data_1BE3
# 
_entry.id   1BE3 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1BE3         
WWPDB D_1000171645 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1BE3 
_pdbx_database_status.recvd_initial_deposition_date   1998-05-19 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    BNL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Iwata, S.'     1 
'Lee, J.W.'     2 
'Okada, K.'     3 
'Lee, J.K.'     4 
'Iwata, M.'     5 
'Ramaswamy, S.' 6 
'Jap, B.K.'     7 
# 
_citation.id                        primary 
_citation.title                     'Complete structure of the 11-subunit bovine mitochondrial cytochrome bc1 complex.' 
_citation.journal_abbrev            Science 
_citation.journal_volume            281 
_citation.page_first                64 
_citation.page_last                 71 
_citation.year                      1998 
_citation.journal_id_ASTM           SCIEAS 
_citation.country                   US 
_citation.journal_id_ISSN           0036-8075 
_citation.journal_id_CSD            0038 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   9651245 
_citation.pdbx_database_id_DOI      10.1126/science.281.5373.64 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Iwata, S.'     1 
primary 'Lee, J.W.'     2 
primary 'Okada, K.'     3 
primary 'Lee, J.K.'     4 
primary 'Iwata, M.'     5 
primary 'Rasmussen, B.' 6 
primary 'Link, T.A.'    7 
primary 'Ramaswamy, S.' 8 
primary 'Jap, B.K.'     9 
# 
_cell.entry_id           1BE3 
_cell.length_a           211.200 
_cell.length_b           211.200 
_cell.length_c           339.280 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              12 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1BE3 
_symmetry.space_group_name_H-M             'P 65 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                179 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     nat 'CYTOCHROME BC1 COMPLEX'          49266.254 1 1.10.2.2 ? ? ? 
2  polymer     nat 'CYTOCHROME BC1 COMPLEX'          46575.469 1 1.10.2.2 ? ? ? 
3  polymer     nat 'CYTOCHROME BC1 COMPLEX'          42620.340 1 1.10.2.2 ? ? ? 
4  polymer     nat 'CYTOCHROME BC1 COMPLEX'          27323.277 1 1.10.2.2 ? ? ? 
5  polymer     nat 'CYTOCHROME BC1 COMPLEX'          21640.580 1 1.10.2.2 ? ? ? 
6  polymer     nat 'CYTOCHROME BC1 COMPLEX'          13371.190 1 1.10.2.2 ? ? ? 
7  polymer     nat 'CYTOCHROME BC1 COMPLEX'          9606.027  1 1.10.2.2 ? ? ? 
8  polymer     nat 'CYTOCHROME BC1 COMPLEX'          9189.116  1 1.10.2.2 ? ? ? 
9  polymer     nat 'CYTOCHROME BC1 COMPLEX'          7964.259  1 1.10.2.2 ? ? ? 
10 polymer     nat 'CYTOCHROME BC1 COMPLEX'          7209.311  1 1.10.2.2 ? ? ? 
11 polymer     nat 'CYTOCHROME BC1 COMPLEX'          6370.390  1 1.10.2.2 ? ? ? 
12 non-polymer syn 'PROTOPORPHYRIN IX CONTAINING FE' 616.487   2 ?        ? ? ? 
13 non-polymer syn 'HEME C'                          618.503   1 ?        ? ? ? 
14 non-polymer syn 'FE2/S2 (INORGANIC) CLUSTER'      175.820   1 ?        ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1  'UBIQUINOL CYTOCHROME C OXIDOREDUCTASE, COMPLEX III' 
2  'UBIQUINOL CYTOCHROME C OXIDOREDUCTASE, COMPLEX III' 
3  'UBIQUINOL CYTOCHROME C OXIDOREDUCTASE, COMPLEX III' 
4  'UBIQUINOL CYTOCHROME C OXIDOREDUCTASE, COMPLEX III' 
5  'UBIQUINOL CYTOCHROME C OXIDOREDUCTASE, COMPLEX III' 
6  'UBIQUINOL CYTOCHROME C OXIDOREDUCTASE, COMPLEX III' 
7  'UBIQUINOL CYTOCHROME C OXIDOREDUCTASE, COMPLEX III' 
8  'UBIQUINOL CYTOCHROME C OXIDOREDUCTASE, COMPLEX III' 
9  'UBIQUINOL CYTOCHROME C OXIDOREDUCTASE, COMPLEX III' 
10 'UBIQUINOL CYTOCHROME C OXIDOREDUCTASE, COMPLEX III' 
11 'UBIQUINOL CYTOCHROME C OXIDOREDUCTASE, COMPLEX III' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1  'polypeptide(L)' no no 
;TATYAQALQSVPETQVSQLDNGLRVASEQSSQPTCTVGVWIDAGSRYESEKNNGAGYFVEHLAFKGTKNRPGNALEKEVE
SMGAHLNAYSTREHTAYYIKALSKDLPKAVELLADIVQNCSLEDSQIEKERDVILQELQENDTSMRDVVFNYLHATAFQG
TPLAQSVEGPSENVRKLSRADLTEYLSRHYKAPRMVLAAAGGLEHRQLLDLAQKHFSGLSGTYDEDAVPTLSPCRFTGSQ
ICHREDGLPLAHVAIAVEGPGWAHPDNVALQVANAIIGHYDCTYGGGAHLSSPLASIAATNKLCQSFQTFNICYADTGLL
GAHFVCDHMSIDDMMFVLQGQWMRLCTSATESEVLRGKNLLRNALVSHLDGTTPVCEDIGRSLLTYGRRIPLAEWESRIA
EVDARVVREVCSKYFYDQCPAVAGFGPIEQLPDYNRIRSGMFWLRF
;
;TATYAQALQSVPETQVSQLDNGLRVASEQSSQPTCTVGVWIDAGSRYESEKNNGAGYFVEHLAFKGTKNRPGNALEKEVE
SMGAHLNAYSTREHTAYYIKALSKDLPKAVELLADIVQNCSLEDSQIEKERDVILQELQENDTSMRDVVFNYLHATAFQG
TPLAQSVEGPSENVRKLSRADLTEYLSRHYKAPRMVLAAAGGLEHRQLLDLAQKHFSGLSGTYDEDAVPTLSPCRFTGSQ
ICHREDGLPLAHVAIAVEGPGWAHPDNVALQVANAIIGHYDCTYGGGAHLSSPLASIAATNKLCQSFQTFNICYADTGLL
GAHFVCDHMSIDDMMFVLQGQWMRLCTSATESEVLRGKNLLRNALVSHLDGTTPVCEDIGRSLLTYGRRIPLAEWESRIA
EVDARVVREVCSKYFYDQCPAVAGFGPIEQLPDYNRIRSGMFWLRF
;
A ? 
2  'polypeptide(L)' no no 
;SLKVAPKVKATEAPAGVPPHPQDLEFTRLPNGLVIASLENYAPASRIGLFIKAGSRYENSNNLGTSHLLRLASSLTTKGA
SSFKITRGIEAVGGKLSVTSTRENMAYTVECLRDDVDILMEFLLNVTTAPEFRRWEVAALQPQLRIDKAVALQNPQAHVI
ENLHAAAYRNALANSLYCPDYRIGKVTPVELHDYVQNHFTSARMALIGLGVSHPVLKQVAEQFLNIRGGLGLSGAKAKYH
GGEIREQNGDSLVHAALVAESAAIGSAEANAFSVLQHVLGAGPHVKRGSNATSSLYQAVAKGVHQPFDVSAFNASYSDSG
LFGFYTISQAASAGDVIKAAYNQVKTIAQGNLSNPDVQAAKNKLKAGYLMSVESSEGFLDEVGSQALAAGSYTPPSTVLQ
QIDAVADADVINAAKKFVSGRKSMAASGNLGHTPFIDEL
;
;SLKVAPKVKATEAPAGVPPHPQDLEFTRLPNGLVIASLENYAPASRIGLFIKAGSRYENSNNLGTSHLLRLASSLTTKGA
SSFKITRGIEAVGGKLSVTSTRENMAYTVECLRDDVDILMEFLLNVTTAPEFRRWEVAALQPQLRIDKAVALQNPQAHVI
ENLHAAAYRNALANSLYCPDYRIGKVTPVELHDYVQNHFTSARMALIGLGVSHPVLKQVAEQFLNIRGGLGLSGAKAKYH
GGEIREQNGDSLVHAALVAESAAIGSAEANAFSVLQHVLGAGPHVKRGSNATSSLYQAVAKGVHQPFDVSAFNASYSDSG
LFGFYTISQAASAGDVIKAAYNQVKTIAQGNLSNPDVQAAKNKLKAGYLMSVESSEGFLDEVGSQALAAGSYTPPSTVLQ
QIDAVADADVINAAKKFVSGRKSMAASGNLGHTPFIDEL
;
B ? 
3  'polypeptide(L)' no no 
;MTNIRKSHPLMKIVNNAFIDLPAPSNISSWWNFGSLLGICLILQILTGLFLAMHYTSDTTTAFSSVTHICRDVNYGWIIR
YMHANGASMFFICLYMHVGRGLYYGSYTFLETWNIGVILLLTVMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTNL
VEWIWGGFSVDKATLTRFFAFHFILPFIIMAIAMVHLLFLHETGSNNPTGISSDVDKIPFHPYYTIKDILGALLLILALM
LLVLFAPDLLGDPDNYTPANPLNTPPHIKPEWYFLFAYAILRSIPNKLGGVLALAFSILILALIPLLHTSKQRSMMFRPL
SQCLFWALVADLLTLTWIGGQPVEHPYITIGQLASVLYFLLILVLMPTAGTIENKLLKW
;
;MTNIRKSHPLMKIVNNAFIDLPAPSNISSWWNFGSLLGICLILQILTGLFLAMHYTSDTTTAFSSVTHICRDVNYGWIIR
YMHANGASMFFICLYMHVGRGLYYGSYTFLETWNIGVILLLTVMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTNL
VEWIWGGFSVDKATLTRFFAFHFILPFIIMAIAMVHLLFLHETGSNNPTGISSDVDKIPFHPYYTIKDILGALLLILALM
LLVLFAPDLLGDPDNYTPANPLNTPPHIKPEWYFLFAYAILRSIPNKLGGVLALAFSILILALIPLLHTSKQRSMMFRPL
SQCLFWALVADLLTLTWIGGQPVEHPYITIGQLASVLYFLLILVLMPTAGTIENKLLKW
;
C ? 
4  'polypeptide(L)' no no 
;SDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQVCSSCHSMDYVAYRHLVGVCYTEDEAKALAEEVEVQDGPNEDGEM
FMRPGKLSDYFPKPYPNPEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIGM
APPIYNEVLEFDDGTPATMSQVAKDVCTFLRWAAEPEHDHRKRMGLKMLLMMGLLLPLVYAMKRHKWSVLKSRKLAYRPP
K
;
;SDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQVCSSCHSMDYVAYRHLVGVCYTEDEAKALAEEVEVQDGPNEDGEM
FMRPGKLSDYFPKPYPNPEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIGM
APPIYNEVLEFDDGTPATMSQVAKDVCTFLRWAAEPEHDHRKRMGLKMLLMMGLLLPLVYAMKRHKWSVLKSRKLAYRPP
K
;
D ? 
5  'polypeptide(L)' no no 
;SHTDIKVPDFSDYRRPEVLDSTKSSKESSEARKGFSYLVTATTTVGVAYAAKNVVSQFVSSMSASADVLAMSKIEIKLSD
IPEGKNMAFKWRGKPLFVRHRTKKEIDQEAAVEVSQLRDPQHDLERVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPC
HGSHYDASGRIRKGPAPLNLEVPSYEFTSDDMVIVG
;
;SHTDIKVPDFSDYRRPEVLDSTKSSKESSEARKGFSYLVTATTTVGVAYAAKNVVSQFVSSMSASADVLAMSKIEIKLSD
IPEGKNMAFKWRGKPLFVRHRTKKEIDQEAAVEVSQLRDPQHDLERVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPC
HGSHYDASGRIRKGPAPLNLEVPSYEFTSDDMVIVG
;
E ? 
6  'polypeptide(L)' no no 
;AGRPAVSASSRWLEGIRKWYYNAAGFNKLGLMRDDTIHENDDVKEAIRRLPENLYDDRVFRIKRALDLSMRQQILPKEQW
TKYEEDKSYLEPYLKEVIRERKEREEWAKK
;
;AGRPAVSASSRWLEGIRKWYYNAAGFNKLGLMRDDTIHENDDVKEAIRRLPENLYDDRVFRIKRALDLSMRQQILPKEQW
TKYEEDKSYLEPYLKEVIRERKEREEWAKK
;
F ? 
7  'polypeptide(L)' no no 
;GRQFGHLTRVRHVITYSLSPFEQRAFPHYFSKGIPNVLRRTRACILRVAPPFVAFYLVYTWGTQEFEKSKRKNPAAYEND
R
;
;GRQFGHLTRVRHVITYSLSPFEQRAFPHYFSKGIPNVLRRTRACILRVAPPFVAFYLVYTWGTQEFEKSKRKNPAAYEND
R
;
G ? 
8  'polypeptide(L)' no no GDPKEEEEEEEELVDPLTTVREQCEQLEKCVKARERLELCDERVSSRSQTEEDCTEELLDFLHARDHCVAHKLFNSLK 
GDPKEEEEEEEELVDPLTTVREQCEQLEKCVKARERLELCDERVSSRSQTEEDCTEELLDFLHARDHCVAHKLFNSLK H ? 
9  'polypeptide(L)' no no MLSVAARSGPFAPVLSATSRGVAGALRPLVQAAVPATSESPVLDLKRSVLCRESLRGQAAGRPLVASVSLNVPASVRY 
MLSVAARSGPFAPVLSATSRGVAGALRPLVQAAVPATSESPVLDLKRSVLCRESLRGQAAGRPLVASVSLNVPASVRY I ? 
10 'polypeptide(L)' no no VAPTLTARLYSLLFRRTSTFALTIVVGALFFERAFDQGADAIYEHINEGKLWKHIKHKYENK 
VAPTLTARLYSLLFRRTSTFALTIVVGALFFERAFDQGADAIYEHINEGKLWKHIKHKYENK J ? 
11 'polypeptide(L)' no no MLTRFLGPRYRQLARNWVPTAQLWGAVGAVGLVSATDSRLILDWVPYINGKFKKDD 
MLTRFLGPRYRQLARNWVPTAQLWGAVGAVGLVSATDSRLILDWVPYINGKFKKDD K ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1  1   THR n 
1  2   ALA n 
1  3   THR n 
1  4   TYR n 
1  5   ALA n 
1  6   GLN n 
1  7   ALA n 
1  8   LEU n 
1  9   GLN n 
1  10  SER n 
1  11  VAL n 
1  12  PRO n 
1  13  GLU n 
1  14  THR n 
1  15  GLN n 
1  16  VAL n 
1  17  SER n 
1  18  GLN n 
1  19  LEU n 
1  20  ASP n 
1  21  ASN n 
1  22  GLY n 
1  23  LEU n 
1  24  ARG n 
1  25  VAL n 
1  26  ALA n 
1  27  SER n 
1  28  GLU n 
1  29  GLN n 
1  30  SER n 
1  31  SER n 
1  32  GLN n 
1  33  PRO n 
1  34  THR n 
1  35  CYS n 
1  36  THR n 
1  37  VAL n 
1  38  GLY n 
1  39  VAL n 
1  40  TRP n 
1  41  ILE n 
1  42  ASP n 
1  43  ALA n 
1  44  GLY n 
1  45  SER n 
1  46  ARG n 
1  47  TYR n 
1  48  GLU n 
1  49  SER n 
1  50  GLU n 
1  51  LYS n 
1  52  ASN n 
1  53  ASN n 
1  54  GLY n 
1  55  ALA n 
1  56  GLY n 
1  57  TYR n 
1  58  PHE n 
1  59  VAL n 
1  60  GLU n 
1  61  HIS n 
1  62  LEU n 
1  63  ALA n 
1  64  PHE n 
1  65  LYS n 
1  66  GLY n 
1  67  THR n 
1  68  LYS n 
1  69  ASN n 
1  70  ARG n 
1  71  PRO n 
1  72  GLY n 
1  73  ASN n 
1  74  ALA n 
1  75  LEU n 
1  76  GLU n 
1  77  LYS n 
1  78  GLU n 
1  79  VAL n 
1  80  GLU n 
1  81  SER n 
1  82  MET n 
1  83  GLY n 
1  84  ALA n 
1  85  HIS n 
1  86  LEU n 
1  87  ASN n 
1  88  ALA n 
1  89  TYR n 
1  90  SER n 
1  91  THR n 
1  92  ARG n 
1  93  GLU n 
1  94  HIS n 
1  95  THR n 
1  96  ALA n 
1  97  TYR n 
1  98  TYR n 
1  99  ILE n 
1  100 LYS n 
1  101 ALA n 
1  102 LEU n 
1  103 SER n 
1  104 LYS n 
1  105 ASP n 
1  106 LEU n 
1  107 PRO n 
1  108 LYS n 
1  109 ALA n 
1  110 VAL n 
1  111 GLU n 
1  112 LEU n 
1  113 LEU n 
1  114 ALA n 
1  115 ASP n 
1  116 ILE n 
1  117 VAL n 
1  118 GLN n 
1  119 ASN n 
1  120 CYS n 
1  121 SER n 
1  122 LEU n 
1  123 GLU n 
1  124 ASP n 
1  125 SER n 
1  126 GLN n 
1  127 ILE n 
1  128 GLU n 
1  129 LYS n 
1  130 GLU n 
1  131 ARG n 
1  132 ASP n 
1  133 VAL n 
1  134 ILE n 
1  135 LEU n 
1  136 GLN n 
1  137 GLU n 
1  138 LEU n 
1  139 GLN n 
1  140 GLU n 
1  141 ASN n 
1  142 ASP n 
1  143 THR n 
1  144 SER n 
1  145 MET n 
1  146 ARG n 
1  147 ASP n 
1  148 VAL n 
1  149 VAL n 
1  150 PHE n 
1  151 ASN n 
1  152 TYR n 
1  153 LEU n 
1  154 HIS n 
1  155 ALA n 
1  156 THR n 
1  157 ALA n 
1  158 PHE n 
1  159 GLN n 
1  160 GLY n 
1  161 THR n 
1  162 PRO n 
1  163 LEU n 
1  164 ALA n 
1  165 GLN n 
1  166 SER n 
1  167 VAL n 
1  168 GLU n 
1  169 GLY n 
1  170 PRO n 
1  171 SER n 
1  172 GLU n 
1  173 ASN n 
1  174 VAL n 
1  175 ARG n 
1  176 LYS n 
1  177 LEU n 
1  178 SER n 
1  179 ARG n 
1  180 ALA n 
1  181 ASP n 
1  182 LEU n 
1  183 THR n 
1  184 GLU n 
1  185 TYR n 
1  186 LEU n 
1  187 SER n 
1  188 ARG n 
1  189 HIS n 
1  190 TYR n 
1  191 LYS n 
1  192 ALA n 
1  193 PRO n 
1  194 ARG n 
1  195 MET n 
1  196 VAL n 
1  197 LEU n 
1  198 ALA n 
1  199 ALA n 
1  200 ALA n 
1  201 GLY n 
1  202 GLY n 
1  203 LEU n 
1  204 GLU n 
1  205 HIS n 
1  206 ARG n 
1  207 GLN n 
1  208 LEU n 
1  209 LEU n 
1  210 ASP n 
1  211 LEU n 
1  212 ALA n 
1  213 GLN n 
1  214 LYS n 
1  215 HIS n 
1  216 PHE n 
1  217 SER n 
1  218 GLY n 
1  219 LEU n 
1  220 SER n 
1  221 GLY n 
1  222 THR n 
1  223 TYR n 
1  224 ASP n 
1  225 GLU n 
1  226 ASP n 
1  227 ALA n 
1  228 VAL n 
1  229 PRO n 
1  230 THR n 
1  231 LEU n 
1  232 SER n 
1  233 PRO n 
1  234 CYS n 
1  235 ARG n 
1  236 PHE n 
1  237 THR n 
1  238 GLY n 
1  239 SER n 
1  240 GLN n 
1  241 ILE n 
1  242 CYS n 
1  243 HIS n 
1  244 ARG n 
1  245 GLU n 
1  246 ASP n 
1  247 GLY n 
1  248 LEU n 
1  249 PRO n 
1  250 LEU n 
1  251 ALA n 
1  252 HIS n 
1  253 VAL n 
1  254 ALA n 
1  255 ILE n 
1  256 ALA n 
1  257 VAL n 
1  258 GLU n 
1  259 GLY n 
1  260 PRO n 
1  261 GLY n 
1  262 TRP n 
1  263 ALA n 
1  264 HIS n 
1  265 PRO n 
1  266 ASP n 
1  267 ASN n 
1  268 VAL n 
1  269 ALA n 
1  270 LEU n 
1  271 GLN n 
1  272 VAL n 
1  273 ALA n 
1  274 ASN n 
1  275 ALA n 
1  276 ILE n 
1  277 ILE n 
1  278 GLY n 
1  279 HIS n 
1  280 TYR n 
1  281 ASP n 
1  282 CYS n 
1  283 THR n 
1  284 TYR n 
1  285 GLY n 
1  286 GLY n 
1  287 GLY n 
1  288 ALA n 
1  289 HIS n 
1  290 LEU n 
1  291 SER n 
1  292 SER n 
1  293 PRO n 
1  294 LEU n 
1  295 ALA n 
1  296 SER n 
1  297 ILE n 
1  298 ALA n 
1  299 ALA n 
1  300 THR n 
1  301 ASN n 
1  302 LYS n 
1  303 LEU n 
1  304 CYS n 
1  305 GLN n 
1  306 SER n 
1  307 PHE n 
1  308 GLN n 
1  309 THR n 
1  310 PHE n 
1  311 ASN n 
1  312 ILE n 
1  313 CYS n 
1  314 TYR n 
1  315 ALA n 
1  316 ASP n 
1  317 THR n 
1  318 GLY n 
1  319 LEU n 
1  320 LEU n 
1  321 GLY n 
1  322 ALA n 
1  323 HIS n 
1  324 PHE n 
1  325 VAL n 
1  326 CYS n 
1  327 ASP n 
1  328 HIS n 
1  329 MET n 
1  330 SER n 
1  331 ILE n 
1  332 ASP n 
1  333 ASP n 
1  334 MET n 
1  335 MET n 
1  336 PHE n 
1  337 VAL n 
1  338 LEU n 
1  339 GLN n 
1  340 GLY n 
1  341 GLN n 
1  342 TRP n 
1  343 MET n 
1  344 ARG n 
1  345 LEU n 
1  346 CYS n 
1  347 THR n 
1  348 SER n 
1  349 ALA n 
1  350 THR n 
1  351 GLU n 
1  352 SER n 
1  353 GLU n 
1  354 VAL n 
1  355 LEU n 
1  356 ARG n 
1  357 GLY n 
1  358 LYS n 
1  359 ASN n 
1  360 LEU n 
1  361 LEU n 
1  362 ARG n 
1  363 ASN n 
1  364 ALA n 
1  365 LEU n 
1  366 VAL n 
1  367 SER n 
1  368 HIS n 
1  369 LEU n 
1  370 ASP n 
1  371 GLY n 
1  372 THR n 
1  373 THR n 
1  374 PRO n 
1  375 VAL n 
1  376 CYS n 
1  377 GLU n 
1  378 ASP n 
1  379 ILE n 
1  380 GLY n 
1  381 ARG n 
1  382 SER n 
1  383 LEU n 
1  384 LEU n 
1  385 THR n 
1  386 TYR n 
1  387 GLY n 
1  388 ARG n 
1  389 ARG n 
1  390 ILE n 
1  391 PRO n 
1  392 LEU n 
1  393 ALA n 
1  394 GLU n 
1  395 TRP n 
1  396 GLU n 
1  397 SER n 
1  398 ARG n 
1  399 ILE n 
1  400 ALA n 
1  401 GLU n 
1  402 VAL n 
1  403 ASP n 
1  404 ALA n 
1  405 ARG n 
1  406 VAL n 
1  407 VAL n 
1  408 ARG n 
1  409 GLU n 
1  410 VAL n 
1  411 CYS n 
1  412 SER n 
1  413 LYS n 
1  414 TYR n 
1  415 PHE n 
1  416 TYR n 
1  417 ASP n 
1  418 GLN n 
1  419 CYS n 
1  420 PRO n 
1  421 ALA n 
1  422 VAL n 
1  423 ALA n 
1  424 GLY n 
1  425 PHE n 
1  426 GLY n 
1  427 PRO n 
1  428 ILE n 
1  429 GLU n 
1  430 GLN n 
1  431 LEU n 
1  432 PRO n 
1  433 ASP n 
1  434 TYR n 
1  435 ASN n 
1  436 ARG n 
1  437 ILE n 
1  438 ARG n 
1  439 SER n 
1  440 GLY n 
1  441 MET n 
1  442 PHE n 
1  443 TRP n 
1  444 LEU n 
1  445 ARG n 
1  446 PHE n 
2  1   SER n 
2  2   LEU n 
2  3   LYS n 
2  4   VAL n 
2  5   ALA n 
2  6   PRO n 
2  7   LYS n 
2  8   VAL n 
2  9   LYS n 
2  10  ALA n 
2  11  THR n 
2  12  GLU n 
2  13  ALA n 
2  14  PRO n 
2  15  ALA n 
2  16  GLY n 
2  17  VAL n 
2  18  PRO n 
2  19  PRO n 
2  20  HIS n 
2  21  PRO n 
2  22  GLN n 
2  23  ASP n 
2  24  LEU n 
2  25  GLU n 
2  26  PHE n 
2  27  THR n 
2  28  ARG n 
2  29  LEU n 
2  30  PRO n 
2  31  ASN n 
2  32  GLY n 
2  33  LEU n 
2  34  VAL n 
2  35  ILE n 
2  36  ALA n 
2  37  SER n 
2  38  LEU n 
2  39  GLU n 
2  40  ASN n 
2  41  TYR n 
2  42  ALA n 
2  43  PRO n 
2  44  ALA n 
2  45  SER n 
2  46  ARG n 
2  47  ILE n 
2  48  GLY n 
2  49  LEU n 
2  50  PHE n 
2  51  ILE n 
2  52  LYS n 
2  53  ALA n 
2  54  GLY n 
2  55  SER n 
2  56  ARG n 
2  57  TYR n 
2  58  GLU n 
2  59  ASN n 
2  60  SER n 
2  61  ASN n 
2  62  ASN n 
2  63  LEU n 
2  64  GLY n 
2  65  THR n 
2  66  SER n 
2  67  HIS n 
2  68  LEU n 
2  69  LEU n 
2  70  ARG n 
2  71  LEU n 
2  72  ALA n 
2  73  SER n 
2  74  SER n 
2  75  LEU n 
2  76  THR n 
2  77  THR n 
2  78  LYS n 
2  79  GLY n 
2  80  ALA n 
2  81  SER n 
2  82  SER n 
2  83  PHE n 
2  84  LYS n 
2  85  ILE n 
2  86  THR n 
2  87  ARG n 
2  88  GLY n 
2  89  ILE n 
2  90  GLU n 
2  91  ALA n 
2  92  VAL n 
2  93  GLY n 
2  94  GLY n 
2  95  LYS n 
2  96  LEU n 
2  97  SER n 
2  98  VAL n 
2  99  THR n 
2  100 SER n 
2  101 THR n 
2  102 ARG n 
2  103 GLU n 
2  104 ASN n 
2  105 MET n 
2  106 ALA n 
2  107 TYR n 
2  108 THR n 
2  109 VAL n 
2  110 GLU n 
2  111 CYS n 
2  112 LEU n 
2  113 ARG n 
2  114 ASP n 
2  115 ASP n 
2  116 VAL n 
2  117 ASP n 
2  118 ILE n 
2  119 LEU n 
2  120 MET n 
2  121 GLU n 
2  122 PHE n 
2  123 LEU n 
2  124 LEU n 
2  125 ASN n 
2  126 VAL n 
2  127 THR n 
2  128 THR n 
2  129 ALA n 
2  130 PRO n 
2  131 GLU n 
2  132 PHE n 
2  133 ARG n 
2  134 ARG n 
2  135 TRP n 
2  136 GLU n 
2  137 VAL n 
2  138 ALA n 
2  139 ALA n 
2  140 LEU n 
2  141 GLN n 
2  142 PRO n 
2  143 GLN n 
2  144 LEU n 
2  145 ARG n 
2  146 ILE n 
2  147 ASP n 
2  148 LYS n 
2  149 ALA n 
2  150 VAL n 
2  151 ALA n 
2  152 LEU n 
2  153 GLN n 
2  154 ASN n 
2  155 PRO n 
2  156 GLN n 
2  157 ALA n 
2  158 HIS n 
2  159 VAL n 
2  160 ILE n 
2  161 GLU n 
2  162 ASN n 
2  163 LEU n 
2  164 HIS n 
2  165 ALA n 
2  166 ALA n 
2  167 ALA n 
2  168 TYR n 
2  169 ARG n 
2  170 ASN n 
2  171 ALA n 
2  172 LEU n 
2  173 ALA n 
2  174 ASN n 
2  175 SER n 
2  176 LEU n 
2  177 TYR n 
2  178 CYS n 
2  179 PRO n 
2  180 ASP n 
2  181 TYR n 
2  182 ARG n 
2  183 ILE n 
2  184 GLY n 
2  185 LYS n 
2  186 VAL n 
2  187 THR n 
2  188 PRO n 
2  189 VAL n 
2  190 GLU n 
2  191 LEU n 
2  192 HIS n 
2  193 ASP n 
2  194 TYR n 
2  195 VAL n 
2  196 GLN n 
2  197 ASN n 
2  198 HIS n 
2  199 PHE n 
2  200 THR n 
2  201 SER n 
2  202 ALA n 
2  203 ARG n 
2  204 MET n 
2  205 ALA n 
2  206 LEU n 
2  207 ILE n 
2  208 GLY n 
2  209 LEU n 
2  210 GLY n 
2  211 VAL n 
2  212 SER n 
2  213 HIS n 
2  214 PRO n 
2  215 VAL n 
2  216 LEU n 
2  217 LYS n 
2  218 GLN n 
2  219 VAL n 
2  220 ALA n 
2  221 GLU n 
2  222 GLN n 
2  223 PHE n 
2  224 LEU n 
2  225 ASN n 
2  226 ILE n 
2  227 ARG n 
2  228 GLY n 
2  229 GLY n 
2  230 LEU n 
2  231 GLY n 
2  232 LEU n 
2  233 SER n 
2  234 GLY n 
2  235 ALA n 
2  236 LYS n 
2  237 ALA n 
2  238 LYS n 
2  239 TYR n 
2  240 HIS n 
2  241 GLY n 
2  242 GLY n 
2  243 GLU n 
2  244 ILE n 
2  245 ARG n 
2  246 GLU n 
2  247 GLN n 
2  248 ASN n 
2  249 GLY n 
2  250 ASP n 
2  251 SER n 
2  252 LEU n 
2  253 VAL n 
2  254 HIS n 
2  255 ALA n 
2  256 ALA n 
2  257 LEU n 
2  258 VAL n 
2  259 ALA n 
2  260 GLU n 
2  261 SER n 
2  262 ALA n 
2  263 ALA n 
2  264 ILE n 
2  265 GLY n 
2  266 SER n 
2  267 ALA n 
2  268 GLU n 
2  269 ALA n 
2  270 ASN n 
2  271 ALA n 
2  272 PHE n 
2  273 SER n 
2  274 VAL n 
2  275 LEU n 
2  276 GLN n 
2  277 HIS n 
2  278 VAL n 
2  279 LEU n 
2  280 GLY n 
2  281 ALA n 
2  282 GLY n 
2  283 PRO n 
2  284 HIS n 
2  285 VAL n 
2  286 LYS n 
2  287 ARG n 
2  288 GLY n 
2  289 SER n 
2  290 ASN n 
2  291 ALA n 
2  292 THR n 
2  293 SER n 
2  294 SER n 
2  295 LEU n 
2  296 TYR n 
2  297 GLN n 
2  298 ALA n 
2  299 VAL n 
2  300 ALA n 
2  301 LYS n 
2  302 GLY n 
2  303 VAL n 
2  304 HIS n 
2  305 GLN n 
2  306 PRO n 
2  307 PHE n 
2  308 ASP n 
2  309 VAL n 
2  310 SER n 
2  311 ALA n 
2  312 PHE n 
2  313 ASN n 
2  314 ALA n 
2  315 SER n 
2  316 TYR n 
2  317 SER n 
2  318 ASP n 
2  319 SER n 
2  320 GLY n 
2  321 LEU n 
2  322 PHE n 
2  323 GLY n 
2  324 PHE n 
2  325 TYR n 
2  326 THR n 
2  327 ILE n 
2  328 SER n 
2  329 GLN n 
2  330 ALA n 
2  331 ALA n 
2  332 SER n 
2  333 ALA n 
2  334 GLY n 
2  335 ASP n 
2  336 VAL n 
2  337 ILE n 
2  338 LYS n 
2  339 ALA n 
2  340 ALA n 
2  341 TYR n 
2  342 ASN n 
2  343 GLN n 
2  344 VAL n 
2  345 LYS n 
2  346 THR n 
2  347 ILE n 
2  348 ALA n 
2  349 GLN n 
2  350 GLY n 
2  351 ASN n 
2  352 LEU n 
2  353 SER n 
2  354 ASN n 
2  355 PRO n 
2  356 ASP n 
2  357 VAL n 
2  358 GLN n 
2  359 ALA n 
2  360 ALA n 
2  361 LYS n 
2  362 ASN n 
2  363 LYS n 
2  364 LEU n 
2  365 LYS n 
2  366 ALA n 
2  367 GLY n 
2  368 TYR n 
2  369 LEU n 
2  370 MET n 
2  371 SER n 
2  372 VAL n 
2  373 GLU n 
2  374 SER n 
2  375 SER n 
2  376 GLU n 
2  377 GLY n 
2  378 PHE n 
2  379 LEU n 
2  380 ASP n 
2  381 GLU n 
2  382 VAL n 
2  383 GLY n 
2  384 SER n 
2  385 GLN n 
2  386 ALA n 
2  387 LEU n 
2  388 ALA n 
2  389 ALA n 
2  390 GLY n 
2  391 SER n 
2  392 TYR n 
2  393 THR n 
2  394 PRO n 
2  395 PRO n 
2  396 SER n 
2  397 THR n 
2  398 VAL n 
2  399 LEU n 
2  400 GLN n 
2  401 GLN n 
2  402 ILE n 
2  403 ASP n 
2  404 ALA n 
2  405 VAL n 
2  406 ALA n 
2  407 ASP n 
2  408 ALA n 
2  409 ASP n 
2  410 VAL n 
2  411 ILE n 
2  412 ASN n 
2  413 ALA n 
2  414 ALA n 
2  415 LYS n 
2  416 LYS n 
2  417 PHE n 
2  418 VAL n 
2  419 SER n 
2  420 GLY n 
2  421 ARG n 
2  422 LYS n 
2  423 SER n 
2  424 MET n 
2  425 ALA n 
2  426 ALA n 
2  427 SER n 
2  428 GLY n 
2  429 ASN n 
2  430 LEU n 
2  431 GLY n 
2  432 HIS n 
2  433 THR n 
2  434 PRO n 
2  435 PHE n 
2  436 ILE n 
2  437 ASP n 
2  438 GLU n 
2  439 LEU n 
3  1   MET n 
3  2   THR n 
3  3   ASN n 
3  4   ILE n 
3  5   ARG n 
3  6   LYS n 
3  7   SER n 
3  8   HIS n 
3  9   PRO n 
3  10  LEU n 
3  11  MET n 
3  12  LYS n 
3  13  ILE n 
3  14  VAL n 
3  15  ASN n 
3  16  ASN n 
3  17  ALA n 
3  18  PHE n 
3  19  ILE n 
3  20  ASP n 
3  21  LEU n 
3  22  PRO n 
3  23  ALA n 
3  24  PRO n 
3  25  SER n 
3  26  ASN n 
3  27  ILE n 
3  28  SER n 
3  29  SER n 
3  30  TRP n 
3  31  TRP n 
3  32  ASN n 
3  33  PHE n 
3  34  GLY n 
3  35  SER n 
3  36  LEU n 
3  37  LEU n 
3  38  GLY n 
3  39  ILE n 
3  40  CYS n 
3  41  LEU n 
3  42  ILE n 
3  43  LEU n 
3  44  GLN n 
3  45  ILE n 
3  46  LEU n 
3  47  THR n 
3  48  GLY n 
3  49  LEU n 
3  50  PHE n 
3  51  LEU n 
3  52  ALA n 
3  53  MET n 
3  54  HIS n 
3  55  TYR n 
3  56  THR n 
3  57  SER n 
3  58  ASP n 
3  59  THR n 
3  60  THR n 
3  61  THR n 
3  62  ALA n 
3  63  PHE n 
3  64  SER n 
3  65  SER n 
3  66  VAL n 
3  67  THR n 
3  68  HIS n 
3  69  ILE n 
3  70  CYS n 
3  71  ARG n 
3  72  ASP n 
3  73  VAL n 
3  74  ASN n 
3  75  TYR n 
3  76  GLY n 
3  77  TRP n 
3  78  ILE n 
3  79  ILE n 
3  80  ARG n 
3  81  TYR n 
3  82  MET n 
3  83  HIS n 
3  84  ALA n 
3  85  ASN n 
3  86  GLY n 
3  87  ALA n 
3  88  SER n 
3  89  MET n 
3  90  PHE n 
3  91  PHE n 
3  92  ILE n 
3  93  CYS n 
3  94  LEU n 
3  95  TYR n 
3  96  MET n 
3  97  HIS n 
3  98  VAL n 
3  99  GLY n 
3  100 ARG n 
3  101 GLY n 
3  102 LEU n 
3  103 TYR n 
3  104 TYR n 
3  105 GLY n 
3  106 SER n 
3  107 TYR n 
3  108 THR n 
3  109 PHE n 
3  110 LEU n 
3  111 GLU n 
3  112 THR n 
3  113 TRP n 
3  114 ASN n 
3  115 ILE n 
3  116 GLY n 
3  117 VAL n 
3  118 ILE n 
3  119 LEU n 
3  120 LEU n 
3  121 LEU n 
3  122 THR n 
3  123 VAL n 
3  124 MET n 
3  125 ALA n 
3  126 THR n 
3  127 ALA n 
3  128 PHE n 
3  129 MET n 
3  130 GLY n 
3  131 TYR n 
3  132 VAL n 
3  133 LEU n 
3  134 PRO n 
3  135 TRP n 
3  136 GLY n 
3  137 GLN n 
3  138 MET n 
3  139 SER n 
3  140 PHE n 
3  141 TRP n 
3  142 GLY n 
3  143 ALA n 
3  144 THR n 
3  145 VAL n 
3  146 ILE n 
3  147 THR n 
3  148 ASN n 
3  149 LEU n 
3  150 LEU n 
3  151 SER n 
3  152 ALA n 
3  153 ILE n 
3  154 PRO n 
3  155 TYR n 
3  156 ILE n 
3  157 GLY n 
3  158 THR n 
3  159 ASN n 
3  160 LEU n 
3  161 VAL n 
3  162 GLU n 
3  163 TRP n 
3  164 ILE n 
3  165 TRP n 
3  166 GLY n 
3  167 GLY n 
3  168 PHE n 
3  169 SER n 
3  170 VAL n 
3  171 ASP n 
3  172 LYS n 
3  173 ALA n 
3  174 THR n 
3  175 LEU n 
3  176 THR n 
3  177 ARG n 
3  178 PHE n 
3  179 PHE n 
3  180 ALA n 
3  181 PHE n 
3  182 HIS n 
3  183 PHE n 
3  184 ILE n 
3  185 LEU n 
3  186 PRO n 
3  187 PHE n 
3  188 ILE n 
3  189 ILE n 
3  190 MET n 
3  191 ALA n 
3  192 ILE n 
3  193 ALA n 
3  194 MET n 
3  195 VAL n 
3  196 HIS n 
3  197 LEU n 
3  198 LEU n 
3  199 PHE n 
3  200 LEU n 
3  201 HIS n 
3  202 GLU n 
3  203 THR n 
3  204 GLY n 
3  205 SER n 
3  206 ASN n 
3  207 ASN n 
3  208 PRO n 
3  209 THR n 
3  210 GLY n 
3  211 ILE n 
3  212 SER n 
3  213 SER n 
3  214 ASP n 
3  215 VAL n 
3  216 ASP n 
3  217 LYS n 
3  218 ILE n 
3  219 PRO n 
3  220 PHE n 
3  221 HIS n 
3  222 PRO n 
3  223 TYR n 
3  224 TYR n 
3  225 THR n 
3  226 ILE n 
3  227 LYS n 
3  228 ASP n 
3  229 ILE n 
3  230 LEU n 
3  231 GLY n 
3  232 ALA n 
3  233 LEU n 
3  234 LEU n 
3  235 LEU n 
3  236 ILE n 
3  237 LEU n 
3  238 ALA n 
3  239 LEU n 
3  240 MET n 
3  241 LEU n 
3  242 LEU n 
3  243 VAL n 
3  244 LEU n 
3  245 PHE n 
3  246 ALA n 
3  247 PRO n 
3  248 ASP n 
3  249 LEU n 
3  250 LEU n 
3  251 GLY n 
3  252 ASP n 
3  253 PRO n 
3  254 ASP n 
3  255 ASN n 
3  256 TYR n 
3  257 THR n 
3  258 PRO n 
3  259 ALA n 
3  260 ASN n 
3  261 PRO n 
3  262 LEU n 
3  263 ASN n 
3  264 THR n 
3  265 PRO n 
3  266 PRO n 
3  267 HIS n 
3  268 ILE n 
3  269 LYS n 
3  270 PRO n 
3  271 GLU n 
3  272 TRP n 
3  273 TYR n 
3  274 PHE n 
3  275 LEU n 
3  276 PHE n 
3  277 ALA n 
3  278 TYR n 
3  279 ALA n 
3  280 ILE n 
3  281 LEU n 
3  282 ARG n 
3  283 SER n 
3  284 ILE n 
3  285 PRO n 
3  286 ASN n 
3  287 LYS n 
3  288 LEU n 
3  289 GLY n 
3  290 GLY n 
3  291 VAL n 
3  292 LEU n 
3  293 ALA n 
3  294 LEU n 
3  295 ALA n 
3  296 PHE n 
3  297 SER n 
3  298 ILE n 
3  299 LEU n 
3  300 ILE n 
3  301 LEU n 
3  302 ALA n 
3  303 LEU n 
3  304 ILE n 
3  305 PRO n 
3  306 LEU n 
3  307 LEU n 
3  308 HIS n 
3  309 THR n 
3  310 SER n 
3  311 LYS n 
3  312 GLN n 
3  313 ARG n 
3  314 SER n 
3  315 MET n 
3  316 MET n 
3  317 PHE n 
3  318 ARG n 
3  319 PRO n 
3  320 LEU n 
3  321 SER n 
3  322 GLN n 
3  323 CYS n 
3  324 LEU n 
3  325 PHE n 
3  326 TRP n 
3  327 ALA n 
3  328 LEU n 
3  329 VAL n 
3  330 ALA n 
3  331 ASP n 
3  332 LEU n 
3  333 LEU n 
3  334 THR n 
3  335 LEU n 
3  336 THR n 
3  337 TRP n 
3  338 ILE n 
3  339 GLY n 
3  340 GLY n 
3  341 GLN n 
3  342 PRO n 
3  343 VAL n 
3  344 GLU n 
3  345 HIS n 
3  346 PRO n 
3  347 TYR n 
3  348 ILE n 
3  349 THR n 
3  350 ILE n 
3  351 GLY n 
3  352 GLN n 
3  353 LEU n 
3  354 ALA n 
3  355 SER n 
3  356 VAL n 
3  357 LEU n 
3  358 TYR n 
3  359 PHE n 
3  360 LEU n 
3  361 LEU n 
3  362 ILE n 
3  363 LEU n 
3  364 VAL n 
3  365 LEU n 
3  366 MET n 
3  367 PRO n 
3  368 THR n 
3  369 ALA n 
3  370 GLY n 
3  371 THR n 
3  372 ILE n 
3  373 GLU n 
3  374 ASN n 
3  375 LYS n 
3  376 LEU n 
3  377 LEU n 
3  378 LYS n 
3  379 TRP n 
4  1   SER n 
4  2   ASP n 
4  3   LEU n 
4  4   GLU n 
4  5   LEU n 
4  6   HIS n 
4  7   PRO n 
4  8   PRO n 
4  9   SER n 
4  10  TYR n 
4  11  PRO n 
4  12  TRP n 
4  13  SER n 
4  14  HIS n 
4  15  ARG n 
4  16  GLY n 
4  17  LEU n 
4  18  LEU n 
4  19  SER n 
4  20  SER n 
4  21  LEU n 
4  22  ASP n 
4  23  HIS n 
4  24  THR n 
4  25  SER n 
4  26  ILE n 
4  27  ARG n 
4  28  ARG n 
4  29  GLY n 
4  30  PHE n 
4  31  GLN n 
4  32  VAL n 
4  33  TYR n 
4  34  LYS n 
4  35  GLN n 
4  36  VAL n 
4  37  CYS n 
4  38  SER n 
4  39  SER n 
4  40  CYS n 
4  41  HIS n 
4  42  SER n 
4  43  MET n 
4  44  ASP n 
4  45  TYR n 
4  46  VAL n 
4  47  ALA n 
4  48  TYR n 
4  49  ARG n 
4  50  HIS n 
4  51  LEU n 
4  52  VAL n 
4  53  GLY n 
4  54  VAL n 
4  55  CYS n 
4  56  TYR n 
4  57  THR n 
4  58  GLU n 
4  59  ASP n 
4  60  GLU n 
4  61  ALA n 
4  62  LYS n 
4  63  ALA n 
4  64  LEU n 
4  65  ALA n 
4  66  GLU n 
4  67  GLU n 
4  68  VAL n 
4  69  GLU n 
4  70  VAL n 
4  71  GLN n 
4  72  ASP n 
4  73  GLY n 
4  74  PRO n 
4  75  ASN n 
4  76  GLU n 
4  77  ASP n 
4  78  GLY n 
4  79  GLU n 
4  80  MET n 
4  81  PHE n 
4  82  MET n 
4  83  ARG n 
4  84  PRO n 
4  85  GLY n 
4  86  LYS n 
4  87  LEU n 
4  88  SER n 
4  89  ASP n 
4  90  TYR n 
4  91  PHE n 
4  92  PRO n 
4  93  LYS n 
4  94  PRO n 
4  95  TYR n 
4  96  PRO n 
4  97  ASN n 
4  98  PRO n 
4  99  GLU n 
4  100 ALA n 
4  101 ALA n 
4  102 ARG n 
4  103 ALA n 
4  104 ALA n 
4  105 ASN n 
4  106 ASN n 
4  107 GLY n 
4  108 ALA n 
4  109 LEU n 
4  110 PRO n 
4  111 PRO n 
4  112 ASP n 
4  113 LEU n 
4  114 SER n 
4  115 TYR n 
4  116 ILE n 
4  117 VAL n 
4  118 ARG n 
4  119 ALA n 
4  120 ARG n 
4  121 HIS n 
4  122 GLY n 
4  123 GLY n 
4  124 GLU n 
4  125 ASP n 
4  126 TYR n 
4  127 VAL n 
4  128 PHE n 
4  129 SER n 
4  130 LEU n 
4  131 LEU n 
4  132 THR n 
4  133 GLY n 
4  134 TYR n 
4  135 CYS n 
4  136 GLU n 
4  137 PRO n 
4  138 PRO n 
4  139 THR n 
4  140 GLY n 
4  141 VAL n 
4  142 SER n 
4  143 LEU n 
4  144 ARG n 
4  145 GLU n 
4  146 GLY n 
4  147 LEU n 
4  148 TYR n 
4  149 PHE n 
4  150 ASN n 
4  151 PRO n 
4  152 TYR n 
4  153 PHE n 
4  154 PRO n 
4  155 GLY n 
4  156 GLN n 
4  157 ALA n 
4  158 ILE n 
4  159 GLY n 
4  160 MET n 
4  161 ALA n 
4  162 PRO n 
4  163 PRO n 
4  164 ILE n 
4  165 TYR n 
4  166 ASN n 
4  167 GLU n 
4  168 VAL n 
4  169 LEU n 
4  170 GLU n 
4  171 PHE n 
4  172 ASP n 
4  173 ASP n 
4  174 GLY n 
4  175 THR n 
4  176 PRO n 
4  177 ALA n 
4  178 THR n 
4  179 MET n 
4  180 SER n 
4  181 GLN n 
4  182 VAL n 
4  183 ALA n 
4  184 LYS n 
4  185 ASP n 
4  186 VAL n 
4  187 CYS n 
4  188 THR n 
4  189 PHE n 
4  190 LEU n 
4  191 ARG n 
4  192 TRP n 
4  193 ALA n 
4  194 ALA n 
4  195 GLU n 
4  196 PRO n 
4  197 GLU n 
4  198 HIS n 
4  199 ASP n 
4  200 HIS n 
4  201 ARG n 
4  202 LYS n 
4  203 ARG n 
4  204 MET n 
4  205 GLY n 
4  206 LEU n 
4  207 LYS n 
4  208 MET n 
4  209 LEU n 
4  210 LEU n 
4  211 MET n 
4  212 MET n 
4  213 GLY n 
4  214 LEU n 
4  215 LEU n 
4  216 LEU n 
4  217 PRO n 
4  218 LEU n 
4  219 VAL n 
4  220 TYR n 
4  221 ALA n 
4  222 MET n 
4  223 LYS n 
4  224 ARG n 
4  225 HIS n 
4  226 LYS n 
4  227 TRP n 
4  228 SER n 
4  229 VAL n 
4  230 LEU n 
4  231 LYS n 
4  232 SER n 
4  233 ARG n 
4  234 LYS n 
4  235 LEU n 
4  236 ALA n 
4  237 TYR n 
4  238 ARG n 
4  239 PRO n 
4  240 PRO n 
4  241 LYS n 
5  1   SER n 
5  2   HIS n 
5  3   THR n 
5  4   ASP n 
5  5   ILE n 
5  6   LYS n 
5  7   VAL n 
5  8   PRO n 
5  9   ASP n 
5  10  PHE n 
5  11  SER n 
5  12  ASP n 
5  13  TYR n 
5  14  ARG n 
5  15  ARG n 
5  16  PRO n 
5  17  GLU n 
5  18  VAL n 
5  19  LEU n 
5  20  ASP n 
5  21  SER n 
5  22  THR n 
5  23  LYS n 
5  24  SER n 
5  25  SER n 
5  26  LYS n 
5  27  GLU n 
5  28  SER n 
5  29  SER n 
5  30  GLU n 
5  31  ALA n 
5  32  ARG n 
5  33  LYS n 
5  34  GLY n 
5  35  PHE n 
5  36  SER n 
5  37  TYR n 
5  38  LEU n 
5  39  VAL n 
5  40  THR n 
5  41  ALA n 
5  42  THR n 
5  43  THR n 
5  44  THR n 
5  45  VAL n 
5  46  GLY n 
5  47  VAL n 
5  48  ALA n 
5  49  TYR n 
5  50  ALA n 
5  51  ALA n 
5  52  LYS n 
5  53  ASN n 
5  54  VAL n 
5  55  VAL n 
5  56  SER n 
5  57  GLN n 
5  58  PHE n 
5  59  VAL n 
5  60  SER n 
5  61  SER n 
5  62  MET n 
5  63  SER n 
5  64  ALA n 
5  65  SER n 
5  66  ALA n 
5  67  ASP n 
5  68  VAL n 
5  69  LEU n 
5  70  ALA n 
5  71  MET n 
5  72  SER n 
5  73  LYS n 
5  74  ILE n 
5  75  GLU n 
5  76  ILE n 
5  77  LYS n 
5  78  LEU n 
5  79  SER n 
5  80  ASP n 
5  81  ILE n 
5  82  PRO n 
5  83  GLU n 
5  84  GLY n 
5  85  LYS n 
5  86  ASN n 
5  87  MET n 
5  88  ALA n 
5  89  PHE n 
5  90  LYS n 
5  91  TRP n 
5  92  ARG n 
5  93  GLY n 
5  94  LYS n 
5  95  PRO n 
5  96  LEU n 
5  97  PHE n 
5  98  VAL n 
5  99  ARG n 
5  100 HIS n 
5  101 ARG n 
5  102 THR n 
5  103 LYS n 
5  104 LYS n 
5  105 GLU n 
5  106 ILE n 
5  107 ASP n 
5  108 GLN n 
5  109 GLU n 
5  110 ALA n 
5  111 ALA n 
5  112 VAL n 
5  113 GLU n 
5  114 VAL n 
5  115 SER n 
5  116 GLN n 
5  117 LEU n 
5  118 ARG n 
5  119 ASP n 
5  120 PRO n 
5  121 GLN n 
5  122 HIS n 
5  123 ASP n 
5  124 LEU n 
5  125 GLU n 
5  126 ARG n 
5  127 VAL n 
5  128 LYS n 
5  129 LYS n 
5  130 PRO n 
5  131 GLU n 
5  132 TRP n 
5  133 VAL n 
5  134 ILE n 
5  135 LEU n 
5  136 ILE n 
5  137 GLY n 
5  138 VAL n 
5  139 CYS n 
5  140 THR n 
5  141 HIS n 
5  142 LEU n 
5  143 GLY n 
5  144 CYS n 
5  145 VAL n 
5  146 PRO n 
5  147 ILE n 
5  148 ALA n 
5  149 ASN n 
5  150 ALA n 
5  151 GLY n 
5  152 ASP n 
5  153 PHE n 
5  154 GLY n 
5  155 GLY n 
5  156 TYR n 
5  157 TYR n 
5  158 CYS n 
5  159 PRO n 
5  160 CYS n 
5  161 HIS n 
5  162 GLY n 
5  163 SER n 
5  164 HIS n 
5  165 TYR n 
5  166 ASP n 
5  167 ALA n 
5  168 SER n 
5  169 GLY n 
5  170 ARG n 
5  171 ILE n 
5  172 ARG n 
5  173 LYS n 
5  174 GLY n 
5  175 PRO n 
5  176 ALA n 
5  177 PRO n 
5  178 LEU n 
5  179 ASN n 
5  180 LEU n 
5  181 GLU n 
5  182 VAL n 
5  183 PRO n 
5  184 SER n 
5  185 TYR n 
5  186 GLU n 
5  187 PHE n 
5  188 THR n 
5  189 SER n 
5  190 ASP n 
5  191 ASP n 
5  192 MET n 
5  193 VAL n 
5  194 ILE n 
5  195 VAL n 
5  196 GLY n 
6  1   ALA n 
6  2   GLY n 
6  3   ARG n 
6  4   PRO n 
6  5   ALA n 
6  6   VAL n 
6  7   SER n 
6  8   ALA n 
6  9   SER n 
6  10  SER n 
6  11  ARG n 
6  12  TRP n 
6  13  LEU n 
6  14  GLU n 
6  15  GLY n 
6  16  ILE n 
6  17  ARG n 
6  18  LYS n 
6  19  TRP n 
6  20  TYR n 
6  21  TYR n 
6  22  ASN n 
6  23  ALA n 
6  24  ALA n 
6  25  GLY n 
6  26  PHE n 
6  27  ASN n 
6  28  LYS n 
6  29  LEU n 
6  30  GLY n 
6  31  LEU n 
6  32  MET n 
6  33  ARG n 
6  34  ASP n 
6  35  ASP n 
6  36  THR n 
6  37  ILE n 
6  38  HIS n 
6  39  GLU n 
6  40  ASN n 
6  41  ASP n 
6  42  ASP n 
6  43  VAL n 
6  44  LYS n 
6  45  GLU n 
6  46  ALA n 
6  47  ILE n 
6  48  ARG n 
6  49  ARG n 
6  50  LEU n 
6  51  PRO n 
6  52  GLU n 
6  53  ASN n 
6  54  LEU n 
6  55  TYR n 
6  56  ASP n 
6  57  ASP n 
6  58  ARG n 
6  59  VAL n 
6  60  PHE n 
6  61  ARG n 
6  62  ILE n 
6  63  LYS n 
6  64  ARG n 
6  65  ALA n 
6  66  LEU n 
6  67  ASP n 
6  68  LEU n 
6  69  SER n 
6  70  MET n 
6  71  ARG n 
6  72  GLN n 
6  73  GLN n 
6  74  ILE n 
6  75  LEU n 
6  76  PRO n 
6  77  LYS n 
6  78  GLU n 
6  79  GLN n 
6  80  TRP n 
6  81  THR n 
6  82  LYS n 
6  83  TYR n 
6  84  GLU n 
6  85  GLU n 
6  86  ASP n 
6  87  LYS n 
6  88  SER n 
6  89  TYR n 
6  90  LEU n 
6  91  GLU n 
6  92  PRO n 
6  93  TYR n 
6  94  LEU n 
6  95  LYS n 
6  96  GLU n 
6  97  VAL n 
6  98  ILE n 
6  99  ARG n 
6  100 GLU n 
6  101 ARG n 
6  102 LYS n 
6  103 GLU n 
6  104 ARG n 
6  105 GLU n 
6  106 GLU n 
6  107 TRP n 
6  108 ALA n 
6  109 LYS n 
6  110 LYS n 
7  1   GLY n 
7  2   ARG n 
7  3   GLN n 
7  4   PHE n 
7  5   GLY n 
7  6   HIS n 
7  7   LEU n 
7  8   THR n 
7  9   ARG n 
7  10  VAL n 
7  11  ARG n 
7  12  HIS n 
7  13  VAL n 
7  14  ILE n 
7  15  THR n 
7  16  TYR n 
7  17  SER n 
7  18  LEU n 
7  19  SER n 
7  20  PRO n 
7  21  PHE n 
7  22  GLU n 
7  23  GLN n 
7  24  ARG n 
7  25  ALA n 
7  26  PHE n 
7  27  PRO n 
7  28  HIS n 
7  29  TYR n 
7  30  PHE n 
7  31  SER n 
7  32  LYS n 
7  33  GLY n 
7  34  ILE n 
7  35  PRO n 
7  36  ASN n 
7  37  VAL n 
7  38  LEU n 
7  39  ARG n 
7  40  ARG n 
7  41  THR n 
7  42  ARG n 
7  43  ALA n 
7  44  CYS n 
7  45  ILE n 
7  46  LEU n 
7  47  ARG n 
7  48  VAL n 
7  49  ALA n 
7  50  PRO n 
7  51  PRO n 
7  52  PHE n 
7  53  VAL n 
7  54  ALA n 
7  55  PHE n 
7  56  TYR n 
7  57  LEU n 
7  58  VAL n 
7  59  TYR n 
7  60  THR n 
7  61  TRP n 
7  62  GLY n 
7  63  THR n 
7  64  GLN n 
7  65  GLU n 
7  66  PHE n 
7  67  GLU n 
7  68  LYS n 
7  69  SER n 
7  70  LYS n 
7  71  ARG n 
7  72  LYS n 
7  73  ASN n 
7  74  PRO n 
7  75  ALA n 
7  76  ALA n 
7  77  TYR n 
7  78  GLU n 
7  79  ASN n 
7  80  ASP n 
7  81  ARG n 
8  1   GLY n 
8  2   ASP n 
8  3   PRO n 
8  4   LYS n 
8  5   GLU n 
8  6   GLU n 
8  7   GLU n 
8  8   GLU n 
8  9   GLU n 
8  10  GLU n 
8  11  GLU n 
8  12  GLU n 
8  13  LEU n 
8  14  VAL n 
8  15  ASP n 
8  16  PRO n 
8  17  LEU n 
8  18  THR n 
8  19  THR n 
8  20  VAL n 
8  21  ARG n 
8  22  GLU n 
8  23  GLN n 
8  24  CYS n 
8  25  GLU n 
8  26  GLN n 
8  27  LEU n 
8  28  GLU n 
8  29  LYS n 
8  30  CYS n 
8  31  VAL n 
8  32  LYS n 
8  33  ALA n 
8  34  ARG n 
8  35  GLU n 
8  36  ARG n 
8  37  LEU n 
8  38  GLU n 
8  39  LEU n 
8  40  CYS n 
8  41  ASP n 
8  42  GLU n 
8  43  ARG n 
8  44  VAL n 
8  45  SER n 
8  46  SER n 
8  47  ARG n 
8  48  SER n 
8  49  GLN n 
8  50  THR n 
8  51  GLU n 
8  52  GLU n 
8  53  ASP n 
8  54  CYS n 
8  55  THR n 
8  56  GLU n 
8  57  GLU n 
8  58  LEU n 
8  59  LEU n 
8  60  ASP n 
8  61  PHE n 
8  62  LEU n 
8  63  HIS n 
8  64  ALA n 
8  65  ARG n 
8  66  ASP n 
8  67  HIS n 
8  68  CYS n 
8  69  VAL n 
8  70  ALA n 
8  71  HIS n 
8  72  LYS n 
8  73  LEU n 
8  74  PHE n 
8  75  ASN n 
8  76  SER n 
8  77  LEU n 
8  78  LYS n 
9  1   MET n 
9  2   LEU n 
9  3   SER n 
9  4   VAL n 
9  5   ALA n 
9  6   ALA n 
9  7   ARG n 
9  8   SER n 
9  9   GLY n 
9  10  PRO n 
9  11  PHE n 
9  12  ALA n 
9  13  PRO n 
9  14  VAL n 
9  15  LEU n 
9  16  SER n 
9  17  ALA n 
9  18  THR n 
9  19  SER n 
9  20  ARG n 
9  21  GLY n 
9  22  VAL n 
9  23  ALA n 
9  24  GLY n 
9  25  ALA n 
9  26  LEU n 
9  27  ARG n 
9  28  PRO n 
9  29  LEU n 
9  30  VAL n 
9  31  GLN n 
9  32  ALA n 
9  33  ALA n 
9  34  VAL n 
9  35  PRO n 
9  36  ALA n 
9  37  THR n 
9  38  SER n 
9  39  GLU n 
9  40  SER n 
9  41  PRO n 
9  42  VAL n 
9  43  LEU n 
9  44  ASP n 
9  45  LEU n 
9  46  LYS n 
9  47  ARG n 
9  48  SER n 
9  49  VAL n 
9  50  LEU n 
9  51  CYS n 
9  52  ARG n 
9  53  GLU n 
9  54  SER n 
9  55  LEU n 
9  56  ARG n 
9  57  GLY n 
9  58  GLN n 
9  59  ALA n 
9  60  ALA n 
9  61  GLY n 
9  62  ARG n 
9  63  PRO n 
9  64  LEU n 
9  65  VAL n 
9  66  ALA n 
9  67  SER n 
9  68  VAL n 
9  69  SER n 
9  70  LEU n 
9  71  ASN n 
9  72  VAL n 
9  73  PRO n 
9  74  ALA n 
9  75  SER n 
9  76  VAL n 
9  77  ARG n 
9  78  TYR n 
10 1   VAL n 
10 2   ALA n 
10 3   PRO n 
10 4   THR n 
10 5   LEU n 
10 6   THR n 
10 7   ALA n 
10 8   ARG n 
10 9   LEU n 
10 10  TYR n 
10 11  SER n 
10 12  LEU n 
10 13  LEU n 
10 14  PHE n 
10 15  ARG n 
10 16  ARG n 
10 17  THR n 
10 18  SER n 
10 19  THR n 
10 20  PHE n 
10 21  ALA n 
10 22  LEU n 
10 23  THR n 
10 24  ILE n 
10 25  VAL n 
10 26  VAL n 
10 27  GLY n 
10 28  ALA n 
10 29  LEU n 
10 30  PHE n 
10 31  PHE n 
10 32  GLU n 
10 33  ARG n 
10 34  ALA n 
10 35  PHE n 
10 36  ASP n 
10 37  GLN n 
10 38  GLY n 
10 39  ALA n 
10 40  ASP n 
10 41  ALA n 
10 42  ILE n 
10 43  TYR n 
10 44  GLU n 
10 45  HIS n 
10 46  ILE n 
10 47  ASN n 
10 48  GLU n 
10 49  GLY n 
10 50  LYS n 
10 51  LEU n 
10 52  TRP n 
10 53  LYS n 
10 54  HIS n 
10 55  ILE n 
10 56  LYS n 
10 57  HIS n 
10 58  LYS n 
10 59  TYR n 
10 60  GLU n 
10 61  ASN n 
10 62  LYS n 
11 1   MET n 
11 2   LEU n 
11 3   THR n 
11 4   ARG n 
11 5   PHE n 
11 6   LEU n 
11 7   GLY n 
11 8   PRO n 
11 9   ARG n 
11 10  TYR n 
11 11  ARG n 
11 12  GLN n 
11 13  LEU n 
11 14  ALA n 
11 15  ARG n 
11 16  ASN n 
11 17  TRP n 
11 18  VAL n 
11 19  PRO n 
11 20  THR n 
11 21  ALA n 
11 22  GLN n 
11 23  LEU n 
11 24  TRP n 
11 25  GLY n 
11 26  ALA n 
11 27  VAL n 
11 28  GLY n 
11 29  ALA n 
11 30  VAL n 
11 31  GLY n 
11 32  LEU n 
11 33  VAL n 
11 34  SER n 
11 35  ALA n 
11 36  THR n 
11 37  ASP n 
11 38  SER n 
11 39  ARG n 
11 40  LEU n 
11 41  ILE n 
11 42  LEU n 
11 43  ASP n 
11 44  TRP n 
11 45  VAL n 
11 46  PRO n 
11 47  TYR n 
11 48  ILE n 
11 49  ASN n 
11 50  GLY n 
11 51  LYS n 
11 52  PHE n 
11 53  LYS n 
11 54  LYS n 
11 55  ASP n 
11 56  ASP n 
# 
loop_
_entity_src_nat.entity_id 
_entity_src_nat.pdbx_src_id 
_entity_src_nat.pdbx_alt_source_flag 
_entity_src_nat.pdbx_beg_seq_num 
_entity_src_nat.pdbx_end_seq_num 
_entity_src_nat.common_name 
_entity_src_nat.pdbx_organism_scientific 
_entity_src_nat.pdbx_ncbi_taxonomy_id 
_entity_src_nat.genus 
_entity_src_nat.species 
_entity_src_nat.strain 
_entity_src_nat.tissue 
_entity_src_nat.tissue_fraction 
_entity_src_nat.pdbx_secretion 
_entity_src_nat.pdbx_fragment 
_entity_src_nat.pdbx_variant 
_entity_src_nat.pdbx_cell_line 
_entity_src_nat.pdbx_atcc 
_entity_src_nat.pdbx_cellular_location 
_entity_src_nat.pdbx_organ 
_entity_src_nat.pdbx_organelle 
_entity_src_nat.pdbx_cell 
_entity_src_nat.pdbx_plasmid_name 
_entity_src_nat.pdbx_plasmid_details 
_entity_src_nat.details 
1  1 sample ? ? cattle 'Bos taurus' 9913 Bos ? ? 'HEART MUSCLE' ? ? ? ? ? ? 'MITOCHONDRIAL INNER MEMBRANE' HEART MITOCHONDRION ? ? 
? ? 
2  1 sample ? ? cattle 'Bos taurus' 9913 Bos ? ? 'HEART MUSCLE' ? ? ? ? ? ? 'MITOCHONDRIAL INNER MEMBRANE' HEART MITOCHONDRION ? ? 
? ? 
3  1 sample ? ? cattle 'Bos taurus' 9913 Bos ? ? 'HEART MUSCLE' ? ? ? ? ? ? 'MITOCHONDRIAL INNER MEMBRANE' HEART MITOCHONDRION ? ? 
? ? 
4  1 sample ? ? cattle 'Bos taurus' 9913 Bos ? ? 'HEART MUSCLE' ? ? ? ? ? ? 'MITOCHONDRIAL INNER MEMBRANE' HEART MITOCHONDRION ? ? 
? ? 
5  1 sample ? ? cattle 'Bos taurus' 9913 Bos ? ? 'HEART MUSCLE' ? ? ? ? ? ? 'MITOCHONDRIAL INNER MEMBRANE' HEART MITOCHONDRION ? ? 
? ? 
6  1 sample ? ? cattle 'Bos taurus' 9913 Bos ? ? 'HEART MUSCLE' ? ? ? ? ? ? 'MITOCHONDRIAL INNER MEMBRANE' HEART MITOCHONDRION ? ? 
? ? 
7  1 sample ? ? cattle 'Bos taurus' 9913 Bos ? ? 'HEART MUSCLE' ? ? ? ? ? ? 'MITOCHONDRIAL INNER MEMBRANE' HEART MITOCHONDRION ? ? 
? ? 
8  1 sample ? ? cattle 'Bos taurus' 9913 Bos ? ? 'HEART MUSCLE' ? ? ? ? ? ? 'MITOCHONDRIAL INNER MEMBRANE' HEART MITOCHONDRION ? ? 
? ? 
9  1 sample ? ? cattle 'Bos taurus' 9913 Bos ? ? 'HEART MUSCLE' ? ? ? ? ? ? 'MITOCHONDRIAL INNER MEMBRANE' HEART MITOCHONDRION ? ? 
? ? 
10 1 sample ? ? cattle 'Bos taurus' 9913 Bos ? ? 'HEART MUSCLE' ? ? ? ? ? ? 'MITOCHONDRIAL INNER MEMBRANE' HEART MITOCHONDRION ? ? 
? ? 
11 1 sample ? ? cattle 'Bos taurus' 9913 Bos ? ? 'HEART MUSCLE' ? ? ? ? ? ? 'MITOCHONDRIAL INNER MEMBRANE' HEART MITOCHONDRION ? ? 
? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
_struct_ref.pdbx_seq_one_letter_code 
1  UNP UQCR1_BOVIN P31800 1  35 ? ? 
2  UNP UQCR2_BOVIN P23004 2  15 ? ? 
3  UNP CYB_BOVIN   P00157 3  1  ? ? 
4  UNP CY1_BOVIN   P00125 4  1  ? ? 
5  UNP UCRI_BOVIN  P13272 5  79 ? ? 
6  UNP UCR6_BOVIN  P00129 6  1  ? ? 
7  UNP UCRQ_BOVIN  P13271 7  1  ? ? 
8  UNP UCRH_BOVIN  P00126 8  1  ? ? 
9  UNP UCRI_BOVIN  P13272 9  1  ? ? 
10 UNP UCR10_BOVIN P00130 10 1  ? ? 
11 UNP UCR11_BOVIN P07552 11 1  ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1  1BE3 A 1 ? 446 ? P31800 35 ? 480 ? 1 446 
2  2  1BE3 B 1 ? 439 ? P23004 15 ? 453 ? 1 439 
3  3  1BE3 C 1 ? 379 ? P00157 1  ? 379 ? 1 379 
4  4  1BE3 D 1 ? 241 ? P00125 1  ? 241 ? 1 241 
5  5  1BE3 E 1 ? 196 ? P13272 79 ? 274 ? 1 196 
6  6  1BE3 F 1 ? 110 ? P00129 1  ? 110 ? 1 110 
7  7  1BE3 G 1 ? 81  ? P13271 1  ? 81  ? 1 81  
8  8  1BE3 H 1 ? 78  ? P00126 1  ? 78  ? 1 78  
9  9  1BE3 I 1 ? 78  ? P13272 1  ? 78  ? 1 78  
10 10 1BE3 J 1 ? 62  ? P00130 1  ? 62  ? 1 62  
11 11 1BE3 K 1 ? 56  ? P07552 1  ? 56  ? 1 56  
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                           ?    'C3 H7 N O2'       89.093  
ARG 'L-peptide linking' y ARGININE                          ?    'C6 H15 N4 O2 1'   175.209 
ASN 'L-peptide linking' y ASPARAGINE                        ?    'C4 H8 N2 O3'      132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                   ?    'C4 H7 N O4'       133.103 
CYS 'L-peptide linking' y CYSTEINE                          ?    'C3 H7 N O2 S'     121.158 
FES non-polymer         . 'FE2/S2 (INORGANIC) CLUSTER'      ?    'Fe2 S2'           175.820 
GLN 'L-peptide linking' y GLUTAMINE                         ?    'C5 H10 N2 O3'     146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                   ?    'C5 H9 N O4'       147.129 
GLY 'peptide linking'   y GLYCINE                           ?    'C2 H5 N O2'       75.067  
HEC non-polymer         . 'HEME C'                          ?    'C34 H34 Fe N4 O4' 618.503 
HEM non-polymer         . 'PROTOPORPHYRIN IX CONTAINING FE' HEME 'C34 H32 Fe N4 O4' 616.487 
HIS 'L-peptide linking' y HISTIDINE                         ?    'C6 H10 N3 O2 1'   156.162 
ILE 'L-peptide linking' y ISOLEUCINE                        ?    'C6 H13 N O2'      131.173 
LEU 'L-peptide linking' y LEUCINE                           ?    'C6 H13 N O2'      131.173 
LYS 'L-peptide linking' y LYSINE                            ?    'C6 H15 N2 O2 1'   147.195 
MET 'L-peptide linking' y METHIONINE                        ?    'C5 H11 N O2 S'    149.211 
PHE 'L-peptide linking' y PHENYLALANINE                     ?    'C9 H11 N O2'      165.189 
PRO 'L-peptide linking' y PROLINE                           ?    'C5 H9 N O2'       115.130 
SER 'L-peptide linking' y SERINE                            ?    'C3 H7 N O3'       105.093 
THR 'L-peptide linking' y THREONINE                         ?    'C4 H9 N O3'       119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                        ?    'C11 H12 N2 O2'    204.225 
TYR 'L-peptide linking' y TYROSINE                          ?    'C9 H11 N O3'      181.189 
VAL 'L-peptide linking' y VALINE                            ?    'C5 H11 N O2'      117.146 
# 
_exptl.entry_id          1BE3 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      4.52 
_exptl_crystal.density_percent_sol   69.3 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.6 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    'pH 6.6' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   1997-09 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.99 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID2' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID2 
_diffrn_source.pdbx_wavelength             0.99 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1BE3 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             40.0 
_reflns.d_resolution_high            3.0 
_reflns.number_obs                   79396 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         88.9 
_reflns.pdbx_Rmerge_I_obs            0.07 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        12.6 
_reflns.B_iso_Wilson_estimate        37.4 
_reflns.pdbx_redundancy              2.8 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             3.0 
_reflns_shell.d_res_low              3.11 
_reflns_shell.percent_possible_all   76.8 
_reflns_shell.Rmerge_I_obs           0.266 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.6 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1BE3 
_refine.ls_number_reflns_obs                     72948 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             40.0 
_refine.ls_d_res_high                            3.0 
_refine.ls_percent_reflns_obs                    81.7 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.26 
_refine.ls_R_factor_R_free                       0.32 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 2.0 
_refine.ls_number_reflns_R_free                  1460 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               30.0 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          MIR 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        16089 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         133 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               16222 
_refine_hist.d_res_high                       3.0 
_refine_hist.d_res_low                        40.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
p_bond_d            0.010  0.01  ? ? 'X-RAY DIFFRACTION' ? 
p_angle_d           0.032  0.02  ? ? 'X-RAY DIFFRACTION' ? 
p_angle_deg         ?      ?     ? ? 'X-RAY DIFFRACTION' ? 
p_planar_d          0.057  0.05  ? ? 'X-RAY DIFFRACTION' ? 
p_hb_or_metal_coord ?      ?     ? ? 'X-RAY DIFFRACTION' ? 
p_mcbond_it         3.426  3.00  ? ? 'X-RAY DIFFRACTION' ? 
p_mcangle_it        5.113  3.50  ? ? 'X-RAY DIFFRACTION' ? 
p_scbond_it         5.909  4.00  ? ? 'X-RAY DIFFRACTION' ? 
p_scangle_it        8.568  5.50  ? ? 'X-RAY DIFFRACTION' ? 
p_plane_restr       0.0263 0.02  ? ? 'X-RAY DIFFRACTION' ? 
p_chiral_restr      0.198  0.15  ? ? 'X-RAY DIFFRACTION' ? 
p_singtor_nbd       0.232  0.30  ? ? 'X-RAY DIFFRACTION' ? 
p_multtor_nbd       0.325  0.30  ? ? 'X-RAY DIFFRACTION' ? 
p_xhyhbond_nbd      ?      ?     ? ? 'X-RAY DIFFRACTION' ? 
p_xyhbond_nbd       0.249  0.30  ? ? 'X-RAY DIFFRACTION' ? 
p_planar_tor        5.2    7.0   ? ? 'X-RAY DIFFRACTION' ? 
p_staggered_tor     26.9   15.0  ? ? 'X-RAY DIFFRACTION' ? 
p_orthonormal_tor   ?      ?     ? ? 'X-RAY DIFFRACTION' ? 
p_transverse_tor    30.1   20.00 ? ? 'X-RAY DIFFRACTION' ? 
p_special_tor       ?      ?     ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  1BE3 
_struct.title                     'CYTOCHROME BC1 COMPLEX FROM BOVINE' 
_struct.pdbx_descriptor           'CYTOCHROME BC1 COMPLEX, PROTOPORPHYRIN IX CONTAINING FE, HEME C, FE2/S2 (INORGANIC) CLUSTER' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1BE3 
_struct_keywords.pdbx_keywords   'ELECTRON TRANSPORT' 
_struct_keywords.text            'ELECTRON TRANSPORT, CYTOCHROME, MEMBRANE PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1  ? 
B N N 2  ? 
C N N 3  ? 
D N N 4  ? 
E N N 5  ? 
F N N 6  ? 
G N N 7  ? 
H N N 8  ? 
I N N 9  ? 
J N N 10 ? 
K N N 11 ? 
L N N 12 ? 
M N N 12 ? 
N N N 13 ? 
O N N 14 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  TYR A 4   ? GLN A 9   ? TYR A 4   GLN A 9   1 ? 6  
HELX_P HELX_P2  2  LYS A 51  ? LEU A 62  ? LYS A 51  LEU A 62  5 ? 12 
HELX_P HELX_P3  3  GLY A 72  ? MET A 82  ? GLY A 72  MET A 82  5 ? 11 
HELX_P HELX_P4  4  SER A 103 ? GLN A 118 ? SER A 103 GLN A 118 5 ? 16 
HELX_P HELX_P5  5  ASP A 124 ? THR A 143 ? ASP A 124 THR A 143 1 ? 20 
HELX_P HELX_P6  6  MET A 145 ? ALA A 157 ? MET A 145 ALA A 157 1 ? 13 
HELX_P HELX_P7  7  PRO A 162 ? ALA A 164 ? PRO A 162 ALA A 164 5 ? 3  
HELX_P HELX_P8  8  SER A 171 ? LYS A 176 ? SER A 171 LYS A 176 1 ? 6  
HELX_P HELX_P9  9  ARG A 179 ? TYR A 190 ? ARG A 179 TYR A 190 1 ? 12 
HELX_P HELX_P10 10 HIS A 205 ? LEU A 211 ? HIS A 205 LEU A 211 1 ? 7  
HELX_P HELX_P11 11 ASP A 224 ? ASP A 226 ? ASP A 224 ASP A 226 5 ? 3  
HELX_P HELX_P12 12 PRO A 265 ? ILE A 277 ? PRO A 265 ILE A 277 5 ? 13 
HELX_P HELX_P13 13 GLY A 287 ? HIS A 289 ? GLY A 287 HIS A 289 5 ? 3  
HELX_P HELX_P14 14 PRO A 293 ? THR A 300 ? PRO A 293 THR A 300 1 ? 8  
HELX_P HELX_P15 15 ILE A 331 ? SER A 348 ? ILE A 331 SER A 348 1 ? 18 
HELX_P HELX_P16 16 GLU A 351 ? LEU A 369 ? GLU A 351 LEU A 369 1 ? 19 
HELX_P HELX_P17 17 THR A 372 ? THR A 385 ? THR A 372 THR A 385 1 ? 14 
HELX_P HELX_P18 18 LEU A 392 ? GLU A 401 ? LEU A 392 GLU A 401 1 ? 10 
HELX_P HELX_P19 19 ALA A 404 ? TYR A 414 ? ALA A 404 TYR A 414 1 ? 11 
HELX_P HELX_P20 20 TYR A 434 ? MET A 441 ? TYR A 434 MET A 441 1 ? 8  
HELX_P HELX_P21 21 SER B 55  ? TYR B 57  ? SER B 55  TYR B 57  5 ? 3  
HELX_P HELX_P22 22 THR B 65  ? LEU B 71  ? THR B 65  LEU B 71  1 ? 7  
HELX_P HELX_P23 23 SER B 82  ? VAL B 92  ? SER B 82  VAL B 92  1 ? 11 
HELX_P HELX_P24 24 ARG B 113 ? THR B 128 ? ARG B 113 THR B 128 5 ? 16 
HELX_P HELX_P25 25 ARG B 134 ? GLN B 153 ? ARG B 134 GLN B 153 1 ? 20 
HELX_P HELX_P26 26 PRO B 155 ? ALA B 167 ? PRO B 155 ALA B 167 1 ? 13 
HELX_P HELX_P27 27 ILE B 183 ? LYS B 185 ? ILE B 183 LYS B 185 5 ? 3  
HELX_P HELX_P28 28 PRO B 188 ? HIS B 198 ? PRO B 188 HIS B 198 1 ? 11 
HELX_P HELX_P29 29 SER B 201 ? ARG B 203 ? SER B 201 ARG B 203 5 ? 3  
HELX_P HELX_P30 30 HIS B 213 ? PHE B 223 ? HIS B 213 PHE B 223 1 ? 11 
HELX_P HELX_P31 31 ALA B 267 ? LEU B 279 ? ALA B 267 LEU B 279 1 ? 13 
HELX_P HELX_P32 32 SER B 294 ? GLY B 302 ? SER B 294 GLY B 302 1 ? 9  
HELX_P HELX_P33 33 ALA B 333 ? ALA B 348 ? ALA B 333 ALA B 348 1 ? 16 
HELX_P HELX_P34 34 ASN B 354 ? VAL B 372 ? ASN B 354 VAL B 372 5 ? 19 
HELX_P HELX_P35 35 SER B 375 ? ALA B 388 ? SER B 375 ALA B 388 1 ? 14 
HELX_P HELX_P36 36 PRO B 395 ? ALA B 404 ? PRO B 395 ALA B 404 1 ? 10 
HELX_P HELX_P37 37 ASP B 407 ? VAL B 418 ? ASP B 407 VAL B 418 1 ? 12 
HELX_P HELX_P38 38 ARG C 5   ? HIS C 8   ? ARG C 5   HIS C 8   1 ? 4  
HELX_P HELX_P39 39 LEU C 10  ? PHE C 18  ? LEU C 10  PHE C 18  1 ? 9  
HELX_P HELX_P40 40 SER C 29  ? TRP C 31  ? SER C 29  TRP C 31  5 ? 3  
HELX_P HELX_P41 41 PHE C 33  ? MET C 53  ? PHE C 33  MET C 53  1 ? 21 
HELX_P HELX_P42 42 ALA C 62  ? ASP C 72  ? ALA C 62  ASP C 72  1 ? 11 
HELX_P HELX_P43 43 GLY C 76  ? TYR C 104 ? GLY C 76  TYR C 104 1 ? 29 
HELX_P HELX_P44 44 SER C 106 ? THR C 108 ? SER C 106 THR C 108 5 ? 3  
HELX_P HELX_P45 45 LEU C 110 ? LEU C 133 ? LEU C 110 LEU C 133 1 ? 24 
HELX_P HELX_P46 46 GLN C 137 ? ALA C 152 ? GLN C 137 ALA C 152 1 ? 16 
HELX_P HELX_P47 47 GLY C 157 ? TRP C 165 ? GLY C 157 TRP C 165 1 ? 9  
HELX_P HELX_P48 48 LYS C 172 ? GLU C 202 ? LYS C 172 GLU C 202 1 ? 31 
HELX_P HELX_P49 49 ASP C 214 ? ASP C 216 ? ASP C 214 ASP C 216 5 ? 3  
HELX_P HELX_P50 50 PRO C 222 ? LEU C 244 ? PRO C 222 LEU C 244 1 ? 23 
HELX_P HELX_P51 51 TRP C 272 ? ARG C 282 ? TRP C 272 ARG C 282 1 ? 11 
HELX_P HELX_P52 52 LYS C 287 ? LEU C 307 ? LYS C 287 LEU C 307 1 ? 21 
HELX_P HELX_P53 53 MET C 315 ? PHE C 317 ? MET C 315 PHE C 317 5 ? 3  
HELX_P HELX_P54 54 PRO C 319 ? GLY C 340 ? PRO C 319 GLY C 340 1 ? 22 
HELX_P HELX_P55 55 HIS C 345 ? LEU C 363 ? HIS C 345 LEU C 363 1 ? 19 
HELX_P HELX_P56 56 LEU C 365 ? LEU C 376 ? LEU C 365 LEU C 376 1 ? 12 
HELX_P HELX_P57 57 HIS D 23  ? VAL D 36  ? HIS D 23  VAL D 36  1 ? 14 
HELX_P HELX_P58 58 GLU D 58  ? GLN D 71  ? GLU D 58  GLN D 71  1 ? 14 
HELX_P HELX_P59 59 PRO D 74  ? GLU D 76  ? PRO D 74  GLU D 76  5 ? 3  
HELX_P HELX_P60 60 PRO D 98  ? ALA D 104 ? PRO D 98  ALA D 104 1 ? 7  
HELX_P HELX_P61 61 LEU D 113 ? TYR D 115 ? LEU D 113 TYR D 115 5 ? 3  
HELX_P HELX_P62 62 GLY D 123 ? LEU D 131 ? GLY D 123 LEU D 131 1 ? 9  
HELX_P HELX_P63 63 MET D 179 ? ALA D 194 ? MET D 179 ALA D 194 1 ? 16 
HELX_P HELX_P64 64 PRO D 196 ? ARG D 201 ? PRO D 196 ARG D 201 5 ? 6  
HELX_P HELX_P65 65 MET D 204 ? LYS D 231 ? MET D 204 LYS D 231 1 ? 28 
HELX_P HELX_P66 66 PRO E 16  ? VAL E 18  ? PRO E 16  VAL E 18  5 ? 3  
HELX_P HELX_P67 67 LYS E 26  ? MET E 62  ? LYS E 26  MET E 62  1 ? 37 
HELX_P HELX_P68 68 ALA E 66  ? LYS E 73  ? ALA E 66  LYS E 73  1 ? 8  
HELX_P HELX_P69 69 LYS E 103 ? ALA E 111 ? LYS E 103 ALA E 111 1 ? 9  
HELX_P HELX_P70 70 ASP E 123 ? GLU E 125 ? ASP E 123 GLU E 125 5 ? 3  
HELX_P HELX_P71 71 GLY E 151 ? PHE E 153 ? GLY E 151 PHE E 153 5 ? 3  
HELX_P HELX_P72 72 LEU F 13  ? ALA F 23  ? LEU F 13  ALA F 23  1 ? 11 
HELX_P HELX_P73 73 GLY F 25  ? LEU F 29  ? GLY F 25  LEU F 29  5 ? 5  
HELX_P HELX_P74 74 ARG F 33  ? THR F 36  ? ARG F 33  THR F 36  5 ? 4  
HELX_P HELX_P75 75 ASP F 41  ? ARG F 49  ? ASP F 41  ARG F 49  1 ? 9  
HELX_P HELX_P76 76 GLU F 52  ? ARG F 71  ? GLU F 52  ARG F 71  1 ? 20 
HELX_P HELX_P77 77 LYS F 77  ? GLN F 79  ? LYS F 77  GLN F 79  5 ? 3  
HELX_P HELX_P78 78 TYR F 89  ? ALA F 108 ? TYR F 89  ALA F 108 1 ? 20 
HELX_P HELX_P79 79 PRO G 20  ? GLU G 22  ? PRO G 20  GLU G 22  5 ? 3  
HELX_P HELX_P80 80 TYR G 29  ? ARG G 71  ? TYR G 29  ARG G 71  1 ? 43 
HELX_P HELX_P81 81 PRO H 16  ? GLN H 26  ? PRO H 16  GLN H 26  1 ? 11 
HELX_P HELX_P82 82 GLU H 28  ? CYS H 40  ? GLU H 28  CYS H 40  1 ? 13 
HELX_P HELX_P83 83 THR H 50  ? GLU H 52  ? THR H 50  GLU H 52  5 ? 3  
HELX_P HELX_P84 84 THR H 55  ? SER H 76  ? THR H 55  SER H 76  1 ? 22 
HELX_P HELX_P85 85 LEU J 5   ? LEU J 13  ? LEU J 5   LEU J 13  1 ? 9  
HELX_P HELX_P86 86 THR J 17  ? ASN J 47  ? THR J 17  ASN J 47  1 ? 31 
HELX_P HELX_P87 87 TRP J 52  ? ILE J 55  ? TRP J 52  ILE J 55  1 ? 4  
HELX_P HELX_P88 88 ASN K 16  ? SER K 34  ? ASN K 16  SER K 34  1 ? 19 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1  disulf ? ? E CYS 144 SG  ? ? ? 1_555 E CYS 160 SG  ? ? E CYS 144 E CYS 160 1_555 ? ? ? ? ? ? ? 2.010 ? 
disulf2  disulf ? ? H CYS 24  SG  ? ? ? 1_555 H CYS 68  SG  ? ? H CYS 24  H CYS 68  1_555 ? ? ? ? ? ? ? 2.045 ? 
disulf3  disulf ? ? H CYS 40  SG  ? ? ? 1_555 H CYS 54  SG  ? ? H CYS 40  H CYS 54  1_555 ? ? ? ? ? ? ? 2.037 ? 
metalc1  metalc ? ? L HEM .   FE  ? ? ? 1_555 C HIS 83  NE2 ? ? C HEM 380 C HIS 83  1_555 ? ? ? ? ? ? ? 2.084 ? 
metalc2  metalc ? ? L HEM .   FE  ? ? ? 1_555 C HIS 182 NE2 ? ? C HEM 380 C HIS 182 1_555 ? ? ? ? ? ? ? 2.061 ? 
metalc3  metalc ? ? M HEM .   FE  ? ? ? 1_555 C HIS 97  NE2 ? ? C HEM 381 C HIS 97  1_555 ? ? ? ? ? ? ? 2.076 ? 
metalc4  metalc ? ? M HEM .   FE  ? ? ? 1_555 C HIS 196 NE2 ? ? C HEM 381 C HIS 196 1_555 ? ? ? ? ? ? ? 2.054 ? 
metalc5  metalc ? ? N HEC .   FE  ? ? ? 1_555 D HIS 41  NE2 ? ? D HEC 242 D HIS 41  1_555 ? ? ? ? ? ? ? 2.029 ? 
metalc6  metalc ? ? N HEC .   FE  ? ? ? 1_555 D MET 160 SD  ? ? D HEC 242 D MET 160 1_555 ? ? ? ? ? ? ? 2.371 ? 
covale1  covale ? ? N HEC .   CAB ? ? ? 1_555 D CYS 37  SG  ? ? D HEC 242 D CYS 37  1_555 ? ? ? ? ? ? ? 1.844 ? 
covale2  covale ? ? N HEC .   CAC ? ? ? 1_555 D CYS 40  SG  ? ? D HEC 242 D CYS 40  1_555 ? ? ? ? ? ? ? 1.859 ? 
metalc7  metalc ? ? O FES .   FE1 ? ? ? 1_555 E CYS 139 SG  ? ? E FES 197 E CYS 139 1_555 ? ? ? ? ? ? ? 2.210 ? 
metalc8  metalc ? ? O FES .   FE1 ? ? ? 1_555 E CYS 158 SG  ? ? E FES 197 E CYS 158 1_555 ? ? ? ? ? ? ? 2.250 ? 
metalc9  metalc ? ? O FES .   FE2 ? ? ? 1_555 E HIS 141 ND1 ? ? E FES 197 E HIS 141 1_555 ? ? ? ? ? ? ? 2.186 ? 
metalc10 metalc ? ? O FES .   FE2 ? ? ? 1_555 E HIS 161 ND1 ? ? E FES 197 E HIS 161 1_555 ? ? ? ? ? ? ? 2.170 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
metalc ? ? 
covale ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 ALA 192 A . ? ALA 192 A PRO 193 A ? PRO 193 A 1 19.78 
2 GLY 426 A . ? GLY 426 A PRO 427 A ? PRO 427 A 1 7.85  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 6 ? 
C ? 2 ? 
D ? 2 ? 
E ? 5 ? 
F ? 2 ? 
G ? 3 ? 
H ? 2 ? 
I ? 2 ? 
J ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
B 1 2 ? parallel      
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
B 5 6 ? anti-parallel 
C 1 2 ? parallel      
D 1 2 ? anti-parallel 
E 1 2 ? parallel      
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
E 4 5 ? anti-parallel 
F 1 2 ? anti-parallel 
G 1 2 ? anti-parallel 
G 2 3 ? anti-parallel 
H 1 2 ? anti-parallel 
I 1 2 ? anti-parallel 
J 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ARG A 24  ? GLN A 29  ? ARG A 24  GLN A 29  
A 2 VAL A 196 ? GLY A 201 ? VAL A 196 GLY A 201 
A 3 THR A 34  ? VAL A 39  ? THR A 34  VAL A 39  
A 4 THR A 95  ? LEU A 102 ? THR A 95  LEU A 102 
A 5 HIS A 85  ? SER A 90  ? HIS A 85  SER A 90  
B 1 GLN A 240 ? HIS A 243 ? GLN A 240 HIS A 243 
B 2 ALA A 421 ? PHE A 425 ? ALA A 421 PHE A 425 
B 3 ALA A 251 ? ALA A 256 ? ALA A 251 ALA A 256 
B 4 GLY A 318 ? CYS A 326 ? GLY A 318 CYS A 326 
B 5 SER A 306 ? CYS A 313 ? SER A 306 CYS A 313 
B 6 HIS A 279 ? ASP A 281 ? HIS A 279 ASP A 281 
C 1 VAL B 34  ? SER B 37  ? VAL B 34  SER B 37  
C 2 ALA B 205 ? GLY B 208 ? ALA B 205 GLY B 208 
D 1 ALA B 44  ? ILE B 51  ? ALA B 44  ILE B 51  
D 2 MET B 105 ? LEU B 112 ? MET B 105 LEU B 112 
E 1 GLU B 243 ? GLN B 247 ? GLU B 243 GLN B 247 
E 2 SER B 423 ? GLY B 428 ? SER B 423 GLY B 428 
E 3 LEU B 252 ? GLU B 260 ? LEU B 252 GLU B 260 
E 4 GLY B 320 ? GLN B 329 ? GLY B 320 GLN B 329 
E 5 ASP B 308 ? SER B 315 ? ASP B 308 SER B 315 
F 1 PRO C 22  ? PRO C 24  ? PRO C 22  PRO C 24  
F 2 LYS C 217 ? PRO C 219 ? LYS C 217 PRO C 219 
G 1 PHE E 89  ? TRP E 91  ? PHE E 89  TRP E 91  
G 2 LYS E 94  ? HIS E 100 ? LYS E 94  HIS E 100 
G 3 TRP E 132 ? ILE E 136 ? TRP E 132 ILE E 136 
H 1 TYR E 156 ? CYS E 158 ? TYR E 156 CYS E 158 
H 2 SER E 163 ? TYR E 165 ? SER E 163 TYR E 165 
I 1 TYR E 185 ? PHE E 187 ? TYR E 185 PHE E 187 
I 2 VAL E 193 ? VAL E 195 ? VAL E 193 VAL E 195 
J 1 SER I 67  ? SER I 69  ? SER I 67  SER I 69  
J 2 ALA I 74  ? VAL I 76  ? ALA I 74  VAL I 76  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O ARG A 24  ? O ARG A 24  N LEU A 197 ? N LEU A 197 
A 2 3 O ALA A 198 ? O ALA A 198 N GLY A 38  ? N GLY A 38  
A 3 4 O CYS A 35  ? O CYS A 35  N ALA A 101 ? N ALA A 101 
A 4 5 O ALA A 96  ? O ALA A 96  N TYR A 89  ? N TYR A 89  
B 1 2 O ILE A 241 ? O ILE A 241 N VAL A 422 ? N VAL A 422 
B 2 3 O ALA A 421 ? O ALA A 421 N ALA A 256 ? N ALA A 256 
B 3 4 O ALA A 251 ? O ALA A 251 N CYS A 326 ? N CYS A 326 
B 4 5 O LEU A 319 ? O LEU A 319 N ILE A 312 ? N ILE A 312 
B 5 6 O PHE A 307 ? O PHE A 307 N TYR A 280 ? N TYR A 280 
C 1 2 O VAL B 34  ? O VAL B 34  N LEU B 206 ? N LEU B 206 
D 1 2 O SER B 45  ? O SER B 45  N CYS B 111 ? N CYS B 111 
E 1 2 O ILE B 244 ? O ILE B 244 N MET B 424 ? N MET B 424 
E 2 3 O SER B 423 ? O SER B 423 N VAL B 258 ? N VAL B 258 
E 3 4 O VAL B 253 ? O VAL B 253 N SER B 328 ? N SER B 328 
E 4 5 O LEU B 321 ? O LEU B 321 N ALA B 314 ? N ALA B 314 
F 1 2 O ALA C 23  ? O ALA C 23  N ILE C 218 ? N ILE C 218 
G 1 2 O PHE E 89  ? O PHE E 89  N LEU E 96  ? N LEU E 96  
G 2 3 O PHE E 97  ? O PHE E 97  N LEU E 135 ? N LEU E 135 
H 1 2 O TYR E 156 ? O TYR E 156 N TYR E 165 ? N TYR E 165 
I 1 2 O GLU E 186 ? O GLU E 186 N ILE E 194 ? N ILE E 194 
J 1 2 O VAL I 68  ? O VAL I 68  N SER I 75  ? N SER I 75  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 17 'BINDING SITE FOR RESIDUE HEM C 380' 
AC2 Software ? ? ? ? 17 'BINDING SITE FOR RESIDUE HEM C 381' 
AC3 Software ? ? ? ? 19 'BINDING SITE FOR RESIDUE HEC D 242' 
AC4 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE FES E 197' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 17 LEU C 41  ? LEU C 41  . ? 1_555  ? 
