data_1BC8
# 
_entry.id   1BC8 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1BC8         
RCSB  PD0020       
WWPDB D_1000171581 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1BC8 
_pdbx_database_status.recvd_initial_deposition_date   1998-05-05 
_pdbx_database_status.deposit_site                    BNL 
_pdbx_database_status.process_site                    NDB 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Mo, Y.'          1 
'Vaessen, B.'     2 
'Johnston, K.'    3 
'Marmorstein, R.' 4 
# 
_citation.id                        primary 
_citation.title                     
;Structures of SAP-1 bound to DNA targets from the E74 and c-fos promoters: insights into DNA sequence discrimination by Ets proteins.
;
_citation.journal_abbrev            Mol.Cell 
_citation.journal_volume            2 
_citation.page_first                201 
_citation.page_last                 212 
_citation.year                      1998 
_citation.journal_id_ASTM           MOCEFL 
_citation.country                   US 
_citation.journal_id_ISSN           1097-2765 
_citation.journal_id_CSD            2168 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   9734357 
_citation.pdbx_database_id_DOI      '10.1016/S1097-2765(00)80130-6' 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Mo, Y.'          1 
primary 'Vaessen, B.'     2 
primary 'Johnston, K.'    3 
primary 'Marmorstein, R.' 4 
# 
_cell.entry_id           1BC8 
_cell.length_a           31.590 
_cell.length_b           55.670 
_cell.length_c           44.230 
_cell.angle_alpha        90.00 
_cell.angle_beta         107.16 
_cell.angle_gamma        90.00 
_cell.Z_PDB              2 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1BC8 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     monoclinic 
_symmetry.Int_Tables_number                4 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     syn 
;DNA (5'-D(*TP*AP*CP*CP*GP*GP*AP*AP*GP*T)-3')
;
3069.029  1   ? ? ?                           ? 
2 polymer     syn 
;DNA (5'-D(*AP*AP*CP*TP*TP*CP*CP*GP*GP*T)-3')
;
3019.991  1   ? ? ?                           ? 
3 polymer     man 'PROTEIN (SAP-1 ETS DOMAIN)'                   11219.207 1   ? ? 'ETS DOMAIN, RESIDUES 1-93' ? 
4 non-polymer syn 'ZINC ION'                                     65.409    2   ? ? ?                           ? 
5 water       nat water                                          18.015    160 ? ? ?                           ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'E74 DNA FRAGMENT' 
2 'E74 DNA FRAGMENT' 
3 SAP-1              
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no no '(DT)(DA)(DC)(DC)(DG)(DG)(DA)(DA)(DG)(DT)'                                                       
TACCGGAAGT                                                                                       A ? 
2 polydeoxyribonucleotide no no '(DA)(DA)(DC)(DT)(DT)(DC)(DC)(DG)(DG)(DT)'                                                       
AACTTCCGGT                                                                                       B ? 
3 'polypeptide(L)'        no no 
;MDSAITLWQFLLQLLQKPQNKHMICWTSNDGQFKLLQAEEVARLWGIRKNKPNMNYDKLSRALRYYYVKNIIKKVNGQKF
VYKFVSYPEILNM
;
;MDSAITLWQFLLQLLQKPQNKHMICWTSNDGQFKLLQAEEVARLWGIRKNKPNMNYDKLSRALRYYYVKNIIKKVNGQKF
VYKFVSYPEILNM
;
C ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  DT  n 
1 2  DA  n 
1 3  DC  n 
1 4  DC  n 
1 5  DG  n 
1 6  DG  n 
1 7  DA  n 
1 8  DA  n 
1 9  DG  n 
1 10 DT  n 
2 1  DA  n 
2 2  DA  n 
2 3  DC  n 
2 4  DT  n 
2 5  DT  n 
2 6  DC  n 
2 7  DC  n 
2 8  DG  n 
2 9  DG  n 
2 10 DT  n 
3 1  MET n 
3 2  ASP n 
3 3  SER n 
3 4  ALA n 
3 5  ILE n 
3 6  THR n 
3 7  LEU n 
3 8  TRP n 
3 9  GLN n 
3 10 PHE n 
3 11 LEU n 
3 12 LEU n 
3 13 GLN n 
3 14 LEU n 
3 15 LEU n 
3 16 GLN n 
3 17 LYS n 
3 18 PRO n 
3 19 GLN n 
3 20 ASN n 
3 21 LYS n 
3 22 HIS n 
3 23 MET n 
3 24 ILE n 
3 25 CYS n 
3 26 TRP n 
3 27 THR n 
3 28 SER n 
3 29 ASN n 
3 30 ASP n 
3 31 GLY n 
3 32 GLN n 
3 33 PHE n 
3 34 LYS n 
3 35 LEU n 
3 36 LEU n 
3 37 GLN n 
3 38 ALA n 
3 39 GLU n 
3 40 GLU n 
3 41 VAL n 
3 42 ALA n 
3 43 ARG n 
3 44 LEU n 
3 45 TRP n 
3 46 GLY n 
3 47 ILE n 
3 48 ARG n 
3 49 LYS n 
3 50 ASN n 
3 51 LYS n 
3 52 PRO n 
3 53 ASN n 
3 54 MET n 
3 55 ASN n 
3 56 TYR n 
3 57 ASP n 
3 58 LYS n 
3 59 LEU n 
3 60 SER n 
3 61 ARG n 
3 62 ALA n 
3 63 LEU n 
3 64 ARG n 
3 65 TYR n 
3 66 TYR n 
3 67 TYR n 
3 68 VAL n 
3 69 LYS n 
3 70 ASN n 
3 71 ILE n 
3 72 ILE n 
3 73 LYS n 
3 74 LYS n 
3 75 VAL n 
3 76 ASN n 
3 77 GLY n 
3 78 GLN n 
3 79 LYS n 
3 80 PHE n 
3 81 VAL n 
3 82 TYR n 
3 83 LYS n 
3 84 PHE n 
3 85 VAL n 
3 86 SER n 
3 87 TYR n 
3 88 PRO n 
3 89 GLU n 
3 90 ILE n 
3 91 LEU n 
3 92 ASN n 
3 93 MET n 
# 
_entity_src_gen.entity_id                          3 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 'SAP-1 RESIDUES 1-93' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    NUCLEUS 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              LYSS 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          BACTERIA 
_entity_src_gen.pdbx_host_org_vector               PRSETA 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP ELK4_HUMAN 3 ? ? P28324 ? 
2 PDB 1BC8       1 ? ? 1BC8   ? 
3 PDB 1BC8       2 ? ? 1BC8   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1BC8 C 1 ? 93 ? P28324 1  ? 93 ? 1  93 
2 2 1BC8 A 1 ? 10 ? 1BC8   1  ? 10 ? 1  10 
3 3 1BC8 B 1 ? 10 ? 1BC8   11 ? 20 ? 11 20 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
ZN  non-polymer         . 'ZINC ION'                           ? 'Zn 2'            65.409  
# 
_exptl.entry_id          1BC8 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.13 
_exptl_crystal.density_percent_sol   42.2 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.0 
_exptl_crystal_grow.pdbx_details    '50 MM NA CACODYLATE (PH 6.0), 5.0% PEG8000, 20 MM ZINC ACETATE' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
loop_
_exptl_crystal_grow_comp.crystal_id 
_exptl_crystal_grow_comp.id 
_exptl_crystal_grow_comp.sol_id 
_exptl_crystal_grow_comp.name 
_exptl_crystal_grow_comp.volume 
_exptl_crystal_grow_comp.conc 
_exptl_crystal_grow_comp.details 
1 1 1 'SODIUM CACODYLATE' ? ? ? 
1 2 1 'PEG 8000'          ? ? ? 
1 3 1 'ZINC ACETATE'      ? ? ? 
1 4 2 'PEG 8000'          ? ? ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           110 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   1997-12-15 
_diffrn_detector.details                MIRRORS 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'NI FILTER' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU RU200' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1BC8 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             28.9 
_reflns.d_resolution_high            1.93 
_reflns.number_obs                   10728 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         96.7 
_reflns.pdbx_Rmerge_I_obs            0.0710000 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        15.0 
_reflns.B_iso_Wilson_estimate        14.8 
_reflns.pdbx_redundancy              7.1 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             1.93 
_reflns_shell.d_res_low              2.02 
_reflns_shell.percent_possible_all   91.7 
_reflns_shell.Rmerge_I_obs           0.1410000 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1BC8 
_refine.ls_number_reflns_obs                     10700 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          2.0 
_refine.pdbx_data_cutoff_high_absF               1000000.00 
_refine.pdbx_data_cutoff_low_absF                0.001 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             28.9 
_refine.ls_d_res_high                            1.93 
_refine.ls_percent_reflns_obs                    96.4 
_refine.ls_R_factor_obs                          0.2200000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2200000 
_refine.ls_R_factor_R_free                       0.2770000 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 10.1 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               17.0 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MULTIPLE ISOMORPHOUS REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1BC8 
_refine_analyze.Luzzati_coordinate_error_obs    0.25 
_refine_analyze.Luzzati_sigma_a_obs             0.26 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.32 
_refine_analyze.Luzzati_sigma_a_free            0.29 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        790 
_refine_hist.pdbx_number_atoms_nucleic_acid   404 
_refine_hist.pdbx_number_atoms_ligand         2 
_refine_hist.number_atoms_solvent             160 
_refine_hist.number_atoms_total               1356 
_refine_hist.d_res_high                       1.93 
_refine_hist.d_res_low                        28.9 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d                0.007 ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg             1.19  ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d      23.0  ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d      1.14  ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   8 
_refine_ls_shell.d_res_high                       1.93 
_refine_ls_shell.d_res_low                        2.02 
_refine_ls_shell.number_reflns_R_work             1129 
_refine_ls_shell.R_factor_R_work                  0.3144000 
_refine_ls_shell.percent_reflns_obs               91.2 
_refine_ls_shell.R_factor_R_free                  0.3956000 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            8.5 
_refine_ls_shell.number_reflns_R_free             ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PROTEIN_REP.PARAM TOPHCSDX.PRO 'X-RAY DIFFRACTION' 
2 DNA-RNA.PARAM     DNA-RNA.TOP  'X-RAY DIFFRACTION' 
3 ?                 TOPH11.WAT   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1BC8 
_struct.title                     
;STRUCTURES OF SAP-1 BOUND TO DNA SEQUENCES FROM THE E74 AND C-FOS PROMOTERS PROVIDE INSIGHTS INTO HOW ETS PROTEINS DISCRIMINATE BETWEEN RELATED DNA TARGETS
;
_struct.pdbx_descriptor           'SAP-1 ETS DOMAIN/DNA COMPLEX' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1BC8 
_struct_keywords.pdbx_keywords   TRANSCRIPTION/DNA 
_struct_keywords.text            
'ETS DOMAIN, DNA-BINDING DOMAIN, WINGED HELIX-TURN-HELIX, DNA-BINDING SPECIFICITY, TRANSCRIPTION-DNA COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 4 ? 
F N N 5 ? 
G N N 5 ? 
H N N 5 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 H1  THR C 6  ? LEU C 15 ? THR C 6  LEU C 15 1 ? 10 
HELX_P HELX_P2 H2  GLN C 37 ? ASN C 50 ? GLN C 37 ASN C 50 1 ? 14 
HELX_P HELX_P3 H3  ASN C 55 ? ASN C 70 ? ASN C 55 ASN C 70 1 ? 16 
HELX_P HELX_P4 3-1 GLN C 16 ? LYS C 21 ? GLN C 16 LYS C 21 5 ? 6  
HELX_P HELX_P5 3-2 PRO C 88 ? ASN C 92 ? PRO C 88 ASN C 92 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? E ZN .  ZN ? ? ? 1_555 C GLU 89 OE2 ? ? C ZN 94 C GLU 89  1_555 ? ? ? ? ? ? ?            2.018 ? 
metalc2  metalc ? ? E ZN .  ZN ? ? ? 1_555 H HOH .  O   ? ? C ZN 94 C HOH 118 1_555 ? ? ? ? ? ? ?            1.951 ? 
metalc3  metalc ? ? D ZN .  ZN ? ? ? 1_555 B DG  8  N7  ? ? B ZN 2  B DG  18  1_555 ? ? ? ? ? ? ?            2.172 ? 
metalc4  metalc ? ? D ZN .  ZN ? ? ? 1_555 G HOH .  O   ? ? B ZN 2  B HOH 54  1_555 ? ? ? ? ? ? ?            2.122 ? 
metalc5  metalc ? ? D ZN .  ZN ? ? ? 1_555 G HOH .  O   ? ? B ZN 2  B HOH 135 1_555 ? ? ? ? ? ? ?            2.210 ? 
metalc6  metalc ? ? D ZN .  ZN ? ? ? 1_555 G HOH .  O   ? ? B ZN 2  B HOH 136 1_555 ? ? ? ? ? ? ?            2.352 ? 
metalc7  metalc ? ? D ZN .  ZN ? ? ? 1_555 G HOH .  O   ? ? B ZN 2  B HOH 137 1_555 ? ? ? ? ? ? ?            2.392 ? 
metalc8  metalc ? ? D ZN .  ZN ? ? ? 1_555 G HOH .  O   ? ? B ZN 2  B HOH 82  1_555 ? ? ? ? ? ? ?            2.574 ? 
hydrog1  hydrog ? ? A DA 2  N1 ? ? ? 1_555 B DT  10 N3  ? ? A DA 2  B DT  20  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? A DA 2  N6 ? ? ? 1_555 B DT  10 O4  ? ? A DA 2  B DT  20  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? A DC 3  N3 ? ? ? 1_555 B DG  9  N1  ? ? A DC 3  B DG  19  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? A DC 3  N4 ? ? ? 1_555 B DG  9  O6  ? ? A DC 3  B DG  19  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? A DC 3  O2 ? ? ? 1_555 B DG  9  N2  ? ? A DC 3  B DG  19  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? A DC 4  N3 ? ? ? 1_555 B DG  8  N1  ? ? A DC 4  B DG  18  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? A DC 4  N4 ? ? ? 1_555 B DG  8  O6  ? ? A DC 4  B DG  18  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? A DC 4  O2 ? ? ? 1_555 B DG  8  N2  ? ? A DC 4  B DG  18  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? A DG 5  N1 ? ? ? 1_555 B DC  7  N3  ? ? A DG 5  B DC  17  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? A DG 5  N2 ? ? ? 1_555 B DC  7  O2  ? ? A DG 5  B DC  17  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? A DG 5  O6 ? ? ? 1_555 B DC  7  N4  ? ? A DG 5  B DC  17  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? A DG 6  N1 ? ? ? 1_555 B DC  6  N3  ? ? A DG 6  B DC  16  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? A DG 6  N2 ? ? ? 1_555 B DC  6  O2  ? ? A DG 6  B DC  16  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? A DG 6  O6 ? ? ? 1_555 B DC  6  N4  ? ? A DG 6  B DC  16  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? A DA 7  N1 ? ? ? 1_555 B DT  5  N3  ? ? A DA 7  B DT  15  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? A DA 7  N6 ? ? ? 1_555 B DT  5  O4  ? ? A DA 7  B DT  15  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? A DA 8  N1 ? ? ? 1_555 B DT  4  N3  ? ? A DA 8  B DT  14  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? A DA 8  N6 ? ? ? 1_555 B DT  4  O4  ? ? A DA 8  B DT  14  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? A DG 9  N1 ? ? ? 1_555 B DC  3  N3  ? ? A DG 9  B DC  13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? A DG 9  N2 ? ? ? 1_555 B DC  3  O2  ? ? A DG 9  B DC  13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ? ? A DG 9  O6 ? ? ? 1_555 B DC  3  N4  ? ? A DG 9  B DC  13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ? ? A DT 10 N3 ? ? ? 1_555 B DA  2  N1  ? ? A DT 10 B DA  12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ? ? A DT 10 O4 ? ? ? 1_555 B DA  2  N6  ? ? A DT 10 B DA  12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          TYR 
_struct_mon_prot_cis.label_seq_id           87 
_struct_mon_prot_cis.label_asym_id          C 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           TYR 
_struct_mon_prot_cis.auth_seq_id            87 
_struct_mon_prot_cis.auth_asym_id           C 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    88 
_struct_mon_prot_cis.pdbx_label_asym_id_2   C 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     88 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    C 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       0.12 
# 
_struct_sheet.id               S1 
_struct_sheet.type             ? 
_struct_sheet.number_strands   4 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
S1 1 2 ? anti-parallel 
S1 2 3 ? anti-parallel 
S1 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
S1 1 CYS C 25 ? TRP C 26 ? CYS C 25 TRP C 26 
S1 2 GLN C 32 ? LYS C 34 ? GLN C 32 LYS C 34 
S1 3 VAL C 81 ? PHE C 84 ? VAL C 81 PHE C 84 
S1 4 ILE C 72 ? LYS C 74 ? ILE C 72 LYS C 74 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE ZN C 94' 
AC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE ZN B 2'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 2 GLU C 89 ? GLU C 89  . ? 1_555 ? 
2 AC1 2 HOH H .  ? HOH C 118 . ? 1_555 ? 
3 AC2 6 DG  B 8  ? DG  B 18  . ? 1_555 ? 
4 AC2 6 HOH G .  ? HOH B 54  . ? 1_555 ? 
5 AC2 6 HOH G .  ? HOH B 82  . ? 1_555 ? 
6 AC2 6 HOH G .  ? HOH B 135 . ? 1_555 ? 
7 AC2 6 HOH G .  ? HOH B 136 . ? 1_555 ? 
8 AC2 6 HOH G .  ? HOH B 137 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1BC8 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1BC8 
_atom_sites.fract_transf_matrix[1][1]   0.031656 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.009775 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.017963 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.023662 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
N  
O  
P  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    O  "O5'" . DT  A 1 1  ? 18.304  10.313  14.820  1.00 17.18 ? 1   DT  A "O5'" 1 
ATOM   2    C  "C5'" . DT  A 1 1  ? 19.094  9.803   13.737  1.00 12.46 ? 1   DT  A "C5'" 1 
ATOM   3    C  "C4'" . DT  A 1 1  ? 18.917  8.315   13.559  1.00 18.60 ? 1   DT  A "C4'" 1 
ATOM   4    O  "O4'" . DT  A 1 1  ? 19.697  7.616   14.562  1.00 20.04 ? 1   DT  A "O4'" 1 
ATOM   5    C  "C3'" . DT  A 1 1  ? 17.470  7.855   13.741  1.00 16.09 ? 1   DT  A "C3'" 1 
ATOM   6    O  "O3'" . DT  A 1 1  ? 17.095  6.863   12.788  1.00 15.10 ? 1   DT  A "O3'" 1 
ATOM   7    C  "C2'" . DT  A 1 1  ? 17.458  7.238   15.125  1.00 14.72 ? 1   DT  A "C2'" 1 
ATOM   8    C  "C1'" . DT  A 1 1  ? 18.865  6.691   15.255  1.00 15.05 ? 1   DT  A "C1'" 1 
ATOM   9    N  N1    . DT  A 1 1  ? 19.304  6.626   16.668  1.00 14.53 ? 1   DT  A N1    1 
ATOM   10   C  C2    . DT  A 1 1  ? 19.705  5.412   17.182  1.00 18.55 ? 1   DT  A C2    1 
ATOM   11   O  O2    . DT  A 1 1  ? 19.791  4.385   16.537  1.00 13.78 ? 1   DT  A O2    1 
ATOM   12   N  N3    . DT  A 1 1  ? 20.012  5.437   18.502  1.00 16.23 ? 1   DT  A N3    1 
ATOM   13   C  C4    . DT  A 1 1  ? 19.951  6.509   19.368  1.00 18.17 ? 1   DT  A C4    1 
ATOM   14   O  O4    . DT  A 1 1  ? 20.205  6.342   20.562  1.00 18.13 ? 1   DT  A O4    1 
ATOM   15   C  C5    . DT  A 1 1  ? 19.567  7.762   18.762  1.00 16.52 ? 1   DT  A C5    1 
ATOM   16   C  C7    . DT  A 1 1  ? 19.513  8.999   19.602  1.00 16.20 ? 1   DT  A C7    1 
ATOM   17   C  C6    . DT  A 1 1  ? 19.273  7.759   17.458  1.00 17.00 ? 1   DT  A C6    1 
ATOM   18   P  P     . DA  A 1 2  ? 15.599  6.249   12.825  1.00 16.79 ? 2   DA  A P     1 
ATOM   19   O  OP1   . DA  A 1 2  ? 15.051  6.238   11.437  1.00 17.73 ? 2   DA  A OP1   1 
ATOM   20   O  OP2   . DA  A 1 2  ? 14.829  6.923   13.914  1.00 17.63 ? 2   DA  A OP2   1 
ATOM   21   O  "O5'" . DA  A 1 2  ? 15.831  4.747   13.296  1.00 19.10 ? 2   DA  A "O5'" 1 
ATOM   22   C  "C5'" . DA  A 1 2  ? 16.645  3.854   12.539  1.00 17.15 ? 2   DA  A "C5'" 1 
ATOM   23   C  "C4'" . DA  A 1 2  ? 16.501  2.449   13.077  1.00 13.00 ? 2   DA  A "C4'" 1 
ATOM   24   O  "O4'" . DA  A 1 2  ? 17.058  2.395   14.415  1.00 17.27 ? 2   DA  A "O4'" 1 
ATOM   25   C  "C3'" . DA  A 1 2  ? 15.052  1.969   13.198  1.00 16.19 ? 2   DA  A "C3'" 1 
ATOM   26   O  "O3'" . DA  A 1 2  ? 14.977  0.578   12.848  1.00 13.90 ? 2   DA  A "O3'" 1 
ATOM   27   C  "C2'" . DA  A 1 2  ? 14.719  2.214   14.663  1.00 13.74 ? 2   DA  A "C2'" 1 
ATOM   28   C  "C1'" . DA  A 1 2  ? 16.062  2.014   15.360  1.00 14.39 ? 2   DA  A "C1'" 1 
ATOM   29   N  N9    . DA  A 1 2  ? 16.254  2.824   16.570  1.00 14.09 ? 2   DA  A N9    1 
ATOM   30   C  C8    . DA  A 1 2  ? 16.103  4.182   16.715  1.00 16.98 ? 2   DA  A C8    1 
ATOM   31   N  N7    . DA  A 1 2  ? 16.322  4.612   17.935  1.00 18.93 ? 2   DA  A N7    1 
ATOM   32   C  C5    . DA  A 1 2  ? 16.643  3.462   18.643  1.00 15.08 ? 2   DA  A C5    1 
ATOM   33   C  C6    . DA  A 1 2  ? 16.964  3.235   20.000  1.00 18.66 ? 2   DA  A C6    1 
ATOM   34   N  N6    . DA  A 1 2  ? 17.022  4.194   20.924  1.00 14.45 ? 2   DA  A N6    1 
ATOM   35   N  N1    . DA  A 1 2  ? 17.226  1.969   20.377  1.00 20.40 ? 2   DA  A N1    1 
