.317  1.00 0.00 ? 29 GLY A CA   8  
ATOM 4626 C C    . GLY A 1 29 ? 14.764  0.829   -5.408  1.00 0.00 ? 29 GLY A C    8  
ATOM 4627 O O    . GLY A 1 29 ? 15.693  1.486   -5.838  1.00 0.00 ? 29 GLY A O    8  
ATOM 4628 H H    . GLY A 1 29 ? 11.612  0.231   -5.763  1.00 0.00 ? 29 GLY A H    8  
ATOM 4629 H HA2  . GLY A 1 29 ? 13.371  2.452   -5.673  1.00 0.00 ? 29 GLY A HA2  8  
ATOM 4630 H HA3  . GLY A 1 29 ? 13.033  1.412   -4.289  1.00 0.00 ? 29 GLY A HA3  8  
ATOM 4631 N N    . ALA A 1 30 ? 14.883  -0.417  -5.013  1.00 0.00 ? 30 ALA A N    8  
ATOM 4632 C CA   . ALA A 1 30 ? 16.226  -1.086  -5.064  1.00 0.00 ? 30 ALA A CA   8  
ATOM 4633 C C    . ALA A 1 30 ? 16.790  -1.087  -6.491  1.00 0.00 ? 30 ALA A C    8  
ATOM 4634 O O    . ALA A 1 30 ? 17.958  -0.833  -6.714  1.00 0.00 ? 30 ALA A O    8  
ATOM 4635 C CB   . ALA A 1 30 ? 16.074  -2.527  -4.558  1.00 0.00 ? 30 ALA A CB   8  
ATOM 4636 H H    . ALA A 1 30 ? 14.095  -0.912  -4.688  1.00 0.00 ? 30 ALA A H    8  
ATOM 4637 H HA   . ALA A 1 30 ? 16.908  -0.527  -4.439  1.00 0.00 ? 30 ALA A HA   8  
ATOM 4638 H HB1  . ALA A 1 30 ? 15.704  -2.522  -3.543  1.00 0.00 ? 30 ALA A HB1  8  
ATOM 4639 H HB2  . ALA A 1 30 ? 15.380  -3.073  -5.180  1.00 0.00 ? 30 ALA A HB2  8  
ATOM 4640 H HB3  . ALA A 1 30 ? 17.031  -3.029  -4.575  1.00 0.00 ? 30 ALA A HB3  8  
ATOM 4641 N N    . ILE A 1 31 ? 15.921  -1.373  -7.420  1.00 0.00 ? 31 ILE A N    8  
ATOM 4642 C CA   . ILE A 1 31 ? 16.286  -1.421  -8.862  1.00 0.00 ? 31 ILE A CA   8  
ATOM 4643 C C    . ILE A 1 31 ? 16.939  -0.094  -9.271  1.00 0.00 ? 31 ILE A C    8  
ATOM 4644 O O    . ILE A 1 31 ? 18.047  -0.077  -9.763  1.00 0.00 ? 31 ILE A O    8  
ATOM 4645 C CB   . ILE A 1 31 ? 14.957  -1.730  -9.605  1.00 0.00 ? 31 ILE A CB   8  
ATOM 4646 C CG1  . ILE A 1 31 ? 14.623  -3.231  -9.372  1.00 0.00 ? 31 ILE A CG1  8  
ATOM 4647 C CG2  . ILE A 1 31 ? 15.024  -1.399  -11.106 1.00 0.00 ? 31 ILE A CG2  8  
ATOM 4648 C CD1  . ILE A 1 31 ? 13.238  -3.602  -9.941  1.00 0.00 ? 31 ILE A CD1  8  
ATOM 4649 H H    . ILE A 1 31 ? 14.999  -1.567  -7.168  1.00 0.00 ? 31 ILE A H    8  
ATOM 4650 H HA   . ILE A 1 31 ? 17.023  -2.198  -8.993  1.00 0.00 ? 31 ILE A HA   8  
ATOM 4651 H HB   . ILE A 1 31 ? 14.176  -1.132  -9.167  1.00 0.00 ? 31 ILE A HB   8  
ATOM 4652 H HG12 . ILE A 1 31 ? 15.386  -3.842  -9.825  1.00 0.00 ? 31 ILE A HG12 8  
ATOM 4653 H HG13 . ILE A 1 31 ? 14.621  -3.438  -8.312  1.00 0.00 ? 31 ILE A HG13 8  
ATOM 4654 H HG21 . ILE A 1 31 ? 15.821  -1.949  -11.581 1.00 0.00 ? 31 ILE A HG21 8  
ATOM 4655 H HG22 . ILE A 1 31 ? 14.086  -1.654  -11.576 1.00 0.00 ? 31 ILE A HG22 8  
ATOM 4656 H HG23 . ILE A 1 31 ? 15.185  -0.339  -11.240 1.00 0.00 ? 31 ILE A HG23 8  
ATOM 4657 H HD11 . ILE A 1 31 ? 12.509  -2.841  -9.708  1.00 0.00 ? 31 ILE A HD11 8  
ATOM 4658 H HD12 . ILE A 1 31 ? 13.293  -3.719  -11.013 1.00 0.00 ? 31 ILE A HD12 8  
ATOM 4659 H HD13 . ILE A 1 31 ? 12.908  -4.536  -9.509  1.00 0.00 ? 31 ILE A HD13 8  
ATOM 4660 N N    . ILE A 1 32 ? 16.248  0.989   -9.055  1.00 0.00 ? 32 ILE A N    8  
ATOM 4661 C CA   . ILE A 1 32 ? 16.801  2.325   -9.416  1.00 0.00 ? 32 ILE A CA   8  
ATOM 4662 C C    . ILE A 1 32 ? 18.157  2.505   -8.732  1.00 0.00 ? 32 ILE A C    8  
ATOM 4663 O O    . ILE A 1 32 ? 19.104  2.930   -9.359  1.00 0.00 ? 32 ILE A O    8  
ATOM 4664 C CB   . ILE A 1 32 ? 15.796  3.413   -8.956  1.00 0.00 ? 32 ILE A CB   8  
ATOM 4665 C CG1  . ILE A 1 32 ? 14.464  3.218   -9.729  1.00 0.00 ? 32 ILE A CG1  8  
ATOM 4666 C CG2  . ILE A 1 32 ? 16.363  4.824   -9.258  1.00 0.00 ? 32 ILE A CG2  8  
ATOM 4667 C CD1  . ILE A 1 32 ? 13.296  3.861   -8.956  1.00 0.00 ? 32 ILE A CD1  8  
ATOM 4668 H H    . ILE A 1 32 ? 15.361  0.929   -8.657  1.00 0.00 ? 32 ILE A H    8  
ATOM 4669 H HA   . ILE A 1 32 ? 16.961  2.351   -10.480 1.00 0.00 ? 32 ILE A HA   8  
ATOM 4670 H HB   . ILE A 1 32 ? 15.627  3.314   -7.894  1.00 0.00 ? 32 ILE A HB   8  
ATOM 4671 H HG12 . ILE A 1 32 ? 14.543  3.658   -10.709 1.00 0.00 ? 32 ILE A HG12 8  
ATOM 4672 H HG13 . ILE A 1 32 ? 14.262  2.166   -9.864  1.00 0.00 ? 32 ILE A HG13 8  
ATOM 4673 H HG21 . ILE A 1 32 ? 16.661  4.899   -10.293 1.00 0.00 ? 32 ILE A HG21 8  
ATOM 4674 H HG22 . ILE A 1 32 ? 15.618  5.580   -9.056  1.00 0.00 ? 32 ILE A HG22 8  
ATOM 4675 H HG23 . ILE A 1 32 ? 17.223  5.020   -8.633  1.00 0.00 ? 32 ILE A HG23 8  
ATOM 4676 H HD11 . ILE A 1 32 ? 13.314  3.563   -7.918  1.00 0.00 ? 32 ILE A HD11 8  
ATOM 4677 H HD12 . ILE A 1 32 ? 13.364  4.938   -9.011  1.00 0.00 ? 32 ILE A HD12 8  
ATOM 4678 H HD13 . ILE A 1 32 ? 12.356  3.552   -9.389  1.00 0.00 ? 32 ILE A HD13 8  
ATOM 4679 N N    . GLY A 1 33 ? 18.214  2.165   -7.472  1.00 0.00 ? 33 GLY A N    8  
ATOM 4680 C CA   . GLY A 1 33 ? 19.492  2.303   -6.713  1.00 0.00 ? 33 GLY A CA   8  
ATOM 4681 C C    . GLY A 1 33 ? 20.650  1.589   -7.418  1.00 0.00 ? 33 GLY A C    8  
ATOM 4682 O O    . GLY A 1 33 ? 21.684  2.187   -7.647  1.00 0.00 ? 33 GLY A O    8  
ATOM 4683 H H    . GLY A 1 33 ? 17.415  1.818   -7.027  1.00 0.00 ? 33 GLY A H    8  
ATOM 4684 H HA2  . GLY A 1 33 ? 19.733  3.355   -6.628  1.00 0.00 ? 33 GLY A HA2  8  
ATOM 4685 H HA3  . GLY A 1 33 ? 19.367  1.884   -5.727  1.00 0.00 ? 33 GLY A HA3  8  
ATOM 4686 N N    . LEU A 1 34 ? 20.457  0.337   -7.761  1.00 0.00 ? 34 LEU A N    8  
ATOM 4687 C CA   . LEU A 1 34 ? 21.567  -0.393  -8.448  1.00 0.00 ? 34 LEU A CA   8  
ATOM 4688 C C    . LEU A 1 34 ? 21.862  0.218   -9.827  1.00 0.00 ? 34 LEU A C    8  
ATOM 4689 O O    . LEU A 1 34 ? 23.017  0.316   -10.196 1.00 0.00 ? 34 LEU A O    8  
ATOM 4690 C CB   . LEU A 1 34 ? 21.164  -1.913  -8.531  1.00 0.00 ? 34 LEU A CB   8  
ATOM 4691 C CG   . LEU A 1 34 ? 20.348  -2.303  -9.796  1.00 0.00 ? 34 LEU A CG   8  
ATOM 4692 C CD1  . LEU A 1 34 ? 21.297  -2.746  -10.936 1.00 0.00 ? 34 LEU A CD1  8  
ATOM 4693 C CD2  . LEU A 1 34 ? 19.405  -3.478  -9.453  1.00 0.00 ? 34 LEU A CD2  8  
ATOM 4694 H H    . LEU A 1 34 ? 19.601  -0.104  -7.568  1.00 0.00 ? 34 LEU A H    8  
ATOM 4695 H HA   . LEU A 1 34 ? 22.449  -0.295  -7.839  1.00 0.00 ? 34 LEU A HA   8  
ATOM 4696 H HB2  . LEU A 1 34 ? 22.068  -2.505  -8.493  1.00 0.00 ? 34 LEU A HB2  8  
ATOM 4697 H HB3  . LEU A 1 34 ? 20.589  -2.152  -7.648  1.00 0.00 ? 34 LEU A HB3  8  
ATOM 4698 H HG   . LEU A 1 34 ? 19.755  -1.469  -10.119 1.00 0.00 ? 34 LEU A HG   8  
ATOM 4699 H HD11 . LEU A 1 34 ? 22.035  -3.443  -10.565 1.00 0.00 ? 34 LEU A HD11 8  
ATOM 4700 H HD12 . LEU A 1 34 ? 20.735  -3.228  -11.722 1.00 0.00 ? 34 LEU A HD12 8  
ATOM 4701 H HD13 . LEU A 1 34 ? 21.809  -1.894  -11.357 1.00 0.00 ? 34 LEU A HD13 8  
ATOM 4702 H HD21 . LEU A 1 34 ? 18.866  -3.274  -8.539  1.00 0.00 ? 34 LEU A HD21 8  
ATOM 4703 H HD22 . LEU A 1 34 ? 18.689  -3.620  -10.250 1.00 0.00 ? 34 LEU A HD22 8  
ATOM 4704 H HD23 . LEU A 1 34 ? 19.969  -4.390  -9.325  1.00 0.00 ? 34 LEU A HD23 8  
ATOM 4705 N N    . MET A 1 35 ? 20.831  0.609   -10.539 1.00 0.00 ? 35 MET A N    8  
ATOM 4706 C CA   . MET A 1 35 ? 21.010  1.224   -11.893 1.00 0.00 ? 35 MET A CA   8  
ATOM 4707 C C    . MET A 1 35 ? 21.908  2.467   -11.775 1.00 0.00 ? 35 MET A C    8  
ATOM 4708 O O    . MET A 1 35 ? 22.845  2.645   -12.528 1.00 0.00 ? 35 MET A O    8  
ATOM 4709 C CB   . MET A 1 35 ? 19.614  1.616   -12.453 1.00 0.00 ? 35 MET A CB   8  
ATOM 4710 C CG   . MET A 1 35 ? 19.426  1.104   -13.900 1.00 0.00 ? 35 MET A CG   8  
ATOM 4711 S SD   . MET A 1 35 ? 18.159  -0.159  -14.179 1.00 0.00 ? 35 MET A SD   8  
ATOM 4712 C CE   . MET A 1 35 ? 18.799  -1.438  -13.067 1.00 0.00 ? 35 MET A CE   8  
ATOM 4713 H H    . MET A 1 35 ? 19.923  0.494   -10.188 1.00 0.00 ? 35 MET A H    8  
ATOM 4714 H HA   . MET A 1 35 ? 21.504  0.504   -12.525 1.00 0.00 ? 35 MET A HA   8  
ATOM 4715 H HB2  . MET A 1 35 ? 18.840  1.192   -11.831 1.00 0.00 ? 35 MET A HB2  8  
ATOM 4716 H HB3  . MET A 1 35 ? 19.495  2.690   -12.441 1.00 0.00 ? 35 MET A HB3  8  
ATOM 4717 H HG2  . MET A 1 35 ? 19.160  1.952   -14.512 1.00 0.00 ? 35 MET A HG2  8  
ATOM 4718 H HG3  . MET A 1 35 ? 20.359  0.717   -14.285 1.00 0.00 ? 35 MET A HG3  8  
ATOM 4719 H HE1  . MET A 1 35 ? 19.877  -1.387  -13.033 1.00 0.00 ? 35 MET A HE1  8  
ATOM 4720 H HE2  . MET A 1 35 ? 18.398  -1.284  -12.076 1.00 0.00 ? 35 MET A HE2  8  
ATOM 4721 H HE3  . MET A 1 35 ? 18.496  -2.410  -13.428 1.00 0.00 ? 35 MET A HE3  8  
ATOM 4722 N N    . VAL A 1 36 ? 21.562  3.279   -10.811 1.00 0.00 ? 36 VAL A N    8  
ATOM 4723 C CA   . VAL A 1 36 ? 22.291  4.544   -10.512 1.00 0.00 ? 36 VAL A CA   8  
ATOM 4724 C C    . VAL A 1 36 ? 23.758  4.227   -10.186 1.00 0.00 ? 36 VAL A C    8  
ATOM 4725 O O    . VAL A 1 36 ? 24.651  4.764   -10.813 1.00 0.00 ? 36 VAL A O    8  
ATOM 4726 C CB   . VAL A 1 36 ? 21.563  5.231   -9.314  1.00 0.00 ? 36 VAL A CB   8  
ATOM 4727 C CG1  . VAL A 1 36 ? 22.409  6.397   -8.748  1.00 0.00 ? 36 VAL A CG1  8  
ATOM 4728 C CG2  . VAL A 1 36 ? 20.210  5.795   -9.810  1.00 0.00 ? 36 VAL A CG2  8  
ATOM 4729 H H    . VAL A 1 36 ? 20.787  3.049   -10.267 1.00 0.00 ? 36 VAL A H    8  
ATOM 4730 H HA   . VAL A 1 36 ? 22.256  5.178   -11.387 1.00 0.00 ? 36 VAL A HA   8  
ATOM 4731 H HB   . VAL A 1 36 ? 21.371  4.509   -8.528  1.00 0.00 ? 36 VAL A HB   8  
ATOM 4732 H HG11 . VAL A 1 36 ? 22.747  7.042   -9.546  1.00 0.00 ? 36 VAL A HG11 8  
ATOM 4733 H HG12 . VAL A 1 36 ? 21.821  6.981   -8.055  1.00 0.00 ? 36 VAL A HG12 8  
ATOM 4734 H HG13 . VAL A 1 36 ? 23.271  6.012   -8.223  1.00 0.00 ? 36 VAL A HG13 8  
ATOM 4735 H HG21 . VAL A 1 36 ? 19.719  5.089   -10.463 1.00 0.00 ? 36 VAL A HG21 8  
ATOM 4736 H HG22 . VAL A 1 36 ? 19.562  5.992   -8.970  1.00 0.00 ? 36 VAL A HG22 8  
ATOM 4737 H HG23 . VAL A 1 36 ? 20.361  6.716   -10.355 1.00 0.00 ? 36 VAL A HG23 8  
ATOM 4738 N N    . GLY A 1 37 ? 23.961  3.366   -9.219  1.00 0.00 ? 37 GLY A N    8  
ATOM 4739 C CA   . GLY A 1 37 ? 25.354  2.996   -8.835  1.00 0.00 ? 37 GLY A CA   8  
ATOM 4740 C C    . GLY A 1 37 ? 25.402  2.262   -7.496  1.00 0.00 ? 37 GLY A C    8  
ATOM 4741 O O    . GLY A 1 37 ? 26.180  2.618   -6.631  1.00 0.00 ? 37 GLY A O    8  
ATOM 4742 H H    . GLY A 1 37 ? 23.201  2.966   -8.747  1.00 0.00 ? 37 GLY A H    8  
ATOM 4743 H HA2  . GLY A 1 37 ? 25.767  2.354   -9.598  1.00 0.00 ? 37 GLY A HA2  8  
ATOM 4744 H HA3  . GLY A 1 37 ? 25.953  3.894   -8.762  1.00 0.00 ? 37 GLY A HA3  8  
ATOM 4745 N N    . GLY A 1 38 ? 24.570  1.257   -7.364  1.00 0.00 ? 38 GLY A N    8  
ATOM 4746 C CA   . GLY A 1 38 ? 24.527  0.457   -6.095  1.00 0.00 ? 38 GLY A CA   8  
ATOM 4747 C C    . GLY A 1 38 ? 25.910  -0.150  -5.829  1.00 0.00 ? 38 GLY A C    8  
ATOM 4748 O O    . GLY A 1 38 ? 26.343  -0.262  -4.698  1.00 0.00 ? 38 GLY A O    8  
ATOM 4749 H H    . GLY A 1 38 ? 23.975  1.027   -8.105  1.00 0.00 ? 38 GLY A H    8  
ATOM 4750 H HA2  . GLY A 1 38 ? 24.248  1.100   -5.274  1.00 0.00 ? 38 GLY A HA2  8  
ATOM 4751 H HA3  . GLY A 1 38 ? 23.805  -0.339  -6.194  1.00 0.00 ? 38 GLY A HA3  8  
ATOM 4752 N N    . VAL A 1 39 ? 26.546  -0.519  -6.911  1.00 0.00 ? 39 VAL A N    8  
ATOM 4753 C CA   . VAL A 1 39 ? 27.906  -1.125  -6.878  1.00 0.00 ? 39 VAL A CA   8  
ATOM 4754 C C    . VAL A 1 39 ? 28.769  -0.246  -7.802  1.00 0.00 ? 39 VAL A C    8  
ATOM 4755 O O    . VAL A 1 39 ? 29.485  -0.732  -8.655  1.00 0.00 ? 39 VAL A O    8  
ATOM 4756 C CB   . VAL A 1 39 ? 27.822  -2.599  -7.395  1.00 0.00 ? 39 VAL A CB   8  
ATOM 4757 C CG1  . VAL A 1 39 ? 29.123  -3.356  -7.030  1.00 0.00 ? 39 VAL A CG1  8  
ATOM 4758 C CG2  . VAL A 1 39 ? 26.630  -3.329  -6.733  1.00 0.00 ? 39 VAL A CG2  8  
ATOM 4759 H H    . VAL A 1 39 ? 26.117  -0.393  -7.778  1.00 0.00 ? 39 VAL A H    8  
ATOM 4760 H HA   . VAL A 1 39 ? 28.297  -1.073  -5.877  1.00 0.00 ? 39 VAL A HA   8  
ATOM 4761 H HB   . VAL A 1 39 ? 27.691  -2.607  -8.467  1.00 0.00 ? 39 VAL A HB   8  
ATOM 4762 H HG11 . VAL A 1 39 ? 29.982  -2.870  -7.469  1.00 0.00 ? 39 VAL A HG11 8  
ATOM 4763 H HG12 . VAL A 1 39 ? 29.256  -3.384  -5.958  1.00 0.00 ? 39 VAL A HG12 8  
ATOM 4764 H HG13 . VAL A 1 39 ? 29.078  -4.369  -7.402  1.00 0.00 ? 39 VAL A HG13 8  
ATOM 4765 H HG21 . VAL A 1 39 ? 26.648  -3.186  -5.662  1.00 0.00 ? 39 VAL A HG21 8  
ATOM 4766 H HG22 . VAL A 1 39 ? 25.697  -2.942  -7.119  1.00 0.00 ? 39 VAL A HG22 8  
ATOM 4767 H HG23 . VAL A 1 39 ? 26.674  -4.389  -6.941  1.00 0.00 ? 39 VAL A HG23 8  
ATOM 4768 N N    . VAL A 1 40 ? 28.637  1.039   -7.566  1.00 0.00 ? 40 VAL A N    8  
ATOM 4769 C CA   . VAL A 1 40 ? 29.354  2.123   -8.311  1.00 0.00 ? 40 VAL A CA   8  
ATOM 4770 C C    . VAL A 1 40 ? 28.903  2.192   -9.790  1.00 0.00 ? 40 VAL A C    8  
ATOM 4771 O O    . VAL A 1 40 ? 29.176  1.251   -10.520 1.00 0.00 ? 40 VAL A O    8  
ATOM 4772 C CB   . VAL A 1 40 ? 30.895  1.867   -8.207  1.00 0.00 ? 40 VAL A CB   8  
ATOM 4773 C CG1  . VAL A 1 40 ? 31.671  2.949   -8.996  1.00 0.00 ? 40 VAL A CG1  8  
ATOM 4774 C CG2  . VAL A 1 40 ? 31.332  1.927   -6.725  1.00 0.00 ? 40 VAL A CG2  8  
ATOM 4775 O OXT  . VAL A 1 40 ? 28.301  3.202   -10.113 1.00 0.00 ? 40 VAL A OXT  8  
ATOM 4776 H H    . VAL A 1 40 ? 28.028  1.311   -6.852  1.00 0.00 ? 40 VAL A H    8  
ATOM 4777 H HA   . VAL A 1 40 ? 29.118  3.062   -7.830  1.00 0.00 ? 40 VAL A HA   8  
ATOM 4778 H HB   . VAL A 1 40 ? 31.126  0.892   -8.597  1.00 0.00 ? 40 VAL A HB   8  
ATOM 4779 H HG11 . VAL A 1 40 ? 31.362  3.935   -8.683  1.00 0.00 ? 40 VAL A HG11 8  
ATOM 4780 H HG12 . VAL A 1 40 ? 32.733  2.846   -8.825  1.00 0.00 ? 40 VAL A HG12 8  
ATOM 4781 H HG13 . VAL A 1 40 ? 31.484  2.845   -10.055 1.00 0.00 ? 40 VAL A HG13 8  
ATOM 4782 H HG21 . VAL A 1 40 ? 31.085  2.887   -6.296  1.00 0.00 ? 40 VAL A HG21 8  
ATOM 4783 H HG22 . VAL A 1 40 ? 30.838  1.153   -6.157  1.00 0.00 ? 40 VAL A HG22 8  
ATOM 4784 H HG23 . VAL A 1 40 ? 32.400  1.777   -6.648  1.00 0.00 ? 40 VAL A HG23 8  
ATOM 4785 N N    . ASP A 1 1  ? -1.575  22.745  -7.941  1.00 0.00 ? 1  ASP A N    9  
ATOM 4786 C CA   . ASP A 1 1  ? -1.358  21.297  -8.228  1.00 0.00 ? 1  ASP A CA   9  
ATOM 4787 C C    . ASP A 1 1  ? -2.078  20.933  -9.533  1.00 0.00 ? 1  ASP A C    9  
ATOM 4788 O O    . ASP A 1 1  ? -3.282  20.762  -9.554  1.00 0.00 ? 1  ASP A O    9  
ATOM 4789 C CB   . ASP A 1 1  ? -1.916  20.439  -7.068  1.00 0.00 ? 1  ASP A CB   9  
ATOM 4790 C CG   . ASP A 1 1  ? -1.120  20.750  -5.788  1.00 0.00 ? 1  ASP A CG   9  
ATOM 4791 O OD1  . ASP A 1 1  ? -1.501  21.704  -5.131  1.00 0.00 ? 1  ASP A OD1  9  
ATOM 4792 O OD2  . ASP A 1 1  ? -0.176  20.017  -5.543  1.00 0.00 ? 1  ASP A OD2  9  
ATOM 4793 H H1   . ASP A 1 1  ? -2.160  23.165  -8.690  1.00 0.00 ? 1  ASP A H1   9  
ATOM 4794 H H2   . ASP A 1 1  ? -2.055  22.852  -7.025  1.00 0.00 ? 1  ASP A H2   9  
ATOM 4795 H H3   . ASP A 1 1  ? -0.655  23.229  -7.908  1.00 0.00 ? 1  ASP A H3   9  
ATOM 4796 H HA   . ASP A 1 1  ? -0.298  21.120  -8.345  1.00 0.00 ? 1  ASP A HA   9  
ATOM 4797 H HB2  . ASP A 1 1  ? -2.960  20.666  -6.898  1.00 0.00 ? 1  ASP A HB2  9  
ATOM 4798 H HB3  . ASP A 1 1  ? -1.824  19.387  -7.299  1.00 0.00 ? 1  ASP A HB3  9  
ATOM 4799 N N    . ALA A 1 2  ? -1.307  20.828  -10.586 1.00 0.00 ? 2  ALA A N    9  