2  AC1 17 ILE C 45  ? ILE C 45  . ? 1_555  ? 
3  AC1 17 GLY C 48  ? GLY C 48  . ? 1_555  ? 
4  AC1 17 LEU C 49  ? LEU C 49  . ? 1_555  ? 
5  AC1 17 LEU C 51  ? LEU C 51  . ? 1_555  ? 
6  AC1 17 ALA C 52  ? ALA C 52  . ? 1_555  ? 
7  AC1 17 ARG C 80  ? ARG C 80  . ? 1_555  ? 
8  AC1 17 HIS C 83  ? HIS C 83  . ? 1_555  ? 
9  AC1 17 ALA C 87  ? ALA C 87  . ? 1_555  ? 
10 AC1 17 GLY C 130 ? GLY C 130 . ? 1_555  ? 
11 AC1 17 TYR C 131 ? TYR C 131 . ? 1_555  ? 
12 AC1 17 LEU C 133 ? LEU C 133 . ? 1_555  ? 
13 AC1 17 PRO C 134 ? PRO C 134 . ? 1_555  ? 
14 AC1 17 HIS C 182 ? HIS C 182 . ? 1_555  ? 
15 AC1 17 PHE C 183 ? PHE C 183 . ? 1_555  ? 
16 AC1 17 PRO C 186 ? PRO C 186 . ? 1_555  ? 
17 AC1 17 TYR C 273 ? TYR C 273 . ? 1_555  ? 
18 AC2 17 TRP C 31  ? TRP C 31  . ? 1_555  ? 
19 AC2 17 GLY C 34  ? GLY C 34  . ? 1_555  ? 
20 AC2 17 LEU C 37  ? LEU C 37  . ? 1_555  ? 
21 AC2 17 LEU C 94  ? LEU C 94  . ? 1_555  ? 
22 AC2 17 HIS C 97  ? HIS C 97  . ? 1_555  ? 
23 AC2 17 ARG C 100 ? ARG C 100 . ? 1_555  ? 
24 AC2 17 SER C 106 ? SER C 106 . ? 1_555  ? 
25 AC2 17 PHE C 109 ? PHE C 109 . ? 1_555  ? 
26 AC2 17 TRP C 113 ? TRP C 113 . ? 1_555  ? 
27 AC2 17 GLY C 116 ? GLY C 116 . ? 1_555  ? 
28 AC2 17 VAL C 117 ? VAL C 117 . ? 1_555  ? 
29 AC2 17 LEU C 119 ? LEU C 119 . ? 1_555  ? 
30 AC2 17 LEU C 120 ? LEU C 120 . ? 1_555  ? 
31 AC2 17 HIS C 196 ? HIS C 196 . ? 1_555  ? 
32 AC2 17 LEU C 200 ? LEU C 200 . ? 1_555  ? 
33 AC2 17 SER C 205 ? SER C 205 . ? 1_555  ? 
34 AC2 17 ASN C 206 ? ASN C 206 . ? 1_555  ? 
35 AC3 19 VAL D 36  ? VAL D 36  . ? 1_555  ? 
36 AC3 19 CYS D 37  ? CYS D 37  . ? 1_555  ? 
37 AC3 19 SER D 39  ? SER D 39  . ? 1_555  ? 
38 AC3 19 CYS D 40  ? CYS D 40  . ? 1_555  ? 
39 AC3 19 HIS D 41  ? HIS D 41  . ? 1_555  ? 
40 AC3 19 ALA D 108 ? ALA D 108 . ? 1_555  ? 
41 AC3 19 LEU D 113 ? LEU D 113 . ? 1_555  ? 
42 AC3 19 ILE D 116 ? ILE D 116 . ? 1_555  ? 
43 AC3 19 ARG D 120 ? ARG D 120 . ? 1_555  ? 
44 AC3 19 TYR D 126 ? TYR D 126 . ? 1_555  ? 
45 AC3 19 VAL D 127 ? VAL D 127 . ? 1_555  ? 
46 AC3 19 LEU D 130 ? LEU D 130 . ? 1_555  ? 
47 AC3 19 PHE D 153 ? PHE D 153 . ? 1_555  ? 
48 AC3 19 ILE D 158 ? ILE D 158 . ? 1_555  ? 
49 AC3 19 GLY D 159 ? GLY D 159 . ? 1_555  ? 
50 AC3 19 MET D 160 ? MET D 160 . ? 1_555  ? 
51 AC3 19 ILE D 164 ? ILE D 164 . ? 1_555  ? 
52 AC3 19 LEU D 190 ? LEU D 190 . ? 1_555  ? 
53 AC3 19 HIS E 161 ? HIS E 161 . ? 10_665 ? 
54 AC4 9  CYS E 139 ? CYS E 139 . ? 1_555  ? 
55 AC4 9  HIS E 141 ? HIS E 141 . ? 1_555  ? 
56 AC4 9  LEU E 142 ? LEU E 142 . ? 1_555  ? 
57 AC4 9  GLY E 143 ? GLY E 143 . ? 1_555  ? 
58 AC4 9  CYS E 144 ? CYS E 144 . ? 1_555  ? 
59 AC4 9  CYS E 158 ? CYS E 158 . ? 1_555  ? 
60 AC4 9  CYS E 160 ? CYS E 160 . ? 1_555  ? 
61 AC4 9  HIS E 161 ? HIS E 161 . ? 1_555  ? 
62 AC4 9  SER E 163 ? SER E 163 . ? 1_555  ? 
# 
_database_PDB_matrix.entry_id          1BE3 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1BE3 
_atom_sites.fract_transf_matrix[1][1]   0.004735 
_atom_sites.fract_transf_matrix[1][2]   0.002734 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.005467 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.002947 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
FE 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N   . THR A 1  1   ? -5.814  141.666 -25.256 1.00 55.17  ? 1   THR A N   1 
ATOM   2     C  CA  . THR A 1  1   ? -4.612  141.041 -24.634 1.00 55.57  ? 1   THR A CA  1 
ATOM   3     C  C   . THR A 1  1   ? -3.536  142.078 -24.299 1.00 54.83  ? 1   THR A C   1 
ATOM   4     O  O   . THR A 1  1   ? -3.440  143.114 -24.955 1.00 58.33  ? 1   THR A O   1 
ATOM   5     C  CB  . THR A 1  1   ? -3.932  139.982 -25.531 1.00 51.31  ? 1   THR A CB  1 
ATOM   6     O  OG1 . THR A 1  1   ? -2.914  139.311 -24.758 1.00 47.85  ? 1   THR A OG1 1 
ATOM   7     C  CG2 . THR A 1  1   ? -3.217  140.680 -26.685 1.00 44.76  ? 1   THR A CG2 1 
ATOM   8     N  N   . ALA A 1  2   ? -2.659  141.717 -23.383 1.00 53.72  ? 2   ALA A N   1 
ATOM   9     C  CA  . ALA A 1  2   ? -1.536  142.525 -22.939 1.00 54.30  ? 2   ALA A CA  1 
ATOM   10    C  C   . ALA A 1  2   ? -0.731  141.745 -21.899 1.00 54.09  ? 2   ALA A C   1 
ATOM   11    O  O   . ALA A 1  2   ? -1.275  141.099 -20.996 1.00 57.13  ? 2   ALA A O   1 
ATOM   12    C  CB  . ALA A 1  2   ? -1.952  143.868 -22.359 1.00 60.61  ? 2   ALA A CB  1 
ATOM   13    N  N   . THR A 1  3   ? 0.585   141.855 -22.013 1.00 50.99  ? 3   THR A N   1 
ATOM   14    C  CA  . THR A 1  3   ? 1.513   141.070 -21.210 1.00 43.69  ? 3   THR A CA  1 
ATOM   15    C  C   . THR A 1  3   ? 2.442   141.823 -20.288 1.00 37.92  ? 3   THR A C   1 
ATOM   16    O  O   . THR A 1  3   ? 2.905   142.916 -20.609 1.00 37.21  ? 3   THR A O   1 
ATOM   17    C  CB  . THR A 1  3   ? 2.392   140.292 -22.227 1.00 46.57  ? 3   THR A CB  1 
ATOM   18    O  OG1 . THR A 1  3   ? 1.554   139.461 -23.033 1.00 55.85  ? 3   THR A OG1 1 
ATOM   19    C  CG2 . THR A 1  3   ? 3.472   139.567 -21.471 1.00 49.24  ? 3   THR A CG2 1 
ATOM   20    N  N   . TYR A 1  4   ? 2.850   141.212 -19.175 1.00 34.12  ? 4   TYR A N   1 
ATOM   21    C  CA  . TYR A 1  4   ? 3.464   141.911 -18.059 1.00 30.70  ? 4   TYR A CA  1 
ATOM   22    C  C   . TYR A 1  4   ? 4.381   143.047 -18.491 1.00 32.24  ? 4   TYR A C   1 
ATOM   23    O  O   . TYR A 1  4   ? 4.172   144.225 -18.195 1.00 33.17  ? 4   TYR A O   1 
ATOM   24    C  CB  . TYR A 1  4   ? 4.176   140.976 -17.093 1.00 22.38  ? 4   TYR A CB  1 
ATOM   25    C  CG  . TYR A 1  4   ? 4.932   141.671 -15.983 1.00 15.88  ? 4   TYR A CG  1 
ATOM   26    C  CD1 . TYR A 1  4   ? 4.350   142.671 -15.212 1.00 13.62  ? 4   TYR A CD1 1 
ATOM   27    C  CD2 . TYR A 1  4   ? 6.246   141.320 -15.700 1.00 11.63  ? 4   TYR A CD2 1 
ATOM   28    C  CE1 . TYR A 1  4   ? 5.063   143.291 -14.201 1.00 12.79  ? 4   TYR A CE1 1 
ATOM   29    C  CE2 . TYR A 1  4   ? 6.963   141.940 -14.697 1.00 9.43   ? 4   TYR A CE2 1 
ATOM   30    C  CZ  . TYR A 1  4   ? 6.367   142.929 -13.948 1.00 11.05  ? 4   TYR A CZ  1 
ATOM   31    O  OH  . TYR A 1  4   ? 7.120   143.525 -12.962 1.00 9.47   ? 4   TYR A OH  1 
ATOM   32    N  N   . ALA A 1  5   ? 5.412   142.667 -19.234 1.00 33.54  ? 5   ALA A N   1 
ATOM   33    C  CA  . ALA A 1  5   ? 6.367   143.605 -19.806 1.00 34.23  ? 5   ALA A CA  1 
ATOM   34    C  C   . ALA A 1  5   ? 5.625   144.861 -20.280 1.00 35.14  ? 5   ALA A C   1 
ATOM   35    O  O   . ALA A 1  5   ? 5.837   145.952 -19.782 1.00 33.32  ? 5   ALA A O   1 
ATOM   36    C  CB  . ALA A 1  5   ? 6.977   142.965 -21.060 1.00 34.91  ? 5   ALA A CB  1 
ATOM   37    N  N   . GLN A 1  6   ? 4.815   144.578 -21.309 1.00 35.57  ? 6   GLN A N   1 
ATOM   38    C  CA  . GLN A 1  6   ? 4.060   145.653 -21.940 1.00 38.56  ? 6   GLN A CA  1 
ATOM   39    C  C   . GLN A 1  6   ? 3.559   146.582 -20.847 1.00 36.69  ? 6   GLN A C   1 
ATOM   40    O  O   . GLN A 1  6   ? 4.237   147.560 -20.497 1.00 39.48  ? 6   GLN A O   1 
ATOM   41    C  CB  . GLN A 1  6   ? 2.967   145.162 -22.869 1.00 49.00  ? 6   GLN A CB  1 
ATOM   42    C  CG  . GLN A 1  6   ? 3.391   144.186 -23.945 1.00 62.93  ? 6   GLN A CG  1 
ATOM   43    C  CD  . GLN A 1  6   ? 4.491   144.696 -24.848 1.00 72.72  ? 6   GLN A CD  1 
ATOM   44    O  OE1 . GLN A 1  6   ? 4.802   145.887 -24.885 1.00 80.23  ? 6   GLN A OE1 1 
ATOM   45    N  NE2 . GLN A 1  6   ? 5.112   143.797 -25.607 1.00 75.82  ? 6   GLN A NE2 1 
ATOM   46    N  N   . ALA A 1  7   ? 2.555   146.138 -20.102 1.00 32.86  ? 7   ALA A N   1 
ATOM   47    C  CA  . ALA A 1  7   ? 2.094   146.886 -18.940 1.00 29.59  ? 7   ALA A CA  1 
ATOM   48    C  C   . ALA A 1  7   ? 3.160   147.816 -18.364 1.00 29.16  ? 7   ALA A C   1 
ATOM   49    O  O   . ALA A 1  7   ? 2.997   149.025 -18.206 1.00 24.29  ? 7   ALA A O   1 
ATOM   50    C  CB  . ALA A 1  7   ? 1.772   145.824 -17.883 1.00 37.12  ? 7   ALA A CB  1 
ATOM   51    N  N   . LEU A 1  8   ? 4.271   147.200 -17.958 1.00 26.91  ? 8   LEU A N   1 
ATOM   52    C  CA  . LEU A 1  8   ? 5.330   147.933 -17.302 1.00 28.67  ? 8   LEU A CA  1 
ATOM   53    C  C   . LEU A 1  8   ? 5.701   149.215 -18.015 1.00 30.89  ? 8   LEU A C   1 
ATOM   54    O  O   . LEU A 1  8   ? 5.921   150.259 -17.385 1.00 31.98  ? 8   LEU A O   1 
ATOM   55    C  CB  . LEU A 1  8   ? 6.542   147.019 -17.135 1.00 29.71  ? 8   LEU A CB  1 
ATOM   56    C  CG  . LEU A 1  8   ? 6.461   146.042 -15.961 1.00 21.14  ? 8   LEU A CG  1 
ATOM   57    C  CD1 . LEU A 1  8   ? 7.760   145.268 -15.812 1.00 27.82  ? 8   LEU A CD1 1 
ATOM   58    C  CD2 . LEU A 1  8   ? 6.169   146.832 -14.703 1.00 19.94  ? 8   LEU A CD2 1 
ATOM   59    N  N   . GLN A 1  9   ? 5.871   149.118 -19.335 1.00 32.56  ? 9   GLN A N   1 
ATOM   60    C  CA  . GLN A 1  9   ? 6.452   150.215 -20.102 1.00 32.23  ? 9   GLN A CA  1 
ATOM   61    C  C   . GLN A 1  9   ? 5.436   151.335 -20.295 1.00 28.29  ? 9   GLN A C   1 
ATOM   62    O  O   . GLN A 1  9   ? 5.791   152.511 -20.350 1.00 22.80  ? 9   GLN A O   1 
ATOM   63    C  CB  . GLN A 1  9   ? 7.055   149.765 -21.423 1.00 37.90  ? 9   GLN A CB  1 
ATOM   64    C  CG  . GLN A 1  9   ? 7.907   150.838 -22.094 1.00 44.57  ? 9   GLN A CG  1 
ATOM   65    C  CD  . GLN A 1  9   ? 9.181   151.148 -21.342 1.00 46.11  ? 9   GLN A CD  1 
ATOM   66    O  OE1 . GLN A 1  9   ? 9.549   150.459 -20.394 1.00 51.71  ? 9   GLN A OE1 1 
ATOM   67    N  NE2 . GLN A 1  9   ? 9.893   152.187 -21.751 1.00 45.75  ? 9   GLN A NE2 1 
ATOM   68    N  N   . SER A 1  10  ? 4.190   150.903 -20.228 1.00 25.23  ? 10  SER A N   1 
ATOM   69    C  CA  . SER A 1  10  ? 3.011   151.711 -20.370 1.00 29.79  ? 10  SER A CA  1 
ATOM   70    C  C   . SER A 1  10  ? 2.551   152.453 -19.129 1.00 31.23  ? 10  SER A C   1 
ATOM   71    O  O   . SER A 1  10  ? 1.471   153.057 -19.096 1.00 32.28  ? 10  SER A O   1 
ATOM   72    C  CB  . SER A 1  10  ? 1.856   150.737 -20.745 1.00 31.74  ? 10  SER A CB  1 
ATOM   73    O  OG  . SER A 1  10  ? 1.213   150.404 -19.521 1.00 43.06  ? 10  SER A OG  1 
ATOM   74    N  N   . VAL A 1  11  ? 3.324   152.427 -18.055 1.00 33.75  ? 11  VAL A N   1 
ATOM   75    C  CA  . VAL A 1  11  ? 2.911   153.119 -16.840 1.00 28.91  ? 11  VAL A CA  1 
ATOM   76    C  C   . VAL A 1  11  ? 3.369   154.576 -16.886 1.00 28.52  ? 11  VAL A C   1 
ATOM   77    O  O   . VAL A 1  11  ? 4.468   154.907 -17.313 1.00 29.66  ? 11  VAL A O   1 
ATOM   78    C  CB  . VAL A 1  11  ? 3.481   152.421 -15.605 1.00 30.43  ? 11  VAL A CB  1 
ATOM   79    C  CG1 . VAL A 1  11  ? 2.929   152.998 -14.324 1.00 27.95  ? 11  VAL A CG1 1 
ATOM   80    C  CG2 . VAL A 1  11  ? 3.293   150.913 -15.670 1.00 23.60  ? 11  VAL A CG2 1 
ATOM   81    N  N   . PRO A 1  12  ? 2.451   155.405 -16.435 1.00 25.35  ? 12  PRO A N   1 
ATOM   82    C  CA  . PRO A 1  12  ? 2.511   156.839 -16.386 1.00 22.50  ? 12  PRO A CA  1 
ATOM   83    C  C   . PRO A 1  12  ? 3.772   157.336 -15.688 1.00 20.69  ? 12  PRO A C   1 
ATOM   84    O  O   . PRO A 1  12  ? 3.762   157.320 -14.456 1.00 21.16  ? 12  PRO A O   1 
ATOM   85    C  CB  . PRO A 1  12  ? 1.300   157.303 -15.544 1.00 20.59  ? 12  PRO A CB  1 
ATOM   86    C  CG  . PRO A 1  12  ? 0.395   156.115 -15.584 1.00 25.71  ? 12  PRO A CG  1 
ATOM   87    C  CD  . PRO A 1  12  ? 1.139   154.885 -16.006 1.00 25.70  ? 12  PRO A CD  1 
ATOM   88    N  N   . GLU A 1  13  ? 4.687   157.905 -16.464 1.00 20.42  ? 13  GLU A N   1 
ATOM   89    C  CA  . GLU A 1  13  ? 5.893   158.492 -15.921 1.00 21.06  ? 13  GLU A CA  1 
ATOM   90    C  C   . GLU A 1  13  ? 5.615   159.550 -14.860 1.00 16.62  ? 13  GLU A C   1 
ATOM   91    O  O   . GLU A 1  13  ? 4.569   160.139 -14.658 1.00 9.30   ? 13  GLU A O   1 
ATOM   92    C  CB  . GLU A 1  13  ? 6.988   158.925 -16.862 1.00 25.99  ? 13  GLU A CB  1 
ATOM   93    C  CG  . GLU A 1  13  ? 6.666   159.133 -18.327 1.00 36.41  ? 13  GLU A CG  1 
ATOM   94    C  CD  . GLU A 1  13  ? 7.788   159.840 -19.066 1.00 41.12  ? 13  GLU A CD  1 
ATOM   95    O  OE1 . GLU A 1  13  ? 8.184   160.936 -18.616 1.00 46.55  ? 13  GLU A OE1 1 
ATOM   96    O  OE2 . GLU A 1  13  ? 8.285   159.281 -20.060 1.00 47.73  ? 13  GLU A OE2 1 
ATOM   97    N  N   . THR A 1  14  ? 6.678   159.717 -14.088 1.00 19.05  ? 14  THR A N   1 
ATOM   98    C  CA  . THR A 1  14  ? 6.593   160.640 -12.965 1.00 25.07  ? 14  THR A CA  1 
ATOM   99    C  C   . THR A 1  14  ? 7.303   161.911 -13.367 1.00 27.74  ? 14  THR A C   1 
ATOM   100   O  O   . THR A 1  14  ? 8.386   161.860 -13.936 1.00 28.03  ? 14  THR A O   1 
ATOM   101   C  CB  . THR A 1  14  ? 7.258   159.979 -11.747 1.00 27.68  ? 14  THR A CB  1 
ATOM   102   O  OG1 . THR A 1  14  ? 6.468   158.805 -11.443 1.00 29.24  ? 14  THR A OG1 1 
ATOM   103   C  CG2 . THR A 1  14  ? 7.450   160.955 -10.613 1.00 17.08  ? 14  THR A CG2 1 
ATOM   104   N  N   . GLN A 1  15  ? 6.595   163.008 -13.129 1.00 31.62  ? 15  GLN A N   1 
ATOM   105   C  CA  . GLN A 1  15  ? 7.184   164.292 -13.481 1.00 38.02  ? 15  GLN A CA  1 
ATOM   106   C  C   . GLN A 1  15  ? 7.878   164.985 -12.338 1.00 37.92  ? 15  GLN A C   1 
ATOM   107   O  O   . GLN A 1  15  ? 7.324   165.387 -11.317 1.00 32.77  ? 15  GLN A O   1 
ATOM   108   C  CB  . GLN A 1  15  ? 6.126   165.144 -14.166 1.00 51.75  ? 15  GLN A CB  1 
ATOM   109   C  CG  . GLN A 1  15  ? 5.765   164.489 -15.511 1.00 69.33  ? 15  GLN A CG  1 
ATOM   110   C  CD  . GLN A 1  15  ? 4.822   165.404 -16.268 1.00 82.58  ? 15  GLN A CD  1 
ATOM   111   O  OE1 . GLN A 1  15  ? 4.670   166.566 -15.890 1.00 89.95  ? 15  GLN A OE1 1 
ATOM   112   N  NE2 . GLN A 1  15  ? 4.233   164.825 -17.305 1.00 89.03  ? 15  GLN A NE2 1 
ATOM   113   N  N   . VAL A 1  16  ? 9.213   165.078 -12.456 1.00 37.59  ? 16  VAL A N   1 
ATOM   114   C  CA  . VAL A 1  16  ? 9.911   165.808 -11.382 1.00 36.88  ? 16  VAL A CA  1 
ATOM   115   C  C   . VAL A 1  16  ? 10.086  167.242 -11.871 1.00 35.16  ? 16  VAL A C   1 
ATOM   116   O  O   . VAL A 1  16  ? 10.169  167.492 -13.079 1.00 35.33  ? 16  VAL A O   1 
ATOM   117   C  CB  . VAL A 1  16  ? 11.267  165.139 -11.109 1.00 34.30  ? 16  VAL A CB  1 
ATOM   118   C  CG1 . VAL A 1  16  ? 11.925  165.732 -9.889  1.00 18.12  ? 16  VAL A CG1 1 
ATOM   119   C  CG2 . VAL A 1  16  ? 11.059  163.637 -10.979 1.00 39.46  ? 16  VAL A CG2 1 
ATOM   120   N  N   . SER A 1  17  ? 9.845   168.197 -10.996 1.00 31.69  ? 17  SER A N   1 
ATOM   121   C  CA  . SER A 1  17  ? 10.137  169.585 -11.301 1.00 33.32  ? 17  SER A CA  1 
ATOM   122   C  C   . SER A 1  17  ? 10.558  170.366 -10.060 1.00 34.80  ? 17  SER A C   1 
ATOM   123   O  O   . SER A 1  17  ? 10.522  169.922 -8.909  1.00 37.09  ? 17  SER A O   1 
ATOM   124   C  CB  . SER A 1  17  ? 9.021   170.322 -12.011 1.00 32.49  ? 17  SER A CB  1 
ATOM   125   O  OG  . SER A 1  17  ? 8.689   169.762 -13.258 1.00 29.79  ? 17  SER A OG  1 
ATOM   126   N  N   . GLN A 1  18  ? 11.017  171.592 -10.317 1.00 32.04  ? 18  GLN A N   1 
ATOM   127   C  CA  . GLN A 1  18  ? 11.656  172.307 -9.233  1.00 33.29  ? 18  GLN A CA  1 
ATOM   128   C  C   . GLN A 1  18  ? 11.385  173.804 -9.245  1.00 35.10  ? 18  GLN A C   1 
ATOM   129   O  O   . GLN A 1  18  ? 11.588  174.466 -10.254 1.00 33.41  ? 18  GLN A O   1 
ATOM   130   C  CB  . GLN A 1  18  ? 13.175  172.127 -9.273  1.00 29.74  ? 18  GLN A CB  1 
ATOM   131   C  CG  . GLN A 1  18  ? 13.835  172.889 -8.113  1.00 27.92  ? 18  GLN A CG  1 
ATOM   132   C  CD  . GLN A 1  18  ? 15.306  172.497 -8.129  1.00 32.87  ? 18  GLN A CD  1 
ATOM   133   O  OE1 . GLN A 1  18  ? 15.673  171.812 -9.095  1.00 25.13  ? 18  GLN A OE1 1 
ATOM   134   N  NE2 . GLN A 1  18  ? 16.047  172.910 -7.120  1.00 43.51  ? 18  GLN A NE2 1 
ATOM   135   N  N   . LEU A 1  19  ? 11.035  174.271 -8.056  1.00 37.26  ? 19  LEU A N   1 
ATOM   136   C  CA  . LEU A 1  19  ? 10.893  175.674 -7.771  1.00 40.06  ? 19  LEU A CA  1 
ATOM   137   C  C   . LEU A 1  19  ? 12.260  176.323 -7.555  1.00 44.33  ? 19  LEU A C   1 
ATOM   138   O  O   . LEU A 1  19  ? 13.325  175.720 -7.463  1.00 45.10  ? 19  LEU A O   1 
ATOM   139   C  CB  . LEU A 1  19  ? 9.981   175.946 -6.583  1.00 28.08  ? 19  LEU A CB  1 
ATOM   140   C  CG  . LEU A 1  19  ? 8.537   175.472 -6.700  1.00 23.52  ? 19  LEU A CG  1 
ATOM   141   C  CD1 . LEU A 1  19  ? 7.633   176.281 -5.781  1.00 22.54  ? 19  LEU A CD1 1 
ATOM   142   C  CD2 . LEU A 1  19  ? 7.965   175.429 -8.106  1.00 11.88  ? 19  LEU A CD2 1 
ATOM   143   N  N   . ASP A 1  20  ? 12.193  177.650 -7.553  1.00 49.57  ? 20  ASP A N   1 
ATOM   144   C  CA  . ASP A 1  20  ? 13.407  178.454 -7.474  1.00 51.92  ? 20  ASP A CA  1 
ATOM   145   C  C   . ASP A 1  20  ? 14.235  178.065 -6.264  1.00 50.64  ? 20  ASP A C   1 
ATOM   146   O  O   . ASP A 1  20  ? 15.456  177.930 -6.318  1.00 50.32  ? 20  ASP A O   1 
ATOM   147   C  CB  . ASP A 1  20  ? 13.036  179.928 -7.469  1.00 56.50  ? 20  ASP A CB  1 
ATOM   148   C  CG  . ASP A 1  20  ? 12.427  180.458 -8.745  1.00 55.35  ? 20  ASP A CG  1 
ATOM   149   O  OD1 . ASP A 1  20  ? 12.561  179.811 -9.805  1.00 58.24  ? 20  ASP A OD1 1 
ATOM   150   O  OD2 . ASP A 1  20  ? 11.818  181.550 -8.661  1.00 51.39  ? 20  ASP A OD2 1 
ATOM   151   N  N   . ASN A 1  21  ? 13.563  177.827 -5.137  1.00 48.62  ? 21  ASN A N   1 
ATOM   152   C  CA  . ASN A 1  21  ? 14.323  177.484 -3.944  1.00 45.04  ? 21  ASN A CA  1 
ATOM   153   C  C   . ASN A 1  21  ? 14.808  176.048 -3.954  1.00 44.82  ? 21  ASN A C   1 
ATOM   154   O  O   . ASN A 1  21  ? 15.657  175.675 -3.145  1.00 47.85  ? 21  ASN A O   1 
ATOM   155   C  CB  . ASN A 1  21  ? 13.496  177.738 -2.712  1.00 36.53  ? 21  ASN A CB  1 
ATOM   156   C  CG  . ASN A 1  21  ? 12.041  177.370 -2.811  1.00 29.93  ? 21  ASN A CG  1 
ATOM   157   O  OD1 . ASN A 1  21  ? 11.726  176.637 -3.754  1.00 30.42  ? 21  ASN A OD1 1 
ATOM   158   N  ND2 . ASN A 1  21  ? 11.279  177.888 -1.861  1.00 25.81  ? 21  ASN A ND2 1 
ATOM   159   N  N   . GLY A 1  22  ? 14.243  175.240 -4.838  1.00 45.48  ? 22  GLY A N   1 
ATOM   160   C  CA  . GLY A 1  22  ? 14.611  173.820 -4.872  1.00 45.29  ? 22  GLY A CA  1 
ATOM   161   C  C   . GLY A 1  22  ? 13.427  172.959 -4.433  1.00 41.40  ? 22  GLY A C   1 
ATOM   162   O  O   . GLY A 1  22  ? 13.552  171.806 -4.032  1.00 45.88  ? 22  GLY A O   1 
ATOM   163   N  N   . LEU A 1  23  ? 12.240  173.557 -4.452  1.00 36.23  ? 23  LEU A N   1 
ATOM   164   C  CA  . LEU A 1  23  ? 11.048  172.807 -4.060  1.00 27.67  ? 23  LEU A CA  1 
ATOM   165   C  C   . LEU A 1  23  ? 10.825  171.732 -5.114  1.00 25.50  ? 23  LEU A C   1 
ATOM   166   O  O   . LEU A 1  23  ? 11.071  171.963 -6.297  1.00 24.40  ? 23  LEU A O   1 
ATOM   167   C  CB  . LEU A 1  23  ? 9.832   173.722 -3.941  1.00 22.43  ? 23  LEU A CB  1 
ATOM   168   C  CG  . LEU A 1  23  ? 8.616   173.103 -3.246  1.00 19.09  ? 23  LEU A CG  1 
ATOM   169   C  CD1 . LEU A 1  23  ? 8.824   173.077 -1.738  1.00 11.12  ? 23  LEU A CD1 1 
ATOM   170   C  CD2 . LEU A 1  23  ? 7.293   173.761 -3.573  1.00 20.46  ? 23  LEU A CD2 1 
ATOM   171   N  N   . ARG A 1  24  ? 10.745  170.495 -4.631  1.00 23.26  ? 24  ARG A N   1 
ATOM   172   C  CA  . ARG A 1  24  ? 10.682  169.445 -5.662  1.00 22.48  ? 24  ARG A CA  1 
ATOM   173   C  C   . ARG A 1  24  ? 9.226   169.053 -5.829  1.00 17.69  ? 24  ARG A C   1 
ATOM   174   O  O   . ARG A 1  24  ? 8.466   169.081 -4.868  1.00 13.45  ? 24  ARG A O   1 
ATOM   175   C  CB  . ARG A 1  24  ? 11.722  168.385 -5.421  1.00 27.74  ? 24  ARG A CB  1 
ATOM   176   C  CG  . ARG A 1  24  ? 12.733  168.838 -4.356  1.00 28.95  ? 24  ARG A CG  1 
ATOM   177   C  CD  . ARG A 1  24  ? 14.146  168.503 -4.750  1.00 24.33  ? 24  ARG A CD  1 
ATOM   178   N  NE  . ARG A 1  24  ? 15.014  168.169 -3.618  1.00 16.05  ? 24  ARG A NE  1 
ATOM   179   C  CZ  . ARG A 1  24  ? 15.625  166.990 -3.525  1.00 9.21   ? 24  ARG A CZ  1 
ATOM   180   N  NH1 . ARG A 1  24  ? 15.445  166.078 -4.465  1.00 7.19   ? 24  ARG A NH1 1 
ATOM   181   N  NH2 . ARG A 1  24  ? 16.415  166.722 -2.500  1.00 10.44  ? 24  ARG A NH2 1 
ATOM   182   N  N   . VAL A 1  25  ? 8.886   168.970 -7.110  1.00 2.31   ? 25  VAL A N   1 
ATOM   183   C  CA  . VAL A 1  25  ? 7.512   168.717 -7.501  1.00 14.67  ? 25  VAL A CA  1 
ATOM   184   C  C   . VAL A 1  25  ? 7.464   167.452 -8.332  1.00 19.38  ? 25  VAL A C   1 
ATOM   185   O  O   . VAL A 1  25  ? 8.170   167.304 -9.338  1.00 22.78  ? 25  VAL A O   1 
ATOM   186   C  CB  . VAL A 1  25  ? 6.873   169.941 -8.153  1.00 14.42  ? 25  VAL A CB  1 
ATOM   187   C  CG1 . VAL A 1  25  ? 5.799   169.605 -9.162  1.00 13.17  ? 25  VAL A CG1 1 
ATOM   188   C  CG2 . VAL A 1  25  ? 6.323   170.878 -7.061  1.00 14.17  ? 25  VAL A CG2 1 
ATOM   189   N  N   . ALA A 1  26  ? 6.799   166.429 -7.773  1.00 19.44  ? 26  ALA A N   1 
ATOM   190   C  CA  . ALA A 1  26  ? 6.580   165.217 -8.563  1.00 15.28  ? 26  ALA A CA  1 
ATOM   191   C  C   . ALA A 1  26  ? 5.094   164.881 -8.542  1.00 15.37  ? 26  ALA A C   1 
ATOM   192   O  O   . ALA A 1  26  ? 4.315   165.449 -7.775  1.00 14.38  ? 26  ALA A O   1 
ATOM   193   C  CB  . ALA A 1  26  ? 7.441   164.080 -8.120  1.00 23.99  ? 26  ALA A CB  1 
ATOM   194   N  N   . SER A 1  27  ? 4.743   163.985 -9.449  1.00 13.96  ? 27  SER A N   1 
ATOM   195   C  CA  . SER A 1  27  ? 3.314   163.652 -9.501  1.00 17.46  ? 27  SER A CA  1 
ATOM   196   C  C   . SER A 1  27  ? 3.160   162.574 -10.561 1.00 21.70  ? 27  SER A C   1 
ATOM   197   O  O   . SER A 1  27  ? 4.024   162.518 -11.449 1.00 20.41  ? 27  SER A O   1 
ATOM   198   C  CB  . SER A 1  27  ? 2.508   164.909 -9.804  1.00 18.84  ? 27  SER A CB  1 
ATOM   199   O  OG  . SER A 1  27  ? 2.808   165.396 -11.097 1.00 21.29  ? 27  SER A OG  1 
ATOM   200   N  N   . GLU A 1  28  ? 2.333   161.597 -10.231 1.00 23.51  ? 28  GLU A N   1 
ATOM   201   C  CA  . GLU A 1  28  ? 1.894   160.647 -11.263 1.00 30.07  ? 28  GLU A CA  1 
ATOM   202   C  C   . GLU A 1  28  ? 0.396   160.886 -11.469 1.00 35.54  ? 28  GLU A C   1 
ATOM   203   O  O   . GLU A 1  28  ? -0.315  161.148 -10.487 1.00 37.26  ? 28  GLU A O   1 
ATOM   204   C  CB  . GLU A 1  28  ? 2.345   159.261 -10.939 1.00 24.40  ? 28  GLU A CB  1 
ATOM   205   C  CG  . GLU A 1  28  ? 1.757   158.102 -11.708 1.00 29.21  ? 28  GLU A CG  1 
ATOM   206   C  CD  . GLU A 1  28  ? 1.980   156.778 -11.013 1.00 31.25  ? 28  GLU A CD  1 
ATOM   207   O  OE1 . GLU A 1  28  ? 2.263   156.801 -9.795  1.00 36.52  ? 28  GLU A OE1 1 
ATOM   208   O  OE2 . GLU A 1  28  ? 1.882   155.692 -11.606 1.00 30.19  ? 28  GLU A OE2 1 
ATOM   209   N  N   . GLN A 1  29  ? -0.015  160.929 -12.723 1.00 38.70  ? 29  GLN A N   1 
ATOM   210   C  CA  . GLN A 1  29  ? -1.376  161.210 -13.142 1.00 43.06  ? 29  GLN A CA  1 
ATOM   211   C  C   . GLN A 1  29  ? -2.114  159.951 -13.587 1.00 43.49  ? 29  GLN A C   1 
ATOM   212   O  O   . GLN A 1  29  ? -1.612  159.097 -14.299 1.00 43.64  ? 29  GLN A O   1 
ATOM   213   C  CB  . GLN A 1  29  ? -1.351  162.154 -14.352 1.00 52.49  ? 29  GLN A CB  1 
ATOM   214   C  CG  . GLN A 1  29  ? -2.611  162.964 -14.572 1.00 56.82  ? 29  GLN A CG  1 
ATOM   215   C  CD  . GLN A 1  29  ? -2.405  163.981 -15.687 1.00 59.59  ? 29  GLN A CD  1 
ATOM   216   O  OE1 . GLN A 1  29  ? -1.273  164.227 -16.103 1.00 59.63  ? 29  GLN A OE1 1 
ATOM   217   N  NE2 . GLN A 1  29  ? -3.522  164.538 -16.133 1.00 62.99  ? 29  GLN A NE2 1 
ATOM   218   N  N   . SER A 1  30  ? -3.397  159.953 -13.253 1.00 45.92  ? 30  SER A N   1 
ATOM   219   C  CA  . SER A 1  30  ? -4.300  158.878 -13.638 1.00 50.39  ? 30  SER A CA  1 
ATOM   220   C  C   . SER A 1  30  ? -5.704  159.407 -13.904 1.00 56.00  ? 30  SER A C   1 
ATOM   221   O  O   . SER A 1  30  ? -6.592  158.679 -14.365 1.00 56.31  ? 30  SER A O   1 
ATOM   222   C  CB  . SER A 1  30  ? -4.295  157.796 -12.573 1.00 43.85  ? 30  SER A CB  1 
ATOM   223   O  OG  . SER A 1  30  ? -5.585  157.400 -12.176 1.00 38.11  ? 30  SER A OG  1 
ATOM   224   N  N   . SER A 1  31  ? -5.928  160.690 -13.622 1.00 59.18  ? 31  SER A N   1 
ATOM   225   C  CA  . SER A 1  31  ? -7.234  161.295 -13.854 1.00 65.43  ? 31  SER A CA  1 
ATOM   226   C  C   . SER A 1  31  ? -8.328  160.641 -13.018 1.00 65.07  ? 31  SER A C   1 
ATOM   227   O  O   . SER A 1  31  ? -9.504  160.646 -13.409 1.00 67.70  ? 31  SER A O   1 
ATOM   228   C  CB  . SER A 1  31  ? -7.617  161.262 -15.337 1.00 74.46  ? 31  SER A CB  1 
ATOM   229   O  OG  . SER A 1  31  ? -8.602  162.239 -15.656 1.00 76.30  ? 31  SER A OG  1 
ATOM   230   N  N   . GLN A 1  32  ? -8.008  160.143 -11.827 1.00 63.14  ? 32  GLN A N   1 
ATOM   231   C  CA  . GLN A 1  32  ? -8.993  159.502 -10.963 1.00 56.53  ? 32  GLN A CA  1 
ATOM   232   C  C   . GLN A 1  32  ? -9.316  160.317 -9.723  1.00 51.32  ? 32  GLN A C   1 
ATOM   233   O  O   . GLN A 1  32  ? -8.607  161.255 -9.333  1.00 49.91  ? 32  GLN A O   1 
ATOM   234   C  CB  . GLN A 1  32  ? -8.601  158.073 -10.608 1.00 60.90  ? 32  GLN A CB  1 
ATOM   235   C  CG  . GLN A 1  32  ? -8.397  157.179 -11.820 1.00 69.97  ? 32  GLN A CG  1 
ATOM   236   C  CD  . GLN A 1  32  ? -9.646  157.015 -12.660 1.00 72.07  ? 32  GLN A CD  1 
ATOM   237   O  OE1 . GLN A 1  32  ? -10.687 157.603 -12.374 1.00 73.04  ? 32  GLN A OE1 1 
ATOM   238   N  NE2 . GLN A 1  32  ? -9.535  156.201 -13.703 1.00 73.88  ? 32  GLN A NE2 1 
ATOM   239   N  N   . PRO A 1  33  ? -10.417 159.969 -9.062  1.00 45.43  ? 33  PRO A N   1 
ATOM   240   C  CA  . PRO A 1  33  ? -11.092 160.790 -8.098  1.00 40.96  ? 33  PRO A CA  1 
ATOM   241   C  C   . PRO A 1  33  ? -10.393 161.260 -6.858  1.00 38.45  ? 33  PRO A C   1 
ATOM   242   O  O   . PRO A 1  33  ? -10.623 162.432 -6.488  1.00 35.08  ? 33  PRO A O   1 
ATOM   243   C  CB  . PRO A 1  33  ? -12.456 160.160 -7.759  1.00 39.71  ? 33  PRO A CB  1 
ATOM   244   C  CG  . PRO A 1  33  ? -12.525 158.991 -8.688  1.00 40.18  ? 33  PRO A CG  1 
ATOM   245   C  CD  . PRO A 1  33  ? -11.332 158.943 -9.599  1.00 43.37  ? 33  PRO A CD  1 
ATOM   246   N  N   . THR A 1  34  ? -9.704  160.420 -6.103  1.00 37.36  ? 34  THR A N   1 
ATOM   247   C  CA  . THR A 1  34  ? -9.157  160.915 -4.814  1.00 30.63  ? 34  THR A CA  1 
ATOM   248   C  C   . THR A 1  34  ? -7.687  161.187 -5.100  1.00 27.02  ? 34  THR A C   1 
ATOM   249   O  O   . THR A 1  34  ? -7.242  160.666 -6.126  1.00 27.84  ? 34  THR A O   1 
ATOM   250   C  CB  . THR A 1  34  ? -9.309  159.799 -3.772  1.00 26.28  ? 34  THR A CB  1 
ATOM   251   O  OG1 . THR A 1  34  ? -10.096 158.760 -4.384  1.00 13.66  ? 34  THR A OG1 1 
ATOM   252   C  CG2 . THR A 1  34  ? -10.033 160.291 -2.537  1.00 32.30  ? 34  THR A CG2 1 
ATOM   253   N  N   . CYS A 1  35  ? -7.090  162.096 -4.370  1.00 24.04  ? 35  CYS A N   1 
ATOM   254   C  CA  . CYS A 1  35  ? -5.666  162.381 -4.537  1.00 22.28  ? 35  CYS A CA  1 
ATOM   255   C  C   . CYS A 1  35  ? -5.033  162.242 -3.148  1.00 23.60  ? 35  CYS A C   1 
ATOM   256   O  O   . CYS A 1  35  ? -5.710  162.117 -2.117  1.00 23.28  ? 35  CYS A O   1 
ATOM   257   C  CB  . CYS A 1  35  ? -5.414  163.767 -5.125  1.00 14.51  ? 35  CYS A CB  1 
ATOM   258   S  SG  . CYS A 1  35  ? -5.469  165.087 -3.889  1.00 24.50  ? 35  CYS A SG  1 
ATOM   259   N  N   . THR A 1  36  ? -3.710  162.170 -3.136  1.00 21.72  ? 36  THR A N   1 
ATOM   260   C  CA  . THR A 1  36  ? -2.943  162.101 -1.898  1.00 19.62  ? 36  THR A CA  1 
ATOM   261   C  C   . THR A 1  36  ? -1.734  163.019 -2.060  1.00 19.75  ? 36  THR A C   1 
ATOM   262   O  O   . THR A 1  36  ? -0.686  162.643 -2.575  1.00 18.99  ? 36  THR A O   1 
ATOM   263   C  CB  . THR A 1  36  ? -2.400  160.697 -1.592  1.00 19.38  ? 36  THR A CB  1 
ATOM   264   O  OG1 . THR A 1  36  ? -3.466  159.769 -1.364  1.00 28.38  ? 36  THR A OG1 1 
ATOM   265   C  CG2 . THR A 1  36  ? -1.420  160.661 -0.451  1.00 8.36   ? 36  THR A CG2 1 
ATOM   266   N  N   . VAL A 1  37  ? -1.948  164.288 -1.734  1.00 23.59  ? 37  VAL A N   1 
ATOM   267   C  CA  . VAL A 1  37  ? -0.810  165.201 -1.877  1.00 27.21  ? 37  VAL A CA  1 
ATOM   268   C  C   . VAL A 1  37  ? 0.078   165.105 -0.648  1.00 27.68  ? 37  VAL A C   1 
ATOM   269   O  O   . VAL A 1  37  ? -0.351  165.041 0.501   1.00 31.06  ? 37  VAL A O   1 
ATOM   270   C  CB  . VAL A 1  37  ? -1.196  166.668 -2.095  1.00 26.18  ? 37  VAL A CB  1 
ATOM   271   C  CG1 . VAL A 1  37  ? -0.287  167.243 -3.172  1.00 20.83  ? 37  VAL A CG1 1 
ATOM   272   C  CG2 . VAL A 1  37  ? -2.681  166.793 -2.374  1.00 20.39  ? 37  VAL A CG2 1 
ATOM   273   N  N   . GLY A 1  38  ? 1.383   165.161 -0.897  1.00 26.25  ? 38  GLY A N   1 
ATOM   274   C  CA  . GLY A 1  38  ? 2.283   165.097 0.233   1.00 22.61  ? 38  GLY A CA  1 
ATOM   275   C  C   . GLY A 1  38  ? 3.572   165.884 0.079   1.00 20.95  ? 38  GLY A C   1 
ATOM   276   O  O   . GLY A 1  38  ? 4.338   165.866 -0.887  1.00 17.36  ? 38  GLY A O   1 
ATOM   277   N  N   . VAL A 1  39  ? 3.943   166.394 1.246   1.00 18.37  ? 39  VAL A N   1 
ATOM   278   C  CA  . VAL A 1  39  ? 5.248   167.019 1.452   1.00 17.60  ? 39  VAL A CA  1 
ATOM   279   C  C   . VAL A 1  39  ? 6.162   166.058 2.218   1.00 17.93  ? 39  VAL A C   1 
ATOM   280   O  O   . VAL A 1  39  ? 5.879   165.756 3.378   1.00 13.72  ? 39  VAL A O   1 
ATOM   281   C  CB  . VAL A 1  39  ? 5.001   168.291 2.282   1.00 3.15   ? 39  VAL A CB  1 
ATOM   282   C  CG1 . VAL A 1  39  ? 6.283   168.823 2.859   1.00 2.90   ? 39  VAL A CG1 1 
ATOM   283   C  CG2 . VAL A 1  39  ? 4.298   169.331 1.419   1.00 6.83   ? 39  VAL A CG2 1 
ATOM   284   N  N   . TRP A 1  40  ? 7.217   165.557 1.599   1.00 20.00  ? 40  TRP A N   1 
ATOM   285   C  CA  . TRP A 1  40  ? 8.187   164.629 2.142   1.00 23.07  ? 40  TRP A CA  1 
ATOM   286   C  C   . TRP A 1  40  ? 9.510   165.275 2.553   1.00 24.21  ? 40  TRP A C   1 
ATOM   287   O  O   . TRP A 1  40  ? 10.554  165.136 1.903   1.00 20.67  ? 40  TRP A O   1 
ATOM   288   C  CB  . TRP A 1  40  ? 8.508   163.557 1.092   1.00 31.47  ? 40  TRP A CB  1 
ATOM   289   C  CG  . TRP A 1  40  ? 7.794   162.256 1.208   1.00 41.11  ? 40  TRP A CG  1 
ATOM   290   C  CD1 . TRP A 1  40  ? 8.360   161.031 1.424   1.00 40.97  ? 40  TRP A CD1 1 
ATOM   291   C  CD2 . TRP A 1  40  ? 6.377   162.013 1.107   1.00 47.80  ? 40  TRP A CD2 1 
ATOM   292   N  NE1 . TRP A 1  40  ? 7.387   160.054 1.461   1.00 42.99  ? 40  TRP A NE1 1 
ATOM   293   C  CE2 . TRP A 1  40  ? 6.162   160.628 1.268   1.00 43.44  ? 40  TRP A CE2 1 
ATOM   294   C  CE3 . TRP A 1  40  ? 5.265   162.838 0.896   1.00 52.02  ? 40  TRP A CE3 1 
ATOM   295   C  CZ2 . TRP A 1  40  ? 4.894   160.064 1.234   1.00 43.75  ? 40  TRP A CZ2 1 
ATOM   296   C  CZ3 . TRP A 1  40  ? 4.004   162.270 0.857   1.00 51.67  ? 40  TRP A CZ3 1 
ATOM   297   C  CH2 . TRP A 1  40  ? 3.831   160.892 1.025   1.00 48.80  ? 40  TRP A CH2 1 
ATOM   298   N  N   . ILE A 1  41  ? 9.561   165.885 3.724   1.00 28.01  ? 41  ILE A N   1 
ATOM   299   C  CA  . ILE A 1  41  ? 10.768  166.537 4.243   1.00 28.95  ? 41  ILE A CA  1 
ATOM   300   C  C   . ILE A 1  41  ? 11.833  165.558 4.665   1.00 31.83  ? 41  ILE A C   1 
ATOM   301   O  O   . ILE A 1  41  ? 11.549  164.563 5.345   1.00 38.84  ? 41  ILE A O   1 
ATOM   302   C  CB  . ILE A 1  41  ? 10.336  167.356 5.478   1.00 27.75  ? 41  ILE A CB  1 
ATOM   303   C  CG1 . ILE A 1  41  ? 9.233   168.328 5.041   1.00 39.77  ? 41  ILE A CG1 1 
ATOM   304   C  CG2 . ILE A 1  41  ? 11.530  168.042 6.103   1.00 22.54  ? 41  ILE A CG2 1 
ATOM   305   C  CD1 . ILE A 1  41  ? 7.844   167.772 5.289   1.00 47.60  ? 41  ILE A CD1 1 
ATOM   306   N  N   . ASP A 1  42  ? 13.115  165.762 4.343   1.00 29.75  ? 42  ASP A N   1 
ATOM   307   C  CA  . ASP A 1  42  ? 14.023  164.712 4.758   1.00 29.72  ? 42  ASP A CA  1 
ATOM   308   C  C   . ASP A 1  42  ? 15.001  164.942 5.858   1.00 30.97  ? 42  ASP A C   1 
ATOM   309   O  O   . ASP A 1  42  ? 16.053  164.279 5.975   1.00 36.83  ? 42  ASP A O   1 
ATOM   310   C  CB  . ASP A 1  42  ? 14.603  164.016 3.542   1.00 29.90  ? 42  ASP A CB  1 
ATOM   311   C  CG  . ASP A 1  42  ? 15.944  164.627 3.183   1.00 30.64  ? 42  ASP A CG  1 
ATOM   312   O  OD1 . ASP A 1  42  ? 15.952  165.673 2.523   1.00 39.69  ? 42  ASP A OD1 1 
ATOM   313   O  OD2 . ASP A 1  42  ? 16.968  164.055 3.593   1.00 31.85  ? 42  ASP A OD2 1 
ATOM   314   N  N   . ALA A 1  43  ? 14.709  165.833 6.799   1.00 27.66  ? 43  ALA A N   1 
ATOM   315   C  CA  . ALA A 1  43  ? 15.625  165.902 7.939   1.00 26.97  ? 43  ALA A CA  1 
ATOM   316   C  C   . ALA A 1  43  ? 14.901  165.131 9.056   1.00 27.11  ? 43  ALA A C   1 
ATOM   317   O  O   . ALA A 1  43  ? 13.882  165.535 9.604   1.00 27.97  ? 43  ALA A O   1 
ATOM   318   C  CB  . ALA A 1  43  ? 16.112  167.245 8.354   1.00 30.74  ? 43  ALA A CB  1 
ATOM   319   N  N   . GLY A 1  44  ? 15.400  163.940 9.359   1.00 23.03  ? 44  GLY A N   1 
ATOM   320   C  CA  . GLY A 1  44  ? 14.916  163.106 10.410  1.00 19.00  ? 44  GLY A CA  1 
ATOM   321   C  C   . GLY A 1  44  ? 15.670  163.175 11.743  1.00 16.31  ? 44  GLY A C   1 
ATOM   322   O  O   . GLY A 1  44  ? 15.723  164.192 12.430  1.00 11.28  ? 44  GLY A O   1 
ATOM   323   N  N   . SER A 1  45  ? 15.972  161.987 12.271  1.00 16.56  ? 45  SER A N   1 
ATOM   324   C  CA  . SER A 1  45  ? 16.308  161.715 13.658  1.00 16.17  ? 45  SER A CA  1 
ATOM   325   C  C   . SER A 1  45  ? 17.817  161.563 13.745  1.00 15.61  ? 45  SER A C   1 
ATOM   326   O  O   . SER A 1  45  ? 18.542  161.642 14.720  1.00 17.56  ? 45  SER A O   1 
ATOM   327   C  CB  . SER A 1  45  ? 15.799  160.334 14.117  1.00 16.31  ? 45  SER A CB  1 
ATOM   328   O  OG  . SER A 1  45  ? 16.626  159.887 15.189  1.00 17.27  ? 45  SER A OG  1 
ATOM   329   N  N   . ARG A 1  46  ? 18.289  161.340 12.524  1.00 15.32  ? 46  ARG A N   1 
ATOM   330   C  CA  . ARG A 1  46  ? 19.751  161.268 12.429  1.00 18.14  ? 46  ARG A CA  1 
ATOM   331   C  C   . ARG A 1  46  ? 20.435  162.608 12.294  1.00 22.76  ? 46  ARG A C   1 
ATOM   332   O  O   . ARG A 1  46  ? 21.647  162.612 12.081  1.00 27.60  ? 46  ARG A O   1 
ATOM   333   C  CB  . ARG A 1  46  ? 20.073  160.323 11.288  1.00 5.80   ? 46  ARG A CB  1 
ATOM   334   C  CG  . ARG A 1  46  ? 21.268  160.674 10.499  1.00 2.20   ? 46  ARG A CG  1 
ATOM   335   C  CD  . ARG A 1  46  ? 21.343  159.964 9.163   1.00 8.92   ? 46  ARG A CD  1 
ATOM   336   N  NE  . ARG A 1  46  ? 22.615  159.215 9.132   1.00 2.20   ? 46  ARG A NE  1 
ATOM   337   C  CZ  . ARG A 1  46  ? 22.947  158.575 8.013   1.00 13.60  ? 46  ARG A CZ  1 
ATOM   338   N  NH1 . ARG A 1  46  ? 22.106  158.652 6.982   1.00 20.68  ? 46  ARG A NH1 1 
ATOM   339   N  NH2 . ARG A 1  46  ? 24.037  157.866 7.822   1.00 12.24  ? 46  ARG A NH2 1 
ATOM   340   N  N   . TYR A 1  47  ? 19.779  163.752 12.389  1.00 27.84  ? 47  TYR A N   1 
ATOM   341   C  CA  . TYR A 1  47  ? 20.453  165.045 12.387  1.00 24.71  ? 47  TYR A CA  1 
ATOM   342   C  C   . TYR A 1  47  ? 20.366  165.605 13.806  1.00 26.63  ? 47  TYR A C   1 
ATOM   343   O  O   . TYR A 1  47  ? 20.597  166.806 13.967  1.00 33.96  ? 47  TYR A O   1 
ATOM   344   C  CB  . TYR A 1  47  ? 19.700  166.000 11.452  1.00 28.32  ? 47  TYR A CB  1 
ATOM   345   C  CG  . TYR A 1  47  ? 19.633  165.401 10.063  1.00 25.78  ? 47  TYR A CG  1 
ATOM   346   C  CD1 . TYR A 1  47  ? 18.765  164.382 9.735   1.00 15.27  ? 47  TYR A CD1 1 
ATOM   347   C  CD2 . TYR A 1  47  ? 20.505  165.887 9.103   1.00 30.67  ? 47  TYR A CD2 1 
ATOM   348   C  CE1 . TYR A 1  47  ? 18.744  163.873 8.461   1.00 18.73  ? 47  TYR A CE1 1 
ATOM   349   C  CE2 . TYR A 1  47  ? 20.488  165.373 7.819   1.00 32.12  ? 47  TYR A CE2 1 
ATOM   350   C  CZ  . TYR A 1  47  ? 19.603  164.368 7.506   1.00 26.47  ? 47  TYR A CZ  1 
ATOM   351   O  OH  . TYR A 1  47  ? 19.494  163.807 6.255   1.00 24.74  ? 47  TYR A OH  1 
ATOM   352   N  N   . GLU A 1  48  ? 19.591  164.874 14.613  1.00 25.17  ? 48  GLU A N   1 
ATOM   353   C  CA  . GLU A 1  48  ? 19.298  165.447 15.925  1.00 29.76  ? 48  GLU A CA  1 
ATOM   354   C  C   . GLU A 1  48  ? 20.577  165.255 16.740  1.00 28.27  ? 48  GLU A C   1 
ATOM   355   O  O   . GLU A 1  48  ? 21.341  164.342 16.473  1.00 24.81  ? 48  GLU A O   1 
ATOM   356   C  CB  . GLU A 1  48  ? 18.091  164.758 16.555  1.00 39.06  ? 48  GLU A CB  1 
ATOM   357   C  CG  . GLU A 1  48  ? 16.913  164.581 15.635  1.00 41.01  ? 48  GLU A CG  1 
ATOM   358   C  CD  . GLU A 1  48  ? 15.556  164.974 16.142  1.00 47.38  ? 48  GLU A CD  1 
ATOM   359   O  OE1 . GLU A 1  48  ? 15.066  164.593 17.215  1.00 48.46  ? 48  GLU A OE1 1 
ATOM   360   O  OE2 . GLU A 1  48  ? 14.863  165.737 15.421  1.00 45.81  ? 48  GLU A OE2 1 
ATOM   361   N  N   . SER A 1  49  ? 20.854  166.173 17.638  1.00 29.81  ? 49  SER A N   1 
ATOM   362   C  CA  . SER A 1  49  ? 21.999  166.035 18.526  1.00 34.06  ? 49  SER A CA  1 
ATOM   363   C  C   . SER A 1  49  ? 21.438  165.183 19.687  1.00 39.38  ? 49  SER A C   1 
ATOM   364   O  O   . SER A 1  49  ? 20.266  164.818 19.609  1.00 38.11  ? 49  SER A O   1 
ATOM   365   C  CB  . SER A 1  49  ? 22.484  167.355 19.092  1.00 34.36  ? 49  SER A CB  1 
ATOM   366   O  OG  . SER A 1  49  ? 22.021  168.484 18.389  1.00 43.76  ? 49  SER A OG  1 
ATOM   367   N  N   . GLU A 1  50  ? 22.237  165.026 20.719  1.00 43.41  ? 50  GLU A N   1 
ATOM   368   C  CA  . GLU A 1  50  ? 21.839  164.221 21.863  1.00 51.52  ? 50  GLU A CA  1 
ATOM   369   C  C   . GLU A 1  50  ? 20.618  164.806 22.548  1.00 54.35  ? 50  GLU A C   1 
ATOM   370   O  O   . GLU A 1  50  ? 19.650  164.126 22.905  1.00 58.00  ? 50  GLU A O   1 
ATOM   371   C  CB  . GLU A 1  50  ? 23.037  164.109 22.806  1.00 63.37  ? 50  GLU A CB  1 
ATOM   372   C  CG  . GLU A 1  50  ? 24.181  163.295 22.213  1.00 74.34  ? 50  GLU A CG  1 
ATOM   373   C  CD  . GLU A 1  50  ? 25.322  163.057 23.182  1.00 79.47  ? 50  GLU A CD  1 
ATOM   374   O  OE1 . GLU A 1  50  ? 25.211  163.409 24.374  1.00 83.92  ? 50  GLU A OE1 1 
ATOM   375   O  OE2 . GLU A 1  50  ? 26.344  162.503 22.710  1.00 79.02  ? 50  GLU A OE2 1 
ATOM   376   N  N   . LYS A 1  51  ? 20.654  166.136 22.689  1.00 55.90  ? 51  LYS A N   1 
ATOM   377   C  CA  . LYS A 1  51  ? 19.518  166.831 23.278  1.00 56.95  ? 51  LYS A CA  1 
ATOM   378   C  C   . LYS A 1  51  ? 18.288  166.627 22.387  1.00 57.61  ? 51  LYS A C   1 
ATOM   379   O  O   . LYS A 1  51  ? 17.539  165.653 22.577  1.00 58.82  ? 51  LYS A O   1 
ATOM   380   C  CB  . LYS A 1  51  ? 19.762  168.341 23.350  1.00 57.69  ? 51  LYS A CB  1 
ATOM   381   C  CG  . LYS A 1  51  ? 18.428  169.101 23.460  1.00 57.85  ? 51  LYS A CG  1 
ATOM   382   C  CD  . LYS A 1  51  ? 18.527  170.237 24.450  1.00 60.41  ? 51  LYS A CD  1 
ATOM   383   C  CE  . LYS A 1  51  ? 17.507  170.145 25.566  1.00 58.92  ? 51  LYS A CE  1 
ATOM   384   N  NZ  . LYS A 1  51  ? 17.379  171.426 26.326  1.00 65.67  ? 51  LYS A NZ  1 
ATOM   385   N  N   . ASN A 1  52  ? 18.284  167.381 21.285  1.00 52.34  ? 52  ASN A N   1 
ATOM   386   C  CA  . ASN A 1  52  ? 17.139  167.287 20.388  1.00 53.88  ? 52  ASN A CA  1 
ATOM   387   C  C   . ASN A 1  52  ? 16.930  165.927 19.765  1.00 51.28  ? 52  ASN A C   1 
ATOM   388   O  O   . ASN A 1  52  ? 16.094  165.757 18.866  1.00 51.41  ? 52  ASN A O   1 
ATOM   389   C  CB  . ASN A 1  52  ? 17.174  168.438 19.397  1.00 60.71  ? 52  ASN A CB  1 
ATOM   390   C  CG  . ASN A 1  52  ? 18.429  168.508 18.558  1.00 62.49  ? 52  ASN A CG  1 
ATOM   391   O  OD1 . ASN A 1  52  ? 19.227  167.575 18.571  1.00 64.52  ? 52  ASN A OD1 1 
ATOM   392   N  ND2 . ASN A 1  52  ? 18.631  169.595 17.819  1.00 64.39  ? 52  ASN A ND2 1 
ATOM   393   N  N   . ASN A 1  53  ? 17.475  164.842 20.299  1.00 49.63  ? 53  ASN A N   1 
ATOM   394   C  CA  . ASN A 1  53  ? 17.273  163.499 19.826  1.00 48.94  ? 53  ASN A CA  1 
ATOM   395   C  C   . ASN A 1  53  ? 15.825  163.244 19.446  1.00 50.52  ? 53  ASN A C   1 
ATOM   396   O  O   . ASN A 1  53  ? 15.608  162.695 18.351  1.00 57.94  ? 53  ASN A O   1 
ATOM   397   C  CB  . ASN A 1  53  ? 17.748  162.423 20.797  1.00 43.84  ? 53  ASN A CB  1 
ATOM   398   C  CG  . ASN A 1  53  ? 17.638  161.032 20.216  1.00 41.02  ? 53  ASN A CG  1 
ATOM   399   O  OD1 . ASN A 1  53  ? 17.930  160.051 20.908  1.00 46.34  ? 53  ASN A OD1 1 
ATOM   400   N  ND2 . ASN A 1  53  ? 17.241  160.894 18.956  1.00 29.09  ? 53  ASN A ND2 1 
ATOM   401   N  N   . GLY A 1  54  ? 14.830  163.756 20.166  1.00 46.21  ? 54  GLY A N   1 
ATOM   402   C  CA  . GLY A 1  54  ? 13.445  163.525 19.739  1.00 40.15  ? 54  GLY A CA  1 
ATOM   403   C  C   . GLY A 1  54  ? 12.737  164.822 19.381  1.00 34.71  ? 54  GLY A C   1 
ATOM   404   O  O   . GLY A 1  54  ? 11.510  164.923 19.476  1.00 31.96  ? 54  GLY A O   1 
ATOM   405   N  N   . ALA A 1  55  ? 13.530  165.805 18.974  1.00 31.27  ? 55  ALA A N   1 
ATOM   406   C  CA  . ALA A 1  55  ? 13.010  167.105 18.561  1.00 25.12  ? 55  ALA A CA  1 
ATOM   407   C  C   . ALA A 1  55  ? 12.057  166.946 17.381  1.00 22.03  ? 55  ALA A C   1 
ATOM   408   O  O   . ALA A 1  55  ? 10.884  167.286 17.443  1.00 21.78  ? 55  ALA A O   1 
ATOM   409   C  CB  . ALA A 1  55  ? 14.161  167.996 18.112  1.00 24.79  ? 55  ALA A CB  1 
ATOM   410   N  N   . GLY A 1  56  ? 12.569  166.430 16.270  1.00 20.06  ? 56  GLY A N   1 
ATOM   411   C  CA  . GLY A 1  56  ? 11.687  166.221 15.119  1.00 21.07  ? 56  GLY A CA  1 
ATOM   412   C  C   . GLY A 1  56  ? 10.375  165.593 15.580  1.00 19.91  ? 56  GLY A C   1 
ATOM   413   O  O   . GLY A 1  56  ? 9.334   166.246 15.537  1.00 18.11  ? 56  GLY A O   1 
ATOM   414   N  N   . TYR A 1  57  ? 10.451  164.366 16.080  1.00 21.73  ? 57  TYR A N   1 
ATOM   415   C  CA  . TYR A 1  57  ? 9.312   163.618 16.586  1.00 19.51  ? 57  TYR A CA  1 
ATOM   416   C  C   . TYR A 1  57  ? 8.331   164.439 17.401  1.00 15.21  ? 57  TYR A C   1 
ATOM   417   O  O   . TYR A 1  57  ? 7.132   164.250 17.193  1.00 16.13  ? 57  TYR A O   1 
ATOM   418   C  CB  . TYR A 1  57  ? 9.705   162.323 17.263  1.00 16.74  ? 57  TYR A CB  1 
ATOM   419   C  CG  . TYR A 1  57  ? 8.558   161.479 17.744  1.00 13.40  ? 57  TYR A CG  1 
ATOM   420   C  CD1 . TYR A 1  57  ? 7.841   160.659 16.890  1.00 9.60   ? 57  TYR A CD1 1 
ATOM   421   C  CD2 . TYR A 1  57  ? 8.186   161.546 19.086  1.00 14.11  ? 57  TYR A CD2 1 
ATOM   422   C  CE1 . TYR A 1  57  ? 6.754   159.927 17.360  1.00 7.84   ? 57  TYR A CE1 1 
ATOM   423   C  CE2 . TYR A 1  57  ? 7.121   160.799 19.558  1.00 11.62  ? 57  TYR A CE2 1 
ATOM   424   C  CZ  . TYR A 1  57  ? 6.408   160.001 18.689  1.00 7.82   ? 57  TYR A CZ  1 
ATOM   425   O  OH  . TYR A 1  57  ? 5.374   159.249 19.157  1.00 3.73   ? 57  TYR A OH  1 
ATOM   426   N  N   . PHE A 1  58  ? 8.744   165.404 18.172  1.00 13.90  ? 58  PHE A N   1 
ATOM   427   C  CA  . PHE A 1  58  ? 7.924   166.379 18.880  1.00 14.17  ? 58  PHE A CA  1 
ATOM   428   C  C   . PHE A 1  58  ? 7.247   167.338 17.915  1.00 13.89  ? 58  PHE A C   1 
ATOM   429   O  O   . PHE A 1  58  ? 6.075   167.704 17.961  1.00 17.61  ? 58  PHE A O   1 
ATOM   430   C  CB  . PHE A 1  58  ? 8.868   167.225 19.764  1.00 12.47  ? 58  PHE A CB  1 
ATOM   431   C  CG  . PHE A 1  58  ? 8.355   167.641 21.099  1.00 5.99   ? 58  PHE A CG  1 
ATOM   432   C  CD1 . PHE A 1  58  ? 7.112   168.246 21.220  1.00 9.71   ? 58  PHE A CD1 1 
ATOM   433   C  CD2 . PHE A 1  58  ? 9.120   167.428 22.232  1.00 6.00   ? 58  PHE A CD2 1 
ATOM   434   C  CE1 . PHE A 1  58  ? 6.650   168.628 22.470  1.00 15.73  ? 58  PHE A CE1 1 
ATOM   435   C  CE2 . PHE A 1  58  ? 8.685   167.799 23.475  1.00 5.90   ? 58  PHE A CE2 1 
ATOM   436   C  CZ  . PHE A 1  58  ? 7.437   168.405 23.596  1.00 15.70  ? 58  PHE A CZ  1 
ATOM   437   N  N   . VAL A 1  59  ? 8.009   167.855 16.952  1.00 16.91  ? 59  VAL A N   1 
ATOM   438   C  CA  . VAL A 1  59  ? 7.368   168.773 16.003  1.00 16.40  ? 59  VAL A CA  1 
ATOM   439   C  C   . VAL A 1  59  ? 6.105   168.111 15.452  1.00 16.91  ? 59  VAL A C   1 
ATOM   440   O  O   . VAL A 1  59  ? 5.031   168.704 15.528  1.00 18.92  ? 59  VAL A O   1 
ATOM   441   C  CB  . VAL A 1  59  ? 8.352   169.082 14.863  1.00 17.00  ? 59  VAL A CB  1 
ATOM   442   C  CG1 . VAL A 1  59  ? 7.585   169.394 13.600  1.00 11.50  ? 59  VAL A CG1 1 
ATOM   443   C  CG2 . VAL A 1  59  ? 9.338   170.135 15.333  1.00 14.56  ? 59  VAL A CG2 1 
ATOM   444   N  N   . GLU A 1  60  ? 6.204   166.871 15.007  1.00 14.39  ? 60  GLU A N   1 
ATOM   445   C  CA  . GLU A 1  60  ? 5.153   166.043 14.500  1.00 9.85   ? 60  GLU A CA  1 
ATOM   446   C  C   . GLU A 1  60  ? 3.841   166.125 15.258  1.00 12.68  ? 60  GLU A C   1 
ATOM   447   O  O   . GLU A 1  60  ? 2.770   166.088 14.633  1.00 11.02  ? 60  GLU A O   1 
ATOM   448   C  CB  . GLU A 1  60  ? 5.557   164.570 14.569  1.00 10.70  ? 60  GLU A CB  1 
ATOM   449   C  CG  . GLU A 1  60  ? 4.837   163.741 13.509  1.00 23.05  ? 60  GLU A CG  1 
ATOM   450   C  CD  . GLU A 1  60  ? 5.408   162.341 13.454  1.00 23.55  ? 60  GLU A CD  1 
ATOM   451   O  OE1 . GLU A 1  60  ? 6.535   162.202 13.967  1.00 38.20  ? 60  GLU A OE1 1 
ATOM   452   O  OE2 . GLU A 1  60  ? 4.771   161.414 12.940  1.00 26.10  ? 60  GLU A OE2 1 
ATOM   453   N  N   . HIS A 1  61  ? 3.914   166.159 16.583  1.00 13.84  ? 61  HIS A N   1 
ATOM   454   C  CA  . HIS A 1  61  ? 2.711   166.244 17.397  1.00 23.51  ? 61  HIS A CA  1 
ATOM   455   C  C   . HIS A 1  61  ? 2.047   167.625 17.328  1.00 27.77  ? 61  HIS A C   1 
ATOM   456   O  O   . HIS A 1  61  ? 0.877   167.756 17.676  1.00 32.64  ? 61  HIS A O   1 
ATOM   457   C  CB  . HIS A 1  61  ? 3.055   166.094 18.883  1.00 29.25  ? 61  HIS A CB  1 
ATOM   458   C  CG  . HIS A 1  61  ? 3.487   164.699 19.167  1.00 35.33  ? 61  HIS A CG  1 
ATOM   459   N  ND1 . HIS A 1  61  ? 4.675   164.228 18.650  1.00 47.21  ? 61  HIS A ND1 1 
ATOM   460   C  CD2 . HIS A 1  61  ? 2.930   163.687 19.849  1.00 31.29  ? 61  HIS A CD2 1 
ATOM   461   C  CE1 . HIS A 1  61  ? 4.844   162.974 19.029  1.00 43.49  ? 61  HIS A CE1 1 
ATOM   462   N  NE2 . HIS A 1  61  ? 3.802   162.622 19.757  1.00 35.34  ? 61  HIS A NE2 1 
ATOM   463   N  N   . LEU A 1  62  ? 2.896   168.587 17.005  1.00 23.93  ? 62  LEU A N   1 
ATOM   464   C  CA  . LEU A 1  62  ? 2.469   169.955 16.843  1.00 19.84  ? 62  LEU A CA  1 
ATOM   465   C  C   . LEU A 1  62  ? 2.040   170.260 15.425  1.00 17.28  ? 62  LEU A C   1 
ATOM   466   O  O   . LEU A 1  62  ? 1.206   171.136 15.195  1.00 23.81  ? 62  LEU A O   1 
ATOM   467   C  CB  . LEU A 1  62  ? 3.680   170.825 17.222  1.00 16.15  ? 62  LEU A CB  1 
ATOM   468   C  CG  . LEU A 1  62  ? 3.987   170.756 18.724  1.00 11.75  ? 62  LEU A CG  1 
ATOM   469   C  CD1 . LEU A 1  62  ? 5.342   171.354 19.048  1.00 2.20   ? 62  LEU A CD1 1 
ATOM   470   C  CD2 . LEU A 1  62  ? 2.847   171.409 19.488  1.00 7.61   ? 62  LEU A CD2 1 
ATOM   471   N  N   . ALA A 1  63  ? 2.597   169.552 14.468  1.00 15.68  ? 63  ALA A N   1 
ATOM   472   C  CA  . ALA A 1  63  ? 2.327   169.772 13.066  1.00 20.71  ? 63  ALA A CA  1 
ATOM   473   C  C   . ALA A 1  63  ? 0.890   170.119 12.716  1.00 24.57  ? 63  ALA A C   1 
ATOM   474   O  O   . ALA A 1  63  ? 0.676   171.079 11.959  1.00 28.23  ? 63  ALA A O   1 
ATOM   475   C  CB  . ALA A 1  63  ? 2.870   168.656 12.213  1.00 11.18  ? 63  ALA A CB  1 
ATOM   476   N  N   . PHE A 1  64  ? -0.078  169.402 13.270  1.00 22.72  ? 64  PHE A N   1 
ATOM   477   C  CA  . PHE A 1  64  ? -1.478  169.608 12.998  1.00 18.60  ? 64  PHE A CA  1 
ATOM   478   C  C   . PHE A 1  64  ? -2.292  170.358 14.030  1.00 20.57  ? 64  PHE A C   1 
ATOM   479   O  O   . PHE A 1  64  ? -3.517  170.098 13.958  1.00 18.06  ? 64  PHE A O   1 
ATOM   480   C  CB  . PHE A 1  64  ? -2.144  168.206 12.914  1.00 15.19  ? 64  PHE A CB  1 
ATOM   481   C  CG  . PHE A 1  64  ? -1.452  167.331 11.928  1.00 14.11  ? 64  PHE A CG  1 
ATOM   482   C  CD1 . PHE A 1  64  ? -1.815  167.388 10.600  1.00 23.57  ? 64  PHE A CD1 1 
ATOM   483   C  CD2 . PHE A 1  64  ? -0.459  166.457 12.269  1.00 21.72  ? 64  PHE A CD2 1 
ATOM   484   C  CE1 . PHE A 1  64  ? -1.193  166.600 9.664   1.00 24.46  ? 64  PHE A CE1 1 
ATOM   485   C  CE2 . PHE A 1  64  ? 0.165   165.659 11.329  1.00 22.76  ? 64  PHE A CE2 1 
ATOM   486   C  CZ  . PHE A 1  64  ? -0.195  165.720 10.001  1.00 20.53  ? 64  PHE A CZ  1 
ATOM   487   N  N   . LYS A 1  65  ? -1.773  171.141 14.963  1.00 20.98  ? 65  LYS A N   1 
ATOM   488   C  CA  . LYS A 1  65  ? -2.646  171.752 15.969  1.00 24.09  ? 65  LYS A CA  1 
ATOM   489   C  C   . LYS A 1  65  ? -2.842  173.250 15.861  1.00 28.07  ? 65  LYS A C   1 
ATOM   490   O  O   . LYS A 1  65  ? -3.402  173.856 16.785  1.00 29.67  ? 65  LYS A O   1 
ATOM   491   C  CB  . LYS A 1  65  ? -2.160  171.333 17.363  1.00 20.65  ? 65  LYS A CB  1 
ATOM   492   C  CG  . LYS A 1  65  ? -2.993  170.235 17.992  1.00 33.26  ? 65  LYS A CG  1 
ATOM   493   C  CD  . LYS A 1  65  ? -2.258  169.269 18.895  1.00 30.84  ? 65  LYS A CD  1 
ATOM   494   C  CE  . LYS A 1  65  ? -2.462  167.805 18.492  1.00 26.12  ? 65  LYS A CE  1 
ATOM   495   N  NZ  . LYS A 1  65  ? -1.262  166.968 18.791  1.00 28.87  ? 65  LYS A NZ  1 
ATOM   496   N  N   . GLY A 1  66  ? -2.424  173.877 14.758  1.00 29.12  ? 66  GLY A N   1 
ATOM   497   C  CA  . GLY A 1  66  ? -2.479  175.317 14.599  1.00 25.40  ? 66  GLY A CA  1 
ATOM   498   C  C   . GLY A 1  66  ? -1.415  175.855 13.653  1.00 24.05  ? 66  GLY A C   1 
ATOM   499   O  O   . GLY A 1  66  ? -0.380  175.263 13.419  1.00 18.93  ? 66  GLY A O   1 
ATOM   500   N  N   . THR A 1  67  ? -1.706  176.996 13.075  1.00 27.48  ? 67  THR A N   1 
ATOM   501   C  CA  . THR A 1  67  ? -0.822  177.691 12.113  1.00 30.65  ? 67  THR A CA  1 
ATOM   502   C  C   . THR A 1  67  ? -1.168  179.145 12.363  1.00 33.50  ? 67  THR A C   1 
ATOM   503   O  O   . THR A 1  67  ? -2.342  179.308 12.775  1.00 36.79  ? 67  THR A O   1 
ATOM   504   C  CB  . THR A 1  67  ? -1.195  177.186 10.716  1.00 32.82  ? 67  THR A CB  1 
ATOM   505   O  OG1 . THR A 1  67  ? -0.168  177.379 9.763   1.00 43.86  ? 67  THR A OG1 1 
ATOM   506   C  CG2 . THR A 1  67  ? -2.499  177.747 10.193  1.00 36.09  ? 67  THR A CG2 1 
ATOM   507   N  N   . LYS A 1  68  ? -0.317  180.159 12.308  1.00 35.96  ? 68  LYS A N   1 
ATOM   508   C  CA  . LYS A 1  68  ? -0.788  181.506 12.677  1.00 38.02  ? 68  LYS A CA  1 
ATOM   509   C  C   . LYS A 1  68  ? -2.106  181.835 11.979  1.00 38.01  ? 68  LYS A C   1 
ATOM   510   O  O   . LYS A 1  68  ? -2.948  182.538 12.549  1.00 37.17  ? 68  LYS A O   1 
ATOM   511   C  CB  . LYS A 1  68  ? 0.249   182.595 12.537  1.00 43.52  ? 68  LYS A CB  1 
ATOM   512   C  CG  . LYS A 1  68  ? 0.055   183.883 13.317  1.00 51.78  ? 68  LYS A CG  1 
ATOM   513   C  CD  . LYS A 1  68  ? -0.338  183.681 14.764  1.00 59.78  ? 68  LYS A CD  1 
ATOM   514   C  CE  . LYS A 1  68  ? -0.948  184.912 15.418  1.00 58.19  ? 68  LYS A CE  1 
ATOM   515   N  NZ  . LYS A 1  68  ? -1.484  184.570 16.769  1.00 62.74  ? 68  LYS A NZ  1 
ATOM   516   N  N   . ASN A 1  69  ? -2.311  181.290 10.792  1.00 35.08  ? 69  ASN A N   1 
ATOM   517   C  CA  . ASN A 1  69  ? -3.482  181.412 9.966   1.00 34.52  ? 69  ASN A CA  1 
ATOM   518   C  C   . ASN A 1  69  ? -4.646  180.529 10.393  1.00 34.12  ? 69  ASN A C   1 
ATOM   519   O  O   . ASN A 1  69  ? -5.711  180.493 9.773   1.00 32.43  ? 69  ASN A O   1 
ATOM   520   C  CB  . ASN A 1  69  ? -3.083  180.949 8.545   1.00 38.70  ? 69  ASN A CB  1 
ATOM   521   C  CG  . ASN A 1  69  ? -2.064  181.923 7.973   1.00 40.90  ? 69  ASN A CG  1 
ATOM   522   O  OD1 . ASN A 1  69  ? -2.025  183.076 8.401   1.00 44.29  ? 69  ASN A OD1 1 
ATOM   523   N  ND2 . ASN A 1  69  ? -1.275  181.411 7.044   1.00 38.30  ? 69  ASN A ND2 1 
ATOM   524   N  N   . ARG A 1  70  ? -4.417  179.631 11.335  1.00 36.17  ? 70  ARG A N   1 
ATOM   525   C  CA  . ARG A 1  70  ? -5.448  178.696 11.757  1.00 36.09  ? 70  ARG A CA  1 
ATOM   526   C  C   . ARG A 1  70  ? -5.167  178.185 13.164  1.00 36.36  ? 70  ARG A C   1 
ATOM   527   O  O   . ARG A 1  70  ? -4.721  177.056 13.332  1.00 37.67  ? 70  ARG A O   1 
ATOM   528   C  CB  . ARG A 1  70  ? -5.517  177.494 10.814  1.00 36.01  ? 70  ARG A CB  1 
ATOM   529   C  CG  . ARG A 1  70  ? -6.323  177.620 9.554   1.00 34.56  ? 70  ARG A CG  1 
ATOM   530   C  CD  . ARG A 1  70  ? -5.437  177.622 8.314   1.00 31.54  ? 70  ARG A CD  1 
ATOM   531   N  NE  . ARG A 1  70  ? -6.237  177.320 7.142   1.00 35.59  ? 70  ARG A NE  1 
ATOM   532   C  CZ  . ARG A 1  70  ? -6.085  177.737 5.900   1.00 33.13  ? 70  ARG A CZ  1 
ATOM   533   N  NH1 . ARG A 1  70  ? -5.086  178.526 5.563   1.00 27.13  ? 70  ARG A NH1 1 
ATOM   534   N  NH2 . ARG A 1  70  ? -6.926  177.350 4.941   1.00 39.09  ? 70  ARG A NH2 1 
ATOM   535   N  N   . PRO A 1  71  ? -5.430  178.983 14.166  1.00 37.95  ? 71  PRO A N   1 
ATOM   536   C  CA  . PRO A 1  71  ? -5.277  178.597 15.560  1.00 35.31  ? 71  PRO A CA  1 
ATOM   537   C  C   . PRO A 1  71  ? -6.249  177.485 15.934  1.00 31.79  ? 71  PRO A C   1 
ATOM   538   O  O   . PRO A 1  71  ? -7.156  177.146 15.175  1.00 29.36  ? 71  PRO A O   1 
ATOM   539   C  CB  . PRO A 1  71  ? -5.506  179.849 16.413  1.00 37.43  ? 71  PRO A CB  1 
ATOM   540   C  CG  . PRO A 1  71  ? -5.477  180.943 15.369  1.00 42.01  ? 71  PRO A CG  1 
ATOM   541   C  CD  . PRO A 1  71  ? -5.867  180.377 14.022  1.00 39.15  ? 71  PRO A CD  1 
ATOM   542   N  N   . GLY A 1  72  ? -6.008  176.905 17.105  1.00 30.46  ? 72  GLY A N   1 
ATOM   543   C  CA  . GLY A 1  72  ? -6.860  175.831 17.604  1.00 28.19  ? 72  GLY A CA  1 
ATOM   544   C  C   . GLY A 1  72  ? -7.100  174.772 16.524  1.00 24.86  ? 72  GLY A C   1 
ATOM   545   O  O   . GLY A 1  72  ? -6.225  174.412 15.747  1.00 21.15  ? 72  GLY A O   1 
ATOM   546   N  N   . ASN A 1  73  ? -8.337  174.350 16.472  1.00 23.79  ? 73  ASN A N   1 
ATOM   547   C  CA  . ASN A 1  73  ? -8.956  173.283 15.756  1.00 25.60  ? 73  ASN A CA  1 
ATOM   548   C  C   . ASN A 1  73  ? -9.150  173.546 14.273  1.00 25.44  ? 73  ASN A C   1 
ATOM   549   O  O   . ASN A 1  73  ? -9.625  172.683 13.529  1.00 25.63  ? 73  ASN A O   1 
ATOM   550   C  CB  . ASN A 1  73  ? -10.307 172.939 16.408  1.00 30.08  ? 73  ASN A CB  1 
ATOM   551   C  CG  . ASN A 1  73  ? -10.743 173.940 17.450  1.00 41.68  ? 73  ASN A CG  1 
ATOM   552   O  OD1 . ASN A 1  73  ? -11.879 174.417 17.372  1.00 50.45  ? 73  ASN A OD1 1 
ATOM   553   N  ND2 . ASN A 1  73  ? -9.921  174.304 18.430  1.00 46.73  ? 73  ASN A ND2 1 
ATOM   554   N  N   . ALA A 1  74  ? -8.777  174.743 13.843  1.00 22.49  ? 74  ALA A N   1 
ATOM   555   C  CA  . ALA A 1  74  ? -8.858  175.122 12.445  1.00 18.15  ? 74  ALA A CA  1 
ATOM   556   C  C   . ALA A 1  74  ? -8.317  174.042 11.533  1.00 17.98  ? 74  ALA A C   1 
ATOM   557   O  O   . ALA A 1  74  ? -9.087  173.482 10.745  1.00 19.08  ? 74  ALA A O   1 
ATOM   558   C  CB  . ALA A 1  74  ? -8.118  176.419 12.230  1.00 14.77  ? 74  ALA A CB  1 
ATOM   559   N  N   . LEU A 1  75  ? -7.018  173.745 11.605  1.00 18.70  ? 75  LEU A N   1 
ATOM   560   C  CA  . LEU A 1  75  ? -6.527  172.695 10.726  1.00 25.35  ? 75  LEU A CA  1 
ATOM   561   C  C   . LEU A 1  75  ? -7.559  171.568 10.579  1.00 32.51  ? 75  LEU A C   1 
ATOM   562   O  O   . LEU A 1  75  ? -8.109  171.311 9.504   1.00 32.18  ? 75  LEU A O   1 
ATOM   563   C  CB  . LEU A 1  75  ? -5.244  172.049 11.280  1.00 21.82  ? 75  LEU A CB  1 
ATOM   564   C  CG  . LEU A 1  75  ? -4.190  171.963 10.146  1.00 23.05  ? 75  LEU A CG  1 
ATOM   565   C  CD1 . LEU A 1  75  ? -3.824  173.416 9.834   1.00 2.75   ? 75  LEU A CD1 1 
ATOM   566   C  CD2 . LEU A 1  75  ? -2.968  171.160 10.519  1.00 19.43  ? 75  LEU A CD2 1 
ATOM   567   N  N   . GLU A 1  76  ? -7.678  170.812 11.688  1.00 31.97  ? 76  GLU A N   1 
ATOM   568   C  CA  . GLU A 1  76  ? -8.519  169.627 11.655  1.00 28.39  ? 76  GLU A CA  1 
ATOM   569   C  C   . GLU A 1  76  ? -9.894  169.896 11.075  1.00 25.79  ? 76  GLU A C   1 
ATOM   570   O  O   . GLU A 1  76  ? -10.284 169.253 10.082  1.00 27.80  ? 76  GLU A O   1 
ATOM   571   C  CB  . GLU A 1  76  ? -8.566  168.937 13.007  1.00 30.29  ? 76  GLU A CB  1 
ATOM   572   C  CG  . GLU A 1  76  ? -9.169  169.785 14.111  1.00 47.04  ? 76  GLU A CG  1 
ATOM   573   C  CD  . GLU A 1  76  ? -8.941  169.191 15.484  1.00 51.08  ? 76  GLU A CD  1 
ATOM   574   O  OE1 . GLU A 1  76  ? -8.082  168.286 15.563  1.00 49.32  ? 76  GLU A OE1 1 
ATOM   575   O  OE2 . GLU A 1  76  ? -9.575  169.577 16.488  1.00 55.27  ? 76  GLU A OE2 1 
ATOM   576   N  N   . LYS A 1  77  ? -10.648 170.863 11.616  1.00 17.62  ? 77  LYS A N   1 
ATOM   577   C  CA  . LYS A 1  77  ? -11.983 171.091 11.104  1.00 11.89  ? 77  LYS A CA  1 
ATOM   578   C  C   . LYS A 1  77  ? -11.983 171.342 9.610   1.00 13.20  ? 77  LYS A C   1 
ATOM   579   O  O   . LYS A 1  77  ? -12.991 171.108 8.949   1.00 12.28  ? 77  LYS A O   1 
ATOM   580   C  CB  . LYS A 1  77  ? -12.795 172.113 11.835  1.00 3.77   ? 77  LYS A CB  1 
ATOM   581   C  CG  . LYS A 1  77  ? -12.433 172.538 13.227  1.00 13.91  ? 77  LYS A CG  1 
ATOM   582   C  CD  . LYS A 1  77  ? -12.973 173.901 13.606  1.00 15.48  ? 77  LYS A CD  1 
ATOM   583   C  CE  . LYS A 1  77  ? -13.884 173.918 14.820  1.00 17.47  ? 77  LYS A CE  1 
ATOM   584   N  NZ  . LYS A 1  77  ? -13.857 175.235 15.535  1.00 6.36   ? 77  LYS A NZ  1 
ATOM   585   N  N   . GLU A 1  78  ? -10.900 171.927 9.113   1.00 18.79  ? 78  GLU A N   1 
ATOM   586   C  CA  . GLU A 1  78  ? -10.784 172.186 7.681   1.00 21.49  ? 78  GLU A CA  1 
ATOM   587   C  C   . GLU A 1  78  ? -10.600 170.859 6.974   1.00 22.90  ? 78  GLU A C   1 
ATOM   588   O  O   . GLU A 1  78  ? -11.383 170.545 6.081   1.00 28.45  ? 78  GLU A O   1 
ATOM   589   C  CB  . GLU A 1  78  ? -9.670  173.158 7.391   1.00 27.20  ? 78  GLU A CB  1 
ATOM   590   C  CG  . GLU A 1  78  ? -9.510  173.751 6.036   1.00 40.88  ? 78  GLU A CG  1 
ATOM   591   C  CD  . GLU A 1  78  ? -10.496 174.757 5.526   1.00 48.01  ? 78  GLU A CD  1 
ATOM   592   O  OE1 . GLU A 1  78  ? -11.404 175.204 6.253   1.00 58.15  ? 78  GLU A OE1 1 
ATOM   593   O  OE2 . GLU A 1  78  ? -10.338 175.101 4.328   1.00 52.86  ? 78  GLU A OE2 1 
ATOM   594   N  N   . VAL A 1  79  ? -9.677  170.021 7.442   1.00 24.52  ? 79  VAL A N   1 
ATOM   595   C  CA  . VAL A 1  79  ? -9.430  168.754 6.767   1.00 20.26  ? 79  VAL A CA  1 
ATOM   596   C  C   . VAL A 1  79  ? -10.659 167.854 6.760   1.00 23.35  ? 79  VAL A C   1 
ATOM   597   O  O   . VAL A 1  79  ? -10.847 167.076 5.825   1.00 24.18  ? 79  VAL A O   1 
ATOM   598   C  CB  . VAL A 1  79  ? -8.306  167.931 7.400   1.00 17.17  ? 79  VAL A CB  1 
ATOM   599   C  CG1 . VAL A 1  79  ? -7.307  167.521 6.336   1.00 21.54  ? 79  VAL A CG1 1 
ATOM   600   C  CG2 . VAL A 1  79  ? -7.630  168.700 8.508   1.00 22.60  ? 79  VAL A CG2 1 
ATOM   601   N  N   . GLU A 1  80  ? -11.285 167.846 7.933   1.00 22.84  ? 80  GLU A N   1 
ATOM   602   C  CA  . GLU A 1  80  ? -12.430 166.981 8.173   1.00 23.97  ? 80  GLU A CA  1 
ATOM   603   C  C   . GLU A 1  80  ? -13.573 167.266 7.223   1.00 24.80  ? 80  GLU A C   1 
ATOM   604   O  O   . GLU A 1  80  ? -13.823 166.472 6.318   1.00 25.81  ? 80  GLU A O   1 
ATOM   605   C  CB  . GLU A 1  80  ? -12.880 167.113 9.626   1.00 25.13  ? 80  GLU A CB  1 
ATOM   606   C  CG  . GLU A 1  80  ? -11.892 166.432 10.568  1.00 27.46  ? 80  GLU A CG  1 
ATOM   607   C  CD  . GLU A 1  80  ? -12.283 166.600 12.013  1.00 28.50  ? 80  GLU A CD  1 
ATOM   608   O  OE1 . GLU A 1  80  ? -12.639 167.728 12.397  1.00 35.76  ? 80  GLU A OE1 1 
ATOM   609   O  OE2 . GLU A 1  80  ? -12.260 165.608 12.759  1.00 28.32  ? 80  GLU A OE2 1 
ATOM   610   N  N   . SER A 1  81  ? -14.127 168.465 7.321   1.00 26.00  ? 81  SER A N   1 
ATOM   611   C  CA  . SER A 1  81  ? -15.261 168.919 6.548   1.00 26.71  ? 81  SER A CA  1 
ATOM   612   C  C   . SER A 1  81  ? -15.108 168.699 5.059   1.00 26.90  ? 81  SER A C   1 
ATOM   613   O  O   . SER A 1  81  ? -16.075 168.723 4.286   1.00 29.93  ? 81  SER A O   1 
ATOM   614   C  CB  . SER A 1  81  ? -15.684 170.332 6.886   1.00 31.32  ? 81  SER A CB  1 
ATOM   615   O  OG  . SER A 1  81  ? -15.429 170.679 8.234   1.00 29.89  ? 81  SER A OG  1 
ATOM   616   N  N   . MET A 1  82  ? -13.889 168.444 4.617   1.00 23.84  ? 82  MET A N   1 
ATOM   617   C  CA  . MET A 1  82  ? -13.672 168.115 3.209   1.00 27.89  ? 82  MET A CA  1 
ATOM   618   C  C   . MET A 1  82  ? -13.827 166.590 3.069   1.00 32.69  ? 82  MET A C   1 
ATOM   619   O  O   . MET A 1  82  ? -14.146 166.088 2.006   1.00 37.80  ? 82  MET A O   1 
ATOM   620   C  CB  . MET A 1  82  ? -12.225 168.443 2.908   1.00 23.69  ? 82  MET A CB  1 
ATOM   621   C  CG  . MET A 1  82  ? -11.808 168.660 1.489   1.00 15.29  ? 82  MET A CG  1 
ATOM   622   S  SD  . MET A 1  82  ? -10.360 169.727 1.414   1.00 22.74  ? 82  MET A SD  1 
ATOM   623   C  CE  . MET A 1  82  ? -10.118 170.252 3.106   1.00 9.15   ? 82  MET A CE  1 
ATOM   624   N  N   . GLY A 1  83  ? -13.364 165.914 4.120   1.00 32.35  ? 83  GLY A N   1 
ATOM   625   C  CA  . GLY A 1  83  ? -13.348 164.459 4.166   1.00 27.61  ? 83  GLY A CA  1 
ATOM   626   C  C   . GLY A 1  83  ? -11.933 163.964 3.894   1.00 24.61  ? 83  GLY A C   1 
ATOM   627   O  O   . GLY A 1  83  ? -11.713 162.811 3.543   1.00 29.35  ? 83  GLY A O   1 
ATOM   628   N  N   . ALA A 1  84  ? -10.984 164.885 4.034   1.00 20.55  ? 84  ALA A N   1 
ATOM   629   C  CA  . ALA A 1  84  ? -9.595  164.515 3.786   1.00 21.11  ? 84  ALA A CA  1 
ATOM   630   C  C   . ALA A 1  84  ? -8.996  163.985 5.097   1.00 22.02  ? 84  ALA A C   1 
ATOM   631   O  O   . ALA A 1  84  ? -9.426  164.342 6.187   1.00 17.22  ? 84  ALA A O   1 
ATOM   632   C  CB  . ALA A 1  84  ? -8.740  165.697 3.354   1.00 21.14  ? 84  ALA A CB  1 
ATOM   633   N  N   . HIS A 1  85  ? -8.005  163.129 4.913   1.00 20.20  ? 85  HIS A N   1 
ATOM   634   C  CA  . HIS A 1  85  ? -7.275  162.539 6.013   1.00 17.55  ? 85  HIS A CA  1 
ATOM   635   C  C   . HIS A 1  85  ? -5.857  163.094 6.021   1.00 19.06  ? 85  HIS A C   1 
ATOM   636   O  O   . HIS A 1  85  ? -5.261  163.316 4.974   1.00 23.98  ? 85  HIS A O   1 
ATOM   637   C  CB  . HIS A 1  85  ? -7.201  161.033 5.803   1.00 23.33  ? 85  HIS A CB  1 
ATOM   638   C  CG  . HIS A 1  85  ? -8.568  160.416 5.886   1.00 25.64  ? 85  HIS A CG  1 
ATOM   639   N  ND1 . HIS A 1  85  ? -9.130  159.951 7.053   1.00 23.40  ? 85  HIS A ND1 1 
ATOM   640   C  CD2 . HIS A 1  85  ? -9.479  160.222 4.905   1.00 25.31  ? 85  HIS A CD2 1 
ATOM   641   C  CE1 . HIS A 1  85  ? -10.337 159.482 6.770   1.00 28.33  ? 85  HIS A CE1 1 
ATOM   642   N  NE2 . HIS A 1  85  ? -10.579 159.637 5.475   1.00 22.95  ? 85  HIS A NE2 1 
ATOM   643   N  N   . LEU A 1  86  ? -5.346  163.338 7.214   1.00 18.95  ? 86  LEU A N   1 
ATOM   644   C  CA  . LEU A 1  86  ? -4.038  163.983 7.317   1.00 22.22  ? 86  LEU A CA  1 
ATOM   645   C  C   . LEU A 1  86  ? -3.096  163.156 8.181   1.00 24.74  ? 86  LEU A C   1 
ATOM   646   O  O   . LEU A 1  86  ? -3.426  163.019 9.363   1.00 27.54  ? 86  LEU A O   1 
ATOM   647   C  CB  . LEU A 1  86  ? -4.198  165.330 8.042   1.00 12.71  ? 86  LEU A CB  1 
ATOM   648   C  CG  . LEU A 1  86  ? -3.207  166.383 7.619   1.00 4.23   ? 86  LEU A CG  1 
ATOM   649   C  CD1 . LEU A 1  86  ? -2.673  166.204 6.223   1.00 2.20   ? 86  LEU A CD1 1 
ATOM   650   C  CD2 . LEU A 1  86  ? -3.815  167.742 7.870   1.00 10.98  ? 86  LEU A CD2 1 
ATOM   651   N  N   . ASN A 1  87  ? -2.000  162.675 7.614   1.00 25.46  ? 87  ASN A N   1 
ATOM   652   C  CA  . ASN A 1  87  ? -1.076  161.863 8.395   1.00 29.79  ? 87  ASN A CA  1 
ATOM   653   C  C   . ASN A 1  87  ? 0.336   162.413 8.524   1.00 26.80  ? 87  ASN A C   1 
ATOM   654   O  O   . ASN A 1  87  ? 0.873   163.032 7.619   1.00 29.80  ? 87  ASN A O   1 
ATOM   655   C  CB  . ASN A 1  87  ? -1.053  160.454 7.812   1.00 35.56  ? 87  ASN A CB  1 
ATOM   656   C  CG  . ASN A 1  87  ? -0.610  159.400 8.801   1.00 41.14  ? 87  ASN A CG  1 
ATOM   657   O  OD1 . ASN A 1  87  ? -0.298  159.691 9.951   1.00 43.60  ? 87  ASN A OD1 1 
ATOM   658   N  ND2 . ASN A 1  87  ? -0.591  158.169 8.298   1.00 45.69  ? 87  ASN A ND2 1 
ATOM   659   N  N   . ALA A 1  88  ? 0.986   162.179 9.660   1.00 22.91  ? 88  ALA A N   1 
ATOM   660   C  CA  . ALA A 1  88  ? 2.368   162.542 9.912   1.00 12.96  ? 88  ALA A CA  1 
ATOM   661   C  C   . ALA A 1  88  ? 3.140   161.277 10.249  1.00 13.20  ? 88  ALA A C   1 
ATOM   662   O  O   . ALA A 1  88  ? 2.782   160.513 11.134  1.00 11.79  ? 88  ALA A O   1 
ATOM   663   C  CB  . ALA A 1  88  ? 2.478   163.464 11.123  1.00 7.48   ? 88  ALA A CB  1 
ATOM   664   N  N   . TYR A 1  89  ? 4.242   161.055 9.574   1.00 17.63  ? 89  TYR A N   1 
ATOM   665   C  CA  . TYR A 1  89  ? 5.082   159.881 9.898   1.00 17.33  ? 89  TYR A CA  1 
ATOM   666   C  C   . TYR A 1  89  ? 6.522   160.342 10.032  1.00 20.80  ? 89  TYR A C   1 
ATOM   667   O  O   . TYR A 1  89  ? 6.973   161.297 9.388   1.00 26.36  ? 89  TYR A O   1 
ATOM   668   C  CB  . TYR A 1  89  ? 4.899   158.831 8.862   1.00 14.22  ? 89  TYR A CB  1 
ATOM   669   C  CG  . TYR A 1  89  ? 5.830   158.613 7.705   1.00 2.70   ? 89  TYR A CG  1 
ATOM   670   C  CD1 . TYR A 1  89  ? 7.222   158.619 7.746   1.00 3.16   ? 89  TYR A CD1 1 
ATOM   671   C  CD2 . TYR A 1  89  ? 5.209   158.338 6.476   1.00 5.72   ? 89  TYR A CD2 1 
ATOM   672   C  CE1 . TYR A 1  89  ? 7.923   158.363 6.580   1.00 6.50   ? 89  TYR A CE1 1 
ATOM   673   C  CE2 . TYR A 1  89  ? 5.912   158.101 5.322   1.00 6.09   ? 89  TYR A CE2 1 
ATOM   674   C  CZ  . TYR A 1  89  ? 7.291   158.110 5.392   1.00 6.14   ? 89  TYR A CZ  1 
ATOM   675   O  OH  . TYR A 1  89  ? 7.984   157.845 4.230   1.00 9.79   ? 89  TYR A OH  1 
ATOM   676   N  N   . SER A 1  90  ? 7.268   159.818 10.992  1.00 22.31  ? 90  SER A N   1 
ATOM   677   C  CA  . SER A 1  90  ? 8.639   160.375 11.112  1.00 21.96  ? 90  SER A CA  1 
ATOM   678   C  C   . SER A 1  90  ? 9.622   159.230 11.217  1.00 19.84  ? 90  SER A C   1 
ATOM   679   O  O   . SER A 1  90  ? 9.323   158.275 11.942  1.00 30.92  ? 90  SER A O   1 
ATOM   680   C  CB  . SER A 1  90  ? 8.659   161.381 12.238  1.00 16.28  ? 90  SER A CB  1 
ATOM   681   O  OG  . SER A 1  90  ? 9.969   161.780 12.576  1.00 24.91  ? 90  SER A OG  1 
ATOM   682   N  N   . THR A 1  91  ? 10.697  159.219 10.449  1.00 12.92  ? 91  THR A N   1 
ATOM   683   C  CA  . THR A 1  91  ? 11.690  158.126 10.507  1.00 2.23   ? 91  THR A CA  1 
ATOM   684   C  C   . THR A 1  91  ? 12.997  158.651 11.082  1.00 10.19  ? 91  THR A C   1 
ATOM   685   O  O   . THR A 1  91  ? 13.088  159.720 11.703  1.00 8.75   ? 91  THR A O   1 
ATOM   686   C  CB  . THR A 1  91  ? 11.851  157.651 9.063   1.00 3.02   ? 91  THR A CB  1 
ATOM   687   O  OG1 . THR A 1  91  ? 10.941  156.607 8.746   1.00 3.82   ? 91  THR A OG1 1 
ATOM   688   C  CG2 . THR A 1  91  ? 13.232  157.354 8.543   1.00 2.20   ? 91  THR A CG2 1 
ATOM   689   N  N   . ARG A 1  92  ? 14.111  157.949 10.950  1.00 11.82  ? 92  ARG A N   1 
ATOM   690   C  CA  . ARG A 1  92  ? 15.398  158.425 11.444  1.00 14.26  ? 92  ARG A CA  1 
ATOM   691   C  C   . ARG A 1  92  ? 16.133  159.236 10.387  1.00 11.99  ? 92  ARG A C   1 
ATOM   692   O  O   . ARG A 1  92  ? 17.251  159.701 10.588  1.00 9.28   ? 92  ARG A O   1 
ATOM   693   C  CB  . ARG A 1  92  ? 16.293  157.241 11.845  1.00 17.22  ? 92  ARG A CB  1 
ATOM   694   C  CG  . ARG A 1  92  ? 16.966  157.434 13.196  1.00 20.46  ? 92  ARG A CG  1 
ATOM   695   C  CD  . ARG A 1  92  ? 17.484  156.128 13.746  1.00 20.67  ? 92  ARG A CD  1 
ATOM   696   N  NE  . ARG A 1  92  ? 16.598  154.999 13.570  1.00 24.69  ? 92  ARG A NE  1 
ATOM   697   C  CZ  . ARG A 1  92  ? 16.035  154.156 14.412  1.00 20.97  ? 92  ARG A CZ  1 
ATOM   698   N  NH1 . ARG A 1  92  ? 16.166  154.157 15.727  1.00 17.21  ? 92  ARG A NH1 1 
ATOM   699   N  NH2 . ARG A 1  92  ? 15.247  153.181 13.954  1.00 23.21  ? 92  ARG A NH2 1 
ATOM   700   N  N   . GLU A 1  93  ? 15.519  159.318 9.220   1.00 13.73  ? 93  GLU A N   1 
ATOM   701   C  CA  . GLU A 1  93  ? 16.099  159.987 8.066   1.00 14.82  ? 93  GLU A CA  1 
ATOM   702   C  C   . GLU A 1  93  ? 15.068  160.786 7.276   1.00 13.83  ? 93  GLU A C   1 
ATOM   703   O  O   . GLU A 1  93  ? 15.442  161.455 6.320   1.00 13.47  ? 93  GLU A O   1 
ATOM   704   C  CB  . GLU A 1  93  ? 16.712  158.951 7.113   1.00 5.08   ? 93  GLU A CB  1 
ATOM   705   C  CG  . GLU A 1  93  ? 18.085  158.474 7.559   1.00 7.33   ? 93  GLU A CG  1 
ATOM   706   C  CD  . GLU A 1  93  ? 18.739  157.790 6.377   1.00 6.52   ? 93  GLU A CD  1 
ATOM   707   O  OE1 . GLU A 1  93  ? 18.094  157.711 5.319   1.00 12.94  ? 93  GLU A OE1 1 
ATOM   708   O  OE2 . GLU A 1  93  ? 19.877  157.313 6.457   1.00 21.32  ? 93  GLU A OE2 1 
ATOM   709   N  N   . HIS A 1  94  ? 13.780  160.582 7.555   1.00 13.09  ? 94  HIS A N   1 
ATOM   710   C  CA  . HIS A 1  94  ? 12.729  161.260 6.844   1.00 13.83  ? 94  HIS A CA  1 
ATOM   711   C  C   . HIS A 1  94  ? 11.456  161.571 7.632   1.00 12.34  ? 94  HIS A C   1 
ATOM   712   O  O   . HIS A 1  94  ? 10.727  160.616 7.902   1.00 14.98  ? 94  HIS A O   1 
ATOM   713   C  CB  . HIS A 1  94  ? 12.239  160.409 5.678   1.00 2.64   ? 94  HIS A CB  1 
ATOM   714   C  CG  . HIS A 1  94  ? 13.245  160.063 4.652   1.00 6.77   ? 94  HIS A CG  1 
ATOM   715   N  ND1 . HIS A 1  94  ? 14.207  160.907 4.172   1.00 15.96  ? 94  HIS A ND1 1 
ATOM   716   C  CD2 . HIS A 1  94  ? 13.400  158.911 3.964   1.00 16.40  ? 94  HIS A CD2 1 
ATOM   717   C  CE1 . HIS A 1  94  ? 14.922  160.286 3.251   1.00 22.58  ? 94  HIS A CE1 1 
ATOM   718   N  NE2 . HIS A 1  94  ? 14.450  159.065 3.094   1.00 12.35  ? 94  HIS A NE2 1 
ATOM   719   N  N   . THR A 1  95  ? 11.095  162.827 7.758   1.00 5.54   ? 95  THR A N   1 
ATOM   720   C  CA  . THR A 1  95  ? 9.787   163.171 8.346   1.00 4.22   ? 95  THR A CA  1 
ATOM   721   C  C   . THR A 1  95  ? 8.839   163.235 7.143   1.00 2.83   ? 95  THR A C   1 
ATOM   722   O  O   . THR A 1  95  ? 9.406   163.357 6.055   1.00 4.79   ? 95  THR A O   1 
ATOM   723   C  CB  . THR A 1  95  ? 9.993   164.511 9.065   1.00 2.20   ? 95  THR A CB  1 
ATOM   724   O  OG1 . THR A 1  95  ? 11.265  164.459 9.733   1.00 13.46  ? 95  THR A OG1 1 
ATOM   725   C  CG2 . THR A 1  95  ? 8.908   164.850 10.047  1.00 4.09   ? 95  THR A CG2 1 
ATOM   726   N  N   . ALA A 1  96  ? 7.535   163.127 7.209   1.00 4.01   ? 96  ALA A N   1 
ATOM   727   C  CA  . ALA A 1  96  ? 6.625   163.246 6.088   1.00 6.03   ? 96  ALA A CA  1 
ATOM   728   C  C   . ALA A 1  96  ? 5.168   163.513 6.444   1.00 7.54   ? 96  ALA A C   1 
ATOM   729   O  O   . ALA A 1  96  ? 4.515   162.703 7.102   1.00 3.85   ? 96  ALA A O   1 
ATOM   730   C  CB  . ALA A 1  96  ? 6.639   162.037 5.162   1.00 5.58   ? 96  ALA A CB  1 
ATOM   731   N  N   . TYR A 1  97  ? 4.608   164.624 5.939   1.00 10.15  ? 97  TYR A N   1 
ATOM   732   C  CA  . TYR A 1  97  ? 3.200   164.900 6.201   1.00 10.68  ? 97  TYR A CA  1 
ATOM   733   C  C   . TYR A 1  97  ? 2.446   164.861 4.867   1.00 12.76  ? 97  TYR A C   1 
ATOM   734   O  O   . TYR A 1  97  ? 2.960   165.499 3.954   1.00 15.54  ? 97  TYR A O   1 
ATOM   735   C  CB  . TYR A 1  97  ? 2.918   166.220 6.880   1.00 12.18  ? 97  TYR A CB  1 
ATOM   736   C  CG  . TYR A 1  97  ? 3.940   166.723 7.861   1.00 13.09  ? 97  TYR A CG  1 
ATOM   737   C  CD1 . TYR A 1  97  ? 5.191   167.127 7.402   1.00 14.61  ? 97  TYR A CD1 1 
ATOM   738   C  CD2 . TYR A 1  97  ? 3.681   166.818 9.220   1.00 5.86   ? 97  TYR A CD2 1 
ATOM   739   C  CE1 . TYR A 1  97  ? 6.154   167.592 8.271   1.00 16.19  ? 97  TYR A CE1 1 
ATOM   740   C  CE2 . TYR A 1  97  ? 4.651   167.269 10.094  1.00 8.04   ? 97  TYR A CE2 1 
ATOM   741   C  CZ  . TYR A 1  97  ? 5.881   167.653 9.621   1.00 14.48  ? 97  TYR A CZ  1 
ATOM   742   O  OH  . TYR A 1  97  ? 6.891   168.128 10.427  1.00 16.18  ? 97  TYR A OH  1 
ATOM   743   N  N   . TYR A 1  98  ? 1.315   164.159 4.817   1.00 12.51  ? 98  TYR A N   1 
ATOM   744   C  CA  . TYR A 1  98  ? 0.546   164.037 3.602   1.00 9.92   ? 98  TYR A CA  1 
ATOM   745   C  C   . TYR A 1  98  ? -0.956  164.061 3.839   1.00 10.55  ? 98  TYR A C   1 
ATOM   746   O  O   . TYR A 1  98  ? -1.341  163.762 4.949   1.00 15.06  ? 98  TYR A O   1 
ATOM   747   C  CB  . TYR A 1  98  ? 0.901   162.782 2.849   1.00 13.85  ? 98  TYR A CB  1 
ATOM   748   C  CG  . TYR A 1  98  ? 0.637   161.493 3.589   1.00 22.52  ? 98  TYR A CG  1 
ATOM   749   C  CD1 . TYR A 1  98  ? 1.560   160.973 4.488   1.00 24.02  ? 98  TYR A CD1 1 
ATOM   750   C  CD2 . TYR A 1  98  ? -0.503  160.739 3.342   1.00 22.04  ? 98  TYR A CD2 1 
ATOM   751   C  CE1 . TYR A 1  98  ? 1.337   159.774 5.125   1.00 20.96  ? 98  TYR A CE1 1 
ATOM   752   C  CE2 . TYR A 1  98  ? -0.731  159.525 3.962   1.00 18.17  ? 98  TYR A CE2 1 
ATOM   753   C  CZ  . TYR A 1  98  ? 0.194   159.053 4.863   1.00 19.50  ? 98  TYR A CZ  1 
ATOM   754   O  OH  . TYR A 1  98  ? 0.028   157.878 5.562   1.00 20.73  ? 98  TYR A OH  1 
ATOM   755   N  N   . ILE A 1  99  ? -1.704  164.408 2.802   1.00 11.93  ? 99  ILE A N   1 
ATOM   756   C  CA  . ILE A 1  99  ? -3.138  164.539 2.766   1.00 2.74   ? 99  ILE A CA  1 
ATOM   757   C  C   . ILE A 1  99  ? -3.750  163.614 1.710   1.00 7.53   ? 99  ILE A C   1 
ATOM   758   O  O   . ILE A 1  99  ? -3.323  163.556 0.577   1.00 5.39   ? 99  ILE A O   1 
ATOM   759   C  CB  . ILE A 1  99  ? -3.593  165.951 2.308   1.00 5.60   ? 99  ILE A CB  1 
ATOM   760   C  CG1 . ILE A 1  99  ? -3.253  167.017 3.324   1.00 3.72   ? 99  ILE A CG1 1 
ATOM   761   C  CG2 . ILE A 1  99  ? -5.049  165.880 1.929   1.00 6.56   ? 99  ILE A CG2 1 
ATOM   762   C  CD1 . ILE A 1  99  ? -4.389  167.645 4.102   1.00 3.91   ? 99  ILE A CD1 1 
ATOM   763   N  N   . LYS A 1  100 ? -4.783  162.916 2.147   1.00 9.12   ? 100 LYS A N   1 
ATOM   764   C  CA  . LYS A 1  100 ? -5.592  162.102 1.230   1.00 13.01  ? 100 LYS A CA  1 
ATOM   765   C  C   . LYS A 1  100 ? -6.844  162.952 1.012   1.00 19.65  ? 100 LYS A C   1 
ATOM   766   O  O   . LYS A 1  100 ? -7.329  163.547 1.992   1.00 17.28  ? 100 LYS A O   1 
ATOM   767   C  CB  . LYS A 1  100 ? -5.925  160.781 1.905   1.00 17.50  ? 100 LYS A CB  1 
ATOM   768   C  CG  . LYS A 1  100 ? -5.551  159.521 1.150   1.00 14.69  ? 100 LYS A CG  1 
ATOM   769   C  CD  . LYS A 1  100 ? -5.587  158.277 2.005   1.00 7.11   ? 100 LYS A CD  1 
ATOM   770   C  CE  . LYS A 1  100 ? -6.133  157.015 1.346   1.00 3.01   ? 100 LYS A CE  1 
ATOM   771   N  NZ  . LYS A 1  100 ? -5.342  156.643 0.138   1.00 17.12  ? 100 LYS A NZ  1 
ATOM   772   N  N   . ALA A 1  101 ? -7.288  163.064 -0.238  1.00 22.45  ? 101 ALA A N   1 
ATOM   773   C  CA  . ALA A 1  101 ? -8.474  163.902 -0.457  1.00 22.32  ? 101 ALA A CA  1 
ATOM   774   C  C   . ALA A 1  101 ? -9.088  163.645 -1.826  1.00 22.14  ? 101 ALA A C   1 
ATOM   775   O  O   . ALA A 1  101 ? -8.560  162.864 -2.605  1.00 18.84  ? 101 ALA A O   1 
ATOM   776   C  CB  . ALA A 1  101 ? -8.126  165.374 -0.321  1.00 12.02  ? 101 ALA A CB  1 
ATOM   777   N  N   . LEU A 1  102 ? -10.212 164.317 -2.056  1.00 24.42  ? 102 LEU A N   1 
ATOM   778   C  CA  . LEU A 1  102 ? -10.929 164.200 -3.331  1.00 23.02  ? 102 LEU A CA  1 
ATOM   779   C  C   . LEU A 1  102 ? -10.173 165.095 -4.321  1.00 21.09  ? 102 LEU A C   1 
ATOM   780   O  O   . LEU A 1  102 ? -9.595  166.091 -3.862  1.00 11.07  ? 102 LEU A O   1 
ATOM   781   C  CB  . LEU A 1  102 ? -12.377 164.658 -3.176  1.00 23.00  ? 102 LEU A CB  1 
ATOM   782   C  CG  . LEU A 1  102 ? -13.365 163.773 -2.428  1.00 10.71  ? 102 LEU A CG  1 
ATOM   783   C  CD1 . LEU A 1  102 ? -14.633 164.512 -2.067  1.00 16.32  ? 102 LEU A CD1 1 
ATOM   784   C  CD2 . LEU A 1  102 ? -13.765 162.565 -3.253  1.00 10.90  ? 102 LEU A CD2 1 
ATOM   785   N  N   . SER A 1  103 ? -10.106 164.666 -5.576  1.00 21.49  ? 103 SER A N   1 
ATOM   786   C  CA  . SER A 1  103 ? -9.151  165.284 -6.486  1.00 29.34  ? 103 SER A CA  1 
ATOM   787   C  C   . SER A 1  103 ? -9.466  166.731 -6.779  1.00 28.29  ? 103 SER A C   1 
ATOM   788   O  O   . SER A 1  103 ? -8.556  167.505 -7.054  1.00 31.37  ? 103 SER A O   1 
ATOM   789   C  CB  . SER A 1  103 ? -8.758  164.458 -7.681  1.00 33.81  ? 103 SER A CB  1 
ATOM   790   O  OG  . SER A 1  103 ? -9.761  163.671 -8.265  1.00 50.87  ? 103 SER A OG  1 
ATOM   791   N  N   . LYS A 1  104 ? -10.713 167.142 -6.616  1.00 31.91  ? 104 LYS A N   1 
ATOM   792   C  CA  . LYS A 1  104 ? -11.121 168.530 -6.766  1.00 33.39  ? 104 LYS A CA  1 
ATOM   793   C  C   . LYS A 1  104 ? -10.757 169.402 -5.565  1.00 34.27  ? 104 LYS A C   1 
ATOM   794   O  O   . LYS A 1  104 ? -11.053 170.602 -5.577  1.00 32.95  ? 104 LYS A O   1 
ATOM   795   C  CB  . LYS A 1  104 ? -12.650 168.569 -6.962  1.00 35.78  ? 104 LYS A CB  1 
ATOM   796   C  CG  . LYS A 1  104 ? -13.190 167.403 -7.784  1.00 41.37  ? 104 LYS A CG  1 
ATOM   797   C  CD  . LYS A 1  104 ? -14.576 167.703 -8.326  1.00 47.46  ? 104 LYS A CD  1 
ATOM   798   C  CE  . LYS A 1  104 ? -14.958 166.872 -9.543  1.00 43.21  ? 104 LYS A CE  1 
ATOM   799   N  NZ  . LYS A 1  104 ? -16.266 167.321 -10.107 1.00 35.30  ? 104 LYS A NZ  1 
ATOM   800   N  N   . ASP A 1  105 ? -10.126 168.857 -4.533  1.00 35.84  ? 105 ASP A N   1 
ATOM   801   C  CA  . ASP A 1  105 ? -9.838  169.522 -3.287  1.00 36.32  ? 105 ASP A CA  1 
ATOM   802   C  C   . ASP A 1  105 ? -8.387  169.992 -3.177  1.00 36.57  ? 105 ASP A C   1 
ATOM   803   O  O   . ASP A 1  105 ? -8.023  170.497 -2.109  1.00 36.46  ? 105 ASP A O   1 
ATOM   804   C  CB  . ASP A 1  105 ? -10.051 168.593 -2.088  1.00 45.42  ? 105 ASP A CB  1 
ATOM   805   C  CG  . ASP A 1  105 ? -11.440 167.986 -2.047  1.00 48.03  ? 105 ASP A CG  1 
ATOM   806   O  OD1 . ASP A 1  105 ? -12.359 168.765 -2.375  1.00 51.31  ? 105 ASP A OD1 1 
ATOM   807   O  OD2 . ASP A 1  105 ? -11.540 166.795 -1.687  1.00 41.77  ? 105 ASP A OD2 1 
ATOM   808   N  N   . LEU A 1  106 ? -7.604  169.784 -4.213  1.00 33.55  ? 106 LEU A N   1 
ATOM   809   C  CA  . LEU A 1  106 ? -6.236  170.285 -4.288  1.00 33.45  ? 106 LEU A CA  1 
ATOM   810   C  C   . LEU A 1  106 ? -6.083  171.754 -3.935  1.00 35.63  ? 106 LEU A C   1 
ATOM   811   O  O   . LEU A 1  106 ? -5.315  172.091 -3.022  1.00 29.72  ? 106 LEU A O   1 
ATOM   812   C  CB  . LEU A 1  106 ? -5.751  169.993 -5.704  1.00 33.49  ? 106 LEU A CB  1 
ATOM   813   C  CG  . LEU A 1  106 ? -4.239  169.813 -5.819  1.00 34.06  ? 106 LEU A CG  1 
ATOM   814   C  CD1 . LEU A 1  106 ? -3.768  168.879 -4.741  1.00 28.23  ? 106 LEU A CD1 1 
ATOM   815   C  CD2 . LEU A 1  106 ? -3.857  169.345 -7.202  1.00 37.95  ? 106 LEU A CD2 1 
ATOM   816   N  N   . PRO A 1  107 ? -6.756  172.639 -4.648  1.00 38.18  ? 107 PRO A N   1 
ATOM   817   C  CA  . PRO A 1  107 ? -6.908  174.021 -4.216  1.00 41.04  ? 107 PRO A CA  1 
ATOM   818   C  C   . PRO A 1  107 ? -6.608  174.089 -2.715  1.00 41.23  ? 107 PRO A C   1 
ATOM   819   O  O   . PRO A 1  107 ? -5.457  174.365 -2.357  1.00 38.80  ? 107 PRO A O   1 
ATOM   820   C  CB  . PRO A 1  107 ? -8.388  174.403 -4.472  1.00 44.36  ? 107 PRO A CB  1 
ATOM   821   C  CG  . PRO A 1  107 ? -8.925  173.215 -5.228  1.00 45.12  ? 107 PRO A CG  1 
ATOM   822   C  CD  . PRO A 1  107 ? -7.778  172.316 -5.649  1.00 40.17  ? 107 PRO A CD  1 
ATOM   823   N  N   . LYS A 1  108 ? -7.578  173.767 -1.850  1.00 39.10  ? 108 LYS A N   1 
ATOM   824   C  CA  . LYS A 1  108 ? -7.436  173.929 -0.414  1.00 35.74  ? 108 LYS A CA  1 
ATOM   825   C  C   . LYS A 1  108 ? -6.449  172.940 0.179   1.00 30.84  ? 108 LYS A C   1 
ATOM   826   O  O   . LYS A 1  108 ? -5.767  173.189 1.173   1.00 28.01  ? 108 LYS A O   1 
ATOM   827   C  CB  . LYS A 1  108 ? -8.719  174.014 0.403   1.00 37.58  ? 108 LYS A CB  1 
ATOM   828   C  CG  . LYS A 1  108 ? -10.045 173.994 -0.323  1.00 49.52  ? 108 LYS A CG  1 
ATOM   829   C  CD  . LYS A 1  108 ? -11.181 174.734 0.345   1.00 56.34  ? 108 LYS A CD  1 
ATOM   830   C  CE  . LYS A 1  108 ? -11.843 175.768 -0.553  1.00 59.60  ? 108 LYS A CE  1 
ATOM   831   N  NZ  . LYS A 1  108 ? -11.847 177.157 -0.011  1.00 60.99  ? 108 LYS A NZ  1 
ATOM   832   N  N   . ALA A 1  109 ? -6.291  171.782 -0.457  1.00 29.00  ? 109 ALA A N   1 
ATOM   833   C  CA  . ALA A 1  109 ? -5.383  170.768 0.082   1.00 23.36  ? 109 ALA A CA  1 
ATOM   834   C  C   . ALA A 1  109 ? -3.973  171.334 0.208   1.00 19.52  ? 109 ALA A C   1 
ATOM   835   O  O   . ALA A 1  109 ? -3.555  171.725 1.290   1.00 18.04  ? 109 ALA A O   1 
ATOM   836   C  CB  . ALA A 1  109 ? -5.339  169.545 -0.819  1.00 20.85  ? 109 ALA A CB  1 
ATOM   837   N  N   . VAL A 1  110 ? -3.320  171.383 -0.953  1.00 17.97  ? 110 VAL A N   1 
ATOM   838   C  CA  . VAL A 1  110 ? -1.966  171.918 -1.075  1.00 15.50  ? 110 VAL A CA  1 
ATOM   839   C  C   . VAL A 1  110 ? -1.728  173.208 -0.297  1.00 15.47  ? 110 VAL A C   1 
ATOM   840   O  O   . VAL A 1  110 ? -0.580  173.445 0.075   1.00 7.05   ? 110 VAL A O   1 
ATOM   841   C  CB  . VAL A 1  110 ? -1.491  172.111 -2.512  1.00 11.28  ? 110 VAL A CB  1 
ATOM   842   C  CG1 . VAL A 1  110 ? -0.043  172.560 -2.666  1.00 3.70   ? 110 VAL A CG1 1 
ATOM   843   C  CG2 . VAL A 1  110 ? -1.714  170.855 -3.333  1.00 19.00  ? 110 VAL A CG2 1 
ATOM   844   N  N   . GLU A 1  111 ? -2.706  174.070 -0.091  1.00 17.91  ? 111 GLU A N   1 
ATOM   845   C  CA  . GLU A 1  111 ? -2.557  175.291 0.675   1.00 26.55  ? 111 GLU A CA  1 
ATOM   846   C  C   . GLU A 1  111 ? -2.378  174.946 2.157   1.00 30.14  ? 111 GLU A C   1 
ATOM   847   O  O   . GLU A 1  111 ? -1.701  175.639 2.915   1.00 28.74  ? 111 GLU A O   1 
ATOM   848   C  CB  . GLU A 1  111 ? -3.818  176.174 0.572   1.00 39.07  ? 111 GLU A CB  1 
ATOM   849   C  CG  . GLU A 1  111 ? -3.955  176.880 -0.758  1.00 51.15  ? 111 GLU A CG  1 
ATOM   850   C  CD  . GLU A 1  111 ? -5.284  177.591 -0.925  1.00 53.87  ? 111 GLU A CD  1 
ATOM   851   O  OE1 . GLU A 1  111 ? -5.899  177.880 0.118   1.00 55.90  ? 111 GLU A OE1 1 
ATOM   852   O  OE2 . GLU A 1  111 ? -5.619  177.814 -2.107  1.00 56.90  ? 111 GLU A OE2 1 
ATOM   853   N  N   . LEU A 1  112 ? -3.161  173.945 2.571   1.00 33.75  ? 112 LEU A N   1 
ATOM   854   C  CA  . LEU A 1  112 ? -3.181  173.459 3.937   1.00 31.14  ? 112 LEU A CA  1 
ATOM   855   C  C   . LEU A 1  112 ? -1.855  172.817 4.337   1.00 30.79  ? 112 LEU A C   1 
ATOM   856   O  O   . LEU A 1  112 ? -1.290  173.117 5.381   1.00 32.95  ? 112 LEU A O   1 
ATOM   857   C  CB  . LEU A 1  112 ? -4.266  172.392 4.124   1.00 24.70  ? 112 LEU A CB  1 
ATOM   858   C  CG  . LEU A 1  112 ? -5.128  172.606 5.364   1.00 22.94  ? 112 LEU A CG  1 
ATOM   859   C  CD1 . LEU A 1  112 ? -4.548  173.707 6.235   1.00 24.93  ? 112 LEU A CD1 1 
ATOM   860   C  CD2 . LEU A 1  112 ? -6.551  172.928 4.953   1.00 21.42  ? 112 LEU A CD2 1 
ATOM   861   N  N   . LEU A 1  113 ? -1.388  171.939 3.457   1.00 29.02  ? 113 LEU A N   1 
ATOM   862   C  CA  . LEU A 1  113 ? -0.127  171.235 3.639   1.00 25.88  ? 113 LEU A CA  1 
ATOM   863   C  C   . LEU A 1  113 ? 1.056   172.193 3.802   1.00 25.18  ? 113 LEU A C   1 
ATOM   864   O  O   . LEU A 1  113 ? 1.801   172.076 4.765   1.00 19.95  ? 113 LEU A O   1 
ATOM   865   C  CB  . LEU A 1  113 ? 0.206   170.377 2.413   1.00 22.89  ? 113 LEU A CB  1 
ATOM   866   C  CG  . LEU A 1  113 ? 0.862   169.034 2.706   1.00 26.08  ? 113 LEU A CG  1 