ATOM   36   C  C2    . DA  A 1 2  ? 17.176  1.003   19.457  1.00 16.64 ? 2   DA  A C2    1 
ATOM   37   N  N3    . DA  A 1 2  ? 16.887  1.084   18.163  1.00 13.95 ? 2   DA  A N3    1 
ATOM   38   C  C4    . DA  A 1 2  ? 16.619  2.355   17.813  1.00 15.74 ? 2   DA  A C4    1 
ATOM   39   P  P     . DC  A 1 3  ? 13.558  -0.169  12.821  1.00 14.83 ? 3   DC  A P     1 
ATOM   40   O  OP1   . DC  A 1 3  ? 13.640  -1.321  11.905  1.00 19.09 ? 3   DC  A OP1   1 
ATOM   41   O  OP2   . DC  A 1 3  ? 12.525  0.871   12.617  1.00 15.53 ? 3   DC  A OP2   1 
ATOM   42   O  "O5'" . DC  A 1 3  ? 13.380  -0.737  14.299  1.00 14.21 ? 3   DC  A "O5'" 1 
ATOM   43   C  "C5'" . DC  A 1 3  ? 14.400  -1.524  14.907  1.00 16.00 ? 3   DC  A "C5'" 1 
ATOM   44   C  "C4'" . DC  A 1 3  ? 13.967  -2.001  16.275  1.00 15.51 ? 3   DC  A "C4'" 1 
ATOM   45   O  "O4'" . DC  A 1 3  ? 14.336  -1.015  17.272  1.00 18.24 ? 3   DC  A "O4'" 1 
ATOM   46   C  "C3'" . DC  A 1 3  ? 12.472  -2.279  16.468  1.00 17.28 ? 3   DC  A "C3'" 1 
ATOM   47   O  "O3'" . DC  A 1 3  ? 12.313  -3.566  17.075  1.00 15.26 ? 3   DC  A "O3'" 1 
ATOM   48   C  "C2'" . DC  A 1 3  ? 12.009  -1.161  17.390  1.00 17.05 ? 3   DC  A "C2'" 1 
ATOM   49   C  "C1'" . DC  A 1 3  ? 13.266  -0.839  18.181  1.00 13.47 ? 3   DC  A "C1'" 1 
ATOM   50   N  N1    . DC  A 1 3  ? 13.361  0.526   18.749  1.00 14.95 ? 3   DC  A N1    1 
ATOM   51   C  C2    . DC  A 1 3  ? 13.811  0.679   20.081  1.00 14.31 ? 3   DC  A C2    1 
ATOM   52   O  O2    . DC  A 1 3  ? 14.117  -0.328  20.740  1.00 13.83 ? 3   DC  A O2    1 
ATOM   53   N  N3    . DC  A 1 3  ? 13.895  1.920   20.611  1.00 17.87 ? 3   DC  A N3    1 
ATOM   54   C  C4    . DC  A 1 3  ? 13.551  2.986   19.881  1.00 15.67 ? 3   DC  A C4    1 
ATOM   55   N  N4    . DC  A 1 3  ? 13.648  4.189   20.454  1.00 17.05 ? 3   DC  A N4    1 
ATOM   56   C  C5    . DC  A 1 3  ? 13.090  2.863   18.530  1.00 17.58 ? 3   DC  A C5    1 
ATOM   57   C  C6    . DC  A 1 3  ? 13.015  1.628   18.010  1.00 15.35 ? 3   DC  A C6    1 
ATOM   58   P  P     . DC  A 1 4  ? 10.841  -4.169  17.337  1.00 13.52 ? 4   DC  A P     1 
ATOM   59   O  OP1   . DC  A 1 4  ? 10.889  -5.642  17.128  1.00 11.14 ? 4   DC  A OP1   1 
ATOM   60   O  OP2   . DC  A 1 4  ? 9.841   -3.354  16.599  1.00 14.42 ? 4   DC  A OP2   1 
ATOM   61   O  "O5'" . DC  A 1 4  ? 10.610  -3.896  18.887  1.00 18.88 ? 4   DC  A "O5'" 1 
ATOM   62   C  "C5'" . DC  A 1 4  ? 11.624  -4.211  19.840  1.00 17.04 ? 4   DC  A "C5'" 1 
ATOM   63   C  "C4'" . DC  A 1 4  ? 11.077  -4.102  21.242  1.00 13.77 ? 4   DC  A "C4'" 1 
ATOM   64   O  "O4'" . DC  A 1 4  ? 11.519  -2.836  21.796  1.00 16.13 ? 4   DC  A "O4'" 1 
ATOM   65   C  "C3'" . DC  A 1 4  ? 9.548   -4.087  21.270  1.00 14.89 ? 4   DC  A "C3'" 1 
ATOM   66   O  "O3'" . DC  A 1 4  ? 8.983   -5.058  22.133  1.00 21.15 ? 4   DC  A "O3'" 1 
ATOM   67   C  "C2'" . DC  A 1 4  ? 9.174   -2.695  21.730  1.00 14.30 ? 4   DC  A "C2'" 1 
ATOM   68   C  "C1'" . DC  A 1 4  ? 10.429  -2.136  22.378  1.00 15.84 ? 4   DC  A "C1'" 1 
ATOM   69   N  N1    . DC  A 1 4  ? 10.556  -0.702  22.049  1.00 17.22 ? 4   DC  A N1    1 
ATOM   70   C  C2    . DC  A 1 4  ? 10.557  0.249   23.091  1.00 16.52 ? 4   DC  A C2    1 
ATOM   71   O  O2    . DC  A 1 4  ? 10.547  -0.140  24.273  1.00 17.28 ? 4   DC  A O2    1 
ATOM   72   N  N3    . DC  A 1 4  ? 10.560  1.564   22.778  1.00 15.50 ? 4   DC  A N3    1 
ATOM   73   C  C4    . DC  A 1 4  ? 10.559  1.949   21.496  1.00 13.37 ? 4   DC  A C4    1 
ATOM   74   N  N4    . DC  A 1 4  ? 10.505  3.253   21.236  1.00 17.30 ? 4   DC  A N4    1 
ATOM   75   C  C5    . DC  A 1 4  ? 10.602  1.011   20.425  1.00 13.99 ? 4   DC  A C5    1 
ATOM   76   C  C6    . DC  A 1 4  ? 10.612  -0.291  20.743  1.00 16.58 ? 4   DC  A C6    1 
ATOM   77   P  P     . DG  A 1 5  ? 7.455   -5.511  21.910  1.00 16.98 ? 5   DG  A P     1 
ATOM   78   O  OP1   . DG  A 1 5  ? 7.431   -6.984  21.812  1.00 14.91 ? 5   DG  A OP1   1 
ATOM   79   O  OP2   . DG  A 1 5  ? 6.832   -4.697  20.834  1.00 16.97 ? 5   DG  A OP2   1 
ATOM   80   O  "O5'" . DG  A 1 5  ? 6.759   -5.086  23.279  1.00 15.22 ? 5   DG  A "O5'" 1 
ATOM   81   C  "C5'" . DG  A 1 5  ? 7.337   -5.436  24.539  1.00 16.43 ? 5   DG  A "C5'" 1 
ATOM   82   C  "C4'" . DG  A 1 5  ? 6.876   -4.472  25.610  1.00 19.88 ? 5   DG  A "C4'" 1 
ATOM   83   O  "O4'" . DG  A 1 5  ? 7.321   -3.132  25.288  1.00 15.74 ? 5   DG  A "O4'" 1 
ATOM   84   C  "C3'" . DG  A 1 5  ? 5.362   -4.373  25.791  1.00 19.76 ? 5   DG  A "C3'" 1 
ATOM   85   O  "O3'" . DG  A 1 5  ? 5.084   -4.149  27.177  1.00 16.42 ? 5   DG  A "O3'" 1 
ATOM   86   C  "C2'" . DG  A 1 5  ? 4.998   -3.139  24.982  1.00 15.59 ? 5   DG  A "C2'" 1 
ATOM   87   C  "C1'" . DG  A 1 5  ? 6.203   -2.256  25.230  1.00 16.34 ? 5   DG  A "C1'" 1 
ATOM   88   N  N9    . DG  A 1 5  ? 6.465   -1.239  24.213  1.00 14.70 ? 5   DG  A N9    1 
ATOM   89   C  C8    . DG  A 1 5  ? 6.402   -1.381  22.845  1.00 15.36 ? 5   DG  A C8    1 
ATOM   90   N  N7    . DG  A 1 5  ? 6.676   -0.276  22.204  1.00 15.80 ? 5   DG  A N7    1 
ATOM   91   C  C5    . DG  A 1 5  ? 6.938   0.650   23.208  1.00 16.23 ? 5   DG  A C5    1 
ATOM   92   C  C6    . DG  A 1 5  ? 7.280   2.026   23.126  1.00 15.00 ? 5   DG  A C6    1 
ATOM   93   O  O6    . DG  A 1 5  ? 7.421   2.721   22.118  1.00 19.50 ? 5   DG  A O6    1 
ATOM   94   N  N1    . DG  A 1 5  ? 7.454   2.589   24.393  1.00 17.96 ? 5   DG  A N1    1 
ATOM   95   C  C2    . DG  A 1 5  ? 7.313   1.908   25.583  1.00 19.25 ? 5   DG  A C2    1 
ATOM   96   N  N2    . DG  A 1 5  ? 7.525   2.605   26.721  1.00 16.42 ? 5   DG  A N2    1 
ATOM   97   N  N3    . DG  A 1 5  ? 6.988   0.633   25.665  1.00 15.96 ? 5   DG  A N3    1 
ATOM   98   C  C4    . DG  A 1 5  ? 6.816   0.069   24.451  1.00 14.08 ? 5   DG  A C4    1 
ATOM   99   P  P     . DG  A 1 6  ? 3.574   -4.238  27.728  1.00 15.18 ? 6   DG  A P     1 
ATOM   100  O  OP1   . DG  A 1 6  ? 3.439   -5.516  28.484  1.00 15.91 ? 6   DG  A OP1   1 
ATOM   101  O  OP2   . DG  A 1 6  ? 2.597   -3.914  26.651  1.00 17.41 ? 6   DG  A OP2   1 
ATOM   102  O  "O5'" . DG  A 1 6  ? 3.529   -3.055  28.788  1.00 14.00 ? 6   DG  A "O5'" 1 
ATOM   103  C  "C5'" . DG  A 1 6  ? 4.595   -2.864  29.713  1.00 17.89 ? 6   DG  A "C5'" 1 
ATOM   104  C  "C4'" . DG  A 1 6  ? 4.483   -1.505  30.357  1.00 14.78 ? 6   DG  A "C4'" 1 
ATOM   105  O  "O4'" . DG  A 1 6  ? 4.861   -0.450  29.443  1.00 16.57 ? 6   DG  A "O4'" 1 
ATOM   106  C  "C3'" . DG  A 1 6  ? 3.078   -1.162  30.839  1.00 17.24 ? 6   DG  A "C3'" 1 
ATOM   107  O  "O3'" . DG  A 1 6  ? 3.181   -0.493  32.087  1.00 16.38 ? 6   DG  A "O3'" 1 
ATOM   108  C  "C2'" . DG  A 1 6  ? 2.543   -0.236  29.760  1.00 15.42 ? 6   DG  A "C2'" 1 
ATOM   109  C  "C1'" . DG  A 1 6  ? 3.794   0.483   29.279  1.00 16.24 ? 6   DG  A "C1'" 1 
ATOM   110  N  N9    . DG  A 1 6  ? 3.768   0.876   27.870  1.00 13.81 ? 6   DG  A N9    1 
ATOM   111  C  C8    . DG  A 1 6  ? 3.526   0.057   26.790  1.00 14.47 ? 6   DG  A C8    1 
ATOM   112  N  N7    . DG  A 1 6  ? 3.640   0.671   25.646  1.00 20.23 ? 6   DG  A N7    1 
ATOM   113  C  C5    . DG  A 1 6  ? 3.957   1.979   25.985  1.00 12.59 ? 6   DG  A C5    1 
ATOM   114  C  C6    . DG  A 1 6  ? 4.211   3.105   25.157  1.00 15.44 ? 6   DG  A C6    1 
ATOM   115  O  O6    . DG  A 1 6  ? 4.217   3.166   23.918  1.00 14.65 ? 6   DG  A O6    1 
ATOM   116  N  N1    . DG  A 1 6  ? 4.481   4.244   25.909  1.00 15.46 ? 6   DG  A N1    1 
ATOM   117  C  C2    . DG  A 1 6  ? 4.495   4.294   27.286  1.00 17.09 ? 6   DG  A C2    1 
ATOM   118  N  N2    . DG  A 1 6  ? 4.734   5.494   27.835  1.00 18.97 ? 6   DG  A N2    1 
ATOM   119  N  N3    . DG  A 1 6  ? 4.280   3.244   28.067  1.00 15.05 ? 6   DG  A N3    1 
ATOM   120  C  C4    . DG  A 1 6  ? 4.019   2.130   27.355  1.00 17.38 ? 6   DG  A C4    1 
ATOM   121  P  P     . DA  A 1 7  ? 1.858   -0.155  32.916  1.00 16.48 ? 7   DA  A P     1 
ATOM   122  O  OP1   . DA  A 1 7  ? 2.280   -0.017  34.333  1.00 17.89 ? 7   DA  A OP1   1 
ATOM   123  O  OP2   . DA  A 1 7  ? 0.793   -1.130  32.549  1.00 14.37 ? 7   DA  A OP2   1 
ATOM   124  O  "O5'" . DA  A 1 7  ? 1.457   1.274   32.352  1.00 16.83 ? 7   DA  A "O5'" 1 
ATOM   125  C  "C5'" . DA  A 1 7  ? 2.256   2.408   32.638  1.00 16.03 ? 7   DA  A "C5'" 1 
ATOM   126  C  "C4'" . DA  A 1 7  ? 1.571   3.659   32.146  1.00 17.62 ? 7   DA  A "C4'" 1 
ATOM   127  O  "O4'" . DA  A 1 7  ? 1.761   3.835   30.718  1.00 18.57 ? 7   DA  A "O4'" 1 
ATOM   128  C  "C3'" . DA  A 1 7  ? 0.062   3.741   32.403  1.00 17.77 ? 7   DA  A "C3'" 1 
ATOM   129  O  "O3'" . DA  A 1 7  ? -0.223  5.027   32.953  1.00 18.36 ? 7   DA  A "O3'" 1 
ATOM   130  C  "C2'" . DA  A 1 7  ? -0.543  3.574   31.013  1.00 13.69 ? 7   DA  A "C2'" 1 
ATOM   131  C  "C1'" . DA  A 1 7  ? 0.526   4.180   30.110  1.00 17.20 ? 7   DA  A "C1'" 1 
ATOM   132  N  N9    . DA  A 1 7  ? 0.561   3.700   28.723  1.00 17.33 ? 7   DA  A N9    1 
ATOM   133  C  C8    . DA  A 1 7  ? 0.339   2.431   28.248  1.00 16.28 ? 7   DA  A C8    1 
ATOM   134  N  N7    . DA  A 1 7  ? 0.472   2.322   26.946  1.00 15.88 ? 7   DA  A N7    1 
ATOM   135  C  C5    . DA  A 1 7  ? 0.796   3.608   26.534  1.00 16.34 ? 7   DA  A C5    1 
ATOM   136  C  C6    . DA  A 1 7  ? 1.071   4.161   25.263  1.00 19.38 ? 7   DA  A C6    1 
ATOM   137  N  N6    . DA  A 1 7  ? 1.055   3.462   24.126  1.00 14.51 ? 7   DA  A N6    1 
ATOM   138  N  N1    . DA  A 1 7  ? 1.367   5.481   25.204  1.00 16.03 ? 7   DA  A N1    1 
ATOM   139  C  C2    . DA  A 1 7  ? 1.386   6.182   26.342  1.00 17.05 ? 7   DA  A C2    1 
ATOM   140  N  N3    . DA  A 1 7  ? 1.145   5.776   27.587  1.00 15.82 ? 7   DA  A N3    1 
ATOM   141  C  C4    . DA  A 1 7  ? 0.852   4.467   27.616  1.00 14.88 ? 7   DA  A C4    1 
ATOM   142  P  P     . DA  A 1 8  ? -1.702  5.389   33.460  1.00 18.53 ? 8   DA  A P     1 
ATOM   143  O  OP1   . DA  A 1 8  ? -1.561  6.127   34.742  1.00 16.72 ? 8   DA  A OP1   1 
ATOM   144  O  OP2   . DA  A 1 8  ? -2.599  4.209   33.379  1.00 15.44 ? 8   DA  A OP2   1 
ATOM   145  O  "O5'" . DA  A 1 8  ? -2.185  6.443   32.385  1.00 17.38 ? 8   DA  A "O5'" 1 
ATOM   146  C  "C5'" . DA  A 1 8  ? -1.409  7.602   32.152  1.00 16.43 ? 8   DA  A "C5'" 1 
ATOM   147  C  "C4'" . DA  A 1 8  ? -1.868  8.288   30.891  1.00 11.57 ? 8   DA  A "C4'" 1 
ATOM   148  O  "O4'" . DA  A 1 8  ? -1.571  7.465   29.737  1.00 15.57 ? 8   DA  A "O4'" 1 
ATOM   149  C  "C3'" . DA  A 1 8  ? -3.366  8.586   30.831  1.00 16.80 ? 8   DA  A "C3'" 1 
ATOM   150  O  "O3'" . DA  A 1 8  ? -3.512  9.915   30.341  1.00 14.29 ? 8   DA  A "O3'" 1 
ATOM   151  C  "C2'" . DA  A 1 8  ? -3.890  7.566   29.830  1.00 17.01 ? 8   DA  A "C2'" 1 
ATOM   152  C  "C1'" . DA  A 1 8  ? -2.708  7.462   28.894  1.00 19.16 ? 8   DA  A "C1'" 1 
ATOM   153  N  N9    . DA  A 1 8  ? -2.646  6.287   28.027  1.00 15.34 ? 8   DA  A N9    1 
ATOM   154  C  C8    . DA  A 1 8  ? -2.861  4.961   28.316  1.00 16.04 ? 8   DA  A C8    1 
ATOM   155  N  N7    . DA  A 1 8  ? -2.739  4.168   27.273  1.00 16.72 ? 8   DA  A N7    1 
ATOM   156  C  C5    . DA  A 1 8  ? -2.417  5.031   26.231  1.00 14.75 ? 8   DA  A C5    1 
ATOM   157  C  C6    . DA  A 1 8  ? -2.153  4.819   24.852  1.00 16.65 ? 8   DA  A C6    1 
ATOM   158  N  N6    . DA  A 1 8  ? -2.167  3.618   24.263  1.00 15.60 ? 8   DA  A N6    1 
ATOM   159  N  N1    . DA  A 1 8  ? -1.865  5.902   24.097  1.00 19.88 ? 8   DA  A N1    1 
ATOM   160  C  C2    . DA  A 1 8  ? -1.838  7.105   24.684  1.00 19.47 ? 8   DA  A C2    1 
ATOM   161  N  N3    . DA  A 1 8  ? -2.065  7.431   25.958  1.00 15.72 ? 8   DA  A N3    1 
ATOM   162  C  C4    . DA  A 1 8  ? -2.352  6.337   26.685  1.00 15.50 ? 8   DA  A C4    1 
ATOM   163  P  P     . DG  A 1 9  ? -4.956  10.607  30.276  1.00 14.96 ? 9   DG  A P     1 
ATOM   164  O  OP1   . DG  A 1 9  ? -4.885  11.863  31.061  1.00 15.46 ? 9   DG  A OP1   1 
ATOM   165  O  OP2   . DG  A 1 9  ? -6.006  9.603   30.576  1.00 13.77 ? 9   DG  A OP2   1 
ATOM   166  O  "O5'" . DG  A 1 9  ? -5.074  10.984  28.734  1.00 13.48 ? 9   DG  A "O5'" 1 
ATOM   167  C  "C5'" . DG  A 1 9  ? -4.136  11.869  28.135  1.00 16.11 ? 9   DG  A "C5'" 1 
ATOM   168  C  "C4'" . DG  A 1 9  ? -4.463  12.060  26.674  1.00 18.04 ? 9   DG  A "C4'" 1 
ATOM   169  O  "O4'" . DG  A 1 9  ? -4.156  10.846  25.948  1.00 14.73 ? 9   DG  A "O4'" 1 
ATOM   170  C  "C3'" . DG  A 1 9  ? -5.927  12.387  26.371  1.00 16.72 ? 9   DG  A "C3'" 1 
ATOM   171  O  "O3'" . DG  A 1 9  ? -5.991  13.394  25.360  1.00 19.93 ? 9   DG  A "O3'" 1 
ATOM   172  C  "C2'" . DG  A 1 9  ? -6.494  11.069  25.879  1.00 14.67 ? 9   DG  A "C2'" 1 
ATOM   173  C  "C1'" . DG  A 1 9  ? -5.294  10.411  25.218  1.00 20.49 ? 9   DG  A "C1'" 1 
ATOM   174  N  N9    . DG  A 1 9  ? -5.318  8.951   25.254  1.00 14.69 ? 9   DG  A N9    1 
ATOM   175  C  C8    . DG  A 1 9  ? -5.424  8.148   26.366  1.00 17.56 ? 9   DG  A C8    1 
ATOM   176  N  N7    . DG  A 1 9  ? -5.433  6.876   26.080  1.00 15.14 ? 9   DG  A N7    1 
ATOM   177  C  C5    . DG  A 1 9  ? -5.321  6.831   24.700  1.00 20.89 ? 9   DG  A C5    1 
ATOM   178  C  C6    . DG  A 1 9  ? -5.280  5.728   23.832  1.00 16.26 ? 9   DG  A C6    1 
ATOM   179  O  O6    . DG  A 1 9  ? -5.335  4.529   24.121  1.00 16.06 ? 9   DG  A O6    1 
ATOM   180  N  N1    . DG  A 1 9  ? -5.165  6.122   22.498  1.00 17.21 ? 9   DG  A N1    1 
ATOM   181  C  C2    . DG  A 1 9  ? -5.094  7.428   22.065  1.00 21.36 ? 9   DG  A C2    1 
ATOM   182  N  N2    . DG  A 1 9  ? -4.988  7.619   20.737  1.00 14.52 ? 9   DG  A N2    1 
ATOM   183  N  N3    . DG  A 1 9  ? -5.127  8.474   22.875  1.00 12.99 ? 9   DG  A N3    1 
ATOM   184  C  C4    . DG  A 1 9  ? -5.244  8.103   24.171  1.00 17.78 ? 9   DG  A C4    1 
ATOM   185  P  P     . DT  A 1 10 ? -7.414  13.887  24.796  1.00 16.26 ? 10  DT  A P     1 
ATOM   186  O  OP1   . DT  A 1 10 ? -7.222  15.289  24.332  1.00 15.56 ? 10  DT  A OP1   1 
ATOM   187  O  OP2   . DT  A 1 10 ? -8.502  13.575  25.763  1.00 13.41 ? 10  DT  A OP2   1 
ATOM   188  O  "O5'" . DT  A 1 10 ? -7.631  12.962  23.511  1.00 13.59 ? 10  DT  A "O5'" 1 
ATOM   189  C  "C5'" . DT  A 1 10 ? -6.781  13.101  22.371  1.00 15.79 ? 10  DT  A "C5'" 1 
ATOM   190  C  "C4'" . DT  A 1 10 ? -7.422  12.481  21.152  1.00 16.32 ? 10  DT  A "C4'" 1 
ATOM   191  O  "O4'" . DT  A 1 10 ? -7.287  11.044  21.195  1.00 16.97 ? 10  DT  A "O4'" 1 
ATOM   192  C  "C3'" . DT  A 1 10 ? -8.913  12.766  20.979  1.00 18.99 ? 10  DT  A "C3'" 1 
ATOM   193  O  "O3'" . DT  A 1 10 ? -9.196  12.942  19.592  1.00 15.40 ? 10  DT  A "O3'" 1 
ATOM   194  C  "C2'" . DT  A 1 10 ? -9.566  11.479  21.453  1.00 16.43 ? 10  DT  A "C2'" 1 
ATOM   195  C  "C1'" . DT  A 1 10 ? -8.549  10.431  21.020  1.00 17.74 ? 10  DT  A "C1'" 1 
ATOM   196  N  N1    . DT  A 1 10 ? -8.545  9.162   21.790  1.00 15.83 ? 10  DT  A N1    1 
ATOM   197  C  C2    . DT  A 1 10 ? -8.395  7.963   21.106  1.00 12.93 ? 10  DT  A C2    1 
ATOM   198  O  O2    . DT  A 1 10 ? -8.268  7.885   19.896  1.00 17.43 ? 10  DT  A O2    1 
ATOM   199  N  N3    . DT  A 1 10 ? -8.402  6.847   21.907  1.00 17.21 ? 10  DT  A N3    1 
ATOM   200  C  C4    . DT  A 1 10 ? -8.544  6.798   23.283  1.00 13.38 ? 10  DT  A C4    1 
ATOM   201  O  O4    . DT  A 1 10 ? -8.535  5.711   23.865  1.00 14.60 ? 10  DT  A O4    1 
ATOM   202  C  C5    . DT  A 1 10 ? -8.698  8.081   23.932  1.00 14.93 ? 10  DT  A C5    1 
ATOM   203  C  C7    . DT  A 1 10 ? -8.860  8.129   25.419  1.00 22.05 ? 10  DT  A C7    1 
ATOM   204  C  C6    . DT  A 1 10 ? -8.689  9.183   23.166  1.00 18.59 ? 10  DT  A C6    1 
ATOM   205  O  "O5'" . DA  B 2 1  ? -11.321 -3.165  21.625  1.00 17.00 ? 11  DA  B "O5'" 1 
ATOM   206  C  "C5'" . DA  B 2 1  ? -12.292 -3.560  20.649  1.00 17.12 ? 11  DA  B "C5'" 1 
ATOM   207  C  "C4'" . DA  B 2 1  ? -12.040 -2.969  19.280  1.00 17.24 ? 11  DA  B "C4'" 1 
ATOM   208  O  "O4'" . DA  B 2 1  ? -12.252 -1.543  19.299  1.00 15.39 ? 11  DA  B "O4'" 1 
ATOM   209  C  "C3'" . DA  B 2 1  ? -10.634 -3.172  18.721  1.00 15.49 ? 11  DA  B "C3'" 1 
ATOM   210  O  "O3'" . DA  B 2 1  ? -10.731 -3.375  17.306  1.00 12.48 ? 11  DA  B "O3'" 1 
ATOM   211  C  "C2'" . DA  B 2 1  ? -9.907  -1.883  19.079  1.00 12.36 ? 11  DA  B "C2'" 1 
ATOM   212  C  "C1'" . DA  B 2 1  ? -11.009 -0.837  19.267  1.00 16.41 ? 11  DA  B "C1'" 1 
ATOM   213  N  N9    . DA  B 2 1  ? -10.895 -0.158  20.561  1.00 18.30 ? 11  DA  B N9    1 
ATOM   214  C  C8    . DA  B 2 1  ? -10.718 -0.787  21.775  1.00 12.44 ? 11  DA  B C8    1 
ATOM   215  N  N7    . DA  B 2 1  ? -10.705 0.020   22.795  1.00 18.24 ? 11  DA  B N7    1 
ATOM   216  C  C5    . DA  B 2 1  ? -10.869 1.266   22.226  1.00 17.90 ? 11  DA  B C5    1 
ATOM   217  C  C6    . DA  B 2 1  ? -10.952 2.518   22.793  1.00 15.10 ? 11  DA  B C6    1 
ATOM   218  N  N6    . DA  B 2 1  ? -10.919 2.716   24.101  1.00 13.54 ? 11  DA  B N6    1 
ATOM   219  N  N1    . DA  B 2 1  ? -11.095 3.571   21.975  1.00 16.27 ? 11  DA  B N1    1 
ATOM   220  C  C2    . DA  B 2 1  ? -11.181 3.342   20.659  1.00 17.24 ? 11  DA  B C2    1 
ATOM   221  N  N3    . DA  B 2 1  ? -11.138 2.195   19.991  1.00 13.64 ? 11  DA  B N3    1 
ATOM   222  C  C4    . DA  B 2 1  ? -10.974 1.177   20.848  1.00 16.16 ? 11  DA  B C4    1 
ATOM   223  P  P     . DA  B 2 2  ? -9.435  -3.789  16.458  1.00 14.94 ? 12  DA  B P     1 
ATOM   224  O  OP1   . DA  B 2 2  ? -9.943  -4.405  15.206  1.00 17.61 ? 12  DA  B OP1   1 
ATOM   225  O  OP2   . DA  B 2 2  ? -8.497  -4.550  17.314  1.00 18.50 ? 12  DA  B OP2   1 
ATOM   226  O  "O5'" . DA  B 2 2  ? -8.783  -2.383  16.114  1.00 17.56 ? 12  DA  B "O5'" 1 
ATOM   227  C  "C5'" . DA  B 2 2  ? -9.447  -1.484  15.234  1.00 18.44 ? 12  DA  B "C5'" 1 
ATOM   228  C  "C4'" . DA  B 2 2  ? -8.656  -0.207  15.093  1.00 15.29 ? 12  DA  B "C4'" 1 
ATOM   229  O  "O4'" . DA  B 2 2  ? -8.760  0.577   16.303  1.00 16.60 ? 12  DA  B "O4'" 1 
ATOM   230  C  "C3'" . DA  B 2 2  ? -7.159  -0.372  14.821  1.00 18.11 ? 12  DA  B "C3'" 1 
ATOM   231  O  "O3'" . DA  B 2 2  ? -6.742  0.602   13.862  1.00 17.19 ? 12  DA  B "O3'" 1 
ATOM   232  C  "C2'" . DA  B 2 2  ? -6.528  -0.057  16.164  1.00 17.52 ? 12  DA  B "C2'" 1 
ATOM   233  C  "C1'" . DA  B 2 2  ? -7.470  1.013   16.682  1.00 16.14 ? 12  DA  B "C1'" 1 
ATOM   234  N  N9    . DA  B 2 2  ? -7.470  1.240   18.129  1.00 17.57 ? 12  DA  B N9    1 
ATOM   235  C  C8    . DA  B 2 2  ? -7.200  0.351   19.140  1.00 18.61 ? 12  DA  B C8    1 
ATOM   236  N  N7    . DA  B 2 2  ? -7.262  0.878   20.336  1.00 18.80 ? 12  DA  B N7    1 
ATOM   237  C  C5    . DA  B 2 2  ? -7.602  2.203   20.099  1.00 14.59 ? 12  DA  B C5    1 
ATOM   238  C  C6    . DA  B 2 2  ? -7.821  3.294   20.961  1.00 15.40 ? 12  DA  B C6    1 
ATOM   239  N  N6    . DA  B 2 2  ? -7.723  3.223   22.298  1.00 17.47 ? 12  DA  B N6    1 
ATOM   240  N  N1    . DA  B 2 2  ? -8.148  4.479   20.399  1.00 17.32 ? 12  DA  B N1    1 
ATOM   241  C  C2    . DA  B 2 2  ? -8.248  4.549   19.063  1.00 18.52 ? 12  DA  B C2    1 
ATOM   242  N  N3    . DA  B 2 2  ? -8.068  3.597   18.155  1.00 17.23 ? 12  DA  B N3    1 
ATOM   243  C  C4    . DA  B 2 2  ? -7.741  2.436   18.744  1.00 17.52 ? 12  DA  B C4    1 
ATOM   244  P  P     . DC  B 2 3  ? -5.372  0.389   13.051  1.00 15.36 ? 13  DC  B P     1 
ATOM   245  O  OP1   . DC  B 2 3  ? -5.270  1.456   12.022  1.00 16.49 ? 13  DC  B OP1   1 
ATOM   246  O  OP2   . DC  B 2 3  ? -5.353  -1.032  12.637  1.00 20.64 ? 13  DC  B OP2   1 
ATOM   247  O  "O5'" . DC  B 2 3  ? -4.245  0.619   14.163  1.00 17.63 ? 13  DC  B "O5'" 1 