ATOM 4800 C CA   . ALA A 1 2  ? -1.874  20.479  -11.924 1.00 0.00 ? 2  ALA A CA   9  
ATOM 4801 C C    . ALA A 1 2  ? -0.775  19.879  -12.814 1.00 0.00 ? 2  ALA A C    9  
ATOM 4802 O O    . ALA A 1 2  ? -0.261  20.515  -13.714 1.00 0.00 ? 2  ALA A O    9  
ATOM 4803 C CB   . ALA A 1 2  ? -2.449  21.756  -12.556 1.00 0.00 ? 2  ALA A CB   9  
ATOM 4804 H H    . ALA A 1 2  ? -0.344  20.982  -10.498 1.00 0.00 ? 2  ALA A H    9  
ATOM 4805 H HA   . ALA A 1 2  ? -2.656  19.743  -11.799 1.00 0.00 ? 2  ALA A HA   9  
ATOM 4806 H HB1  . ALA A 1 2  ? -3.145  22.222  -11.876 1.00 0.00 ? 2  ALA A HB1  9  
ATOM 4807 H HB2  . ALA A 1 2  ? -1.656  22.454  -12.777 1.00 0.00 ? 2  ALA A HB2  9  
ATOM 4808 H HB3  . ALA A 1 2  ? -2.968  21.509  -13.467 1.00 0.00 ? 2  ALA A HB3  9  
ATOM 4809 N N    . GLU A 1 3  ? -0.451  18.648  -12.518 1.00 0.00 ? 3  GLU A N    9  
ATOM 4810 C CA   . GLU A 1 3  ? 0.603   17.918  -13.293 1.00 0.00 ? 3  GLU A CA   9  
ATOM 4811 C C    . GLU A 1 3  ? 0.045   17.418  -14.634 1.00 0.00 ? 3  GLU A C    9  
ATOM 4812 O O    . GLU A 1 3  ? 0.798   17.112  -15.536 1.00 0.00 ? 3  GLU A O    9  
ATOM 4813 C CB   . GLU A 1 3  ? 1.106   16.718  -12.463 1.00 0.00 ? 3  GLU A CB   9  
ATOM 4814 C CG   . GLU A 1 3  ? 2.612   16.453  -12.790 1.00 0.00 ? 3  GLU A CG   9  
ATOM 4815 C CD   . GLU A 1 3  ? 3.017   14.963  -12.690 1.00 0.00 ? 3  GLU A CD   9  
ATOM 4816 O OE1  . GLU A 1 3  ? 2.213   14.148  -12.263 1.00 0.00 ? 3  GLU A OE1  9  
ATOM 4817 O OE2  . GLU A 1 3  ? 4.154   14.716  -13.060 1.00 0.00 ? 3  GLU A OE2  9  
ATOM 4818 H H    . GLU A 1 3  ? -0.912  18.205  -11.777 1.00 0.00 ? 3  GLU A H    9  
ATOM 4819 H HA   . GLU A 1 3  ? 1.415   18.604  -13.491 1.00 0.00 ? 3  GLU A HA   9  
ATOM 4820 H HB2  . GLU A 1 3  ? 1.005   16.935  -11.410 1.00 0.00 ? 3  GLU A HB2  9  
ATOM 4821 H HB3  . GLU A 1 3  ? 0.500   15.852  -12.690 1.00 0.00 ? 3  GLU A HB3  9  
ATOM 4822 H HG2  . GLU A 1 3  ? 2.839   16.797  -13.789 1.00 0.00 ? 3  GLU A HG2  9  
ATOM 4823 H HG3  . GLU A 1 3  ? 3.222   17.014  -12.097 1.00 0.00 ? 3  GLU A HG3  9  
ATOM 4824 N N    . PHE A 1 4  ? -1.262  17.356  -14.709 1.00 0.00 ? 4  PHE A N    9  
ATOM 4825 C CA   . PHE A 1 4  ? -1.997  16.894  -15.934 1.00 0.00 ? 4  PHE A CA   9  
ATOM 4826 C C    . PHE A 1 4  ? -1.811  15.393  -16.205 1.00 0.00 ? 4  PHE A C    9  
ATOM 4827 O O    . PHE A 1 4  ? -1.834  14.947  -17.337 1.00 0.00 ? 4  PHE A O    9  
ATOM 4828 C CB   . PHE A 1 4  ? -1.518  17.724  -17.171 1.00 0.00 ? 4  PHE A CB   9  
ATOM 4829 C CG   . PHE A 1 4  ? -1.524  19.224  -16.825 1.00 0.00 ? 4  PHE A CG   9  
ATOM 4830 C CD1  . PHE A 1 4  ? -2.696  19.844  -16.429 1.00 0.00 ? 4  PHE A CD1  9  
ATOM 4831 C CD2  . PHE A 1 4  ? -0.364  19.973  -16.905 1.00 0.00 ? 4  PHE A CD2  9  
ATOM 4832 C CE1  . PHE A 1 4  ? -2.709  21.187  -16.117 1.00 0.00 ? 4  PHE A CE1  9  
ATOM 4833 C CE2  . PHE A 1 4  ? -0.377  21.317  -16.592 1.00 0.00 ? 4  PHE A CE2  9  
ATOM 4834 C CZ   . PHE A 1 4  ? -1.549  21.924  -16.198 1.00 0.00 ? 4  PHE A CZ   9  
ATOM 4835 H H    . PHE A 1 4  ? -1.787  17.626  -13.926 1.00 0.00 ? 4  PHE A H    9  
ATOM 4836 H HA   . PHE A 1 4  ? -3.046  17.069  -15.772 1.00 0.00 ? 4  PHE A HA   9  
ATOM 4837 H HB2  . PHE A 1 4  ? -0.525  17.430  -17.482 1.00 0.00 ? 4  PHE A HB2  9  
ATOM 4838 H HB3  . PHE A 1 4  ? -2.194  17.563  -17.998 1.00 0.00 ? 4  PHE A HB3  9  
ATOM 4839 H HD1  . PHE A 1 4  ? -3.611  19.275  -16.363 1.00 0.00 ? 4  PHE A HD1  9  
ATOM 4840 H HD2  . PHE A 1 4  ? 0.561   19.508  -17.213 1.00 0.00 ? 4  PHE A HD2  9  
ATOM 4841 H HE1  . PHE A 1 4  ? -3.630  21.659  -15.808 1.00 0.00 ? 4  PHE A HE1  9  
ATOM 4842 H HE2  . PHE A 1 4  ? 0.533   21.893  -16.657 1.00 0.00 ? 4  PHE A HE2  9  
ATOM 4843 H HZ   . PHE A 1 4  ? -1.557  22.976  -15.952 1.00 0.00 ? 4  PHE A HZ   9  
ATOM 4844 N N    . ARG A 1 5  ? -1.636  14.660  -15.134 1.00 0.00 ? 5  ARG A N    9  
ATOM 4845 C CA   . ARG A 1 5  ? -1.445  13.178  -15.225 1.00 0.00 ? 5  ARG A CA   9  
ATOM 4846 C C    . ARG A 1 5  ? -2.809  12.541  -14.928 1.00 0.00 ? 5  ARG A C    9  
ATOM 4847 O O    . ARG A 1 5  ? -2.997  11.832  -13.957 1.00 0.00 ? 5  ARG A O    9  
ATOM 4848 C CB   . ARG A 1 5  ? -0.361  12.755  -14.183 1.00 0.00 ? 5  ARG A CB   9  
ATOM 4849 C CG   . ARG A 1 5  ? 1.000   12.545  -14.893 1.00 0.00 ? 5  ARG A CG   9  
ATOM 4850 C CD   . ARG A 1 5  ? 1.452   13.849  -15.580 1.00 0.00 ? 5  ARG A CD   9  
ATOM 4851 N NE   . ARG A 1 5  ? 2.945   13.912  -15.543 1.00 0.00 ? 5  ARG A NE   9  
ATOM 4852 C CZ   . ARG A 1 5  ? 3.601   14.900  -16.099 1.00 0.00 ? 5  ARG A CZ   9  
ATOM 4853 N NH1  . ARG A 1 5  ? 2.962   15.861  -16.712 1.00 0.00 ? 5  ARG A NH1  9  
ATOM 4854 N NH2  . ARG A 1 5  ? 4.903   14.894  -16.018 1.00 0.00 ? 5  ARG A NH2  9  
ATOM 4855 H H    . ARG A 1 5  ? -1.632  15.097  -14.258 1.00 0.00 ? 5  ARG A H    9  
ATOM 4856 H HA   . ARG A 1 5  ? -1.148  12.905  -16.228 1.00 0.00 ? 5  ARG A HA   9  
ATOM 4857 H HB2  . ARG A 1 5  ? -0.259  13.512  -13.419 1.00 0.00 ? 5  ARG A HB2  9  
ATOM 4858 H HB3  . ARG A 1 5  ? -0.632  11.826  -13.702 1.00 0.00 ? 5  ARG A HB3  9  
ATOM 4859 H HG2  . ARG A 1 5  ? 1.738   12.239  -14.165 1.00 0.00 ? 5  ARG A HG2  9  
ATOM 4860 H HG3  . ARG A 1 5  ? 0.909   11.761  -15.631 1.00 0.00 ? 5  ARG A HG3  9  
ATOM 4861 H HD2  . ARG A 1 5  ? 1.120   13.867  -16.608 1.00 0.00 ? 5  ARG A HD2  9  
ATOM 4862 H HD3  . ARG A 1 5  ? 1.059   14.710  -15.062 1.00 0.00 ? 5  ARG A HD3  9  
ATOM 4863 H HE   . ARG A 1 5  ? 3.444   13.201  -15.090 1.00 0.00 ? 5  ARG A HE   9  
ATOM 4864 H HH11 . ARG A 1 5  ? 1.963   15.845  -16.763 1.00 0.00 ? 5  ARG A HH11 9  
ATOM 4865 H HH12 . ARG A 1 5  ? 3.470   16.614  -17.130 1.00 0.00 ? 5  ARG A HH12 9  
ATOM 4866 H HH21 . ARG A 1 5  ? 5.371   14.150  -15.544 1.00 0.00 ? 5  ARG A HH21 9  
ATOM 4867 H HH22 . ARG A 1 5  ? 5.432   15.635  -16.432 1.00 0.00 ? 5  ARG A HH22 9  
ATOM 4868 N N    . HIS A 1 6  ? -3.731  12.837  -15.810 1.00 0.00 ? 6  HIS A N    9  
ATOM 4869 C CA   . HIS A 1 6  ? -5.126  12.324  -15.709 1.00 0.00 ? 6  HIS A CA   9  
ATOM 4870 C C    . HIS A 1 6  ? -5.235  10.882  -16.244 1.00 0.00 ? 6  HIS A C    9  
ATOM 4871 O O    . HIS A 1 6  ? -6.238  10.483  -16.805 1.00 0.00 ? 6  HIS A O    9  
ATOM 4872 C CB   . HIS A 1 6  ? -6.022  13.291  -16.507 1.00 0.00 ? 6  HIS A CB   9  
ATOM 4873 C CG   . HIS A 1 6  ? -5.784  14.738  -16.041 1.00 0.00 ? 6  HIS A CG   9  
ATOM 4874 N ND1  . HIS A 1 6  ? -5.353  15.086  -14.874 1.00 0.00 ? 6  HIS A ND1  9  
ATOM 4875 C CD2  . HIS A 1 6  ? -5.959  15.938  -16.708 1.00 0.00 ? 6  HIS A CD2  9  
ATOM 4876 C CE1  . HIS A 1 6  ? -5.264  16.376  -14.805 1.00 0.00 ? 6  HIS A CE1  9  
ATOM 4877 N NE2  . HIS A 1 6  ? -5.631  16.946  -15.925 1.00 0.00 ? 6  HIS A NE2  9  
ATOM 4878 H H    . HIS A 1 6  ? -3.515  13.417  -16.564 1.00 0.00 ? 6  HIS A H    9  
ATOM 4879 H HA   . HIS A 1 6  ? -5.416  12.326  -14.672 1.00 0.00 ? 6  HIS A HA   9  
ATOM 4880 H HB2  . HIS A 1 6  ? -5.809  13.224  -17.563 1.00 0.00 ? 6  HIS A HB2  9  
ATOM 4881 H HB3  . HIS A 1 6  ? -7.055  13.044  -16.341 1.00 0.00 ? 6  HIS A HB3  9  
ATOM 4882 H HD1  . HIS A 1 6  ? -5.128  14.464  -14.151 1.00 0.00 ? 6  HIS A HD1  9  
ATOM 4883 H HD2  . HIS A 1 6  ? -6.314  16.036  -17.723 1.00 0.00 ? 6  HIS A HD2  9  
ATOM 4884 H HE1  . HIS A 1 6  ? -4.927  16.916  -13.933 1.00 0.00 ? 6  HIS A HE1  9  
ATOM 4885 N N    . ASP A 1 7  ? -4.172  10.148  -16.038 1.00 0.00 ? 7  ASP A N    9  
ATOM 4886 C CA   . ASP A 1 7  ? -4.080  8.728   -16.479 1.00 0.00 ? 7  ASP A CA   9  
ATOM 4887 C C    . ASP A 1 7  ? -4.911  7.852   -15.531 1.00 0.00 ? 7  ASP A C    9  
ATOM 4888 O O    . ASP A 1 7  ? -4.834  8.006   -14.327 1.00 0.00 ? 7  ASP A O    9  
ATOM 4889 C CB   . ASP A 1 7  ? -2.593  8.290   -16.455 1.00 0.00 ? 7  ASP A CB   9  
ATOM 4890 C CG   . ASP A 1 7  ? -1.818  9.024   -15.340 1.00 0.00 ? 7  ASP A CG   9  
ATOM 4891 O OD1  . ASP A 1 7  ? -1.985  8.621   -14.201 1.00 0.00 ? 7  ASP A OD1  9  
ATOM 4892 O OD2  . ASP A 1 7  ? -1.107  9.952   -15.692 1.00 0.00 ? 7  ASP A OD2  9  
ATOM 4893 H H    . ASP A 1 7  ? -3.403  10.536  -15.582 1.00 0.00 ? 7  ASP A H    9  
ATOM 4894 H HA   . ASP A 1 7  ? -4.472  8.652   -17.481 1.00 0.00 ? 7  ASP A HA   9  
ATOM 4895 H HB2  . ASP A 1 7  ? -2.522  7.229   -16.279 1.00 0.00 ? 7  ASP A HB2  9  
ATOM 4896 H HB3  . ASP A 1 7  ? -2.134  8.507   -17.410 1.00 0.00 ? 7  ASP A HB3  9  
ATOM 4897 N N    . SER A 1 8  ? -5.680  6.962   -16.106 1.00 0.00 ? 8  SER A N    9  
ATOM 4898 C CA   . SER A 1 8  ? -6.538  6.049   -15.291 1.00 0.00 ? 8  SER A CA   9  
ATOM 4899 C C    . SER A 1 8  ? -5.683  5.067   -14.478 1.00 0.00 ? 8  SER A C    9  
ATOM 4900 O O    . SER A 1 8  ? -4.653  4.614   -14.942 1.00 0.00 ? 8  SER A O    9  
ATOM 4901 C CB   . SER A 1 8  ? -7.468  5.268   -16.231 1.00 0.00 ? 8  SER A CB   9  
ATOM 4902 O OG   . SER A 1 8  ? -8.238  6.276   -16.869 1.00 0.00 ? 8  SER A OG   9  
ATOM 4903 H H    . SER A 1 8  ? -5.696  6.892   -17.083 1.00 0.00 ? 8  SER A H    9  
ATOM 4904 H HA   . SER A 1 8  ? -7.126  6.649   -14.612 1.00 0.00 ? 8  SER A HA   9  
ATOM 4905 H HB2  . SER A 1 8  ? -6.911  4.715   -16.974 1.00 0.00 ? 8  SER A HB2  9  
ATOM 4906 H HB3  . SER A 1 8  ? -8.125  4.608   -15.684 1.00 0.00 ? 8  SER A HB3  9  
ATOM 4907 H HG   . SER A 1 8  ? -8.087  6.213   -17.815 1.00 0.00 ? 8  SER A HG   9  
ATOM 4908 N N    . GLY A 1 9  ? -6.142  4.772   -13.287 1.00 0.00 ? 9  GLY A N    9  
ATOM 4909 C CA   . GLY A 1 9  ? -5.408  3.830   -12.390 1.00 0.00 ? 9  GLY A CA   9  
ATOM 4910 C C    . GLY A 1 9  ? -5.671  2.390   -12.839 1.00 0.00 ? 9  GLY A C    9  
ATOM 4911 O O    . GLY A 1 9  ? -4.801  1.748   -13.396 1.00 0.00 ? 9  GLY A O    9  
ATOM 4912 H H    . GLY A 1 9  ? -6.979  5.173   -12.977 1.00 0.00 ? 9  GLY A H    9  
ATOM 4913 H HA2  . GLY A 1 9  ? -4.348  4.037   -12.430 1.00 0.00 ? 9  GLY A HA2  9  
ATOM 4914 H HA3  . GLY A 1 9  ? -5.761  3.958   -11.377 1.00 0.00 ? 9  GLY A HA3  9  
ATOM 4915 N N    . TYR A 1 10 ? -6.871  1.934   -12.577 1.00 0.00 ? 10 TYR A N    9  
ATOM 4916 C CA   . TYR A 1 10 ? -7.267  0.544   -12.961 1.00 0.00 ? 10 TYR A CA   9  
ATOM 4917 C C    . TYR A 1 10 ? -8.802  0.462   -13.062 1.00 0.00 ? 10 TYR A C    9  
ATOM 4918 O O    . TYR A 1 10 ? -9.321  0.287   -14.148 1.00 0.00 ? 10 TYR A O    9  
ATOM 4919 C CB   . TYR A 1 10 ? -6.663  -0.431  -11.875 1.00 0.00 ? 10 TYR A CB   9  
ATOM 4920 C CG   . TYR A 1 10 ? -7.669  -1.451  -11.308 1.00 0.00 ? 10 TYR A CG   9  
ATOM 4921 C CD1  . TYR A 1 10 ? -8.236  -2.427  -12.106 1.00 0.00 ? 10 TYR A CD1  9  
ATOM 4922 C CD2  . TYR A 1 10 ? -8.017  -1.397  -9.977  1.00 0.00 ? 10 TYR A CD2  9  
ATOM 4923 C CE1  . TYR A 1 10 ? -9.134  -3.330  -11.573 1.00 0.00 ? 10 TYR A CE1  9  
ATOM 4924 C CE2  . TYR A 1 10 ? -8.911  -2.299  -9.448  1.00 0.00 ? 10 TYR A CE2  9  
ATOM 4925 C CZ   . TYR A 1 10 ? -9.477  -3.270  -10.240 1.00 0.00 ? 10 TYR A CZ   9  
ATOM 4926 O OH   . TYR A 1 10 ? -10.372 -4.172  -9.704  1.00 0.00 ? 10 TYR A OH   9  
ATOM 4927 H H    . TYR A 1 10 ? -7.518  2.514   -12.124 1.00 0.00 ? 10 TYR A H    9  
ATOM 4928 H HA   . TYR A 1 10 ? -6.846  0.314   -13.929 1.00 0.00 ? 10 TYR A HA   9  
ATOM 4929 H HB2  . TYR A 1 10 ? -5.847  -0.982  -12.321 1.00 0.00 ? 10 TYR A HB2  9  
ATOM 4930 H HB3  . TYR A 1 10 ? -6.260  0.144   -11.054 1.00 0.00 ? 10 TYR A HB3  9  
ATOM 4931 H HD1  . TYR A 1 10 ? -7.978  -2.486  -13.154 1.00 0.00 ? 10 TYR A HD1  9  
ATOM 4932 H HD2  . TYR A 1 10 ? -7.585  -0.639  -9.343  1.00 0.00 ? 10 TYR A HD2  9  
ATOM 4933 H HE1  . TYR A 1 10 ? -9.577  -4.085  -12.202 1.00 0.00 ? 10 TYR A HE1  9  
ATOM 4934 H HE2  . TYR A 1 10 ? -9.167  -2.244  -8.402  1.00 0.00 ? 10 TYR A HE2  9  
ATOM 4935 H HH   . TYR A 1 10 ? -11.199 -3.711  -9.551  1.00 0.00 ? 10 TYR A HH   9  
ATOM 4936 N N    . GLU A 1 11 ? -9.485  0.589   -11.948 1.00 0.00 ? 11 GLU A N    9  
ATOM 4937 C CA   . GLU A 1 11 ? -10.982 0.520   -11.959 1.00 0.00 ? 11 GLU A CA   9  
ATOM 4938 C C    . GLU A 1 11 ? -11.581 0.967   -10.620 1.00 0.00 ? 11 GLU A C    9  
ATOM 4939 O O    . GLU A 1 11 ? -12.489 1.777   -10.605 1.00 0.00 ? 11 GLU A O    9  
ATOM 4940 C CB   . GLU A 1 11 ? -11.434 -0.939  -12.260 1.00 0.00 ? 11 GLU A CB   9  
ATOM 4941 C CG   . GLU A 1 11 ? -12.623 -0.932  -13.245 1.00 0.00 ? 11 GLU A CG   9  
ATOM 4942 C CD   . GLU A 1 11 ? -12.118 -0.593  -14.661 1.00 0.00 ? 11 GLU A CD   9  
ATOM 4943 O OE1  . GLU A 1 11 ? -11.538 -1.485  -15.259 1.00 0.00 ? 11 GLU A OE1  9  
ATOM 4944 O OE2  . GLU A 1 11 ? -12.336 0.539   -15.064 1.00 0.00 ? 11 GLU A OE2  9  
ATOM 4945 H H    . GLU A 1 11 ? -9.013  0.731   -11.101 1.00 0.00 ? 11 GLU A H    9  
ATOM 4946 H HA   . GLU A 1 11 ? -11.339 1.196   -12.722 1.00 0.00 ? 11 GLU A HA   9  
ATOM 4947 H HB2  . GLU A 1 11 ? -10.623 -1.494  -12.702 1.00 0.00 ? 11 GLU A HB2  9  
ATOM 4948 H HB3  . GLU A 1 11 ? -11.728 -1.442  -11.351 1.00 0.00 ? 11 GLU A HB3  9  
ATOM 4949 H HG2  . GLU A 1 11 ? -13.087 -1.907  -13.263 1.00 0.00 ? 11 GLU A HG2  9  
ATOM 4950 H HG3  . GLU A 1 11 ? -13.364 -0.206  -12.940 1.00 0.00 ? 11 GLU A HG3  9  
ATOM 4951 N N    . VAL A 1 12 ? -11.067 0.435   -9.538  1.00 0.00 ? 12 VAL A N    9  
ATOM 4952 C CA   . VAL A 1 12 ? -11.591 0.812   -8.190  1.00 0.00 ? 12 VAL A CA   9  
ATOM 4953 C C    . VAL A 1 12 ? -11.111 2.214   -7.806  1.00 0.00 ? 12 VAL A C    9  
ATOM 4954 O O    . VAL A 1 12 ? -10.610 2.958   -8.627  1.00 0.00 ? 12 VAL A O    9  
ATOM 4955 C CB   . VAL A 1 12 ? -11.109 -0.235  -7.128  1.00 0.00 ? 12 VAL A CB   9  
ATOM 4956 C CG1  . VAL A 1 12 ? -11.549 -1.657  -7.552  1.00 0.00 ? 12 VAL A CG1  9  
ATOM 4957 C CG2  . VAL A 1 12 ? -9.574  -0.155  -6.916  1.00 0.00 ? 12 VAL A CG2  9  
ATOM 4958 H H    . VAL A 1 12 ? -10.336 -0.210  -9.595  1.00 0.00 ? 12 VAL A H    9  
ATOM 4959 H HA   . VAL A 1 12 ? -12.666 0.809   -8.212  1.00 0.00 ? 12 VAL A HA   9  
ATOM 4960 H HB   . VAL A 1 12 ? -11.591 -0.020  -6.185  1.00 0.00 ? 12 VAL A HB   9  
ATOM 4961 H HG11 . VAL A 1 12 ? -11.370 -1.825  -8.603  1.00 0.00 ? 12 VAL A HG11 9  
ATOM 4962 H HG12 . VAL A 1 12 ? -11.017 -2.405  -6.982  1.00 0.00 ? 12 VAL A HG12 9  
ATOM 4963 H HG13 . VAL A 1 12 ? -12.607 -1.776  -7.366  1.00 0.00 ? 12 VAL A HG13 9  
ATOM 4964 H HG21 . VAL A 1 12 ? -9.069  -0.009  -7.857  1.00 0.00 ? 12 VAL A HG21 9  
ATOM 4965 H HG22 . VAL A 1 12 ? -9.336  0.678   -6.270  1.00 0.00 ? 12 VAL A HG22 9  
ATOM 4966 H HG23 . VAL A 1 12 ? -9.208  -1.058  -6.455  1.00 0.00 ? 12 VAL A HG23 9  
ATOM 4967 N N    . HIS A 1 13 ? -11.292 2.509   -6.548  1.00 0.00 ? 13 HIS A N    9  
ATOM 4968 C CA   . HIS A 1 13 ? -10.891 3.824   -5.976  1.00 0.00 ? 13 HIS A CA   9  
ATOM 4969 C C    . HIS A 1 13 ? -9.375  3.999   -6.134  1.00 0.00 ? 13 HIS A C    9  
ATOM 4970 O O    . HIS A 1 13 ? -8.922  4.526   -7.132  1.00 0.00 ? 13 HIS A O    9  
ATOM 4971 C CB   . HIS A 1 13 ? -11.318 3.827   -4.501  1.00 0.00 ? 13 HIS A CB   9  
ATOM 4972 C CG   . HIS A 1 13 ? -12.803 4.180   -4.413  1.00 0.00 ? 13 HIS A CG   9  
ATOM 4973 N ND1  . HIS A 1 13 ? -13.774 3.343   -4.571  1.00 0.00 ? 13 HIS A ND1  9  
ATOM 4974 C CD2  . HIS A 1 13 ? -13.429 5.389   -4.164  1.00 0.00 ? 13 HIS A CD2  9  