ATOM   867   C  CD1 . LEU A 1  113 ? -0.045  168.139 3.544   1.00 25.13  ? 113 LEU A CD1 1 
ATOM   868   C  CD2 . LEU A 1  113 ? 1.249   168.283 1.441   1.00 30.32  ? 113 LEU A CD2 1 
ATOM   869   N  N   . ALA A 1  114 ? 1.178   173.102 2.854   1.00 30.42  ? 114 ALA A N   1 
ATOM   870   C  CA  . ALA A 1  114 ? 2.198   174.134 2.774   1.00 32.19  ? 114 ALA A CA  1 
ATOM   871   C  C   . ALA A 1  114 ? 2.155   175.018 4.015   1.00 32.05  ? 114 ALA A C   1 
ATOM   872   O  O   . ALA A 1  114 ? 3.166   175.370 4.614   1.00 31.32  ? 114 ALA A O   1 
ATOM   873   C  CB  . ALA A 1  114 ? 2.051   174.964 1.509   1.00 38.24  ? 114 ALA A CB  1 
ATOM   874   N  N   . ASP A 1  115 ? 0.933   175.297 4.426   1.00 30.96  ? 115 ASP A N   1 
ATOM   875   C  CA  . ASP A 1  115 ? 0.673   176.069 5.637   1.00 37.28  ? 115 ASP A CA  1 
ATOM   876   C  C   . ASP A 1  115 ? 1.267   175.358 6.849   1.00 37.66  ? 115 ASP A C   1 
ATOM   877   O  O   . ASP A 1  115 ? 2.056   175.931 7.595   1.00 41.01  ? 115 ASP A O   1 
ATOM   878   C  CB  . ASP A 1  115 ? -0.854  176.149 5.725   1.00 43.97  ? 115 ASP A CB  1 
ATOM   879   C  CG  . ASP A 1  115 ? -1.380  177.155 6.711   1.00 48.43  ? 115 ASP A CG  1 
ATOM   880   O  OD1 . ASP A 1  115 ? -0.677  177.408 7.707   1.00 47.11  ? 115 ASP A OD1 1 
ATOM   881   O  OD2 . ASP A 1  115 ? -2.490  177.693 6.508   1.00 52.96  ? 115 ASP A OD2 1 
ATOM   882   N  N   . ILE A 1  116 ? 0.980   174.069 6.919   1.00 37.16  ? 116 ILE A N   1 
ATOM   883   C  CA  . ILE A 1  116 ? 1.398   173.137 7.957   1.00 34.03  ? 116 ILE A CA  1 
ATOM   884   C  C   . ILE A 1  116 ? 2.911   173.029 8.126   1.00 30.67  ? 116 ILE A C   1 
ATOM   885   O  O   . ILE A 1  116 ? 3.446   173.250 9.228   1.00 25.12  ? 116 ILE A O   1 
ATOM   886   C  CB  . ILE A 1  116 ? 0.750   171.779 7.652   1.00 33.97  ? 116 ILE A CB  1 
ATOM   887   C  CG1 . ILE A 1  116 ? -0.506  171.526 8.492   1.00 34.19  ? 116 ILE A CG1 1 
ATOM   888   C  CG2 . ILE A 1  116 ? 1.733   170.641 7.777   1.00 34.03  ? 116 ILE A CG2 1 
ATOM   889   C  CD1 . ILE A 1  116 ? -1.469  170.546 7.837   1.00 39.27  ? 116 ILE A CD1 1 
ATOM   890   N  N   . VAL A 1  117 ? 3.633   172.776 7.038   1.00 22.71  ? 117 VAL A N   1 
ATOM   891   C  CA  . VAL A 1  117 ? 5.083   172.764 7.042   1.00 17.49  ? 117 VAL A CA  1 
ATOM   892   C  C   . VAL A 1  117 ? 5.707   174.043 7.587   1.00 19.28  ? 117 VAL A C   1 
ATOM   893   O  O   . VAL A 1  117 ? 6.743   174.043 8.255   1.00 12.94  ? 117 VAL A O   1 
ATOM   894   C  CB  . VAL A 1  117 ? 5.591   172.619 5.587   1.00 13.82  ? 117 VAL A CB  1 
ATOM   895   C  CG1 . VAL A 1  117 ? 7.017   173.138 5.541   1.00 15.84  ? 117 VAL A CG1 1 
ATOM   896   C  CG2 . VAL A 1  117 ? 5.530   171.172 5.164   1.00 10.80  ? 117 VAL A CG2 1 
ATOM   897   N  N   . GLN A 1  118 ? 5.177   175.222 7.249   1.00 23.71  ? 118 GLN A N   1 
ATOM   898   C  CA  . GLN A 1  118 ? 5.795   176.479 7.632   1.00 28.27  ? 118 GLN A CA  1 
ATOM   899   C  C   . GLN A 1  118 ? 5.266   177.113 8.893   1.00 33.10  ? 118 GLN A C   1 
ATOM   900   O  O   . GLN A 1  118 ? 5.982   177.466 9.826   1.00 38.23  ? 118 GLN A O   1 
ATOM   901   C  CB  . GLN A 1  118 ? 5.666   177.550 6.546   1.00 24.05  ? 118 GLN A CB  1 
ATOM   902   C  CG  . GLN A 1  118 ? 5.912   177.001 5.153   1.00 30.45  ? 118 GLN A CG  1 
ATOM   903   C  CD  . GLN A 1  118 ? 6.302   178.076 4.165   1.00 27.69  ? 118 GLN A CD  1 
ATOM   904   O  OE1 . GLN A 1  118 ? 6.471   179.241 4.516   1.00 28.96  ? 118 GLN A OE1 1 
ATOM   905   N  NE2 . GLN A 1  118 ? 6.455   177.673 2.914   1.00 30.20  ? 118 GLN A NE2 1 
ATOM   906   N  N   . ASN A 1  119 ? 3.971   177.422 8.908   1.00 38.87  ? 119 ASN A N   1 
ATOM   907   C  CA  . ASN A 1  119 ? 3.483   178.066 10.136  1.00 43.68  ? 119 ASN A CA  1 
ATOM   908   C  C   . ASN A 1  119 ? 2.815   177.039 11.021  1.00 47.56  ? 119 ASN A C   1 
ATOM   909   O  O   . ASN A 1  119 ? 2.110   176.134 10.543  1.00 53.60  ? 119 ASN A O   1 
ATOM   910   C  CB  . ASN A 1  119 ? 2.598   179.257 9.802   1.00 48.92  ? 119 ASN A CB  1 
ATOM   911   C  CG  . ASN A 1  119 ? 3.348   180.093 8.761   1.00 56.35  ? 119 ASN A CG  1 
ATOM   912   O  OD1 . ASN A 1  119 ? 4.430   180.597 9.069   1.00 60.87  ? 119 ASN A OD1 1 
ATOM   913   N  ND2 . ASN A 1  119 ? 2.795   180.136 7.562   1.00 57.34  ? 119 ASN A ND2 1 
ATOM   914   N  N   . CYS A 1  120 ? 3.376   176.970 12.223  1.00 47.24  ? 120 CYS A N   1 
ATOM   915   C  CA  . CYS A 1  120 ? 2.891   176.055 13.251  1.00 47.14  ? 120 CYS A CA  1 
ATOM   916   C  C   . CYS A 1  120 ? 2.725   176.846 14.545  1.00 45.71  ? 120 CYS A C   1 
ATOM   917   O  O   . CYS A 1  120 ? 3.689   177.068 15.279  1.00 45.14  ? 120 CYS A O   1 
ATOM   918   C  CB  . CYS A 1  120 ? 3.807   174.851 13.462  1.00 45.14  ? 120 CYS A CB  1 
ATOM   919   S  SG  . CYS A 1  120 ? 4.639   174.164 12.018  1.00 49.56  ? 120 CYS A SG  1 
ATOM   920   N  N   . SER A 1  121 ? 1.521   177.315 14.855  1.00 45.67  ? 121 SER A N   1 
ATOM   921   C  CA  . SER A 1  121 ? 1.293   178.092 16.080  1.00 45.65  ? 121 SER A CA  1 
ATOM   922   C  C   . SER A 1  121 ? 1.539   177.336 17.365  1.00 46.45  ? 121 SER A C   1 
ATOM   923   O  O   . SER A 1  121 ? 0.623   176.740 17.960  1.00 49.91  ? 121 SER A O   1 
ATOM   924   C  CB  . SER A 1  121 ? -0.103  178.715 16.044  1.00 44.08  ? 121 SER A CB  1 
ATOM   925   O  OG  . SER A 1  121 ? -1.029  178.194 16.964  1.00 41.81  ? 121 SER A OG  1 
ATOM   926   N  N   . LEU A 1  122 ? 2.739   177.378 17.958  1.00 44.24  ? 122 LEU A N   1 
ATOM   927   C  CA  . LEU A 1  122 ? 3.000   176.540 19.130  1.00 44.57  ? 122 LEU A CA  1 
ATOM   928   C  C   . LEU A 1  122 ? 3.082   177.197 20.483  1.00 47.81  ? 122 LEU A C   1 
ATOM   929   O  O   . LEU A 1  122 ? 4.300   177.527 20.922  1.00 49.25  ? 122 LEU A O   1 
ATOM   930   C  CB  . LEU A 1  122 ? 4.368   175.845 18.898  1.00 42.84  ? 122 LEU A CB  1 
ATOM   931   C  CG  . LEU A 1  122 ? 4.680   175.568 17.432  1.00 45.54  ? 122 LEU A CG  1 
ATOM   932   C  CD1 . LEU A 1  122 ? 6.162   175.454 17.144  1.00 33.99  ? 122 LEU A CD1 1 
ATOM   933   C  CD2 . LEU A 1  122 ? 3.938   174.350 16.898  1.00 50.93  ? 122 LEU A CD2 1 
ATOM   934   N  N   . GLU A 1  123 ? 2.010   177.184 21.275  1.00 47.80  ? 123 GLU A N   1 
ATOM   935   C  CA  . GLU A 1  123 ? 2.124   177.871 22.556  1.00 54.05  ? 123 GLU A CA  1 
ATOM   936   C  C   . GLU A 1  123 ? 2.649   177.066 23.708  1.00 54.63  ? 123 GLU A C   1 
ATOM   937   O  O   . GLU A 1  123 ? 2.574   175.839 23.801  1.00 52.09  ? 123 GLU A O   1 
ATOM   938   C  CB  . GLU A 1  123 ? 0.810   178.599 22.853  1.00 67.02  ? 123 GLU A CB  1 
ATOM   939   C  CG  . GLU A 1  123 ? 0.697   179.866 21.998  1.00 81.71  ? 123 GLU A CG  1 
ATOM   940   C  CD  . GLU A 1  123 ? -0.618  180.589 22.216  1.00 88.63  ? 123 GLU A CD  1 
ATOM   941   O  OE1 . GLU A 1  123 ? -1.256  180.340 23.263  1.00 92.59  ? 123 GLU A OE1 1 
ATOM   942   O  OE2 . GLU A 1  123 ? -0.999  181.397 21.343  1.00 91.89  ? 123 GLU A OE2 1 
ATOM   943   N  N   . ASP A 1  124 ? 3.132   177.781 24.732  1.00 56.25  ? 124 ASP A N   1 
ATOM   944   C  CA  . ASP A 1  124 ? 3.573   177.088 25.944  1.00 59.79  ? 124 ASP A CA  1 
ATOM   945   C  C   . ASP A 1  124 ? 2.595   175.996 26.319  1.00 57.55  ? 124 ASP A C   1 
ATOM   946   O  O   . ASP A 1  124 ? 3.023   174.842 26.482  1.00 59.17  ? 124 ASP A O   1 
ATOM   947   C  CB  . ASP A 1  124 ? 3.919   178.134 26.998  1.00 70.75  ? 124 ASP A CB  1 
ATOM   948   C  CG  . ASP A 1  124 ? 4.866   179.176 26.383  1.00 75.37  ? 124 ASP A CG  1 
ATOM   949   O  OD1 . ASP A 1  124 ? 5.522   178.837 25.370  1.00 72.46  ? 124 ASP A OD1 1 
ATOM   950   O  OD2 . ASP A 1  124 ? 4.935   180.309 26.908  1.00 77.83  ? 124 ASP A OD2 1 
ATOM   951   N  N   . SER A 1  125 ? 1.296   176.252 26.315  1.00 54.39  ? 125 SER A N   1 
ATOM   952   C  CA  . SER A 1  125 ? 0.258   175.270 26.595  1.00 51.20  ? 125 SER A CA  1 
ATOM   953   C  C   . SER A 1  125 ? 0.366   173.997 25.770  1.00 46.49  ? 125 SER A C   1 
ATOM   954   O  O   . SER A 1  125 ? 0.289   172.871 26.272  1.00 44.27  ? 125 SER A O   1 
ATOM   955   C  CB  . SER A 1  125 ? -1.109  175.938 26.352  1.00 54.03  ? 125 SER A CB  1 
ATOM   956   O  OG  . SER A 1  125 ? -0.897  177.226 25.782  1.00 57.02  ? 125 SER A OG  1 
ATOM   957   N  N   . GLN A 1  126 ? 0.526   174.140 24.462  1.00 41.79  ? 126 GLN A N   1 
ATOM   958   C  CA  . GLN A 1  126 ? 0.618   173.006 23.565  1.00 38.91  ? 126 GLN A CA  1 
ATOM   959   C  C   . GLN A 1  126 ? 1.930   172.257 23.790  1.00 39.61  ? 126 GLN A C   1 
ATOM   960   O  O   . GLN A 1  126 ? 2.003   171.073 23.486  1.00 41.63  ? 126 GLN A O   1 
ATOM   961   C  CB  . GLN A 1  126 ? 0.650   173.480 22.113  1.00 43.43  ? 126 GLN A CB  1 
ATOM   962   C  CG  . GLN A 1  126 ? -0.655  173.990 21.555  1.00 47.42  ? 126 GLN A CG  1 
ATOM   963   C  CD  . GLN A 1  126 ? -1.738  172.930 21.523  1.00 46.87  ? 126 GLN A CD  1 
ATOM   964   O  OE1 . GLN A 1  126 ? -1.527  171.800 21.948  1.00 42.22  ? 126 GLN A OE1 1 
ATOM   965   N  NE2 . GLN A 1  126 ? -2.908  173.305 21.021  1.00 52.95  ? 126 GLN A NE2 1 
ATOM   966   N  N   . ILE A 1  127 ? 2.978   173.001 24.146  1.00 38.11  ? 127 ILE A N   1 
ATOM   967   C  CA  . ILE A 1  127 ? 4.260   172.331 24.380  1.00 35.98  ? 127 ILE A CA  1 
ATOM   968   C  C   . ILE A 1  127 ? 4.083   171.483 25.643  1.00 35.76  ? 127 ILE A C   1 
ATOM   969   O  O   . ILE A 1  127 ? 4.172   170.258 25.545  1.00 39.61  ? 127 ILE A O   1 
ATOM   970   C  CB  . ILE A 1  127 ? 5.461   173.261 24.513  1.00 35.35  ? 127 ILE A CB  1 
ATOM   971   C  CG1 . ILE A 1  127 ? 5.990   173.883 23.225  1.00 26.04  ? 127 ILE A CG1 1 
ATOM   972   C  CG2 . ILE A 1  127 ? 6.627   172.522 25.174  1.00 35.70  ? 127 ILE A CG2 1 
ATOM   973   C  CD1 . ILE A 1  127 ? 5.685   173.086 21.966  1.00 4.84   ? 127 ILE A CD1 1 
ATOM   974   N  N   . GLU A 1  128 ? 3.560   172.054 26.716  1.00 33.33  ? 128 GLU A N   1 
ATOM   975   C  CA  . GLU A 1  128 ? 3.333   171.309 27.942  1.00 35.08  ? 128 GLU A CA  1 
ATOM   976   C  C   . GLU A 1  128 ? 2.224   170.277 27.881  1.00 36.13  ? 128 GLU A C   1 
ATOM   977   O  O   . GLU A 1  128 ? 2.004   169.532 28.851  1.00 32.88  ? 128 GLU A O   1 
ATOM   978   C  CB  . GLU A 1  128 ? 3.081   172.316 29.077  1.00 38.59  ? 128 GLU A CB  1 
ATOM   979   C  CG  . GLU A 1  128 ? 3.956   173.545 28.913  1.00 40.71  ? 128 GLU A CG  1 
ATOM   980   C  CD  . GLU A 1  128 ? 5.337   173.396 29.516  1.00 45.02  ? 128 GLU A CD  1 
ATOM   981   O  OE1 . GLU A 1  128 ? 5.488   173.575 30.748  1.00 51.12  ? 128 GLU A OE1 1 
ATOM   982   O  OE2 . GLU A 1  128 ? 6.290   173.109 28.761  1.00 36.16  ? 128 GLU A OE2 1 
ATOM   983   N  N   . LYS A 1  129 ? 1.436   170.278 26.807  1.00 37.97  ? 129 LYS A N   1 
ATOM   984   C  CA  . LYS A 1  129 ? 0.382   169.266 26.667  1.00 43.20  ? 129 LYS A CA  1 
ATOM   985   C  C   . LYS A 1  129 ? 0.954   168.070 25.911  1.00 43.64  ? 129 LYS A C   1 
ATOM   986   O  O   . LYS A 1  129 ? 0.810   166.912 26.301  1.00 47.41  ? 129 LYS A O   1 
ATOM   987   C  CB  . LYS A 1  129 ? -0.824  169.848 25.943  1.00 50.55  ? 129 LYS A CB  1 
ATOM   988   C  CG  . LYS A 1  129 ? -1.747  170.660 26.846  1.00 63.08  ? 129 LYS A CG  1 
ATOM   989   C  CD  . LYS A 1  129 ? -3.198  170.580 26.393  1.00 70.42  ? 129 LYS A CD  1 
ATOM   990   C  CE  . LYS A 1  129 ? -4.176  171.083 27.444  1.00 74.16  ? 129 LYS A CE  1 
ATOM   991   N  NZ  . LYS A 1  129 ? -5.367  171.711 26.788  1.00 73.34  ? 129 LYS A NZ  1 
ATOM   992   N  N   . GLU A 1  130 ? 1.801   168.395 24.942  1.00 40.76  ? 130 GLU A N   1 
ATOM   993   C  CA  . GLU A 1  130 ? 2.512   167.429 24.135  1.00 36.53  ? 130 GLU A CA  1 
ATOM   994   C  C   . GLU A 1  130 ? 3.648   166.721 24.847  1.00 34.86  ? 130 GLU A C   1 
ATOM   995   O  O   . GLU A 1  130 ? 4.103   165.646 24.438  1.00 34.66  ? 130 GLU A O   1 
ATOM   996   C  CB  . GLU A 1  130 ? 3.054   168.089 22.868  1.00 40.04  ? 130 GLU A CB  1 
ATOM   997   C  CG  . GLU A 1  130 ? 2.416   167.609 21.585  1.00 35.30  ? 130 GLU A CG  1 
ATOM   998   C  CD  . GLU A 1  130 ? 1.032   167.010 21.789  1.00 36.28  ? 130 GLU A CD  1 
ATOM   999   O  OE1 . GLU A 1  130 ? 0.160   167.698 22.365  1.00 18.26  ? 130 GLU A OE1 1 
ATOM   1000  O  OE2 . GLU A 1  130 ? 0.894   165.841 21.363  1.00 39.50  ? 130 GLU A OE2 1 
ATOM   1001  N  N   . ARG A 1  131 ? 4.169   167.327 25.900  1.00 32.35  ? 131 ARG A N   1 
ATOM   1002  C  CA  . ARG A 1  131 ? 5.209   166.658 26.700  1.00 30.79  ? 131 ARG A CA  1 
ATOM   1003  C  C   . ARG A 1  131 ? 4.554   165.464 27.407  1.00 31.31  ? 131 ARG A C   1 
ATOM   1004  O  O   . ARG A 1  131 ? 4.806   164.302 27.119  1.00 34.00  ? 131 ARG A O   1 
ATOM   1005  C  CB  . ARG A 1  131 ? 5.659   167.602 27.807  1.00 24.54  ? 131 ARG A CB  1 
ATOM   1006  C  CG  . ARG A 1  131 ? 7.132   167.554 28.138  1.00 19.93  ? 131 ARG A CG  1 
ATOM   1007  C  CD  . ARG A 1  131 ? 7.528   168.952 28.599  1.00 22.91  ? 131 ARG A CD  1 
ATOM   1008  N  NE  . ARG A 1  131 ? 8.447   169.553 27.641  1.00 21.24  ? 131 ARG A NE  1 
ATOM   1009  C  CZ  . ARG A 1  131 ? 8.758   170.847 27.694  1.00 27.77  ? 131 ARG A CZ  1 
ATOM   1010  N  NH1 . ARG A 1  131 ? 8.184   171.646 28.587  1.00 29.38  ? 131 ARG A NH1 1 
ATOM   1011  N  NH2 . ARG A 1  131 ? 9.642   171.280 26.804  1.00 22.86  ? 131 ARG A NH2 1 
ATOM   1012  N  N   . ASP A 1  132 ? 3.568   165.783 28.247  1.00 29.18  ? 132 ASP A N   1 
ATOM   1013  C  CA  . ASP A 1  132 ? 2.780   164.735 28.872  1.00 26.94  ? 132 ASP A CA  1 
ATOM   1014  C  C   . ASP A 1  132 ? 2.412   163.664 27.848  1.00 24.88  ? 132 ASP A C   1 
ATOM   1015  O  O   . ASP A 1  132 ? 2.168   162.532 28.281  1.00 24.53  ? 132 ASP A O   1 
ATOM   1016  C  CB  . ASP A 1  132 ? 1.486   165.279 29.470  1.00 35.69  ? 132 ASP A CB  1 
ATOM   1017  C  CG  . ASP A 1  132 ? 1.664   166.147 30.693  1.00 41.26  ? 132 ASP A CG  1 
ATOM   1018  O  OD1 . ASP A 1  132 ? 2.725   166.015 31.346  1.00 42.75  ? 132 ASP A OD1 1 
ATOM   1019  O  OD2 . ASP A 1  132 ? 0.757   166.961 31.007  1.00 43.03  ? 132 ASP A OD2 1 
ATOM   1020  N  N   . VAL A 1  133 ? 2.065   164.016 26.602  1.00 19.89  ? 133 VAL A N   1 
ATOM   1021  C  CA  . VAL A 1  133 ? 1.564   162.932 25.753  1.00 18.36  ? 133 VAL A CA  1 
ATOM   1022  C  C   . VAL A 1  133 ? 2.710   162.067 25.294  1.00 17.36  ? 133 VAL A C   1 
ATOM   1023  O  O   . VAL A 1  133 ? 2.750   160.836 25.235  1.00 19.17  ? 133 VAL A O   1 
ATOM   1024  C  CB  . VAL A 1  133 ? 0.693   163.375 24.582  1.00 14.54  ? 133 VAL A CB  1 
ATOM   1025  C  CG1 . VAL A 1  133 ? 0.857   162.438 23.395  1.00 2.20   ? 133 VAL A CG1 1 
ATOM   1026  C  CG2 . VAL A 1  133 ? -0.784  163.360 25.004  1.00 18.12  ? 133 VAL A CG2 1 
ATOM   1027  N  N   . ILE A 1  134 ? 3.813   162.718 24.935  1.00 14.63  ? 134 ILE A N   1 
ATOM   1028  C  CA  . ILE A 1  134 ? 4.918   161.868 24.456  1.00 14.43  ? 134 ILE A CA  1 
ATOM   1029  C  C   . ILE A 1  134 ? 5.502   161.024 25.571  1.00 14.95  ? 134 ILE A C   1 
ATOM   1030  O  O   . ILE A 1  134 ? 5.938   159.890 25.324  1.00 4.32   ? 134 ILE A O   1 
ATOM   1031  C  CB  . ILE A 1  134 ? 6.019   162.735 23.827  1.00 21.38  ? 134 ILE A CB  1 
ATOM   1032  C  CG1 . ILE A 1  134 ? 5.462   163.699 22.776  1.00 14.02  ? 134 ILE A CG1 1 
ATOM   1033  C  CG2 . ILE A 1  134 ? 7.098   161.837 23.244  1.00 2.20   ? 134 ILE A CG2 1 
ATOM   1034  C  CD1 . ILE A 1  134 ? 4.019   163.452 22.429  1.00 19.61  ? 134 ILE A CD1 1 
ATOM   1035  N  N   . LEU A 1  135 ? 5.642   161.563 26.791  1.00 14.21  ? 135 LEU A N   1 
ATOM   1036  C  CA  . LEU A 1  135 ? 6.055   160.753 27.945  1.00 10.06  ? 135 LEU A CA  1 
ATOM   1037  C  C   . LEU A 1  135 ? 5.126   159.544 28.036  1.00 7.30   ? 135 LEU A C   1 
ATOM   1038  O  O   . LEU A 1  135 ? 5.535   158.391 28.054  1.00 10.14  ? 135 LEU A O   1 
ATOM   1039  C  CB  . LEU A 1  135 ? 6.041   161.578 29.216  1.00 14.26  ? 135 LEU A CB  1 
ATOM   1040  C  CG  . LEU A 1  135 ? 7.163   162.513 29.616  1.00 13.69  ? 135 LEU A CG  1 
ATOM   1041  C  CD1 . LEU A 1  135 ? 7.002   163.057 31.040  1.00 2.20   ? 135 LEU A CD1 1 
ATOM   1042  C  CD2 . LEU A 1  135 ? 8.542   161.871 29.521  1.00 13.46  ? 135 LEU A CD2 1 
ATOM   1043  N  N   . GLN A 1  136 ? 3.819   159.725 27.898  1.00 9.97   ? 136 GLN A N   1 
ATOM   1044  C  CA  . GLN A 1  136 ? 2.948   158.557 27.861  1.00 12.28  ? 136 GLN A CA  1 
ATOM   1045  C  C   . GLN A 1  136 ? 3.285   157.664 26.685  1.00 7.50   ? 136 GLN A C   1 
ATOM   1046  O  O   . GLN A 1  136 ? 3.386   156.456 26.860  1.00 4.19   ? 136 GLN A O   1 
ATOM   1047  C  CB  . GLN A 1  136 ? 1.474   158.956 27.831  1.00 23.60  ? 136 GLN A CB  1 
ATOM   1048  C  CG  . GLN A 1  136 ? 0.577   157.810 28.284  1.00 45.65  ? 136 GLN A CG  1 
ATOM   1049  C  CD  . GLN A 1  136 ? -0.849  158.252 28.523  1.00 56.27  ? 136 GLN A CD  1 
ATOM   1050  O  OE1 . GLN A 1  136 ? -1.197  159.417 28.326  1.00 69.60  ? 136 GLN A OE1 1 
ATOM   1051  N  NE2 . GLN A 1  136 ? -1.702  157.339 28.951  1.00 56.33  ? 136 GLN A NE2 1 
ATOM   1052  N  N   . GLU A 1  137 ? 3.422   158.228 25.480  1.00 8.34   ? 137 GLU A N   1 
ATOM   1053  C  CA  . GLU A 1  137 ? 3.713   157.329 24.352  1.00 13.74  ? 137 GLU A CA  1 
ATOM   1054  C  C   . GLU A 1  137 ? 4.943   156.477 24.646  1.00 11.73  ? 137 GLU A C   1 
ATOM   1055  O  O   . GLU A 1  137 ? 4.871   155.248 24.529  1.00 8.45   ? 137 GLU A O   1 
ATOM   1056  C  CB  . GLU A 1  137 ? 3.776   158.009 23.000  1.00 15.02  ? 137 GLU A CB  1 
ATOM   1057  C  CG  . GLU A 1  137 ? 3.067   159.348 22.876  1.00 22.90  ? 137 GLU A CG  1 
ATOM   1058  C  CD  . GLU A 1  137 ? 2.622   159.607 21.444  1.00 24.63  ? 137 GLU A CD  1 
ATOM   1059  O  OE1 . GLU A 1  137 ? 3.543   159.698 20.605  1.00 22.01  ? 137 GLU A OE1 1 
ATOM   1060  O  OE2 . GLU A 1  137 ? 1.397   159.695 21.190  1.00 23.70  ? 137 GLU A OE2 1 
ATOM   1061  N  N   . LEU A 1  138 ? 6.050   157.041 25.116  1.00 11.60  ? 138 LEU A N   1 
ATOM   1062  C  CA  . LEU A 1  138 ? 7.262   156.301 25.456  1.00 9.78   ? 138 LEU A CA  1 
ATOM   1063  C  C   . LEU A 1  138 ? 6.977   155.105 26.355  1.00 8.48   ? 138 LEU A C   1 
ATOM   1064  O  O   . LEU A 1  138 ? 7.386   153.964 26.139  1.00 4.39   ? 138 LEU A O   1 
ATOM   1065  C  CB  . LEU A 1  138 ? 8.310   157.221 26.084  1.00 10.74  ? 138 LEU A CB  1 
ATOM   1066  C  CG  . LEU A 1  138 ? 8.973   158.276 25.211  1.00 14.02  ? 138 LEU A CG  1 
ATOM   1067  C  CD1 . LEU A 1  138 ? 10.468  158.073 25.034  1.00 8.29   ? 138 LEU A CD1 1 
ATOM   1068  C  CD2 . LEU A 1  138 ? 8.311   158.404 23.847  1.00 7.55   ? 138 LEU A CD2 1 
ATOM   1069  N  N   . GLN A 1  139 ? 6.160   155.382 27.371  1.00 9.71   ? 139 GLN A N   1 
ATOM   1070  C  CA  . GLN A 1  139 ? 5.707   154.346 28.289  1.00 11.02  ? 139 GLN A CA  1 
ATOM   1071  C  C   . GLN A 1  139 ? 5.020   153.236 27.510  1.00 8.88   ? 139 GLN A C   1 
ATOM   1072  O  O   . GLN A 1  139 ? 5.299   152.051 27.631  1.00 6.03   ? 139 GLN A O   1 
ATOM   1073  C  CB  . GLN A 1  139 ? 4.837   154.992 29.368  1.00 14.22  ? 139 GLN A CB  1 
ATOM   1074  C  CG  . GLN A 1  139 ? 4.776   154.204 30.653  1.00 33.74  ? 139 GLN A CG  1 
ATOM   1075  C  CD  . GLN A 1  139 ? 3.867   154.743 31.724  1.00 38.02  ? 139 GLN A CD  1 
ATOM   1076  O  OE1 . GLN A 1  139 ? 3.490   155.907 31.682  1.00 41.26  ? 139 GLN A OE1 1 
ATOM   1077  N  NE2 . GLN A 1  139 ? 3.488   153.935 32.714  1.00 47.65  ? 139 GLN A NE2 1 
ATOM   1078  N  N   . GLU A 1  140 ? 4.209   153.596 26.509  1.00 12.63  ? 140 GLU A N   1 
ATOM   1079  C  CA  . GLU A 1  140 ? 3.538   152.565 25.721  1.00 9.81   ? 140 GLU A CA  1 
ATOM   1080  C  C   . GLU A 1  140 ? 4.515   151.902 24.787  1.00 6.41   ? 140 GLU A C   1 
ATOM   1081  O  O   . GLU A 1  140 ? 4.488   150.681 24.655  1.00 4.51   ? 140 GLU A O   1 
ATOM   1082  C  CB  . GLU A 1  140 ? 2.286   153.119 25.043  1.00 17.65  ? 140 GLU A CB  1 
ATOM   1083  C  CG  . GLU A 1  140 ? 1.348   153.780 26.047  1.00 32.61  ? 140 GLU A CG  1 
ATOM   1084  C  CD  . GLU A 1  140 ? 0.117   154.418 25.439  1.00 41.08  ? 140 GLU A CD  1 
ATOM   1085  O  OE1 . GLU A 1  140 ? 0.053   154.470 24.188  1.00 44.47  ? 140 GLU A OE1 1 
ATOM   1086  O  OE2 . GLU A 1  140 ? -0.758  154.851 26.232  1.00 37.83  ? 140 GLU A OE2 1 
ATOM   1087  N  N   . ASN A 1  141 ? 5.528   152.630 24.313  1.00 8.44   ? 141 ASN A N   1 
ATOM   1088  C  CA  . ASN A 1  141 ? 6.462   152.002 23.371  1.00 8.87   ? 141 ASN A CA  1 
ATOM   1089  C  C   . ASN A 1  141 ? 7.183   150.852 24.028  1.00 5.60   ? 141 ASN A C   1 
ATOM   1090  O  O   . ASN A 1  141 ? 7.343   149.761 23.489  1.00 7.45   ? 141 ASN A O   1 
ATOM   1091  C  CB  . ASN A 1  141 ? 7.431   153.022 22.774  1.00 14.66  ? 141 ASN A CB  1 
ATOM   1092  C  CG  . ASN A 1  141 ? 6.640   154.058 21.981  1.00 15.87  ? 141 ASN A CG  1 
ATOM   1093  O  OD1 . ASN A 1  141 ? 5.493   154.344 22.316  1.00 15.63  ? 141 ASN A OD1 1 
ATOM   1094  N  ND2 . ASN A 1  141 ? 7.223   154.619 20.944  1.00 20.92  ? 141 ASN A ND2 1 
ATOM   1095  N  N   . ASP A 1  142 ? 7.490   151.015 25.304  1.00 7.08   ? 142 ASP A N   1 
ATOM   1096  C  CA  . ASP A 1  142 ? 8.189   149.990 26.073  1.00 2.28   ? 142 ASP A CA  1 
ATOM   1097  C  C   . ASP A 1  142 ? 7.456   148.659 26.138  1.00 2.20   ? 142 ASP A C   1 
ATOM   1098  O  O   . ASP A 1  142 ? 8.063   147.639 26.418  1.00 2.44   ? 142 ASP A O   1 
ATOM   1099  C  CB  . ASP A 1  142 ? 8.404   150.545 27.478  1.00 6.30   ? 142 ASP A CB  1 
ATOM   1100  C  CG  . ASP A 1  142 ? 9.417   151.660 27.560  1.00 9.88   ? 142 ASP A CG  1 
ATOM   1101  O  OD1 . ASP A 1  142 ? 10.296  151.815 26.696  1.00 10.41  ? 142 ASP A OD1 1 
ATOM   1102  O  OD2 . ASP A 1  142 ? 9.308   152.376 28.580  1.00 16.74  ? 142 ASP A OD2 1 
ATOM   1103  N  N   . THR A 1  143 ? 6.146   148.692 25.979  1.00 3.23   ? 143 THR A N   1 
ATOM   1104  C  CA  . THR A 1  143 ? 5.278   147.527 26.042  1.00 3.64   ? 143 THR A CA  1 
ATOM   1105  C  C   . THR A 1  143 ? 5.496   146.671 24.787  1.00 2.20   ? 143 THR A C   1 
ATOM   1106  O  O   . THR A 1  143 ? 4.608   145.837 24.557  1.00 2.63   ? 143 THR A O   1 
ATOM   1107  C  CB  . THR A 1  143 ? 3.837   148.012 26.181  1.00 4.31   ? 143 THR A CB  1 
ATOM   1108  O  OG1 . THR A 1  143 ? 3.244   147.424 27.331  1.00 13.79  ? 143 THR A OG1 1 
ATOM   1109  C  CG2 . THR A 1  143 ? 2.965   147.860 24.958  1.00 4.54   ? 143 THR A CG2 1 
ATOM   1110  N  N   . SER A 1  144 ? 6.078   147.305 23.800  1.00 2.20   ? 144 SER A N   1 
ATOM   1111  C  CA  . SER A 1  144 ? 6.321   146.650 22.547  1.00 2.20   ? 144 SER A CA  1 
ATOM   1112  C  C   . SER A 1  144 ? 7.687   146.065 22.342  1.00 6.13   ? 144 SER A C   1 
ATOM   1113  O  O   . SER A 1  144 ? 8.710   146.686 22.069  1.00 6.07   ? 144 SER A O   1 
ATOM   1114  C  CB  . SER A 1  144 ? 5.905   147.393 21.282  1.00 2.20   ? 144 SER A CB  1 
ATOM   1115  O  OG  . SER A 1  144 ? 6.768   147.143 20.187  1.00 3.59   ? 144 SER A OG  1 
ATOM   1116  N  N   . MET A 1  145 ? 7.730   144.734 22.314  1.00 6.31   ? 145 MET A N   1 
ATOM   1117  C  CA  . MET A 1  145 ? 9.002   144.063 22.151  1.00 6.42   ? 145 MET A CA  1 
ATOM   1118  C  C   . MET A 1  145 ? 9.569   144.147 20.760  1.00 7.76   ? 145 MET A C   1 
ATOM   1119  O  O   . MET A 1  145 ? 10.770  143.928 20.551  1.00 10.74  ? 145 MET A O   1 
ATOM   1120  C  CB  . MET A 1  145 ? 8.843   142.602 22.570  1.00 8.63   ? 145 MET A CB  1 
ATOM   1121  C  CG  . MET A 1  145 ? 9.313   142.318 23.983  1.00 7.30   ? 145 MET A CG  1 
ATOM   1122  S  SD  . MET A 1  145 ? 9.052   140.595 24.374  1.00 7.99   ? 145 MET A SD  1 
ATOM   1123  C  CE  . MET A 1  145 ? 7.268   140.678 24.721  1.00 4.83   ? 145 MET A CE  1 
ATOM   1124  N  N   . ARG A 1  146 ? 8.720   144.373 19.759  1.00 5.60   ? 146 ARG A N   1 
ATOM   1125  C  CA  . ARG A 1  146 ? 9.299   144.453 18.413  1.00 7.30   ? 146 ARG A CA  1 
ATOM   1126  C  C   . ARG A 1  146 ? 10.083  145.767 18.324  1.00 5.32   ? 146 ARG A C   1 
ATOM   1127  O  O   . ARG A 1  146 ? 11.181  145.840 17.813  1.00 3.82   ? 146 ARG A O   1 
ATOM   1128  C  CB  . ARG A 1  146 ? 8.225   144.496 17.333  1.00 18.93  ? 146 ARG A CB  1 
ATOM   1129  C  CG  . ARG A 1  146 ? 8.720   145.001 15.984  1.00 28.14  ? 146 ARG A CG  1 
ATOM   1130  C  CD  . ARG A 1  146 ? 8.194   144.091 14.892  1.00 41.73  ? 146 ARG A CD  1 
ATOM   1131  N  NE  . ARG A 1  146 ? 8.797   144.303 13.591  1.00 54.42  ? 146 ARG A NE  1 
ATOM   1132  C  CZ  . ARG A 1  146 ? 8.179   144.280 12.416  1.00 60.20  ? 146 ARG A CZ  1 
ATOM   1133  N  NH1 . ARG A 1  146 ? 6.875   144.050 12.304  1.00 67.07  ? 146 ARG A NH1 1 
ATOM   1134  N  NH2 . ARG A 1  146 ? 8.922   144.506 11.336  1.00 59.87  ? 146 ARG A NH2 1 
ATOM   1135  N  N   . ASP A 1  147 ? 9.342   146.786 18.731  1.00 6.79   ? 147 ASP A N   1 
ATOM   1136  C  CA  . ASP A 1  147 ? 9.864   148.133 18.782  1.00 7.36   ? 147 ASP A CA  1 
ATOM   1137  C  C   . ASP A 1  147 ? 11.088  148.178 19.663  1.00 6.17   ? 147 ASP A C   1 
ATOM   1138  O  O   . ASP A 1  147 ? 12.183  148.404 19.147  1.00 5.59   ? 147 ASP A O   1 
ATOM   1139  C  CB  . ASP A 1  147 ? 8.735   149.059 19.251  1.00 4.03   ? 147 ASP A CB  1 
ATOM   1140  C  CG  . ASP A 1  147 ? 7.824   149.268 18.048  1.00 10.55  ? 147 ASP A CG  1 
ATOM   1141  O  OD1 . ASP A 1  147 ? 8.104   148.559 17.050  1.00 13.39  ? 147 ASP A OD1 1 
ATOM   1142  O  OD2 . ASP A 1  147 ? 6.897   150.092 18.098  1.00 14.49  ? 147 ASP A OD2 1 
ATOM   1143  N  N   . VAL A 1  148 ? 10.967  147.750 20.911  1.00 7.86   ? 148 VAL A N   1 
ATOM   1144  C  CA  . VAL A 1  148 ? 12.078  147.785 21.845  1.00 4.53   ? 148 VAL A CA  1 
ATOM   1145  C  C   . VAL A 1  148 ? 13.292  147.076 21.271  1.00 3.30   ? 148 VAL A C   1 
ATOM   1146  O  O   . VAL A 1  148 ? 14.456  147.378 21.539  1.00 5.79   ? 148 VAL A O   1 
ATOM   1147  C  CB  . VAL A 1  148 ? 11.801  147.148 23.216  1.00 2.20   ? 148 VAL A CB  1 
ATOM   1148  C  CG1 . VAL A 1  148 ? 13.034  147.281 24.107  1.00 3.71   ? 148 VAL A CG1 1 
ATOM   1149  C  CG2 . VAL A 1  148 ? 10.541  147.658 23.865  1.00 4.55   ? 148 VAL A CG2 1 
ATOM   1150  N  N   . VAL A 1  149 ? 13.048  145.977 20.565  1.00 3.97   ? 149 VAL A N   1 
ATOM   1151  C  CA  . VAL A 1  149 ? 14.206  145.262 20.061  1.00 6.28   ? 149 VAL A CA  1 
ATOM   1152  C  C   . VAL A 1  149 ? 14.818  145.923 18.861  1.00 2.78   ? 149 VAL A C   1 
ATOM   1153  O  O   . VAL A 1  149 ? 16.049  146.032 18.798  1.00 9.57   ? 149 VAL A O   1 
ATOM   1154  C  CB  . VAL A 1  149 ? 13.987  143.769 19.867  1.00 10.93  ? 149 VAL A CB  1 
ATOM   1155  C  CG1 . VAL A 1  149 ? 14.334  143.314 18.462  1.00 4.84   ? 149 VAL A CG1 1 
ATOM   1156  C  CG2 . VAL A 1  149 ? 14.861  143.047 20.899  1.00 3.40   ? 149 VAL A CG2 1 
ATOM   1157  N  N   . PHE A 1  150 ? 14.066  146.359 17.858  1.00 5.77   ? 150 PHE A N   1 
ATOM   1158  C  CA  . PHE A 1  150 ? 14.698  147.032 16.734  1.00 5.21   ? 150 PHE A CA  1 
ATOM   1159  C  C   . PHE A 1  150 ? 15.460  148.311 17.087  1.00 4.35   ? 150 PHE A C   1 
ATOM   1160  O  O   . PHE A 1  150 ? 16.435  148.600 16.374  1.00 2.22   ? 150 PHE A O   1 
ATOM   1161  C  CB  . PHE A 1  150 ? 13.714  147.222 15.601  1.00 3.98   ? 150 PHE A CB  1 
ATOM   1162  C  CG  . PHE A 1  150 ? 13.396  146.054 14.728  1.00 2.20   ? 150 PHE A CG  1 
ATOM   1163  C  CD1 . PHE A 1  150 ? 14.239  145.820 13.643  1.00 5.97   ? 150 PHE A CD1 1 
ATOM   1164  C  CD2 . PHE A 1  150 ? 12.302  145.223 14.868  1.00 2.20   ? 150 PHE A CD2 1 
ATOM   1165  C  CE1 . PHE A 1  150 ? 14.082  144.770 12.745  1.00 2.20   ? 150 PHE A CE1 1 
ATOM   1166  C  CE2 . PHE A 1  150 ? 12.126  144.175 13.989  1.00 2.20   ? 150 PHE A CE2 1 
ATOM   1167  C  CZ  . PHE A 1  150 ? 12.954  143.979 12.895  1.00 2.74   ? 150 PHE A CZ  1 
ATOM   1168  N  N   . ASN A 1  151 ? 14.975  149.133 18.005  1.00 5.07   ? 151 ASN A N   1 
ATOM   1169  C  CA  . ASN A 1  151 ? 15.700  150.273 18.555  1.00 5.59   ? 151 ASN A CA  1 
ATOM   1170  C  C   . ASN A 1  151 ? 17.093  149.741 18.966  1.00 4.68   ? 151 ASN A C   1 
ATOM   1171  O  O   . ASN A 1  151 ? 18.112  150.209 18.463  1.00 3.43   ? 151 ASN A O   1 
ATOM   1172  C  CB  . ASN A 1  151 ? 15.040  150.756 19.842  1.00 4.16   ? 151 ASN A CB  1 
ATOM   1173  C  CG  . ASN A 1  151 ? 13.870  151.679 19.769  1.00 5.64   ? 151 ASN A CG  1 
ATOM   1174  O  OD1 . ASN A 1  151 ? 13.589  152.286 18.732  1.00 11.08  ? 151 ASN A OD1 1 
ATOM   1175  N  ND2 . ASN A 1  151 ? 13.134  151.836 20.874  1.00 5.70   ? 151 ASN A ND2 1 
ATOM   1176  N  N   . TYR A 1  152 ? 17.102  148.757 19.873  1.00 5.39   ? 152 TYR A N   1 
ATOM   1177  C  CA  . TYR A 1  152 ? 18.324  148.137 20.360  1.00 5.00   ? 152 TYR A CA  1 
ATOM   1178  C  C   . TYR A 1  152 ? 19.251  147.803 19.201  1.00 4.24   ? 152 TYR A C   1 
ATOM   1179  O  O   . TYR A 1  152 ? 20.455  147.969 19.200  1.00 2.25   ? 152 TYR A O   1 
ATOM   1180  C  CB  . TYR A 1  152 ? 18.077  146.813 21.142  1.00 2.20   ? 152 TYR A CB  1 
ATOM   1181  C  CG  . TYR A 1  152 ? 17.622  147.114 22.558  1.00 3.10   ? 152 TYR A CG  1 
ATOM   1182  C  CD1 . TYR A 1  152 ? 17.284  148.384 22.987  1.00 6.21   ? 152 TYR A CD1 1 
ATOM   1183  C  CD2 . TYR A 1  152 ? 17.510  146.068 23.470  1.00 5.51   ? 152 TYR A CD2 1 
ATOM   1184  C  CE1 . TYR A 1  152 ? 16.870  148.600 24.279  1.00 3.65   ? 152 TYR A CE1 1 
ATOM   1185  C  CE2 . TYR A 1  152 ? 17.074  146.286 24.756  1.00 6.55   ? 152 TYR A CE2 1 
ATOM   1186  C  CZ  . TYR A 1  152 ? 16.757  147.558 25.169  1.00 7.76   ? 152 TYR A CZ  1 
ATOM   1187  O  OH  . TYR A 1  152 ? 16.360  147.771 26.466  1.00 7.80   ? 152 TYR A OH  1 
ATOM   1188  N  N   . LEU A 1  153 ? 18.655  147.199 18.157  1.00 7.87   ? 153 LEU A N   1 
ATOM   1189  C  CA  . LEU A 1  153 ? 19.511  146.745 17.053  1.00 2.20   ? 153 LEU A CA  1 
ATOM   1190  C  C   . LEU A 1  153 ? 20.236  147.952 16.483  1.00 7.12   ? 153 LEU A C   1 
ATOM   1191  O  O   . LEU A 1  153 ? 21.419  147.830 16.176  1.00 10.02  ? 153 LEU A O   1 
ATOM   1192  C  CB  . LEU A 1  153 ? 18.669  146.039 16.001  1.00 2.96   ? 153 LEU A CB  1 
ATOM   1193  C  CG  . LEU A 1  153 ? 19.533  145.532 14.838  1.00 4.08   ? 153 LEU A CG  1 
ATOM   1194  C  CD1 . LEU A 1  153 ? 20.060  144.123 15.209  1.00 13.43  ? 153 LEU A CD1 1 
ATOM   1195  C  CD2 . LEU A 1  153 ? 18.718  145.434 13.577  1.00 5.27   ? 153 LEU A CD2 1 
ATOM   1196  N  N   . HIS A 1  154 ? 19.552  149.084 16.346  1.00 12.30  ? 154 HIS A N   1 
ATOM   1197  C  CA  . HIS A 1  154 ? 20.175  150.284 15.765  1.00 7.38   ? 154 HIS A CA  1 
ATOM   1198  C  C   . HIS A 1  154 ? 21.229  150.790 16.733  1.00 6.83   ? 154 HIS A C   1 
ATOM   1199  O  O   . HIS A 1  154 ? 22.416  150.935 16.466  1.00 8.06   ? 154 HIS A O   1 
ATOM   1200  C  CB  . HIS A 1  154 ? 19.182  151.383 15.452  1.00 5.48   ? 154 HIS A CB  1 
ATOM   1201  C  CG  . HIS A 1  154 ? 18.321  151.132 14.261  1.00 2.72   ? 154 HIS A CG  1 
ATOM   1202  N  ND1 . HIS A 1  154 ? 18.403  151.913 13.137  1.00 12.03  ? 154 HIS A ND1 1 
ATOM   1203  C  CD2 . HIS A 1  154 ? 17.292  150.280 14.060  1.00 2.29   ? 154 HIS A CD2 1 
ATOM   1204  C  CE1 . HIS A 1  154 ? 17.478  151.518 12.268  1.00 12.25  ? 154 HIS A CE1 1 
ATOM   1205  N  NE2 . HIS A 1  154 ? 16.790  150.517 12.795  1.00 2.73   ? 154 HIS A NE2 1 
ATOM   1206  N  N   . ALA A 1  155 ? 20.805  150.990 17.970  1.00 3.80   ? 155 ALA A N   1 
ATOM   1207  C  CA  . ALA A 1  155 ? 21.794  151.351 18.986  1.00 12.20  ? 155 ALA A CA  1 
ATOM   1208  C  C   . ALA A 1  155 ? 23.113  150.580 18.918  1.00 10.21  ? 155 ALA A C   1 
ATOM   1209  O  O   . ALA A 1  155 ? 24.198  151.103 19.172  1.00 16.52  ? 155 ALA A O   1 
ATOM   1210  C  CB  . ALA A 1  155 ? 21.342  151.146 20.432  1.00 2.20   ? 155 ALA A CB  1 
ATOM   1211  N  N   . THR A 1  156 ? 23.020  149.264 18.877  1.00 11.02  ? 156 THR A N   1 
ATOM   1212  C  CA  . THR A 1  156 ? 24.245  148.475 18.914  1.00 11.57  ? 156 THR A CA  1 
ATOM   1213  C  C   . THR A 1  156 ? 24.845  148.398 17.528  1.00 14.39  ? 156 THR A C   1 
ATOM   1214  O  O   . THR A 1  156 ? 26.054  148.306 17.304  1.00 15.29  ? 156 THR A O   1 
ATOM   1215  C  CB  . THR A 1  156 ? 23.926  147.064 19.447  1.00 8.45   ? 156 THR A CB  1 
ATOM   1216  O  OG1 . THR A 1  156 ? 24.456  147.026 20.756  1.00 4.35   ? 156 THR A OG1 1 
ATOM   1217  C  CG2 . THR A 1  156 ? 24.566  145.996 18.595  1.00 8.15   ? 156 THR A CG2 1 
ATOM   1218  N  N   . ALA A 1  157 ? 23.969  148.443 16.514  1.00 13.82  ? 157 ALA A N   1 
ATOM   1219  C  CA  . ALA A 1  157 ? 24.545  148.339 15.158  1.00 10.58  ? 157 ALA A CA  1 
ATOM   1220  C  C   . ALA A 1  157 ? 25.489  149.536 15.015  1.00 8.98   ? 157 ALA A C   1 
ATOM   1221  O  O   . ALA A 1  157 ? 26.500  149.433 14.355  1.00 8.03   ? 157 ALA A O   1 
ATOM   1222  C  CB  . ALA A 1  157 ? 23.426  148.422 14.136  1.00 8.09   ? 157 ALA A CB  1 
ATOM   1223  N  N   . PHE A 1  158 ? 25.009  150.670 15.506  1.00 10.97  ? 158 PHE A N   1 
ATOM   1224  C  CA  . PHE A 1  158 ? 25.644  151.964 15.368  1.00 11.32  ? 158 PHE A CA  1 
ATOM   1225  C  C   . PHE A 1  158 ? 25.983  152.618 16.695  1.00 12.82  ? 158 PHE A C   1 
ATOM   1226  O  O   . PHE A 1  158 ? 25.810  153.812 16.956  1.00 2.86   ? 158 PHE A O   1 
ATOM   1227  C  CB  . PHE A 1  158 ? 24.833  152.862 14.431  1.00 8.07   ? 158 PHE A CB  1 
ATOM   1228  C  CG  . PHE A 1  158 ? 24.267  152.189 13.217  1.00 5.29   ? 158 PHE A CG  1 
ATOM   1229  C  CD1 . PHE A 1  158 ? 25.036  151.962 12.094  1.00 4.71   ? 158 PHE A CD1 1 
ATOM   1230  C  CD2 . PHE A 1  158 ? 22.948  151.763 13.180  1.00 11.55  ? 158 PHE A CD2 1 
ATOM   1231  C  CE1 . PHE A 1  158 ? 24.513  151.329 11.001  1.00 6.84   ? 158 PHE A CE1 1 
ATOM   1232  C  CE2 . PHE A 1  158 ? 22.408  151.152 12.075  1.00 14.32  ? 158 PHE A CE2 1 
ATOM   1233  C  CZ  . PHE A 1  158 ? 23.205  150.938 10.953  1.00 8.70   ? 158 PHE A CZ  1 
ATOM   1234  N  N   . GLN A 1  159 ? 26.610  151.851 17.606  1.00 14.29  ? 159 GLN A N   1 
ATOM   1235  C  CA  . GLN A 1  159 ? 27.008  152.446 18.871  1.00 18.35  ? 159 GLN A CA  1 
ATOM   1236  C  C   . GLN A 1  159 ? 27.693  153.796 18.649  1.00 22.23  ? 159 GLN A C   1 
ATOM   1237  O  O   . GLN A 1  159 ? 28.572  153.978 17.802  1.00 24.11  ? 159 GLN A O   1 
ATOM   1238  C  CB  . GLN A 1  159 ? 27.970  151.586 19.672  1.00 17.02  ? 159 GLN A CB  1 
ATOM   1239  C  CG  . GLN A 1  159 ? 27.983  150.114 19.355  1.00 23.29  ? 159 GLN A CG  1 
ATOM   1240  C  CD  . GLN A 1  159 ? 29.114  149.444 20.123  1.00 28.20  ? 159 GLN A CD  1 
ATOM   1241  O  OE1 . GLN A 1  159 ? 30.127  150.110 20.344  1.00 19.81  ? 159 GLN A OE1 1 
ATOM   1242  N  NE2 . GLN A 1  159 ? 28.883  148.300 20.519  1.00 37.74  ? 159 GLN A NE2 1 
ATOM   1243  N  N   . GLY A 1  160 ? 27.430  154.710 19.585  1.00 19.82  ? 160 GLY A N   1 
ATOM   1244  C  CA  . GLY A 1  160 ? 28.220  155.922 19.537  1.00 21.15  ? 160 GLY A CA  1 
ATOM   1245  C  C   . GLY A 1  160 ? 28.053  156.649 18.220  1.00 23.14  ? 160 GLY A C   1 
ATOM   1246  O  O   . GLY A 1  160 ? 28.849  157.550 17.925  1.00 25.08  ? 160 GLY A O   1 
ATOM   1247  N  N   . THR A 1  161 ? 26.957  156.494 17.475  1.00 25.53  ? 161 THR A N   1 
ATOM   1248  C  CA  . THR A 1  161 ? 26.633  157.471 16.461  1.00 24.74  ? 161 THR A CA  1 
ATOM   1249  C  C   . THR A 1  161 ? 25.209  158.021 16.642  1.00 28.75  ? 161 THR A C   1 
ATOM   1250  O  O   . THR A 1  161 ? 24.272  157.295 16.958  1.00 24.16  ? 161 THR A O   1 
ATOM   1251  C  CB  . THR A 1  161 ? 26.711  157.010 15.004  1.00 19.13  ? 161 THR A CB  1 
ATOM   1252  O  OG1 . THR A 1  161 ? 25.678  156.056 14.721  1.00 32.06  ? 161 THR A OG1 1 
ATOM   1253  C  CG2 . THR A 1  161 ? 28.064  156.464 14.657  1.00 8.46   ? 161 THR A CG2 1 
ATOM   1254  N  N   . PRO A 1  162 ? 25.084  159.239 16.147  1.00 31.43  ? 162 PRO A N   1 
ATOM   1255  C  CA  . PRO A 1  162 ? 23.861  160.028 16.103  1.00 26.48  ? 162 PRO A CA  1 
ATOM   1256  C  C   . PRO A 1  162 ? 22.680  159.273 15.535  1.00 18.43  ? 162 PRO A C   1 
ATOM   1257  O  O   . PRO A 1  162 ? 21.618  159.279 16.174  1.00 5.94   ? 162 PRO A O   1 
ATOM   1258  C  CB  . PRO A 1  162 ? 24.274  161.348 15.424  1.00 26.44  ? 162 PRO A CB  1 
ATOM   1259  C  CG  . PRO A 1  162 ? 25.707  161.473 15.939  1.00 28.31  ? 162 PRO A CG  1 
ATOM   1260  C  CD  . PRO A 1  162 ? 26.264  160.058 15.783  1.00 30.19  ? 162 PRO A CD  1 
ATOM   1261  N  N   . LEU A 1  163 ? 22.888  158.391 14.567  1.00 11.38  ? 163 LEU A N   1 
ATOM   1262  C  CA  . LEU A 1  163 ? 21.866  157.520 14.017  1.00 20.20  ? 163 LEU A CA  1 
ATOM   1263  C  C   . LEU A 1  163 ? 21.366  156.423 14.946  1.00 26.97  ? 163 LEU A C   1 
ATOM   1264  O  O   . LEU A 1  163 ? 20.329  155.779 14.724  1.00 35.17  ? 163 LEU A O   1 
ATOM   1265  C  CB  . LEU A 1  163 ? 22.427  156.870 12.737  1.00 10.08  ? 163 LEU A CB  1 
ATOM   1266  C  CG  . LEU A 1  163 ? 21.461  156.080 11.863  1.00 13.18  ? 163 LEU A CG  1 
ATOM   1267  C  CD1 . LEU A 1  163 ? 20.317  156.940 11.354  1.00 19.17  ? 163 LEU A CD1 1 
ATOM   1268  C  CD2 . LEU A 1  163 ? 22.215  155.364 10.759  1.00 9.79   ? 163 LEU A CD2 1 
ATOM   1269  N  N   . ALA A 1  164 ? 22.038  156.112 16.050  1.00 26.22  ? 164 ALA A N   1 
ATOM   1270  C  CA  . ALA A 1  164 ? 21.572  155.070 16.947  1.00 20.44  ? 164 ALA A CA  1 
ATOM   1271  C  C   . ALA A 1  164 ? 20.614  155.567 18.013  1.00 22.80  ? 164 ALA A C   1 
ATOM   1272  O  O   . ALA A 1  164 ? 20.284  154.801 18.908  1.00 24.43  ? 164 ALA A O   1 
ATOM   1273  C  CB  . ALA A 1  164 ? 22.713  154.337 17.611  1.00 22.32  ? 164 ALA A CB  1 
ATOM   1274  N  N   . GLN A 1  165 ? 20.184  156.816 17.913  1.00 26.47  ? 165 GLN A N   1 
ATOM   1275  C  CA  . GLN A 1  165 ? 19.223  157.306 18.911  1.00 26.90  ? 165 GLN A CA  1 
ATOM   1276  C  C   . GLN A 1  165 ? 17.809  156.923 18.468  1.00 24.55  ? 165 GLN A C   1 
ATOM   1277  O  O   . GLN A 1  165 ? 17.596  156.508 17.326  1.00 23.15  ? 165 GLN A O   1 
ATOM   1278  C  CB  . GLN A 1  165 ? 19.442  158.783 19.122  1.00 30.75  ? 165 GLN A CB  1 
ATOM   1279  C  CG  . GLN A 1  165 ? 19.605  159.592 17.845  1.00 32.26  ? 165 GLN A CG  1 
ATOM   1280  C  CD  . GLN A 1  165 ? 20.463  160.811 18.133  1.00 27.17  ? 165 GLN A CD  1 
ATOM   1281  O  OE1 . GLN A 1  165 ? 20.579  161.229 19.277  1.00 24.94  ? 165 GLN A OE1 1 
ATOM   1282  N  NE2 . GLN A 1  165 ? 21.078  161.416 17.140  1.00 26.54  ? 165 GLN A NE2 1 
ATOM   1283  N  N   . SER A 1  166 ? 16.905  157.020 19.434  1.00 17.90  ? 166 SER A N   1 
ATOM   1284  C  CA  . SER A 1  166 ? 15.512  156.679 19.242  1.00 16.89  ? 166 SER A CA  1 
ATOM   1285  C  C   . SER A 1  166 ? 14.719  157.815 18.621  1.00 15.55  ? 166 SER A C   1 
ATOM   1286  O  O   . SER A 1  166 ? 14.455  158.821 19.285  1.00 19.55  ? 166 SER A O   1 
ATOM   1287  C  CB  . SER A 1  166 ? 14.871  156.384 20.598  1.00 21.07  ? 166 SER A CB  1 
ATOM   1288  O  OG  . SER A 1  166 ? 14.731  157.567 21.360  1.00 34.31  ? 166 SER A OG  1 
ATOM   1289  N  N   . VAL A 1  167 ? 14.193  157.629 17.407  1.00 10.97  ? 167 VAL A N   1 
ATOM   1290  C  CA  . VAL A 1  167 ? 13.368  158.701 16.840  1.00 2.20   ? 167 VAL A CA  1 
ATOM   1291  C  C   . VAL A 1  167 ? 12.524  159.373 17.910  1.00 7.82   ? 167 VAL A C   1 
ATOM   1292  O  O   . VAL A 1  167 ? 12.734  160.533 18.283  1.00 4.12   ? 167 VAL A O   1 
ATOM   1293  C  CB  . VAL A 1  167 ? 12.560  158.188 15.655  1.00 5.48   ? 167 VAL A CB  1 
ATOM   1294  C  CG1 . VAL A 1  167 ? 11.438  159.140 15.269  1.00 3.42   ? 167 VAL A CG1 1 
ATOM   1295  C  CG2 . VAL A 1  167 ? 13.412  157.874 14.439  1.00 6.06   ? 167 VAL A CG2 1 
ATOM   1296  N  N   . GLU A 1  168 ? 11.754  158.563 18.633  1.00 11.85  ? 168 GLU A N   1 
ATOM   1297  C  CA  . GLU A 1  168 ? 10.893  159.011 19.721  1.00 11.32  ? 168 GLU A CA  1 
ATOM   1298  C  C   . GLU A 1  168 ? 11.631  160.056 20.535  1.00 3.70   ? 168 GLU A C   1 
ATOM   1299  O  O   . GLU A 1  168 ? 11.102  161.091 20.961  1.00 4.34   ? 168 GLU A O   1 
ATOM   1300  C  CB  . GLU A 1  168 ? 10.522  157.763 20.528  1.00 19.86  ? 168 GLU A CB  1 
ATOM   1301  C  CG  . GLU A 1  168 ? 10.260  156.523 19.687  1.00 32.75  ? 168 GLU A CG  1 
ATOM   1302  C  CD  . GLU A 1  168 ? 10.069  155.234 20.457  1.00 47.94  ? 168 GLU A CD  1 
ATOM   1303  O  OE1 . GLU A 1  168 ? 10.035  155.182 21.709  1.00 48.90  ? 168 GLU A OE1 1 
ATOM   1304  O  OE2 . GLU A 1  168 ? 9.910   154.159 19.807  1.00 52.55  ? 168 GLU A OE2 1 
ATOM   1305  N  N   . GLY A 1  169 ? 12.896  159.843 20.806  1.00 7.25   ? 169 GLY A N   1 
ATOM   1306  C  CA  . GLY A 1  169 ? 13.741  160.721 21.600  1.00 8.85   ? 169 GLY A CA  1 
ATOM   1307  C  C   . GLY A 1  169 ? 13.804  160.315 23.064  1.00 11.08  ? 169 GLY A C   1 
ATOM   1308  O  O   . GLY A 1  169 ? 12.772  160.141 23.718  1.00 20.81  ? 169 GLY A O   1 
ATOM   1309  N  N   . PRO A 1  170 ? 14.978  160.128 23.618  1.00 7.47   ? 170 PRO A N   1 
ATOM   1310  C  CA  . PRO A 1  170 ? 15.294  159.875 25.001  1.00 7.29   ? 170 PRO A CA  1 
ATOM   1311  C  C   . PRO A 1  170 ? 14.334  160.572 25.959  1.00 3.03   ? 170 PRO A C   1 
ATOM   1312  O  O   . PRO A 1  170 ? 14.146  161.772 25.889  1.00 9.43   ? 170 PRO A O   1 
ATOM   1313  C  CB  . PRO A 1  170 ? 16.662  160.524 25.321  1.00 2.20   ? 170 PRO A CB  1 
ATOM   1314  C  CG  . PRO A 1  170 ? 17.162  160.889 23.961  1.00 8.67   ? 170 PRO A CG  1 
ATOM   1315  C  CD  . PRO A 1  170 ? 16.233  160.343 22.904  1.00 8.97   ? 170 PRO A CD  1 
ATOM   1316  N  N   . SER A 1  171 ? 13.757  159.761 26.815  1.00 12.67  ? 171 SER A N   1 
ATOM   1317  C  CA  . SER A 1  171 ? 12.765  160.237 27.757  1.00 15.21  ? 171 SER A CA  1 
ATOM   1318  C  C   . SER A 1  171 ? 12.999  161.714 28.051  1.00 16.10  ? 171 SER A C   1 
ATOM   1319  O  O   . SER A 1  171 ? 12.364  162.597 27.486  1.00 14.42  ? 171 SER A O   1 
ATOM   1320  C  CB  . SER A 1  171 ? 12.931  159.450 29.070  1.00 19.12  ? 171 SER A CB  1 
ATOM   1321  O  OG  . SER A 1  171 ? 12.652  160.277 30.189  1.00 21.31  ? 171 SER A OG  1 
ATOM   1322  N  N   . GLU A 1  172 ? 13.940  161.901 28.969  1.00 19.32  ? 172 GLU A N   1 
ATOM   1323  C  CA  . GLU A 1  172 ? 14.112  163.148 29.662  1.00 31.99  ? 172 GLU A CA  1 
ATOM   1324  C  C   . GLU A 1  172 ? 14.304  164.393 28.823  1.00 29.71  ? 172 GLU A C   1 
ATOM   1325  O  O   . GLU A 1  172 ? 13.686  165.416 29.168  1.00 30.18  ? 172 GLU A O   1 
ATOM   1326  C  CB  . GLU A 1  172 ? 15.160  163.089 30.759  1.00 50.73  ? 172 GLU A CB  1 
ATOM   1327  C  CG  . GLU A 1  172 ? 16.561  163.374 30.225  1.00 64.62  ? 172 GLU A CG  1 
ATOM   1328  C  CD  . GLU A 1  172 ? 17.602  162.959 31.252  1.00 75.95  ? 172 GLU A CD  1 
ATOM   1329  O  OE1 . GLU A 1  172 ? 17.251  162.821 32.447  1.00 79.99  ? 172 GLU A OE1 1 
ATOM   1330  O  OE2 . GLU A 1  172 ? 18.767  162.775 30.838  1.00 80.89  ? 172 GLU A OE2 1 
ATOM   1331  N  N   . ASN A 1  173 ? 15.093  164.300 27.747  1.00 22.86  ? 173 ASN A N   1 
ATOM   1332  C  CA  . ASN A 1  173 ? 15.071  165.416 26.792  1.00 11.97  ? 173 ASN A CA  1 
ATOM   1333  C  C   . ASN A 1  173 ? 13.646  165.927 26.687  1.00 11.54  ? 173 ASN A C   1 
ATOM   1334  O  O   . ASN A 1  173 ? 13.323  167.028 27.194  1.00 12.22  ? 173 ASN A O   1 
ATOM   1335  C  CB  . ASN A 1  173 ? 15.717  164.996 25.473  1.00 3.63   ? 173 ASN A CB  1 
ATOM   1336  C  CG  . ASN A 1  173 ? 17.224  164.976 25.597  1.00 16.17  ? 173 ASN A CG  1 
ATOM   1337  O  OD1 . ASN A 1  173 ? 17.751  165.438 26.630  1.00 31.83  ? 173 ASN A OD1 1 
ATOM   1338  N  ND2 . ASN A 1  173 ? 18.035  164.478 24.677  1.00 2.20   ? 173 ASN A ND2 1 
ATOM   1339  N  N   . VAL A 1  174 ? 12.682  165.124 26.210  1.00 2.20   ? 174 VAL A N   1 
ATOM   1340  C  CA  . VAL A 1  174 ? 11.303  165.592 26.240  1.00 9.12   ? 174 VAL A CA  1 
ATOM   1341  C  C   . VAL A 1  174 ? 11.016  166.538 27.404  1.00 7.11   ? 174 VAL A C   1 
ATOM   1342  O  O   . VAL A 1  174 ? 10.361  167.562 27.223  1.00 18.06  ? 174 VAL A O   1 
ATOM   1343  C  CB  . VAL A 1  174 ? 10.354  164.407 26.521  1.00 9.83   ? 174 VAL A CB  1 
ATOM   1344  C  CG1 . VAL A 1  174 ? 9.121   164.996 27.195  1.00 13.26  ? 174 VAL A CG1 1 
ATOM   1345  C  CG2 . VAL A 1  174 ? 10.087  163.585 25.296  1.00 5.83   ? 174 VAL A CG2 1 
ATOM   1346  N  N   . ARG A 1  175 ? 11.356  166.173 28.618  1.00 11.37  ? 175 ARG A N   1 
ATOM   1347  C  CA  . ARG A 1  175 ? 11.047  167.091 29.715  1.00 25.84  ? 175 ARG A CA  1 
ATOM   1348  C  C   . ARG A 1  175 ? 11.728  168.457 29.563  1.00 30.09  ? 175 ARG A C   1 
ATOM   1349  O  O   . ARG A 1  175 ? 11.179  169.550 29.699  1.00 32.02  ? 175 ARG A O   1 
ATOM   1350  C  CB  . ARG A 1  175 ? 11.656  166.466 30.982  1.00 32.23  ? 175 ARG A CB  1 
ATOM   1351  C  CG  . ARG A 1  175 ? 10.656  166.355 32.130  1.00 43.46  ? 175 ARG A CG  1 
ATOM   1352  C  CD  . ARG A 1  175 ? 10.925  165.046 32.846  1.00 43.50  ? 175 ARG A CD  1 
ATOM   1353  N  NE  . ARG A 1  175 ? 9.750   164.502 33.534  1.00 51.83  ? 175 ARG A NE  1 
ATOM   1354  C  CZ  . ARG A 1  175 ? 9.733   163.192 33.824  1.00 54.57  ? 175 ARG A CZ  1 
ATOM   1355  N  NH1 . ARG A 1  175 ? 10.778  162.448 33.465  1.00 51.57  ? 175 ARG A NH1 1 
ATOM   1356  N  NH2 . ARG A 1  175 ? 8.723   162.616 34.452  1.00 53.66  ? 175 ARG A NH2 1 
ATOM   1357  N  N   . LYS A 1  176 ? 13.038  168.305 29.400  1.00 30.76  ? 176 LYS A N   1 
ATOM   1358  C  CA  . LYS A 1  176 ? 13.988  169.389 29.326  1.00 29.90  ? 176 LYS A CA  1 
ATOM   1359  C  C   . LYS A 1  176 ? 13.756  170.242 28.093  1.00 29.31  ? 176 LYS A C   1 
ATOM   1360  O  O   . LYS A 1  176 ? 14.032  171.441 28.069  1.00 32.45  ? 176 LYS A O   1 
ATOM   1361  C  CB  . LYS A 1  176 ? 15.403  168.813 29.223  1.00 38.35  ? 176 LYS A CB  1 
ATOM   1362  C  CG  . LYS A 1  176 ? 16.260  168.883 30.466  1.00 47.01  ? 176 LYS A CG  1 
ATOM   1363  C  CD  . LYS A 1  176 ? 17.713  169.180 30.098  1.00 52.94  ? 176 LYS A CD  1 
ATOM   1364  C  CE  . LYS A 1  176 ? 18.616  167.967 30.189  1.00 55.06  ? 176 LYS A CE  1 
ATOM   1365  N  NZ  . LYS A 1  176 ? 19.637  168.116 31.276  1.00 53.48  ? 176 LYS A NZ  1 
ATOM   1366  N  N   . LEU A 1  177 ? 13.371  169.595 26.996  1.00 25.28  ? 177 LEU A N   1 
ATOM   1367  C  CA  . LEU A 1  177 ? 13.428  170.316 25.741  1.00 30.06  ? 177 LEU A CA  1 
ATOM   1368  C  C   . LEU A 1  177 ? 12.996  171.772 25.798  1.00 37.32  ? 177 LEU A C   1 
ATOM   1369  O  O   . LEU A 1  177 ? 11.791  171.992 26.027  1.00 39.20  ? 177 LEU A O   1 
ATOM   1370  C  CB  . LEU A 1  177 ? 12.721  169.573 24.614  1.00 17.38  ? 177 LEU A CB  1 
ATOM   1371  C  CG  . LEU A 1  177 ? 13.461  169.578 23.271  1.00 15.47  ? 177 LEU A CG  1 
ATOM   1372  C  CD1 . LEU A 1  177 ? 14.970  169.485 23.511  1.00 21.83  ? 177 LEU A CD1 1 
ATOM   1373  C  CD2 . LEU A 1  177 ? 13.066  168.421 22.365  1.00 10.88  ? 177 LEU A CD2 1 
ATOM   1374  N  N   . SER A 1  178 ? 13.895  172.714 25.502  1.00 40.11  ? 178 SER A N   1 
ATOM   1375  C  CA  . SER A 1  178 ? 13.607  174.139 25.420  1.00 41.56  ? 178 SER A CA  1 
ATOM   1376  C  C   . SER A 1  178 ? 12.759  174.489 24.187  1.00 40.42  ? 178 SER A C   1 
ATOM   1377  O  O   . SER A 1  178 ? 13.084  174.035 23.082  1.00 39.55  ? 178 SER A O   1 
ATOM   1378  C  CB  . SER A 1  178 ? 14.927  174.931 25.246  1.00 49.72  ? 178 SER A CB  1 
ATOM   1379  O  OG  . SER A 1  178 ? 14.770  175.815 24.128  1.00 53.44  ? 178 SER A OG  1 
ATOM   1380  N  N   . ARG A 1  179 ? 11.738  175.308 24.369  1.00 38.68  ? 179 ARG A N   1 
ATOM   1381  C  CA  . ARG A 1  179 ? 10.823  175.787 23.349  1.00 40.92  ? 179 ARG A CA  1 
ATOM   1382  C  C   . ARG A 1  179 ? 11.470  176.466 22.145  1.00 38.03  ? 179 ARG A C   1 
ATOM   1383  O  O   . ARG A 1  179 ? 10.924  176.471 21.036  1.00 37.26  ? 179 ARG A O   1 
ATOM   1384  C  CB  . ARG A 1  179 ? 9.844   176.816 23.960  1.00 48.36  ? 179 ARG A CB  1 
ATOM   1385  C  CG  . ARG A 1  179 ? 10.560  178.079 24.422  1.00 61.84  ? 179 ARG A CG  1 
ATOM   1386  C  CD  . ARG A 1  179 ? 9.870   179.357 24.012  1.00 66.83  ? 179 ARG A CD  1 
ATOM   1387  N  NE  . ARG A 1  179 ? 10.776  180.505 23.904  1.00 69.39  ? 179 ARG A NE  1 
ATOM   1388  C  CZ  . ARG A 1  179 ? 10.399  181.751 24.189  1.00 70.93  ? 179 ARG A CZ  1 
ATOM   1389  N  NH1 . ARG A 1  179 ? 9.146   181.953 24.587  1.00 69.67  ? 179 ARG A NH1 1 
ATOM   1390  N  NH2 . ARG A 1  179 ? 11.259  182.755 24.074  1.00 71.71  ? 179 ARG A NH2 1 
ATOM   1391  N  N   . ALA A 1  180 ? 12.592  177.131 22.371  1.00 34.65  ? 180 ALA A N   1 
ATOM   1392  C  CA  . ALA A 1  180 ? 13.428  177.724 21.351  1.00 31.16  ? 180 ALA A CA  1 
ATOM   1393  C  C   . ALA A 1  180 ? 13.944  176.701 20.333  1.00 29.52  ? 180 ALA A C   1 
ATOM   1394  O  O   . ALA A 1  180 ? 14.139  177.008 19.160  1.00 27.32  ? 180 ALA A O   1 
ATOM   1395  C  CB  . ALA A 1  180 ? 14.652  178.291 22.092  1.00 29.23  ? 180 ALA A CB  1 
ATOM   1396  N  N   . ASP A 1  181 ? 14.250  175.522 20.850  1.00 28.83  ? 181 ASP A N   1 
ATOM   1397  C  CA  . ASP A 1  181 ? 14.985  174.469 20.204  1.00 28.17  ? 181 ASP A CA  1 
ATOM   1398  C  C   . ASP A 1  181 ? 14.225  173.871 19.029  1.00 27.56  ? 181 ASP A C   1 
ATOM   1399  O  O   . ASP A 1  181 ? 14.862  173.396 18.088  1.00 22.32  ? 181 ASP A O   1 
ATOM   1400  C  CB  . ASP A 1  181 ? 15.353  173.354 21.168  1.00 39.38  ? 181 ASP A CB  1 
ATOM   1401  C  CG  . ASP A 1  181 ? 16.187  173.726 22.360  1.00 44.77  ? 181 ASP A CG  1 
ATOM   1402  O  OD1 . ASP A 1  181 ? 16.768  174.826 22.439  1.00 55.56  ? 181 ASP A OD1 1 
ATOM   1403  O  OD2 . ASP A 1  181 ? 16.256  172.865 23.265  1.00 46.29  ? 181 ASP A OD2 1 
ATOM   1404  N  N   . LEU A 1  182 ? 12.901  173.905 19.181  1.00 27.40  ? 182 LEU A N   1 
ATOM   1405  C  CA  . LEU A 1  182 ? 12.006  173.378 18.147  1.00 30.24  ? 182 LEU A CA  1 
ATOM   1406  C  C   . LEU A 1  182 ? 12.182  174.208 16.865  1.00 32.35  ? 182 LEU A C   1 
ATOM   1407  O  O   . LEU A 1  182 ? 12.468  173.677 15.789  1.00 24.66  ? 182 LEU A O   1 
ATOM   1408  C  CB  . LEU A 1  182 ? 10.553  173.367 18.637  1.00 25.27  ? 182 LEU A CB  1 
ATOM   1409  C  CG  . LEU A 1  182 ? 10.106  172.335 19.667  1.00 16.19  ? 182 LEU A CG  1 
ATOM   1410  C  CD1 . LEU A 1  182 ? 8.596   172.118 19.746  1.00 3.26   ? 182 LEU A CD1 1 
ATOM   1411  C  CD2 . LEU A 1  182 ? 10.809  171.008 19.377  1.00 18.94  ? 182 LEU A CD2 1 
ATOM   1412  N  N   . THR A 1  183 ? 12.170  175.519 17.105  1.00 36.28  ? 183 THR A N   1 
ATOM   1413  C  CA  . THR A 1  183 ? 12.435  176.543 16.108  1.00 40.01  ? 183 THR A CA  1 
ATOM   1414  C  C   . THR A 1  183 ? 13.708  176.233 15.325  1.00 39.37  ? 183 THR A C   1 
ATOM   1415  O  O   . THR A 1  183 ? 13.664  175.890 14.136  1.00 40.58  ? 183 THR A O   1 
ATOM   1416  C  CB  . THR A 1  183 ? 12.557  177.917 16.802  1.00 40.69  ? 183 THR A CB  1 
ATOM   1417  O  OG1 . THR A 1  183 ? 11.321  178.235 17.463  1.00 39.57  ? 183 THR A OG1 1 
ATOM   1418  C  CG2 . THR A 1  183 ? 12.897  179.002 15.793  1.00 46.91  ? 183 THR A CG2 1 
ATOM   1419  N  N   . GLU A 1  184 ? 14.845  176.300 16.023  1.00 36.12  ? 184 GLU A N   1 
ATOM   1420  C  CA  . GLU A 1  184 ? 16.151  176.037 15.427  1.00 31.76  ? 184 GLU A CA  1 
ATOM   1421  C  C   . GLU A 1  184 ? 16.130  174.772 14.578  1.00 26.93  ? 184 GLU A C   1 
ATOM   1422  O  O   . GLU A 1  184 ? 16.401  174.791 13.384  1.00 24.33  ? 184 GLU A O   1 
ATOM   1423  C  CB  . GLU A 1  184 ? 17.277  175.960 16.450  1.00 33.56  ? 184 GLU A CB  1 
ATOM   1424  C  CG  . GLU A 1  184 ? 17.505  177.227 17.256  1.00 46.44  ? 184 GLU A CG  1 
ATOM   1425  C  CD  . GLU A 1  184 ? 18.967  177.493 17.555  1.00 54.92  ? 184 GLU A CD  1 
ATOM   1426  O  OE1 . GLU A 1  184 ? 19.521  176.876 18.501  1.00 59.42  ? 184 GLU A OE1 1 
ATOM   1427  O  OE2 . GLU A 1  184 ? 19.580  178.330 16.854  1.00 57.40  ? 184 GLU A OE2 1 
ATOM   1428  N  N   . TYR A 1  185 ? 15.588  173.718 15.173  1.00 25.69  ? 185 TYR A N   1 
ATOM   1429  C  CA  . TYR A 1  185 ? 15.374  172.482 14.460  1.00 27.06  ? 185 TYR A CA  1 
ATOM   1430  C  C   . TYR A 1  185 ? 14.660  172.703 13.135  1.00 24.82  ? 185 TYR A C   1 
ATOM   1431  O  O   . TYR A 1  185 ? 15.250  172.480 12.072  1.00 22.31  ? 185 TYR A O   1 
ATOM   1432  C  CB  . TYR A 1  185 ? 14.607  171.469 15.359  1.00 28.05  ? 185 TYR A CB  1 
ATOM   1433  C  CG  . TYR A 1  185 ? 14.512  170.131 14.636  1.00 20.78  ? 185 TYR A CG  1 
ATOM   1434  C  CD1 . TYR A 1  185 ? 15.626  169.325 14.509  1.00 19.14  ? 185 TYR A CD1 1 
ATOM   1435  C  CD2 . TYR A 1  185 ? 13.328  169.723 14.044  1.00 15.39  ? 185 TYR A CD2 1 
ATOM   1436  C  CE1 . TYR A 1  185 ? 15.544  168.134 13.821  1.00 21.26  ? 185 TYR A CE1 1 
ATOM   1437  C  CE2 . TYR A 1  185 ? 13.255  168.530 13.363  1.00 14.60  ? 185 TYR A CE2 1 
ATOM   1438  C  CZ  . TYR A 1  185 ? 14.360  167.729 13.246  1.00 14.80  ? 185 TYR A CZ  1 
ATOM   1439  O  OH  . TYR A 1  185 ? 14.339  166.525 12.578  1.00 9.77   ? 185 TYR A OH  1 
ATOM   1440  N  N   . LEU A 1  186 ? 13.396  173.131 13.231  1.00 22.98  ? 186 LEU A N   1 
ATOM   1441  C  CA  . LEU A 1  186 ? 12.635  173.350 11.992  1.00 22.19  ? 186 LEU A CA  1 
ATOM   1442  C  C   . LEU A 1  186 ? 13.481  174.213 11.060  1.00 23.38  ? 186 LEU A C   1 
ATOM   1443  O  O   . LEU A 1  186 ? 13.976  173.756 10.025  1.00 20.31  ? 186 LEU A O   1 
ATOM   1444  C  CB  . LEU A 1  186 ? 11.297  173.997 12.333  1.00 17.64  ? 186 LEU A CB  1 
ATOM   1445  C  CG  . LEU A 1  186 ? 10.280  173.080 13.024  1.00 14.88  ? 186 LEU A CG  1 
ATOM   1446  C  CD1 . LEU A 1  186 ? 9.403   173.815 14.020  1.00 4.93   ? 186 LEU A CD1 1 
ATOM   1447  C  CD2 . LEU A 1  186 ? 9.533   172.296 11.959  1.00 8.60   ? 186 LEU A CD2 1 
ATOM   1448  N  N   . SER A 1  187 ? 13.818  175.403 11.581  1.00 24.05  ? 187 SER A N   1 
ATOM   1449  C  CA  . SER A 1  187 ? 14.448  176.420 10.740  1.00 25.89  ? 187 SER A CA  1 
ATOM   1450  C  C   . SER A 1  187 ? 15.552  175.795 9.915   1.00 24.12  ? 187 SER A C   1 
ATOM   1451  O  O   . SER A 1  187 ? 15.560  175.732 8.684   1.00 17.42  ? 187 SER A O   1 
ATOM   1452  C  CB  . SER A 1  187 ? 14.908  177.598 11.589  1.00 27.07  ? 187 SER A CB  1 
ATOM   1453  O  OG  . SER A 1  187 ? 13.750  178.448 11.722  1.00 47.35  ? 187 SER A OG  1 
ATOM   1454  N  N   . ARG A 1  188 ? 16.511  175.266 10.689  1.00 22.71  ? 188 ARG A N   1 
ATOM   1455  C  CA  . ARG A 1  188 ? 17.629  174.611 10.064  1.00 20.64  ? 188 ARG A CA  1 
ATOM   1456  C  C   . ARG A 1  188 ? 17.277  173.414 9.210   1.00 20.94  ? 188 ARG A C   1 
ATOM   1457  O  O   . ARG A 1  188 ? 18.191  173.073 8.428   1.00 25.58  ? 188 ARG A O   1 
ATOM   1458  C  CB  . ARG A 1  188 ? 18.703  174.162 11.039  1.00 20.24  ? 188 ARG A CB  1 
ATOM   1459  C  CG  . ARG A 1  188 ? 18.906  175.118 12.190  1.00 41.11  ? 188 ARG A CG  1 
ATOM   1460  C  CD  . ARG A 1  188 ? 19.939  174.542 13.145  1.00 58.97  ? 188 ARG A CD  1 
ATOM   1461  N  NE  . ARG A 1  188 ? 20.405  175.516 14.134  1.00 71.54  ? 188 ARG A NE  1 
ATOM   1462  C  CZ  . ARG A 1  188 ? 21.298  175.234 15.082  1.00 76.29  ? 188 ARG A CZ  1 
ATOM   1463  N  NH1 . ARG A 1  188 ? 21.832  174.021 15.191  1.00 77.57  ? 188 ARG A NH1 1 
ATOM   1464  N  NH2 . ARG A 1  188 ? 21.676  176.172 15.940  1.00 78.77  ? 188 ARG A NH2 1 
ATOM   1465  N  N   . HIS A 1  189 ? 16.248  172.604 9.462   1.00 15.67  ? 189 HIS A N   1 
ATOM   1466  C  CA  . HIS A 1  189 ? 16.196  171.409 8.615   1.00 14.25  ? 189 HIS A CA  1 
ATOM   1467  C  C   . HIS A 1  189 ? 15.023  171.412 7.661   1.00 15.48  ? 189 HIS A C   1 
ATOM   1468  O  O   . HIS A 1  189 ? 15.018  170.629 6.701   1.00 15.78  ? 189 HIS A O   1 
ATOM   1469  C  CB  . HIS A 1  189 ? 16.300  170.115 9.367   1.00 17.63  ? 189 HIS A CB  1 
ATOM   1470  C  CG  . HIS A 1  189 ? 17.243  169.989 10.502  1.00 18.54  ? 189 HIS A CG  1 
ATOM   1471  N  ND1 . HIS A 1  189 ? 18.531  169.539 10.306  1.00 17.15  ? 189 HIS A ND1 1 
ATOM   1472  C  CD2 . HIS A 1  189 ? 17.124  170.234 11.832  1.00 19.44  ? 189 HIS A CD2 1 
ATOM   1473  C  CE1 . HIS A 1  189 ? 19.166  169.516 11.460  1.00 16.27  ? 189 HIS A CE1 1 
ATOM   1474  N  NE2 . HIS A 1  189 ? 18.335  169.932 12.408  1.00 22.03  ? 189 HIS A NE2 1 
ATOM   1475  N  N   . TYR A 1  190 ? 14.028  172.291 7.875   1.00 16.86  ? 190 TYR A N   1 
ATOM   1476  C  CA  . TYR A 1  190 ? 12.905  172.261 6.953   1.00 19.26  ? 190 TYR A CA  1 
ATOM   1477  C  C   . TYR A 1  190 ? 13.090  173.044 5.673   1.00 16.62  ? 190 TYR A C   1 
ATOM   1478  O  O   . TYR A 1  190 ? 12.232  172.857 4.808   1.00 13.33  ? 190 TYR A O   1 
ATOM   1479  C  CB  . TYR A 1  190 ? 11.520  172.369 7.541   1.00 22.79  ? 190 TYR A CB  1 
ATOM   1480  C  CG  . TYR A 1  190 ? 10.962  171.141 8.250   1.00 31.33  ? 190 TYR A CG  1 
ATOM   1481  C  CD1 . TYR A 1  190 ? 11.740  170.503 9.217   1.00 33.30  ? 190 TYR A CD1 1 
ATOM   1482  C  CD2 . TYR A 1  190 ? 9.706   170.593 8.016   1.00 25.35  ? 190 TYR A CD2 1 
ATOM   1483  C  CE1 . TYR A 1  190 ? 11.291  169.400 9.899   1.00 30.58  ? 190 TYR A CE1 1 
ATOM   1484  C  CE2 . TYR A 1  190 ? 9.238   169.487 8.700   1.00 23.31  ? 190 TYR A CE2 1 
ATOM   1485  C  CZ  . TYR A 1  190 ? 10.032  168.890 9.647   1.00 28.51  ? 190 TYR A CZ  1 
ATOM   1486  O  OH  . TYR A 1  190 ? 9.640   167.788 10.377  1.00 29.85  ? 190 TYR A OH  1 
ATOM   1487  N  N   . LYS A 1  191 ? 14.277  173.561 5.405   1.00 19.50  ? 191 LYS A N   1 
ATOM   1488  C  CA  . LYS A 1  191 ? 14.649  174.353 4.260   1.00 18.66  ? 191 LYS A CA  1 
ATOM   1489  C  C   . LYS A 1  191 ? 14.936  173.538 3.010   1.00 18.49  ? 191 LYS A C   1 
ATOM   1490  O  O   . LYS A 1  191 ? 16.099  173.124 2.858   1.00 12.59  ? 191 LYS A O   1 
ATOM   1491  C  CB  . LYS A 1  191 ? 15.918  175.207 4.504   1.00 18.25  ? 191 LYS A CB  1 
ATOM   1492  C  CG  . LYS A 1  191 ? 16.795  174.844 5.661   1.00 7.16   ? 191 LYS A CG  1 
ATOM   1493  C  CD  . LYS A 1  191 ? 18.121  175.592 5.662   1.00 18.59  ? 191 LYS A CD  1 
ATOM   1494  C  CE  . LYS A 1  191 ? 19.219  174.647 6.150   1.00 33.45  ? 191 LYS A CE  1 
ATOM   1495  N  NZ  . LYS A 1  191 ? 20.546  175.240 6.447   1.00 35.92  ? 191 LYS A NZ  1 
ATOM   1496  N  N   . ALA A 1  192 ? 13.982  173.343 2.098   1.00 20.58  ? 192 ALA A N   1 
ATOM   1497  C  CA  . ALA A 1  192 ? 14.385  172.600 0.879   1.00 25.71  ? 192 ALA A CA  1 
ATOM   1498  C  C   . ALA A 1  192 ? 15.591  173.365 0.332   1.00 27.69  ? 192 ALA A C   1 
ATOM   1499  O  O   . ALA A 1  192 ? 15.770  174.504 0.771   1.00 32.24  ? 192 ALA A O   1 
ATOM   1500  C  CB  . ALA A 1  192 ? 13.320  172.509 -0.184  1.00 27.41  ? 192 ALA A CB  1 
ATOM   1501  N  N   . PRO A 1  193 ? 16.394  172.764 -0.501  1.00 30.82  ? 193 PRO A N   1 
ATOM   1502  C  CA  . PRO A 1  193 ? 16.159  171.609 -1.307  1.00 35.21  ? 193 PRO A CA  1 
ATOM   1503  C  C   . PRO A 1  193 ? 15.681  170.309 -0.692  1.00 36.01  ? 193 PRO A C   1 
ATOM   1504  O  O   . PRO A 1  193 ? 15.277  169.415 -1.465  1.00 36.32  ? 193 PRO A O   1 
ATOM   1505  C  CB  . PRO A 1  193 ? 17.461  171.303 -2.107  1.00 34.96  ? 193 PRO A CB  1 
ATOM   1506  C  CG  . PRO A 1  193 ? 18.368  172.424 -1.698  1.00 32.59  ? 193 PRO A CG  1 
ATOM   1507  C  CD  . PRO A 1  193 ? 17.563  173.515 -1.045  1.00 32.48  ? 193 PRO A CD  1 
ATOM   1508  N  N   . ARG A 1  194 ? 15.849  170.104 0.602   1.00 30.23  ? 194 ARG A N   1 
ATOM   1509  C  CA  . ARG A 1  194 ? 15.512  168.917 1.346   1.00 26.54  ? 194 ARG A CA  1 
ATOM   1510  C  C   . ARG A 1  194 ? 14.136  168.308 1.053   1.00 23.38  ? 194 ARG A C   1 
ATOM   1511  O  O   . ARG A 1  194 ? 13.989  167.149 0.667   1.00 21.54  ? 194 ARG A O   1 
ATOM   1512  C  CB  . ARG A 1  194 ? 15.557  169.176 2.854   1.00 33.83  ? 194 ARG A CB  1 
ATOM   1513  C  CG  . ARG A 1  194 ? 16.798  169.836 3.405   1.00 46.84  ? 194 ARG A CG  1 
ATOM   1514  C  CD  . ARG A 1  194 ? 17.958  168.891 3.613   1.00 52.13  ? 194 ARG A CD  1 
ATOM   1515  N  NE  . ARG A 1  194 ? 19.259  169.535 3.439   1.00 65.31  ? 194 ARG A NE  1 
ATOM   1516  C  CZ  . ARG A 1  194 ? 20.395  168.856 3.301   1.00 73.54  ? 194 ARG A CZ  1 
ATOM   1517  N  NH1 . ARG A 1  194 ? 20.342  167.531 3.321   1.00 78.22  ? 194 ARG A NH1 1 
ATOM   1518  N  NH2 . ARG A 1  194 ? 21.561  169.473 3.147   1.00 78.82  ? 194 ARG A NH2 1 
ATOM   1519  N  N   . MET A 1  195 ? 13.125  169.088 1.351   1.00 18.75  ? 195 MET A N   1 
ATOM   1520  C  CA  . MET A 1  195 ? 11.721  168.795 1.118   1.00 10.89  ? 195 MET A CA  1 
ATOM   1521  C  C   . MET A 1  195 ? 11.451  168.523 -0.372  1.00 10.00  ? 195 MET A C   1 
ATOM   1522  O  O   . MET A 1  195 ? 11.961  169.282 -1.196  1.00 9.46   ? 195 MET A O   1 
ATOM   1523  C  CB  . MET A 1  195 ? 11.055  170.137 1.442   1.00 2.20   ? 195 MET A CB  1 
ATOM   1524  C  CG  . MET A 1  195 ? 11.484  170.798 2.765   1.00 2.20   ? 195 MET A CG  1 
ATOM   1525  S  SD  . MET A 1  195 ? 9.984   171.759 3.267   1.00 26.53  ? 195 MET A SD  1 
ATOM   1526  C  CE  . MET A 1  195 ? 9.623   172.589 1.706   1.00 31.63  ? 195 MET A CE  1 
ATOM   1527  N  N   . VAL A 1  196 ? 10.514  167.650 -0.669  1.00 12.07  ? 196 VAL A N   1 
ATOM   1528  C  CA  . VAL A 1  196 ? 9.811   167.415 -1.908  1.00 7.08   ? 196 VAL A CA  1 
ATOM   1529  C  C   . VAL A 1  196 ? 8.281   167.455 -1.741  1.00 10.91  ? 196 VAL A C   1 
ATOM   1530  O  O   . VAL A 1  196 ? 7.682   166.869 -0.845  1.00 12.74  ? 196 VAL A O   1 
ATOM   1531  C  CB  . VAL A 1  196 ? 10.098  165.986 -2.397  1.00 7.16   ? 196 VAL A CB  1 
ATOM   1532  C  CG1 . VAL A 1  196 ? 9.181   165.659 -3.568  1.00 3.70   ? 196 VAL A CG1 1 
ATOM   1533  C  CG2 . VAL A 1  196 ? 11.546  165.851 -2.790  1.00 3.45   ? 196 VAL A CG2 1 
ATOM   1534  N  N   . LEU A 1  197 ? 7.583   168.141 -2.629  1.00 12.83  ? 197 LEU A N   1 
ATOM   1535  C  CA  . LEU A 1  197 ? 6.112   168.117 -2.586  1.00 15.64  ? 197 LEU A CA  1 
ATOM   1536  C  C   . LEU A 1  197 ? 5.708   167.210 -3.754  1.00 19.10  ? 197 LEU A C   1 
ATOM   1537  O  O   . LEU A 1  197 ? 6.175   167.335 -4.891  1.00 13.88  ? 197 LEU A O   1 
ATOM   1538  C  CB  . LEU A 1  197 ? 5.503   169.477 -2.656  1.00 15.03  ? 197 LEU A CB  1 
ATOM   1539  C  CG  . LEU A 1  197 ? 4.074   169.804 -3.004  1.00 15.80  ? 197 LEU A CG  1 
ATOM   1540  C  CD1 . LEU A 1  197 ? 3.106   168.647 -2.999  1.00 18.11  ? 197 LEU A CD1 1 
ATOM   1541  C  CD2 . LEU A 1  197 ? 3.576   170.956 -2.129  1.00 18.18  ? 197 LEU A CD2 1 
ATOM   1542  N  N   . ALA A 1  198 ? 5.228   166.028 -3.357  1.00 20.06  ? 198 ALA A N   1 
ATOM   1543  C  CA  . ALA A 1  198 ? 4.908   165.059 -4.413  1.00 22.56  ? 198 ALA A CA  1 
ATOM   1544  C  C   . ALA A 1  198 ? 3.411   164.763 -4.377  1.00 18.56  ? 198 ALA A C   1 
ATOM   1545  O  O   . ALA A 1  198 ? 2.760   165.145 -3.398  1.00 16.86  ? 198 ALA A O   1 
ATOM   1546  C  CB  . ALA A 1  198 ? 5.703   163.786 -4.167  1.00 34.08  ? 198 ALA A CB  1 
ATOM   1547  N  N   . ALA A 1  199 ? 2.916   164.129 -5.445  1.00 12.25  ? 199 ALA A N   1 
ATOM   1548  C  CA  . ALA A 1  199 ? 1.544   163.672 -5.418  1.00 8.70   ? 199 ALA A CA  1 
ATOM   1549  C  C   . ALA A 1  199 ? 1.140   162.814 -6.584  1.00 9.89   ? 199 ALA A C   1 
ATOM   1550  O  O   . ALA A 1  199 ? 1.864   162.657 -7.565  1.00 6.40   ? 199 ALA A O   1 
ATOM   1551  C  CB  . ALA A 1  199 ? 0.488   164.603 -4.953  1.00 2.20   ? 199 ALA A CB  1 
ATOM   1552  N  N   . ALA A 1  200 ? 0.113   161.993 -6.289  1.00 16.35  ? 200 ALA A N   1 
ATOM   1553  C  CA  . ALA A 1  200 ? -0.276  160.991 -7.289  1.00 21.53  ? 200 ALA A CA  1 
ATOM   1554  C  C   . ALA A 1  200 ? -1.792  160.976 -7.476  1.00 28.25  ? 200 ALA A C   1 
ATOM   1555  O  O   . ALA A 1  200 ? -2.562  161.306 -6.555  1.00 25.39  ? 200 ALA A O   1 
ATOM   1556  C  CB  . ALA A 1  200 ? 0.189   159.601 -6.896  1.00 14.03  ? 200 ALA A CB  1 
ATOM   1557  N  N   . GLY A 1  201 ? -2.193  160.600 -8.696  1.00 32.17  ? 201 GLY A N   1 
ATOM   1558  C  CA  . GLY A 1  201 ? -3.590  160.444 -9.028  1.00 35.18  ? 201 GLY A CA  1 
ATOM   1559  C  C   . GLY A 1  201 ? -4.300  161.077 -10.248 1.00 34.64  ? 201 GLY A C   1 
ATOM   1560  O  O   . GLY A 1  201 ? -3.905  160.779 -11.397 1.00 28.03  ? 201 GLY A O   1 
ATOM   1561  N  N   . GLY A 1  202 ? -5.170  161.974 -10.010 1.00 36.58  ? 202 GLY A N   1 
ATOM   1562  C  CA  . GLY A 1  202 ? -5.913  162.677 -11.019 1.00 41.47  ? 202 GLY A CA  1 
ATOM   1563  C  C   . GLY A 1  202 ? -5.429  164.068 -11.371 1.00 43.10  ? 202 GLY A C   1 
ATOM   1564  O  O   . GLY A 1  202 ? -5.886  164.664 -12.350 1.00 45.69  ? 202 GLY A O   1 
ATOM   1565  N  N   . LEU A 1  203 ? -4.414  164.591 -10.700 1.00 45.27  ? 203 LEU A N   1 
ATOM   1566  C  CA  . LEU A 1  203 ? -3.907  165.923 -10.984 1.00 46.23  ? 203 LEU A CA  1 
ATOM   1567  C  C   . LEU A 1  203 ? -2.979  166.038 -12.182 1.00 44.93  ? 203 LEU A C   1 
ATOM   1568  O  O   . LEU A 1  203 ? -2.329  165.092 -12.611 1.00 45.67  ? 203 LEU A O   1 
ATOM   1569  C  CB  . LEU A 1  203 ? -3.200  166.447 -9.719  1.00 51.86  ? 203 LEU A CB  1 
ATOM   1570  C  CG  . LEU A 1  203 ? -4.067  166.252 -8.460  1.00 58.40  ? 203 LEU A CG  1 
ATOM   1571  C  CD1 . LEU A 1  203 ? -3.225  166.504 -7.228  1.00 55.07  ? 203 LEU A CD1 1 
ATOM   1572  C  CD2 . LEU A 1  203 ? -5.351  167.057 -8.550  1.00 57.26  ? 203 LEU A CD2 1 
ATOM   1573  N  N   . GLU A 1  204 ? -2.920  167.246 -12.723 1.00 41.79  ? 204 GLU A N   1 
ATOM   1574  C  CA  . GLU A 1  204 ? -2.039  167.652 -13.814 1.00 36.76  ? 204 GLU A CA  1 
ATOM   1575  C  C   . GLU A 1  204 ? -0.818  168.312 -13.179 1.00 32.60  ? 204 GLU A C   1 
ATOM   1576  O  O   . GLU A 1  204 ? -0.835  169.174 -12.299 1.00 30.23  ? 204 GLU A O   1 
ATOM   1577  C  CB  . GLU A 1  204 ? -2.798  168.472 -14.826 1.00 47.84  ? 204 GLU A CB  1 
ATOM   1578  C  CG  . GLU A 1  204 ? -2.118  169.447 -15.748 1.00 56.65  ? 204 GLU A CG  1 
ATOM   1579  C  CD  . GLU A 1  204 ? -3.067  170.467 -16.360 1.00 60.40  ? 204 GLU A CD  1 
ATOM   1580  O  OE1 . GLU A 1  204 ? -4.184  170.633 -15.814 1.00 61.39  ? 204 GLU A OE1 1 
ATOM   1581  O  OE2 . GLU A 1  204 ? -2.691  171.092 -17.374 1.00 60.68  ? 204 GLU A OE2 1 
ATOM   1582  N  N   . HIS A 1  205 ? 0.332   167.752 -13.529 1.00 29.95  ? 205 HIS A N   1 
ATOM   1583  C  CA  . HIS A 1  205 ? 1.611   168.171 -12.979 1.00 29.25  ? 205 HIS A CA  1 
ATOM   1584  C  C   . HIS A 1  205 ? 1.779   169.684 -12.935 1.00 26.19  ? 205 HIS A C   1 
ATOM   1585  O  O   . HIS A 1  205 ? 2.035   170.263 -11.889 1.00 17.37  ? 205 HIS A O   1 
ATOM   1586  C  CB  . HIS A 1  205 ? 2.749   167.554 -13.817 1.00 37.94  ? 205 HIS A CB  1 
ATOM   1587  C  CG  . HIS A 1  205 ? 4.056   167.833 -13.133 1.00 46.37  ? 205 HIS A CG  1 
ATOM   1588  N  ND1 . HIS A 1  205 ? 4.443   167.119 -12.024 1.00 50.52  ? 205 HIS A ND1 1 
ATOM   1589  C  CD2 . HIS A 1  205 ? 5.013   168.762 -13.343 1.00 50.33  ? 205 HIS A CD2 1 
ATOM   1590  C  CE1 . HIS A 1  205 ? 5.602   167.582 -11.602 1.00 51.44  ? 205 HIS A CE1 1 
ATOM   1591  N  NE2 . HIS A 1  205 ? 5.978   168.577 -12.384 1.00 51.75  ? 205 HIS A NE2 1 
ATOM   1592  N  N   . ARG A 1  206 ? 1.669   170.246 -14.119 1.00 30.89  ? 206 ARG A N   1 
ATOM   1593  C  CA  . ARG A 1  206 ? 1.563   171.635 -14.506 1.00 34.38  ? 206 ARG A CA  1 
ATOM   1594  C  C   . ARG A 1  206 ? 0.998   172.492 -13.371 1.00 34.20  ? 206 ARG A C   1 
ATOM   1595  O  O   . ARG A 1  206 ? 1.621   173.406 -12.847 1.00 29.29  ? 206 ARG A O   1 
ATOM   1596  C  CB  . ARG A 1  206 ? 0.592   171.697 -15.706 1.00 38.79  ? 206 ARG A CB  1 
ATOM   1597  C  CG  . ARG A 1  206 ? 0.549   173.028 -16.424 1.00 46.99  ? 206 ARG A CG  1 
ATOM   1598  C  CD  . ARG A 1  206 ? -0.730  173.797 -16.113 1.00 59.64  ? 206 ARG A CD  1 
ATOM   1599  N  NE  . ARG A 1  206 ? -1.648  173.850 -17.240 1.00 67.68  ? 206 ARG A NE  1 
ATOM   1600  C  CZ  . ARG A 1  206 ? -2.946  174.126 -17.219 1.00 69.20  ? 206 ARG A CZ  1 
ATOM   1601  N  NH1 . ARG A 1  206 ? -3.577  174.401 -16.084 1.00 66.03  ? 206 ARG A NH1 1 
ATOM   1602  N  NH2 . ARG A 1  206 ? -3.642  174.129 -18.353 1.00 71.55  ? 206 ARG A NH2 1 
ATOM   1603  N  N   . GLN A 1  207 ? -0.238  172.155 -13.015 1.00 33.65  ? 207 GLN A N   1 
ATOM   1604  C  CA  . GLN A 1  207 ? -0.914  172.776 -11.891 1.00 35.03  ? 207 GLN A CA  1 
ATOM   1605  C  C   . GLN A 1  207 ? -0.134  172.560 -10.606 1.00 35.09  ? 207 GLN A C   1 
ATOM   1606  O  O   . GLN A 1  207 ? 0.142   173.498 -9.857  1.00 38.38  ? 207 GLN A O   1 
ATOM   1607  C  CB  . GLN A 1  207 ? -2.300  172.115 -11.775 1.00 40.22  ? 207 GLN A CB  1 
ATOM   1608  C  CG  . GLN A 1  207 ? -3.189  172.756 -10.730 1.00 49.68  ? 207 GLN A CG  1 
ATOM   1609  C  CD  . GLN A 1  207 ? -4.578  172.151 -10.683 1.00 55.20  ? 207 GLN A CD  1 
ATOM   1610  O  OE1 . GLN A 1  207 ? -4.951  171.356 -11.545 1.00 62.26  ? 207 GLN A OE1 1 
ATOM   1611  N  NE2 . GLN A 1  207 ? -5.333  172.543 -9.665  1.00 56.01  ? 207 GLN A NE2 1 
ATOM   1612  N  N   . LEU A 1  208 ? 0.214   171.309 -10.290 1.00 31.06  ? 208 LEU A N   1 
ATOM   1613  C  CA  . LEU A 1  208 ? 0.913   171.079 -9.018  1.00 27.29  ? 208 LEU A CA  1 
ATOM   1614  C  C   . LEU A 1  208 ? 2.022   172.121 -8.833  1.00 26.81  ? 208 LEU A C   1 
ATOM   1615  O  O   . LEU A 1  208 ? 1.982   172.939 -7.910  1.00 19.51  ? 208 LEU A O   1 
ATOM   1616  C  CB  . LEU A 1  208 ? 1.469   169.673 -9.001  1.00 28.54  ? 208 LEU A CB  1 
ATOM   1617  C  CG  . LEU A 1  208 ? 1.581   168.854 -7.725  1.00 22.67  ? 208 LEU A CG  1 
ATOM   1618  C  CD1 . LEU A 1  208 ? 0.247   168.694 -7.008  1.00 17.80  ? 208 LEU A CD1 1 
ATOM   1619  C  CD2 . LEU A 1  208 ? 2.135   167.463 -8.034  1.00 18.52  ? 208 LEU A CD2 1 
ATOM   1620  N  N   . LEU A 1  209 ? 2.935   172.126 -9.794  1.00 28.59  ? 209 LEU A N   1 
ATOM   1621  C  CA  . LEU A 1  209 ? 4.111   172.980 -9.845  1.00 32.71  ? 209 LEU A CA  1 
ATOM   1622  C  C   . LEU A 1  209 ? 3.772   174.441 -9.547  1.00 30.77  ? 209 LEU A C   1 
ATOM   1623  O  O   . LEU A 1  209 ? 4.487   175.103 -8.817  1.00 29.94  ? 209 LEU A O   1 
ATOM   1624  C  CB  . LEU A 1  209 ? 4.754   172.920 -11.233 1.00 35.28  ? 209 LEU A CB  1 
ATOM   1625  C  CG  . LEU A 1  209 ? 6.209   173.349 -11.403 1.00 36.65  ? 209 LEU A CG  1 
ATOM   1626  C  CD1 . LEU A 1  209 ? 7.050   173.076 -10.176 1.00 31.34  ? 209 LEU A CD1 1 
ATOM   1627  C  CD2 . LEU A 1  209 ? 6.806   172.628 -12.616 1.00 36.09  ? 209 LEU A CD2 1 
ATOM   1628  N  N   . ASP A 1  210 ? 2.729   174.853 -10.245 1.00 34.64  ? 210 ASP A N   1 
ATOM   1629  C  CA  . ASP A 1  210 ? 2.202   176.198 -10.146 1.00 41.51  ? 210 ASP A CA  1 
ATOM   1630  C  C   . ASP A 1  210 ? 1.648   176.387 -8.740  1.00 44.02  ? 210 ASP A C   1 
ATOM   1631  O  O   . ASP A 1  210 ? 2.137   177.235 -7.963  1.00 44.01  ? 210 ASP A O   1 
ATOM   1632  C  CB  . ASP A 1  210 ? 1.248   176.484 -11.301 1.00 50.75  ? 210 ASP A CB  1 
ATOM   1633  C  CG  . ASP A 1  210 ? 1.906   176.408 -12.671 1.00 64.95  ? 210 ASP A CG  1 
ATOM   1634  O  OD1 . ASP A 1  210 ? 3.144   176.596 -12.778 1.00 68.38  ? 210 ASP A OD1 1 
ATOM   1635  O  OD2 . ASP A 1  210 ? 1.192   176.165 -13.677 1.00 70.24  ? 210 ASP A OD2 1 
ATOM   1636  N  N   . LEU A 1  211 ? 0.966   175.353 -8.212  1.00 44.39  ? 211 LEU A N   1 
ATOM   1637  C  CA  . LEU A 1  211 ? 0.168   175.504 -7.008  1.00 41.59  ? 211 LEU A CA  1 
ATOM   1638  C  C   . LEU A 1  211 ? 0.976   175.549 -5.731  1.00 41.06  ? 211 LEU A C   1 
ATOM   1639  O  O   . LEU A 1  211 ? 0.504   175.893 -4.645  1.00 39.92  ? 211 LEU A O   1 
ATOM   1640  C  CB  . LEU A 1  211 ? -1.001  174.540 -6.935  1.00 40.26  ? 211 LEU A CB  1 
ATOM   1641  C  CG  . LEU A 1  211 ? -2.065  174.705 -5.855  1.00 44.73  ? 211 LEU A CG  1 
ATOM   1642  C  CD1 . LEU A 1  211 ? -2.231  176.085 -5.259  1.00 44.34  ? 211 LEU A CD1 1 
ATOM   1643  C  CD2 . LEU A 1  211 ? -3.421  174.170 -6.315  1.00 46.05  ? 211 LEU A CD2 1 
ATOM   1644  N  N   . ALA A 1  212 ? 2.256   175.234 -5.844  1.00 40.16  ? 212 ALA A N   1 
ATOM   1645  C  CA  . ALA A 1  212 ? 3.194   175.250 -4.736  1.00 41.84  ? 212 ALA A CA  1 
ATOM   1646  C  C   . ALA A 1  212 ? 3.465   176.655 -4.208  1.00 43.59  ? 212 ALA A C   1 
ATOM   1647  O  O   . ALA A 1  212 ? 4.273   177.328 -4.861  1.00 44.10  ? 212 ALA A O   1 
ATOM   1648  C  CB  . ALA A 1  212 ? 4.534   174.755 -5.314  1.00 34.18  ? 212 ALA A CB  1 
ATOM   1649  N  N   . GLN A 1  213 ? 2.978   177.021 -3.050  1.00 48.42  ? 213 GLN A N   1 
ATOM   1650  C  CA  . GLN A 1  213 ? 3.184   178.344 -2.467  1.00 54.91  ? 213 GLN A CA  1 
ATOM   1651  C  C   . GLN A 1  213 ? 4.672   178.670 -2.269  1.00 59.77  ? 213 GLN A C   1 
ATOM   1652  O  O   . GLN A 1  213 ? 5.234   178.289 -1.231  1.00 58.12  ? 213 GLN A O   1 
ATOM   1653  C  CB  . GLN A 1  213 ? 2.494   178.318 -1.115  1.00 46.73  ? 213 GLN A CB  1 
ATOM   1654  C  CG  . GLN A 1  213 ? 1.289   177.516 -0.839  1.00 41.48  ? 213 GLN A CG  1 
ATOM   1655  C  CD  . GLN A 1  213 ? 0.040   177.615 -1.660  1.00 38.83  ? 213 GLN A CD  1 
ATOM   1656  O  OE1 . GLN A 1  213 ? 0.053   177.650 -2.891  1.00 47.55  ? 213 GLN A OE1 1 
ATOM   1657  N  NE2 . GLN A 1  213 ? -1.152  177.649 -1.073  1.00 26.07  ? 213 GLN A NE2 1 
ATOM   1658  N  N   . LYS A 1  214 ? 5.238   179.456 -3.181  1.00 62.80  ? 214 LYS A N   1 
ATOM   1659  C  CA  . LYS A 1  214 ? 6.651   179.850 -3.165  1.00 63.07  ? 214 LYS A CA  1 
ATOM   1660  C  C   . LYS A 1  214 ? 6.866   180.873 -2.058  1.00 63.24  ? 214 LYS A C   1 
ATOM   1661  O  O   . LYS A 1  214 ? 6.620   182.038 -2.384  1.00 61.27  ? 214 LYS A O   1 
ATOM   1662  C  CB  . LYS A 1  214 ? 6.999   180.484 -4.529  1.00 60.06  ? 214 LYS A CB  1 
ATOM   1663  C  CG  . LYS A 1  214 ? 6.252   179.933 -5.738  1.00 54.63  ? 214 LYS A CG  1 
ATOM   1664  C  CD  . LYS A 1  214 ? 7.153   179.734 -6.951  1.00 51.45  ? 214 LYS A CD  1 
ATOM   1665  C  CE  . LYS A 1  214 ? 6.489   178.968 -8.084  1.00 43.54  ? 214 LYS A CE  1 
ATOM   1666  N  NZ  . LYS A 1  214 ? 7.383   178.844 -9.273  1.00 43.21  ? 214 LYS A NZ  1 
ATOM   1667  N  N   . HIS A 1  215 ? 7.025   180.462 -0.806  1.00 65.95  ? 215 HIS A N   1 
ATOM   1668  C  CA  . HIS A 1  215 ? 6.985   181.343 0.345   1.00 68.85  ? 215 HIS A CA  1 
ATOM   1669  C  C   . HIS A 1  215 ? 8.282   181.453 1.121   1.00 66.79  ? 215 HIS A C   1 
ATOM   1670  O  O   . HIS A 1  215 ? 8.687   182.570 1.511   1.00 70.55  ? 215 HIS A O   1 
ATOM   1671  C  CB  . HIS A 1  215 ? 5.771   181.086 1.230   1.00 75.98  ? 215 HIS A CB  1 
ATOM   1672  C  CG  . HIS A 1  215 ? 4.483   181.119 0.462   1.00 83.99  ? 215 HIS A CG  1 
ATOM   1673  N  ND1 . HIS A 1  215 ? 4.257   181.922 -0.634  1.00 85.54  ? 215 HIS A ND1 1 
ATOM   1674  C  CD2 . HIS A 1  215 ? 3.328   180.455 0.652   1.00 90.65  ? 215 HIS A CD2 1 
ATOM   1675  C  CE1 . HIS A 1  215 ? 3.033   181.748 -1.104  1.00 89.69  ? 215 HIS A CE1 1 
ATOM   1676  N  NE2 . HIS A 1  215 ? 2.445   180.861 -0.330  1.00 92.92  ? 215 HIS A NE2 1 
ATOM   1677  N  N   . PHE A 1  216 ? 9.025   180.365 1.208   1.00 61.35  ? 216 PHE A N   1 
ATOM   1678  C  CA  . PHE A 1  216 ? 10.345  180.424 1.826   1.00 57.26  ? 216 PHE A CA  1 
ATOM   1679  C  C   . PHE A 1  216 ? 11.183  179.288 1.267   1.00 53.45  ? 216 PHE A C   1 
ATOM   1680  O  O   . PHE A 1  216 ? 10.677  178.257 0.843   1.00 51.96  ? 216 PHE A O   1 
ATOM   1681  C  CB  . PHE A 1  216 ? 10.351  180.519 3.320   1.00 64.25  ? 216 PHE A CB  1 
ATOM   1682  C  CG  . PHE A 1  216 ? 10.938  181.759 3.935   1.00 73.04  ? 216 PHE A CG  1 
ATOM   1683  C  CD1 . PHE A 1  216 ? 12.280  181.845 4.262   1.00 75.05  ? 216 PHE A CD1 1 
ATOM   1684  C  CD2 . PHE A 1  216 ? 10.134  182.859 4.205   1.00 80.08  ? 216 PHE A CD2 1 
ATOM   1685  C  CE1 . PHE A 1  216 ? 12.799  182.994 4.830   1.00 82.18  ? 216 PHE A CE1 1 
ATOM   1686  C  CE2 . PHE A 1  216 ? 10.636  184.017 4.773   1.00 83.71  ? 216 PHE A CE2 1 
ATOM   1687  C  CZ  . PHE A 1  216 ? 11.985  184.086 5.088   1.00 84.93  ? 216 PHE A CZ  1 
ATOM   1688  N  N   . SER A 1  217 ? 12.472  179.512 1.190   1.00 51.85  ? 217 SER A N   1 
ATOM   1689  C  CA  . SER A 1  217 ? 13.365  178.701 0.378   1.00 52.77  ? 217 SER A CA  1 
ATOM   1690  C  C   . SER A 1  217 ? 14.626  178.410 1.175   1.00 55.76  ? 217 SER A C   1 
ATOM   1691  O  O   . SER A 1  217 ? 14.777  178.927 2.292   1.00 47.68  ? 217 SER A O   1 
ATOM   1692  C  CB  . SER A 1  217 ? 13.644  179.593 -0.839  1.00 58.70  ? 217 SER A CB  1 
ATOM   1693  O  OG  . SER A 1  217 ? 14.890  180.234 -0.846  1.00 61.53  ? 217 SER A OG  1 
ATOM   1694  N  N   . GLY A 1  218 ? 15.496  177.585 0.599   1.00 58.71  ? 218 GLY A N   1 
ATOM   1695  C  CA  . GLY A 1  218 ? 16.743  177.218 1.248   1.00 65.68  ? 218 GLY A CA  1 
ATOM   1696  C  C   . GLY A 1  218 ? 17.628  178.437 1.489   1.00 71.54  ? 218 GLY A C   1 
ATOM   1697  O  O   . GLY A 1  218 ? 18.149  179.030 0.537   1.00 73.72  ? 218 GLY A O   1 
ATOM   1698  N  N   . LEU A 1  219 ? 17.864  178.751 2.757   1.00 75.38  ? 219 LEU A N   1 
ATOM   1699  C  CA  . LEU A 1  219 ? 18.758  179.853 3.147   1.00 78.19  ? 219 LEU A CA  1 
ATOM   1700  C  C   . LEU A 1  219 ? 20.189  179.328 3.278   1.00 77.55  ? 219 LEU A C   1 
ATOM   1701  O  O   . LEU A 1  219 ? 20.849  179.586 4.294   1.00 79.35  ? 219 LEU A O   1 
ATOM   1702  C  CB  . LEU A 1  219 ? 18.248  180.451 4.461   1.00 83.09  ? 219 LEU A CB  1 
ATOM   1703  C  CG  . LEU A 1  219 ? 18.602  181.875 4.861   1.00 87.99  ? 219 LEU A CG  1 
ATOM   1704  C  CD1 . LEU A 1  219 ? 18.015  182.910 3.906   1.00 88.38  ? 219 LEU A CD1 1 
ATOM   1705  C  CD2 . LEU A 1  219 ? 18.119  182.165 6.282   1.00 87.69  ? 219 LEU A CD2 1 
ATOM   1706  N  N   . SER A 1  220 ? 20.685  178.601 2.271   1.00 75.70  ? 220 SER A N   1 
ATOM   1707  C  CA  . SER A 1  220 ? 22.001  177.987 2.281   1.00 73.99  ? 220 SER A CA  1 
ATOM   1708  C  C   . SER A 1  220 ? 23.014  178.439 1.245   1.00 73.96  ? 220 SER A C   1 
ATOM   1709  O  O   . SER A 1  220 ? 22.746  179.281 0.393   1.00 73.32  ? 220 SER A O   1 
ATOM   1710  C  CB  . SER A 1  220 ? 21.885  176.458 2.270   1.00 72.63  ? 220 SER A CB  1 
ATOM   1711  O  OG  . SER A 1  220 ? 22.249  175.932 3.537   1.00 59.06  ? 220 SER A OG  1 
ATOM   1712  N  N   . GLY A 1  221 ? 24.228  177.884 1.316   1.00 73.83  ? 221 GLY A N   1 
ATOM   1713  C  CA  . GLY A 1  221 ? 25.334  178.247 0.464   1.00 75.60  ? 221 GLY A CA  1 
ATOM   1714  C  C   . GLY A 1  221 ? 25.137  177.999 -1.021  1.00 76.19  ? 221 GLY A C   1 
ATOM   1715  O  O   . GLY A 1  221 ? 24.376  177.121 -1.423  1.00 75.44  ? 221 GLY A O   1 
ATOM   1716  N  N   . THR A 1  222 ? 25.930  178.724 -1.811  1.00 76.11  ? 222 THR A N   1 
ATOM   1717  C  CA  . THR A 1  222 ? 25.950  178.543 -3.255  1.00 75.96  ? 222 THR A CA  1 
ATOM   1718  C  C   . THR A 1  222 ? 27.207  177.775 -3.656  1.00 77.09  ? 222 THR A C   1 
ATOM   1719  O  O   . THR A 1  222 ? 27.273  177.288 -4.787  1.00 78.55  ? 222 THR A O   1 
ATOM   1720  C  CB  . THR A 1  222 ? 25.887  179.902 -3.977  1.00 72.88  ? 222 THR A CB  1 
ATOM   1721  O  OG1 . THR A 1  222 ? 26.876  180.745 -3.346  1.00 70.25  ? 222 THR A OG1 1 
ATOM   1722  C  CG2 . THR A 1  222 ? 24.527  180.564 -3.821  1.00 74.74  ? 222 THR A CG2 1 
ATOM   1723  N  N   . TYR A 1  223 ? 28.194  177.620 -2.771  1.00 78.00  ? 223 TYR A N   1 
ATOM   1724  C  CA  . TYR A 1  223 ? 29.430  176.898 -3.073  1.00 79.25  ? 223 TYR A CA  1 
ATOM   1725  C  C   . TYR A 1  223 ? 29.680  175.669 -2.205  1.00 78.64  ? 223 TYR A C   1 
ATOM   1726  O  O   . TYR A 1  223 ? 28.801  175.230 -1.453  1.00 79.09  ? 223 TYR A O   1 
ATOM   1727  C  CB  . TYR A 1  223 ? 30.655  177.837 -3.013  1.00 81.25  ? 223 TYR A CB  1 
ATOM   1728  C  CG  . TYR A 1  223 ? 31.896  177.253 -3.661  1.00 85.54  ? 223 TYR A CG  1 
ATOM   1729  C  CD1 . TYR A 1  223 ? 32.141  177.397 -5.024  1.00 87.54  ? 223 TYR A CD1 1 
ATOM   1730  C  CD2 . TYR A 1  223 ? 32.834  176.552 -2.912  1.00 85.10  ? 223 TYR A CD2 1 
ATOM   1731  C  CE1 . TYR A 1  223 ? 33.276  176.856 -5.603  1.00 89.91  ? 223 TYR A CE1 1 
ATOM   1732  C  CE2 . TYR A 1  223 ? 33.965  176.006 -3.478  1.00 87.52  ? 223 TYR A CE2 1 
ATOM   1733  C  CZ  . TYR A 1  223 ? 34.185  176.161 -4.829  1.00 90.99  ? 223 TYR A CZ  1 
ATOM   1734  O  OH  . TYR A 1  223 ? 35.319  175.620 -5.401  1.00 94.60  ? 223 TYR A OH  1 
ATOM   1735  N  N   . ASP A 1  224 ? 30.843  175.064 -2.271  1.00 77.84  ? 224 ASP A N   1 
ATOM   1736  C  CA  . ASP A 1  224 ? 31.385  173.919 -1.596  1.00 78.77  ? 224 ASP A CA  1 
ATOM   1737  C  C   . ASP A 1  224 ? 31.489  174.028 -0.088  1.00 78.20  ? 224 ASP A C   1 
ATOM   1738  O  O   . ASP A 1  224 ? 31.538  173.012 0.623   1.00 76.08  ? 224 ASP A O   1 
ATOM   1739  C  CB  . ASP A 1  224 ? 32.780  173.613 -2.170  1.00 86.38  ? 224 ASP A CB  1 
ATOM   1740  C  CG  . ASP A 1  224 ? 33.377  172.281 -1.851  1.00 92.75  ? 224 ASP A CG  1 
ATOM   1741  O  OD1 . ASP A 1  224 ? 32.971  171.611 -0.888  1.00 95.75  ? 224 ASP A OD1 1 
ATOM   1742  O  OD2 . ASP A 1  224 ? 34.310  171.853 -2.580  1.00 96.56  ? 224 ASP A OD2 1 
ATOM   1743  N  N   . GLU A 1  225 ? 31.442  175.221 0.503   1.00 78.17  ? 225 GLU A N   1 
ATOM   1744  C  CA  . GLU A 1  225 ? 31.573  175.371 1.948   1.00 77.85  ? 225 GLU A CA  1 
ATOM   1745  C  C   . GLU A 1  225 ? 30.425  174.715 2.709   1.00 77.57  ? 225 GLU A C   1 
ATOM   1746  O  O   . GLU A 1  225 ? 30.468  174.558 3.927   1.00 78.98  ? 225 GLU A O   1 
ATOM   1747  C  CB  . GLU A 1  225 ? 31.666  176.845 2.332   1.00 81.70  ? 225 GLU A CB  1 
ATOM   1748  C  CG  . GLU A 1  225 ? 32.318  177.044 3.697   1.00 86.72  ? 225 GLU A CG  1 
ATOM   1749  C  CD  . GLU A 1  225 ? 33.356  178.153 3.660   1.00 88.92  ? 225 GLU A CD  1 
ATOM   1750  O  OE1 . GLU A 1  225 ? 33.542  178.764 2.585   1.00 88.88  ? 225 GLU A OE1 1 
ATOM   1751  O  OE2 . GLU A 1  225 ? 33.984  178.417 4.708   1.00 87.99  ? 225 GLU A OE2 1 
ATOM   1752  N  N   . ASP A 1  226 ? 29.337  174.475 1.989   1.00 77.31  ? 226 ASP A N   1 
ATOM   1753  C  CA  . ASP A 1  226 ? 28.249  173.639 2.478   1.00 76.81  ? 226 ASP A CA  1 
ATOM   1754  C  C   . ASP A 1  226 ? 28.742  172.195 2.375   1.00 77.85  ? 226 ASP A C   1 
ATOM   1755  O  O   . ASP A 1  226 ? 28.534  171.405 3.297   1.00 81.91  ? 226 ASP A O   1 
ATOM   1756  C  CB  . ASP A 1  226 ? 26.998  173.842 1.630   1.00 79.34  ? 226 ASP A CB  1 
ATOM   1757  C  CG  . ASP A 1  226 ? 25.851  172.917 1.952   1.00 82.01  ? 226 ASP A CG  1 
ATOM   1758  O  OD1 . ASP A 1  226 ? 26.026  171.926 2.683   1.00 86.25  ? 226 ASP A OD1 1 
ATOM   1759  O  OD2 . ASP A 1  226 ? 24.731  173.176 1.456   1.00 86.62  ? 226 ASP A OD2 1 
ATOM   1760  N  N   . ALA A 1  227 ? 29.552  171.891 1.359   1.00 76.56  ? 227 ALA A N   1 
ATOM   1761  C  CA  . ALA A 1  227 ? 29.974  170.548 1.059   1.00 76.36  ? 227 ALA A CA  1 
ATOM   1762  C  C   . ALA A 1  227 ? 30.273  169.623 2.221   1.00 73.12  ? 227 ALA A C   1 
ATOM   1763  O  O   . ALA A 1  227 ? 30.120  168.401 2.059   1.00 69.96  ? 227 ALA A O   1 
ATOM   1764  C  CB  . ALA A 1  227 ? 30.962  170.344 -0.060  1.00 79.41  ? 227 ALA A CB  1 
ATOM   1765  N  N   . VAL A 1  228 ? 30.738  170.114 3.352   1.00 70.84  ? 228 VAL A N   1 
ATOM   1766  C  CA  . VAL A 1  228 ? 30.837  169.301 4.557   1.00 72.20  ? 228 VAL A CA  1 
ATOM   1767  C  C   . VAL A 1  228 ? 29.581  168.462 4.774   1.00 71.33  ? 228 VAL A C   1 