ATOM   248  C  "C5'" . DC  B 2 3  ? -3.370  1.748   14.127  1.00 14.81 ? 13  DC  B "C5'" 1 
ATOM   249  C  "C4'" . DC  B 2 3  ? -4.079  2.979   14.641  1.00 15.32 ? 13  DC  B "C4'" 1 
ATOM   250  O  "O4'" . DC  B 2 3  ? -4.685  2.724   15.936  1.00 16.87 ? 13  DC  B "O4'" 1 
ATOM   251  C  "C3'" . DC  B 2 3  ? -3.171  4.195   14.829  1.00 20.65 ? 13  DC  B "C3'" 1 
ATOM   252  O  "O3'" . DC  B 2 3  ? -3.707  5.358   14.202  1.00 18.31 ? 13  DC  B "O3'" 1 
ATOM   253  C  "C2'" . DC  B 2 3  ? -3.130  4.401   16.333  1.00 17.92 ? 13  DC  B "C2'" 1 
ATOM   254  C  "C1'" . DC  B 2 3  ? -4.457  3.836   16.783  1.00 15.53 ? 13  DC  B "C1'" 1 
ATOM   255  N  N1    . DC  B 2 3  ? -4.442  3.375   18.189  1.00 18.84 ? 13  DC  B N1    1 
ATOM   256  C  C2    . DC  B 2 3  ? -4.721  4.309   19.207  1.00 16.15 ? 13  DC  B C2    1 
ATOM   257  O  O2    . DC  B 2 3  ? -5.002  5.485   18.896  1.00 15.94 ? 13  DC  B O2    1 
ATOM   258  N  N3    . DC  B 2 3  ? -4.668  3.910   20.503  1.00 14.57 ? 13  DC  B N3    1 
ATOM   259  C  C4    . DC  B 2 3  ? -4.347  2.649   20.802  1.00 15.46 ? 13  DC  B C4    1 
ATOM   260  N  N4    . DC  B 2 3  ? -4.276  2.311   22.095  1.00 20.68 ? 13  DC  B N4    1 
ATOM   261  C  C5    . DC  B 2 3  ? -4.079  1.679   19.790  1.00 16.60 ? 13  DC  B C5    1 
ATOM   262  C  C6    . DC  B 2 3  ? -4.142  2.080   18.511  1.00 16.42 ? 13  DC  B C6    1 
ATOM   263  P  P     . DT  B 2 4  ? -2.714  6.556   13.795  1.00 13.95 ? 14  DT  B P     1 
ATOM   264  O  OP1   . DT  B 2 4  ? -3.371  7.413   12.777  1.00 14.49 ? 14  DT  B OP1   1 
ATOM   265  O  OP2   . DT  B 2 4  ? -1.372  5.981   13.524  1.00 17.49 ? 14  DT  B OP2   1 
ATOM   266  O  "O5'" . DT  B 2 4  ? -2.575  7.406   15.129  1.00 14.50 ? 14  DT  B "O5'" 1 
ATOM   267  C  "C5'" . DT  B 2 4  ? -3.595  8.305   15.516  1.00 17.11 ? 14  DT  B "C5'" 1 
ATOM   268  C  "C4'" . DT  B 2 4  ? -3.146  9.115   16.706  1.00 16.38 ? 14  DT  B "C4'" 1 
ATOM   269  O  "O4'" . DT  B 2 4  ? -3.105  8.274   17.880  1.00 16.84 ? 14  DT  B "O4'" 1 
ATOM   270  C  "C3'" . DT  B 2 4  ? -1.766  9.768   16.586  1.00 16.84 ? 14  DT  B "C3'" 1 
ATOM   271  O  "O3'" . DT  B 2 4  ? -1.906  11.127  17.016  1.00 16.31 ? 14  DT  B "O3'" 1 
ATOM   272  C  "C2'" . DT  B 2 4  ? -0.890  8.928   17.513  1.00 18.19 ? 14  DT  B "C2'" 1 
ATOM   273  C  "C1'" . DT  B 2 4  ? -1.880  8.450   18.567  1.00 15.73 ? 14  DT  B "C1'" 1 
ATOM   274  N  N1    . DT  B 2 4  ? -1.594  7.183   19.306  1.00 12.73 ? 14  DT  B N1    1 
ATOM   275  C  C2    . DT  B 2 4  ? -1.690  7.217   20.684  1.00 15.39 ? 14  DT  B C2    1 
ATOM   276  O  O2    . DT  B 2 4  ? -1.860  8.243   21.323  1.00 12.97 ? 14  DT  B O2    1 
ATOM   277  N  N3    . DT  B 2 4  ? -1.558  5.999   21.294  1.00 13.71 ? 14  DT  B N3    1 
ATOM   278  C  C4    . DT  B 2 4  ? -1.306  4.785   20.705  1.00 10.92 ? 14  DT  B C4    1 
ATOM   279  O  O4    . DT  B 2 4  ? -1.257  3.777   21.393  1.00 13.48 ? 14  DT  B O4    1 
ATOM   280  C  C5    . DT  B 2 4  ? -1.134  4.822   19.274  1.00 15.98 ? 14  DT  B C5    1 
ATOM   281  C  C7    . DT  B 2 4  ? -0.793  3.554   18.555  1.00 20.28 ? 14  DT  B C7    1 
ATOM   282  C  C6    . DT  B 2 4  ? -1.289  6.004   18.650  1.00 18.32 ? 14  DT  B C6    1 
ATOM   283  P  P     . DT  B 2 5  ? -0.725  12.189  16.780  1.00 16.07 ? 15  DT  B P     1 
ATOM   284  O  OP1   . DT  B 2 5  ? -1.366  13.512  16.581  1.00 16.75 ? 15  DT  B OP1   1 
ATOM   285  O  OP2   . DT  B 2 5  ? 0.236   11.679  15.770  1.00 19.15 ? 15  DT  B OP2   1 
ATOM   286  O  "O5'" . DT  B 2 5  ? -0.011  12.208  18.204  1.00 18.14 ? 15  DT  B "O5'" 1 
ATOM   287  C  "C5'" . DT  B 2 5  ? -0.766  12.517  19.362  1.00 18.29 ? 15  DT  B "C5'" 1 
ATOM   288  C  "C4'" . DT  B 2 5  ? 0.029   12.250  20.618  1.00 13.66 ? 15  DT  B "C4'" 1 
ATOM   289  O  "O4'" . DT  B 2 5  ? 0.024   10.847  20.979  1.00 19.85 ? 15  DT  B "O4'" 1 
ATOM   290  C  "C3'" . DT  B 2 5  ? 1.490   12.705  20.639  1.00 14.92 ? 15  DT  B "C3'" 1 
ATOM   291  O  "O3'" . DT  B 2 5  ? 1.678   13.512  21.802  1.00 20.02 ? 15  DT  B "O3'" 1 
ATOM   292  C  "C2'" . DT  B 2 5  ? 2.270   11.401  20.765  1.00 14.89 ? 15  DT  B "C2'" 1 
ATOM   293  C  "C1'" . DT  B 2 5  ? 1.286   10.537  21.536  1.00 12.32 ? 15  DT  B "C1'" 1 
ATOM   294  N  N1    . DT  B 2 5  ? 1.458   9.060   21.517  1.00 19.11 ? 15  DT  B N1    1 
ATOM   295  C  C2    . DT  B 2 5  ? 1.364   8.409   22.734  1.00 18.53 ? 15  DT  B C2    1 
ATOM   296  O  O2    . DT  B 2 5  ? 1.195   8.992   23.790  1.00 12.22 ? 15  DT  B O2    1 
ATOM   297  N  N3    . DT  B 2 5  ? 1.481   7.044   22.671  1.00 17.23 ? 15  DT  B N3    1 
ATOM   298  C  C4    . DT  B 2 5  ? 1.691   6.275   21.544  1.00 14.89 ? 15  DT  B C4    1 
ATOM   299  O  O4    . DT  B 2 5  ? 1.760   5.055   21.649  1.00 19.20 ? 15  DT  B O4    1 
ATOM   300  C  C5    . DT  B 2 5  ? 1.811   7.017   20.300  1.00 18.68 ? 15  DT  B C5    1 
ATOM   301  C  C7    . DT  B 2 5  ? 2.069   6.265   19.031  1.00 14.27 ? 15  DT  B C7    1 
ATOM   302  C  C6    . DT  B 2 5  ? 1.686   8.354   20.347  1.00 16.90 ? 15  DT  B C6    1 
ATOM   303  P  P     . DC  B 2 6  ? 2.846   14.608  21.847  1.00 15.26 ? 16  DC  B P     1 
ATOM   304  O  OP1   . DC  B 2 6  ? 2.259   15.928  22.192  1.00 16.68 ? 16  DC  B OP1   1 
ATOM   305  O  OP2   . DC  B 2 6  ? 3.742   14.475  20.662  1.00 16.11 ? 16  DC  B OP2   1 
ATOM   306  O  "O5'" . DC  B 2 6  ? 3.694   14.128  23.085  1.00 16.44 ? 16  DC  B "O5'" 1 
ATOM   307  C  "C5'" . DC  B 2 6  ? 4.153   12.811  23.124  1.00 13.29 ? 16  DC  B "C5'" 1 
ATOM   308  C  "C4'" . DC  B 2 6  ? 4.366   12.395  24.552  1.00 13.05 ? 16  DC  B "C4'" 1 
ATOM   309  O  "O4'" . DC  B 2 6  ? 3.941   11.024  24.639  1.00 12.39 ? 16  DC  B "O4'" 1 
ATOM   310  C  "C3'" . DC  B 2 6  ? 5.835   12.424  24.942  1.00 20.54 ? 16  DC  B "C3'" 1 
ATOM   311  O  "O3'" . DC  B 2 6  ? 5.990   12.882  26.286  1.00 16.67 ? 16  DC  B "O3'" 1 
ATOM   312  C  "C2'" . DC  B 2 6  ? 6.288   10.992  24.741  1.00 15.69 ? 16  DC  B "C2'" 1 
ATOM   313  C  "C1'" . DC  B 2 6  ? 5.023   10.184  24.968  1.00 17.14 ? 16  DC  B "C1'" 1 
ATOM   314  N  N1    . DC  B 2 6  ? 4.916   8.977   24.134  1.00 15.07 ? 16  DC  B N1    1 
ATOM   315  C  C2    . DC  B 2 6  ? 4.779   7.746   24.769  1.00 16.18 ? 16  DC  B C2    1 
ATOM   316  O  O2    . DC  B 2 6  ? 4.671   7.719   26.008  1.00 16.40 ? 16  DC  B O2    1 
ATOM   317  N  N3    . DC  B 2 6  ? 4.759   6.617   24.027  1.00 19.55 ? 16  DC  B N3    1 
ATOM   318  C  C4    . DC  B 2 6  ? 4.848   6.688   22.696  1.00 11.23 ? 16  DC  B C4    1 
ATOM   319  N  N4    . DC  B 2 6  ? 4.842   5.546   22.012  1.00 16.61 ? 16  DC  B N4    1 
ATOM   320  C  C5    . DC  B 2 6  ? 4.949   7.933   22.013  1.00 14.07 ? 16  DC  B C5    1 
ATOM   321  C  C6    . DC  B 2 6  ? 4.975   9.047   22.764  1.00 13.22 ? 16  DC  B C6    1 
ATOM   322  P  P     . DC  B 2 7  ? 7.458   13.230  26.845  1.00 16.29 ? 17  DC  B P     1 
ATOM   323  O  OP1   . DC  B 2 7  ? 7.322   14.261  27.894  1.00 14.75 ? 17  DC  B OP1   1 
ATOM   324  O  OP2   . DC  B 2 7  ? 8.393   13.457  25.712  1.00 15.14 ? 17  DC  B OP2   1 
ATOM   325  O  "O5'" . DC  B 2 7  ? 7.925   11.870  27.513  1.00 14.68 ? 17  DC  B "O5'" 1 
ATOM   326  C  "C5'" . DC  B 2 7  ? 6.986   10.967  28.080  1.00 14.96 ? 17  DC  B "C5'" 1 
ATOM   327  C  "C4'" . DC  B 2 7  ? 7.703   9.812   28.733  1.00 17.12 ? 17  DC  B "C4'" 1 
ATOM   328  O  "O4'" . DC  B 2 7  ? 7.405   8.604   27.996  1.00 16.18 ? 17  DC  B "O4'" 1 
ATOM   329  C  "C3'" . DC  B 2 7  ? 9.228   9.932   28.780  1.00 16.08 ? 17  DC  B "C3'" 1 
ATOM   330  O  "O3'" . DC  B 2 7  ? 9.708   9.565   30.071  1.00 15.69 ? 17  DC  B "O3'" 1 
ATOM   331  C  "C2'" . DC  B 2 7  ? 9.717   8.960   27.719  1.00 15.18 ? 17  DC  B "C2'" 1 
ATOM   332  C  "C1'" . DC  B 2 7  ? 8.596   7.933   27.619  1.00 15.84 ? 17  DC  B "C1'" 1 
ATOM   333  N  N1    . DC  B 2 7  ? 8.397   7.391   26.256  1.00 14.23 ? 17  DC  B N1    1 
ATOM   334  C  C2    . DC  B 2 7  ? 8.285   6.003   26.089  1.00 14.70 ? 17  DC  B C2    1 
ATOM   335  O  O2    . DC  B 2 7  ? 8.296   5.273   27.090  1.00 12.45 ? 17  DC  B O2    1 
ATOM   336  N  N3    . DC  B 2 7  ? 8.164   5.492   24.838  1.00 16.91 ? 17  DC  B N3    1 
ATOM   337  C  C4    . DC  B 2 7  ? 8.142   6.310   23.782  1.00 16.81 ? 17  DC  B C4    1 
ATOM   338  N  N4    . DC  B 2 7  ? 8.051   5.758   22.567  1.00 15.64 ? 17  DC  B N4    1 
ATOM   339  C  C5    . DC  B 2 7  ? 8.219   7.727   23.925  1.00 17.07 ? 17  DC  B C5    1 
ATOM   340  C  C6    . DC  B 2 7  ? 8.343   8.220   25.168  1.00 14.83 ? 17  DC  B C6    1 
ATOM   341  P  P     . DG  B 2 8  ? 11.166  10.040  30.548  1.00 15.77 ? 18  DG  B P     1 
ATOM   342  O  OP1   . DG  B 2 8  ? 11.034  10.651  31.899  1.00 18.65 ? 18  DG  B OP1   1 
ATOM   343  O  OP2   . DG  B 2 8  ? 11.806  10.821  29.449  1.00 16.55 ? 18  DG  B OP2   1 
ATOM   344  O  "O5'" . DG  B 2 8  ? 11.922  8.656   30.729  1.00 15.42 ? 18  DG  B "O5'" 1 
ATOM   345  C  "C5'" . DG  B 2 8  ? 11.366  7.651   31.566  1.00 16.83 ? 18  DG  B "C5'" 1 
ATOM   346  C  "C4'" . DG  B 2 8  ? 11.906  6.297   31.181  1.00 19.75 ? 18  DG  B "C4'" 1 
ATOM   347  O  "O4'" . DG  B 2 8  ? 11.524  5.980   29.820  1.00 23.87 ? 18  DG  B "O4'" 1 
ATOM   348  C  "C3'" . DG  B 2 8  ? 13.431  6.181   31.221  1.00 13.52 ? 18  DG  B "C3'" 1 
ATOM   349  O  "O3'" . DG  B 2 8  ? 13.757  4.851   31.639  1.00 19.14 ? 18  DG  B "O3'" 1 
ATOM   350  C  "C2'" . DG  B 2 8  ? 13.815  6.355   29.759  1.00 16.05 ? 18  DG  B "C2'" 1 
ATOM   351  C  "C1'" . DG  B 2 8  ? 12.682  5.594   29.109  1.00 14.86 ? 18  DG  B "C1'" 1 
ATOM   352  N  N9    . DG  B 2 8  ? 12.444  5.808   27.686  1.00 16.50 ? 18  DG  B N9    1 
ATOM   353  C  C8    . DG  B 2 8  ? 12.673  6.938   26.939  1.00 16.43 ? 18  DG  B C8    1 
ATOM   354  N  N7    . DG  B 2 8  ? 12.337  6.794   25.684  1.00 16.56 ? 18  DG  B N7    1 
ATOM   355  C  C5    . DG  B 2 8  ? 11.860  5.493   25.602  1.00 14.31 ? 18  DG  B C5    1 
ATOM   356  C  C6    . DG  B 2 8  ? 11.338  4.759   24.493  1.00 16.05 ? 18  DG  B C6    1 
ATOM   357  O  O6    . DG  B 2 8  ? 11.174  5.136   23.325  1.00 13.47 ? 18  DG  B O6    1 
ATOM   358  N  N1    . DG  B 2 8  ? 10.979  3.465   24.858  1.00 16.94 ? 18  DG  B N1    1 
ATOM   359  C  C2    . DG  B 2 8  ? 11.095  2.943   26.125  1.00 17.15 ? 18  DG  B C2    1 
ATOM   360  N  N2    . DG  B 2 8  ? 10.697  1.673   26.295  1.00 14.06 ? 18  DG  B N2    1 
ATOM   361  N  N3    . DG  B 2 8  ? 11.566  3.616   27.157  1.00 13.83 ? 18  DG  B N3    1 
ATOM   362  C  C4    . DG  B 2 8  ? 11.926  4.872   26.827  1.00 13.93 ? 18  DG  B C4    1 
ATOM   363  P  P     . DG  B 2 9  ? 14.934  4.598   32.701  1.00 12.87 ? 19  DG  B P     1 
ATOM   364  O  OP1   . DG  B 2 9  ? 14.272  4.275   33.993  1.00 17.39 ? 19  DG  B OP1   1 
ATOM   365  O  OP2   . DG  B 2 9  ? 15.897  5.721   32.631  1.00 14.95 ? 19  DG  B OP2   1 
ATOM   366  O  "O5'" . DG  B 2 9  ? 15.618  3.277   32.137  1.00 16.12 ? 19  DG  B "O5'" 1 
ATOM   367  C  "C5'" . DG  B 2 9  ? 14.880  2.066   32.087  1.00 15.99 ? 19  DG  B "C5'" 1 
ATOM   368  C  "C4'" . DG  B 2 9  ? 15.215  1.267   30.847  1.00 15.13 ? 19  DG  B "C4'" 1 
ATOM   369  O  "O4'" . DG  B 2 9  ? 14.518  1.761   29.665  1.00 16.57 ? 19  DG  B "O4'" 1 
ATOM   370  C  "C3'" . DG  B 2 9  ? 16.697  1.151   30.479  1.00 16.77 ? 19  DG  B "C3'" 1 
ATOM   371  O  "O3'" . DG  B 2 9  ? 17.074  -0.224  30.370  1.00 15.71 ? 19  DG  B "O3'" 1 
ATOM   372  C  "C2'" . DG  B 2 9  ? 16.768  1.791   29.109  1.00 15.89 ? 19  DG  B "C2'" 1 
ATOM   373  C  "C1'" . DG  B 2 9  ? 15.369  1.542   28.553  1.00 14.48 ? 19  DG  B "C1'" 1 
ATOM   374  N  N9    . DG  B 2 9  ? 15.053  2.496   27.493  1.00 14.79 ? 19  DG  B N9    1 
ATOM   375  C  C8    . DG  B 2 9  ? 15.207  3.853   27.554  1.00 11.23 ? 19  DG  B C8    1 
ATOM   376  N  N7    . DG  B 2 9  ? 15.039  4.442   26.406  1.00 18.81 ? 19  DG  B N7    1 
ATOM   377  C  C5    . DG  B 2 9  ? 14.704  3.416   25.535  1.00 16.67 ? 19  DG  B C5    1 
ATOM   378  C  C6    . DG  B 2 9  ? 14.429  3.451   24.138  1.00 15.96 ? 19  DG  B C6    1 
ATOM   379  O  O6    . DG  B 2 9  ? 14.446  4.427   23.375  1.00 16.48 ? 19  DG  B O6    1 
ATOM   380  N  N1    . DG  B 2 9  ? 14.123  2.186   23.645  1.00 18.44 ? 19  DG  B N1    1 
ATOM   381  C  C2    . DG  B 2 9  ? 14.091  1.037   24.394  1.00 15.48 ? 19  DG  B C2    1 
ATOM   382  N  N2    . DG  B 2 9  ? 13.773  -0.085  23.737  1.00 16.44 ? 19  DG  B N2    1 
ATOM   383  N  N3    . DG  B 2 9  ? 14.352  0.990   25.697  1.00 13.59 ? 19  DG  B N3    1 
ATOM   384  C  C4    . DG  B 2 9  ? 14.656  2.211   26.198  1.00 17.11 ? 19  DG  B C4    1 
ATOM   385  P  P     . DT  B 2 10 ? 18.558  -0.628  29.880  1.00 18.03 ? 20  DT  B P     1 
ATOM   386  O  OP1   . DT  B 2 10 ? 19.093  -1.612  30.860  1.00 16.92 ? 20  DT  B OP1   1 
ATOM   387  O  OP2   . DT  B 2 10 ? 19.359  0.577   29.549  1.00 17.99 ? 20  DT  B OP2   1 
ATOM   388  O  "O5'" . DT  B 2 10 ? 18.278  -1.397  28.509  1.00 15.64 ? 20  DT  B "O5'" 1 
ATOM   389  C  "C5'" . DT  B 2 10 ? 17.371  -2.500  28.462  1.00 17.03 ? 20  DT  B "C5'" 1 
ATOM   390  C  "C4'" . DT  B 2 10 ? 17.458  -3.202  27.125  1.00 20.42 ? 20  DT  B "C4'" 1 
ATOM   391  O  "O4'" . DT  B 2 10 ? 16.921  -2.338  26.091  1.00 11.45 ? 20  DT  B "O4'" 1 
ATOM   392  C  "C3'" . DT  B 2 10 ? 18.870  -3.588  26.675  1.00 15.71 ? 20  DT  B "C3'" 1 
ATOM   393  O  "O3'" . DT  B 2 10 ? 18.878  -4.760  25.881  1.00 14.73 ? 20  DT  B "O3'" 1 
ATOM   394  C  "C2'" . DT  B 2 10 ? 19.255  -2.469  25.727  1.00 15.53 ? 20  DT  B "C2'" 1 
ATOM   395  C  "C1'" . DT  B 2 10 ? 17.917  -2.075  25.104  1.00 16.62 ? 20  DT  B "C1'" 1 
ATOM   396  N  N1    . DT  B 2 10 ? 17.828  -0.639  24.740  1.00 18.13 ? 20  DT  B N1    1 
ATOM   397  C  C2    . DT  B 2 10 ? 17.473  -0.302  23.449  1.00 16.84 ? 20  DT  B C2    1 
ATOM   398  O  O2    . DT  B 2 10 ? 17.233  -1.129  22.581  1.00 15.13 ? 20  DT  B O2    1 
ATOM   399  N  N3    . DT  B 2 10 ? 17.413  1.050   23.213  1.00 13.45 ? 20  DT  B N3    1 
ATOM   400  C  C4    . DT  B 2 10 ? 17.677  2.071   24.108  1.00 17.41 ? 20  DT  B C4    1 
ATOM   401  O  O4    . DT  B 2 10 ? 17.588  3.243   23.750  1.00 17.34 ? 20  DT  B O4    1 
ATOM   402  C  C5    . DT  B 2 10 ? 18.053  1.644   25.435  1.00 13.29 ? 20  DT  B C5    1 
ATOM   403  C  C7    . DT  B 2 10 ? 18.376  2.676   26.470  1.00 14.14 ? 20  DT  B C7    1 
ATOM   404  C  C6    . DT  B 2 10 ? 18.102  0.333   25.680  1.00 16.54 ? 20  DT  B C6    1 
ATOM   405  N  N     . MET C 3 1  ? -14.358 13.416  9.007   1.00 48.14 ? 1   MET C N     1 
ATOM   406  C  CA    . MET C 3 1  ? -14.660 12.744  7.707   1.00 47.68 ? 1   MET C CA    1 
ATOM   407  C  C     . MET C 3 1  ? -13.362 12.270  7.055   1.00 47.33 ? 1   MET C C     1 
ATOM   408  O  O     . MET C 3 1  ? -13.026 12.659  5.930   1.00 48.04 ? 1   MET C O     1 
ATOM   409  C  CB    . MET C 3 1  ? -15.401 13.710  6.770   1.00 48.84 ? 1   MET C CB    1 
ATOM   410  C  CG    . MET C 3 1  ? -15.913 13.080  5.475   1.00 50.02 ? 1   MET C CG    1 
ATOM   411  S  SD    . MET C 3 1  ? -15.697 14.169  4.032   1.00 53.05 ? 1   MET C SD    1 
ATOM   412  C  CE    . MET C 3 1  ? -14.142 13.511  3.314   1.00 50.78 ? 1   MET C CE    1 
ATOM   413  N  N     . ASP C 3 2  ? -12.633 11.425  7.779   1.00 45.55 ? 2   ASP C N     1 
ATOM   414  C  CA    . ASP C 3 2  ? -11.368 10.876  7.296   1.00 43.31 ? 2   ASP C CA    1 
ATOM   415  C  C     . ASP C 3 2  ? -11.590 9.499   6.655   1.00 41.91 ? 2   ASP C C     1 
ATOM   416  O  O     . ASP C 3 2  ? -12.731 9.052   6.492   1.00 42.52 ? 2   ASP C O     1 
ATOM   417  C  CB    . ASP C 3 2  ? -10.383 10.751  8.465   1.00 41.90 ? 2   ASP C CB    1 
ATOM   418  C  CG    . ASP C 3 2  ? -11.014 10.104  9.689   1.00 41.75 ? 2   ASP C CG    1 
ATOM   419  O  OD1   . ASP C 3 2  ? -11.913 10.727  10.300  1.00 41.03 ? 2   ASP C OD1   1 
ATOM   420  O  OD2   . ASP C 3 2  ? -10.611 8.972   10.039  1.00 40.75 ? 2   ASP C OD2   1 
ATOM   421  N  N     . SER C 3 3  ? -10.499 8.834   6.284   1.00 40.22 ? 3   SER C N     1 
ATOM   422  C  CA    . SER C 3 3  ? -10.591 7.502   5.691   1.00 37.78 ? 3   SER C CA    1 
ATOM   423  C  C     . SER C 3 3  ? -10.700 6.479   6.821   1.00 36.38 ? 3   SER C C     1 
ATOM   424  O  O     . SER C 3 3  ? -9.978  6.570   7.826   1.00 36.39 ? 3   SER C O     1 
ATOM   425  C  CB    . SER C 3 3  ? -9.352  7.205   4.842   1.00 37.24 ? 3   SER C CB    1 
ATOM   426  O  OG    . SER C 3 3  ? -9.441  5.927   4.236   1.00 36.02 ? 3   SER C OG    1 
ATOM   427  N  N     . ALA C 3 4  ? -11.609 5.518   6.662   1.00 33.88 ? 4   ALA C N     1 
ATOM   428  C  CA    . ALA C 3 4  ? -11.808 4.473   7.667   1.00 31.57 ? 4   ALA C CA    1 
ATOM   429  C  C     . ALA C 3 4  ? -10.742 3.401   7.494   1.00 29.65 ? 4   ALA C C     1 
ATOM   430  O  O     . ALA C 3 4  ? -10.769 2.359   8.155   1.00 29.38 ? 4   ALA C O     1 
ATOM   431  C  CB    . ALA C 3 4  ? -13.172 3.858   7.504   1.00 31.46 ? 4   ALA C CB    1 
ATOM   432  N  N     . ILE C 3 5  ? -9.810  3.666   6.585   1.00 27.46 ? 5   ILE C N     1 
ATOM   433  C  CA    . ILE C 3 5  ? -8.735  2.739   6.294   1.00 24.88 ? 5   ILE C CA    1 
ATOM   434  C  C     . ILE C 3 5  ? -7.933  2.403   7.549   1.00 23.07 ? 5   ILE C C     1 
ATOM   435  O  O     . ILE C 3 5  ? -7.698  3.252   8.412   1.00 23.24 ? 5   ILE C O     1 
ATOM   436  C  CB    . ILE C 3 5  ? -7.786  3.318   5.197   1.00 25.14 ? 5   ILE C CB    1 
ATOM   437  C  CG1   . ILE C 3 5  ? -6.706  2.299   4.840   1.00 24.63 ? 5   ILE C CG1   1 
ATOM   438  C  CG2   . ILE C 3 5  ? -7.151  4.615   5.676   1.00 25.14 ? 5   ILE C CG2   1 
ATOM   439  C  CD1   . ILE C 3 5  ? -7.022  1.487   3.626   1.00 25.13 ? 5   ILE C CD1   1 
ATOM   440  N  N     . THR C 3 6  ? -7.537  1.141   7.630   1.00 19.71 ? 6   THR C N     1 
ATOM   441  C  CA    . THR C 3 6  ? -6.743  0.612   8.726   1.00 18.05 ? 6   THR C CA    1 
ATOM   442  C  C     . THR C 3 6  ? -5.270  0.853   8.347   1.00 16.47 ? 6   THR C C     1 
ATOM   443  O  O     . THR C 3 6  ? -4.983  1.093   7.175   1.00 15.38 ? 6   THR C O     1 
ATOM   444  C  CB    . THR C 3 6  ? -7.047  -0.888  8.862   1.00 17.62 ? 6   THR C CB    1 
ATOM   445  O  OG1   . THR C 3 6  ? -7.414  -1.185  10.210  1.00 20.34 ? 6   THR C OG1   1 
ATOM   446  C  CG2   . THR C 3 6  ? -5.878  -1.713  8.448   1.00 16.14 ? 6   THR C CG2   1 
ATOM   447  N  N     . LEU C 3 7  ? -4.339  0.805   9.302   1.00 14.83 ? 7   LEU C N     1 
ATOM   448  C  CA    . LEU C 3 7  ? -2.934  1.042   8.934   1.00 13.70 ? 7   LEU C CA    1 
ATOM   449  C  C     . LEU C 3 7  ? -2.346  -0.105  8.111   1.00 12.67 ? 7   LEU C C     1 
ATOM   450  O  O     . LEU C 3 7  ? -1.597  0.127   7.163   1.00 13.35 ? 7   LEU C O     1 
ATOM   451  C  CB    . LEU C 3 7  ? -2.043  1.295   10.167  1.00 13.14 ? 7   LEU C CB    1 
ATOM   452  C  CG    . LEU C 3 7  ? -0.515  1.289   9.918   1.00 12.58 ? 7   LEU C CG    1 
ATOM   453  C  CD1   . LEU C 3 7  ? -0.103  2.535   9.145   1.00 11.31 ? 7   LEU C CD1   1 
ATOM   454  C  CD2   . LEU C 3 7  ? 0.243   1.212   11.254  1.00 11.96 ? 7   LEU C CD2   1 
ATOM   455  N  N     . TRP C 3 8  ? -2.672  -1.342  8.456   1.00 12.37 ? 8   TRP C N     1 
ATOM   456  C  CA    . TRP C 3 8  ? -2.122  -2.445  7.691   1.00 11.96 ? 8   TRP C CA    1 
ATOM   457  C  C     . TRP C 3 8  ? -2.766  -2.496  6.303   1.00 11.14 ? 8   TRP C C     1 
ATOM   458  O  O     . TRP C 3 8  ? -2.176  -3.028  5.373   1.00 10.62 ? 8   TRP C O     1 
ATOM   459  C  CB    . TRP C 3 8  ? -2.280  -3.780  8.438   1.00 12.42 ? 8   TRP C CB    1 
ATOM   460  C  CG    . TRP C 3 8  ? -3.690  -4.241  8.644   1.00 14.71 ? 8   TRP C CG    1 