ATOM 4975 C CE1  . HIS A 1 13 ? -14.905 3.958   -4.434  1.00 0.00 ? 13 HIS A CE1  9  
ATOM 4976 N NE2  . HIS A 1 13 ? -14.738 5.233   -4.181  1.00 0.00 ? 13 HIS A NE2  9  
ATOM 4977 H H    . HIS A 1 13 ? -11.704 1.831   -5.975  1.00 0.00 ? 13 HIS A H    9  
ATOM 4978 H HA   . HIS A 1 13 ? -11.388 4.614   -6.515  1.00 0.00 ? 13 HIS A HA   9  
ATOM 4979 H HB2  . HIS A 1 13 ? -11.174 2.844   -4.076  1.00 0.00 ? 13 HIS A HB2  9  
ATOM 4980 H HB3  . HIS A 1 13 ? -10.751 4.550   -3.939  1.00 0.00 ? 13 HIS A HB3  9  
ATOM 4981 H HD1  . HIS A 1 13 ? -13.668 2.388   -4.763  1.00 0.00 ? 13 HIS A HD1  9  
ATOM 4982 H HD2  . HIS A 1 13 ? -12.917 6.323   -3.983  1.00 0.00 ? 13 HIS A HD2  9  
ATOM 4983 H HE1  . HIS A 1 13 ? -15.870 3.479   -4.521  1.00 0.00 ? 13 HIS A HE1  9  
ATOM 4984 N N    . HIS A 1 14 ? -8.633  3.557   -5.152  1.00 0.00 ? 14 HIS A N    9  
ATOM 4985 C CA   . HIS A 1 14 ? -7.147  3.674   -5.208  1.00 0.00 ? 14 HIS A CA   9  
ATOM 4986 C C    . HIS A 1 14 ? -6.474  2.600   -4.358  1.00 0.00 ? 14 HIS A C    9  
ATOM 4987 O O    . HIS A 1 14 ? -5.268  2.563   -4.247  1.00 0.00 ? 14 HIS A O    9  
ATOM 4988 C CB   . HIS A 1 14 ? -6.706  5.083   -4.705  1.00 0.00 ? 14 HIS A CB   9  
ATOM 4989 C CG   . HIS A 1 14 ? -7.886  5.902   -4.156  1.00 0.00 ? 14 HIS A CG   9  
ATOM 4990 N ND1  . HIS A 1 14 ? -8.313  5.861   -2.938  1.00 0.00 ? 14 HIS A ND1  9  
ATOM 4991 C CD2  . HIS A 1 14 ? -8.719  6.815   -4.779  1.00 0.00 ? 14 HIS A CD2  9  
ATOM 4992 C CE1  . HIS A 1 14 ? -9.319  6.664   -2.801  1.00 0.00 ? 14 HIS A CE1  9  
ATOM 4993 N NE2  . HIS A 1 14 ? -9.606  7.279   -3.922  1.00 0.00 ? 14 HIS A NE2  9  
ATOM 4994 H H    . HIS A 1 14 ? -9.048  3.151   -4.368  1.00 0.00 ? 14 HIS A H    9  
ATOM 4995 H HA   . HIS A 1 14 ? -6.841  3.492   -6.220  1.00 0.00 ? 14 HIS A HA   9  
ATOM 4996 H HB2  . HIS A 1 14 ? -5.981  4.972   -3.918  1.00 0.00 ? 14 HIS A HB2  9  
ATOM 4997 H HB3  . HIS A 1 14 ? -6.256  5.637   -5.514  1.00 0.00 ? 14 HIS A HB3  9  
ATOM 4998 H HD1  . HIS A 1 14 ? -7.935  5.303   -2.227  1.00 0.00 ? 14 HIS A HD1  9  
ATOM 4999 H HD2  . HIS A 1 14 ? -8.653  7.102   -5.818  1.00 0.00 ? 14 HIS A HD2  9  
ATOM 5000 H HE1  . HIS A 1 14 ? -9.856  6.812   -1.875  1.00 0.00 ? 14 HIS A HE1  9  
ATOM 5001 N N    . GLN A 1 15 ? -7.262  1.739   -3.781  1.00 0.00 ? 15 GLN A N    9  
ATOM 5002 C CA   . GLN A 1 15 ? -6.693  0.647   -2.923  1.00 0.00 ? 15 GLN A CA   9  
ATOM 5003 C C    . GLN A 1 15 ? -5.703  -0.182  -3.757  1.00 0.00 ? 15 GLN A C    9  
ATOM 5004 O O    . GLN A 1 15 ? -4.623  -0.526  -3.315  1.00 0.00 ? 15 GLN A O    9  
ATOM 5005 C CB   . GLN A 1 15 ? -7.863  -0.221  -2.419  1.00 0.00 ? 15 GLN A CB   9  
ATOM 5006 C CG   . GLN A 1 15 ? -7.338  -1.291  -1.447  1.00 0.00 ? 15 GLN A CG   9  
ATOM 5007 C CD   . GLN A 1 15 ? -8.459  -1.716  -0.491  1.00 0.00 ? 15 GLN A CD   9  
ATOM 5008 O OE1  . GLN A 1 15 ? -9.262  -2.574  -0.797  1.00 0.00 ? 15 GLN A OE1  9  
ATOM 5009 N NE2  . GLN A 1 15 ? -8.549  -1.139  0.675   1.00 0.00 ? 15 GLN A NE2  9  
ATOM 5010 H H    . GLN A 1 15 ? -8.222  1.826   -3.931  1.00 0.00 ? 15 GLN A H    9  
ATOM 5011 H HA   . GLN A 1 15 ? -6.151  1.099   -2.104  1.00 0.00 ? 15 GLN A HA   9  
ATOM 5012 H HB2  . GLN A 1 15 ? -8.581  0.412   -1.920  1.00 0.00 ? 15 GLN A HB2  9  
ATOM 5013 H HB3  . GLN A 1 15 ? -8.353  -0.699  -3.255  1.00 0.00 ? 15 GLN A HB3  9  
ATOM 5014 H HG2  . GLN A 1 15 ? -7.010  -2.156  -2.005  1.00 0.00 ? 15 GLN A HG2  9  
ATOM 5015 H HG3  . GLN A 1 15 ? -6.510  -0.910  -0.865  1.00 0.00 ? 15 GLN A HG3  9  
ATOM 5016 H HE21 . GLN A 1 15 ? -7.905  -0.445  0.930   1.00 0.00 ? 15 GLN A HE21 9  
ATOM 5017 H HE22 . GLN A 1 15 ? -9.261  -1.399  1.297   1.00 0.00 ? 15 GLN A HE22 9  
ATOM 5018 N N    . LYS A 1 16 ? -6.121  -0.468  -4.961  1.00 0.00 ? 16 LYS A N    9  
ATOM 5019 C CA   . LYS A 1 16 ? -5.283  -1.261  -5.899  1.00 0.00 ? 16 LYS A CA   9  
ATOM 5020 C C    . LYS A 1 16 ? -3.930  -0.580  -6.112  1.00 0.00 ? 16 LYS A C    9  
ATOM 5021 O O    . LYS A 1 16 ? -2.891  -1.184  -5.927  1.00 0.00 ? 16 LYS A O    9  
ATOM 5022 C CB   . LYS A 1 16 ? -6.029  -1.380  -7.243  1.00 0.00 ? 16 LYS A CB   9  
ATOM 5023 C CG   . LYS A 1 16 ? -5.234  -2.269  -8.231  1.00 0.00 ? 16 LYS A CG   9  
ATOM 5024 C CD   . LYS A 1 16 ? -5.187  -3.717  -7.694  1.00 0.00 ? 16 LYS A CD   9  
ATOM 5025 C CE   . LYS A 1 16 ? -5.465  -4.720  -8.834  1.00 0.00 ? 16 LYS A CE   9  
ATOM 5026 N NZ   . LYS A 1 16 ? -6.849  -4.533  -9.356  1.00 0.00 ? 16 LYS A NZ   9  
ATOM 5027 H H    . LYS A 1 16 ? -7.001  -0.160  -5.251  1.00 0.00 ? 16 LYS A H    9  
ATOM 5028 H HA   . LYS A 1 16 ? -5.116  -2.231  -5.468  1.00 0.00 ? 16 LYS A HA   9  
ATOM 5029 H HB2  . LYS A 1 16 ? -7.010  -1.804  -7.077  1.00 0.00 ? 16 LYS A HB2  9  
ATOM 5030 H HB3  . LYS A 1 16 ? -6.152  -0.395  -7.670  1.00 0.00 ? 16 LYS A HB3  9  
ATOM 5031 H HG2  . LYS A 1 16 ? -5.703  -2.237  -9.202  1.00 0.00 ? 16 LYS A HG2  9  
ATOM 5032 H HG3  . LYS A 1 16 ? -4.226  -1.894  -8.341  1.00 0.00 ? 16 LYS A HG3  9  
ATOM 5033 H HD2  . LYS A 1 16 ? -4.208  -3.892  -7.271  1.00 0.00 ? 16 LYS A HD2  9  
ATOM 5034 H HD3  . LYS A 1 16 ? -5.920  -3.846  -6.910  1.00 0.00 ? 16 LYS A HD3  9  
ATOM 5035 H HE2  . LYS A 1 16 ? -4.767  -4.579  -9.646  1.00 0.00 ? 16 LYS A HE2  9  
ATOM 5036 H HE3  . LYS A 1 16 ? -5.374  -5.731  -8.464  1.00 0.00 ? 16 LYS A HE3  9  
ATOM 5037 H HZ1  . LYS A 1 16 ? -7.313  -3.767  -8.828  1.00 0.00 ? 16 LYS A HZ1  9  
ATOM 5038 H HZ2  . LYS A 1 16 ? -6.812  -4.283  -10.365 1.00 0.00 ? 16 LYS A HZ2  9  
ATOM 5039 H HZ3  . LYS A 1 16 ? -7.392  -5.412  -9.237  1.00 0.00 ? 16 LYS A HZ3  9  
ATOM 5040 N N    . LEU A 1 17 ? -3.988  0.675   -6.480  1.00 0.00 ? 17 LEU A N    9  
ATOM 5041 C CA   . LEU A 1 17 ? -2.730  1.427   -6.723  1.00 0.00 ? 17 LEU A CA   9  
ATOM 5042 C C    . LEU A 1 17 ? -1.907  1.521   -5.432  1.00 0.00 ? 17 LEU A C    9  
ATOM 5043 O O    . LEU A 1 17 ? -0.709  1.402   -5.490  1.00 0.00 ? 17 LEU A O    9  
ATOM 5044 C CB   . LEU A 1 17 ? -3.136  2.824   -7.310  1.00 0.00 ? 17 LEU A CB   9  
ATOM 5045 C CG   . LEU A 1 17 ? -3.113  3.977   -6.287  1.00 0.00 ? 17 LEU A CG   9  
ATOM 5046 C CD1  . LEU A 1 17 ? -1.645  4.413   -5.981  1.00 0.00 ? 17 LEU A CD1  9  
ATOM 5047 C CD2  . LEU A 1 17 ? -3.881  5.171   -6.884  1.00 0.00 ? 17 LEU A CD2  9  
ATOM 5048 H H    . LEU A 1 17 ? -4.850  1.123   -6.588  1.00 0.00 ? 17 LEU A H    9  
ATOM 5049 H HA   . LEU A 1 17 ? -2.160  0.888   -7.463  1.00 0.00 ? 17 LEU A HA   9  
ATOM 5050 H HB2  . LEU A 1 17 ? -2.474  3.064   -8.129  1.00 0.00 ? 17 LEU A HB2  9  
ATOM 5051 H HB3  . LEU A 1 17 ? -4.137  2.747   -7.713  1.00 0.00 ? 17 LEU A HB3  9  
ATOM 5052 H HG   . LEU A 1 17 ? -3.618  3.638   -5.399  1.00 0.00 ? 17 LEU A HG   9  
ATOM 5053 H HD11 . LEU A 1 17 ? -0.947  3.913   -6.639  1.00 0.00 ? 17 LEU A HD11 9  
ATOM 5054 H HD12 . LEU A 1 17 ? -1.518  5.478   -6.104  1.00 0.00 ? 17 LEU A HD12 9  
ATOM 5055 H HD13 . LEU A 1 17 ? -1.391  4.158   -4.962  1.00 0.00 ? 17 LEU A HD13 9  
ATOM 5056 H HD21 . LEU A 1 17 ? -4.884  4.870   -7.145  1.00 0.00 ? 17 LEU A HD21 9  
ATOM 5057 H HD22 . LEU A 1 17 ? -3.931  5.977   -6.168  1.00 0.00 ? 17 LEU A HD22 9  
ATOM 5058 H HD23 . LEU A 1 17 ? -3.382  5.525   -7.776  1.00 0.00 ? 17 LEU A HD23 9  
ATOM 5059 N N    . VAL A 1 18 ? -2.539  1.725   -4.308  1.00 0.00 ? 18 VAL A N    9  
ATOM 5060 C CA   . VAL A 1 18 ? -1.815  1.824   -3.004  1.00 0.00 ? 18 VAL A CA   9  
ATOM 5061 C C    . VAL A 1 18 ? -0.878  0.606   -2.843  1.00 0.00 ? 18 VAL A C    9  
ATOM 5062 O O    . VAL A 1 18 ? 0.314   0.752   -2.651  1.00 0.00 ? 18 VAL A O    9  
ATOM 5063 C CB   . VAL A 1 18 ? -2.918  1.900   -1.901  1.00 0.00 ? 18 VAL A CB   9  
ATOM 5064 C CG1  . VAL A 1 18 ? -2.419  1.418   -0.534  1.00 0.00 ? 18 VAL A CG1  9  
ATOM 5065 C CG2  . VAL A 1 18 ? -3.437  3.347   -1.780  1.00 0.00 ? 18 VAL A CG2  9  
ATOM 5066 H H    . VAL A 1 18 ? -3.508  1.826   -4.306  1.00 0.00 ? 18 VAL A H    9  
ATOM 5067 H HA   . VAL A 1 18 ? -1.211  2.722   -3.011  1.00 0.00 ? 18 VAL A HA   9  
ATOM 5068 H HB   . VAL A 1 18 ? -3.750  1.280   -2.186  1.00 0.00 ? 18 VAL A HB   9  
ATOM 5069 H HG11 . VAL A 1 18 ? -1.463  1.863   -0.303  1.00 0.00 ? 18 VAL A HG11 9  
ATOM 5070 H HG12 . VAL A 1 18 ? -3.134  1.688   0.229   1.00 0.00 ? 18 VAL A HG12 9  
ATOM 5071 H HG13 . VAL A 1 18 ? -2.321  0.342   -0.546  1.00 0.00 ? 18 VAL A HG13 9  
ATOM 5072 H HG21 . VAL A 1 18 ? -3.601  3.772   -2.760  1.00 0.00 ? 18 VAL A HG21 9  
ATOM 5073 H HG22 . VAL A 1 18 ? -4.375  3.352   -1.244  1.00 0.00 ? 18 VAL A HG22 9  
ATOM 5074 H HG23 . VAL A 1 18 ? -2.727  3.963   -1.248  1.00 0.00 ? 18 VAL A HG23 9  
ATOM 5075 N N    . PHE A 1 19 ? -1.449  -0.567  -2.939  1.00 0.00 ? 19 PHE A N    9  
ATOM 5076 C CA   . PHE A 1 19 ? -0.639  -1.820  -2.800  1.00 0.00 ? 19 PHE A CA   9  
ATOM 5077 C C    . PHE A 1 19 ? 0.440   -1.887  -3.887  1.00 0.00 ? 19 PHE A C    9  
ATOM 5078 O O    . PHE A 1 19 ? 1.592   -2.166  -3.613  1.00 0.00 ? 19 PHE A O    9  
ATOM 5079 C CB   . PHE A 1 19 ? -1.584  -3.036  -2.908  1.00 0.00 ? 19 PHE A CB   9  
ATOM 5080 C CG   . PHE A 1 19 ? -2.440  -3.156  -1.630  1.00 0.00 ? 19 PHE A CG   9  
ATOM 5081 C CD1  . PHE A 1 19 ? -1.839  -3.282  -0.388  1.00 0.00 ? 19 PHE A CD1  9  
ATOM 5082 C CD2  . PHE A 1 19 ? -3.821  -3.140  -1.704  1.00 0.00 ? 19 PHE A CD2  9  
ATOM 5083 C CE1  . PHE A 1 19 ? -2.604  -3.389  0.755   1.00 0.00 ? 19 PHE A CE1  9  
ATOM 5084 C CE2  . PHE A 1 19 ? -4.584  -3.247  -0.559  1.00 0.00 ? 19 PHE A CE2  9  
ATOM 5085 C CZ   . PHE A 1 19 ? -3.978  -3.373  0.670   1.00 0.00 ? 19 PHE A CZ   9  
ATOM 5086 H H    . PHE A 1 19 ? -2.410  -0.612  -3.104  1.00 0.00 ? 19 PHE A H    9  
ATOM 5087 H HA   . PHE A 1 19 ? -0.145  -1.803  -1.843  1.00 0.00 ? 19 PHE A HA   9  
ATOM 5088 H HB2  . PHE A 1 19 ? -2.235  -2.925  -3.763  1.00 0.00 ? 19 PHE A HB2  9  
ATOM 5089 H HB3  . PHE A 1 19 ? -1.013  -3.946  -3.025  1.00 0.00 ? 19 PHE A HB3  9  
ATOM 5090 H HD1  . PHE A 1 19 ? -0.762  -3.299  -0.309  1.00 0.00 ? 19 PHE A HD1  9  
ATOM 5091 H HD2  . PHE A 1 19 ? -4.309  -3.043  -2.663  1.00 0.00 ? 19 PHE A HD2  9  
ATOM 5092 H HE1  . PHE A 1 19 ? -2.123  -3.487  1.718   1.00 0.00 ? 19 PHE A HE1  9  
ATOM 5093 H HE2  . PHE A 1 19 ? -5.661  -3.237  -0.625  1.00 0.00 ? 19 PHE A HE2  9  
ATOM 5094 H HZ   . PHE A 1 19 ? -4.578  -3.456  1.564   1.00 0.00 ? 19 PHE A HZ   9  
ATOM 5095 N N    . PHE A 1 20 ? 0.028   -1.621  -5.100  1.00 0.00 ? 20 PHE A N    9  
ATOM 5096 C CA   . PHE A 1 20 ? 0.967   -1.645  -6.261  1.00 0.00 ? 20 PHE A CA   9  
ATOM 5097 C C    . PHE A 1 20 ? 2.187   -0.751  -5.943  1.00 0.00 ? 20 PHE A C    9  
ATOM 5098 O O    . PHE A 1 20 ? 3.319   -1.182  -6.013  1.00 0.00 ? 20 PHE A O    9  
ATOM 5099 C CB   . PHE A 1 20 ? 0.144   -1.157  -7.501  1.00 0.00 ? 20 PHE A CB   9  
ATOM 5100 C CG   . PHE A 1 20 ? 0.913   -0.162  -8.387  1.00 0.00 ? 20 PHE A CG   9  
ATOM 5101 C CD1  . PHE A 1 20 ? 1.914   -0.621  -9.214  1.00 0.00 ? 20 PHE A CD1  9  
ATOM 5102 C CD2  . PHE A 1 20 ? 0.619   1.189   -8.368  1.00 0.00 ? 20 PHE A CD2  9  
ATOM 5103 C CE1  . PHE A 1 20 ? 2.617   0.254   -10.013 1.00 0.00 ? 20 PHE A CE1  9  
ATOM 5104 C CE2  . PHE A 1 20 ? 1.319   2.067   -9.165  1.00 0.00 ? 20 PHE A CE2  9  
ATOM 5105 C CZ   . PHE A 1 20 ? 2.320   1.601   -9.990  1.00 0.00 ? 20 PHE A CZ   9  
ATOM 5106 H H    . PHE A 1 20 ? -0.912  -1.403  -5.257  1.00 0.00 ? 20 PHE A H    9  
ATOM 5107 H HA   . PHE A 1 20 ? 1.306   -2.661  -6.413  1.00 0.00 ? 20 PHE A HA   9  
ATOM 5108 H HB2  . PHE A 1 20 ? -0.125  -2.011  -8.106  1.00 0.00 ? 20 PHE A HB2  9  
ATOM 5109 H HB3  . PHE A 1 20 ? -0.768  -0.686  -7.170  1.00 0.00 ? 20 PHE A HB3  9  
ATOM 5110 H HD1  . PHE A 1 20 ? 2.145   -1.675  -9.233  1.00 0.00 ? 20 PHE A HD1  9  
ATOM 5111 H HD2  . PHE A 1 20 ? -0.162  1.573   -7.731  1.00 0.00 ? 20 PHE A HD2  9  
ATOM 5112 H HE1  . PHE A 1 20 ? 3.399   -0.119  -10.656 1.00 0.00 ? 20 PHE A HE1  9  
ATOM 5113 H HE2  . PHE A 1 20 ? 1.077   3.119   -9.137  1.00 0.00 ? 20 PHE A HE2  9  
ATOM 5114 H HZ   . PHE A 1 20 ? 2.870   2.288   -10.616 1.00 0.00 ? 20 PHE A HZ   9  
ATOM 5115 N N    . ALA A 1 21 ? 1.898   0.473   -5.589  1.00 0.00 ? 21 ALA A N    9  
ATOM 5116 C CA   . ALA A 1 21 ? 2.936   1.489   -5.244  1.00 0.00 ? 21 ALA A CA   9  
ATOM 5117 C C    . ALA A 1 21 ? 3.885   0.937   -4.188  1.00 0.00 ? 21 ALA A C    9  
ATOM 5118 O O    . ALA A 1 21 ? 5.078   1.097   -4.300  1.00 0.00 ? 21 ALA A O    9  
ATOM 5119 C CB   . ALA A 1 21 ? 2.229   2.749   -4.723  1.00 0.00 ? 21 ALA A CB   9  
ATOM 5120 H H    . ALA A 1 21 ? 0.963   0.733   -5.543  1.00 0.00 ? 21 ALA A H    9  
ATOM 5121 H HA   . ALA A 1 21 ? 3.512   1.715   -6.131  1.00 0.00 ? 21 ALA A HA   9  
ATOM 5122 H HB1  . ALA A 1 21 ? 1.542   3.124   -5.469  1.00 0.00 ? 21 ALA A HB1  9  
ATOM 5123 H HB2  . ALA A 1 21 ? 1.671   2.522   -3.826  1.00 0.00 ? 21 ALA A HB2  9  
ATOM 5124 H HB3  . ALA A 1 21 ? 2.952   3.518   -4.498  1.00 0.00 ? 21 ALA A HB3  9  
ATOM 5125 N N    . GLU A 1 22 ? 3.339   0.304   -3.185  1.00 0.00 ? 22 GLU A N    9  
ATOM 5126 C CA   . GLU A 1 22 ? 4.189   -0.282  -2.100  1.00 0.00 ? 22 GLU A CA   9  
ATOM 5127 C C    . GLU A 1 22 ? 5.238   -1.216  -2.736  1.00 0.00 ? 22 GLU A C    9  
ATOM 5128 O O    . GLU A 1 22 ? 6.425   -1.087  -2.497  1.00 0.00 ? 22 GLU A O    9  
ATOM 5129 C CB   . GLU A 1 22 ? 3.266   -1.054  -1.135  1.00 0.00 ? 22 GLU A CB   9  
ATOM 5130 C CG   . GLU A 1 22 ? 3.951   -1.240  0.229   1.00 0.00 ? 22 GLU A CG   9  
ATOM 5131 C CD   . GLU A 1 22 ? 3.067   -2.149  1.099   1.00 0.00 ? 22 GLU A CD   9  
ATOM 5132 O OE1  . GLU A 1 22 ? 2.204   -1.596  1.763   1.00 0.00 ? 22 GLU A OE1  9  
ATOM 5133 O OE2  . GLU A 1 22 ? 3.302   -3.346  1.050   1.00 0.00 ? 22 GLU A OE2  9  
ATOM 5134 H H    . GLU A 1 22 ? 2.367   0.229   -3.153  1.00 0.00 ? 22 GLU A H    9  
ATOM 5135 H HA   . GLU A 1 22 ? 4.713   0.525   -1.607  1.00 0.00 ? 22 GLU A HA   9  
ATOM 5136 H HB2  . GLU A 1 22 ? 2.349   -0.500  -0.997  1.00 0.00 ? 22 GLU A HB2  9  
ATOM 5137 H HB3  . GLU A 1 22 ? 3.021   -2.021  -1.552  1.00 0.00 ? 22 GLU A HB3  9  
ATOM 5138 H HG2  . GLU A 1 22 ? 4.922   -1.697  0.105   1.00 0.00 ? 22 GLU A HG2  9  
ATOM 5139 H HG3  . GLU A 1 22 ? 4.073   -0.285  0.720   1.00 0.00 ? 22 GLU A HG3  9  
ATOM 5140 N N    . ASP A 1 23 ? 4.751   -2.127  -3.539  1.00 0.00 ? 23 ASP A N    9  
ATOM 5141 C CA   . ASP A 1 23 ? 5.646   -3.105  -4.238  1.00 0.00 ? 23 ASP A CA   9  
ATOM 5142 C C    . ASP A 1 23 ? 6.761   -2.349  -4.975  1.00 0.00 ? 23 ASP A C    9  
ATOM 5143 O O    . ASP A 1 23 ? 7.936   -2.615  -4.831  1.00 0.00 ? 23 ASP A O    9  
ATOM 5144 C CB   . ASP A 1 23 ? 4.826   -3.910  -5.256  1.00 0.00 ? 23 ASP A CB   9  
ATOM 5145 C CG   . ASP A 1 23 ? 5.613   -5.170  -5.663  1.00 0.00 ? 23 ASP A CG   9  
ATOM 5146 O OD1  . ASP A 1 23 ? 6.520   -5.012  -6.467  1.00 0.00 ? 23 ASP A OD1  9  
ATOM 5147 O OD2  . ASP A 1 23 ? 5.264   -6.220  -5.148  1.00 0.00 ? 23 ASP A OD2  9  
ATOM 5148 H H    . ASP A 1 23 ? 3.781   -2.161  -3.675  1.00 0.00 ? 23 ASP A H    9  
ATOM 5149 H HA   . ASP A 1 23 ? 6.087   -3.756  -3.500  1.00 0.00 ? 23 ASP A HA   9  