ATOM   1768  O  O   . VAL A 1  228 ? 28.525  168.943 5.212   1.00 74.20  ? 228 VAL A O   1 
ATOM   1769  C  CB  . VAL A 1  228 ? 31.140  170.218 5.759   1.00 74.70  ? 228 VAL A CB  1 
ATOM   1770  C  CG1 . VAL A 1  228 ? 32.570  170.762 5.651   1.00 76.43  ? 228 VAL A CG1 1 
ATOM   1771  C  CG2 . VAL A 1  228 ? 30.160  171.379 5.834   1.00 69.01  ? 228 VAL A CG2 1 
ATOM   1772  N  N   . PRO A 1  229 ? 29.659  167.178 4.450   1.00 67.83  ? 229 PRO A N   1 
ATOM   1773  C  CA  . PRO A 1  229 ? 28.562  166.242 4.569   1.00 63.21  ? 229 PRO A CA  1 
ATOM   1774  C  C   . PRO A 1  229 ? 27.826  166.374 5.887   1.00 60.30  ? 229 PRO A C   1 
ATOM   1775  O  O   . PRO A 1  229 ? 28.425  166.279 6.960   1.00 63.38  ? 229 PRO A O   1 
ATOM   1776  C  CB  . PRO A 1  229 ? 29.139  164.823 4.394   1.00 64.32  ? 229 PRO A CB  1 
ATOM   1777  C  CG  . PRO A 1  229 ? 30.470  165.087 3.751   1.00 65.67  ? 229 PRO A CG  1 
ATOM   1778  C  CD  . PRO A 1  229 ? 30.870  166.526 3.939   1.00 67.30  ? 229 PRO A CD  1 
ATOM   1779  N  N   . THR A 1  230 ? 26.509  166.588 5.777   1.00 56.12  ? 230 THR A N   1 
ATOM   1780  C  CA  . THR A 1  230 ? 25.679  166.576 6.994   1.00 52.03  ? 230 THR A CA  1 
ATOM   1781  C  C   . THR A 1  230 ? 25.393  165.066 7.237   1.00 51.55  ? 230 THR A C   1 
ATOM   1782  O  O   . THR A 1  230 ? 25.169  164.649 8.359   1.00 53.37  ? 230 THR A O   1 
ATOM   1783  C  CB  . THR A 1  230 ? 24.331  167.288 6.868   1.00 42.80  ? 230 THR A CB  1 
ATOM   1784  O  OG1 . THR A 1  230 ? 24.502  168.623 6.397   1.00 43.11  ? 230 THR A OG1 1 
ATOM   1785  C  CG2 . THR A 1  230 ? 23.625  167.304 8.223   1.00 32.80  ? 230 THR A CG2 1 
ATOM   1786  N  N   . LEU A 1  231 ? 25.505  164.354 6.136   1.00 47.32  ? 231 LEU A N   1 
ATOM   1787  C  CA  . LEU A 1  231 ? 25.387  162.949 5.889   1.00 37.82  ? 231 LEU A CA  1 
ATOM   1788  C  C   . LEU A 1  231 ? 26.755  162.264 5.945   1.00 35.16  ? 231 LEU A C   1 
ATOM   1789  O  O   . LEU A 1  231 ? 27.231  161.591 5.027   1.00 30.85  ? 231 LEU A O   1 
ATOM   1790  C  CB  . LEU A 1  231 ? 24.674  162.739 4.545   1.00 40.69  ? 231 LEU A CB  1 
ATOM   1791  C  CG  . LEU A 1  231 ? 24.320  163.997 3.746   1.00 43.01  ? 231 LEU A CG  1 
ATOM   1792  C  CD1 . LEU A 1  231 ? 24.733  163.865 2.289   1.00 46.80  ? 231 LEU A CD1 1 
ATOM   1793  C  CD2 . LEU A 1  231 ? 22.826  164.313 3.825   1.00 48.19  ? 231 LEU A CD2 1 
ATOM   1794  N  N   . SER A 1  232 ? 27.413  162.443 7.094   1.00 29.48  ? 232 SER A N   1 
ATOM   1795  C  CA  . SER A 1  232 ? 28.723  161.832 7.342   1.00 30.40  ? 232 SER A CA  1 
ATOM   1796  C  C   . SER A 1  232 ? 28.559  160.361 7.712   1.00 28.65  ? 232 SER A C   1 
ATOM   1797  O  O   . SER A 1  232 ? 27.695  160.040 8.527   1.00 31.22  ? 232 SER A O   1 
ATOM   1798  C  CB  . SER A 1  232 ? 29.391  162.579 8.503   1.00 26.41  ? 232 SER A CB  1 
ATOM   1799  O  OG  . SER A 1  232 ? 29.821  161.681 9.501   1.00 15.93  ? 232 SER A OG  1 
ATOM   1800  N  N   . PRO A 1  233 ? 29.222  159.439 7.068   1.00 27.44  ? 233 PRO A N   1 
ATOM   1801  C  CA  . PRO A 1  233 ? 29.144  158.033 7.405   1.00 28.72  ? 233 PRO A CA  1 
ATOM   1802  C  C   . PRO A 1  233 ? 28.883  157.823 8.880   1.00 32.53  ? 233 PRO A C   1 
ATOM   1803  O  O   . PRO A 1  233 ? 29.245  158.625 9.744   1.00 35.73  ? 233 PRO A O   1 
ATOM   1804  C  CB  . PRO A 1  233 ? 30.552  157.500 7.023   1.00 29.95  ? 233 PRO A CB  1 
ATOM   1805  C  CG  . PRO A 1  233 ? 30.785  158.318 5.767   1.00 30.54  ? 233 PRO A CG  1 
ATOM   1806  C  CD  . PRO A 1  233 ? 30.236  159.698 6.038   1.00 30.77  ? 233 PRO A CD  1 
ATOM   1807  N  N   . CYS A 1  234 ? 28.170  156.742 9.208   1.00 34.63  ? 234 CYS A N   1 
ATOM   1808  C  CA  . CYS A 1  234 ? 28.039  156.333 10.617  1.00 28.58  ? 234 CYS A CA  1 
ATOM   1809  C  C   . CYS A 1  234 ? 28.874  155.066 10.769  1.00 26.47  ? 234 CYS A C   1 
ATOM   1810  O  O   . CYS A 1  234 ? 28.886  154.212 9.866   1.00 19.22  ? 234 CYS A O   1 
ATOM   1811  C  CB  . CYS A 1  234 ? 26.576  156.239 11.010  1.00 26.66  ? 234 CYS A CB  1 
ATOM   1812  S  SG  . CYS A 1  234 ? 25.876  157.832 11.529  1.00 28.38  ? 234 CYS A SG  1 
ATOM   1813  N  N   . ARG A 1  235 ? 29.769  155.007 11.758  1.00 26.01  ? 235 ARG A N   1 
ATOM   1814  C  CA  . ARG A 1  235 ? 30.649  153.873 11.963  1.00 27.57  ? 235 ARG A CA  1 
ATOM   1815  C  C   . ARG A 1  235 ? 29.916  152.569 12.275  1.00 30.53  ? 235 ARG A C   1 
ATOM   1816  O  O   . ARG A 1  235 ? 29.231  152.379 13.282  1.00 28.90  ? 235 ARG A O   1 
ATOM   1817  C  CB  . ARG A 1  235 ? 31.750  154.040 13.008  1.00 26.98  ? 235 ARG A CB  1 
ATOM   1818  C  CG  . ARG A 1  235 ? 32.068  152.795 13.842  1.00 9.49   ? 235 ARG A CG  1 
ATOM   1819  C  CD  . ARG A 1  235 ? 32.951  153.141 15.012  1.00 2.94   ? 235 ARG A CD  1 
ATOM   1820  N  NE  . ARG A 1  235 ? 32.257  153.897 16.062  1.00 7.14   ? 235 ARG A NE  1 
ATOM   1821  C  CZ  . ARG A 1  235 ? 32.801  154.173 17.247  1.00 11.71  ? 235 ARG A CZ  1 
ATOM   1822  N  NH1 . ARG A 1  235 ? 34.040  153.699 17.382  1.00 6.88   ? 235 ARG A NH1 1 
ATOM   1823  N  NH2 . ARG A 1  235 ? 32.249  154.842 18.253  1.00 15.02  ? 235 ARG A NH2 1 
ATOM   1824  N  N   . PHE A 1  236 ? 30.342  151.572 11.508  1.00 33.22  ? 236 PHE A N   1 
ATOM   1825  C  CA  . PHE A 1  236 ? 29.723  150.238 11.572  1.00 36.40  ? 236 PHE A CA  1 
ATOM   1826  C  C   . PHE A 1  236 ? 30.243  149.376 12.705  1.00 33.10  ? 236 PHE A C   1 
ATOM   1827  O  O   . PHE A 1  236 ? 31.452  149.106 12.867  1.00 37.72  ? 236 PHE A O   1 
ATOM   1828  C  CB  . PHE A 1  236 ? 30.026  149.599 10.212  1.00 42.26  ? 236 PHE A CB  1 
ATOM   1829  C  CG  . PHE A 1  236 ? 29.155  149.980 9.063   1.00 43.16  ? 236 PHE A CG  1 
ATOM   1830  C  CD1 . PHE A 1  236 ? 29.391  151.105 8.293   1.00 42.28  ? 236 PHE A CD1 1 
ATOM   1831  C  CD2 . PHE A 1  236 ? 28.080  149.188 8.728   1.00 44.09  ? 236 PHE A CD2 1 
ATOM   1832  C  CE1 . PHE A 1  236 ? 28.553  151.395 7.234   1.00 45.85  ? 236 PHE A CE1 1 
ATOM   1833  C  CE2 . PHE A 1  236 ? 27.235  149.458 7.681   1.00 44.04  ? 236 PHE A CE2 1 
ATOM   1834  C  CZ  . PHE A 1  236 ? 27.482  150.575 6.922   1.00 46.56  ? 236 PHE A CZ  1 
ATOM   1835  N  N   . THR A 1  237 ? 29.369  148.873 13.580  1.00 24.78  ? 237 THR A N   1 
ATOM   1836  C  CA  . THR A 1  237 ? 29.877  148.086 14.705  1.00 25.52  ? 237 THR A CA  1 
ATOM   1837  C  C   . THR A 1  237 ? 29.155  146.766 14.941  1.00 23.43  ? 237 THR A C   1 
ATOM   1838  O  O   . THR A 1  237 ? 27.949  146.779 15.220  1.00 23.53  ? 237 THR A O   1 
ATOM   1839  C  CB  . THR A 1  237 ? 29.877  148.833 16.052  1.00 24.54  ? 237 THR A CB  1 
ATOM   1840  O  OG1 . THR A 1  237 ? 30.362  150.159 15.871  1.00 29.99  ? 237 THR A OG1 1 
ATOM   1841  C  CG2 . THR A 1  237 ? 30.730  148.094 17.073  1.00 25.91  ? 237 THR A CG2 1 
ATOM   1842  N  N   . GLY A 1  238 ? 29.876  145.650 14.997  1.00 21.23  ? 238 GLY A N   1 
ATOM   1843  C  CA  . GLY A 1  238 ? 29.245  144.343 15.193  1.00 27.29  ? 238 GLY A CA  1 
ATOM   1844  C  C   . GLY A 1  238 ? 29.300  143.973 16.673  1.00 26.38  ? 238 GLY A C   1 
ATOM   1845  O  O   . GLY A 1  238 ? 30.100  143.284 17.138  1.00 31.64  ? 238 GLY A O   1 
ATOM   1846  N  N   . SER A 1  239 ? 28.193  144.427 17.391  1.00 21.22  ? 239 SER A N   1 
ATOM   1847  C  CA  . SER A 1  239 ? 28.094  144.192 18.815  1.00 14.51  ? 239 SER A CA  1 
ATOM   1848  C  C   . SER A 1  239 ? 26.842  143.408 19.123  1.00 13.73  ? 239 SER A C   1 
ATOM   1849  O  O   . SER A 1  239 ? 26.015  143.360 18.215  1.00 23.21  ? 239 SER A O   1 
ATOM   1850  C  CB  . SER A 1  239 ? 27.966  145.585 19.460  1.00 23.86  ? 239 SER A CB  1 
ATOM   1851  O  OG  . SER A 1  239 ? 26.785  145.728 20.212  1.00 28.87  ? 239 SER A OG  1 
ATOM   1852  N  N   . GLN A 1  240 ? 26.628  143.078 20.384  1.00 8.84   ? 240 GLN A N   1 
ATOM   1853  C  CA  . GLN A 1  240 ? 25.307  142.566 20.753  1.00 8.23   ? 240 GLN A CA  1 
ATOM   1854  C  C   . GLN A 1  240 ? 24.886  143.395 21.960  1.00 2.20   ? 240 GLN A C   1 
ATOM   1855  O  O   . GLN A 1  240 ? 25.669  143.770 22.788  1.00 5.51   ? 240 GLN A O   1 
ATOM   1856  C  CB  . GLN A 1  240 ? 25.365  141.099 21.174  1.00 17.35  ? 240 GLN A CB  1 
ATOM   1857  C  CG  . GLN A 1  240 ? 24.026  140.378 21.130  1.00 26.40  ? 240 GLN A CG  1 
ATOM   1858  C  CD  . GLN A 1  240 ? 24.170  138.883 21.319  1.00 28.65  ? 240 GLN A CD  1 
ATOM   1859  O  OE1 . GLN A 1  240 ? 25.273  138.348 21.362  1.00 11.50  ? 240 GLN A OE1 1 
ATOM   1860  N  NE2 . GLN A 1  240 ? 23.085  138.132 21.441  1.00 43.09  ? 240 GLN A NE2 1 
ATOM   1861  N  N   . ILE A 1  241 ? 23.556  143.476 22.128  1.00 7.60   ? 241 ILE A N   1 
ATOM   1862  C  CA  . ILE A 1  241 ? 22.951  144.070 23.307  1.00 5.12   ? 241 ILE A CA  1 
ATOM   1863  C  C   . ILE A 1  241 ? 21.860  143.112 23.800  1.00 7.62   ? 241 ILE A C   1 
ATOM   1864  O  O   . ILE A 1  241 ? 20.948  142.870 23.007  1.00 9.81   ? 241 ILE A O   1 
ATOM   1865  C  CB  . ILE A 1  241 ? 22.324  145.436 23.100  1.00 5.74   ? 241 ILE A CB  1 
ATOM   1866  C  CG1 . ILE A 1  241 ? 21.543  145.913 24.330  1.00 4.47   ? 241 ILE A CG1 1 
ATOM   1867  C  CG2 . ILE A 1  241 ? 21.417  145.482 21.892  1.00 11.23  ? 241 ILE A CG2 1 
ATOM   1868  C  CD1 . ILE A 1  241 ? 21.067  147.326 24.039  1.00 12.70  ? 241 ILE A CD1 1 
ATOM   1869  N  N   . CYS A 1  242 ? 22.144  142.386 24.876  1.00 7.63   ? 242 CYS A N   1 
ATOM   1870  C  CA  . CYS A 1  242 ? 21.210  141.407 25.402  1.00 3.46   ? 242 CYS A CA  1 
ATOM   1871  C  C   . CYS A 1  242 ? 20.549  141.921 26.678  1.00 9.84   ? 242 CYS A C   1 
ATOM   1872  O  O   . CYS A 1  242 ? 21.211  142.273 27.644  1.00 16.42  ? 242 CYS A O   1 
ATOM   1873  C  CB  . CYS A 1  242 ? 21.796  140.060 25.655  1.00 4.47   ? 242 CYS A CB  1 
ATOM   1874  S  SG  . CYS A 1  242 ? 22.511  139.084 24.355  1.00 7.62   ? 242 CYS A SG  1 
ATOM   1875  N  N   . HIS A 1  243 ? 19.231  141.895 26.614  1.00 9.38   ? 243 HIS A N   1 
ATOM   1876  C  CA  . HIS A 1  243 ? 18.403  142.475 27.663  1.00 7.20   ? 243 HIS A CA  1 
ATOM   1877  C  C   . HIS A 1  243 ? 17.366  141.454 28.137  1.00 6.31   ? 243 HIS A C   1 
ATOM   1878  O  O   . HIS A 1  243 ? 16.324  141.434 27.484  1.00 8.94   ? 243 HIS A O   1 
ATOM   1879  C  CB  . HIS A 1  243 ? 17.660  143.632 26.995  1.00 2.64   ? 243 HIS A CB  1 
ATOM   1880  C  CG  . HIS A 1  243 ? 16.757  144.402 27.905  1.00 6.70   ? 243 HIS A CG  1 
ATOM   1881  N  ND1 . HIS A 1  243 ? 16.792  144.478 29.254  1.00 6.90   ? 243 HIS A ND1 1 
ATOM   1882  C  CD2 . HIS A 1  243 ? 15.746  145.206 27.556  1.00 2.20   ? 243 HIS A CD2 1 
ATOM   1883  C  CE1 . HIS A 1  243 ? 15.854  145.274 29.715  1.00 2.20   ? 243 HIS A CE1 1 
ATOM   1884  N  NE2 . HIS A 1  243 ? 15.180  145.707 28.681  1.00 6.07   ? 243 HIS A NE2 1 
ATOM   1885  N  N   . ARG A 1  244 ? 17.730  140.665 29.115  1.00 4.47   ? 244 ARG A N   1 
ATOM   1886  C  CA  . ARG A 1  244 ? 16.998  139.578 29.687  1.00 2.20   ? 244 ARG A CA  1 
ATOM   1887  C  C   . ARG A 1  244 ? 15.839  139.987 30.581  1.00 5.91   ? 244 ARG A C   1 
ATOM   1888  O  O   . ARG A 1  244 ? 16.009  140.662 31.581  1.00 6.60   ? 244 ARG A O   1 
ATOM   1889  C  CB  . ARG A 1  244 ? 17.909  138.601 30.434  1.00 3.86   ? 244 ARG A CB  1 
ATOM   1890  C  CG  . ARG A 1  244 ? 17.404  137.351 31.084  1.00 4.15   ? 244 ARG A CG  1 
ATOM   1891  C  CD  . ARG A 1  244 ? 18.292  136.138 31.027  1.00 4.46   ? 244 ARG A CD  1 
ATOM   1892  N  NE  . ARG A 1  244 ? 17.754  134.894 31.542  1.00 10.60  ? 244 ARG A NE  1 
ATOM   1893  C  CZ  . ARG A 1  244 ? 18.322  134.025 32.368  1.00 11.69  ? 244 ARG A CZ  1 
ATOM   1894  N  NH1 . ARG A 1  244 ? 19.533  134.225 32.878  1.00 9.71   ? 244 ARG A NH1 1 
ATOM   1895  N  NH2 . ARG A 1  244 ? 17.721  132.906 32.772  1.00 12.44  ? 244 ARG A NH2 1 
ATOM   1896  N  N   . GLU A 1  245 ? 14.679  139.401 30.271  1.00 5.13   ? 245 GLU A N   1 
ATOM   1897  C  CA  . GLU A 1  245 ? 13.506  139.559 31.100  1.00 6.10   ? 245 GLU A CA  1 
ATOM   1898  C  C   . GLU A 1  245 ? 12.647  138.306 31.093  1.00 7.97   ? 245 GLU A C   1 
ATOM   1899  O  O   . GLU A 1  245 ? 11.518  138.345 30.598  1.00 13.45  ? 245 GLU A O   1 
ATOM   1900  C  CB  . GLU A 1  245 ? 12.662  140.759 30.708  1.00 6.23   ? 245 GLU A CB  1 
ATOM   1901  C  CG  . GLU A 1  245 ? 12.282  141.566 31.939  1.00 2.20   ? 245 GLU A CG  1 
ATOM   1902  C  CD  . GLU A 1  245 ? 10.902  141.222 32.433  1.00 4.02   ? 245 GLU A CD  1 
ATOM   1903  O  OE1 . GLU A 1  245 ? 9.984   141.594 31.662  1.00 5.44   ? 245 GLU A OE1 1 
ATOM   1904  O  OE2 . GLU A 1  245 ? 10.702  140.631 33.494  1.00 7.43   ? 245 GLU A OE2 1 
ATOM   1905  N  N   . ASP A 1  246 ? 13.067  137.249 31.752  1.00 7.17   ? 246 ASP A N   1 
ATOM   1906  C  CA  . ASP A 1  246 ? 12.359  136.012 31.929  1.00 5.65   ? 246 ASP A CA  1 
ATOM   1907  C  C   . ASP A 1  246 ? 10.898  136.229 32.324  1.00 5.91   ? 246 ASP A C   1 
ATOM   1908  O  O   . ASP A 1  246 ? 10.191  135.218 32.354  1.00 11.50  ? 246 ASP A O   1 
ATOM   1909  C  CB  . ASP A 1  246 ? 13.033  135.251 33.070  1.00 13.00  ? 246 ASP A CB  1 
ATOM   1910  C  CG  . ASP A 1  246 ? 14.154  134.344 32.622  1.00 24.98  ? 246 ASP A CG  1 
ATOM   1911  O  OD1 . ASP A 1  246 ? 15.216  134.802 32.152  1.00 20.04  ? 246 ASP A OD1 1 
ATOM   1912  O  OD2 . ASP A 1  246 ? 13.967  133.104 32.747  1.00 33.27  ? 246 ASP A OD2 1 
ATOM   1913  N  N   . GLY A 1  247 ? 10.419  137.421 32.603  1.00 5.09   ? 247 GLY A N   1 
ATOM   1914  C  CA  . GLY A 1  247 ? 9.038   137.664 32.922  1.00 5.72   ? 247 GLY A CA  1 
ATOM   1915  C  C   . GLY A 1  247 ? 8.171   137.771 31.688  1.00 4.53   ? 247 GLY A C   1 
ATOM   1916  O  O   . GLY A 1  247 ? 6.940   137.886 31.778  1.00 6.89   ? 247 GLY A O   1 
ATOM   1917  N  N   . LEU A 1  248 ? 8.722   137.795 30.491  1.00 2.20   ? 248 LEU A N   1 
ATOM   1918  C  CA  . LEU A 1  248 ? 7.995   137.964 29.287  1.00 7.41   ? 248 LEU A CA  1 
ATOM   1919  C  C   . LEU A 1  248 ? 7.848   136.566 28.683  1.00 6.18   ? 248 LEU A C   1 
ATOM   1920  O  O   . LEU A 1  248 ? 8.749   135.742 28.748  1.00 6.92   ? 248 LEU A O   1 
ATOM   1921  C  CB  . LEU A 1  248 ? 8.743   138.844 28.333  1.00 10.46  ? 248 LEU A CB  1 
ATOM   1922  C  CG  . LEU A 1  248 ? 9.169   140.265 28.740  1.00 2.97   ? 248 LEU A CG  1 
ATOM   1923  C  CD1 . LEU A 1  248 ? 9.409   140.978 27.393  1.00 3.37   ? 248 LEU A CD1 1 
ATOM   1924  C  CD2 . LEU A 1  248 ? 8.051   140.948 29.478  1.00 3.59   ? 248 LEU A CD2 1 
ATOM   1925  N  N   . PRO A 1  249 ? 6.713   136.369 28.069  1.00 7.16   ? 249 PRO A N   1 
ATOM   1926  C  CA  . PRO A 1  249 ? 6.349   135.143 27.477  1.00 2.20   ? 249 PRO A CA  1 
ATOM   1927  C  C   . PRO A 1  249 ? 7.205   134.633 26.321  1.00 4.93   ? 249 PRO A C   1 
ATOM   1928  O  O   . PRO A 1  249 ? 7.522   133.444 26.238  1.00 3.30   ? 249 PRO A O   1 
ATOM   1929  C  CB  . PRO A 1  249 ? 4.877   135.286 26.978  1.00 8.19   ? 249 PRO A CB  1 
ATOM   1930  C  CG  . PRO A 1  249 ? 4.416   136.505 27.720  1.00 7.91   ? 249 PRO A CG  1 
ATOM   1931  C  CD  . PRO A 1  249 ? 5.636   137.360 27.988  1.00 8.37   ? 249 PRO A CD  1 
ATOM   1932  N  N   . LEU A 1  250 ? 7.445   135.447 25.300  1.00 7.76   ? 250 LEU A N   1 
ATOM   1933  C  CA  . LEU A 1  250 ? 8.173   135.108 24.089  1.00 5.65   ? 250 LEU A CA  1 
ATOM   1934  C  C   . LEU A 1  250 ? 9.494   135.878 24.037  1.00 8.10   ? 250 LEU A C   1 
ATOM   1935  O  O   . LEU A 1  250 ? 9.852   136.549 24.994  1.00 12.50  ? 250 LEU A O   1 
ATOM   1936  C  CB  . LEU A 1  250 ? 7.374   135.374 22.818  1.00 6.57   ? 250 LEU A CB  1 
ATOM   1937  C  CG  . LEU A 1  250 ? 6.191   134.443 22.580  1.00 6.72   ? 250 LEU A CG  1 
ATOM   1938  C  CD1 . LEU A 1  250 ? 5.324   134.852 21.403  1.00 2.89   ? 250 LEU A CD1 1 
ATOM   1939  C  CD2 . LEU A 1  250 ? 6.673   133.032 22.335  1.00 6.59   ? 250 LEU A CD2 1 
ATOM   1940  N  N   . ALA A 1  251 ? 10.267  135.612 23.004  1.00 10.37  ? 251 ALA A N   1 
ATOM   1941  C  CA  . ALA A 1  251 ? 11.638  136.072 22.838  1.00 6.72   ? 251 ALA A CA  1 
ATOM   1942  C  C   . ALA A 1  251 ? 11.708  136.776 21.483  1.00 7.54   ? 251 ALA A C   1 
ATOM   1943  O  O   . ALA A 1  251 ? 11.042  136.279 20.582  1.00 9.15   ? 251 ALA A O   1 
ATOM   1944  C  CB  . ALA A 1  251 ? 12.573  134.878 22.726  1.00 4.87   ? 251 ALA A CB  1 
ATOM   1945  N  N   . HIS A 1  252 ? 12.369  137.888 21.484  1.00 5.26   ? 252 HIS A N   1 
ATOM   1946  C  CA  . HIS A 1  252 ? 12.524  138.693 20.302  1.00 6.14   ? 252 HIS A CA  1 
ATOM   1947  C  C   . HIS A 1  252 ? 14.003  138.817 19.990  1.00 8.19   ? 252 HIS A C   1 
ATOM   1948  O  O   . HIS A 1  252 ? 14.784  139.239 20.834  1.00 8.62   ? 252 HIS A O   1 
ATOM   1949  C  CB  . HIS A 1  252 ? 11.938  140.093 20.470  1.00 5.34   ? 252 HIS A CB  1 
ATOM   1950  C  CG  . HIS A 1  252 ? 10.471  140.110 20.300  1.00 7.32   ? 252 HIS A CG  1 
ATOM   1951  N  ND1 . HIS A 1  252 ? 9.583   139.651 21.147  1.00 7.90   ? 252 HIS A ND1 1 
ATOM   1952  C  CD2 . HIS A 1  252 ? 9.741   140.471 19.131  1.00 5.28   ? 252 HIS A CD2 1 
ATOM   1953  C  CE1 . HIS A 1  252 ? 8.353   139.732 20.666  1.00 8.20   ? 252 HIS A CE1 1 
ATOM   1954  N  NE2 . HIS A 1  252 ? 8.429   140.233 19.444  1.00 4.44   ? 252 HIS A NE2 1 
ATOM   1955  N  N   . VAL A 1  253 ? 14.370  138.392 18.793  1.00 10.88  ? 253 VAL A N   1 
ATOM   1956  C  CA  . VAL A 1  253 ? 15.788  138.507 18.397  1.00 10.11  ? 253 VAL A CA  1 
ATOM   1957  C  C   . VAL A 1  253 ? 15.876  139.197 17.031  1.00 5.90   ? 253 VAL A C   1 
ATOM   1958  O  O   . VAL A 1  253 ? 15.055  138.874 16.176  1.00 2.49   ? 253 VAL A O   1 
ATOM   1959  C  CB  . VAL A 1  253 ? 16.382  137.098 18.254  1.00 2.20   ? 253 VAL A CB  1 
ATOM   1960  C  CG1 . VAL A 1  253 ? 17.763  137.116 17.636  1.00 2.20   ? 253 VAL A CG1 1 
ATOM   1961  C  CG2 . VAL A 1  253 ? 16.393  136.379 19.577  1.00 4.54   ? 253 VAL A CG2 1 
ATOM   1962  N  N   . ALA A 1  254 ? 16.719  140.211 16.947  1.00 2.20   ? 254 ALA A N   1 
ATOM   1963  C  CA  . ALA A 1  254 ? 16.969  140.852 15.649  1.00 2.20   ? 254 ALA A CA  1 
ATOM   1964  C  C   . ALA A 1  254 ? 18.452  140.640 15.362  1.00 6.08   ? 254 ALA A C   1 
ATOM   1965  O  O   . ALA A 1  254 ? 19.306  141.101 16.136  1.00 3.78   ? 254 ALA A O   1 
ATOM   1966  C  CB  . ALA A 1  254 ? 16.582  142.309 15.788  1.00 2.20   ? 254 ALA A CB  1 
ATOM   1967  N  N   . ILE A 1  255 ? 18.793  139.889 14.332  1.00 7.06   ? 255 ILE A N   1 
ATOM   1968  C  CA  . ILE A 1  255 ? 20.142  139.681 13.852  1.00 5.07   ? 255 ILE A CA  1 
ATOM   1969  C  C   . ILE A 1  255 ? 20.327  140.290 12.456  1.00 5.59   ? 255 ILE A C   1 
ATOM   1970  O  O   . ILE A 1  255 ? 19.505  140.154 11.540  1.00 3.58   ? 255 ILE A O   1 
ATOM   1971  C  CB  . ILE A 1  255 ? 20.524  138.194 13.818  1.00 6.60   ? 255 ILE A CB  1 
ATOM   1972  C  CG1 . ILE A 1  255 ? 21.959  138.045 13.351  1.00 4.40   ? 255 ILE A CG1 1 
ATOM   1973  C  CG2 . ILE A 1  255 ? 19.505  137.361 13.058  1.00 10.28  ? 255 ILE A CG2 1 
ATOM   1974  C  CD1 . ILE A 1  255 ? 22.471  136.743 12.827  1.00 3.98   ? 255 ILE A CD1 1 
ATOM   1975  N  N   . ALA A 1  256 ? 21.309  141.171 12.269  1.00 7.56   ? 256 ALA A N   1 
ATOM   1976  C  CA  . ALA A 1  256 ? 21.601  141.757 10.969  1.00 9.06   ? 256 ALA A CA  1 
ATOM   1977  C  C   . ALA A 1  256 ? 23.080  142.088 10.748  1.00 10.18  ? 256 ALA A C   1 
ATOM   1978  O  O   . ALA A 1  256 ? 23.800  142.579 11.623  1.00 9.82   ? 256 ALA A O   1 
ATOM   1979  C  CB  . ALA A 1  256 ? 20.828  143.038 10.731  1.00 4.16   ? 256 ALA A CB  1 
ATOM   1980  N  N   . VAL A 1  257 ? 23.538  141.941 9.510   1.00 12.62  ? 257 VAL A N   1 
ATOM   1981  C  CA  . VAL A 1  257 ? 24.860  142.399 9.109   1.00 15.56  ? 257 VAL A CA  1 
ATOM   1982  C  C   . VAL A 1  257 ? 24.689  143.661 8.234   1.00 13.80  ? 257 VAL A C   1 
ATOM   1983  O  O   . VAL A 1  257 ? 23.803  143.647 7.387   1.00 18.86  ? 257 VAL A O   1 
ATOM   1984  C  CB  . VAL A 1  257 ? 25.698  141.500 8.186   1.00 16.32  ? 257 VAL A CB  1 
ATOM   1985  C  CG1 . VAL A 1  257 ? 26.188  140.245 8.863   1.00 26.48  ? 257 VAL A CG1 1 
ATOM   1986  C  CG2 . VAL A 1  257 ? 24.987  141.185 6.890   1.00 8.47   ? 257 VAL A CG2 1 
ATOM   1987  N  N   . GLU A 1  258 ? 25.691  144.493 8.327   1.00 11.78  ? 258 GLU A N   1 
ATOM   1988  C  CA  . GLU A 1  258 ? 25.673  145.777 7.667   1.00 16.95  ? 258 GLU A CA  1 
ATOM   1989  C  C   . GLU A 1  258 ? 25.666  145.692 6.164   1.00 16.48  ? 258 GLU A C   1 
ATOM   1990  O  O   . GLU A 1  258 ? 26.213  144.825 5.484   1.00 17.18  ? 258 GLU A O   1 
ATOM   1991  C  CB  . GLU A 1  258 ? 26.830  146.587 8.225   1.00 35.78  ? 258 GLU A CB  1 
ATOM   1992  C  CG  . GLU A 1  258 ? 26.554  146.930 9.697   1.00 47.82  ? 258 GLU A CG  1 
ATOM   1993  C  CD  . GLU A 1  258 ? 27.343  146.083 10.665  1.00 49.16  ? 258 GLU A CD  1 
ATOM   1994  O  OE1 . GLU A 1  258 ? 27.995  145.085 10.309  1.00 55.88  ? 258 GLU A OE1 1 
ATOM   1995  O  OE2 . GLU A 1  258 ? 27.301  146.446 11.855  1.00 46.41  ? 258 GLU A OE2 1 
ATOM   1996  N  N   . GLY A 1  259 ? 24.883  146.644 5.634   1.00 12.97  ? 259 GLY A N   1 
ATOM   1997  C  CA  . GLY A 1  259 ? 24.694  146.666 4.202   1.00 2.20   ? 259 GLY A CA  1 
ATOM   1998  C  C   . GLY A 1  259 ? 24.955  148.046 3.619   1.00 18.26  ? 259 GLY A C   1 
ATOM   1999  O  O   . GLY A 1  259 ? 25.439  148.999 4.227   1.00 19.27  ? 259 GLY A O   1 
ATOM   2000  N  N   . PRO A 1  260 ? 24.562  148.137 2.372   1.00 18.66  ? 260 PRO A N   1 
ATOM   2001  C  CA  . PRO A 1  260 ? 24.905  149.276 1.549   1.00 22.50  ? 260 PRO A CA  1 
ATOM   2002  C  C   . PRO A 1  260 ? 23.883  150.370 1.764   1.00 23.82  ? 260 PRO A C   1 
ATOM   2003  O  O   . PRO A 1  260 ? 22.980  150.212 2.594   1.00 28.74  ? 260 PRO A O   1 
ATOM   2004  C  CB  . PRO A 1  260 ? 25.060  148.742 0.136   1.00 25.34  ? 260 PRO A CB  1 
ATOM   2005  C  CG  . PRO A 1  260 ? 24.729  147.279 0.268   1.00 25.39  ? 260 PRO A CG  1 
ATOM   2006  C  CD  . PRO A 1  260 ? 24.012  147.040 1.582   1.00 23.17  ? 260 PRO A CD  1 
ATOM   2007  N  N   . GLY A 1  261 ? 24.113  151.497 1.115   1.00 23.05  ? 261 GLY A N   1 
ATOM   2008  C  CA  . GLY A 1  261 ? 23.170  152.609 1.249   1.00 23.02  ? 261 GLY A CA  1 
ATOM   2009  C  C   . GLY A 1  261 ? 21.908  152.338 0.429   1.00 13.02  ? 261 GLY A C   1 
ATOM   2010  O  O   . GLY A 1  261 ? 21.555  151.195 0.196   1.00 10.53  ? 261 GLY A O   1 
ATOM   2011  N  N   . TRP A 1  262 ? 21.243  153.388 0.005   1.00 9.89   ? 262 TRP A N   1 
ATOM   2012  C  CA  . TRP A 1  262 ? 20.010  153.305 -0.766  1.00 5.94   ? 262 TRP A CA  1 
ATOM   2013  C  C   . TRP A 1  262 ? 20.235  152.941 -2.234  1.00 3.89   ? 262 TRP A C   1 
ATOM   2014  O  O   . TRP A 1  262 ? 19.418  152.343 -2.897  1.00 6.34   ? 262 TRP A O   1 
ATOM   2015  C  CB  . TRP A 1  262 ? 19.438  154.717 -0.752  1.00 6.56   ? 262 TRP A CB  1 
ATOM   2016  C  CG  . TRP A 1  262 ? 18.774  155.075 0.535   1.00 9.73   ? 262 TRP A CG  1 
ATOM   2017  C  CD1 . TRP A 1  262 ? 19.156  155.934 1.516   1.00 4.96   ? 262 TRP A CD1 1 
ATOM   2018  C  CD2 . TRP A 1  262 ? 17.477  154.576 0.910   1.00 6.82   ? 262 TRP A CD2 1 
ATOM   2019  N  NE1 . TRP A 1  262 ? 18.186  155.991 2.485   1.00 5.41   ? 262 TRP A NE1 1 
ATOM   2020  C  CE2 . TRP A 1  262 ? 17.129  155.180 2.123   1.00 3.38   ? 262 TRP A CE2 1 
ATOM   2021  C  CE3 . TRP A 1  262 ? 16.585  153.723 0.258   1.00 6.57   ? 262 TRP A CE3 1 
ATOM   2022  C  CZ2 . TRP A 1  262 ? 15.903  154.944 2.757   1.00 3.56   ? 262 TRP A CZ2 1 
ATOM   2023  C  CZ3 . TRP A 1  262 ? 15.381  153.539 0.839   1.00 2.20   ? 262 TRP A CZ3 1 
ATOM   2024  C  CH2 . TRP A 1  262 ? 15.067  154.119 2.082   1.00 2.20   ? 262 TRP A CH2 1 
ATOM   2025  N  N   . ALA A 1  263 ? 21.389  153.348 -2.761  1.00 11.41  ? 263 ALA A N   1 
ATOM   2026  C  CA  . ALA A 1  263 ? 21.665  153.247 -4.189  1.00 16.61  ? 263 ALA A CA  1 
ATOM   2027  C  C   . ALA A 1  263 ? 22.708  152.196 -4.497  1.00 20.51  ? 263 ALA A C   1 
ATOM   2028  O  O   . ALA A 1  263 ? 23.887  152.497 -4.291  1.00 31.11  ? 263 ALA A O   1 
ATOM   2029  C  CB  . ALA A 1  263 ? 22.234  154.634 -4.524  1.00 11.73  ? 263 ALA A CB  1 
ATOM   2030  N  N   . HIS A 1  264 ? 22.414  151.010 -4.997  1.00 22.33  ? 264 HIS A N   1 
ATOM   2031  C  CA  . HIS A 1  264 ? 23.473  150.035 -5.291  1.00 16.80  ? 264 HIS A CA  1 
ATOM   2032  C  C   . HIS A 1  264 ? 22.930  148.808 -5.994  1.00 24.07  ? 264 HIS A C   1 
ATOM   2033  O  O   . HIS A 1  264 ? 22.050  148.033 -5.575  1.00 15.42  ? 264 HIS A O   1 
ATOM   2034  C  CB  . HIS A 1  264 ? 24.135  149.635 -3.978  1.00 11.12  ? 264 HIS A CB  1 
ATOM   2035  C  CG  . HIS A 1  264 ? 25.543  149.146 -4.046  1.00 8.94   ? 264 HIS A CG  1 
ATOM   2036  N  ND1 . HIS A 1  264 ? 26.008  148.038 -4.706  1.00 6.01   ? 264 HIS A ND1 1 
ATOM   2037  C  CD2 . HIS A 1  264 ? 26.633  149.700 -3.445  1.00 5.83   ? 264 HIS A CD2 1 
ATOM   2038  C  CE1 . HIS A 1  264 ? 27.313  147.930 -4.525  1.00 7.15   ? 264 HIS A CE1 1 
ATOM   2039  N  NE2 . HIS A 1  264 ? 27.713  148.922 -3.769  1.00 12.91  ? 264 HIS A NE2 1 
ATOM   2040  N  N   . PRO A 1  265 ? 23.608  148.413 -7.053  1.00 29.96  ? 265 PRO A N   1 
ATOM   2041  C  CA  . PRO A 1  265 ? 23.307  147.188 -7.765  1.00 34.46  ? 265 PRO A CA  1 
ATOM   2042  C  C   . PRO A 1  265 ? 23.044  145.995 -6.853  1.00 32.79  ? 265 PRO A C   1 
ATOM   2043  O  O   . PRO A 1  265 ? 22.446  145.018 -7.314  1.00 34.44  ? 265 PRO A O   1 
ATOM   2044  C  CB  . PRO A 1  265 ? 24.548  146.855 -8.626  1.00 38.91  ? 265 PRO A CB  1 
ATOM   2045  C  CG  . PRO A 1  265 ? 25.463  148.029 -8.397  1.00 38.90  ? 265 PRO A CG  1 
ATOM   2046  C  CD  . PRO A 1  265 ? 24.802  149.093 -7.555  1.00 32.72  ? 265 PRO A CD  1 
ATOM   2047  N  N   . ASP A 1  266 ? 23.724  145.949 -5.721  1.00 32.04  ? 266 ASP A N   1 
ATOM   2048  C  CA  . ASP A 1  266 ? 23.736  144.790 -4.837  1.00 31.56  ? 266 ASP A CA  1 
ATOM   2049  C  C   . ASP A 1  266 ? 22.447  144.700 -4.038  1.00 28.98  ? 266 ASP A C   1 
ATOM   2050  O  O   . ASP A 1  266 ? 21.966  143.606 -3.732  1.00 31.02  ? 266 ASP A O   1 
ATOM   2051  C  CB  . ASP A 1  266 ? 24.994  144.862 -3.954  1.00 28.66  ? 266 ASP A CB  1 
ATOM   2052  C  CG  . ASP A 1  266 ? 26.201  144.839 -4.891  1.00 35.41  ? 266 ASP A CG  1 
ATOM   2053  O  OD1 . ASP A 1  266 ? 26.301  145.725 -5.765  1.00 29.59  ? 266 ASP A OD1 1 
ATOM   2054  O  OD2 . ASP A 1  266 ? 27.042  143.929 -4.781  1.00 41.93  ? 266 ASP A OD2 1 
ATOM   2055  N  N   . ASN A 1  267 ? 21.829  145.857 -3.914  1.00 22.70  ? 267 ASN A N   1 
ATOM   2056  C  CA  . ASN A 1  267 ? 20.660  146.160 -3.132  1.00 15.44  ? 267 ASN A CA  1 
ATOM   2057  C  C   . ASN A 1  267 ? 19.324  145.719 -3.683  1.00 13.86  ? 267 ASN A C   1 
ATOM   2058  O  O   . ASN A 1  267 ? 18.286  145.993 -3.074  1.00 16.97  ? 267 ASN A O   1 
ATOM   2059  C  CB  . ASN A 1  267 ? 20.691  147.677 -2.948  1.00 11.56  ? 267 ASN A CB  1 
ATOM   2060  C  CG  . ASN A 1  267 ? 19.670  148.198 -1.992  1.00 11.32  ? 267 ASN A CG  1 
ATOM   2061  O  OD1 . ASN A 1  267 ? 19.296  147.507 -1.061  1.00 10.85  ? 267 ASN A OD1 1 
ATOM   2062  N  ND2 . ASN A 1  267 ? 19.235  149.429 -2.254  1.00 29.25  ? 267 ASN A ND2 1 
ATOM   2063  N  N   . VAL A 1  268 ? 19.252  145.174 -4.873  1.00 9.19   ? 268 VAL A N   1 
ATOM   2064  C  CA  . VAL A 1  268 ? 17.992  144.655 -5.423  1.00 8.57   ? 268 VAL A CA  1 
ATOM   2065  C  C   . VAL A 1  268 ? 18.235  143.147 -5.329  1.00 9.76   ? 268 VAL A C   1 
ATOM   2066  O  O   . VAL A 1  268 ? 17.384  142.314 -5.111  1.00 10.63  ? 268 VAL A O   1 
ATOM   2067  C  CB  . VAL A 1  268 ? 17.853  145.022 -6.910  1.00 11.96  ? 268 VAL A CB  1 
ATOM   2068  C  CG1 . VAL A 1  268 ? 16.996  144.081 -7.723  1.00 6.48   ? 268 VAL A CG1 1 
ATOM   2069  C  CG2 . VAL A 1  268 ? 17.464  146.470 -7.092  1.00 10.13  ? 268 VAL A CG2 1 
ATOM   2070  N  N   . ALA A 1  269 ? 19.530  142.840 -5.508  1.00 13.43  ? 269 ALA A N   1 
ATOM   2071  C  CA  . ALA A 1  269 ? 19.938  141.434 -5.509  1.00 11.68  ? 269 ALA A CA  1 
ATOM   2072  C  C   . ALA A 1  269 ? 19.735  140.815 -4.126  1.00 7.99   ? 269 ALA A C   1 
ATOM   2073  O  O   . ALA A 1  269 ? 19.165  139.727 -4.075  1.00 2.43   ? 269 ALA A O   1 
ATOM   2074  C  CB  . ALA A 1  269 ? 21.348  141.259 -6.003  1.00 9.91   ? 269 ALA A CB  1 
ATOM   2075  N  N   . LEU A 1  270 ? 20.084  141.552 -3.088  1.00 7.22   ? 270 LEU A N   1 
ATOM   2076  C  CA  . LEU A 1  270 ? 19.751  141.257 -1.702  1.00 6.63   ? 270 LEU A CA  1 
ATOM   2077  C  C   . LEU A 1  270 ? 18.281  140.948 -1.549  1.00 2.73   ? 270 LEU A C   1 
ATOM   2078  O  O   . LEU A 1  270 ? 17.859  139.819 -1.321  1.00 3.78   ? 270 LEU A O   1 
ATOM   2079  C  CB  . LEU A 1  270 ? 20.192  142.407 -0.782  1.00 7.51   ? 270 LEU A CB  1 
ATOM   2080  C  CG  . LEU A 1  270 ? 21.709  142.640 -0.716  1.00 11.69  ? 270 LEU A CG  1 
ATOM   2081  C  CD1 . LEU A 1  270 ? 22.094  143.817 0.156   1.00 8.19   ? 270 LEU A CD1 1 
ATOM   2082  C  CD2 . LEU A 1  270 ? 22.425  141.378 -0.251  1.00 16.29  ? 270 LEU A CD2 1 
ATOM   2083  N  N   . GLN A 1  271 ? 17.392  141.865 -1.940  1.00 5.29   ? 271 GLN A N   1 
ATOM   2084  C  CA  . GLN A 1  271 ? 15.952  141.669 -1.874  1.00 6.13   ? 271 GLN A CA  1 
ATOM   2085  C  C   . GLN A 1  271 ? 15.556  140.330 -2.455  1.00 10.06  ? 271 GLN A C   1 
ATOM   2086  O  O   . GLN A 1  271 ? 14.805  139.528 -1.889  1.00 12.75  ? 271 GLN A O   1 
ATOM   2087  C  CB  . GLN A 1  271 ? 15.196  142.804 -2.555  1.00 11.70  ? 271 GLN A CB  1 
ATOM   2088  C  CG  . GLN A 1  271 ? 15.293  144.141 -1.848  1.00 19.19  ? 271 GLN A CG  1 
ATOM   2089  C  CD  . GLN A 1  271 ? 14.710  144.152 -0.451  1.00 30.36  ? 271 GLN A CD  1 
ATOM   2090  O  OE1 . GLN A 1  271 ? 14.250  143.144 0.099   1.00 27.25  ? 271 GLN A OE1 1 
ATOM   2091  N  NE2 . GLN A 1  271 ? 14.745  145.360 0.119   1.00 35.54  ? 271 GLN A NE2 1 
ATOM   2092  N  N   . VAL A 1  272 ? 16.079  140.027 -3.643  1.00 11.02  ? 272 VAL A N   1 
ATOM   2093  C  CA  . VAL A 1  272 ? 15.737  138.726 -4.250  1.00 5.65   ? 272 VAL A CA  1 
ATOM   2094  C  C   . VAL A 1  272 ? 16.204  137.602 -3.351  1.00 7.10   ? 272 VAL A C   1 
ATOM   2095  O  O   . VAL A 1  272 ? 15.763  136.459 -3.449  1.00 2.50   ? 272 VAL A O   1 
ATOM   2096  C  CB  . VAL A 1  272 ? 16.507  138.667 -5.580  1.00 4.18   ? 272 VAL A CB  1 
ATOM   2097  C  CG1 . VAL A 1  272 ? 16.697  137.269 -6.104  1.00 3.85   ? 272 VAL A CG1 1 
ATOM   2098  C  CG2 . VAL A 1  272 ? 15.906  139.622 -6.569  1.00 2.91   ? 272 VAL A CG2 1 
ATOM   2099  N  N   . ALA A 1  273 ? 17.283  137.832 -2.597  1.00 8.21   ? 273 ALA A N   1 
ATOM   2100  C  CA  . ALA A 1  273 ? 17.760  136.787 -1.699  1.00 10.47  ? 273 ALA A CA  1 
ATOM   2101  C  C   . ALA A 1  273 ? 16.850  136.695 -0.489  1.00 9.51   ? 273 ALA A C   1 
ATOM   2102  O  O   . ALA A 1  273 ? 16.176  135.645 -0.453  1.00 11.47  ? 273 ALA A O   1 
ATOM   2103  C  CB  . ALA A 1  273 ? 19.233  136.802 -1.415  1.00 13.88  ? 273 ALA A CB  1 
ATOM   2104  N  N   . ASN A 1  274 ? 16.457  137.770 0.192   1.00 8.27   ? 274 ASN A N   1 
ATOM   2105  C  CA  . ASN A 1  274 ? 15.396  137.729 1.188   1.00 12.75  ? 274 ASN A CA  1 
ATOM   2106  C  C   . ASN A 1  274 ? 14.033  137.209 0.734   1.00 11.75  ? 274 ASN A C   1 
ATOM   2107  O  O   . ASN A 1  274 ? 13.221  136.724 1.523   1.00 8.85   ? 274 ASN A O   1 
ATOM   2108  C  CB  . ASN A 1  274 ? 15.166  139.046 1.947   1.00 2.68   ? 274 ASN A CB  1 
ATOM   2109  C  CG  . ASN A 1  274 ? 16.485  139.505 2.541   1.00 5.90   ? 274 ASN A CG  1 
ATOM   2110  O  OD1 . ASN A 1  274 ? 17.318  138.637 2.776   1.00 5.57   ? 274 ASN A OD1 1 
ATOM   2111  N  ND2 . ASN A 1  274 ? 16.675  140.780 2.741   1.00 4.91   ? 274 ASN A ND2 1 
ATOM   2112  N  N   . ALA A 1  275 ? 13.744  137.350 -0.538  1.00 14.40  ? 275 ALA A N   1 
ATOM   2113  C  CA  . ALA A 1  275 ? 12.573  136.774 -1.185  1.00 13.73  ? 275 ALA A CA  1 
ATOM   2114  C  C   . ALA A 1  275 ? 12.538  135.281 -0.875  1.00 14.07  ? 275 ALA A C   1 
ATOM   2115  O  O   . ALA A 1  275 ? 11.540  134.660 -0.512  1.00 18.88  ? 275 ALA A O   1 
ATOM   2116  C  CB  . ALA A 1  275 ? 12.872  136.966 -2.672  1.00 19.51  ? 275 ALA A CB  1 
ATOM   2117  N  N   . ILE A 1  276 ? 13.725  134.708 -0.995  1.00 10.01  ? 276 ILE A N   1 
ATOM   2118  C  CA  . ILE A 1  276 ? 13.889  133.276 -0.778  1.00 13.26  ? 276 ILE A CA  1 
ATOM   2119  C  C   . ILE A 1  276 ? 13.692  132.783 0.627   1.00 12.37  ? 276 ILE A C   1 
ATOM   2120  O  O   . ILE A 1  276 ? 12.747  131.977 0.757   1.00 14.74  ? 276 ILE A O   1 
ATOM   2121  C  CB  . ILE A 1  276 ? 15.159  132.824 -1.500  1.00 4.74   ? 276 ILE A CB  1 
ATOM   2122  C  CG1 . ILE A 1  276 ? 14.955  133.279 -2.968  1.00 2.64   ? 276 ILE A CG1 1 
ATOM   2123  C  CG2 . ILE A 1  276 ? 15.461  131.360 -1.401  1.00 3.91   ? 276 ILE A CG2 1 
ATOM   2124  C  CD1 . ILE A 1  276 ? 16.276  133.461 -3.670  1.00 3.67   ? 276 ILE A CD1 1 
ATOM   2125  N  N   . ILE A 1  277 ? 14.341  133.316 1.643   1.00 9.88   ? 277 ILE A N   1 
ATOM   2126  C  CA  . ILE A 1  277 ? 14.149  133.098 3.062   1.00 7.73   ? 277 ILE A CA  1 
ATOM   2127  C  C   . ILE A 1  277 ? 12.671  133.307 3.459   1.00 2.20   ? 277 ILE A C   1 
ATOM   2128  O  O   . ILE A 1  277 ? 12.030  132.438 3.990   1.00 4.48   ? 277 ILE A O   1 
ATOM   2129  C  CB  . ILE A 1  277 ? 14.919  134.124 3.935   1.00 10.74  ? 277 ILE A CB  1 
ATOM   2130  C  CG1 . ILE A 1  277 ? 16.295  134.369 3.310   1.00 11.67  ? 277 ILE A CG1 1 
ATOM   2131  C  CG2 . ILE A 1  277 ? 15.127  133.618 5.354   1.00 7.78   ? 277 ILE A CG2 1 
ATOM   2132  C  CD1 . ILE A 1  277 ? 17.180  133.176 3.515   1.00 2.20   ? 277 ILE A CD1 1 
ATOM   2133  N  N   . GLY A 1  278 ? 12.210  134.502 3.120   1.00 7.10   ? 278 GLY A N   1 
ATOM   2134  C  CA  . GLY A 1  278 ? 10.808  134.809 3.299   1.00 5.07   ? 278 GLY A CA  1 
ATOM   2135  C  C   . GLY A 1  278 ? 10.502  135.464 4.628   1.00 6.22   ? 278 GLY A C   1 
ATOM   2136  O  O   . GLY A 1  278 ? 11.167  136.428 4.981   1.00 4.50   ? 278 GLY A O   1 
ATOM   2137  N  N   . HIS A 1  279 ? 9.375   135.098 5.214   1.00 7.49   ? 279 HIS A N   1 
ATOM   2138  C  CA  . HIS A 1  279 ? 8.773   135.800 6.337   1.00 2.55   ? 279 HIS A CA  1 
ATOM   2139  C  C   . HIS A 1  279 ? 7.555   134.964 6.724   1.00 8.24   ? 279 HIS A C   1 
ATOM   2140  O  O   . HIS A 1  279 ? 6.921   134.372 5.857   1.00 12.68  ? 279 HIS A O   1 
ATOM   2141  C  CB  . HIS A 1  279 ? 8.399   137.223 5.909   1.00 4.61   ? 279 HIS A CB  1 
ATOM   2142  C  CG  . HIS A 1  279 ? 7.314   137.312 4.894   1.00 3.22   ? 279 HIS A CG  1 
ATOM   2143  N  ND1 . HIS A 1  279 ? 5.976   137.328 5.200   1.00 3.04   ? 279 HIS A ND1 1 
ATOM   2144  C  CD2 . HIS A 1  279 ? 7.368   137.393 3.547   1.00 7.83   ? 279 HIS A CD2 1 
ATOM   2145  C  CE1 . HIS A 1  279 ? 5.250   137.409 4.095   1.00 3.78   ? 279 HIS A CE1 1 
ATOM   2146  N  NE2 . HIS A 1  279 ? 6.074   137.443 3.085   1.00 2.69   ? 279 HIS A NE2 1 
ATOM   2147  N  N   . TYR A 1  280 ? 7.404   134.615 7.990   1.00 12.19  ? 280 TYR A N   1 
ATOM   2148  C  CA  . TYR A 1  280 ? 6.436   133.573 8.355   1.00 8.54   ? 280 TYR A CA  1 
ATOM   2149  C  C   . TYR A 1  280 ? 5.734   133.913 9.669   1.00 8.55   ? 280 TYR A C   1 
ATOM   2150  O  O   . TYR A 1  280 ? 6.396   134.509 10.523  1.00 5.34   ? 280 TYR A O   1 
ATOM   2151  C  CB  . TYR A 1  280 ? 7.262   132.293 8.587   1.00 7.27   ? 280 TYR A CB  1 
ATOM   2152  C  CG  . TYR A 1  280 ? 6.445   131.216 9.254   1.00 3.30   ? 280 TYR A CG  1 
ATOM   2153  C  CD1 . TYR A 1  280 ? 6.250   131.166 10.630  1.00 3.01   ? 280 TYR A CD1 1 
ATOM   2154  C  CD2 . TYR A 1  280 ? 5.816   130.272 8.446   1.00 2.46   ? 280 TYR A CD2 1 
ATOM   2155  C  CE1 . TYR A 1  280 ? 5.466   130.155 11.181  1.00 3.29   ? 280 TYR A CE1 1 
ATOM   2156  C  CE2 . TYR A 1  280 ? 5.047   129.286 8.996   1.00 4.31   ? 280 TYR A CE2 1 
ATOM   2157  C  CZ  . TYR A 1  280 ? 4.860   129.230 10.357  1.00 6.56   ? 280 TYR A CZ  1 
ATOM   2158  O  OH  . TYR A 1  280 ? 4.071   128.231 10.873  1.00 9.78   ? 280 TYR A OH  1 
ATOM   2159  N  N   . ASP A 1  281 ? 4.500   133.427 9.786   1.00 4.54   ? 281 ASP A N   1 
ATOM   2160  C  CA  . ASP A 1  281 ? 3.645   133.729 10.937  1.00 5.80   ? 281 ASP A CA  1 
ATOM   2161  C  C   . ASP A 1  281 ? 2.829   132.533 11.406  1.00 3.97   ? 281 ASP A C   1 
ATOM   2162  O  O   . ASP A 1  281 ? 2.635   131.589 10.630  1.00 5.92   ? 281 ASP A O   1 
ATOM   2163  C  CB  . ASP A 1  281 ? 2.752   134.910 10.565  1.00 3.92   ? 281 ASP A CB  1 
ATOM   2164  C  CG  . ASP A 1  281 ? 1.890   135.388 11.676  1.00 8.75   ? 281 ASP A CG  1 
ATOM   2165  O  OD1 . ASP A 1  281 ? 1.904   134.779 12.755  1.00 29.47  ? 281 ASP A OD1 1 
ATOM   2166  O  OD2 . ASP A 1  281 ? 1.185   136.386 11.475  1.00 14.24  ? 281 ASP A OD2 1 
ATOM   2167  N  N   . CYS A 1  282 ? 2.448   132.447 12.675  1.00 5.79   ? 282 CYS A N   1 
ATOM   2168  C  CA  . CYS A 1  282 ? 1.595   131.482 13.319  1.00 4.96   ? 282 CYS A CA  1 
ATOM   2169  C  C   . CYS A 1  282 ? 0.412   131.137 12.397  1.00 6.97   ? 282 CYS A C   1 
ATOM   2170  O  O   . CYS A 1  282 ? -0.184  130.070 12.563  1.00 4.60   ? 282 CYS A O   1 
ATOM   2171  C  CB  . CYS A 1  282 ? 0.945   132.036 14.627  1.00 2.20   ? 282 CYS A CB  1 
ATOM   2172  S  SG  . CYS A 1  282 ? 2.195   132.407 15.868  1.00 2.20   ? 282 CYS A SG  1 
ATOM   2173  N  N   . THR A 1  283 ? -0.024  132.105 11.595  1.00 8.74   ? 283 THR A N   1 
ATOM   2174  C  CA  . THR A 1  283 ? -1.185  132.027 10.757  1.00 11.27  ? 283 THR A CA  1 
ATOM   2175  C  C   . THR A 1  283 ? -0.973  131.809 9.280   1.00 6.56   ? 283 THR A C   1 
ATOM   2176  O  O   . THR A 1  283 ? -1.888  131.923 8.448   1.00 6.15   ? 283 THR A O   1 
ATOM   2177  C  CB  . THR A 1  283 ? -2.078  133.282 10.933  1.00 16.80  ? 283 THR A CB  1 
ATOM   2178  O  OG1 . THR A 1  283 ? -1.355  134.294 11.590  1.00 14.62  ? 283 THR A OG1 1 
ATOM   2179  C  CG2 . THR A 1  283 ? -3.300  132.818 11.723  1.00 24.96  ? 283 THR A CG2 1 
ATOM   2180  N  N   . TYR A 1  284 ? 0.236   131.508 8.839   1.00 6.70   ? 284 TYR A N   1 
ATOM   2181  C  CA  . TYR A 1  284 ? 0.409   131.316 7.402   1.00 4.45   ? 284 TYR A CA  1 
ATOM   2182  C  C   . TYR A 1  284 ? -0.247  130.035 6.926   1.00 2.20   ? 284 TYR A C   1 
ATOM   2183  O  O   . TYR A 1  284 ? 0.288   128.953 7.225   1.00 3.36   ? 284 TYR A O   1 
ATOM   2184  C  CB  . TYR A 1  284 ? 1.890   131.264 7.045   1.00 3.95   ? 284 TYR A CB  1 
ATOM   2185  C  CG  . TYR A 1  284 ? 2.473   132.654 6.828   1.00 7.28   ? 284 TYR A CG  1 
ATOM   2186  C  CD1 . TYR A 1  284 ? 1.961   133.746 7.486   1.00 7.27   ? 284 TYR A CD1 1 
ATOM   2187  C  CD2 . TYR A 1  284 ? 3.552   132.846 5.979   1.00 10.64  ? 284 TYR A CD2 1 
ATOM   2188  C  CE1 . TYR A 1  284 ? 2.506   134.990 7.285   1.00 13.62  ? 284 TYR A CE1 1 
ATOM   2189  C  CE2 . TYR A 1  284 ? 4.107   134.098 5.785   1.00 8.21   ? 284 TYR A CE2 1 
ATOM   2190  C  CZ  . TYR A 1  284 ? 3.581   135.175 6.437   1.00 9.55   ? 284 TYR A CZ  1 
ATOM   2191  O  OH  . TYR A 1  284 ? 4.060   136.452 6.307   1.00 3.79   ? 284 TYR A OH  1 
ATOM   2192  N  N   . GLY A 1  285 ? -1.058  130.088 5.867   1.00 2.45   ? 285 GLY A N   1 
ATOM   2193  C  CA  . GLY A 1  285 ? -1.835  128.913 5.495   1.00 3.16   ? 285 GLY A CA  1 
ATOM   2194  C  C   . GLY A 1  285 ? -1.013  127.720 5.046   1.00 2.20   ? 285 GLY A C   1 
ATOM   2195  O  O   . GLY A 1  285 ? -1.344  126.521 5.120   1.00 3.16   ? 285 GLY A O   1 
ATOM   2196  N  N   . GLY A 1  286 ? 0.189   128.027 4.553   1.00 5.70   ? 286 GLY A N   1 
ATOM   2197  C  CA  . GLY A 1  286 ? 0.930   126.931 3.954   1.00 10.50  ? 286 GLY A CA  1 
ATOM   2198  C  C   . GLY A 1  286 ? 1.908   126.223 4.851   1.00 13.40  ? 286 GLY A C   1 
ATOM   2199  O  O   . GLY A 1  286 ? 2.510   125.224 4.431   1.00 13.65  ? 286 GLY A O   1 
ATOM   2200  N  N   . GLY A 1  287 ? 2.130   126.772 6.045   1.00 13.18  ? 287 GLY A N   1 
ATOM   2201  C  CA  . GLY A 1  287 ? 3.098   126.123 6.931   1.00 10.21  ? 287 GLY A CA  1 
ATOM   2202  C  C   . GLY A 1  287 ? 4.012   125.168 6.180   1.00 9.58   ? 287 GLY A C   1 
ATOM   2203  O  O   . GLY A 1  287 ? 4.740   125.482 5.226   1.00 9.13   ? 287 GLY A O   1 
ATOM   2204  N  N   . ALA A 1  288 ? 4.055   123.920 6.634   1.00 6.68   ? 288 ALA A N   1 
ATOM   2205  C  CA  . ALA A 1  288 ? 4.980   122.922 6.161   1.00 8.70   ? 288 ALA A CA  1 
ATOM   2206  C  C   . ALA A 1  288 ? 5.253   122.826 4.679   1.00 8.70   ? 288 ALA A C   1 
ATOM   2207  O  O   . ALA A 1  288 ? 6.207   122.143 4.262   1.00 10.55  ? 288 ALA A O   1 
ATOM   2208  C  CB  . ALA A 1  288 ? 4.586   121.510 6.617   1.00 6.61   ? 288 ALA A CB  1 
ATOM   2209  N  N   . HIS A 1  289 ? 4.412   123.403 3.831   1.00 10.40  ? 289 HIS A N   1 
ATOM   2210  C  CA  . HIS A 1  289 ? 4.627   123.286 2.385   1.00 4.89   ? 289 HIS A CA  1 
ATOM   2211  C  C   . HIS A 1  289 ? 5.162   124.596 1.839   1.00 7.07   ? 289 HIS A C   1 
ATOM   2212  O  O   . HIS A 1  289 ? 5.567   124.655 0.685   1.00 5.38   ? 289 HIS A O   1 
ATOM   2213  C  CB  . HIS A 1  289 ? 3.319   122.892 1.737   1.00 6.87   ? 289 HIS A CB  1 
ATOM   2214  C  CG  . HIS A 1  289 ? 2.833   121.524 2.056   1.00 4.00   ? 289 HIS A CG  1 
ATOM   2215  N  ND1 . HIS A 1  289 ? 3.646   120.465 2.340   1.00 4.35   ? 289 HIS A ND1 1 
ATOM   2216  C  CD2 . HIS A 1  289 ? 1.567   121.038 2.113   1.00 6.61   ? 289 HIS A CD2 1 
ATOM   2217  C  CE1 . HIS A 1  289 ? 2.909   119.385 2.563   1.00 11.33  ? 289 HIS A CE1 1 
ATOM   2218  N  NE2 . HIS A 1  289 ? 1.625   119.702 2.420   1.00 3.04   ? 289 HIS A NE2 1 
ATOM   2219  N  N   . LEU A 1  290 ? 5.251   125.609 2.713   1.00 3.16   ? 290 LEU A N   1 
ATOM   2220  C  CA  . LEU A 1  290 ? 6.075   126.752 2.294   1.00 3.98   ? 290 LEU A CA  1 
ATOM   2221  C  C   . LEU A 1  290 ? 7.323   126.250 1.602   1.00 5.23   ? 290 LEU A C   1 
ATOM   2222  O  O   . LEU A 1  290 ? 7.788   125.121 1.577   1.00 2.70   ? 290 LEU A O   1 
ATOM   2223  C  CB  . LEU A 1  290 ? 6.325   127.640 3.513   1.00 2.20   ? 290 LEU A CB  1 
ATOM   2224  C  CG  . LEU A 1  290 ? 5.051   128.121 4.182   1.00 2.57   ? 290 LEU A CG  1 
ATOM   2225  C  CD1 . LEU A 1  290 ? 5.150   129.195 5.212   1.00 7.04   ? 290 LEU A CD1 1 
ATOM   2226  C  CD2 . LEU A 1  290 ? 4.038   128.501 3.087   1.00 10.09  ? 290 LEU A CD2 1 
ATOM   2227  N  N   . SER A 1  291 ? 7.881   127.129 0.769   1.00 7.80   ? 291 SER A N   1 
ATOM   2228  C  CA  . SER A 1  291 ? 9.028   126.773 -0.043  1.00 3.98   ? 291 SER A CA  1 
ATOM   2229  C  C   . SER A 1  291 ? 10.263  127.323 0.631   1.00 3.93   ? 291 SER A C   1 
ATOM   2230  O  O   . SER A 1  291 ? 11.367  126.825 0.403   1.00 2.55   ? 291 SER A O   1 
ATOM   2231  C  CB  . SER A 1  291 ? 8.838   127.107 -1.496  1.00 8.19   ? 291 SER A CB  1 
ATOM   2232  O  OG  . SER A 1  291 ? 9.032   128.435 -1.899  1.00 3.17   ? 291 SER A OG  1 
ATOM   2233  N  N   . SER A 1  292 ? 10.116  128.320 1.508   1.00 4.36   ? 292 SER A N   1 
ATOM   2234  C  CA  . SER A 1  292 ? 11.362  128.758 2.177   1.00 2.54   ? 292 SER A CA  1 
ATOM   2235  C  C   . SER A 1  292 ? 11.659  127.761 3.299   1.00 7.52   ? 292 SER A C   1 
ATOM   2236  O  O   . SER A 1  292 ? 10.958  127.699 4.315   1.00 6.12   ? 292 SER A O   1 
ATOM   2237  C  CB  . SER A 1  292 ? 11.200  130.153 2.759   1.00 3.67   ? 292 SER A CB  1 
ATOM   2238  O  OG  . SER A 1  292 ? 11.725  130.132 4.082   1.00 4.38   ? 292 SER A OG  1 
ATOM   2239  N  N   . PRO A 1  293 ? 12.692  126.960 3.140   1.00 7.92   ? 293 PRO A N   1 
ATOM   2240  C  CA  . PRO A 1  293 ? 13.087  125.967 4.127   1.00 6.84   ? 293 PRO A CA  1 
ATOM   2241  C  C   . PRO A 1  293 ? 13.118  126.521 5.531   1.00 4.71   ? 293 PRO A C   1 
ATOM   2242  O  O   . PRO A 1  293 ? 12.471  125.972 6.433   1.00 6.21   ? 293 PRO A O   1 
ATOM   2243  C  CB  . PRO A 1  293 ? 14.403  125.359 3.647   1.00 7.99   ? 293 PRO A CB  1 
ATOM   2244  C  CG  . PRO A 1  293 ? 14.442  125.734 2.193   1.00 7.27   ? 293 PRO A CG  1 
ATOM   2245  C  CD  . PRO A 1  293 ? 13.601  126.968 1.995   1.00 7.21   ? 293 PRO A CD  1 
ATOM   2246  N  N   . LEU A 1  294 ? 13.618  127.734 5.770   1.00 2.20   ? 294 LEU A N   1 
ATOM   2247  C  CA  . LEU A 1  294 ? 13.292  128.346 7.084   1.00 3.16   ? 294 LEU A CA  1 
ATOM   2248  C  C   . LEU A 1  294 ? 11.819  128.271 7.482   1.00 9.67   ? 294 LEU A C   1 
ATOM   2249  O  O   . LEU A 1  294 ? 11.485  127.838 8.587   1.00 12.58  ? 294 LEU A O   1 
ATOM   2250  C  CB  . LEU A 1  294 ? 13.820  129.771 7.201   1.00 5.53   ? 294 LEU A CB  1 
ATOM   2251  C  CG  . LEU A 1  294 ? 13.761  130.433 8.572   1.00 5.09   ? 294 LEU A CG  1 
ATOM   2252  C  CD1 . LEU A 1  294 ? 14.551  129.695 9.637   1.00 10.61  ? 294 LEU A CD1 1 
ATOM   2253  C  CD2 . LEU A 1  294 ? 14.340  131.835 8.484   1.00 6.26   ? 294 LEU A CD2 1 
ATOM   2254  N  N   . ALA A 1  295 ? 10.897  128.714 6.632   1.00 6.87   ? 295 ALA A N   1 
ATOM   2255  C  CA  . ALA A 1  295 ? 9.469   128.686 6.928   1.00 3.98   ? 295 ALA A CA  1 
ATOM   2256  C  C   . ALA A 1  295 ? 9.037   127.258 7.300   1.00 4.81   ? 295 ALA A C   1 
ATOM   2257  O  O   . ALA A 1  295 ? 8.341   126.928 8.165   1.00 5.04   ? 295 ALA A O   1 
ATOM   2258  C  CB  . ALA A 1  295 ? 8.718   129.224 5.717   1.00 4.12   ? 295 ALA A CB  1 
ATOM   2259  N  N   . SER A 1  296 ? 9.423   126.345 6.327   1.00 3.89   ? 296 SER A N   1 
ATOM   2260  C  CA  . SER A 1  296 ? 9.054   124.949 6.418   1.00 3.10   ? 296 SER A CA  1 
ATOM   2261  C  C   . SER A 1  296 ? 9.409   124.298 7.748   1.00 7.76   ? 296 SER A C   1 
ATOM   2262  O  O   . SER A 1  296 ? 8.765   123.373 8.237   1.00 6.28   ? 296 SER A O   1 
ATOM   2263  C  CB  . SER A 1  296 ? 9.738   124.130 5.333   1.00 6.29   ? 296 SER A CB  1 
ATOM   2264  O  OG  . SER A 1  296 ? 8.793   123.690 4.398   1.00 8.12   ? 296 SER A OG  1 
ATOM   2265  N  N   . ILE A 1  297 ? 10.621  124.607 8.192   1.00 10.07  ? 297 ILE A N   1 
ATOM   2266  C  CA  . ILE A 1  297 ? 11.158  124.079 9.427   1.00 10.24  ? 297 ILE A CA  1 
ATOM   2267  C  C   . ILE A 1  297 ? 10.502  124.649 10.660  1.00 6.43   ? 297 ILE A C   1 
ATOM   2268  O  O   . ILE A 1  297 ? 9.890   123.869 11.414  1.00 16.38  ? 297 ILE A O   1 
ATOM   2269  C  CB  . ILE A 1  297 ? 12.690  124.198 9.448   1.00 17.51  ? 297 ILE A CB  1 
ATOM   2270  C  CG1 . ILE A 1  297 ? 13.237  123.910 8.053   1.00 26.76  ? 297 ILE A CG1 1 
ATOM   2271  C  CG2 . ILE A 1  297 ? 13.257  123.133 10.383  1.00 18.35  ? 297 ILE A CG2 1 
ATOM   2272  C  CD1 . ILE A 1  297 ? 14.715  124.081 7.833   1.00 35.85  ? 297 ILE A CD1 1 
ATOM   2273  N  N   . ALA A 1  298 ? 10.256  125.924 10.792  1.00 5.02   ? 298 ALA A N   1 
ATOM   2274  C  CA  . ALA A 1  298 ? 9.435   126.425 11.918  1.00 2.20   ? 298 ALA A CA  1 
ATOM   2275  C  C   . ALA A 1  298 ? 7.961   126.058 11.828  1.00 10.85  ? 298 ALA A C   1 
ATOM   2276  O  O   . ALA A 1  298 ? 7.174   126.164 12.782  1.00 7.91   ? 298 ALA A O   1 
ATOM   2277  C  CB  . ALA A 1  298 ? 9.567   127.956 11.893  1.00 4.36   ? 298 ALA A CB  1 
ATOM   2278  N  N   . ALA A 1  299 ? 7.529   125.834 10.579  1.00 10.96  ? 299 ALA A N   1 
ATOM   2279  C  CA  . ALA A 1  299 ? 6.134   125.411 10.415  1.00 12.00  ? 299 ALA A CA  1 
ATOM   2280  C  C   . ALA A 1  299 ? 6.065   124.013 11.051  1.00 11.37  ? 299 ALA A C   1 
ATOM   2281  O  O   . ALA A 1  299 ? 5.593   123.921 12.185  1.00 11.74  ? 299 ALA A O   1 
ATOM   2282  C  CB  . ALA A 1  299 ? 5.868   125.384 8.935   1.00 16.63  ? 299 ALA A CB  1 
ATOM   2283  N  N   . THR A 1  300 ? 6.752   123.082 10.416  1.00 9.11   ? 300 THR A N   1 
ATOM   2284  C  CA  . THR A 1  300 ? 6.865   121.693 10.813  1.00 10.98  ? 300 THR A CA  1 
ATOM   2285  C  C   . THR A 1  300 ? 7.224   121.489 12.272  1.00 14.74  ? 300 THR A C   1 
ATOM   2286  O  O   . THR A 1  300 ? 6.605   120.745 13.055  1.00 20.09  ? 300 THR A O   1 
ATOM   2287  C  CB  . THR A 1  300 ? 7.980   120.982 10.013  1.00 5.72   ? 300 THR A CB  1 
ATOM   2288  O  OG1 . THR A 1  300 ? 7.669   121.062 8.628   1.00 4.77   ? 300 THR A OG1 1 
ATOM   2289  C  CG2 . THR A 1  300 ? 8.155   119.555 10.498  1.00 2.51   ? 300 THR A CG2 1 
ATOM   2290  N  N   . ASN A 1  301 ? 8.373   122.069 12.647  1.00 10.19  ? 301 ASN A N   1 
ATOM   2291  C  CA  . ASN A 1  301 ? 8.779   121.808 14.020  1.00 15.17  ? 301 ASN A CA  1 
ATOM   2292  C  C   . ASN A 1  301 ? 8.397   122.846 15.037  1.00 16.99  ? 301 ASN A C   1 
ATOM   2293  O  O   . ASN A 1  301 ? 9.082   123.027 16.060  1.00 18.10  ? 301 ASN A O   1 
ATOM   2294  C  CB  . ASN A 1  301 ? 10.236  121.428 14.100  1.00 16.68  ? 301 ASN A CB  1 
ATOM   2295  C  CG  . ASN A 1  301 ? 10.649  120.312 13.165  1.00 24.82  ? 301 ASN A CG  1 
ATOM   2296  O  OD1 . ASN A 1  301 ? 10.168  119.185 13.070  1.00 33.60  ? 301 ASN A OD1 1 
ATOM   2297  N  ND2 . ASN A 1  301 ? 11.694  120.735 12.455  1.00 19.07  ? 301 ASN A ND2 1 
ATOM   2298  N  N   . LYS A 1  302 ? 7.297   123.581 14.876  1.00 17.24  ? 302 LYS A N   1 
ATOM   2299  C  CA  . LYS A 1  302 ? 6.920   124.570 15.884  1.00 14.99  ? 302 LYS A CA  1 
ATOM   2300  C  C   . LYS A 1  302 ? 8.139   125.314 16.403  1.00 14.65  ? 302 LYS A C   1 
ATOM   2301  O  O   . LYS A 1  302 ? 8.192   125.825 17.527  1.00 18.94  ? 302 LYS A O   1 
ATOM   2302  C  CB  . LYS A 1  302 ? 6.118   123.918 16.994  1.00 29.08  ? 302 LYS A CB  1 
ATOM   2303  C  CG  . LYS A 1  302 ? 6.891   123.401 18.191  1.00 50.08  ? 302 LYS A CG  1 
ATOM   2304  C  CD  . LYS A 1  302 ? 6.552   121.961 18.565  1.00 57.34  ? 302 LYS A CD  1 
ATOM   2305  C  CE  . LYS A 1  302 ? 7.265   121.517 19.837  1.00 57.32  ? 302 LYS A CE  1 
ATOM   2306  N  NZ  . LYS A 1  302 ? 6.292   121.240 20.937  1.00 62.76  ? 302 LYS A NZ  1 
ATOM   2307  N  N   . LEU A 1  303 ? 9.054   125.672 15.496  1.00 7.51   ? 303 LEU A N   1 
ATOM   2308  C  CA  . LEU A 1  303 ? 10.245  126.374 15.881  1.00 8.30   ? 303 LEU A CA  1 
ATOM   2309  C  C   . LEU A 1  303 ? 10.034  127.849 16.149  1.00 13.13  ? 303 LEU A C   1 
ATOM   2310  O  O   . LEU A 1  303 ? 10.966  128.422 16.741  1.00 21.54  ? 303 LEU A O   1 
ATOM   2311  C  CB  . LEU A 1  303 ? 11.320  126.283 14.791  1.00 2.73   ? 303 LEU A CB  1 
ATOM   2312  C  CG  . LEU A 1  303 ? 12.152  125.007 14.774  1.00 9.02   ? 303 LEU A CG  1 
ATOM   2313  C  CD1 . LEU A 1  303 ? 13.031  124.941 13.531  1.00 2.62   ? 303 LEU A CD1 1 
ATOM   2314  C  CD2 . LEU A 1  303 ? 13.058  124.928 15.991  1.00 7.14   ? 303 LEU A CD2 1 
ATOM   2315  N  N   . CYS A 1  304 ? 9.034   128.479 15.529  1.00 11.87  ? 304 CYS A N   1 
ATOM   2316  C  CA  . CYS A 1  304 ? 8.868   129.901 15.829  1.00 8.03   ? 304 CYS A CA  1 
ATOM   2317  C  C   . CYS A 1  304 ? 7.433   130.358 15.661  1.00 5.40   ? 304 CYS A C   1 
ATOM   2318  O  O   . CYS A 1  304 ? 6.603   129.516 15.385  1.00 2.22   ? 304 CYS A O   1 
ATOM   2319  C  CB  . CYS A 1  304 ? 9.860   130.784 15.162  1.00 18.80  ? 304 CYS A CB  1 
ATOM   2320  S  SG  . CYS A 1  304 ? 9.730   131.016 13.386  1.00 31.42  ? 304 CYS A SG  1 
ATOM   2321  N  N   . GLN A 1  305 ? 7.175   131.519 16.201  1.00 2.20   ? 305 GLN A N   1 
ATOM   2322  C  CA  . GLN A 1  305 ? 5.895   132.189 16.165  1.00 4.14   ? 305 GLN A CA  1 
ATOM   2323  C  C   . GLN A 1  305 ? 5.802   133.039 14.905  1.00 4.56   ? 305 GLN A C   1 
ATOM   2324  O  O   . GLN A 1  305 ? 4.879   132.876 14.109  1.00 4.66   ? 305 GLN A O   1 
ATOM   2325  C  CB  . GLN A 1  305 ? 5.700   133.071 17.403  1.00 7.12   ? 305 GLN A CB  1 
ATOM   2326  C  CG  . GLN A 1  305 ? 5.341   132.117 18.551  1.00 2.59   ? 305 GLN A CG  1 
ATOM   2327  C  CD  . GLN A 1  305 ? 3.846   131.827 18.480  1.00 11.23  ? 305 GLN A CD  1 
ATOM   2328  O  OE1 . GLN A 1  305 ? 3.066   132.789 18.490  1.00 10.42  ? 305 GLN A OE1 1 
ATOM   2329  N  NE2 . GLN A 1  305 ? 3.506   130.545 18.415  1.00 16.39  ? 305 GLN A NE2 1 
ATOM   2330  N  N   . SER A 1  306 ? 6.850   133.862 14.723  1.00 3.34   ? 306 SER A N   1 
ATOM   2331  C  CA  . SER A 1  306 ? 6.787   134.663 13.486  1.00 2.20   ? 306 SER A CA  1 
ATOM   2332  C  C   . SER A 1  306 ? 8.220   135.093 13.196  1.00 8.38   ? 306 SER A C   1 
ATOM   2333  O  O   . SER A 1  306 ? 8.866   135.564 14.109  1.00 12.84  ? 306 SER A O   1 
ATOM   2334  C  CB  . SER A 1  306 ? 5.937   135.910 13.743  1.00 4.01   ? 306 SER A CB  1 
ATOM   2335  O  OG  . SER A 1  306 ? 6.544   136.704 14.751  1.00 4.16   ? 306 SER A OG  1 
ATOM   2336  N  N   . PHE A 1  307 ? 8.687   134.913 11.977  1.00 11.51  ? 307 PHE A N   1 
ATOM   2337  C  CA  . PHE A 1  307 ? 9.930   135.521 11.549  1.00 11.13  ? 307 PHE A CA  1 
ATOM   2338  C  C   . PHE A 1  307 ? 9.826   136.213 10.184  1.00 13.73  ? 307 PHE A C   1 
ATOM   2339  O  O   . PHE A 1  307 ? 8.986   135.957 9.330   1.00 2.70   ? 307 PHE A O   1 
ATOM   2340  C  CB  . PHE A 1  307 ? 11.081  134.541 11.489  1.00 3.53   ? 307 PHE A CB  1 
ATOM   2341  C  CG  . PHE A 1  307 ? 11.194  133.906 10.126  1.00 5.79   ? 307 PHE A CG  1 
ATOM   2342  C  CD1 . PHE A 1  307 ? 11.891  134.539 9.124   1.00 5.94   ? 307 PHE A CD1 1 
ATOM   2343  C  CD2 . PHE A 1  307 ? 10.685  132.650 9.905   1.00 2.20   ? 307 PHE A CD2 1 
ATOM   2344  C  CE1 . PHE A 1  307 ? 12.005  133.922 7.894   1.00 11.43  ? 307 PHE A CE1 1 
ATOM   2345  C  CE2 . PHE A 1  307 ? 10.770  132.023 8.684   1.00 6.73   ? 307 PHE A CE2 1 
ATOM   2346  C  CZ  . PHE A 1  307 ? 11.465  132.671 7.693   1.00 2.20   ? 307 PHE A CZ  1 
ATOM   2347  N  N   . GLN A 1  308 ? 10.785  137.117 10.024  1.00 15.83  ? 308 GLN A N   1 
ATOM   2348  C  CA  . GLN A 1  308 ? 10.782  138.108 8.971   1.00 17.06  ? 308 GLN A CA  1 
ATOM   2349  C  C   . GLN A 1  308 ? 12.200  138.619 8.710   1.00 14.74  ? 308 GLN A C   1 
ATOM   2350  O  O   . GLN A 1  308 ? 12.901  139.100 9.596   1.00 15.69  ? 308 GLN A O   1 
ATOM   2351  C  CB  . GLN A 1  308 ? 9.941   139.300 9.486   1.00 26.52  ? 308 GLN A CB  1 
ATOM   2352  C  CG  . GLN A 1  308 ? 10.783  140.320 10.229  1.00 37.47  ? 308 GLN A CG  1 
ATOM   2353  C  CD  . GLN A 1  308 ? 10.036  141.584 10.567  1.00 48.92  ? 308 GLN A CD  1 
ATOM   2354  O  OE1 . GLN A 1  308 ? 8.954   141.840 10.034  1.00 60.76  ? 308 GLN A OE1 1 
ATOM   2355  N  NE2 . GLN A 1  308 ? 10.604  142.390 11.454  1.00 48.85  ? 308 GLN A NE2 1 
ATOM   2356  N  N   . THR A 1  309 ? 12.639  138.479 7.475   1.00 9.96   ? 309 THR A N   1 
ATOM   2357  C  CA  . THR A 1  309 ? 13.860  139.069 7.010   1.00 2.20   ? 309 THR A CA  1 
ATOM   2358  C  C   . THR A 1  309 ? 13.662  140.559 6.650   1.00 6.32   ? 309 THR A C   1 
ATOM   2359  O  O   . THR A 1  309 ? 12.606  140.907 6.108   1.00 4.10   ? 309 THR A O   1 
ATOM   2360  C  CB  . THR A 1  309 ? 14.348  138.432 5.684   1.00 6.24   ? 309 THR A CB  1 
ATOM   2361  O  OG1 . THR A 1  309 ? 13.255  138.441 4.780   1.00 2.20   ? 309 THR A OG1 1 
ATOM   2362  C  CG2 . THR A 1  309 ? 14.779  136.987 5.810   1.00 3.22   ? 309 THR A CG2 1 
ATOM   2363  N  N   . PHE A 1  310 ? 14.678  141.404 6.821   1.00 6.01   ? 310 PHE A N   1 
ATOM   2364  C  CA  . PHE A 1  310 ? 14.543  142.803 6.445   1.00 2.20   ? 310 PHE A CA  1 
ATOM   2365  C  C   . PHE A 1  310 ? 15.857  143.363 5.894   1.00 7.80   ? 310 PHE A C   1 
ATOM   2366  O  O   . PHE A 1  310 ? 16.925  142.883 6.234   1.00 4.64   ? 310 PHE A O   1 
ATOM   2367  C  CB  . PHE A 1  310 ? 14.168  143.631 7.684   1.00 2.88   ? 310 PHE A CB  1 
ATOM   2368  C  CG  . PHE A 1  310 ? 15.151  143.347 8.790   1.00 8.84   ? 310 PHE A CG  1 
ATOM   2369  C  CD1 . PHE A 1  310 ? 16.472  143.754 8.740   1.00 11.28  ? 310 PHE A CD1 1 
ATOM   2370  C  CD2 . PHE A 1  310 ? 14.729  142.626 9.887   1.00 6.09   ? 310 PHE A CD2 1 
ATOM   2371  C  CE1 . PHE A 1  310 ? 17.361  143.454 9.754   1.00 8.98   ? 310 PHE A CE1 1 
ATOM   2372  C  CE2 . PHE A 1  310 ? 15.597  142.344 10.911  1.00 9.43   ? 310 PHE A CE2 1 
ATOM   2373  C  CZ  . PHE A 1  310 ? 16.920  142.741 10.860  1.00 7.91   ? 310 PHE A CZ  1 
ATOM   2374  N  N   . ASN A 1  311 ? 15.785  144.391 5.069   1.00 9.32   ? 311 ASN A N   1 
ATOM   2375  C  CA  . ASN A 1  311 ? 16.871  145.168 4.536   1.00 6.13   ? 311 ASN A CA  1 
ATOM   2376  C  C   . ASN A 1  311 ? 16.639  146.668 4.786   1.00 2.92   ? 311 ASN A C   1 
ATOM   2377  O  O   . ASN A 1  311 ? 16.145  147.315 3.869   1.00 3.71   ? 311 ASN A O   1 
ATOM   2378  C  CB  . ASN A 1  311 ? 17.101  144.989 3.032   1.00 5.91   ? 311 ASN A CB  1 
ATOM   2379  C  CG  . ASN A 1  311 ? 18.389  145.683 2.622   1.00 9.93   ? 311 ASN A CG  1 
ATOM   2380  O  OD1 . ASN A 1  311 ? 19.028  146.409 3.396   1.00 19.22  ? 311 ASN A OD1 1 
ATOM   2381  N  ND2 . ASN A 1  311 ? 18.784  145.498 1.382   1.00 3.18   ? 311 ASN A ND2 1 
ATOM   2382  N  N   . ILE A 1  312 ? 17.039  147.192 5.930   1.00 3.94   ? 312 ILE A N   1 
ATOM   2383  C  CA  . ILE A 1  312 ? 16.917  148.558 6.328   1.00 2.20   ? 312 ILE A CA  1 
ATOM   2384  C  C   . ILE A 1  312 ? 17.797  149.575 5.652   1.00 7.81   ? 312 ILE A C   1 
ATOM   2385  O  O   . ILE A 1  312 ? 18.799  149.952 6.261   1.00 11.63  ? 312 ILE A O   1 
ATOM   2386  C  CB  . ILE A 1  312 ? 16.802  148.810 7.830   1.00 3.94   ? 312 ILE A CB  1 
ATOM   2387  C  CG1 . ILE A 1  312 ? 15.819  147.842 8.453   1.00 2.20   ? 312 ILE A CG1 1 
ATOM   2388  C  CG2 . ILE A 1  312 ? 16.569  150.280 8.152   1.00 3.47   ? 312 ILE A CG2 1 
ATOM   2389  C  CD1 . ILE A 1  312 ? 15.103  148.263 9.698   1.00 2.20   ? 312 ILE A CD1 1 
ATOM   2390  N  N   . CYS A 1  313 ? 17.365  150.166 4.527   1.00 6.65   ? 313 CYS A N   1 
ATOM   2391  C  CA  . CYS A 1  313 ? 18.206  151.024 3.707   1.00 5.52   ? 313 CYS A CA  1 
ATOM   2392  C  C   . CYS A 1  313 ? 18.436  152.398 4.292   1.00 2.20   ? 313 CYS A C   1 
ATOM   2393  O  O   . CYS A 1  313 ? 17.452  153.007 4.772   1.00 5.14   ? 313 CYS A O   1 
ATOM   2394  C  CB  . CYS A 1  313 ? 17.731  151.134 2.248   1.00 2.20   ? 313 CYS A CB  1 
ATOM   2395  S  SG  . CYS A 1  313 ? 18.015  149.663 1.287   1.00 19.32  ? 313 CYS A SG  1 
ATOM   2396  N  N   . TYR A 1  314 ? 19.649  152.882 4.435   1.00 4.99   ? 314 TYR A N   1 
ATOM   2397  C  CA  . TYR A 1  314 ? 20.068  154.204 4.858   1.00 3.40   ? 314 TYR A CA  1 
ATOM   2398  C  C   . TYR A 1  314 ? 21.129  154.730 3.879   1.00 9.95   ? 314 TYR A C   1 
ATOM   2399  O  O   . TYR A 1  314 ? 21.484  154.000 2.956   1.00 5.44   ? 314 TYR A O   1 
ATOM   2400  C  CB  . TYR A 1  314 ? 20.620  154.319 6.243   1.00 6.97   ? 314 TYR A CB  1 
ATOM   2401  C  CG  . TYR A 1  314 ? 19.604  154.208 7.342   1.00 18.92  ? 314 TYR A CG  1 
ATOM   2402  C  CD1 . TYR A 1  314 ? 18.252  154.244 7.085   1.00 23.57  ? 314 TYR A CD1 1 
ATOM   2403  C  CD2 . TYR A 1  314 ? 19.988  154.062 8.665   1.00 23.60  ? 314 TYR A CD2 1 
ATOM   2404  C  CE1 . TYR A 1  314 ? 17.307  154.133 8.078   1.00 26.33  ? 314 TYR A CE1 1 
ATOM   2405  C  CE2 . TYR A 1  314 ? 19.045  153.949 9.662   1.00 26.74  ? 314 TYR A CE2 1 
ATOM   2406  C  CZ  . TYR A 1  314 ? 17.707  153.985 9.378   1.00 23.84  ? 314 TYR A CZ  1 
ATOM   2407  O  OH  . TYR A 1  314 ? 16.750  153.872 10.353  1.00 22.50  ? 314 TYR A OH  1 
ATOM   2408  N  N   . ALA A 1  315 ? 21.352  156.034 3.975   1.00 11.71  ? 315 ALA A N   1 
ATOM   2409  C  CA  . ALA A 1  315 ? 22.372  156.664 3.153   1.00 11.48  ? 315 ALA A CA  1 
ATOM   2410  C  C   . ALA A 1  315 ? 23.704  155.929 3.275   1.00 15.79  ? 315 ALA A C   1 
ATOM   2411  O  O   . ALA A 1  315 ? 24.300  155.132 2.491   1.00 14.78  ? 315 ALA A O   1 
ATOM   2412  C  CB  . ALA A 1  315 ? 22.591  158.080 3.714   1.00 2.20   ? 315 ALA A CB  1 
ATOM   2413  N  N   . ASP A 1  316 ? 24.333  156.287 4.399   1.00 23.06  ? 316 ASP A N   1 
ATOM   2414  C  CA  . ASP A 1  316 ? 25.676  155.850 4.697   1.00 31.90  ? 316 ASP A CA  1 
ATOM   2415  C  C   . ASP A 1  316 ? 25.938  154.439 5.156   1.00 30.09  ? 316 ASP A C   1 
ATOM   2416  O  O   . ASP A 1  316 ? 27.111  154.026 5.098   1.00 32.89  ? 316 ASP A O   1 
ATOM   2417  C  CB  . ASP A 1  316 ? 26.340  156.865 5.639   1.00 49.15  ? 316 ASP A CB  1 
ATOM   2418  C  CG  . ASP A 1  316 ? 26.068  158.306 5.240   1.00 60.98  ? 316 ASP A CG  1 
ATOM   2419  O  OD1 . ASP A 1  316 ? 26.281  158.712 4.076   1.00 57.95  ? 316 ASP A OD1 1 
ATOM   2420  O  OD2 . ASP A 1  316 ? 25.636  159.062 6.143   1.00 69.29  ? 316 ASP A OD2 1 
ATOM   2421  N  N   . THR A 1  317 ? 24.941  153.708 5.601   1.00 25.00  ? 317 THR A N   1 
ATOM   2422  C  CA  . THR A 1  317 ? 25.035  152.371 6.160   1.00 11.02  ? 317 THR A CA  1 
ATOM   2423  C  C   . THR A 1  317 ? 23.772  151.591 5.821   1.00 11.58  ? 317 THR A C   1 
ATOM   2424  O  O   . THR A 1  317 ? 22.904  152.132 5.138   1.00 15.13  ? 317 THR A O   1 
ATOM   2425  C  CB  . THR A 1  317 ? 25.063  152.582 7.694   1.00 14.89  ? 317 THR A CB  1 
ATOM   2426  O  OG1 . THR A 1  317 ? 26.312  153.176 8.031   1.00 22.73  ? 317 THR A OG1 1 
ATOM   2427  C  CG2 . THR A 1  317 ? 24.880  151.247 8.373   1.00 15.59  ? 317 THR A CG2 1 
ATOM   2428  N  N   . GLY A 1  318 ? 23.527  150.425 6.365   1.00 12.58  ? 318 GLY A N   1 
ATOM   2429  C  CA  . GLY A 1  318 ? 22.316  149.646 6.402   1.00 9.98   ? 318 GLY A CA  1 
ATOM   2430  C  C   . GLY A 1  318 ? 22.165  148.711 7.601   1.00 3.94   ? 318 GLY A C   1 
ATOM   2431  O  O   . GLY A 1  318 ? 22.987  148.701 8.522   1.00 4.47   ? 318 GLY A O   1 
ATOM   2432  N  N   . LEU A 1  319 ? 21.011  148.045 7.708   1.00 4.29   ? 319 LEU A N   1 
ATOM   2433  C  CA  . LEU A 1  319 ? 20.773  146.926 8.637   1.00 8.43   ? 319 LEU A CA  1 
ATOM   2434  C  C   . LEU A 1  319 ? 20.132  145.786 7.866   1.00 8.67   ? 319 LEU A C   1 
ATOM   2435  O  O   . LEU A 1  319 ? 19.129  145.984 7.193   1.00 15.59  ? 319 LEU A O   1 
ATOM   2436  C  CB  . LEU A 1  319 ? 19.944  147.255 9.873   1.00 2.20   ? 319 LEU A CB  1 
ATOM   2437  C  CG  . LEU A 1  319 ? 20.702  148.112 10.883  1.00 6.36   ? 319 LEU A CG  1 
ATOM   2438  C  CD1 . LEU A 1  319 ? 19.905  148.548 12.067  1.00 2.20   ? 319 LEU A CD1 1 
ATOM   2439  C  CD2 . LEU A 1  319 ? 21.988  147.443 11.275  1.00 4.70   ? 319 LEU A CD2 1 
ATOM   2440  N  N   . LEU A 1  320 ? 20.763  144.623 7.780   1.00 10.56  ? 320 LEU A N   1 
ATOM   2441  C  CA  . LEU A 1  320 ? 20.140  143.571 6.978   1.00 13.18  ? 320 LEU A CA  1 
ATOM   2442  C  C   . LEU A 1  320 ? 20.232  142.178 7.596   1.00 10.43  ? 320 LEU A C   1 
ATOM   2443  O  O   . LEU A 1  320 ? 21.317  141.647 7.801   1.00 6.40   ? 320 LEU A O   1 
ATOM   2444  C  CB  . LEU A 1  320 ? 20.763  143.500 5.581   1.00 3.51   ? 320 LEU A CB  1 
ATOM   2445  C  CG  . LEU A 1  320 ? 20.410  142.296 4.703   1.00 20.86  ? 320 LEU A CG  1 
ATOM   2446  C  CD1 . LEU A 1  320 ? 19.125  142.474 3.899   1.00 31.28  ? 320 LEU A CD1 1 
ATOM   2447  C  CD2 . LEU A 1  320 ? 21.570  141.974 3.763   1.00 13.88  ? 320 LEU A CD2 1 
ATOM   2448  N  N   . GLY A 1  321 ? 19.069  141.595 7.849   1.00 7.28   ? 321 GLY A N   1 
ATOM   2449  C  CA  . GLY A 1  321 ? 19.004  140.265 8.412   1.00 3.31   ? 321 GLY A CA  1 
ATOM   2450  C  C   . GLY A 1  321 ? 17.566  139.884 8.766   1.00 5.10   ? 321 GLY A C   1 
ATOM   2451  O  O   . GLY A 1  321 ? 16.578  140.537 8.417   1.00 4.38   ? 321 GLY A O   1 
ATOM   2452  N  N   . ALA A 1  322 ? 17.494  138.853 9.596   1.00 4.89   ? 322 ALA A N   1 
ATOM   2453  C  CA  . ALA A 1  322 ? 16.177  138.394 9.985   1.00 2.20   ? 322 ALA A CA  1 
ATOM   2454  C  C   . ALA A 1  322 ? 15.750  138.915 11.352  1.00 2.20   ? 322 ALA A C   1 
ATOM   2455  O  O   . ALA A 1  322 ? 16.409  139.670 12.065  1.00 2.20   ? 322 ALA A O   1 
ATOM   2456  C  CB  . ALA A 1  322 ? 16.217  136.901 9.917   1.00 2.20   ? 322 ALA A CB  1 
ATOM   2457  N  N   . HIS A 1  323 ? 14.501  138.660 11.728  1.00 6.13   ? 323 HIS A N   1 
ATOM   2458  C  CA  . HIS A 1  323 ? 14.026  138.880 13.068  1.00 6.66   ? 323 HIS A CA  1 
ATOM   2459  C  C   . HIS A 1  323 ? 13.007  137.795 13.419  1.00 8.34   ? 323 HIS A C   1 
ATOM   2460  O  O   . HIS A 1  323 ? 12.331  137.230 12.530  1.00 7.43   ? 323 HIS A O   1 
ATOM   2461  C  CB  . HIS A 1  323 ? 13.539  140.262 13.355  1.00 2.57   ? 323 HIS A CB  1 
ATOM   2462  C  CG  . HIS A 1  323 ? 12.343  140.441 14.239  1.00 2.20   ? 323 HIS A CG  1 
ATOM   2463  N  ND1 . HIS A 1  323 ? 12.513  140.474 15.615  1.00 5.26   ? 323 HIS A ND1 1 
ATOM   2464  C  CD2 . HIS A 1  323 ? 11.025  140.646 14.072  1.00 3.83   ? 323 HIS A CD2 1 
ATOM   2465  C  CE1 . HIS A 1  323 ? 11.372  140.658 16.230  1.00 4.01   ? 323 HIS A CE1 1 
ATOM   2466  N  NE2 . HIS A 1  323 ? 10.438  140.764 15.316  1.00 3.41   ? 323 HIS A NE2 1 
ATOM   2467  N  N   . PHE A 1  324 ? 13.222  137.177 14.614  1.00 2.87   ? 324 PHE A N   1 
ATOM   2468  C  CA  . PHE A 1  324 ? 12.279  136.100 14.885  1.00 4.61   ? 324 PHE A CA  1 
ATOM   2469  C  C   . PHE A 1  324 ? 11.685  136.231 16.282  1.00 3.95   ? 324 PHE A C   1 
ATOM   2470  O  O   . PHE A 1  324 ? 12.367  136.781 17.141  1.00 3.07   ? 324 PHE A O   1 
ATOM   2471  C  CB  . PHE A 1  324 ? 12.837  134.704 14.806  1.00 2.76   ? 324 PHE A CB  1 
ATOM   2472  C  CG  . PHE A 1  324 ? 14.117  134.507 15.552  1.00 2.20   ? 324 PHE A CG  1 
ATOM   2473  C  CD1 . PHE A 1  324 ? 15.324  134.801 14.928  1.00 3.84   ? 324 PHE A CD1 1 
ATOM   2474  C  CD2 . PHE A 1  324 ? 14.169  133.962 16.832  1.00 3.05   ? 324 PHE A CD2 1 
ATOM   2475  C  CE1 . PHE A 1  324 ? 16.523  134.586 15.590  1.00 6.09   ? 324 PHE A CE1 1 
ATOM   2476  C  CE2 . PHE A 1  324 ? 15.349  133.744 17.492  1.00 5.38   ? 324 PHE A CE2 1 
ATOM   2477  C  CZ  . PHE A 1  324 ? 16.552  134.057 16.863  1.00 2.45   ? 324 PHE A CZ  1 
ATOM   2478  N  N   . VAL A 1  325 ? 10.441  135.790 16.405  1.00 2.20   ? 325 VAL A N   1 
ATOM   2479  C  CA  . VAL A 1  325 ? 9.865   135.706 17.746  1.00 2.37   ? 325 VAL A CA  1 
ATOM   2480  C  C   . VAL A 1  325 ? 9.682   134.257 18.179  1.00 4.23   ? 325 VAL A C   1 
ATOM   2481  O  O   . VAL A 1  325 ? 9.035   133.453 17.464  1.00 3.46   ? 325 VAL A O   1 
ATOM   2482  C  CB  . VAL A 1  325 ? 8.523   136.426 17.851  1.00 3.33   ? 325 VAL A CB  1 
ATOM   2483  C  CG1 . VAL A 1  325 ? 7.915   136.103 19.205  1.00 4.67   ? 325 VAL A CG1 1 
ATOM   2484  C  CG2 . VAL A 1  325 ? 8.686   137.917 17.665  1.00 2.65   ? 325 VAL A CG2 1 
ATOM   2485  N  N   . CYS A 1  326 ? 10.126  133.810 19.360  1.00 4.29   ? 326 CYS A N   1 
ATOM   2486  C  CA  . CYS A 1  326 ? 9.815   132.407 19.673  1.00 4.69   ? 326 CYS A CA  1 
ATOM   2487  C  C   . CYS A 1  326 ? 9.836   132.039 21.132  1.00 5.06   ? 326 CYS A C   1 
ATOM   2488  O  O   . CYS A 1  326 ? 10.164  132.857 21.973  1.00 2.88   ? 326 CYS A O   1 
ATOM   2489  C  CB  . CYS A 1  326 ? 10.849  131.456 19.055  1.00 2.20   ? 326 CYS A CB  1 
ATOM   2490  S  SG  . CYS A 1  326 ? 12.533  131.995 19.570  1.00 3.93   ? 326 CYS A SG  1 
ATOM   2491  N  N   . ASP A 1  327 ? 9.644   130.750 21.464  1.00 6.77   ? 327 ASP A N   1 
ATOM   2492  C  CA  . ASP A 1  327 ? 9.729   130.320 22.857  1.00 8.61   ? 327 ASP A CA  1 
ATOM   2493  C  C   . ASP A 1  327 ? 11.138  130.502 23.409  1.00 7.31   ? 327 ASP A C   1 
ATOM   2494  O  O   . ASP A 1  327 ? 12.138  130.655 22.705  1.00 11.56  ? 327 ASP A O   1 
ATOM   2495  C  CB  . ASP A 1  327 ? 9.308   128.858 23.028  1.00 19.63  ? 327 ASP A CB  1 
ATOM   2496  C  CG  . ASP A 1  327 ? 8.721   128.612 24.407  1.00 34.13  ? 327 ASP A CG  1 
ATOM   2497  O  OD1 . ASP A 1  327 ? 9.238   129.271 25.338  1.00 49.07  ? 327 ASP A OD1 1 
ATOM   2498  O  OD2 . ASP A 1  327 ? 7.744   127.862 24.605  1.00 38.29  ? 327 ASP A OD2 1 
ATOM   2499  N  N   . HIS A 1  328 ? 11.297  130.394 24.713  1.00 4.04   ? 328 HIS A N   1 
ATOM   2500  C  CA  . HIS A 1  328 ? 12.580  130.495 25.373  1.00 4.79   ? 328 HIS A CA  1 
ATOM   2501  C  C   . HIS A 1  328 ? 13.501  129.322 25.090  1.00 5.67   ? 328 HIS A C   1 
ATOM   2502  O  O   . HIS A 1  328 ? 14.703  129.420 25.304  1.00 2.96   ? 328 HIS A O   1 
ATOM   2503  C  CB  . HIS A 1  328 ? 12.419  130.589 26.901  1.00 6.79   ? 328 HIS A CB  1 
ATOM   2504  C  CG  . HIS A 1  328 ? 11.918  129.326 27.531  1.00 2.61   ? 328 HIS A CG  1 
ATOM   2505  N  ND1 . HIS A 1  328 ? 10.595  128.925 27.521  1.00 7.93   ? 328 HIS A ND1 1 
ATOM   2506  C  CD2 . HIS A 1  328 ? 12.583  128.358 28.208  1.00 2.20   ? 328 HIS A CD2 1 
ATOM   2507  C  CE1 . HIS A 1  328 ? 10.467  127.759 28.138  1.00 3.01   ? 328 HIS A CE1 1 
ATOM   2508  N  NE2 . HIS A 1  328 ? 11.657  127.404 28.560  1.00 3.13   ? 328 HIS A NE2 1 
ATOM   2509  N  N   . MET A 1  329 ? 13.016  128.191 24.710  1.00 3.62   ? 329 MET A N   1 
ATOM   2510  C  CA  . MET A 1  329 ? 13.623  126.940 24.404  1.00 6.51   ? 329 MET A CA  1 
ATOM   2511  C  C   . MET A 1  329 ? 13.826  126.722 22.919  1.00 5.93   ? 329 MET A C   1 
ATOM   2512  O  O   . MET A 1  329 ? 14.251  125.665 22.467  1.00 4.69   ? 329 MET A O   1 
ATOM   2513  C  CB  . MET A 1  329 ? 12.748  125.803 24.980  1.00 7.73   ? 329 MET A CB  1 
ATOM   2514  C  CG  . MET A 1  329 ? 13.068  125.675 26.469  1.00 4.07   ? 329 MET A CG  1 
ATOM   2515  S  SD  . MET A 1  329 ? 14.836  125.507 26.689  1.00 5.99   ? 329 MET A SD  1 
ATOM   2516  C  CE  . MET A 1  329 ? 15.109  124.104 25.629  1.00 6.44   ? 329 MET A CE  1 
ATOM   2517  N  N   . SER A 1  330 ? 13.601  127.751 22.115  1.00 3.82   ? 330 SER A N   1 
ATOM   2518  C  CA  . SER A 1  330 ? 13.727  127.619 20.671  1.00 2.64   ? 330 SER A CA  1 
ATOM   2519  C  C   . SER A 1  330 ? 14.745  128.535 20.038  1.00 5.19   ? 330 SER A C   1 
ATOM   2520  O  O   . SER A 1  330 ? 15.313  128.176 18.990  1.00 3.98   ? 330 SER A O   1 
ATOM   2521  C  CB  . SER A 1  330 ? 12.325  127.678 20.059  1.00 5.10   ? 330 SER A CB  1 
ATOM   2522  O  OG  . SER A 1  330 ? 11.998  126.332 19.711  1.00 5.19   ? 330 SER A OG  1 
ATOM   2523  N  N   . ILE A 1  331 ? 15.187  129.589 20.716  1.00 6.80   ? 331 ILE A N   1 
ATOM   2524  C  CA  . ILE A 1  331 ? 16.131  130.582 20.241  1.00 6.10   ? 331 ILE A CA  1 
ATOM   2525  C  C   . ILE A 1  331 ? 17.301  130.084 19.406  1.00 3.61   ? 331 ILE A C   1 
ATOM   2526  O  O   . ILE A 1  331 ? 17.671  130.666 18.397  1.00 2.20   ? 331 ILE A O   1 
ATOM   2527  C  CB  . ILE A 1  331 ? 16.738  131.359 21.434  1.00 7.06   ? 331 ILE A CB  1 
ATOM   2528  C  CG1 . ILE A 1  331 ? 15.650  131.506 22.486  1.00 8.35   ? 331 ILE A CG1 1 
ATOM   2529  C  CG2 . ILE A 1  331 ? 17.373  132.686 21.045  1.00 4.30   ? 331 ILE A CG2 1 
ATOM   2530  C  CD1 . ILE A 1  331 ? 15.075  132.860 22.657  1.00 2.20   ? 331 ILE A CD1 1 
ATOM   2531  N  N   . ASP A 1  332 ? 17.973  129.051 19.871  1.00 3.77   ? 332 ASP A N   1 
ATOM   2532  C  CA  . ASP A 1  332 ? 19.154  128.478 19.232  1.00 3.91   ? 332 ASP A CA  1 
ATOM   2533  C  C   . ASP A 1  332 ? 18.840  127.712 17.995  1.00 5.31   ? 332 ASP A C   1 
ATOM   2534  O  O   . ASP A 1  332 ? 19.601  127.695 17.034  1.00 9.02   ? 332 ASP A O   1 
ATOM   2535  C  CB  . ASP A 1  332 ? 19.869  127.590 20.257  1.00 16.01  ? 332 ASP A CB  1 
ATOM   2536  C  CG  . ASP A 1  332 ? 19.082  126.299 20.431  1.00 38.97  ? 332 ASP A CG  1 
ATOM   2537  O  OD1 . ASP A 1  332 ? 17.823  126.325 20.385  1.00 40.32  ? 332 ASP A OD1 1 
ATOM   2538  O  OD2 . ASP A 1  332 ? 19.732  125.242 20.614  1.00 54.07  ? 332 ASP A OD2 1 
ATOM   2539  N  N   . ASP A 1  333 ? 17.709  127.017 17.926  1.00 7.72   ? 333 ASP A N   1 
ATOM   2540  C  CA  . ASP A 1  333 ? 17.503  126.263 16.675  1.00 7.72   ? 333 ASP A CA  1 
ATOM   2541  C  C   . ASP A 1  333 ? 17.099  127.281 15.634  1.00 4.77   ? 333 ASP A C   1 
ATOM   2542  O  O   . ASP A 1  333 ? 17.585  127.273 14.525  1.00 7.09   ? 333 ASP A O   1 
ATOM   2543  C  CB  . ASP A 1  333 ? 16.491  125.142 16.871  1.00 2.51   ? 333 ASP A CB  1 
ATOM   2544  C  CG  . ASP A 1  333 ? 16.963  124.230 17.989  1.00 15.04  ? 333 ASP A CG  1 
ATOM   2545  O  OD1 . ASP A 1  333 ? 18.170  123.907 17.950  1.00 23.66  ? 333 ASP A OD1 1 
ATOM   2546  O  OD2 . ASP A 1  333 ? 16.186  123.867 18.878  1.00 29.85  ? 333 ASP A OD2 1 
ATOM   2547  N  N   . MET A 1  334 ? 16.299  128.249 16.123  1.00 2.20   ? 334 MET A N   1 
ATOM   2548  C  CA  . MET A 1  334 ? 15.919  129.285 15.136  1.00 5.08   ? 334 MET A CA  1 
ATOM   2549  C  C   . MET A 1  334 ? 17.197  129.887 14.587  1.00 6.11   ? 334 MET A C   1 
ATOM   2550  O  O   . MET A 1  334 ? 17.608  129.504 13.483  1.00 2.20   ? 334 MET A O   1 
ATOM   2551  C  CB  . MET A 1  334 ? 14.974  130.295 15.718  1.00 5.54   ? 334 MET A CB  1 
ATOM   2552  C  CG  . MET A 1  334 ? 14.218  131.300 14.824  1.00 5.56   ? 334 MET A CG  1 
ATOM   2553  S  SD  . MET A 1  334 ? 13.034  130.590 13.668  1.00 8.42   ? 334 MET A SD  1 
ATOM   2554  C  CE  . MET A 1  334 ? 13.588  128.928 13.362  1.00 2.20   ? 334 MET A CE  1 
ATOM   2555  N  N   . MET A 1  335 ? 18.085  130.318 15.477  1.00 2.28   ? 335 MET A N   1 
ATOM   2556  C  CA  . MET A 1  335 ? 19.297  130.937 14.993  1.00 2.20   ? 335 MET A CA  1 
ATOM   2557  C  C   . MET A 1  335 ? 20.122  130.086 14.079  1.00 2.31   ? 335 MET A C   1 
ATOM   2558  O  O   . MET A 1  335 ? 20.741  130.444 13.084  1.00 6.17   ? 335 MET A O   1 
ATOM   2559  C  CB  . MET A 1  335 ? 20.246  131.361 16.191  1.00 2.20   ? 335 MET A CB  1 
ATOM   2560  C  CG  . MET A 1  335 ? 21.397  132.184 15.657  1.00 2.41   ? 335 MET A CG  1 
ATOM   2561  S  SD  . MET A 1  335 ? 21.024  133.932 15.336  1.00 3.56   ? 335 MET A SD  1 
ATOM   2562  C  CE  . MET A 1  335 ? 20.777  133.850 13.590  1.00 2.20   ? 335 MET A CE  1 
ATOM   2563  N  N   . PHE A 1  336 ? 19.853  128.783 14.219  1.00 3.42   ? 336 PHE A N   1 
ATOM   2564  C  CA  . PHE A 1  336 ? 20.702  127.854 13.491  1.00 5.75   ? 336 PHE A CA  1 
ATOM   2565  C  C   . PHE A 1  336 ? 20.288  127.737 12.038  1.00 3.93   ? 336 PHE A C   1 
ATOM   2566  O  O   . PHE A 1  336 ? 21.152  127.801 11.179  1.00 9.18   ? 336 PHE A O   1 
ATOM   2567  C  CB  . PHE A 1  336 ? 20.717  126.528 14.217  1.00 9.17   ? 336 PHE A CB  1 
ATOM   2568  C  CG  . PHE A 1  336 ? 21.374  125.422 13.437  1.00 5.92   ? 336 PHE A CG  1 
ATOM   2569  C  CD1 . PHE A 1  336 ? 20.669  124.715 12.487  1.00 6.44   ? 336 PHE A CD1 1 
ATOM   2570  C  CD2 . PHE A 1  336 ? 22.690  125.102 13.676  1.00 3.48   ? 336 PHE A CD2 1 
ATOM   2571  C  CE1 . PHE A 1  336 ? 21.264  123.701 11.804  1.00 3.49   ? 336 PHE A CE1 1 
ATOM   2572  C  CE2 . PHE A 1  336 ? 23.305  124.095 12.986  1.00 4.38   ? 336 PHE A CE2 1 
ATOM   2573  C  CZ  . PHE A 1  336 ? 22.583  123.387 12.041  1.00 4.78   ? 336 PHE A CZ  1 
ATOM   2574  N  N   . VAL A 1  337 ? 19.021  127.427 11.840  1.00 9.46   ? 337 VAL A N   1 
ATOM   2575  C  CA  . VAL A 1  337 ? 18.309  127.334 10.600  1.00 3.88   ? 337 VAL A CA  1 
ATOM   2576  C  C   . VAL A 1  337 ? 18.415  128.659 9.851   1.00 4.95   ? 337 VAL A C   1 
ATOM   2577  O  O   . VAL A 1  337 ? 18.699  128.512 8.674   1.00 10.09  ? 337 VAL A O   1 
ATOM   2578  C  CB  . VAL A 1  337 ? 16.828  127.006 10.728  1.00 2.23   ? 337 VAL A CB  1 
ATOM   2579  C  CG1 . VAL A 1  337 ? 16.344  125.961 9.771   1.00 5.17   ? 337 VAL A CG1 1 
ATOM   2580  C  CG2 . VAL A 1  337 ? 16.420  126.648 12.154  1.00 6.52   ? 337 VAL A CG2 1 
ATOM   2581  N  N   . LEU A 1  338 ? 18.330  129.806 10.508  1.00 4.98   ? 338 LEU A N   1 
ATOM   2582  C  CA  . LEU A 1  338 ? 18.434  131.095 9.828   1.00 7.94   ? 338 LEU A CA  1 
ATOM   2583  C  C   . LEU A 1  338 ? 19.789  131.310 9.165   1.00 3.88   ? 338 LEU A C   1 
ATOM   2584  O  O   . LEU A 1  338 ? 19.916  131.341 7.946   1.00 5.79   ? 338 LEU A O   1 
ATOM   2585  C  CB  . LEU A 1  338 ? 18.196  132.313 10.705  1.00 4.61   ? 338 LEU A CB  1 
ATOM   2586  C  CG  . LEU A 1  338 ? 18.274  133.678 10.022  1.00 4.90   ? 338 LEU A CG  1 
ATOM   2587  C  CD1 . LEU A 1  338 ? 17.072  133.968 9.154   1.00 3.59   ? 338 LEU A CD1 1 
ATOM   2588  C  CD2 . LEU A 1  338 ? 18.422  134.691 11.162  1.00 2.36   ? 338 LEU A CD2 1 
ATOM   2589  N  N   . GLN A 1  339 ? 20.834  131.449 9.972   1.00 6.13   ? 339 GLN A N   1 
ATOM   2590  C  CA  . GLN A 1  339 ? 22.198  131.666 9.500   1.00 6.76   ? 339 GLN A CA  1 
ATOM   2591  C  C   . GLN A 1  339 ? 22.590  130.611 8.483   1.00 4.80   ? 339 GLN A C   1 
ATOM   2592  O  O   . GLN A 1  339 ? 23.558  130.664 7.737   1.00 6.69   ? 339 GLN A O   1 
ATOM   2593  C  CB  . GLN A 1  339 ? 23.200  131.553 10.656  1.00 2.36   ? 339 GLN A CB  1 
ATOM   2594  C  CG  . GLN A 1  339 ? 23.303  132.804 11.517  1.00 20.35  ? 339 GLN A CG  1 
ATOM   2595  C  CD  . GLN A 1  339 ? 24.384  132.687 12.578  1.00 23.40  ? 339 GLN A CD  1 
ATOM   2596  O  OE1 . GLN A 1  339 ? 24.381  131.721 13.341  1.00 25.99  ? 339 GLN A OE1 1 
ATOM   2597  N  NE2 . GLN A 1  339 ? 25.322  133.629 12.637  1.00 26.49  ? 339 GLN A NE2 1 
ATOM   2598  N  N   . GLY A 1  340 ? 21.983  129.451 8.619   1.00 2.34   ? 340 GLY A N   1 
ATOM   2599  C  CA  . GLY A 1  340 ? 22.272  128.294 7.800   1.00 6.80   ? 340 GLY A CA  1 
ATOM   2600  C  C   . GLY A 1  340 ? 21.709  128.544 6.402   1.00 4.12   ? 340 GLY A C   1 
ATOM   2601  O  O   . GLY A 1  340 ? 22.294  128.016 5.497   1.00 3.03   ? 340 GLY A O   1 
ATOM   2602  N  N   . GLN A 1  341 ? 20.653  129.329 6.331   1.00 2.35   ? 341 GLN A N   1 
ATOM   2603  C  CA  . GLN A 1  341 ? 19.993  129.679 5.074   1.00 2.85   ? 341 GLN A CA  1 
ATOM   2604  C  C   . GLN A 1  341 ? 20.777  130.787 4.369   1.00 2.20   ? 341 GLN A C   1 
ATOM   2605  O  O   . GLN A 1  341 ? 21.467  130.527 3.386   1.00 3.35   ? 341 GLN A O   1 
ATOM   2606  C  CB  . GLN A 1  341 ? 18.558  130.125 5.353   1.00 6.67   ? 341 GLN A CB  1 
ATOM   2607  C  CG  . GLN A 1  341 ? 17.495  129.191 4.854   1.00 5.07   ? 341 GLN A CG  1 
ATOM   2608  C  CD  . GLN A 1  341 ? 17.971  127.788 4.560   1.00 11.54  ? 341 GLN A CD  1 
ATOM   2609  O  OE1 . GLN A 1  341 ? 18.064  127.396 3.393   1.00 16.87  ? 341 GLN A OE1 1 
ATOM   2610  N  NE2 . GLN A 1  341 ? 18.276  126.998 5.588   1.00 3.06   ? 341 GLN A NE2 1 
ATOM   2611  N  N   . TRP A 1  342 ? 21.205  131.805 5.122   1.00 4.78   ? 342 TRP A N   1 
ATOM   2612  C  CA  . TRP A 1  342 ? 22.239  132.718 4.685   1.00 6.00   ? 342 TRP A CA  1 
ATOM   2613  C  C   . TRP A 1  342 ? 23.436  132.029 4.039   1.00 4.04   ? 342 TRP A C   1 
ATOM   2614  O  O   . TRP A 1  342 ? 23.791  132.187 2.866   1.00 9.12   ? 342 TRP A O   1 
ATOM   2615  C  CB  . TRP A 1  342 ? 22.762  133.566 5.840   1.00 5.29   ? 342 TRP A CB  1 
ATOM   2616  C  CG  . TRP A 1  342 ? 21.807  134.540 6.431   1.00 4.26   ? 342 TRP A CG  1 
ATOM   2617  C  CD1 . TRP A 1  342 ? 20.617  134.914 5.861   1.00 9.20   ? 342 TRP A CD1 1 
ATOM   2618  C  CD2 . TRP A 1  342 ? 21.848  135.266 7.671   1.00 2.20   ? 342 TRP A CD2 1 
ATOM   2619  N  NE1 . TRP A 1  342 ? 19.946  135.821 6.638   1.00 8.97   ? 342 TRP A NE1 1 
ATOM   2620  C  CE2 . TRP A 1  342 ? 20.688  136.063 7.767   1.00 3.33   ? 342 TRP A CE2 1 
ATOM   2621  C  CE3 . TRP A 1  342 ? 22.793  135.338 8.691   1.00 5.79   ? 342 TRP A CE3 1 
ATOM   2622  C  CZ2 . TRP A 1  342 ? 20.422  136.905 8.850   1.00 6.45   ? 342 TRP A CZ2 1 
ATOM   2623  C  CZ3 . TRP A 1  342 ? 22.517  136.174 9.756   1.00 10.79  ? 342 TRP A CZ3 1 
ATOM   2624  C  CH2 . TRP A 1  342 ? 21.353  136.954 9.845   1.00 2.64   ? 342 TRP A CH2 1 
ATOM   2625  N  N   . MET A 1  343 ? 24.180  131.206 4.766   1.00 7.45   ? 343 MET A N   1 
ATOM   2626  C  CA  . MET A 1  343 ? 25.344  130.560 4.300   1.00 3.88   ? 343 MET A CA  1 
ATOM   2627  C  C   . MET A 1  343 ? 25.036  129.765 2.940   1.00 6.36   ? 343 MET A C   1 
ATOM   2628  O  O   . MET A 1  343 ? 25.859  129.622 2.031   1.00 4.80   ? 343 MET A O   1 
ATOM   2629  C  CB  . MET A 1  343 ? 26.065  129.606 5.136   1.00 4.83   ? 343 MET A CB  1 
ATOM   2630  C  CG  . MET A 1  343 ? 26.844  130.081 6.326   1.00 2.20   ? 343 MET A CG  1 
ATOM   2631  S  SD  . MET A 1  343 ? 27.385  131.807 6.300   1.00 4.43   ? 343 MET A SD  1 
ATOM   2632  C  CE  . MET A 1  343 ? 28.966  131.484 5.521   1.00 5.88   ? 343 MET A CE  1 
ATOM   2633  N  N   . ARG A 1  344 ? 23.952  128.986 2.987   1.00 3.65   ? 344 ARG A N   1 
ATOM   2634  C  CA  . ARG A 1  344 ? 23.670  128.109 1.849   1.00 5.27   ? 344 ARG A CA  1 
ATOM   2635  C  C   . ARG A 1  344 ? 23.302  128.967 0.658   1.00 2.20   ? 344 ARG A C   1 
ATOM   2636  O  O   . ARG A 1  344 ? 23.746  128.724 -0.461  1.00 5.75   ? 344 ARG A O   1 
ATOM   2637  C  CB  . ARG A 1  344 ? 22.710  126.998 2.154   1.00 2.20   ? 344 ARG A CB  1 
ATOM   2638  C  CG  . ARG A 1  344 ? 21.746  126.620 1.068   1.00 8.88   ? 344 ARG A CG  1 
ATOM   2639  C  CD  . ARG A 1  344 ? 20.262  126.574 1.454   1.00 13.68  ? 344 ARG A CD  1 
ATOM   2640  N  NE  . ARG A 1  344 ? 19.479  126.932 0.277   1.00 17.53  ? 344 ARG A NE  1 
ATOM   2641  C  CZ  . ARG A 1  344 ? 18.540  127.851 0.173   1.00 29.73  ? 344 ARG A CZ  1 
ATOM   2642  N  NH1 . ARG A 1  344 ? 18.115  128.612 1.179   1.00 26.09  ? 344 ARG A NH1 1 
ATOM   2643  N  NH2 . ARG A 1  344 ? 17.963  128.030 -1.021  1.00 37.73  ? 344 ARG A NH2 1 
ATOM   2644  N  N   . LEU A 1  345 ? 22.786  130.175 0.948   1.00 7.95   ? 345 LEU A N   1 
ATOM   2645  C  CA  . LEU A 1  345 ? 22.546  131.128 -0.108  1.00 8.44   ? 345 LEU A CA  1 
ATOM   2646  C  C   . LEU A 1  345 ? 23.831  131.587 -0.777  1.00 11.14  ? 345 LEU A C   1 
ATOM   2647  O  O   . LEU A 1  345 ? 23.811  131.561 -2.024  1.00 15.39  ? 345 LEU A O   1 
ATOM   2648  C  CB  . LEU A 1  345 ? 21.695  132.297 0.334   1.00 11.87  ? 345 LEU A CB  1 
ATOM   2649  C  CG  . LEU A 1  345 ? 20.178  132.107 0.398   1.00 12.15  ? 345 LEU A CG  1 
ATOM   2650  C  CD1 . LEU A 1  345 ? 19.473  133.416 0.714   1.00 6.33   ? 345 LEU A CD1 1 
ATOM   2651  C  CD2 . LEU A 1  345 ? 19.624  131.450 -0.845  1.00 2.20   ? 345 LEU A CD2 1 
ATOM   2652  N  N   . CYS A 1  346 ? 24.908  131.976 -0.070  1.00 2.20   ? 346 CYS A N   1 
ATOM   2653  C  CA  . CYS A 1  346 ? 26.076  132.442 -0.795  1.00 5.03   ? 346 CYS A CA  1 
ATOM   2654  C  C   . CYS A 1  346 ? 26.973  131.368 -1.377  1.00 2.38   ? 346 CYS A C   1 
ATOM   2655  O  O   . CYS A 1  346 ? 28.126  131.711 -1.693  1.00 2.78   ? 346 CYS A O   1 
ATOM   2656  C  CB  . CYS A 1  346 ? 27.027  133.318 0.041   1.00 3.10   ? 346 CYS A CB  1 
ATOM   2657  S  SG  . CYS A 1  346 ? 26.714  133.428 1.785   1.00 9.17   ? 346 CYS A SG  1 
ATOM   2658  N  N   . THR A 1  347 ? 26.710  130.099 -1.359  1.00 2.21   ? 347 THR A N   1 
ATOM   2659  C  CA  . THR A 1  347 ? 27.560  129.005 -1.749  1.00 5.35   ? 347 THR A CA  1 
ATOM   2660  C  C   . THR A 1  347 ? 26.817  127.944 -2.565  1.00 7.03   ? 347 THR A C   1 
ATOM   2661  O  O   . THR A 1  347 ? 27.400  127.054 -3.179  1.00 4.46   ? 347 THR A O   1 
ATOM   2662  C  CB  . THR A 1  347 ? 28.141  128.308 -0.504  1.00 5.38   ? 347 THR A CB  1 
ATOM   2663  O  OG1 . THR A 1  347 ? 27.267  127.334 0.085   1.00 7.56   ? 347 THR A OG1 1 
ATOM   2664  C  CG2 . THR A 1  347 ? 28.592  129.272 0.578   1.00 4.19   ? 347 THR A CG2 1 
ATOM   2665  N  N   . SER A 1  348 ? 25.484  127.959 -2.480  1.00 10.44  ? 348 SER A N   1 
ATOM   2666  C  CA  . SER A 1  348 ? 24.713  126.886 -3.069  1.00 12.17  ? 348 SER A CA  1 
ATOM   2667  C  C   . SER A 1  348 ? 23.410  127.364 -3.666  1.00 14.19  ? 348 SER A C   1 
ATOM   2668  O  O   . SER A 1  348 ? 22.466  126.557 -3.579  1.00 21.30  ? 348 SER A O   1 