ATOM   461  C  CD1   . TRP C 3 8  ? -4.428  -4.130  9.789   1.00 13.68 ? 8   TRP C CD1   1 
ATOM   462  C  CD2   . TRP C 3 8  ? -4.539  -4.884  7.677   1.00 15.24 ? 8   TRP C CD2   1 
ATOM   463  N  NE1   . TRP C 3 8  ? -5.687  -4.661  9.596   1.00 14.95 ? 8   TRP C NE1   1 
ATOM   464  C  CE2   . TRP C 3 8  ? -5.782  -5.132  8.310   1.00 15.66 ? 8   TRP C CE2   1 
ATOM   465  C  CE3   . TRP C 3 8  ? -4.370  -5.273  6.339   1.00 14.21 ? 8   TRP C CE3   1 
ATOM   466  C  CZ2   . TRP C 3 8  ? -6.853  -5.753  7.649   1.00 15.13 ? 8   TRP C CZ2   1 
ATOM   467  C  CZ3   . TRP C 3 8  ? -5.434  -5.890  5.682   1.00 15.09 ? 8   TRP C CZ3   1 
ATOM   468  C  CH2   . TRP C 3 8  ? -6.659  -6.122  6.339   1.00 15.89 ? 8   TRP C CH2   1 
ATOM   469  N  N     . GLN C 3 9  ? -3.956  -1.915  6.159   1.00 10.26 ? 9   GLN C N     1 
ATOM   470  C  CA    . GLN C 3 9  ? -4.644  -1.901  4.861   1.00 11.58 ? 9   GLN C CA    1 
ATOM   471  C  C     . GLN C 3 9  ? -4.031  -0.811  3.997   1.00 12.02 ? 9   GLN C C     1 
ATOM   472  O  O     . GLN C 3 9  ? -3.926  -0.942  2.779   1.00 12.36 ? 9   GLN C O     1 
ATOM   473  C  CB    . GLN C 3 9  ? -6.130  -1.592  5.022   1.00 12.48 ? 9   GLN C CB    1 
ATOM   474  C  CG    . GLN C 3 9  ? -6.971  -2.692  5.623   1.00 13.65 ? 9   GLN C CG    1 
ATOM   475  C  CD    . GLN C 3 9  ? -8.365  -2.194  5.989   1.00 14.77 ? 9   GLN C CD    1 
ATOM   476  O  OE1   . GLN C 3 9  ? -8.672  -1.014  5.829   1.00 14.89 ? 9   GLN C OE1   1 
ATOM   477  N  NE2   . GLN C 3 9  ? -9.213  -3.090  6.475   1.00 16.11 ? 9   GLN C NE2   1 
ATOM   478  N  N     . PHE C 3 10 ? -3.644  0.277   4.654   1.00 12.02 ? 10  PHE C N     1 
ATOM   479  C  CA    . PHE C 3 10 ? -3.032  1.420   4.001   1.00 12.30 ? 10  PHE C CA    1 
ATOM   480  C  C     . PHE C 3 10 ? -1.670  1.009   3.451   1.00 12.37 ? 10  PHE C C     1 
ATOM   481  O  O     . PHE C 3 10 ? -1.290  1.417   2.357   1.00 11.81 ? 10  PHE C O     1 
ATOM   482  C  CB    . PHE C 3 10 ? -2.889  2.559   5.010   1.00 12.03 ? 10  PHE C CB    1 
ATOM   483  C  CG    . PHE C 3 10 ? -2.050  3.708   4.530   1.00 13.06 ? 10  PHE C CG    1 
ATOM   484  C  CD1   . PHE C 3 10 ? -2.574  4.651   3.657   1.00 13.40 ? 10  PHE C CD1   1 
ATOM   485  C  CD2   . PHE C 3 10 ? -0.740  3.863   4.977   1.00 12.38 ? 10  PHE C CD2   1 
ATOM   486  C  CE1   . PHE C 3 10 ? -1.805  5.734   3.239   1.00 13.80 ? 10  PHE C CE1   1 
ATOM   487  C  CE2   . PHE C 3 10 ? 0.036   4.942   4.567   1.00 12.21 ? 10  PHE C CE2   1 
ATOM   488  C  CZ    . PHE C 3 10 ? -0.491  5.875   3.701   1.00 13.42 ? 10  PHE C CZ    1 
ATOM   489  N  N     . LEU C 3 11 ? -0.944  0.193   4.211   1.00 11.56 ? 11  LEU C N     1 
ATOM   490  C  CA    . LEU C 3 11 ? 0.369   -0.277  3.776   1.00 11.48 ? 11  LEU C CA    1 
ATOM   491  C  C     . LEU C 3 11 ? 0.181   -1.185  2.575   1.00 12.32 ? 11  LEU C C     1 
ATOM   492  O  O     . LEU C 3 11 ? 0.926   -1.104  1.598   1.00 11.73 ? 11  LEU C O     1 
ATOM   493  C  CB    . LEU C 3 11 ? 1.061   -1.031  4.908   1.00 10.56 ? 11  LEU C CB    1 
ATOM   494  C  CG    . LEU C 3 11 ? 1.430   -0.088  6.057   1.00 10.59 ? 11  LEU C CG    1 
ATOM   495  C  CD1   . LEU C 3 11 ? 2.062   -0.884  7.184   1.00 10.95 ? 11  LEU C CD1   1 
ATOM   496  C  CD2   . LEU C 3 11 ? 2.381   1.011   5.546   1.00 10.23 ? 11  LEU C CD2   1 
ATOM   497  N  N     . LEU C 3 12 ? -0.833  -2.043  2.660   1.00 12.43 ? 12  LEU C N     1 
ATOM   498  C  CA    . LEU C 3 12 ? -1.168  -2.966  1.583   1.00 13.65 ? 12  LEU C CA    1 
ATOM   499  C  C     . LEU C 3 12 ? -1.523  -2.162  0.331   1.00 13.79 ? 12  LEU C C     1 
ATOM   500  O  O     . LEU C 3 12 ? -1.217  -2.566  -0.785  1.00 15.40 ? 12  LEU C O     1 
ATOM   501  C  CB    . LEU C 3 12 ? -2.357  -3.847  1.999   1.00 13.90 ? 12  LEU C CB    1 
ATOM   502  C  CG    . LEU C 3 12 ? -2.180  -5.372  2.114   1.00 14.96 ? 12  LEU C CG    1 
ATOM   503  C  CD1   . LEU C 3 12 ? -0.756  -5.749  2.541   1.00 14.23 ? 12  LEU C CD1   1 
ATOM   504  C  CD2   . LEU C 3 12 ? -3.200  -5.907  3.101   1.00 13.90 ? 12  LEU C CD2   1 
ATOM   505  N  N     . GLN C 3 13 ? -2.155  -1.015  0.517   1.00 14.28 ? 13  GLN C N     1 
ATOM   506  C  CA    . GLN C 3 13 ? -2.525  -0.179  -0.615  1.00 16.00 ? 13  GLN C CA    1 
ATOM   507  C  C     . GLN C 3 13 ? -1.292  0.389   -1.324  1.00 15.46 ? 13  GLN C C     1 
ATOM   508  O  O     . GLN C 3 13 ? -1.210  0.358   -2.554  1.00 14.97 ? 13  GLN C O     1 
ATOM   509  C  CB    . GLN C 3 13 ? -3.443  0.955   -0.153  1.00 18.13 ? 13  GLN C CB    1 
ATOM   510  C  CG    . GLN C 3 13 ? -4.773  1.019   -0.905  1.00 22.10 ? 13  GLN C CG    1 
ATOM   511  C  CD    . GLN C 3 13 ? -5.982  1.226   0.013   1.00 24.06 ? 13  GLN C CD    1 
ATOM   512  O  OE1   . GLN C 3 13 ? -6.947  0.447   -0.022  1.00 25.48 ? 13  GLN C OE1   1 
ATOM   513  N  NE2   . GLN C 3 13 ? -5.936  2.280   0.834   1.00 24.49 ? 13  GLN C NE2   1 
ATOM   514  N  N     . LEU C 3 14 ? -0.335  0.897   -0.549  1.00 14.25 ? 14  LEU C N     1 
ATOM   515  C  CA    . LEU C 3 14 ? 0.901   1.459   -1.108  1.00 13.32 ? 14  LEU C CA    1 
ATOM   516  C  C     . LEU C 3 14 ? 1.700   0.372   -1.809  1.00 13.33 ? 14  LEU C C     1 
ATOM   517  O  O     . LEU C 3 14 ? 2.312   0.602   -2.858  1.00 12.12 ? 14  LEU C O     1 
ATOM   518  C  CB    . LEU C 3 14 ? 1.768   2.084   0.001   1.00 12.53 ? 14  LEU C CB    1 
ATOM   519  C  CG    . LEU C 3 14 ? 1.167   3.283   0.744   1.00 12.36 ? 14  LEU C CG    1 
ATOM   520  C  CD1   . LEU C 3 14 ? 2.045   3.674   1.912   1.00 11.75 ? 14  LEU C CD1   1 
ATOM   521  C  CD2   . LEU C 3 14 ? 1.014   4.454   -0.215  1.00 13.50 ? 14  LEU C CD2   1 
ATOM   522  N  N     . LEU C 3 15 ? 1.689   -0.816  -1.217  1.00 12.74 ? 15  LEU C N     1 
ATOM   523  C  CA    . LEU C 3 15 ? 2.410   -1.956  -1.759  1.00 13.71 ? 15  LEU C CA    1 
ATOM   524  C  C     . LEU C 3 15 ? 1.807   -2.461  -3.092  1.00 14.78 ? 15  LEU C C     1 
ATOM   525  O  O     . LEU C 3 15 ? 2.419   -3.262  -3.791  1.00 14.32 ? 15  LEU C O     1 
ATOM   526  C  CB    . LEU C 3 15 ? 2.413   -3.084  -0.723  1.00 12.89 ? 15  LEU C CB    1 
ATOM   527  C  CG    . LEU C 3 15 ? 3.675   -3.555  0.025   1.00 12.15 ? 15  LEU C CG    1 
ATOM   528  C  CD1   . LEU C 3 15 ? 4.879   -2.696  -0.284  1.00 11.12 ? 15  LEU C CD1   1 
ATOM   529  C  CD2   . LEU C 3 15 ? 3.391   -3.570  1.516   1.00 11.61 ? 15  LEU C CD2   1 
ATOM   530  N  N     . GLN C 3 16 ? 0.615   -1.991  -3.438  1.00 15.88 ? 16  GLN C N     1 
ATOM   531  C  CA    . GLN C 3 16 ? -0.045  -2.417  -4.672  1.00 18.12 ? 16  GLN C CA    1 
ATOM   532  C  C     . GLN C 3 16 ? 0.300   -1.509  -5.867  1.00 18.00 ? 16  GLN C C     1 
ATOM   533  O  O     . GLN C 3 16 ? 0.163   -1.903  -7.024  1.00 18.24 ? 16  GLN C O     1 
ATOM   534  C  CB    . GLN C 3 16 ? -1.564  -2.440  -4.445  1.00 21.41 ? 16  GLN C CB    1 
ATOM   535  C  CG    . GLN C 3 16 ? -2.386  -3.234  -5.465  1.00 26.16 ? 16  GLN C CG    1 
ATOM   536  C  CD    . GLN C 3 16 ? -1.803  -4.615  -5.775  1.00 29.74 ? 16  GLN C CD    1 
ATOM   537  O  OE1   . GLN C 3 16 ? -1.380  -5.348  -4.875  1.00 32.32 ? 16  GLN C OE1   1 
ATOM   538  N  NE2   . GLN C 3 16 ? -1.788  -4.975  -7.058  1.00 30.30 ? 16  GLN C NE2   1 
ATOM   539  N  N     . LYS C 3 17 ? 0.766   -0.300  -5.581  1.00 18.05 ? 17  LYS C N     1 
ATOM   540  C  CA    . LYS C 3 17 ? 1.094   0.654   -6.628  1.00 17.81 ? 17  LYS C CA    1 
ATOM   541  C  C     . LYS C 3 17 ? 2.595   0.875   -6.823  1.00 16.99 ? 17  LYS C C     1 
ATOM   542  O  O     . LYS C 3 17 ? 3.308   1.257   -5.893  1.00 15.88 ? 17  LYS C O     1 
ATOM   543  C  CB    . LYS C 3 17 ? 0.406   1.987   -6.327  1.00 18.91 ? 17  LYS C CB    1 
ATOM   544  C  CG    . LYS C 3 17 ? -1.072  1.848   -6.028  1.00 20.88 ? 17  LYS C CG    1 
ATOM   545  C  CD    . LYS C 3 17 ? -1.866  1.588   -7.302  1.00 22.33 ? 17  LYS C CD    1 
ATOM   546  C  CE    . LYS C 3 17 ? -3.276  1.100   -6.998  1.00 21.94 ? 17  LYS C CE    1 
ATOM   547  N  NZ    . LYS C 3 17 ? -4.145  2.220   -6.568  1.00 24.52 ? 17  LYS C NZ    1 
ATOM   548  N  N     . PRO C 3 18 ? 3.088   0.651   -8.056  1.00 16.53 ? 18  PRO C N     1 
ATOM   549  C  CA    . PRO C 3 18 ? 4.506   0.820   -8.397  1.00 15.39 ? 18  PRO C CA    1 
ATOM   550  C  C     . PRO C 3 18 ? 5.018   2.202   -8.032  1.00 13.18 ? 18  PRO C C     1 
ATOM   551  O  O     . PRO C 3 18 ? 6.188   2.374   -7.705  1.00 12.91 ? 18  PRO C O     1 
ATOM   552  C  CB    . PRO C 3 18 ? 4.548   0.585   -9.910  1.00 16.16 ? 18  PRO C CB    1 
ATOM   553  C  CG    . PRO C 3 18 ? 3.347   -0.239  -10.195 1.00 17.25 ? 18  PRO C CG    1 
ATOM   554  C  CD    . PRO C 3 18 ? 2.294   0.237   -9.227  1.00 17.73 ? 18  PRO C CD    1 
ATOM   555  N  N     . GLN C 3 19 ? 4.128   3.184   -8.093  1.00 12.58 ? 19  GLN C N     1 
ATOM   556  C  CA    . GLN C 3 19 ? 4.476   4.559   -7.780  1.00 13.24 ? 19  GLN C CA    1 
ATOM   557  C  C     . GLN C 3 19 ? 5.068   4.718   -6.385  1.00 13.21 ? 19  GLN C C     1 
ATOM   558  O  O     . GLN C 3 19 ? 5.790   5.683   -6.128  1.00 12.78 ? 19  GLN C O     1 
ATOM   559  C  CB    . GLN C 3 19 ? 3.245   5.459   -7.886  1.00 14.67 ? 19  GLN C CB    1 
ATOM   560  C  CG    . GLN C 3 19 ? 2.343   5.148   -9.064  1.00 19.09 ? 19  GLN C CG    1 
ATOM   561  C  CD    . GLN C 3 19 ? 1.169   4.256   -8.696  1.00 20.01 ? 19  GLN C CD    1 
ATOM   562  O  OE1   . GLN C 3 19 ? 1.171   3.059   -8.993  1.00 19.64 ? 19  GLN C OE1   1 
ATOM   563  N  NE2   . GLN C 3 19 ? 0.156   4.837   -8.051  1.00 20.47 ? 19  GLN C NE2   1 
ATOM   564  N  N     . ASN C 3 20 ? 4.756   3.785   -5.489  1.00 12.67 ? 20  ASN C N     1 
ATOM   565  C  CA    . ASN C 3 20 ? 5.246   3.857   -4.110  1.00 12.68 ? 20  ASN C CA    1 
ATOM   566  C  C     . ASN C 3 20 ? 6.346   2.871   -3.777  1.00 13.13 ? 20  ASN C C     1 
ATOM   567  O  O     . ASN C 3 20 ? 6.733   2.745   -2.610  1.00 13.10 ? 20  ASN C O     1 
ATOM   568  C  CB    . ASN C 3 20 ? 4.089   3.646   -3.133  1.00 12.27 ? 20  ASN C CB    1 
ATOM   569  C  CG    . ASN C 3 20 ? 2.858   4.419   -3.522  1.00 11.64 ? 20  ASN C CG    1 
ATOM   570  O  OD1   . ASN C 3 20 ? 2.827   5.640   -3.418  1.00 12.43 ? 20  ASN C OD1   1 
ATOM   571  N  ND2   . ASN C 3 20 ? 1.832   3.710   -3.974  1.00 11.23 ? 20  ASN C ND2   1 
ATOM   572  N  N     . LYS C 3 21 ? 6.839   2.163   -4.791  1.00 12.56 ? 21  LYS C N     1 
ATOM   573  C  CA    . LYS C 3 21 ? 7.899   1.180   -4.591  1.00 12.71 ? 21  LYS C CA    1 
ATOM   574  C  C     . LYS C 3 21 ? 9.150   1.832   -4.004  1.00 12.06 ? 21  LYS C C     1 
ATOM   575  O  O     . LYS C 3 21 ? 9.897   1.197   -3.257  1.00 12.10 ? 21  LYS C O     1 
ATOM   576  C  CB    . LYS C 3 21 ? 8.251   0.503   -5.916  1.00 14.24 ? 21  LYS C CB    1 
ATOM   577  C  CG    . LYS C 3 21 ? 8.017   -0.989  -5.936  1.00 17.58 ? 21  LYS C CG    1 
ATOM   578  C  CD    . LYS C 3 21 ? 8.761   -1.624  -7.093  1.00 18.54 ? 21  LYS C CD    1 
ATOM   579  C  CE    . LYS C 3 21 ? 10.218  -1.875  -6.713  1.00 20.06 ? 21  LYS C CE    1 
ATOM   580  N  NZ    . LYS C 3 21 ? 10.382  -3.147  -5.954  1.00 21.36 ? 21  LYS C NZ    1 
ATOM   581  N  N     . HIS C 3 22 ? 9.378   3.098   -4.334  1.00 11.26 ? 22  HIS C N     1 
ATOM   582  C  CA    . HIS C 3 22 ? 10.550  3.795   -3.815  1.00 11.41 ? 22  HIS C CA    1 
ATOM   583  C  C     . HIS C 3 22 ? 10.450  4.075   -2.319  1.00 10.93 ? 22  HIS C C     1 
ATOM   584  O  O     . HIS C 3 22 ? 11.466  4.326   -1.680  1.00 10.91 ? 22  HIS C O     1 
ATOM   585  C  CB    . HIS C 3 22 ? 10.776  5.119   -4.547  1.00 9.28  ? 22  HIS C CB    1 
ATOM   586  C  CG    . HIS C 3 22 ? 9.704   6.129   -4.298  1.00 9.58  ? 22  HIS C CG    1 
ATOM   587  N  ND1   . HIS C 3 22 ? 8.481   6.080   -4.928  1.00 9.37  ? 22  HIS C ND1   1 
ATOM   588  C  CD2   . HIS C 3 22 ? 9.672   7.221   -3.501  1.00 8.54  ? 22  HIS C CD2   1 
ATOM   589  C  CE1   . HIS C 3 22 ? 7.742   7.098   -4.534  1.00 7.65  ? 22  HIS C CE1   1 
ATOM   590  N  NE2   . HIS C 3 22 ? 8.440   7.806   -3.666  1.00 7.72  ? 22  HIS C NE2   1 
ATOM   591  N  N     . MET C 3 23 ? 9.241   4.039   -1.756  1.00 10.59 ? 23  MET C N     1 
ATOM   592  C  CA    . MET C 3 23 ? 9.090   4.302   -0.325  1.00 9.82  ? 23  MET C CA    1 
ATOM   593  C  C     . MET C 3 23 ? 8.722   3.068   0.499   1.00 10.39 ? 23  MET C C     1 
ATOM   594  O  O     . MET C 3 23 ? 8.972   3.021   1.713   1.00 9.33  ? 23  MET C O     1 
ATOM   595  C  CB    . MET C 3 23 ? 8.077   5.430   -0.094  1.00 10.40 ? 23  MET C CB    1 
ATOM   596  C  CG    . MET C 3 23 ? 6.630   5.021   -0.136  1.00 10.96 ? 23  MET C CG    1 
ATOM   597  S  SD    . MET C 3 23 ? 5.578   6.442   0.245   1.00 12.43 ? 23  MET C SD    1 
ATOM   598  C  CE    . MET C 3 23 ? 5.563   7.290   -1.388  1.00 12.88 ? 23  MET C CE    1 
ATOM   599  N  N     . ILE C 3 24 ? 8.132   2.075   -0.158  1.00 10.11 ? 24  ILE C N     1 
ATOM   600  C  CA    . ILE C 3 24 ? 7.755   0.821   0.492   1.00 10.87 ? 24  ILE C CA    1 
ATOM   601  C  C     . ILE C 3 24 ? 7.678   -0.280  -0.570  1.00 11.19 ? 24  ILE C C     1 
ATOM   602  O  O     . ILE C 3 24 ? 6.964   -0.156  -1.564  1.00 11.01 ? 24  ILE C O     1 
ATOM   603  C  CB    . ILE C 3 24 ? 6.405   0.948   1.257   1.00 10.16 ? 24  ILE C CB    1 
ATOM   604  C  CG1   . ILE C 3 24 ? 6.038   -0.401  1.885   1.00 10.04 ? 24  ILE C CG1   1 
ATOM   605  C  CG2   . ILE C 3 24 ? 5.318   1.458   0.334   1.00 11.05 ? 24  ILE C CG2   1 
ATOM   606  C  CD1   . ILE C 3 24 ? 4.928   -0.323  2.935   1.00 10.49 ? 24  ILE C CD1   1 
ATOM   607  N  N     . CYS C 3 25 ? 8.434   -1.354  -0.367  1.00 11.32 ? 25  CYS C N     1 
ATOM   608  C  CA    . CYS C 3 25 ? 8.470   -2.438  -1.343  1.00 11.83 ? 25  CYS C CA    1 
ATOM   609  C  C     . CYS C 3 25 ? 8.447   -3.820  -0.703  1.00 12.69 ? 25  CYS C C     1 
ATOM   610  O  O     . CYS C 3 25 ? 8.791   -3.980  0.470   1.00 13.01 ? 25  CYS C O     1 
ATOM   611  C  CB    . CYS C 3 25 ? 9.736   -2.306  -2.189  1.00 12.02 ? 25  CYS C CB    1 
ATOM   612  S  SG    . CYS C 3 25 ? 11.265  -2.574  -1.211  1.00 13.67 ? 25  CYS C SG    1 
ATOM   613  N  N     . TRP C 3 26 ? 8.031   -4.821  -1.474  1.00 12.71 ? 26  TRP C N     1 
ATOM   614  C  CA    . TRP C 3 26 ? 8.006   -6.191  -0.972  1.00 12.43 ? 26  TRP C CA    1 
ATOM   615  C  C     . TRP C 3 26 ? 9.446   -6.677  -1.057  1.00 12.97 ? 26  TRP C C     1 
ATOM   616  O  O     . TRP C 3 26 ? 10.159  -6.364  -2.021  1.00 11.73 ? 26  TRP C O     1 
ATOM   617  C  CB    . TRP C 3 26 ? 7.124   -7.096  -1.846  1.00 11.87 ? 26  TRP C CB    1 
ATOM   618  C  CG    . TRP C 3 26 ? 5.648   -6.831  -1.770  1.00 12.13 ? 26  TRP C CG    1 
ATOM   619  C  CD1   . TRP C 3 26 ? 4.856   -6.327  -2.764  1.00 12.17 ? 26  TRP C CD1   1 
ATOM   620  C  CD2   . TRP C 3 26 ? 4.774   -7.121  -0.670  1.00 11.94 ? 26  TRP C CD2   1 
ATOM   621  N  NE1   . TRP C 3 26 ? 3.543   -6.290  -2.354  1.00 12.73 ? 26  TRP C NE1   1 
ATOM   622  C  CE2   . TRP C 3 26 ? 3.462   -6.772  -1.074  1.00 12.33 ? 26  TRP C CE2   1 
ATOM   623  C  CE3   . TRP C 3 26 ? 4.971   -7.644  0.620   1.00 11.12 ? 26  TRP C CE3   1 
ATOM   624  C  CZ2   . TRP C 3 26 ? 2.347   -6.929  -0.235  1.00 11.66 ? 26  TRP C CZ2   1 
ATOM   625  C  CZ3   . TRP C 3 26 ? 3.862   -7.801  1.455   1.00 10.62 ? 26  TRP C CZ3   1 
ATOM   626  C  CH2   . TRP C 3 26 ? 2.565   -7.443  1.020   1.00 11.37 ? 26  TRP C CH2   1 
ATOM   627  N  N     . THR C 3 27 ? 9.876   -7.430  -0.052  1.00 13.09 ? 27  THR C N     1 
ATOM   628  C  CA    . THR C 3 27 ? 11.232  -7.957  -0.026  1.00 14.65 ? 27  THR C CA    1 
ATOM   629  C  C     . THR C 3 27 ? 11.215  -9.474  -0.020  1.00 15.30 ? 27  THR C C     1 
ATOM   630  O  O     . THR C 3 27 ? 12.252  -10.122 0.112   1.00 14.68 ? 27  THR C O     1 
ATOM   631  C  CB    . THR C 3 27 ? 11.998  -7.461  1.202   1.00 13.89 ? 27  THR C CB    1 
ATOM   632  O  OG1   . THR C 3 27 ? 11.241  -7.735  2.378   1.00 15.65 ? 27  THR C OG1   1 
ATOM   633  C  CG2   . THR C 3 27 ? 12.227  -5.974  1.105   1.00 14.44 ? 27  THR C CG2   1 
ATOM   634  N  N     . SER C 3 28 ? 10.022  -10.040 -0.159  1.00 15.80 ? 28  SER C N     1 
ATOM   635  C  CA    . SER C 3 28 ? 9.868   -11.486 -0.203  1.00 16.47 ? 28  SER C CA    1 
ATOM   636  C  C     . SER C 3 28 ? 8.556   -11.828 -0.896  1.00 16.94 ? 28  SER C C     1 
ATOM   637  O  O     . SER C 3 28 ? 7.742   -10.939 -1.162  1.00 16.98 ? 28  SER C O     1 
ATOM   638  C  CB    . SER C 3 28 ? 9.878   -12.075 1.214   1.00 17.89 ? 28  SER C CB    1 
ATOM   639  O  OG    . SER C 3 28 ? 8.560   -12.287 1.707   1.00 15.83 ? 28  SER C OG    1 
ATOM   640  N  N     . ASN C 3 29 ? 8.365   -13.114 -1.195  1.00 17.88 ? 29  ASN C N     1 
ATOM   641  C  CA    . ASN C 3 29 ? 7.139   -13.584 -1.834  1.00 18.92 ? 29  ASN C CA    1 
ATOM   642  C  C     . ASN C 3 29 ? 6.224   -14.245 -0.796  1.00 19.46 ? 29  ASN C C     1 
ATOM   643  O  O     . ASN C 3 29 ? 5.378   -15.085 -1.139  1.00 19.01 ? 29  ASN C O     1 
ATOM   644  C  CB    . ASN C 3 29 ? 7.459   -14.574 -2.957  1.00 20.55 ? 29  ASN C CB    1 
ATOM   645  C  CG    . ASN C 3 29 ? 8.071   -15.859 -2.444  1.00 22.02 ? 29  ASN C CG    1 
ATOM   646  O  OD1   . ASN C 3 29 ? 8.587   -15.917 -1.323  1.00 23.49 ? 29  ASN C OD1   1 
ATOM   647  N  ND2   . ASN C 3 29 ? 8.021   -16.903 -3.267  1.00 23.01 ? 29  ASN C ND2   1 
ATOM   648  N  N     . ASP C 3 30 ? 6.406   -13.875 0.475   1.00 19.08 ? 30  ASP C N     1 
ATOM   649  C  CA    . ASP C 3 30 ? 5.564   -14.422 1.534   1.00 18.88 ? 30  ASP C CA    1 
ATOM   650  C  C     . ASP C 3 30 ? 5.128   -13.409 2.596   1.00 18.10 ? 30  ASP C C     1 
ATOM   651  O  O     . ASP C 3 30 ? 4.908   -13.765 3.757   1.00 18.10 ? 30  ASP C O     1 
ATOM   652  C  CB    . ASP C 3 30 ? 6.231   -15.651 2.175   1.00 20.05 ? 30  ASP C CB    1 
ATOM   653  C  CG    . ASP C 3 30 ? 7.444   -15.311 3.025   1.00 19.64 ? 30  ASP C CG    1 
ATOM   654  O  OD1   . ASP C 3 30 ? 7.927   -14.158 2.975   1.00 19.75 ? 30  ASP C OD1   1 
ATOM   655  O  OD2   . ASP C 3 30 ? 7.914   -16.223 3.747   1.00 20.86 ? 30  ASP C OD2   1 
ATOM   656  N  N     . GLY C 3 31 ? 5.001   -12.145 2.190   1.00 17.67 ? 31  GLY C N     1 
ATOM   657  C  CA    . GLY C 3 31 ? 4.542   -11.109 3.104   1.00 15.78 ? 31  GLY C CA    1 
ATOM   658  C  C     . GLY C 3 31 ? 5.525   -10.097 3.664   1.00 15.01 ? 31  GLY C C     1 
ATOM   659  O  O     . GLY C 3 31 ? 5.108   -9.128  4.297   1.00 15.54 ? 31  GLY C O     1 
ATOM   660  N  N     . GLN C 3 32 ? 6.816   -10.309 3.436   1.00 14.35 ? 32  GLN C N     1 
ATOM   661  C  CA    . GLN C 3 32 ? 7.860   -9.414  3.937   1.00 13.67 ? 32  GLN C CA    1 
ATOM   662  C  C     . GLN C 3 32 ? 7.968   -8.122  3.119   1.00 13.33 ? 32  GLN C C     1 
ATOM   663  O  O     . GLN C 3 32 ? 7.941   -8.145  1.888   1.00 11.91 ? 32  GLN C O     1 
ATOM   664  C  CB    . GLN C 3 32 ? 9.194   -10.149 3.912   1.00 14.92 ? 32  GLN C CB    1 
ATOM   665  C  CG    . GLN C 3 32 ? 10.215  -9.669  4.912   1.00 18.62 ? 32  GLN C CG    1 
ATOM   666  C  CD    . GLN C 3 32 ? 11.237  -10.743 5.233   1.00 19.87 ? 32  GLN C CD    1 
ATOM   667  O  OE1   . GLN C 3 32 ? 10.899  -11.921 5.369   1.00 22.44 ? 32  GLN C OE1   1 
ATOM   668  N  NE2   . GLN C 3 32 ? 12.492  -10.344 5.352   1.00 22.35 ? 32  GLN C NE2   1 
ATOM   669  N  N     . PHE C 3 33 ? 8.091   -6.992  3.803   1.00 12.08 ? 33  PHE C N     1 
ATOM   670  C  CA    . PHE C 3 33 ? 8.195   -5.713  3.119   1.00 11.28 ? 33  PHE C CA    1 
ATOM   671  C  C     . PHE C 3 33 ? 9.123   -4.791  3.883   1.00 11.58 ? 33  PHE C C     1 
ATOM   672  O  O     . PHE C 3 33 ? 9.396   -5.025  5.056   1.00 11.41 ? 33  PHE C O     1 
ATOM   673  C  CB    . PHE C 3 33 ? 6.806   -5.067  2.958   1.00 10.42 ? 33  PHE C CB    1 