ATOM 5150 H HB2  . ASP A 1 23 ? 3.867   -4.184  -4.844  1.00 0.00 ? 23 ASP A HB2  9  
ATOM 5151 H HB3  . ASP A 1 23 ? 4.640   -3.317  -6.138  1.00 0.00 ? 23 ASP A HB3  9  
ATOM 5152 N N    . VAL A 1 24 ? 6.303   -1.411  -5.755  1.00 0.00 ? 24 VAL A N    9  
ATOM 5153 C CA   . VAL A 1 24 ? 7.177   -0.532  -6.582  1.00 0.00 ? 24 VAL A CA   9  
ATOM 5154 C C    . VAL A 1 24 ? 8.251   0.138   -5.717  1.00 0.00 ? 24 VAL A C    9  
ATOM 5155 O O    . VAL A 1 24 ? 9.416   0.123   -6.053  1.00 0.00 ? 24 VAL A O    9  
ATOM 5156 C CB   . VAL A 1 24 ? 6.246   0.495   -7.261  1.00 0.00 ? 24 VAL A CB   9  
ATOM 5157 C CG1  . VAL A 1 24 ? 7.013   1.370   -8.237  1.00 0.00 ? 24 VAL A CG1  9  
ATOM 5158 C CG2  . VAL A 1 24 ? 5.125   -0.242  -8.025  1.00 0.00 ? 24 VAL A CG2  9  
ATOM 5159 H H    . VAL A 1 24 ? 5.334   -1.282  -5.799  1.00 0.00 ? 24 VAL A H    9  
ATOM 5160 H HA   . VAL A 1 24 ? 7.666   -1.141  -7.326  1.00 0.00 ? 24 VAL A HA   9  
ATOM 5161 H HB   . VAL A 1 24 ? 5.803   1.135   -6.514  1.00 0.00 ? 24 VAL A HB   9  
ATOM 5162 H HG11 . VAL A 1 24 ? 7.862   1.801   -7.737  1.00 0.00 ? 24 VAL A HG11 9  
ATOM 5163 H HG12 . VAL A 1 24 ? 7.350   0.784   -9.079  1.00 0.00 ? 24 VAL A HG12 9  
ATOM 5164 H HG13 . VAL A 1 24 ? 6.365   2.161   -8.586  1.00 0.00 ? 24 VAL A HG13 9  
ATOM 5165 H HG21 . VAL A 1 24 ? 5.081   -1.288  -7.755  1.00 0.00 ? 24 VAL A HG21 9  
ATOM 5166 H HG22 . VAL A 1 24 ? 4.182   0.217   -7.774  1.00 0.00 ? 24 VAL A HG22 9  
ATOM 5167 H HG23 . VAL A 1 24 ? 5.273   -0.180  -9.090  1.00 0.00 ? 24 VAL A HG23 9  
ATOM 5168 N N    . GLY A 1 25 ? 7.816   0.705   -4.625  1.00 0.00 ? 25 GLY A N    9  
ATOM 5169 C CA   . GLY A 1 25 ? 8.734   1.403   -3.666  1.00 0.00 ? 25 GLY A CA   9  
ATOM 5170 C C    . GLY A 1 25 ? 9.979   0.549   -3.438  1.00 0.00 ? 25 GLY A C    9  
ATOM 5171 O O    . GLY A 1 25 ? 11.096  1.014   -3.561  1.00 0.00 ? 25 GLY A O    9  
ATOM 5172 H H    . GLY A 1 25 ? 6.858   0.663   -4.445  1.00 0.00 ? 25 GLY A H    9  
ATOM 5173 H HA2  . GLY A 1 25 ? 9.022   2.361   -4.071  1.00 0.00 ? 25 GLY A HA2  9  
ATOM 5174 H HA3  . GLY A 1 25 ? 8.223   1.544   -2.725  1.00 0.00 ? 25 GLY A HA3  9  
ATOM 5175 N N    . SER A 1 26 ? 9.718   -0.688  -3.113  1.00 0.00 ? 26 SER A N    9  
ATOM 5176 C CA   . SER A 1 26 ? 10.816  -1.665  -2.860  1.00 0.00 ? 26 SER A CA   9  
ATOM 5177 C C    . SER A 1 26 ? 11.590  -1.959  -4.156  1.00 0.00 ? 26 SER A C    9  
ATOM 5178 O O    . SER A 1 26 ? 12.781  -1.739  -4.244  1.00 0.00 ? 26 SER A O    9  
ATOM 5179 C CB   . SER A 1 26 ? 10.190  -2.958  -2.294  1.00 0.00 ? 26 SER A CB   9  
ATOM 5180 O OG   . SER A 1 26 ? 11.293  -3.786  -1.944  1.00 0.00 ? 26 SER A OG   9  
ATOM 5181 H H    . SER A 1 26 ? 8.780   -0.959  -3.035  1.00 0.00 ? 26 SER A H    9  
ATOM 5182 H HA   . SER A 1 26 ? 11.491  -1.238  -2.141  1.00 0.00 ? 26 SER A HA   9  
ATOM 5183 H HB2  . SER A 1 26 ? 9.605   -2.753  -1.410  1.00 0.00 ? 26 SER A HB2  9  
ATOM 5184 H HB3  . SER A 1 26 ? 9.583   -3.466  -3.028  1.00 0.00 ? 26 SER A HB3  9  
ATOM 5185 H HG   . SER A 1 26 ? 12.110  -3.326  -2.151  1.00 0.00 ? 26 SER A HG   9  
ATOM 5186 N N    . ASN A 1 27 ? 10.873  -2.442  -5.136  1.00 0.00 ? 27 ASN A N    9  
ATOM 5187 C CA   . ASN A 1 27 ? 11.470  -2.788  -6.460  1.00 0.00 ? 27 ASN A CA   9  
ATOM 5188 C C    . ASN A 1 27 ? 12.173  -1.599  -7.113  1.00 0.00 ? 27 ASN A C    9  
ATOM 5189 O O    . ASN A 1 27 ? 13.386  -1.573  -7.182  1.00 0.00 ? 27 ASN A O    9  
ATOM 5190 C CB   . ASN A 1 27 ? 10.331  -3.316  -7.356  1.00 0.00 ? 27 ASN A CB   9  
ATOM 5191 C CG   . ASN A 1 27 ? 9.761   -4.634  -6.804  1.00 0.00 ? 27 ASN A CG   9  
ATOM 5192 O OD1  . ASN A 1 27 ? 9.424   -4.754  -5.643  1.00 0.00 ? 27 ASN A OD1  9  
ATOM 5193 N ND2  . ASN A 1 27 ? 9.637   -5.654  -7.609  1.00 0.00 ? 27 ASN A ND2  9  
ATOM 5194 H H    . ASN A 1 27 ? 9.917   -2.577  -4.998  1.00 0.00 ? 27 ASN A H    9  
ATOM 5195 H HA   . ASN A 1 27 ? 12.226  -3.534  -6.289  1.00 0.00 ? 27 ASN A HA   9  
ATOM 5196 H HB2  . ASN A 1 27 ? 9.530   -2.592  -7.405  1.00 0.00 ? 27 ASN A HB2  9  
ATOM 5197 H HB3  . ASN A 1 27 ? 10.703  -3.486  -8.350  1.00 0.00 ? 27 ASN A HB3  9  
ATOM 5198 H HD21 . ASN A 1 27 ? 9.906   -5.573  -8.548  1.00 0.00 ? 27 ASN A HD21 9  
ATOM 5199 H HD22 . ASN A 1 27 ? 9.272   -6.501  -7.276  1.00 0.00 ? 27 ASN A HD22 9  
ATOM 5200 N N    . LYS A 1 28 ? 11.404  -0.648  -7.579  1.00 0.00 ? 28 LYS A N    9  
ATOM 5201 C CA   . LYS A 1 28 ? 11.986  0.569   -8.233  1.00 0.00 ? 28 LYS A CA   9  
ATOM 5202 C C    . LYS A 1 28 ? 13.070  1.141   -7.308  1.00 0.00 ? 28 LYS A C    9  
ATOM 5203 O O    . LYS A 1 28 ? 14.063  1.647   -7.777  1.00 0.00 ? 28 LYS A O    9  
ATOM 5204 C CB   . LYS A 1 28 ? 10.840  1.613   -8.487  1.00 0.00 ? 28 LYS A CB   9  
ATOM 5205 C CG   . LYS A 1 28 ? 10.750  2.723   -7.392  1.00 0.00 ? 28 LYS A CG   9  
ATOM 5206 C CD   . LYS A 1 28 ? 9.667   3.767   -7.777  1.00 0.00 ? 28 LYS A CD   9  
ATOM 5207 C CE   . LYS A 1 28 ? 8.724   4.023   -6.582  1.00 0.00 ? 28 LYS A CE   9  
ATOM 5208 N NZ   . LYS A 1 28 ? 7.409   4.531   -7.066  1.00 0.00 ? 28 LYS A NZ   9  
ATOM 5209 H H    . LYS A 1 28 ? 10.436  -0.747  -7.493  1.00 0.00 ? 28 LYS A H    9  
ATOM 5210 H HA   . LYS A 1 28 ? 12.443  0.284   -9.174  1.00 0.00 ? 28 LYS A HA   9  
ATOM 5211 H HB2  . LYS A 1 28 ? 11.019  2.087   -9.442  1.00 0.00 ? 28 LYS A HB2  9  
ATOM 5212 H HB3  . LYS A 1 28 ? 9.895   1.095   -8.546  1.00 0.00 ? 28 LYS A HB3  9  
ATOM 5213 H HG2  . LYS A 1 28 ? 10.535  2.276   -6.432  1.00 0.00 ? 28 LYS A HG2  9  
ATOM 5214 H HG3  . LYS A 1 28 ? 11.694  3.239   -7.317  1.00 0.00 ? 28 LYS A HG3  9  
ATOM 5215 H HD2  . LYS A 1 28 ? 10.150  4.696   -8.045  1.00 0.00 ? 28 LYS A HD2  9  
ATOM 5216 H HD3  . LYS A 1 28 ? 9.094   3.430   -8.629  1.00 0.00 ? 28 LYS A HD3  9  
ATOM 5217 H HE2  . LYS A 1 28 ? 8.548   3.112   -6.032  1.00 0.00 ? 28 LYS A HE2  9  
ATOM 5218 H HE3  . LYS A 1 28 ? 9.156   4.756   -5.916  1.00 0.00 ? 28 LYS A HE3  9  
ATOM 5219 H HZ1  . LYS A 1 28 ? 7.420   4.602   -8.103  1.00 0.00 ? 28 LYS A HZ1  9  
ATOM 5220 H HZ2  . LYS A 1 28 ? 6.658   3.874   -6.772  1.00 0.00 ? 28 LYS A HZ2  9  
ATOM 5221 H HZ3  . LYS A 1 28 ? 7.228   5.470   -6.656  1.00 0.00 ? 28 LYS A HZ3  9  
ATOM 5222 N N    . GLY A 1 29 ? 12.849  1.033   -6.021  1.00 0.00 ? 29 GLY A N    9  
ATOM 5223 C CA   . GLY A 1 29 ? 13.843  1.555   -5.035  1.00 0.00 ? 29 GLY A CA   9  
ATOM 5224 C C    . GLY A 1 29 ? 15.205  0.907   -5.302  1.00 0.00 ? 29 GLY A C    9  
ATOM 5225 O O    . GLY A 1 29 ? 16.171  1.584   -5.596  1.00 0.00 ? 29 GLY A O    9  
ATOM 5226 H H    . GLY A 1 29 ? 12.024  0.605   -5.716  1.00 0.00 ? 29 GLY A H    9  
ATOM 5227 H HA2  . GLY A 1 29 ? 13.922  2.628   -5.135  1.00 0.00 ? 29 GLY A HA2  9  
ATOM 5228 H HA3  . GLY A 1 29 ? 13.521  1.305   -4.035  1.00 0.00 ? 29 GLY A HA3  9  
ATOM 5229 N N    . ALA A 1 30 ? 15.237  -0.399  -5.205  1.00 0.00 ? 30 ALA A N    9  
ATOM 5230 C CA   . ALA A 1 30 ? 16.519  -1.137  -5.443  1.00 0.00 ? 30 ALA A CA   9  
ATOM 5231 C C    . ALA A 1 30 ? 17.068  -0.848  -6.844  1.00 0.00 ? 30 ALA A C    9  
ATOM 5232 O O    . ALA A 1 30 ? 18.244  -0.609  -7.020  1.00 0.00 ? 30 ALA A O    9  
ATOM 5233 C CB   . ALA A 1 30 ? 16.254  -2.639  -5.279  1.00 0.00 ? 30 ALA A CB   9  
ATOM 5234 H H    . ALA A 1 30 ? 14.417  -0.892  -4.979  1.00 0.00 ? 30 ALA A H    9  
ATOM 5235 H HA   . ALA A 1 30 ? 17.247  -0.791  -4.723  1.00 0.00 ? 30 ALA A HA   9  
ATOM 5236 H HB1  . ALA A 1 30 ? 15.496  -2.963  -5.977  1.00 0.00 ? 30 ALA A HB1  9  
ATOM 5237 H HB2  . ALA A 1 30 ? 17.159  -3.201  -5.456  1.00 0.00 ? 30 ALA A HB2  9  
ATOM 5238 H HB3  . ALA A 1 30 ? 15.911  -2.843  -4.274  1.00 0.00 ? 30 ALA A HB3  9  
ATOM 5239 N N    . ILE A 1 31 ? 16.186  -0.873  -7.803  1.00 0.00 ? 31 ILE A N    9  
ATOM 5240 C CA   . ILE A 1 31 ? 16.545  -0.613  -9.225  1.00 0.00 ? 31 ILE A CA   9  
ATOM 5241 C C    . ILE A 1 31 ? 17.296  0.722   -9.349  1.00 0.00 ? 31 ILE A C    9  
ATOM 5242 O O    . ILE A 1 31 ? 18.397  0.768   -9.861  1.00 0.00 ? 31 ILE A O    9  
ATOM 5243 C CB   . ILE A 1 31 ? 15.192  -0.653  -9.989  1.00 0.00 ? 31 ILE A CB   9  
ATOM 5244 C CG1  . ILE A 1 31 ? 14.769  -2.142  -10.125 1.00 0.00 ? 31 ILE A CG1  9  
ATOM 5245 C CG2  . ILE A 1 31 ? 15.258  0.040   -11.363 1.00 0.00 ? 31 ILE A CG2  9  
ATOM 5246 C CD1  . ILE A 1 31 ? 13.360  -2.278  -10.736 1.00 0.00 ? 31 ILE A CD1  9  
ATOM 5247 H H    . ILE A 1 31 ? 15.254  -1.071  -7.590  1.00 0.00 ? 31 ILE A H    9  
ATOM 5248 H HA   . ILE A 1 31 ? 17.222  -1.391  -9.543  1.00 0.00 ? 31 ILE A HA   9  
ATOM 5249 H HB   . ILE A 1 31 ? 14.454  -0.141  -9.394  1.00 0.00 ? 31 ILE A HB   9  
ATOM 5250 H HG12 . ILE A 1 31 ? 15.490  -2.665  -10.731 1.00 0.00 ? 31 ILE A HG12 9  
ATOM 5251 H HG13 . ILE A 1 31 ? 14.762  -2.604  -9.148  1.00 0.00 ? 31 ILE A HG13 9  
ATOM 5252 H HG21 . ILE A 1 31 ? 15.536  1.076   -11.242 1.00 0.00 ? 31 ILE A HG21 9  
ATOM 5253 H HG22 . ILE A 1 31 ? 15.973  -0.452  -12.004 1.00 0.00 ? 31 ILE A HG22 9  
ATOM 5254 H HG23 . ILE A 1 31 ? 14.284  0.012   -11.829 1.00 0.00 ? 31 ILE A HG23 9  
ATOM 5255 H HD11 . ILE A 1 31 ? 12.665  -1.617  -10.240 1.00 0.00 ? 31 ILE A HD11 9  
ATOM 5256 H HD12 . ILE A 1 31 ? 13.382  -2.043  -11.789 1.00 0.00 ? 31 ILE A HD12 9  
ATOM 5257 H HD13 . ILE A 1 31 ? 13.010  -3.294  -10.620 1.00 0.00 ? 31 ILE A HD13 9  
ATOM 5258 N N    . ILE A 1 32 ? 16.682  1.772   -8.874  1.00 0.00 ? 32 ILE A N    9  
ATOM 5259 C CA   . ILE A 1 32 ? 17.313  3.122   -8.934  1.00 0.00 ? 32 ILE A CA   9  
ATOM 5260 C C    . ILE A 1 32 ? 18.666  3.062   -8.225  1.00 0.00 ? 32 ILE A C    9  
ATOM 5261 O O    . ILE A 1 32 ? 19.648  3.545   -8.748  1.00 0.00 ? 32 ILE A O    9  
ATOM 5262 C CB   . ILE A 1 32 ? 16.368  4.145   -8.247  1.00 0.00 ? 32 ILE A CB   9  
ATOM 5263 C CG1  . ILE A 1 32 ? 15.036  4.206   -9.048  1.00 0.00 ? 32 ILE A CG1  9  
ATOM 5264 C CG2  . ILE A 1 32 ? 17.027  5.548   -8.244  1.00 0.00 ? 32 ILE A CG2  9  
ATOM 5265 C CD1  . ILE A 1 32 ? 13.912  4.800   -8.174  1.00 0.00 ? 32 ILE A CD1  9  
ATOM 5266 H H    . ILE A 1 32 ? 15.797  1.678   -8.475  1.00 0.00 ? 32 ILE A H    9  
ATOM 5267 H HA   . ILE A 1 32 ? 17.485  3.374   -9.967  1.00 0.00 ? 32 ILE A HA   9  
ATOM 5268 H HB   . ILE A 1 32 ? 16.175  3.832   -7.230  1.00 0.00 ? 32 ILE A HB   9  
ATOM 5269 H HG12 . ILE A 1 32 ? 15.168  4.806   -9.932  1.00 0.00 ? 32 ILE A HG12 9  
ATOM 5270 H HG13 . ILE A 1 32 ? 14.747  3.217   -9.368  1.00 0.00 ? 32 ILE A HG13 9  
ATOM 5271 H HG21 . ILE A 1 32 ? 17.361  5.811   -9.237  1.00 0.00 ? 32 ILE A HG21 9  
ATOM 5272 H HG22 . ILE A 1 32 ? 16.321  6.295   -7.909  1.00 0.00 ? 32 ILE A HG22 9  
ATOM 5273 H HG23 . ILE A 1 32 ? 17.877  5.560   -7.577  1.00 0.00 ? 32 ILE A HG23 9  
ATOM 5274 H HD11 . ILE A 1 32 ? 13.862  4.292   -7.222  1.00 0.00 ? 32 ILE A HD11 9  
ATOM 5275 H HD12 . ILE A 1 32 ? 14.088  5.851   -7.999  1.00 0.00 ? 32 ILE A HD12 9  
ATOM 5276 H HD13 . ILE A 1 32 ? 12.962  4.689   -8.676  1.00 0.00 ? 32 ILE A HD13 9  
ATOM 5277 N N    . GLY A 1 33 ? 18.680  2.465   -7.061  1.00 0.00 ? 33 GLY A N    9  
ATOM 5278 C CA   . GLY A 1 33 ? 19.956  2.351   -6.288  1.00 0.00 ? 33 GLY A CA   9  
ATOM 5279 C C    . GLY A 1 33 ? 21.048  1.736   -7.169  1.00 0.00 ? 33 GLY A C    9  
ATOM 5280 O O    . GLY A 1 33 ? 22.131  2.273   -7.271  1.00 0.00 ? 33 GLY A O    9  
ATOM 5281 H H    . GLY A 1 33 ? 17.852  2.093   -6.694  1.00 0.00 ? 33 GLY A H    9  
ATOM 5282 H HA2  . GLY A 1 33 ? 20.267  3.339   -5.976  1.00 0.00 ? 33 GLY A HA2  9  
ATOM 5283 H HA3  . GLY A 1 33 ? 19.797  1.728   -5.422  1.00 0.00 ? 33 GLY A HA3  9  
ATOM 5284 N N    . LEU A 1 34 ? 20.732  0.629   -7.792  1.00 0.00 ? 34 LEU A N    9  
ATOM 5285 C CA   . LEU A 1 34 ? 21.724  -0.053  -8.679  1.00 0.00 ? 34 LEU A CA   9  
ATOM 5286 C C    . LEU A 1 34 ? 22.169  0.877   -9.817  1.00 0.00 ? 34 LEU A C    9  
ATOM 5287 O O    . LEU A 1 34 ? 23.352  1.016   -10.060 1.00 0.00 ? 34 LEU A O    9  
ATOM 5288 C CB   . LEU A 1 34 ? 21.079  -1.332  -9.259  1.00 0.00 ? 34 LEU A CB   9  
ATOM 5289 C CG   . LEU A 1 34 ? 20.834  -2.368  -8.125  1.00 0.00 ? 34 LEU A CG   9  
ATOM 5290 C CD1  . LEU A 1 34 ? 19.728  -3.350  -8.563  1.00 0.00 ? 34 LEU A CD1  9  
ATOM 5291 C CD2  . LEU A 1 34 ? 22.134  -3.162  -7.847  1.00 0.00 ? 34 LEU A CD2  9  
ATOM 5292 H H    . LEU A 1 34 ? 19.839  0.243   -7.672  1.00 0.00 ? 34 LEU A H    9  
ATOM 5293 H HA   . LEU A 1 34 ? 22.595  -0.291  -8.086  1.00 0.00 ? 34 LEU A HA   9  
ATOM 5294 H HB2  . LEU A 1 34 ? 20.140  -1.074  -9.727  1.00 0.00 ? 34 LEU A HB2  9  
ATOM 5295 H HB3  . LEU A 1 34 ? 21.727  -1.756  -10.013 1.00 0.00 ? 34 LEU A HB3  9  
ATOM 5296 H HG   . LEU A 1 34 ? 20.522  -1.870  -7.218  1.00 0.00 ? 34 LEU A HG   9  
ATOM 5297 H HD11 . LEU A 1 34 ? 18.819  -2.813  -8.792  1.00 0.00 ? 34 LEU A HD11 9  
ATOM 5298 H HD12 . LEU A 1 34 ? 20.037  -3.898  -9.441  1.00 0.00 ? 34 LEU A HD12 9  
ATOM 5299 H HD13 . LEU A 1 34 ? 19.520  -4.054  -7.770  1.00 0.00 ? 34 LEU A HD13 9  
ATOM 5300 H HD21 . LEU A 1 34 ? 22.931  -2.490  -7.566  1.00 0.00 ? 34 LEU A HD21 9  
ATOM 5301 H HD22 . LEU A 1 34 ? 21.974  -3.861  -7.040  1.00 0.00 ? 34 LEU A HD22 9  
ATOM 5302 H HD23 . LEU A 1 34 ? 22.438  -3.711  -8.726  1.00 0.00 ? 34 LEU A HD23 9  
ATOM 5303 N N    . MET A 1 35 ? 21.209  1.483   -10.475 1.00 0.00 ? 35 MET A N    9  
ATOM 5304 C CA   . MET A 1 35 ? 21.510  2.420   -11.604 1.00 0.00 ? 35 MET A CA   9  
ATOM 5305 C C    . MET A 1 35 ? 22.515  3.489   -11.148 1.00 0.00 ? 35 MET A C    9  
ATOM 5306 O O    . MET A 1 35 ? 23.508  3.741   -11.803 1.00 0.00 ? 35 MET A O    9  
ATOM 5307 C CB   . MET A 1 35 ? 20.177  3.057   -12.050 1.00 0.00 ? 35 MET A CB   9  
ATOM 5308 C CG   . MET A 1 35 ? 20.375  3.836   -13.357 1.00 0.00 ? 35 MET A CG   9  
ATOM 5309 S SD   . MET A 1 35 ? 21.025  2.935   -14.786 1.00 0.00 ? 35 MET A SD   9  
ATOM 5310 C CE   . MET A 1 35 ? 21.021  4.303   -15.972 1.00 0.00 ? 35 MET A CE   9  
ATOM 5311 H H    . MET A 1 35 ? 20.276  1.319   -10.229 1.00 0.00 ? 35 MET A H    9  
ATOM 5312 H HA   . MET A 1 35 ? 21.946  1.853   -12.409 1.00 0.00 ? 35 MET A HA   9  
ATOM 5313 H HB2  . MET A 1 35 ? 19.444  2.279   -12.204 1.00 0.00 ? 35 MET A HB2  9  
ATOM 5314 H HB3  . MET A 1 35 ? 19.809  3.724   -11.284 1.00 0.00 ? 35 MET A HB3  9  
ATOM 5315 H HG2  . MET A 1 35 ? 19.416  4.247   -13.638 1.00 0.00 ? 35 MET A HG2  9  
ATOM 5316 H HG3  . MET A 1 35 ? 21.040  4.663   -13.156 1.00 0.00 ? 35 MET A HG3  9  
ATOM 5317 H HE1  . MET A 1 35 ? 21.517  5.161   -15.542 1.00 0.00 ? 35 MET A HE1  9  
ATOM 5318 H HE2  . MET A 1 35 ? 21.544  4.001   -16.868 1.00 0.00 ? 35 MET A HE2  9  
ATOM 5319 H HE3  . MET A 1 35 ? 20.003  4.563   -16.223 1.00 0.00 ? 35 MET A HE3  9  
ATOM 5320 N N    . VAL A 1 36 ? 22.202  4.077   -10.024 1.00 0.00 ? 36 VAL A N    9  
ATOM 5321 C CA   . VAL A 1 36 ? 23.054  5.141   -9.411  1.00 0.00 ? 36 VAL A CA   9  
ATOM 5322 C C    . VAL A 1 36 ? 24.462  4.581   -9.133  1.00 0.00 ? 36 VAL A C    9  
ATOM 5323 O O    . VAL A 1 36 ? 25.450  5.153   -9.551  1.00 0.00 ? 36 VAL A O    9  
ATOM 5324 C CB   . VAL A 1 36 ? 22.356  5.611   -8.093  1.00 0.00 ? 36 VAL A CB   9  