ATOM   2669  C  CB  . SER A 1  348 ? 24.421  125.871 -1.946  1.00 22.20  ? 348 SER A CB  1 
ATOM   2670  O  OG  . SER A 1  348 ? 25.654  125.309 -1.496  1.00 35.31  ? 348 SER A OG  1 
ATOM   2671  N  N   . ALA A 1  349 ? 23.353  128.612 -4.128  1.00 10.35  ? 349 ALA A N   1 
ATOM   2672  C  CA  . ALA A 1  349 ? 22.117  129.117 -4.737  1.00 8.43   ? 349 ALA A CA  1 
ATOM   2673  C  C   . ALA A 1  349 ? 21.868  128.359 -6.033  1.00 12.31  ? 349 ALA A C   1 
ATOM   2674  O  O   . ALA A 1  349 ? 22.798  127.910 -6.712  1.00 14.92  ? 349 ALA A O   1 
ATOM   2675  C  CB  . ALA A 1  349 ? 22.123  130.605 -4.920  1.00 2.28   ? 349 ALA A CB  1 
ATOM   2676  N  N   . THR A 1  350 ? 20.598  128.064 -6.251  1.00 13.11  ? 350 THR A N   1 
ATOM   2677  C  CA  . THR A 1  350 ? 20.224  127.281 -7.439  1.00 16.21  ? 350 THR A CA  1 
ATOM   2678  C  C   . THR A 1  350 ? 19.453  128.184 -8.370  1.00 17.92  ? 350 THR A C   1 
ATOM   2679  O  O   . THR A 1  350 ? 18.899  129.218 -7.947  1.00 14.67  ? 350 THR A O   1 
ATOM   2680  C  CB  . THR A 1  350 ? 19.489  126.011 -7.019  1.00 19.83  ? 350 THR A CB  1 
ATOM   2681  O  OG1 . THR A 1  350 ? 20.508  125.050 -6.721  1.00 21.56  ? 350 THR A OG1 1 
ATOM   2682  C  CG2 . THR A 1  350 ? 18.502  125.536 -8.064  1.00 29.36  ? 350 THR A CG2 1 
ATOM   2683  N  N   . GLU A 1  351 ? 19.505  127.965 -9.693  1.00 19.45  ? 351 GLU A N   1 
ATOM   2684  C  CA  . GLU A 1  351 ? 18.808  128.976 -10.500 1.00 20.76  ? 351 GLU A CA  1 
ATOM   2685  C  C   . GLU A 1  351 ? 17.326  128.925 -10.205 1.00 17.67  ? 351 GLU A C   1 
ATOM   2686  O  O   . GLU A 1  351 ? 16.716  129.937 -9.829  1.00 18.79  ? 351 GLU A O   1 
ATOM   2687  C  CB  . GLU A 1  351 ? 19.249  129.059 -11.936 1.00 18.16  ? 351 GLU A CB  1 
ATOM   2688  C  CG  . GLU A 1  351 ? 19.788  130.433 -12.349 1.00 18.14  ? 351 GLU A CG  1 
ATOM   2689  C  CD  . GLU A 1  351 ? 21.284  130.426 -12.529 1.00 22.46  ? 351 GLU A CD  1 
ATOM   2690  O  OE1 . GLU A 1  351 ? 21.802  129.705 -13.407 1.00 30.94  ? 351 GLU A OE1 1 
ATOM   2691  O  OE2 . GLU A 1  351 ? 21.925  131.158 -11.762 1.00 23.03  ? 351 GLU A OE2 1 
ATOM   2692  N  N   . SER A 1  352 ? 16.715  127.748 -10.113 1.00 16.23  ? 352 SER A N   1 
ATOM   2693  C  CA  . SER A 1  352 ? 15.302  127.676 -9.747  1.00 17.06  ? 352 SER A CA  1 
ATOM   2694  C  C   . SER A 1  352 ? 14.935  128.547 -8.552  1.00 18.87  ? 352 SER A C   1 
ATOM   2695  O  O   . SER A 1  352 ? 14.017  129.369 -8.620  1.00 19.35  ? 352 SER A O   1 
ATOM   2696  C  CB  . SER A 1  352 ? 14.843  126.260 -9.408  1.00 14.81  ? 352 SER A CB  1 
ATOM   2697  O  OG  . SER A 1  352 ? 15.705  125.243 -9.882  1.00 28.39  ? 352 SER A OG  1 
ATOM   2698  N  N   . GLU A 1  353 ? 15.599  128.374 -7.413  1.00 20.77  ? 353 GLU A N   1 
ATOM   2699  C  CA  . GLU A 1  353 ? 15.369  129.102 -6.189  1.00 15.99  ? 353 GLU A CA  1 
ATOM   2700  C  C   . GLU A 1  353 ? 15.389  130.609 -6.368  1.00 12.10  ? 353 GLU A C   1 
ATOM   2701  O  O   . GLU A 1  353 ? 14.507  131.279 -5.854  1.00 8.57   ? 353 GLU A O   1 
ATOM   2702  C  CB  . GLU A 1  353 ? 16.372  128.815 -5.064  1.00 20.40  ? 353 GLU A CB  1 
ATOM   2703  C  CG  . GLU A 1  353 ? 17.314  127.657 -5.293  1.00 30.90  ? 353 GLU A CG  1 
ATOM   2704  C  CD  . GLU A 1  353 ? 18.282  127.438 -4.147  1.00 37.79  ? 353 GLU A CD  1 
ATOM   2705  O  OE1 . GLU A 1  353 ? 18.694  128.430 -3.513  1.00 30.10  ? 353 GLU A OE1 1 
ATOM   2706  O  OE2 . GLU A 1  353 ? 18.652  126.272 -3.868  1.00 48.06  ? 353 GLU A OE2 1 
ATOM   2707  N  N   . VAL A 1  354 ? 16.474  131.111 -6.961  1.00 14.32  ? 354 VAL A N   1 
ATOM   2708  C  CA  . VAL A 1  354 ? 16.586  132.553 -7.123  1.00 15.41  ? 354 VAL A CA  1 
ATOM   2709  C  C   . VAL A 1  354 ? 15.460  133.073 -8.023  1.00 21.51  ? 354 VAL A C   1 
ATOM   2710  O  O   . VAL A 1  354 ? 14.832  134.102 -7.751  1.00 17.38  ? 354 VAL A O   1 
ATOM   2711  C  CB  . VAL A 1  354 ? 17.924  133.007 -7.721  1.00 4.71   ? 354 VAL A CB  1 
ATOM   2712  C  CG1 . VAL A 1  354 ? 17.782  134.516 -7.953  1.00 4.18   ? 354 VAL A CG1 1 
ATOM   2713  C  CG2 . VAL A 1  354 ? 19.093  132.735 -6.786  1.00 6.90   ? 354 VAL A CG2 1 
ATOM   2714  N  N   . LEU A 1  355 ? 15.190  132.263 -9.057  1.00 24.44  ? 355 LEU A N   1 
ATOM   2715  C  CA  . LEU A 1  355 ? 14.157  132.572 -10.027 1.00 27.52  ? 355 LEU A CA  1 
ATOM   2716  C  C   . LEU A 1  355 ? 12.819  132.835 -9.366  1.00 24.13  ? 355 LEU A C   1 
ATOM   2717  O  O   . LEU A 1  355 ? 12.162  133.826 -9.682  1.00 22.18  ? 355 LEU A O   1 
ATOM   2718  C  CB  . LEU A 1  355 ? 14.092  131.627 -11.204 1.00 42.23  ? 355 LEU A CB  1 
ATOM   2719  C  CG  . LEU A 1  355 ? 15.217  131.608 -12.240 1.00 57.19  ? 355 LEU A CG  1 
ATOM   2720  C  CD1 . LEU A 1  355 ? 14.728  130.960 -13.537 1.00 59.80  ? 355 LEU A CD1 1 
ATOM   2721  C  CD2 . LEU A 1  355 ? 15.879  132.947 -12.536 1.00 57.56  ? 355 LEU A CD2 1 
ATOM   2722  N  N   . ARG A 1  356 ? 12.437  132.014 -8.391  1.00 22.79  ? 356 ARG A N   1 
ATOM   2723  C  CA  . ARG A 1  356 ? 11.175  132.188 -7.681  1.00 21.11  ? 356 ARG A CA  1 
ATOM   2724  C  C   . ARG A 1  356 ? 11.209  133.411 -6.794  1.00 19.31  ? 356 ARG A C   1 
ATOM   2725  O  O   . ARG A 1  356 ? 10.252  134.147 -6.575  1.00 19.01  ? 356 ARG A O   1 
ATOM   2726  C  CB  . ARG A 1  356 ? 10.760  130.968 -6.871  1.00 26.09  ? 356 ARG A CB  1 
ATOM   2727  C  CG  . ARG A 1  356 ? 10.958  130.957 -5.367  1.00 38.97  ? 356 ARG A CG  1 
ATOM   2728  C  CD  . ARG A 1  356 ? 11.189  129.590 -4.770  1.00 49.59  ? 356 ARG A CD  1 
ATOM   2729  N  NE  . ARG A 1  356 ? 12.031  129.446 -3.592  1.00 51.76  ? 356 ARG A NE  1 
ATOM   2730  C  CZ  . ARG A 1  356 ? 12.424  128.272 -3.088  1.00 56.31  ? 356 ARG A CZ  1 
ATOM   2731  N  NH1 . ARG A 1  356 ? 12.054  127.124 -3.644  1.00 55.08  ? 356 ARG A NH1 1 
ATOM   2732  N  NH2 . ARG A 1  356 ? 13.206  128.241 -2.016  1.00 61.17  ? 356 ARG A NH2 1 
ATOM   2733  N  N   . GLY A 1  357 ? 12.377  133.663 -6.202  1.00 20.05  ? 357 GLY A N   1 
ATOM   2734  C  CA  . GLY A 1  357 ? 12.475  134.781 -5.256  1.00 18.92  ? 357 GLY A CA  1 
ATOM   2735  C  C   . GLY A 1  357 ? 12.504  136.084 -6.029  1.00 15.94  ? 357 GLY A C   1 
ATOM   2736  O  O   . GLY A 1  357 ? 12.252  137.164 -5.528  1.00 15.68  ? 357 GLY A O   1 
ATOM   2737  N  N   . LYS A 1  358 ? 12.907  135.940 -7.282  1.00 18.06  ? 358 LYS A N   1 
ATOM   2738  C  CA  . LYS A 1  358 ? 12.911  137.068 -8.228  1.00 15.06  ? 358 LYS A CA  1 
ATOM   2739  C  C   . LYS A 1  358 ? 11.485  137.599 -8.429  1.00 8.15   ? 358 LYS A C   1 
ATOM   2740  O  O   . LYS A 1  358 ? 11.130  138.708 -8.090  1.00 8.42   ? 358 LYS A O   1 
ATOM   2741  C  CB  . LYS A 1  358 ? 13.349  136.491 -9.578  1.00 15.80  ? 358 LYS A CB  1 
ATOM   2742  C  CG  . LYS A 1  358 ? 14.329  137.364 -10.350 1.00 12.12  ? 358 LYS A CG  1 
ATOM   2743  C  CD  . LYS A 1  358 ? 15.347  136.387 -10.952 1.00 10.98  ? 358 LYS A CD  1 
ATOM   2744  C  CE  . LYS A 1  358 ? 15.864  136.895 -12.277 1.00 18.92  ? 358 LYS A CE  1 
ATOM   2745  N  NZ  . LYS A 1  358 ? 15.859  135.765 -13.258 1.00 29.52  ? 358 LYS A NZ  1 
ATOM   2746  N  N   . ASN A 1  359 ? 10.706  136.704 -9.026  1.00 6.53   ? 359 ASN A N   1 
ATOM   2747  C  CA  . ASN A 1  359 ? 9.305   136.914 -9.280  1.00 9.13   ? 359 ASN A CA  1 
ATOM   2748  C  C   . ASN A 1  359 ? 8.593   137.493 -8.081  1.00 10.47  ? 359 ASN A C   1 
ATOM   2749  O  O   . ASN A 1  359 ? 7.880   138.508 -8.120  1.00 14.49  ? 359 ASN A O   1 
ATOM   2750  C  CB  . ASN A 1  359 ? 8.666   135.578 -9.698  1.00 10.77  ? 359 ASN A CB  1 
ATOM   2751  C  CG  . ASN A 1  359 ? 9.219   135.174 -11.056 1.00 20.23  ? 359 ASN A CG  1 
ATOM   2752  O  OD1 . ASN A 1  359 ? 9.681   136.038 -11.806 1.00 32.98  ? 359 ASN A OD1 1 
ATOM   2753  N  ND2 . ASN A 1  359 ? 9.151   133.876 -11.281 1.00 20.54  ? 359 ASN A ND2 1 
ATOM   2754  N  N   . LEU A 1  360 ? 8.783   136.879 -6.916  1.00 10.37  ? 360 LEU A N   1 
ATOM   2755  C  CA  . LEU A 1  360 ? 8.139   137.406 -5.712  1.00 8.26   ? 360 LEU A CA  1 
ATOM   2756  C  C   . LEU A 1  360 ? 8.416   138.912 -5.580  1.00 2.20   ? 360 LEU A C   1 
ATOM   2757  O  O   . LEU A 1  360 ? 7.550   139.636 -5.079  1.00 6.11   ? 360 LEU A O   1 
ATOM   2758  C  CB  . LEU A 1  360 ? 8.743   136.762 -4.461  1.00 6.68   ? 360 LEU A CB  1 
ATOM   2759  C  CG  . LEU A 1  360 ? 7.817   136.109 -3.456  1.00 5.06   ? 360 LEU A CG  1 
ATOM   2760  C  CD1 . LEU A 1  360 ? 6.350   136.403 -3.733  1.00 10.37  ? 360 LEU A CD1 1 
ATOM   2761  C  CD2 . LEU A 1  360 ? 8.093   134.611 -3.443  1.00 2.20   ? 360 LEU A CD2 1 
ATOM   2762  N  N   . LEU A 1  361 ? 9.669   139.264 -5.768  1.00 5.41   ? 361 LEU A N   1 
ATOM   2763  C  CA  . LEU A 1  361 ? 10.043  140.648 -5.564  1.00 5.54   ? 361 LEU A CA  1 
ATOM   2764  C  C   . LEU A 1  361 ? 9.244   141.588 -6.455  1.00 2.59   ? 361 LEU A C   1 
ATOM   2765  O  O   . LEU A 1  361 ? 8.768   142.618 -5.973  1.00 8.48   ? 361 LEU A O   1 
ATOM   2766  C  CB  . LEU A 1  361 ? 11.544  140.829 -5.678  1.00 4.24   ? 361 LEU A CB  1 
ATOM   2767  C  CG  . LEU A 1  361 ? 11.921  142.316 -5.792  1.00 2.52   ? 361 LEU A CG  1 
ATOM   2768  C  CD1 . LEU A 1  361 ? 11.543  143.054 -4.525  1.00 5.99   ? 361 LEU A CD1 1 
ATOM   2769  C  CD2 . LEU A 1  361 ? 13.384  142.403 -6.180  1.00 2.67   ? 361 LEU A CD2 1 
ATOM   2770  N  N   . ARG A 1  362 ? 9.048   141.200 -7.706  1.00 12.39  ? 362 ARG A N   1 
ATOM   2771  C  CA  . ARG A 1  362 ? 8.262   141.891 -8.722  1.00 10.03  ? 362 ARG A CA  1 
ATOM   2772  C  C   . ARG A 1  362 ? 6.899   142.279 -8.147  1.00 10.68  ? 362 ARG A C   1 
ATOM   2773  O  O   . ARG A 1  362 ? 6.575   143.455 -8.037  1.00 6.54   ? 362 ARG A O   1 
ATOM   2774  C  CB  . ARG A 1  362 ? 7.957   140.918 -9.880  1.00 3.20   ? 362 ARG A CB  1 
ATOM   2775  C  CG  . ARG A 1  362 ? 9.232   140.445 -10.531 1.00 4.82   ? 362 ARG A CG  1 
ATOM   2776  C  CD  . ARG A 1  362 ? 9.012   139.805 -11.893 1.00 3.54   ? 362 ARG A CD  1 
ATOM   2777  N  NE  . ARG A 1  362 ? 10.341  139.348 -12.362 1.00 18.54  ? 362 ARG A NE  1 
ATOM   2778  C  CZ  . ARG A 1  362 ? 10.460  138.523 -13.401 1.00 24.45  ? 362 ARG A CZ  1 
ATOM   2779  N  NH1 . ARG A 1  362 ? 9.319   138.144 -13.989 1.00 31.54  ? 362 ARG A NH1 1 
ATOM   2780  N  NH2 . ARG A 1  362 ? 11.644  138.114 -13.815 1.00 13.12  ? 362 ARG A NH2 1 
ATOM   2781  N  N   . ASN A 1  363 ? 6.229   141.197 -7.738  1.00 11.27  ? 363 ASN A N   1 
ATOM   2782  C  CA  . ASN A 1  363 ? 4.918   141.327 -7.113  1.00 9.26   ? 363 ASN A CA  1 
ATOM   2783  C  C   . ASN A 1  363 ? 4.875   142.192 -5.869  1.00 6.92   ? 363 ASN A C   1 
ATOM   2784  O  O   . ASN A 1  363 ? 3.941   142.995 -5.674  1.00 4.62   ? 363 ASN A O   1 
ATOM   2785  C  CB  . ASN A 1  363 ? 4.463   139.918 -6.749  1.00 6.88   ? 363 ASN A CB  1 
ATOM   2786  C  CG  . ASN A 1  363 ? 3.789   139.238 -7.910  1.00 5.48   ? 363 ASN A CG  1 
ATOM   2787  O  OD1 . ASN A 1  363 ? 2.682   139.643 -8.262  1.00 7.72   ? 363 ASN A OD1 1 
ATOM   2788  N  ND2 . ASN A 1  363 ? 4.454   138.242 -8.463  1.00 2.22   ? 363 ASN A ND2 1 
ATOM   2789  N  N   . ALA A 1  364 ? 5.904   142.072 -5.000  1.00 2.20   ? 364 ALA A N   1 
ATOM   2790  C  CA  . ALA A 1  364 ? 5.803   142.825 -3.749  1.00 8.01   ? 364 ALA A CA  1 
ATOM   2791  C  C   . ALA A 1  364 ? 5.874   144.287 -4.139  1.00 8.67   ? 364 ALA A C   1 
ATOM   2792  O  O   . ALA A 1  364 ? 5.204   145.190 -3.681  1.00 13.24  ? 364 ALA A O   1 
ATOM   2793  C  CB  . ALA A 1  364 ? 6.946   142.459 -2.834  1.00 11.39  ? 364 ALA A CB  1 
ATOM   2794  N  N   . LEU A 1  365 ? 6.749   144.444 -5.142  1.00 11.55  ? 365 LEU A N   1 
ATOM   2795  C  CA  . LEU A 1  365 ? 7.037   145.792 -5.583  1.00 12.42  ? 365 LEU A CA  1 
ATOM   2796  C  C   . LEU A 1  365 ? 6.048   146.332 -6.577  1.00 11.44  ? 365 LEU A C   1 
ATOM   2797  O  O   . LEU A 1  365 ? 5.914   147.553 -6.725  1.00 14.02  ? 365 LEU A O   1 
ATOM   2798  C  CB  . LEU A 1  365 ? 8.495   145.927 -5.931  1.00 7.74   ? 365 LEU A CB  1 
ATOM   2799  C  CG  . LEU A 1  365 ? 8.882   147.226 -6.625  1.00 9.25   ? 365 LEU A CG  1 
ATOM   2800  C  CD1 . LEU A 1  365 ? 8.816   148.401 -5.671  1.00 2.82   ? 365 LEU A CD1 1 
ATOM   2801  C  CD2 . LEU A 1  365 ? 10.263  147.024 -7.238  1.00 13.12  ? 365 LEU A CD2 1 
ATOM   2802  N  N   . VAL A 1  366 ? 5.168   145.483 -7.138  1.00 8.13   ? 366 VAL A N   1 
ATOM   2803  C  CA  . VAL A 1  366 ? 4.081   146.073 -7.906  1.00 8.86   ? 366 VAL A CA  1 
ATOM   2804  C  C   . VAL A 1  366 ? 2.899   146.333 -6.975  1.00 9.26   ? 366 VAL A C   1 
ATOM   2805  O  O   . VAL A 1  366 ? 2.344   147.421 -6.959  1.00 4.50   ? 366 VAL A O   1 
ATOM   2806  C  CB  . VAL A 1  366 ? 3.518   145.338 -9.127  1.00 2.20   ? 366 VAL A CB  1 
ATOM   2807  C  CG1 . VAL A 1  366 ? 2.028   145.634 -9.255  1.00 5.85   ? 366 VAL A CG1 1 
ATOM   2808  C  CG2 . VAL A 1  366 ? 4.260   145.771 -10.387 1.00 15.63  ? 366 VAL A CG2 1 
ATOM   2809  N  N   . SER A 1  367 ? 2.547   145.284 -6.227  1.00 14.64  ? 367 SER A N   1 
ATOM   2810  C  CA  . SER A 1  367 ? 1.374   145.364 -5.379  1.00 15.01  ? 367 SER A CA  1 
ATOM   2811  C  C   . SER A 1  367 ? 1.396   146.466 -4.352  1.00 10.46  ? 367 SER A C   1 
ATOM   2812  O  O   . SER A 1  367 ? 0.361   147.025 -4.012  1.00 8.91   ? 367 SER A O   1 
ATOM   2813  C  CB  . SER A 1  367 ? 1.007   144.023 -4.753  1.00 19.48  ? 367 SER A CB  1 
ATOM   2814  O  OG  . SER A 1  367 ? -0.389  144.072 -4.424  1.00 27.99  ? 367 SER A OG  1 
ATOM   2815  N  N   . HIS A 1  368 ? 2.554   146.820 -3.808  1.00 10.63  ? 368 HIS A N   1 
ATOM   2816  C  CA  . HIS A 1  368 ? 2.588   147.924 -2.870  1.00 9.98   ? 368 HIS A CA  1 
ATOM   2817  C  C   . HIS A 1  368 ? 2.082   149.198 -3.533  1.00 12.49  ? 368 HIS A C   1 
ATOM   2818  O  O   . HIS A 1  368 ? 1.374   149.988 -2.913  1.00 18.80  ? 368 HIS A O   1 
ATOM   2819  C  CB  . HIS A 1  368 ? 4.041   148.205 -2.452  1.00 17.52  ? 368 HIS A CB  1 
ATOM   2820  C  CG  . HIS A 1  368 ? 4.051   149.272 -1.398  1.00 19.36  ? 368 HIS A CG  1 
ATOM   2821  N  ND1 . HIS A 1  368 ? 3.335   149.101 -0.228  1.00 29.35  ? 368 HIS A ND1 1 
ATOM   2822  C  CD2 . HIS A 1  368 ? 4.650   150.470 -1.338  1.00 19.35  ? 368 HIS A CD2 1 
ATOM   2823  C  CE1 . HIS A 1  368 ? 3.514   150.164 0.533   1.00 38.25  ? 368 HIS A CE1 1 
ATOM   2824  N  NE2 . HIS A 1  368 ? 4.309   151.008 -0.126  1.00 39.18  ? 368 HIS A NE2 1 
ATOM   2825  N  N   . LEU A 1  369 ? 2.441   149.419 -4.792  1.00 11.84  ? 369 LEU A N   1 
ATOM   2826  C  CA  . LEU A 1  369 ? 2.024   150.598 -5.522  1.00 9.62   ? 369 LEU A CA  1 
ATOM   2827  C  C   . LEU A 1  369 ? 0.572   150.674 -5.926  1.00 9.63   ? 369 LEU A C   1 
ATOM   2828  O  O   . LEU A 1  369 ? 0.162   151.583 -6.644  1.00 11.02  ? 369 LEU A O   1 
ATOM   2829  C  CB  . LEU A 1  369 ? 2.970   150.859 -6.686  1.00 8.18   ? 369 LEU A CB  1 
ATOM   2830  C  CG  . LEU A 1  369 ? 4.470   150.980 -6.356  1.00 2.20   ? 369 LEU A CG  1 
ATOM   2831  C  CD1 . LEU A 1  369 ? 5.243   150.245 -7.450  1.00 4.72   ? 369 LEU A CD1 1 
ATOM   2832  C  CD2 . LEU A 1  369 ? 4.970   152.379 -6.148  1.00 5.04   ? 369 LEU A CD2 1 
ATOM   2833  N  N   . ASP A 1  370 ? -0.333  149.841 -5.463  1.00 13.52  ? 370 ASP A N   1 
ATOM   2834  C  CA  . ASP A 1  370 ? -1.770  149.960 -5.659  1.00 15.57  ? 370 ASP A CA  1 
ATOM   2835  C  C   . ASP A 1  370 ? -2.304  151.037 -4.703  1.00 17.08  ? 370 ASP A C   1 
ATOM   2836  O  O   . ASP A 1  370 ? -2.068  150.920 -3.504  1.00 15.91  ? 370 ASP A O   1 
ATOM   2837  C  CB  . ASP A 1  370 ? -2.482  148.662 -5.199  1.00 22.32  ? 370 ASP A CB  1 
ATOM   2838  C  CG  . ASP A 1  370 ? -3.121  147.996 -6.399  1.00 29.33  ? 370 ASP A CG  1 
ATOM   2839  O  OD1 . ASP A 1  370 ? -3.973  148.724 -6.951  1.00 33.92  ? 370 ASP A OD1 1 
ATOM   2840  O  OD2 . ASP A 1  370 ? -2.769  146.854 -6.760  1.00 34.82  ? 370 ASP A OD2 1 
ATOM   2841  N  N   . GLY A 1  371 ? -3.001  152.014 -5.254  1.00 17.95  ? 371 GLY A N   1 
ATOM   2842  C  CA  . GLY A 1  371 ? -3.595  153.047 -4.417  1.00 19.38  ? 371 GLY A CA  1 
ATOM   2843  C  C   . GLY A 1  371 ? -2.878  154.370 -4.528  1.00 19.62  ? 371 GLY A C   1 
ATOM   2844  O  O   . GLY A 1  371 ? -1.684  154.471 -4.804  1.00 21.98  ? 371 GLY A O   1 
ATOM   2845  N  N   . THR A 1  372 ? -3.556  155.435 -4.132  1.00 21.17  ? 372 THR A N   1 
ATOM   2846  C  CA  . THR A 1  372 ? -2.935  156.765 -4.239  1.00 19.43  ? 372 THR A CA  1 
ATOM   2847  C  C   . THR A 1  372 ? -1.889  157.045 -3.198  1.00 15.31  ? 372 THR A C   1 
ATOM   2848  O  O   . THR A 1  372 ? -0.781  157.500 -3.498  1.00 12.92  ? 372 THR A O   1 
ATOM   2849  C  CB  . THR A 1  372 ? -4.114  157.757 -4.242  1.00 22.78  ? 372 THR A CB  1 
ATOM   2850  O  OG1 . THR A 1  372 ? -4.638  157.725 -5.587  1.00 20.94  ? 372 THR A OG1 1 
ATOM   2851  C  CG2 . THR A 1  372 ? -3.765  159.144 -3.828  1.00 19.75  ? 372 THR A CG2 1 
ATOM   2852  N  N   . THR A 1  373 ? -2.115  156.630 -1.945  1.00 14.22  ? 373 THR A N   1 
ATOM   2853  C  CA  . THR A 1  373 ? -1.180  156.994 -0.895  1.00 10.69  ? 373 THR A CA  1 
ATOM   2854  C  C   . THR A 1  373 ? 0.169   156.312 -0.991  1.00 5.71   ? 373 THR A C   1 
ATOM   2855  O  O   . THR A 1  373 ? 1.275   156.829 -0.794  1.00 2.20   ? 373 THR A O   1 
ATOM   2856  C  CB  . THR A 1  373 ? -1.746  156.841 0.513   1.00 3.94   ? 373 THR A CB  1 
ATOM   2857  O  OG1 . THR A 1  373 ? -2.996  157.524 0.603   1.00 5.09   ? 373 THR A OG1 1 
ATOM   2858  C  CG2 . THR A 1  373 ? -0.722  157.380 1.521   1.00 3.86   ? 373 THR A CG2 1 
ATOM   2859  N  N   . PRO A 1  374 ? 0.136   155.050 -1.309  1.00 3.27   ? 374 PRO A N   1 
ATOM   2860  C  CA  . PRO A 1  374 ? 1.385   154.311 -1.494  1.00 3.82   ? 374 PRO A CA  1 
ATOM   2861  C  C   . PRO A 1  374 ? 2.194   154.982 -2.599  1.00 12.72  ? 374 PRO A C   1 
ATOM   2862  O  O   . PRO A 1  374 ? 3.410   155.193 -2.494  1.00 9.97   ? 374 PRO A O   1 
ATOM   2863  C  CB  . PRO A 1  374 ? 0.992   152.870 -1.893  1.00 6.18   ? 374 PRO A CB  1 
ATOM   2864  C  CG  . PRO A 1  374 ? -0.498  152.852 -1.810  1.00 5.70   ? 374 PRO A CG  1 
ATOM   2865  C  CD  . PRO A 1  374 ? -1.051  154.228 -1.540  1.00 8.61   ? 374 PRO A CD  1 
ATOM   2866  N  N   . VAL A 1  375 ? 1.499   155.288 -3.725  1.00 15.97  ? 375 VAL A N   1 
ATOM   2867  C  CA  . VAL A 1  375 ? 2.223   155.840 -4.858  1.00 12.48  ? 375 VAL A CA  1 
ATOM   2868  C  C   . VAL A 1  375 ? 2.798   157.197 -4.514  1.00 11.90  ? 375 VAL A C   1 
ATOM   2869  O  O   . VAL A 1  375 ? 3.982   157.416 -4.774  1.00 11.40  ? 375 VAL A O   1 
ATOM   2870  C  CB  . VAL A 1  375 ? 1.506   155.859 -6.193  1.00 8.73   ? 375 VAL A CB  1 
ATOM   2871  C  CG1 . VAL A 1  375 ? 1.442   154.452 -6.757  1.00 11.03  ? 375 VAL A CG1 1 
ATOM   2872  C  CG2 . VAL A 1  375 ? 0.147   156.498 -6.057  1.00 16.95  ? 375 VAL A CG2 1 
ATOM   2873  N  N   . CYS A 1  376 ? 2.057   157.995 -3.739  1.00 9.30   ? 376 CYS A N   1 
ATOM   2874  C  CA  . CYS A 1  376 ? 2.682   159.250 -3.306  1.00 14.33  ? 376 CYS A CA  1 
ATOM   2875  C  C   . CYS A 1  376 ? 4.048   158.937 -2.685  1.00 21.35  ? 376 CYS A C   1 
ATOM   2876  O  O   . CYS A 1  376 ? 5.101   159.231 -3.287  1.00 24.07  ? 376 CYS A O   1 
ATOM   2877  C  CB  . CYS A 1  376 ? 1.805   160.048 -2.379  1.00 9.25   ? 376 CYS A CB  1 
ATOM   2878  S  SG  . CYS A 1  376 ? 2.324   161.766 -2.050  1.00 10.10  ? 376 CYS A SG  1 
ATOM   2879  N  N   . GLU A 1  377 ? 4.021   158.265 -1.535  1.00 20.39  ? 377 GLU A N   1 
ATOM   2880  C  CA  . GLU A 1  377 ? 5.223   157.875 -0.829  1.00 17.59  ? 377 GLU A CA  1 
ATOM   2881  C  C   . GLU A 1  377 ? 6.383   157.504 -1.738  1.00 17.20  ? 377 GLU A C   1 
ATOM   2882  O  O   . GLU A 1  377 ? 7.428   158.157 -1.743  1.00 12.73  ? 377 GLU A O   1 
ATOM   2883  C  CB  . GLU A 1  377 ? 4.934   156.714 0.122   1.00 23.99  ? 377 GLU A CB  1 
ATOM   2884  C  CG  . GLU A 1  377 ? 5.955   156.652 1.240   1.00 42.50  ? 377 GLU A CG  1 
ATOM   2885  C  CD  . GLU A 1  377 ? 5.677   155.654 2.335   1.00 48.35  ? 377 GLU A CD  1 
ATOM   2886  O  OE1 . GLU A 1  377 ? 4.709   154.869 2.256   1.00 53.51  ? 377 GLU A OE1 1 
ATOM   2887  O  OE2 . GLU A 1  377 ? 6.487   155.663 3.294   1.00 53.27  ? 377 GLU A OE2 1 
ATOM   2888  N  N   . ASP A 1  378 ? 6.159   156.512 -2.611  1.00 17.59  ? 378 ASP A N   1 
ATOM   2889  C  CA  . ASP A 1  378 ? 7.223   156.055 -3.499  1.00 13.67  ? 378 ASP A CA  1 
ATOM   2890  C  C   . ASP A 1  378 ? 7.902   157.274 -4.106  1.00 20.23  ? 378 ASP A C   1 
ATOM   2891  O  O   . ASP A 1  378 ? 9.117   157.386 -4.013  1.00 23.77  ? 378 ASP A O   1 
ATOM   2892  C  CB  . ASP A 1  378 ? 6.727   155.098 -4.569  1.00 9.23   ? 378 ASP A CB  1 
ATOM   2893  C  CG  . ASP A 1  378 ? 7.851   154.481 -5.372  1.00 11.30  ? 378 ASP A CG  1 
ATOM   2894  O  OD1 . ASP A 1  378 ? 8.986   154.999 -5.216  1.00 22.87  ? 378 ASP A OD1 1 
ATOM   2895  O  OD2 . ASP A 1  378 ? 7.685   153.530 -6.168  1.00 6.71   ? 378 ASP A OD2 1 
ATOM   2896  N  N   . ILE A 1  379 ? 7.084   158.180 -4.621  1.00 20.13  ? 379 ILE A N   1 
ATOM   2897  C  CA  . ILE A 1  379 ? 7.560   159.385 -5.281  1.00 19.14  ? 379 ILE A CA  1 
ATOM   2898  C  C   . ILE A 1  379 ? 8.309   160.314 -4.354  1.00 14.36  ? 379 ILE A C   1 
ATOM   2899  O  O   . ILE A 1  379 ? 9.438   160.728 -4.589  1.00 6.08   ? 379 ILE A O   1 
ATOM   2900  C  CB  . ILE A 1  379 ? 6.323   160.063 -5.917  1.00 26.54  ? 379 ILE A CB  1 
ATOM   2901  C  CG1 . ILE A 1  379 ? 6.023   159.333 -7.233  1.00 26.64  ? 379 ILE A CG1 1 
ATOM   2902  C  CG2 . ILE A 1  379 ? 6.491   161.552 -6.125  1.00 26.18  ? 379 ILE A CG2 1 
ATOM   2903  C  CD1 . ILE A 1  379 ? 6.830   158.061 -7.472  1.00 9.88   ? 379 ILE A CD1 1 
ATOM   2904  N  N   . GLY A 1  380 ? 7.653   160.635 -3.239  1.00 10.84  ? 380 GLY A N   1 
ATOM   2905  C  CA  . GLY A 1  380 ? 8.297   161.586 -2.337  1.00 17.75  ? 380 GLY A CA  1 
ATOM   2906  C  C   . GLY A 1  380 ? 9.630   161.013 -1.886  1.00 18.60  ? 380 GLY A C   1 
ATOM   2907  O  O   . GLY A 1  380 ? 10.732  161.398 -2.216  1.00 21.58  ? 380 GLY A O   1 
ATOM   2908  N  N   . ARG A 1  381 ? 9.530   159.949 -1.108  1.00 24.17  ? 381 ARG A N   1 
ATOM   2909  C  CA  . ARG A 1  381 ? 10.723  159.330 -0.558  1.00 24.06  ? 381 ARG A CA  1 
ATOM   2910  C  C   . ARG A 1  381 ? 11.747  159.054 -1.637  1.00 22.38  ? 381 ARG A C   1 
ATOM   2911  O  O   . ARG A 1  381 ? 12.905  159.468 -1.483  1.00 23.68  ? 381 ARG A O   1 
ATOM   2912  C  CB  . ARG A 1  381 ? 10.351  158.057 0.186   1.00 34.70  ? 381 ARG A CB  1 
ATOM   2913  C  CG  . ARG A 1  381 ? 11.486  157.411 0.959   1.00 43.62  ? 381 ARG A CG  1 
ATOM   2914  C  CD  . ARG A 1  381 ? 10.968  156.154 1.642   1.00 53.77  ? 381 ARG A CD  1 
ATOM   2915  N  NE  . ARG A 1  381 ? 10.960  155.001 0.748   1.00 64.31  ? 381 ARG A NE  1 
ATOM   2916  C  CZ  . ARG A 1  381 ? 10.451  153.819 1.091   1.00 74.29  ? 381 ARG A CZ  1 
ATOM   2917  N  NH1 . ARG A 1  381 ? 9.896   153.629 2.281   1.00 77.37  ? 381 ARG A NH1 1 
ATOM   2918  N  NH2 . ARG A 1  381 ? 10.517  152.824 0.212   1.00 79.44  ? 381 ARG A NH2 1 
ATOM   2919  N  N   . SER A 1  382 ? 11.331  158.447 -2.742  1.00 21.41  ? 382 SER A N   1 
ATOM   2920  C  CA  . SER A 1  382 ? 12.223  158.040 -3.818  1.00 16.58  ? 382 SER A CA  1 
ATOM   2921  C  C   . SER A 1  382 ? 13.153  159.161 -4.267  1.00 18.09  ? 382 SER A C   1 
ATOM   2922  O  O   . SER A 1  382 ? 14.195  158.795 -4.798  1.00 19.47  ? 382 SER A O   1 
ATOM   2923  C  CB  . SER A 1  382 ? 11.490  157.463 -5.010  1.00 4.55   ? 382 SER A CB  1 
ATOM   2924  O  OG  . SER A 1  382 ? 11.843  156.161 -5.427  1.00 3.29   ? 382 SER A OG  1 
ATOM   2925  N  N   . LEU A 1  383 ? 12.769  160.422 -4.134  1.00 20.80  ? 383 LEU A N   1 
ATOM   2926  C  CA  . LEU A 1  383 ? 13.545  161.565 -4.503  1.00 21.45  ? 383 LEU A CA  1 
ATOM   2927  C  C   . LEU A 1  383 ? 14.493  162.057 -3.433  1.00 23.55  ? 383 LEU A C   1 
ATOM   2928  O  O   . LEU A 1  383 ? 15.527  162.666 -3.754  1.00 28.16  ? 383 LEU A O   1 
ATOM   2929  C  CB  . LEU A 1  383 ? 12.878  162.711 -5.204  1.00 24.68  ? 383 LEU A CB  1 
ATOM   2930  C  CG  . LEU A 1  383 ? 11.750  162.485 -6.183  1.00 34.11  ? 383 LEU A CG  1 
ATOM   2931  C  CD1 . LEU A 1  383 ? 11.583  163.666 -7.125  1.00 36.86  ? 383 LEU A CD1 1 
ATOM   2932  C  CD2 . LEU A 1  383 ? 11.904  161.204 -6.976  1.00 36.60  ? 383 LEU A CD2 1 
ATOM   2933  N  N   . LEU A 1  384 ? 14.286  161.644 -2.188  1.00 21.04  ? 384 LEU A N   1 
ATOM   2934  C  CA  . LEU A 1  384 ? 15.410  161.985 -1.286  1.00 22.52  ? 384 LEU A CA  1 
ATOM   2935  C  C   . LEU A 1  384 ? 16.338  160.786 -1.247  1.00 21.44  ? 384 LEU A C   1 
ATOM   2936  O  O   . LEU A 1  384 ? 17.553  160.936 -1.289  1.00 15.21  ? 384 LEU A O   1 
ATOM   2937  C  CB  . LEU A 1  384 ? 14.882  162.500 0.026   1.00 23.70  ? 384 LEU A CB  1 
ATOM   2938  C  CG  . LEU A 1  384 ? 13.453  163.059 -0.026  1.00 19.51  ? 384 LEU A CG  1 
ATOM   2939  C  CD1 . LEU A 1  384 ? 12.454  161.976 0.380   1.00 19.30  ? 384 LEU A CD1 1 
ATOM   2940  C  CD2 . LEU A 1  384 ? 13.282  164.270 0.873   1.00 15.37  ? 384 LEU A CD2 1 
ATOM   2941  N  N   . THR A 1  385 ? 15.729  159.606 -1.341  1.00 23.91  ? 385 THR A N   1 
ATOM   2942  C  CA  . THR A 1  385 ? 16.530  158.388 -1.336  1.00 29.47  ? 385 THR A CA  1 
ATOM   2943  C  C   . THR A 1  385 ? 17.421  158.353 -2.567  1.00 27.02  ? 385 THR A C   1 
ATOM   2944  O  O   . THR A 1  385 ? 18.504  158.899 -2.653  1.00 29.49  ? 385 THR A O   1 
ATOM   2945  C  CB  . THR A 1  385 ? 15.596  157.155 -1.386  1.00 31.92  ? 385 THR A CB  1 
ATOM   2946  O  OG1 . THR A 1  385 ? 14.864  157.110 -0.165  1.00 35.15  ? 385 THR A OG1 1 
ATOM   2947  C  CG2 . THR A 1  385 ? 16.427  155.911 -1.600  1.00 38.65  ? 385 THR A CG2 1 
ATOM   2948  N  N   . TYR A 1  386 ? 16.863  157.791 -3.619  1.00 31.62  ? 386 TYR A N   1 
ATOM   2949  C  CA  . TYR A 1  386 ? 17.544  157.511 -4.858  1.00 33.12  ? 386 TYR A CA  1 
ATOM   2950  C  C   . TYR A 1  386 ? 17.583  158.769 -5.717  1.00 36.29  ? 386 TYR A C   1 
ATOM   2951  O  O   . TYR A 1  386 ? 17.757  158.679 -6.930  1.00 37.06  ? 386 TYR A O   1 
ATOM   2952  C  CB  . TYR A 1  386 ? 16.915  156.373 -5.631  1.00 32.99  ? 386 TYR A CB  1 
ATOM   2953  C  CG  . TYR A 1  386 ? 15.899  155.468 -4.996  1.00 35.01  ? 386 TYR A CG  1 
ATOM   2954  C  CD1 . TYR A 1  386 ? 14.983  155.825 -4.022  1.00 38.20  ? 386 TYR A CD1 1 
ATOM   2955  C  CD2 . TYR A 1  386 ? 15.770  154.168 -5.483  1.00 32.37  ? 386 TYR A CD2 1 
ATOM   2956  C  CE1 . TYR A 1  386 ? 14.073  154.951 -3.471  1.00 38.05  ? 386 TYR A CE1 1 
ATOM   2957  C  CE2 . TYR A 1  386 ? 14.839  153.275 -4.994  1.00 30.08  ? 386 TYR A CE2 1 
ATOM   2958  C  CZ  . TYR A 1  386 ? 13.990  153.666 -3.982  1.00 36.26  ? 386 TYR A CZ  1 
ATOM   2959  O  OH  . TYR A 1  386 ? 13.037  152.806 -3.467  1.00 32.60  ? 386 TYR A OH  1 
ATOM   2960  N  N   . GLY A 1  387 ? 17.422  159.933 -5.093  1.00 40.06  ? 387 GLY A N   1 
ATOM   2961  C  CA  . GLY A 1  387 ? 17.341  161.144 -5.917  1.00 43.72  ? 387 GLY A CA  1 
ATOM   2962  C  C   . GLY A 1  387 ? 16.033  161.136 -6.698  1.00 46.81  ? 387 GLY A C   1 
ATOM   2963  O  O   . GLY A 1  387 ? 15.007  160.516 -6.383  1.00 55.94  ? 387 GLY A O   1 
ATOM   2964  N  N   . ARG A 1  388 ? 16.008  161.881 -7.790  1.00 42.23  ? 388 ARG A N   1 
ATOM   2965  C  CA  . ARG A 1  388 ? 14.735  162.091 -8.476  1.00 42.79  ? 388 ARG A CA  1 
ATOM   2966  C  C   . ARG A 1  388 ? 14.239  160.881 -9.233  1.00 37.50  ? 388 ARG A C   1 
ATOM   2967  O  O   . ARG A 1  388 ? 13.079  160.798 -9.681  1.00 37.79  ? 388 ARG A O   1 
ATOM   2968  C  CB  . ARG A 1  388 ? 14.863  163.321 -9.390  1.00 53.64  ? 388 ARG A CB  1 
ATOM   2969  C  CG  . ARG A 1  388 ? 14.962  163.026 -10.872 1.00 61.31  ? 388 ARG A CG  1 
ATOM   2970  C  CD  . ARG A 1  388 ? 15.749  164.112 -11.600 1.00 64.70  ? 388 ARG A CD  1 
ATOM   2971  N  NE  . ARG A 1  388 ? 15.125  164.371 -12.897 1.00 66.19  ? 388 ARG A NE  1 
ATOM   2972  C  CZ  . ARG A 1  388 ? 15.537  165.311 -13.741 1.00 62.61  ? 388 ARG A CZ  1 
ATOM   2973  N  NH1 . ARG A 1  388 ? 16.559  166.075 -13.386 1.00 58.20  ? 388 ARG A NH1 1 
ATOM   2974  N  NH2 . ARG A 1  388 ? 14.931  165.474 -14.909 1.00 62.71  ? 388 ARG A NH2 1 
ATOM   2975  N  N   . ARG A 1  389 ? 15.087  159.872 -9.414  1.00 30.27  ? 389 ARG A N   1 
ATOM   2976  C  CA  . ARG A 1  389 ? 14.632  158.783 -10.284 1.00 37.08  ? 389 ARG A CA  1 
ATOM   2977  C  C   . ARG A 1  389 ? 13.331  158.152 -9.799  1.00 35.80  ? 389 ARG A C   1 
ATOM   2978  O  O   . ARG A 1  389 ? 13.069  158.127 -8.595  1.00 37.04  ? 389 ARG A O   1 
ATOM   2979  C  CB  . ARG A 1  389 ? 15.765  157.899 -10.764 1.00 34.34  ? 389 ARG A CB  1 
ATOM   2980  C  CG  . ARG A 1  389 ? 17.153  158.400 -11.044 1.00 43.21  ? 389 ARG A CG  1 
ATOM   2981  C  CD  . ARG A 1  389 ? 17.992  157.597 -12.017 1.00 50.75  ? 389 ARG A CD  1 
ATOM   2982  N  NE  . ARG A 1  389 ? 19.031  158.294 -12.794 1.00 64.66  ? 389 ARG A NE  1 
ATOM   2983  C  CZ  . ARG A 1  389 ? 20.075  157.766 -13.417 1.00 67.18  ? 389 ARG A CZ  1 
ATOM   2984  N  NH1 . ARG A 1  389 ? 20.314  156.462 -13.403 1.00 72.01  ? 389 ARG A NH1 1 
ATOM   2985  N  NH2 . ARG A 1  389 ? 20.951  158.502 -14.096 1.00 73.04  ? 389 ARG A NH2 1 
ATOM   2986  N  N   . ILE A 1  390 ? 12.578  157.552 -10.720 1.00 33.04  ? 390 ILE A N   1 
ATOM   2987  C  CA  . ILE A 1  390 ? 11.509  156.617 -10.614 1.00 34.70  ? 390 ILE A CA  1 
ATOM   2988  C  C   . ILE A 1  390 ? 11.767  155.310 -11.365 1.00 35.64  ? 390 ILE A C   1 
ATOM   2989  O  O   . ILE A 1  390 ? 11.123  154.771 -12.272 1.00 35.35  ? 390 ILE A O   1 
ATOM   2990  C  CB  . ILE A 1  390 ? 10.072  157.054 -10.927 1.00 42.34  ? 390 ILE A CB  1 
ATOM   2991  C  CG1 . ILE A 1  390 ? 9.753   158.272 -10.050 1.00 42.92  ? 390 ILE A CG1 1 
ATOM   2992  C  CG2 . ILE A 1  390 ? 9.067   155.958 -10.539 1.00 45.30  ? 390 ILE A CG2 1 
ATOM   2993  C  CD1 . ILE A 1  390 ? 9.797   157.930 -8.580  1.00 38.71  ? 390 ILE A CD1 1 
ATOM   2994  N  N   . PRO A 1  391 ? 12.739  154.593 -10.823 1.00 35.25  ? 391 PRO A N   1 
ATOM   2995  C  CA  . PRO A 1  391 ? 13.226  153.313 -11.242 1.00 37.55  ? 391 PRO A CA  1 
ATOM   2996  C  C   . PRO A 1  391 ? 12.215  152.204 -11.482 1.00 42.75  ? 391 PRO A C   1 
ATOM   2997  O  O   . PRO A 1  391 ? 12.661  151.073 -11.799 1.00 47.03  ? 391 PRO A O   1 
ATOM   2998  C  CB  . PRO A 1  391 ? 14.266  152.905 -10.166 1.00 32.64  ? 391 PRO A CB  1 
ATOM   2999  C  CG  . PRO A 1  391 ? 14.567  154.170 -9.428  1.00 30.21  ? 391 PRO A CG  1 
ATOM   3000  C  CD  . PRO A 1  391 ? 13.537  155.183 -9.745  1.00 31.72  ? 391 PRO A CD  1 
ATOM   3001  N  N   . LEU A 1  392 ? 10.895  152.382 -11.366 1.00 40.94  ? 392 LEU A N   1 
ATOM   3002  C  CA  . LEU A 1  392 ? 9.849   151.395 -11.381 1.00 41.50  ? 392 LEU A CA  1 
ATOM   3003  C  C   . LEU A 1  392 ? 9.837   150.396 -12.526 1.00 39.38  ? 392 LEU A C   1 
ATOM   3004  O  O   . LEU A 1  392 ? 9.509   149.210 -12.482 1.00 39.34  ? 392 LEU A O   1 
ATOM   3005  C  CB  . LEU A 1  392 ? 8.426   151.878 -11.178 1.00 42.59  ? 392 LEU A CB  1 
ATOM   3006  C  CG  . LEU A 1  392 ? 7.285   150.854 -11.366 1.00 42.61  ? 392 LEU A CG  1 
ATOM   3007  C  CD1 . LEU A 1  392 ? 7.312   149.687 -10.413 1.00 46.10  ? 392 LEU A CD1 1 
ATOM   3008  C  CD2 . LEU A 1  392 ? 5.959   151.614 -11.269 1.00 46.93  ? 392 LEU A CD2 1 
ATOM   3009  N  N   . ALA A 1  393 ? 10.049  151.030 -13.667 1.00 38.41  ? 393 ALA A N   1 
ATOM   3010  C  CA  . ALA A 1  393 ? 10.025  150.208 -14.877 1.00 42.59  ? 393 ALA A CA  1 
ATOM   3011  C  C   . ALA A 1  393 ? 11.381  149.548 -15.089 1.00 42.31  ? 393 ALA A C   1 
ATOM   3012  O  O   . ALA A 1  393 ? 11.405  148.418 -15.588 1.00 41.89  ? 393 ALA A O   1 
ATOM   3013  C  CB  . ALA A 1  393 ? 9.532   150.962 -16.083 1.00 51.95  ? 393 ALA A CB  1 
ATOM   3014  N  N   . GLU A 1  394 ? 12.462  150.208 -14.710 1.00 41.94  ? 394 GLU A N   1 
ATOM   3015  C  CA  . GLU A 1  394 ? 13.840  149.704 -14.745 1.00 33.77  ? 394 GLU A CA  1 
ATOM   3016  C  C   . GLU A 1  394 ? 13.915  148.436 -13.879 1.00 30.83  ? 394 GLU A C   1 
ATOM   3017  O  O   . GLU A 1  394 ? 14.456  147.404 -14.225 1.00 29.79  ? 394 GLU A O   1 
ATOM   3018  C  CB  . GLU A 1  394 ? 14.704  150.746 -14.021 1.00 33.98  ? 394 GLU A CB  1 
ATOM   3019  C  CG  . GLU A 1  394 ? 15.833  151.357 -14.814 1.00 36.97  ? 394 GLU A CG  1 
ATOM   3020  C  CD  . GLU A 1  394 ? 16.569  152.343 -13.912 1.00 39.51  ? 394 GLU A CD  1 
ATOM   3021  O  OE1 . GLU A 1  394 ? 15.888  153.129 -13.227 1.00 38.42  ? 394 GLU A OE1 1 
ATOM   3022  O  OE2 . GLU A 1  394 ? 17.810  152.336 -13.862 1.00 45.37  ? 394 GLU A OE2 1 
ATOM   3023  N  N   . TRP A 1  395 ? 13.342  148.562 -12.670 1.00 27.50  ? 395 TRP A N   1 
ATOM   3024  C  CA  . TRP A 1  395 ? 13.287  147.457 -11.738 1.00 16.62  ? 395 TRP A CA  1 
ATOM   3025  C  C   . TRP A 1  395 ? 13.198  146.135 -12.488 1.00 12.30  ? 395 TRP A C   1 
ATOM   3026  O  O   . TRP A 1  395 ? 14.124  145.343 -12.557 1.00 11.81  ? 395 TRP A O   1 
ATOM   3027  C  CB  . TRP A 1  395 ? 12.082  147.486 -10.803 1.00 8.96   ? 395 TRP A CB  1 
ATOM   3028  C  CG  . TRP A 1  395 ? 11.979  148.676 -9.940  1.00 2.20   ? 395 TRP A CG  1 
ATOM   3029  C  CD1 . TRP A 1  395 ? 10.953  149.534 -9.817  1.00 5.04   ? 395 TRP A CD1 1 
ATOM   3030  C  CD2 . TRP A 1  395 ? 12.977  149.200 -9.047  1.00 3.14   ? 395 TRP A CD2 1 
ATOM   3031  N  NE1 . TRP A 1  395 ? 11.204  150.569 -8.948  1.00 5.41   ? 395 TRP A NE1 1 
ATOM   3032  C  CE2 . TRP A 1  395 ? 12.415  150.386 -8.449  1.00 2.20   ? 395 TRP A CE2 1 
ATOM   3033  C  CE3 . TRP A 1  395 ? 14.245  148.730 -8.691  1.00 4.68   ? 395 TRP A CE3 1 
ATOM   3034  C  CZ2 . TRP A 1  395 ? 13.221  151.060 -7.543  1.00 2.41   ? 395 TRP A CZ2 1 
ATOM   3035  C  CZ3 . TRP A 1  395 ? 15.007  149.409 -7.771  1.00 3.15   ? 395 TRP A CZ3 1 
ATOM   3036  C  CH2 . TRP A 1  395 ? 14.448  150.579 -7.200  1.00 2.38   ? 395 TRP A CH2 1 
ATOM   3037  N  N   . GLU A 1  396 ? 12.020  145.864 -13.051 1.00 10.62  ? 396 GLU A N   1 
ATOM   3038  C  CA  . GLU A 1  396 ? 11.881  144.590 -13.735 1.00 11.30  ? 396 GLU A CA  1 
ATOM   3039  C  C   . GLU A 1  396 ? 13.091  144.268 -14.579 1.00 8.20   ? 396 GLU A C   1 
ATOM   3040  O  O   . GLU A 1  396 ? 13.557  143.135 -14.568 1.00 7.44   ? 396 GLU A O   1 
ATOM   3041  C  CB  . GLU A 1  396 ? 10.559  144.398 -14.433 1.00 10.35  ? 396 GLU A CB  1 
ATOM   3042  C  CG  . GLU A 1  396 ? 10.101  142.941 -14.406 1.00 19.49  ? 396 GLU A CG  1 
ATOM   3043  C  CD  . GLU A 1  396 ? 10.943  142.126 -15.376 1.00 30.36  ? 396 GLU A CD  1 
ATOM   3044  O  OE1 . GLU A 1  396 ? 11.515  142.771 -16.282 1.00 41.01  ? 396 GLU A OE1 1 
ATOM   3045  O  OE2 . GLU A 1  396 ? 11.067  140.889 -15.292 1.00 29.70  ? 396 GLU A OE2 1 
ATOM   3046  N  N   . SER A 1  397 ? 13.714  145.235 -15.221 1.00 11.69  ? 397 SER A N   1 
ATOM   3047  C  CA  . SER A 1  397 ? 14.954  145.026 -15.975 1.00 15.09  ? 397 SER A CA  1 
ATOM   3048  C  C   . SER A 1  397 ? 16.100  144.596 -15.061 1.00 15.59  ? 397 SER A C   1 
ATOM   3049  O  O   . SER A 1  397 ? 16.737  143.550 -15.225 1.00 15.74  ? 397 SER A O   1 
ATOM   3050  C  CB  . SER A 1  397 ? 15.333  146.313 -16.708 1.00 17.43  ? 397 SER A CB  1 
ATOM   3051  O  OG  . SER A 1  397 ? 16.350  146.133 -17.662 1.00 20.28  ? 397 SER A OG  1 
ATOM   3052  N  N   . ARG A 1  398 ? 16.380  145.413 -14.047 1.00 16.22  ? 398 ARG A N   1 
ATOM   3053  C  CA  . ARG A 1  398 ? 17.382  145.145 -13.021 1.00 13.64  ? 398 ARG A CA  1 
ATOM   3054  C  C   . ARG A 1  398 ? 17.093  143.786 -12.354 1.00 18.16  ? 398 ARG A C   1 
ATOM   3055  O  O   . ARG A 1  398 ? 17.974  142.932 -12.350 1.00 18.70  ? 398 ARG A O   1 
ATOM   3056  C  CB  . ARG A 1  398 ? 17.372  146.191 -11.918 1.00 18.42  ? 398 ARG A CB  1 
ATOM   3057  C  CG  . ARG A 1  398 ? 17.504  147.645 -12.210 1.00 14.10  ? 398 ARG A CG  1 
ATOM   3058  C  CD  . ARG A 1  398 ? 18.300  148.390 -11.081 1.00 10.13  ? 398 ARG A CD  1 
ATOM   3059  N  NE  . ARG A 1  398 ? 18.631  149.709 -11.542 1.00 25.79  ? 398 ARG A NE  1 
ATOM   3060  C  CZ  . ARG A 1  398 ? 19.046  150.715 -10.786 1.00 32.56  ? 398 ARG A CZ  1 
ATOM   3061  N  NH1 . ARG A 1  398 ? 19.140  150.578 -9.467  1.00 30.47  ? 398 ARG A NH1 1 
ATOM   3062  N  NH2 . ARG A 1  398 ? 19.405  151.872 -11.334 1.00 36.95  ? 398 ARG A NH2 1 
ATOM   3063  N  N   . ILE A 1  399 ? 15.869  143.607 -11.830 1.00 15.71  ? 399 ILE A N   1 
ATOM   3064  C  CA  . ILE A 1  399 ? 15.428  142.349 -11.252 1.00 10.03  ? 399 ILE A CA  1 
ATOM   3065  C  C   . ILE A 1  399 ? 15.743  141.209 -12.217 1.00 12.07  ? 399 ILE A C   1 
ATOM   3066  O  O   . ILE A 1  399 ? 16.248  140.146 -11.887 1.00 13.38  ? 399 ILE A O   1 
ATOM   3067  C  CB  . ILE A 1  399 ? 13.920  142.381 -10.949 1.00 7.51   ? 399 ILE A CB  1 
ATOM   3068  C  CG1 . ILE A 1  399 ? 13.583  143.415 -9.883  1.00 2.83   ? 399 ILE A CG1 1 
ATOM   3069  C  CG2 . ILE A 1  399 ? 13.412  140.987 -10.582 1.00 2.81   ? 399 ILE A CG2 1 
ATOM   3070  C  CD1 . ILE A 1  399 ? 12.285  143.080 -9.171  1.00 4.20   ? 399 ILE A CD1 1 
ATOM   3071  N  N   . ALA A 1  400 ? 15.516  141.456 -13.504 1.00 10.93  ? 400 ALA A N   1 
ATOM   3072  C  CA  . ALA A 1  400 ? 15.679  140.446 -14.525 1.00 17.00  ? 400 ALA A CA  1 
ATOM   3073  C  C   . ALA A 1  400 ? 17.128  140.068 -14.787 1.00 19.70  ? 400 ALA A C   1 
ATOM   3074  O  O   . ALA A 1  400 ? 17.484  139.051 -15.394 1.00 20.05  ? 400 ALA A O   1 
ATOM   3075  C  CB  . ALA A 1  400 ? 15.105  140.938 -15.849 1.00 23.79  ? 400 ALA A CB  1 
ATOM   3076  N  N   . GLU A 1  401 ? 18.034  140.960 -14.380 1.00 16.43  ? 401 GLU A N   1 
ATOM   3077  C  CA  . GLU A 1  401 ? 19.436  140.652 -14.615 1.00 17.85  ? 401 GLU A CA  1 
ATOM   3078  C  C   . GLU A 1  401 ? 19.966  139.574 -13.687 1.00 19.63  ? 401 GLU A C   1 
ATOM   3079  O  O   . GLU A 1  401 ? 21.135  139.166 -13.788 1.00 11.41  ? 401 GLU A O   1 
ATOM   3080  C  CB  . GLU A 1  401 ? 20.302  141.899 -14.442 1.00 22.49  ? 401 GLU A CB  1 
ATOM   3081  C  CG  . GLU A 1  401 ? 20.176  142.939 -15.510 1.00 38.69  ? 401 GLU A CG  1 
ATOM   3082  C  CD  . GLU A 1  401 ? 20.460  142.508 -16.925 1.00 47.56  ? 401 GLU A CD  1 
ATOM   3083  O  OE1 . GLU A 1  401 ? 21.066  141.446 -17.179 1.00 45.90  ? 401 GLU A OE1 1 
ATOM   3084  O  OE2 . GLU A 1  401 ? 20.055  143.292 -17.825 1.00 57.08  ? 401 GLU A OE2 1 
ATOM   3085  N  N   . VAL A 1  402 ? 19.157  139.099 -12.742 1.00 24.80  ? 402 VAL A N   1 
ATOM   3086  C  CA  . VAL A 1  402 ? 19.637  138.154 -11.768 1.00 30.00  ? 402 VAL A CA  1 
ATOM   3087  C  C   . VAL A 1  402 ? 19.744  136.683 -12.085 1.00 35.09  ? 402 VAL A C   1 
ATOM   3088  O  O   . VAL A 1  402 ? 18.847  135.875 -11.825 1.00 36.42  ? 402 VAL A O   1 
ATOM   3089  C  CB  . VAL A 1  402 ? 18.959  138.324 -10.398 1.00 23.81  ? 402 VAL A CB  1 
ATOM   3090  C  CG1 . VAL A 1  402 ? 19.892  137.807 -9.316  1.00 24.27  ? 402 VAL A CG1 1 
ATOM   3091  C  CG2 . VAL A 1  402 ? 18.702  139.802 -10.157 1.00 25.84  ? 402 VAL A CG2 1 
ATOM   3092  N  N   . ASP A 1  403 ? 20.937  136.292 -12.526 1.00 35.76  ? 403 ASP A N   1 
ATOM   3093  C  CA  . ASP A 1  403 ? 21.252  134.859 -12.716 1.00 34.14  ? 403 ASP A CA  1 
ATOM   3094  C  C   . ASP A 1  403 ? 21.595  134.428 -11.298 1.00 34.17  ? 403 ASP A C   1 
ATOM   3095  O  O   . ASP A 1  403 ? 21.950  135.346 -10.530 1.00 38.03  ? 403 ASP A O   1 
ATOM   3096  C  CB  . ASP A 1  403 ? 22.442  134.822 -13.653 1.00 45.32  ? 403 ASP A CB  1 
ATOM   3097  C  CG  . ASP A 1  403 ? 23.253  133.574 -13.751 1.00 54.25  ? 403 ASP A CG  1 
ATOM   3098  O  OD1 . ASP A 1  403 ? 23.095  132.667 -12.916 1.00 61.73  ? 403 ASP A OD1 1 
ATOM   3099  O  OD2 . ASP A 1  403 ? 24.094  133.471 -14.678 1.00 59.59  ? 403 ASP A OD2 1 
ATOM   3100  N  N   . ALA A 1  404 ? 21.356  133.200 -10.869 1.00 29.59  ? 404 ALA A N   1 
ATOM   3101  C  CA  . ALA A 1  404 ? 21.682  132.800 -9.501  1.00 20.71  ? 404 ALA A CA  1 
ATOM   3102  C  C   . ALA A 1  404 ? 23.097  133.084 -9.039  1.00 17.50  ? 404 ALA A C   1 
ATOM   3103  O  O   . ALA A 1  404 ? 23.316  133.296 -7.848  1.00 16.92  ? 404 ALA A O   1 
ATOM   3104  C  CB  . ALA A 1  404 ? 21.447  131.317 -9.292  1.00 17.56  ? 404 ALA A CB  1 
ATOM   3105  N  N   . ARG A 1  405 ? 24.099  133.043 -9.902  1.00 17.55  ? 405 ARG A N   1 
ATOM   3106  C  CA  . ARG A 1  405 ? 25.441  133.471 -9.528  1.00 19.72  ? 405 ARG A CA  1 
ATOM   3107  C  C   . ARG A 1  405 ? 25.438  134.905 -9.028  1.00 18.81  ? 405 ARG A C   1 
ATOM   3108  O  O   . ARG A 1  405 ? 26.058  135.206 -8.015  1.00 17.01  ? 405 ARG A O   1 
ATOM   3109  C  CB  . ARG A 1  405 ? 26.440  133.260 -10.665 1.00 28.06  ? 405 ARG A CB  1 
ATOM   3110  C  CG  . ARG A 1  405 ? 27.097  131.883 -10.604 1.00 43.70  ? 405 ARG A CG  1 
ATOM   3111  C  CD  . ARG A 1  405 ? 28.155  131.709 -11.686 1.00 53.37  ? 405 ARG A CD  1 
ATOM   3112  N  NE  . ARG A 1  405 ? 27.811  130.571 -12.543 1.00 61.76  ? 405 ARG A NE  1 
ATOM   3113  C  CZ  . ARG A 1  405 ? 28.261  130.395 -13.778 1.00 63.55  ? 405 ARG A CZ  1 
ATOM   3114  N  NH1 . ARG A 1  405 ? 29.092  131.284 -14.305 1.00 62.01  ? 405 ARG A NH1 1 
ATOM   3115  N  NH2 . ARG A 1  405 ? 27.875  129.329 -14.467 1.00 67.30  ? 405 ARG A NH2 1 
ATOM   3116  N  N   . VAL A 1  406 ? 24.665  135.777 -9.675  1.00 19.99  ? 406 VAL A N   1 
ATOM   3117  C  CA  . VAL A 1  406 ? 24.596  137.171 -9.247  1.00 18.97  ? 406 VAL A CA  1 
ATOM   3118  C  C   . VAL A 1  406 ? 24.136  137.252 -7.806  1.00 20.13  ? 406 VAL A C   1 
ATOM   3119  O  O   . VAL A 1  406 ? 24.791  137.782 -6.925  1.00 16.37  ? 406 VAL A O   1 
ATOM   3120  C  CB  . VAL A 1  406 ? 23.596  137.945 -10.119 1.00 14.33  ? 406 VAL A CB  1 
ATOM   3121  C  CG1 . VAL A 1  406 ? 23.530  139.387 -9.673  1.00 8.27   ? 406 VAL A CG1 1 
ATOM   3122  C  CG2 . VAL A 1  406 ? 24.074  137.768 -11.550 1.00 22.88  ? 406 VAL A CG2 1 
ATOM   3123  N  N   . VAL A 1  407 ? 23.051  136.511 -7.561  1.00 22.80  ? 407 VAL A N   1 
ATOM   3124  C  CA  . VAL A 1  407 ? 22.499  136.525 -6.213  1.00 27.54  ? 407 VAL A CA  1 
ATOM   3125  C  C   . VAL A 1  407 ? 23.467  135.952 -5.190  1.00 24.53  ? 407 VAL A C   1 
ATOM   3126  O  O   . VAL A 1  407 ? 23.498  136.363 -4.032  1.00 27.08  ? 407 VAL A O   1 
ATOM   3127  C  CB  . VAL A 1  407 ? 21.197  135.698 -6.119  1.00 32.77  ? 407 VAL A CB  1 
ATOM   3128  C  CG1 . VAL A 1  407 ? 21.372  134.653 -5.025  1.00 28.33  ? 407 VAL A CG1 1 
ATOM   3129  C  CG2 . VAL A 1  407 ? 20.020  136.599 -5.773  1.00 35.21  ? 407 VAL A CG2 1 
ATOM   3130  N  N   . ARG A 1  408 ? 24.284  134.995 -5.592  1.00 23.64  ? 408 ARG A N   1 
ATOM   3131  C  CA  . ARG A 1  408 ? 25.212  134.366 -4.658  1.00 21.13  ? 408 ARG A CA  1 
ATOM   3132  C  C   . ARG A 1  408 ? 26.453  135.156 -4.330  1.00 21.06  ? 408 ARG A C   1 
ATOM   3133  O  O   . ARG A 1  408 ? 26.612  135.512 -3.143  1.00 25.55  ? 408 ARG A O   1 
ATOM   3134  C  CB  . ARG A 1  408 ? 25.465  132.962 -5.154  1.00 10.34  ? 408 ARG A CB  1 
ATOM   3135  C  CG  . ARG A 1  408 ? 26.885  132.485 -5.032  1.00 2.20   ? 408 ARG A CG  1 
ATOM   3136  C  CD  . ARG A 1  408 ? 26.873  131.016 -5.519  1.00 11.02  ? 408 ARG A CD  1 
ATOM   3137  N  NE  . ARG A 1  408 ? 26.155  130.833 -6.766  1.00 14.34  ? 408 ARG A NE  1 
ATOM   3138  C  CZ  . ARG A 1  408 ? 25.658  129.688 -7.223  1.00 25.97  ? 408 ARG A CZ  1 
ATOM   3139  N  NH1 . ARG A 1  408 ? 25.778  128.563 -6.518  1.00 27.44  ? 408 ARG A NH1 1 
ATOM   3140  N  NH2 . ARG A 1  408 ? 25.008  129.646 -8.385  1.00 25.98  ? 408 ARG A NH2 1 
ATOM   3141  N  N   . GLU A 1  409 ? 27.196  135.715 -5.267  1.00 19.95  ? 409 GLU A N   1 
ATOM   3142  C  CA  . GLU A 1  409 ? 28.272  136.668 -5.046  1.00 14.91  ? 409 GLU A CA  1 
ATOM   3143  C  C   . GLU A 1  409 ? 27.834  137.955 -4.350  1.00 15.24  ? 409 GLU A C   1 
ATOM   3144  O  O   . GLU A 1  409 ? 28.534  138.575 -3.511  1.00 5.59   ? 409 GLU A O   1 
ATOM   3145  C  CB  . GLU A 1  409 ? 29.002  137.005 -6.340  1.00 26.76  ? 409 GLU A CB  1 
ATOM   3146  C  CG  . GLU A 1  409 ? 29.034  135.996 -7.468  1.00 38.65  ? 409 GLU A CG  1 
ATOM   3147  C  CD  . GLU A 1  409 ? 29.513  136.606 -8.780  1.00 43.29  ? 409 GLU A CD  1 
ATOM   3148  O  OE1 . GLU A 1  409 ? 29.519  137.863 -8.847  1.00 45.13  ? 409 GLU A OE1 1 
ATOM   3149  O  OE2 . GLU A 1  409 ? 29.887  135.867 -9.713  1.00 44.93  ? 409 GLU A OE2 1 
ATOM   3150  N  N   . VAL A 1  410 ? 26.620  138.436 -4.684  1.00 14.35  ? 410 VAL A N   1 
ATOM   3151  C  CA  . VAL A 1  410 ? 26.161  139.638 -3.995  1.00 16.75  ? 410 VAL A CA  1 
ATOM   3152  C  C   . VAL A 1  410 ? 26.008  139.313 -2.506  1.00 20.33  ? 410 VAL A C   1 
ATOM   3153  O  O   . VAL A 1  410 ? 26.669  139.968 -1.695  1.00 21.75  ? 410 VAL A O   1 
ATOM   3154  C  CB  . VAL A 1  410 ? 24.865  140.257 -4.506  1.00 10.00  ? 410 VAL A CB  1 
ATOM   3155  C  CG1 . VAL A 1  410 ? 24.636  141.537 -3.690  1.00 2.28   ? 410 VAL A CG1 1 
ATOM   3156  C  CG2 . VAL A 1  410 ? 24.949  140.594 -5.983  1.00 14.83  ? 410 VAL A CG2 1 
ATOM   3157  N  N   . CYS A 1  411 ? 25.414  138.161 -2.238  1.00 19.56  ? 411 CYS A N   1 
ATOM   3158  C  CA  . CYS A 1  411 ? 25.115  137.684 -0.907  1.00 22.71  ? 411 CYS A CA  1 
ATOM   3159  C  C   . CYS A 1  411 ? 26.291  137.532 0.050   1.00 22.27  ? 411 CYS A C   1 
ATOM   3160  O  O   . CYS A 1  411 ? 26.189  137.835 1.246   1.00 26.89  ? 411 CYS A O   1 
ATOM   3161  C  CB  . CYS A 1  411 ? 24.422  136.314 -1.064  1.00 17.78  ? 411 CYS A CB  1 
ATOM   3162  S  SG  . CYS A 1  411 ? 22.629  136.356 -0.947  1.00 8.61   ? 411 CYS A SG  1 
ATOM   3163  N  N   . SER A 1  412 ? 27.402  137.043 -0.482  1.00 15.74  ? 412 SER A N   1 
ATOM   3164  C  CA  . SER A 1  412 ? 28.611  136.790 0.283   1.00 11.17  ? 412 SER A CA  1 
ATOM   3165  C  C   . SER A 1  412 ? 29.365  138.016 0.727   1.00 5.49   ? 412 SER A C   1 
ATOM   3166  O  O   . SER A 1  412 ? 30.340  137.891 1.457   1.00 5.49   ? 412 SER A O   1 
ATOM   3167  C  CB  . SER A 1  412 ? 29.572  135.957 -0.592  1.00 6.75   ? 412 SER A CB  1 
ATOM   3168  O  OG  . SER A 1  412 ? 28.810  135.074 -1.399  1.00 8.24   ? 412 SER A OG  1 
ATOM   3169  N  N   . LYS A 1  413 ? 29.094  139.152 0.094   1.00 2.58   ? 413 LYS A N   1 
ATOM   3170  C  CA  . LYS A 1  413 ? 29.901  140.317 0.477   1.00 9.26   ? 413 LYS A CA  1 
ATOM   3171  C  C   . LYS A 1  413 ? 29.533  140.794 1.890   1.00 6.79   ? 413 LYS A C   1 
ATOM   3172  O  O   . LYS A 1  413 ? 30.448  141.209 2.578   1.00 8.03   ? 413 LYS A O   1 
ATOM   3173  C  CB  . LYS A 1  413 ? 29.599  141.508 -0.423  1.00 15.93  ? 413 LYS A CB  1 
ATOM   3174  C  CG  . LYS A 1  413 ? 29.815  141.200 -1.893  1.00 21.93  ? 413 LYS A CG  1 
ATOM   3175  C  CD  . LYS A 1  413 ? 30.517  142.414 -2.511  1.00 26.46  ? 413 LYS A CD  1 
ATOM   3176  C  CE  . LYS A 1  413 ? 29.491  143.298 -3.204  1.00 26.48  ? 413 LYS A CE  1 
ATOM   3177  N  NZ  . LYS A 1  413 ? 30.183  144.456 -3.845  1.00 26.81  ? 413 LYS A NZ  1 
ATOM   3178  N  N   . TYR A 1  414 ? 28.220  140.814 2.060   1.00 2.32   ? 414 TYR A N   1 
ATOM   3179  C  CA  . TYR A 1  414 ? 27.574  141.305 3.241   1.00 9.80   ? 414 TYR A CA  1 
ATOM   3180  C  C   . TYR A 1  414 ? 27.492  140.269 4.338   1.00 3.03   ? 414 TYR A C   1 
ATOM   3181  O  O   . TYR A 1  414 ? 27.557  140.615 5.520   1.00 6.70   ? 414 TYR A O   1 
ATOM   3182  C  CB  . TYR A 1  414 ? 26.194  141.820 2.768   1.00 13.96  ? 414 TYR A CB  1 
ATOM   3183  C  CG  . TYR A 1  414 ? 26.352  142.787 1.601   1.00 13.15  ? 414 TYR A CG  1 
ATOM   3184  C  CD1 . TYR A 1  414 ? 26.614  144.121 1.881   1.00 10.95  ? 414 TYR A CD1 1 
ATOM   3185  C  CD2 . TYR A 1  414 ? 26.241  142.398 0.282   1.00 11.77  ? 414 TYR A CD2 1 
ATOM   3186  C  CE1 . TYR A 1  414 ? 26.745  145.048 0.875   1.00 12.29  ? 414 TYR A CE1 1 
ATOM   3187  C  CE2 . TYR A 1  414 ? 26.393  143.324 -0.729  1.00 17.03  ? 414 TYR A CE2 1 
ATOM   3188  C  CZ  . TYR A 1  414 ? 26.636  144.654 -0.439  1.00 17.65  ? 414 TYR A CZ  1 
ATOM   3189  O  OH  . TYR A 1  414 ? 26.785  145.591 -1.450  1.00 15.85  ? 414 TYR A OH  1 
ATOM   3190  N  N   . PHE A 1  415 ? 27.259  139.014 3.991   1.00 6.61   ? 415 PHE A N   1 
ATOM   3191  C  CA  . PHE A 1  415 ? 26.978  137.997 4.997   1.00 3.34   ? 415 PHE A CA  1 
ATOM   3192  C  C   . PHE A 1  415 ? 28.294  137.326 5.362   1.00 8.62   ? 415 PHE A C   1 
ATOM   3193  O  O   . PHE A 1  415 ? 28.793  137.472 6.474   1.00 11.38  ? 415 PHE A O   1 
ATOM   3194  C  CB  . PHE A 1  415 ? 25.956  136.980 4.543   1.00 5.23   ? 415 PHE A CB  1 
ATOM   3195  C  CG  . PHE A 1  415 ? 24.521  137.384 4.629   1.00 7.36   ? 415 PHE A CG  1 
ATOM   3196  C  CD1 . PHE A 1  415 ? 23.968  137.760 5.837   1.00 8.61   ? 415 PHE A CD1 1 
ATOM   3197  C  CD2 . PHE A 1  415 ? 23.708  137.368 3.516   1.00 2.94   ? 415 PHE A CD2 1 
ATOM   3198  C  CE1 . PHE A 1  415 ? 22.650  138.126 5.959   1.00 6.85   ? 415 PHE A CE1 1 
ATOM   3199  C  CE2 . PHE A 1  415 ? 22.389  137.747 3.631   1.00 2.22   ? 415 PHE A CE2 1 
ATOM   3200  C  CZ  . PHE A 1  415 ? 21.852  138.119 4.843   1.00 4.87   ? 415 PHE A CZ  1 
ATOM   3201  N  N   . TYR A 1  416 ? 28.858  136.615 4.389   1.00 5.55   ? 416 TYR A N   1 
ATOM   3202  C  CA  . TYR A 1  416 ? 30.084  135.895 4.641   1.00 6.59   ? 416 TYR A CA  1 
ATOM   3203  C  C   . TYR A 1  416 ? 31.183  136.620 5.382   1.00 7.50   ? 416 TYR A C   1 
ATOM   3204  O  O   . TYR A 1  416 ? 31.576  137.760 5.155   1.00 20.24  ? 416 TYR A O   1 
ATOM   3205  C  CB  . TYR A 1  416 ? 30.580  135.181 3.411   1.00 2.90   ? 416 TYR A CB  1 
ATOM   3206  C  CG  . TYR A 1  416 ? 31.266  133.866 3.692   1.00 3.35   ? 416 TYR A CG  1 
ATOM   3207  C  CD1 . TYR A 1  416 ? 32.527  133.836 4.271   1.00 9.64   ? 416 TYR A CD1 1 
ATOM   3208  C  CD2 . TYR A 1  416 ? 30.670  132.659 3.387   1.00 3.29   ? 416 TYR A CD2 1 
ATOM   3209  C  CE1 . TYR A 1  416 ? 33.150  132.636 4.524   1.00 11.76  ? 416 TYR A CE1 1 
ATOM   3210  C  CE2 . TYR A 1  416 ? 31.284  131.435 3.617   1.00 2.20   ? 416 TYR A CE2 1 
ATOM   3211  C  CZ  . TYR A 1  416 ? 32.522  131.444 4.214   1.00 11.17  ? 416 TYR A CZ  1 
ATOM   3212  O  OH  . TYR A 1  416 ? 33.215  130.286 4.496   1.00 13.25  ? 416 TYR A OH  1 
ATOM   3213  N  N   . ASP A 1  417 ? 31.551  135.970 6.473   1.00 6.98   ? 417 ASP A N   1 
ATOM   3214  C  CA  . ASP A 1  417 ? 32.421  136.437 7.486   1.00 10.65  ? 417 ASP A CA  1 
ATOM   3215  C  C   . ASP A 1  417 ? 32.323  137.891 7.909   1.00 9.75   ? 417 ASP A C   1 
ATOM   3216  O  O   . ASP A 1  417 ? 33.381  138.510 7.969   1.00 14.07  ? 417 ASP A O   1 
ATOM   3217  C  CB  . ASP A 1  417 ? 33.895  136.155 7.166   1.00 10.55  ? 417 ASP A CB  1 
ATOM   3218  C  CG  . ASP A 1  417 ? 34.550  135.870 8.520   1.00 8.98   ? 417 ASP A CG  1 
ATOM   3219  O  OD1 . ASP A 1  417 ? 34.054  136.369 9.532   1.00 17.74  ? 417 ASP A OD1 1 
ATOM   3220  O  OD2 . ASP A 1  417 ? 35.539  135.137 8.466   1.00 5.09   ? 417 ASP A OD2 1 
ATOM   3221  N  N   . GLN A 1  418 ? 31.096  138.292 8.177   1.00 6.36   ? 418 GLN A N   1 
ATOM   3222  C  CA  . GLN A 1  418 ? 30.838  139.651 8.615   1.00 12.30  ? 418 GLN A CA  1 
ATOM   3223  C  C   . GLN A 1  418 ? 30.375  139.587 10.054  1.00 11.77  ? 418 GLN A C   1 
ATOM   3224  O  O   . GLN A 1  418 ? 30.000  138.515 10.531  1.00 13.14  ? 418 GLN A O   1 
ATOM   3225  C  CB  . GLN A 1  418 ? 29.808  140.265 7.676   1.00 22.64  ? 418 GLN A CB  1 
ATOM   3226  C  CG  . GLN A 1  418 ? 30.322  140.387 6.259   1.00 21.13  ? 418 GLN A CG  1 
ATOM   3227  C  CD  . GLN A 1  418 ? 31.569  141.238 6.131   1.00 19.48  ? 418 GLN A CD  1 
ATOM   3228  O  OE1 . GLN A 1  418 ? 32.031  141.909 7.043   1.00 23.29  ? 418 GLN A OE1 1 
ATOM   3229  N  NE2 . GLN A 1  418 ? 32.117  141.164 4.929   1.00 18.90  ? 418 GLN A NE2 1 
ATOM   3230  N  N   . CYS A 1  419 ? 30.704  140.598 10.863  1.00 8.86   ? 419 CYS A N   1 
ATOM   3231  C  CA  . CYS A 1  419 ? 30.291  140.334 12.221  1.00 5.92   ? 419 CYS A CA  1 
ATOM   3232  C  C   . CYS A 1  419 ? 28.832  140.737 12.386  1.00 7.18   ? 419 CYS A C   1 
ATOM   3233  O  O   . CYS A 1  419 ? 28.608  141.942 12.460  1.00 8.11   ? 419 CYS A O   1 
ATOM   3234  C  CB  . CYS A 1  419 ? 31.191  140.984 13.247  1.00 13.17  ? 419 CYS A CB  1 
ATOM   3235  S  SG  . CYS A 1  419 ? 32.969  140.848 12.909  1.00 6.17   ? 419 CYS A SG  1 
ATOM   3236  N  N   . PRO A 1  420 ? 27.936  139.803 12.659  1.00 2.20   ? 420 PRO A N   1 
ATOM   3237  C  CA  . PRO A 1  420 ? 26.524  140.176 12.840  1.00 7.19   ? 420 PRO A CA  1 
ATOM   3238  C  C   . PRO A 1  420 ? 26.353  141.140 14.009  1.00 9.96   ? 420 PRO A C   1 
ATOM   3239  O  O   . PRO A 1  420 ? 27.227  141.160 14.876  1.00 13.17  ? 420 PRO A O   1 
ATOM   3240  C  CB  . PRO A 1  420 ? 25.818  138.836 13.160  1.00 8.80   ? 420 PRO A CB  1 
ATOM   3241  C  CG  . PRO A 1  420 ? 26.652  137.874 12.317  1.00 8.14   ? 420 PRO A CG  1 
ATOM   3242  C  CD  . PRO A 1  420 ? 28.071  138.363 12.516  1.00 8.29   ? 420 PRO A CD  1 
ATOM   3243  N  N   . ALA A 1  421 ? 25.301  141.951 14.045  1.00 11.03  ? 421 ALA A N   1 
ATOM   3244  C  CA  . ALA A 1  421 ? 24.854  142.862 15.067  1.00 3.33   ? 421 ALA A CA  1 
ATOM   3245  C  C   . ALA A 1  421 ? 23.587  142.259 15.692  1.00 2.25   ? 421 ALA A C   1 
ATOM   3246  O  O   . ALA A 1  421 ? 22.693  141.843 14.957  1.00 8.13   ? 421 ALA A O   1 
ATOM   3247  C  CB  . ALA A 1  421 ? 24.575  144.271 14.629  1.00 4.50   ? 421 ALA A CB  1 
ATOM   3248  N  N   . VAL A 1  422 ? 23.599  142.036 16.992  1.00 2.20   ? 422 VAL A N   1 
ATOM   3249  C  CA  . VAL A 1  422 ? 22.581  141.112 17.540  1.00 5.49   ? 422 VAL A CA  1 
ATOM   3250  C  C   . VAL A 1  422 ? 21.797  141.831 18.601  1.00 5.76   ? 422 VAL A C   1 
ATOM   3251  O  O   . VAL A 1  422 ? 22.366  142.623 19.378  1.00 6.69   ? 422 VAL A O   1 
ATOM   3252  C  CB  . VAL A 1  422 ? 23.166  139.789 18.067  1.00 6.58   ? 422 VAL A CB  1 
ATOM   3253  C  CG1 . VAL A 1  422 ? 22.072  138.978 18.726  1.00 6.70   ? 422 VAL A CG1 1 
ATOM   3254  C  CG2 . VAL A 1  422 ? 23.868  138.968 16.996  1.00 2.40   ? 422 VAL A CG2 1 
ATOM   3255  N  N   . ALA A 1  423 ? 20.488  141.588 18.708  1.00 6.22   ? 423 ALA A N   1 
ATOM   3256  C  CA  . ALA A 1  423 ? 19.831  142.146 19.881  1.00 2.20   ? 423 ALA A CA  1 
ATOM   3257  C  C   . ALA A 1  423 ? 18.628  141.260 20.263  1.00 6.38   ? 423 ALA A C   1 
ATOM   3258  O  O   . ALA A 1  423 ? 18.015  140.782 19.283  1.00 5.34   ? 423 ALA A O   1 
ATOM   3259  C  CB  . ALA A 1  423 ? 19.427  143.580 19.694  1.00 9.03   ? 423 ALA A CB  1 
ATOM   3260  N  N   . GLY A 1  424 ? 18.423  140.981 21.566  1.00 3.60   ? 424 GLY A N   1 
ATOM   3261  C  CA  . GLY A 1  424 ? 17.245  140.214 21.981  1.00 3.09   ? 424 GLY A CA  1 
ATOM   3262  C  C   . GLY A 1  424 ? 16.604  140.676 23.277  1.00 4.51   ? 424 GLY A C   1 
ATOM   3263  O  O   . GLY A 1  424 ? 17.271  141.442 23.991  1.00 2.20   ? 424 GLY A O   1 
ATOM   3264  N  N   . PHE A 1  425 ? 15.409  140.212 23.647  1.00 5.98   ? 425 PHE A N   1 
ATOM   3265  C  CA  . PHE A 1  425 ? 14.890  140.701 24.945  1.00 6.94   ? 425 PHE A CA  1 
ATOM   3266  C  C   . PHE A 1  425 ? 14.264  139.533 25.706  1.00 5.02   ? 425 PHE A C   1 
ATOM   3267  O  O   . PHE A 1  425 ? 13.516  138.867 25.021  1.00 5.62   ? 425 PHE A O   1 
ATOM   3268  C  CB  . PHE A 1  425 ? 13.788  141.701 24.650  1.00 16.71  ? 425 PHE A CB  1 
ATOM   3269  C  CG  . PHE A 1  425 ? 13.175  142.446 25.768  1.00 14.79  ? 425 PHE A CG  1 
ATOM   3270  C  CD1 . PHE A 1  425 ? 13.662  143.634 26.198  1.00 19.26  ? 425 PHE A CD1 1 
ATOM   3271  C  CD2 . PHE A 1  425 ? 12.081  142.003 26.470  1.00 35.20  ? 425 PHE A CD2 1 
ATOM   3272  C  CE1 . PHE A 1  425 ? 13.118  144.334 27.239  1.00 19.14  ? 425 PHE A CE1 1 
ATOM   3273  C  CE2 . PHE A 1  425 ? 11.533  142.703 27.526  1.00 32.61  ? 425 PHE A CE2 1 
ATOM   3274  C  CZ  . PHE A 1  425 ? 12.037  143.904 27.939  1.00 21.37  ? 425 PHE A CZ  1 
ATOM   3275  N  N   . GLY A 1  426 ? 14.770  139.195 26.869  1.00 8.05   ? 426 GLY A N   1 
ATOM   3276  C  CA  . GLY A 1  426 ? 14.619  137.893 27.545  1.00 2.20   ? 426 GLY A CA  1 
ATOM   3277  C  C   . GLY A 1  426 ? 13.232  137.393 27.428  1.00 3.34   ? 426 GLY A C   1 
ATOM   3278  O  O   . GLY A 1  426 ? 12.323  138.197 27.159  1.00 2.20   ? 426 GLY A O   1 
ATOM   3279  N  N   . PRO A 1  427 ? 13.050  136.104 27.551  1.00 4.77   ? 427 PRO A N   1 
ATOM   3280  C  CA  . PRO A 1  427 ? 14.097  135.213 27.950  1.00 8.64   ? 427 PRO A CA  1 
ATOM   3281  C  C   . PRO A 1  427 ? 15.106  134.947 26.846  1.00 12.18  ? 427 PRO A C   1 
ATOM   3282  O  O   . PRO A 1  427 ? 14.835  134.034 26.062  1.00 14.75  ? 427 PRO A O   1 
ATOM   3283  C  CB  . PRO A 1  427 ? 13.476  133.848 28.251  1.00 2.61   ? 427 PRO A CB  1 
ATOM   3284  C  CG  . PRO A 1  427 ? 12.007  134.102 28.092  1.00 3.20   ? 427 PRO A CG  1 
ATOM   3285  C  CD  . PRO A 1  427 ? 11.748  135.440 27.487  1.00 4.14   ? 427 PRO A CD  1 
ATOM   3286  N  N   . ILE A 1  428 ? 16.289  135.518 26.949  1.00 14.33  ? 428 ILE A N   1 
ATOM   3287  C  CA  . ILE A 1  428 ? 17.321  135.223 25.961  1.00 3.07   ? 428 ILE A CA  1 
ATOM   3288  C  C   . ILE A 1  428 ? 18.303  134.178 26.461  1.00 7.56   ? 428 ILE A C   1 
ATOM   3289  O  O   . ILE A 1  428 ? 19.151  133.755 25.673  1.00 6.42   ? 428 ILE A O   1 
ATOM   3290  C  CB  . ILE A 1  428 ? 18.126  136.485 25.732  1.00 13.96  ? 428 ILE A CB  1 
ATOM   3291  C  CG1 . ILE A 1  428 ? 17.250  137.654 25.339  1.00 13.78  ? 428 ILE A CG1 1 
ATOM   3292  C  CG2 . ILE A 1  428 ? 19.368  136.364 24.924  1.00 28.07  ? 428 ILE A CG2 1 
ATOM   3293  C  CD1 . ILE A 1  428 ? 17.794  138.801 26.211  1.00 15.63  ? 428 ILE A CD1 1 
ATOM   3294  N  N   . GLU A 1  429 ? 18.168  133.772 27.716  1.00 4.08   ? 429 GLU A N   1 
ATOM   3295  C  CA  . GLU A 1  429 ? 19.044  132.772 28.298  1.00 5.81   ? 429 GLU A CA  1 
ATOM   3296  C  C   . GLU A 1  429 ? 19.555  131.739 27.316  1.00 5.33   ? 429 GLU A C   1 
ATOM   3297  O  O   . GLU A 1  429 ? 20.681  131.308 27.473  1.00 3.81   ? 429 GLU A O   1 
ATOM   3298  C  CB  . GLU A 1  429 ? 18.555  132.123 29.577  1.00 2.20   ? 429 GLU A CB  1 
ATOM   3299  C  CG  . GLU A 1  429 ? 19.093  130.737 29.747  1.00 2.20   ? 429 GLU A CG  1 
ATOM   3300  C  CD  . GLU A 1  429 ? 19.287  130.175 31.125  1.00 8.10   ? 429 GLU A CD  1 
ATOM   3301  O  OE1 . GLU A 1  429 ? 19.717  130.885 32.048  1.00 24.05  ? 429 GLU A OE1 1 
ATOM   3302  O  OE2 . GLU A 1  429 ? 18.944  128.967 31.281  1.00 2.74   ? 429 GLU A OE2 1 
ATOM   3303  N  N   . GLN A 1  430 ? 18.836  131.308 26.300  1.00 3.48   ? 430 GLN A N   1 
ATOM   3304  C  CA  . GLN A 1  430 ? 19.344  130.371 25.312  1.00 5.08   ? 430 GLN A CA  1 
ATOM   3305  C  C   . GLN A 1  430 ? 19.976  131.004 24.077  1.00 6.99   ? 430 GLN A C   1 
ATOM   3306  O  O   . GLN A 1  430 ? 20.611  130.290 23.284  1.00 5.10   ? 430 GLN A O   1 
ATOM   3307  C  CB  . GLN A 1  430 ? 18.229  129.469 24.821  1.00 2.78   ? 430 GLN A CB  1 
ATOM   3308  C  CG  . GLN A 1  430 ? 18.598  128.434 23.791  1.00 5.11   ? 430 GLN A CG  1 
ATOM   3309  C  CD  . GLN A 1  430 ? 17.490  127.425 23.632  1.00 7.06   ? 430 GLN A CD  1 
ATOM   3310  O  OE1 . GLN A 1  430 ? 16.506  127.461 24.358  1.00 13.01  ? 430 GLN A OE1 1 
ATOM   3311  N  NE2 . GLN A 1  430 ? 17.573  126.499 22.710  1.00 11.74  ? 430 GLN A NE2 1 
ATOM   3312  N  N   . LEU A 1  431 ? 19.741  132.293 23.874  1.00 6.89   ? 431 LEU A N   1 
ATOM   3313  C  CA  . LEU A 1  431 ? 20.390  132.990 22.774  1.00 6.41   ? 431 LEU A CA  1 
ATOM   3314  C  C   . LEU A 1  431 ? 21.894  132.814 22.687  1.00 3.11   ? 431 LEU A C   1 
ATOM   3315  O  O   . LEU A 1  431 ? 22.768  133.271 23.446  1.00 2.20   ? 431 LEU A O   1 
ATOM   3316  C  CB  . LEU A 1  431 ? 20.076  134.457 22.999  1.00 7.44   ? 431 LEU A CB  1 
ATOM   3317  C  CG  . LEU A 1  431 ? 20.333  135.329 21.794  1.00 2.20   ? 431 LEU A CG  1 
ATOM   3318  C  CD1 . LEU A 1  431 ? 19.041  135.836 21.174  1.00 2.29   ? 431 LEU A CD1 1 
ATOM   3319  C  CD2 . LEU A 1  431 ? 21.200  136.502 22.218  1.00 3.75   ? 431 LEU A CD2 1 
ATOM   3320  N  N   . PRO A 1  432 ? 22.341  132.209 21.597  1.00 5.16   ? 432 PRO A N   1 
ATOM   3321  C  CA  . PRO A 1  432 ? 23.722  131.941 21.313  1.00 2.20   ? 432 PRO A CA  1 
ATOM   3322  C  C   . PRO A 1  432 ? 24.706  132.919 21.861  1.00 2.60   ? 432 PRO A C   1 
ATOM   3323  O  O   . PRO A 1  432 ? 24.474  134.071 22.269  1.00 6.86   ? 432 PRO A O   1 
ATOM   3324  C  CB  . PRO A 1  432 ? 23.927  131.458 19.876  1.00 2.20   ? 432 PRO A CB  1 
ATOM   3325  C  CG  . PRO A 1  432 ? 22.513  130.974 19.626  1.00 3.18   ? 432 PRO A CG  1 
ATOM   3326  C  CD  . PRO A 1  432 ? 21.520  131.673 20.524  1.00 4.68   ? 432 PRO A CD  1 
ATOM   3327  N  N   . ASP A 1  433 ? 25.952  132.469 21.958  1.00 3.61   ? 433 ASP A N   1 
ATOM   3328  C  CA  . ASP A 1  433 ? 27.025  133.338 22.463  1.00 4.04   ? 433 ASP A CA  1 
ATOM   3329  C  C   . ASP A 1  433 ? 27.524  134.068 21.202  1.00 2.27   ? 433 ASP A C   1 
ATOM   3330  O  O   . ASP A 1  433 ? 26.905  133.736 20.182  1.00 5.79   ? 433 ASP A O   1 
ATOM   3331  C  CB  . ASP A 1  433 ? 28.156  132.474 22.971  1.00 5.17   ? 433 ASP A CB  1 
ATOM   3332  C  CG  . ASP A 1  433 ? 29.308  133.288 23.472  1.00 3.81   ? 433 ASP A CG  1 
ATOM   3333  O  OD1 . ASP A 1  433 ? 29.250  133.918 24.530  1.00 2.89   ? 433 ASP A OD1 1 
ATOM   3334  O  OD2 . ASP A 1  433 ? 30.394  133.261 22.744  1.00 5.98   ? 433 ASP A OD2 1 
ATOM   3335  N  N   . TYR A 1  434 ? 28.187  135.209 21.372  1.00 3.09   ? 434 TYR A N   1 
ATOM   3336  C  CA  . TYR A 1  434 ? 28.397  136.083 20.250  1.00 6.19   ? 434 TYR A CA  1 
ATOM   3337  C  C   . TYR A 1  434 ? 29.304  135.292 19.306  1.00 7.60   ? 434 TYR A C   1 
ATOM   3338  O  O   . TYR A 1  434 ? 29.104  135.216 18.100  1.00 10.40  ? 434 TYR A O   1 
ATOM   3339  C  CB  . TYR A 1  434 ? 29.100  137.399 20.552  1.00 4.76   ? 434 TYR A CB  1 
ATOM   3340  C  CG  . TYR A 1  434 ? 29.221  138.134 19.225  1.00 5.73   ? 434 TYR A CG  1 
ATOM   3341  C  CD1 . TYR A 1  434 ? 30.262  137.930 18.351  1.00 5.19   ? 434 TYR A CD1 1 
ATOM   3342  C  CD2 . TYR A 1  434 ? 28.227  139.025 18.895  1.00 3.07   ? 434 TYR A CD2 1 
ATOM   3343  C  CE1 . TYR A 1  434 ? 30.307  138.618 17.156  1.00 8.80   ? 434 TYR A CE1 1 
ATOM   3344  C  CE2 . TYR A 1  434 ? 28.264  139.717 17.708  1.00 8.27   ? 434 TYR A CE2 1 
ATOM   3345  C  CZ  . TYR A 1  434 ? 29.312  139.508 16.832  1.00 9.26   ? 434 TYR A CZ  1 
ATOM   3346  O  OH  . TYR A 1  434 ? 29.320  140.217 15.651  1.00 3.46   ? 434 TYR A OH  1 
ATOM   3347  N  N   . ASN A 1  435 ? 30.293  134.641 19.917  1.00 3.68   ? 435 ASN A N   1 
ATOM   3348  C  CA  . ASN A 1  435 ? 31.210  133.833 19.159  1.00 3.49   ? 435 ASN A CA  1 
ATOM   3349  C  C   . ASN A 1  435 ? 30.522  132.748 18.360  1.00 3.97   ? 435 ASN A C   1 
ATOM   3350  O  O   . ASN A 1  435 ? 31.048  132.343 17.316  1.00 2.60   ? 435 ASN A O   1 
ATOM   3351  C  CB  . ASN A 1  435 ? 32.323  133.225 19.994  1.00 5.43   ? 435 ASN A CB  1 
ATOM   3352  C  CG  . ASN A 1  435 ? 33.420  134.219 20.316  1.00 5.57   ? 435 ASN A CG  1 
ATOM   3353  O  OD1 . ASN A 1  435 ? 34.074  134.794 19.450  1.00 8.00   ? 435 ASN A OD1 1 
ATOM   3354  N  ND2 . ASN A 1  435 ? 33.543  134.400 21.617  1.00 8.48   ? 435 ASN A ND2 1 
ATOM   3355  N  N   . ARG A 1  436 ? 29.391  132.261 18.852  1.00 6.79   ? 436 ARG A N   1 
ATOM   3356  C  CA  . ARG A 1  436 ? 28.718  131.175 18.121  1.00 8.77   ? 436 ARG A CA  1 
ATOM   3357  C  C   . ARG A 1  436 ? 27.998  131.713 16.897  1.00 9.44   ? 436 ARG A C   1 
ATOM   3358  O  O   . ARG A 1  436 ? 28.160  131.089 15.858  1.00 9.27   ? 436 ARG A O   1 
ATOM   3359  C  CB  . ARG A 1  436 ? 27.786  130.408 19.042  1.00 10.82  ? 436 ARG A CB  1 
ATOM   3360  C  CG  . ARG A 1  436 ? 28.549  129.712 20.172  1.00 5.50   ? 436 ARG A CG  1 
ATOM   3361  C  CD  . ARG A 1  436 ? 29.493  128.659 19.568  1.00 7.10   ? 436 ARG A CD  1 
ATOM   3362  N  NE  . ARG A 1  436 ? 29.629  127.575 20.535  1.00 2.39   ? 436 ARG A NE  1 
ATOM   3363  C  CZ  . ARG A 1  436 ? 28.715  126.600 20.638  1.00 5.37   ? 436 ARG A CZ  1 
ATOM   3364  N  NH1 . ARG A 1  436 ? 27.706  126.483 19.785  1.00 3.46   ? 436 ARG A NH1 1 
ATOM   3365  N  NH2 . ARG A 1  436 ? 28.829  125.691 21.601  1.00 17.90  ? 436 ARG A NH2 1 
ATOM   3366  N  N   . ILE A 1  437 ? 27.326  132.844 17.074  1.00 9.67   ? 437 ILE A N   1 
ATOM   3367  C  CA  . ILE A 1  437 ? 26.618  133.577 16.038  1.00 6.91   ? 437 ILE A CA  1 
ATOM   3368  C  C   . ILE A 1  437 ? 27.623  133.867 14.911  1.00 2.20   ? 437 ILE A C   1 
ATOM   3369  O  O   . ILE A 1  437 ? 27.536  133.325 13.816  1.00 7.08   ? 437 ILE A O   1 
ATOM   3370  C  CB  . ILE A 1  437 ? 26.054  134.909 16.564  1.00 6.81   ? 437 ILE A CB  1 
ATOM   3371  C  CG1 . ILE A 1  437 ? 25.187  134.675 17.816  1.00 3.60   ? 437 ILE A CG1 1 
ATOM   3372  C  CG2 . ILE A 1  437 ? 25.264  135.653 15.505  1.00 3.27   ? 437 ILE A CG2 1 
ATOM   3373  C  CD1 . ILE A 1  437 ? 24.672  135.976 18.396  1.00 7.27   ? 437 ILE A CD1 1 
ATOM   3374  N  N   . ARG A 1  438 ? 28.790  134.314 15.357  1.00 6.44   ? 438 ARG A N   1 
ATOM   3375  C  CA  . ARG A 1  438 ? 29.831  134.767 14.447  1.00 7.54   ? 438 ARG A CA  1 
ATOM   3376  C  C   . ARG A 1  438 ? 30.346  133.671 13.564  1.00 8.34   ? 438 ARG A C   1 
ATOM   3377  O  O   . ARG A 1  438 ? 30.347  133.686 12.336  1.00 8.01   ? 438 ARG A O   1 
ATOM   3378  C  CB  . ARG A 1  438 ? 30.964  135.350 15.289  1.00 7.87   ? 438 ARG A CB  1 
ATOM   3379  C  CG  . ARG A 1  438 ? 32.122  135.845 14.473  1.00 8.54   ? 438 ARG A CG  1 
ATOM   3380  C  CD  . ARG A 1  438 ? 31.762  137.200 13.868  1.00 15.89  ? 438 ARG A CD  1 
ATOM   3381  N  NE  . ARG A 1  438 ? 32.925  137.709 13.131  1.00 15.91  ? 438 ARG A NE  1 
ATOM   3382  C  CZ  . ARG A 1  438 ? 33.337  137.076 12.040  1.00 14.46  ? 438 ARG A CZ  1 
ATOM   3383  N  NH1 . ARG A 1  438 ? 32.702  136.027 11.555  1.00 8.71   ? 438 ARG A NH1 1 
ATOM   3384  N  NH2 . ARG A 1  438 ? 34.408  137.589 11.448  1.00 23.13  ? 438 ARG A NH2 1 
ATOM   3385  N  N   . SER A 1  439 ? 30.705  132.538 14.177  1.00 15.85  ? 439 SER A N   1 
ATOM   3386  C  CA  . SER A 1  439 ? 31.237  131.411 13.399  1.00 12.15  ? 439 SER A CA  1 
ATOM   3387  C  C   . SER A 1  439 ? 30.135  130.773 12.547  1.00 11.93  ? 439 SER A C   1 
ATOM   3388  O  O   . SER A 1  439 ? 30.434  129.882 11.740  1.00 8.20   ? 439 SER A O   1 
ATOM   3389  C  CB  . SER A 1  439 ? 31.864  130.371 14.313  1.00 6.57   ? 439 SER A CB  1 
ATOM   3390  O  OG  . SER A 1  439 ? 32.510  131.039 15.385  1.00 15.16  ? 439 SER A OG  1 
ATOM   3391  N  N   . GLY A 1  440 ? 28.938  131.302 12.768  1.00 2.80   ? 440 GLY A N   1 
ATOM   3392  C  CA  . GLY A 1  440 ? 27.731  130.903 12.094  1.00 4.63   ? 440 GLY A CA  1 
ATOM   3393  C  C   . GLY A 1  440 ? 27.705  131.582 10.725  1.00 4.06   ? 440 GLY A C   1 
ATOM   3394  O  O   . GLY A 1  440 ? 27.062  131.047 9.842   1.00 4.83   ? 440 GLY A O   1 
ATOM   3395  N  N   . MET A 1  441 ? 28.581  132.564 10.585  1.00 6.19   ? 441 MET A N   1 
ATOM   3396  C  CA  . MET A 1  441 ? 28.855  133.281 9.376   1.00 6.73   ? 441 MET A CA  1 
ATOM   3397  C  C   . MET A 1  441 ? 29.843  132.640 8.420   1.00 4.06   ? 441 MET A C   1 
ATOM   3398  O  O   . MET A 1  441 ? 30.101  133.295 7.385   1.00 6.48   ? 441 MET A O   1 
ATOM   3399  C  CB  . MET A 1  441 ? 29.370  134.689 9.743   1.00 3.96   ? 441 MET A CB  1 
ATOM   3400  C  CG  . MET A 1  441 ? 28.324  135.432 10.586  1.00 3.09   ? 441 MET A CG  1 
ATOM   3401  S  SD  . MET A 1  441 ? 26.704  135.118 9.918   1.00 3.90   ? 441 MET A SD  1 
ATOM   3402  C  CE  . MET A 1  441 ? 26.318  136.696 9.156   1.00 7.36   ? 441 MET A CE  1 
ATOM   3403  N  N   . PHE A 1  442 ? 30.405  131.464 8.608   1.00 2.69   ? 442 PHE A N   1 
ATOM   3404  C  CA  . PHE A 1  442 ? 31.309  130.791 7.703   1.00 6.87   ? 442 PHE A CA  1 
ATOM   3405  C  C   . PHE A 1  442 ? 30.929  129.322 7.605   1.00 8.01   ? 442 PHE A C   1 
ATOM   3406  O  O   . PHE A 1  442 ? 29.886  129.070 8.186   1.00 10.20  ? 442 PHE A O   1 
ATOM   3407  C  CB  . PHE A 1  442 ? 32.779  130.969 8.013   1.00 7.72   ? 442 PHE A CB  1 
ATOM   3408  C  CG  . PHE A 1  442 ? 33.331  130.248 9.205   1.00 15.25  ? 442 PHE A CG  1 
ATOM   3409  C  CD1 . PHE A 1  442 ? 33.311  130.830 10.461  1.00 17.41  ? 442 PHE A CD1 1 
ATOM   3410  C  CD2 . PHE A 1  442 ? 33.860  128.972 9.076   1.00 19.21  ? 442 PHE A CD2 1 
ATOM   3411  C  CE1 . PHE A 1  442 ? 33.780  130.142 11.555  1.00 23.86  ? 442 PHE A CE1 1 
ATOM   3412  C  CE2 . PHE A 1  442 ? 34.341  128.270 10.155  1.00 19.12  ? 442 PHE A CE2 1 
ATOM   3413  C  CZ  . PHE A 1  442 ? 34.290  128.866 11.404  1.00 28.45  ? 442 PHE A CZ  1 
ATOM   3414  N  N   . TRP A 1  443 ? 31.539  128.477 6.779   1.00 16.65  ? 443 TRP A N   1 
ATOM   3415  C  CA  . TRP A 1  443 ? 31.074  127.133 6.650   1.00 27.65  ? 443 TRP A CA  1 
ATOM   3416  C  C   . TRP A 1  443 ? 32.057  126.000 6.700   1.00 38.60  ? 443 TRP A C   1 
ATOM   3417  O  O   . TRP A 1  443 ? 32.324  125.334 5.709   1.00 43.18  ? 443 TRP A O   1 
ATOM   3418  C  CB  . TRP A 1  443 ? 30.092  126.882 5.518   1.00 16.26  ? 443 TRP A CB  1 
ATOM   3419  C  CG  . TRP A 1  443 ? 28.714  126.872 6.128   1.00 18.61  ? 443 TRP A CG  1 
ATOM   3420  C  CD1 . TRP A 1  443 ? 28.336  127.200 7.388   1.00 17.23  ? 443 TRP A CD1 1 
ATOM   3421  C  CD2 . TRP A 1  443 ? 27.531  126.494 5.437   1.00 14.74  ? 443 TRP A CD2 1 
ATOM   3422  N  NE1 . TRP A 1  443 ? 26.989  127.087 7.541   1.00 20.47  ? 443 TRP A NE1 1 
ATOM   3423  C  CE2 . TRP A 1  443 ? 26.480  126.644 6.339   1.00 18.98  ? 443 TRP A CE2 1 
ATOM   3424  C  CE3 . TRP A 1  443 ? 27.307  126.043 4.145   1.00 10.56  ? 443 TRP A CE3 1 
ATOM   3425  C  CZ2 . TRP A 1  443 ? 25.179  126.355 5.941   1.00 21.02  ? 443 TRP A CZ2 1 
ATOM   3426  C  CZ3 . TRP A 1  443 ? 26.021  125.748 3.759   1.00 7.06   ? 443 TRP A CZ3 1 
ATOM   3427  C  CH2 . TRP A 1  443 ? 24.990  125.924 4.670   1.00 13.61  ? 443 TRP A CH2 1 
ATOM   3428  N  N   . LEU A 1  444 ? 32.463  125.632 7.903   1.00 49.46  ? 444 LEU A N   1 
ATOM   3429  C  CA  . LEU A 1  444 ? 33.324  124.467 8.067   1.00 51.50  ? 444 LEU A CA  1 
ATOM   3430  C  C   . LEU A 1  444 ? 32.439  123.230 8.270   1.00 53.17  ? 444 LEU A C   1 
ATOM   3431  O  O   . LEU A 1  444 ? 32.798  122.131 7.832   1.00 60.25  ? 444 LEU A O   1 
ATOM   3432  C  CB  . LEU A 1  444 ? 34.181  124.746 9.306   1.00 53.26  ? 444 LEU A CB  1 
ATOM   3433  C  CG  . LEU A 1  444 ? 35.349  123.782 9.475   1.00 55.44  ? 444 LEU A CG  1 
ATOM   3434  C  CD1 . LEU A 1  444 ? 36.297  123.991 8.300   1.00 63.43  ? 444 LEU A CD1 1 
ATOM   3435  C  CD2 . LEU A 1  444 ? 35.992  124.065 10.815  1.00 56.56  ? 444 LEU A CD2 1 
ATOM   3436  N  N   . ARG A 1  445 ? 31.281  123.416 8.891   1.00 44.63  ? 445 ARG A N   1 
ATOM   3437  C  CA  . ARG A 1  445 ? 30.356  122.357 9.232   1.00 48.63  ? 445 ARG A CA  1 
ATOM   3438  C  C   . ARG A 1  445 ? 29.129  122.969 9.904   1.00 48.93  ? 445 ARG A C   1 
ATOM   3439  O  O   . ARG A 1  445 ? 29.181  124.163 10.179  1.00 50.63  ? 445 ARG A O   1 
ATOM   3440  C  CB  . ARG A 1  445 ? 31.009  121.307 10.144  1.00 54.74  ? 445 ARG A CB  1 
ATOM   3441  C  CG  . ARG A 1  445 ? 31.475  120.113 9.305   1.00 58.33  ? 445 ARG A CG  1 
ATOM   3442  C  CD  . ARG A 1  445 ? 32.056  119.040 10.183  1.00 66.41  ? 445 ARG A CD  1 
ATOM   3443  N  NE  . ARG A 1  445 ? 33.111  118.235 9.583   1.00 68.96  ? 445 ARG A NE  1 
ATOM   3444  C  CZ  . ARG A 1  445 ? 33.312  116.964 9.932   1.00 71.59  ? 445 ARG A CZ  1 
ATOM   3445  N  NH1 . ARG A 1  445 ? 32.547  116.378 10.842  1.00 73.60  ? 445 ARG A NH1 1 
ATOM   3446  N  NH2 . ARG A 1  445 ? 34.286  116.271 9.363   1.00 74.90  ? 445 ARG A NH2 1 
ATOM   3447  N  N   . PHE A 1  446 ? 28.110  122.195 10.199  1.00 48.25  ? 446 PHE A N   1 
ATOM   3448  C  CA  . PHE A 1  446 ? 26.916  122.567 10.901  1.00 49.10  ? 446 PHE A CA  1 
ATOM   3449  C  C   . PHE A 1  446 ? 25.662  122.399 10.063  1.00 54.90  ? 446 PHE A C   1 
ATOM   3450  O  O   . PHE A 1  446 ? 25.139  121.288 9.997   1.00 58.95  ? 446 PHE A O   1 
ATOM   3451  C  CB  . PHE A 1  446 ? 27.008  123.919 11.597  1.00 42.49  ? 446 PHE A CB  1 
ATOM   3452  C  CG  . PHE A 1  446 ? 27.414  123.753 13.044  1.00 36.94  ? 446 PHE A CG  1 
ATOM   3453  C  CD1 . PHE A 1  446 ? 28.711  123.362 13.330  1.00 35.76  ? 446 PHE A CD1 1 
ATOM   3454  C  CD2 . PHE A 1  446 ? 26.533  123.972 14.078  1.00 31.45  ? 446 PHE A CD2 1 
ATOM   3455  C  CE1 . PHE A 1  446 ? 29.154  123.191 14.624  1.00 32.31  ? 446 PHE A CE1 1 
ATOM   3456  C  CE2 . PHE A 1  446 ? 26.950  123.804 15.378  1.00 31.16  ? 446 PHE A CE2 1 
ATOM   3457  C  CZ  . PHE A 1  446 ? 28.251  123.417 15.644  1.00 37.29  ? 446 PHE A CZ  1 
ATOM   3458  O  OXT . PHE A 1  446 ? 25.208  123.379 9.475   1.00 58.95  ? 446 PHE A OXT 1 
ATOM   3459  N  N   . PRO B 2  21  ? -9.571  152.371 -19.302 1.00 81.18  ? 21  PRO B N   1 
ATOM   3460  C  CA  . PRO B 2  21  ? -10.127 152.698 -20.649 1.00 81.05  ? 21  PRO B CA  1 
ATOM   3461  C  C   . PRO B 2  21  ? -11.385 151.920 -20.975 1.00 80.84  ? 21  PRO B C   1 
ATOM   3462  O  O   . PRO B 2  21  ? -12.392 152.532 -21.378 1.00 80.40  ? 21  PRO B O   1 
ATOM   3463  C  CB  . PRO B 2  21  ? -9.007  152.533 -21.680 1.00 81.31  ? 21  PRO B CB  1 
ATOM   3464  C  CG  . PRO B 2  21  ? -7.786  152.716 -20.806 1.00 81.16  ? 21  PRO B CG  1 
ATOM   3465  C  CD  . PRO B 2  21  ? -8.111  152.241 -19.413 1.00 81.70  ? 21  PRO B CD  1 
ATOM   3466  N  N   . GLN B 2  22  ? -11.411 150.602 -20.786 1.00 78.92  ? 22  GLN B N   1 
ATOM   3467  C  CA  . GLN B 2  22  ? -12.698 149.893 -20.933 1.00 79.78  ? 22  GLN B CA  1 
ATOM   3468  C  C   . GLN B 2  22  ? -13.310 149.855 -19.529 1.00 77.96  ? 22  GLN B C   1 
ATOM   3469  O  O   . GLN B 2  22  ? -12.529 149.664 -18.590 1.00 81.86  ? 22  GLN B O   1 
ATOM   3470  C  CB  . GLN B 2  22  ? -12.493 148.481 -21.463 1.00 82.62  ? 22  GLN B CB  1 
ATOM   3471  C  CG  . GLN B 2  22  ? -12.465 148.317 -22.963 1.00 86.58  ? 22  GLN B CG  1 
ATOM   3472  C  CD  . GLN B 2  22  ? -13.665 148.850 -23.713 1.00 88.89  ? 22  GLN B CD  1 
ATOM   3473  O  OE1 . GLN B 2  22  ? -14.621 149.378 -23.138 1.00 88.38  ? 22  GLN B OE1 1 
ATOM   3474  N  NE2 . GLN B 2  22  ? -13.643 148.721 -25.039 1.00 88.78  ? 22  GLN B NE2 1 
ATOM   3475  N  N   . ASP B 2  23  ? -14.604 150.076 -19.347 1.00 74.29  ? 23  ASP B N   1 
ATOM   3476  C  CA  . ASP B 2  23  ? -15.171 150.005 -17.986 1.00 65.58  ? 23  ASP B CA  1 
ATOM   3477  C  C   . ASP B 2  23  ? -15.509 148.556 -17.686 1.00 59.04  ? 23  ASP B C   1 
ATOM   3478  O  O   . ASP B 2  23  ? -15.209 147.658 -18.478 1.00 54.96  ? 23  ASP B O   1 
ATOM   3479  C  CB  . ASP B 2  23  ? -16.404 150.904 -17.870 1.00 69.37  ? 23  ASP B CB  1 
ATOM   3480  C  CG  . ASP B 2  23  ? -16.272 152.059 -18.860 1.00 70.89  ? 23  ASP B CG  1 
ATOM   3481  O  OD1 . ASP B 2  23  ? -15.297 152.819 -18.674 1.00 70.78  ? 23  ASP B OD1 1 
ATOM   3482  O  OD2 . ASP B 2  23  ? -17.083 152.128 -19.800 1.00 71.31  ? 23  ASP B OD2 1 
ATOM   3483  N  N   . LEU B 2  24  ? -16.026 148.255 -16.500 1.00 53.58  ? 24  LEU B N   1 
ATOM   3484  C  CA  . LEU B 2  24  ? -16.305 146.849 -16.227 1.00 49.80  ? 24  LEU B CA  1 
ATOM   3485  C  C   . LEU B 2  24  ? -17.433 146.322 -17.110 1.00 45.68  ? 24  LEU B C   1 
ATOM   3486  O  O   . LEU B 2  24  ? -18.205 147.064 -17.700 1.00 46.42  ? 24  LEU B O   1 
ATOM   3487  C  CB  . LEU B 2  24  ? -16.627 146.550 -14.774 1.00 49.60  ? 24  LEU B CB  1 
ATOM   3488  C  CG  . LEU B 2  24  ? -16.570 147.719 -13.792 1.00 44.11  ? 24  LEU B CG  1 
ATOM   3489  C  CD1 . LEU B 2  24  ? -17.408 148.878 -14.288 1.00 33.29  ? 24  LEU B CD1 1 
ATOM   3490  C  CD2 . LEU B 2  24  ? -16.982 147.244 -12.413 1.00 42.69  ? 24  LEU B CD2 1 
ATOM   3491  N  N   . GLU B 2  25  ? -17.620 145.017 -17.002 1.00 42.26  ? 25  GLU B N   1 
ATOM   3492  C  CA  . GLU B 2  25  ? -18.584 144.315 -17.834 1.00 41.42  ? 25  GLU B CA  1 
ATOM   3493  C  C   . GLU B 2  25  ? -19.348 143.234 -17.097 1.00 38.97  ? 25  GLU B C   1 
ATOM   3494  O  O   . GLU B 2  25  ? -18.849 142.101 -17.032 1.00 38.82  ? 25  GLU B O   1 
ATOM   3495  C  CB  . GLU B 2  25  ? -17.738 143.684 -18.963 1.00 40.16  ? 25  GLU B CB  1 
ATOM   3496  C  CG  . GLU B 2  25  ? -18.538 143.399 -20.225 1.00 44.83  ? 25  GLU B CG  1 
ATOM   3497  C  CD  . GLU B 2  25  ? -17.593 143.100 -21.373 1.00 46.94  ? 25  GLU B CD  1 
ATOM   3498  O  OE1 . GLU B 2  25  ? -16.408 142.856 -21.059 1.00 54.71  ? 25  GLU B OE1 1 
ATOM   3499  O  OE2 . GLU B 2  25  ? -18.043 143.117 -22.528 1.00 46.74  ? 25  GLU B OE2 1 
ATOM   3500  N  N   . PHE B 2  26  ? -20.547 143.487 -16.560 1.00 35.53  ? 26  PHE B N   1 
ATOM   3501  C  CA  . PHE B 2  26  ? -21.232 142.388 -15.880 1.00 38.95  ? 26  PHE B CA  1 
ATOM   3502  C  C   . PHE B 2  26  ? -21.980 141.458 -16.810 1.00 34.17  ? 26  PHE B C   1 
ATOM   3503  O  O   . PHE B 2  26  ? -22.175 141.742 -17.983 1.00 32.83  ? 26  PHE B O   1 
ATOM   3504  C  CB  . PHE B 2  26  ? -22.080 142.839 -14.707 1.00 54.87  ? 26  PHE B CB  1 
ATOM   3505  C  CG  . PHE B 2  26  ? -22.857 144.093 -14.956 1.00 71.03  ? 26  PHE B CG  1 
ATOM   3506  C  CD1 . PHE B 2  26  ? -24.054 144.055 -15.654 1.00 77.75  ? 26  PHE B CD1 1 
ATOM   3507  C  CD2 . PHE B 2  26  ? -22.390 145.316 -14.502 1.00 78.37  ? 26  PHE B CD2 1 
ATOM   3508  C  CE1 . PHE B 2  26  ? -24.779 145.208 -15.895 1.00 81.73  ? 26  PHE B CE1 1 
ATOM   3509  C  CE2 . PHE B 2  26  ? -23.111 146.476 -14.736 1.00 81.37  ? 26  PHE B CE2 1 
ATOM   3510  C  CZ  . PHE B 2  26  ? -24.303 146.425 -15.434 1.00 82.21  ? 26  PHE B CZ  1 
ATOM   3511  N  N   . THR B 2  27  ? -22.202 140.224 -16.387 1.00 34.47  ? 27  THR B N   1 
ATOM   3512  C  CA  . THR B 2  27  ? -22.893 139.221 -17.186 1.00 39.74  ? 27  THR B CA  1 
ATOM   3513  C  C   . THR B 2  27  ? -23.595 138.219 -16.269 1.00 42.91  ? 27  THR B C   1 
ATOM   3514  O  O   . THR B 2  27  ? -22.986 137.588 -15.401 1.00 47.54  ? 27  THR B O   1 
ATOM   3515  C  CB  . THR B 2  27  ? -21.978 138.440 -18.145 1.00 33.65  ? 27  THR B CB  1 
ATOM   3516  O  OG1 . THR B 2  27  ? -21.559 139.234 -19.246 1.00 28.09  ? 27  THR B OG1 1 
ATOM   3517  C  CG2 . THR B 2  27  ? -22.639 137.155 -18.618 1.00 22.00  ? 27  THR B CG2 1 
ATOM   3518  N  N   . ARG B 2  28  ? -24.919 138.122 -16.380 1.00 42.74  ? 28  ARG B N   1 
ATOM   3519  C  CA  . ARG B 2  28  ? -25.583 137.134 -15.510 1.00 45.09  ? 28  ARG B CA  1 
ATOM   3520  C  C   . ARG B 2  28  ? -25.903 135.931 -16.379 1.00 43.20  ? 28  ARG B C   1 
ATOM   3521  O  O   . ARG B 2  28  ? -26.312 136.117 -17.533 1.00 47.96  ? 28  ARG B O   1 
ATOM   3522  C  CB  . ARG B 2  28  ? -26.774 137.729 -14.784 1.00 52.66  ? 28  ARG B CB  1 
ATOM   3523  C  CG  . ARG B 2  28  ? -27.354 136.904 -13.654 1.00 57.50  ? 28  ARG B CG  1 
ATOM   3524  C  CD  . ARG B 2  28  ? -27.598 137.664 -12.357 1.00 57.93  ? 28  ARG B CD  1 
ATOM   3525  N  NE  . ARG B 2  28  ? -27.912 136.758 -11.252 1.00 58.00  ? 28  ARG B NE  1 
ATOM   3526  C  CZ  . ARG B 2  28  ? -28.446 137.019 -10.074 1.00 58.07  ? 28  ARG B CZ  1 
ATOM   3527  N  NH1 . ARG B 2  28  ? -28.789 138.255 -9.723  1.00 58.74  ? 28  ARG B NH1 1 
ATOM   3528  N  NH2 . ARG B 2  28  ? -28.668 136.053 -9.182  1.00 54.97  ? 28  ARG B NH2 1 
ATOM   3529  N  N   . LEU B 2  29  ? -25.463 134.745 -15.990 1.00 39.89  ? 29  LEU B N   1 
ATOM   3530  C  CA  . LEU B 2  29  ? -25.697 133.552 -16.785 1.00 34.44  ? 29  LEU B CA  1 
ATOM   3531  C  C   . LEU B 2  29  ? -27.074 132.945 -16.467 1.00 37.80  ? 29  LEU B C   1 
ATOM   3532  O  O   . LEU B 2  29  ? -27.667 133.140 -15.405 1.00 36.68  ? 29  LEU B O   1 
ATOM   3533  C  CB  . LEU B 2  29  ? -24.655 132.494 -16.460 1.00 21.45  ? 29  LEU B CB  1 
ATOM   3534  C  CG  . LEU B 2  29  ? -23.197 132.667 -16.796 1.00 16.22  ? 29  LEU B CG  1 
ATOM   3535  C  CD1 . LEU B 2  29  ? -22.380 131.441 -16.363 1.00 2.20   ? 29  LEU B CD1 1 
ATOM   3536  C  CD2 . LEU B 2  29  ? -22.973 132.996 -18.260 1.00 14.11  ? 29  LEU B CD2 1 
ATOM   3537  N  N   . PRO B 2  30  ? -27.423 131.958 -17.273 1.00 39.30  ? 30  PRO B N   1 
ATOM   3538  C  CA  . PRO B 2  30  ? -28.495 131.025 -16.979 1.00 39.82  ? 30  PRO B CA  1 
ATOM   3539  C  C   . PRO B 2  30  ? -28.408 130.539 -15.543 1.00 36.99  ? 30  PRO B C   1 
ATOM   3540  O  O   . PRO B 2  30  ? -29.429 130.520 -14.843 1.00 35.16  ? 30  PRO B O   1 
ATOM   3541  C  CB  . PRO B 2  30  ? -28.396 129.891 -18.016 1.00 40.90  ? 30  PRO B CB  1 
ATOM   3542  C  CG  . PRO B 2  30  ? -27.580 130.534 -19.110 1.00 39.41  ? 30  PRO B CG  1 
ATOM   3543  C  CD  . PRO B 2  30  ? -26.678 131.566 -18.475 1.00 40.78  ? 30  PRO B CD  1 
ATOM   3544  N  N   . ASN B 2  31  ? -27.232 130.192 -15.029 1.00 35.18  ? 31  ASN B N   1 
ATOM   3545  C  CA  . ASN B 2  31  ? -27.126 129.740 -13.650 1.00 38.21  ? 31  ASN B CA  1 
ATOM   3546  C  C   . ASN B 2  31  ? -27.536 130.810 -12.644 1.00 37.14  ? 31  ASN B C   1 
ATOM   3547  O  O   . ASN B 2  31  ? -27.933 130.480 -11.526 1.00 39.12  ? 31  ASN B O   1 
ATOM   3548  C  CB  . ASN B 2  31  ? -25.678 129.350 -13.327 1.00 40.86  ? 31  ASN B CB  1 
ATOM   3549  C  CG  . ASN B 2  31  ? -25.263 128.110 -14.091 1.00 42.81  ? 31  ASN B CG  1 
ATOM   3550  O  OD1 . ASN B 2  31  ? -24.102 128.014 -14.484 1.00 40.27  ? 31  ASN B OD1 1 
ATOM   3551  N  ND2 . ASN B 2  31  ? -26.207 127.191 -14.266 1.00 47.78  ? 31  ASN B ND2 1 
ATOM   3552  N  N   . GLY B 2  32  ? -27.199 132.048 -12.970 1.00 33.98  ? 32  GLY B N   1 
ATOM   3553  C  CA  . GLY B 2  32  ? -27.387 133.142 -12.038 1.00 34.14  ? 32  GLY B CA  1 
ATOM   3554  C  C   . GLY B 2  32  ? -26.066 133.626 -11.469 1.00 33.54  ? 32  GLY B C   1 
ATOM   3555  O  O   . GLY B 2  32  ? -26.088 134.387 -10.499 1.00 37.37  ? 32  GLY B O   1 
ATOM   3556  N  N   . LEU B 2  33  ? -24.917 133.222 -12.025 1.00 32.57  ? 33  LEU B N   1 
ATOM   3557  C  CA  . LEU B 2  33  ? -23.686 133.781 -11.468 1.00 33.40  ? 33  LEU B CA  1 
ATOM   3558  C  C   . LEU B 2  33  ? -23.201 134.910 -12.389 1.00 31.16  ? 33  LEU B C   1 
ATOM   3559  O  O   . LEU B 2  33  ? -23.219 134.731 -13.594 1.00 32.66  ? 33  LEU B O   1 
ATOM   3560  C  CB  . LEU B 2  33  ? -22.543 132.816 -11.208 1.00 33.48  ? 33  LEU B CB  1 
ATOM   3561  C  CG  . LEU B 2  33  ? -21.755 132.403 -12.456 1.00 32.53  ? 33  LEU B CG  1 
ATOM   3562  C  CD1 . LEU B 2  33  ? -20.625 131.442 -12.158 1.00 21.56  ? 33  LEU B CD1 1 
ATOM   3563  C  CD2 . LEU B 2  33  ? -22.776 131.815 -13.432 1.00 32.49  ? 33  LEU B CD2 1 
ATOM   3564  N  N   . VAL B 2  34  ? -22.895 136.014 -11.771 1.00 27.56  ? 34  VAL B N   1 
ATOM   3565  C  CA  . VAL B 2  34  ? -22.470 137.285 -12.302 1.00 24.33  ? 34  VAL B CA  1 
ATOM   3566  C  C   . VAL B 2  34  ? -20.954 137.284 -12.522 1.00 26.67  ? 34  VAL B C   1 
ATOM   3567  O  O   . VAL B 2  34  ? -20.300 136.645 -11.693 1.00 27.52  ? 34  VAL B O   1 
ATOM   3568  C  CB  . VAL B 2  34  ? -22.684 138.303 -11.137 1.00 19.73  ? 34  VAL B CB  1 
ATOM   3569  C  CG1 . VAL B 2  34  ? -22.127 139.663 -11.469 1.00 18.72  ? 34  VAL B CG1 1 