ATOM   674  C  CG    . PHE C 3 33 ? 6.147   -4.669  4.263   1.00 9.28  ? 33  PHE C CG    1 
ATOM   675  C  CD1   . PHE C 3 33 ? 5.426   -5.603  5.010   1.00 9.59  ? 33  PHE C CD1   1 
ATOM   676  C  CD2   . PHE C 3 33 ? 6.239   -3.360  4.736   1.00 9.03  ? 33  PHE C CD2   1 
ATOM   677  C  CE1   . PHE C 3 33 ? 4.803   -5.233  6.223   1.00 7.34  ? 33  PHE C CE1   1 
ATOM   678  C  CE2   . PHE C 3 33 ? 5.622   -2.980  5.941   1.00 8.14  ? 33  PHE C CE2   1 
ATOM   679  C  CZ    . PHE C 3 33 ? 4.905   -3.920  6.680   1.00 7.02  ? 33  PHE C CZ    1 
ATOM   680  N  N     . LYS C 3 34 ? 9.606   -3.748  3.211   1.00 11.68 ? 34  LYS C N     1 
ATOM   681  C  CA    . LYS C 3 34 ? 10.522  -2.791  3.819   1.00 11.90 ? 34  LYS C CA    1 
ATOM   682  C  C     . LYS C 3 34 ? 10.136  -1.342  3.532   1.00 12.16 ? 34  LYS C C     1 
ATOM   683  O  O     . LYS C 3 34 ? 9.821   -0.972  2.391   1.00 10.80 ? 34  LYS C O     1 
ATOM   684  C  CB    . LYS C 3 34 ? 11.948  -3.057  3.317   1.00 12.29 ? 34  LYS C CB    1 
ATOM   685  C  CG    . LYS C 3 34 ? 12.983  -2.010  3.717   1.00 13.19 ? 34  LYS C CG    1 
ATOM   686  C  CD    . LYS C 3 34 ? 14.400  -2.485  3.373   1.00 14.49 ? 34  LYS C CD    1 
ATOM   687  C  CE    . LYS C 3 34 ? 15.466  -1.542  3.917   1.00 15.79 ? 34  LYS C CE    1 
ATOM   688  N  NZ    . LYS C 3 34 ? 14.892  -0.296  4.508   1.00 16.74 ? 34  LYS C NZ    1 
ATOM   689  N  N     . LEU C 3 35 ? 10.147  -0.527  4.587   1.00 12.51 ? 35  LEU C N     1 
ATOM   690  C  CA    . LEU C 3 35 ? 9.837   0.890   4.475   1.00 12.86 ? 35  LEU C CA    1 
ATOM   691  C  C     . LEU C 3 35 ? 11.118  1.607   4.045   1.00 13.32 ? 35  LEU C C     1 
ATOM   692  O  O     . LEU C 3 35 ? 11.896  2.086   4.884   1.00 13.56 ? 35  LEU C O     1 
ATOM   693  C  CB    . LEU C 3 35 ? 9.357   1.438   5.823   1.00 14.11 ? 35  LEU C CB    1 
ATOM   694  C  CG    . LEU C 3 35 ? 8.166   0.710   6.442   1.00 14.11 ? 35  LEU C CG    1 
ATOM   695  C  CD1   . LEU C 3 35 ? 8.080   1.046   7.927   1.00 14.99 ? 35  LEU C CD1   1 
ATOM   696  C  CD2   . LEU C 3 35 ? 6.896   1.121   5.718   1.00 13.04 ? 35  LEU C CD2   1 
ATOM   697  N  N     . LEU C 3 36 ? 11.337  1.666   2.731   1.00 12.82 ? 36  LEU C N     1 
ATOM   698  C  CA    . LEU C 3 36 ? 12.523  2.307   2.177   1.00 11.99 ? 36  LEU C CA    1 
ATOM   699  C  C     . LEU C 3 36 ? 12.591  3.754   2.608   1.00 10.86 ? 36  LEU C C     1 
ATOM   700  O  O     . LEU C 3 36 ? 13.658  4.253   2.933   1.00 10.61 ? 36  LEU C O     1 
ATOM   701  C  CB    . LEU C 3 36 ? 12.515  2.218   0.648   1.00 11.33 ? 36  LEU C CB    1 
ATOM   702  C  CG    . LEU C 3 36 ? 12.502  0.813   0.049   1.00 12.80 ? 36  LEU C CG    1 
ATOM   703  C  CD1   . LEU C 3 36 ? 12.661  0.920   -1.458  1.00 12.15 ? 36  LEU C CD1   1 
ATOM   704  C  CD2   . LEU C 3 36 ? 13.636  -0.029  0.637   1.00 13.59 ? 36  LEU C CD2   1 
ATOM   705  N  N     . GLN C 3 37 ? 11.441  4.422   2.595   1.00 11.05 ? 37  GLN C N     1 
ATOM   706  C  CA    . GLN C 3 37 ? 11.324  5.820   2.996   1.00 11.01 ? 37  GLN C CA    1 
ATOM   707  C  C     . GLN C 3 37 ? 10.264  5.872   4.111   1.00 11.31 ? 37  GLN C C     1 
ATOM   708  O  O     . GLN C 3 37 ? 9.114   6.265   3.882   1.00 10.23 ? 37  GLN C O     1 
ATOM   709  C  CB    . GLN C 3 37 ? 10.878  6.668   1.800   1.00 11.79 ? 37  GLN C CB    1 
ATOM   710  C  CG    . GLN C 3 37 ? 11.854  6.672   0.630   1.00 14.11 ? 37  GLN C CG    1 
ATOM   711  C  CD    . GLN C 3 37 ? 13.223  7.238   0.990   1.00 15.46 ? 37  GLN C CD    1 
ATOM   712  O  OE1   . GLN C 3 37 ? 14.246  6.780   0.477   1.00 17.23 ? 37  GLN C OE1   1 
ATOM   713  N  NE2   . GLN C 3 37 ? 13.249  8.241   1.872   1.00 15.64 ? 37  GLN C NE2   1 
ATOM   714  N  N     . ALA C 3 38 ? 10.682  5.474   5.314   1.00 12.36 ? 38  ALA C N     1 
ATOM   715  C  CA    . ALA C 3 38 ? 9.828   5.395   6.496   1.00 11.58 ? 38  ALA C CA    1 
ATOM   716  C  C     . ALA C 3 38 ? 9.088   6.667   6.895   1.00 11.57 ? 38  ALA C C     1 
ATOM   717  O  O     . ALA C 3 38 ? 7.893   6.616   7.199   1.00 12.20 ? 38  ALA C O     1 
ATOM   718  C  CB    . ALA C 3 38 ? 10.640  4.880   7.663   1.00 12.17 ? 38  ALA C CB    1 
ATOM   719  N  N     . GLU C 3 39 ? 9.785   7.801   6.900   1.00 10.34 ? 39  GLU C N     1 
ATOM   720  C  CA    . GLU C 3 39 ? 9.163   9.073   7.247   1.00 10.03 ? 39  GLU C CA    1 
ATOM   721  C  C     . GLU C 3 39 ? 8.218   9.536   6.129   1.00 10.28 ? 39  GLU C C     1 
ATOM   722  O  O     . GLU C 3 39 ? 7.218   10.212  6.385   1.00 8.56  ? 39  GLU C O     1 
ATOM   723  C  CB    . GLU C 3 39 ? 10.238  10.130  7.494   1.00 10.80 ? 39  GLU C CB    1 
ATOM   724  C  CG    . GLU C 3 39 ? 11.127  9.827   8.695   1.00 11.58 ? 39  GLU C CG    1 
ATOM   725  C  CD    . GLU C 3 39 ? 10.352  9.745   10.013  1.00 12.52 ? 39  GLU C CD    1 
ATOM   726  O  OE1   . GLU C 3 39 ? 9.162   10.112  10.040  1.00 12.74 ? 39  GLU C OE1   1 
ATOM   727  O  OE2   . GLU C 3 39 ? 10.943  9.313   11.023  1.00 12.35 ? 39  GLU C OE2   1 
ATOM   728  N  N     . GLU C 3 40 ? 8.537   9.187   4.883   1.00 10.18 ? 40  GLU C N     1 
ATOM   729  C  CA    . GLU C 3 40 ? 7.668   9.576   3.785   1.00 10.19 ? 40  GLU C CA    1 
ATOM   730  C  C     . GLU C 3 40 ? 6.354   8.786   3.881   1.00 9.86  ? 40  GLU C C     1 
ATOM   731  O  O     . GLU C 3 40 ? 5.276   9.342   3.668   1.00 10.62 ? 40  GLU C O     1 
ATOM   732  C  CB    . GLU C 3 40 ? 8.337   9.333   2.428   1.00 8.63  ? 40  GLU C CB    1 
ATOM   733  C  CG    . GLU C 3 40 ? 7.468   9.825   1.292   1.00 8.66  ? 40  GLU C CG    1 
ATOM   734  C  CD    . GLU C 3 40 ? 8.092   9.654   -0.079  1.00 8.32  ? 40  GLU C CD    1 
ATOM   735  O  OE1   . GLU C 3 40 ? 9.163   9.016   -0.205  1.00 7.48  ? 40  GLU C OE1   1 
ATOM   736  O  OE2   . GLU C 3 40 ? 7.495   10.178  -1.038  1.00 9.73  ? 40  GLU C OE2   1 
ATOM   737  N  N     . VAL C 3 41 ? 6.441   7.498   4.213   1.00 10.29 ? 41  VAL C N     1 
ATOM   738  C  CA    . VAL C 3 41 ? 5.245   6.659   4.362   1.00 9.15  ? 41  VAL C CA    1 
ATOM   739  C  C     . VAL C 3 41 ? 4.414   7.203   5.534   1.00 10.06 ? 41  VAL C C     1 
ATOM   740  O  O     . VAL C 3 41 ? 3.185   7.242   5.464   1.00 9.64  ? 41  VAL C O     1 
ATOM   741  C  CB    . VAL C 3 41 ? 5.610   5.173   4.670   1.00 8.85  ? 41  VAL C CB    1 
ATOM   742  C  CG1   . VAL C 3 41 ? 4.368   4.397   5.062   1.00 8.85  ? 41  VAL C CG1   1 
ATOM   743  C  CG2   . VAL C 3 41 ? 6.264   4.512   3.450   1.00 9.44  ? 41  VAL C CG2   1 
ATOM   744  N  N     . ALA C 3 42 ? 5.091   7.633   6.602   1.00 10.14 ? 42  ALA C N     1 
ATOM   745  C  CA    . ALA C 3 42 ? 4.412   8.161   7.792   1.00 10.96 ? 42  ALA C CA    1 
ATOM   746  C  C     . ALA C 3 42 ? 3.652   9.457   7.514   1.00 11.19 ? 42  ALA C C     1 
ATOM   747  O  O     . ALA C 3 42 ? 2.543   9.671   8.025   1.00 12.54 ? 42  ALA C O     1 
ATOM   748  C  CB    . ALA C 3 42 ? 5.420   8.375   8.925   1.00 9.96  ? 42  ALA C CB    1 
ATOM   749  N  N     . ARG C 3 43 ? 4.250   10.330  6.715   1.00 11.52 ? 43  ARG C N     1 
ATOM   750  C  CA    . ARG C 3 43 ? 3.610   11.592  6.367   1.00 11.02 ? 43  ARG C CA    1 
ATOM   751  C  C     . ARG C 3 43 ? 2.358   11.292  5.542   1.00 11.29 ? 43  ARG C C     1 
ATOM   752  O  O     . ARG C 3 43 ? 1.308   11.923  5.724   1.00 11.57 ? 43  ARG C O     1 
ATOM   753  C  CB    . ARG C 3 43 ? 4.588   12.470  5.579   1.00 11.64 ? 43  ARG C CB    1 
ATOM   754  C  CG    . ARG C 3 43 ? 5.741   13.009  6.429   1.00 12.39 ? 43  ARG C CG    1 
ATOM   755  C  CD    . ARG C 3 43 ? 6.493   14.145  5.737   1.00 13.37 ? 43  ARG C CD    1 
ATOM   756  N  NE    . ARG C 3 43 ? 7.182   13.703  4.522   1.00 14.66 ? 43  ARG C NE    1 
ATOM   757  C  CZ    . ARG C 3 43 ? 8.445   13.297  4.482   1.00 14.57 ? 43  ARG C CZ    1 
ATOM   758  N  NH1   . ARG C 3 43 ? 9.166   13.273  5.596   1.00 16.54 ? 43  ARG C NH1   1 
ATOM   759  N  NH2   . ARG C 3 43 ? 8.987   12.918  3.334   1.00 13.51 ? 43  ARG C NH2   1 
ATOM   760  N  N     . LEU C 3 44 ? 2.468   10.309  4.653   1.00 11.55 ? 44  LEU C N     1 
ATOM   761  C  CA    . LEU C 3 44 ? 1.354   9.894   3.790   1.00 12.34 ? 44  LEU C CA    1 
ATOM   762  C  C     . LEU C 3 44 ? 0.209   9.334   4.630   1.00 12.24 ? 44  LEU C C     1 
ATOM   763  O  O     . LEU C 3 44 ? -0.964  9.530   4.322   1.00 11.45 ? 44  LEU C O     1 
ATOM   764  C  CB    . LEU C 3 44 ? 1.834   8.816   2.805   1.00 13.26 ? 44  LEU C CB    1 
ATOM   765  C  CG    . LEU C 3 44 ? 1.091   8.643   1.479   1.00 12.89 ? 44  LEU C CG    1 
ATOM   766  C  CD1   . LEU C 3 44 ? 1.066   9.968   0.731   1.00 13.22 ? 44  LEU C CD1   1 
ATOM   767  C  CD2   . LEU C 3 44 ? 1.781   7.573   0.654   1.00 12.61 ? 44  LEU C CD2   1 
ATOM   768  N  N     . TRP C 3 45 ? 0.569   8.623   5.692   1.00 11.97 ? 45  TRP C N     1 
ATOM   769  C  CA    . TRP C 3 45 ? -0.403  8.025   6.606   1.00 12.60 ? 45  TRP C CA    1 
ATOM   770  C  C     . TRP C 3 45 ? -1.100  9.140   7.400   1.00 12.86 ? 45  TRP C C     1 
ATOM   771  O  O     . TRP C 3 45 ? -2.317  9.114   7.613   1.00 12.48 ? 45  TRP C O     1 
ATOM   772  C  CB    . TRP C 3 45 ? 0.335   7.033   7.532   1.00 11.92 ? 45  TRP C CB    1 
ATOM   773  C  CG    . TRP C 3 45 ? -0.471  6.460   8.657   1.00 11.84 ? 45  TRP C CG    1 
ATOM   774  C  CD1   . TRP C 3 45 ? -0.141  6.477   9.990   1.00 12.10 ? 45  TRP C CD1   1 
ATOM   775  C  CD2   . TRP C 3 45 ? -1.732  5.777   8.562   1.00 12.01 ? 45  TRP C CD2   1 
ATOM   776  N  NE1   . TRP C 3 45 ? -1.120  5.851   10.724  1.00 11.63 ? 45  TRP C NE1   1 
ATOM   777  C  CE2   . TRP C 3 45 ? -2.108  5.411   9.878   1.00 11.89 ? 45  TRP C CE2   1 
ATOM   778  C  CE3   . TRP C 3 45 ? -2.582  5.439   7.495   1.00 11.55 ? 45  TRP C CE3   1 
ATOM   779  C  CZ2   . TRP C 3 45 ? -3.302  4.720   10.156  1.00 12.16 ? 45  TRP C CZ2   1 
ATOM   780  C  CZ3   . TRP C 3 45 ? -3.771  4.753   7.772   1.00 12.28 ? 45  TRP C CZ3   1 
ATOM   781  C  CH2   . TRP C 3 45 ? -4.116  4.402   9.095   1.00 12.27 ? 45  TRP C CH2   1 
ATOM   782  N  N     . GLY C 3 46 ? -0.324  10.133  7.818   1.00 13.12 ? 46  GLY C N     1 
ATOM   783  C  CA    . GLY C 3 46 ? -0.893  11.245  8.559   1.00 13.54 ? 46  GLY C CA    1 
ATOM   784  C  C     . GLY C 3 46 ? -1.851  12.069  7.706   1.00 13.89 ? 46  GLY C C     1 
ATOM   785  O  O     . GLY C 3 46 ? -2.833  12.613  8.213   1.00 12.56 ? 46  GLY C O     1 
ATOM   786  N  N     . ILE C 3 47 ? -1.563  12.179  6.411   1.00 13.51 ? 47  ILE C N     1 
ATOM   787  C  CA    . ILE C 3 47 ? -2.429  12.931  5.512   1.00 13.56 ? 47  ILE C CA    1 
ATOM   788  C  C     . ILE C 3 47 ? -3.747  12.161  5.392   1.00 14.81 ? 47  ILE C C     1 
ATOM   789  O  O     . ILE C 3 47 ? -4.834  12.741  5.446   1.00 15.06 ? 47  ILE C O     1 
ATOM   790  C  CB    . ILE C 3 47 ? -1.769  13.100  4.114   1.00 12.81 ? 47  ILE C CB    1 
ATOM   791  C  CG1   . ILE C 3 47 ? -0.720  14.219  4.176   1.00 13.13 ? 47  ILE C CG1   1 
ATOM   792  C  CG2   . ILE C 3 47 ? -2.832  13.422  3.061   1.00 12.85 ? 47  ILE C CG2   1 
ATOM   793  C  CD1   . ILE C 3 47 ? 0.226   14.285  2.994   1.00 13.51 ? 47  ILE C CD1   1 
ATOM   794  N  N     . ARG C 3 48 ? -3.642  10.844  5.257   1.00 15.43 ? 48  ARG C N     1 
ATOM   795  C  CA    . ARG C 3 48 ? -4.813  9.987   5.133   1.00 18.30 ? 48  ARG C CA    1 
ATOM   796  C  C     . ARG C 3 48 ? -5.712  10.021  6.381   1.00 18.37 ? 48  ARG C C     1 
ATOM   797  O  O     . ARG C 3 48 ? -6.934  10.081  6.273   1.00 18.65 ? 48  ARG C O     1 
ATOM   798  C  CB    . ARG C 3 48 ? -4.360  8.550   4.860   1.00 21.41 ? 48  ARG C CB    1 
ATOM   799  C  CG    . ARG C 3 48 ? -5.471  7.608   4.429   1.00 27.65 ? 48  ARG C CG    1 
ATOM   800  C  CD    . ARG C 3 48 ? -5.912  7.888   3.002   1.00 31.11 ? 48  ARG C CD    1 
ATOM   801  N  NE    . ARG C 3 48 ? -4.808  8.392   2.188   1.00 35.46 ? 48  ARG C NE    1 
ATOM   802  C  CZ    . ARG C 3 48 ? -4.819  8.441   0.859   1.00 37.45 ? 48  ARG C CZ    1 
ATOM   803  N  NH1   . ARG C 3 48 ? -5.879  8.013   0.175   1.00 38.27 ? 48  ARG C NH1   1 
ATOM   804  N  NH2   . ARG C 3 48 ? -3.762  8.915   0.211   1.00 37.35 ? 48  ARG C NH2   1 
ATOM   805  N  N     . LYS C 3 49 ? -5.100  9.988   7.562   1.00 18.38 ? 49  LYS C N     1 
ATOM   806  C  CA    . LYS C 3 49 ? -5.845  9.991   8.817   1.00 17.99 ? 49  LYS C CA    1 
ATOM   807  C  C     . LYS C 3 49 ? -6.034  11.386  9.389   1.00 18.18 ? 49  LYS C C     1 
ATOM   808  O  O     . LYS C 3 49 ? -6.663  11.553  10.427  1.00 17.33 ? 49  LYS C O     1 
ATOM   809  C  CB    . LYS C 3 49 ? -5.133  9.119   9.850   1.00 17.43 ? 49  LYS C CB    1 
ATOM   810  C  CG    . LYS C 3 49 ? -5.217  7.638   9.557   1.00 18.46 ? 49  LYS C CG    1 
ATOM   811  C  CD    . LYS C 3 49 ? -6.452  7.016   10.194  1.00 20.06 ? 49  LYS C CD    1 
ATOM   812  C  CE    . LYS C 3 49 ? -6.093  6.206   11.442  1.00 21.46 ? 49  LYS C CE    1 
ATOM   813  N  NZ    . LYS C 3 49 ? -6.068  7.033   12.679  1.00 22.33 ? 49  LYS C NZ    1 
ATOM   814  N  N     . ASN C 3 50 ? -5.481  12.387  8.716   1.00 18.66 ? 50  ASN C N     1 
ATOM   815  C  CA    . ASN C 3 50 ? -5.598  13.761  9.178   1.00 19.33 ? 50  ASN C CA    1 
ATOM   816  C  C     . ASN C 3 50 ? -4.805  14.041  10.468  1.00 19.35 ? 50  ASN C C     1 
ATOM   817  O  O     . ASN C 3 50 ? -5.278  14.755  11.353  1.00 18.17 ? 50  ASN C O     1 
ATOM   818  C  CB    . ASN C 3 50 ? -7.074  14.102  9.389   1.00 20.79 ? 50  ASN C CB    1 
ATOM   819  C  CG    . ASN C 3 50 ? -7.452  15.428  8.788   1.00 22.56 ? 50  ASN C CG    1 
ATOM   820  O  OD1   . ASN C 3 50 ? -7.278  16.479  9.416   1.00 23.99 ? 50  ASN C OD1   1 
ATOM   821  N  ND2   . ASN C 3 50 ? -7.967  15.397  7.558   1.00 22.79 ? 50  ASN C ND2   1 
ATOM   822  N  N     . LYS C 3 51 ? -3.605  13.471  10.567  1.00 18.39 ? 51  LYS C N     1 
ATOM   823  C  CA    . LYS C 3 51 ? -2.727  13.671  11.730  1.00 18.54 ? 51  LYS C CA    1 
ATOM   824  C  C     . LYS C 3 51 ? -1.411  14.280  11.218  1.00 17.93 ? 51  LYS C C     1 
ATOM   825  O  O     . LYS C 3 51 ? -0.425  13.570  11.007  1.00 18.14 ? 51  LYS C O     1 
ATOM   826  C  CB    . LYS C 3 51 ? -2.447  12.331  12.428  1.00 17.54 ? 51  LYS C CB    1 
ATOM   827  C  CG    . LYS C 3 51 ? -3.692  11.586  12.887  1.00 18.26 ? 51  LYS C CG    1 
ATOM   828  C  CD    . LYS C 3 51 ? -4.284  12.205  14.155  1.00 19.94 ? 51  LYS C CD    1 
ATOM   829  C  CE    . LYS C 3 51 ? -5.620  11.551  14.522  1.00 20.86 ? 51  LYS C CE    1 
ATOM   830  N  NZ    . LYS C 3 51 ? -6.372  12.356  15.535  1.00 22.14 ? 51  LYS C NZ    1 
ATOM   831  N  N     . PRO C 3 52 ? -1.381  15.610  11.033  1.00 17.51 ? 52  PRO C N     1 
ATOM   832  C  CA    . PRO C 3 52 ? -0.212  16.345  10.537  1.00 17.45 ? 52  PRO C CA    1 
ATOM   833  C  C     . PRO C 3 52 ? 1.104   16.112  11.244  1.00 16.74 ? 52  PRO C C     1 
ATOM   834  O  O     . PRO C 3 52 ? 2.155   16.373  10.672  1.00 16.69 ? 52  PRO C O     1 
ATOM   835  C  CB    . PRO C 3 52 ? -0.638  17.811  10.610  1.00 17.13 ? 52  PRO C CB    1 
ATOM   836  C  CG    . PRO C 3 52 ? -1.811  17.830  11.517  1.00 17.91 ? 52  PRO C CG    1 
ATOM   837  C  CD    . PRO C 3 52 ? -2.498  16.521  11.330  1.00 18.33 ? 52  PRO C CD    1 
ATOM   838  N  N     . ASN C 3 53 ? 1.060   15.627  12.479  1.00 16.40 ? 53  ASN C N     1 
ATOM   839  C  CA    . ASN C 3 53 ? 2.297   15.396  13.219  1.00 15.45 ? 53  ASN C CA    1 
ATOM   840  C  C     . ASN C 3 53 ? 2.729   13.937  13.211  1.00 14.41 ? 53  ASN C C     1 
ATOM   841  O  O     . ASN C 3 53 ? 3.606   13.539  13.977  1.00 13.44 ? 53  ASN C O     1 
ATOM   842  C  CB    . ASN C 3 53 ? 2.148   15.881  14.658  1.00 16.44 ? 53  ASN C CB    1 
ATOM   843  C  CG    . ASN C 3 53 ? 1.656   17.314  14.738  1.00 18.48 ? 53  ASN C CG    1 
ATOM   844  O  OD1   . ASN C 3 53 ? 0.675   17.610  15.423  1.00 21.02 ? 53  ASN C OD1   1 
ATOM   845  N  ND2   . ASN C 3 53 ? 2.334   18.210  14.037  1.00 17.02 ? 53  ASN C ND2   1 
ATOM   846  N  N     . MET C 3 54 ? 2.114   13.144  12.334  1.00 13.34 ? 54  MET C N     1 
ATOM   847  C  CA    . MET C 3 54 ? 2.438   11.727  12.221  1.00 12.77 ? 54  MET C CA    1 
ATOM   848  C  C     . MET C 3 54 ? 3.869   11.546  11.720  1.00 12.48 ? 54  MET C C     1 
ATOM   849  O  O     . MET C 3 54 ? 4.325   12.263  10.824  1.00 12.31 ? 54  MET C O     1 
ATOM   850  C  CB    . MET C 3 54 ? 1.456   11.035  11.254  1.00 12.86 ? 54  MET C CB    1 
ATOM   851  C  CG    . MET C 3 54 ? 1.642   9.522   11.100  1.00 9.65  ? 54  MET C CG    1 
ATOM   852  S  SD    . MET C 3 54 ? 1.898   8.592   12.638  1.00 12.30 ? 54  MET C SD    1 
ATOM   853  C  CE    . MET C 3 54 ? 0.306   8.848   13.488  1.00 10.42 ? 54  MET C CE    1 
ATOM   854  N  N     . ASN C 3 55 ? 4.588   10.605  12.317  1.00 11.48 ? 55  ASN C N     1 
ATOM   855  C  CA    . ASN C 3 55 ? 5.947   10.331  11.880  1.00 11.27 ? 55  ASN C CA    1 
ATOM   856  C  C     . ASN C 3 55 ? 6.185   8.840   12.036  1.00 11.24 ? 55  ASN C C     1 
ATOM   857  O  O     . ASN C 3 55 ? 5.294   8.108   12.496  1.00 10.72 ? 55  ASN C O     1 
ATOM   858  C  CB    . ASN C 3 55 ? 6.976   11.154  12.676  1.00 10.80 ? 55  ASN C CB    1 
ATOM   859  C  CG    . ASN C 3 55 ? 6.892   10.919  14.163  1.00 10.59 ? 55  ASN C CG    1 
ATOM   860  O  OD1   . ASN C 3 55 ? 6.516   9.843   14.604  1.00 11.77 ? 55  ASN C OD1   1 
ATOM   861  N  ND2   . ASN C 3 55 ? 7.247   11.931  14.948  1.00 9.97  ? 55  ASN C ND2   1 
ATOM   862  N  N     . TYR C 3 56 ? 7.368   8.378   11.644  1.00 9.65  ? 56  TYR C N     1 
ATOM   863  C  CA    . TYR C 3 56 ? 7.657   6.957   11.734  1.00 9.41  ? 56  TYR C CA    1 
ATOM   864  C  C     . TYR C 3 56 ? 7.709   6.457   13.178  1.00 9.09  ? 56  TYR C C     1 
ATOM   865  O  O     . TYR C 3 56 ? 7.413   5.294   13.448  1.00 9.69  ? 56  TYR C O     1 
ATOM   866  C  CB    . TYR C 3 56 ? 8.969   6.632   11.018  1.00 8.18  ? 56  TYR C CB    1 
ATOM   867  C  CG    . TYR C 3 56 ? 9.331   5.170   11.078  1.00 7.50  ? 56  TYR C CG    1 
ATOM   868  C  CD1   . TYR C 3 56 ? 8.417   4.190   10.672  1.00 5.68  ? 56  TYR C CD1   1 
ATOM   869  C  CD2   . TYR C 3 56 ? 10.572  4.758   11.571  1.00 5.84  ? 56  TYR C CD2   1 
ATOM   870  C  CE1   . TYR C 3 56 ? 8.731   2.841   10.759  1.00 6.06  ? 56  TYR C CE1   1 
ATOM   871  C  CE2   . TYR C 3 56 ? 10.893  3.408   11.663  1.00 5.84  ? 56  TYR C CE2   1 
ATOM   872  C  CZ    . TYR C 3 56 ? 9.968   2.457   11.258  1.00 5.03  ? 56  TYR C CZ    1 
ATOM   873  O  OH    . TYR C 3 56 ? 10.265  1.127   11.371  1.00 4.77  ? 56  TYR C OH    1 
ATOM   874  N  N     . ASP C 3 57 ? 8.089   7.333   14.100  1.00 9.57  ? 57  ASP C N     1 
ATOM   875  C  CA    . ASP C 3 57 ? 8.156   6.952   15.508  1.00 10.25 ? 57  ASP C CA    1 
ATOM   876  C  C     . ASP C 3 57 ? 6.808   6.390   15.949  1.00 10.20 ? 57  ASP C C     1 
ATOM   877  O  O     . ASP C 3 57 ? 6.719   5.256   16.418  1.00 10.44 ? 57  ASP C O     1 
ATOM   878  C  CB    . ASP C 3 57 ? 8.504   8.171   16.355  1.00 11.38 ? 57  ASP C CB    1 
ATOM   879  C  CG    . ASP C 3 57 ? 8.725   7.828   17.820  1.00 13.26 ? 57  ASP C CG    1 
ATOM   880  O  OD1   . ASP C 3 57 ? 8.722   6.638   18.183  1.00 15.46 ? 57  ASP C OD1   1 
ATOM   881  O  OD2   . ASP C 3 57 ? 8.907   8.765   18.611  1.00 15.16 ? 57  ASP C OD2   1 
ATOM   882  N  N     . LYS C 3 58 ? 5.761   7.191   15.778  1.00 10.70 ? 58  LYS C N     1 
ATOM   883  C  CA    . LYS C 3 58 ? 4.413   6.796   16.162  1.00 10.53 ? 58  LYS C CA    1 
ATOM   884  C  C     . LYS C 3 58 ? 3.806   5.728   15.251  1.00 9.80  ? 58  LYS C C     1 
ATOM   885  O  O     . LYS C 3 58 ? 3.042   4.896   15.714  1.00 9.96  ? 58  LYS C O     1 