ATOM 5325 C CG1  . VAL A 1 36 ? 23.313  6.491   -7.252  1.00 0.00 ? 36 VAL A CG1  9  
ATOM 5326 C CG2  . VAL A 1 36 ? 21.105  6.447   -8.452  1.00 0.00 ? 36 VAL A CG2  9  
ATOM 5327 H H    . VAL A 1 36 ? 21.378  3.812   -9.577  1.00 0.00 ? 36 VAL A H    9  
ATOM 5328 H HA   . VAL A 1 36 ? 23.135  5.964   -10.107 1.00 0.00 ? 36 VAL A HA   9  
ATOM 5329 H HB   . VAL A 1 36 ? 22.046  4.755   -7.507  1.00 0.00 ? 36 VAL A HB   9  
ATOM 5330 H HG11 . VAL A 1 36 ? 23.798  7.225   -7.877  1.00 0.00 ? 36 VAL A HG11 9  
ATOM 5331 H HG12 . VAL A 1 36 ? 22.766  7.004   -6.474  1.00 0.00 ? 36 VAL A HG12 9  
ATOM 5332 H HG13 . VAL A 1 36 ? 24.070  5.876   -6.787  1.00 0.00 ? 36 VAL A HG13 9  
ATOM 5333 H HG21 . VAL A 1 36 ? 20.465  5.900   -9.128  1.00 0.00 ? 36 VAL A HG21 9  
ATOM 5334 H HG22 . VAL A 1 36 ? 20.545  6.674   -7.556  1.00 0.00 ? 36 VAL A HG22 9  
ATOM 5335 H HG23 . VAL A 1 36 ? 21.392  7.375   -8.924  1.00 0.00 ? 36 VAL A HG23 9  
ATOM 5336 N N    . GLY A 1 37 ? 24.494  3.473   -8.433  1.00 0.00 ? 37 GLY A N    9  
ATOM 5337 C CA   . GLY A 1 37 ? 25.776  2.799   -8.074  1.00 0.00 ? 37 GLY A CA   9  
ATOM 5338 C C    . GLY A 1 37 ? 25.702  2.411   -6.598  1.00 0.00 ? 37 GLY A C    9  
ATOM 5339 O O    . GLY A 1 37 ? 24.905  1.574   -6.220  1.00 0.00 ? 37 GLY A O    9  
ATOM 5340 H H    . GLY A 1 37 ? 23.660  3.068   -8.127  1.00 0.00 ? 37 GLY A H    9  
ATOM 5341 H HA2  . GLY A 1 37 ? 25.893  1.909   -8.675  1.00 0.00 ? 37 GLY A HA2  9  
ATOM 5342 H HA3  . GLY A 1 37 ? 26.611  3.466   -8.235  1.00 0.00 ? 37 GLY A HA3  9  
ATOM 5343 N N    . GLY A 1 38 ? 26.541  3.035   -5.808  1.00 0.00 ? 38 GLY A N    9  
ATOM 5344 C CA   . GLY A 1 38 ? 26.582  2.758   -4.339  1.00 0.00 ? 38 GLY A CA   9  
ATOM 5345 C C    . GLY A 1 38 ? 27.545  1.606   -4.034  1.00 0.00 ? 38 GLY A C    9  
ATOM 5346 O O    . GLY A 1 38 ? 28.131  1.554   -2.970  1.00 0.00 ? 38 GLY A O    9  
ATOM 5347 H H    . GLY A 1 38 ? 27.156  3.693   -6.190  1.00 0.00 ? 38 GLY A H    9  
ATOM 5348 H HA2  . GLY A 1 38 ? 26.920  3.647   -3.825  1.00 0.00 ? 38 GLY A HA2  9  
ATOM 5349 H HA3  . GLY A 1 38 ? 25.594  2.498   -3.984  1.00 0.00 ? 38 GLY A HA3  9  
ATOM 5350 N N    . VAL A 1 39 ? 27.670  0.721   -4.991  1.00 0.00 ? 39 VAL A N    9  
ATOM 5351 C CA   . VAL A 1 39 ? 28.566  -0.466  -4.864  1.00 0.00 ? 39 VAL A CA   9  
ATOM 5352 C C    . VAL A 1 39 ? 29.628  -0.394  -5.978  1.00 0.00 ? 39 VAL A C    9  
ATOM 5353 O O    . VAL A 1 39 ? 30.041  -1.394  -6.533  1.00 0.00 ? 39 VAL A O    9  
ATOM 5354 C CB   . VAL A 1 39 ? 27.693  -1.760  -4.985  1.00 0.00 ? 39 VAL A CB   9  
ATOM 5355 C CG1  . VAL A 1 39 ? 28.499  -2.989  -4.497  1.00 0.00 ? 39 VAL A CG1  9  
ATOM 5356 C CG2  . VAL A 1 39 ? 26.424  -1.630  -4.106  1.00 0.00 ? 39 VAL A CG2  9  
ATOM 5357 H H    . VAL A 1 39 ? 27.163  0.839   -5.816  1.00 0.00 ? 39 VAL A H    9  
ATOM 5358 H HA   . VAL A 1 39 ? 29.065  -0.427  -3.911  1.00 0.00 ? 39 VAL A HA   9  
ATOM 5359 H HB   . VAL A 1 39 ? 27.398  -1.907  -6.014  1.00 0.00 ? 39 VAL A HB   9  
ATOM 5360 H HG11 . VAL A 1 39 ? 28.974  -2.781  -3.550  1.00 0.00 ? 39 VAL A HG11 9  
ATOM 5361 H HG12 . VAL A 1 39 ? 27.844  -3.839  -4.375  1.00 0.00 ? 39 VAL A HG12 9  
ATOM 5362 H HG13 . VAL A 1 39 ? 29.260  -3.254  -5.216  1.00 0.00 ? 39 VAL A HG13 9  
ATOM 5363 H HG21 . VAL A 1 39 ? 26.680  -1.261  -3.123  1.00 0.00 ? 39 VAL A HG21 9  
ATOM 5364 H HG22 . VAL A 1 39 ? 25.725  -0.945  -4.563  1.00 0.00 ? 39 VAL A HG22 9  
ATOM 5365 H HG23 . VAL A 1 39 ? 25.940  -2.590  -3.999  1.00 0.00 ? 39 VAL A HG23 9  
ATOM 5366 N N    . VAL A 1 40 ? 30.043  0.815   -6.268  1.00 0.00 ? 40 VAL A N    9  
ATOM 5367 C CA   . VAL A 1 40 ? 31.074  1.039   -7.331  1.00 0.00 ? 40 VAL A CA   9  
ATOM 5368 C C    . VAL A 1 40 ? 32.467  0.651   -6.791  1.00 0.00 ? 40 VAL A C    9  
ATOM 5369 O O    . VAL A 1 40 ? 32.728  0.999   -5.649  1.00 0.00 ? 40 VAL A O    9  
ATOM 5370 C CB   . VAL A 1 40 ? 31.069  2.538   -7.750  1.00 0.00 ? 40 VAL A CB   9  
ATOM 5371 C CG1  . VAL A 1 40 ? 31.904  2.712   -9.041  1.00 0.00 ? 40 VAL A CG1  9  
ATOM 5372 C CG2  . VAL A 1 40 ? 29.622  3.011   -8.023  1.00 0.00 ? 40 VAL A CG2  9  
ATOM 5373 O OXT  . VAL A 1 40 ? 33.189  0.028   -7.551  1.00 0.00 ? 40 VAL A OXT  9  
ATOM 5374 H H    . VAL A 1 40 ? 29.673  1.581   -5.782  1.00 0.00 ? 40 VAL A H    9  
ATOM 5375 H HA   . VAL A 1 40 ? 30.833  0.418   -8.185  1.00 0.00 ? 40 VAL A HA   9  
ATOM 5376 H HB   . VAL A 1 40 ? 31.497  3.139   -6.960  1.00 0.00 ? 40 VAL A HB   9  
ATOM 5377 H HG11 . VAL A 1 40 ? 31.514  2.083   -9.828  1.00 0.00 ? 40 VAL A HG11 9  
ATOM 5378 H HG12 . VAL A 1 40 ? 31.870  3.739   -9.372  1.00 0.00 ? 40 VAL A HG12 9  
ATOM 5379 H HG13 . VAL A 1 40 ? 32.934  2.445   -8.862  1.00 0.00 ? 40 VAL A HG13 9  
ATOM 5380 H HG21 . VAL A 1 40 ? 29.118  2.319   -8.682  1.00 0.00 ? 40 VAL A HG21 9  
ATOM 5381 H HG22 . VAL A 1 40 ? 29.073  3.076   -7.095  1.00 0.00 ? 40 VAL A HG22 9  
ATOM 5382 H HG23 . VAL A 1 40 ? 29.633  3.989   -8.483  1.00 0.00 ? 40 VAL A HG23 9  
ATOM 5383 N N    . ASP A 1 1  ? 3.371   23.286  -9.277  1.00 0.00 ? 1  ASP A N    10 
ATOM 5384 C CA   . ASP A 1 1  ? 2.601   23.797  -8.105  1.00 0.00 ? 1  ASP A CA   10 
ATOM 5385 C C    . ASP A 1 1  ? 1.913   22.624  -7.379  1.00 0.00 ? 1  ASP A C    10 
ATOM 5386 O O    . ASP A 1 1  ? 2.302   21.483  -7.539  1.00 0.00 ? 1  ASP A O    10 
ATOM 5387 C CB   . ASP A 1 1  ? 1.543   24.827  -8.602  1.00 0.00 ? 1  ASP A CB   10 
ATOM 5388 C CG   . ASP A 1 1  ? 0.392   24.110  -9.340  1.00 0.00 ? 1  ASP A CG   10 
ATOM 5389 O OD1  . ASP A 1 1  ? 0.643   23.698  -10.461 1.00 0.00 ? 1  ASP A OD1  10 
ATOM 5390 O OD2  . ASP A 1 1  ? -0.667  24.012  -8.740  1.00 0.00 ? 1  ASP A OD2  10 
ATOM 5391 H H1   . ASP A 1 1  ? 3.263   22.254  -9.342  1.00 0.00 ? 1  ASP A H1   10 
ATOM 5392 H H2   . ASP A 1 1  ? 3.008   23.725  -10.148 1.00 0.00 ? 1  ASP A H2   10 
ATOM 5393 H H3   . ASP A 1 1  ? 4.376   23.522  -9.160  1.00 0.00 ? 1  ASP A H3   10 
ATOM 5394 H HA   . ASP A 1 1  ? 3.288   24.273  -7.421  1.00 0.00 ? 1  ASP A HA   10 
ATOM 5395 H HB2  . ASP A 1 1  ? 1.144   25.380  -7.763  1.00 0.00 ? 1  ASP A HB2  10 
ATOM 5396 H HB3  . ASP A 1 1  ? 2.006   25.530  -9.280  1.00 0.00 ? 1  ASP A HB3  10 
ATOM 5397 N N    . ALA A 1 2  ? 0.910   22.952  -6.604  1.00 0.00 ? 2  ALA A N    10 
ATOM 5398 C CA   . ALA A 1 2  ? 0.143   21.930  -5.837  1.00 0.00 ? 2  ALA A CA   10 
ATOM 5399 C C    . ALA A 1 2  ? -1.343  22.272  -5.903  1.00 0.00 ? 2  ALA A C    10 
ATOM 5400 O O    . ALA A 1 2  ? -1.727  23.407  -5.699  1.00 0.00 ? 2  ALA A O    10 
ATOM 5401 C CB   . ALA A 1 2  ? 0.595   21.930  -4.373  1.00 0.00 ? 2  ALA A CB   10 
ATOM 5402 H H    . ALA A 1 2  ? 0.651   23.893  -6.524  1.00 0.00 ? 2  ALA A H    10 
ATOM 5403 H HA   . ALA A 1 2  ? 0.301   20.957  -6.280  1.00 0.00 ? 2  ALA A HA   10 
ATOM 5404 H HB1  . ALA A 1 2  ? 0.563   22.936  -3.978  1.00 0.00 ? 2  ALA A HB1  10 
ATOM 5405 H HB2  . ALA A 1 2  ? -0.064  21.307  -3.783  1.00 0.00 ? 2  ALA A HB2  10 
ATOM 5406 H HB3  . ALA A 1 2  ? 1.602   21.550  -4.292  1.00 0.00 ? 2  ALA A HB3  10 
ATOM 5407 N N    . GLU A 1 3  ? -2.132  21.269  -6.189  1.00 0.00 ? 3  GLU A N    10 
ATOM 5408 C CA   . GLU A 1 3  ? -3.603  21.456  -6.282  1.00 0.00 ? 3  GLU A CA   10 
ATOM 5409 C C    . GLU A 1 3  ? -4.155  21.431  -4.845  1.00 0.00 ? 3  GLU A C    10 
ATOM 5410 O O    . GLU A 1 3  ? -3.959  22.396  -4.133  1.00 0.00 ? 3  GLU A O    10 
ATOM 5411 C CB   . GLU A 1 3  ? -4.154  20.313  -7.164  1.00 0.00 ? 3  GLU A CB   10 
ATOM 5412 C CG   . GLU A 1 3  ? -5.596  20.645  -7.588  1.00 0.00 ? 3  GLU A CG   10 
ATOM 5413 C CD   . GLU A 1 3  ? -6.154  19.481  -8.420  1.00 0.00 ? 3  GLU A CD   10 
ATOM 5414 O OE1  . GLU A 1 3  ? -5.904  19.490  -9.615  1.00 0.00 ? 3  GLU A OE1  10 
ATOM 5415 O OE2  . GLU A 1 3  ? -6.800  18.643  -7.814  1.00 0.00 ? 3  GLU A OE2  10 
ATOM 5416 H H    . GLU A 1 3  ? -1.755  20.383  -6.347  1.00 0.00 ? 3  GLU A H    10 
ATOM 5417 H HA   . GLU A 1 3  ? -3.817  22.417  -6.729  1.00 0.00 ? 3  GLU A HA   10 
ATOM 5418 H HB2  . GLU A 1 3  ? -3.539  20.241  -8.050  1.00 0.00 ? 3  GLU A HB2  10 
ATOM 5419 H HB3  . GLU A 1 3  ? -4.114  19.363  -6.652  1.00 0.00 ? 3  GLU A HB3  10 
ATOM 5420 H HG2  . GLU A 1 3  ? -6.223  20.796  -6.720  1.00 0.00 ? 3  GLU A HG2  10 
ATOM 5421 H HG3  . GLU A 1 3  ? -5.612  21.547  -8.186  1.00 0.00 ? 3  GLU A HG3  10 
ATOM 5422 N N    . PHE A 1 4  ? -4.805  20.361  -4.446  1.00 0.00 ? 4  PHE A N    10 
ATOM 5423 C CA   . PHE A 1 4  ? -5.368  20.280  -3.059  1.00 0.00 ? 4  PHE A CA   10 
ATOM 5424 C C    . PHE A 1 4  ? -5.564  18.823  -2.606  1.00 0.00 ? 4  PHE A C    10 
ATOM 5425 O O    . PHE A 1 4  ? -6.617  18.241  -2.792  1.00 0.00 ? 4  PHE A O    10 
ATOM 5426 C CB   . PHE A 1 4  ? -6.729  21.026  -3.023  1.00 0.00 ? 4  PHE A CB   10 
ATOM 5427 C CG   . PHE A 1 4  ? -6.500  22.545  -2.966  1.00 0.00 ? 4  PHE A CG   10 
ATOM 5428 C CD1  . PHE A 1 4  ? -6.005  23.135  -1.817  1.00 0.00 ? 4  PHE A CD1  10 
ATOM 5429 C CD2  . PHE A 1 4  ? -6.782  23.339  -4.063  1.00 0.00 ? 4  PHE A CD2  10 
ATOM 5430 C CE1  . PHE A 1 4  ? -5.799  24.497  -1.765  1.00 0.00 ? 4  PHE A CE1  10 
ATOM 5431 C CE2  . PHE A 1 4  ? -6.576  24.701  -4.010  1.00 0.00 ? 4  PHE A CE2  10 
ATOM 5432 C CZ   . PHE A 1 4  ? -6.083  25.282  -2.861  1.00 0.00 ? 4  PHE A CZ   10 
ATOM 5433 H H    . PHE A 1 4  ? -4.921  19.607  -5.059  1.00 0.00 ? 4  PHE A H    10 
ATOM 5434 H HA   . PHE A 1 4  ? -4.674  20.750  -2.375  1.00 0.00 ? 4  PHE A HA   10 
ATOM 5435 H HB2  . PHE A 1 4  ? -7.305  20.787  -3.905  1.00 0.00 ? 4  PHE A HB2  10 
ATOM 5436 H HB3  . PHE A 1 4  ? -7.296  20.735  -2.151  1.00 0.00 ? 4  PHE A HB3  10 
ATOM 5437 H HD1  . PHE A 1 4  ? -5.776  22.529  -0.953  1.00 0.00 ? 4  PHE A HD1  10 
ATOM 5438 H HD2  . PHE A 1 4  ? -7.165  22.892  -4.968  1.00 0.00 ? 4  PHE A HD2  10 
ATOM 5439 H HE1  . PHE A 1 4  ? -5.413  24.951  -0.862  1.00 0.00 ? 4  PHE A HE1  10 
ATOM 5440 H HE2  . PHE A 1 4  ? -6.799  25.314  -4.871  1.00 0.00 ? 4  PHE A HE2  10 
ATOM 5441 H HZ   . PHE A 1 4  ? -5.922  26.348  -2.820  1.00 0.00 ? 4  PHE A HZ   10 
ATOM 5442 N N    . ARG A 1 5  ? -4.520  18.286  -2.022  1.00 0.00 ? 5  ARG A N    10 
ATOM 5443 C CA   . ARG A 1 5  ? -4.513  16.875  -1.505  1.00 0.00 ? 5  ARG A CA   10 
ATOM 5444 C C    . ARG A 1 5  ? -5.039  15.839  -2.514  1.00 0.00 ? 5  ARG A C    10 
ATOM 5445 O O    . ARG A 1 5  ? -5.513  14.778  -2.154  1.00 0.00 ? 5  ARG A O    10 
ATOM 5446 C CB   . ARG A 1 5  ? -5.360  16.839  -0.197  1.00 0.00 ? 5  ARG A CB   10 
ATOM 5447 C CG   . ARG A 1 5  ? -4.692  15.916  0.847   1.00 0.00 ? 5  ARG A CG   10 
ATOM 5448 C CD   . ARG A 1 5  ? -3.483  16.634  1.479   1.00 0.00 ? 5  ARG A CD   10 
ATOM 5449 N NE   . ARG A 1 5  ? -3.043  15.850  2.675   1.00 0.00 ? 5  ARG A NE   10 
ATOM 5450 C CZ   . ARG A 1 5  ? -1.947  16.155  3.324   1.00 0.00 ? 5  ARG A CZ   10 
ATOM 5451 N NH1  . ARG A 1 5  ? -1.204  17.159  2.936   1.00 0.00 ? 5  ARG A NH1  10 
ATOM 5452 N NH2  . ARG A 1 5  ? -1.623  15.430  4.358   1.00 0.00 ? 5  ARG A NH2  10 
ATOM 5453 H H    . ARG A 1 5  ? -3.713  18.831  -1.922  1.00 0.00 ? 5  ARG A H    10 
ATOM 5454 H HA   . ARG A 1 5  ? -3.486  16.622  -1.298  1.00 0.00 ? 5  ARG A HA   10 
ATOM 5455 H HB2  . ARG A 1 5  ? -5.449  17.837  0.210   1.00 0.00 ? 5  ARG A HB2  10 
ATOM 5456 H HB3  . ARG A 1 5  ? -6.357  16.481  -0.407  1.00 0.00 ? 5  ARG A HB3  10 
ATOM 5457 H HG2  . ARG A 1 5  ? -5.410  15.673  1.617   1.00 0.00 ? 5  ARG A HG2  10 
ATOM 5458 H HG3  . ARG A 1 5  ? -4.367  14.997  0.380   1.00 0.00 ? 5  ARG A HG3  10 
ATOM 5459 H HD2  . ARG A 1 5  ? -2.666  16.688  0.775   1.00 0.00 ? 5  ARG A HD2  10 
ATOM 5460 H HD3  . ARG A 1 5  ? -3.751  17.631  1.798   1.00 0.00 ? 5  ARG A HD3  10 
ATOM 5461 H HE   . ARG A 1 5  ? -3.587  15.094  2.980   1.00 0.00 ? 5  ARG A HE   10 
ATOM 5462 H HH11 . ARG A 1 5  ? -1.470  17.703  2.140   1.00 0.00 ? 5  ARG A HH11 10 
ATOM 5463 H HH12 . ARG A 1 5  ? -0.368  17.384  3.436   1.00 0.00 ? 5  ARG A HH12 10 
ATOM 5464 H HH21 . ARG A 1 5  ? -2.207  14.667  4.635   1.00 0.00 ? 5  ARG A HH21 10 
ATOM 5465 H HH22 . ARG A 1 5  ? -0.792  15.637  4.873   1.00 0.00 ? 5  ARG A HH22 10 
ATOM 5466 N N    . HIS A 1 6  ? -4.922  16.212  -3.758  1.00 0.00 ? 6  HIS A N    10 
ATOM 5467 C CA   . HIS A 1 6  ? -5.362  15.375  -4.901  1.00 0.00 ? 6  HIS A CA   10 
ATOM 5468 C C    . HIS A 1 6  ? -4.070  15.000  -5.618  1.00 0.00 ? 6  HIS A C    10 
ATOM 5469 O O    . HIS A 1 6  ? -3.248  14.296  -5.071  1.00 0.00 ? 6  HIS A O    10 
ATOM 5470 C CB   . HIS A 1 6  ? -6.332  16.246  -5.743  1.00 0.00 ? 6  HIS A CB   10 
ATOM 5471 C CG   . HIS A 1 6  ? -6.881  15.469  -6.953  1.00 0.00 ? 6  HIS A CG   10 
ATOM 5472 N ND1  . HIS A 1 6  ? -7.732  15.944  -7.803  1.00 0.00 ? 6  HIS A ND1  10 
ATOM 5473 C CD2  . HIS A 1 6  ? -6.635  14.183  -7.409  1.00 0.00 ? 6  HIS A CD2  10 
ATOM 5474 C CE1  . HIS A 1 6  ? -7.996  15.054  -8.705  1.00 0.00 ? 6  HIS A CE1  10 
ATOM 5475 N NE2  . HIS A 1 6  ? -7.336  13.943  -8.498  1.00 0.00 ? 6  HIS A NE2  10 
ATOM 5476 H H    . HIS A 1 6  ? -4.526  17.083  -3.948  1.00 0.00 ? 6  HIS A H    10 
ATOM 5477 H HA   . HIS A 1 6  ? -5.842  14.483  -4.574  1.00 0.00 ? 6  HIS A HA   10 
ATOM 5478 H HB2  . HIS A 1 6  ? -7.166  16.555  -5.130  1.00 0.00 ? 6  HIS A HB2  10 
ATOM 5479 H HB3  . HIS A 1 6  ? -5.820  17.128  -6.094  1.00 0.00 ? 6  HIS A HB3  10 
ATOM 5480 H HD1  . HIS A 1 6  ? -8.115  16.845  -7.769  1.00 0.00 ? 6  HIS A HD1  10 
ATOM 5481 H HD2  . HIS A 1 6  ? -5.966  13.478  -6.941  1.00 0.00 ? 6  HIS A HD2  10 
ATOM 5482 H HE1  . HIS A 1 6  ? -8.678  15.208  -9.527  1.00 0.00 ? 6  HIS A HE1  10 
ATOM 5483 N N    . ASP A 1 7  ? -3.932  15.487  -6.813  1.00 0.00 ? 7  ASP A N    10 
ATOM 5484 C CA   . ASP A 1 7  ? -2.729  15.229  -7.654  1.00 0.00 ? 7  ASP A CA   10 
ATOM 5485 C C    . ASP A 1 7  ? -1.528  16.076  -7.170  1.00 0.00 ? 7  ASP A C    10 
ATOM 5486 O O    . ASP A 1 7  ? -0.697  16.508  -7.945  1.00 0.00 ? 7  ASP A O    10 
ATOM 5487 C CB   . ASP A 1 7  ? -3.099  15.569  -9.113  1.00 0.00 ? 7  ASP A CB   10 
ATOM 5488 C CG   . ASP A 1 7  ? -4.007  16.813  -9.167  1.00 0.00 ? 7  ASP A CG   10 
ATOM 5489 O OD1  . ASP A 1 7  ? -3.454  17.892  -9.037  1.00 0.00 ? 7  ASP A OD1  10 
ATOM 5490 O OD2  . ASP A 1 7  ? -5.200  16.610  -9.331  1.00 0.00 ? 7  ASP A OD2  10 
ATOM 5491 H H    . ASP A 1 7  ? -4.657  16.036  -7.157  1.00 0.00 ? 7  ASP A H    10 
ATOM 5492 H HA   . ASP A 1 7  ? -2.474  14.185  -7.569  1.00 0.00 ? 7  ASP A HA   10 
ATOM 5493 H HB2  . ASP A 1 7  ? -2.199  15.774  -9.664  1.00 0.00 ? 7  ASP A HB2  10 
ATOM 5494 H HB3  . ASP A 1 7  ? -3.605  14.733  -9.575  1.00 0.00 ? 7  ASP A HB3  10 
ATOM 5495 N N    . SER A 1 8  ? -1.491  16.283  -5.879  1.00 0.00 ? 8  SER A N    10 
ATOM 5496 C CA   . SER A 1 8  ? -0.417  17.073  -5.215  1.00 0.00 ? 8  SER A CA   10 
ATOM 5497 C C    . SER A 1 8  ? -0.382  16.790  -3.700  1.00 0.00 ? 8  SER A C    10 
ATOM 5498 O O    . SER A 1 8  ? 0.050   17.619  -2.921  1.00 0.00 ? 8  SER A O    10 
ATOM 5499 C CB   . SER A 1 8  ? -0.684  18.564  -5.478  1.00 0.00 ? 8  SER A CB   10 