ATOM   3570  C  CG2 . VAL B 2  34  ? -24.125 138.313 -10.699 1.00 13.42  ? 34  VAL B CG2 1 
ATOM   3571  N  N   . ILE B 2  35  ? -20.439 137.928 -13.568 1.00 25.56  ? 35  ILE B N   1 
ATOM   3572  C  CA  . ILE B 2  35  ? -18.998 138.069 -13.738 1.00 26.85  ? 35  ILE B CA  1 
ATOM   3573  C  C   . ILE B 2  35  ? -18.568 139.428 -14.282 1.00 31.86  ? 35  ILE B C   1 
ATOM   3574  O  O   . ILE B 2  35  ? -19.302 140.011 -15.076 1.00 32.80  ? 35  ILE B O   1 
ATOM   3575  C  CB  . ILE B 2  35  ? -18.343 136.950 -14.513 1.00 12.27  ? 35  ILE B CB  1 
ATOM   3576  C  CG1 . ILE B 2  35  ? -17.744 137.480 -15.809 1.00 12.26  ? 35  ILE B CG1 1 
ATOM   3577  C  CG2 . ILE B 2  35  ? -19.268 135.778 -14.772 1.00 16.91  ? 35  ILE B CG2 1 
ATOM   3578  C  CD1 . ILE B 2  35  ? -17.270 136.333 -16.699 1.00 18.93  ? 35  ILE B CD1 1 
ATOM   3579  N  N   . ALA B 2  36  ? -17.445 139.990 -13.838 1.00 33.07  ? 36  ALA B N   1 
ATOM   3580  C  CA  . ALA B 2  36  ? -17.022 141.320 -14.268 1.00 35.90  ? 36  ALA B CA  1 
ATOM   3581  C  C   . ALA B 2  36  ? -15.540 141.341 -14.637 1.00 37.21  ? 36  ALA B C   1 
ATOM   3582  O  O   . ALA B 2  36  ? -14.862 140.393 -14.242 1.00 39.25  ? 36  ALA B O   1 
ATOM   3583  C  CB  . ALA B 2  36  ? -17.331 142.320 -13.165 1.00 37.55  ? 36  ALA B CB  1 
ATOM   3584  N  N   . SER B 2  37  ? -15.081 142.358 -15.351 1.00 36.28  ? 37  SER B N   1 
ATOM   3585  C  CA  . SER B 2  37  ? -13.700 142.411 -15.819 1.00 41.43  ? 37  SER B CA  1 
ATOM   3586  C  C   . SER B 2  37  ? -13.300 143.791 -16.312 1.00 47.04  ? 37  SER B C   1 
ATOM   3587  O  O   . SER B 2  37  ? -13.936 144.375 -17.192 1.00 52.21  ? 37  SER B O   1 
ATOM   3588  C  CB  . SER B 2  37  ? -13.517 141.371 -16.936 1.00 28.86  ? 37  SER B CB  1 
ATOM   3589  O  OG  . SER B 2  37  ? -12.673 141.852 -17.959 1.00 33.23  ? 37  SER B OG  1 
ATOM   3590  N  N   . LEU B 2  38  ? -12.178 144.330 -15.849 1.00 50.20  ? 38  LEU B N   1 
ATOM   3591  C  CA  . LEU B 2  38  ? -11.687 145.610 -16.374 1.00 51.21  ? 38  LEU B CA  1 
ATOM   3592  C  C   . LEU B 2  38  ? -10.283 145.420 -16.920 1.00 55.61  ? 38  LEU B C   1 
ATOM   3593  O  O   . LEU B 2  38  ? -9.415  145.207 -16.058 1.00 58.79  ? 38  LEU B O   1 
ATOM   3594  C  CB  . LEU B 2  38  ? -11.514 146.540 -15.154 1.00 42.78  ? 38  LEU B CB  1 
ATOM   3595  C  CG  . LEU B 2  38  ? -12.812 147.268 -14.804 1.00 39.93  ? 38  LEU B CG  1 
ATOM   3596  C  CD1 . LEU B 2  38  ? -13.133 147.114 -13.341 1.00 43.18  ? 38  LEU B CD1 1 
ATOM   3597  C  CD2 . LEU B 2  38  ? -12.647 148.718 -15.223 1.00 35.54  ? 38  LEU B CD2 1 
ATOM   3598  N  N   . GLU B 2  39  ? -10.001 145.495 -18.216 1.00 59.84  ? 39  GLU B N   1 
ATOM   3599  C  CA  . GLU B 2  39  ? -8.562  145.301 -18.523 1.00 61.74  ? 39  GLU B CA  1 
ATOM   3600  C  C   . GLU B 2  39  ? -7.833  146.589 -18.155 1.00 60.21  ? 39  GLU B C   1 
ATOM   3601  O  O   . GLU B 2  39  ? -8.174  147.632 -18.711 1.00 59.75  ? 39  GLU B O   1 
ATOM   3602  C  CB  . GLU B 2  39  ? -8.303  144.843 -19.928 1.00 69.29  ? 39  GLU B CB  1 
ATOM   3603  C  CG  . GLU B 2  39  ? -6.831  144.603 -20.244 1.00 81.37  ? 39  GLU B CG  1 
ATOM   3604  C  CD  . GLU B 2  39  ? -6.559  144.397 -21.718 1.00 89.86  ? 39  GLU B CD  1 
ATOM   3605  O  OE1 . GLU B 2  39  ? -7.459  144.613 -22.563 1.00 94.64  ? 39  GLU B OE1 1 
ATOM   3606  O  OE2 . GLU B 2  39  ? -5.426  144.010 -22.087 1.00 92.69  ? 39  GLU B OE2 1 
ATOM   3607  N  N   . ASN B 2  40  ? -7.152  146.572 -17.013 1.00 60.75  ? 40  ASN B N   1 
ATOM   3608  C  CA  . ASN B 2  40  ? -6.475  147.774 -16.530 1.00 62.49  ? 40  ASN B CA  1 
ATOM   3609  C  C   . ASN B 2  40  ? -5.125  147.918 -17.232 1.00 64.09  ? 40  ASN B C   1 
ATOM   3610  O  O   . ASN B 2  40  ? -4.680  147.033 -17.973 1.00 61.14  ? 40  ASN B O   1 
ATOM   3611  C  CB  . ASN B 2  40  ? -6.363  147.732 -15.012 1.00 61.10  ? 40  ASN B CB  1 
ATOM   3612  C  CG  . ASN B 2  40  ? -6.095  149.086 -14.388 1.00 64.71  ? 40  ASN B CG  1 
ATOM   3613  O  OD1 . ASN B 2  40  ? -5.862  150.080 -15.072 1.00 67.38  ? 40  ASN B OD1 1 
ATOM   3614  N  ND2 . ASN B 2  40  ? -6.122  149.122 -13.061 1.00 64.66  ? 40  ASN B ND2 1 
ATOM   3615  N  N   . TYR B 2  41  ? -4.490  149.068 -17.064 1.00 66.56  ? 41  TYR B N   1 
ATOM   3616  C  CA  . TYR B 2  41  ? -3.215  149.387 -17.666 1.00 71.06  ? 41  TYR B CA  1 
ATOM   3617  C  C   . TYR B 2  41  ? -1.994  148.764 -16.984 1.00 69.91  ? 41  TYR B C   1 
ATOM   3618  O  O   . TYR B 2  41  ? -1.089  148.268 -17.661 1.00 68.86  ? 41  TYR B O   1 
ATOM   3619  C  CB  . TYR B 2  41  ? -2.998  150.909 -17.661 1.00 75.75  ? 41  TYR B CB  1 
ATOM   3620  C  CG  . TYR B 2  41  ? -2.721  151.545 -16.320 1.00 79.89  ? 41  TYR B CG  1 
ATOM   3621  C  CD1 . TYR B 2  41  ? -3.769  151.941 -15.497 1.00 80.62  ? 41  TYR B CD1 1 
ATOM   3622  C  CD2 . TYR B 2  41  ? -1.422  151.776 -15.874 1.00 81.12  ? 41  TYR B CD2 1 
ATOM   3623  C  CE1 . TYR B 2  41  ? -3.543  152.535 -14.274 1.00 82.66  ? 41  TYR B CE1 1 
ATOM   3624  C  CE2 . TYR B 2  41  ? -1.184  152.372 -14.650 1.00 83.14  ? 41  TYR B CE2 1 
ATOM   3625  C  CZ  . TYR B 2  41  ? -2.245  152.751 -13.854 1.00 83.98  ? 41  TYR B CZ  1 
ATOM   3626  O  OH  . TYR B 2  41  ? -2.030  153.349 -12.634 1.00 84.14  ? 41  TYR B OH  1 
ATOM   3627  N  N   . ALA B 2  42  ? -1.974  148.842 -15.663 1.00 66.56  ? 42  ALA B N   1 
ATOM   3628  C  CA  . ALA B 2  42  ? -0.918  148.378 -14.800 1.00 60.68  ? 42  ALA B CA  1 
ATOM   3629  C  C   . ALA B 2  42  ? -0.720  146.862 -14.787 1.00 53.60  ? 42  ALA B C   1 
ATOM   3630  O  O   . ALA B 2  42  ? -1.616  146.125 -15.199 1.00 47.17  ? 42  ALA B O   1 
ATOM   3631  C  CB  . ALA B 2  42  ? -1.114  148.894 -13.380 1.00 63.64  ? 42  ALA B CB  1 
ATOM   3632  N  N   . PRO B 2  43  ? 0.457   146.452 -14.324 1.00 47.82  ? 43  PRO B N   1 
ATOM   3633  C  CA  . PRO B 2  43  ? 0.959   145.114 -14.300 1.00 43.96  ? 43  PRO B CA  1 
ATOM   3634  C  C   . PRO B 2  43  ? 0.331   144.141 -13.328 1.00 43.07  ? 43  PRO B C   1 
ATOM   3635  O  O   . PRO B 2  43  ? 0.804   142.997 -13.287 1.00 44.02  ? 43  PRO B O   1 
ATOM   3636  C  CB  . PRO B 2  43  ? 2.482   145.208 -14.009 1.00 42.99  ? 43  PRO B CB  1 
ATOM   3637  C  CG  . PRO B 2  43  ? 2.588   146.552 -13.355 1.00 44.23  ? 43  PRO B CG  1 
ATOM   3638  C  CD  . PRO B 2  43  ? 1.484   147.426 -13.880 1.00 47.86  ? 43  PRO B CD  1 
ATOM   3639  N  N   . ALA B 2  44  ? -0.681  144.468 -12.553 1.00 42.13  ? 44  ALA B N   1 
ATOM   3640  C  CA  . ALA B 2  44  ? -1.263  143.628 -11.519 1.00 34.13  ? 44  ALA B CA  1 
ATOM   3641  C  C   . ALA B 2  44  ? -2.620  143.042 -11.841 1.00 28.68  ? 44  ALA B C   1 
ATOM   3642  O  O   . ALA B 2  44  ? -3.619  143.799 -11.788 1.00 34.40  ? 44  ALA B O   1 
ATOM   3643  C  CB  . ALA B 2  44  ? -1.430  144.573 -10.288 1.00 40.58  ? 44  ALA B CB  1 
ATOM   3644  N  N   . SER B 2  45  ? -2.815  141.724 -11.972 1.00 20.01  ? 45  SER B N   1 
ATOM   3645  C  CA  . SER B 2  45  ? -4.225  141.260 -12.119 1.00 14.56  ? 45  SER B CA  1 
ATOM   3646  C  C   . SER B 2  45  ? -4.799  140.457 -10.969 1.00 8.61   ? 45  SER B C   1 
ATOM   3647  O  O   . SER B 2  45  ? -4.142  139.545 -10.485 1.00 2.35   ? 45  SER B O   1 
ATOM   3648  C  CB  . SER B 2  45  ? -4.350  140.533 -13.446 1.00 7.14   ? 45  SER B CB  1 
ATOM   3649  O  OG  . SER B 2  45  ? -3.890  139.208 -13.388 1.00 2.52   ? 45  SER B OG  1 
ATOM   3650  N  N   . ARG B 2  46  ? -6.000  140.647 -10.425 1.00 7.63   ? 46  ARG B N   1 
ATOM   3651  C  CA  . ARG B 2  46  ? -6.481  139.813 -9.299  1.00 2.20   ? 46  ARG B CA  1 
ATOM   3652  C  C   . ARG B 2  46  ? -7.898  139.277 -9.513  1.00 7.79   ? 46  ARG B C   1 
ATOM   3653  O  O   . ARG B 2  46  ? -8.910  139.975 -9.550  1.00 7.24   ? 46  ARG B O   1 
ATOM   3654  C  CB  . ARG B 2  46  ? -6.511  140.702 -8.058  1.00 8.93   ? 46  ARG B CB  1 
ATOM   3655  C  CG  . ARG B 2  46  ? -5.814  142.036 -8.067  1.00 13.07  ? 46  ARG B CG  1 
ATOM   3656  C  CD  . ARG B 2  46  ? -6.315  142.885 -6.912  1.00 24.67  ? 46  ARG B CD  1 
ATOM   3657  N  NE  . ARG B 2  46  ? -5.316  143.313 -5.938  1.00 28.46  ? 46  ARG B NE  1 
ATOM   3658  C  CZ  . ARG B 2  46  ? -5.570  143.274 -4.625  1.00 36.86  ? 46  ARG B CZ  1 
ATOM   3659  N  NH1 . ARG B 2  46  ? -6.727  142.811 -4.158  1.00 34.61  ? 46  ARG B NH1 1 
ATOM   3660  N  NH2 . ARG B 2  46  ? -4.656  143.701 -3.771  1.00 46.42  ? 46  ARG B NH2 1 
ATOM   3661  N  N   . ILE B 2  47  ? -8.042  137.964 -9.522  1.00 7.89   ? 47  ILE B N   1 
ATOM   3662  C  CA  . ILE B 2  47  ? -9.368  137.338 -9.581  1.00 12.16  ? 47  ILE B CA  1 
ATOM   3663  C  C   . ILE B 2  47  ? -9.852  137.037 -8.174  1.00 17.21  ? 47  ILE B C   1 
ATOM   3664  O  O   . ILE B 2  47  ? -9.107  137.183 -7.193  1.00 23.18  ? 47  ILE B O   1 
ATOM   3665  C  CB  . ILE B 2  47  ? -9.282  136.049 -10.418 1.00 10.91  ? 47  ILE B CB  1 
ATOM   3666  C  CG1 . ILE B 2  47  ? -8.497  136.352 -11.701 1.00 4.88   ? 47  ILE B CG1 1 
ATOM   3667  C  CG2 . ILE B 2  47  ? -10.621 135.384 -10.629 1.00 4.00   ? 47  ILE B CG2 1 
ATOM   3668  C  CD1 . ILE B 2  47  ? -9.161  136.029 -13.012 1.00 7.03   ? 47  ILE B CD1 1 
ATOM   3669  N  N   . GLY B 2  48  ? -11.133 136.742 -8.004  1.00 15.27  ? 48  GLY B N   1 
ATOM   3670  C  CA  . GLY B 2  48  ? -11.659 136.649 -6.652  1.00 15.98  ? 48  GLY B CA  1 
ATOM   3671  C  C   . GLY B 2  48  ? -13.109 136.193 -6.743  1.00 16.83  ? 48  GLY B C   1 
ATOM   3672  O  O   . GLY B 2  48  ? -13.990 136.998 -6.990  1.00 20.15  ? 48  GLY B O   1 
ATOM   3673  N  N   . LEU B 2  49  ? -13.298 134.889 -6.589  1.00 15.91  ? 49  LEU B N   1 
ATOM   3674  C  CA  . LEU B 2  49  ? -14.635 134.331 -6.644  1.00 11.06  ? 49  LEU B CA  1 
ATOM   3675  C  C   . LEU B 2  49  ? -15.365 134.581 -5.328  1.00 9.41   ? 49  LEU B C   1 
ATOM   3676  O  O   . LEU B 2  49  ? -14.881 134.087 -4.316  1.00 3.78   ? 49  LEU B O   1 
ATOM   3677  C  CB  . LEU B 2  49  ? -14.573 132.812 -6.864  1.00 12.24  ? 49  LEU B CB  1 
ATOM   3678  C  CG  . LEU B 2  49  ? -15.947 132.139 -6.699  1.00 19.25  ? 49  LEU B CG  1 
ATOM   3679  C  CD1 . LEU B 2  49  ? -16.957 132.779 -7.650  1.00 17.09  ? 49  LEU B CD1 1 
ATOM   3680  C  CD2 . LEU B 2  49  ? -15.894 130.649 -6.949  1.00 2.71   ? 49  LEU B CD2 1 
ATOM   3681  N  N   . PHE B 2  50  ? -16.474 135.304 -5.343  1.00 10.37  ? 50  PHE B N   1 
ATOM   3682  C  CA  . PHE B 2  50  ? -17.300 135.575 -4.104  1.00 14.51  ? 50  PHE B CA  1 
ATOM   3683  C  C   . PHE B 2  50  ? -18.358 134.590 -3.964  1.00 19.55  ? 50  PHE B C   1 
ATOM   3684  O  O   . PHE B 2  50  ? -19.370 134.728 -4.666  1.00 26.90  ? 50  PHE B O   1 
ATOM   3685  C  CB  . PHE B 2  50  ? -17.732 136.993 -4.015  1.00 7.12   ? 50  PHE B CB  1 
ATOM   3686  C  CG  . PHE B 2  50  ? -16.777 138.141 -3.982  1.00 5.75   ? 50  PHE B CG  1 
ATOM   3687  C  CD1 . PHE B 2  50  ? -16.022 138.481 -5.091  1.00 2.60   ? 50  PHE B CD1 1 
ATOM   3688  C  CD2 . PHE B 2  50  ? -16.608 138.949 -2.866  1.00 2.30   ? 50  PHE B CD2 1 
ATOM   3689  C  CE1 . PHE B 2  50  ? -15.155 139.561 -5.060  1.00 4.24   ? 50  PHE B CE1 1 
ATOM   3690  C  CE2 . PHE B 2  50  ? -15.788 140.054 -2.825  1.00 3.01   ? 50  PHE B CE2 1 
ATOM   3691  C  CZ  . PHE B 2  50  ? -15.019 140.337 -3.938  1.00 3.92   ? 50  PHE B CZ  1 
ATOM   3692  N  N   . ILE B 2  51  ? -18.262 133.594 -3.085  1.00 18.65  ? 51  ILE B N   1 
ATOM   3693  C  CA  . ILE B 2  51  ? -19.432 132.715 -2.907  1.00 15.29  ? 51  ILE B CA  1 
ATOM   3694  C  C   . ILE B 2  51  ? -20.332 133.240 -1.807  1.00 19.10  ? 51  ILE B C   1 
ATOM   3695  O  O   . ILE B 2  51  ? -19.864 133.685 -0.748  1.00 21.35  ? 51  ILE B O   1 
ATOM   3696  C  CB  . ILE B 2  51  ? -18.964 131.293 -2.596  1.00 9.36   ? 51  ILE B CB  1 
ATOM   3697  C  CG1 . ILE B 2  51  ? -17.715 130.927 -3.377  1.00 11.46  ? 51  ILE B CG1 1 
ATOM   3698  C  CG2 . ILE B 2  51  ? -20.132 130.347 -2.836  1.00 16.33  ? 51  ILE B CG2 1 
ATOM   3699  C  CD1 . ILE B 2  51  ? -17.184 129.527 -3.160  1.00 9.15   ? 51  ILE B CD1 1 
ATOM   3700  N  N   . LYS B 2  52  ? -21.651 133.144 -1.956  1.00 20.08  ? 52  LYS B N   1 
ATOM   3701  C  CA  . LYS B 2  52  ? -22.549 133.664 -0.956  1.00 27.15  ? 52  LYS B CA  1 
ATOM   3702  C  C   . LYS B 2  52  ? -22.592 133.006 0.394   1.00 28.50  ? 52  LYS B C   1 
ATOM   3703  O  O   . LYS B 2  52  ? -23.576 133.242 1.125   1.00 37.36  ? 52  LYS B O   1 
ATOM   3704  C  CB  . LYS B 2  52  ? -23.995 133.782 -1.461  1.00 27.37  ? 52  LYS B CB  1 
ATOM   3705  C  CG  . LYS B 2  52  ? -24.469 135.251 -1.491  1.00 23.30  ? 52  LYS B CG  1 
ATOM   3706  C  CD  . LYS B 2  52  ? -25.862 135.251 -2.065  1.00 18.13  ? 52  LYS B CD  1 
ATOM   3707  C  CE  . LYS B 2  52  ? -26.212 136.330 -3.049  1.00 11.82  ? 52  LYS B CE  1 
ATOM   3708  N  NZ  . LYS B 2  52  ? -27.465 137.031 -2.571  1.00 22.51  ? 52  LYS B NZ  1 
ATOM   3709  N  N   . ALA B 2  53  ? -21.625 132.229 0.837   1.00 28.19  ? 53  ALA B N   1 
ATOM   3710  C  CA  . ALA B 2  53  ? -21.752 131.692 2.195   1.00 26.73  ? 53  ALA B CA  1 
ATOM   3711  C  C   . ALA B 2  53  ? -21.089 132.517 3.278   1.00 24.38  ? 53  ALA B C   1 
ATOM   3712  O  O   . ALA B 2  53  ? -19.920 132.869 3.337   1.00 31.56  ? 53  ALA B O   1 
ATOM   3713  C  CB  . ALA B 2  53  ? -21.215 130.283 2.244   1.00 32.40  ? 53  ALA B CB  1 
ATOM   3714  N  N   . GLY B 2  54  ? -21.908 132.887 4.239   1.00 21.46  ? 54  GLY B N   1 
ATOM   3715  C  CA  . GLY B 2  54  ? -21.315 133.713 5.304   1.00 20.57  ? 54  GLY B CA  1 
ATOM   3716  C  C   . GLY B 2  54  ? -21.304 132.739 6.492   1.00 19.10  ? 54  GLY B C   1 
ATOM   3717  O  O   . GLY B 2  54  ? -21.715 131.594 6.309   1.00 17.13  ? 54  GLY B O   1 
ATOM   3718  N  N   . SER B 2  55  ? -21.191 133.372 7.647   1.00 18.11  ? 55  SER B N   1 
ATOM   3719  C  CA  . SER B 2  55  ? -21.334 132.621 8.887   1.00 13.70  ? 55  SER B CA  1 
ATOM   3720  C  C   . SER B 2  55  ? -22.812 132.435 9.181   1.00 10.47  ? 55  SER B C   1 
ATOM   3721  O  O   . SER B 2  55  ? -23.146 131.433 9.821   1.00 13.03  ? 55  SER B O   1 
ATOM   3722  C  CB  . SER B 2  55  ? -20.579 133.334 10.010  1.00 3.41   ? 55  SER B CB  1 
ATOM   3723  O  OG  . SER B 2  55  ? -21.374 134.314 10.642  1.00 13.71  ? 55  SER B OG  1 
ATOM   3724  N  N   . ARG B 2  56  ? -23.661 133.292 8.604   1.00 4.91   ? 56  ARG B N   1 
ATOM   3725  C  CA  . ARG B 2  56  ? -25.076 133.188 8.971   1.00 7.57   ? 56  ARG B CA  1 
ATOM   3726  C  C   . ARG B 2  56  ? -25.682 131.925 8.423   1.00 2.20   ? 56  ARG B C   1 
ATOM   3727  O  O   . ARG B 2  56  ? -26.781 131.527 8.864   1.00 7.40   ? 56  ARG B O   1 
ATOM   3728  C  CB  . ARG B 2  56  ? -25.836 134.423 8.526   1.00 14.04  ? 56  ARG B CB  1 
ATOM   3729  C  CG  . ARG B 2  56  ? -25.862 134.531 7.002   1.00 4.26   ? 56  ARG B CG  1 
ATOM   3730  C  CD  . ARG B 2  56  ? -27.323 134.637 6.551   1.00 6.02   ? 56  ARG B CD  1 
ATOM   3731  N  NE  . ARG B 2  56  ? -27.704 136.011 6.425   1.00 3.16   ? 56  ARG B NE  1 
ATOM   3732  C  CZ  . ARG B 2  56  ? -28.741 136.745 6.690   1.00 6.35   ? 56  ARG B CZ  1 
ATOM   3733  N  NH1 . ARG B 2  56  ? -29.852 136.316 7.208   1.00 3.23   ? 56  ARG B NH1 1 
ATOM   3734  N  NH2 . ARG B 2  56  ? -28.691 138.036 6.422   1.00 5.30   ? 56  ARG B NH2 1 
ATOM   3735  N  N   . TYR B 2  57  ? -24.970 131.249 7.522   1.00 7.60   ? 57  TYR B N   1 
ATOM   3736  C  CA  . TYR B 2  57  ? -25.400 130.000 6.964   1.00 13.03  ? 57  TYR B CA  1 
ATOM   3737  C  C   . TYR B 2  57  ? -25.215 128.759 7.787   1.00 14.57  ? 57  TYR B C   1 
ATOM   3738  O  O   . TYR B 2  57  ? -25.360 127.671 7.209   1.00 22.51  ? 57  TYR B O   1 
ATOM   3739  C  CB  . TYR B 2  57  ? -24.798 129.729 5.562   1.00 13.39  ? 57  TYR B CB  1 
ATOM   3740  C  CG  . TYR B 2  57  ? -25.302 130.839 4.668   1.00 13.79  ? 57  TYR B CG  1 
ATOM   3741  C  CD1 . TYR B 2  57  ? -26.556 130.781 4.100   1.00 13.96  ? 57  TYR B CD1 1 
ATOM   3742  C  CD2 . TYR B 2  57  ? -24.559 131.973 4.480   1.00 18.84  ? 57  TYR B CD2 1 
ATOM   3743  C  CE1 . TYR B 2  57  ? -27.032 131.813 3.327   1.00 7.62   ? 57  TYR B CE1 1 
ATOM   3744  C  CE2 . TYR B 2  57  ? -25.027 133.011 3.715   1.00 14.64  ? 57  TYR B CE2 1 
ATOM   3745  C  CZ  . TYR B 2  57  ? -26.264 132.922 3.147   1.00 9.17   ? 57  TYR B CZ  1 
ATOM   3746  O  OH  . TYR B 2  57  ? -26.684 133.997 2.418   1.00 16.25  ? 57  TYR B OH  1 
ATOM   3747  N  N   . GLU B 2  58  ? -24.882 128.821 9.059   1.00 16.42  ? 58  GLU B N   1 
ATOM   3748  C  CA  . GLU B 2  58  ? -24.750 127.532 9.753   1.00 23.16  ? 58  GLU B CA  1 
ATOM   3749  C  C   . GLU B 2  58  ? -25.897 127.413 10.747  1.00 26.13  ? 58  GLU B C   1 
ATOM   3750  O  O   . GLU B 2  58  ? -26.671 128.375 10.782  1.00 26.74  ? 58  GLU B O   1 
ATOM   3751  C  CB  . GLU B 2  58  ? -23.373 127.353 10.355  1.00 22.79  ? 58  GLU B CB  1 
ATOM   3752  C  CG  . GLU B 2  58  ? -22.272 128.197 9.759   1.00 21.04  ? 58  GLU B CG  1 
ATOM   3753  C  CD  . GLU B 2  58  ? -21.060 128.520 10.593  1.00 11.33  ? 58  GLU B CD  1 
ATOM   3754  O  OE1 . GLU B 2  58  ? -21.039 128.437 11.836  1.00 5.82   ? 58  GLU B OE1 1 
ATOM   3755  O  OE2 . GLU B 2  58  ? -19.989 128.923 10.058  1.00 7.33   ? 58  GLU B OE2 1 
ATOM   3756  N  N   . ASN B 2  59  ? -26.014 126.261 11.398  1.00 28.82  ? 59  ASN B N   1 
ATOM   3757  C  CA  . ASN B 2  59  ? -27.024 126.048 12.423  1.00 32.19  ? 59  ASN B CA  1 
ATOM   3758  C  C   . ASN B 2  59  ? -26.304 125.634 13.712  1.00 29.14  ? 59  ASN B C   1 
ATOM   3759  O  O   . ASN B 2  59  ? -25.085 125.507 13.635  1.00 32.71  ? 59  ASN B O   1 
ATOM   3760  C  CB  . ASN B 2  59  ? -28.027 124.960 12.072  1.00 49.23  ? 59  ASN B CB  1 
ATOM   3761  C  CG  . ASN B 2  59  ? -29.289 125.042 12.929  1.00 65.87  ? 59  ASN B CG  1 
ATOM   3762  O  OD1 . ASN B 2  59  ? -29.363 125.800 13.901  1.00 68.50  ? 59  ASN B OD1 1 
ATOM   3763  N  ND2 . ASN B 2  59  ? -30.311 124.252 12.589  1.00 72.37  ? 59  ASN B ND2 1 
ATOM   3764  N  N   . SER B 2  60  ? -27.045 125.396 14.762  1.00 23.00  ? 60  SER B N   1 
ATOM   3765  C  CA  . SER B 2  60  ? -26.573 124.923 16.051  1.00 14.17  ? 60  SER B CA  1 
ATOM   3766  C  C   . SER B 2  60  ? -25.634 123.748 15.871  1.00 10.08  ? 60  SER B C   1 
ATOM   3767  O  O   . SER B 2  60  ? -24.567 123.669 16.468  1.00 10.07  ? 60  SER B O   1 
ATOM   3768  C  CB  . SER B 2  60  ? -27.817 124.471 16.830  1.00 2.20   ? 60  SER B CB  1 
ATOM   3769  O  OG  . SER B 2  60  ? -28.823 125.449 16.581  1.00 15.47  ? 60  SER B OG  1 
ATOM   3770  N  N   . ASN B 2  61  ? -26.050 122.915 14.920  1.00 9.87   ? 61  ASN B N   1 
ATOM   3771  C  CA  . ASN B 2  61  ? -25.267 121.740 14.580  1.00 11.38  ? 61  ASN B CA  1 
ATOM   3772  C  C   . ASN B 2  61  ? -24.125 121.977 13.633  1.00 7.18   ? 61  ASN B C   1 
ATOM   3773  O  O   . ASN B 2  61  ? -23.189 121.191 13.496  1.00 13.48  ? 61  ASN B O   1 
ATOM   3774  C  CB  . ASN B 2  61  ? -26.250 120.681 14.088  1.00 17.50  ? 61  ASN B CB  1 
ATOM   3775  C  CG  . ASN B 2  61  ? -27.119 120.123 15.194  1.00 29.22  ? 61  ASN B CG  1 
ATOM   3776  O  OD1 . ASN B 2  61  ? -26.712 119.742 16.289  1.00 38.01  ? 61  ASN B OD1 1 
ATOM   3777  N  ND2 . ASN B 2  61  ? -28.421 120.025 14.948  1.00 38.12  ? 61  ASN B ND2 1 
ATOM   3778  N  N   . ASN B 2  62  ? -24.086 123.104 12.935  1.00 13.21  ? 62  ASN B N   1 
ATOM   3779  C  CA  . ASN B 2  62  ? -23.058 123.357 11.938  1.00 10.39  ? 62  ASN B CA  1 
ATOM   3780  C  C   . ASN B 2  62  ? -21.994 124.353 12.322  1.00 7.91   ? 62  ASN B C   1 
ATOM   3781  O  O   . ASN B 2  62  ? -20.867 124.429 11.817  1.00 6.92   ? 62  ASN B O   1 
ATOM   3782  C  CB  . ASN B 2  62  ? -23.751 123.759 10.599  1.00 3.24   ? 62  ASN B CB  1 
ATOM   3783  C  CG  . ASN B 2  62  ? -22.772 123.357 9.509   1.00 19.86  ? 62  ASN B CG  1 
ATOM   3784  O  OD1 . ASN B 2  62  ? -23.086 123.181 8.350   1.00 30.42  ? 62  ASN B OD1 1 
ATOM   3785  N  ND2 . ASN B 2  62  ? -21.508 123.197 9.913   1.00 33.19  ? 62  ASN B ND2 1 
ATOM   3786  N  N   . LEU B 2  63  ? -22.289 125.140 13.348  1.00 7.77   ? 63  LEU B N   1 
ATOM   3787  C  CA  . LEU B 2  63  ? -21.443 126.237 13.754  1.00 7.53   ? 63  LEU B CA  1 
ATOM   3788  C  C   . LEU B 2  63  ? -19.965 125.944 13.692  1.00 7.53   ? 63  LEU B C   1 
ATOM   3789  O  O   . LEU B 2  63  ? -19.421 124.966 14.161  1.00 2.20   ? 63  LEU B O   1 
ATOM   3790  C  CB  . LEU B 2  63  ? -21.842 126.811 15.093  1.00 4.38   ? 63  LEU B CB  1 
ATOM   3791  C  CG  . LEU B 2  63  ? -23.276 127.297 15.265  1.00 6.80   ? 63  LEU B CG  1 
ATOM   3792  C  CD1 . LEU B 2  63  ? -23.534 127.551 16.737  1.00 8.78   ? 63  LEU B CD1 1 
ATOM   3793  C  CD2 . LEU B 2  63  ? -23.560 128.550 14.470  1.00 9.44   ? 63  LEU B CD2 1 
ATOM   3794  N  N   . GLY B 2  64  ? -19.180 126.867 13.111  1.00 7.78   ? 64  GLY B N   1 
ATOM   3795  C  CA  . GLY B 2  64  ? -17.732 126.716 13.060  1.00 6.44   ? 64  GLY B CA  1 
ATOM   3796  C  C   . GLY B 2  64  ? -17.261 126.106 11.770  1.00 5.29   ? 64  GLY B C   1 
ATOM   3797  O  O   . GLY B 2  64  ? -16.128 125.680 11.569  1.00 2.25   ? 64  GLY B O   1 
ATOM   3798  N  N   . THR B 2  65  ? -18.190 125.877 10.838  1.00 4.90   ? 65  THR B N   1 
ATOM   3799  C  CA  . THR B 2  65  ? -17.713 125.185 9.636   1.00 5.57   ? 65  THR B CA  1 
ATOM   3800  C  C   . THR B 2  65  ? -17.167 126.206 8.644   1.00 2.20   ? 65  THR B C   1 
ATOM   3801  O  O   . THR B 2  65  ? -16.087 126.031 8.114   1.00 7.44   ? 65  THR B O   1 
ATOM   3802  C  CB  . THR B 2  65  ? -18.814 124.308 9.048   1.00 2.52   ? 65  THR B CB  1 
ATOM   3803  O  OG1 . THR B 2  65  ? -19.066 123.275 10.021  1.00 3.18   ? 65  THR B OG1 1 
ATOM   3804  C  CG2 . THR B 2  65  ? -18.205 123.706 7.786   1.00 3.74   ? 65  THR B CG2 1 
ATOM   3805  N  N   . SER B 2  66  ? -17.900 127.319 8.606   1.00 5.52   ? 66  SER B N   1 
ATOM   3806  C  CA  . SER B 2  66  ? -17.413 128.366 7.717   1.00 2.28   ? 66  SER B CA  1 
ATOM   3807  C  C   . SER B 2  66  ? -15.939 128.617 8.046   1.00 6.75   ? 66  SER B C   1 
ATOM   3808  O  O   . SER B 2  66  ? -15.037 128.355 7.271   1.00 9.07   ? 66  SER B O   1 
ATOM   3809  C  CB  . SER B 2  66  ? -18.220 129.644 7.910   1.00 2.61   ? 66  SER B CB  1 
ATOM   3810  O  OG  . SER B 2  66  ? -17.318 130.679 8.295   1.00 15.18  ? 66  SER B OG  1 
ATOM   3811  N  N   . HIS B 2  67  ? -15.667 128.989 9.278   1.00 2.73   ? 67  HIS B N   1 
ATOM   3812  C  CA  . HIS B 2  67  ? -14.329 129.245 9.766   1.00 6.85   ? 67  HIS B CA  1 
ATOM   3813  C  C   . HIS B 2  67  ? -13.341 128.162 9.385   1.00 4.73   ? 67  HIS B C   1 
ATOM   3814  O  O   . HIS B 2  67  ? -12.175 128.437 9.081   1.00 3.17   ? 67  HIS B O   1 
ATOM   3815  C  CB  . HIS B 2  67  ? -14.380 129.397 11.292  1.00 13.61  ? 67  HIS B CB  1 
ATOM   3816  C  CG  . HIS B 2  67  ? -13.102 129.852 11.924  1.00 11.64  ? 67  HIS B CG  1 
ATOM   3817  N  ND1 . HIS B 2  67  ? -12.751 131.160 12.100  1.00 11.44  ? 67  HIS B ND1 1 
ATOM   3818  C  CD2 . HIS B 2  67  ? -12.077 129.146 12.439  1.00 13.70  ? 67  HIS B CD2 1 
ATOM   3819  C  CE1 . HIS B 2  67  ? -11.569 131.240 12.679  1.00 11.60  ? 67  HIS B CE1 1 
ATOM   3820  N  NE2 . HIS B 2  67  ? -11.135 130.021 12.885  1.00 13.07  ? 67  HIS B NE2 1 
ATOM   3821  N  N   . LEU B 2  68  ? -13.710 126.887 9.504   1.00 3.81   ? 68  LEU B N   1 
ATOM   3822  C  CA  . LEU B 2  68  ? -12.630 125.891 9.252   1.00 5.08   ? 68  LEU B CA  1 
ATOM   3823  C  C   . LEU B 2  68  ? -12.313 125.777 7.775   1.00 2.20   ? 68  LEU B C   1 
ATOM   3824  O  O   . LEU B 2  68  ? -11.157 125.783 7.344   1.00 6.81   ? 68  LEU B O   1 
ATOM   3825  C  CB  . LEU B 2  68  ? -12.939 124.576 9.931   1.00 3.92   ? 68  LEU B CB  1 
ATOM   3826  C  CG  . LEU B 2  68  ? -12.246 123.326 9.416   1.00 9.16   ? 68  LEU B CG  1 
ATOM   3827  C  CD1 . LEU B 2  68  ? -10.778 123.291 9.843   1.00 4.80   ? 68  LEU B CD1 1 
ATOM   3828  C  CD2 . LEU B 2  68  ? -13.008 122.068 9.841   1.00 3.77   ? 68  LEU B CD2 1 
ATOM   3829  N  N   . LEU B 2  69  ? -13.352 125.936 6.975   1.00 5.26   ? 69  LEU B N   1 
ATOM   3830  C  CA  . LEU B 2  69  ? -13.234 125.951 5.526   1.00 4.97   ? 69  LEU B CA  1 
ATOM   3831  C  C   . LEU B 2  69  ? -12.331 127.085 5.072   1.00 2.20   ? 69  LEU B C   1 
ATOM   3832  O  O   . LEU B 2  69  ? -11.251 126.743 4.596   1.00 7.78   ? 69  LEU B O   1 
ATOM   3833  C  CB  . LEU B 2  69  ? -14.641 126.036 4.986   1.00 10.90  ? 69  LEU B CB  1 
ATOM   3834  C  CG  . LEU B 2  69  ? -14.913 126.142 3.496   1.00 4.01   ? 69  LEU B CG  1 
ATOM   3835  C  CD1 . LEU B 2  69  ? -14.371 124.937 2.782   1.00 2.73   ? 69  LEU B CD1 1 
ATOM   3836  C  CD2 . LEU B 2  69  ? -16.414 126.323 3.296   1.00 2.72   ? 69  LEU B CD2 1 
ATOM   3837  N  N   . ARG B 2  70  ? -12.475 128.289 5.614   1.00 2.20   ? 70  ARG B N   1 
ATOM   3838  C  CA  . ARG B 2  70  ? -11.691 129.492 5.383   1.00 2.88   ? 70  ARG B CA  1 
ATOM   3839  C  C   . ARG B 2  70  ? -10.213 129.267 5.640   1.00 3.74   ? 70  ARG B C   1 
ATOM   3840  O  O   . ARG B 2  70  ? -9.305  129.753 4.965   1.00 5.70   ? 70  ARG B O   1 
ATOM   3841  C  CB  . ARG B 2  70  ? -12.170 130.665 6.245   1.00 7.25   ? 70  ARG B CB  1 
ATOM   3842  C  CG  . ARG B 2  70  ? -11.432 131.968 6.027   1.00 9.04   ? 70  ARG B CG  1 
ATOM   3843  C  CD  . ARG B 2  70  ? -11.748 133.082 6.988   1.00 3.31   ? 70  ARG B CD  1 
ATOM   3844  N  NE  . ARG B 2  70  ? -12.722 132.893 8.019   1.00 5.40   ? 70  ARG B NE  1 
ATOM   3845  C  CZ  . ARG B 2  70  ? -12.755 133.372 9.248   1.00 6.30   ? 70  ARG B CZ  1 
ATOM   3846  N  NH1 . ARG B 2  70  ? -11.797 134.113 9.781   1.00 3.96   ? 70  ARG B NH1 1 
ATOM   3847  N  NH2 . ARG B 2  70  ? -13.817 133.094 10.021  1.00 12.05  ? 70  ARG B NH2 1 
ATOM   3848  N  N   . LEU B 2  71  ? -9.967  128.444 6.665   1.00 5.69   ? 71  LEU B N   1 
ATOM   3849  C  CA  . LEU B 2  71  ? -8.582  128.126 6.999   1.00 2.42   ? 71  LEU B CA  1 
ATOM   3850  C  C   . LEU B 2  71  ? -8.114  126.910 6.192   1.00 6.74   ? 71  LEU B C   1 
ATOM   3851  O  O   . LEU B 2  71  ? -6.953  126.502 6.188   1.00 6.01   ? 71  LEU B O   1 
ATOM   3852  C  CB  . LEU B 2  71  ? -8.496  127.721 8.465   1.00 2.65   ? 71  LEU B CB  1 
ATOM   3853  C  CG  . LEU B 2  71  ? -8.681  128.838 9.498   1.00 6.57   ? 71  LEU B CG  1 
ATOM   3854  C  CD1 . LEU B 2  71  ? -8.015  128.267 10.740  1.00 2.20   ? 71  LEU B CD1 1 
ATOM   3855  C  CD2 . LEU B 2  71  ? -7.969  130.105 9.039   1.00 5.53   ? 71  LEU B CD2 1 
ATOM   3856  N  N   . ALA B 2  72  ? -9.068  126.247 5.563   1.00 2.20   ? 72  ALA B N   1 
ATOM   3857  C  CA  . ALA B 2  72  ? -8.821  125.024 4.836   1.00 2.70   ? 72  ALA B CA  1 
ATOM   3858  C  C   . ALA B 2  72  ? -8.463  125.113 3.358   1.00 8.58   ? 72  ALA B C   1 
ATOM   3859  O  O   . ALA B 2  72  ? -8.568  124.115 2.611   1.00 8.06   ? 72  ALA B O   1 
ATOM   3860  C  CB  . ALA B 2  72  ? -10.063 124.143 4.989   1.00 3.20   ? 72  ALA B CB  1 
ATOM   3861  N  N   . SER B 2  73  ? -7.984  126.250 2.867   1.00 5.74   ? 73  SER B N   1 
ATOM   3862  C  CA  . SER B 2  73  ? -7.929  126.521 1.451   1.00 4.90   ? 73  SER B CA  1 
ATOM   3863  C  C   . SER B 2  73  ? -6.717  126.027 0.717   1.00 3.56   ? 73  SER B C   1 
ATOM   3864  O  O   . SER B 2  73  ? -6.676  126.185 -0.501  1.00 5.97   ? 73  SER B O   1 
ATOM   3865  C  CB  . SER B 2  73  ? -8.054  128.028 1.255   1.00 5.21   ? 73  SER B CB  1 
ATOM   3866  O  OG  . SER B 2  73  ? -6.851  128.566 0.747   1.00 3.62   ? 73  SER B OG  1 
ATOM   3867  N  N   . SER B 2  74  ? -5.759  125.416 1.404   1.00 6.36   ? 74  SER B N   1 
ATOM   3868  C  CA  . SER B 2  74  ? -4.573  124.894 0.720   1.00 5.31   ? 74  SER B CA  1 
ATOM   3869  C  C   . SER B 2  74  ? -4.469  123.386 0.929   1.00 7.78   ? 74  SER B C   1 
ATOM   3870  O  O   . SER B 2  74  ? -3.323  122.902 0.923   1.00 9.24   ? 74  SER B O   1 
ATOM   3871  C  CB  . SER B 2  74  ? -3.292  125.535 1.282   1.00 5.49   ? 74  SER B CB  1 
ATOM   3872  O  OG  . SER B 2  74  ? -3.663  126.322 2.403   1.00 11.93  ? 74  SER B OG  1 
ATOM   3873  N  N   . LEU B 2  75  ? -5.606  122.727 1.183   1.00 6.25   ? 75  LEU B N   1 
ATOM   3874  C  CA  . LEU B 2  75  ? -5.556  121.285 1.331   1.00 3.46   ? 75  LEU B CA  1 
ATOM   3875  C  C   . LEU B 2  75  ? -5.794  120.648 -0.049  1.00 4.74   ? 75  LEU B C   1 
ATOM   3876  O  O   . LEU B 2  75  ? -6.350  121.272 -0.939  1.00 8.01   ? 75  LEU B O   1 
ATOM   3877  C  CB  . LEU B 2  75  ? -6.549  120.629 2.247   1.00 2.20   ? 75  LEU B CB  1 
ATOM   3878  C  CG  . LEU B 2  75  ? -6.806  121.399 3.554   1.00 3.27   ? 75  LEU B CG  1 
ATOM   3879  C  CD1 . LEU B 2  75  ? -8.152  121.202 4.221   1.00 2.20   ? 75  LEU B CD1 1 
ATOM   3880  C  CD2 . LEU B 2  75  ? -5.636  121.132 4.489   1.00 2.50   ? 75  LEU B CD2 1 
ATOM   3881  N  N   . THR B 2  76  ? -5.462  119.371 -0.081  1.00 6.25   ? 76  THR B N   1 
ATOM   3882  C  CA  . THR B 2  76  ? -5.518  118.614 -1.311  1.00 9.02   ? 76  THR B CA  1 
ATOM   3883  C  C   . THR B 2  76  ? -6.911  118.737 -1.921  1.00 12.10  ? 76  THR B C   1 
ATOM   3884  O  O   . THR B 2  76  ? -7.904  118.724 -1.190  1.00 14.32  ? 76  THR B O   1 
ATOM   3885  C  CB  . THR B 2  76  ? -5.172  117.133 -1.080  1.00 7.56   ? 76  THR B CB  1 
ATOM   3886  O  OG1 . THR B 2  76  ? -3.764  116.914 -1.037  1.00 6.36   ? 76  THR B OG1 1 
ATOM   3887  C  CG2 . THR B 2  76  ? -5.756  116.358 -2.252  1.00 9.97   ? 76  THR B CG2 1 
ATOM   3888  N  N   . THR B 2  77  ? -6.996  118.951 -3.219  1.00 13.84  ? 77  THR B N   1 
ATOM   3889  C  CA  . THR B 2  77  ? -8.271  119.010 -3.933  1.00 12.64  ? 77  THR B CA  1 
ATOM   3890  C  C   . THR B 2  77  ? -8.048  118.152 -5.187  1.00 10.57  ? 77  THR B C   1 
ATOM   3891  O  O   . THR B 2  77  ? -6.909  117.805 -5.399  1.00 13.09  ? 77  THR B O   1 
ATOM   3892  C  CB  . THR B 2  77  ? -8.676  120.407 -4.403  1.00 8.70   ? 77  THR B CB  1 
ATOM   3893  O  OG1 . THR B 2  77  ? -7.606  120.741 -5.312  1.00 8.39   ? 77  THR B OG1 1 
ATOM   3894  C  CG2 . THR B 2  77  ? -8.707  121.426 -3.280  1.00 2.20   ? 77  THR B CG2 1 
ATOM   3895  N  N   . LYS B 2  78  ? -9.078  117.831 -5.907  1.00 12.25  ? 78  LYS B N   1 
ATOM   3896  C  CA  . LYS B 2  78  ? -9.088  116.912 -7.018  1.00 14.26  ? 78  LYS B CA  1 
ATOM   3897  C  C   . LYS B 2  78  ? -7.932  116.999 -7.976  1.00 6.65   ? 78  LYS B C   1 
ATOM   3898  O  O   . LYS B 2  78  ? -7.283  115.998 -8.260  1.00 5.87   ? 78  LYS B O   1 
ATOM   3899  C  CB  . LYS B 2  78  ? -10.421 116.964 -7.783  1.00 35.64  ? 78  LYS B CB  1 
ATOM   3900  C  CG  . LYS B 2  78  ? -10.583 115.996 -8.938  1.00 44.89  ? 78  LYS B CG  1 
ATOM   3901  C  CD  . LYS B 2  78  ? -10.663 116.705 -10.284 1.00 52.36  ? 78  LYS B CD  1 
ATOM   3902  C  CE  . LYS B 2  78  ? -10.135 115.809 -11.395 1.00 58.78  ? 78  LYS B CE  1 
ATOM   3903  N  NZ  . LYS B 2  78  ? -8.703  115.425 -11.210 1.00 60.30  ? 78  LYS B NZ  1 
ATOM   3904  N  N   . GLY B 2  79  ? -7.730  118.130 -8.643  1.00 7.11   ? 79  GLY B N   1 
ATOM   3905  C  CA  . GLY B 2  79  ? -6.627  118.270 -9.585  1.00 6.71   ? 79  GLY B CA  1 
ATOM   3906  C  C   . GLY B 2  79  ? -5.333  118.783 -8.994  1.00 2.20   ? 79  GLY B C   1 
ATOM   3907  O  O   . GLY B 2  79  ? -4.282  118.872 -9.620  1.00 7.47   ? 79  GLY B O   1 
ATOM   3908  N  N   . ALA B 2  80  ? -5.318  119.330 -7.757  1.00 6.57   ? 80  ALA B N   1 
ATOM   3909  C  CA  . ALA B 2  80  ? -4.089  119.827 -7.155  1.00 10.76  ? 80  ALA B CA  1 
ATOM   3910  C  C   . ALA B 2  80  ? -3.813  119.383 -5.726  1.00 13.15  ? 80  ALA B C   1 
ATOM   3911  O  O   . ALA B 2  80  ? -4.603  119.462 -4.788  1.00 12.32  ? 80  ALA B O   1 
ATOM   3912  C  CB  . ALA B 2  80  ? -4.000  121.342 -7.145  1.00 2.20   ? 80  ALA B CB  1 
ATOM   3913  N  N   . SER B 2  81  ? -2.592  118.888 -5.478  1.00 15.67  ? 81  SER B N   1 
ATOM   3914  C  CA  . SER B 2  81  ? -2.298  118.472 -4.101  1.00 11.01  ? 81  SER B CA  1 
ATOM   3915  C  C   . SER B 2  81  ? -1.899  119.760 -3.367  1.00 10.65  ? 81  SER B C   1 
ATOM   3916  O  O   . SER B 2  81  ? -1.288  120.647 -3.955  1.00 8.60   ? 81  SER B O   1 
ATOM   3917  C  CB  . SER B 2  81  ? -1.140  117.489 -4.005  1.00 6.09   ? 81  SER B CB  1 
ATOM   3918  O  OG  . SER B 2  81  ? -0.074  117.928 -4.839  1.00 6.14   ? 81  SER B OG  1 
ATOM   3919  N  N   . SER B 2  82  ? -2.010  119.656 -2.051  1.00 12.74  ? 82  SER B N   1 
ATOM   3920  C  CA  . SER B 2  82  ? -1.786  120.758 -1.135  1.00 10.01  ? 82  SER B CA  1 
ATOM   3921  C  C   . SER B 2  82  ? -0.374  121.298 -1.341  1.00 2.31   ? 82  SER B C   1 
ATOM   3922  O  O   . SER B 2  82  ? -0.212  122.499 -1.182  1.00 7.66   ? 82  SER B O   1 
ATOM   3923  C  CB  . SER B 2  82  ? -2.113  120.460 0.300   1.00 5.67   ? 82  SER B CB  1 
ATOM   3924  O  OG  . SER B 2  82  ? -1.047  120.073 1.121   1.00 24.79  ? 82  SER B OG  1 
ATOM   3925  N  N   . PHE B 2  83  ? 0.550   120.416 -1.663  1.00 7.97   ? 83  PHE B N   1 
ATOM   3926  C  CA  . PHE B 2  83  ? 1.912   120.800 -1.987  1.00 7.55   ? 83  PHE B CA  1 
ATOM   3927  C  C   . PHE B 2  83  ? 1.984   121.625 -3.270  1.00 10.63  ? 83  PHE B C   1 
ATOM   3928  O  O   . PHE B 2  83  ? 2.374   122.799 -3.215  1.00 13.83  ? 83  PHE B O   1 
ATOM   3929  C  CB  . PHE B 2  83  ? 2.671   119.488 -2.270  1.00 13.87  ? 83  PHE B CB  1 
ATOM   3930  C  CG  . PHE B 2  83  ? 4.130   119.857 -2.361  1.00 18.20  ? 83  PHE B CG  1 
ATOM   3931  C  CD1 . PHE B 2  83  ? 4.674   120.254 -3.564  1.00 15.78  ? 83  PHE B CD1 1 
ATOM   3932  C  CD2 . PHE B 2  83  ? 4.873   119.835 -1.200  1.00 16.98  ? 83  PHE B CD2 1 
ATOM   3933  C  CE1 . PHE B 2  83  ? 6.009   120.613 -3.595  1.00 2.20   ? 83  PHE B CE1 1 
ATOM   3934  C  CE2 . PHE B 2  83  ? 6.199   120.201 -1.242  1.00 17.23  ? 83  PHE B CE2 1 
ATOM   3935  C  CZ  . PHE B 2  83  ? 6.753   120.585 -2.444  1.00 17.25  ? 83  PHE B CZ  1 
ATOM   3936  N  N   . LYS B 2  84  ? 1.425   121.051 -4.346  1.00 7.18   ? 84  LYS B N   1 
ATOM   3937  C  CA  . LYS B 2  84  ? 1.379   121.766 -5.600  1.00 4.81   ? 84  LYS B CA  1 
ATOM   3938  C  C   . LYS B 2  84  ? 0.689   123.117 -5.478  1.00 4.22   ? 84  LYS B C   1 
ATOM   3939  O  O   . LYS B 2  84  ? 1.105   124.153 -5.997  1.00 4.44   ? 84  LYS B O   1 
ATOM   3940  C  CB  . LYS B 2  84  ? 0.741   120.978 -6.750  1.00 7.86   ? 84  LYS B CB  1 
ATOM   3941  C  CG  . LYS B 2  84  ? 0.564   121.959 -7.920  1.00 4.85   ? 84  LYS B CG  1 
ATOM   3942  C  CD  . LYS B 2  84  ? 0.770   121.302 -9.262  1.00 10.92  ? 84  LYS B CD  1 
ATOM   3943  C  CE  . LYS B 2  84  ? 0.024   121.997 -10.389 1.00 16.53  ? 84  LYS B CE  1 
ATOM   3944  N  NZ  . LYS B 2  84  ? -0.824  121.044 -11.169 1.00 14.91  ? 84  LYS B NZ  1 
ATOM   3945  N  N   . ILE B 2  85  ? -0.458  123.163 -4.793  1.00 2.95   ? 85  ILE B N   1 
ATOM   3946  C  CA  . ILE B 2  85  ? -1.137  124.445 -4.648  1.00 5.97   ? 85  ILE B CA  1 
ATOM   3947  C  C   . ILE B 2  85  ? -0.245  125.507 -4.019  1.00 8.39   ? 85  ILE B C   1 
ATOM   3948  O  O   . ILE B 2  85  ? -0.165  126.677 -4.384  1.00 5.52   ? 85  ILE B O   1 
ATOM   3949  C  CB  . ILE B 2  85  ? -2.354  124.272 -3.710  1.00 6.40   ? 85  ILE B CB  1 
ATOM   3950  C  CG1 . ILE B 2  85  ? -3.402  123.400 -4.372  1.00 5.17   ? 85  ILE B CG1 1 
ATOM   3951  C  CG2 . ILE B 2  85  ? -2.900  125.643 -3.344  1.00 4.49   ? 85  ILE B CG2 1 
ATOM   3952  C  CD1 . ILE B 2  85  ? -4.753  123.509 -3.714  1.00 2.57   ? 85  ILE B CD1 1 
ATOM   3953  N  N   . THR B 2  86  ? 0.347   125.169 -2.869  1.00 11.40  ? 86  THR B N   1 
ATOM   3954  C  CA  . THR B 2  86  ? 1.164   126.121 -2.148  1.00 10.61  ? 86  THR B CA  1 
ATOM   3955  C  C   . THR B 2  86  ? 2.401   126.494 -2.970  1.00 6.91   ? 86  THR B C   1 
ATOM   3956  O  O   . THR B 2  86  ? 2.660   127.647 -3.278  1.00 3.33   ? 86  THR B O   1 
ATOM   3957  C  CB  . THR B 2  86  ? 1.728   125.708 -0.779  1.00 16.74  ? 86  THR B CB  1 
ATOM   3958  O  OG1 . THR B 2  86  ? 1.125   124.566 -0.209  1.00 27.27  ? 86  THR B OG1 1 
ATOM   3959  C  CG2 . THR B 2  86  ? 1.671   126.891 0.193   1.00 3.53   ? 86  THR B CG2 1 
ATOM   3960  N  N   . ARG B 2  87  ? 3.195   125.460 -3.260  1.00 7.42   ? 87  ARG B N   1 
ATOM   3961  C  CA  . ARG B 2  87  ? 4.417   125.671 -4.032  1.00 3.48   ? 87  ARG B CA  1 
ATOM   3962  C  C   . ARG B 2  87  ? 4.221   126.344 -5.396  1.00 2.61   ? 87  ARG B C   1 
ATOM   3963  O  O   . ARG B 2  87  ? 5.092   127.152 -5.706  1.00 3.24   ? 87  ARG B O   1 
ATOM   3964  C  CB  . ARG B 2  87  ? 5.099   124.331 -4.258  1.00 2.90   ? 87  ARG B CB  1 
ATOM   3965  C  CG  . ARG B 2  87  ? 5.520   123.703 -2.955  1.00 2.58   ? 87  ARG B CG  1 
ATOM   3966  C  CD  . ARG B 2  87  ? 6.809   124.310 -2.424  1.00 11.68  ? 87  ARG B CD  1 
ATOM   3967  N  NE  . ARG B 2  87  ? 7.183   123.590 -1.216  1.00 30.77  ? 87  ARG B NE  1 
ATOM   3968  C  CZ  . ARG B 2  87  ? 8.401   123.445 -0.715  1.00 37.52  ? 87  ARG B CZ  1 
ATOM   3969  N  NH1 . ARG B 2  87  ? 9.398   124.014 -1.374  1.00 28.50  ? 87  ARG B NH1 1 
ATOM   3970  N  NH2 . ARG B 2  87  ? 8.620   122.764 0.413   1.00 43.06  ? 87  ARG B NH2 1 
ATOM   3971  N  N   . GLY B 2  88  ? 3.228   125.910 -6.129  1.00 4.96   ? 88  GLY B N   1 
ATOM   3972  C  CA  . GLY B 2  88  ? 2.682   126.571 -7.257  1.00 3.51   ? 88  GLY B CA  1 
ATOM   3973  C  C   . GLY B 2  88  ? 2.668   128.080 -7.045  1.00 6.66   ? 88  GLY B C   1 
ATOM   3974  O  O   . GLY B 2  88  ? 3.545   128.836 -7.489  1.00 7.87   ? 88  GLY B O   1 
ATOM   3975  N  N   . ILE B 2  89  ? 1.669   128.522 -6.286  1.00 3.53   ? 89  ILE B N   1 
ATOM   3976  C  CA  . ILE B 2  89  ? 1.560   129.986 -6.086  1.00 6.55   ? 89  ILE B CA  1 
ATOM   3977  C  C   . ILE B 2  89  ? 2.883   130.632 -5.698  1.00 2.20   ? 89  ILE B C   1 
ATOM   3978  O  O   . ILE B 2  89  ? 3.226   131.653 -6.272  1.00 9.88   ? 89  ILE B O   1 
ATOM   3979  C  CB  . ILE B 2  89  ? 0.435   130.245 -5.073  1.00 2.20   ? 89  ILE B CB  1 
ATOM   3980  C  CG1 . ILE B 2  89  ? -0.758  129.458 -5.637  1.00 2.20   ? 89  ILE B CG1 1 
ATOM   3981  C  CG2 . ILE B 2  89  ? 0.029   131.701 -5.044  1.00 5.27   ? 89  ILE B CG2 1 
ATOM   3982  C  CD1 . ILE B 2  89  ? -2.014  129.583 -4.772  1.00 3.81   ? 89  ILE B CD1 1 
ATOM   3983  N  N   . GLU B 2  90  ? 3.644   129.926 -4.886  1.00 4.29   ? 90  GLU B N   1 
ATOM   3984  C  CA  . GLU B 2  90  ? 4.941   130.518 -4.522  1.00 13.24  ? 90  GLU B CA  1 
ATOM   3985  C  C   . GLU B 2  90  ? 5.792   130.690 -5.760  1.00 11.34  ? 90  GLU B C   1 
ATOM   3986  O  O   . GLU B 2  90  ? 6.155   131.824 -6.124  1.00 9.90   ? 90  GLU B O   1 
ATOM   3987  C  CB  . GLU B 2  90  ? 5.587   129.734 -3.391  1.00 22.99  ? 90  GLU B CB  1 
ATOM   3988  C  CG  . GLU B 2  90  ? 4.837   129.960 -2.065  1.00 22.53  ? 90  GLU B CG  1 
ATOM   3989  C  CD  . GLU B 2  90  ? 5.491   129.193 -0.939  1.00 27.36  ? 90  GLU B CD  1 
ATOM   3990  O  OE1 . GLU B 2  90  ? 6.607   128.689 -1.177  1.00 28.87  ? 90  GLU B OE1 1 
ATOM   3991  O  OE2 . GLU B 2  90  ? 4.897   129.098 0.152   1.00 35.25  ? 90  GLU B OE2 1 
ATOM   3992  N  N   . ALA B 2  91  ? 5.795   129.670 -6.611  1.00 8.11   ? 91  ALA B N   1 
ATOM   3993  C  CA  . ALA B 2  91  ? 6.647   129.644 -7.793  1.00 2.20   ? 91  ALA B CA  1 
ATOM   3994  C  C   . ALA B 2  91  ? 6.576   130.970 -8.556  1.00 6.36   ? 91  ALA B C   1 
ATOM   3995  O  O   . ALA B 2  91  ? 7.527   131.425 -9.195  1.00 5.55   ? 91  ALA B O   1 
ATOM   3996  C  CB  . ALA B 2  91  ? 6.173   128.481 -8.662  1.00 3.14   ? 91  ALA B CB  1 
ATOM   3997  N  N   . VAL B 2  92  ? 5.411   131.579 -8.524  1.00 7.89   ? 92  VAL B N   1 
ATOM   3998  C  CA  . VAL B 2  92  ? 4.983   132.757 -9.211  1.00 2.20   ? 92  VAL B CA  1 
ATOM   3999  C  C   . VAL B 2  92  ? 4.822   133.996 -8.366  1.00 2.20   ? 92  VAL B C   1 
ATOM   4000  O  O   . VAL B 2  92  ? 4.695   135.115 -8.867  1.00 8.04   ? 92  VAL B O   1 
ATOM   4001  C  CB  . VAL B 2  92  ? 3.720   132.390 -10.012 1.00 8.64   ? 92  VAL B CB  1 
ATOM   4002  C  CG1 . VAL B 2  92  ? 2.879   133.573 -10.394 1.00 14.62  ? 92  VAL B CG1 1 
ATOM   4003  C  CG2 . VAL B 2  92  ? 4.116   131.497 -11.180 1.00 2.27   ? 92  VAL B CG2 1 
ATOM   4004  N  N   . GLY B 2  93  ? 4.950   133.881 -7.047  1.00 5.49   ? 93  GLY B N   1 
ATOM   4005  C  CA  . GLY B 2  93  ? 4.879   135.093 -6.232  1.00 2.20   ? 93  GLY B CA  1 
ATOM   4006  C  C   . GLY B 2  93  ? 3.455   135.564 -6.042  1.00 6.01   ? 93  GLY B C   1 
ATOM   4007  O  O   . GLY B 2  93  ? 3.157   136.737 -5.789  1.00 4.83   ? 93  GLY B O   1 
ATOM   4008  N  N   . GLY B 2  94  ? 2.541   134.584 -6.028  1.00 7.62   ? 94  GLY B N   1 
ATOM   4009  C  CA  . GLY B 2  94  ? 1.122   134.940 -5.928  1.00 2.20   ? 94  GLY B CA  1 
ATOM   4010  C  C   . GLY B 2  94  ? 0.507   134.783 -4.551  1.00 7.12   ? 94  GLY B C   1 
ATOM   4011  O  O   . GLY B 2  94  ? 0.995   133.912 -3.861  1.00 5.98   ? 94  GLY B O   1 
ATOM   4012  N  N   . LYS B 2  95  ? -0.535  135.513 -4.222  1.00 8.00   ? 95  LYS B N   1 
ATOM   4013  C  CA  . LYS B 2  95  ? -1.323  135.440 -3.014  1.00 8.57   ? 95  LYS B CA  1 
ATOM   4014  C  C   . LYS B 2  95  ? -2.581  134.587 -3.255  1.00 10.19  ? 95  LYS B C   1 
ATOM   4015  O  O   . LYS B 2  95  ? -3.188  134.602 -4.327  1.00 10.24  ? 95  LYS B O   1 
ATOM   4016  C  CB  . LYS B 2  95  ? -1.744  136.831 -2.519  1.00 9.24   ? 95  LYS B CB  1 
ATOM   4017  C  CG  . LYS B 2  95  ? -3.049  136.869 -1.745  1.00 25.89  ? 95  LYS B CG  1 
ATOM   4018  C  CD  . LYS B 2  95  ? -3.874  138.134 -1.684  1.00 35.56  ? 95  LYS B CD  1 
ATOM   4019  C  CE  . LYS B 2  95  ? -3.512  139.104 -0.578  1.00 46.23  ? 95  LYS B CE  1 
ATOM   4020  N  NZ  . LYS B 2  95  ? -4.330  139.079 0.655   1.00 45.38  ? 95  LYS B NZ  1 
ATOM   4021  N  N   . LEU B 2  96  ? -3.132  134.023 -2.187  1.00 13.42  ? 96  LEU B N   1 
ATOM   4022  C  CA  . LEU B 2  96  ? -4.470  133.452 -2.205  1.00 12.36  ? 96  LEU B CA  1 
ATOM   4023  C  C   . LEU B 2  96  ? -5.265  133.804 -0.949  1.00 13.23  ? 96  LEU B C   1 
ATOM   4024  O  O   . LEU B 2  96  ? -5.269  132.965 -0.050  1.00 10.74  ? 96  LEU B O   1 
ATOM   4025  C  CB  . LEU B 2  96  ? -4.357  131.922 -2.163  1.00 2.20   ? 96  LEU B CB  1 
ATOM   4026  C  CG  . LEU B 2  96  ? -5.747  131.234 -2.271  1.00 6.06   ? 96  LEU B CG  1 
ATOM   4027  C  CD1 . LEU B 2  96  ? -6.372  131.549 -3.623  1.00 19.93  ? 96  LEU B CD1 1 
ATOM   4028  C  CD2 . LEU B 2  96  ? -5.686  129.719 -2.122  1.00 2.31   ? 96  LEU B CD2 1 
ATOM   4029  N  N   . SER B 2  97  ? -5.889  134.968 -0.853  1.00 13.30  ? 97  SER B N   1 
ATOM   4030  C  CA  . SER B 2  97  ? -6.635  135.151 0.402   1.00 14.01  ? 97  SER B CA  1 
ATOM   4031  C  C   . SER B 2  97  ? -7.976  134.439 0.305   1.00 17.16  ? 97  SER B C   1 
ATOM   4032  O  O   . SER B 2  97  ? -8.353  133.968 -0.784  1.00 15.22  ? 97  SER B O   1 
ATOM   4033  C  CB  . SER B 2  97  ? -6.713  136.619 0.741   1.00 20.17  ? 97  SER B CB  1 
ATOM   4034  O  OG  . SER B 2  97  ? -5.415  137.071 1.149   1.00 24.97  ? 97  SER B OG  1 
ATOM   4035  N  N   . VAL B 2  98  ? -8.492  134.076 1.484   1.00 13.94  ? 98  VAL B N   1 
ATOM   4036  C  CA  . VAL B 2  98  ? -9.880  133.582 1.591   1.00 9.40   ? 98  VAL B CA  1 
ATOM   4037  C  C   . VAL B 2  98  ? -10.544 134.549 2.568   1.00 8.89   ? 98  VAL B C   1 
ATOM   4038  O  O   . VAL B 2  98  ? -10.132 134.512 3.707   1.00 2.20   ? 98  VAL B O   1 
ATOM   4039  C  CB  . VAL B 2  98  ? -9.974  132.180 2.194   1.00 2.43   ? 98  VAL B CB  1 
ATOM   4040  C  CG1 . VAL B 2  98  ? -11.375 131.593 2.152   1.00 2.83   ? 98  VAL B CG1 1 
ATOM   4041  C  CG2 . VAL B 2  98  ? -8.922  131.238 1.636   1.00 4.76   ? 98  VAL B CG2 1 
ATOM   4042  N  N   . THR B 2  99  ? -11.426 135.457 2.193   1.00 11.54  ? 99  THR B N   1 
ATOM   4043  C  CA  . THR B 2  99  ? -11.996 136.322 3.218   1.00 8.44   ? 99  THR B CA  1 
ATOM   4044  C  C   . THR B 2  99  ? -13.478 136.068 3.425   1.00 10.44  ? 99  THR B C   1 
ATOM   4045  O  O   . THR B 2  99  ? -14.184 136.009 2.426   1.00 18.62  ? 99  THR B O   1 
ATOM   4046  C  CB  . THR B 2  99  ? -11.961 137.802 2.833   1.00 2.20   ? 99  THR B CB  1 
ATOM   4047  O  OG1 . THR B 2  99  ? -10.700 138.256 3.350   1.00 4.28   ? 99  THR B OG1 1 
ATOM   4048  C  CG2 . THR B 2  99  ? -13.040 138.584 3.626   1.00 3.37   ? 99  THR B CG2 1 
ATOM   4049  N  N   . SER B 2  100 ? -13.992 136.296 4.624   1.00 10.80  ? 100 SER B N   1 
ATOM   4050  C  CA  . SER B 2  100 ? -15.438 136.126 4.748   1.00 9.88   ? 100 SER B CA  1 
ATOM   4051  C  C   . SER B 2  100 ? -16.005 137.033 5.816   1.00 11.96  ? 100 SER B C   1 
ATOM   4052  O  O   . SER B 2  100 ? -15.295 137.477 6.709   1.00 9.79   ? 100 SER B O   1 
ATOM   4053  C  CB  . SER B 2  100 ? -15.635 134.658 5.166   1.00 17.21  ? 100 SER B CB  1 
ATOM   4054  O  OG  . SER B 2  100 ? -15.327 134.513 6.536   1.00 17.29  ? 100 SER B OG  1 
ATOM   4055  N  N   . THR B 2  101 ? -17.307 137.249 5.698   1.00 14.82  ? 101 THR B N   1 
ATOM   4056  C  CA  . THR B 2  101 ? -18.053 138.084 6.645   1.00 13.53  ? 101 THR B CA  1 
ATOM   4057  C  C   . THR B 2  101 ? -19.281 137.331 7.122   1.00 10.00  ? 101 THR B C   1 
ATOM   4058  O  O   . THR B 2  101 ? -19.320 136.102 7.030   1.00 11.25  ? 101 THR B O   1 
ATOM   4059  C  CB  . THR B 2  101 ? -18.433 139.390 5.918   1.00 13.93  ? 101 THR B CB  1 
ATOM   4060  O  OG1 . THR B 2  101 ? -19.056 140.333 6.797   1.00 24.89  ? 101 THR B OG1 1 
ATOM   4061  C  CG2 . THR B 2  101 ? -19.375 139.043 4.769   1.00 3.54   ? 101 THR B CG2 1 
ATOM   4062  N  N   . ARG B 2  102 ? -20.280 137.989 7.701   1.00 8.85   ? 102 ARG B N   1 
ATOM   4063  C  CA  . ARG B 2  102 ? -21.449 137.233 8.144   1.00 7.67   ? 102 ARG B CA  1 
ATOM   4064  C  C   . ARG B 2  102 ? -22.327 136.822 6.976   1.00 9.37   ? 102 ARG B C   1 
ATOM   4065  O  O   . ARG B 2  102 ? -22.966 135.751 7.028   1.00 6.67   ? 102 ARG B O   1 
ATOM   4066  C  CB  . ARG B 2  102 ? -22.194 137.934 9.276   1.00 2.75   ? 102 ARG B CB  1 
ATOM   4067  C  CG  . ARG B 2  102 ? -21.867 137.372 10.659  1.00 3.31   ? 102 ARG B CG  1 
ATOM   4068  C  CD  . ARG B 2  102 ? -22.451 138.152 11.809  1.00 5.96   ? 102 ARG B CD  1 
ATOM   4069  N  NE  . ARG B 2  102 ? -21.489 138.974 12.534  1.00 3.37   ? 102 ARG B NE  1 
ATOM   4070  C  CZ  . ARG B 2  102 ? -20.842 138.586 13.623  1.00 11.66  ? 102 ARG B CZ  1 
ATOM   4071  N  NH1 . ARG B 2  102 ? -21.069 137.389 14.139  1.00 12.18  ? 102 ARG B NH1 1 
ATOM   4072  N  NH2 . ARG B 2  102 ? -19.957 139.356 14.233  1.00 13.89  ? 102 ARG B NH2 1 
ATOM   4073  N  N   . GLU B 2  103 ? -22.222 137.548 5.843   1.00 3.95   ? 103 GLU B N   1 
ATOM   4074  C  CA  . GLU B 2  103 ? -23.093 137.237 4.722   1.00 8.44   ? 103 GLU B CA  1 
ATOM   4075  C  C   . GLU B 2  103 ? -22.365 136.520 3.597   1.00 2.20   ? 103 GLU B C   1 
ATOM   4076  O  O   . GLU B 2  103 ? -22.892 135.619 2.954   1.00 8.59   ? 103 GLU B O   1 
ATOM   4077  C  CB  . GLU B 2  103 ? -23.852 138.444 4.189   1.00 2.42   ? 103 GLU B CB  1 
ATOM   4078  C  CG  . GLU B 2  103 ? -24.813 139.072 5.191   1.00 9.68   ? 103 GLU B CG  1 
ATOM   4079  C  CD  . GLU B 2  103 ? -26.091 138.239 5.089   1.00 17.80  ? 103 GLU B CD  1 
ATOM   4080  O  OE1 . GLU B 2  103 ? -26.037 137.103 5.600   1.00 20.84  ? 103 GLU B OE1 1 
ATOM   4081  O  OE2 . GLU B 2  103 ? -27.039 138.757 4.475   1.00 19.68  ? 103 GLU B OE2 1 
ATOM   4082  N  N   . ASN B 2  104 ? -21.122 136.877 3.358   1.00 11.30  ? 104 ASN B N   1 
ATOM   4083  C  CA  . ASN B 2  104 ? -20.434 136.446 2.144   1.00 10.89  ? 104 ASN B CA  1 
ATOM   4084  C  C   . ASN B 2  104 ? -19.065 135.842 2.402   1.00 15.53  ? 104 ASN B C   1 
ATOM   4085  O  O   . ASN B 2  104 ? -18.477 135.842 3.489   1.00 16.52  ? 104 ASN B O   1 
ATOM   4086  C  CB  . ASN B 2  104 ? -20.196 137.764 1.344   1.00 20.08  ? 104 ASN B CB  1 
ATOM   4087  C  CG  . ASN B 2  104 ? -21.424 138.081 0.524   1.00 29.37  ? 104 ASN B CG  1 
ATOM   4088  O  OD1 . ASN B 2  104 ? -22.070 137.152 0.031   1.00 35.96  ? 104 ASN B OD1 1 
ATOM   4089  N  ND2 . ASN B 2  104 ? -21.766 139.347 0.372   1.00 39.62  ? 104 ASN B ND2 1 
ATOM   4090  N  N   . MET B 2  105 ? -18.436 135.325 1.337   1.00 13.56  ? 105 MET B N   1 
ATOM   4091  C  CA  . MET B 2  105 ? -17.109 134.737 1.481   1.00 7.60   ? 105 MET B CA  1 
ATOM   4092  C  C   . MET B 2  105 ? -16.201 134.917 0.275   1.00 8.47   ? 105 MET B C   1 
ATOM   4093  O  O   . MET B 2  105 ? -15.704 133.956 -0.328  1.00 10.88  ? 105 MET B O   1 
ATOM   4094  C  CB  . MET B 2  105 ? -17.254 133.252 1.804   1.00 6.41   ? 105 MET B CB  1 
ATOM   4095  C  CG  . MET B 2  105 ? -16.359 132.682 2.875   1.00 7.81   ? 105 MET B CG  1 
ATOM   4096  S  SD  . MET B 2  105 ? -16.129 130.886 2.808   1.00 9.65   ? 105 MET B SD  1 
ATOM   4097  C  CE  . MET B 2  105 ? -17.145 130.371 4.183   1.00 7.27   ? 105 MET B CE  1 
ATOM   4098  N  N   . ALA B 2  106 ? -15.572 136.068 0.118   1.00 6.49   ? 106 ALA B N   1 
ATOM   4099  C  CA  . ALA B 2  106 ? -14.590 136.391 -0.867  1.00 5.42   ? 106 ALA B CA  1 
ATOM   4100  C  C   . ALA B 2  106 ? -13.312 135.584 -0.955  1.00 7.76   ? 106 ALA B C   1 
ATOM   4101  O  O   . ALA B 2  106 ? -12.291 135.846 -0.278  1.00 13.46  ? 106 ALA B O   1 
ATOM   4102  C  CB  . ALA B 2  106 ? -14.185 137.902 -0.718  1.00 4.90   ? 106 ALA B CB  1 
ATOM   4103  N  N   . TYR B 2  107 ? -13.187 134.685 -1.938  1.00 2.95   ? 107 TYR B N   1 
ATOM   4104  C  CA  . TYR B 2  107 ? -11.902 134.019 -2.146  1.00 3.24   ? 107 TYR B CA  1 
ATOM   4105  C  C   . TYR B 2  107 ? -11.023 134.784 -3.164  1.00 9.40   ? 107 TYR B C   1 
ATOM   4106  O  O   . TYR B 2  107 ? -10.970 134.426 -4.341  1.00 2.24   ? 107 TYR B O   1 
ATOM   4107  C  CB  . TYR B 2  107 ? -12.080 132.620 -2.728  1.00 4.08   ? 107 TYR B CB  1 
ATOM   4108  C  CG  . TYR B 2  107 ? -12.398 131.546 -1.751  1.00 6.55   ? 107 TYR B CG  1 
ATOM   4109  C  CD1 . TYR B 2  107 ? -13.695 131.391 -1.310  1.00 3.04   ? 107 TYR B CD1 1 
ATOM   4110  C  CD2 . TYR B 2  107 ? -11.434 130.682 -1.287  1.00 2.41   ? 107 TYR B CD2 1 
ATOM   4111  C  CE1 . TYR B 2  107 ? -14.034 130.397 -0.415  1.00 5.68   ? 107 TYR B CE1 1 
ATOM   4112  C  CE2 . TYR B 2  107 ? -11.731 129.677 -0.391  1.00 5.19   ? 107 TYR B CE2 1 
ATOM   4113  C  CZ  . TYR B 2  107 ? -13.045 129.554 0.043   1.00 2.20   ? 107 TYR B CZ  1 
ATOM   4114  O  OH  . TYR B 2  107 ? -13.366 128.577 0.952   1.00 7.79   ? 107 TYR B OH  1 
ATOM   4115  N  N   . THR B 2  108 ? -10.059 135.585 -2.745  1.00 14.14  ? 108 THR B N   1 
ATOM   4116  C  CA  . THR B 2  108 ? -9.202  136.401 -3.601  1.00 17.29  ? 108 THR B CA  1 
ATOM   4117  C  C   . THR B 2  108 ? -7.944  135.727 -4.118  1.00 17.97  ? 108 THR B C   1 
ATOM   4118  O  O   . THR B 2  108 ? -7.335  134.884 -3.462  1.00 20.48  ? 108 THR B O   1 
ATOM   4119  C  CB  . THR B 2  108 ? -8.810  137.649 -2.772  1.00 27.62  ? 108 THR B CB  1 
ATOM   4120  O  OG1 . THR B 2  108 ? -9.432  138.810 -3.329  1.00 33.43  ? 108 THR B OG1 1 
ATOM   4121  C  CG2 . THR B 2  108 ? -7.305  137.797 -2.648  1.00 32.69  ? 108 THR B CG2 1 
ATOM   4122  N  N   . VAL B 2  109 ? -7.458  136.101 -5.301  1.00 17.53  ? 109 VAL B N   1 
ATOM   4123  C  CA  . VAL B 2  109 ? -6.262  135.533 -5.938  1.00 18.03  ? 109 VAL B CA  1 
ATOM   4124  C  C   . VAL B 2  109 ? -5.412  136.550 -6.676  1.00 20.95  ? 109 VAL B C   1 
ATOM   4125  O  O   . VAL B 2  109 ? -5.751  137.125 -7.709  1.00 20.99  ? 109 VAL B O   1 
ATOM   4126  C  CB  . VAL B 2  109 ? -6.656  134.405 -6.905  1.00 9.91   ? 109 VAL B CB  1 
ATOM   4127  C  CG1 . VAL B 2  109 ? -6.929  134.811 -8.339  1.00 6.37   ? 109 VAL B CG1 1 
ATOM   4128  C  CG2 . VAL B 2  109 ? -5.645  133.290 -6.967  1.00 2.20   ? 109 VAL B CG2 1 
ATOM   4129  N  N   . GLU B 2  110 ? -4.233  136.925 -6.184  1.00 24.71  ? 110 GLU B N   1 
ATOM   4130  C  CA  . GLU B 2  110 ? -3.467  137.995 -6.835  1.00 29.02  ? 110 GLU B CA  1 
ATOM   4131  C  C   . GLU B 2  110 ? -2.181  137.449 -7.437  1.00 30.41  ? 110 GLU B C   1 
ATOM   4132  O  O   . GLU B 2  110 ? -1.511  136.621 -6.818  1.00 30.08  ? 110 GLU B O   1 
ATOM   4133  C  CB  . GLU B 2  110 ? -3.115  139.081 -5.807  1.00 33.02  ? 110 GLU B CB  1 
ATOM   4134  C  CG  . GLU B 2  110 ? -2.481  140.335 -6.353  1.00 49.36  ? 110 GLU B CG  1 
ATOM   4135  C  CD  . GLU B 2  110 ? -0.972  140.349 -6.384  1.00 61.64  ? 110 GLU B CD  1 
ATOM   4136  O  OE1 . GLU B 2  110 ? -0.335  139.444 -5.812  1.00 72.30  ? 110 GLU B OE1 1 
ATOM   4137  O  OE2 . GLU B 2  110 ? -0.404  141.286 -6.992  1.00 68.73  ? 110 GLU B OE2 1 
ATOM   4138  N  N   . CYS B 2  111 ? -1.777  137.904 -8.615  1.00 30.91  ? 111 CYS B N   1 
ATOM   4139  C  CA  . CYS B 2  111 ? -0.524  137.425 -9.204  1.00 30.22  ? 111 CYS B CA  1 
ATOM   4140  C  C   . CYS B 2  111 ? -0.175  138.299 -10.397 1.00 27.82  ? 111 CYS B C   1 
ATOM   4141  O  O   . CYS B 2  111 ? -0.939  139.220 -10.676 1.00 28.25  ? 111 CYS B O   1 
ATOM   4142  C  CB  . CYS B 2  111 ? -0.694  135.980 -9.683  1.00 34.80  ? 111 CYS B CB  1 
ATOM   4143  S  SG  . CYS B 2  111 ? -1.628  135.905 -11.222 1.00 37.79  ? 111 CYS B SG  1 
ATOM   4144  N  N   . LEU B 2  112 ? 0.915   138.008 -11.090 1.00 28.02  ? 112 LEU B N   1 
ATOM   4145  C  CA  . LEU B 2  112 ? 1.284   138.836 -12.236 1.00 27.92  ? 112 LEU B CA  1 
ATOM   4146  C  C   . LEU B 2  112 ? 0.506   138.480 -13.495 1.00 30.97  ? 112 LEU B C   1 
ATOM   4147  O  O   . LEU B 2  112 ? 0.254   137.300 -13.754 1.00 33.46  ? 112 LEU B O   1 
ATOM   4148  C  CB  . LEU B 2  112 ? 2.772   138.732 -12.561 1.00 22.09  ? 112 LEU B CB  1 
ATOM   4149  C  CG  . LEU B 2  112 ? 3.681   139.702 -11.815 1.00 18.52  ? 112 LEU B CG  1 
ATOM   4150  C  CD1 . LEU B 2  112 ? 4.793   140.264 -12.679 1.00 22.53  ? 112 LEU B CD1 1 
ATOM   4151  C  CD2 . LEU B 2  112 ? 2.898   140.874 -11.258 1.00 3.25   ? 112 LEU B CD2 1 
ATOM   4152  N  N   . ARG B 2  113 ? 0.304   139.487 -14.335 1.00 30.41  ? 113 ARG B N   1 
ATOM   4153  C  CA  . ARG B 2  113 ? -0.469  139.413 -15.564 1.00 27.62  ? 113 ARG B CA  1 
ATOM   4154  C  C   . ARG B 2  113 ? -0.199  138.143 -16.361 1.00 24.69  ? 113 ARG B C   1 
ATOM   4155  O  O   . ARG B 2  113 ? -1.115  137.545 -16.922 1.00 22.54  ? 113 ARG B O   1 
ATOM   4156  C  CB  . ARG B 2  113 ? -0.154  140.608 -16.458 1.00 35.40  ? 113 ARG B CB  1 
ATOM   4157  C  CG  . ARG B 2  113 ? -1.183  141.690 -16.633 1.00 50.93  ? 113 ARG B CG  1 
ATOM   4158  C  CD  . ARG B 2  113 ? -1.884  141.623 -17.992 1.00 58.73  ? 113 ARG B CD  1 
ATOM   4159  N  NE  . ARG B 2  113 ? -2.840  140.521 -17.991 1.00 73.23  ? 113 ARG B NE  1 
ATOM   4160  C  CZ  . ARG B 2  113 ? -3.655  140.120 -18.948 1.00 76.39  ? 113 ARG B CZ  1 
ATOM   4161  N  NH1 . ARG B 2  113 ? -3.686  140.756 -20.107 1.00 75.70  ? 113 ARG B NH1 1 
ATOM   4162  N  NH2 . ARG B 2  113 ? -4.451  139.071 -18.728 1.00 79.28  ? 113 ARG B NH2 1 
ATOM   4163  N  N   . ASP B 2  114 ? 1.049   137.708 -16.459 1.00 21.05  ? 114 ASP B N   1 
ATOM   4164  C  CA  . ASP B 2  114 ? 1.416   136.534 -17.206 1.00 23.39  ? 114 ASP B CA  1 
ATOM   4165  C  C   . ASP B 2  114 ? 1.051   135.215 -16.575 1.00 28.97  ? 114 ASP B C   1 
ATOM   4166  O  O   . ASP B 2  114 ? 1.089   134.161 -17.228 1.00 31.51  ? 114 ASP B O   1 
ATOM   4167  C  CB  . ASP B 2  114 ? 2.922   136.592 -17.508 1.00 28.15  ? 114 ASP B CB  1 
ATOM   4168  C  CG  . ASP B 2  114 ? 3.158   137.606 -18.616 1.00 39.35  ? 114 ASP B CG  1 
ATOM   4169  O  OD1 . ASP B 2  114 ? 2.263   137.667 -19.488 1.00 46.15  ? 114 ASP B OD1 1 
ATOM   4170  O  OD2 . ASP B 2  114 ? 4.162   138.335 -18.671 1.00 46.21  ? 114 ASP B OD2 1 
ATOM   4171  N  N   . ASP B 2  115 ? 0.629   135.199 -15.317 1.00 33.21  ? 115 ASP B N   1 
ATOM   4172  C  CA  . ASP B 2  115 ? 0.462   133.953 -14.569 1.00 31.42  ? 115 ASP B CA  1 
ATOM   4173  C  C   . ASP B 2  115 ? -0.968  133.704 -14.116 1.00 30.26  ? 115 ASP B C   1 
ATOM   4174  O  O   . ASP B 2  115 ? -1.245  132.733 -13.393 1.00 26.62  ? 115 ASP B O   1 
ATOM   4175  C  CB  . ASP B 2  115 ? 1.387   134.016 -13.335 1.00 31.20  ? 115 ASP B CB  1 
ATOM   4176  C  CG  . ASP B 2  115 ? 2.847   133.978 -13.779 1.00 28.44  ? 115 ASP B CG  1 
ATOM   4177  O  OD1 . ASP B 2  115 ? 3.227   132.988 -14.449 1.00 15.97  ? 115 ASP B OD1 1 
ATOM   4178  O  OD2 . ASP B 2  115 ? 3.569   134.942 -13.446 1.00 29.63  ? 115 ASP B OD2 1 
ATOM   4179  N  N   . VAL B 2  116 ? -1.888  134.551 -14.601 1.00 24.57  ? 116 VAL B N   1 
ATOM   4180  C  CA  . VAL B 2  116 ? -3.278  134.401 -14.205 1.00 21.03  ? 116 VAL B CA  1 
ATOM   4181  C  C   . VAL B 2  116 ? -3.808  132.990 -14.378 1.00 18.00  ? 116 VAL B C   1 
ATOM   4182  O  O   . VAL B 2  116 ? -4.747  132.587 -13.705 1.00 16.47  ? 116 VAL B O   1 
ATOM   4183  C  CB  . VAL B 2  116 ? -4.216  135.353 -14.964 1.00 16.27  ? 116 VAL B CB  1 
ATOM   4184  C  CG1 . VAL B 2  116 ? -5.513  135.508 -14.176 1.00 26.22  ? 116 VAL B CG1 1 
ATOM   4185  C  CG2 . VAL B 2  116 ? -3.538  136.703 -15.091 1.00 24.32  ? 116 VAL B CG2 1 
ATOM   4186  N  N   . ASP B 2  117 ? -3.363  132.342 -15.430 1.00 23.10  ? 117 ASP B N   1 
ATOM   4187  C  CA  . ASP B 2  117 ? -3.914  131.100 -15.924 1.00 31.01  ? 117 ASP B CA  1 
ATOM   4188  C  C   . ASP B 2  117 ? -3.467  129.940 -15.048 1.00 33.38  ? 117 ASP B C   1 
ATOM   4189  O  O   . ASP B 2  117 ? -4.232  128.999 -14.812 1.00 34.87  ? 117 ASP B O   1 
ATOM   4190  C  CB  . ASP B 2  117 ? -3.488  130.841 -17.374 1.00 40.48  ? 117 ASP B CB  1 
ATOM   4191  C  CG  . ASP B 2  117 ? -4.532  131.295 -18.377 1.00 39.40  ? 117 ASP B CG  1 
ATOM   4192  O  OD1 . ASP B 2  117 ? -4.612  132.518 -18.624 1.00 40.21  ? 117 ASP B OD1 1 
ATOM   4193  O  OD2 . ASP B 2  117 ? -5.261  130.426 -18.894 1.00 43.00  ? 117 ASP B OD2 1 
ATOM   4194  N  N   . ILE B 2  118 ? -2.228  130.057 -14.552 1.00 34.16  ? 118 ILE B N   1 
ATOM   4195  C  CA  . ILE B 2  118 ? -1.706  129.021 -13.652 1.00 30.47  ? 118 ILE B CA  1 
ATOM   4196  C  C   . ILE B 2  118 ? -2.434  129.149 -12.307 1.00 27.15  ? 118 ILE B C   1 
ATOM   4197  O  O   . ILE B 2  118 ? -3.026  128.233 -11.745 1.00 27.70  ? 118 ILE B O   1 
ATOM   4198  C  CB  . ILE B 2  118 ? -0.216  129.145 -13.325 1.00 28.58  ? 118 ILE B CB  1 
ATOM   4199  C  CG1 . ILE B 2  118 ? 0.689   129.095 -14.548 1.00 34.84  ? 118 ILE B CG1 1 
ATOM   4200  C  CG2 . ILE B 2  118 ? 0.150   128.006 -12.382 1.00 22.08  ? 118 ILE B CG2 1 
ATOM   4201  C  CD1 . ILE B 2  118 ? 1.669   130.263 -14.580 1.00 37.84  ? 118 ILE B CD1 1 
ATOM   4202  N  N   . LEU B 2  119 ? -2.551  130.415 -11.918 1.00 22.90  ? 119 LEU B N   1 
ATOM   4203  C  CA  . LEU B 2  119 ? -3.318  130.747 -10.750 1.00 22.41  ? 119 LEU B CA  1 
ATOM   4204  C  C   . LEU B 2  119 ? -4.807  130.470 -10.751 1.00 21.16  ? 119 LEU B C   1 
ATOM   4205  O  O   . LEU B 2  119 ? -5.352  130.136 -9.692  1.00 24.86  ? 119 LEU B O   1 
ATOM   4206  C  CB  . LEU B 2  119 ? -3.150  132.231 -10.390 1.00 21.13  ? 119 LEU B CB  1 
ATOM   4207  C  CG  . LEU B 2  119 ? -3.201  132.394 -8.872  1.00 26.90  ? 119 LEU B CG  1 
ATOM   4208  C  CD1 . LEU B 2  119 ? -2.093  131.531 -8.270  1.00 31.62  ? 119 LEU B CD1 1 
ATOM   4209  C  CD2 . LEU B 2  119 ? -2.978  133.851 -8.527  1.00 44.05  ? 119 LEU B CD2 1 
ATOM   4210  N  N   . MET B 2  120 ? -5.488  130.713 -11.861 1.00 20.09  ? 120 MET B N   1 
ATOM   4211  C  CA  . MET B 2  120 ? -6.937  130.549 -11.917 1.00 17.15  ? 120 MET B CA  1 
ATOM   4212  C  C   . MET B 2  120 ? -7.322  129.074 -11.866 1.00 16.19  ? 120 MET B C   1 
ATOM   4213  O  O   . MET B 2  120 ? -8.359  128.676 -11.327 1.00 4.21   ? 120 MET B O   1 
ATOM   4214  C  CB  . MET B 2  120 ? -7.490  131.164 -13.188 1.00 22.83  ? 120 MET B CB  1 
ATOM   4215  C  CG  . MET B 2  120 ? -8.982  130.897 -13.397 1.00 22.12  ? 120 MET B CG  1 
ATOM   4216  S  SD  . MET B 2  120 ? -9.773  132.398 -13.973 1.00 46.31  ? 120 MET B SD  1 
ATOM   4217  C  CE  . MET B 2  120 ? -8.459  133.074 -15.043 1.00 45.65  ? 120 MET B CE  1 
ATOM   4218  N  N   . GLU B 2  121 ? -6.394  128.239 -12.360 1.00 11.71  ? 121 GLU B N   1 
ATOM   4219  C  CA  . GLU B 2  121 ? -6.655  126.796 -12.255 1.00 9.89   ? 121 GLU B CA  1 
ATOM   4220  C  C   . GLU B 2  121 ? -6.586  126.371 -10.793 1.00 11.68  ? 121 GLU B C   1 
ATOM   4221  O  O   . GLU B 2  121 ? -6.930  125.231 -10.467 1.00 3.30   ? 121 GLU B O   1 
ATOM   4222  C  CB  . GLU B 2  121 ? -5.606  126.080 -13.097 1.00 7.82   ? 121 GLU B CB  1 
ATOM   4223  C  CG  . GLU B 2  121 ? -5.781  124.601 -13.299 1.00 6.97   ? 121 GLU B CG  1 
ATOM   4224  C  CD  . GLU B 2  121 ? -4.743  123.922 -14.156 1.00 19.64  ? 121 GLU B CD  1 
ATOM   4225  O  OE1 . GLU B 2  121 ? -3.947  124.569 -14.873 1.00 22.83  ? 121 GLU B OE1 1 
ATOM   4226  O  OE2 . GLU B 2  121 ? -4.710  122.662 -14.137 1.00 25.38  ? 121 GLU B OE2 1 
ATOM   4227  N  N   . PHE B 2  122 ? -5.813  127.160 -10.020 1.00 16.25  ? 122 PHE B N   1 
ATOM   4228  C  CA  . PHE B 2  122 ? -5.708  126.902 -8.588  1.00 18.33  ? 122 PHE B CA  1 
ATOM   4229  C  C   . PHE B 2  122 ? -7.003  127.308 -7.898  1.00 16.83  ? 122 PHE B C   1 
ATOM   4230  O  O   . PHE B 2  122 ? -7.688  126.479 -7.267  1.00 10.06  ? 122 PHE B O   1 
ATOM   4231  C  CB  . PHE B 2  122 ? -4.477  127.533 -7.945  1.00 18.27  ? 122 PHE B CB  1 
ATOM   4232  C  CG  . PHE B 2  122 ? -3.266  126.625 -8.028  1.00 13.45  ? 122 PHE B CG  1 
ATOM   4233  C  CD1 . PHE B 2  122 ? -3.423  125.255 -8.057  1.00 8.21   ? 122 PHE B CD1 1 
ATOM   4234  C  CD2 . PHE B 2  122 ? -1.987  127.153 -8.098  1.00 7.03   ? 122 PHE B CD2 1 
ATOM   4235  C  CE1 . PHE B 2  122 ? -2.343  124.406 -8.134  1.00 6.39   ? 122 PHE B CE1 1 
ATOM   4236  C  CE2 . PHE B 2  122 ? -0.904  126.306 -8.185  1.00 3.49   ? 122 PHE B CE2 1 
ATOM   4237  C  CZ  . PHE B 2  122 ? -1.071  124.931 -8.191  1.00 8.02   ? 122 PHE B CZ  1 
ATOM   4238  N  N   . LEU B 2  123 ? -7.404  128.551 -8.181  1.00 12.82  ? 123 LEU B N   1 
ATOM   4239  C  CA  . LEU B 2  123 ? -8.663  129.015 -7.613  1.00 16.19  ? 123 LEU B CA  1 
ATOM   4240  C  C   . LEU B 2  123 ? -9.845  128.089 -7.866  1.00 15.45  ? 123 LEU B C   1 
ATOM   4241  O  O   . LEU B 2  123 ? -10.799 128.079 -7.080  1.00 16.50  ? 123 LEU B O   1 
ATOM   4242  C  CB  . LEU B 2  123 ? -9.001  130.436 -8.060  1.00 13.00  ? 123 LEU B CB  1 
ATOM   4243  C  CG  . LEU B 2  123 ? -10.323 130.976 -7.504  1.00 8.71   ? 123 LEU B CG  1 
ATOM   4244  C  CD1 . LEU B 2  123 ? -10.208 131.225 -6.005  1.00 18.76  ? 123 LEU B CD1 1 
ATOM   4245  C  CD2 . LEU B 2  123 ? -10.685 132.261 -8.212  1.00 10.95  ? 123 LEU B CD2 1 
ATOM   4246  N  N   . LEU B 2  124 ? -9.861  127.405 -9.002  1.00 17.47  ? 124 LEU B N   1 
ATOM   4247  C  CA  . LEU B 2  124 ? -10.954 126.536 -9.387  1.00 16.25  ? 124 LEU B CA  1 
ATOM   4248  C  C   . LEU B 2  124 ? -10.910 125.209 -8.663  1.00 14.91  ? 124 LEU B C   1 
ATOM   4249  O  O   . LEU B 2  124 ? -11.952 124.638 -8.335  1.00 19.66  ? 124 LEU B O   1 
ATOM   4250  C  CB  . LEU B 2  124 ? -11.041 126.336 -10.907 1.00 10.13  ? 124 LEU B CB  1 
ATOM   4251  C  CG  . LEU B 2  124 ? -11.575 127.551 -11.659 1.00 9.08   ? 124 LEU B CG  1 
ATOM   4252  C  CD1 . LEU B 2  124 ? -11.716 127.253 -13.130 1.00 7.73   ? 124 LEU B CD1 1 
ATOM   4253  C  CD2 . LEU B 2  124 ? -12.860 128.081 -11.061 1.00 7.76   ? 124 LEU B CD2 1 
ATOM   4254  N  N   . ASN B 2  125 ? -9.732  124.676 -8.389  1.00 15.51  ? 125 ASN B N   1 
ATOM   4255  C  CA  . ASN B 2  125 ? -9.651  123.398 -7.670  1.00 10.78  ? 125 ASN B CA  1 
ATOM   4256  C  C   . ASN B 2  125 ? -9.929  123.674 -6.188  1.00 13.99  ? 125 ASN B C   1 
ATOM   4257  O  O   . ASN B 2  125 ? -10.322 122.791 -5.431  1.00 10.43  ? 125 ASN B O   1 
ATOM   4258  C  CB  . ASN B 2  125 ? -8.197  122.916 -7.716  1.00 8.47   ? 125 ASN B CB  1 
ATOM   4259  C  CG  . ASN B 2  125 ? -7.871  122.188 -8.985  1.00 6.91   ? 125 ASN B CG  1 
ATOM   4260  O  OD1 . ASN B 2  125 ? -7.775  122.812 -10.027 1.00 16.07  ? 125 ASN B OD1 1 
ATOM   4261  N  ND2 . ASN B 2  125 ? -7.671  120.900 -8.894  1.00 6.57   ? 125 ASN B ND2 1 
ATOM   4262  N  N   . VAL B 2  126 ? -9.442  124.842 -5.721  1.00 13.53  ? 126 VAL B N   1 
ATOM   4263  C  CA  . VAL B 2  126 ? -9.663  125.107 -4.304  1.00 11.18  ? 126 VAL B CA  1 
ATOM   4264  C  C   . VAL B 2  126 ? -11.160 125.243 -4.022  1.00 8.01   ? 126 VAL B C   1 
ATOM   4265  O  O   . VAL B 2  126 ? -11.637 124.856 -2.958  1.00 9.04   ? 126 VAL B O   1 
ATOM   4266  C  CB  . VAL B 2  126 ? -8.985  126.367 -3.755  1.00 10.19  ? 126 VAL B CB  1 
ATOM   4267  C  CG1 . VAL B 2  126 ? -9.055  126.344 -2.236  1.00 3.27   ? 126 VAL B CG1 1 
ATOM   4268  C  CG2 . VAL B 2  126 ? -7.557  126.553 -4.198  1.00 11.89  ? 126 VAL B CG2 1 
ATOM   4269  N  N   . THR B 2  127 ? -11.881 125.811 -4.973  1.00 3.68   ? 127 THR B N   1 
ATOM   4270  C  CA  . THR B 2  127 ? -13.282 126.090 -4.671  1.00 7.35   ? 127 THR B CA  1 
ATOM   4271  C  C   . THR B 2  127 ? -14.296 125.076 -5.098  1.00 3.93   ? 127 THR B C   1 
ATOM   4272  O  O   . THR B 2  127 ? -15.406 124.992 -4.554  1.00 8.19   ? 127 THR B O   1 
ATOM   4273  C  CB  . THR B 2  127 ? -13.565 127.545 -5.086  1.00 2.69   ? 127 THR B CB  1 
ATOM   4274  O  OG1 . THR B 2  127 ? -14.216 128.140 -3.964  1.00 13.97  ? 127 THR B OG1 1 
ATOM   4275  C  CG2 . THR B 2  127 ? -14.308 127.662 -6.381  1.00 2.20   ? 127 THR B CG2 1 
ATOM   4276  N  N   . THR B 2  128 ? -13.903 124.199 -6.017  1.00 8.44   ? 128 THR B N   1 
ATOM   4277  C  CA  . THR B 2  128 ? -14.799 123.381 -6.803  1.00 7.60   ? 128 THR B CA  1 
ATOM   4278  C  C   . THR B 2  128 ? -14.539 121.912 -6.697  1.00 11.14  ? 128 THR B C   1 
ATOM   4279  O  O   . THR B 2  128 ? -15.440 121.051 -6.698  1.00 15.96  ? 128 THR B O   1 
ATOM   4280  C  CB  . THR B 2  128 ? -14.730 123.828 -8.270  1.00 5.30   ? 128 THR B CB  1 
ATOM   4281  O  OG1 . THR B 2  128 ? -15.487 125.029 -8.349  1.00 8.16   ? 128 THR B OG1 1 
ATOM   4282  C  CG2 . THR B 2  128 ? -15.182 122.762 -9.228  1.00 15.70  ? 128 THR B CG2 1 
ATOM   4283  N  N   . ALA B 2  129 ? -13.289 121.566 -6.356  1.00 7.70   ? 129 ALA B N   1 
ATOM   4284  C  CA  . ALA B 2  129 ? -13.065 120.141 -6.118  1.00 12.52  ? 129 ALA B CA  1 
ATOM   4285  C  C   . ALA B 2  129 ? -12.263 119.881 -4.856  1.00 17.07  ? 129 ALA B C   1 
ATOM   4286  O  O   . ALA B 2  129 ? -11.367 119.034 -4.808  1.00 14.64  ? 129 ALA B O   1 
ATOM   4287  C  CB  . ALA B 2  129 ? -12.517 119.424 -7.316  1.00 8.90   ? 129 ALA B CB  1 
ATOM   4288  N  N   . PRO B 2  130 ? -12.562 120.613 -3.805  1.00 16.59  ? 130 PRO B N   1 
ATOM   4289  C  CA  . PRO B 2  130 ? -11.930 120.435 -2.509  1.00 17.45  ? 130 PRO B CA  1 
ATOM   4290  C  C   . PRO B 2  130 ? -12.078 118.956 -2.161  1.00 17.59  ? 130 PRO B C   1 
ATOM   4291  O  O   . PRO B 2  130 ? -13.139 118.432 -2.487  1.00 23.45  ? 130 PRO B O   1 
ATOM   4292  C  CB  . PRO B 2  130 ? -12.847 121.206 -1.527  1.00 20.59  ? 130 PRO B CB  1 
ATOM   4293  C  CG  . PRO B 2  130 ? -13.382 122.291 -2.420  1.00 21.80  ? 130 PRO B CG  1 
ATOM   4294  C  CD  . PRO B 2  130 ? -13.580 121.651 -3.760  1.00 19.92  ? 130 PRO B CD  1 
ATOM   4295  N  N   . GLU B 2  131 ? -11.114 118.291 -1.585  1.00 19.29  ? 131 GLU B N   1 
ATOM   4296  C  CA  . GLU B 2  131 ? -11.199 116.890 -1.135  1.00 17.37  ? 131 GLU B CA  1 
ATOM   4297  C  C   . GLU B 2  131 ? -10.912 116.819 0.366   1.00 15.12  ? 131 GLU B C   1 
ATOM   4298  O  O   . GLU B 2  131 ? -9.723  116.767 0.730   1.00 22.05  ? 131 GLU B O   1 
ATOM   4299  C  CB  . GLU B 2  131 ? -10.048 116.109 -1.795  1.00 20.25  ? 131 GLU B CB  1 
ATOM   4300  C  CG  . GLU B 2  131 ? -10.444 115.369 -3.043  1.00 33.81  ? 131 GLU B CG  1 
ATOM   4301  C  CD  . GLU B 2  131 ? -9.536  114.200 -3.372  1.00 33.52  ? 131 GLU B CD  1 
ATOM   4302  O  OE1 . GLU B 2  131 ? -8.807  113.759 -2.466  1.00 28.93  ? 131 GLU B OE1 1 
ATOM   4303  O  OE2 . GLU B 2  131 ? -9.555  113.726 -4.527  1.00 37.45  ? 131 GLU B OE2 1 
ATOM   4304  N  N   . PHE B 2  132 ? -11.887 116.916 1.255   1.00 8.40   ? 132 PHE B N   1 
ATOM   4305  C  CA  . PHE B 2  132 ? -11.488 117.051 2.664   1.00 9.28   ? 132 PHE B CA  1 
ATOM   4306  C  C   . PHE B 2  132 ? -11.027 115.729 3.213   1.00 7.17   ? 132 PHE B C   1 
ATOM   4307  O  O   . PHE B 2  132 ? -11.861 114.844 3.380   1.00 13.99  ? 132 PHE B O   1 
ATOM   4308  C  CB  . PHE B 2  132 ? -12.488 117.839 3.486   1.00 3.50   ? 132 PHE B CB  1 
ATOM   4309  C  CG  . PHE B 2  132 ? -12.764 119.244 3.018   1.00 9.09   ? 132 PHE B CG  1 
ATOM   4310  C  CD1 . PHE B 2  132 ? -13.622 119.524 1.965   1.00 11.24  ? 132 PHE B CD1 1 
ATOM   4311  C  CD2 . PHE B 2  132 ? -12.164 120.324 3.628   1.00 6.68   ? 132 PHE B CD2 1 
ATOM   4312  C  CE1 . PHE B 2  132 ? -13.879 120.818 1.553   1.00 7.11   ? 132 PHE B CE1 1 
ATOM   4313  C  CE2 . PHE B 2  132 ? -12.410 121.610 3.219   1.00 9.56   ? 132 PHE B CE2 1 
ATOM   4314  C  CZ  . PHE B 2  132 ? -13.194 121.877 2.132   1.00 2.20   ? 132 PHE B CZ  1 
ATOM   4315  N  N   . ARG B 2  133 ? -9.711  115.536 3.430   1.00 3.42   ? 133 ARG B N   1 
ATOM   4316  C  CA  . ARG B 2  133 ? -9.294  114.189 3.772   1.00 3.08   ? 133 ARG B CA  1 
ATOM   4317  C  C   . ARG B 2  133 ? -9.196  114.003 5.274   1.00 7.13   ? 133 ARG B C   1 
ATOM   4318  O  O   . ARG B 2  133 ? -8.556  114.804 5.954   1.00 8.19   ? 133 ARG B O   1 
ATOM   4319  C  CB  . ARG B 2  133 ? -7.945  113.911 3.105   1.00 5.83   ? 133 ARG B CB  1 
ATOM   4320  C  CG  . ARG B 2  133 ? -8.006  113.661 1.616   1.00 7.81   ? 133 ARG B CG  1 
ATOM   4321  C  CD  . ARG B 2  133 ? -6.696  113.890 0.953   1.00 8.26   ? 133 ARG B CD  1 
ATOM   4322  N  NE  . ARG B 2  133 ? -6.643  113.829 -0.499  1.00 11.97  ? 133 ARG B NE  1 
ATOM   4323  C  CZ  . ARG B 2  133 ? -5.513  113.460 -1.122  1.00 11.80  ? 133 ARG B CZ  1 
ATOM   4324  N  NH1 . ARG B 2  133 ? -4.421  113.155 -0.428  1.00 8.10   ? 133 ARG B NH1 1 
ATOM   4325  N  NH2 . ARG B 2  133 ? -5.437  113.394 -2.436  1.00 15.02  ? 133 ARG B NH2 1 
ATOM   4326  N  N   . ARG B 2  134 ? -9.671  112.869 5.784   1.00 7.82   ? 134 ARG B N   1 
ATOM   4327  C  CA  . ARG B 2  134 ? -9.840  112.733 7.232   1.00 9.11   ? 134 ARG B CA  1 
ATOM   4328  C  C   . ARG B 2  134 ? -8.598  113.227 7.940   1.00 5.99   ? 134 ARG B C   1 
ATOM   4329  O  O   . ARG B 2  134 ? -8.702  114.089 8.813   1.00 10.86  ? 134 ARG B O   1 
ATOM   4330  C  CB  . ARG B 2  134 ? -10.355 111.382 7.585   1.00 16.56  ? 134 ARG B CB  1 
ATOM   4331  C  CG  . ARG B 2  134 ? -9.690  110.438 8.536   1.00 28.82  ? 134 ARG B CG  1 
ATOM   4332  C  CD  . ARG B 2  134 ? -9.515  109.021 7.975   1.00 25.48  ? 134 ARG B CD  1 
ATOM   4333  N  NE  . ARG B 2  134 ? -10.261 108.861 6.728   1.00 47.13  ? 134 ARG B NE  1 
ATOM   4334  C  CZ  . ARG B 2  134 ? -10.516 107.684 6.165   1.00 56.70  ? 134 ARG B CZ  1 
ATOM   4335  N  NH1 . ARG B 2  134 ? -10.007 106.651 6.825   1.00 57.78  ? 134 ARG B NH1 1 
ATOM   4336  N  NH2 . ARG B 2  134 ? -11.300 107.468 5.048   1.00 56.45  ? 134 ARG B NH2 1 
ATOM   4337  N  N   . TRP B 2  135 ? -7.449  112.821 7.431   1.00 7.78   ? 135 TRP B N   1 
ATOM   4338  C  CA  . TRP B 2  135 ? -6.141  113.134 7.970   1.00 6.41   ? 135 TRP B CA  1 
ATOM   4339  C  C   . TRP B 2  135 ? -5.667  114.538 7.720   1.00 3.97   ? 135 TRP B C   1 
ATOM   4340  O  O   . TRP B 2  135 ? -4.780  115.086 8.375   1.00 10.00  ? 135 TRP B O   1 
ATOM   4341  C  CB  . TRP B 2  135 ? -5.155  112.142 7.397   1.00 6.62   ? 135 TRP B CB  1 
ATOM   4342  C  CG  . TRP B 2  135 ? -4.832  112.326 5.964   1.00 10.83  ? 135 TRP B CG  1 
ATOM   4343  C  CD1 . TRP B 2  135 ? -3.945  113.218 5.429   1.00 18.21  ? 135 TRP B CD1 1 
ATOM   4344  C  CD2 . TRP B 2  135 ? -5.349  111.571 4.864   1.00 10.27  ? 135 TRP B CD2 1 
ATOM   4345  N  NE1 . TRP B 2  135 ? -3.866  113.059 4.062   1.00 8.23   ? 135 TRP B NE1 1 
ATOM   4346  C  CE2 . TRP B 2  135 ? -4.722  112.074 3.705   1.00 6.20   ? 135 TRP B CE2 1 
ATOM   4347  C  CE3 . TRP B 2  135 ? -6.319  110.523 4.817   1.00 2.20   ? 135 TRP B CE3 1 
ATOM   4348  C  CZ2 . TRP B 2  135 ? -5.007  111.566 2.454   1.00 12.47  ? 135 TRP B CZ2 1 
ATOM   4349  C  CZ3 . TRP B 2  135 ? -6.510  110.011 3.533   1.00 5.58   ? 135 TRP B CZ3 1 
ATOM   4350  C  CH2 . TRP B 2  135 ? -5.909  110.545 2.386   1.00 7.29   ? 135 TRP B CH2 1 
ATOM   4351  N  N   . GLU B 2  136 ? -6.109  115.144 6.618   1.00 7.18   ? 136 GLU B N   1 
ATOM   4352  C  CA  . GLU B 2  136 ? -5.601  116.480 6.319   1.00 4.05   ? 136 GLU B CA  1 
ATOM   4353  C  C   . GLU B 2  136 ? -6.417  117.490 7.109   1.00 4.18   ? 136 GLU B C   1 
ATOM   4354  O  O   . GLU B 2  136 ? -5.963  118.550 7.541   1.00 4.07   ? 136 GLU B O   1 
ATOM   4355  C  CB  . GLU B 2  136 ? -5.702  116.746 4.818   1.00 2.97   ? 136 GLU B CB  1 
ATOM   4356  C  CG  . GLU B 2  136 ? -4.654  116.057 3.969   1.00 7.81   ? 136 GLU B CG  1 
ATOM   4357  C  CD  . GLU B 2  136 ? -4.630  116.401 2.502   1.00 6.98   ? 136 GLU B CD  1 
ATOM   4358  O  OE1 . GLU B 2  136 ? -5.371  117.332 2.128   1.00 8.47   ? 136 GLU B OE1 1 
ATOM   4359  O  OE2 . GLU B 2  136 ? -3.893  115.746 1.734   1.00 7.12   ? 136 GLU B OE2 1 
ATOM   4360  N  N   . VAL B 2  137 ? -7.684  117.140 7.322   1.00 6.88   ? 137 VAL B N   1 
ATOM   4361  C  CA  . VAL B 2  137 ? -8.659  118.031 7.927   1.00 2.20   ? 137 VAL B CA  1 
ATOM   4362  C  C   . VAL B 2  137 ? -8.545  117.954 9.462   1.00 4.27   ? 137 VAL B C   1 
ATOM   4363  O  O   . VAL B 2  137 ? -8.966  118.836 10.207  1.00 4.77   ? 137 VAL B O   1 
ATOM   4364  C  CB  . VAL B 2  137 ? -10.063 117.495 7.650   1.00 3.01   ? 137 VAL B CB  1 
ATOM   4365  C  CG1 . VAL B 2  137 ? -11.056 118.079 8.635   1.00 2.20   ? 137 VAL B CG1 1 
ATOM   4366  C  CG2 . VAL B 2  137 ? -10.473 117.998 6.264   1.00 3.84   ? 137 VAL B CG2 1 
ATOM   4367  N  N   . ALA B 2  138 ? -8.064  116.799 9.952   1.00 8.02   ? 138 ALA B N   1 
ATOM   4368  C  CA  . ALA B 2  138 ? -7.789  116.691 11.376  1.00 3.60   ? 138 ALA B CA  1 
ATOM   4369  C  C   . ALA B 2  138 ? -6.569  117.586 11.656  1.00 6.69   ? 138 ALA B C   1 
ATOM   4370  O  O   . ALA B 2  138 ? -6.652  118.401 12.560  1.00 14.16  ? 138 ALA B O   1 
ATOM   4371  C  CB  . ALA B 2  138 ? -7.355  115.344 11.896  1.00 2.23   ? 138 ALA B CB  1 
ATOM   4372  N  N   . ALA B 2  139 ? -5.540  117.446 10.838  1.00 4.86   ? 139 ALA B N   1 
ATOM   4373  C  CA  . ALA B 2  139 ? -4.309  118.205 11.018  1.00 5.29   ? 139 ALA B CA  1 
ATOM   4374  C  C   . ALA B 2  139 ? -4.547  119.697 11.179  1.00 5.31   ? 139 ALA B C   1 
ATOM   4375  O  O   . ALA B 2  139 ? -3.720  120.371 11.787  1.00 8.49   ? 139 ALA B O   1 
ATOM   4376  C  CB  . ALA B 2  139 ? -3.401  117.951 9.830   1.00 5.17   ? 139 ALA B CB  1 
ATOM   4377  N  N   . LEU B 2  140 ? -5.635  120.187 10.606  1.00 4.50   ? 140 LEU B N   1 
ATOM   4378  C  CA  . LEU B 2  140 ? -5.963  121.594 10.599  1.00 3.91   ? 140 LEU B CA  1 
ATOM   4379  C  C   . LEU B 2  140 ? -6.681  122.007 11.852  1.00 3.43   ? 140 LEU B C   1 
ATOM   4380  O  O   . LEU B 2  140 ? -6.253  122.933 12.567  1.00 4.91   ? 140 LEU B O   1 
ATOM   4381  C  CB  . LEU B 2  140 ? -6.673  121.874 9.285   1.00 2.52   ? 140 LEU B CB  1 
ATOM   4382  C  CG  . LEU B 2  140 ? -7.220  123.274 9.030   1.00 2.55   ? 140 LEU B CG  1 
ATOM   4383  C  CD1 . LEU B 2  140 ? -6.073  124.272 9.107   1.00 4.38   ? 140 LEU B CD1 1 
ATOM   4384  C  CD2 . LEU B 2  140 ? -7.907  123.333 7.672   1.00 2.85   ? 140 LEU B CD2 1 
ATOM   4385  N  N   . GLN B 2  141 ? -7.633  121.190 12.310  1.00 3.52   ? 141 GLN B N   1 
ATOM   4386  C  CA  . GLN B 2  141 ? -8.356  121.509 13.545  1.00 6.94   ? 141 GLN B CA  1 
ATOM   4387  C  C   . GLN B 2  141 ? -7.647  122.443 14.511  1.00 3.85   ? 141 GLN B C   1 
ATOM   4388  O  O   . GLN B 2  141 ? -8.054  123.581 14.750  1.00 6.32   ? 141 GLN B O   1 
ATOM   4389  C  CB  . GLN B 2  141 ? -8.817  120.225 14.227  1.00 5.22   ? 141 GLN B CB  1 
ATOM   4390  C  CG  . GLN B 2  141 ? -9.903  119.474 13.476  1.00 4.49   ? 141 GLN B CG  1 
ATOM   4391  C  CD  . GLN B 2  141 ? -11.084 120.316 13.064  1.00 8.94   ? 141 GLN B CD  1 
ATOM   4392  O  OE1 . GLN B 2  141 ? -11.286 121.439 13.510  1.00 11.12  ? 141 GLN B OE1 1 
ATOM   4393  N  NE2 . GLN B 2  141 ? -11.904 119.771 12.179  1.00 13.59  ? 141 GLN B NE2 1 
ATOM   4394  N  N   . PRO B 2  142 ? -6.493  122.047 14.978  1.00 2.20   ? 142 PRO B N   1 
ATOM   4395  C  CA  . PRO B 2  142 ? -5.707  122.894 15.903  1.00 7.72   ? 142 PRO B CA  1 
ATOM   4396  C  C   . PRO B 2  142 ? -5.610  124.346 15.484  1.00 8.80   ? 142 PRO B C   1 
ATOM   4397  O  O   . PRO B 2  142 ? -5.792  125.326 16.223  1.00 4.24   ? 142 PRO B O   1 
ATOM   4398  C  CB  . PRO B 2  142 ? -4.312  122.256 15.999  1.00 6.88   ? 142 PRO B CB  1 
ATOM   4399  C  CG  . PRO B 2  142 ? -4.390  121.239 14.875  1.00 2.58   ? 142 PRO B CG  1 
ATOM   4400  C  CD  . PRO B 2  142 ? -5.821  120.788 14.770  1.00 9.69   ? 142 PRO B CD  1 
ATOM   4401  N  N   . GLN B 2  143 ? -5.335  124.544 14.186  1.00 12.28  ? 143 GLN B N   1 
ATOM   4402  C  CA  . GLN B 2  143 ? -5.181  125.842 13.568  1.00 9.26   ? 143 GLN B CA  1 
ATOM   4403  C  C   . GLN B 2  143 ? -6.287  126.808 13.965  1.00 9.91   ? 143 GLN B C   1 
ATOM   4404  O  O   . GLN B 2  143 ? -6.024  128.001 13.944  1.00 13.42  ? 143 GLN B O   1 
ATOM   4405  C  CB  . GLN B 2  143 ? -5.149  125.718 12.045  1.00 7.47   ? 143 GLN B CB  1 
ATOM   4406  C  CG  . GLN B 2  143 ? -4.879  127.038 11.331  1.00 3.43   ? 143 GLN B CG  1 
ATOM   4407  C  CD  . GLN B 2  143 ? -3.502  127.548 11.728  1.00 6.72   ? 143 GLN B CD  1 
ATOM   4408  O  OE1 . GLN B 2  143 ? -2.684  126.786 12.226  1.00 4.79   ? 143 GLN B OE1 1 
ATOM   4409  N  NE2 . GLN B 2  143 ? -3.263  128.820 11.481  1.00 9.71   ? 143 GLN B NE2 1 
ATOM   4410  N  N   . LEU B 2  144 ? -7.498  126.328 14.187  1.00 14.03  ? 144 LEU B N   1 
ATOM   4411  C  CA  . LEU B 2  144 ? -8.663  127.110 14.563  1.00 9.43   ? 144 LEU B CA  1 
ATOM   4412  C  C   . LEU B 2  144 ? -8.439  127.824 15.910  1.00 6.92   ? 144 LEU B C   1 
ATOM   4413  O  O   . LEU B 2  144 ? -8.951  128.928 16.092  1.00 3.66   ? 144 LEU B O   1 
ATOM   4414  C  CB  . LEU B 2  144 ? -9.892  126.252 14.798  1.00 2.20   ? 144 LEU B CB  1 
ATOM   4415  C  CG  . LEU B 2  144 ? -10.565 125.463 13.690  1.00 7.07   ? 144 LEU B CG  1 
ATOM   4416  C  CD1 . LEU B 2  144 ? -11.582 124.433 14.174  1.00 2.20   ? 144 LEU B CD1 1 
ATOM   4417  C  CD2 . LEU B 2  144 ? -11.246 126.345 12.679  1.00 2.20   ? 144 LEU B CD2 1 
ATOM   4418  N  N   . ARG B 2  145 ? -7.852  127.112 16.874  1.00 3.33   ? 145 ARG B N   1 
ATOM   4419  C  CA  . ARG B 2  145 ? -7.592  127.708 18.186  1.00 2.20   ? 145 ARG B CA  1 
ATOM   4420  C  C   . ARG B 2  145 ? -6.620  128.877 17.965  1.00 5.44   ? 145 ARG B C   1 
ATOM   4421  O  O   . ARG B 2  145 ? -6.831  129.932 18.528  1.00 6.72   ? 145 ARG B O   1 
ATOM   4422  C  CB  . ARG B 2  145 ? -6.954  126.796 19.198  1.00 7.87   ? 145 ARG B CB  1 
ATOM   4423  C  CG  . ARG B 2  145 ? -7.734  126.359 20.408  1.00 18.62  ? 145 ARG B CG  1 
ATOM   4424  C  CD  . ARG B 2  145 ? -7.312  124.988 20.862  1.00 27.64  ? 145 ARG B CD  1 
ATOM   4425  N  NE  . ARG B 2  145 ? -8.366  123.999 21.063  1.00 37.94  ? 145 ARG B NE  1 
ATOM   4426  C  CZ  . ARG B 2  145 ? -8.340  123.122 22.061  1.00 51.38  ? 145 ARG B CZ  1 
ATOM   4427  N  NH1 . ARG B 2  145 ? -7.345  123.127 22.945  1.00 64.62  ? 145 ARG B NH1 1 
ATOM   4428  N  NH2 . ARG B 2  145 ? -9.333  122.250 22.147  1.00 58.22  ? 145 ARG B NH2 1 
ATOM   4429  N  N   . ILE B 2  146 ? -5.476  128.618 17.376  1.00 5.54   ? 146 ILE B N   1 
ATOM   4430  C  CA  . ILE B 2  146 ? -4.460  129.608 17.044  1.00 3.32   ? 146 ILE B CA  1 
ATOM   4431  C  C   . ILE B 2  146 ? -5.009  130.861 16.369  1.00 2.20   ? 146 ILE B C   1 
ATOM   4432  O  O   . ILE B 2  146 ? -4.776  132.009 16.774  1.00 5.12   ? 146 ILE B O   1 
ATOM   4433  C  CB  . ILE B 2  146 ? -3.393  128.997 16.100  1.00 3.22   ? 146 ILE B CB  1 
ATOM   4434  C  CG1 . ILE B 2  146 ? -2.557  127.992 16.849  1.00 4.45   ? 146 ILE B CG1 1 
ATOM   4435  C  CG2 . ILE B 2  146 ? -2.613  130.111 15.434  1.00 3.02   ? 146 ILE B CG2 1 
ATOM   4436  C  CD1 . ILE B 2  146 ? -1.111  127.928 16.426  1.00 2.27   ? 146 ILE B CD1 1 
ATOM   4437  N  N   . ASP B 2  147 ? -5.768  130.686 15.297  1.00 4.17   ? 147 ASP B N   1 
ATOM   4438  C  CA  . ASP B 2  147 ? -6.489  131.730 14.629  1.00 7.10   ? 147 ASP B CA  1 
ATOM   4439  C  C   . ASP B 2  147 ? -7.419  132.544 15.540  1.00 2.20   ? 147 ASP B C   1 
ATOM   4440  O  O   . ASP B 2  147 ? -6.983  133.583 16.059  1.00 5.56   ? 147 ASP B O   1 
ATOM   4441  C  CB  . ASP B 2  147 ? -7.259  131.200 13.424  1.00 5.42   ? 147 ASP B CB  1 
ATOM   4442  C  CG  . ASP B 2  147 ? -7.514  132.329 12.454  1.00 16.05  ? 147 ASP B CG  1 
ATOM   4443  O  OD1 . ASP B 2  147 ? -7.134  133.491 12.751  1.00 20.28  ? 147 ASP B OD1 1 
ATOM   4444  O  OD2 . ASP B 2  147 ? -8.113  132.055 11.402  1.00 28.38  ? 147 ASP B OD2 1 
ATOM   4445  N  N   . LYS B 2  148 ? -8.421  131.854 16.085  1.00 5.46   ? 148 LYS B N   1 
ATOM   4446  C  CA  . LYS B 2  148 ? -9.310  132.479 17.041  1.00 5.23   ? 148 LYS B CA  1 
ATOM   4447  C  C   . LYS B 2  148 ? -8.610  133.265 18.141  1.00 3.49   ? 148 LYS B C   1 
ATOM   4448  O  O   . LYS B 2  148 ? -9.095  134.347 18.466  1.00 4.31   ? 148 LYS B O   1 
ATOM   4449  C  CB  . LYS B 2  148 ? -10.278 131.452 17.635  1.00 2.41   ? 148 LYS B CB  1 
ATOM   4450  C  CG  . LYS B 2  148 ? -11.552 132.106 18.169  1.00 7.84   ? 148 LYS B CG  1 
ATOM   4451  C  CD  . LYS B 2  148 ? -12.304 131.047 18.956  1.00 12.74  ? 148 LYS B CD  1 
ATOM   4452  C  CE  . LYS B 2  148 ? -13.299 131.611 19.943  1.00 10.94  ? 148 LYS B CE  1 
ATOM   4453  N  NZ  . LYS B 2  148 ? -14.276 130.535 20.323  1.00 15.26  ? 148 LYS B NZ  1 
ATOM   4454  N  N   . ALA B 2  149 ? -7.513  132.764 18.649  1.00 8.82   ? 149 ALA B N   1 
ATOM   4455  C  CA  . ALA B 2  149 ? -6.665  133.218 19.738  1.00 2.20   ? 149 ALA B CA  1 
ATOM   4456  C  C   . ALA B 2  149 ? -5.996  134.560 19.490  1.00 5.86   ? 149 ALA B C   1 
ATOM   4457  O  O   . ALA B 2  149 ? -6.221  135.532 20.197  1.00 6.69   ? 149 ALA B O   1 
ATOM   4458  C  CB  . ALA B 2  149 ? -5.629  132.115 19.895  1.00 2.20   ? 149 ALA B CB  1 
ATOM   4459  N  N   . VAL B 2  150 ? -5.599  134.652 18.228  1.00 2.20   ? 150 VAL B N   1 
ATOM   4460  C  CA  . VAL B 2  150 ? -4.978  135.885 17.729  1.00 2.90   ? 150 VAL B CA  1 
ATOM   4461  C  C   . VAL B 2  150 ? -6.054  136.898 17.430  1.00 6.31   ? 150 VAL B C   1 
ATOM   4462  O  O   . VAL B 2  150 ? -6.038  138.009 17.938  1.00 2.96   ? 150 VAL B O   1 
ATOM   4463  C  CB  . VAL B 2  150 ? -4.026  135.652 16.557  1.00 6.81   ? 150 VAL B CB  1 
ATOM   4464  C  CG1 . VAL B 2  150 ? -2.977  134.582 16.890  1.00 2.55   ? 150 VAL B CG1 1 
ATOM   4465  C  CG2 . VAL B 2  150 ? -4.729  135.192 15.303  1.00 10.14  ? 150 VAL B CG2 1 
ATOM   4466  N  N   . ALA B 2  151 ? -7.121  136.507 16.730  1.00 6.38   ? 151 ALA B N   1 
ATOM   4467  C  CA  . ALA B 2  151 ? -8.211  137.439 16.480  1.00 6.89   ? 151 ALA B CA  1 
ATOM   4468  C  C   . ALA B 2  151 ? -8.816  137.948 17.778  1.00 5.36   ? 151 ALA B C   1 
ATOM   4469  O  O   . ALA B 2  151 ? -9.096  139.127 17.797  1.00 2.20   ? 151 ALA B O   1 
ATOM   4470  C  CB  . ALA B 2  151 ? -9.347  136.851 15.677  1.00 12.11  ? 151 ALA B CB  1 
ATOM   4471  N  N   . LEU B 2  152 ? -8.945  137.144 18.820  1.00 9.28   ? 152 LEU B N   1 