ATOM   886  C  CB    . LYS C 3 58 ? 3.514   8.034   16.207  1.00 10.90 ? 58  LYS C CB    1 
ATOM   887  C  CG    . LYS C 3 58 ? 3.918   9.026   17.293  1.00 10.57 ? 58  LYS C CG    1 
ATOM   888  C  CD    . LYS C 3 58 ? 3.076   10.289  17.238  1.00 10.36 ? 58  LYS C CD    1 
ATOM   889  C  CE    . LYS C 3 58 ? 3.729   11.368  16.388  1.00 10.57 ? 58  LYS C CE    1 
ATOM   890  N  NZ    . LYS C 3 58 ? 2.956   12.649  16.380  1.00 8.98  ? 58  LYS C NZ    1 
ATOM   891  N  N     . LEU C 3 59 ? 4.131   5.745   13.959  1.00 9.78  ? 59  LEU C N     1 
ATOM   892  C  CA    . LEU C 3 59 ? 3.596   4.726   13.054  1.00 8.53  ? 59  LEU C CA    1 
ATOM   893  C  C     . LEU C 3 59 ? 4.143   3.365   13.478  1.00 8.51  ? 59  LEU C C     1 
ATOM   894  O  O     . LEU C 3 59 ? 3.419   2.372   13.518  1.00 7.31  ? 59  LEU C O     1 
ATOM   895  C  CB    . LEU C 3 59 ? 3.989   5.024   11.589  1.00 8.50  ? 59  LEU C CB    1 
ATOM   896  C  CG    . LEU C 3 59 ? 3.374   4.143   10.483  1.00 7.12  ? 59  LEU C CG    1 
ATOM   897  C  CD1   . LEU C 3 59 ? 3.338   4.937   9.170   1.00 8.48  ? 59  LEU C CD1   1 
ATOM   898  C  CD2   . LEU C 3 59 ? 4.164   2.862   10.286  1.00 5.61  ? 59  LEU C CD2   1 
ATOM   899  N  N     . SER C 3 60 ? 5.430   3.329   13.806  1.00 8.84  ? 60  SER C N     1 
ATOM   900  C  CA    . SER C 3 60 ? 6.062   2.097   14.238  1.00 9.16  ? 60  SER C CA    1 
ATOM   901  C  C     . SER C 3 60 ? 5.406   1.599   15.537  1.00 8.58  ? 60  SER C C     1 
ATOM   902  O  O     . SER C 3 60 ? 5.298   0.392   15.756  1.00 8.59  ? 60  SER C O     1 
ATOM   903  C  CB    . SER C 3 60 ? 7.575   2.315   14.428  1.00 9.28  ? 60  SER C CB    1 
ATOM   904  O  OG    . SER C 3 60 ? 7.880   3.120   15.566  1.00 9.83  ? 60  SER C OG    1 
ATOM   905  N  N     . ARG C 3 61 ? 4.961   2.509   16.402  1.00 8.63  ? 61  ARG C N     1 
ATOM   906  C  CA    . ARG C 3 61 ? 4.311   2.062   17.636  1.00 8.08  ? 61  ARG C CA    1 
ATOM   907  C  C     . ARG C 3 61 ? 3.026   1.323   17.282  1.00 8.43  ? 61  ARG C C     1 
ATOM   908  O  O     . ARG C 3 61 ? 2.678   0.328   17.920  1.00 8.82  ? 61  ARG C O     1 
ATOM   909  C  CB    . ARG C 3 61 ? 3.984   3.231   18.561  1.00 9.18  ? 61  ARG C CB    1 
ATOM   910  C  CG    . ARG C 3 61 ? 3.413   2.781   19.914  1.00 8.79  ? 61  ARG C CG    1 
ATOM   911  C  CD    . ARG C 3 61 ? 4.399   1.874   20.656  1.00 9.92  ? 61  ARG C CD    1 
ATOM   912  N  NE    . ARG C 3 61 ? 3.873   1.201   21.853  1.00 8.43  ? 61  ARG C NE    1 
ATOM   913  C  CZ    . ARG C 3 61 ? 3.348   -0.022  21.863  1.00 9.08  ? 61  ARG C CZ    1 
ATOM   914  N  NH1   . ARG C 3 61 ? 3.260   -0.729  20.741  1.00 8.52  ? 61  ARG C NH1   1 
ATOM   915  N  NH2   . ARG C 3 61 ? 2.962   -0.569  23.010  1.00 7.55  ? 61  ARG C NH2   1 
ATOM   916  N  N     . ALA C 3 62 ? 2.321   1.818   16.262  1.00 7.20  ? 62  ALA C N     1 
ATOM   917  C  CA    . ALA C 3 62 ? 1.086   1.187   15.794  1.00 7.19  ? 62  ALA C CA    1 
ATOM   918  C  C     . ALA C 3 62 ? 1.404   -0.187  15.209  1.00 7.46  ? 62  ALA C C     1 
ATOM   919  O  O     . ALA C 3 62 ? 0.632   -1.138  15.361  1.00 6.68  ? 62  ALA C O     1 
ATOM   920  C  CB    . ALA C 3 62 ? 0.415   2.069   14.743  1.00 7.48  ? 62  ALA C CB    1 
ATOM   921  N  N     . LEU C 3 63 ? 2.544   -0.301  14.529  1.00 7.60  ? 63  LEU C N     1 
ATOM   922  C  CA    . LEU C 3 63 ? 2.934   -1.583  13.961  1.00 6.61  ? 63  LEU C CA    1 
ATOM   923  C  C     . LEU C 3 63 ? 3.232   -2.545  15.106  1.00 7.16  ? 63  LEU C C     1 
ATOM   924  O  O     . LEU C 3 63 ? 2.899   -3.727  15.039  1.00 7.33  ? 63  LEU C O     1 
ATOM   925  C  CB    . LEU C 3 63 ? 4.175   -1.426  13.076  1.00 7.16  ? 63  LEU C CB    1 
ATOM   926  C  CG    . LEU C 3 63 ? 3.931   -0.766  11.711  1.00 7.30  ? 63  LEU C CG    1 
ATOM   927  C  CD1   . LEU C 3 63 ? 5.260   -0.639  10.951  1.00 8.28  ? 63  LEU C CD1   1 
ATOM   928  C  CD2   . LEU C 3 63 ? 2.904   -1.576  10.923  1.00 6.98  ? 63  LEU C CD2   1 
ATOM   929  N  N     . ARG C 3 64 ? 3.853   -2.034  16.162  1.00 7.76  ? 64  ARG C N     1 
ATOM   930  C  CA    . ARG C 3 64 ? 4.197   -2.873  17.304  1.00 9.75  ? 64  ARG C CA    1 
ATOM   931  C  C     . ARG C 3 64 ? 2.961   -3.443  17.983  1.00 10.09 ? 64  ARG C C     1 
ATOM   932  O  O     . ARG C 3 64 ? 3.001   -4.522  18.564  1.00 11.06 ? 64  ARG C O     1 
ATOM   933  C  CB    . ARG C 3 64 ? 5.049   -2.078  18.291  1.00 11.13 ? 64  ARG C CB    1 
ATOM   934  C  CG    . ARG C 3 64 ? 6.497   -1.940  17.821  1.00 13.94 ? 64  ARG C CG    1 
ATOM   935  C  CD    . ARG C 3 64 ? 7.447   -1.607  18.953  1.00 13.57 ? 64  ARG C CD    1 
ATOM   936  N  NE    . ARG C 3 64 ? 7.285   -0.230  19.398  1.00 16.02 ? 64  ARG C NE    1 
ATOM   937  C  CZ    . ARG C 3 64 ? 7.698   0.837   18.718  1.00 14.50 ? 64  ARG C CZ    1 
ATOM   938  N  NH1   . ARG C 3 64 ? 8.310   0.700   17.548  1.00 15.49 ? 64  ARG C NH1   1 
ATOM   939  N  NH2   . ARG C 3 64 ? 7.514   2.051   19.219  1.00 17.42 ? 64  ARG C NH2   1 
ATOM   940  N  N     . TYR C 3 65 ? 1.852   -2.726  17.888  1.00 10.27 ? 65  TYR C N     1 
ATOM   941  C  CA    . TYR C 3 65 ? 0.602   -3.202  18.471  1.00 10.38 ? 65  TYR C CA    1 
ATOM   942  C  C     . TYR C 3 65 ? 0.064   -4.378  17.654  1.00 10.36 ? 65  TYR C C     1 
ATOM   943  O  O     . TYR C 3 65 ? -0.732  -5.179  18.144  1.00 11.51 ? 65  TYR C O     1 
ATOM   944  C  CB    . TYR C 3 65 ? -0.419  -2.064  18.515  1.00 8.91  ? 65  TYR C CB    1 
ATOM   945  C  CG    . TYR C 3 65 ? -0.399  -1.299  19.817  1.00 7.96  ? 65  TYR C CG    1 
ATOM   946  C  CD1   . TYR C 3 65 ? -0.455  -1.972  21.044  1.00 8.67  ? 65  TYR C CD1   1 
ATOM   947  C  CD2   . TYR C 3 65 ? -0.301  0.086   19.826  1.00 7.43  ? 65  TYR C CD2   1 
ATOM   948  C  CE1   . TYR C 3 65 ? -0.407  -1.271  22.260  1.00 8.27  ? 65  TYR C CE1   1 
ATOM   949  C  CE2   . TYR C 3 65 ? -0.255  0.796   21.020  1.00 8.64  ? 65  TYR C CE2   1 
ATOM   950  C  CZ    . TYR C 3 65 ? -0.307  0.113   22.240  1.00 7.47  ? 65  TYR C CZ    1 
ATOM   951  O  OH    . TYR C 3 65 ? -0.254  0.825   23.418  1.00 7.88  ? 65  TYR C OH    1 
ATOM   952  N  N     . TYR C 3 66 ? 0.508   -4.485  16.405  1.00 9.19  ? 66  TYR C N     1 
ATOM   953  C  CA    . TYR C 3 66 ? 0.065   -5.565  15.534  1.00 8.52  ? 66  TYR C CA    1 
ATOM   954  C  C     . TYR C 3 66 ? 0.768   -6.874  15.891  1.00 8.33  ? 66  TYR C C     1 
ATOM   955  O  O     . TYR C 3 66 ? 0.320   -7.946  15.492  1.00 7.53  ? 66  TYR C O     1 
ATOM   956  C  CB    . TYR C 3 66 ? 0.346   -5.219  14.059  1.00 7.48  ? 66  TYR C CB    1 
ATOM   957  C  CG    . TYR C 3 66 ? -0.596  -4.213  13.406  1.00 7.02  ? 66  TYR C CG    1 
ATOM   958  C  CD1   . TYR C 3 66 ? -1.929  -4.090  13.806  1.00 8.57  ? 66  TYR C CD1   1 
ATOM   959  C  CD2   . TYR C 3 66 ? -0.153  -3.416  12.359  1.00 6.76  ? 66  TYR C CD2   1 
ATOM   960  C  CE1   . TYR C 3 66 ? -2.792  -3.197  13.168  1.00 7.43  ? 66  TYR C CE1   1 
ATOM   961  C  CE2   . TYR C 3 66 ? -0.999  -2.523  11.715  1.00 8.37  ? 66  TYR C CE2   1 
ATOM   962  C  CZ    . TYR C 3 66 ? -2.318  -2.417  12.119  1.00 7.99  ? 66  TYR C CZ    1 
ATOM   963  O  OH    . TYR C 3 66 ? -3.148  -1.550  11.441  1.00 7.10  ? 66  TYR C OH    1 
ATOM   964  N  N     . TYR C 3 67 ? 1.871   -6.792  16.632  1.00 8.83  ? 67  TYR C N     1 
ATOM   965  C  CA    . TYR C 3 67 ? 2.606   -7.999  17.015  1.00 10.40 ? 67  TYR C CA    1 
ATOM   966  C  C     . TYR C 3 67 ? 1.705   -8.898  17.852  1.00 11.72 ? 67  TYR C C     1 
ATOM   967  O  O     . TYR C 3 67 ? 1.666   -10.115 17.673  1.00 11.71 ? 67  TYR C O     1 
ATOM   968  C  CB    . TYR C 3 67 ? 3.852   -7.660  17.851  1.00 9.37  ? 67  TYR C CB    1 
ATOM   969  C  CG    . TYR C 3 67 ? 4.928   -6.836  17.162  1.00 10.05 ? 67  TYR C CG    1 
ATOM   970  C  CD1   . TYR C 3 67 ? 4.873   -6.555  15.794  1.00 9.16  ? 67  TYR C CD1   1 
ATOM   971  C  CD2   . TYR C 3 67 ? 5.986   -6.308  17.896  1.00 8.84  ? 67  TYR C CD2   1 
ATOM   972  C  CE1   . TYR C 3 67 ? 5.843   -5.765  15.185  1.00 9.08  ? 67  TYR C CE1   1 
ATOM   973  C  CE2   . TYR C 3 67 ? 6.966   -5.514  17.293  1.00 8.30  ? 67  TYR C CE2   1 
ATOM   974  C  CZ    . TYR C 3 67 ? 6.888   -5.245  15.942  1.00 9.60  ? 67  TYR C CZ    1 
ATOM   975  O  OH    . TYR C 3 67 ? 7.853   -4.458  15.358  1.00 9.17  ? 67  TYR C OH    1 
ATOM   976  N  N     . VAL C 3 68 ? 1.000   -8.272  18.785  1.00 13.15 ? 68  VAL C N     1 
ATOM   977  C  CA    . VAL C 3 68 ? 0.084   -8.964  19.684  1.00 14.69 ? 68  VAL C CA    1 
ATOM   978  C  C     . VAL C 3 68 ? -1.109  -9.530  18.910  1.00 14.89 ? 68  VAL C C     1 
ATOM   979  O  O     . VAL C 3 68 ? -1.571  -10.649 19.168  1.00 15.85 ? 68  VAL C O     1 
ATOM   980  C  CB    . VAL C 3 68 ? -0.453  -7.989  20.750  1.00 15.58 ? 68  VAL C CB    1 
ATOM   981  C  CG1   . VAL C 3 68 ? -1.250  -8.751  21.789  1.00 17.01 ? 68  VAL C CG1   1 
ATOM   982  C  CG2   . VAL C 3 68 ? 0.703   -7.236  21.400  1.00 15.02 ? 68  VAL C CG2   1 
ATOM   983  N  N     . LYS C 3 69 ? -1.598  -8.736  17.962  1.00 15.36 ? 69  LYS C N     1 
ATOM   984  C  CA    . LYS C 3 69 ? -2.733  -9.109  17.137  1.00 14.63 ? 69  LYS C CA    1 
ATOM   985  C  C     . LYS C 3 69 ? -2.364  -10.141 16.087  1.00 14.51 ? 69  LYS C C     1 
ATOM   986  O  O     . LYS C 3 69 ? -3.232  -10.741 15.458  1.00 14.53 ? 69  LYS C O     1 
ATOM   987  C  CB    . LYS C 3 69 ? -3.303  -7.861  16.469  1.00 15.89 ? 69  LYS C CB    1 
ATOM   988  C  CG    . LYS C 3 69 ? -4.383  -7.180  17.295  1.00 17.72 ? 69  LYS C CG    1 
ATOM   989  C  CD    . LYS C 3 69 ? -4.267  -5.679  17.232  1.00 19.32 ? 69  LYS C CD    1 
ATOM   990  C  CE    . LYS C 3 69 ? -5.512  -5.060  16.616  1.00 21.50 ? 69  LYS C CE    1 
ATOM   991  N  NZ    . LYS C 3 69 ? -5.363  -3.586  16.437  1.00 22.25 ? 69  LYS C NZ    1 
ATOM   992  N  N     . ASN C 3 70 ? -1.071  -10.350 15.899  1.00 14.12 ? 70  ASN C N     1 
ATOM   993  C  CA    . ASN C 3 70 ? -0.596  -11.309 14.916  1.00 15.18 ? 70  ASN C CA    1 
ATOM   994  C  C     . ASN C 3 70 ? -0.943  -10.912 13.490  1.00 14.76 ? 70  ASN C C     1 
ATOM   995  O  O     . ASN C 3 70 ? -1.236  -11.763 12.661  1.00 14.35 ? 70  ASN C O     1 
ATOM   996  C  CB    . ASN C 3 70 ? -1.167  -12.691 15.206  1.00 17.62 ? 70  ASN C CB    1 
ATOM   997  C  CG    . ASN C 3 70 ? -0.164  -13.582 15.876  1.00 21.38 ? 70  ASN C CG    1 
ATOM   998  O  OD1   . ASN C 3 70 ? 0.662   -14.215 15.208  1.00 24.45 ? 70  ASN C OD1   1 
ATOM   999  N  ND2   . ASN C 3 70 ? -0.205  -13.628 17.213  1.00 21.93 ? 70  ASN C ND2   1 
ATOM   1000 N  N     . ILE C 3 71 ? -0.916  -9.615  13.215  1.00 15.04 ? 71  ILE C N     1 
ATOM   1001 C  CA    . ILE C 3 71 ? -1.207  -9.113  11.879  1.00 14.46 ? 71  ILE C CA    1 
ATOM   1002 C  C     . ILE C 3 71 ? 0.127   -8.886  11.176  1.00 14.30 ? 71  ILE C C     1 
ATOM   1003 O  O     . ILE C 3 71 ? 0.306   -9.250  10.014  1.00 14.38 ? 71  ILE C O     1 
ATOM   1004 C  CB    . ILE C 3 71 ? -1.983  -7.774  11.939  1.00 14.25 ? 71  ILE C CB    1 
ATOM   1005 C  CG1   . ILE C 3 71 ? -3.458  -8.040  12.256  1.00 13.44 ? 71  ILE C CG1   1 
ATOM   1006 C  CG2   . ILE C 3 71 ? -1.847  -7.023  10.608  1.00 13.90 ? 71  ILE C CG2   1 
ATOM   1007 C  CD1   . ILE C 3 71 ? -4.281  -6.775  12.394  1.00 13.78 ? 71  ILE C CD1   1 
ATOM   1008 N  N     . ILE C 3 72 ? 1.058   -8.290  11.912  1.00 13.62 ? 72  ILE C N     1 
ATOM   1009 C  CA    . ILE C 3 72 ? 2.390   -7.989  11.409  1.00 13.17 ? 72  ILE C CA    1 
ATOM   1010 C  C     . ILE C 3 72 ? 3.421   -8.258  12.508  1.00 13.95 ? 72  ILE C C     1 
ATOM   1011 O  O     . ILE C 3 72 ? 3.170   -8.020  13.692  1.00 13.85 ? 72  ILE C O     1 
ATOM   1012 C  CB    . ILE C 3 72 ? 2.511   -6.490  10.968  1.00 11.77 ? 72  ILE C CB    1 
ATOM   1013 C  CG1   . ILE C 3 72 ? 1.923   -6.295  9.572   1.00 11.57 ? 72  ILE C CG1   1 
ATOM   1014 C  CG2   . ILE C 3 72 ? 3.973   -6.060  10.918  1.00 11.60 ? 72  ILE C CG2   1 
ATOM   1015 C  CD1   . ILE C 3 72 ? 1.499   -4.868  9.273   1.00 7.49  ? 72  ILE C CD1   1 
ATOM   1016 N  N     . LYS C 3 73 ? 4.574   -8.777  12.103  1.00 13.63 ? 73  LYS C N     1 
ATOM   1017 C  CA    . LYS C 3 73 ? 5.657   -9.043  13.026  1.00 14.30 ? 73  LYS C CA    1 
ATOM   1018 C  C     . LYS C 3 73 ? 6.886   -8.323  12.487  1.00 14.22 ? 73  LYS C C     1 
ATOM   1019 O  O     . LYS C 3 73 ? 6.925   -7.929  11.320  1.00 13.58 ? 73  LYS C O     1 
ATOM   1020 C  CB    . LYS C 3 73 ? 5.907   -10.554 13.157  1.00 14.69 ? 73  LYS C CB    1 
ATOM   1021 C  CG    . LYS C 3 73 ? 6.799   -11.161 12.100  1.00 18.04 ? 73  LYS C CG    1 
ATOM   1022 C  CD    . LYS C 3 73 ? 6.543   -12.654 11.957  1.00 19.63 ? 73  LYS C CD    1 
ATOM   1023 C  CE    . LYS C 3 73 ? 7.783   -13.484 12.288  1.00 21.78 ? 73  LYS C CE    1 
ATOM   1024 N  NZ    . LYS C 3 73 ? 9.058   -12.710 12.167  1.00 22.69 ? 73  LYS C NZ    1 
ATOM   1025 N  N     . LYS C 3 74 ? 7.876   -8.120  13.343  1.00 14.42 ? 74  LYS C N     1 
ATOM   1026 C  CA    . LYS C 3 74 ? 9.099   -7.454  12.934  1.00 14.67 ? 74  LYS C CA    1 
ATOM   1027 C  C     . LYS C 3 74 ? 10.081  -8.490  12.388  1.00 15.80 ? 74  LYS C C     1 
ATOM   1028 O  O     . LYS C 3 74 ? 10.115  -9.625  12.870  1.00 15.92 ? 74  LYS C O     1 
ATOM   1029 C  CB    . LYS C 3 74 ? 9.717   -6.723  14.138  1.00 12.80 ? 74  LYS C CB    1 
ATOM   1030 C  CG    . LYS C 3 74 ? 10.999  -5.970  13.837  1.00 11.08 ? 74  LYS C CG    1 
ATOM   1031 C  CD    . LYS C 3 74 ? 10.708  -4.644  13.174  1.00 10.42 ? 74  LYS C CD    1 
ATOM   1032 C  CE    . LYS C 3 74 ? 11.992  -3.892  12.857  1.00 9.87  ? 74  LYS C CE    1 
ATOM   1033 N  NZ    . LYS C 3 74 ? 12.762  -4.522  11.754  1.00 11.20 ? 74  LYS C NZ    1 
ATOM   1034 N  N     . VAL C 3 75 ? 10.838  -8.128  11.350  1.00 16.68 ? 75  VAL C N     1 
ATOM   1035 C  CA    . VAL C 3 75 ? 11.859  -9.038  10.829  1.00 17.58 ? 75  VAL C CA    1 
ATOM   1036 C  C     . VAL C 3 75 ? 13.081  -8.613  11.652  1.00 18.13 ? 75  VAL C C     1 
ATOM   1037 O  O     . VAL C 3 75 ? 13.637  -7.535  11.449  1.00 17.55 ? 75  VAL C O     1 
ATOM   1038 C  CB    . VAL C 3 75 ? 12.115  -8.835  9.311   1.00 17.50 ? 75  VAL C CB    1 
ATOM   1039 C  CG1   . VAL C 3 75 ? 13.440  -9.470  8.913   1.00 16.62 ? 75  VAL C CG1   1 
ATOM   1040 C  CG2   . VAL C 3 75 ? 10.989  -9.468  8.508   1.00 16.79 ? 75  VAL C CG2   1 
ATOM   1041 N  N     . ASN C 3 76 ? 13.467  -9.452  12.608  1.00 19.79 ? 76  ASN C N     1 
ATOM   1042 C  CA    . ASN C 3 76 ? 14.576  -9.143  13.503  1.00 21.98 ? 76  ASN C CA    1 
ATOM   1043 C  C     . ASN C 3 76 ? 15.916  -8.827  12.830  1.00 22.65 ? 76  ASN C C     1 
ATOM   1044 O  O     . ASN C 3 76 ? 16.351  -9.525  11.908  1.00 23.63 ? 76  ASN C O     1 
ATOM   1045 C  CB    . ASN C 3 76 ? 14.762  -10.287 14.515  1.00 23.73 ? 76  ASN C CB    1 
ATOM   1046 C  CG    . ASN C 3 76 ? 13.601  -10.394 15.524  1.00 25.34 ? 76  ASN C CG    1 
ATOM   1047 O  OD1   . ASN C 3 76 ? 12.887  -9.420  15.791  1.00 25.89 ? 76  ASN C OD1   1 
ATOM   1048 N  ND2   . ASN C 3 76 ? 13.423  -11.583 16.088  1.00 25.50 ? 76  ASN C ND2   1 
ATOM   1049 N  N     . GLY C 3 77 ? 16.560  -7.762  13.306  1.00 23.02 ? 77  GLY C N     1 
ATOM   1050 C  CA    . GLY C 3 77 ? 17.860  -7.362  12.789  1.00 23.18 ? 77  GLY C CA    1 
ATOM   1051 C  C     . GLY C 3 77 ? 17.910  -6.851  11.361  1.00 22.80 ? 77  GLY C C     1 
ATOM   1052 O  O     . GLY C 3 77 ? 18.944  -6.946  10.703  1.00 23.63 ? 77  GLY C O     1 
ATOM   1053 N  N     . GLN C 3 78 ? 16.796  -6.310  10.882  1.00 22.12 ? 78  GLN C N     1 
ATOM   1054 C  CA    . GLN C 3 78 ? 16.718  -5.771  9.526   1.00 21.12 ? 78  GLN C CA    1 
ATOM   1055 C  C     . GLN C 3 78 ? 15.926  -4.480  9.563   1.00 19.71 ? 78  GLN C C     1 
ATOM   1056 O  O     . GLN C 3 78 ? 14.704  -4.496  9.476   1.00 19.91 ? 78  GLN C O     1 
ATOM   1057 C  CB    . GLN C 3 78 ? 16.040  -6.773  8.594   1.00 20.85 ? 78  GLN C CB    1 
ATOM   1058 C  CG    . GLN C 3 78 ? 16.786  -8.088  8.496   1.00 23.29 ? 78  GLN C CG    1 
ATOM   1059 C  CD    . GLN C 3 78 ? 16.579  -8.786  7.179   1.00 23.32 ? 78  GLN C CD    1 
ATOM   1060 O  OE1   . GLN C 3 78 ? 16.364  -9.998  7.137   1.00 24.32 ? 78  GLN C OE1   1 
ATOM   1061 N  NE2   . GLN C 3 78 ? 16.637  -8.028  6.088   1.00 24.06 ? 78  GLN C NE2   1 
ATOM   1062 N  N     . LYS C 3 79 ? 16.639  -3.367  9.695   1.00 19.31 ? 79  LYS C N     1 
ATOM   1063 C  CA    . LYS C 3 79 ? 16.029  -2.045  9.769   1.00 19.08 ? 79  LYS C CA    1 
ATOM   1064 C  C     . LYS C 3 79 ? 14.916  -1.814  8.754   1.00 17.55 ? 79  LYS C C     1 
ATOM   1065 O  O     . LYS C 3 79 ? 15.066  -2.109  7.569   1.00 16.61 ? 79  LYS C O     1 
ATOM   1066 C  CB    . LYS C 3 79 ? 17.098  -0.956  9.608   1.00 21.75 ? 79  LYS C CB    1 
ATOM   1067 C  CG    . LYS C 3 79 ? 17.665  -0.435  10.923  1.00 25.31 ? 79  LYS C CG    1 
ATOM   1068 C  CD    . LYS C 3 79 ? 19.090  0.084   10.738  1.00 27.64 ? 79  LYS C CD    1 
ATOM   1069 C  CE    . LYS C 3 79 ? 19.213  1.549   11.143  1.00 29.74 ? 79  LYS C CE    1 
ATOM   1070 N  NZ    . LYS C 3 79 ? 20.550  2.135   10.805  1.00 30.60 ? 79  LYS C NZ    1 
ATOM   1071 N  N     . PHE C 3 80 ? 13.795  -1.295  9.254   1.00 16.54 ? 80  PHE C N     1 
ATOM   1072 C  CA    . PHE C 3 80 ? 12.615  -0.972  8.454   1.00 14.66 ? 80  PHE C CA    1 
ATOM   1073 C  C     . PHE C 3 80 ? 11.898  -2.143  7.774   1.00 13.79 ? 80  PHE C C     1 
ATOM   1074 O  O     . PHE C 3 80 ? 10.962  -1.936  6.998   1.00 13.22 ? 80  PHE C O     1 
ATOM   1075 C  CB    . PHE C 3 80 ? 13.002  0.096   7.425   1.00 13.47 ? 80  PHE C CB    1 
ATOM   1076 C  CG    . PHE C 3 80 ? 13.634  1.313   8.038   1.00 12.85 ? 80  PHE C CG    1 
ATOM   1077 C  CD1   . PHE C 3 80 ? 12.906  2.129   8.898   1.00 12.11 ? 80  PHE C CD1   1 
ATOM   1078 C  CD2   . PHE C 3 80 ? 14.958  1.639   7.770   1.00 13.01 ? 80  PHE C CD2   1 
ATOM   1079 C  CE1   . PHE C 3 80 ? 13.480  3.248   9.480   1.00 11.95 ? 80  PHE C CE1   1 
ATOM   1080 C  CE2   . PHE C 3 80 ? 15.550  2.764   8.351   1.00 13.46 ? 80  PHE C CE2   1 
ATOM   1081 C  CZ    . PHE C 3 80 ? 14.806  3.570   9.209   1.00 12.93 ? 80  PHE C CZ    1 
ATOM   1082 N  N     . VAL C 3 81 ? 12.325  -3.367  8.079   1.00 12.95 ? 81  VAL C N     1 
ATOM   1083 C  CA    . VAL C 3 81 ? 11.723  -4.553  7.489   1.00 12.76 ? 81  VAL C CA    1 
ATOM   1084 C  C     . VAL C 3 81 ? 10.730  -5.217  8.435   1.00 12.86 ? 81  VAL C C     1 
ATOM   1085 O  O     . VAL C 3 81 ? 11.028  -5.455  9.611   1.00 12.04 ? 81  VAL C O     1 
ATOM   1086 C  CB    . VAL C 3 81 ? 12.786  -5.589  7.095   1.00 13.13 ? 81  VAL C CB    1 
ATOM   1087 C  CG1   . VAL C 3 81 ? 12.113  -6.789  6.438   1.00 12.76 ? 81  VAL C CG1   1 
ATOM   1088 C  CG2   . VAL C 3 81 ? 13.815  -4.954  6.150   1.00 12.86 ? 81  VAL C CG2   1 
ATOM   1089 N  N     . TYR C 3 82 ? 9.552   -5.515  7.899   1.00 12.32 ? 82  TYR C N     1 
ATOM   1090 C  CA    . TYR C 3 82 ? 8.475   -6.140  8.649   1.00 11.73 ? 82  TYR C CA    1 
ATOM   1091 C  C     . TYR C 3 82 ? 7.896   -7.264  7.810   1.00 12.75 ? 82  TYR C C     1 
ATOM   1092 O  O     . TYR C 3 82 ? 8.253   -7.438  6.647   1.00 11.53 ? 82  TYR C O     1 
ATOM   1093 C  CB    . TYR C 3 82 ? 7.366   -5.126  8.944   1.00 10.72 ? 82  TYR C CB    1 
ATOM   1094 C  CG    . TYR C 3 82 ? 7.735   -4.052  9.941   1.00 10.37 ? 82  TYR C CG    1 
ATOM   1095 C  CD1   . TYR C 3 82 ? 8.380   -2.886  9.530   1.00 8.83  ? 82  TYR C CD1   1 
ATOM   1096 C  CD2   . TYR C 3 82 ? 7.423   -4.198  11.306  1.00 9.50  ? 82  TYR C CD2   1 
ATOM   1097 C  CE1   . TYR C 3 82 ? 8.706   -1.888  10.445  1.00 10.03 ? 82  TYR C CE1   1 
ATOM   1098 C  CE2   . TYR C 3 82 ? 7.744   -3.202  12.231  1.00 8.39  ? 82  TYR C CE2   1 