ATOM 5500 O OG   . SER A 1 8  ? -2.007  18.777  -5.000  1.00 0.00 ? 8  SER A OG   10 
ATOM 5501 H H    . SER A 1 8  ? -2.194  15.908  -5.326  1.00 0.00 ? 8  SER A H    10 
ATOM 5502 H HA   . SER A 1 8  ? 0.526   16.760  -5.627  1.00 0.00 ? 8  SER A HA   10 
ATOM 5503 H HB2  . SER A 1 8  ? 0.003   19.192  -4.934  1.00 0.00 ? 8  SER A HB2  10 
ATOM 5504 H HB3  . SER A 1 8  ? -0.642  18.793  -6.533  1.00 0.00 ? 8  SER A HB3  10 
ATOM 5505 H HG   . SER A 1 8  ? -1.975  19.464  -4.330  1.00 0.00 ? 8  SER A HG   10 
ATOM 5506 N N    . GLY A 1 9  ? -0.841  15.622  -3.327  1.00 0.00 ? 9  GLY A N    10 
ATOM 5507 C CA   . GLY A 1 9  ? -0.853  15.241  -1.878  1.00 0.00 ? 9  GLY A CA   10 
ATOM 5508 C C    . GLY A 1 9  ? -1.397  13.828  -1.631  1.00 0.00 ? 9  GLY A C    10 
ATOM 5509 O O    . GLY A 1 9  ? -1.142  13.250  -0.593  1.00 0.00 ? 9  GLY A O    10 
ATOM 5510 H H    . GLY A 1 9  ? -1.178  15.001  -4.006  1.00 0.00 ? 9  GLY A H    10 
ATOM 5511 H HA2  . GLY A 1 9  ? 0.157   15.291  -1.499  1.00 0.00 ? 9  GLY A HA2  10 
ATOM 5512 H HA3  . GLY A 1 9  ? -1.462  15.947  -1.334  1.00 0.00 ? 9  GLY A HA3  10 
ATOM 5513 N N    . TYR A 1 10 ? -2.129  13.312  -2.587  1.00 0.00 ? 10 TYR A N    10 
ATOM 5514 C CA   . TYR A 1 10 ? -2.720  11.943  -2.475  1.00 0.00 ? 10 TYR A CA   10 
ATOM 5515 C C    . TYR A 1 10 ? -1.654  10.905  -2.901  1.00 0.00 ? 10 TYR A C    10 
ATOM 5516 O O    . TYR A 1 10 ? -0.486  11.065  -2.602  1.00 0.00 ? 10 TYR A O    10 
ATOM 5517 C CB   . TYR A 1 10 ? -3.977  11.923  -3.396  1.00 0.00 ? 10 TYR A CB   10 
ATOM 5518 C CG   . TYR A 1 10 ? -5.037  10.860  -3.024  1.00 0.00 ? 10 TYR A CG   10 
ATOM 5519 C CD1  . TYR A 1 10 ? -4.758  9.733   -2.264  1.00 0.00 ? 10 TYR A CD1  10 
ATOM 5520 C CD2  . TYR A 1 10 ? -6.329  11.037  -3.486  1.00 0.00 ? 10 TYR A CD2  10 
ATOM 5521 C CE1  . TYR A 1 10 ? -5.745  8.814   -1.979  1.00 0.00 ? 10 TYR A CE1  10 
ATOM 5522 C CE2  . TYR A 1 10 ? -7.316  10.116  -3.199  1.00 0.00 ? 10 TYR A CE2  10 
ATOM 5523 C CZ   . TYR A 1 10 ? -7.030  8.998   -2.443  1.00 0.00 ? 10 TYR A CZ   10 
ATOM 5524 O OH   . TYR A 1 10 ? -8.015  8.075   -2.160  1.00 0.00 ? 10 TYR A OH   10 
ATOM 5525 H H    . TYR A 1 10 ? -2.307  13.818  -3.403  1.00 0.00 ? 10 TYR A H    10 
ATOM 5526 H HA   . TYR A 1 10 ? -3.002  11.759  -1.449  1.00 0.00 ? 10 TYR A HA   10 
ATOM 5527 H HB2  . TYR A 1 10 ? -4.454  12.890  -3.345  1.00 0.00 ? 10 TYR A HB2  10 
ATOM 5528 H HB3  . TYR A 1 10 ? -3.677  11.755  -4.420  1.00 0.00 ? 10 TYR A HB3  10 
ATOM 5529 H HD1  . TYR A 1 10 ? -3.764  9.561   -1.882  1.00 0.00 ? 10 TYR A HD1  10 
ATOM 5530 H HD2  . TYR A 1 10 ? -6.574  11.906  -4.079  1.00 0.00 ? 10 TYR A HD2  10 
ATOM 5531 H HE1  . TYR A 1 10 ? -5.504  7.941   -1.389  1.00 0.00 ? 10 TYR A HE1  10 
ATOM 5532 H HE2  . TYR A 1 10 ? -8.317  10.271  -3.573  1.00 0.00 ? 10 TYR A HE2  10 
ATOM 5533 H HH   . TYR A 1 10 ? -8.731  8.534   -1.716  1.00 0.00 ? 10 TYR A HH   10 
ATOM 5534 N N    . GLU A 1 11 ? -2.091  9.878   -3.584  1.00 0.00 ? 11 GLU A N    10 
ATOM 5535 C CA   . GLU A 1 11 ? -1.193  8.786   -4.069  1.00 0.00 ? 11 GLU A CA   10 
ATOM 5536 C C    . GLU A 1 11 ? -2.017  7.944   -5.048  1.00 0.00 ? 11 GLU A C    10 
ATOM 5537 O O    . GLU A 1 11 ? -1.535  7.549   -6.092  1.00 0.00 ? 11 GLU A O    10 
ATOM 5538 C CB   . GLU A 1 11 ? -0.730  7.912   -2.869  1.00 0.00 ? 11 GLU A CB   10 
ATOM 5539 C CG   . GLU A 1 11 ? 0.573   7.145   -3.219  1.00 0.00 ? 11 GLU A CG   10 
ATOM 5540 C CD   . GLU A 1 11 ? 0.239   5.724   -3.718  1.00 0.00 ? 11 GLU A CD   10 
ATOM 5541 O OE1  . GLU A 1 11 ? 0.025   4.879   -2.862  1.00 0.00 ? 11 GLU A OE1  10 
ATOM 5542 O OE2  . GLU A 1 11 ? 0.216   5.560   -4.928  1.00 0.00 ? 11 GLU A OE2  10 
ATOM 5543 H H    . GLU A 1 11 ? -3.046  9.817   -3.790  1.00 0.00 ? 11 GLU A H    10 
ATOM 5544 H HA   . GLU A 1 11 ? -0.355  9.224   -4.593  1.00 0.00 ? 11 GLU A HA   10 
ATOM 5545 H HB2  . GLU A 1 11 ? -0.537  8.544   -2.015  1.00 0.00 ? 11 GLU A HB2  10 
ATOM 5546 H HB3  . GLU A 1 11 ? -1.512  7.219   -2.595  1.00 0.00 ? 11 GLU A HB3  10 
ATOM 5547 H HG2  . GLU A 1 11 ? 1.137   7.665   -3.981  1.00 0.00 ? 11 GLU A HG2  10 
ATOM 5548 H HG3  . GLU A 1 11 ? 1.192   7.065   -2.337  1.00 0.00 ? 11 GLU A HG3  10 
ATOM 5549 N N    . VAL A 1 12 ? -3.246  7.704   -4.657  1.00 0.00 ? 12 VAL A N    10 
ATOM 5550 C CA   . VAL A 1 12 ? -4.193  6.899   -5.486  1.00 0.00 ? 12 VAL A CA   10 
ATOM 5551 C C    . VAL A 1 12 ? -5.603  7.501   -5.475  1.00 0.00 ? 12 VAL A C    10 
ATOM 5552 O O    . VAL A 1 12 ? -5.829  8.627   -5.088  1.00 0.00 ? 12 VAL A O    10 
ATOM 5553 C CB   . VAL A 1 12 ? -4.269  5.439   -4.931  1.00 0.00 ? 12 VAL A CB   10 
ATOM 5554 C CG1  . VAL A 1 12 ? -2.892  4.826   -4.801  1.00 0.00 ? 12 VAL A CG1  10 
ATOM 5555 C CG2  . VAL A 1 12 ? -4.964  5.396   -3.541  1.00 0.00 ? 12 VAL A CG2  10 
ATOM 5556 H H    . VAL A 1 12 ? -3.553  8.058   -3.798  1.00 0.00 ? 12 VAL A H    10 
ATOM 5557 H HA   . VAL A 1 12 ? -3.854  6.891   -6.508  1.00 0.00 ? 12 VAL A HA   10 
ATOM 5558 H HB   . VAL A 1 12 ? -4.831  4.823   -5.615  1.00 0.00 ? 12 VAL A HB   10 
ATOM 5559 H HG11 . VAL A 1 12 ? -2.358  4.879   -5.737  1.00 0.00 ? 12 VAL A HG11 10 
ATOM 5560 H HG12 . VAL A 1 12 ? -2.335  5.315   -4.021  1.00 0.00 ? 12 VAL A HG12 10 
ATOM 5561 H HG13 . VAL A 1 12 ? -3.026  3.793   -4.536  1.00 0.00 ? 12 VAL A HG13 10 
ATOM 5562 H HG21 . VAL A 1 12 ? -5.963  5.804   -3.593  1.00 0.00 ? 12 VAL A HG21 10 
ATOM 5563 H HG22 . VAL A 1 12 ? -5.042  4.373   -3.202  1.00 0.00 ? 12 VAL A HG22 10 
ATOM 5564 H HG23 . VAL A 1 12 ? -4.395  5.960   -2.817  1.00 0.00 ? 12 VAL A HG23 10 
ATOM 5565 N N    . HIS A 1 13 ? -6.478  6.653   -5.937  1.00 0.00 ? 13 HIS A N    10 
ATOM 5566 C CA   . HIS A 1 13 ? -7.941  6.876   -6.066  1.00 0.00 ? 13 HIS A CA   10 
ATOM 5567 C C    . HIS A 1 13 ? -8.559  5.453   -5.980  1.00 0.00 ? 13 HIS A C    10 
ATOM 5568 O O    . HIS A 1 13 ? -9.749  5.274   -6.152  1.00 0.00 ? 13 HIS A O    10 
ATOM 5569 C CB   . HIS A 1 13 ? -8.234  7.537   -7.425  1.00 0.00 ? 13 HIS A CB   10 
ATOM 5570 C CG   . HIS A 1 13 ? -7.683  8.969   -7.388  1.00 0.00 ? 13 HIS A CG   10 
ATOM 5571 N ND1  . HIS A 1 13 ? -6.566  9.348   -7.917  1.00 0.00 ? 13 HIS A ND1  10 
ATOM 5572 C CD2  . HIS A 1 13 ? -8.199  10.121  -6.819  1.00 0.00 ? 13 HIS A CD2  10 
ATOM 5573 C CE1  . HIS A 1 13 ? -6.390  10.613  -7.704  1.00 0.00 ? 13 HIS A CE1  10 
ATOM 5574 N NE2  . HIS A 1 13 ? -7.381  11.134  -7.025  1.00 0.00 ? 13 HIS A NE2  10 
ATOM 5575 H H    . HIS A 1 13 ? -6.136  5.787   -6.236  1.00 0.00 ? 13 HIS A H    10 
ATOM 5576 H HA   . HIS A 1 13 ? -8.296  7.472   -5.235  1.00 0.00 ? 13 HIS A HA   10 
ATOM 5577 H HB2  . HIS A 1 13 ? -7.754  6.994   -8.227  1.00 0.00 ? 13 HIS A HB2  10 
ATOM 5578 H HB3  . HIS A 1 13 ? -9.297  7.578   -7.611  1.00 0.00 ? 13 HIS A HB3  10 
ATOM 5579 H HD1  . HIS A 1 13 ? -5.946  8.765   -8.403  1.00 0.00 ? 13 HIS A HD1  10 
ATOM 5580 H HD2  . HIS A 1 13 ? -9.135  10.182  -6.283  1.00 0.00 ? 13 HIS A HD2  10 
ATOM 5581 H HE1  . HIS A 1 13 ? -5.531  11.171  -8.045  1.00 0.00 ? 13 HIS A HE1  10 
ATOM 5582 N N    . HIS A 1 14 ? -7.695  4.494   -5.709  1.00 0.00 ? 14 HIS A N    10 
ATOM 5583 C CA   . HIS A 1 14 ? -8.045  3.049   -5.578  1.00 0.00 ? 14 HIS A CA   10 
ATOM 5584 C C    . HIS A 1 14 ? -6.970  2.366   -4.706  1.00 0.00 ? 14 HIS A C    10 
ATOM 5585 O O    . HIS A 1 14 ? -5.783  2.487   -4.958  1.00 0.00 ? 14 HIS A O    10 
ATOM 5586 C CB   . HIS A 1 14 ? -8.068  2.411   -6.974  1.00 0.00 ? 14 HIS A CB   10 
ATOM 5587 C CG   . HIS A 1 14 ? -9.370  2.785   -7.660  1.00 0.00 ? 14 HIS A CG   10 
ATOM 5588 N ND1  . HIS A 1 14 ? -10.559 2.406   -7.328  1.00 0.00 ? 14 HIS A ND1  10 
ATOM 5589 C CD2  . HIS A 1 14 ? -9.552  3.591   -8.751  1.00 0.00 ? 14 HIS A CD2  10 
ATOM 5590 C CE1  . HIS A 1 14 ? -11.416 2.932   -8.144  1.00 0.00 ? 14 HIS A CE1  10 
ATOM 5591 N NE2  . HIS A 1 14 ? -10.832 3.679   -9.049  1.00 0.00 ? 14 HIS A NE2  10 
ATOM 5592 H H    . HIS A 1 14 ? -6.755  4.728   -5.581  1.00 0.00 ? 14 HIS A H    10 
ATOM 5593 H HA   . HIS A 1 14 ? -9.012  2.959   -5.105  1.00 0.00 ? 14 HIS A HA   10 
ATOM 5594 H HB2  . HIS A 1 14 ? -7.250  2.792   -7.568  1.00 0.00 ? 14 HIS A HB2  10 
ATOM 5595 H HB3  . HIS A 1 14 ? -7.997  1.339   -6.951  1.00 0.00 ? 14 HIS A HB3  10 
ATOM 5596 H HD1  . HIS A 1 14 ? -10.777 1.815   -6.578  1.00 0.00 ? 14 HIS A HD1  10 
ATOM 5597 H HD2  . HIS A 1 14 ? -8.734  4.066   -9.261  1.00 0.00 ? 14 HIS A HD2  10 
ATOM 5598 H HE1  . HIS A 1 14 ? -12.483 2.773   -8.085  1.00 0.00 ? 14 HIS A HE1  10 
ATOM 5599 N N    . GLN A 1 15 ? -7.409  1.657   -3.696  1.00 0.00 ? 15 GLN A N    10 
ATOM 5600 C CA   . GLN A 1 15 ? -6.449  0.949   -2.783  1.00 0.00 ? 15 GLN A CA   10 
ATOM 5601 C C    . GLN A 1 15 ? -5.583  -0.068  -3.561  1.00 0.00 ? 15 GLN A C    10 
ATOM 5602 O O    . GLN A 1 15 ? -4.591  -0.570  -3.069  1.00 0.00 ? 15 GLN A O    10 
ATOM 5603 C CB   . GLN A 1 15 ? -7.256  0.223   -1.688  1.00 0.00 ? 15 GLN A CB   10 
ATOM 5604 C CG   . GLN A 1 15 ? -6.370  -0.008  -0.444  1.00 0.00 ? 15 GLN A CG   10 
ATOM 5605 C CD   . GLN A 1 15 ? -7.024  -1.073  0.444   1.00 0.00 ? 15 GLN A CD   10 
ATOM 5606 O OE1  . GLN A 1 15 ? -6.735  -2.249  0.341   1.00 0.00 ? 15 GLN A OE1  10 
ATOM 5607 N NE2  . GLN A 1 15 ? -7.911  -0.704  1.327   1.00 0.00 ? 15 GLN A NE2  10 
ATOM 5608 H H    . GLN A 1 15 ? -8.373  1.587   -3.533  1.00 0.00 ? 15 GLN A H    10 
ATOM 5609 H HA   . GLN A 1 15 ? -5.803  1.691   -2.336  1.00 0.00 ? 15 GLN A HA   10 
ATOM 5610 H HB2  . GLN A 1 15 ? -8.110  0.825   -1.409  1.00 0.00 ? 15 GLN A HB2  10 
ATOM 5611 H HB3  . GLN A 1 15 ? -7.616  -0.723  -2.067  1.00 0.00 ? 15 GLN A HB3  10 
ATOM 5612 H HG2  . GLN A 1 15 ? -5.384  -0.350  -0.721  1.00 0.00 ? 15 GLN A HG2  10 
ATOM 5613 H HG3  . GLN A 1 15 ? -6.275  0.908   0.124   1.00 0.00 ? 15 GLN A HG3  10 
ATOM 5614 H HE21 . GLN A 1 15 ? -8.150  0.242   1.416   1.00 0.00 ? 15 GLN A HE21 10 
ATOM 5615 H HE22 . GLN A 1 15 ? -8.337  -1.374  1.901   1.00 0.00 ? 15 GLN A HE22 10 
ATOM 5616 N N    . LYS A 1 16 ? -5.985  -0.331  -4.777  1.00 0.00 ? 16 LYS A N    10 
ATOM 5617 C CA   . LYS A 1 16 ? -5.261  -1.292  -5.651  1.00 0.00 ? 16 LYS A CA   10 
ATOM 5618 C C    . LYS A 1 16 ? -3.935  -0.636  -5.995  1.00 0.00 ? 16 LYS A C    10 
ATOM 5619 O O    . LYS A 1 16 ? -2.869  -1.198  -5.841  1.00 0.00 ? 16 LYS A O    10 
ATOM 5620 C CB   . LYS A 1 16 ? -6.118  -1.544  -6.918  1.00 0.00 ? 16 LYS A CB   10 
ATOM 5621 C CG   . LYS A 1 16 ? -5.351  -2.396  -7.959  1.00 0.00 ? 16 LYS A CG   10 
ATOM 5622 C CD   . LYS A 1 16 ? -4.797  -3.666  -7.282  1.00 0.00 ? 16 LYS A CD   10 
ATOM 5623 C CE   . LYS A 1 16 ? -4.404  -4.707  -8.346  1.00 0.00 ? 16 LYS A CE   10 
ATOM 5624 N NZ   . LYS A 1 16 ? -5.624  -5.272  -8.994  1.00 0.00 ? 16 LYS A NZ   10 
ATOM 5625 H H    . LYS A 1 16 ? -6.770  0.125   -5.131  1.00 0.00 ? 16 LYS A H    10 
ATOM 5626 H HA   . LYS A 1 16 ? -5.084  -2.202  -5.100  1.00 0.00 ? 16 LYS A HA   10 
ATOM 5627 H HB2  . LYS A 1 16 ? -7.028  -2.056  -6.637  1.00 0.00 ? 16 LYS A HB2  10 
ATOM 5628 H HB3  . LYS A 1 16 ? -6.390  -0.599  -7.366  1.00 0.00 ? 16 LYS A HB3  10 
ATOM 5629 H HG2  . LYS A 1 16 ? -6.026  -2.665  -8.759  1.00 0.00 ? 16 LYS A HG2  10 
ATOM 5630 H HG3  . LYS A 1 16 ? -4.538  -1.821  -8.379  1.00 0.00 ? 16 LYS A HG3  10 
ATOM 5631 H HD2  . LYS A 1 16 ? -3.928  -3.397  -6.700  1.00 0.00 ? 16 LYS A HD2  10 
ATOM 5632 H HD3  . LYS A 1 16 ? -5.544  -4.069  -6.613  1.00 0.00 ? 16 LYS A HD3  10 
ATOM 5633 H HE2  . LYS A 1 16 ? -3.785  -4.256  -9.108  1.00 0.00 ? 16 LYS A HE2  10 
ATOM 5634 H HE3  . LYS A 1 16 ? -3.856  -5.516  -7.886  1.00 0.00 ? 16 LYS A HE3  10 
ATOM 5635 H HZ1  . LYS A 1 16 ? -6.473  -4.839  -8.577  1.00 0.00 ? 16 LYS A HZ1  10 
ATOM 5636 H HZ2  . LYS A 1 16 ? -5.597  -5.073  -10.015 1.00 0.00 ? 16 LYS A HZ2  10 
ATOM 5637 H HZ3  . LYS A 1 16 ? -5.651  -6.301  -8.843  1.00 0.00 ? 16 LYS A HZ3  10 
ATOM 5638 N N    . LEU A 1 17 ? -4.073  0.577   -6.452  1.00 0.00 ? 17 LEU A N    10 
ATOM 5639 C CA   . LEU A 1 17 ? -2.885  1.377   -6.839  1.00 0.00 ? 17 LEU A CA   10 
ATOM 5640 C C    . LEU A 1 17 ? -1.995  1.510   -5.598  1.00 0.00 ? 17 LEU A C    10 
ATOM 5641 O O    . LEU A 1 17 ? -0.791  1.519   -5.725  1.00 0.00 ? 17 LEU A O    10 
ATOM 5642 C CB   . LEU A 1 17 ? -3.365  2.747   -7.340  1.00 0.00 ? 17 LEU A CB   10 
ATOM 5643 C CG   . LEU A 1 17 ? -4.474  2.599   -8.416  1.00 0.00 ? 17 LEU A CG   10 
ATOM 5644 C CD1  . LEU A 1 17 ? -4.839  3.999   -8.935  1.00 0.00 ? 17 LEU A CD1  10 
ATOM 5645 C CD2  . LEU A 1 17 ? -4.009  1.718   -9.594  1.00 0.00 ? 17 LEU A CD2  10 
ATOM 5646 H H    . LEU A 1 17 ? -4.972  0.956   -6.537  1.00 0.00 ? 17 LEU A H    10 
ATOM 5647 H HA   . LEU A 1 17 ? -2.337  0.848   -7.605  1.00 0.00 ? 17 LEU A HA   10 
ATOM 5648 H HB2  . LEU A 1 17 ? -3.793  3.277   -6.510  1.00 0.00 ? 17 LEU A HB2  10 
ATOM 5649 H HB3  . LEU A 1 17 ? -2.530  3.314   -7.727  1.00 0.00 ? 17 LEU A HB3  10 
ATOM 5650 H HG   . LEU A 1 17 ? -5.347  2.147   -7.973  1.00 0.00 ? 17 LEU A HG   10 
ATOM 5651 H HD11 . LEU A 1 17 ? -5.157  4.626   -8.115  1.00 0.00 ? 17 LEU A HD11 10 
ATOM 5652 H HD12 . LEU A 1 17 ? -3.982  4.455   -9.411  1.00 0.00 ? 17 LEU A HD12 10 
ATOM 5653 H HD13 . LEU A 1 17 ? -5.643  3.929   -9.653  1.00 0.00 ? 17 LEU A HD13 10 
ATOM 5654 H HD21 . LEU A 1 17 ? -3.026  2.017   -9.926  1.00 0.00 ? 17 LEU A HD21 10 
ATOM 5655 H HD22 . LEU A 1 17 ? -3.979  0.682   -9.289  1.00 0.00 ? 17 LEU A HD22 10 
ATOM 5656 H HD23 . LEU A 1 17 ? -4.701  1.809   -10.418 1.00 0.00 ? 17 LEU A HD23 10 
ATOM 5657 N N    . VAL A 1 18 ? -2.588  1.608   -4.430  1.00 0.00 ? 18 VAL A N    10 
ATOM 5658 C CA   . VAL A 1 18 ? -1.761  1.731   -3.183  1.00 0.00 ? 18 VAL A CA   10 
ATOM 5659 C C    . VAL A 1 18 ? -0.858  0.482   -3.096  1.00 0.00 ? 18 VAL A C    10 
ATOM 5660 O O    . VAL A 1 18 ? 0.350   0.596   -3.045  1.00 0.00 ? 18 VAL A O    10 
ATOM 5661 C CB   . VAL A 1 18 ? -2.746  1.851   -1.956  1.00 0.00 ? 18 VAL A CB   10 
ATOM 5662 C CG1  . VAL A 1 18 ? -2.271  1.082   -0.705  1.00 0.00 ? 18 VAL A CG1  10 
ATOM 5663 C CG2  . VAL A 1 18 ? -2.881  3.329   -1.551  1.00 0.00 ? 18 VAL A CG2  10 
ATOM 5664 H H    . VAL A 1 18 ? -3.568  1.613   -4.379  1.00 0.00 ? 18 VAL A H    10 
ATOM 5665 H HA   . VAL A 1 18 ? -1.135  2.607   -3.266  1.00 0.00 ? 18 VAL A HA   10 
ATOM 5666 H HB   . VAL A 1 18 ? -3.719  1.487   -2.236  1.00 0.00 ? 18 VAL A HB   10 
ATOM 5667 H HG11 . VAL A 1 18 ? -1.307  1.452   -0.391  1.00 0.00 ? 18 VAL A HG11 10 
ATOM 5668 H HG12 . VAL A 1 18 ? -2.976  1.229   0.100   1.00 0.00 ? 18 VAL A HG12 10 
ATOM 5669 H HG13 . VAL A 1 18 ? -2.200  0.025   -0.902  1.00 0.00 ? 18 VAL A HG13 10 
ATOM 5670 H HG21 . VAL A 1 18 ? -3.047  3.943   -2.417  1.00 0.00 ? 18 VAL A HG21 10 
ATOM 5671 H HG22 . VAL A 1 18 ? -3.717  3.451   -0.879  1.00 0.00 ? 18 VAL A HG22 10 
ATOM 5672 H HG23 . VAL A 1 18 ? -1.982  3.668   -1.057  1.00 0.00 ? 18 VAL A HG23 10 
ATOM 5673 N N    . PHE A 1 19 ? -1.469  -0.677  -3.095  1.00 0.00 ? 19 PHE A N    10 
ATOM 5674 C CA   . PHE A 1 19 ? -0.703  -1.966  -3.015  1.00 0.00 ? 19 PHE A CA   10 