ATOM   4472  C  CA  . LEU B 2  152 ? -9.562  137.593 20.047  1.00 12.23  ? 152 LEU B CA  1 
ATOM   4473  C  C   . LEU B 2  152 ? -8.573  138.348 20.928  1.00 16.57  ? 152 LEU B C   1 
ATOM   4474  O  O   . LEU B 2  152 ? -8.818  138.440 22.132  1.00 22.55  ? 152 LEU B O   1 
ATOM   4475  C  CB  . LEU B 2  152 ? -10.098 136.520 20.975  1.00 9.25   ? 152 LEU B CB  1 
ATOM   4476  C  CG  . LEU B 2  152 ? -11.111 135.513 20.477  1.00 6.72   ? 152 LEU B CG  1 
ATOM   4477  C  CD1 . LEU B 2  152 ? -11.223 134.314 21.406  1.00 5.46   ? 152 LEU B CD1 1 
ATOM   4478  C  CD2 . LEU B 2  152 ? -12.411 136.197 20.123  1.00 6.82   ? 152 LEU B CD2 1 
ATOM   4479  N  N   . GLN B 2  153 ? -7.515  138.901 20.392  1.00 20.94  ? 153 GLN B N   1 
ATOM   4480  C  CA  . GLN B 2  153 ? -6.697  139.826 21.165  1.00 22.98  ? 153 GLN B CA  1 
ATOM   4481  C  C   . GLN B 2  153 ? -7.186  141.270 21.034  1.00 26.71  ? 153 GLN B C   1 
ATOM   4482  O  O   . GLN B 2  153 ? -6.659  142.146 21.735  1.00 27.33  ? 153 GLN B O   1 
ATOM   4483  C  CB  . GLN B 2  153 ? -5.275  139.816 20.667  1.00 29.95  ? 153 GLN B CB  1 
ATOM   4484  C  CG  . GLN B 2  153 ? -4.410  138.624 20.973  1.00 41.51  ? 153 GLN B CG  1 
ATOM   4485  C  CD  . GLN B 2  153 ? -3.020  138.849 20.377  1.00 54.87  ? 153 GLN B CD  1 
ATOM   4486  O  OE1 . GLN B 2  153 ? -2.705  139.960 19.928  1.00 64.69  ? 153 GLN B OE1 1 
ATOM   4487  N  NE2 . GLN B 2  153 ? -2.212  137.800 20.374  1.00 55.12  ? 153 GLN B NE2 1 
ATOM   4488  N  N   . ASN B 2  154 ? -8.018  141.572 20.046  1.00 27.61  ? 154 ASN B N   1 
ATOM   4489  C  CA  . ASN B 2  154 ? -8.555  142.931 19.964  1.00 31.10  ? 154 ASN B CA  1 
ATOM   4490  C  C   . ASN B 2  154 ? -9.945  142.922 20.578  1.00 31.85  ? 154 ASN B C   1 
ATOM   4491  O  O   . ASN B 2  154 ? -10.863 142.363 19.967  1.00 36.56  ? 154 ASN B O   1 
ATOM   4492  C  CB  . ASN B 2  154 ? -8.667  143.367 18.501  1.00 42.87  ? 154 ASN B CB  1 
ATOM   4493  C  CG  . ASN B 2  154 ? -7.291  143.409 17.864  1.00 57.44  ? 154 ASN B CG  1 
ATOM   4494  O  OD1 . ASN B 2  154 ? -6.363  143.967 18.459  1.00 66.44  ? 154 ASN B OD1 1 
ATOM   4495  N  ND2 . ASN B 2  154 ? -7.148  142.815 16.688  1.00 59.86  ? 154 ASN B ND2 1 
ATOM   4496  N  N   . PRO B 2  155 ? -10.152 143.569 21.693  1.00 29.38  ? 155 PRO B N   1 
ATOM   4497  C  CA  . PRO B 2  155 ? -11.479 143.641 22.297  1.00 29.24  ? 155 PRO B CA  1 
ATOM   4498  C  C   . PRO B 2  155 ? -12.536 143.871 21.241  1.00 27.87  ? 155 PRO B C   1 
ATOM   4499  O  O   . PRO B 2  155 ? -13.427 143.012 21.154  1.00 23.90  ? 155 PRO B O   1 
ATOM   4500  C  CB  . PRO B 2  155 ? -11.406 144.684 23.412  1.00 31.52  ? 155 PRO B CB  1 
ATOM   4501  C  CG  . PRO B 2  155 ? -9.926  144.599 23.738  1.00 31.26  ? 155 PRO B CG  1 
ATOM   4502  C  CD  . PRO B 2  155 ? -9.166  144.315 22.457  1.00 28.16  ? 155 PRO B CD  1 
ATOM   4503  N  N   . GLN B 2  156 ? -12.334 144.763 20.269  1.00 25.02  ? 156 GLN B N   1 
ATOM   4504  C  CA  . GLN B 2  156 ? -13.252 144.855 19.151  1.00 21.25  ? 156 GLN B CA  1 
ATOM   4505  C  C   . GLN B 2  156 ? -13.710 143.494 18.693  1.00 16.41  ? 156 GLN B C   1 
ATOM   4506  O  O   . GLN B 2  156 ? -14.930 143.236 18.684  1.00 17.03  ? 156 GLN B O   1 
ATOM   4507  C  CB  . GLN B 2  156 ? -12.718 145.795 18.089  1.00 39.64  ? 156 GLN B CB  1 
ATOM   4508  C  CG  . GLN B 2  156 ? -11.279 145.616 17.664  1.00 55.09  ? 156 GLN B CG  1 
ATOM   4509  C  CD  . GLN B 2  156 ? -10.760 146.585 16.625  1.00 59.48  ? 156 GLN B CD  1 
ATOM   4510  O  OE1 . GLN B 2  156 ? -11.445 147.052 15.718  1.00 63.87  ? 156 GLN B OE1 1 
ATOM   4511  N  NE2 . GLN B 2  156 ? -9.469  146.903 16.748  1.00 59.63  ? 156 GLN B NE2 1 
ATOM   4512  N  N   . ALA B 2  157 ? -12.863 142.516 18.369  1.00 9.41   ? 157 ALA B N   1 
ATOM   4513  C  CA  . ALA B 2  157 ? -13.407 141.252 17.929  1.00 7.91   ? 157 ALA B CA  1 
ATOM   4514  C  C   . ALA B 2  157 ? -14.350 140.548 18.872  1.00 7.18   ? 157 ALA B C   1 
ATOM   4515  O  O   . ALA B 2  157 ? -15.355 140.107 18.286  1.00 9.72   ? 157 ALA B O   1 
ATOM   4516  C  CB  . ALA B 2  157 ? -12.444 140.312 17.305  1.00 5.78   ? 157 ALA B CB  1 
ATOM   4517  N  N   . HIS B 2  158 ? -14.152 140.383 20.171  1.00 4.99   ? 158 HIS B N   1 
ATOM   4518  C  CA  . HIS B 2  158 ? -15.062 139.634 21.041  1.00 3.90   ? 158 HIS B CA  1 
ATOM   4519  C  C   . HIS B 2  158 ? -16.342 140.396 21.331  1.00 5.50   ? 158 HIS B C   1 
ATOM   4520  O  O   . HIS B 2  158 ? -17.449 139.844 21.253  1.00 7.95   ? 158 HIS B O   1 
ATOM   4521  C  CB  . HIS B 2  158 ? -14.441 139.061 22.314  1.00 14.41  ? 158 HIS B CB  1 
ATOM   4522  C  CG  . HIS B 2  158 ? -15.163 137.839 22.836  1.00 22.26  ? 158 HIS B CG  1 
ATOM   4523  N  ND1 . HIS B 2  158 ? -16.144 137.870 23.819  1.00 26.49  ? 158 HIS B ND1 1 
ATOM   4524  C  CD2 . HIS B 2  158 ? -15.076 136.532 22.495  1.00 14.59  ? 158 HIS B CD2 1 
ATOM   4525  C  CE1 . HIS B 2  158 ? -16.615 136.655 24.054  1.00 9.48   ? 158 HIS B CE1 1 
ATOM   4526  N  NE2 . HIS B 2  158 ? -15.979 135.827 23.256  1.00 5.35   ? 158 HIS B NE2 1 
ATOM   4527  N  N   . VAL B 2  159 ? -16.227 141.685 21.593  1.00 6.14   ? 159 VAL B N   1 
ATOM   4528  C  CA  . VAL B 2  159 ? -17.402 142.543 21.790  1.00 7.48   ? 159 VAL B CA  1 
ATOM   4529  C  C   . VAL B 2  159 ? -18.309 142.567 20.568  1.00 5.66   ? 159 VAL B C   1 
ATOM   4530  O  O   . VAL B 2  159 ? -19.506 142.237 20.588  1.00 2.40   ? 159 VAL B O   1 
ATOM   4531  C  CB  . VAL B 2  159 ? -16.900 143.979 22.073  1.00 8.69   ? 159 VAL B CB  1 
ATOM   4532  C  CG1 . VAL B 2  159 ? -17.936 145.024 21.755  1.00 6.08   ? 159 VAL B CG1 1 
ATOM   4533  C  CG2 . VAL B 2  159 ? -16.327 144.085 23.466  1.00 13.47  ? 159 VAL B CG2 1 
ATOM   4534  N  N   . ILE B 2  160 ? -17.727 142.948 19.435  1.00 4.87   ? 160 ILE B N   1 
ATOM   4535  C  CA  . ILE B 2  160 ? -18.449 143.035 18.180  1.00 6.13   ? 160 ILE B CA  1 
ATOM   4536  C  C   . ILE B 2  160 ? -19.109 141.711 17.842  1.00 7.65   ? 160 ILE B C   1 
ATOM   4537  O  O   . ILE B 2  160 ? -20.251 141.677 17.365  1.00 7.89   ? 160 ILE B O   1 
ATOM   4538  C  CB  . ILE B 2  160 ? -17.551 143.519 17.019  1.00 2.20   ? 160 ILE B CB  1 
ATOM   4539  C  CG1 . ILE B 2  160 ? -17.578 145.063 16.991  1.00 15.48  ? 160 ILE B CG1 1 
ATOM   4540  C  CG2 . ILE B 2  160 ? -18.112 143.021 15.703  1.00 7.24   ? 160 ILE B CG2 1 
ATOM   4541  C  CD1 . ILE B 2  160 ? -16.347 145.736 17.557  1.00 24.59  ? 160 ILE B CD1 1 
ATOM   4542  N  N   . GLU B 2  161 ? -18.453 140.606 18.171  1.00 8.98   ? 161 GLU B N   1 
ATOM   4543  C  CA  . GLU B 2  161 ? -19.047 139.276 17.980  1.00 8.91   ? 161 GLU B CA  1 
ATOM   4544  C  C   . GLU B 2  161 ? -20.219 139.046 18.914  1.00 5.70   ? 161 GLU B C   1 
ATOM   4545  O  O   . GLU B 2  161 ? -21.349 138.843 18.481  1.00 11.31  ? 161 GLU B O   1 
ATOM   4546  C  CB  . GLU B 2  161 ? -17.973 138.241 18.261  1.00 2.96   ? 161 GLU B CB  1 
ATOM   4547  C  CG  . GLU B 2  161 ? -16.928 138.331 17.114  1.00 12.23  ? 161 GLU B CG  1 
ATOM   4548  C  CD  . GLU B 2  161 ? -17.296 137.314 16.049  1.00 10.26  ? 161 GLU B CD  1 
ATOM   4549  O  OE1 . GLU B 2  161 ? -16.936 136.141 16.273  1.00 17.35  ? 161 GLU B OE1 1 
ATOM   4550  O  OE2 . GLU B 2  161 ? -17.945 137.728 15.079  1.00 4.44   ? 161 GLU B OE2 1 
ATOM   4551  N  N   . ASN B 2  162 ? -19.957 139.255 20.193  1.00 7.02   ? 162 ASN B N   1 
ATOM   4552  C  CA  . ASN B 2  162 ? -20.942 139.130 21.226  1.00 2.20   ? 162 ASN B CA  1 
ATOM   4553  C  C   . ASN B 2  162 ? -22.146 140.080 20.976  1.00 6.60   ? 162 ASN B C   1 
ATOM   4554  O  O   . ASN B 2  162 ? -23.292 139.753 21.320  1.00 3.07   ? 162 ASN B O   1 
ATOM   4555  C  CB  . ASN B 2  162 ? -20.286 139.443 22.570  1.00 5.51   ? 162 ASN B CB  1 
ATOM   4556  C  CG  . ASN B 2  162 ? -19.659 138.206 23.165  1.00 4.99   ? 162 ASN B CG  1 
ATOM   4557  O  OD1 . ASN B 2  162 ? -18.783 137.605 22.565  1.00 7.07   ? 162 ASN B OD1 1 
ATOM   4558  N  ND2 . ASN B 2  162 ? -20.065 137.763 24.344  1.00 5.00   ? 162 ASN B ND2 1 
ATOM   4559  N  N   . LEU B 2  163 ? -21.919 141.226 20.323  1.00 7.28   ? 163 LEU B N   1 
ATOM   4560  C  CA  . LEU B 2  163 ? -23.008 142.121 19.904  1.00 7.86   ? 163 LEU B CA  1 
ATOM   4561  C  C   . LEU B 2  163 ? -23.882 141.345 18.927  1.00 5.92   ? 163 LEU B C   1 
ATOM   4562  O  O   . LEU B 2  163 ? -24.981 140.926 19.192  1.00 2.20   ? 163 LEU B O   1 
ATOM   4563  C  CB  . LEU B 2  163 ? -22.477 143.408 19.266  1.00 9.47   ? 163 LEU B CB  1 
ATOM   4564  C  CG  . LEU B 2  163 ? -23.372 144.633 19.092  1.00 9.05   ? 163 LEU B CG  1 
ATOM   4565  C  CD1 . LEU B 2  163 ? -24.031 144.922 20.441  1.00 3.74   ? 163 LEU B CD1 1 
ATOM   4566  C  CD2 . LEU B 2  163 ? -22.679 145.869 18.450  1.00 2.20   ? 163 LEU B CD2 1 
ATOM   4567  N  N   . HIS B 2  164 ? -23.330 140.846 17.814  1.00 2.20   ? 164 HIS B N   1 
ATOM   4568  C  CA  . HIS B 2  164 ? -24.168 140.094 16.885  1.00 4.89   ? 164 HIS B CA  1 
ATOM   4569  C  C   . HIS B 2  164 ? -24.963 138.989 17.543  1.00 3.65   ? 164 HIS B C   1 
ATOM   4570  O  O   . HIS B 2  164 ? -26.163 138.824 17.322  1.00 7.08   ? 164 HIS B O   1 
ATOM   4571  C  CB  . HIS B 2  164 ? -23.339 139.600 15.701  1.00 2.87   ? 164 HIS B CB  1 
ATOM   4572  C  CG  . HIS B 2  164 ? -23.008 140.732 14.762  1.00 6.88   ? 164 HIS B CG  1 
ATOM   4573  N  ND1 . HIS B 2  164 ? -23.481 140.787 13.471  1.00 2.82   ? 164 HIS B ND1 1 
ATOM   4574  C  CD2 . HIS B 2  164 ? -22.293 141.860 14.944  1.00 5.81   ? 164 HIS B CD2 1 
ATOM   4575  C  CE1 . HIS B 2  164 ? -23.083 141.901 12.886  1.00 6.01   ? 164 HIS B CE1 1 
ATOM   4576  N  NE2 . HIS B 2  164 ? -22.353 142.564 13.756  1.00 9.08   ? 164 HIS B NE2 1 
ATOM   4577  N  N   . ALA B 2  165 ? -24.297 138.211 18.387  1.00 7.10   ? 165 ALA B N   1 
ATOM   4578  C  CA  . ALA B 2  165 ? -24.948 137.094 19.067  1.00 5.30   ? 165 ALA B CA  1 
ATOM   4579  C  C   . ALA B 2  165 ? -26.111 137.567 19.925  1.00 7.30   ? 165 ALA B C   1 
ATOM   4580  O  O   . ALA B 2  165 ? -27.050 136.822 20.190  1.00 7.14   ? 165 ALA B O   1 
ATOM   4581  C  CB  . ALA B 2  165 ? -23.948 136.326 19.905  1.00 4.38   ? 165 ALA B CB  1 
ATOM   4582  N  N   . ALA B 2  166 ? -26.000 138.756 20.505  1.00 6.25   ? 166 ALA B N   1 
ATOM   4583  C  CA  . ALA B 2  166 ? -27.037 139.210 21.414  1.00 11.70  ? 166 ALA B CA  1 
ATOM   4584  C  C   . ALA B 2  166 ? -28.199 139.807 20.644  1.00 17.02  ? 166 ALA B C   1 
ATOM   4585  O  O   . ALA B 2  166 ? -29.352 139.519 20.933  1.00 24.21  ? 166 ALA B O   1 
ATOM   4586  C  CB  . ALA B 2  166 ? -26.511 140.226 22.409  1.00 13.96  ? 166 ALA B CB  1 
ATOM   4587  N  N   . ALA B 2  167 ? -27.899 140.669 19.679  1.00 20.04  ? 167 ALA B N   1 
ATOM   4588  C  CA  . ALA B 2  167 ? -28.931 141.315 18.875  1.00 17.89  ? 167 ALA B CA  1 
ATOM   4589  C  C   . ALA B 2  167 ? -29.588 140.341 17.922  1.00 12.28  ? 167 ALA B C   1 
ATOM   4590  O  O   . ALA B 2  167 ? -30.719 140.414 17.438  1.00 11.84  ? 167 ALA B O   1 
ATOM   4591  C  CB  . ALA B 2  167 ? -28.432 142.577 18.211  1.00 10.00  ? 167 ALA B CB  1 
ATOM   4592  N  N   . TYR B 2  168 ? -28.946 139.235 17.601  1.00 12.04  ? 168 TYR B N   1 
ATOM   4593  C  CA  . TYR B 2  168 ? -29.669 138.300 16.740  1.00 14.48  ? 168 TYR B CA  1 
ATOM   4594  C  C   . TYR B 2  168 ? -29.902 137.024 17.512  1.00 15.19  ? 168 TYR B C   1 
ATOM   4595  O  O   . TYR B 2  168 ? -29.219 136.550 18.415  1.00 28.72  ? 168 TYR B O   1 
ATOM   4596  C  CB  . TYR B 2  168 ? -29.083 138.124 15.364  1.00 8.16   ? 168 TYR B CB  1 
ATOM   4597  C  CG  . TYR B 2  168 ? -29.060 139.349 14.496  1.00 8.09   ? 168 TYR B CG  1 
ATOM   4598  C  CD1 . TYR B 2  168 ? -30.082 139.700 13.646  1.00 3.63   ? 168 TYR B CD1 1 
ATOM   4599  C  CD2 . TYR B 2  168 ? -27.956 140.189 14.498  1.00 20.46  ? 168 TYR B CD2 1 
ATOM   4600  C  CE1 . TYR B 2  168 ? -30.068 140.824 12.837  1.00 2.20   ? 168 TYR B CE1 1 
ATOM   4601  C  CE2 . TYR B 2  168 ? -27.901 141.317 13.692  1.00 22.61  ? 168 TYR B CE2 1 
ATOM   4602  C  CZ  . TYR B 2  168 ? -28.966 141.637 12.878  1.00 14.79  ? 168 TYR B CZ  1 
ATOM   4603  O  OH  . TYR B 2  168 ? -28.877 142.768 12.115  1.00 16.89  ? 168 TYR B OH  1 
ATOM   4604  N  N   . ARG B 2  169 ? -30.926 136.324 17.088  1.00 14.32  ? 169 ARG B N   1 
ATOM   4605  C  CA  . ARG B 2  169 ? -31.336 135.101 17.721  1.00 21.01  ? 169 ARG B CA  1 
ATOM   4606  C  C   . ARG B 2  169 ? -30.956 133.838 16.980  1.00 21.56  ? 169 ARG B C   1 
ATOM   4607  O  O   . ARG B 2  169 ? -30.936 132.747 17.539  1.00 24.95  ? 169 ARG B O   1 
ATOM   4608  C  CB  . ARG B 2  169 ? -32.892 135.068 17.692  1.00 28.21  ? 169 ARG B CB  1 
ATOM   4609  C  CG  . ARG B 2  169 ? -33.365 134.218 18.856  1.00 51.79  ? 169 ARG B CG  1 
ATOM   4610  C  CD  . ARG B 2  169 ? -34.855 134.469 19.086  1.00 71.89  ? 169 ARG B CD  1 
ATOM   4611  N  NE  . ARG B 2  169 ? -35.547 133.187 18.916  1.00 83.39  ? 169 ARG B NE  1 
ATOM   4612  C  CZ  . ARG B 2  169 ? -36.821 133.068 18.615  1.00 84.90  ? 169 ARG B CZ  1 
ATOM   4613  N  NH1 . ARG B 2  169 ? -37.634 134.107 18.513  1.00 83.90  ? 169 ARG B NH1 1 
ATOM   4614  N  NH2 . ARG B 2  169 ? -37.294 131.823 18.497  1.00 86.66  ? 169 ARG B NH2 1 
ATOM   4615  N  N   . ASN B 2  170 ? -30.965 133.932 15.655  1.00 23.01  ? 170 ASN B N   1 
ATOM   4616  C  CA  . ASN B 2  170 ? -30.814 132.737 14.873  1.00 27.65  ? 170 ASN B CA  1 
ATOM   4617  C  C   . ASN B 2  170 ? -29.702 132.702 13.854  1.00 32.43  ? 170 ASN B C   1 
ATOM   4618  O  O   . ASN B 2  170 ? -28.911 131.736 13.823  1.00 41.58  ? 170 ASN B O   1 
ATOM   4619  C  CB  . ASN B 2  170 ? -32.152 132.455 14.149  1.00 30.04  ? 170 ASN B CB  1 
ATOM   4620  C  CG  . ASN B 2  170 ? -32.380 133.481 13.056  1.00 37.25  ? 170 ASN B CG  1 
ATOM   4621  O  OD1 . ASN B 2  170 ? -31.911 134.621 13.158  1.00 38.36  ? 170 ASN B OD1 1 
ATOM   4622  N  ND2 . ASN B 2  170 ? -33.058 133.112 11.982  1.00 35.37  ? 170 ASN B ND2 1 
ATOM   4623  N  N   . ALA B 2  171 ? -29.657 133.642 12.920  1.00 30.74  ? 171 ALA B N   1 
ATOM   4624  C  CA  . ALA B 2  171 ? -28.789 133.535 11.758  1.00 29.40  ? 171 ALA B CA  1 
ATOM   4625  C  C   . ALA B 2  171 ? -27.569 134.414 11.727  1.00 26.63  ? 171 ALA B C   1 
ATOM   4626  O  O   . ALA B 2  171 ? -26.426 134.006 11.575  1.00 24.86  ? 171 ALA B O   1 
ATOM   4627  C  CB  . ALA B 2  171 ? -29.582 133.821 10.469  1.00 28.04  ? 171 ALA B CB  1 
ATOM   4628  N  N   . LEU B 2  172 ? -27.815 135.724 11.701  1.00 25.83  ? 172 LEU B N   1 
ATOM   4629  C  CA  . LEU B 2  172 ? -26.692 136.654 11.706  1.00 17.47  ? 172 LEU B CA  1 
ATOM   4630  C  C   . LEU B 2  172 ? -26.010 136.589 13.069  1.00 15.51  ? 172 LEU B C   1 
ATOM   4631  O  O   . LEU B 2  172 ? -25.238 137.517 13.358  1.00 18.35  ? 172 LEU B O   1 
ATOM   4632  C  CB  . LEU B 2  172 ? -27.186 138.086 11.512  1.00 10.07  ? 172 LEU B CB  1 
ATOM   4633  C  CG  . LEU B 2  172 ? -27.547 138.577 10.123  1.00 7.55   ? 172 LEU B CG  1 
ATOM   4634  C  CD1 . LEU B 2  172 ? -27.378 140.093 10.066  1.00 9.71   ? 172 LEU B CD1 1 
ATOM   4635  C  CD2 . LEU B 2  172 ? -26.668 137.914 9.087   1.00 2.70   ? 172 LEU B CD2 1 
ATOM   4636  N  N   . ALA B 2  173 ? -26.543 135.883 14.066  1.00 14.29  ? 173 ALA B N   1 
ATOM   4637  C  CA  . ALA B 2  173 ? -25.903 136.041 15.386  1.00 14.70  ? 173 ALA B CA  1 
ATOM   4638  C  C   . ALA B 2  173 ? -24.682 135.131 15.424  1.00 11.76  ? 173 ALA B C   1 
ATOM   4639  O  O   . ALA B 2  173 ? -23.692 135.321 16.116  1.00 14.19  ? 173 ALA B O   1 
ATOM   4640  C  CB  . ALA B 2  173 ? -26.813 135.670 16.543  1.00 8.40   ? 173 ALA B CB  1 
ATOM   4641  N  N   . ASN B 2  174 ? -24.808 134.050 14.672  1.00 8.76   ? 174 ASN B N   1 
ATOM   4642  C  CA  . ASN B 2  174 ? -23.690 133.105 14.766  1.00 11.89  ? 174 ASN B CA  1 
ATOM   4643  C  C   . ASN B 2  174 ? -22.467 133.833 14.229  1.00 13.15  ? 174 ASN B C   1 
ATOM   4644  O  O   . ASN B 2  174 ? -22.664 134.676 13.358  1.00 15.76  ? 174 ASN B O   1 
ATOM   4645  C  CB  . ASN B 2  174 ? -24.099 131.847 14.092  1.00 2.20   ? 174 ASN B CB  1 
ATOM   4646  C  CG  . ASN B 2  174 ? -24.266 131.988 12.603  1.00 2.42   ? 174 ASN B CG  1 
ATOM   4647  O  OD1 . ASN B 2  174 ? -24.688 131.014 11.964  1.00 3.05   ? 174 ASN B OD1 1 
ATOM   4648  N  ND2 . ASN B 2  174 ? -23.980 133.300 12.144  1.00 16.51  ? 174 ASN B ND2 1 
ATOM   4649  N  N   . SER B 2  175 ? -21.422 133.834 15.041  1.00 14.71  ? 175 SER B N   1 
ATOM   4650  C  CA  . SER B 2  175 ? -20.222 134.596 14.831  1.00 12.54  ? 175 SER B CA  1 
ATOM   4651  C  C   . SER B 2  175 ? -19.429 134.015 13.655  1.00 13.92  ? 175 SER B C   1 
ATOM   4652  O  O   . SER B 2  175 ? -19.829 133.008 13.094  1.00 11.18  ? 175 SER B O   1 
ATOM   4653  C  CB  . SER B 2  175 ? -19.276 134.375 16.038  1.00 22.02  ? 175 SER B CB  1 
ATOM   4654  O  OG  . SER B 2  175 ? -18.259 133.478 15.590  1.00 10.29  ? 175 SER B OG  1 
ATOM   4655  N  N   . LEU B 2  176 ? -18.237 134.582 13.521  1.00 13.70  ? 176 LEU B N   1 
ATOM   4656  C  CA  . LEU B 2  176 ? -17.304 134.179 12.496  1.00 17.67  ? 176 LEU B CA  1 
ATOM   4657  C  C   . LEU B 2  176 ? -16.304 133.136 12.972  1.00 16.48  ? 176 LEU B C   1 
ATOM   4658  O  O   . LEU B 2  176 ? -15.802 132.395 12.126  1.00 22.97  ? 176 LEU B O   1 
ATOM   4659  C  CB  . LEU B 2  176 ? -16.508 135.409 12.012  1.00 17.40  ? 176 LEU B CB  1 
ATOM   4660  C  CG  . LEU B 2  176 ? -17.293 136.363 11.112  1.00 22.75  ? 176 LEU B CG  1 
ATOM   4661  C  CD1 . LEU B 2  176 ? -16.517 137.654 10.904  1.00 18.34  ? 176 LEU B CD1 1 
ATOM   4662  C  CD2 . LEU B 2  176 ? -17.596 135.752 9.754   1.00 21.10  ? 176 LEU B CD2 1 
ATOM   4663  N  N   . TYR B 2  177 ? -16.032 133.132 14.265  1.00 11.04  ? 177 TYR B N   1 
ATOM   4664  C  CA  . TYR B 2  177 ? -15.044 132.234 14.835  1.00 7.60   ? 177 TYR B CA  1 
ATOM   4665  C  C   . TYR B 2  177 ? -15.617 130.987 15.461  1.00 9.46   ? 177 TYR B C   1 
ATOM   4666  O  O   . TYR B 2  177 ? -16.497 130.960 16.338  1.00 15.67  ? 177 TYR B O   1 
ATOM   4667  C  CB  . TYR B 2  177 ? -14.176 133.046 15.799  1.00 7.50   ? 177 TYR B CB  1 
ATOM   4668  C  CG  . TYR B 2  177 ? -13.564 134.253 15.176  1.00 7.39   ? 177 TYR B CG  1 
ATOM   4669  C  CD1 . TYR B 2  177 ? -12.449 134.091 14.381  1.00 7.01   ? 177 TYR B CD1 1 
ATOM   4670  C  CD2 . TYR B 2  177 ? -14.075 135.523 15.348  1.00 6.55   ? 177 TYR B CD2 1 
ATOM   4671  C  CE1 . TYR B 2  177 ? -11.843 135.167 13.768  1.00 7.43   ? 177 TYR B CE1 1 
ATOM   4672  C  CE2 . TYR B 2  177 ? -13.474 136.615 14.734  1.00 8.47   ? 177 TYR B CE2 1 
ATOM   4673  C  CZ  . TYR B 2  177 ? -12.359 136.436 13.948  1.00 7.15   ? 177 TYR B CZ  1 
ATOM   4674  O  OH  . TYR B 2  177 ? -11.719 137.465 13.318  1.00 4.41   ? 177 TYR B OH  1 
ATOM   4675  N  N   . CYS B 2  178 ? -15.061 129.843 15.052  1.00 6.85   ? 178 CYS B N   1 
ATOM   4676  C  CA  . CYS B 2  178 ? -15.559 128.639 15.641  1.00 2.30   ? 178 CYS B CA  1 
ATOM   4677  C  C   . CYS B 2  178 ? -15.757 128.755 17.158  1.00 9.25   ? 178 CYS B C   1 
ATOM   4678  O  O   . CYS B 2  178 ? -14.841 129.138 17.910  1.00 15.10  ? 178 CYS B O   1 
ATOM   4679  C  CB  . CYS B 2  178 ? -14.360 127.573 15.528  1.00 2.20   ? 178 CYS B CB  1 
ATOM   4680  S  SG  . CYS B 2  178 ? -15.171 125.929 15.557  1.00 3.92   ? 178 CYS B SG  1 
ATOM   4681  N  N   . PRO B 2  179 ? -16.810 128.167 17.706  1.00 5.04   ? 179 PRO B N   1 
ATOM   4682  C  CA  . PRO B 2  179 ? -17.023 128.031 19.137  1.00 6.37   ? 179 PRO B CA  1 
ATOM   4683  C  C   . PRO B 2  179 ? -15.969 127.128 19.765  1.00 10.24  ? 179 PRO B C   1 
ATOM   4684  O  O   . PRO B 2  179 ? -15.568 126.091 19.188  1.00 10.35  ? 179 PRO B O   1 
ATOM   4685  C  CB  . PRO B 2  179 ? -18.441 127.462 19.315  1.00 5.60   ? 179 PRO B CB  1 
ATOM   4686  C  CG  . PRO B 2  179 ? -19.025 127.515 17.940  1.00 5.94   ? 179 PRO B CG  1 
ATOM   4687  C  CD  . PRO B 2  179 ? -17.944 127.714 16.912  1.00 7.09   ? 179 PRO B CD  1 
ATOM   4688  N  N   . ASP B 2  180 ? -15.520 127.521 20.974  1.00 5.70   ? 180 ASP B N   1 
ATOM   4689  C  CA  . ASP B 2  180 ? -14.496 126.738 21.648  1.00 4.53   ? 180 ASP B CA  1 
ATOM   4690  C  C   . ASP B 2  180 ? -14.840 125.268 21.700  1.00 4.68   ? 180 ASP B C   1 
ATOM   4691  O  O   . ASP B 2  180 ? -14.044 124.419 21.290  1.00 10.49  ? 180 ASP B O   1 
ATOM   4692  C  CB  . ASP B 2  180 ? -13.925 127.289 22.909  1.00 8.47   ? 180 ASP B CB  1 
ATOM   4693  C  CG  . ASP B 2  180 ? -13.202 128.600 22.790  1.00 16.22  ? 180 ASP B CG  1 
ATOM   4694  O  OD1 . ASP B 2  180 ? -12.460 128.825 21.813  1.00 34.18  ? 180 ASP B OD1 1 
ATOM   4695  O  OD2 . ASP B 2  180 ? -13.348 129.486 23.657  1.00 23.52  ? 180 ASP B OD2 1 
ATOM   4696  N  N   . TYR B 2  181 ? -16.112 124.926 21.899  1.00 4.66   ? 181 TYR B N   1 
ATOM   4697  C  CA  . TYR B 2  181 ? -16.388 123.528 22.016  1.00 3.14   ? 181 TYR B CA  1 
ATOM   4698  C  C   . TYR B 2  181 ? -16.567 122.706 20.767  1.00 6.62   ? 181 TYR B C   1 
ATOM   4699  O  O   . TYR B 2  181 ? -16.911 121.535 20.957  1.00 4.28   ? 181 TYR B O   1 
ATOM   4700  C  CB  . TYR B 2  181 ? -17.670 123.334 22.797  1.00 3.24   ? 181 TYR B CB  1 
ATOM   4701  C  CG  . TYR B 2  181 ? -18.849 123.735 21.952  1.00 2.57   ? 181 TYR B CG  1 
ATOM   4702  C  CD1 . TYR B 2  181 ? -19.378 125.014 21.938  1.00 11.05  ? 181 TYR B CD1 1 
ATOM   4703  C  CD2 . TYR B 2  181 ? -19.498 122.758 21.211  1.00 4.43   ? 181 TYR B CD2 1 
ATOM   4704  C  CE1 . TYR B 2  181 ? -20.508 125.330 21.202  1.00 12.01  ? 181 TYR B CE1 1 
ATOM   4705  C  CE2 . TYR B 2  181 ? -20.551 123.108 20.465  1.00 2.20   ? 181 TYR B CE2 1 
ATOM   4706  C  CZ  . TYR B 2  181 ? -21.131 124.348 20.462  1.00 11.01  ? 181 TYR B CZ  1 
ATOM   4707  O  OH  . TYR B 2  181 ? -22.256 124.525 19.671  1.00 14.87  ? 181 TYR B OH  1 
ATOM   4708  N  N   . ARG B 2  182 ? -16.189 123.243 19.640  1.00 3.09   ? 182 ARG B N   1 
ATOM   4709  C  CA  . ARG B 2  182 ? -16.584 122.606 18.360  1.00 4.41   ? 182 ARG B CA  1 
ATOM   4710  C  C   . ARG B 2  182 ? -15.364 122.408 17.489  1.00 5.82   ? 182 ARG B C   1 
ATOM   4711  O  O   . ARG B 2  182 ? -15.233 121.445 16.757  1.00 5.87   ? 182 ARG B O   1 
ATOM   4712  C  CB  . ARG B 2  182 ? -17.685 123.439 17.784  1.00 4.12   ? 182 ARG B CB  1 
ATOM   4713  C  CG  . ARG B 2  182 ? -18.119 123.389 16.379  1.00 6.55   ? 182 ARG B CG  1 
ATOM   4714  C  CD  . ARG B 2  182 ? -19.443 122.621 16.249  1.00 2.33   ? 182 ARG B CD  1 
ATOM   4715  N  NE  . ARG B 2  182 ? -19.394 121.977 14.940  1.00 7.53   ? 182 ARG B NE  1 
ATOM   4716  C  CZ  . ARG B 2  182 ? -19.493 120.678 14.735  1.00 13.45  ? 182 ARG B CZ  1 
ATOM   4717  N  NH1 . ARG B 2  182 ? -19.776 119.870 15.749  1.00 13.71  ? 182 ARG B NH1 1 
ATOM   4718  N  NH2 . ARG B 2  182 ? -19.352 120.291 13.472  1.00 17.35  ? 182 ARG B NH2 1 
ATOM   4719  N  N   . ILE B 2  183 ? -14.316 123.134 17.813  1.00 5.71   ? 183 ILE B N   1 
ATOM   4720  C  CA  . ILE B 2  183 ? -12.991 123.029 17.242  1.00 8.34   ? 183 ILE B CA  1 
ATOM   4721  C  C   . ILE B 2  183 ? -12.633 121.666 16.763  1.00 6.04   ? 183 ILE B C   1 
ATOM   4722  O  O   . ILE B 2  183 ? -12.942 121.229 15.636  1.00 9.92   ? 183 ILE B O   1 
ATOM   4723  C  CB  . ILE B 2  183 ? -11.938 123.590 18.239  1.00 5.47   ? 183 ILE B CB  1 
ATOM   4724  C  CG1 . ILE B 2  183 ? -12.001 125.104 18.214  1.00 2.20   ? 183 ILE B CG1 1 
ATOM   4725  C  CG2 . ILE B 2  183 ? -10.556 123.159 17.754  1.00 3.93   ? 183 ILE B CG2 1 
ATOM   4726  C  CD1 . ILE B 2  183 ? -12.152 125.964 19.383  1.00 5.21   ? 183 ILE B CD1 1 
ATOM   4727  N  N   . GLY B 2  184 ? -12.060 120.807 17.602  1.00 6.05   ? 184 GLY B N   1 
ATOM   4728  C  CA  . GLY B 2  184 ? -11.743 119.493 17.037  1.00 4.71   ? 184 GLY B CA  1 
ATOM   4729  C  C   . GLY B 2  184 ? -12.903 118.696 16.481  1.00 3.03   ? 184 GLY B C   1 
ATOM   4730  O  O   . GLY B 2  184 ? -12.660 117.507 16.251  1.00 2.20   ? 184 GLY B O   1 
ATOM   4731  N  N   . LYS B 2  185 ? -14.157 119.143 16.557  1.00 6.87   ? 185 LYS B N   1 
ATOM   4732  C  CA  . LYS B 2  185 ? -15.317 118.383 16.162  1.00 4.89   ? 185 LYS B CA  1 
ATOM   4733  C  C   . LYS B 2  185 ? -15.799 118.588 14.731  1.00 4.02   ? 185 LYS B C   1 
ATOM   4734  O  O   . LYS B 2  185 ? -16.678 117.864 14.250  1.00 4.03   ? 185 LYS B O   1 
ATOM   4735  C  CB  . LYS B 2  185 ? -16.484 118.666 17.092  1.00 2.20   ? 185 LYS B CB  1 
ATOM   4736  C  CG  . LYS B 2  185 ? -17.746 117.846 16.765  1.00 25.25  ? 185 LYS B CG  1 
ATOM   4737  C  CD  . LYS B 2  185 ? -18.586 117.554 17.988  1.00 36.31  ? 185 LYS B CD  1 
ATOM   4738  C  CE  . LYS B 2  185 ? -20.021 118.054 17.884  1.00 37.95  ? 185 LYS B CE  1 
ATOM   4739  N  NZ  . LYS B 2  185 ? -20.438 118.689 19.173  1.00 35.84  ? 185 LYS B NZ  1 
ATOM   4740  N  N   . VAL B 2  186 ? -15.248 119.510 13.999  1.00 2.20   ? 186 VAL B N   1 
ATOM   4741  C  CA  . VAL B 2  186 ? -15.775 119.939 12.707  1.00 2.95   ? 186 VAL B CA  1 
ATOM   4742  C  C   . VAL B 2  186 ? -15.494 118.949 11.591  1.00 6.44   ? 186 VAL B C   1 
ATOM   4743  O  O   . VAL B 2  186 ? -14.782 119.325 10.660  1.00 7.66   ? 186 VAL B O   1 
ATOM   4744  C  CB  . VAL B 2  186 ? -15.164 121.280 12.228  1.00 6.37   ? 186 VAL B CB  1 
ATOM   4745  C  CG1 . VAL B 2  186 ? -16.096 121.989 11.290  1.00 2.20   ? 186 VAL B CG1 1 
ATOM   4746  C  CG2 . VAL B 2  186 ? -14.667 122.096 13.395  1.00 2.79   ? 186 VAL B CG2 1 
ATOM   4747  N  N   . THR B 2  187 ? -16.294 117.920 11.417  1.00 3.73   ? 187 THR B N   1 
ATOM   4748  C  CA  . THR B 2  187 ? -15.925 116.806 10.542  1.00 8.24   ? 187 THR B CA  1 
ATOM   4749  C  C   . THR B 2  187 ? -15.915 117.139 9.066   1.00 5.08   ? 187 THR B C   1 
ATOM   4750  O  O   . THR B 2  187 ? -16.660 118.006 8.622   1.00 2.34   ? 187 THR B O   1 
ATOM   4751  C  CB  . THR B 2  187 ? -16.908 115.595 10.706  1.00 7.98   ? 187 THR B CB  1 
ATOM   4752  O  OG1 . THR B 2  187 ? -18.195 115.917 10.175  1.00 9.09   ? 187 THR B OG1 1 
ATOM   4753  C  CG2 . THR B 2  187 ? -16.987 115.013 12.092  1.00 2.88   ? 187 THR B CG2 1 
ATOM   4754  N  N   . PRO B 2  188 ? -15.124 116.342 8.360   1.00 2.93   ? 188 PRO B N   1 
ATOM   4755  C  CA  . PRO B 2  188 ? -15.059 116.419 6.913   1.00 3.85   ? 188 PRO B CA  1 
ATOM   4756  C  C   . PRO B 2  188 ? -16.429 116.455 6.257   1.00 4.38   ? 188 PRO B C   1 
ATOM   4757  O  O   . PRO B 2  188 ? -16.730 117.446 5.560   1.00 4.13   ? 188 PRO B O   1 
ATOM   4758  C  CB  . PRO B 2  188 ? -14.184 115.274 6.403   1.00 4.90   ? 188 PRO B CB  1 
ATOM   4759  C  CG  . PRO B 2  188 ? -13.454 114.886 7.665   1.00 2.20   ? 188 PRO B CG  1 
ATOM   4760  C  CD  . PRO B 2  188 ? -14.297 115.267 8.849   1.00 6.36   ? 188 PRO B CD  1 
ATOM   4761  N  N   . VAL B 2  189 ? -17.378 115.545 6.530   1.00 3.06   ? 189 VAL B N   1 
ATOM   4762  C  CA  . VAL B 2  189 ? -18.668 115.646 5.854   1.00 6.75   ? 189 VAL B CA  1 
ATOM   4763  C  C   . VAL B 2  189 ? -19.163 117.075 5.917   1.00 7.25   ? 189 VAL B C   1 
ATOM   4764  O  O   . VAL B 2  189 ? -19.290 117.691 4.854   1.00 13.19  ? 189 VAL B O   1 
ATOM   4765  C  CB  . VAL B 2  189 ? -19.726 114.615 6.164   1.00 6.38   ? 189 VAL B CB  1 
ATOM   4766  C  CG1 . VAL B 2  189 ? -21.020 114.905 5.397   1.00 4.90   ? 189 VAL B CG1 1 
ATOM   4767  C  CG2 . VAL B 2  189 ? -19.284 113.209 5.730   1.00 4.27   ? 189 VAL B CG2 1 
ATOM   4768  N  N   . GLU B 2  190 ? -19.297 117.598 7.114   1.00 2.20   ? 190 GLU B N   1 
ATOM   4769  C  CA  . GLU B 2  190 ? -19.583 119.025 7.336   1.00 6.24   ? 190 GLU B CA  1 
ATOM   4770  C  C   . GLU B 2  190 ? -18.976 119.988 6.327   1.00 4.56   ? 190 GLU B C   1 
ATOM   4771  O  O   . GLU B 2  190 ? -19.689 120.784 5.717   1.00 2.60   ? 190 GLU B O   1 
ATOM   4772  C  CB  . GLU B 2  190 ? -19.133 119.411 8.737   1.00 5.06   ? 190 GLU B CB  1 
ATOM   4773  C  CG  . GLU B 2  190 ? -20.241 119.655 9.729   1.00 7.52   ? 190 GLU B CG  1 
ATOM   4774  C  CD  . GLU B 2  190 ? -20.192 118.705 10.906  1.00 5.99   ? 190 GLU B CD  1 
ATOM   4775  O  OE1 . GLU B 2  190 ? -19.174 118.004 11.058  1.00 9.25   ? 190 GLU B OE1 1 
ATOM   4776  O  OE2 . GLU B 2  190 ? -21.158 118.635 11.709  1.00 21.81  ? 190 GLU B OE2 1 
ATOM   4777  N  N   . LEU B 2  191 ? -17.665 119.982 6.107   1.00 4.70   ? 191 LEU B N   1 
ATOM   4778  C  CA  . LEU B 2  191 ? -17.054 120.858 5.107   1.00 6.36   ? 191 LEU B CA  1 
ATOM   4779  C  C   . LEU B 2  191 ? -17.543 120.483 3.701   1.00 2.33   ? 191 LEU B C   1 
ATOM   4780  O  O   . LEU B 2  191 ? -17.996 121.307 2.929   1.00 2.20   ? 191 LEU B O   1 
ATOM   4781  C  CB  . LEU B 2  191 ? -15.526 120.828 5.123   1.00 7.68   ? 191 LEU B CB  1 
ATOM   4782  C  CG  . LEU B 2  191 ? -14.691 121.251 6.303   1.00 7.72   ? 191 LEU B CG  1 
ATOM   4783  C  CD1 . LEU B 2  191 ? -13.364 120.474 6.393   1.00 3.43   ? 191 LEU B CD1 1 
ATOM   4784  C  CD2 . LEU B 2  191 ? -14.274 122.715 6.294   1.00 2.26   ? 191 LEU B CD2 1 
ATOM   4785  N  N   . HIS B 2  192 ? -17.550 119.175 3.382   1.00 9.03   ? 192 HIS B N   1 
ATOM   4786  C  CA  . HIS B 2  192 ? -18.127 118.755 2.089   1.00 10.60  ? 192 HIS B CA  1 
ATOM   4787  C  C   . HIS B 2  192 ? -19.488 119.435 1.960   1.00 6.16   ? 192 HIS B C   1 
ATOM   4788  O  O   . HIS B 2  192 ? -19.619 120.434 1.257   1.00 7.82   ? 192 HIS B O   1 
ATOM   4789  C  CB  . HIS B 2  192 ? -18.262 117.253 1.931   1.00 15.75  ? 192 HIS B CB  1 
ATOM   4790  C  CG  . HIS B 2  192 ? -18.583 116.760 0.554   1.00 27.11  ? 192 HIS B CG  1 
ATOM   4791  N  ND1 . HIS B 2  192 ? -17.655 116.622 -0.455  1.00 33.67  ? 192 HIS B ND1 1 
ATOM   4792  C  CD2 . HIS B 2  192 ? -19.762 116.333 0.025   1.00 32.36  ? 192 HIS B CD2 1 
ATOM   4793  C  CE1 . HIS B 2  192 ? -18.248 116.143 -1.544  1.00 35.26  ? 192 HIS B CE1 1 
ATOM   4794  N  NE2 . HIS B 2  192 ? -19.527 115.956 -1.275  1.00 33.49  ? 192 HIS B NE2 1 
ATOM   4795  N  N   . ASP B 2  193 ? -20.446 118.949 2.744   1.00 5.87   ? 193 ASP B N   1 
ATOM   4796  C  CA  . ASP B 2  193 ? -21.752 119.578 2.699   1.00 8.42   ? 193 ASP B CA  1 
ATOM   4797  C  C   . ASP B 2  193 ? -21.673 121.071 2.503   1.00 12.22  ? 193 ASP B C   1 
ATOM   4798  O  O   . ASP B 2  193 ? -22.058 121.617 1.463   1.00 13.61  ? 193 ASP B O   1 
ATOM   4799  C  CB  . ASP B 2  193 ? -22.501 119.197 3.969   1.00 17.17  ? 193 ASP B CB  1 
ATOM   4800  C  CG  . ASP B 2  193 ? -22.898 117.723 3.870   1.00 27.69  ? 193 ASP B CG  1 
ATOM   4801  O  OD1 . ASP B 2  193 ? -22.265 117.065 3.009   1.00 23.53  ? 193 ASP B OD1 1 
ATOM   4802  O  OD2 . ASP B 2  193 ? -23.809 117.251 4.589   1.00 30.07  ? 193 ASP B OD2 1 
ATOM   4803  N  N   . TYR B 2  194 ? -21.038 121.811 3.401   1.00 14.16  ? 194 TYR B N   1 
ATOM   4804  C  CA  . TYR B 2  194 ? -21.034 123.257 3.341   1.00 12.69  ? 194 TYR B CA  1 
ATOM   4805  C  C   . TYR B 2  194 ? -20.590 123.809 1.998   1.00 15.29  ? 194 TYR B C   1 
ATOM   4806  O  O   . TYR B 2  194 ? -20.959 124.963 1.718   1.00 17.18  ? 194 TYR B O   1 
ATOM   4807  C  CB  . TYR B 2  194 ? -20.165 123.902 4.397   1.00 10.77  ? 194 TYR B CB  1 
ATOM   4808  C  CG  . TYR B 2  194 ? -20.419 125.352 4.708   1.00 7.23   ? 194 TYR B CG  1 
ATOM   4809  C  CD1 . TYR B 2  194 ? -21.579 125.689 5.382   1.00 7.23   ? 194 TYR B CD1 1 
ATOM   4810  C  CD2 . TYR B 2  194 ? -19.470 126.343 4.355   1.00 2.20   ? 194 TYR B CD2 1 
ATOM   4811  C  CE1 . TYR B 2  194 ? -21.891 126.982 5.716   1.00 2.20   ? 194 TYR B CE1 1 
ATOM   4812  C  CE2 . TYR B 2  194 ? -19.839 127.632 4.756   1.00 3.12   ? 194 TYR B CE2 1 
ATOM   4813  C  CZ  . TYR B 2  194 ? -20.989 127.969 5.420   1.00 5.07   ? 194 TYR B CZ  1 
ATOM   4814  O  OH  . TYR B 2  194 ? -21.218 129.297 5.704   1.00 2.54   ? 194 TYR B OH  1 
ATOM   4815  N  N   . VAL B 2  195 ? -19.736 123.070 1.302   1.00 16.08  ? 195 VAL B N   1 
ATOM   4816  C  CA  . VAL B 2  195 ? -19.260 123.513 -0.020  1.00 15.01  ? 195 VAL B CA  1 
ATOM   4817  C  C   . VAL B 2  195 ? -20.345 123.257 -1.064  1.00 15.17  ? 195 VAL B C   1 
ATOM   4818  O  O   . VAL B 2  195 ? -20.899 124.150 -1.723  1.00 9.52   ? 195 VAL B O   1 
ATOM   4819  C  CB  . VAL B 2  195 ? -17.954 122.807 -0.396  1.00 10.67  ? 195 VAL B CB  1 
ATOM   4820  C  CG1 . VAL B 2  195 ? -17.422 123.234 -1.749  1.00 13.78  ? 195 VAL B CG1 1 
ATOM   4821  C  CG2 . VAL B 2  195 ? -16.879 123.137 0.635   1.00 21.18  ? 195 VAL B CG2 1 
ATOM   4822  N  N   . GLN B 2  196 ? -20.795 122.002 -1.106  1.00 13.89  ? 196 GLN B N   1 
ATOM   4823  C  CA  . GLN B 2  196 ? -21.887 121.589 -1.960  1.00 15.61  ? 196 GLN B CA  1 
ATOM   4824  C  C   . GLN B 2  196 ? -23.182 122.367 -1.798  1.00 15.60  ? 196 GLN B C   1 
ATOM   4825  O  O   . GLN B 2  196 ? -23.932 122.566 -2.768  1.00 16.64  ? 196 GLN B O   1 
ATOM   4826  C  CB  . GLN B 2  196 ? -22.173 120.094 -1.732  1.00 18.99  ? 196 GLN B CB  1 
ATOM   4827  C  CG  . GLN B 2  196 ? -23.622 119.824 -1.357  1.00 37.42  ? 196 GLN B CG  1 
ATOM   4828  C  CD  . GLN B 2  196 ? -24.092 118.385 -1.383  1.00 47.47  ? 196 GLN B CD  1 
ATOM   4829  O  OE1 . GLN B 2  196 ? -23.617 117.531 -2.146  1.00 49.24  ? 196 GLN B OE1 1 
ATOM   4830  N  NE2 . GLN B 2  196 ? -25.079 118.050 -0.541  1.00 42.83  ? 196 GLN B NE2 1 
ATOM   4831  N  N   . ASN B 2  197 ? -23.550 122.848 -0.607  1.00 9.98   ? 197 ASN B N   1 
ATOM   4832  C  CA  . ASN B 2  197 ? -24.811 123.542 -0.536  1.00 7.71   ? 197 ASN B CA  1 
ATOM   4833  C  C   . ASN B 2  197 ? -24.690 125.028 -0.796  1.00 4.33   ? 197 ASN B C   1 
ATOM   4834  O  O   . ASN B 2  197 ? -25.737 125.609 -1.073  1.00 13.65  ? 197 ASN B O   1 
ATOM   4835  C  CB  . ASN B 2  197 ? -25.523 123.403 0.793   1.00 6.10   ? 197 ASN B CB  1 
ATOM   4836  C  CG  . ASN B 2  197 ? -25.720 122.011 1.319   1.00 10.73  ? 197 ASN B CG  1 
ATOM   4837  O  OD1 . ASN B 2  197 ? -25.189 121.039 0.797   1.00 13.70  ? 197 ASN B OD1 1 
ATOM   4838  N  ND2 . ASN B 2  197 ? -26.481 121.900 2.414   1.00 6.19   ? 197 ASN B ND2 1 
ATOM   4839  N  N   . HIS B 2  198 ? -23.569 125.610 -0.443  1.00 12.53  ? 198 HIS B N   1 
ATOM   4840  C  CA  . HIS B 2  198 ? -23.399 127.064 -0.475  1.00 8.46   ? 198 HIS B CA  1 
ATOM   4841  C  C   . HIS B 2  198 ? -22.463 127.483 -1.569  1.00 5.81   ? 198 HIS B C   1 
ATOM   4842  O  O   . HIS B 2  198 ? -22.710 128.426 -2.226  1.00 2.20   ? 198 HIS B O   1 
ATOM   4843  C  CB  . HIS B 2  198 ? -22.760 127.473 0.881   1.00 9.64   ? 198 HIS B CB  1 
ATOM   4844  C  CG  . HIS B 2  198 ? -23.657 126.977 1.973   1.00 4.49   ? 198 HIS B CG  1 
ATOM   4845  N  ND1 . HIS B 2  198 ? -24.616 127.762 2.554   1.00 4.43   ? 198 HIS B ND1 1 
ATOM   4846  C  CD2 . HIS B 2  198 ? -23.796 125.749 2.501   1.00 6.74   ? 198 HIS B CD2 1 
ATOM   4847  C  CE1 . HIS B 2  198 ? -25.275 127.050 3.439   1.00 8.21   ? 198 HIS B CE1 1 
ATOM   4848  N  NE2 . HIS B 2  198 ? -24.801 125.818 3.423   1.00 5.50   ? 198 HIS B NE2 1 
ATOM   4849  N  N   . PHE B 2  199 ? -21.400 126.757 -1.859  1.00 16.19  ? 199 PHE B N   1 
ATOM   4850  C  CA  . PHE B 2  199 ? -20.505 127.165 -2.964  1.00 26.47  ? 199 PHE B CA  1 
ATOM   4851  C  C   . PHE B 2  199 ? -21.129 126.682 -4.275  1.00 31.94  ? 199 PHE B C   1 
ATOM   4852  O  O   . PHE B 2  199 ? -20.710 125.654 -4.805  1.00 37.75  ? 199 PHE B O   1 
ATOM   4853  C  CB  . PHE B 2  199 ? -19.129 126.552 -2.747  1.00 24.65  ? 199 PHE B CB  1 
ATOM   4854  C  CG  . PHE B 2  199 ? -18.236 127.093 -1.675  1.00 17.84  ? 199 PHE B CG  1 
ATOM   4855  C  CD1 . PHE B 2  199 ? -18.660 127.981 -0.706  1.00 18.37  ? 199 PHE B CD1 1 
ATOM   4856  C  CD2 . PHE B 2  199 ? -16.908 126.702 -1.641  1.00 17.80  ? 199 PHE B CD2 1 
ATOM   4857  C  CE1 . PHE B 2  199 ? -17.820 128.469 0.267   1.00 12.50  ? 199 PHE B CE1 1 
ATOM   4858  C  CE2 . PHE B 2  199 ? -16.055 127.179 -0.673  1.00 20.59  ? 199 PHE B CE2 1 
ATOM   4859  C  CZ  . PHE B 2  199 ? -16.504 128.060 0.286   1.00 17.22  ? 199 PHE B CZ  1 
ATOM   4860  N  N   . THR B 2  200 ? -22.153 127.362 -4.769  1.00 33.80  ? 200 THR B N   1 
ATOM   4861  C  CA  . THR B 2  200 ? -22.912 126.963 -5.936  1.00 27.41  ? 200 THR B CA  1 
ATOM   4862  C  C   . THR B 2  200 ? -23.049 128.084 -6.955  1.00 26.92  ? 200 THR B C   1 
ATOM   4863  O  O   . THR B 2  200 ? -22.787 129.232 -6.630  1.00 31.28  ? 200 THR B O   1 
ATOM   4864  C  CB  . THR B 2  200 ? -24.372 126.672 -5.483  1.00 26.83  ? 200 THR B CB  1 
ATOM   4865  O  OG1 . THR B 2  200 ? -24.998 125.997 -6.587  1.00 47.50  ? 200 THR B OG1 1 
ATOM   4866  C  CG2 . THR B 2  200 ? -25.076 128.027 -5.408  1.00 18.33  ? 200 THR B CG2 1 
ATOM   4867  N  N   . SER B 2  201 ? -23.684 127.834 -8.078  1.00 29.65  ? 201 SER B N   1 
ATOM   4868  C  CA  . SER B 2  201 ? -23.786 128.743 -9.197  1.00 28.93  ? 201 SER B CA  1 
ATOM   4869  C  C   . SER B 2  201 ? -24.575 130.007 -8.921  1.00 29.93  ? 201 SER B C   1 
ATOM   4870  O  O   . SER B 2  201 ? -24.224 131.106 -9.345  1.00 26.09  ? 201 SER B O   1 
ATOM   4871  C  CB  . SER B 2  201 ? -24.482 128.029 -10.369 1.00 35.85  ? 201 SER B CB  1 
ATOM   4872  O  OG  . SER B 2  201 ? -23.553 127.128 -10.961 1.00 38.71  ? 201 SER B OG  1 
ATOM   4873  N  N   . ALA B 2  202 ? -25.735 129.834 -8.284  1.00 30.11  ? 202 ALA B N   1 
ATOM   4874  C  CA  . ALA B 2  202 ? -26.622 130.971 -8.060  1.00 28.30  ? 202 ALA B CA  1 
ATOM   4875  C  C   . ALA B 2  202 ? -26.020 131.995 -7.117  1.00 27.65  ? 202 ALA B C   1 
ATOM   4876  O  O   . ALA B 2  202 ? -26.357 133.182 -7.160  1.00 29.68  ? 202 ALA B O   1 
ATOM   4877  C  CB  . ALA B 2  202 ? -27.943 130.422 -7.536  1.00 29.54  ? 202 ALA B CB  1 
ATOM   4878  N  N   . ARG B 2  203 ? -25.135 131.532 -6.241  1.00 24.80  ? 203 ARG B N   1 
ATOM   4879  C  CA  . ARG B 2  203 ? -24.541 132.352 -5.201  1.00 22.41  ? 203 ARG B CA  1 
ATOM   4880  C  C   . ARG B 2  203 ? -23.212 132.979 -5.537  1.00 22.55  ? 203 ARG B C   1 
ATOM   4881  O  O   . ARG B 2  203 ? -22.633 133.764 -4.771  1.00 24.46  ? 203 ARG B O   1 
ATOM   4882  C  CB  . ARG B 2  203 ? -24.362 131.494 -3.936  1.00 8.83   ? 203 ARG B CB  1 
ATOM   4883  C  CG  . ARG B 2  203 ? -25.605 130.631 -3.756  1.00 13.61  ? 203 ARG B CG  1 
ATOM   4884  C  CD  . ARG B 2  203 ? -25.367 129.461 -2.837  1.00 14.58  ? 203 ARG B CD  1 
ATOM   4885  N  NE  . ARG B 2  203 ? -26.371 129.332 -1.798  1.00 24.05  ? 203 ARG B NE  1 
ATOM   4886  C  CZ  . ARG B 2  203 ? -26.225 129.687 -0.528  1.00 31.75  ? 203 ARG B CZ  1 
ATOM   4887  N  NH1 . ARG B 2  203 ? -25.081 130.203 -0.089  1.00 35.69  ? 203 ARG B NH1 1 
ATOM   4888  N  NH2 . ARG B 2  203 ? -27.237 129.549 0.325   1.00 34.06  ? 203 ARG B NH2 1 
ATOM   4889  N  N   . MET B 2  204 ? -22.689 132.664 -6.719  1.00 20.02  ? 204 MET B N   1 
ATOM   4890  C  CA  . MET B 2  204 ? -21.357 133.182 -7.024  1.00 16.39  ? 204 MET B CA  1 
ATOM   4891  C  C   . MET B 2  204 ? -21.317 134.389 -7.933  1.00 15.75  ? 204 MET B C   1 
ATOM   4892  O  O   . MET B 2  204 ? -22.301 134.715 -8.596  1.00 17.50  ? 204 MET B O   1 
ATOM   4893  C  CB  . MET B 2  204 ? -20.565 132.025 -7.635  1.00 8.31   ? 204 MET B CB  1 
ATOM   4894  C  CG  . MET B 2  204 ? -20.536 130.887 -6.623  1.00 8.56   ? 204 MET B CG  1 
ATOM   4895  S  SD  . MET B 2  204 ? -19.223 129.738 -6.967  1.00 11.18  ? 204 MET B SD  1 
ATOM   4896  C  CE  . MET B 2  204 ? -19.590 129.252 -8.648  1.00 16.58  ? 204 MET B CE  1 
ATOM   4897  N  N   . ALA B 2  205 ? -20.174 135.052 -7.877  1.00 9.13   ? 205 ALA B N   1 
ATOM   4898  C  CA  . ALA B 2  205 ? -19.833 136.166 -8.714  1.00 11.58  ? 205 ALA B CA  1 
ATOM   4899  C  C   . ALA B 2  205 ? -18.321 136.184 -8.938  1.00 13.37  ? 205 ALA B C   1 
ATOM   4900  O  O   . ALA B 2  205 ? -17.521 136.405 -8.034  1.00 18.35  ? 205 ALA B O   1 
ATOM   4901  C  CB  . ALA B 2  205 ? -20.331 137.477 -8.141  1.00 7.76   ? 205 ALA B CB  1 
ATOM   4902  N  N   . LEU B 2  206 ? -17.907 135.870 -10.146 1.00 10.43  ? 206 LEU B N   1 
ATOM   4903  C  CA  . LEU B 2  206 ? -16.520 136.032 -10.556 1.00 10.94  ? 206 LEU B CA  1 
ATOM   4904  C  C   . LEU B 2  206 ? -16.214 137.524 -10.708 1.00 11.43  ? 206 LEU B C   1 
ATOM   4905  O  O   . LEU B 2  206 ? -17.173 138.284 -10.903 1.00 8.16   ? 206 LEU B O   1 
ATOM   4906  C  CB  . LEU B 2  206 ? -16.377 135.369 -11.937 1.00 3.42   ? 206 LEU B CB  1 
ATOM   4907  C  CG  . LEU B 2  206 ? -15.026 134.661 -12.132 1.00 9.34   ? 206 LEU B CG  1 
ATOM   4908  C  CD1 . LEU B 2  206 ? -14.766 133.819 -10.879 1.00 13.05  ? 206 LEU B CD1 1 
ATOM   4909  C  CD2 . LEU B 2  206 ? -15.005 133.823 -13.379 1.00 2.21   ? 206 LEU B CD2 1 
ATOM   4910  N  N   . ILE B 2  207 ? -15.002 138.000 -10.479 1.00 13.05  ? 207 ILE B N   1 
ATOM   4911  C  CA  . ILE B 2  207 ? -14.610 139.389 -10.642 1.00 18.16  ? 207 ILE B CA  1 
ATOM   4912  C  C   . ILE B 2  207 ? -13.141 139.434 -11.076 1.00 23.05  ? 207 ILE B C   1 
ATOM   4913  O  O   . ILE B 2  207 ? -12.296 138.775 -10.462 1.00 29.71  ? 207 ILE B O   1 
ATOM   4914  C  CB  . ILE B 2  207 ? -14.793 140.297 -9.421  1.00 12.71  ? 207 ILE B CB  1 
ATOM   4915  C  CG1 . ILE B 2  207 ? -15.992 139.998 -8.547  1.00 11.12  ? 207 ILE B CG1 1 
ATOM   4916  C  CG2 . ILE B 2  207 ? -14.791 141.785 -9.812  1.00 12.67  ? 207 ILE B CG2 1 
ATOM   4917  C  CD1 . ILE B 2  207 ? -17.366 140.414 -9.004  1.00 8.62   ? 207 ILE B CD1 1 
ATOM   4918  N  N   . GLY B 2  208 ? -12.768 140.182 -12.096 1.00 22.58  ? 208 GLY B N   1 
ATOM   4919  C  CA  . GLY B 2  208 ? -11.335 140.255 -12.451 1.00 23.51  ? 208 GLY B CA  1 
ATOM   4920  C  C   . GLY B 2  208 ? -10.944 141.726 -12.434 1.00 28.28  ? 208 GLY B C   1 
ATOM   4921  O  O   . GLY B 2  208 ? -11.808 142.583 -12.635 1.00 30.44  ? 208 GLY B O   1 
ATOM   4922  N  N   . LEU B 2  209 ? -9.692  142.073 -12.144 1.00 30.61  ? 209 LEU B N   1 
ATOM   4923  C  CA  . LEU B 2  209 ? -9.339  143.490 -12.173 1.00 27.93  ? 209 LEU B CA  1 
ATOM   4924  C  C   . LEU B 2  209 ? -8.252  143.706 -13.214 1.00 28.86  ? 209 LEU B C   1 
ATOM   4925  O  O   . LEU B 2  209 ? -7.797  144.821 -13.495 1.00 34.92  ? 209 LEU B O   1 
ATOM   4926  C  CB  . LEU B 2  209 ? -8.971  144.075 -10.827 1.00 16.27  ? 209 LEU B CB  1 
ATOM   4927  C  CG  . LEU B 2  209 ? -8.498  145.534 -10.941 1.00 24.90  ? 209 LEU B CG  1 
ATOM   4928  C  CD1 . LEU B 2  209 ? -9.566  146.467 -10.410 1.00 30.16  ? 209 LEU B CD1 1 
ATOM   4929  C  CD2 . LEU B 2  209 ? -7.115  145.732 -10.356 1.00 29.28  ? 209 LEU B CD2 1 
ATOM   4930  N  N   . GLY B 2  210 ? -7.973  142.635 -13.960 1.00 28.20  ? 210 GLY B N   1 
ATOM   4931  C  CA  . GLY B 2  210 ? -7.029  142.764 -15.081 1.00 27.28  ? 210 GLY B CA  1 
ATOM   4932  C  C   . GLY B 2  210 ? -7.099  141.562 -16.015 1.00 25.37  ? 210 GLY B C   1 
ATOM   4933  O  O   . GLY B 2  210 ? -6.068  141.052 -16.473 1.00 20.08  ? 210 GLY B O   1 
ATOM   4934  N  N   . VAL B 2  211 ? -8.316  141.040 -16.161 1.00 25.49  ? 211 VAL B N   1 
ATOM   4935  C  CA  . VAL B 2  211 ? -8.553  139.884 -17.020 1.00 26.91  ? 211 VAL B CA  1 
ATOM   4936  C  C   . VAL B 2  211 ? -9.462  140.309 -18.176 1.00 27.01  ? 211 VAL B C   1 
ATOM   4937  O  O   . VAL B 2  211 ? -10.068 141.382 -18.181 1.00 25.10  ? 211 VAL B O   1 
ATOM   4938  C  CB  . VAL B 2  211 ? -9.125  138.681 -16.263 1.00 25.04  ? 211 VAL B CB  1 
ATOM   4939  C  CG1 . VAL B 2  211 ? -9.538  137.520 -17.162 1.00 27.80  ? 211 VAL B CG1 1 
ATOM   4940  C  CG2 . VAL B 2  211 ? -8.080  138.162 -15.277 1.00 23.50  ? 211 VAL B CG2 1 
ATOM   4941  N  N   . SER B 2  212 ? -9.443  139.487 -19.206 1.00 25.90  ? 212 SER B N   1 
ATOM   4942  C  CA  . SER B 2  212 ? -10.306 139.594 -20.371 1.00 23.22  ? 212 SER B CA  1 
ATOM   4943  C  C   . SER B 2  212 ? -11.686 139.030 -20.043 1.00 19.33  ? 212 SER B C   1 
ATOM   4944  O  O   . SER B 2  212 ? -11.814 137.869 -19.648 1.00 15.52  ? 212 SER B O   1 
ATOM   4945  C  CB  . SER B 2  212 ? -9.677  138.754 -21.496 1.00 23.65  ? 212 SER B CB  1 
ATOM   4946  O  OG  . SER B 2  212 ? -10.336 137.521 -21.728 1.00 6.15   ? 212 SER B OG  1 
ATOM   4947  N  N   . HIS B 2  213 ? -12.754 139.788 -20.251 1.00 17.70  ? 213 HIS B N   1 
ATOM   4948  C  CA  . HIS B 2  213 ? -14.060 139.220 -19.919 1.00 23.47  ? 213 HIS B CA  1 
ATOM   4949  C  C   . HIS B 2  213 ? -14.486 138.116 -20.856 1.00 28.08  ? 213 HIS B C   1 
ATOM   4950  O  O   . HIS B 2  213 ? -15.068 137.117 -20.424 1.00 23.42  ? 213 HIS B O   1 
ATOM   4951  C  CB  . HIS B 2  213 ? -15.101 140.318 -19.840 1.00 26.86  ? 213 HIS B CB  1 
ATOM   4952  C  CG  . HIS B 2  213 ? -16.456 139.831 -19.433 1.00 25.84  ? 213 HIS B CG  1 
ATOM   4953  N  ND1 . HIS B 2  213 ? -17.467 140.719 -19.125 1.00 26.52  ? 213 HIS B ND1 1 
ATOM   4954  C  CD2 . HIS B 2  213 ? -16.979 138.601 -19.284 1.00 25.76  ? 213 HIS B CD2 1 
ATOM   4955  C  CE1 . HIS B 2  213 ? -18.555 140.042 -18.806 1.00 28.43  ? 213 HIS B CE1 1 
ATOM   4956  N  NE2 . HIS B 2  213 ? -18.289 138.755 -18.886 1.00 27.77  ? 213 HIS B NE2 1 
ATOM   4957  N  N   . PRO B 2  214 ? -14.157 138.224 -22.126 1.00 34.02  ? 214 PRO B N   1 
ATOM   4958  C  CA  . PRO B 2  214 ? -14.432 137.153 -23.085 1.00 36.43  ? 214 PRO B CA  1 
ATOM   4959  C  C   . PRO B 2  214 ? -13.722 135.892 -22.632 1.00 35.18  ? 214 PRO B C   1 
ATOM   4960  O  O   . PRO B 2  214 ? -14.342 134.834 -22.436 1.00 36.38  ? 214 PRO B O   1 
ATOM   4961  C  CB  . PRO B 2  214 ? -14.002 137.657 -24.466 1.00 39.17  ? 214 PRO B CB  1 
ATOM   4962  C  CG  . PRO B 2  214 ? -13.923 139.156 -24.243 1.00 38.10  ? 214 PRO B CG  1 
ATOM   4963  C  CD  . PRO B 2  214 ? -13.548 139.377 -22.789 1.00 35.90  ? 214 PRO B CD  1 
ATOM   4964  N  N   . VAL B 2  215 ? -12.440 135.998 -22.230 1.00 30.75  ? 215 VAL B N   1 
ATOM   4965  C  CA  . VAL B 2  215 ? -11.824 134.773 -21.753 1.00 27.82  ? 215 VAL B CA  1 
ATOM   4966  C  C   . VAL B 2  215 ? -12.281 134.384 -20.365 1.00 25.98  ? 215 VAL B C   1 
ATOM   4967  O  O   . VAL B 2  215 ? -12.371 133.202 -20.038 1.00 23.46  ? 215 VAL B O   1 
ATOM   4968  C  CB  . VAL B 2  215 ? -10.309 134.724 -21.871 1.00 27.87  ? 215 VAL B CB  1 
ATOM   4969  C  CG1 . VAL B 2  215 ? -9.679  134.449 -20.518 1.00 31.81  ? 215 VAL B CG1 1 
ATOM   4970  C  CG2 . VAL B 2  215 ? -9.952  133.598 -22.848 1.00 35.36  ? 215 VAL B CG2 1 
ATOM   4971  N  N   . LEU B 2  216 ? -12.612 135.372 -19.543 1.00 24.52  ? 216 LEU B N   1 
ATOM   4972  C  CA  . LEU B 2  216 ? -13.130 135.054 -18.220 1.00 19.66  ? 216 LEU B CA  1 
ATOM   4973  C  C   . LEU B 2  216 ? -14.426 134.263 -18.325 1.00 26.37  ? 216 LEU B C   1 
ATOM   4974  O  O   . LEU B 2  216 ? -14.518 133.230 -17.668 1.00 29.24  ? 216 LEU B O   1 
ATOM   4975  C  CB  . LEU B 2  216 ? -13.418 136.343 -17.466 1.00 16.66  ? 216 LEU B CB  1 
ATOM   4976  C  CG  . LEU B 2  216 ? -13.601 136.160 -15.959 1.00 15.15  ? 216 LEU B CG  1 
ATOM   4977  C  CD1 . LEU B 2  216 ? -12.236 135.823 -15.391 1.00 2.20   ? 216 LEU B CD1 1 
ATOM   4978  C  CD2 . LEU B 2  216 ? -14.166 137.426 -15.329 1.00 22.22  ? 216 LEU B CD2 1 
ATOM   4979  N  N   . LYS B 2  217 ? -15.403 134.731 -19.108 1.00 31.12  ? 217 LYS B N   1 
ATOM   4980  C  CA  . LYS B 2  217 ? -16.677 134.016 -19.199 1.00 31.65  ? 217 LYS B CA  1 
ATOM   4981  C  C   . LYS B 2  217 ? -16.500 132.597 -19.716 1.00 33.46  ? 217 LYS B C   1 
ATOM   4982  O  O   . LYS B 2  217 ? -17.047 131.670 -19.100 1.00 26.62  ? 217 LYS B O   1 
ATOM   4983  C  CB  . LYS B 2  217 ? -17.711 134.801 -19.972 1.00 34.34  ? 217 LYS B CB  1 
ATOM   4984  C  CG  . LYS B 2  217 ? -18.963 134.042 -20.380 1.00 39.97  ? 217 LYS B CG  1 
ATOM   4985  C  CD  . LYS B 2  217 ? -19.498 134.545 -21.716 1.00 44.96  ? 217 LYS B CD  1 
ATOM   4986  C  CE  . LYS B 2  217 ? -20.764 133.797 -22.114 1.00 50.71  ? 217 LYS B CE  1 
ATOM   4987  N  NZ  . LYS B 2  217 ? -21.841 133.997 -21.096 1.00 58.27  ? 217 LYS B NZ  1 
ATOM   4988  N  N   . GLN B 2  218 ? -15.682 132.375 -20.748 1.00 34.37  ? 218 GLN B N   1 
ATOM   4989  C  CA  . GLN B 2  218 ? -15.438 131.005 -21.211 1.00 36.83  ? 218 GLN B CA  1 
ATOM   4990  C  C   . GLN B 2  218 ? -15.178 130.107 -20.007 1.00 35.61  ? 218 GLN B C   1 
ATOM   4991  O  O   . GLN B 2  218 ? -15.918 129.191 -19.669 1.00 34.61  ? 218 GLN B O   1 
ATOM   4992  C  CB  . GLN B 2  218 ? -14.231 130.973 -22.156 1.00 45.64  ? 218 GLN B CB  1 
ATOM   4993  C  CG  . GLN B 2  218 ? -14.089 129.683 -22.946 1.00 58.00  ? 218 GLN B CG  1 
ATOM   4994  C  CD  . GLN B 2  218 ? -12.830 129.591 -23.783 1.00 60.58  ? 218 GLN B CD  1 
ATOM   4995  O  OE1 . GLN B 2  218 ? -12.071 130.557 -23.904 1.00 60.36  ? 218 GLN B OE1 1 
ATOM   4996  N  NE2 . GLN B 2  218 ? -12.584 128.423 -24.372 1.00 61.47  ? 218 GLN B NE2 1 
ATOM   4997  N  N   . VAL B 2  219 ? -14.101 130.427 -19.307 1.00 37.67  ? 219 VAL B N   1 
ATOM   4998  C  CA  . VAL B 2  219 ? -13.717 129.740 -18.088 1.00 40.01  ? 219 VAL B CA  1 
ATOM   4999  C  C   . VAL B 2  219 ? -14.877 129.653 -17.119 1.00 40.43  ? 219 VAL B C   1 
ATOM   5000  O  O   . VAL B 2  219 ? -15.299 128.543 -16.771 1.00 41.15  ? 219 VAL B O   1 
ATOM   5001  C  CB  . VAL B 2  219 ? -12.494 130.379 -17.413 1.00 45.27  ? 219 VAL B CB  1 
ATOM   5002  C  CG1 . VAL B 2  219 ? -12.699 130.638 -15.937 1.00 43.94  ? 219 VAL B CG1 1 
ATOM   5003  C  CG2 . VAL B 2  219 ? -11.290 129.475 -17.654 1.00 46.19  ? 219 VAL B CG2 1 
ATOM   5004  N  N   . ALA B 2  220 ? -15.473 130.783 -16.749 1.00 40.16  ? 220 ALA B N   1 
ATOM   5005  C  CA  . ALA B 2  220 ? -16.654 130.738 -15.881 1.00 42.02  ? 220 ALA B CA  1 
ATOM   5006  C  C   . ALA B 2  220 ? -17.589 129.586 -16.283 1.00 42.70  ? 220 ALA B C   1 
ATOM   5007  O  O   . ALA B 2  220 ? -17.713 128.617 -15.531 1.00 41.33  ? 220 ALA B O   1 
ATOM   5008  C  CB  . ALA B 2  220 ? -17.414 132.052 -15.977 1.00 44.13  ? 220 ALA B CB  1 
ATOM   5009  N  N   . GLU B 2  221 ? -18.131 129.673 -17.495 1.00 41.68  ? 221 GLU B N   1 
ATOM   5010  C  CA  . GLU B 2  221 ? -19.027 128.724 -18.104 1.00 38.97  ? 221 GLU B CA  1 
ATOM   5011  C  C   . GLU B 2  221 ? -18.546 127.279 -18.036 1.00 36.68  ? 221 GLU B C   1 
ATOM   5012  O  O   . GLU B 2  221 ? -19.347 126.349 -17.817 1.00 32.63  ? 221 GLU B O   1 
ATOM   5013  C  CB  . GLU B 2  221 ? -19.451 129.071 -19.520 1.00 45.04  ? 221 GLU B CB  1 
ATOM   5014  C  CG  . GLU B 2  221 ? -19.315 130.481 -20.050 1.00 51.51  ? 221 GLU B CG  1 
ATOM   5015  C  CD  . GLU B 2  221 ? -19.407 130.544 -21.567 1.00 52.36  ? 221 GLU B CD  1 
ATOM   5016  O  OE1 . GLU B 2  221 ? -19.963 129.545 -22.087 1.00 55.53  ? 221 GLU B OE1 1 
ATOM   5017  O  OE2 . GLU B 2  221 ? -18.966 131.484 -22.255 1.00 48.11  ? 221 GLU B OE2 1 
ATOM   5018  N  N   . GLN B 2  222 ? -17.251 127.043 -18.183 1.00 34.59  ? 222 GLN B N   1 
ATOM   5019  C  CA  . GLN B 2  222 ? -16.700 125.701 -18.105 1.00 39.57  ? 222 GLN B CA  1 
ATOM   5020  C  C   . GLN B 2  222 ? -16.592 125.134 -16.698 1.00 40.95  ? 222 GLN B C   1 
ATOM   5021  O  O   . GLN B 2  222 ? -16.439 123.921 -16.527 1.00 38.99  ? 222 GLN B O   1 
ATOM   5022  C  CB  . GLN B 2  222 ? -15.268 125.754 -18.656 1.00 49.70  ? 222 GLN B CB  1 
ATOM   5023  C  CG  . GLN B 2  222 ? -14.808 124.442 -19.271 1.00 58.61  ? 222 GLN B CG  1 
ATOM   5024  C  CD  . GLN B 2  222 ? -14.170 124.744 -20.622 1.00 66.96  ? 222 GLN B CD  1 
ATOM   5025  O  OE1 . GLN B 2  222 ? -14.002 125.929 -20.935 1.00 67.85  ? 222 GLN B OE1 1 
ATOM   5026  N  NE2 . GLN B 2  222 ? -13.841 123.701 -21.370 1.00 72.09  ? 222 GLN B NE2 1 
ATOM   5027  N  N   . PHE B 2  223 ? -16.293 125.999 -15.723 1.00 44.36  ? 223 PHE B N   1 
ATOM   5028  C  CA  . PHE B 2  223 ? -16.027 125.503 -14.388 1.00 46.07  ? 223 PHE B CA  1 
ATOM   5029  C  C   . PHE B 2  223 ? -17.057 125.892 -13.355 1.00 45.65  ? 223 PHE B C   1 
ATOM   5030  O  O   . PHE B 2  223 ? -17.179 125.128 -12.385 1.00 48.10  ? 223 PHE B O   1 
ATOM   5031  C  CB  . PHE B 2  223 ? -14.629 125.906 -13.917 1.00 54.17  ? 223 PHE B CB  1 
ATOM   5032  C  CG  . PHE B 2  223 ? -13.543 125.403 -14.827 1.00 63.69  ? 223 PHE B CG  1 
ATOM   5033  C  CD1 . PHE B 2  223 ? -13.108 126.171 -15.895 1.00 67.11  ? 223 PHE B CD1 1 
ATOM   5034  C  CD2 . PHE B 2  223 ? -12.955 124.173 -14.604 1.00 66.48  ? 223 PHE B CD2 1 
ATOM   5035  C  CE1 . PHE B 2  223 ? -12.108 125.725 -16.732 1.00 65.00  ? 223 PHE B CE1 1 
ATOM   5036  C  CE2 . PHE B 2  223 ? -11.949 123.715 -15.437 1.00 68.47  ? 223 PHE B CE2 1 
ATOM   5037  C  CZ  . PHE B 2  223 ? -11.530 124.492 -16.501 1.00 67.48  ? 223 PHE B CZ  1 
ATOM   5038  N  N   . LEU B 2  224 ? -17.787 126.992 -13.469 1.00 41.57  ? 224 LEU B N   1 
ATOM   5039  C  CA  . LEU B 2  224 ? -18.717 127.328 -12.402 1.00 43.21  ? 224 LEU B CA  1 
ATOM   5040  C  C   . LEU B 2  224 ? -20.155 126.901 -12.576 1.00 46.12  ? 224 LEU B C   1 
ATOM   5041  O  O   . LEU B 2  224 ? -21.069 127.577 -12.061 1.00 48.18  ? 224 LEU B O   1 
ATOM   5042  C  CB  . LEU B 2  224 ? -18.685 128.832 -12.121 1.00 41.62  ? 224 LEU B CB  1 
ATOM   5043  C  CG  . LEU B 2  224 ? -17.348 129.401 -11.660 1.00 39.99  ? 224 LEU B CG  1 
ATOM   5044  C  CD1 . LEU B 2  224 ? -17.489 130.842 -11.197 1.00 38.38  ? 224 LEU B CD1 1 
ATOM   5045  C  CD2 . LEU B 2  224 ? -16.765 128.549 -10.553 1.00 32.94  ? 224 LEU B CD2 1 
ATOM   5046  N  N   . ASN B 2  225 ? -20.467 125.763 -13.188 1.00 46.09  ? 225 ASN B N   1 
ATOM   5047  C  CA  . ASN B 2  225 ? -21.901 125.457 -13.309 1.00 46.81  ? 225 ASN B CA  1 
ATOM   5048  C  C   . ASN B 2  225 ? -22.380 124.380 -12.365 1.00 46.25  ? 225 ASN B C   1 
ATOM   5049  O  O   . ASN B 2  225 ? -22.488 123.192 -12.695 1.00 38.17  ? 225 ASN B O   1 
ATOM   5050  C  CB  . ASN B 2  225 ? -22.185 125.125 -14.770 1.00 56.69  ? 225 ASN B CB  1 
ATOM   5051  C  CG  . ASN B 2  225 ? -23.670 125.078 -15.074 1.00 59.00  ? 225 ASN B CG  1 
ATOM   5052  O  OD1 . ASN B 2  225 ? -24.492 125.345 -14.204 1.00 62.96  ? 225 ASN B OD1 1 
ATOM   5053  N  ND2 . ASN B 2  225 ? -23.976 124.737 -16.315 1.00 56.41  ? 225 ASN B ND2 1 
ATOM   5054  N  N   . ILE B 2  226 ? -22.696 124.771 -11.119 1.00 46.24  ? 226 ILE B N   1 
ATOM   5055  C  CA  . ILE B 2  226 ? -23.200 123.802 -10.160 1.00 48.90  ? 226 ILE B CA  1 
ATOM   5056  C  C   . ILE B 2  226 ? -24.499 124.232 -9.497  1.00 51.13  ? 226 ILE B C   1 
ATOM   5057  O  O   . ILE B 2  226 ? -24.697 125.398 -9.180  1.00 50.83  ? 226 ILE B O   1 
ATOM   5058  C  CB  . ILE B 2  226 ? -22.195 123.453 -9.057  1.00 44.20  ? 226 ILE B CB  1 
ATOM   5059  C  CG1 . ILE B 2  226 ? -20.805 123.141 -9.602  1.00 34.53  ? 226 ILE B CG1 1 
ATOM   5060  C  CG2 . ILE B 2  226 ? -22.712 122.248 -8.262  1.00 49.61  ? 226 ILE B CG2 1 
ATOM   5061  C  CD1 . ILE B 2  226 ? -19.904 124.342 -9.648  1.00 8.86   ? 226 ILE B CD1 1 
ATOM   5062  N  N   . ARG B 2  227 ? -25.396 123.266 -9.253  1.00 55.01  ? 227 ARG B N   1 
ATOM   5063  C  CA  . ARG B 2  227 ? -26.687 123.640 -8.697  1.00 59.79  ? 227 ARG B CA  1 
ATOM   5064  C  C   . ARG B 2  227 ? -26.744 123.513 -7.189  1.00 60.86  ? 227 ARG B C   1 
ATOM   5065  O  O   . ARG B 2  227 ? -26.042 122.710 -6.592  1.00 58.05  ? 227 ARG B O   1 
ATOM   5066  C  CB  . ARG B 2  227 ? -27.848 122.974 -9.420  1.00 65.19  ? 227 ARG B CB  1 
ATOM   5067  C  CG  . ARG B 2  227 ? -28.134 123.606 -10.789 1.00 72.70  ? 227 ARG B CG  1 
ATOM   5068  C  CD  . ARG B 2  227 ? -27.014 123.294 -11.759 1.00 76.84  ? 227 ARG B CD  1 
ATOM   5069  N  NE  . ARG B 2  227 ? -27.196 123.776 -13.117 1.00 77.18  ? 227 ARG B NE  1 
ATOM   5070  C  CZ  . ARG B 2  227 ? -26.555 123.270 -14.171 1.00 80.08  ? 227 ARG B CZ  1 
ATOM   5071  N  NH1 . ARG B 2  227 ? -25.688 122.275 -14.057 1.00 85.10  ? 227 ARG B NH1 1 
ATOM   5072  N  NH2 . ARG B 2  227 ? -26.782 123.771 -15.376 1.00 80.04  ? 227 ARG B NH2 1 
ATOM   5073  N  N   . GLY B 2  228 ? -27.549 124.381 -6.599  1.00 65.03  ? 228 GLY B N   1 
ATOM   5074  C  CA  . GLY B 2  228 ? -27.809 124.552 -5.185  1.00 67.63  ? 228 GLY B CA  1 
ATOM   5075  C  C   . GLY B 2  228 ? -28.677 125.790 -4.914  1.00 69.15  ? 228 GLY B C   1 
ATOM   5076  O  O   . GLY B 2  228 ? -28.411 126.872 -5.442  1.00 72.93  ? 228 GLY B O   1 
ATOM   5077  N  N   . GLY B 2  229 ? -29.756 125.587 -4.171  1.00 68.74  ? 229 GLY B N   1 
ATOM   5078  C  CA  . GLY B 2  229 ? -30.735 126.640 -3.867  1.00 65.74  ? 229 GLY B CA  1 
ATOM   5079  C  C   . GLY B 2  229 ? -30.292 127.264 -2.556  1.00 65.13  ? 229 GLY B C   1 
ATOM   5080  O  O   . GLY B 2  229 ? -29.364 126.698 -1.966  1.00 66.49  ? 229 GLY B O   1 
ATOM   5081  N  N   . LEU B 2  230 ? -30.871 128.382 -2.162  1.00 64.56  ? 230 LEU B N   1 
ATOM   5082  C  CA  . LEU B 2  230 ? -30.346 128.967 -0.914  1.00 68.71  ? 230 LEU B CA  1 
ATOM   5083  C  C   . LEU B 2  230 ? -30.888 128.207 0.275   1.00 70.32  ? 230 LEU B C   1 
ATOM   5084  O  O   . LEU B 2  230 ? -31.883 127.481 0.118   1.00 66.97  ? 230 LEU B O   1 
ATOM   5085  C  CB  . LEU B 2  230 ? -30.618 130.462 -0.935  1.00 70.62  ? 230 LEU B CB  1 
ATOM   5086  C  CG  . LEU B 2  230 ? -29.922 131.241 -2.057  1.00 73.56  ? 230 LEU B CG  1 
ATOM   5087  C  CD1 . LEU B 2  230 ? -30.379 132.693 -1.989  1.00 74.73  ? 230 LEU B CD1 1 
ATOM   5088  C  CD2 . LEU B 2  230 ? -28.412 131.250 -1.848  1.00 75.79  ? 230 LEU B CD2 1 
ATOM   5089  N  N   . GLY B 2  231 ? -30.254 128.301 1.431   1.00 72.70  ? 231 GLY B N   1 
ATOM   5090  C  CA  . GLY B 2  231 ? -30.658 127.953 2.755   1.00 74.45  ? 231 GLY B CA  1 
ATOM   5091  C  C   . GLY B 2  231 ? -30.889 126.488 3.018   1.00 75.71  ? 231 GLY B C   1 
ATOM   5092  O  O   . GLY B 2  231 ? -31.524 126.125 4.020   1.00 76.54  ? 231 GLY B O   1 
ATOM   5093  N  N   . LEU B 2  232 ? -30.257 125.659 2.197   1.00 76.39  ? 232 LEU B N   1 
ATOM   5094  C  CA  . LEU B 2  232 ? -30.119 124.269 2.677   1.00 76.51  ? 232 LEU B CA  1 
ATOM   5095  C  C   . LEU B 2  232 ? -29.471 124.367 4.070   1.00 74.12  ? 232 LEU B C   1 
ATOM   5096  O  O   . LEU B 2  232 ? -29.610 123.469 4.902   1.00 72.22  ? 232 LEU B O   1 
ATOM   5097  C  CB  . LEU B 2  232 ? -29.251 123.525 1.668   1.00 80.75  ? 232 LEU B CB  1 
ATOM   5098  C  CG  . LEU B 2  232 ? -29.810 123.509 0.236   1.00 79.89  ? 232 LEU B CG  1 
ATOM   5099  C  CD1 . LEU B 2  232 ? -28.711 123.835 -0.758  1.00 76.92  ? 232 LEU B CD1 1 
ATOM   5100  C  CD2 . LEU B 2  232 ? -30.429 122.149 -0.042  1.00 83.96  ? 232 LEU B CD2 1 
ATOM   5101  N  N   . SER B 2  233 ? -28.838 125.477 4.405   1.00 70.26  ? 233 SER B N   1 
ATOM   5102  C  CA  . SER B 2  233 ? -28.395 125.964 5.669   1.00 69.55  ? 233 SER B CA  1 
ATOM   5103  C  C   . SER B 2  233 ? -29.469 126.421 6.653   1.00 74.91  ? 233 SER B C   1 
ATOM   5104  O  O   . SER B 2  233 ? -29.373 126.078 7.843   1.00 76.42  ? 233 SER B O   1 
ATOM   5105  C  CB  . SER B 2  233 ? -27.486 127.190 5.405   1.00 57.43  ? 233 SER B CB  1 
ATOM   5106  O  OG  . SER B 2  233 ? -27.930 127.812 4.221   1.00 52.71  ? 233 SER B OG  1 
ATOM   5107  N  N   . GLY B 2  234 ? -30.455 127.213 6.237   1.00 77.54  ? 234 GLY B N   1 
ATOM   5108  C  CA  . GLY B 2  234 ? -31.503 127.692 7.143   1.00 78.13  ? 234 GLY B CA  1 
ATOM   5109  C  C   . GLY B 2  234 ? -31.536 129.220 7.164   1.00 78.75  ? 234 GLY B C   1 
ATOM   5110  O  O   . GLY B 2  234 ? -31.596 129.855 8.216   1.00 80.94  ? 234 GLY B O   1 
ATOM   5111  N  N   . ALA B 2  235 ? -31.554 129.815 5.981   1.00 77.32  ? 235 ALA B N   1 
ATOM   5112  C  CA  . ALA B 2  235 ? -31.603 131.258 5.794   1.00 74.40  ? 235 ALA B CA  1 
ATOM   5113  C  C   . ALA B 2  235 ? -32.868 131.901 6.360   1.00 70.38  ? 235 ALA B C   1 
ATOM   5114  O  O   . ALA B 2  235 ? -33.942 131.295 6.302   1.00 70.91  ? 235 ALA B O   1 
ATOM   5115  C  CB  . ALA B 2  235 ? -31.519 131.551 4.293   1.00 78.56  ? 235 ALA B CB  1 
ATOM   5116  N  N   . LYS B 2  236 ? -32.792 133.132 6.845   1.00 65.65  ? 236 LYS B N   1 
ATOM   5117  C  CA  . LYS B 2  236 ? -33.923 133.863 7.436   1.00 60.50  ? 236 LYS B CA  1 
ATOM   5118  C  C   . LYS B 2  236 ? -33.435 135.042 8.254   1.00 56.61  ? 236 LYS B C   1 
ATOM   5119  O  O   . LYS B 2  236 ? -32.264 135.057 8.667   1.00 62.13  ? 236 LYS B O   1 
ATOM   5120  C  CB  . LYS B 2  236 ? -34.787 132.899 8.246   1.00 63.28  ? 236 LYS B CB  1 
ATOM   5121  C  CG  . LYS B 2  236 ? -35.349 133.366 9.560   1.00 67.66  ? 236 LYS B CG  1 
ATOM   5122  C  CD  . LYS B 2  236 ? -36.628 132.650 9.968   1.00 70.40  ? 236 LYS B CD  1 
ATOM   5123  C  CE  . LYS B 2  236 ? -37.648 133.647 10.518  1.00 77.04  ? 236 LYS B CE  1 
ATOM   5124  N  NZ  . LYS B 2  236 ? -37.200 134.265 11.801  1.00 80.15  ? 236 LYS B NZ  1 
ATOM   5125  N  N   . ALA B 2  237 ? -34.189 136.101 8.527   1.00 51.32  ? 237 ALA B N   1 
ATOM   5126  C  CA  . ALA B 2  237 ? -33.589 137.164 9.348   1.00 50.32  ? 237 ALA B CA  1 
ATOM   5127  C  C   . ALA B 2  237 ? -34.402 137.496 10.587  1.00 51.07  ? 237 ALA B C   1 
ATOM   5128  O  O   . ALA B 2  237 ? -35.638 137.502 10.563  1.00 57.80  ? 237 ALA B O   1 
ATOM   5129  C  CB  . ALA B 2  237 ? -33.407 138.437 8.556   1.00 52.35  ? 237 ALA B CB  1 
ATOM   5130  N  N   . LYS B 2  238 ? -33.767 137.918 11.677  1.00 46.32  ? 238 LYS B N   1 
ATOM   5131  C  CA  . LYS B 2  238 ? -34.579 138.261 12.850  1.00 48.29  ? 238 LYS B CA  1 
ATOM   5132  C  C   . LYS B 2  238 ? -33.782 139.129 13.807  1.00 46.93  ? 238 LYS B C   1 
ATOM   5133  O  O   . LYS B 2  238 ? -32.571 138.956 13.782  1.00 52.37  ? 238 LYS B O   1 
ATOM   5134  C  CB  . LYS B 2  238 ? -35.040 136.995 13.575  1.00 51.38  ? 238 LYS B CB  1 
ATOM   5135  C  CG  . LYS B 2  238 ? -36.343 137.191 14.347  1.00 62.75  ? 238 LYS B CG  1 
ATOM   5136  C  CD  . LYS B 2  238 ? -36.450 136.340 15.598  1.00 69.48  ? 238 LYS B CD  1 
ATOM   5137  C  CE  . LYS B 2  238 ? -37.304 136.937 16.704  1.00 65.11  ? 238 LYS B CE  1 
ATOM   5138  N  NZ  . LYS B 2  238 ? -36.946 136.432 18.066  1.00 57.80  ? 238 LYS B NZ  1 
ATOM   5139  N  N   . TYR B 2  239 ? -34.381 140.044 14.546  1.00 43.00  ? 239 TYR B N   1 
ATOM   5140  C  CA  . TYR B 2  239 ? -33.623 140.925 15.423  1.00 34.53  ? 239 TYR B CA  1 
ATOM   5141  C  C   . TYR B 2  239 ? -34.275 140.791 16.787  1.00 36.51  ? 239 TYR B C   1 
ATOM   5142  O  O   . TYR B 2  239 ? -35.477 140.914 16.951  1.00 45.23  ? 239 TYR B O   1 
ATOM   5143  C  CB  . TYR B 2  239 ? -33.569 142.389 15.054  1.00 23.55  ? 239 TYR B CB  1 
ATOM   5144  C  CG  . TYR B 2  239 ? -33.096 143.325 16.137  1.00 11.61  ? 239 TYR B CG  1 
ATOM   5145  C  CD1 . TYR B 2  239 ? -31.753 143.539 16.409  1.00 7.20   ? 239 TYR B CD1 1 
ATOM   5146  C  CD2 . TYR B 2  239 ? -34.041 144.047 16.871  1.00 16.03  ? 239 TYR B CD2 1 
ATOM   5147  C  CE1 . TYR B 2  239 ? -31.353 144.419 17.391  1.00 7.72   ? 239 TYR B CE1 1 
ATOM   5148  C  CE2 . TYR B 2  239 ? -33.655 144.938 17.856  1.00 15.21  ? 239 TYR B CE2 1 
ATOM   5149  C  CZ  . TYR B 2  239 ? -32.305 145.111 18.108  1.00 11.51  ? 239 TYR B CZ  1 
ATOM   5150  O  OH  . TYR B 2  239 ? -31.888 145.981 19.085  1.00 9.15   ? 239 TYR B OH  1 
ATOM   5151  N  N   . HIS B 2  240 ? -33.396 140.517 17.718  1.00 39.91  ? 240 HIS B N   1 
ATOM   5152  C  CA  . HIS B 2  240 ? -33.842 140.401 19.111  1.00 40.13  ? 240 HIS B CA  1 
ATOM   5153  C  C   . HIS B 2  240 ? -32.905 141.161 20.028  1.00 39.81  ? 240 HIS B C   1 
ATOM   5154  O  O   . HIS B 2  240 ? -31.682 140.987 20.068  1.00 47.27  ? 240 HIS B O   1 
ATOM   5155  C  CB  . HIS B 2  240 ? -33.892 138.931 19.475  1.00 50.50  ? 240 HIS B CB  1 
ATOM   5156  C  CG  . HIS B 2  240 ? -33.374 138.607 20.834  1.00 60.56  ? 240 HIS B CG  1 
ATOM   5157  N  ND1 . HIS B 2  240 ? -32.048 138.507 21.188  1.00 67.91  ? 240 HIS B ND1 1 
ATOM   5158  C  CD2 . HIS B 2  240 ? -34.082 138.344 21.958  1.00 63.29  ? 240 HIS B CD2 1 
ATOM   5159  C  CE1 . HIS B 2  240 ? -31.952 138.204 22.472  1.00 67.06  ? 240 HIS B CE1 1 
ATOM   5160  N  NE2 . HIS B 2  240 ? -33.176 138.097 22.955  1.00 66.19  ? 240 HIS B NE2 1 
ATOM   5161  N  N   . GLY B 2  241 ? -33.491 142.072 20.798  1.00 34.21  ? 241 GLY B N   1 
ATOM   5162  C  CA  . GLY B 2  241 ? -32.629 142.886 21.671  1.00 29.80  ? 241 GLY B CA  1 
ATOM   5163  C  C   . GLY B 2  241 ? -32.200 142.088 22.897  1.00 22.88  ? 241 GLY B C   1 
ATOM   5164  O  O   . GLY B 2  241 ? -33.067 141.474 23.525  1.00 22.40  ? 241 GLY B O   1 
ATOM   5165  N  N   . GLY B 2  242 ? -30.908 142.098 23.177  1.00 16.06  ? 242 GLY B N   1 
ATOM   5166  C  CA  . GLY B 2  242 ? -30.373 141.374 24.316  1.00 12.18  ? 242 GLY B CA  1 
ATOM   5167  C  C   . GLY B 2  242 ? -29.123 142.112 24.785  1.00 11.01  ? 242 GLY B C   1 
ATOM   5168  O  O   . GLY B 2  242 ? -28.850 143.177 24.243  1.00 11.57  ? 242 GLY B O   1 
ATOM   5169  N  N   . GLU B 2  243 ? -28.492 141.589 25.818  1.00 11.96  ? 243 GLU B N   1 
ATOM   5170  C  CA  . GLU B 2  243 ? -27.220 142.163 26.264  1.00 3.50   ? 243 GLU B CA  1 
ATOM   5171  C  C   . GLU B 2  243 ? -26.329 140.951 26.567  1.00 7.88   ? 243 GLU B C   1 
ATOM   5172  O  O   . GLU B 2  243 ? -26.838 140.009 27.179  1.00 5.61   ? 243 GLU B O   1 
ATOM   5173  C  CB  . GLU B 2  243 ? -27.375 142.944 27.550  1.00 2.20   ? 243 GLU B CB  1 
ATOM   5174  C  CG  . GLU B 2  243 ? -28.271 142.440 28.635  1.00 14.99  ? 243 GLU B CG  1 
ATOM   5175  C  CD  . GLU B 2  243 ? -28.726 143.505 29.607  1.00 21.99  ? 243 GLU B CD  1 
ATOM   5176  O  OE1 . GLU B 2  243 ? -28.208 144.638 29.598  1.00 28.26  ? 243 GLU B OE1 1 
ATOM   5177  O  OE2 . GLU B 2  243 ? -29.638 143.176 30.394  1.00 28.08  ? 243 GLU B OE2 1 
ATOM   5178  N  N   . ILE B 2  244 ? -25.070 141.048 26.168  1.00 3.06   ? 244 ILE B N   1 
ATOM   5179  C  CA  . ILE B 2  244 ? -24.123 139.994 26.514  1.00 7.06   ? 244 ILE B CA  1 
ATOM   5180  C  C   . ILE B 2  244 ? -22.902 140.664 27.139  1.00 7.13   ? 244 ILE B C   1 
ATOM   5181  O  O   . ILE B 2  244 ? -22.539 141.748 26.704  1.00 5.77   ? 244 ILE B O   1 
ATOM   5182  C  CB  . ILE B 2  244 ? -23.784 139.177 25.291  1.00 2.66   ? 244 ILE B CB  1 
ATOM   5183  C  CG1 . ILE B 2  244 ? -24.912 138.231 24.836  1.00 6.29   ? 244 ILE B CG1 1 
ATOM   5184  C  CG2 . ILE B 2  244 ? -22.534 138.343 25.498  1.00 2.65   ? 244 ILE B CG2 1 
ATOM   5185  C  CD1 . ILE B 2  244 ? -24.617 137.703 23.432  1.00 2.50   ? 244 ILE B CD1 1 
ATOM   5186  N  N   . ARG B 2  245 ? -22.544 140.284 28.353  1.00 4.15   ? 245 ARG B N   1 
ATOM   5187  C  CA  . ARG B 2  245 ? -21.657 141.061 29.194  1.00 5.41   ? 245 ARG B CA  1 
ATOM   5188  C  C   . ARG B 2  245 ? -20.425 140.271 29.600  1.00 6.15   ? 245 ARG B C   1 
ATOM   5189  O  O   . ARG B 2  245 ? -20.493 139.254 30.299  1.00 10.39  ? 245 ARG B O   1 
ATOM   5190  C  CB  . ARG B 2  245 ? -22.387 141.487 30.504  1.00 3.40   ? 245 ARG B CB  1 
ATOM   5191  C  CG  . ARG B 2  245 ? -23.216 142.751 30.286  1.00 3.86   ? 245 ARG B CG  1 
ATOM   5192  C  CD  . ARG B 2  245 ? -23.805 143.226 31.599  1.00 4.14   ? 245 ARG B CD  1 
ATOM   5193  N  NE  . ARG B 2  245 ? -23.464 144.665 31.839  1.00 2.20   ? 245 ARG B NE  1 
ATOM   5194  C  CZ  . ARG B 2  245 ? -23.207 144.933 33.125  1.00 3.25   ? 245 ARG B CZ  1 
ATOM   5195  N  NH1 . ARG B 2  245 ? -23.168 143.935 33.993  1.00 17.95  ? 245 ARG B NH1 1 
ATOM   5196  N  NH2 . ARG B 2  245 ? -22.928 146.169 33.462  1.00 6.14   ? 245 ARG B NH2 1 
ATOM   5197  N  N   . GLU B 2  246 ? -19.241 140.757 29.231  1.00 7.22   ? 246 GLU B N   1 
ATOM   5198  C  CA  . GLU B 2  246 ? -18.080 139.953 29.636  1.00 4.43   ? 246 GLU B CA  1 
ATOM   5199  C  C   . GLU B 2  246 ? -17.251 140.691 30.669  1.00 6.90   ? 246 GLU B C   1 
ATOM   5200  O  O   . GLU B 2  246 ? -16.492 141.566 30.272  1.00 6.90   ? 246 GLU B O   1 
ATOM   5201  C  CB  . GLU B 2  246 ? -17.177 139.751 28.418  1.00 12.55  ? 246 GLU B CB  1 
ATOM   5202  C  CG  . GLU B 2  246 ? -16.123 138.681 28.638  1.00 27.60  ? 246 GLU B CG  1 
ATOM   5203  C  CD  . GLU B 2  246 ? -15.358 138.378 27.366  1.00 35.84  ? 246 GLU B CD  1 
ATOM   5204  O  OE1 . GLU B 2  246 ? -15.729 138.927 26.309  1.00 41.49  ? 246 GLU B OE1 1 
ATOM   5205  O  OE2 . GLU B 2  246 ? -14.392 137.593 27.425  1.00 44.89  ? 246 GLU B OE2 1 
ATOM   5206  N  N   . GLN B 2  247 ? -17.083 140.146 31.851  1.00 3.24   ? 247 GLN B N   1 
ATOM   5207  C  CA  . GLN B 2  247 ? -16.215 140.757 32.860  1.00 6.94   ? 247 GLN B CA  1 
ATOM   5208  C  C   . GLN B 2  247 ? -14.783 140.303 32.674  1.00 2.63   ? 247 GLN B C   1 
ATOM   5209  O  O   . GLN B 2  247 ? -14.402 139.167 32.416  1.00 3.89   ? 247 GLN B O   1 
ATOM   5210  C  CB  . GLN B 2  247 ? -16.786 140.442 34.240  1.00 9.08   ? 247 GLN B CB  1 
ATOM   5211  C  CG  . GLN B 2  247 ? -15.856 140.782 35.380  1.00 15.79  ? 247 GLN B CG  1 
ATOM   5212  C  CD  . GLN B 2  247 ? -16.273 142.019 36.144  1.00 21.91  ? 247 GLN B CD  1 
ATOM   5213  O  OE1 . GLN B 2  247 ? -17.403 142.117 36.653  1.00 29.89  ? 247 GLN B OE1 1 
ATOM   5214  N  NE2 . GLN B 2  247 ? -15.327 142.952 36.187  1.00 9.80   ? 247 GLN B NE2 1 
ATOM   5215  N  N   . ASN B 2  248 ? -13.850 141.212 32.901  1.00 16.36  ? 248 ASN B N   1 
ATOM   5216  C  CA  . ASN B 2  248 ? -12.403 141.141 32.721  1.00 14.56  ? 248 ASN B CA  1 
ATOM   5217  C  C   . ASN B 2  248 ? -11.752 141.754 33.966  1.00 15.67  ? 248 ASN B C   1 
ATOM   5218  O  O   . ASN B 2  248 ? -12.481 142.326 34.768  1.00 23.57  ? 248 ASN B O   1 
ATOM   5219  C  CB  . ASN B 2  248 ? -12.094 142.207 31.609  1.00 13.64  ? 248 ASN B CB  1 
ATOM   5220  C  CG  . ASN B 2  248 ? -11.917 141.549 30.265  1.00 2.20   ? 248 ASN B CG  1 
ATOM   5221  O  OD1 . ASN B 2  248 ? -12.481 140.474 30.083  1.00 15.55  ? 248 ASN B OD1 1 
ATOM   5222  N  ND2 . ASN B 2  248 ? -11.072 142.130 29.426  1.00 13.04  ? 248 ASN B ND2 1 
ATOM   5223  N  N   . GLY B 2  249 ? -10.458 141.985 33.932  1.00 21.16  ? 249 GLY B N   1 
ATOM   5224  C  CA  . GLY B 2  249 ? -9.806  142.779 34.973  1.00 28.30  ? 249 GLY B CA  1 
ATOM   5225  C  C   . GLY B 2  249 ? -9.145  144.019 34.369  1.00 32.34  ? 249 GLY B C   1 
ATOM   5226  O  O   . GLY B 2  249 ? -8.570  144.836 35.101  1.00 37.90  ? 249 GLY B O   1 
ATOM   5227  N  N   . ASP B 2  250 ? -9.077  144.061 33.043  1.00 31.26  ? 250 ASP B N   1 
ATOM   5228  C  CA  . ASP B 2  250 ? -8.555  145.202 32.310  1.00 25.89  ? 250 ASP B CA  1 
ATOM   5229  C  C   . ASP B 2  250 ? -9.167  146.522 32.767  1.00 19.62  ? 250 ASP B C   1 
ATOM   5230  O  O   . ASP B 2  250 ? -10.375 146.681 32.929  1.00 15.97  ? 250 ASP B O   1 
ATOM   5231  C  CB  . ASP B 2  250 ? -8.843  145.019 30.808  1.00 36.83  ? 250 ASP B CB  1 
ATOM   5232  C  CG  . ASP B 2  250 ? -8.111  146.047 29.959  1.00 43.64  ? 250 ASP B CG  1 
ATOM   5233  O  OD1 . ASP B 2  250 ? -7.991  147.218 30.377  1.00 30.32  ? 250 ASP B OD1 1 
ATOM   5234  O  OD2 . ASP B 2  250 ? -7.659  145.682 28.848  1.00 57.32  ? 250 ASP B OD2 1 
ATOM   5235  N  N   . SER B 2  251 ? -8.363  147.542 32.919  1.00 17.36  ? 251 SER B N   1 
ATOM   5236  C  CA  . SER B 2  251 ? -8.671  148.913 33.260  1.00 11.28  ? 251 SER B CA  1 
ATOM   5237  C  C   . SER B 2  251 ? -9.641  149.565 32.286  1.00 8.60   ? 251 SER B C   1 
ATOM   5238  O  O   . SER B 2  251 ? -10.488 150.361 32.688  1.00 4.64   ? 251 SER B O   1 
ATOM   5239  C  CB  . SER B 2  251 ? -7.332  149.695 33.059  1.00 19.13  ? 251 SER B CB  1 
ATOM   5240  O  OG  . SER B 2  251 ? -7.009  149.485 31.674  1.00 20.92  ? 251 SER B OG  1 
ATOM   5241  N  N   . LEU B 2  252 ? -9.521  149.263 30.996  1.00 5.25   ? 252 LEU B N   1 
ATOM   5242  C  CA  . LEU B 2  252 ? -10.462 149.844 30.035  1.00 6.87   ? 252 LEU B CA  1 
ATOM   5243  C  C   . LEU B 2  252 ? -11.689 148.927 29.863  1.00 6.05   ? 252 LEU B C   1 
ATOM   5244  O  O   . LEU B 2  252 ? -11.569 147.750 30.176  1.00 6.11   ? 252 LEU B O   1 
ATOM   5245  C  CB  . LEU B 2  252 ? -9.845  150.037 28.677  1.00 4.72   ? 252 LEU B CB  1 
ATOM   5246  C  CG  . LEU B 2  252 ? -8.736  151.042 28.401  1.00 2.20   ? 252 LEU B CG  1 
ATOM   5247  C  CD1 . LEU B 2  252 ? -8.217  150.884 26.989  1.00 5.60   ? 252 LEU B CD1 1 
ATOM   5248  C  CD2 . LEU B 2  252 ? -9.179  152.458 28.703  1.00 3.42   ? 252 LEU B CD2 1 
ATOM   5249  N  N   . VAL B 2  253 ? -12.862 149.456 29.536  1.00 4.53   ? 253 VAL B N   1 
ATOM   5250  C  CA  . VAL B 2  253 ? -14.070 148.700 29.234  1.00 6.21   ? 253 VAL B CA  1 
ATOM   5251  C  C   . VAL B 2  253 ? -14.621 149.114 27.863  1.00 6.99   ? 253 VAL B C   1 
ATOM   5252  O  O   . VAL B 2  253 ? -14.854 150.313 27.641  1.00 2.20   ? 253 VAL B O   1 
ATOM   5253  C  CB  . VAL B 2  253 ? -15.212 148.673 30.278  1.00 2.20   ? 253 VAL B CB  1 
ATOM   5254  C  CG1 . VAL B 2  253 ? -15.256 150.036 30.974  1.00 4.12   ? 253 VAL B CG1 1 
ATOM   5255  C  CG2 . VAL B 2  253 ? -16.507 148.457 29.514  1.00 4.12   ? 253 VAL B CG2 1 
ATOM   5256  N  N   . HIS B 2  254 ? -14.880 148.092 26.980  1.00 2.20   ? 254 HIS B N   1 
ATOM   5257  C  CA  . HIS B 2  254 ? -15.545 148.508 25.752  1.00 8.24   ? 254 HIS B CA  1 
ATOM   5258  C  C   . HIS B 2  254 ? -17.029 148.061 25.775  1.00 11.99  ? 254 HIS B C   1 
ATOM   5259  O  O   . HIS B 2  254 ? -17.200 146.877 26.065  1.00 16.04  ? 254 HIS B O   1 
ATOM   5260  C  CB  . HIS B 2  254 ? -14.994 147.794 24.554  1.00 2.54   ? 254 HIS B CB  1 
ATOM   5261  C  CG  . HIS B 2  254 ? -13.584 147.894 24.140  1.00 2.52   ? 254 HIS B CG  1 
ATOM   5262  N  ND1 . HIS B 2  254 ? -13.205 147.957 22.811  1.00 5.44   ? 254 HIS B ND1 1 
ATOM   5263  C  CD2 . HIS B 2  254 ? -12.442 147.925 24.843  1.00 2.93   ? 254 HIS B CD2 1 
ATOM   5264  C  CE1 . HIS B 2  254 ? -11.898 148.030 22.752  1.00 2.71   ? 254 HIS B CE1 1 
ATOM   5265  N  NE2 . HIS B 2  254 ? -11.379 147.996 23.972  1.00 2.20   ? 254 HIS B NE2 1 
ATOM   5266  N  N   . ALA B 2  255 ? -17.932 148.883 25.274  1.00 7.32   ? 255 ALA B N   1 
ATOM   5267  C  CA  . ALA B 2  255 ? -19.317 148.489 25.117  1.00 7.19   ? 255 ALA B CA  1 
ATOM   5268  C  C   . ALA B 2  255 ? -19.882 148.893 23.768  1.00 7.28   ? 255 ALA B C   1 
ATOM   5269  O  O   . ALA B 2  255 ? -19.564 149.893 23.139  1.00 5.35   ? 255 ALA B O   1 
ATOM   5270  C  CB  . ALA B 2  255 ? -20.124 149.030 26.272  1.00 2.74   ? 255 ALA B CB  1 
ATOM   5271  N  N   . ALA B 2  256 ? -20.811 148.133 23.180  1.00 7.09   ? 256 ALA B N   1 
ATOM   5272  C  CA  . ALA B 2  256 ? -21.540 148.675 22.029  1.00 6.87   ? 256 ALA B CA  1 
ATOM   5273  C  C   . ALA B 2  256 ? -23.022 148.794 22.397  1.00 8.69   ? 256 ALA B C   1 
ATOM   5274  O  O   . ALA B 2  256 ? -23.480 148.047 23.261  1.00 14.06  ? 256 ALA B O   1 
ATOM   5275  C  CB  . ALA B 2  256 ? -21.387 147.759 20.847  1.00 5.23   ? 256 ALA B CB  1 
ATOM   5276  N  N   . LEU B 2  257 ? -23.765 149.679 21.787  1.00 8.85   ? 257 LEU B N   1 
ATOM   5277  C  CA  . LEU B 2  257 ? -25.183 149.925 21.973  1.00 5.73   ? 257 LEU B CA  1 
ATOM   5278  C  C   . LEU B 2  257 ? -25.771 150.228 20.586  1.00 7.17   ? 257 LEU B C   1 
ATOM   5279  O  O   . LEU B 2  257 ? -25.278 151.084 19.852  1.00 4.43   ? 257 LEU B O   1 
ATOM   5280  C  CB  . LEU B 2  257 ? -25.507 151.097 22.884  1.00 3.33   ? 257 LEU B CB  1 
ATOM   5281  C  CG  . LEU B 2  257 ? -26.935 151.127 23.436  1.00 2.20   ? 257 LEU B CG  1 
ATOM   5282  C  CD1 . LEU B 2  257 ? -27.177 149.793 24.129  1.00 2.72   ? 257 LEU B CD1 1 
ATOM   5283  C  CD2 . LEU B 2  257 ? -27.220 152.293 24.364  1.00 6.89   ? 257 LEU B CD2 1 
ATOM   5284  N  N   . VAL B 2  258 ? -26.656 149.317 20.201  1.00 7.95   ? 258 VAL B N   1 
ATOM   5285  C  CA  . VAL B 2  258 ? -27.087 149.250 18.810  1.00 7.34   ? 258 VAL B CA  1 
ATOM   5286  C  C   . VAL B 2  258 ? -28.541 148.814 18.737  1.00 7.74   ? 258 VAL B C   1 
ATOM   5287  O  O   . VAL B 2  258 ? -28.981 148.079 19.615  1.00 3.80   ? 258 VAL B O   1 
ATOM   5288  C  CB  . VAL B 2  258 ? -26.157 148.258 18.117  1.00 6.64   ? 258 VAL B CB  1 
ATOM   5289  C  CG1 . VAL B 2  258 ? -26.879 147.302 17.220  1.00 17.02  ? 258 VAL B CG1 1 
ATOM   5290  C  CG2 . VAL B 2  258 ? -24.986 148.927 17.410  1.00 2.63   ? 258 VAL B CG2 1 
ATOM   5291  N  N   . ALA B 2  259 ? -29.211 149.407 17.774  1.00 12.30  ? 259 ALA B N   1 
ATOM   5292  C  CA  . ALA B 2  259 ? -30.577 149.115 17.395  1.00 12.90  ? 259 ALA B CA  1 
ATOM   5293  C  C   . ALA B 2  259 ? -30.635 148.655 15.946  1.00 14.39  ? 259 ALA B C   1 
ATOM   5294  O  O   . ALA B 2  259 ? -29.671 148.732 15.182  1.00 13.10  ? 259 ALA B O   1 
ATOM   5295  C  CB  . ALA B 2  259 ? -31.429 150.349 17.587  1.00 18.69  ? 259 ALA B CB  1 
ATOM   5296  N  N   . GLU B 2  260 ? -31.794 148.089 15.627  1.00 21.38  ? 260 GLU B N   1 
ATOM   5297  C  CA  . GLU B 2  260 ? -31.911 147.559 14.269  1.00 28.53  ? 260 GLU B CA  1 
ATOM   5298  C  C   . GLU B 2  260 ? -31.671 148.634 13.231  1.00 33.53  ? 260 GLU B C   1 
ATOM   5299  O  O   . GLU B 2  260 ? -32.300 149.683 13.184  1.00 27.49  ? 260 GLU B O   1 
ATOM   5300  C  CB  . GLU B 2  260 ? -33.211 146.820 14.092  1.00 27.75  ? 260 GLU B CB  1 
ATOM   5301  C  CG  . GLU B 2  260 ? -33.247 145.969 12.846  1.00 31.30  ? 260 GLU B CG  1 
ATOM   5302  C  CD  . GLU B 2  260 ? -34.602 145.312 12.641  1.00 37.53  ? 260 GLU B CD  1 
ATOM   5303  O  OE1 . GLU B 2  260 ? -35.525 145.436 13.476  1.00 34.12  ? 260 GLU B OE1 1 
ATOM   5304  O  OE2 . GLU B 2  260 ? -34.694 144.654 11.579  1.00 41.40  ? 260 GLU B OE2 1 
ATOM   5305  N  N   . SER B 2  261 ? -30.630 148.412 12.421  1.00 43.39  ? 261 SER B N   1 
ATOM   5306  C  CA  . SER B 2  261 ? -30.295 149.394 11.388  1.00 47.27  ? 261 SER B CA  1 
ATOM   5307  C  C   . SER B 2  261 ? -31.290 149.249 10.240  1.00 47.17  ? 261 SER B C   1 
ATOM   5308  O  O   . SER B 2  261 ? -31.900 148.300 10.008  1.00 52.70  ? 261 SER B O   1 
ATOM   5309  C  CB  . SER B 2  261 ? -28.889 149.215 10.819  1.00 49.16  ? 261 SER B CB  1 
ATOM   5310  O  OG  . SER B 2  261 ? -28.322 150.412 10.364  1.00 51.83  ? 261 SER B OG  1 
ATOM   5311  N  N   . ALA B 2  262 ? -31.179 150.190 9.299   1.00 45.96  ? 262 ALA B N   1 
ATOM   5312  C  CA  . ALA B 2  262 ? -31.879 149.933 8.048   1.00 44.20  ? 262 ALA B CA  1 
ATOM   5313  C  C   . ALA B 2  262 ? -31.126 148.923 7.192   1.00 42.89  ? 262 ALA B C   1 
ATOM   5314  O  O   . ALA B 2  262 ? -29.909 148.753 7.235   1.00 44.18  ? 262 ALA B O   1 
ATOM   5315  C  CB  . ALA B 2  262 ? -32.274 151.142 7.273   1.00 50.05  ? 262 ALA B CB  1 
ATOM   5316  N  N   . ALA B 2  263 ? -31.922 148.258 6.360   1.00 40.91  ? 263 ALA B N   1 
ATOM   5317  C  CA  . ALA B 2  263 ? -31.390 147.254 5.477   1.00 41.92  ? 263 ALA B CA  1 
ATOM   5318  C  C   . ALA B 2  263 ? -30.491 147.745 4.358   1.00 43.05  ? 263 ALA B C   1 
ATOM   5319  O  O   . ALA B 2  263 ? -30.543 148.848 3.857   1.00 41.40  ? 263 ALA B O   1 
ATOM   5320  C  CB  . ALA B 2  263 ? -32.437 146.312 4.919   1.00 47.92  ? 263 ALA B CB  1 
ATOM   5321  N  N   . ILE B 2  264 ? -29.722 146.773 3.897   1.00 48.48  ? 264 ILE B N   1 
ATOM   5322  C  CA  . ILE B 2  264 ? -28.706 146.919 2.879   1.00 52.41  ? 264 ILE B CA  1 
ATOM   5323  C  C   . ILE B 2  264 ? -29.221 147.467 1.561   1.00 51.16  ? 264 ILE B C   1 
ATOM   5324  O  O   . ILE B 2  264 ? -30.224 147.045 0.985   1.00 49.82  ? 264 ILE B O   1 
ATOM   5325  C  CB  . ILE B 2  264 ? -27.977 145.586 2.605   1.00 54.49  ? 264 ILE B CB  1 
ATOM   5326  C  CG1 . ILE B 2  264 ? -26.646 145.854 1.910   1.00 52.94  ? 264 ILE B CG1 1 
ATOM   5327  C  CG2 . ILE B 2  264 ? -28.854 144.645 1.796   1.00 55.69  ? 264 ILE B CG2 1 
ATOM   5328  C  CD1 . ILE B 2  264 ? -25.506 145.071 2.521   1.00 57.20  ? 264 ILE B CD1 1 
ATOM   5329  N  N   . GLY B 2  265 ? -28.535 148.507 1.086   1.00 50.92  ? 265 GLY B N   1 
ATOM   5330  C  CA  . GLY B 2  265 ? -28.838 149.129 -0.184  1.00 49.38  ? 265 GLY B CA  1 
ATOM   5331  C  C   . GLY B 2  265 ? -30.206 149.758 -0.284  1.00 45.96  ? 265 GLY B C   1 
ATOM   5332  O  O   . GLY B 2  265 ? -30.761 149.943 -1.367  1.00 49.41  ? 265 GLY B O   1 
ATOM   5333  N  N   . SER B 2  266 ? -30.835 150.114 0.819   1.00 42.30  ? 266 SER B N   1 
ATOM   5334  C  CA  . SER B 2  266 ? -32.163 150.733 0.721   1.00 37.42  ? 266 SER B CA  1 
ATOM   5335  C  C   . SER B 2  266 ? -32.016 152.168 1.172   1.00 40.13  ? 266 SER B C   1 
ATOM   5336  O  O   . SER B 2  266 ? -30.959 152.576 1.646   1.00 38.84  ? 266 SER B O   1 
ATOM   5337  C  CB  . SER B 2  266 ? -33.079 149.956 1.670   1.00 28.87  ? 266 SER B CB  1 
ATOM   5338  O  OG  . SER B 2  266 ? -32.540 148.631 1.665   1.00 34.98  ? 266 SER B OG  1 
ATOM   5339  N  N   . ALA B 2  267 ? -33.062 152.959 0.973   1.00 44.68  ? 267 ALA B N   1 
ATOM   5340  C  CA  . ALA B 2  267 ? -32.944 154.339 1.447   1.00 45.73  ? 267 ALA B CA  1 
ATOM   5341  C  C   . ALA B 2  267 ? -32.673 154.319 2.942   1.00 44.73  ? 267 ALA B C   1 
ATOM   5342  O  O   . ALA B 2  267 ? -31.506 154.495 3.309   1.00 47.26  ? 267 ALA B O   1 
ATOM   5343  C  CB  . ALA B 2  267 ? -34.163 155.158 1.093   1.00 55.30  ? 267 ALA B CB  1 
ATOM   5344  N  N   . GLU B 2  268 ? -33.645 153.987 3.791   1.00 42.67  ? 268 GLU B N   1 
ATOM   5345  C  CA  . GLU B 2  268 ? -33.408 154.090 5.239   1.00 40.94  ? 268 GLU B CA  1 
ATOM   5346  C  C   . GLU B 2  268 ? -31.909 153.930 5.498   1.00 35.31  ? 268 GLU B C   1 
ATOM   5347  O  O   . GLU B 2  268 ? -31.180 154.805 5.960   1.00 28.36  ? 268 GLU B O   1 
ATOM   5348  C  CB  . GLU B 2  268 ? -34.233 153.096 6.045   1.00 52.09  ? 268 GLU B CB  1 
ATOM   5349  C  CG  . GLU B 2  268 ? -35.716 153.403 6.091   1.00 70.09  ? 268 GLU B CG  1 
ATOM   5350  C  CD  . GLU B 2  268 ? -36.548 152.429 6.895   1.00 75.13  ? 268 GLU B CD  1 
ATOM   5351  O  OE1 . GLU B 2  268 ? -35.920 151.655 7.647   1.00 74.50  ? 268 GLU B OE1 1 
ATOM   5352  O  OE2 . GLU B 2  268 ? -37.802 152.429 6.794   1.00 80.15  ? 268 GLU B OE2 1 
ATOM   5353  N  N   . ALA B 2  269 ? -31.480 152.718 5.153   1.00 29.88  ? 269 ALA B N   1 
ATOM   5354  C  CA  . ALA B 2  269 ? -30.094 152.320 5.272   1.00 28.00  ? 269 ALA B CA  1 
ATOM   5355  C  C   . ALA B 2  269 ? -29.174 153.540 5.153   1.00 26.26  ? 269 ALA B C   1 
ATOM   5356  O  O   . ALA B 2  269 ? -28.656 154.113 6.102   1.00 27.59  ? 269 ALA B O   1 
ATOM   5357  C  CB  . ALA B 2  269 ? -29.797 151.397 4.094   1.00 29.44  ? 269 ALA B CB  1 
ATOM   5358  N  N   . ASN B 2  270 ? -29.064 153.922 3.894   1.00 21.47  ? 270 ASN B N   1 
ATOM   5359  C  CA  . ASN B 2  270 ? -28.317 155.050 3.392   1.00 19.37  ? 270 ASN B CA  1 
ATOM   5360  C  C   . ASN B 2  270 ? -28.493 156.304 4.228   1.00 18.81  ? 270 ASN B C   1 
ATOM   5361  O  O   . ASN B 2  270 ? -27.552 157.040 4.537   1.00 14.48  ? 270 ASN B O   1 
ATOM   5362  C  CB  . ASN B 2  270 ? -28.783 155.293 1.960   1.00 25.56  ? 270 ASN B CB  1 
ATOM   5363  C  CG  . ASN B 2  270 ? -27.699 155.898 1.102   1.00 33.48  ? 270 ASN B CG  1 
ATOM   5364  O  OD1 . ASN B 2  270 ? -26.731 156.464 1.603   1.00 37.82  ? 270 ASN B OD1 1 
ATOM   5365  N  ND2 . ASN B 2  270 ? -27.914 155.778 -0.204  1.00 40.23  ? 270 ASN B ND2 1 
ATOM   5366  N  N   . ALA B 2  271 ? -29.725 156.519 4.701   1.00 17.76  ? 271 ALA B N   1 
ATOM   5367  C  CA  . ALA B 2  271 ? -29.944 157.595 5.655   1.00 19.89  ? 271 ALA B CA  1 
ATOM   5368  C  C   . ALA B 2  271 ? -29.157 157.346 6.942   1.00 17.86  ? 271 ALA B C   1 
ATOM   5369  O  O   . ALA B 2  271 ? -28.338 158.191 7.327   1.00 16.61  ? 271 ALA B O   1 
ATOM   5370  C  CB  . ALA B 2  271 ? -31.415 157.760 5.956   1.00 24.00  ? 271 ALA B CB  1 
ATOM   5371  N  N   . PHE B 2  272 ? -29.302 156.146 7.502   1.00 13.57  ? 272 PHE B N   1 
ATOM   5372  C  CA  . PHE B 2  272 ? -28.424 155.791 8.613   1.00 11.70  ? 272 PHE B CA  1 