ATOM   1099 C  CZ    . TYR C 3 82 ? 8.382   -2.053  11.798  1.00 9.03  ? 82  TYR C CZ    1 
ATOM   1100 O  OH    . TYR C 3 82 ? 8.690   -1.054  12.698  1.00 7.61  ? 82  TYR C OH    1 
ATOM   1101 N  N     . LYS C 3 83 ? 6.977   -8.016  8.397   1.00 12.52 ? 83  LYS C N     1 
ATOM   1102 C  CA    . LYS C 3 83 ? 6.372   -9.119  7.685   1.00 13.39 ? 83  LYS C CA    1 
ATOM   1103 C  C     . LYS C 3 83 ? 4.920   -9.292  8.044   1.00 14.28 ? 83  LYS C C     1 
ATOM   1104 O  O     . LYS C 3 83 ? 4.553   -9.245  9.214   1.00 14.32 ? 83  LYS C O     1 
ATOM   1105 C  CB    . LYS C 3 83 ? 7.110   -10.419 7.991   1.00 12.92 ? 83  LYS C CB    1 
ATOM   1106 C  CG    . LYS C 3 83 ? 6.695   -11.549 7.081   1.00 13.81 ? 83  LYS C CG    1 
ATOM   1107 C  CD    . LYS C 3 83 ? 7.118   -12.889 7.619   1.00 14.96 ? 83  LYS C CD    1 
ATOM   1108 C  CE    . LYS C 3 83 ? 6.438   -14.009 6.856   1.00 15.12 ? 83  LYS C CE    1 
ATOM   1109 N  NZ    . LYS C 3 83 ? 7.292   -15.222 6.868   1.00 17.44 ? 83  LYS C NZ    1 
ATOM   1110 N  N     . PHE C 3 84 ? 4.089   -9.482  7.030   1.00 14.91 ? 84  PHE C N     1 
ATOM   1111 C  CA    . PHE C 3 84 ? 2.678   -9.712  7.264   1.00 15.58 ? 84  PHE C CA    1 
ATOM   1112 C  C     . PHE C 3 84 ? 2.607   -11.164 7.727   1.00 16.64 ? 84  PHE C C     1 
ATOM   1113 O  O     . PHE C 3 84 ? 3.049   -12.067 7.017   1.00 16.37 ? 84  PHE C O     1 
ATOM   1114 C  CB    . PHE C 3 84 ? 1.889   -9.516  5.971   1.00 14.77 ? 84  PHE C CB    1 
ATOM   1115 C  CG    . PHE C 3 84 ? 1.273   -8.150  5.841   1.00 14.94 ? 84  PHE C CG    1 
ATOM   1116 C  CD1   . PHE C 3 84 ? 0.003   -7.896  6.348   1.00 14.24 ? 84  PHE C CD1   1 
ATOM   1117 C  CD2   . PHE C 3 84 ? 1.971   -7.113  5.231   1.00 14.57 ? 84  PHE C CD2   1 
ATOM   1118 C  CE1   . PHE C 3 84 ? -0.561  -6.633  6.255   1.00 14.52 ? 84  PHE C CE1   1 
ATOM   1119 C  CE2   . PHE C 3 84 ? 1.413   -5.836  5.131   1.00 15.10 ? 84  PHE C CE2   1 
ATOM   1120 C  CZ    . PHE C 3 84 ? 0.143   -5.596  5.646   1.00 14.93 ? 84  PHE C CZ    1 
ATOM   1121 N  N     . VAL C 3 85 ? 2.071   -11.388 8.925   1.00 17.82 ? 85  VAL C N     1 
ATOM   1122 C  CA    . VAL C 3 85 ? 1.985   -12.740 9.467   1.00 18.88 ? 85  VAL C CA    1 
ATOM   1123 C  C     . VAL C 3 85 ? 1.360   -13.705 8.479   1.00 20.66 ? 85  VAL C C     1 
ATOM   1124 O  O     . VAL C 3 85 ? 1.939   -14.754 8.183   1.00 21.86 ? 85  VAL C O     1 
ATOM   1125 C  CB    . VAL C 3 85 ? 1.193   -12.770 10.792  1.00 17.64 ? 85  VAL C CB    1 
ATOM   1126 C  CG1   . VAL C 3 85 ? 0.860   -14.207 11.178  1.00 15.48 ? 85  VAL C CG1   1 
ATOM   1127 C  CG2   . VAL C 3 85 ? 2.012   -12.108 11.885  1.00 16.17 ? 85  VAL C CG2   1 
ATOM   1128 N  N     . SER C 3 86 ? 0.183   -13.359 7.967   1.00 21.72 ? 86  SER C N     1 
ATOM   1129 C  CA    . SER C 3 86 ? -0.487  -14.222 7.002   1.00 22.54 ? 86  SER C CA    1 
ATOM   1130 C  C     . SER C 3 86 ? -1.010  -13.449 5.796   1.00 22.73 ? 86  SER C C     1 
ATOM   1131 O  O     . SER C 3 86 ? -2.179  -13.051 5.728   1.00 22.37 ? 86  SER C O     1 
ATOM   1132 C  CB    . SER C 3 86 ? -1.621  -15.004 7.671   1.00 23.48 ? 86  SER C CB    1 
ATOM   1133 O  OG    . SER C 3 86 ? -1.194  -16.318 7.995   1.00 24.33 ? 86  SER C OG    1 
ATOM   1134 N  N     . TYR C 3 87 ? -0.102  -13.221 4.855   1.00 22.08 ? 87  TYR C N     1 
ATOM   1135 C  CA    . TYR C 3 87 ? -0.418  -12.532 3.617   1.00 22.03 ? 87  TYR C CA    1 
ATOM   1136 C  C     . TYR C 3 87 ? -0.442  -13.663 2.600   1.00 21.40 ? 87  TYR C C     1 
ATOM   1137 O  O     . TYR C 3 87 ? 0.460   -14.490 2.588   1.00 22.45 ? 87  TYR C O     1 
ATOM   1138 C  CB    . TYR C 3 87 ? 0.692   -11.536 3.274   1.00 22.30 ? 87  TYR C CB    1 
ATOM   1139 C  CG    . TYR C 3 87 ? 0.540   -10.897 1.918   1.00 22.10 ? 87  TYR C CG    1 
ATOM   1140 C  CD1   . TYR C 3 87 ? -0.411  -9.899  1.702   1.00 23.20 ? 87  TYR C CD1   1 
ATOM   1141 C  CD2   . TYR C 3 87 ? 1.334   -11.298 0.842   1.00 22.66 ? 87  TYR C CD2   1 
ATOM   1142 C  CE1   . TYR C 3 87 ? -0.571  -9.313  0.441   1.00 23.46 ? 87  TYR C CE1   1 
ATOM   1143 C  CE2   . TYR C 3 87 ? 1.184   -10.719 -0.423  1.00 23.75 ? 87  TYR C CE2   1 
ATOM   1144 C  CZ    . TYR C 3 87 ? 0.230   -9.729  -0.612  1.00 23.35 ? 87  TYR C CZ    1 
ATOM   1145 O  OH    . TYR C 3 87 ? 0.085   -9.144  -1.850  1.00 25.66 ? 87  TYR C OH    1 
ATOM   1146 N  N     . PRO C 3 88 ? -1.474  -13.726 1.743   1.00 20.96 ? 88  PRO C N     1 
ATOM   1147 C  CA    . PRO C 3 88 ? -2.643  -12.851 1.604   1.00 20.08 ? 88  PRO C CA    1 
ATOM   1148 C  C     . PRO C 3 88 ? -3.914  -13.295 2.337   1.00 19.87 ? 88  PRO C C     1 
ATOM   1149 O  O     . PRO C 3 88 ? -5.005  -12.823 2.027   1.00 20.52 ? 88  PRO C O     1 
ATOM   1150 C  CB    . PRO C 3 88 ? -2.861  -12.823 0.100   1.00 20.27 ? 88  PRO C CB    1 
ATOM   1151 C  CG    . PRO C 3 88 ? -2.404  -14.204 -0.351  1.00 20.22 ? 88  PRO C CG    1 
ATOM   1152 C  CD    . PRO C 3 88 ? -1.485  -14.777 0.711   1.00 20.61 ? 88  PRO C CD    1 
ATOM   1153 N  N     . GLU C 3 89 ? -3.787  -14.208 3.290   1.00 19.86 ? 89  GLU C N     1 
ATOM   1154 C  CA    . GLU C 3 89 ? -4.942  -14.690 4.047   1.00 20.05 ? 89  GLU C CA    1 
ATOM   1155 C  C     . GLU C 3 89 ? -5.803  -13.534 4.586   1.00 20.66 ? 89  GLU C C     1 
ATOM   1156 O  O     . GLU C 3 89 ? -7.038  -13.619 4.636   1.00 19.63 ? 89  GLU C O     1 
ATOM   1157 C  CB    . GLU C 3 89 ? -4.461  -15.544 5.222   1.00 19.55 ? 89  GLU C CB    1 
ATOM   1158 C  CG    . GLU C 3 89 ? -5.370  -16.698 5.581   1.00 19.44 ? 89  GLU C CG    1 
ATOM   1159 C  CD    . GLU C 3 89 ? -6.016  -17.329 4.372   1.00 19.27 ? 89  GLU C CD    1 
ATOM   1160 O  OE1   . GLU C 3 89 ? -5.384  -18.206 3.738   1.00 18.84 ? 89  GLU C OE1   1 
ATOM   1161 O  OE2   . GLU C 3 89 ? -7.161  -16.942 4.062   1.00 19.27 ? 89  GLU C OE2   1 
ATOM   1162 N  N     . ILE C 3 90 ? -5.140  -12.452 4.982   1.00 21.14 ? 90  ILE C N     1 
ATOM   1163 C  CA    . ILE C 3 90 ? -5.826  -11.287 5.531   1.00 22.72 ? 90  ILE C CA    1 
ATOM   1164 C  C     . ILE C 3 90 ? -6.670  -10.532 4.491   1.00 23.33 ? 90  ILE C C     1 
ATOM   1165 O  O     . ILE C 3 90 ? -7.395  -9.588  4.829   1.00 23.89 ? 90  ILE C O     1 
ATOM   1166 C  CB    . ILE C 3 90 ? -4.789  -10.321 6.186   1.00 22.93 ? 90  ILE C CB    1 
ATOM   1167 C  CG1   . ILE C 3 90 ? -5.513  -9.233  6.986   1.00 23.11 ? 90  ILE C CG1   1 
ATOM   1168 C  CG2   . ILE C 3 90 ? -3.858  -9.732  5.115   1.00 21.50 ? 90  ILE C CG2   1 
ATOM   1169 C  CD1   . ILE C 3 90 ? -4.581  -8.428  7.882   1.00 23.60 ? 90  ILE C CD1   1 
ATOM   1170 N  N     . LEU C 3 91 ? -6.577  -10.948 3.228   1.00 24.25 ? 91  LEU C N     1 
ATOM   1171 C  CA    . LEU C 3 91 ? -7.338  -10.295 2.160   1.00 25.74 ? 91  LEU C CA    1 
ATOM   1172 C  C     . LEU C 3 91 ? -8.600  -11.055 1.730   1.00 26.58 ? 91  LEU C C     1 
ATOM   1173 O  O     . LEU C 3 91 ? -9.434  -10.527 1.002   1.00 26.60 ? 91  LEU C O     1 
ATOM   1174 C  CB    . LEU C 3 91 ? -6.419  -10.001 0.962   1.00 25.03 ? 91  LEU C CB    1 
ATOM   1175 C  CG    . LEU C 3 91 ? -5.510  -8.784  1.143   1.00 26.09 ? 91  LEU C CG    1 
ATOM   1176 C  CD1   . LEU C 3 91 ? -5.070  -8.271  -0.222  1.00 26.13 ? 91  LEU C CD1   1 
ATOM   1177 C  CD2   . LEU C 3 91 ? -6.242  -7.693  1.904   1.00 25.12 ? 91  LEU C CD2   1 
ATOM   1178 N  N     . ASN C 3 92 ? -8.733  -12.301 2.167   1.00 28.46 ? 92  ASN C N     1 
ATOM   1179 C  CA    . ASN C 3 92 ? -9.945  -13.070 1.889   1.00 30.65 ? 92  ASN C CA    1 
ATOM   1180 C  C     . ASN C 3 92 ? -10.546 -13.404 3.247   1.00 33.17 ? 92  ASN C C     1 
ATOM   1181 O  O     . ASN C 3 92 ? -10.434 -14.541 3.724   1.00 33.49 ? 92  ASN C O     1 
ATOM   1182 C  CB    . ASN C 3 92 ? -9.672  -14.381 1.159   1.00 30.54 ? 92  ASN C CB    1 
ATOM   1183 C  CG    . ASN C 3 92 ? -8.447  -14.328 0.317   1.00 31.12 ? 92  ASN C CG    1 
ATOM   1184 O  OD1   . ASN C 3 92 ? -8.522  -14.377 -0.909  1.00 30.94 ? 92  ASN C OD1   1 
ATOM   1185 N  ND2   . ASN C 3 92 ? -7.290  -14.226 0.967   1.00 31.19 ? 92  ASN C ND2   1 
ATOM   1186 N  N     . MET C 3 93 ? -11.152 -12.402 3.878   1.00 34.91 ? 93  MET C N     1 
ATOM   1187 C  CA    . MET C 3 93 ? -11.779 -12.611 5.167   1.00 35.90 ? 93  MET C CA    1 
ATOM   1188 C  C     . MET C 3 93 ? -13.050 -13.403 4.882   1.00 36.50 ? 93  MET C C     1 
ATOM   1189 O  O     . MET C 3 93 ? -13.476 -14.188 5.762   1.00 36.90 ? 93  MET C O     1 
ATOM   1190 C  CB    . MET C 3 93 ? -12.110 -11.265 5.802   1.00 36.07 ? 93  MET C CB    1 
ATOM   1191 C  CG    . MET C 3 93 ? -11.129 -10.895 6.912   1.00 37.16 ? 93  MET C CG    1 
ATOM   1192 S  SD    . MET C 3 93 ? -10.619 -9.145  6.971   1.00 39.69 ? 93  MET C SD    1 
ATOM   1193 C  CE    . MET C 3 93 ? -9.062  -9.270  7.750   1.00 37.29 ? 93  MET C CE    1 
ATOM   1194 O  OXT   . MET C 3 93 ? -13.574 -13.244 3.754   1.00 36.38 ? 93  MET C OXT   1 
HETATM 1195 ZN ZN    . ZN  D 4 .  ? 12.870  8.232   24.146  1.00 26.33 ? 2   ZN  B ZN    1 
HETATM 1196 ZN ZN    . ZN  E 4 .  ? -8.319  -18.103 2.886   1.00 15.69 ? 94  ZN  C ZN    1 
HETATM 1197 O  O     . HOH F 5 .  ? -3.779  2.060   27.272  1.00 2.00  ? 19  HOH A O     1 
HETATM 1198 O  O     . HOH F 5 .  ? -4.182  3.536   31.329  1.00 12.57 ? 20  HOH A O     1 
HETATM 1199 O  O     . HOH F 5 .  ? -2.030  1.708   34.158  1.00 19.76 ? 21  HOH A O     1 
HETATM 1200 O  O     . HOH F 5 .  ? -7.263  9.583   33.539  1.00 29.52 ? 23  HOH A O     1 
HETATM 1201 O  O     . HOH F 5 .  ? -7.793  6.387   29.739  1.00 27.14 ? 24  HOH A O     1 
HETATM 1202 O  O     . HOH F 5 .  ? -9.006  4.494   26.763  1.00 26.07 ? 25  HOH A O     1 
HETATM 1203 O  O     . HOH F 5 .  ? 19.360  7.516   22.897  1.00 19.18 ? 26  HOH A O     1 
HETATM 1204 O  O     . HOH F 5 .  ? 15.527  9.205   8.859   1.00 39.43 ? 47  HOH A O     1 
HETATM 1205 O  O     . HOH F 5 .  ? 14.477  9.809   12.041  1.00 34.73 ? 48  HOH A O     1 
HETATM 1206 O  O     . HOH F 5 .  ? 11.216  5.269   14.800  1.00 30.33 ? 50  HOH A O     1 
HETATM 1207 O  O     . HOH F 5 .  ? 13.068  5.710   16.139  1.00 22.93 ? 51  HOH A O     1 
HETATM 1208 O  O     . HOH F 5 .  ? 12.870  6.418   18.713  1.00 18.61 ? 52  HOH A O     1 
HETATM 1209 O  O     . HOH F 5 .  ? 16.109  7.158   20.592  1.00 34.83 ? 53  HOH A O     1 
HETATM 1210 O  O     . HOH F 5 .  ? 8.365   -8.310  20.088  1.00 15.96 ? 57  HOH A O     1 
HETATM 1211 O  O     . HOH F 5 .  ? 4.189   -5.088  21.008  1.00 17.58 ? 58  HOH A O     1 
HETATM 1212 O  O     . HOH F 5 .  ? 6.180   -10.522 24.664  1.00 28.40 ? 59  HOH A O     1 
HETATM 1213 O  O     . HOH F 5 .  ? 18.129  13.454  14.823  1.00 23.77 ? 60  HOH A O     1 
HETATM 1214 O  O     . HOH F 5 .  ? 9.743   3.882   18.463  1.00 9.48  ? 71  HOH A O     1 
HETATM 1215 O  O     . HOH F 5 .  ? 11.098  1.122   15.107  1.00 7.24  ? 72  HOH A O     1 
HETATM 1216 O  O     . HOH F 5 .  ? 9.096   -0.982  15.460  1.00 4.41  ? 73  HOH A O     1 
HETATM 1217 O  O     . HOH F 5 .  ? 9.513   -7.765  17.970  1.00 15.12 ? 74  HOH A O     1 
HETATM 1218 O  O     . HOH F 5 .  ? 13.154  -6.908  16.674  1.00 8.41  ? 77  HOH A O     1 
HETATM 1219 O  O     . HOH F 5 .  ? -8.382  8.838   28.652  1.00 28.87 ? 84  HOH A O     1 
HETATM 1220 O  O     . HOH F 5 .  ? 5.813   -8.236  25.969  1.00 17.19 ? 92  HOH A O     1 
HETATM 1221 O  O     . HOH F 5 .  ? 3.980   -8.424  27.915  1.00 45.26 ? 93  HOH A O     1 
HETATM 1222 O  O     . HOH F 5 .  ? 3.003   -4.890  32.601  1.00 33.05 ? 95  HOH A O     1 
HETATM 1223 O  O     . HOH F 5 .  ? 5.954   2.959   30.728  1.00 22.71 ? 100 HOH A O     1 
HETATM 1224 O  O     . HOH F 5 .  ? 1.427   8.064   29.137  1.00 20.32 ? 102 HOH A O     1 
HETATM 1225 O  O     . HOH F 5 .  ? 0.069   10.278  28.671  1.00 26.96 ? 103 HOH A O     1 
HETATM 1226 O  O     . HOH F 5 .  ? 11.731  7.616   14.957  1.00 35.32 ? 107 HOH A O     1 
HETATM 1227 O  O     . HOH F 5 .  ? 17.752  -1.488  16.332  1.00 16.28 ? 109 HOH A O     1 
HETATM 1228 O  O     . HOH F 5 .  ? 18.300  -2.617  13.629  1.00 36.31 ? 110 HOH A O     1 
HETATM 1229 O  O     . HOH F 5 .  ? 15.384  -2.693  21.288  1.00 15.66 ? 112 HOH A O     1 
HETATM 1230 O  O     . HOH F 5 .  ? 16.975  6.559   9.588   1.00 22.37 ? 115 HOH A O     1 
HETATM 1231 O  O     . HOH F 5 .  ? -6.399  4.993   27.632  1.00 21.16 ? 133 HOH A O     1 
HETATM 1232 O  O     . HOH F 5 .  ? -5.284  2.494   25.502  1.00 25.98 ? 134 HOH A O     1 
HETATM 1233 O  O     . HOH F 5 .  ? 2.424   7.060   31.524  1.00 39.18 ? 145 HOH A O     1 
HETATM 1234 O  O     . HOH F 5 .  ? 0.953   5.800   35.902  1.00 17.56 ? 146 HOH A O     1 
HETATM 1235 O  O     . HOH F 5 .  ? -3.357  8.477   35.074  1.00 22.51 ? 147 HOH A O     1 
HETATM 1236 O  O     . HOH F 5 .  ? -5.784  2.630   28.262  1.00 18.81 ? 156 HOH A O     1 
HETATM 1237 O  O     . HOH G 5 .  ? -9.278  -3.873  12.531  1.00 22.08 ? 8   HOH B O     1 
HETATM 1238 O  O     . HOH G 5 .  ? -6.054  -3.575  12.922  1.00 20.44 ? 9   HOH B O     1 
HETATM 1239 O  O     . HOH G 5 .  ? -7.885  -7.604  15.173  1.00 30.12 ? 10  HOH B O     1 
HETATM 1240 O  O     . HOH G 5 .  ? -6.667  7.348   17.580  1.00 13.20 ? 27  HOH B O     1 
HETATM 1241 O  O     . HOH G 5 .  ? -4.717  10.722  19.158  1.00 30.06 ? 28  HOH B O     1 
HETATM 1242 O  O     . HOH G 5 .  ? -3.967  13.263  17.705  1.00 25.97 ? 29  HOH B O     1 
HETATM 1243 O  O     . HOH G 5 .  ? -1.825  15.769  20.641  1.00 20.02 ? 30  HOH B O     1 
HETATM 1244 O  O     . HOH G 5 .  ? 2.720   14.979  18.192  1.00 24.77 ? 32  HOH B O     1 
HETATM 1245 O  O     . HOH G 5 .  ? 13.497  9.788   22.847  1.00 35.42 ? 54  HOH B O     1 
HETATM 1246 O  O     . HOH G 5 .  ? -7.871  4.341   15.399  1.00 12.56 ? 62  HOH B O     1 
HETATM 1247 O  O     . HOH G 5 .  ? -6.931  3.498   11.850  1.00 18.53 ? 63  HOH B O     1 
HETATM 1248 O  O     . HOH G 5 .  ? -2.253  9.110   10.742  1.00 10.27 ? 68  HOH B O     1 
HETATM 1249 O  O     . HOH G 5 .  ? 5.655   5.872   19.345  1.00 11.56 ? 70  HOH B O     1 
HETATM 1250 O  O     . HOH G 5 .  ? 9.022   17.022  27.006  1.00 14.84 ? 76  HOH B O     1 
HETATM 1251 O  O     . HOH G 5 .  ? 9.413   10.924  23.743  1.00 29.22 ? 80  HOH B O     1 
HETATM 1252 O  O     . HOH G 5 .  ? 12.505  11.357  27.184  1.00 46.92 ? 81  HOH B O     1 
HETATM 1253 O  O     . HOH G 5 .  ? 14.659  9.548   25.447  1.00 33.65 ? 82  HOH B O     1 
HETATM 1254 O  O     . HOH G 5 .  ? 16.156  6.560   26.149  1.00 15.70 ? 83  HOH B O     1 
HETATM 1255 O  O     . HOH G 5 .  ? 9.517   12.777  32.170  1.00 36.80 ? 90  HOH B O     1 
HETATM 1256 O  O     . HOH G 5 .  ? 9.400   8.568   35.268  1.00 53.84 ? 98  HOH B O     1 
HETATM 1257 O  O     . HOH G 5 .  ? 10.971  2.032   31.701  1.00 28.16 ? 99  HOH B O     1 
HETATM 1258 O  O     . HOH G 5 .  ? 4.201   8.892   28.546  1.00 37.32 ? 101 HOH B O     1 
HETATM 1259 O  O     . HOH G 5 .  ? 13.862  -2.993  25.084  1.00 22.26 ? 113 HOH B O     1 
HETATM 1260 O  O     . HOH G 5 .  ? -6.955  -0.760  22.674  1.00 11.33 ? 114 HOH B O     1 
HETATM 1261 O  O     . HOH G 5 .  ? 21.061  -3.230  30.793  1.00 31.30 ? 131 HOH B O     1 
HETATM 1262 O  O     . HOH G 5 .  ? 19.823  2.765   30.305  1.00 11.63 ? 132 HOH B O     1 
HETATM 1263 O  O     . HOH G 5 .  ? 14.316  6.844   23.216  1.00 20.88 ? 135 HOH B O     1 
HETATM 1264 O  O     . HOH G 5 .  ? 11.398  7.588   22.429  1.00 16.80 ? 136 HOH B O     1 
HETATM 1265 O  O     . HOH G 5 .  ? 11.613  9.932   25.264  1.00 18.92 ? 137 HOH B O     1 
HETATM 1266 O  O     . HOH G 5 .  ? 10.404  2.565   29.530  1.00 35.68 ? 138 HOH B O     1 
HETATM 1267 O  O     . HOH G 5 .  ? 12.031  -0.283  31.059  1.00 43.63 ? 139 HOH B O     1 
HETATM 1268 O  O     . HOH G 5 .  ? -4.349  -0.647  22.381  1.00 11.16 ? 152 HOH B O     1 
HETATM 1269 O  O     . HOH G 5 .  ? -7.370  0.974   24.524  1.00 18.00 ? 153 HOH B O     1 
HETATM 1270 O  O     . HOH G 5 .  ? -9.365  2.262   25.807  1.00 13.32 ? 154 HOH B O     1 
HETATM 1271 O  O     . HOH G 5 .  ? 21.374  0.314   27.844  1.00 19.80 ? 155 HOH B O     1 
HETATM 1272 O  O     . HOH G 5 .  ? -12.076 5.580   24.546  1.00 23.50 ? 157 HOH B O     1 
HETATM 1273 O  O     . HOH G 5 .  ? 12.734  -1.437  26.691  1.00 39.94 ? 158 HOH B O     1 
HETATM 1274 O  O     . HOH G 5 .  ? 10.804  -4.644  30.943  1.00 40.09 ? 159 HOH B O     1 
HETATM 1275 O  O     . HOH H 5 .  ? 13.379  -9.074  3.257   1.00 48.86 ? 95  HOH C O     1 
HETATM 1276 O  O     . HOH H 5 .  ? 17.885  -5.923  5.663   1.00 23.42 ? 96  HOH C O     1 
HETATM 1277 O  O     . HOH H 5 .  ? 17.209  -2.844  6.112   1.00 27.49 ? 97  HOH C O     1 
HETATM 1278 O  O     . HOH H 5 .  ? 20.127  -0.971  7.422   1.00 20.39 ? 98  HOH C O     1 
HETATM 1279 O  O     . HOH H 5 .  ? 19.547  -3.636  9.249   1.00 19.47 ? 99  HOH C O     1 
HETATM 1280 O  O     . HOH H 5 .  ? -6.500  -2.753  19.496  1.00 15.15 ? 100 HOH C O     1 
HETATM 1281 O  O     . HOH H 5 .  ? -3.854  -2.388  19.880  1.00 18.78 ? 101 HOH C O     1 
HETATM 1282 O  O     . HOH H 5 .  ? -3.790  -1.923  17.463  1.00 13.03 ? 102 HOH C O     1 
HETATM 1283 O  O     . HOH H 5 .  ? -2.026  -0.617  15.665  1.00 10.30 ? 103 HOH C O     1 
HETATM 1284 O  O     . HOH H 5 .  ? -2.384  -4.715  20.146  1.00 10.46 ? 104 HOH C O     1 
HETATM 1285 O  O     . HOH H 5 .  ? -2.139  -4.781  23.192  1.00 19.39 ? 105 HOH C O     1 
HETATM 1286 O  O     . HOH H 5 .  ? 2.688   -3.470  21.765  1.00 18.69 ? 106 HOH C O     1 
HETATM 1287 O  O     . HOH H 5 .  ? 0.012   -0.087  25.833  1.00 21.85 ? 107 HOH C O     1 
HETATM 1288 O  O     . HOH H 5 .  ? 8.430   4.164   -7.002  1.00 8.77  ? 108 HOH C O     1 
HETATM 1289 O  O     . HOH H 5 .  ? 0.424   15.870  17.776  1.00 30.46 ? 109 HOH C O     1 
HETATM 1290 O  O     . HOH H 5 .  ? 3.383   14.225  9.282   1.00 9.55  ? 110 HOH C O     1 
HETATM 1291 O  O     . HOH H 5 .  ? 1.015   14.139  7.405   1.00 10.78 ? 111 HOH C O     1 
HETATM 1292 O  O     . HOH H 5 .  ? -5.483  -13.870 -2.575  1.00 11.38 ? 112 HOH C O     1 
HETATM 1293 O  O     . HOH H 5 .  ? -5.606  -13.953 -0.265  1.00 16.05 ? 113 HOH C O     1 
HETATM 1294 O  O     . HOH H 5 .  ? -4.550  -16.308 -1.822  1.00 10.94 ? 114 HOH C O     1 
HETATM 1295 O  O     . HOH H 5 .  ? -4.944  -16.921 0.633   1.00 19.48 ? 115 HOH C O     1 
HETATM 1296 O  O     . HOH H 5 .  ? -2.727  -17.831 2.206   1.00 14.93 ? 116 HOH C O     1 
HETATM 1297 O  O     . HOH H 5 .  ? 6.863   7.706   -7.748  1.00 17.41 ? 117 HOH C O     1 
HETATM 1298 O  O     . HOH H 5 .  ? -10.014 -17.138 2.857   1.00 14.59 ? 118 HOH C O     1 
HETATM 1299 O  O     . HOH H 5 .  ? -11.276 -11.619 -2.396  1.00 27.63 ? 119 HOH C O     1 
HETATM 1300 O  O     . HOH H 5 .  ? -8.189  -10.764 -3.411  1.00 22.89 ? 120 HOH C O     1 
HETATM 1301 O  O     . HOH H 5 .  ? 12.313  12.906  6.183   1.00 27.07 ? 121 HOH C O     1 
HETATM 1302 O  O     . HOH H 5 .  ? 12.889  7.986   6.738   1.00 18.75 ? 122 HOH C O     1 
HETATM 1303 O  O     . HOH H 5 .  ? 13.484  4.776   5.829   1.00 15.99 ? 123 HOH C O     1 
HETATM 1304 O  O     . HOH H 5 .  ? 9.941   9.500   13.550  1.00 7.66  ? 124 HOH C O     1 
HETATM 1305 O  O     . HOH H 5 .  ? 1.990   -12.613 19.250  1.00 26.67 ? 125 HOH C O     1 
HETATM 1306 O  O     . HOH H 5 .  ? 6.262   -9.287  16.028  1.00 41.21 ? 126 HOH C O     1 
HETATM 1307 O  O     . HOH H 5 .  ? -9.708  10.635  16.305  1.00 34.70 ? 127 HOH C O     1 
HETATM 1308 O  O     . HOH H 5 .  ? 18.597  4.867   10.375  1.00 25.57 ? 128 HOH C O     1 
HETATM 1309 O  O     . HOH H 5 .  ? -12.480 5.750   3.557   1.00 23.56 ? 129 HOH C O     1 
HETATM 1310 O  O     . HOH H 5 .  ? -10.583 13.732  6.312   1.00 36.90 ? 130 HOH C O     1 
HETATM 1311 O  O     . HOH H 5 .  ? 7.228   11.451  8.758   1.00 19.80 ? 131 HOH C O     1 