ATOM 5675 C C    . PHE A 1 19 ? 0.438   -1.956  -4.039  1.00 0.00 ? 19 PHE A C    10 
ATOM 5676 O O    . PHE A 1 19 ? 1.579   -2.238  -3.728  1.00 0.00 ? 19 PHE A O    10 
ATOM 5677 C CB   . PHE A 1 19 ? -1.677  -3.134  -3.296  1.00 0.00 ? 19 PHE A CB   10 
ATOM 5678 C CG   . PHE A 1 19 ? -2.255  -3.655  -1.968  1.00 0.00 ? 19 PHE A CG   10 
ATOM 5679 C CD1  . PHE A 1 19 ? -3.050  -2.843  -1.178  1.00 0.00 ? 19 PHE A CD1  10 
ATOM 5680 C CD2  . PHE A 1 19 ? -1.985  -4.944  -1.543  1.00 0.00 ? 19 PHE A CD2  10 
ATOM 5681 C CE1  . PHE A 1 19 ? -3.567  -3.309  0.012   1.00 0.00 ? 19 PHE A CE1  10 
ATOM 5682 C CE2  . PHE A 1 19 ? -2.502  -5.411  -0.352  1.00 0.00 ? 19 PHE A CE2  10 
ATOM 5683 C CZ   . PHE A 1 19 ? -3.293  -4.594  0.426   1.00 0.00 ? 19 PHE A CZ   10 
ATOM 5684 H H    . PHE A 1 19 ? -2.444  -0.693  -3.146  1.00 0.00 ? 19 PHE A H    10 
ATOM 5685 H HA   . PHE A 1 19 ? -0.275  -2.052  -2.030  1.00 0.00 ? 19 PHE A HA   10 
ATOM 5686 H HB2  . PHE A 1 19 ? -2.494  -2.806  -3.921  1.00 0.00 ? 19 PHE A HB2  10 
ATOM 5687 H HB3  . PHE A 1 19 ? -1.164  -3.943  -3.796  1.00 0.00 ? 19 PHE A HB3  10 
ATOM 5688 H HD1  . PHE A 1 19 ? -3.271  -1.835  -1.492  1.00 0.00 ? 19 PHE A HD1  10 
ATOM 5689 H HD2  . PHE A 1 19 ? -1.366  -5.592  -2.146  1.00 0.00 ? 19 PHE A HD2  10 
ATOM 5690 H HE1  . PHE A 1 19 ? -4.186  -2.666  0.620   1.00 0.00 ? 19 PHE A HE1  10 
ATOM 5691 H HE2  . PHE A 1 19 ? -2.286  -6.419  -0.029  1.00 0.00 ? 19 PHE A HE2  10 
ATOM 5692 H HZ   . PHE A 1 19 ? -3.698  -4.960  1.358   1.00 0.00 ? 19 PHE A HZ   10 
ATOM 5693 N N    . PHE A 1 20 ? 0.071   -1.614  -5.246  1.00 0.00 ? 20 PHE A N    10 
ATOM 5694 C CA   . PHE A 1 20 ? 1.046   -1.544  -6.366  1.00 0.00 ? 20 PHE A CA   10 
ATOM 5695 C C    . PHE A 1 20 ? 2.207   -0.613  -5.951  1.00 0.00 ? 20 PHE A C    10 
ATOM 5696 O O    . PHE A 1 20 ? 3.358   -0.992  -6.004  1.00 0.00 ? 20 PHE A O    10 
ATOM 5697 C CB   . PHE A 1 20 ? 0.246   -1.033  -7.599  1.00 0.00 ? 20 PHE A CB   10 
ATOM 5698 C CG   . PHE A 1 20 ? 1.115   -0.188  -8.533  1.00 0.00 ? 20 PHE A CG   10 
ATOM 5699 C CD1  . PHE A 1 20 ? 2.002   -0.798  -9.395  1.00 0.00 ? 20 PHE A CD1  10 
ATOM 5700 C CD2  . PHE A 1 20 ? 1.022   1.189   -8.515  1.00 0.00 ? 20 PHE A CD2  10 
ATOM 5701 C CE1  . PHE A 1 20 ? 2.788   -0.038  -10.232 1.00 0.00 ? 20 PHE A CE1  10 
ATOM 5702 C CE2  . PHE A 1 20 ? 1.806   1.951   -9.350  1.00 0.00 ? 20 PHE A CE2  10 
ATOM 5703 C CZ   . PHE A 1 20 ? 2.692   1.338   -10.212 1.00 0.00 ? 20 PHE A CZ   10 
ATOM 5704 H H    . PHE A 1 20 ? -0.865  -1.399  -5.425  1.00 0.00 ? 20 PHE A H    10 
ATOM 5705 H HA   . PHE A 1 20 ? 1.433   -2.536  -6.555  1.00 0.00 ? 20 PHE A HA   10 
ATOM 5706 H HB2  . PHE A 1 20 ? -0.142  -1.873  -8.157  1.00 0.00 ? 20 PHE A HB2  10 
ATOM 5707 H HB3  . PHE A 1 20 ? -0.593  -0.434  -7.276  1.00 0.00 ? 20 PHE A HB3  10 
ATOM 5708 H HD1  . PHE A 1 20 ? 2.079   -1.875  -9.416  1.00 0.00 ? 20 PHE A HD1  10 
ATOM 5709 H HD2  . PHE A 1 20 ? 0.330   1.678   -7.847  1.00 0.00 ? 20 PHE A HD2  10 
ATOM 5710 H HE1  . PHE A 1 20 ? 3.477   -0.529  -10.901 1.00 0.00 ? 20 PHE A HE1  10 
ATOM 5711 H HE2  . PHE A 1 20 ? 1.719   3.026   -9.321  1.00 0.00 ? 20 PHE A HE2  10 
ATOM 5712 H HZ   . PHE A 1 20 ? 3.310   1.933   -10.869 1.00 0.00 ? 20 PHE A HZ   10 
ATOM 5713 N N    . ALA A 1 21 ? 1.864   0.581   -5.535  1.00 0.00 ? 21 ALA A N    10 
ATOM 5714 C CA   . ALA A 1 21 ? 2.882   1.591   -5.101  1.00 0.00 ? 21 ALA A CA   10 
ATOM 5715 C C    . ALA A 1 21 ? 3.851   1.006   -4.073  1.00 0.00 ? 21 ALA A C    10 
ATOM 5716 O O    . ALA A 1 21 ? 5.041   1.191   -4.196  1.00 0.00 ? 21 ALA A O    10 
ATOM 5717 C CB   . ALA A 1 21 ? 2.148   2.803   -4.504  1.00 0.00 ? 21 ALA A CB   10 
ATOM 5718 H H    . ALA A 1 21 ? 0.918   0.819   -5.508  1.00 0.00 ? 21 ALA A H    10 
ATOM 5719 H HA   . ALA A 1 21 ? 3.460   1.886   -5.967  1.00 0.00 ? 21 ALA A HA   10 
ATOM 5720 H HB1  . ALA A 1 21 ? 1.306   3.068   -5.125  1.00 0.00 ? 21 ALA A HB1  10 
ATOM 5721 H HB2  . ALA A 1 21 ? 1.791   2.585   -3.509  1.00 0.00 ? 21 ALA A HB2  10 
ATOM 5722 H HB3  . ALA A 1 21 ? 2.818   3.649   -4.453  1.00 0.00 ? 21 ALA A HB3  10 
ATOM 5723 N N    . GLU A 1 22 ? 3.340   0.317   -3.090  1.00 0.00 ? 22 GLU A N    10 
ATOM 5724 C CA   . GLU A 1 22 ? 4.242   -0.288  -2.051  1.00 0.00 ? 22 GLU A CA   10 
ATOM 5725 C C    . GLU A 1 22 ? 5.247   -1.228  -2.736  1.00 0.00 ? 22 GLU A C    10 
ATOM 5726 O O    . GLU A 1 22 ? 6.440   -1.115  -2.533  1.00 0.00 ? 22 GLU A O    10 
ATOM 5727 C CB   . GLU A 1 22 ? 3.407   -1.090  -1.028  1.00 0.00 ? 22 GLU A CB   10 
ATOM 5728 C CG   . GLU A 1 22 ? 2.865   -0.151  0.070   1.00 0.00 ? 22 GLU A CG   10 
ATOM 5729 C CD   . GLU A 1 22 ? 1.541   0.469   -0.401  1.00 0.00 ? 22 GLU A CD   10 
ATOM 5730 O OE1  . GLU A 1 22 ? 0.558   -0.251  -0.331  1.00 0.00 ? 22 GLU A OE1  10 
ATOM 5731 O OE2  . GLU A 1 22 ? 1.588   1.620   -0.806  1.00 0.00 ? 22 GLU A OE2  10 
ATOM 5732 H H    . GLU A 1 22 ? 2.369   0.223   -3.056  1.00 0.00 ? 22 GLU A H    10 
ATOM 5733 H HA   . GLU A 1 22 ? 4.800   0.508   -1.578  1.00 0.00 ? 22 GLU A HA   10 
ATOM 5734 H HB2  . GLU A 1 22 ? 2.592   -1.592  -1.528  1.00 0.00 ? 22 GLU A HB2  10 
ATOM 5735 H HB3  . GLU A 1 22 ? 4.029   -1.842  -0.560  1.00 0.00 ? 22 GLU A HB3  10 
ATOM 5736 H HG2  . GLU A 1 22 ? 2.682   -0.714  0.975   1.00 0.00 ? 22 GLU A HG2  10 
ATOM 5737 H HG3  . GLU A 1 22 ? 3.574   0.634   0.296   1.00 0.00 ? 22 GLU A HG3  10 
ATOM 5738 N N    . ASP A 1 23 ? 4.719   -2.124  -3.535  1.00 0.00 ? 23 ASP A N    10 
ATOM 5739 C CA   . ASP A 1 23 ? 5.575   -3.109  -4.278  1.00 0.00 ? 23 ASP A CA   10 
ATOM 5740 C C    . ASP A 1 23 ? 6.729   -2.370  -4.956  1.00 0.00 ? 23 ASP A C    10 
ATOM 5741 O O    . ASP A 1 23 ? 7.891   -2.677  -4.788  1.00 0.00 ? 23 ASP A O    10 
ATOM 5742 C CB   . ASP A 1 23 ? 4.742   -3.817  -5.359  1.00 0.00 ? 23 ASP A CB   10 
ATOM 5743 C CG   . ASP A 1 23 ? 5.587   -4.934  -5.998  1.00 0.00 ? 23 ASP A CG   10 
ATOM 5744 O OD1  . ASP A 1 23 ? 5.721   -5.961  -5.354  1.00 0.00 ? 23 ASP A OD1  10 
ATOM 5745 O OD2  . ASP A 1 23 ? 6.056   -4.691  -7.099  1.00 0.00 ? 23 ASP A OD2  10 
ATOM 5746 H H    . ASP A 1 23 ? 3.748   -2.143  -3.642  1.00 0.00 ? 23 ASP A H    10 
ATOM 5747 H HA   . ASP A 1 23 ? 5.975   -3.823  -3.573  1.00 0.00 ? 23 ASP A HA   10 
ATOM 5748 H HB2  . ASP A 1 23 ? 3.834   -4.226  -4.953  1.00 0.00 ? 23 ASP A HB2  10 
ATOM 5749 H HB3  . ASP A 1 23 ? 4.463   -3.112  -6.129  1.00 0.00 ? 23 ASP A HB3  10 
ATOM 5750 N N    . VAL A 1 24 ? 6.309   -1.395  -5.709  1.00 0.00 ? 24 VAL A N    10 
ATOM 5751 C CA   . VAL A 1 24 ? 7.210   -0.508  -6.491  1.00 0.00 ? 24 VAL A CA   10 
ATOM 5752 C C    . VAL A 1 24 ? 8.274   0.116   -5.585  1.00 0.00 ? 24 VAL A C    10 
ATOM 5753 O O    . VAL A 1 24 ? 9.455   0.015   -5.843  1.00 0.00 ? 24 VAL A O    10 
ATOM 5754 C CB   . VAL A 1 24 ? 6.288   0.541   -7.146  1.00 0.00 ? 24 VAL A CB   10 
ATOM 5755 C CG1  . VAL A 1 24 ? 7.074   1.552   -7.974  1.00 0.00 ? 24 VAL A CG1  10 
ATOM 5756 C CG2  . VAL A 1 24 ? 5.247   -0.179  -8.034  1.00 0.00 ? 24 VAL A CG2  10 
ATOM 5757 H H    . VAL A 1 24 ? 5.346   -1.237  -5.762  1.00 0.00 ? 24 VAL A H    10 
ATOM 5758 H HA   . VAL A 1 24 ? 7.706   -1.103  -7.242  1.00 0.00 ? 24 VAL A HA   10 
ATOM 5759 H HB   . VAL A 1 24 ? 5.761   1.085   -6.380  1.00 0.00 ? 24 VAL A HB   10 
ATOM 5760 H HG11 . VAL A 1 24 ? 7.685   1.040   -8.700  1.00 0.00 ? 24 VAL A HG11 10 
ATOM 5761 H HG12 . VAL A 1 24 ? 6.380   2.206   -8.482  1.00 0.00 ? 24 VAL A HG12 10 
ATOM 5762 H HG13 . VAL A 1 24 ? 7.697   2.144   -7.322  1.00 0.00 ? 24 VAL A HG13 10 
ATOM 5763 H HG21 . VAL A 1 24 ? 5.128   -1.212  -7.738  1.00 0.00 ? 24 VAL A HG21 10 
ATOM 5764 H HG22 . VAL A 1 24 ? 4.293   0.313   -7.921  1.00 0.00 ? 24 VAL A HG22 10 
ATOM 5765 H HG23 . VAL A 1 24 ? 5.541   -0.158  -9.070  1.00 0.00 ? 24 VAL A HG23 10 
ATOM 5766 N N    . GLY A 1 25 ? 7.803   0.740   -4.541  1.00 0.00 ? 25 GLY A N    10 
ATOM 5767 C CA   . GLY A 1 25 ? 8.700   1.410   -3.547  1.00 0.00 ? 25 GLY A CA   10 
ATOM 5768 C C    . GLY A 1 25 ? 9.835   0.468   -3.146  1.00 0.00 ? 25 GLY A C    10 
ATOM 5769 O O    . GLY A 1 25 ? 10.995  0.827   -3.189  1.00 0.00 ? 25 GLY A O    10 
ATOM 5770 H H    . GLY A 1 25 ? 6.834   0.759   -4.421  1.00 0.00 ? 25 GLY A H    10 
ATOM 5771 H HA2  . GLY A 1 25 ? 9.112   2.305   -3.990  1.00 0.00 ? 25 GLY A HA2  10 
ATOM 5772 H HA3  . GLY A 1 25 ? 8.125   1.670   -2.670  1.00 0.00 ? 25 GLY A HA3  10 
ATOM 5773 N N    . SER A 1 26 ? 9.439   -0.718  -2.767  1.00 0.00 ? 26 SER A N    10 
ATOM 5774 C CA   . SER A 1 26 ? 10.420  -1.762  -2.345  1.00 0.00 ? 26 SER A CA   10 
ATOM 5775 C C    . SER A 1 26 ? 11.366  -2.147  -3.495  1.00 0.00 ? 26 SER A C    10 
ATOM 5776 O O    . SER A 1 26 ? 12.565  -1.981  -3.408  1.00 0.00 ? 26 SER A O    10 
ATOM 5777 C CB   . SER A 1 26 ? 9.643   -3.006  -1.867  1.00 0.00 ? 26 SER A CB   10 
ATOM 5778 O OG   . SER A 1 26 ? 8.722   -2.502  -0.909  1.00 0.00 ? 26 SER A OG   10 
ATOM 5779 H H    . SER A 1 26 ? 8.479   -0.911  -2.760  1.00 0.00 ? 26 SER A H    10 
ATOM 5780 H HA   . SER A 1 26 ? 11.007  -1.368  -1.534  1.00 0.00 ? 26 SER A HA   10 
ATOM 5781 H HB2  . SER A 1 26 ? 9.097   -3.479  -2.670  1.00 0.00 ? 26 SER A HB2  10 
ATOM 5782 H HB3  . SER A 1 26 ? 10.299  -3.721  -1.391  1.00 0.00 ? 26 SER A HB3  10 
ATOM 5783 H HG   . SER A 1 26 ? 8.905   -2.927  -0.068  1.00 0.00 ? 26 SER A HG   10 
ATOM 5784 N N    . ASN A 1 27 ? 10.782  -2.642  -4.552  1.00 0.00 ? 27 ASN A N    10 
ATOM 5785 C CA   . ASN A 1 27 ? 11.546  -3.075  -5.756  1.00 0.00 ? 27 ASN A CA   10 
ATOM 5786 C C    . ASN A 1 27 ? 12.378  -1.953  -6.371  1.00 0.00 ? 27 ASN A C    10 
ATOM 5787 O O    . ASN A 1 27 ? 13.589  -1.977  -6.285  1.00 0.00 ? 27 ASN A O    10 
ATOM 5788 C CB   . ASN A 1 27 ? 10.522  -3.622  -6.768  1.00 0.00 ? 27 ASN A CB   10 
ATOM 5789 C CG   . ASN A 1 27 ? 9.984   -4.976  -6.278  1.00 0.00 ? 27 ASN A CG   10 
ATOM 5790 O OD1  . ASN A 1 27 ? 10.717  -5.933  -6.129  1.00 0.00 ? 27 ASN A OD1  10 
ATOM 5791 N ND2  . ASN A 1 27 ? 8.711   -5.096  -6.018  1.00 0.00 ? 27 ASN A ND2  10 
ATOM 5792 H H    . ASN A 1 27 ? 9.812   -2.728  -4.560  1.00 0.00 ? 27 ASN A H    10 
ATOM 5793 H HA   . ASN A 1 27 ? 12.244  -3.831  -5.439  1.00 0.00 ? 27 ASN A HA   10 
ATOM 5794 H HB2  . ASN A 1 27 ? 9.695   -2.935  -6.869  1.00 0.00 ? 27 ASN A HB2  10 
ATOM 5795 H HB3  . ASN A 1 27 ? 10.978  -3.752  -7.733  1.00 0.00 ? 27 ASN A HB3  10 
ATOM 5796 H HD21 . ASN A 1 27 ? 8.111   -4.331  -6.137  1.00 0.00 ? 27 ASN A HD21 10 
ATOM 5797 H HD22 . ASN A 1 27 ? 8.352   -5.952  -5.704  1.00 0.00 ? 27 ASN A HD22 10 
ATOM 5798 N N    . LYS A 1 28 ? 11.715  -1.001  -6.974  1.00 0.00 ? 28 LYS A N    10 
ATOM 5799 C CA   . LYS A 1 28 ? 12.421  0.154   -7.610  1.00 0.00 ? 28 LYS A CA   10 
ATOM 5800 C C    . LYS A 1 28 ? 13.406  0.744   -6.591  1.00 0.00 ? 28 LYS A C    10 
ATOM 5801 O O    . LYS A 1 28 ? 14.478  1.172   -6.955  1.00 0.00 ? 28 LYS A O    10 
ATOM 5802 C CB   . LYS A 1 28 ? 11.373  1.210   -8.031  1.00 0.00 ? 28 LYS A CB   10 
ATOM 5803 C CG   . LYS A 1 28 ? 11.541  1.521   -9.528  1.00 0.00 ? 28 LYS A CG   10 
ATOM 5804 C CD   . LYS A 1 28 ? 10.482  2.552   -9.989  1.00 0.00 ? 28 LYS A CD   10 
ATOM 5805 C CE   . LYS A 1 28 ? 10.850  3.970   -9.497  1.00 0.00 ? 28 LYS A CE   10 
ATOM 5806 N NZ   . LYS A 1 28 ? 10.318  4.194   -8.122  1.00 0.00 ? 28 LYS A NZ   10 
ATOM 5807 H H    . LYS A 1 28 ? 10.740  -1.049  -7.005  1.00 0.00 ? 28 LYS A H    10 
ATOM 5808 H HA   . LYS A 1 28 ? 12.988  -0.205  -8.462  1.00 0.00 ? 28 LYS A HA   10 
ATOM 5809 H HB2  . LYS A 1 28 ? 10.375  0.830   -7.870  1.00 0.00 ? 28 LYS A HB2  10 
ATOM 5810 H HB3  . LYS A 1 28 ? 11.496  2.109   -7.446  1.00 0.00 ? 28 LYS A HB3  10 
ATOM 5811 H HG2  . LYS A 1 28 ? 12.539  1.893   -9.711  1.00 0.00 ? 28 LYS A HG2  10 
ATOM 5812 H HG3  . LYS A 1 28 ? 11.407  0.606   -10.087 1.00 0.00 ? 28 LYS A HG3  10 
ATOM 5813 H HD2  . LYS A 1 28 ? 10.441  2.555   -11.069 1.00 0.00 ? 28 LYS A HD2  10 
ATOM 5814 H HD3  . LYS A 1 28 ? 9.506   2.275   -9.617  1.00 0.00 ? 28 LYS A HD3  10 
ATOM 5815 H HE2  . LYS A 1 28 ? 11.922  4.109   -9.480  1.00 0.00 ? 28 LYS A HE2  10 
ATOM 5816 H HE3  . LYS A 1 28 ? 10.415  4.708   -10.154 1.00 0.00 ? 28 LYS A HE3  10 
ATOM 5817 H HZ1  . LYS A 1 28 ? 9.816   3.343   -7.799  1.00 0.00 ? 28 LYS A HZ1  10 
ATOM 5818 H HZ2  . LYS A 1 28 ? 11.106  4.396   -7.475  1.00 0.00 ? 28 LYS A HZ2  10 
ATOM 5819 H HZ3  . LYS A 1 28 ? 9.662   5.002   -8.131  1.00 0.00 ? 28 LYS A HZ3  10 
ATOM 5820 N N    . GLY A 1 29 ? 13.017  0.738   -5.340  1.00 0.00 ? 29 GLY A N    10 
ATOM 5821 C CA   . GLY A 1 29 ? 13.901  1.284   -4.267  1.00 0.00 ? 29 GLY A CA   10 
ATOM 5822 C C    . GLY A 1 29 ? 15.241  0.539   -4.284  1.00 0.00 ? 29 GLY A C    10 
ATOM 5823 O O    . GLY A 1 29 ? 16.285  1.135   -4.470  1.00 0.00 ? 29 GLY A O    10 
ATOM 5824 H H    . GLY A 1 29 ? 12.140  0.369   -5.115  1.00 0.00 ? 29 GLY A H    10 
ATOM 5825 H HA2  . GLY A 1 29 ? 14.068  2.338   -4.439  1.00 0.00 ? 29 GLY A HA2  10 
ATOM 5826 H HA3  . GLY A 1 29 ? 13.432  1.143   -3.306  1.00 0.00 ? 29 GLY A HA3  10 
ATOM 5827 N N    . ALA A 1 30 ? 15.172  -0.758  -4.100  1.00 0.00 ? 30 ALA A N    10 
ATOM 5828 C CA   . ALA A 1 30 ? 16.424  -1.583  -4.097  1.00 0.00 ? 30 ALA A CA   10 
ATOM 5829 C C    . ALA A 1 30 ? 17.194  -1.400  -5.409  1.00 0.00 ? 30 ALA A C    10 
ATOM 5830 O O    . ALA A 1 30 ? 18.393  -1.218  -5.414  1.00 0.00 ? 30 ALA A O    10 
ATOM 5831 C CB   . ALA A 1 30 ? 16.041  -3.057  -3.912  1.00 0.00 ? 30 ALA A CB   10 
ATOM 5832 H H    . ALA A 1 30 ? 14.299  -1.191  -3.967  1.00 0.00 ? 30 ALA A H    10 
ATOM 5833 H HA   . ALA A 1 30 ? 17.054  -1.241  -3.288  1.00 0.00 ? 30 ALA A HA   10 
ATOM 5834 H HB1  . ALA A 1 30 ? 15.509  -3.185  -2.981  1.00 0.00 ? 30 ALA A HB1  10 
ATOM 5835 H HB2  . ALA A 1 30 ? 15.407  -3.385  -4.723  1.00 0.00 ? 30 ALA A HB2  10 
ATOM 5836 H HB3  . ALA A 1 30 ? 16.930  -3.671  -3.892  1.00 0.00 ? 30 ALA A HB3  10 
ATOM 5837 N N    . ILE A 1 31 ? 16.465  -1.448  -6.489  1.00 0.00 ? 31 ILE A N    10 
ATOM 5838 C CA   . ILE A 1 31 ? 17.041  -1.289  -7.853  1.00 0.00 ? 31 ILE A CA   10 
ATOM 5839 C C    . ILE A 1 31 ? 17.891  -0.014  -7.910  1.00 0.00 ? 31 ILE A C    10 
ATOM 5840 O O    . ILE A 1 31 ? 19.056  -0.062  -8.255  1.00 0.00 ? 31 ILE A O    10 
ATOM 5841 C CB   . ILE A 1 31 ? 15.812  -1.284  -8.805  1.00 0.00 ? 31 ILE A CB   10 
ATOM 5842 C CG1  . ILE A 1 31 ? 15.327  -2.754  -8.958  1.00 0.00 ? 31 ILE A CG1  10 
ATOM 5843 C CG2  . ILE A 1 31 ? 16.121  -0.651  -10.172 1.00 0.00 ? 31 ILE A CG2  10 
ATOM 5844 C CD1  . ILE A 1 31 ? 14.040  -2.845  -9.803  1.00 0.00 ? 31 ILE A CD1  10 
ATOM 5845 H H    . ILE A 1 31 ? 15.504  -1.596  -6.410  1.00 0.00 ? 31 ILE A H    10 
ATOM 5846 H HA   . ILE A 1 31 ? 17.701  -2.124  -8.039  1.00 0.00 ? 31 ILE A HA   10 
ATOM 5847 H HB   . ILE A 1 31 ? 15.025  -0.713  -8.343  1.00 0.00 ? 31 ILE A HB   10 
ATOM 5848 H HG12 . ILE A 1 31 ? 16.109  -3.342  -9.411  1.00 0.00 ? 31 ILE A HG12 10 