HETATM 1312 O  O     . HOH H 5 .  ? 0.379   5.794   15.738  1.00 16.33 ? 132 HOH C O     1 
HETATM 1313 O  O     . HOH H 5 .  ? 8.428   -8.872  16.199  1.00 21.07 ? 133 HOH C O     1 
HETATM 1314 O  O     . HOH H 5 .  ? 15.263  -5.902  14.948  1.00 25.50 ? 134 HOH C O     1 
HETATM 1315 O  O     . HOH H 5 .  ? 13.525  -8.670  20.288  1.00 32.94 ? 135 HOH C O     1 
HETATM 1316 O  O     . HOH H 5 .  ? -1.744  -16.725 10.692  1.00 31.86 ? 136 HOH C O     1 
HETATM 1317 O  O     . HOH H 5 .  ? -1.522  -16.334 4.190   1.00 17.68 ? 137 HOH C O     1 
HETATM 1318 O  O     . HOH H 5 .  ? 3.714   8.310   -4.655  1.00 18.37 ? 138 HOH C O     1 
HETATM 1319 O  O     . HOH H 5 .  ? -0.332  5.189   -4.451  1.00 36.99 ? 139 HOH C O     1 
HETATM 1320 O  O     . HOH H 5 .  ? 5.556   -17.349 5.418   1.00 35.57 ? 140 HOH C O     1 
HETATM 1321 O  O     . HOH H 5 .  ? 3.109   -11.077 15.290  1.00 27.55 ? 141 HOH C O     1 
HETATM 1322 O  O     . HOH H 5 .  ? -16.325 15.816  12.838  1.00 37.80 ? 142 HOH C O     1 
HETATM 1323 O  O     . HOH H 5 .  ? 9.725   -4.030  -8.587  1.00 37.10 ? 143 HOH C O     1 
HETATM 1324 O  O     . HOH H 5 .  ? 14.196  4.993   -2.118  1.00 18.41 ? 144 HOH C O     1 
HETATM 1325 O  O     . HOH H 5 .  ? 12.901  -12.258 12.578  1.00 21.05 ? 145 HOH C O     1 
HETATM 1326 O  O     . HOH H 5 .  ? -3.438  -11.800 9.184   1.00 26.75 ? 146 HOH C O     1 
HETATM 1327 O  O     . HOH H 5 .  ? -4.329  -11.347 19.703  1.00 29.29 ? 147 HOH C O     1 
HETATM 1328 O  O     . HOH H 5 .  ? 11.193  3.384   15.931  1.00 24.01 ? 148 HOH C O     1 
HETATM 1329 O  O     . HOH H 5 .  ? 15.413  -4.345  12.751  1.00 16.66 ? 149 HOH C O     1 
HETATM 1330 O  O     . HOH H 5 .  ? -12.354 3.244   3.826   1.00 27.34 ? 150 HOH C O     1 
HETATM 1331 O  O     . HOH H 5 .  ? -10.330 0.950   1.379   1.00 40.89 ? 151 HOH C O     1 
HETATM 1332 O  O     . HOH H 5 .  ? -9.380  -2.784  0.235   1.00 35.41 ? 152 HOH C O     1 
HETATM 1333 O  O     . HOH H 5 .  ? -0.533  -5.385  -1.801  1.00 27.14 ? 153 HOH C O     1 
HETATM 1334 O  O     . HOH H 5 .  ? 1.050   -6.028  -3.872  1.00 22.21 ? 154 HOH C O     1 
HETATM 1335 O  O     . HOH H 5 .  ? 2.846   -10.037 -3.659  1.00 20.20 ? 155 HOH C O     1 
HETATM 1336 O  O     . HOH H 5 .  ? -4.774  15.348  5.709   1.00 21.05 ? 156 HOH C O     1 
HETATM 1337 O  O     . HOH H 5 .  ? -3.471  16.121  7.903   1.00 25.27 ? 157 HOH C O     1 
HETATM 1338 O  O     . HOH H 5 .  ? 4.970   -11.026 -0.642  1.00 19.31 ? 158 HOH C O     1 
HETATM 1339 O  O     . HOH H 5 .  ? 10.184  -10.157 -3.778  1.00 27.39 ? 159 HOH C O     1 
HETATM 1340 O  O     . HOH H 5 .  ? 11.462  -14.418 -1.832  1.00 23.66 ? 160 HOH C O     1 
HETATM 1341 O  O     . HOH H 5 .  ? 7.062   -4.071  -4.220  1.00 13.87 ? 161 HOH C O     1 
HETATM 1342 O  O     . HOH H 5 .  ? 5.256   -2.369  -4.377  1.00 16.63 ? 162 HOH C O     1 
HETATM 1343 O  O     . HOH H 5 .  ? 5.147   -0.010  -3.468  1.00 16.67 ? 163 HOH C O     1 
HETATM 1344 O  O     . HOH H 5 .  ? 3.207   -3.759  -8.095  1.00 25.03 ? 164 HOH C O     1 
HETATM 1345 O  O     . HOH H 5 .  ? -2.444  4.281   -2.781  1.00 40.99 ? 165 HOH C O     1 
HETATM 1346 O  O     . HOH H 5 .  ? 3.145   -14.270 5.856   1.00 16.39 ? 166 HOH C O     1 
HETATM 1347 O  O     . HOH H 5 .  ? -1.289  -10.739 8.287   1.00 15.54 ? 167 HOH C O     1 
HETATM 1348 O  O     . HOH H 5 .  ? 11.333  11.670  3.863   1.00 19.16 ? 168 HOH C O     1 
HETATM 1349 O  O     . HOH H 5 .  ? 15.475  -13.570 14.354  1.00 18.27 ? 169 HOH C O     1 
HETATM 1350 O  O     . HOH H 5 .  ? 11.543  9.093   4.178   1.00 11.87 ? 170 HOH C O     1 
HETATM 1351 O  O     . HOH H 5 .  ? 17.742  -5.157  3.056   1.00 30.99 ? 171 HOH C O     1 
HETATM 1352 O  O     . HOH H 5 .  ? -12.118 -2.974  6.319   1.00 31.41 ? 172 HOH C O     1 
HETATM 1353 O  O     . HOH H 5 .  ? 21.166  -5.689  8.683   1.00 34.61 ? 173 HOH C O     1 
HETATM 1354 O  O     . HOH H 5 .  ? 0.872   -5.200  -6.659  1.00 43.14 ? 174 HOH C O     1 
HETATM 1355 O  O     . HOH H 5 .  ? 4.826   -2.150  -7.022  1.00 32.59 ? 175 HOH C O     1 
HETATM 1356 O  O     . HOH H 5 .  ? -5.366  -5.513  25.888  1.00 36.08 ? 176 HOH C O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  DT  1  1  1  DT  T   A . n 
A 1 2  DA  2  2  2  DA  A   A . n 
A 1 3  DC  3  3  3  DC  C   A . n 
A 1 4  DC  4  4  4  DC  C   A . n 
A 1 5  DG  5  5  5  DG  G   A . n 
A 1 6  DG  6  6  6  DG  G   A . n 
A 1 7  DA  7  7  7  DA  A   A . n 
A 1 8  DA  8  8  8  DA  A   A . n 
A 1 9  DG  9  9  9  DG  G   A . n 
A 1 10 DT  10 10 10 DT  T   A . n 
B 2 1  DA  1  11 11 DA  A   B . n 
B 2 2  DA  2  12 12 DA  A   B . n 
B 2 3  DC  3  13 13 DC  C   B . n 
B 2 4  DT  4  14 14 DT  T   B . n 
B 2 5  DT  5  15 15 DT  T   B . n 
B 2 6  DC  6  16 16 DC  C   B . n 
B 2 7  DC  7  17 17 DC  C   B . n 
B 2 8  DG  8  18 18 DG  G   B . n 
B 2 9  DG  9  19 19 DG  G   B . n 
B 2 10 DT  10 20 20 DT  T   B . n 
C 3 1  MET 1  1  1  MET MET C . n 
C 3 2  ASP 2  2  2  ASP ASP C . n 
C 3 3  SER 3  3  3  SER SER C . n 
C 3 4  ALA 4  4  4  ALA ALA C . n 
C 3 5  ILE 5  5  5  ILE ILE C . n 
C 3 6  THR 6  6  6  THR THR C . n 
C 3 7  LEU 7  7  7  LEU LEU C . n 
C 3 8  TRP 8  8  8  TRP TRP C . n 
C 3 9  GLN 9  9  9  GLN GLN C . n 
C 3 10 PHE 10 10 10 PHE PHE C . n 
C 3 11 LEU 11 11 11 LEU LEU C . n 
C 3 12 LEU 12 12 12 LEU LEU C . n 
C 3 13 GLN 13 13 13 GLN GLN C . n 
C 3 14 LEU 14 14 14 LEU LEU C . n 
C 3 15 LEU 15 15 15 LEU LEU C . n 
C 3 16 GLN 16 16 16 GLN GLN C . n 
C 3 17 LYS 17 17 17 LYS LYS C . n 
C 3 18 PRO 18 18 18 PRO PRO C . n 
C 3 19 GLN 19 19 19 GLN GLN C . n 
C 3 20 ASN 20 20 20 ASN ASN C . n 
C 3 21 LYS 21 21 21 LYS LYS C . n 
C 3 22 HIS 22 22 22 HIS HIS C . n 
C 3 23 MET 23 23 23 MET MET C . n 
C 3 24 ILE 24 24 24 ILE ILE C . n 
C 3 25 CYS 25 25 25 CYS CYS C . n 
C 3 26 TRP 26 26 26 TRP TRP C . n 
C 3 27 THR 27 27 27 THR THR C . n 
C 3 28 SER 28 28 28 SER SER C . n 
C 3 29 ASN 29 29 29 ASN ASN C . n 
C 3 30 ASP 30 30 30 ASP ASP C . n 
C 3 31 GLY 31 31 31 GLY GLY C . n 
C 3 32 GLN 32 32 32 GLN GLN C . n 
C 3 33 PHE 33 33 33 PHE PHE C . n 
C 3 34 LYS 34 34 34 LYS LYS C . n 
C 3 35 LEU 35 35 35 LEU LEU C . n 
C 3 36 LEU 36 36 36 LEU LEU C . n 
C 3 37 GLN 37 37 37 GLN GLN C . n 
C 3 38 ALA 38 38 38 ALA ALA C . n 
C 3 39 GLU 39 39 39 GLU GLU C . n 
C 3 40 GLU 40 40 40 GLU GLU C . n 
C 3 41 VAL 41 41 41 VAL VAL C . n 
C 3 42 ALA 42 42 42 ALA ALA C . n 
C 3 43 ARG 43 43 43 ARG ARG C . n 
C 3 44 LEU 44 44 44 LEU LEU C . n 
C 3 45 TRP 45 45 45 TRP TRP C . n 
C 3 46 GLY 46 46 46 GLY GLY C . n 
C 3 47 ILE 47 47 47 ILE ILE C . n 
C 3 48 ARG 48 48 48 ARG ARG C . n 
C 3 49 LYS 49 49 49 LYS LYS C . n 
C 3 50 ASN 50 50 50 ASN ASN C . n 
C 3 51 LYS 51 51 51 LYS LYS C . n 
C 3 52 PRO 52 52 52 PRO PRO C . n 
C 3 53 ASN 53 53 53 ASN ASN C . n 
C 3 54 MET 54 54 54 MET MET C . n 
C 3 55 ASN 55 55 55 ASN ASN C . n 
C 3 56 TYR 56 56 56 TYR TYR C . n 
C 3 57 ASP 57 57 57 ASP ASP C . n 
C 3 58 LYS 58 58 58 LYS LYS C . n 
C 3 59 LEU 59 59 59 LEU LEU C . n 
C 3 60 SER 60 60 60 SER SER C . n 
C 3 61 ARG 61 61 61 ARG ARG C . n 
C 3 62 ALA 62 62 62 ALA ALA C . n 
C 3 63 LEU 63 63 63 LEU LEU C . n 
C 3 64 ARG 64 64 64 ARG ARG C . n 
C 3 65 TYR 65 65 65 TYR TYR C . n 
C 3 66 TYR 66 66 66 TYR TYR C . n 
C 3 67 TYR 67 67 67 TYR TYR C . n 
C 3 68 VAL 68 68 68 VAL VAL C . n 
C 3 69 LYS 69 69 69 LYS LYS C . n 
C 3 70 ASN 70 70 70 ASN ASN C . n 
C 3 71 ILE 71 71 71 ILE ILE C . n 
C 3 72 ILE 72 72 72 ILE ILE C . n 
C 3 73 LYS 73 73 73 LYS LYS C . n 
C 3 74 LYS 74 74 74 LYS LYS C . n 
C 3 75 VAL 75 75 75 VAL VAL C . n 
C 3 76 ASN 76 76 76 ASN ASN C . n 
C 3 77 GLY 77 77 77 GLY GLY C . n 
C 3 78 GLN 78 78 78 GLN GLN C . n 
C 3 79 LYS 79 79 79 LYS LYS C . n 
C 3 80 PHE 80 80 80 PHE PHE C . n 
C 3 81 VAL 81 81 81 VAL VAL C . n 
C 3 82 TYR 82 82 82 TYR TYR C . n 
C 3 83 LYS 83 83 83 LYS LYS C . n 
C 3 84 PHE 84 84 84 PHE PHE C . n 
C 3 85 VAL 85 85 85 VAL VAL C . n 
C 3 86 SER 86 86 86 SER SER C . n 
C 3 87 TYR 87 87 87 TYR TYR C . n 
C 3 88 PRO 88 88 88 PRO PRO C . n 
C 3 89 GLU 89 89 89 GLU GLU C . n 
C 3 90 ILE 90 90 90 ILE ILE C . n 
C 3 91 LEU 91 91 91 LEU LEU C . n 
C 3 92 ASN 92 92 92 ASN ASN C . n 
C 3 93 MET 93 93 93 MET MET C . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OE2 ? C GLU 89 ? C GLU 89  ? 1_555 ZN ? E ZN . ? C ZN 94 ? 1_555 O ? H HOH . ? C HOH 118 ? 1_555 102.9 ? 
2  N7  ? B DG  8  ? B DG  18  ? 1_555 ZN ? D ZN . ? B ZN 2  ? 1_555 O ? G HOH . ? B HOH 54  ? 1_555 172.6 ? 
3  N7  ? B DG  8  ? B DG  18  ? 1_555 ZN ? D ZN . ? B ZN 2  ? 1_555 O ? G HOH . ? B HOH 135 ? 1_555 92.4  ? 
4  O   ? G HOH .  ? B HOH 54  ? 1_555 ZN ? D ZN . ? B ZN 2  ? 1_555 O ? G HOH . ? B HOH 135 ? 1_555 90.6  ? 
5  N7  ? B DG  8  ? B DG  18  ? 1_555 ZN ? D ZN . ? B ZN 2  ? 1_555 O ? G HOH . ? B HOH 136 ? 1_555 100.5 ? 
6  O   ? G HOH .  ? B HOH 54  ? 1_555 ZN ? D ZN . ? B ZN 2  ? 1_555 O ? G HOH . ? B HOH 136 ? 1_555 86.5  ? 
7  O   ? G HOH .  ? B HOH 135 ? 1_555 ZN ? D ZN . ? B ZN 2  ? 1_555 O ? G HOH . ? B HOH 136 ? 1_555 86.0  ? 
8  N7  ? B DG  8  ? B DG  18  ? 1_555 ZN ? D ZN . ? B ZN 2  ? 1_555 O ? G HOH . ? B HOH 137 ? 1_555 90.6  ? 
9  O   ? G HOH .  ? B HOH 54  ? 1_555 ZN ? D ZN . ? B ZN 2  ? 1_555 O ? G HOH . ? B HOH 137 ? 1_555 85.4  ? 
10 O   ? G HOH .  ? B HOH 135 ? 1_555 ZN ? D ZN . ? B ZN 2  ? 1_555 O ? G HOH . ? B HOH 137 ? 1_555 170.8 ? 
11 O   ? G HOH .  ? B HOH 136 ? 1_555 ZN ? D ZN . ? B ZN 2  ? 1_555 O ? G HOH . ? B HOH 137 ? 1_555 101.9 ? 
12 N7  ? B DG  8  ? B DG  18  ? 1_555 ZN ? D ZN . ? B ZN 2  ? 1_555 O ? G HOH . ? B HOH 82  ? 1_555 98.7  ? 
13 O   ? G HOH .  ? B HOH 54  ? 1_555 ZN ? D ZN . ? B ZN 2  ? 1_555 O ? G HOH . ? B HOH 82  ? 1_555 74.3  ? 
14 O   ? G HOH .  ? B HOH 135 ? 1_555 ZN ? D ZN . ? B ZN 2  ? 1_555 O ? G HOH . ? B HOH 82  ? 1_555 94.5  ? 
15 O   ? G HOH .  ? B HOH 136 ? 1_555 ZN ? D ZN . ? B ZN 2  ? 1_555 O ? G HOH . ? B HOH 82  ? 1_555 160.8 ? 
16 O   ? G HOH .  ? B HOH 137 ? 1_555 ZN ? D ZN . ? B ZN 2  ? 1_555 O ? G HOH . ? B HOH 82  ? 1_555 76.4  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1998-12-01 
2 'Structure model' 1 1 2008-05-22 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
PHASES    phasing          .     ? 1 
X-PLOR    refinement       3.851 ? 2 
DENZO     'data reduction' .     ? 3 
SCALEPACK 'data scaling'   .     ? 4 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   ND2 
_pdbx_validate_close_contact.auth_asym_id_1   C 
_pdbx_validate_close_contact.auth_comp_id_1   ASN 
_pdbx_validate_close_contact.auth_seq_id_1    92 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   O 
_pdbx_validate_close_contact.auth_asym_id_2   C 
_pdbx_validate_close_contact.auth_comp_id_2   HOH 
_pdbx_validate_close_contact.auth_seq_id_2    113 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.10 
# 
_pdbx_validate_torsion.id              1 
_pdbx_validate_torsion.PDB_model_num   1 
_pdbx_validate_torsion.auth_comp_id    ASN 
_pdbx_validate_torsion.auth_asym_id    C 
_pdbx_validate_torsion.auth_seq_id     92 
_pdbx_validate_torsion.PDB_ins_code    ? 
_pdbx_validate_torsion.label_alt_id    ? 
_pdbx_validate_torsion.phi             -118.92 
_pdbx_validate_torsion.psi             74.69 
# 
_pdbx_validate_planes.id              1 
_pdbx_validate_planes.PDB_model_num   1 
_pdbx_validate_planes.auth_comp_id    DG 
_pdbx_validate_planes.auth_asym_id    B 
_pdbx_validate_planes.auth_seq_id     19 
_pdbx_validate_planes.PDB_ins_code    ? 
_pdbx_validate_planes.label_alt_id    ? 
_pdbx_validate_planes.rmsd            0.068 
_pdbx_validate_planes.type            'SIDE CHAIN' 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
1BC8 'double helix'        
1BC8 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 A DA 2  1_555 B DT 10 1_555 0.165  -0.009 -0.497 0.095   -9.245  0.517  1 A_DA2:DT20_B  A 2  ? B 20 ? 20 1 
1 A DC 3  1_555 B DG 9  1_555 0.160  -0.005 -0.543 3.628   -14.196 0.993  2 A_DC3:DG19_B  A 3  ? B 19 ? 19 1 
1 A DC 4  1_555 B DG 8  1_555 0.046  -0.085 0.273  -23.477 -1.943  0.552  3 A_DC4:DG18_B  A 4  ? B 18 ? 19 1 
1 A DG 5  1_555 B DC 7  1_555 0.052  0.068  0.328  10.137  5.488   2.826  4 A_DG5:DC17_B  A 5  ? B 17 ? 19 1 
1 A DG 6  1_555 B DC 6  1_555 -0.650 -0.072 0.091  7.212   -7.206  1.572  5 A_DG6:DC16_B  A 6  ? B 16 ? 19 1 
1 A DA 7  1_555 B DT 5  1_555 0.182  0.030  -0.039 9.134   -14.362 -0.393 6 A_DA7:DT15_B  A 7  ? B 15 ? 20 1 
1 A DA 8  1_555 B DT 4  1_555 0.204  -0.094 0.143  7.497   -16.131 2.718  7 A_DA8:DT14_B  A 8  ? B 14 ? 20 1 
1 A DG 9  1_555 B DC 3  1_555 -0.343 -0.006 0.174  -7.032  -14.179 1.848  8 A_DG9:DC13_B  A 9  ? B 13 ? 19 1 
1 A DT 10 1_555 B DA 2  1_555 0.098  -0.120 0.054  -5.566  -12.534 3.440  9 A_DT10:DA12_B A 10 ? B 12 ? 20 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 A DA 2 1_555 B DT 10 1_555 A DC 3  1_555 B DG 9 1_555 0.590  -0.827 3.134 1.250  5.886  34.622 -2.198 -0.801 2.976 9.798  -2.081 
35.125 1 AA_DA2DC3:DG19DT20_BB  A 2 ? B 20 ? A 3  ? B 19 ? 
1 A DC 3 1_555 B DG 9  1_555 A DC 4  1_555 B DG 8 1_555 0.079  -0.598 3.849 -4.746 11.411 35.044 -2.697 -0.856 3.455 18.263 7.595  
37.094 2 AA_DC3DC4:DG18DG19_BB  A 3 ? B 19 ? A 4  ? B 18 ? 
1 A DC 4 1_555 B DG 8  1_555 A DG 5  1_555 B DC 7 1_555 -0.014 0.730  2.756 -1.728 2.293  27.061 1.062  -0.339 2.802 4.882  3.679  
27.210 3 AA_DC4DG5:DC17DG18_BB  A 4 ? B 18 ? A 5  ? B 17 ? 
1 A DG 5 1_555 B DC 7  1_555 A DG 6  1_555 B DC 6 1_555 -0.872 -0.556 3.381 -0.376 3.945  33.067 -1.644 1.457  3.304 6.900  0.658  
33.297 4 AA_DG5DG6:DC16DC17_BB  A 5 ? B 17 ? A 6  ? B 16 ? 
1 A DG 6 1_555 B DC 6  1_555 A DA 7  1_555 B DT 5 1_555 -0.277 -0.499 3.259 0.197  7.633  33.391 -2.027 0.501  3.072 13.073 -0.338 
34.229 5 AA_DG6DA7:DT15DC16_BB  A 6 ? B 16 ? A 7  ? B 15 ? 
1 A DA 7 1_555 B DT 5  1_555 A DA 8  1_555 B DT 4 1_555 0.156  -0.344 3.240 -0.382 5.476  30.628 -1.670 -0.362 3.131 10.263 0.716  
31.105 6 AA_DA7DA8:DT14DT15_BB  A 7 ? B 15 ? A 8  ? B 14 ? 
1 A DA 8 1_555 B DT 4  1_555 A DG 9  1_555 B DC 3 1_555 -0.120 -0.721 3.431 -3.993 6.045  40.751 -1.692 -0.273 3.293 8.599  5.680  
41.363 7 AA_DA8DG9:DC13DT14_BB  A 8 ? B 14 ? A 9  ? B 13 ? 
1 A DG 9 1_555 B DC 3  1_555 A DT 10 1_555 B DA 2 1_555 -0.862 -0.742 3.165 0.810  3.123  29.499 -2.075 1.845  3.048 6.111  -1.584 
29.671 8 AA_DG9DT10:DA12DC13_BB A 9 ? B 13 ? A 10 ? B 12 ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 'ZINC ION' ZN  
5 water      HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 4 ZN  1  2   2   ZN  ZN  B . 
E 4 ZN  1  94  1   ZN  ZN  C . 
F 5 HOH 1  19  19  HOH HOH A . 
F 5 HOH 2  20  20  HOH HOH A . 
F 5 HOH 3  21  21  HOH HOH A . 
F 5 HOH 4  23  23  HOH HOH A . 
F 5 HOH 5  24  24  HOH HOH A . 
F 5 HOH 6  25  25  HOH HOH A . 
F 5 HOH 7  26  26  HOH HOH A . 
F 5 HOH 8  47  47  HOH HOH A . 
F 5 HOH 9  48  48  HOH HOH A . 
F 5 HOH 10 50  50  HOH HOH A . 
F 5 HOH 11 51  51  HOH HOH A . 
F 5 HOH 12 52  52  HOH HOH A . 
F 5 HOH 13 53  53  HOH HOH A . 
F 5 HOH 14 57  57  HOH HOH A . 
F 5 HOH 15 58  58  HOH HOH A . 
F 5 HOH 16 59  59  HOH HOH A . 
F 5 HOH 17 60  60  HOH HOH A . 
F 5 HOH 18 71  71  HOH HOH A . 
F 5 HOH 19 72  72  HOH HOH A . 
F 5 HOH 20 73  73  HOH HOH A . 
F 5 HOH 21 74  74  HOH HOH A . 
F 5 HOH 22 77  77  HOH HOH A . 
F 5 HOH 23 84  84  HOH HOH A . 
F 5 HOH 24 92  92  HOH HOH A . 
F 5 HOH 25 93  93  HOH HOH A . 
F 5 HOH 26 95  95  HOH HOH A . 
F 5 HOH 27 100 100 HOH HOH A . 
F 5 HOH 28 102 102 HOH HOH A . 
F 5 HOH 29 103 103 HOH HOH A . 
F 5 HOH 30 107 107 HOH HOH A . 
F 5 HOH 31 109 109 HOH HOH A . 
F 5 HOH 32 110 110 HOH HOH A . 
F 5 HOH 33 112 112 HOH HOH A . 
F 5 HOH 34 115 115 HOH HOH A . 
F 5 HOH 35 133 133 HOH HOH A . 
F 5 HOH 36 134 134 HOH HOH A . 
F 5 HOH 37 145 145 HOH HOH A . 
F 5 HOH 38 146 146 HOH HOH A . 
F 5 HOH 39 147 147 HOH HOH A . 
F 5 HOH 40 156 156 HOH HOH A . 
G 5 HOH 1  8   8   HOH HOH B . 
G 5 HOH 2  9   9   HOH HOH B . 
G 5 HOH 3  10  10  HOH HOH B . 
G 5 HOH 4  27  27  HOH HOH B . 
G 5 HOH 5  28  28  HOH HOH B . 
G 5 HOH 6  29  29  HOH HOH B . 
G 5 HOH 7  30  30  HOH HOH B . 
G 5 HOH 8  32  32  HOH HOH B . 
G 5 HOH 9  54  54  HOH HOH B . 
G 5 HOH 10 62  62  HOH HOH B . 
G 5 HOH 11 63  63  HOH HOH B . 
G 5 HOH 12 68  68  HOH HOH B . 
G 5 HOH 13 70  70  HOH HOH B . 
G 5 HOH 14 76  76  HOH HOH B . 
G 5 HOH 15 80  80  HOH HOH B . 
G 5 HOH 16 81  81  HOH HOH B . 
G 5 HOH 17 82  82  HOH HOH B . 
G 5 HOH 18 83  83  HOH HOH B . 
G 5 HOH 19 90  90  HOH HOH B . 
G 5 HOH 20 98  98  HOH HOH B . 
G 5 HOH 21 99  99  HOH HOH B . 
G 5 HOH 22 101 101 HOH HOH B . 
G 5 HOH 23 113 113 HOH HOH B . 
G 5 HOH 24 114 114 HOH HOH B . 
G 5 HOH 25 131 131 HOH HOH B . 
G 5 HOH 26 132 132 HOH HOH B . 
G 5 HOH 27 135 135 HOH HOH B . 
G 5 HOH 28 136 136 HOH HOH B . 
G 5 HOH 29 137 137 HOH HOH B . 
G 5 HOH 30 138 138 HOH HOH B . 
G 5 HOH 31 139 139 HOH HOH B . 
G 5 HOH 32 152 152 HOH HOH B . 
G 5 HOH 33 153 153 HOH HOH B . 
G 5 HOH 34 154 154 HOH HOH B . 
G 5 HOH 35 155 155 HOH HOH B . 
G 5 HOH 36 157 157 HOH HOH B . 
G 5 HOH 37 158 158 HOH HOH B . 
G 5 HOH 38 159 159 HOH HOH B . 
H 5 HOH 1  95  3   HOH HOH C . 
H 5 HOH 2  96  4   HOH HOH C . 
H 5 HOH 3  97  5   HOH HOH C . 
H 5 HOH 4  98  6   HOH HOH C . 
H 5 HOH 5  99  7   HOH HOH C . 
H 5 HOH 6  100 11  HOH HOH C . 
H 5 HOH 7  101 12  HOH HOH C . 
H 5 HOH 8  102 13  HOH HOH C . 
H 5 HOH 9  103 14  HOH HOH C . 
H 5 HOH 10 104 15  HOH HOH C . 
H 5 HOH 11 105 16  HOH HOH C . 
H 5 HOH 12 106 17  HOH HOH C . 
H 5 HOH 13 107 18  HOH HOH C . 
H 5 HOH 14 108 22  HOH HOH C . 
H 5 HOH 15 109 31  HOH HOH C . 
H 5 HOH 16 110 33  HOH HOH C . 
H 5 HOH 17 111 34  HOH HOH C . 
H 5 HOH 18 112 35  HOH HOH C . 
H 5 HOH 19 113 36  HOH HOH C . 
H 5 HOH 20 114 37  HOH HOH C . 
H 5 HOH 21 115 38  HOH HOH C . 
H 5 HOH 22 116 39  HOH HOH C . 
H 5 HOH 23 117 40  HOH HOH C . 
H 5 HOH 24 118 41  HOH HOH C . 
H 5 HOH 25 119 42  HOH HOH C . 
H 5 HOH 26 120 43  HOH HOH C . 
H 5 HOH 27 121 44  HOH HOH C . 
H 5 HOH 28 122 45  HOH HOH C . 
H 5 HOH 29 123 46  HOH HOH C . 
H 5 HOH 30 124 49  HOH HOH C . 
H 5 HOH 31 125 55  HOH HOH C . 
H 5 HOH 32 126 56  HOH HOH C . 
H 5 HOH 33 127 61  HOH HOH C . 
H 5 HOH 34 128 64  HOH HOH C . 
H 5 HOH 35 129 65  HOH HOH C . 
H 5 HOH 36 130 66  HOH HOH C . 
H 5 HOH 37 131 67  HOH HOH C . 
H 5 HOH 38 132 69  HOH HOH C . 
H 5 HOH 39 133 75  HOH HOH C . 
H 5 HOH 40 134 78  HOH HOH C . 
H 5 HOH 41 135 79  HOH HOH C . 
H 5 HOH 42 136 85  HOH HOH C . 
H 5 HOH 43 137 86  HOH HOH C . 
H 5 HOH 44 138 87  HOH HOH C . 
H 5 HOH 45 139 88  HOH HOH C . 
H 5 HOH 46 140 89  HOH HOH C . 
H 5 HOH 47 141 91  HOH HOH C . 
H 5 HOH 48 142 94  HOH HOH C . 
H 5 HOH 49 143 96  HOH HOH C . 
H 5 HOH 50 144 97  HOH HOH C . 
H 5 HOH 51 145 104 HOH HOH C . 
H 5 HOH 52 146 105 HOH HOH C . 
H 5 HOH 53 147 106 HOH HOH C . 
H 5 HOH 54 148 108 HOH HOH C . 
H 5 HOH 55 149 111 HOH HOH C . 
H 5 HOH 56 150 116 HOH HOH C . 
H 5 HOH 57 151 117 HOH HOH C . 
H 5 HOH 58 152 118 HOH HOH C . 
H 5 HOH 59 153 119 HOH HOH C . 
H 5 HOH 60 154 120 HOH HOH C . 
H 5 HOH 61 155 121 HOH HOH C . 
H 5 HOH 62 156 122 HOH HOH C . 
H 5 HOH 63 157 123 HOH HOH C . 
H 5 HOH 64 158 124 HOH HOH C . 
H 5 HOH 65 159 125 HOH HOH C . 
H 5 HOH 66 160 126 HOH HOH C . 
H 5 HOH 67 161 127 HOH HOH C . 
H 5 HOH 68 162 128 HOH HOH C . 
H 5 HOH 69 163 129 HOH HOH C . 
H 5 HOH 70 164 130 HOH HOH C . 
H 5 HOH 71 165 140 HOH HOH C . 
H 5 HOH 72 166 141 HOH HOH C . 
H 5 HOH 73 167 142 HOH HOH C . 
H 5 HOH 74 168 143 HOH HOH C . 
H 5 HOH 75 169 144 HOH HOH C . 
H 5 HOH 76 170 148 HOH HOH C . 
H 5 HOH 77 171 149 HOH HOH C . 
H 5 HOH 78 172 150 HOH HOH C . 
H 5 HOH 79 173 151 HOH HOH C . 
H 5 HOH 80 174 160 HOH HOH C . 
H 5 HOH 81 175 161 HOH HOH C . 
H 5 HOH 82 176 162 HOH HOH C . 
#