ATOM 5849 H HG13 . ILE A 1 31 ? 15.126  -3.169  -7.982  1.00 0.00 ? 31 ILE A HG13 10 
ATOM 5850 H HG21 . ILE A 1 31 ? 16.913  -1.189  -10.666 1.00 0.00 ? 31 ILE A HG21 10 
ATOM 5851 H HG22 . ILE A 1 31 ? 15.235  -0.670  -10.790 1.00 0.00 ? 31 ILE A HG22 10 
ATOM 5852 H HG23 . ILE A 1 31 ? 16.410  0.381   -10.040 1.00 0.00 ? 31 ILE A HG23 10 
ATOM 5853 H HD11 . ILE A 1 31 ? 13.332  -2.084  -9.509  1.00 0.00 ? 31 ILE A HD11 10 
ATOM 5854 H HD12 . ILE A 1 31 ? 14.271  -2.723  -10.851 1.00 0.00 ? 31 ILE A HD12 10 
ATOM 5855 H HD13 . ILE A 1 31 ? 13.581  -3.813  -9.663  1.00 0.00 ? 31 ILE A HD13 10 
ATOM 5856 N N    . ILE A 1 32 ? 17.291  1.095   -7.566  1.00 0.00 ? 32 ILE A N    10 
ATOM 5857 C CA   . ILE A 1 32 ? 18.024  2.394   -7.580  1.00 0.00 ? 32 ILE A CA   10 
ATOM 5858 C C    . ILE A 1 32 ? 19.271  2.273   -6.703  1.00 0.00 ? 32 ILE A C    10 
ATOM 5859 O O    . ILE A 1 32 ? 20.344  2.655   -7.118  1.00 0.00 ? 32 ILE A O    10 
ATOM 5860 C CB   . ILE A 1 32 ? 17.073  3.500   -7.052  1.00 0.00 ? 32 ILE A CB   10 
ATOM 5861 C CG1  . ILE A 1 32 ? 15.877  3.626   -8.034  1.00 0.00 ? 32 ILE A CG1  10 
ATOM 5862 C CG2  . ILE A 1 32 ? 17.823  4.855   -6.981  1.00 0.00 ? 32 ILE A CG2  10 
ATOM 5863 C CD1  . ILE A 1 32 ? 14.670  4.276   -7.330  1.00 0.00 ? 32 ILE A CD1  10 
ATOM 5864 H H    . ILE A 1 32 ? 16.351  1.077   -7.301  1.00 0.00 ? 32 ILE A H    10 
ATOM 5865 H HA   . ILE A 1 32 ? 18.344  2.593   -8.589  1.00 0.00 ? 32 ILE A HA   10 
ATOM 5866 H HB   . ILE A 1 32 ? 16.721  3.230   -6.067  1.00 0.00 ? 32 ILE A HB   10 
ATOM 5867 H HG12 . ILE A 1 32 ? 16.166  4.215   -8.888  1.00 0.00 ? 32 ILE A HG12 10 
ATOM 5868 H HG13 . ILE A 1 32 ? 15.591  2.651   -8.395  1.00 0.00 ? 32 ILE A HG13 10 
ATOM 5869 H HG21 . ILE A 1 32 ? 18.322  5.059   -7.918  1.00 0.00 ? 32 ILE A HG21 10 
ATOM 5870 H HG22 . ILE A 1 32 ? 17.129  5.659   -6.778  1.00 0.00 ? 32 ILE A HG22 10 
ATOM 5871 H HG23 . ILE A 1 32 ? 18.560  4.834   -6.192  1.00 0.00 ? 32 ILE A HG23 10 
ATOM 5872 H HD11 . ILE A 1 32 ? 14.497  3.814   -6.369  1.00 0.00 ? 32 ILE A HD11 10 
ATOM 5873 H HD12 . ILE A 1 32 ? 14.845  5.332   -7.183  1.00 0.00 ? 32 ILE A HD12 10 
ATOM 5874 H HD13 . ILE A 1 32 ? 13.784  4.154   -7.935  1.00 0.00 ? 32 ILE A HD13 10 
ATOM 5875 N N    . GLY A 1 33 ? 19.098  1.739   -5.522  1.00 0.00 ? 33 GLY A N    10 
ATOM 5876 C CA   . GLY A 1 33 ? 20.260  1.574   -4.592  1.00 0.00 ? 33 GLY A CA   10 
ATOM 5877 C C    . GLY A 1 33 ? 21.410  0.843   -5.299  1.00 0.00 ? 33 GLY A C    10 
ATOM 5878 O O    . GLY A 1 33 ? 22.540  1.289   -5.286  1.00 0.00 ? 33 GLY A O    10 
ATOM 5879 H H    . GLY A 1 33 ? 18.202  1.451   -5.254  1.00 0.00 ? 33 GLY A H    10 
ATOM 5880 H HA2  . GLY A 1 33 ? 20.599  2.551   -4.275  1.00 0.00 ? 33 GLY A HA2  10 
ATOM 5881 H HA3  . GLY A 1 33 ? 19.948  1.002   -3.731  1.00 0.00 ? 33 GLY A HA3  10 
ATOM 5882 N N    . LEU A 1 34 ? 21.085  -0.267  -5.912  1.00 0.00 ? 34 LEU A N    10 
ATOM 5883 C CA   . LEU A 1 34 ? 22.122  -1.064  -6.636  1.00 0.00 ? 34 LEU A CA   10 
ATOM 5884 C C    . LEU A 1 34 ? 22.785  -0.220  -7.735  1.00 0.00 ? 34 LEU A C    10 
ATOM 5885 O O    . LEU A 1 34 ? 23.997  -0.173  -7.823  1.00 0.00 ? 34 LEU A O    10 
ATOM 5886 C CB   . LEU A 1 34 ? 21.444  -2.314  -7.248  1.00 0.00 ? 34 LEU A CB   10 
ATOM 5887 C CG   . LEU A 1 34 ? 20.846  -3.209  -6.119  1.00 0.00 ? 34 LEU A CG   10 
ATOM 5888 C CD1  . LEU A 1 34 ? 19.716  -4.088  -6.696  1.00 0.00 ? 34 LEU A CD1  10 
ATOM 5889 C CD2  . LEU A 1 34 ? 21.937  -4.122  -5.530  1.00 0.00 ? 34 LEU A CD2  10 
ATOM 5890 H H    . LEU A 1 34 ? 20.155  -0.575  -5.891  1.00 0.00 ? 34 LEU A H    10 
ATOM 5891 H HA   . LEU A 1 34 ? 22.885  -1.340  -5.924  1.00 0.00 ? 34 LEU A HA   10 
ATOM 5892 H HB2  . LEU A 1 34 ? 20.655  -1.997  -7.915  1.00 0.00 ? 34 LEU A HB2  10 
ATOM 5893 H HB3  . LEU A 1 34 ? 22.165  -2.875  -7.823  1.00 0.00 ? 34 LEU A HB3  10 
ATOM 5894 H HG   . LEU A 1 34 ? 20.442  -2.599  -5.325  1.00 0.00 ? 34 LEU A HG   10 
ATOM 5895 H HD11 . LEU A 1 34 ? 20.031  -4.549  -7.623  1.00 0.00 ? 34 LEU A HD11 10 
ATOM 5896 H HD12 . LEU A 1 34 ? 19.447  -4.865  -5.995  1.00 0.00 ? 34 LEU A HD12 10 
ATOM 5897 H HD13 . LEU A 1 34 ? 18.841  -3.486  -6.887  1.00 0.00 ? 34 LEU A HD13 10 
ATOM 5898 H HD21 . LEU A 1 34 ? 22.357  -4.751  -6.301  1.00 0.00 ? 34 LEU A HD21 10 
ATOM 5899 H HD22 . LEU A 1 34 ? 22.721  -3.523  -5.097  1.00 0.00 ? 34 LEU A HD22 10 
ATOM 5900 H HD23 . LEU A 1 34 ? 21.520  -4.751  -4.757  1.00 0.00 ? 34 LEU A HD23 10 
ATOM 5901 N N    . MET A 1 35 ? 21.968  0.423   -8.534  1.00 0.00 ? 35 MET A N    10 
ATOM 5902 C CA   . MET A 1 35 ? 22.487  1.286   -9.647  1.00 0.00 ? 35 MET A CA   10 
ATOM 5903 C C    . MET A 1 35 ? 23.485  2.319   -9.100  1.00 0.00 ? 35 MET A C    10 
ATOM 5904 O O    . MET A 1 35 ? 24.578  2.469   -9.613  1.00 0.00 ? 35 MET A O    10 
ATOM 5905 C CB   . MET A 1 35 ? 21.297  2.005   -10.316 1.00 0.00 ? 35 MET A CB   10 
ATOM 5906 C CG   . MET A 1 35 ? 20.414  0.992   -11.070 1.00 0.00 ? 35 MET A CG   10 
ATOM 5907 S SD   . MET A 1 35 ? 18.707  1.494   -11.408 1.00 0.00 ? 35 MET A SD   10 
ATOM 5908 C CE   . MET A 1 35 ? 18.341  0.316   -12.733 1.00 0.00 ? 35 MET A CE   10 
ATOM 5909 H H    . MET A 1 35 ? 21.002  0.335   -8.405  1.00 0.00 ? 35 MET A H    10 
ATOM 5910 H HA   . MET A 1 35 ? 22.996  0.658   -10.360 1.00 0.00 ? 35 MET A HA   10 
ATOM 5911 H HB2  . MET A 1 35 ? 20.703  2.509   -9.568  1.00 0.00 ? 35 MET A HB2  10 
ATOM 5912 H HB3  . MET A 1 35 ? 21.664  2.743   -11.013 1.00 0.00 ? 35 MET A HB3  10 
ATOM 5913 H HG2  . MET A 1 35 ? 20.889  0.777   -12.017 1.00 0.00 ? 35 MET A HG2  10 
ATOM 5914 H HG3  . MET A 1 35 ? 20.372  0.068   -10.511 1.00 0.00 ? 35 MET A HG3  10 
ATOM 5915 H HE1  . MET A 1 35 ? 18.604  -0.683  -12.417 1.00 0.00 ? 35 MET A HE1  10 
ATOM 5916 H HE2  . MET A 1 35 ? 17.286  0.352   -12.963 1.00 0.00 ? 35 MET A HE2  10 
ATOM 5917 H HE3  . MET A 1 35 ? 18.908  0.576   -13.615 1.00 0.00 ? 35 MET A HE3  10 
ATOM 5918 N N    . VAL A 1 36 ? 23.050  2.990   -8.065  1.00 0.00 ? 36 VAL A N    10 
ATOM 5919 C CA   . VAL A 1 36 ? 23.866  4.039   -7.382  1.00 0.00 ? 36 VAL A CA   10 
ATOM 5920 C C    . VAL A 1 36 ? 25.215  3.438   -6.957  1.00 0.00 ? 36 VAL A C    10 
ATOM 5921 O O    . VAL A 1 36 ? 26.249  4.013   -7.236  1.00 0.00 ? 36 VAL A O    10 
ATOM 5922 C CB   . VAL A 1 36 ? 23.054  4.555   -6.155  1.00 0.00 ? 36 VAL A CB   10 
ATOM 5923 C CG1  . VAL A 1 36 ? 23.941  5.426   -5.232  1.00 0.00 ? 36 VAL A CG1  10 
ATOM 5924 C CG2  . VAL A 1 36 ? 21.869  5.413   -6.658  1.00 0.00 ? 36 VAL A CG2  10 
ATOM 5925 H H    . VAL A 1 36 ? 22.156  2.798   -7.731  1.00 0.00 ? 36 VAL A H    10 
ATOM 5926 H HA   . VAL A 1 36 ? 24.048  4.845   -8.079  1.00 0.00 ? 36 VAL A HA   10 
ATOM 5927 H HB   . VAL A 1 36 ? 22.662  3.719   -5.591  1.00 0.00 ? 36 VAL A HB   10 
ATOM 5928 H HG11 . VAL A 1 36 ? 24.492  6.152   -5.813  1.00 0.00 ? 36 VAL A HG11 10 
ATOM 5929 H HG12 . VAL A 1 36 ? 23.330  5.949   -4.511  1.00 0.00 ? 36 VAL A HG12 10 
ATOM 5930 H HG13 . VAL A 1 36 ? 24.643  4.803   -4.697  1.00 0.00 ? 36 VAL A HG13 10 
ATOM 5931 H HG21 . VAL A 1 36 ? 21.358  4.918   -7.471  1.00 0.00 ? 36 VAL A HG21 10 
ATOM 5932 H HG22 . VAL A 1 36 ? 21.164  5.574   -5.855  1.00 0.00 ? 36 VAL A HG22 10 
ATOM 5933 H HG23 . VAL A 1 36 ? 22.222  6.372   -7.009  1.00 0.00 ? 36 VAL A HG23 10 
ATOM 5934 N N    . GLY A 1 37 ? 25.157  2.307   -6.294  1.00 0.00 ? 37 GLY A N    10 
ATOM 5935 C CA   . GLY A 1 37 ? 26.408  1.628   -5.835  1.00 0.00 ? 37 GLY A CA   10 
ATOM 5936 C C    . GLY A 1 37 ? 27.361  1.405   -7.018  1.00 0.00 ? 37 GLY A C    10 
ATOM 5937 O O    . GLY A 1 37 ? 28.502  1.823   -6.983  1.00 0.00 ? 37 GLY A O    10 
ATOM 5938 H H    . GLY A 1 37 ? 24.288  1.902   -6.091  1.00 0.00 ? 37 GLY A H    10 
ATOM 5939 H HA2  . GLY A 1 37 ? 26.894  2.243   -5.090  1.00 0.00 ? 37 GLY A HA2  10 
ATOM 5940 H HA3  . GLY A 1 37 ? 26.151  0.675   -5.399  1.00 0.00 ? 37 GLY A HA3  10 
ATOM 5941 N N    . GLY A 1 38 ? 26.850  0.748   -8.029  1.00 0.00 ? 38 GLY A N    10 
ATOM 5942 C CA   . GLY A 1 38 ? 27.653  0.454   -9.259  1.00 0.00 ? 38 GLY A CA   10 
ATOM 5943 C C    . GLY A 1 38 ? 28.415  -0.863  -9.084  1.00 0.00 ? 38 GLY A C    10 
ATOM 5944 O O    . GLY A 1 38 ? 28.618  -1.601  -10.028 1.00 0.00 ? 38 GLY A O    10 
ATOM 5945 H H    . GLY A 1 38 ? 25.926  0.439   -7.974  1.00 0.00 ? 38 GLY A H    10 
ATOM 5946 H HA2  . GLY A 1 38 ? 26.982  0.368   -10.101 1.00 0.00 ? 38 GLY A HA2  10 
ATOM 5947 H HA3  . GLY A 1 38 ? 28.356  1.254   -9.441  1.00 0.00 ? 38 GLY A HA3  10 
ATOM 5948 N N    . VAL A 1 39 ? 28.807  -1.095  -7.858  1.00 0.00 ? 39 VAL A N    10 
ATOM 5949 C CA   . VAL A 1 39 ? 29.562  -2.320  -7.470  1.00 0.00 ? 39 VAL A CA   10 
ATOM 5950 C C    . VAL A 1 39 ? 28.758  -3.000  -6.347  1.00 0.00 ? 39 VAL A C    10 
ATOM 5951 O O    . VAL A 1 39 ? 29.294  -3.697  -5.506  1.00 0.00 ? 39 VAL A O    10 
ATOM 5952 C CB   . VAL A 1 39 ? 30.988  -1.903  -6.978  1.00 0.00 ? 39 VAL A CB   10 
ATOM 5953 C CG1  . VAL A 1 39 ? 31.931  -3.129  -6.999  1.00 0.00 ? 39 VAL A CG1  10 
ATOM 5954 C CG2  . VAL A 1 39 ? 31.582  -0.811  -7.902  1.00 0.00 ? 39 VAL A CG2  10 
ATOM 5955 H H    . VAL A 1 39 ? 28.596  -0.442  -7.165  1.00 0.00 ? 39 VAL A H    10 
ATOM 5956 H HA   . VAL A 1 39 ? 29.603  -2.987  -8.312  1.00 0.00 ? 39 VAL A HA   10 
ATOM 5957 H HB   . VAL A 1 39 ? 30.923  -1.513  -5.972  1.00 0.00 ? 39 VAL A HB   10 
ATOM 5958 H HG11 . VAL A 1 39 ? 31.968  -3.559  -7.991  1.00 0.00 ? 39 VAL A HG11 10 
ATOM 5959 H HG12 . VAL A 1 39 ? 32.931  -2.835  -6.714  1.00 0.00 ? 39 VAL A HG12 10 
ATOM 5960 H HG13 . VAL A 1 39 ? 31.591  -3.885  -6.308  1.00 0.00 ? 39 VAL A HG13 10 
ATOM 5961 H HG21 . VAL A 1 39 ? 31.503  -1.107  -8.938  1.00 0.00 ? 39 VAL A HG21 10 
ATOM 5962 H HG22 . VAL A 1 39 ? 31.052  0.121   -7.764  1.00 0.00 ? 39 VAL A HG22 10 
ATOM 5963 H HG23 . VAL A 1 39 ? 32.625  -0.647  -7.666  1.00 0.00 ? 39 VAL A HG23 10 
ATOM 5964 N N    . VAL A 1 40 ? 27.472  -2.757  -6.390  1.00 0.00 ? 40 VAL A N    10 
ATOM 5965 C CA   . VAL A 1 40 ? 26.517  -3.320  -5.390  1.00 0.00 ? 40 VAL A CA   10 
ATOM 5966 C C    . VAL A 1 40 ? 25.285  -3.837  -6.157  1.00 0.00 ? 40 VAL A C    10 
ATOM 5967 O O    . VAL A 1 40 ? 24.953  -4.988  -5.929  1.00 0.00 ? 40 VAL A O    10 
ATOM 5968 C CB   . VAL A 1 40 ? 26.105  -2.201  -4.385  1.00 0.00 ? 40 VAL A CB   10 
ATOM 5969 C CG1  . VAL A 1 40 ? 25.281  -2.813  -3.231  1.00 0.00 ? 40 VAL A CG1  10 
ATOM 5970 C CG2  . VAL A 1 40 ? 27.362  -1.522  -3.792  1.00 0.00 ? 40 VAL A CG2  10 
ATOM 5971 O OXT  . VAL A 1 40 ? 24.748  -3.054  -6.926  1.00 0.00 ? 40 VAL A OXT  10 
ATOM 5972 H H    . VAL A 1 40 ? 27.122  -2.185  -7.103  1.00 0.00 ? 40 VAL A H    10 
ATOM 5973 H HA   . VAL A 1 40 ? 26.986  -4.143  -4.868  1.00 0.00 ? 40 VAL A HA   10 
ATOM 5974 H HB   . VAL A 1 40 ? 25.506  -1.457  -4.891  1.00 0.00 ? 40 VAL A HB   10 
ATOM 5975 H HG11 . VAL A 1 40 ? 25.837  -3.604  -2.747  1.00 0.00 ? 40 VAL A HG11 10 
ATOM 5976 H HG12 . VAL A 1 40 ? 25.048  -2.054  -2.499  1.00 0.00 ? 40 VAL A HG12 10 
ATOM 5977 H HG13 . VAL A 1 40 ? 24.355  -3.222  -3.607  1.00 0.00 ? 40 VAL A HG13 10 
ATOM 5978 H HG21 . VAL A 1 40 ? 28.036  -2.263  -3.386  1.00 0.00 ? 40 VAL A HG21 10 
ATOM 5979 H HG22 . VAL A 1 40 ? 27.880  -0.960  -4.557  1.00 0.00 ? 40 VAL A HG22 10 
ATOM 5980 H HG23 . VAL A 1 40 ? 27.079  -0.841  -3.003  1.00 0.00 ? 40 VAL A HG23 10 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  ASP 1  1  1  ASP ASP A . n 
A 1 2  ALA 2  2  2  ALA ALA A . n 
A 1 3  GLU 3  3  3  GLU GLU A . n 
A 1 4  PHE 4  4  4  PHE PHE A . n 
A 1 5  ARG 5  5  5  ARG ARG A . n 
A 1 6  HIS 6  6  6  HIS HIS A . n 
A 1 7  ASP 7  7  7  ASP ASP A . n 
A 1 8  SER 8  8  8  SER SER A . n 
A 1 9  GLY 9  9  9  GLY GLY A . n 
A 1 10 TYR 10 10 10 TYR TYR A . n 
A 1 11 GLU 11 11 11 GLU GLU A . n 
A 1 12 VAL 12 12 12 VAL VAL A . n 
A 1 13 HIS 13 13 13 HIS HIS A . n 
A 1 14 HIS 14 14 14 HIS HIS A . n 
A 1 15 GLN 15 15 15 GLN GLN A . n 
A 1 16 LYS 16 16 16 LYS LYS A . n 
A 1 17 LEU 17 17 17 LEU LEU A . n 
A 1 18 VAL 18 18 18 VAL VAL A . n 
A 1 19 PHE 19 19 19 PHE PHE A . n 
A 1 20 PHE 20 20 20 PHE PHE A . n 
A 1 21 ALA 21 21 21 ALA ALA A . n 
A 1 22 GLU 22 22 22 GLU GLU A . n 
A 1 23 ASP 23 23 23 ASP ASP A . n 
A 1 24 VAL 24 24 24 VAL VAL A . n 
A 1 25 GLY 25 25 25 GLY GLY A . n 
A 1 26 SER 26 26 26 SER SER A . n 
A 1 27 ASN 27 27 27 ASN ASN A . n 
A 1 28 LYS 28 28 28 LYS LYS A . n 
A 1 29 GLY 29 29 29 GLY GLY A . n 
A 1 30 ALA 30 30 30 ALA ALA A . n 
A 1 31 ILE 31 31 31 ILE ILE A . n 
A 1 32 ILE 32 32 32 ILE ILE A . n 
A 1 33 GLY 33 33 33 GLY GLY A . n 
A 1 34 LEU 34 34 34 LEU LEU A . n 
A 1 35 MET 35 35 35 MET MET A . n 
A 1 36 VAL 36 36 36 VAL VAL A . n 
A 1 37 GLY 37 37 37 GLY GLY A . n 
A 1 38 GLY 38 38 38 GLY GLY A . n 
A 1 39 VAL 39 39 39 VAL VAL A . n 
A 1 40 VAL 40 40 40 VAL VAL A . n 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1998-06-17 
2 'Structure model' 1 1 2008-03-24 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
X-PLOR 'model building' . ? 1 
X-PLOR refinement       . ? 2 
X-PLOR phasing          . ? 3 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1  PHE A 4  ? ? 176.64  103.89  
2  1  HIS A 6  ? ? 38.85   35.19   
3  1  GLU A 11 ? ? 69.64   -78.65  
4  1  HIS A 13 ? ? -63.42  -74.88  
5  1  LYS A 28 ? ? -36.60  -39.64  
6  1  VAL A 39 ? ? -96.83  33.60   
7  2  HIS A 6  ? ? 38.25   29.04   
8  3  PHE A 4  ? ? 60.67   99.03   
9  3  HIS A 6  ? ? -87.92  42.81   
10 3  HIS A 13 ? ? -115.53 65.60   
11 4  PHE A 4  ? ? -162.77 92.94   
12 4  ARG A 5  ? ? -156.78 27.74   
13 4  HIS A 6  ? ? -161.09 48.52   
14 4  GLU A 11 ? ? -166.32 -6.01   
15 4  VAL A 39 ? ? -92.22  33.60   
16 5  PHE A 4  ? ? -147.51 59.09   
17 5  ASP A 7  ? ? -65.45  -158.57 
18 5  HIS A 13 ? ? -86.62  -78.97  
19 6  GLU A 3  ? ? -102.90 48.06   
20 6  ARG A 5  ? ? 52.86   72.77   
21 6  HIS A 6  ? ? 34.25   39.35   
22 6  SER A 8  ? ? 47.35   -160.11 
23 6  TYR A 10 ? ? 62.22   140.21  
24 6  HIS A 13 ? ? -75.11  -73.52  
25 6  HIS A 14 ? ? -148.56 14.65   
26 6  VAL A 39 ? ? -91.40  31.74   
27 7  ARG A 5  ? ? -146.04 37.92   
28 7  HIS A 6  ? ? -154.47 18.18   
29 7  VAL A 12 ? ? -78.59  -152.41 
30 7  HIS A 13 ? ? -120.59 -82.88  
31 7  HIS A 14 ? ? -148.84 17.40   
32 8  ARG A 5  ? ? 64.42   82.00   
33 8  HIS A 6  ? ? -88.85  48.97   
34 8  GLU A 11 ? ? 62.96   107.14  
35 8  HIS A 13 ? ? -74.27  -73.86  
36 8  HIS A 14 ? ? -148.48 11.52   
37 8  ASN A 27 ? ? -61.60  -73.89  
38 9  ALA A 2  ? ? -157.33 75.32   
39 9  HIS A 6  ? ? -80.98  33.46   
40 9  TYR A 10 ? ? -157.58 -67.50  
41 9  GLU A 11 ? ? -168.61 -48.90  
42 9  VAL A 12 ? ? -74.45  -166.77 
43 9  HIS A 13 ? ? -61.23  -89.81  
44 9  HIS A 14 ? ? -154.13 2.84    
45 9  ASN A 27 ? ? -57.30  -71.75  
46 10 GLU A 3  ? ? -81.09  -105.77 
47 10 PHE A 4  ? ? -156.85 88.65   
48 10 ARG A 5  ? ? 48.66   24.90   
49 10 HIS A 6  ? ? -113.08 -114.23 
50 10 ASP A 7  ? ? -75.86  33.32   
51 10 SER A 8  ? ? -162.47 26.16   
52 10 TYR A 10 ? ? -83.65  -142.00 
53 10 GLU A 11 ? ? -168.74 -42.39  
54 10 HIS A 13 ? ? -153.21 5.62    
55 10 ASN A 27 ? ? -58.53  -70.66  
#