ATOM   5373  C  C   . PHE B 2  272 ? -26.973 156.126 8.302   1.00 10.04  ? 272 PHE B C   1 
ATOM   5374  O  O   . PHE B 2  272 ? -26.338 156.895 9.046   1.00 11.86  ? 272 PHE B O   1 
ATOM   5375  C  CB  . PHE B 2  272 ? -28.556 154.330 9.031   1.00 9.48   ? 272 PHE B CB  1 
ATOM   5376  C  CG  . PHE B 2  272 ? -29.861 153.983 9.684   1.00 7.08   ? 272 PHE B CG  1 
ATOM   5377  C  CD1 . PHE B 2  272 ? -30.143 154.308 10.994  1.00 13.02  ? 272 PHE B CD1 1 
ATOM   5378  C  CD2 . PHE B 2  272 ? -30.838 153.337 8.958   1.00 5.22   ? 272 PHE B CD2 1 
ATOM   5379  C  CE1 . PHE B 2  272 ? -31.374 154.027 11.561  1.00 11.10  ? 272 PHE B CE1 1 
ATOM   5380  C  CE2 . PHE B 2  272 ? -32.059 153.040 9.520   1.00 5.10   ? 272 PHE B CE2 1 
ATOM   5381  C  CZ  . PHE B 2  272 ? -32.340 153.374 10.817  1.00 4.41   ? 272 PHE B CZ  1 
ATOM   5382  N  N   . SER B 2  273 ? -26.418 155.632 7.184   1.00 3.37   ? 273 SER B N   1 
ATOM   5383  C  CA  . SER B 2  273 ? -24.969 155.924 7.046   1.00 10.38  ? 273 SER B CA  1 
ATOM   5384  C  C   . SER B 2  273 ? -24.615 157.384 7.178   1.00 14.14  ? 273 SER B C   1 
ATOM   5385  O  O   . SER B 2  273 ? -23.597 157.796 7.739   1.00 14.46  ? 273 SER B O   1 
ATOM   5386  C  CB  . SER B 2  273 ? -24.404 155.295 5.778   1.00 4.99   ? 273 SER B CB  1 
ATOM   5387  O  OG  . SER B 2  273 ? -25.229 154.188 5.458   1.00 3.74   ? 273 SER B OG  1 
ATOM   5388  N  N   . VAL B 2  274 ? -25.451 158.252 6.614   1.00 21.28  ? 274 VAL B N   1 
ATOM   5389  C  CA  . VAL B 2  274 ? -25.252 159.700 6.711   1.00 19.94  ? 274 VAL B CA  1 
ATOM   5390  C  C   . VAL B 2  274 ? -25.219 160.173 8.163   1.00 14.73  ? 274 VAL B C   1 
ATOM   5391  O  O   . VAL B 2  274 ? -24.284 160.786 8.631   1.00 4.40   ? 274 VAL B O   1 
ATOM   5392  C  CB  . VAL B 2  274 ? -26.442 160.416 6.016   1.00 19.49  ? 274 VAL B CB  1 
ATOM   5393  C  CG1 . VAL B 2  274 ? -26.185 161.915 5.989   1.00 13.91  ? 274 VAL B CG1 1 
ATOM   5394  C  CG2 . VAL B 2  274 ? -26.595 159.828 4.622   1.00 20.76  ? 274 VAL B CG2 1 
ATOM   5395  N  N   . LEU B 2  275 ? -26.319 159.882 8.854   1.00 14.51  ? 275 LEU B N   1 
ATOM   5396  C  CA  . LEU B 2  275 ? -26.416 160.184 10.254  1.00 18.70  ? 275 LEU B CA  1 
ATOM   5397  C  C   . LEU B 2  275 ? -25.243 159.560 11.015  1.00 22.04  ? 275 LEU B C   1 
ATOM   5398  O  O   . LEU B 2  275 ? -24.725 160.182 11.950  1.00 26.36  ? 275 LEU B O   1 
ATOM   5399  C  CB  . LEU B 2  275 ? -27.647 159.560 10.942  1.00 16.56  ? 275 LEU B CB  1 
ATOM   5400  C  CG  . LEU B 2  275 ? -27.446 159.470 12.466  1.00 14.97  ? 275 LEU B CG  1 
ATOM   5401  C  CD1 . LEU B 2  275 ? -27.311 160.831 13.137  1.00 14.43  ? 275 LEU B CD1 1 
ATOM   5402  C  CD2 . LEU B 2  275 ? -28.528 158.631 13.109  1.00 18.24  ? 275 LEU B CD2 1 
ATOM   5403  N  N   . GLN B 2  276 ? -24.912 158.318 10.669  1.00 18.59  ? 276 GLN B N   1 
ATOM   5404  C  CA  . GLN B 2  276 ? -23.759 157.717 11.351  1.00 21.95  ? 276 GLN B CA  1 
ATOM   5405  C  C   . GLN B 2  276 ? -22.590 158.709 11.398  1.00 19.11  ? 276 GLN B C   1 
ATOM   5406  O  O   . GLN B 2  276 ? -22.280 159.307 12.434  1.00 19.87  ? 276 GLN B O   1 
ATOM   5407  C  CB  . GLN B 2  276 ? -23.287 156.431 10.660  1.00 26.27  ? 276 GLN B CB  1 
ATOM   5408  C  CG  . GLN B 2  276 ? -21.782 156.241 10.744  1.00 18.38  ? 276 GLN B CG  1 
ATOM   5409  C  CD  . GLN B 2  276 ? -21.199 155.066 10.005  1.00 17.65  ? 276 GLN B CD  1 
ATOM   5410  O  OE1 . GLN B 2  276 ? -20.651 154.170 10.659  1.00 11.50  ? 276 GLN B OE1 1 
ATOM   5411  N  NE2 . GLN B 2  276 ? -21.231 154.983 8.679   1.00 13.75  ? 276 GLN B NE2 1 
ATOM   5412  N  N   . HIS B 2  277 ? -22.164 159.172 10.235  1.00 16.63  ? 277 HIS B N   1 
ATOM   5413  C  CA  . HIS B 2  277 ? -21.182 160.187 10.020  1.00 15.12  ? 277 HIS B CA  1 
ATOM   5414  C  C   . HIS B 2  277 ? -21.312 161.539 10.689  1.00 19.86  ? 277 HIS B C   1 
ATOM   5415  O  O   . HIS B 2  277 ? -20.284 162.249 10.766  1.00 22.64  ? 277 HIS B O   1 
ATOM   5416  C  CB  . HIS B 2  277 ? -21.099 160.524 8.523   1.00 12.47  ? 277 HIS B CB  1 
ATOM   5417  C  CG  . HIS B 2  277 ? -20.238 159.538 7.810   1.00 13.14  ? 277 HIS B CG  1 
ATOM   5418  N  ND1 . HIS B 2  277 ? -18.880 159.482 7.981   1.00 14.21  ? 277 HIS B ND1 1 
ATOM   5419  C  CD2 . HIS B 2  277 ? -20.546 158.560 6.930   1.00 12.76  ? 277 HIS B CD2 1 
ATOM   5420  C  CE1 . HIS B 2  277 ? -18.381 158.522 7.227   1.00 10.66  ? 277 HIS B CE1 1 
ATOM   5421  N  NE2 . HIS B 2  277 ? -19.370 157.944 6.586   1.00 9.15   ? 277 HIS B NE2 1 
ATOM   5422  N  N   . VAL B 2  278 ? -22.509 161.993 11.028  1.00 19.32  ? 278 VAL B N   1 
ATOM   5423  C  CA  . VAL B 2  278 ? -22.663 163.264 11.746  1.00 20.27  ? 278 VAL B CA  1 
ATOM   5424  C  C   . VAL B 2  278 ? -22.068 163.127 13.161  1.00 20.27  ? 278 VAL B C   1 
ATOM   5425  O  O   . VAL B 2  278 ? -21.670 164.118 13.775  1.00 18.76  ? 278 VAL B O   1 
ATOM   5426  C  CB  . VAL B 2  278 ? -24.166 163.568 11.912  1.00 24.33  ? 278 VAL B CB  1 
ATOM   5427  C  CG1 . VAL B 2  278 ? -24.445 164.914 12.544  1.00 19.34  ? 278 VAL B CG1 1 
ATOM   5428  C  CG2 . VAL B 2  278 ? -24.864 163.403 10.577  1.00 28.90  ? 278 VAL B CG2 1 
ATOM   5429  N  N   . LEU B 2  279 ? -22.157 161.898 13.680  1.00 13.29  ? 279 LEU B N   1 
ATOM   5430  C  CA  . LEU B 2  279 ? -21.621 161.574 14.970  1.00 11.13  ? 279 LEU B CA  1 
ATOM   5431  C  C   . LEU B 2  279 ? -20.314 160.795 14.825  1.00 16.16  ? 279 LEU B C   1 
ATOM   5432  O  O   . LEU B 2  279 ? -19.396 160.968 15.628  1.00 19.21  ? 279 LEU B O   1 
ATOM   5433  C  CB  . LEU B 2  279 ? -22.620 160.767 15.786  1.00 14.89  ? 279 LEU B CB  1 
ATOM   5434  C  CG  . LEU B 2  279 ? -23.987 161.312 16.153  1.00 19.44  ? 279 LEU B CG  1 
ATOM   5435  C  CD1 . LEU B 2  279 ? -24.930 160.125 16.329  1.00 3.47   ? 279 LEU B CD1 1 
ATOM   5436  C  CD2 . LEU B 2  279 ? -24.057 162.193 17.391  1.00 21.85  ? 279 LEU B CD2 1 
ATOM   5437  N  N   . GLY B 2  280 ? -20.237 159.942 13.831  1.00 22.57  ? 280 GLY B N   1 
ATOM   5438  C  CA  . GLY B 2  280 ? -19.172 159.012 13.520  1.00 30.03  ? 280 GLY B CA  1 
ATOM   5439  C  C   . GLY B 2  280 ? -17.775 159.559 13.703  1.00 36.80  ? 280 GLY B C   1 
ATOM   5440  O  O   . GLY B 2  280 ? -17.453 160.541 13.028  1.00 40.13  ? 280 GLY B O   1 
ATOM   5441  N  N   . ALA B 2  281 ? -16.983 159.003 14.609  1.00 44.06  ? 281 ALA B N   1 
ATOM   5442  C  CA  . ALA B 2  281 ? -15.673 159.503 14.998  1.00 49.54  ? 281 ALA B CA  1 
ATOM   5443  C  C   . ALA B 2  281 ? -14.515 158.573 14.643  1.00 54.33  ? 281 ALA B C   1 
ATOM   5444  O  O   . ALA B 2  281 ? -13.973 157.921 15.546  1.00 58.06  ? 281 ALA B O   1 
ATOM   5445  C  CB  . ALA B 2  281 ? -15.600 159.773 16.503  1.00 39.37  ? 281 ALA B CB  1 
ATOM   5446  N  N   . GLY B 2  282 ? -14.133 158.536 13.382  1.00 57.68  ? 282 GLY B N   1 
ATOM   5447  C  CA  . GLY B 2  282 ? -13.003 157.733 12.896  1.00 59.59  ? 282 GLY B CA  1 
ATOM   5448  C  C   . GLY B 2  282 ? -11.943 158.742 12.407  1.00 61.42  ? 282 GLY B C   1 
ATOM   5449  O  O   . GLY B 2  282 ? -12.100 159.286 11.312  1.00 66.35  ? 282 GLY B O   1 
ATOM   5450  N  N   . PRO B 2  283 ? -11.195 159.282 13.353  1.00 60.19  ? 283 PRO B N   1 
ATOM   5451  C  CA  . PRO B 2  283 ? -10.195 160.318 13.158  1.00 56.84  ? 283 PRO B CA  1 
ATOM   5452  C  C   . PRO B 2  283 ? -9.665  160.387 11.742  1.00 54.54  ? 283 PRO B C   1 
ATOM   5453  O  O   . PRO B 2  283 ? -9.258  159.395 11.139  1.00 58.09  ? 283 PRO B O   1 
ATOM   5454  C  CB  . PRO B 2  283 ? -9.035  160.030 14.133  1.00 58.27  ? 283 PRO B CB  1 
ATOM   5455  C  CG  . PRO B 2  283 ? -9.440  158.690 14.697  1.00 57.88  ? 283 PRO B CG  1 
ATOM   5456  C  CD  . PRO B 2  283 ? -10.951 158.581 14.632  1.00 59.43  ? 283 PRO B CD  1 
ATOM   5457  N  N   . HIS B 2  284 ? -9.677  161.591 11.191  1.00 49.40  ? 284 HIS B N   1 
ATOM   5458  C  CA  . HIS B 2  284 ? -9.177  161.762 9.822   1.00 47.31  ? 284 HIS B CA  1 
ATOM   5459  C  C   . HIS B 2  284 ? -7.732  162.256 9.909   1.00 45.50  ? 284 HIS B C   1 
ATOM   5460  O  O   . HIS B 2  284 ? -7.000  162.332 8.937   1.00 45.16  ? 284 HIS B O   1 
ATOM   5461  C  CB  . HIS B 2  284 ? -10.036 162.823 9.126   1.00 51.19  ? 284 HIS B CB  1 
ATOM   5462  C  CG  . HIS B 2  284 ? -11.497 162.488 9.123   1.00 52.62  ? 284 HIS B CG  1 
ATOM   5463  N  ND1 . HIS B 2  284 ? -11.999 161.440 8.385   1.00 49.92  ? 284 HIS B ND1 1 
ATOM   5464  C  CD2 . HIS B 2  284 ? -12.552 163.045 9.761   1.00 55.11  ? 284 HIS B CD2 1 
ATOM   5465  C  CE1 . HIS B 2  284 ? -13.304 161.363 8.557   1.00 51.53  ? 284 HIS B CE1 1 
ATOM   5466  N  NE2 . HIS B 2  284 ? -13.667 162.322 9.386   1.00 57.43  ? 284 HIS B NE2 1 
ATOM   5467  N  N   . VAL B 2  285 ? -7.369  162.623 11.129  1.00 45.37  ? 285 VAL B N   1 
ATOM   5468  C  CA  . VAL B 2  285 ? -6.103  163.243 11.479  1.00 44.69  ? 285 VAL B CA  1 
ATOM   5469  C  C   . VAL B 2  285 ? -5.241  162.484 12.476  1.00 42.19  ? 285 VAL B C   1 
ATOM   5470  O  O   . VAL B 2  285 ? -5.668  162.134 13.572  1.00 44.32  ? 285 VAL B O   1 
ATOM   5471  C  CB  . VAL B 2  285 ? -6.425  164.622 12.131  1.00 41.49  ? 285 VAL B CB  1 
ATOM   5472  C  CG1 . VAL B 2  285 ? -5.168  165.300 12.622  1.00 45.34  ? 285 VAL B CG1 1 
ATOM   5473  C  CG2 . VAL B 2  285 ? -7.196  165.478 11.145  1.00 37.18  ? 285 VAL B CG2 1 
ATOM   5474  N  N   . LYS B 2  286 ? -3.961  162.271 12.168  1.00 39.06  ? 286 LYS B N   1 
ATOM   5475  C  CA  . LYS B 2  286 ? -3.067  161.619 13.114  1.00 37.92  ? 286 LYS B CA  1 
ATOM   5476  C  C   . LYS B 2  286 ? -2.782  162.547 14.292  1.00 38.14  ? 286 LYS B C   1 
ATOM   5477  O  O   . LYS B 2  286 ? -2.591  163.756 14.154  1.00 39.19  ? 286 LYS B O   1 
ATOM   5478  C  CB  . LYS B 2  286 ? -1.732  161.195 12.488  1.00 31.75  ? 286 LYS B CB  1 
ATOM   5479  C  CG  . LYS B 2  286 ? -0.697  160.698 13.497  1.00 16.17  ? 286 LYS B CG  1 
ATOM   5480  C  CD  . LYS B 2  286 ? 0.621   160.321 12.894  1.00 23.05  ? 286 LYS B CD  1 
ATOM   5481  C  CE  . LYS B 2  286 ? 1.167   158.972 13.277  1.00 21.47  ? 286 LYS B CE  1 
ATOM   5482  N  NZ  . LYS B 2  286 ? 1.817   158.274 12.123  1.00 27.04  ? 286 LYS B NZ  1 
ATOM   5483  N  N   . ARG B 2  287 ? -3.089  162.068 15.490  1.00 40.80  ? 287 ARG B N   1 
ATOM   5484  C  CA  . ARG B 2  287 ? -2.732  162.768 16.725  1.00 46.62  ? 287 ARG B CA  1 
ATOM   5485  C  C   . ARG B 2  287 ? -3.688  163.936 16.913  1.00 49.97  ? 287 ARG B C   1 
ATOM   5486  O  O   . ARG B 2  287 ? -3.571  164.785 17.776  1.00 53.50  ? 287 ARG B O   1 
ATOM   5487  C  CB  . ARG B 2  287 ? -1.283  163.251 16.607  1.00 50.85  ? 287 ARG B CB  1 
ATOM   5488  C  CG  . ARG B 2  287 ? -0.351  162.467 17.535  1.00 42.48  ? 287 ARG B CG  1 
ATOM   5489  C  CD  . ARG B 2  287 ? 1.065   162.893 17.275  1.00 46.59  ? 287 ARG B CD  1 
ATOM   5490  N  NE  . ARG B 2  287 ? 2.091   161.869 17.269  1.00 50.70  ? 287 ARG B NE  1 
ATOM   5491  C  CZ  . ARG B 2  287 ? 2.667   161.414 16.155  1.00 52.91  ? 287 ARG B CZ  1 
ATOM   5492  N  NH1 . ARG B 2  287 ? 2.302   161.879 14.970  1.00 53.08  ? 287 ARG B NH1 1 
ATOM   5493  N  NH2 . ARG B 2  287 ? 3.605   160.490 16.232  1.00 57.11  ? 287 ARG B NH2 1 
ATOM   5494  N  N   . GLY B 2  288 ? -4.639  163.917 15.990  1.00 52.96  ? 288 GLY B N   1 
ATOM   5495  C  CA  . GLY B 2  288 ? -5.654  164.934 15.911  1.00 58.72  ? 288 GLY B CA  1 
ATOM   5496  C  C   . GLY B 2  288 ? -6.936  164.423 16.566  1.00 61.76  ? 288 GLY B C   1 
ATOM   5497  O  O   . GLY B 2  288 ? -7.227  163.235 16.599  1.00 63.33  ? 288 GLY B O   1 
ATOM   5498  N  N   . SER B 2  289 ? -7.676  165.386 17.098  1.00 66.13  ? 289 SER B N   1 
ATOM   5499  C  CA  . SER B 2  289 ? -8.978  165.136 17.650  1.00 70.37  ? 289 SER B CA  1 
ATOM   5500  C  C   . SER B 2  289 ? -10.107 165.792 16.867  1.00 71.37  ? 289 SER B C   1 
ATOM   5501  O  O   . SER B 2  289 ? -9.977  166.778 16.151  1.00 74.51  ? 289 SER B O   1 
ATOM   5502  C  CB  . SER B 2  289 ? -9.176  165.479 19.116  1.00 76.70  ? 289 SER B CB  1 
ATOM   5503  O  OG  . SER B 2  289 ? -10.591 165.275 19.352  1.00 83.40  ? 289 SER B OG  1 
ATOM   5504  N  N   . ASN B 2  290 ? -11.272 165.136 16.992  1.00 68.88  ? 290 ASN B N   1 
ATOM   5505  C  CA  . ASN B 2  290 ? -12.336 165.567 16.089  1.00 69.03  ? 290 ASN B CA  1 
ATOM   5506  C  C   . ASN B 2  290 ? -13.064 166.779 16.624  1.00 66.57  ? 290 ASN B C   1 
ATOM   5507  O  O   . ASN B 2  290 ? -13.378 166.811 17.817  1.00 63.94  ? 290 ASN B O   1 
ATOM   5508  C  CB  . ASN B 2  290 ? -13.212 164.379 15.725  1.00 77.11  ? 290 ASN B CB  1 
ATOM   5509  C  CG  . ASN B 2  290 ? -12.422 163.286 15.023  1.00 81.41  ? 290 ASN B CG  1 
ATOM   5510  O  OD1 . ASN B 2  290 ? -11.648 163.553 14.105  1.00 87.34  ? 290 ASN B OD1 1 
ATOM   5511  N  ND2 . ASN B 2  290 ? -12.616 162.050 15.460  1.00 84.13  ? 290 ASN B ND2 1 
ATOM   5512  N  N   . ALA B 2  291 ? -13.201 167.780 15.758  1.00 63.27  ? 291 ALA B N   1 
ATOM   5513  C  CA  . ALA B 2  291 ? -13.990 168.971 16.077  1.00 62.96  ? 291 ALA B CA  1 
ATOM   5514  C  C   . ALA B 2  291 ? -15.410 168.699 15.557  1.00 64.07  ? 291 ALA B C   1 
ATOM   5515  O  O   . ALA B 2  291 ? -16.434 169.055 16.121  1.00 66.28  ? 291 ALA B O   1 
ATOM   5516  C  CB  . ALA B 2  291 ? -13.407 170.161 15.343  1.00 60.92  ? 291 ALA B CB  1 
ATOM   5517  N  N   . THR B 2  292 ? -15.413 167.978 14.440  1.00 64.79  ? 292 THR B N   1 
ATOM   5518  C  CA  . THR B 2  292 ? -16.673 167.627 13.819  1.00 68.13  ? 292 THR B CA  1 
ATOM   5519  C  C   . THR B 2  292 ? -17.507 166.648 14.623  1.00 69.68  ? 292 THR B C   1 
ATOM   5520  O  O   . THR B 2  292 ? -18.741 166.752 14.632  1.00 73.87  ? 292 THR B O   1 
ATOM   5521  C  CB  . THR B 2  292 ? -16.415 167.003 12.429  1.00 70.74  ? 292 THR B CB  1 
ATOM   5522  O  OG1 . THR B 2  292 ? -15.356 167.772 11.832  1.00 68.31  ? 292 THR B OG1 1 
ATOM   5523  C  CG2 . THR B 2  292 ? -17.689 167.185 11.613  1.00 76.30  ? 292 THR B CG2 1 
ATOM   5524  N  N   . SER B 2  293 ? -16.867 165.667 15.248  1.00 68.98  ? 293 SER B N   1 
ATOM   5525  C  CA  . SER B 2  293 ? -17.599 164.654 15.980  1.00 69.35  ? 293 SER B CA  1 
ATOM   5526  C  C   . SER B 2  293 ? -18.448 165.189 17.120  1.00 69.00  ? 293 SER B C   1 
ATOM   5527  O  O   . SER B 2  293 ? -17.952 165.689 18.126  1.00 71.14  ? 293 SER B O   1 
ATOM   5528  C  CB  . SER B 2  293 ? -16.704 163.521 16.452  1.00 72.49  ? 293 SER B CB  1 
ATOM   5529  O  OG  . SER B 2  293 ? -17.056 162.303 15.808  1.00 76.76  ? 293 SER B OG  1 
ATOM   5530  N  N   . SER B 2  294 ? -19.757 165.034 16.916  1.00 66.08  ? 294 SER B N   1 
ATOM   5531  C  CA  . SER B 2  294 ? -20.724 165.447 17.924  1.00 64.05  ? 294 SER B CA  1 
ATOM   5532  C  C   . SER B 2  294 ? -20.606 164.516 19.125  1.00 61.43  ? 294 SER B C   1 
ATOM   5533  O  O   . SER B 2  294 ? -20.329 164.946 20.247  1.00 61.20  ? 294 SER B O   1 
ATOM   5534  C  CB  . SER B 2  294 ? -22.134 165.407 17.339  1.00 68.61  ? 294 SER B CB  1 
ATOM   5535  O  OG  . SER B 2  294 ? -22.950 166.386 17.966  1.00 70.66  ? 294 SER B OG  1 
ATOM   5536  N  N   . LEU B 2  295 ? -20.569 163.208 18.842  1.00 55.80  ? 295 LEU B N   1 
ATOM   5537  C  CA  . LEU B 2  295 ? -20.454 162.262 19.952  1.00 50.70  ? 295 LEU B CA  1 
ATOM   5538  C  C   . LEU B 2  295 ? -19.241 162.599 20.795  1.00 48.13  ? 295 LEU B C   1 
ATOM   5539  O  O   . LEU B 2  295 ? -19.251 162.849 21.995  1.00 51.20  ? 295 LEU B O   1 
ATOM   5540  C  CB  . LEU B 2  295 ? -20.383 160.835 19.436  1.00 41.10  ? 295 LEU B CB  1 
ATOM   5541  C  CG  . LEU B 2  295 ? -21.473 159.904 19.978  1.00 40.53  ? 295 LEU B CG  1 
ATOM   5542  C  CD1 . LEU B 2  295 ? -22.859 160.525 19.877  1.00 45.86  ? 295 LEU B CD1 1 
ATOM   5543  C  CD2 . LEU B 2  295 ? -21.420 158.592 19.223  1.00 35.54  ? 295 LEU B CD2 1 
ATOM   5544  N  N   . TYR B 2  296 ? -18.136 162.729 20.078  1.00 43.99  ? 296 TYR B N   1 
ATOM   5545  C  CA  . TYR B 2  296 ? -16.911 163.095 20.753  1.00 44.01  ? 296 TYR B CA  1 
ATOM   5546  C  C   . TYR B 2  296 ? -16.961 164.408 21.489  1.00 45.94  ? 296 TYR B C   1 
ATOM   5547  O  O   . TYR B 2  296 ? -16.423 164.449 22.596  1.00 46.99  ? 296 TYR B O   1 
ATOM   5548  C  CB  . TYR B 2  296 ? -15.803 163.034 19.716  1.00 45.47  ? 296 TYR B CB  1 
ATOM   5549  C  CG  . TYR B 2  296 ? -14.483 162.670 20.345  1.00 48.79  ? 296 TYR B CG  1 
ATOM   5550  C  CD1 . TYR B 2  296 ? -13.717 163.677 20.908  1.00 49.92  ? 296 TYR B CD1 1 
ATOM   5551  C  CD2 . TYR B 2  296 ? -14.035 161.365 20.398  1.00 50.61  ? 296 TYR B CD2 1 
ATOM   5552  C  CE1 . TYR B 2  296 ? -12.506 163.396 21.496  1.00 52.18  ? 296 TYR B CE1 1 
ATOM   5553  C  CE2 . TYR B 2  296 ? -12.826 161.077 21.002  1.00 53.27  ? 296 TYR B CE2 1 
ATOM   5554  C  CZ  . TYR B 2  296 ? -12.070 162.095 21.542  1.00 53.74  ? 296 TYR B CZ  1 
ATOM   5555  O  OH  . TYR B 2  296 ? -10.866 161.760 22.123  1.00 55.17  ? 296 TYR B OH  1 
ATOM   5556  N  N   . GLN B 2  297 ? -17.596 165.432 20.933  1.00 48.20  ? 297 GLN B N   1 
ATOM   5557  C  CA  . GLN B 2  297 ? -17.675 166.698 21.649  1.00 49.43  ? 297 GLN B CA  1 
ATOM   5558  C  C   . GLN B 2  297 ? -18.465 166.513 22.940  1.00 48.83  ? 297 GLN B C   1 
ATOM   5559  O  O   . GLN B 2  297 ? -17.987 166.869 24.013  1.00 44.10  ? 297 GLN B O   1 
ATOM   5560  C  CB  . GLN B 2  297 ? -18.237 167.801 20.766  1.00 59.76  ? 297 GLN B CB  1 
ATOM   5561  C  CG  . GLN B 2  297 ? -17.180 168.556 19.988  1.00 64.62  ? 297 GLN B CG  1 
ATOM   5562  C  CD  . GLN B 2  297 ? -15.763 168.305 20.433  1.00 63.31  ? 297 GLN B CD  1 
ATOM   5563  O  OE1 . GLN B 2  297 ? -15.420 167.873 21.526  1.00 59.51  ? 297 GLN B OE1 1 
ATOM   5564  N  NE2 . GLN B 2  297 ? -14.811 168.600 19.550  1.00 69.42  ? 297 GLN B NE2 1 
ATOM   5565  N  N   . ALA B 2  298 ? -19.590 165.827 22.785  1.00 46.84  ? 298 ALA B N   1 
ATOM   5566  C  CA  . ALA B 2  298 ? -20.626 165.684 23.786  1.00 45.49  ? 298 ALA B CA  1 
ATOM   5567  C  C   . ALA B 2  298 ? -20.141 164.828 24.951  1.00 43.59  ? 298 ALA B C   1 
ATOM   5568  O  O   . ALA B 2  298 ? -20.301 165.112 26.120  1.00 39.06  ? 298 ALA B O   1 
ATOM   5569  C  CB  . ALA B 2  298 ? -21.805 164.955 23.136  1.00 49.59  ? 298 ALA B CB  1 
ATOM   5570  N  N   . VAL B 2  299 ? -19.636 163.690 24.505  1.00 46.00  ? 299 VAL B N   1 
ATOM   5571  C  CA  . VAL B 2  299 ? -19.050 162.707 25.409  1.00 52.34  ? 299 VAL B CA  1 
ATOM   5572  C  C   . VAL B 2  299 ? -17.902 163.432 26.116  1.00 53.21  ? 299 VAL B C   1 
ATOM   5573  O  O   . VAL B 2  299 ? -17.947 163.649 27.315  1.00 53.02  ? 299 VAL B O   1 
ATOM   5574  C  CB  . VAL B 2  299 ? -18.448 161.537 24.600  1.00 50.50  ? 299 VAL B CB  1 
ATOM   5575  C  CG1 . VAL B 2  299 ? -17.571 160.631 25.439  1.00 47.55  ? 299 VAL B CG1 1 
ATOM   5576  C  CG2 . VAL B 2  299 ? -19.511 160.727 23.873  1.00 51.93  ? 299 VAL B CG2 1 
ATOM   5577  N  N   . ALA B 2  300 ? -16.997 163.960 25.297  1.00 56.63  ? 300 ALA B N   1 
ATOM   5578  C  CA  . ALA B 2  300 ? -15.812 164.623 25.793  1.00 60.35  ? 300 ALA B CA  1 
ATOM   5579  C  C   . ALA B 2  300 ? -16.043 165.669 26.863  1.00 62.80  ? 300 ALA B C   1 
ATOM   5580  O  O   . ALA B 2  300 ? -15.202 165.810 27.754  1.00 65.63  ? 300 ALA B O   1 
ATOM   5581  C  CB  . ALA B 2  300 ? -14.881 165.175 24.731  1.00 55.41  ? 300 ALA B CB  1 
ATOM   5582  N  N   . LYS B 2  301 ? -17.116 166.437 26.793  1.00 65.37  ? 301 LYS B N   1 
ATOM   5583  C  CA  . LYS B 2  301 ? -17.418 167.462 27.774  1.00 66.64  ? 301 LYS B CA  1 
ATOM   5584  C  C   . LYS B 2  301 ? -17.892 166.862 29.085  1.00 67.73  ? 301 LYS B C   1 
ATOM   5585  O  O   . LYS B 2  301 ? -17.548 167.408 30.135  1.00 66.77  ? 301 LYS B O   1 
ATOM   5586  C  CB  . LYS B 2  301 ? -18.464 168.451 27.253  1.00 71.25  ? 301 LYS B CB  1 
ATOM   5587  C  CG  . LYS B 2  301 ? -17.958 169.513 26.288  1.00 77.83  ? 301 LYS B CG  1 
ATOM   5588  C  CD  . LYS B 2  301 ? -19.064 170.026 25.382  1.00 78.61  ? 301 LYS B CD  1 
ATOM   5589  C  CE  . LYS B 2  301 ? -18.584 170.928 24.262  1.00 81.17  ? 301 LYS B CE  1 
ATOM   5590  N  NZ  . LYS B 2  301 ? -19.700 171.671 23.600  1.00 86.25  ? 301 LYS B NZ  1 
ATOM   5591  N  N   . GLY B 2  302 ? -18.699 165.805 29.066  1.00 70.82  ? 302 GLY B N   1 
ATOM   5592  C  CA  . GLY B 2  302 ? -19.100 165.218 30.352  1.00 74.43  ? 302 GLY B CA  1 
ATOM   5593  C  C   . GLY B 2  302 ? -18.091 164.138 30.740  1.00 77.36  ? 302 GLY B C   1 
ATOM   5594  O  O   . GLY B 2  302 ? -18.228 163.503 31.789  1.00 80.61  ? 302 GLY B O   1 
ATOM   5595  N  N   . VAL B 2  303 ? -17.091 163.938 29.881  1.00 77.43  ? 303 VAL B N   1 
ATOM   5596  C  CA  . VAL B 2  303 ? -16.112 162.890 30.075  1.00 75.69  ? 303 VAL B CA  1 
ATOM   5597  C  C   . VAL B 2  303 ? -14.766 163.259 30.633  1.00 75.43  ? 303 VAL B C   1 
ATOM   5598  O  O   . VAL B 2  303 ? -14.344 164.409 30.733  1.00 76.86  ? 303 VAL B O   1 
ATOM   5599  C  CB  . VAL B 2  303 ? -15.966 162.041 28.789  1.00 73.63  ? 303 VAL B CB  1 
ATOM   5600  C  CG1 . VAL B 2  303 ? -14.992 160.902 29.041  1.00 70.67  ? 303 VAL B CG1 1 
ATOM   5601  C  CG2 . VAL B 2  303 ? -17.322 161.333 28.585  1.00 73.85  ? 303 VAL B CG2 1 
ATOM   5602  N  N   . HIS B 2  304 ? -14.022 162.263 31.110  1.00 76.83  ? 304 HIS B N   1 
ATOM   5603  C  CA  . HIS B 2  304 ? -12.658 162.426 31.588  1.00 76.53  ? 304 HIS B CA  1 
ATOM   5604  C  C   . HIS B 2  304 ? -11.730 162.849 30.440  1.00 76.51  ? 304 HIS B C   1 
ATOM   5605  O  O   . HIS B 2  304 ? -12.179 163.056 29.311  1.00 77.22  ? 304 HIS B O   1 
ATOM   5606  C  CB  . HIS B 2  304 ? -12.159 161.072 32.164  1.00 81.62  ? 304 HIS B CB  1 
ATOM   5607  C  CG  . HIS B 2  304 ? -10.801 161.239 32.782  1.00 85.72  ? 304 HIS B CG  1 
ATOM   5608  N  ND1 . HIS B 2  304 ? -10.680 161.699 34.076  1.00 89.82  ? 304 HIS B ND1 1 
ATOM   5609  C  CD2 . HIS B 2  304 ? -9.545  161.056 32.347  1.00 86.06  ? 304 HIS B CD2 1 
ATOM   5610  C  CE1 . HIS B 2  304 ? -9.395  161.788 34.393  1.00 91.39  ? 304 HIS B CE1 1 
ATOM   5611  N  NE2 . HIS B 2  304 ? -8.673  161.407 33.348  1.00 90.26  ? 304 HIS B NE2 1 
ATOM   5612  N  N   . GLN B 2  305 ? -10.464 162.994 30.745  1.00 75.41  ? 305 GLN B N   1 
ATOM   5613  C  CA  . GLN B 2  305 ? -9.312  163.168 29.867  1.00 75.86  ? 305 GLN B CA  1 
ATOM   5614  C  C   . GLN B 2  305 ? -9.212  161.957 28.952  1.00 72.67  ? 305 GLN B C   1 
ATOM   5615  O  O   . GLN B 2  305 ? -9.957  161.946 27.941  1.00 74.40  ? 305 GLN B O   1 
ATOM   5616  C  CB  . GLN B 2  305 ? -8.109  163.544 30.737  1.00 84.60  ? 305 GLN B CB  1 
ATOM   5617  C  CG  . GLN B 2  305 ? -8.448  164.414 31.949  1.00 91.64  ? 305 GLN B CG  1 
ATOM   5618  C  CD  . GLN B 2  305 ? -7.296  164.924 32.786  1.00 90.90  ? 305 GLN B CD  1 
ATOM   5619  O  OE1 . GLN B 2  305 ? -6.145  164.491 32.678  1.00 91.54  ? 305 GLN B OE1 1 
ATOM   5620  N  NE2 . GLN B 2  305 ? -7.560  165.883 33.674  1.00 86.74  ? 305 GLN B NE2 1 
ATOM   5621  N  N   . PRO B 2  306 ? -8.618  160.833 29.311  1.00 68.14  ? 306 PRO B N   1 
ATOM   5622  C  CA  . PRO B 2  306 ? -8.504  159.635 28.491  1.00 62.45  ? 306 PRO B CA  1 
ATOM   5623  C  C   . PRO B 2  306 ? -9.807  158.920 28.184  1.00 57.13  ? 306 PRO B C   1 
ATOM   5624  O  O   . PRO B 2  306 ? -10.483 158.473 29.113  1.00 59.05  ? 306 PRO B O   1 
ATOM   5625  C  CB  . PRO B 2  306 ? -7.541  158.670 29.214  1.00 64.48  ? 306 PRO B CB  1 
ATOM   5626  C  CG  . PRO B 2  306 ? -6.782  159.603 30.113  1.00 69.96  ? 306 PRO B CG  1 
ATOM   5627  C  CD  . PRO B 2  306 ? -7.641  160.800 30.407  1.00 69.21  ? 306 PRO B CD  1 
ATOM   5628  N  N   . PHE B 2  307 ? -10.170 158.732 26.923  1.00 50.98  ? 307 PHE B N   1 
ATOM   5629  C  CA  . PHE B 2  307 ? -11.381 158.085 26.457  1.00 42.62  ? 307 PHE B CA  1 
ATOM   5630  C  C   . PHE B 2  307 ? -11.538 158.200 24.944  1.00 38.20  ? 307 PHE B C   1 
ATOM   5631  O  O   . PHE B 2  307 ? -10.998 159.121 24.325  1.00 45.85  ? 307 PHE B O   1 
ATOM   5632  C  CB  . PHE B 2  307 ? -12.658 158.595 27.131  1.00 44.18  ? 307 PHE B CB  1 
ATOM   5633  C  CG  . PHE B 2  307 ? -13.158 159.874 26.517  1.00 48.17  ? 307 PHE B CG  1 
ATOM   5634  C  CD1 . PHE B 2  307 ? -13.931 159.874 25.371  1.00 45.73  ? 307 PHE B CD1 1 
ATOM   5635  C  CD2 . PHE B 2  307 ? -12.795 161.070 27.120  1.00 49.99  ? 307 PHE B CD2 1 
ATOM   5636  C  CE1 . PHE B 2  307 ? -14.365 161.076 24.832  1.00 48.02  ? 307 PHE B CE1 1 
ATOM   5637  C  CE2 . PHE B 2  307 ? -13.249 162.264 26.600  1.00 56.71  ? 307 PHE B CE2 1 
ATOM   5638  C  CZ  . PHE B 2  307 ? -14.018 162.253 25.451  1.00 54.06  ? 307 PHE B CZ  1 
ATOM   5639  N  N   . ASP B 2  308 ? -12.110 157.193 24.306  1.00 29.54  ? 308 ASP B N   1 
ATOM   5640  C  CA  . ASP B 2  308 ? -12.352 157.250 22.874  1.00 28.41  ? 308 ASP B CA  1 
ATOM   5641  C  C   . ASP B 2  308 ? -13.674 156.589 22.507  1.00 24.83  ? 308 ASP B C   1 
ATOM   5642  O  O   . ASP B 2  308 ? -14.172 155.754 23.263  1.00 24.56  ? 308 ASP B O   1 
ATOM   5643  C  CB  . ASP B 2  308 ? -11.198 156.697 22.052  1.00 36.80  ? 308 ASP B CB  1 
ATOM   5644  C  CG  . ASP B 2  308 ? -11.434 156.846 20.566  1.00 43.76  ? 308 ASP B CG  1 
ATOM   5645  O  OD1 . ASP B 2  308 ? -12.627 156.904 20.192  1.00 44.99  ? 308 ASP B OD1 1 
ATOM   5646  O  OD2 . ASP B 2  308 ? -10.553 156.929 19.699  1.00 52.14  ? 308 ASP B OD2 1 
ATOM   5647  N  N   . VAL B 2  309 ? -14.356 157.073 21.483  1.00 20.12  ? 309 VAL B N   1 
ATOM   5648  C  CA  . VAL B 2  309 ? -15.696 156.685 21.108  1.00 19.71  ? 309 VAL B CA  1 
ATOM   5649  C  C   . VAL B 2  309 ? -16.078 156.944 19.657  1.00 19.43  ? 309 VAL B C   1 
ATOM   5650  O  O   . VAL B 2  309 ? -15.684 157.883 18.964  1.00 23.45  ? 309 VAL B O   1 
ATOM   5651  C  CB  . VAL B 2  309 ? -16.747 157.407 21.986  1.00 19.41  ? 309 VAL B CB  1 
ATOM   5652  C  CG1 . VAL B 2  309 ? -18.040 157.517 21.224  1.00 4.22   ? 309 VAL B CG1 1 
ATOM   5653  C  CG2 . VAL B 2  309 ? -16.954 156.674 23.311  1.00 28.28  ? 309 VAL B CG2 1 
ATOM   5654  N  N   . SER B 2  310 ? -16.894 156.043 19.100  1.00 14.86  ? 310 SER B N   1 
ATOM   5655  C  CA  . SER B 2  310 ? -17.247 156.079 17.704  1.00 12.15  ? 310 SER B CA  1 
ATOM   5656  C  C   . SER B 2  310 ? -18.601 155.473 17.353  1.00 10.83  ? 310 SER B C   1 
ATOM   5657  O  O   . SER B 2  310 ? -19.098 154.443 17.794  1.00 4.64   ? 310 SER B O   1 
ATOM   5658  C  CB  . SER B 2  310 ? -16.173 155.400 16.841  1.00 3.57   ? 310 SER B CB  1 
ATOM   5659  O  OG  . SER B 2  310 ? -16.762 155.153 15.566  1.00 4.91   ? 310 SER B OG  1 
ATOM   5660  N  N   . ALA B 2  311 ? -19.273 156.141 16.404  1.00 9.21   ? 311 ALA B N   1 
ATOM   5661  C  CA  . ALA B 2  311 ? -20.519 155.596 15.905  1.00 8.88   ? 311 ALA B CA  1 
ATOM   5662  C  C   . ALA B 2  311 ? -20.223 154.311 15.123  1.00 6.46   ? 311 ALA B C   1 
ATOM   5663  O  O   . ALA B 2  311 ? -19.343 154.249 14.271  1.00 2.45   ? 311 ALA B O   1 
ATOM   5664  C  CB  . ALA B 2  311 ? -21.242 156.582 15.008  1.00 8.57   ? 311 ALA B CB  1 
ATOM   5665  N  N   . PHE B 2  312 ? -21.119 153.363 15.354  1.00 5.51   ? 312 PHE B N   1 
ATOM   5666  C  CA  . PHE B 2  312 ? -21.038 152.032 14.756  1.00 6.90   ? 312 PHE B CA  1 
ATOM   5667  C  C   . PHE B 2  312 ? -22.161 151.886 13.737  1.00 8.50   ? 312 PHE B C   1 
ATOM   5668  O  O   . PHE B 2  312 ? -23.304 152.243 14.042  1.00 5.22   ? 312 PHE B O   1 
ATOM   5669  C  CB  . PHE B 2  312 ? -21.221 150.968 15.865  1.00 9.03   ? 312 PHE B CB  1 
ATOM   5670  C  CG  . PHE B 2  312 ? -21.201 149.559 15.388  1.00 4.20   ? 312 PHE B CG  1 
ATOM   5671  C  CD1 . PHE B 2  312 ? -20.080 149.001 14.812  1.00 9.92   ? 312 PHE B CD1 1 
ATOM   5672  C  CD2 . PHE B 2  312 ? -22.326 148.764 15.467  1.00 4.71   ? 312 PHE B CD2 1 
ATOM   5673  C  CE1 . PHE B 2  312 ? -20.004 147.718 14.314  1.00 4.80   ? 312 PHE B CE1 1 
ATOM   5674  C  CE2 . PHE B 2  312 ? -22.271 147.484 14.972  1.00 7.87   ? 312 PHE B CE2 1 
ATOM   5675  C  CZ  . PHE B 2  312 ? -21.137 146.943 14.399  1.00 7.22   ? 312 PHE B CZ  1 
ATOM   5676  N  N   . ASN B 2  313 ? -21.857 151.377 12.549  1.00 9.55   ? 313 ASN B N   1 
ATOM   5677  C  CA  . ASN B 2  313 ? -22.935 151.206 11.566  1.00 11.82  ? 313 ASN B CA  1 
ATOM   5678  C  C   . ASN B 2  313 ? -22.691 149.969 10.713  1.00 11.10  ? 313 ASN B C   1 
ATOM   5679  O  O   . ASN B 2  313 ? -21.650 149.864 10.068  1.00 9.11   ? 313 ASN B O   1 
ATOM   5680  C  CB  . ASN B 2  313 ? -23.159 152.476 10.758  1.00 11.59  ? 313 ASN B CB  1 
ATOM   5681  C  CG  . ASN B 2  313 ? -24.035 152.260 9.537   1.00 5.59   ? 313 ASN B CG  1 
ATOM   5682  O  OD1 . ASN B 2  313 ? -25.162 151.763 9.638   1.00 4.23   ? 313 ASN B OD1 1 
ATOM   5683  N  ND2 . ASN B 2  313 ? -23.447 152.620 8.406   1.00 5.53   ? 313 ASN B ND2 1 
ATOM   5684  N  N   . ALA B 2  314 ? -23.657 149.061 10.720  1.00 12.03  ? 314 ALA B N   1 
ATOM   5685  C  CA  . ALA B 2  314 ? -23.580 147.731 10.119  1.00 10.00  ? 314 ALA B CA  1 
ATOM   5686  C  C   . ALA B 2  314 ? -24.786 147.425 9.237   1.00 9.40   ? 314 ALA B C   1 
ATOM   5687  O  O   . ALA B 2  314 ? -25.892 147.419 9.810   1.00 16.52  ? 314 ALA B O   1 
ATOM   5688  C  CB  . ALA B 2  314 ? -23.607 146.823 11.359  1.00 4.47   ? 314 ALA B CB  1 
ATOM   5689  N  N   . SER B 2  315 ? -24.683 147.141 7.942   1.00 3.74   ? 315 SER B N   1 
ATOM   5690  C  CA  . SER B 2  315 ? -25.901 146.813 7.189   1.00 2.65   ? 315 SER B CA  1 
ATOM   5691  C  C   . SER B 2  315 ? -25.729 145.505 6.423   1.00 2.45   ? 315 SER B C   1 
ATOM   5692  O  O   . SER B 2  315 ? -24.600 145.253 5.972   1.00 4.90   ? 315 SER B O   1 
ATOM   5693  C  CB  . SER B 2  315 ? -26.290 147.966 6.266   1.00 10.55  ? 315 SER B CB  1 
ATOM   5694  O  OG  . SER B 2  315 ? -25.932 147.648 4.925   1.00 24.97  ? 315 SER B OG  1 
ATOM   5695  N  N   . TYR B 2  316 ? -26.753 144.670 6.472   1.00 3.68   ? 316 TYR B N   1 
ATOM   5696  C  CA  . TYR B 2  316 ? -26.677 143.361 5.843   1.00 13.48  ? 316 TYR B CA  1 
ATOM   5697  C  C   . TYR B 2  316 ? -27.955 143.224 5.029   1.00 17.51  ? 316 TYR B C   1 
ATOM   5698  O  O   . TYR B 2  316 ? -28.813 144.112 5.073   1.00 19.12  ? 316 TYR B O   1 
ATOM   5699  C  CB  . TYR B 2  316 ? -26.485 142.173 6.799   1.00 20.93  ? 316 TYR B CB  1 
ATOM   5700  C  CG  . TYR B 2  316 ? -25.247 142.319 7.667   1.00 27.06  ? 316 TYR B CG  1 
ATOM   5701  C  CD1 . TYR B 2  316 ? -25.277 142.981 8.890   1.00 23.18  ? 316 TYR B CD1 1 
ATOM   5702  C  CD2 . TYR B 2  316 ? -24.028 141.818 7.228   1.00 29.96  ? 316 TYR B CD2 1 
ATOM   5703  C  CE1 . TYR B 2  316 ? -24.144 143.139 9.662   1.00 20.29  ? 316 TYR B CE1 1 
ATOM   5704  C  CE2 . TYR B 2  316 ? -22.888 141.972 7.998   1.00 30.99  ? 316 TYR B CE2 1 
ATOM   5705  C  CZ  . TYR B 2  316 ? -22.954 142.628 9.207   1.00 27.57  ? 316 TYR B CZ  1 
ATOM   5706  O  OH  . TYR B 2  316 ? -21.796 142.753 9.942   1.00 35.45  ? 316 TYR B OH  1 
ATOM   5707  N  N   . SER B 2  317 ? -28.074 142.141 4.284   1.00 17.67  ? 317 SER B N   1 
ATOM   5708  C  CA  . SER B 2  317 ? -29.208 141.983 3.407   1.00 18.02  ? 317 SER B CA  1 
ATOM   5709  C  C   . SER B 2  317 ? -30.603 142.069 3.970   1.00 19.33  ? 317 SER B C   1 
ATOM   5710  O  O   . SER B 2  317 ? -31.431 142.737 3.336   1.00 22.41  ? 317 SER B O   1 
ATOM   5711  C  CB  . SER B 2  317 ? -28.976 140.726 2.579   1.00 13.60  ? 317 SER B CB  1 
ATOM   5712  O  OG  . SER B 2  317 ? -29.244 139.562 3.315   1.00 4.45   ? 317 SER B OG  1 
ATOM   5713  N  N   . ASP B 2  318 ? -30.911 141.419 5.071   1.00 20.82  ? 318 ASP B N   1 
ATOM   5714  C  CA  . ASP B 2  318 ? -32.216 141.378 5.695   1.00 20.33  ? 318 ASP B CA  1 
ATOM   5715  C  C   . ASP B 2  318 ? -32.354 142.219 6.944   1.00 21.50  ? 318 ASP B C   1 
ATOM   5716  O  O   . ASP B 2  318 ? -33.442 142.459 7.484   1.00 24.86  ? 318 ASP B O   1 
ATOM   5717  C  CB  . ASP B 2  318 ? -32.656 139.939 5.912   1.00 18.21  ? 318 ASP B CB  1 
ATOM   5718  C  CG  . ASP B 2  318 ? -31.572 138.931 6.152   1.00 27.88  ? 318 ASP B CG  1 
ATOM   5719  O  OD1 . ASP B 2  318 ? -30.396 139.293 6.007   1.00 37.69  ? 318 ASP B OD1 1 
ATOM   5720  O  OD2 . ASP B 2  318 ? -31.847 137.759 6.501   1.00 37.39  ? 318 ASP B OD2 1 
ATOM   5721  N  N   . SER B 2  319 ? -31.271 142.768 7.487   1.00 21.40  ? 319 SER B N   1 
ATOM   5722  C  CA  . SER B 2  319 ? -31.373 143.535 8.734   1.00 15.12  ? 319 SER B CA  1 
ATOM   5723  C  C   . SER B 2  319 ? -30.241 144.569 8.726   1.00 12.11  ? 319 SER B C   1 
ATOM   5724  O  O   . SER B 2  319 ? -29.426 144.548 7.811   1.00 12.52  ? 319 SER B O   1 
ATOM   5725  C  CB  . SER B 2  319 ? -31.079 142.652 9.948   1.00 2.20   ? 319 SER B CB  1 
ATOM   5726  O  OG  . SER B 2  319 ? -31.719 143.120 11.106  1.00 7.94   ? 319 SER B OG  1 
ATOM   5727  N  N   . GLY B 2  320 ? -30.113 145.269 9.837   1.00 5.64   ? 320 GLY B N   1 
ATOM   5728  C  CA  . GLY B 2  320 ? -28.903 146.044 10.083  1.00 7.67   ? 320 GLY B CA  1 
ATOM   5729  C  C   . GLY B 2  320 ? -28.702 146.159 11.602  1.00 11.05  ? 320 GLY B C   1 
ATOM   5730  O  O   . GLY B 2  320 ? -29.692 145.987 12.320  1.00 10.19  ? 320 GLY B O   1 
ATOM   5731  N  N   . LEU B 2  321 ? -27.642 146.877 11.975  1.00 10.46  ? 321 LEU B N   1 
ATOM   5732  C  CA  . LEU B 2  321 ? -27.484 147.394 13.328  1.00 11.39  ? 321 LEU B CA  1 
ATOM   5733  C  C   . LEU B 2  321 ? -26.839 148.782 13.325  1.00 13.36  ? 321 LEU B C   1 
ATOM   5734  O  O   . LEU B 2  321 ? -25.814 148.906 12.633  1.00 19.28  ? 321 LEU B O   1 
ATOM   5735  C  CB  . LEU B 2  321 ? -26.510 146.463 14.061  1.00 9.23   ? 321 LEU B CB  1 
ATOM   5736  C  CG  . LEU B 2  321 ? -27.006 145.045 14.334  1.00 8.13   ? 321 LEU B CG  1 
ATOM   5737  C  CD1 . LEU B 2  321 ? -25.909 144.123 14.809  1.00 2.20   ? 321 LEU B CD1 1 
ATOM   5738  C  CD2 . LEU B 2  321 ? -28.213 145.037 15.243  1.00 7.70   ? 321 LEU B CD2 1 
ATOM   5739  N  N   . PHE B 2  322 ? -27.467 149.759 13.986  1.00 5.17   ? 322 PHE B N   1 
ATOM   5740  C  CA  . PHE B 2  322 ? -26.854 151.089 14.050  1.00 5.97   ? 322 PHE B CA  1 
ATOM   5741  C  C   . PHE B 2  322 ? -26.867 151.609 15.488  1.00 7.82   ? 322 PHE B C   1 
ATOM   5742  O  O   . PHE B 2  322 ? -27.765 151.292 16.271  1.00 5.23   ? 322 PHE B O   1 
ATOM   5743  C  CB  . PHE B 2  322 ? -27.413 152.142 13.100  1.00 8.81   ? 322 PHE B CB  1 
ATOM   5744  C  CG  . PHE B 2  322 ? -27.094 153.559 13.523  1.00 2.20   ? 322 PHE B CG  1 
ATOM   5745  C  CD1 . PHE B 2  322 ? -27.685 154.114 14.656  1.00 5.21   ? 322 PHE B CD1 1 
ATOM   5746  C  CD2 . PHE B 2  322 ? -26.175 154.327 12.855  1.00 5.43   ? 322 PHE B CD2 1 
ATOM   5747  C  CE1 . PHE B 2  322 ? -27.409 155.392 15.069  1.00 3.45   ? 322 PHE B CE1 1 
ATOM   5748  C  CE2 . PHE B 2  322 ? -25.865 155.568 13.339  1.00 2.20   ? 322 PHE B CE2 1 
ATOM   5749  C  CZ  . PHE B 2  322 ? -26.466 156.160 14.404  1.00 3.44   ? 322 PHE B CZ  1 
ATOM   5750  N  N   . GLY B 2  323 ? -25.847 152.361 15.872  1.00 7.30   ? 323 GLY B N   1 
ATOM   5751  C  CA  . GLY B 2  323 ? -25.643 152.840 17.209  1.00 7.79   ? 323 GLY B CA  1 
ATOM   5752  C  C   . GLY B 2  323 ? -24.186 153.221 17.429  1.00 11.72  ? 323 GLY B C   1 
ATOM   5753  O  O   . GLY B 2  323 ? -23.481 153.608 16.499  1.00 8.32   ? 323 GLY B O   1 
ATOM   5754  N  N   . PHE B 2  324 ? -23.653 153.056 18.644  1.00 15.63  ? 324 PHE B N   1 
ATOM   5755  C  CA  . PHE B 2  324 ? -22.265 153.489 18.841  1.00 16.18  ? 324 PHE B CA  1 
ATOM   5756  C  C   . PHE B 2  324 ? -21.398 152.554 19.651  1.00 15.51  ? 324 PHE B C   1 
ATOM   5757  O  O   . PHE B 2  324 ? -21.909 151.642 20.281  1.00 20.20  ? 324 PHE B O   1 
ATOM   5758  C  CB  . PHE B 2  324 ? -22.303 154.862 19.490  1.00 18.11  ? 324 PHE B CB  1 
ATOM   5759  C  CG  . PHE B 2  324 ? -22.994 154.889 20.814  1.00 15.30  ? 324 PHE B CG  1 
ATOM   5760  C  CD1 . PHE B 2  324 ? -22.315 154.650 21.986  1.00 18.28  ? 324 PHE B CD1 1 
ATOM   5761  C  CD2 . PHE B 2  324 ? -24.338 155.175 20.877  1.00 20.04  ? 324 PHE B CD2 1 
ATOM   5762  C  CE1 . PHE B 2  324 ? -22.943 154.689 23.213  1.00 12.44  ? 324 PHE B CE1 1 
ATOM   5763  C  CE2 . PHE B 2  324 ? -24.975 155.219 22.097  1.00 24.59  ? 324 PHE B CE2 1 
ATOM   5764  C  CZ  . PHE B 2  324 ? -24.283 154.975 23.270  1.00 16.86  ? 324 PHE B CZ  1 
ATOM   5765  N  N   . TYR B 2  325 ? -20.090 152.777 19.690  1.00 16.41  ? 325 TYR B N   1 
ATOM   5766  C  CA  . TYR B 2  325 ? -19.157 151.924 20.442  1.00 13.02  ? 325 TYR B CA  1 
ATOM   5767  C  C   . TYR B 2  325 ? -18.307 152.766 21.393  1.00 12.35  ? 325 TYR B C   1 
ATOM   5768  O  O   . TYR B 2  325 ? -17.889 153.856 20.986  1.00 14.26  ? 325 TYR B O   1 
ATOM   5769  C  CB  . TYR B 2  325 ? -18.272 151.255 19.403  1.00 9.45   ? 325 TYR B CB  1 
ATOM   5770  C  CG  . TYR B 2  325 ? -17.384 150.161 19.906  1.00 11.57  ? 325 TYR B CG  1 
ATOM   5771  C  CD1 . TYR B 2  325 ? -16.316 150.407 20.748  1.00 5.33   ? 325 TYR B CD1 1 
ATOM   5772  C  CD2 . TYR B 2  325 ? -17.609 148.846 19.497  1.00 16.30  ? 325 TYR B CD2 1 
ATOM   5773  C  CE1 . TYR B 2  325 ? -15.515 149.365 21.176  1.00 9.37   ? 325 TYR B CE1 1 
ATOM   5774  C  CE2 . TYR B 2  325 ? -16.807 147.805 19.926  1.00 14.61  ? 325 TYR B CE2 1 
ATOM   5775  C  CZ  . TYR B 2  325 ? -15.755 148.076 20.773  1.00 12.05  ? 325 TYR B CZ  1 
ATOM   5776  O  OH  . TYR B 2  325 ? -14.945 147.068 21.232  1.00 13.90  ? 325 TYR B OH  1 
ATOM   5777  N  N   . THR B 2  326 ? -18.253 152.464 22.677  1.00 4.68   ? 326 THR B N   1 
ATOM   5778  C  CA  . THR B 2  326 ? -17.506 153.255 23.636  1.00 8.18   ? 326 THR B CA  1 
ATOM   5779  C  C   . THR B 2  326 ? -16.299 152.472 24.115  1.00 5.47   ? 326 THR B C   1 
ATOM   5780  O  O   . THR B 2  326 ? -16.285 151.251 24.046  1.00 6.33   ? 326 THR B O   1 
ATOM   5781  C  CB  . THR B 2  326 ? -18.339 153.728 24.829  1.00 7.41   ? 326 THR B CB  1 
ATOM   5782  O  OG1 . THR B 2  326 ? -19.073 152.670 25.445  1.00 21.84  ? 326 THR B OG1 1 
ATOM   5783  C  CG2 . THR B 2  326 ? -19.316 154.792 24.345  1.00 9.37   ? 326 THR B CG2 1 
ATOM   5784  N  N   . ILE B 2  327 ? -15.300 153.178 24.596  1.00 8.79   ? 327 ILE B N   1 
ATOM   5785  C  CA  . ILE B 2  327 ? -14.117 152.610 25.240  1.00 7.91   ? 327 ILE B CA  1 
ATOM   5786  C  C   . ILE B 2  327 ? -13.794 153.550 26.427  1.00 5.27   ? 327 ILE B C   1 
ATOM   5787  O  O   . ILE B 2  327 ? -13.475 154.689 26.136  1.00 4.67   ? 327 ILE B O   1 
ATOM   5788  C  CB  . ILE B 2  327 ? -12.812 152.689 24.438  1.00 3.01   ? 327 ILE B CB  1 
ATOM   5789  C  CG1 . ILE B 2  327 ? -12.708 151.688 23.303  1.00 3.39   ? 327 ILE B CG1 1 
ATOM   5790  C  CG2 . ILE B 2  327 ? -11.656 152.521 25.433  1.00 2.77   ? 327 ILE B CG2 1 
ATOM   5791  C  CD1 . ILE B 2  327 ? -11.420 151.801 22.521  1.00 3.67   ? 327 ILE B CD1 1 
ATOM   5792  N  N   . SER B 2  328 ? -14.217 153.185 27.609  1.00 11.69  ? 328 SER B N   1 
ATOM   5793  C  CA  . SER B 2  328 ? -14.005 154.129 28.716  1.00 16.15  ? 328 SER B CA  1 
ATOM   5794  C  C   . SER B 2  328 ? -13.129 153.452 29.768  1.00 20.48  ? 328 SER B C   1 
ATOM   5795  O  O   . SER B 2  328 ? -12.571 152.382 29.568  1.00 23.31  ? 328 SER B O   1 
ATOM   5796  C  CB  . SER B 2  328 ? -15.366 154.476 29.328  1.00 11.24  ? 328 SER B CB  1 
ATOM   5797  O  OG  . SER B 2  328 ? -16.002 153.287 29.782  1.00 9.22   ? 328 SER B OG  1 
ATOM   5798  N  N   . GLN B 2  329 ? -13.071 154.085 30.919  1.00 20.99  ? 329 GLN B N   1 
ATOM   5799  C  CA  . GLN B 2  329 ? -12.341 153.470 32.029  1.00 25.09  ? 329 GLN B CA  1 
ATOM   5800  C  C   . GLN B 2  329 ? -13.412 152.895 32.944  1.00 25.79  ? 329 GLN B C   1 
ATOM   5801  O  O   . GLN B 2  329 ? -14.594 153.212 32.743  1.00 23.21  ? 329 GLN B O   1 
ATOM   5802  C  CB  . GLN B 2  329 ? -11.478 154.587 32.633  1.00 40.95  ? 329 GLN B CB  1 
ATOM   5803  C  CG  . GLN B 2  329 ? -10.723 155.313 31.514  1.00 54.84  ? 329 GLN B CG  1 
ATOM   5804  C  CD  . GLN B 2  329 ? -9.699  156.306 31.998  1.00 65.94  ? 329 GLN B CD  1 
ATOM   5805  O  OE1 . GLN B 2  329 ? -9.667  156.640 33.182  1.00 75.20  ? 329 GLN B OE1 1 
ATOM   5806  N  NE2 . GLN B 2  329 ? -8.863  156.816 31.096  1.00 69.71  ? 329 GLN B NE2 1 
ATOM   5807  N  N   . ALA B 2  330 ? -13.040 152.014 33.846  1.00 26.67  ? 330 ALA B N   1 
ATOM   5808  C  CA  . ALA B 2  330 ? -13.874 151.424 34.860  1.00 21.38  ? 330 ALA B CA  1 
ATOM   5809  C  C   . ALA B 2  330 ? -14.986 152.363 35.320  1.00 18.01  ? 330 ALA B C   1 
ATOM   5810  O  O   . ALA B 2  330 ? -16.116 152.032 34.975  1.00 23.91  ? 330 ALA B O   1 
ATOM   5811  C  CB  . ALA B 2  330 ? -13.030 151.106 36.105  1.00 34.62  ? 330 ALA B CB  1 
ATOM   5812  N  N   . ALA B 2  331 ? -14.675 153.410 36.079  1.00 10.79  ? 331 ALA B N   1 
ATOM   5813  C  CA  . ALA B 2  331 ? -15.712 154.260 36.628  1.00 2.32   ? 331 ALA B CA  1 
ATOM   5814  C  C   . ALA B 2  331 ? -16.410 155.179 35.658  1.00 7.82   ? 331 ALA B C   1 
ATOM   5815  O  O   . ALA B 2  331 ? -17.466 155.710 35.995  1.00 5.15   ? 331 ALA B O   1 
ATOM   5816  C  CB  . ALA B 2  331 ? -15.207 155.014 37.841  1.00 16.43  ? 331 ALA B CB  1 
ATOM   5817  N  N   . SER B 2  332 ? -15.866 155.374 34.473  1.00 6.23   ? 332 SER B N   1 
ATOM   5818  C  CA  . SER B 2  332 ? -16.500 156.293 33.535  1.00 13.24  ? 332 SER B CA  1 
ATOM   5819  C  C   . SER B 2  332 ? -17.463 155.637 32.586  1.00 12.76  ? 332 SER B C   1 
ATOM   5820  O  O   . SER B 2  332 ? -18.448 156.229 32.131  1.00 12.89  ? 332 SER B O   1 
ATOM   5821  C  CB  . SER B 2  332 ? -15.393 157.102 32.863  1.00 20.85  ? 332 SER B CB  1 
ATOM   5822  O  OG  . SER B 2  332 ? -14.407 157.363 33.871  1.00 32.66  ? 332 SER B OG  1 
ATOM   5823  N  N   . ALA B 2  333 ? -17.257 154.352 32.371  1.00 11.64  ? 333 ALA B N   1 
ATOM   5824  C  CA  . ALA B 2  333 ? -18.167 153.533 31.595  1.00 10.72  ? 333 ALA B CA  1 
ATOM   5825  C  C   . ALA B 2  333 ? -19.530 154.167 31.368  1.00 12.84  ? 333 ALA B C   1 
ATOM   5826  O  O   . ALA B 2  333 ? -19.922 154.520 30.253  1.00 7.50   ? 333 ALA B O   1 
ATOM   5827  C  CB  . ALA B 2  333 ? -18.329 152.206 32.356  1.00 3.03   ? 333 ALA B CB  1 
ATOM   5828  N  N   . GLY B 2  334 ? -20.296 154.276 32.453  1.00 18.54  ? 334 GLY B N   1 
ATOM   5829  C  CA  . GLY B 2  334 ? -21.646 154.819 32.389  1.00 17.63  ? 334 GLY B CA  1 
ATOM   5830  C  C   . GLY B 2  334 ? -21.639 156.231 31.842  1.00 15.42  ? 334 GLY B C   1 
ATOM   5831  O  O   . GLY B 2  334 ? -22.292 156.571 30.863  1.00 12.36  ? 334 GLY B O   1 
ATOM   5832  N  N   . ASP B 2  335 ? -20.800 157.077 32.445  1.00 16.97  ? 335 ASP B N   1 
ATOM   5833  C  CA  . ASP B 2  335 ? -20.887 158.489 32.089  1.00 17.88  ? 335 ASP B CA  1 
ATOM   5834  C  C   . ASP B 2  335 ? -20.736 158.668 30.598  1.00 16.33  ? 335 ASP B C   1 
ATOM   5835  O  O   . ASP B 2  335 ? -21.567 159.358 30.003  1.00 19.43  ? 335 ASP B O   1 
ATOM   5836  C  CB  . ASP B 2  335 ? -20.021 159.357 32.960  1.00 22.76  ? 335 ASP B CB  1 
ATOM   5837  C  CG  . ASP B 2  335 ? -20.259 159.175 34.447  1.00 25.85  ? 335 ASP B CG  1 
ATOM   5838  O  OD1 . ASP B 2  335 ? -21.410 159.134 34.939  1.00 19.74  ? 335 ASP B OD1 1 
ATOM   5839  O  OD2 . ASP B 2  335 ? -19.262 159.064 35.200  1.00 33.46  ? 335 ASP B OD2 1 
ATOM   5840  N  N   . VAL B 2  336 ? -19.753 158.037 29.988  1.00 14.43  ? 336 VAL B N   1 
ATOM   5841  C  CA  . VAL B 2  336 ? -19.477 158.052 28.556  1.00 14.32  ? 336 VAL B CA  1 
ATOM   5842  C  C   . VAL B 2  336 ? -20.568 157.377 27.711  1.00 18.99  ? 336 VAL B C   1 
ATOM   5843  O  O   . VAL B 2  336 ? -21.069 157.929 26.717  1.00 17.58  ? 336 VAL B O   1 
ATOM   5844  C  CB  . VAL B 2  336 ? -18.161 157.310 28.258  1.00 2.20   ? 336 VAL B CB  1 
ATOM   5845  C  CG1 . VAL B 2  336 ? -17.633 157.452 26.849  1.00 2.20   ? 336 VAL B CG1 1 
ATOM   5846  C  CG2 . VAL B 2  336 ? -17.074 157.718 29.238  1.00 12.31  ? 336 VAL B CG2 1 
ATOM   5847  N  N   . ILE B 2  337 ? -20.963 156.154 28.082  1.00 18.08  ? 337 ILE B N   1 
ATOM   5848  C  CA  . ILE B 2  337 ? -22.121 155.495 27.519  1.00 13.03  ? 337 ILE B CA  1 
ATOM   5849  C  C   . ILE B 2  337 ? -23.389 156.334 27.486  1.00 14.58  ? 337 ILE B C   1 
ATOM   5850  O  O   . ILE B 2  337 ? -23.956 156.414 26.387  1.00 17.01  ? 337 ILE B O   1 
ATOM   5851  C  CB  . ILE B 2  337 ? -22.426 154.140 28.181  1.00 8.25   ? 337 ILE B CB  1 
ATOM   5852  C  CG1 . ILE B 2  337 ? -21.402 153.082 27.754  1.00 10.29  ? 337 ILE B CG1 1 
ATOM   5853  C  CG2 . ILE B 2  337 ? -23.829 153.677 27.786  1.00 8.80   ? 337 ILE B CG2 1 
ATOM   5854  C  CD1 . ILE B 2  337 ? -21.004 152.117 28.841  1.00 4.23   ? 337 ILE B CD1 1 
ATOM   5855  N  N   . LYS B 2  338 ? -23.879 156.941 28.569  1.00 14.94  ? 338 LYS B N   1 
ATOM   5856  C  CA  . LYS B 2  338 ? -25.104 157.738 28.533  1.00 14.15  ? 338 LYS B CA  1 
ATOM   5857  C  C   . LYS B 2  338 ? -24.876 159.072 27.835  1.00 14.36  ? 338 LYS B C   1 
ATOM   5858  O  O   . LYS B 2  338 ? -25.694 159.471 27.004  1.00 6.73   ? 338 LYS B O   1 
ATOM   5859  C  CB  . LYS B 2  338 ? -25.820 157.925 29.861  1.00 13.39  ? 338 LYS B CB  1 
ATOM   5860  C  CG  . LYS B 2  338 ? -25.405 157.027 30.996  1.00 20.72  ? 338 LYS B CG  1 
ATOM   5861  C  CD  . LYS B 2  338 ? -26.302 157.042 32.212  1.00 16.09  ? 338 LYS B CD  1 
ATOM   5862  C  CE  . LYS B 2  338 ? -26.066 155.815 33.081  1.00 19.37  ? 338 LYS B CE  1 
ATOM   5863  N  NZ  . LYS B 2  338 ? -27.198 155.478 33.990  1.00 21.17  ? 338 LYS B NZ  1 
ATOM   5864  N  N   . ALA B 2  339 ? -23.699 159.665 28.063  1.00 19.52  ? 339 ALA B N   1 
ATOM   5865  C  CA  . ALA B 2  339 ? -23.309 160.884 27.351  1.00 19.88  ? 339 ALA B CA  1 
ATOM   5866  C  C   . ALA B 2  339 ? -23.559 160.657 25.863  1.00 19.25  ? 339 ALA B C   1 
ATOM   5867  O  O   . ALA B 2  339 ? -24.370 161.346 25.256  1.00 23.33  ? 339 ALA B O   1 
ATOM   5868  C  CB  . ALA B 2  339 ? -21.849 161.244 27.542  1.00 13.69  ? 339 ALA B CB  1 
ATOM   5869  N  N   . ALA B 2  340 ? -22.899 159.656 25.289  1.00 16.00  ? 340 ALA B N   1 
ATOM   5870  C  CA  . ALA B 2  340 ? -23.142 159.416 23.865  1.00 13.51  ? 340 ALA B CA  1 
ATOM   5871  C  C   . ALA B 2  340 ? -24.606 159.172 23.571  1.00 14.64  ? 340 ALA B C   1 
ATOM   5872  O  O   . ALA B 2  340 ? -25.165 159.707 22.611  1.00 15.28  ? 340 ALA B O   1 
ATOM   5873  C  CB  . ALA B 2  340 ? -22.214 158.323 23.385  1.00 8.90   ? 340 ALA B CB  1 
ATOM   5874  N  N   . TYR B 2  341 ? -25.343 158.389 24.348  1.00 18.09  ? 341 TYR B N   1 
ATOM   5875  C  CA  . TYR B 2  341 ? -26.759 158.166 24.021  1.00 21.16  ? 341 TYR B CA  1 
ATOM   5876  C  C   . TYR B 2  341 ? -27.523 159.484 23.993  1.00 25.14  ? 341 TYR B C   1 
ATOM   5877  O  O   . TYR B 2  341 ? -28.138 159.855 22.999  1.00 22.12  ? 341 TYR B O   1 
ATOM   5878  C  CB  . TYR B 2  341 ? -27.349 157.254 25.075  1.00 25.28  ? 341 TYR B CB  1 
ATOM   5879  C  CG  . TYR B 2  341 ? -28.692 156.665 24.751  1.00 35.24  ? 341 TYR B CG  1 
ATOM   5880  C  CD1 . TYR B 2  341 ? -28.801 155.474 24.063  1.00 40.90  ? 341 TYR B CD1 1 
ATOM   5881  C  CD2 . TYR B 2  341 ? -29.869 157.273 25.144  1.00 42.54  ? 341 TYR B CD2 1 
ATOM   5882  C  CE1 . TYR B 2  341 ? -30.028 154.920 23.785  1.00 45.67  ? 341 TYR B CE1 1 
ATOM   5883  C  CE2 . TYR B 2  341 ? -31.104 156.724 24.863  1.00 42.88  ? 341 TYR B CE2 1 
ATOM   5884  C  CZ  . TYR B 2  341 ? -31.181 155.546 24.185  1.00 44.42  ? 341 TYR B CZ  1 
ATOM   5885  O  OH  . TYR B 2  341 ? -32.386 154.955 23.887  1.00 51.10  ? 341 TYR B OH  1 
ATOM   5886  N  N   . ASN B 2  342 ? -27.453 160.212 25.110  1.00 29.19  ? 342 ASN B N   1 
ATOM   5887  C  CA  . ASN B 2  342 ? -28.050 161.534 25.205  1.00 29.91  ? 342 ASN B CA  1 
ATOM   5888  C  C   . ASN B 2  342 ? -27.797 162.346 23.948  1.00 28.27  ? 342 ASN B C   1 
ATOM   5889  O  O   . ASN B 2  342 ? -28.726 162.891 23.354  1.00 29.50  ? 342 ASN B O   1 
ATOM   5890  C  CB  . ASN B 2  342 ? -27.540 162.288 26.440  1.00 35.81  ? 342 ASN B CB  1 
ATOM   5891  C  CG  . ASN B 2  342 ? -28.523 162.165 27.592  1.00 42.59  ? 342 ASN B CG  1 
ATOM   5892  O  OD1 . ASN B 2  342 ? -29.502 161.426 27.457  1.00 49.65  ? 342 ASN B OD1 1 
ATOM   5893  N  ND2 . ASN B 2  342 ? -28.301 162.839 28.706  1.00 43.76  ? 342 ASN B ND2 1 
ATOM   5894  N  N   . GLN B 2  343 ? -26.562 162.459 23.467  1.00 26.52  ? 343 GLN B N   1 
ATOM   5895  C  CA  . GLN B 2  343 ? -26.282 163.300 22.259  1.00 23.01  ? 343 GLN B CA  1 
ATOM   5896  C  C   . GLN B 2  343 ? -27.028 162.658 21.057  1.00 22.74  ? 343 GLN B C   1 
ATOM   5897  O  O   . GLN B 2  343 ? -27.329 163.398 20.121  1.00 30.53  ? 343 GLN B O   1 
ATOM   5898  C  CB  . GLN B 2  343 ? -24.791 163.204 21.859  1.00 17.15  ? 343 GLN B CB  1 
ATOM   5899  C  CG  . GLN B 2  343 ? -24.551 164.148 20.693  1.00 16.06  ? 343 GLN B CG  1 
ATOM   5900  C  CD  . GLN B 2  343 ? -24.494 165.598 21.140  1.00 28.75  ? 343 GLN B CD  1 
ATOM   5901  O  OE1 . GLN B 2  343 ? -24.827 166.002 22.260  1.00 33.56  ? 343 GLN B OE1 1 
ATOM   5902  N  NE2 . GLN B 2  343 ? -24.019 166.396 20.186  1.00 28.56  ? 343 GLN B NE2 1 
ATOM   5903  N  N   . VAL B 2  344 ? -27.162 161.341 20.935  1.00 20.18  ? 344 VAL B N   1 
ATOM   5904  C  CA  . VAL B 2  344 ? -27.804 160.831 19.718  1.00 17.43  ? 344 VAL B CA  1 
ATOM   5905  C  C   . VAL B 2  344 ? -29.308 161.059 19.849  1.00 18.58  ? 344 VAL B C   1 
ATOM   5906  O  O   . VAL B 2  344 ? -30.055 161.066 18.880  1.00 18.01  ? 344 VAL B O   1 
ATOM   5907  C  CB  . VAL B 2  344 ? -27.515 159.359 19.462  1.00 17.70  ? 344 VAL B CB  1 
ATOM   5908  C  CG1 . VAL B 2  344 ? -28.033 158.900 18.103  1.00 12.69  ? 344 VAL B CG1 1 
ATOM   5909  C  CG2 . VAL B 2  344 ? -26.014 159.085 19.562  1.00 19.71  ? 344 VAL B CG2 1 
ATOM   5910  N  N   . LYS B 2  345 ? -29.715 161.241 21.090  1.00 22.85  ? 345 LYS B N   1 
ATOM   5911  C  CA  . LYS B 2  345 ? -31.082 161.542 21.502  1.00 26.98  ? 345 LYS B CA  1 
ATOM   5912  C  C   . LYS B 2  345 ? -31.463 162.969 21.062  1.00 26.45  ? 345 LYS B C   1 
ATOM   5913  O  O   . LYS B 2  345 ? -32.534 163.191 20.496  1.00 20.69  ? 345 LYS B O   1 
ATOM   5914  C  CB  . LYS B 2  345 ? -31.252 161.378 23.008  1.00 26.60  ? 345 LYS B CB  1 
ATOM   5915  C  CG  . LYS B 2  345 ? -31.365 159.997 23.627  1.00 17.98  ? 345 LYS B CG  1 
ATOM   5916  C  CD  . LYS B 2  345 ? -32.598 159.846 24.489  1.00 18.04  ? 345 LYS B CD  1 
ATOM   5917  C  CE  . LYS B 2  345 ? -32.471 159.201 25.823  1.00 12.84  ? 345 LYS B CE  1 
ATOM   5918  N  NZ  . LYS B 2  345 ? -31.726 159.962 26.848  1.00 22.03  ? 345 LYS B NZ  1 
ATOM   5919  N  N   . THR B 2  346 ? -30.533 163.910 21.187  1.00 28.90  ? 346 THR B N   1 
ATOM   5920  C  CA  . THR B 2  346 ? -30.614 165.269 20.683  1.00 27.24  ? 346 THR B CA  1 
ATOM   5921  C  C   . THR B 2  346 ? -30.898 165.258 19.194  1.00 27.14  ? 346 THR B C   1 
ATOM   5922  O  O   . THR B 2  346 ? -31.773 165.947 18.669  1.00 31.02  ? 346 THR B O   1 
ATOM   5923  C  CB  . THR B 2  346 ? -29.312 166.059 20.931  1.00 25.39  ? 346 THR B CB  1 
ATOM   5924  O  OG1 . THR B 2  346 ? -29.275 166.582 22.259  1.00 31.30  ? 346 THR B OG1 1 
ATOM   5925  C  CG2 . THR B 2  346 ? -29.171 167.192 19.936  1.00 25.70  ? 346 THR B CG2 1 
ATOM   5926  N  N   . ILE B 2  347 ? -30.184 164.443 18.407  1.00 27.18  ? 347 ILE B N   1 
ATOM   5927  C  CA  . ILE B 2  347 ? -30.570 164.463 16.993  1.00 26.64  ? 347 ILE B CA  1 
ATOM   5928  C  C   . ILE B 2  347 ? -31.980 163.928 16.785  1.00 32.70  ? 347 ILE B C   1 
ATOM   5929  O  O   . ILE B 2  347 ? -32.715 164.515 15.986  1.00 33.79  ? 347 ILE B O   1 
ATOM   5930  C  CB  . ILE B 2  347 ? -29.605 163.707 16.093  1.00 12.17  ? 347 ILE B CB  1 
ATOM   5931  C  CG1 . ILE B 2  347 ? -28.311 164.520 15.922  1.00 9.33   ? 347 ILE B CG1 1 
ATOM   5932  C  CG2 . ILE B 2  347 ? -30.266 163.533 14.736  1.00 7.53   ? 347 ILE B CG2 1 
ATOM   5933  C  CD1 . ILE B 2  347 ? -27.494 163.898 14.806  1.00 3.01   ? 347 ILE B CD1 1 
ATOM   5934  N  N   . ALA B 2  348 ? -32.416 162.920 17.541  1.00 36.41  ? 348 ALA B N   1 
ATOM   5935  C  CA  . ALA B 2  348 ? -33.791 162.444 17.433  1.00 36.48  ? 348 ALA B CA  1 
ATOM   5936  C  C   . ALA B 2  348 ? -34.781 163.412 18.049  1.00 35.88  ? 348 ALA B C   1 
ATOM   5937  O  O   . ALA B 2  348 ? -35.988 163.345 17.780  1.00 40.23  ? 348 ALA B O   1 
ATOM   5938  C  CB  . ALA B 2  348 ? -33.947 161.051 18.008  1.00 42.06  ? 348 ALA B CB  1 
ATOM   5939  N  N   . GLN B 2  349 ? -34.363 164.382 18.862  1.00 30.88  ? 349 GLN B N   1 
ATOM   5940  C  CA  . GLN B 2  349 ? -35.359 165.329 19.365  1.00 27.06  ? 349 GLN B CA  1 
ATOM   5941  C  C   . GLN B 2  349 ? -35.533 166.459 18.353  1.00 28.73  ? 349 GLN B C   1 
ATOM   5942  O  O   . GLN B 2  349 ? -36.060 167.521 18.673  1.00 29.23  ? 349 GLN B O   1 
ATOM   5943  C  CB  . GLN B 2  349 ? -34.910 165.940 20.676  1.00 26.23  ? 349 GLN B CB  1 
ATOM   5944  C  CG  . GLN B 2  349 ? -35.450 165.237 21.914  1.00 38.82  ? 349 GLN B CG  1 
ATOM   5945  C  CD  . GLN B 2  349 ? -35.055 166.037 23.150  1.00 44.77  ? 349 GLN B CD  1 
ATOM   5946  O  OE1 . GLN B 2  349 ? -34.407 167.071 22.975  1.00 50.42  ? 349 GLN B OE1 1 
ATOM   5947  N  NE2 . GLN B 2  349 ? -35.429 165.576 24.330  1.00 47.58  ? 349 GLN B NE2 1 
ATOM   5948  N  N   . GLY B 2  350 ? -34.975 166.299 17.168  1.00 29.84  ? 350 GLY B N   1 
ATOM   5949  C  CA  . GLY B 2  350 ? -35.115 167.279 16.117  1.00 32.47  ? 350 GLY B CA  1 
ATOM   5950  C  C   . GLY B 2  350 ? -33.859 168.104 15.882  1.00 33.62  ? 350 GLY B C   1 
ATOM   5951  O  O   . GLY B 2  350 ? -33.597 168.511 14.745  1.00 30.45  ? 350 GLY B O   1 
ATOM   5952  N  N   . ASN B 2  351 ? -33.146 168.391 16.953  1.00 33.41  ? 351 ASN B N   1 
ATOM   5953  C  CA  . ASN B 2  351 ? -32.020 169.299 16.952  1.00 37.29  ? 351 ASN B CA  1 
ATOM   5954  C  C   . ASN B 2  351 ? -30.898 168.971 15.997  1.00 39.32  ? 351 ASN B C   1 
ATOM   5955  O  O   . ASN B 2  351 ? -29.959 168.273 16.383  1.00 44.40  ? 351 ASN B O   1 
ATOM   5956  C  CB  . ASN B 2  351 ? -31.495 169.340 18.400  1.00 38.16  ? 351 ASN B CB  1 
ATOM   5957  C  CG  . ASN B 2  351 ? -30.269 170.223 18.510  1.00 43.87  ? 351 ASN B CG  1 
ATOM   5958  O  OD1 . ASN B 2  351 ? -29.848 170.812 17.512  1.00 45.69  ? 351 ASN B OD1 1 
ATOM   5959  N  ND2 . ASN B 2  351 ? -29.722 170.296 19.714  1.00 44.53  ? 351 ASN B ND2 1 
ATOM   5960  N  N   . LEU B 2  352 ? -30.909 169.434 14.757  1.00 42.50  ? 352 LEU B N   1 
ATOM   5961  C  CA  . LEU B 2  352 ? -29.838 169.195 13.814  1.00 47.01  ? 352 LEU B CA  1 
ATOM   5962  C  C   . LEU B 2  352 ? -29.879 170.121 12.592  1.00 52.15  ? 352 LEU B C   1 
ATOM   5963  O  O   . LEU B 2  352 ? -30.588 169.854 11.615  1.00 52.14  ? 352 LEU B O   1 
ATOM   5964  C  CB  . LEU B 2  352 ? -29.663 167.765 13.317  1.00 40.26  ? 352 LEU B CB  1 
ATOM   5965  C  CG  . LEU B 2  352 ? -28.755 167.686 12.072  1.00 39.15  ? 352 LEU B CG  1 
ATOM   5966  C  CD1 . LEU B 2  352 ? -27.325 168.030 12.438  1.00 39.70  ? 352 LEU B CD1 1 
ATOM   5967  C  CD2 . LEU B 2  352 ? -28.872 166.334 11.410  1.00 38.14  ? 352 LEU B CD2 1 
ATOM   5968  N  N   . SER B 2  353 ? -28.926 171.055 12.581  1.00 54.01  ? 353 SER B N   1 
ATOM   5969  C  CA  . SER B 2  353 ? -28.871 172.095 11.568  1.00 55.43  ? 353 SER B CA  1 
ATOM   5970  C  C   . SER B 2  353 ? -28.082 171.678 10.334  1.00 53.78  ? 353 SER B C   1 
ATOM   5971  O  O   . SER B 2  353 ? -26.999 171.103 10.430  1.00 46.52  ? 353 SER B O   1 
ATOM   5972  C  CB  . SER B 2  353 ? -28.343 173.392 12.194  1.00 59.42  ? 353 SER B CB  1 
ATOM   5973  O  OG  . SER B 2  353 ? -29.350 174.007 12.992  1.00 63.31  ? 353 SER B OG  1 
ATOM   5974  N  N   . ASN B 2  354 ? -28.603 172.000 9.164   1.00 54.80  ? 354 ASN B N   1 
ATOM   5975  C  CA  . ASN B 2  354 ? -28.144 171.773 7.826   1.00 58.23  ? 354 ASN B CA  1 
ATOM   5976  C  C   . ASN B 2  354 ? -26.647 171.781 7.596   1.00 59.50  ? 354 ASN B C   1 
ATOM   5977  O  O   . ASN B 2  354 ? -26.086 170.869 6.965   1.00 56.98  ? 354 ASN B O   1 
ATOM   5978  C  CB  . ASN B 2  354 ? -28.820 172.719 6.839   1.00 65.49  ? 354 ASN B CB  1 
ATOM   5979  C  CG  . ASN B 2  354 ? -29.930 172.150 5.991   1.00 70.24  ? 354 ASN B CG  1 
ATOM   5980  O  OD1 . ASN B 2  354 ? -31.028 171.829 6.455   1.00 69.30  ? 354 ASN B OD1 1 
ATOM   5981  N  ND2 . ASN B 2  354 ? -29.707 172.044 4.678   1.00 72.76  ? 354 ASN B ND2 1 
ATOM   5982  N  N   . PRO B 2  355 ? -25.916 172.777 8.050   1.00 62.11  ? 355 PRO B N   1 
ATOM   5983  C  CA  . PRO B 2  355 ? -24.464 172.810 7.949   1.00 61.92  ? 355 PRO B CA  1 
ATOM   5984  C  C   . PRO B 2  355 ? -23.810 171.474 8.270   1.00 60.34  ? 355 PRO B C   1 
ATOM   5985  O  O   . PRO B 2  355 ? -22.869 171.069 7.576   1.00 60.61  ? 355 PRO B O   1 
ATOM   5986  C  CB  . PRO B 2  355 ? -23.959 173.929 8.881   1.00 62.73  ? 355 PRO B CB  1 
ATOM   5987  C  CG  . PRO B 2  355 ? -25.216 174.433 9.534   1.00 64.40  ? 355 PRO B CG  1 
ATOM   5988  C  CD  . PRO B 2  355 ? -26.425 173.950 8.767   1.00 63.87  ? 355 PRO B CD  1 
ATOM   5989  N  N   . ASP B 2  356 ? -24.250 170.730 9.278   1.00 59.04  ? 356 ASP B N   1 
ATOM   5990  C  CA  . ASP B 2  356 ? -23.649 169.492 9.705   1.00 57.92  ? 356 ASP B CA  1 
ATOM   5991  C  C   . ASP B 2  356 ? -23.991 168.264 8.889   1.00 57.21  ? 356 ASP B C   1 
ATOM   5992  O  O   . ASP B 2  356 ? -23.247 167.275 8.973   1.00 61.14  ? 356 ASP B O   1 
ATOM   5993  C  CB  . ASP B 2  356 ? -23.952 169.199 11.179  1.00 58.57  ? 356 ASP B CB  1 
ATOM   5994  C  CG  . ASP B 2  356 ? -23.605 170.388 12.055  1.00 61.36  ? 356 ASP B CG  1 
ATOM   5995  O  OD1 . ASP B 2  356 ? -22.757 171.209 11.624  1.00 58.94  ? 356 ASP B OD1 1 
ATOM   5996  O  OD2 . ASP B 2  356 ? -24.181 170.519 13.157  1.00 58.93  ? 356 ASP B OD2 1 
ATOM   5997  N  N   . VAL B 2  357 ? -25.090 168.292 8.152   1.00 53.02  ? 357 VAL B N   1 
ATOM   5998  C  CA  . VAL B 2  357 ? -25.437 167.137 7.323   1.00 51.50  ? 357 VAL B CA  1 
ATOM   5999  C  C   . VAL B 2  357 ? -24.675 167.181 6.004   1.00 52.07  ? 357 VAL B C   1 
ATOM   6000  O  O   . VAL B 2  357 ? -24.421 166.176 5.344   1.00 48.14  ? 357 VAL B O   1 
ATOM   6001  C  CB  . VAL B 2  357 ? -26.944 167.047 7.037   1.00 49.61  ? 357 VAL B CB  1 
ATOM   6002  C  CG1 . VAL B 2  357 ? -27.200 166.251 5.761   1.00 47.62  ? 357 VAL B CG1 1 
ATOM   6003  C  CG2 . VAL B 2  357 ? -27.716 166.423 8.189   1.00 44.36  ? 357 VAL B CG2 1 
ATOM   6004  N  N   . GLN B 2  358 ? -24.349 168.399 5.554   1.00 55.65  ? 358 GLN B N   1 
ATOM   6005  C  CA  . GLN B 2  358 ? -23.661 168.485 4.259   1.00 57.99  ? 358 GLN B CA  1 
ATOM   6006  C  C   . GLN B 2  358 ? -22.218 168.031 4.480   1.00 58.22  ? 358 GLN B C   1 
ATOM   6007  O  O   . GLN B 2  358 ? -21.649 167.318 3.667   1.00 59.13  ? 358 GLN B O   1 
ATOM   6008  C  CB  . GLN B 2  358 ? -23.673 169.900 3.691   1.00 60.13  ? 358 GLN B CB  1 
ATOM   6009  C  CG  . GLN B 2  358 ? -23.081 169.971 2.289   1.00 61.12  ? 358 GLN B CG  1 
ATOM   6010  C  CD  . GLN B 2  358 ? -24.031 169.402 1.249   1.00 62.87  ? 358 GLN B CD  1 
ATOM   6011  O  OE1 . GLN B 2  358 ? -25.112 168.907 1.571   1.00 58.56  ? 358 GLN B OE1 1 
ATOM   6012  N  NE2 . GLN B 2  358 ? -23.624 169.497 -0.012  1.00 67.88  ? 358 GLN B NE2 1 
ATOM   6013  N  N   . ALA B 2  359 ? -21.682 168.478 5.617   1.00 56.84  ? 359 ALA B N   1 
ATOM   6014  C  CA  . ALA B 2  359 ? -20.305 168.108 5.958   1.00 56.50  ? 359 ALA B CA  1 
ATOM   6015  C  C   . ALA B 2  359 ? -20.196 166.576 5.967   1.00 55.84  ? 359 ALA B C   1 
ATOM   6016  O  O   . ALA B 2  359 ? -19.405 165.989 5.222   1.00 53.35  ? 359 ALA B O   1 
ATOM   6017  C  CB  . ALA B 2  359 ? -19.956 168.697 7.313   1.00 58.80  ? 359 ALA B CB  1 
ATOM   6018  N  N   . ALA B 2  360 ? -21.088 165.978 6.755   1.00 52.27  ? 360 ALA B N   1 
ATOM   6019  C  CA  . ALA B 2  360 ? -21.261 164.553 6.943   1.00 45.14  ? 360 ALA B CA  1 
ATOM   6020  C  C   . ALA B 2  360 ? -21.245 163.812 5.610   1.00 43.16  ? 360 ALA B C   1 
ATOM   6021  O  O   . ALA B 2  360 ? -20.460 162.906 5.372   1.00 46.73  ? 360 ALA B O   1 
ATOM   6022  C  CB  . ALA B 2  360 ? -22.581 164.239 7.633   1.00 31.75  ? 360 ALA B CB  1 
ATOM   6023  N  N   . LYS B 2  361 ? -22.144 164.230 4.744   1.00 42.66  ? 361 LYS B N   1 
ATOM   6024  C  CA  . LYS B 2  361 ? -22.297 163.687 3.403   1.00 43.56  ? 361 LYS B CA  1 
ATOM   6025  C  C   . LYS B 2  361 ? -20.982 163.712 2.621   1.00 41.74  ? 361 LYS B C   1 
ATOM   6026  O  O   . LYS B 2  361 ? -20.486 162.713 2.111   1.00 39.01  ? 361 LYS B O   1 
ATOM   6027  C  CB  . LYS B 2  361 ? -23.336 164.519 2.638   1.00 42.66  ? 361 LYS B CB  1 
ATOM   6028  C  CG  . LYS B 2  361 ? -24.788 164.377 3.054   1.00 36.54  ? 361 LYS B CG  1 
ATOM   6029  C  CD  . LYS B 2  361 ? -25.711 164.462 1.855   1.00 33.71  ? 361 LYS B CD  1 
ATOM   6030  C  CE  . LYS B 2  361 ? -27.148 164.769 2.176   1.00 38.73  ? 361 LYS B CE  1 
ATOM   6031  N  NZ  . LYS B 2  361 ? -27.538 166.194 1.995   1.00 37.89  ? 361 LYS B NZ  1 
ATOM   6032  N  N   . ASN B 2  362 ? -20.399 164.900 2.500   1.00 41.22  ? 362 ASN B N   1 
ATOM   6033  C  CA  . ASN B 2  362 ? -19.111 165.053 1.822   1.00 41.44  ? 362 ASN B CA  1 
ATOM   6034  C  C   . ASN B 2  362 ? -18.105 164.117 2.484   1.00 39.50  ? 362 ASN B C   1 
ATOM   6035  O  O   . ASN B 2  362 ? -17.286 163.491 1.815   1.00 35.50  ? 362 ASN B O   1 
ATOM   6036  C  CB  . ASN B 2  362 ? -18.633 166.506 1.877   1.00 47.75  ? 362 ASN B CB  1 
ATOM   6037  C  CG  . ASN B 2  362 ? -19.306 167.359 0.813   1.00 47.37  ? 362 ASN B CG  1 
ATOM   6038  O  OD1 . ASN B 2  362 ? -19.518 166.876 -0.299  1.00 46.01  ? 362 ASN B OD1 1 
ATOM   6039  N  ND2 . ASN B 2  362 ? -19.643 168.593 1.159   1.00 44.45  ? 362 ASN B ND2 1 
ATOM   6040  N  N   . LYS B 2  363 ? -18.212 164.026 3.819   1.00 38.84  ? 363 LYS B N   1 
ATOM   6041  C  CA  . LYS B 2  363 ? -17.328 163.114 4.547   1.00 38.55  ? 363 LYS B CA  1 
ATOM   6042  C  C   . LYS B 2  363 ? -17.518 161.706 3.977   1.00 35.97  ? 363 LYS B C   1 
ATOM   6043  O  O   . LYS B 2  363 ? -16.589 161.166 3.373   1.00 37.69  ? 363 LYS B O   1 
ATOM   6044  C  CB  . LYS B 2  363 ? -17.490 163.136 6.060   1.00 32.82  ? 363 LYS B CB  1 
ATOM   6045  C  CG  . LYS B 2  363 ? -16.395 163.903 6.791   1.00 29.83  ? 363 LYS B CG  1 
ATOM   6046  C  CD  . LYS B 2  363 ? -16.438 163.855 8.283   1.00 29.40  ? 363 LYS B CD  1 
ATOM   6047  C  CE  . LYS B 2  363 ? -17.013 165.073 8.984   1.00 27.87  ? 363 LYS B CE  1 
ATOM   6048  N  NZ  . LYS B 2  363 ? -17.418 164.690 10.380  1.00 33.46  ? 363 LYS B NZ  1 
ATOM   6049  N  N   . LEU B 2  364 ? -18.760 161.227 4.003   1.00 32.72  ? 364 LEU B N   1 
ATOM   6050  C  CA  . LEU B 2  364 ? -19.109 159.931 3.456   1.00 28.91  ? 364 LEU B CA  1 
ATOM   6051  C  C   . LEU B 2  364 ? -18.594 159.712 2.038   1.00 30.10  ? 364 LEU B C   1 
ATOM   6052  O  O   . LEU B 2  364 ? -17.833 158.769 1.835   1.00 28.95  ? 364 LEU B O   1 
ATOM   6053  C  CB  . LEU B 2  364 ? -20.608 159.660 3.536   1.00 14.35  ? 364 LEU B CB  1 
ATOM   6054  C  CG  . LEU B 2  364 ? -21.118 158.285 3.127   1.00 11.92  ? 364 LEU B CG  1 
ATOM   6055  C  CD1 . LEU B 2  364 ? -20.278 157.115 3.595   1.00 6.78   ? 364 LEU B CD1 1 
ATOM   6056  C  CD2 . LEU B 2  364 ? -22.538 158.069 3.621   1.00 3.87   ? 364 LEU B CD2 1 
ATOM   6057  N  N   . LYS B 2  365 ? -18.996 160.575 1.110   1.00 31.95  ? 365 LYS B N   1 
ATOM   6058  C  CA  . LYS B 2  365 ? -18.658 160.517 -0.289  1.00 25.73  ? 365 LYS B CA  1 
ATOM   6059  C  C   . LYS B 2  365 ? -17.148 160.457 -0.531  1.00 19.49  ? 365 LYS B C   1 
ATOM   6060  O  O   . LYS B 2  365 ? -16.720 159.750 -1.438  1.00 15.37  ? 365 LYS B O   1 
ATOM   6061  C  CB  . LYS B 2  365 ? -19.211 161.612 -1.178  1.00 32.71  ? 365 LYS B CB  1 
ATOM   6062  C  CG  . LYS B 2  365 ? -20.440 162.371 -0.769  1.00 42.87  ? 365 LYS B CG  1 
ATOM   6063  C  CD  . LYS B 2  365 ? -20.374 163.843 -1.159  1.00 50.31  ? 365 LYS B CD  1 
ATOM   6064  C  CE  . LYS B 2  365 ? -21.388 164.216 -2.226  1.00 46.43  ? 365 LYS B CE  1 
ATOM   6065  N  NZ  . LYS B 2  365 ? -21.783 165.650 -2.202  1.00 35.62  ? 365 LYS B NZ  1 
ATOM   6066  N  N   . ALA B 2  366 ? -16.429 161.271 0.228   1.00 17.09  ? 366 ALA B N   1 
ATOM   6067  C  CA  . ALA B 2  366 ? -14.965 161.247 0.133   1.00 19.23  ? 366 ALA B CA  1 
ATOM   6068  C  C   . ALA B 2  366 ? -14.471 159.857 0.546   1.00 18.64  ? 366 ALA B C   1 
ATOM   6069  O  O   . ALA B 2  366 ? -13.724 159.223 -0.194  1.00 16.79  ? 366 ALA B O   1 
ATOM   6070  C  CB  . ALA B 2  366 ? -14.384 162.323 1.018   1.00 21.85  ? 366 ALA B CB  1 
ATOM   6071  N  N   . GLY B 2  367 ? -15.008 159.322 1.631   1.00 16.72  ? 367 GLY B N   1 
ATOM   6072  C  CA  . GLY B 2  367 ? -14.746 157.997 2.135   1.00 16.88  ? 367 GLY B CA  1 
ATOM   6073  C  C   . GLY B 2  367 ? -14.963 156.888 1.125   1.00 18.25  ? 367 GLY B C   1 
ATOM   6074  O  O   . GLY B 2  367 ? -14.078 156.095 0.789   1.00 17.02  ? 367 GLY B O   1 
ATOM   6075  N  N   . TYR B 2  368 ? -16.165 156.756 0.589   1.00 20.18  ? 368 TYR B N   1 
ATOM   6076  C  CA  . TYR B 2  368 ? -16.464 155.752 -0.419  1.00 21.76  ? 368 TYR B CA  1 
ATOM   6077  C  C   . TYR B 2  368 ? -15.532 155.842 -1.614  1.00 23.55  ? 368 TYR B C   1 
ATOM   6078  O  O   . TYR B 2  368 ? -15.197 154.829 -2.248  1.00 25.90  ? 368 TYR B O   1 
ATOM   6079  C  CB  . TYR B 2  368 ? -17.910 155.868 -0.905  1.00 16.31  ? 368 TYR B CB  1 
ATOM   6080  C  CG  . TYR B 2  368 ? -18.305 154.901 -1.989  1.00 12.76  ? 368 TYR B CG  1 
ATOM   6081  C  CD1 . TYR B 2  368 ? -18.726 153.616 -1.694  1.00 9.47   ? 368 TYR B CD1 1 
ATOM   6082  C  CD2 . TYR B 2  368 ? -18.312 155.263 -3.328  1.00 17.01  ? 368 TYR B CD2 1 
ATOM   6083  C  CE1 . TYR B 2  368 ? -19.134 152.752 -2.684  1.00 11.49  ? 368 TYR B CE1 1 
ATOM   6084  C  CE2 . TYR B 2  368 ? -18.708 154.408 -4.335  1.00 11.96  ? 368 TYR B CE2 1 
ATOM   6085  C  CZ  . TYR B 2  368 ? -19.114 153.139 -3.999  1.00 16.74  ? 368 TYR B CZ  1 
ATOM   6086  O  OH  . TYR B 2  368 ? -19.493 152.249 -4.979  1.00 24.57  ? 368 TYR B OH  1 
ATOM   6087  N  N   . LEU B 2  369 ? -15.134 157.052 -2.020  1.00 24.18  ? 369 LEU B N   1 
ATOM   6088  C  CA  . LEU B 2  369 ? -14.300 157.027 -3.249  1.00 26.46  ? 369 LEU B CA  1 
ATOM   6089  C  C   . LEU B 2  369 ? -12.952 156.433 -2.907  1.00 23.03  ? 369 LEU B C   1 
ATOM   6090  O  O   . LEU B 2  369 ? -12.464 155.496 -3.546  1.00 23.54  ? 369 LEU B O   1 
ATOM   6091  C  CB  . LEU B 2  369 ? -14.327 158.391 -3.922  1.00 28.51  ? 369 LEU B CB  1 
ATOM   6092  C  CG  . LEU B 2  369 ? -15.758 158.809 -4.342  1.00 23.31  ? 369 LEU B CG  1 
ATOM   6093  C  CD1 . LEU B 2  369 ? -15.832 160.274 -4.686  1.00 10.18  ? 369 LEU B CD1 1 
ATOM   6094  C  CD2 . LEU B 2  369 ? -16.209 157.876 -5.457  1.00 19.30  ? 369 LEU B CD2 1 
ATOM   6095  N  N   . MET B 2  370 ? -12.379 156.906 -1.804  1.00 18.39  ? 370 MET B N   1 
ATOM   6096  C  CA  . MET B 2  370 ? -11.094 156.431 -1.310  1.00 14.05  ? 370 MET B CA  1 
ATOM   6097  C  C   . MET B 2  370 ? -11.136 154.929 -1.085  1.00 16.34  ? 370 MET B C   1 
ATOM   6098  O  O   . MET B 2  370 ? -10.141 154.251 -1.308  1.00 22.68  ? 370 MET B O   1 
ATOM   6099  C  CB  . MET B 2  370 ? -10.751 157.102 0.023   1.00 5.49   ? 370 MET B CB  1 
ATOM   6100  C  CG  . MET B 2  370 ? -10.935 158.593 -0.034  1.00 9.32   ? 370 MET B CG  1 
ATOM   6101  S  SD  . MET B 2  370 ? -10.043 159.512 1.201   1.00 11.92  ? 370 MET B SD  1 
ATOM   6102  C  CE  . MET B 2  370 ? -11.381 160.125 2.239   1.00 19.24  ? 370 MET B CE  1 
ATOM   6103  N  N   . SER B 2  371 ? -12.278 154.428 -0.626  1.00 16.14  ? 371 SER B N   1 
ATOM   6104  C  CA  . SER B 2  371 ? -12.502 153.007 -0.435  1.00 11.32  ? 371 SER B CA  1 
ATOM   6105  C  C   . SER B 2  371 ? -12.275 152.254 -1.741  1.00 13.39  ? 371 SER B C   1 
ATOM   6106  O  O   . SER B 2  371 ? -11.786 151.135 -1.734  1.00 14.93  ? 371 SER B O   1 
ATOM   6107  C  CB  . SER B 2  371 ? -13.944 152.736 -0.002  1.00 13.58  ? 371 SER B CB  1 
ATOM   6108  O  OG  . SER B 2  371 ? -14.507 153.855 0.659   1.00 19.70  ? 371 SER B OG  1 
ATOM   6109  N  N   . VAL B 2  372 ? -12.703 152.891 -2.826  1.00 13.30  ? 372 VAL B N   1 
ATOM   6110  C  CA  . VAL B 2  372 ? -12.565 152.322 -4.144  1.00 14.68  ? 372 VAL B CA  1 
ATOM   6111  C  C   . VAL B 2  372 ? -11.321 152.705 -4.921  1.00 18.47  ? 372 VAL B C   1 
ATOM   6112  O  O   . VAL B 2  372 ? -11.004 152.046 -5.934  1.00 19.20  ? 372 VAL B O   1 
ATOM   6113  C  CB  . VAL B 2  372 ? -13.837 152.675 -4.943  1.00 11.50  ? 372 VAL B CB  1 
ATOM   6114  C  CG1 . VAL B 2  372 ? -13.819 151.870 -6.230  1.00 17.10  ? 372 VAL B CG1 1 
ATOM   6115  C  CG2 . VAL B 2  372 ? -15.047 152.300 -4.118  1.00 7.18   ? 372 VAL B CG2 1 
ATOM   6116  N  N   . GLU B 2  373 ? -10.497 153.639 -4.451  1.00 17.52  ? 373 GLU B N   1 
ATOM   6117  C  CA  . GLU B 2  373 ? -9.307  154.068 -5.159  1.00 24.30  ? 373 GLU B CA  1 
ATOM   6118  C  C   . GLU B 2  373 ? -8.202  153.032 -5.259  1.00 27.11  ? 373 GLU B C   1 
ATOM   6119  O  O   . GLU B 2  373 ? -7.105  153.401 -5.685  1.00 30.33  ? 373 GLU B O   1 
ATOM   6120  C  CB  . GLU B 2  373 ? -8.725  155.353 -4.581  1.00 29.84  ? 373 GLU B CB  1 
ATOM   6121  C  CG  . GLU B 2  373 ? -7.735  155.285 -3.443  1.00 31.63  ? 373 GLU B CG  1 
ATOM   6122  C  CD  . GLU B 2  373 ? -7.272  156.649 -2.972  1.00 35.53  ? 373 GLU B CD  1 
ATOM   6123  O  OE1 . GLU B 2  373 ? -7.656  157.658 -3.594  1.00 43.28  ? 373 GLU B OE1 1 
ATOM   6124  O  OE2 . GLU B 2  373 ? -6.519  156.767 -1.988  1.00 38.34  ? 373 GLU B OE2 1 
ATOM   6125  N  N   . SER B 2  374 ? -8.435  151.802 -4.871  1.00 30.77  ? 374 SER B N   1 
ATOM   6126  C  CA  . SER B 2  374 ? -7.451  150.741 -4.784  1.00 34.50  ? 374 SER B CA  1 
ATOM   6127  C  C   . SER B 2  374 ? -7.941  149.479 -5.481  1.00 37.75  ? 374 SER B C   1 
ATOM   6128  O  O   . SER B 2  374 ? -9.143  149.188 -5.431  1.00 37.99  ? 374 SER B O   1 
ATOM   6129  C  CB  . SER B 2  374 ? -7.238  150.394 -3.297  1.00 38.85  ? 374 SER B CB  1 
ATOM   6130  O  OG  . SER B 2  374 ? -8.030  149.270 -2.932  1.00 45.39  ? 374 SER B OG  1 
ATOM   6131  N  N   . SER B 2  375 ? -7.015  148.723 -6.080  1.00 37.56  ? 375 SER B N   1 
ATOM   6132  C  CA  . SER B 2  375 ? -7.469  147.507 -6.756  1.00 36.59  ? 375 SER B CA  1 
ATOM   6133  C  C   . SER B 2  375 ? -8.290  146.669 -5.773  1.00 33.96  ? 375 SER B C   1 
ATOM   6134  O  O   . SER B 2  375 ? -9.465  146.420 -6.032  1.00 32.75  ? 375 SER B O   1 
ATOM   6135  C  CB  . SER B 2  375 ? -6.298  146.660 -7.235  1.00 46.34  ? 375 SER B CB  1 
ATOM   6136  O  OG  . SER B 2  375 ? -5.952  145.733 -6.211  1.00 59.52  ? 375 SER B OG  1 
ATOM   6137  N  N   . GLU B 2  376 ? -7.654  146.318 -4.657  1.00 31.94  ? 376 GLU B N   1 
ATOM   6138  C  CA  . GLU B 2  376 ? -8.274  145.456 -3.664  1.00 30.18  ? 376 GLU B CA  1 
ATOM   6139  C  C   . GLU B 2  376 ? -9.576  146.027 -3.135  1.00 25.76  ? 376 GLU B C   1 
ATOM   6140  O  O   . GLU B 2  376 ? -10.582 145.342 -2.984  1.00 25.95  ? 376 GLU B O   1 
ATOM   6141  C  CB  . GLU B 2  376 ? -7.325  145.092 -2.535  1.00 33.79  ? 376 GLU B CB  1 
ATOM   6142  C  CG  . GLU B 2  376 ? -7.947  144.100 -1.566  1.00 47.78  ? 376 GLU B CG  1 
ATOM   6143  C  CD  . GLU B 2  376 ? -7.306  144.123 -0.195  1.00 57.23  ? 376 GLU B CD  1 
ATOM   6144  O  OE1 . GLU B 2  376 ? -6.399  144.948 0.059   1.00 56.93  ? 376 GLU B OE1 1 
ATOM   6145  O  OE2 . GLU B 2  376 ? -7.719  143.290 0.645   1.00 62.42  ? 376 GLU B OE2 1 
ATOM   6146  N  N   . GLY B 2  377 ? -9.640  147.333 -2.931  1.00 22.02  ? 377 GLY B N   1 
ATOM   6147  C  CA  . GLY B 2  377 ? -10.932 147.934 -2.590  1.00 21.08  ? 377 GLY B CA  1 
ATOM   6148  C  C   . GLY B 2  377 ? -11.892 147.722 -3.759  1.00 20.30  ? 377 GLY B C   1 
ATOM   6149  O  O   . GLY B 2  377 ? -12.854 146.970 -3.647  1.00 23.00  ? 377 GLY B O   1 
ATOM   6150  N  N   . PHE B 2  378 ? -11.557 148.212 -4.943  1.00 21.65  ? 378 PHE B N   1 
ATOM   6151  C  CA  . PHE B 2  378 ? -12.411 148.140 -6.113  1.00 15.86  ? 378 PHE B CA  1 
ATOM   6152  C  C   . PHE B 2  378 ? -12.995 146.756 -6.330  1.00 11.94  ? 378 PHE B C   1 
ATOM   6153  O  O   . PHE B 2  378 ? -14.191 146.631 -6.557  1.00 4.09   ? 378 PHE B O   1 
ATOM   6154  C  CB  . PHE B 2  378 ? -11.638 148.518 -7.384  1.00 22.30  ? 378 PHE B CB  1 
ATOM   6155  C  CG  . PHE B 2  378 ? -12.535 148.646 -8.586  1.00 18.34  ? 378 PHE B CG  1 
ATOM   6156  C  CD1 . PHE B 2  378 ? -13.156 149.847 -8.855  1.00 19.88  ? 378 PHE B CD1 1 
ATOM   6157  C  CD2 . PHE B 2  378 ? -12.753 147.583 -9.436  1.00 14.62  ? 378 PHE B CD2 1 
ATOM   6158  C  CE1 . PHE B 2  378 ? -13.984 150.000 -9.948  1.00 19.26  ? 378 PHE B CE1 1 
ATOM   6159  C  CE2 . PHE B 2  378 ? -13.583 147.729 -10.521 1.00 11.95  ? 378 PHE B CE2 1 
ATOM   6160  C  CZ  . PHE B 2  378 ? -14.191 148.934 -10.798 1.00 13.94  ? 378 PHE B CZ  1 
ATOM   6161  N  N   . LEU B 2  379 ? -12.134 145.740 -6.310  1.00 9.96   ? 379 LEU B N   1 
ATOM   6162  C  CA  . LEU B 2  379 ? -12.568 144.371 -6.476  1.00 11.33  ? 379 LEU B CA  1 
ATOM   6163  C  C   . LEU B 2  379 ? -13.566 143.926 -5.407  1.00 15.28  ? 379 LEU B C   1 
ATOM   6164  O  O   . LEU B 2  379 ? -14.293 142.945 -5.581  1.00 13.37  ? 379 LEU B O   1 
ATOM   6165  C  CB  . LEU B 2  379 ? -11.423 143.351 -6.422  1.00 2.93   ? 379 LEU B CB  1 
ATOM   6166  C  CG  . LEU B 2  379 ? -11.886 141.948 -6.850  1.00 7.88   ? 379 LEU B CG  1 
ATOM   6167  C  CD1 . LEU B 2  379 ? -11.807 141.848 -8.373  1.00 14.58  ? 379 LEU B CD1 1 
ATOM   6168  C  CD2 . LEU B 2  379 ? -11.098 140.828 -6.217  1.00 4.73   ? 379 LEU B CD2 1 
ATOM   6169  N  N   . ASP B 2  380 ? -13.318 144.381 -4.173  1.00 20.08  ? 380 ASP B N   1 
ATOM   6170  C  CA  . ASP B 2  380 ? -14.298 144.065 -3.138  1.00 24.03  ? 380 ASP B CA  1 
ATOM   6171  C  C   . ASP B 2  380 ? -15.597 144.760 -3.525  1.00 24.21  ? 380 ASP B C   1 
ATOM   6172  O  O   . ASP B 2  380 ? -16.610 144.103 -3.769  1.00 27.25  ? 380 ASP B O   1 
ATOM   6173  C  CB  . ASP B 2  380 ? -13.829 144.441 -1.747  1.00 34.31  ? 380 ASP B CB  1 
ATOM   6174  C  CG  . ASP B 2  380 ? -14.691 143.854 -0.647  1.00 47.00  ? 380 ASP B CG  1 
ATOM   6175  O  OD1 . ASP B 2  380 ? -15.794 143.348 -0.956  1.00 53.75  ? 380 ASP B OD1 1 
ATOM   6176  O  OD2 . ASP B 2  380 ? -14.298 143.901 0.536   1.00 55.97  ? 380 ASP B OD2 1 
ATOM   6177  N  N   . GLU B 2  381 ? -15.540 146.083 -3.721  1.00 22.77  ? 381 GLU B N   1 
ATOM   6178  C  CA  . GLU B 2  381 ? -16.738 146.828 -3.989  1.00 19.25  ? 381 GLU B CA  1 
ATOM   6179  C  C   . GLU B 2  381 ? -17.645 146.240 -5.069  1.00 19.24  ? 381 GLU B C   1 
ATOM   6180  O  O   . GLU B 2  381 ? -18.854 146.328 -4.863  1.00 19.69  ? 381 GLU B O   1 
ATOM   6181  C  CB  . GLU B 2  381 ? -16.579 148.304 -4.301  1.00 13.56  ? 381 GLU B CB  1 
ATOM   6182  C  CG  . GLU B 2  381 ? -17.958 148.963 -4.217  1.00 14.17  ? 381 GLU B CG  1 
ATOM   6183  C  CD  . GLU B 2  381 ? -18.489 149.033 -2.811  1.00 15.35  ? 381 GLU B CD  1 
ATOM   6184  O  OE1 . GLU B 2  381 ? -17.934 148.445 -1.875  1.00 14.08  ? 381 GLU B OE1 1 
ATOM   6185  O  OE2 . GLU B 2  381 ? -19.517 149.713 -2.606  1.00 29.68  ? 381 GLU B OE2 1 
ATOM   6186  N  N   . VAL B 2  382 ? -17.020 145.801 -6.135  1.00 14.95  ? 382 VAL B N   1 
ATOM   6187  C  CA  . VAL B 2  382 ? -17.644 145.200 -7.277  1.00 13.06  ? 382 VAL B CA  1 
ATOM   6188  C  C   . VAL B 2  382 ? -18.234 143.845 -6.950  1.00 12.29  ? 382 VAL B C   1 
ATOM   6189  O  O   . VAL B 2  382 ? -19.351 143.524 -7.340  1.00 19.35  ? 382 VAL B O   1 
ATOM   6190  C  CB  . VAL B 2  382 ? -16.596 145.015 -8.398  1.00 15.26  ? 382 VAL B CB  1 
ATOM   6191  C  CG1 . VAL B 2  382 ? -17.220 144.309 -9.597  1.00 18.02  ? 382 VAL B CG1 1 
ATOM   6192  C  CG2 . VAL B 2  382 ? -16.016 146.376 -8.732  1.00 12.16  ? 382 VAL B CG2 1 
ATOM   6193  N  N   . GLY B 2  383 ? -17.481 142.987 -6.300  1.00 16.25  ? 383 GLY B N   1 
ATOM   6194  C  CA  . GLY B 2  383 ? -17.921 141.626 -5.969  1.00 14.20  ? 383 GLY B CA  1 
ATOM   6195  C  C   . GLY B 2  383 ? -19.121 141.663 -5.027  1.00 11.13  ? 383 GLY B C   1 
ATOM   6196  O  O   . GLY B 2  383 ? -20.114 141.008 -5.277  1.00 10.89  ? 383 GLY B O   1 
ATOM   6197  N  N   . SER B 2  384 ? -19.051 142.537 -4.048  1.00 14.98  ? 384 SER B N   1 
ATOM   6198  C  CA  . SER B 2  384 ? -20.103 142.809 -3.099  1.00 20.34  ? 384 SER B CA  1 
ATOM   6199  C  C   . SER B 2  384 ? -21.379 143.227 -3.811  1.00 22.60  ? 384 SER B C   1 
ATOM   6200  O  O   . SER B 2  384 ? -22.439 142.624 -3.596  1.00 30.07  ? 384 SER B O   1 
ATOM   6201  C  CB  . SER B 2  384 ? -19.671 143.910 -2.122  1.00 22.45  ? 384 SER B CB  1 
ATOM   6202  O  OG  . SER B 2  384 ? -18.582 143.503 -1.317  1.00 28.42  ? 384 SER B OG  1 
ATOM   6203  N  N   . GLN B 2  385 ? -21.308 144.224 -4.694  1.00 19.92  ? 385 GLN B N   1 
ATOM   6204  C  CA  . GLN B 2  385 ? -22.554 144.611 -5.370  1.00 15.72  ? 385 GLN B CA  1 
ATOM   6205  C  C   . GLN B 2  385 ? -23.084 143.374 -6.073  1.00 15.75  ? 385 GLN B C   1 
ATOM   6206  O  O   . GLN B 2  385 ? -24.204 142.926 -5.866  1.00 11.15  ? 385 GLN B O   1 
ATOM   6207  C  CB  . GLN B 2  385 ? -22.326 145.718 -6.390  1.00 14.58  ? 385 GLN B CB  1 
ATOM   6208  C  CG  . GLN B 2  385 ? -21.792 146.983 -5.726  1.00 23.00  ? 385 GLN B CG  1 
ATOM   6209  C  CD  . GLN B 2  385 ? -22.088 148.196 -6.578  1.00 23.62  ? 385 GLN B CD  1 
ATOM   6210  O  OE1 . GLN B 2  385 ? -22.738 148.002 -7.603  1.00 29.46  ? 385 GLN B OE1 1 
ATOM   6211  N  NE2 . GLN B 2  385 ? -21.616 149.338 -6.119  1.00 28.31  ? 385 GLN B NE2 1 
ATOM   6212  N  N   . ALA B 2  386 ? -22.197 142.723 -6.811  1.00 17.80  ? 386 ALA B N   1 
ATOM   6213  C  CA  . ALA B 2  386 ? -22.577 141.548 -7.573  1.00 25.44  ? 386 ALA B CA  1 
ATOM   6214  C  C   . ALA B 2  386 ? -23.568 140.670 -6.827  1.00 32.77  ? 386 ALA B C   1 
ATOM   6215  O  O   . ALA B 2  386 ? -24.545 140.146 -7.382  1.00 39.21  ? 386 ALA B O   1 
ATOM   6216  C  CB  . ALA B 2  386 ? -21.353 140.751 -7.962  1.00 24.32  ? 386 ALA B CB  1 
ATOM   6217  N  N   . LEU B 2  387 ? -23.274 140.391 -5.567  1.00 35.83  ? 387 LEU B N   1 
ATOM   6218  C  CA  . LEU B 2  387 ? -24.051 139.497 -4.739  1.00 33.87  ? 387 LEU B CA  1 
ATOM   6219  C  C   . LEU B 2  387 ? -25.284 140.124 -4.130  1.00 35.49  ? 387 LEU B C   1 
ATOM   6220  O  O   . LEU B 2  387 ? -26.044 139.414 -3.476  1.00 36.31  ? 387 LEU B O   1 
ATOM   6221  C  CB  . LEU B 2  387 ? -23.183 139.041 -3.551  1.00 31.30  ? 387 LEU B CB  1 
ATOM   6222  C  CG  . LEU B 2  387 ? -21.937 138.276 -3.982  1.00 32.76  ? 387 LEU B CG  1 
ATOM   6223  C  CD1 . LEU B 2  387 ? -21.133 137.814 -2.783  1.00 35.92  ? 387 LEU B CD1 1 
ATOM   6224  C  CD2 . LEU B 2  387 ? -22.336 137.103 -4.865  1.00 26.19  ? 387 LEU B CD2 1 
ATOM   6225  N  N   . ALA B 2  388 ? -25.378 141.444 -4.144  1.00 39.89  ? 388 ALA B N   1 
ATOM   6226  C  CA  . ALA B 2  388 ? -26.572 142.058 -3.550  1.00 42.60  ? 388 ALA B CA  1 
ATOM   6227  C  C   . ALA B 2  388 ? -27.599 142.390 -4.629  1.00 42.95  ? 388 ALA B C   1 
ATOM   6228  O  O   . ALA B 2  388 ? -28.701 141.838 -4.637  1.00 34.84  ? 388 ALA B O   1 
ATOM   6229  C  CB  . ALA B 2  388 ? -26.198 143.234 -2.673  1.00 36.55  ? 388 ALA B CB  1 
ATOM   6230  N  N   . ALA B 2  389 ? -27.193 143.177 -5.616  1.00 47.61  ? 389 ALA B N   1 
ATOM   6231  C  CA  . ALA B 2  389 ? -28.027 143.695 -6.674  1.00 52.80  ? 389 ALA B CA  1 
ATOM   6232  C  C   . ALA B 2  389 ? -28.095 142.894 -7.961  1.00 53.71  ? 389 ALA B C   1 
ATOM   6233  O  O   . ALA B 2  389 ? -29.205 142.681 -8.483  1.00 57.72  ? 389 ALA B O   1 
ATOM   6234  C  CB  . ALA B 2  389 ? -27.605 145.137 -6.965  1.00 52.87  ? 389 ALA B CB  1 
ATOM   6235  N  N   . GLY B 2  390 ? -26.981 142.480 -8.548  1.00 51.59  ? 390 GLY B N   1 
ATOM   6236  C  CA  . GLY B 2  390 ? -27.003 141.721 -9.794  1.00 47.84  ? 390 GLY B CA  1 
ATOM   6237  C  C   . GLY B 2  390 ? -26.184 142.417 -10.875 1.00 47.24  ? 390 GLY B C   1 
ATOM   6238  O  O   . GLY B 2  390 ? -25.934 141.867 -11.949 1.00 47.87  ? 390 GLY B O   1 
ATOM   6239  N  N   . SER B 2  391 ? -25.670 143.604 -10.569 1.00 44.72  ? 391 SER B N   1 
ATOM   6240  C  CA  . SER B 2  391 ? -24.839 144.351 -11.511 1.00 38.37  ? 391 SER B CA  1 
ATOM   6241  C  C   . SER B 2  391 ? -23.817 145.194 -10.728 1.00 36.86  ? 391 SER B C   1 
ATOM   6242  O  O   . SER B 2  391 ? -23.951 145.374 -9.512  1.00 34.83  ? 391 SER B O   1 
ATOM   6243  C  CB  . SER B 2  391 ? -25.761 145.389 -12.206 1.00 37.91  ? 391 SER B CB  1 
ATOM   6244  O  OG  . SER B 2  391 ? -26.158 146.312 -11.186 1.00 44.09  ? 391 SER B OG  1 
ATOM   6245  N  N   . TYR B 2  392 ? -23.191 146.098 -11.480 1.00 34.62  ? 392 TYR B N   1 
ATOM   6246  C  CA  . TYR B 2  392 ? -22.330 147.094 -10.926 1.00 29.76  ? 392 TYR B CA  1 
ATOM   6247  C  C   . TYR B 2  392 ? -22.802 148.532 -11.025 1.00 26.70  ? 392 TYR B C   1 
ATOM   6248  O  O   . TYR B 2  392 ? -22.410 149.171 -12.014 1.00 29.62  ? 392 TYR B O   1 
ATOM   6249  C  CB  . TYR B 2  392 ? -20.965 147.115 -11.678 1.00 35.75  ? 392 TYR B CB  1 
ATOM   6250  C  CG  . TYR B 2  392 ? -20.117 148.221 -11.062 1.00 45.15  ? 392 TYR B CG  1 
ATOM   6251  C  CD1 . TYR B 2  392 ? -20.105 148.364 -9.678  1.00 52.64  ? 392 TYR B CD1 1 
ATOM   6252  C  CD2 . TYR B 2  392 ? -19.436 149.148 -11.815 1.00 46.93  ? 392 TYR B CD2 1 
ATOM   6253  C  CE1 . TYR B 2  392 ? -19.357 149.346 -9.066  1.00 57.83  ? 392 TYR B CE1 1 
ATOM   6254  C  CE2 . TYR B 2  392 ? -18.674 150.134 -11.216 1.00 53.35  ? 392 TYR B CE2 1 
ATOM   6255  C  CZ  . TYR B 2  392 ? -18.637 150.233 -9.846  1.00 58.39  ? 392 TYR B CZ  1 
ATOM   6256  O  OH  . TYR B 2  392 ? -17.891 151.198 -9.300  1.00 61.09  ? 392 TYR B OH  1 
ATOM   6257  N  N   . THR B 2  393 ? -23.317 149.108 -9.958  1.00 21.42  ? 393 THR B N   1 
ATOM   6258  C  CA  . THR B 2  393 ? -23.589 150.550 -9.969  1.00 20.30  ? 393 THR B CA  1 
ATOM   6259  C  C   . THR B 2  393 ? -22.312 151.375 -9.997  1.00 23.28  ? 393 THR B C   1 
ATOM   6260  O  O   . THR B 2  393 ? -21.439 151.230 -9.141  1.00 24.74  ? 393 THR B O   1 
ATOM   6261  C  CB  . THR B 2  393 ? -24.268 150.938 -8.638  1.00 14.35  ? 393 THR B CB  1 
ATOM   6262  O  OG1 . THR B 2  393 ? -25.540 150.337 -8.534  1.00 19.95  ? 393 THR B OG1 1 
ATOM   6263  C  CG2 . THR B 2  393 ? -24.233 152.438 -8.514  1.00 13.25  ? 393 THR B CG2 1 
ATOM   6264  N  N   . PRO B 2  394 ? -22.187 152.339 -10.868 1.00 29.04  ? 394 PRO B N   1 
ATOM   6265  C  CA  . PRO B 2  394 ? -20.967 153.147 -10.950 1.00 29.20  ? 394 PRO B CA  1 
ATOM   6266  C  C   . PRO B 2  394 ? -20.982 154.123 -9.782  1.00 30.01  ? 394 PRO B C   1 
ATOM   6267  O  O   . PRO B 2  394 ? -22.028 154.265 -9.142  1.00 30.36  ? 394 PRO B O   1 
ATOM   6268  C  CB  . PRO B 2  394 ? -20.943 153.827 -12.307 1.00 30.63  ? 394 PRO B CB  1 
ATOM   6269  C  CG  . PRO B 2  394 ? -22.155 153.256 -12.994 1.00 33.26  ? 394 PRO B CG  1 
ATOM   6270  C  CD  . PRO B 2  394 ? -23.096 152.657 -11.967 1.00 31.52  ? 394 PRO B CD  1 
ATOM   6271  N  N   . PRO B 2  395 ? -19.822 154.672 -9.478  1.00 28.99  ? 395 PRO B N   1 
ATOM   6272  C  CA  . PRO B 2  395 ? -19.556 155.545 -8.358  1.00 24.48  ? 395 PRO B CA  1 
ATOM   6273  C  C   . PRO B 2  395 ? -20.449 156.766 -8.334  1.00 21.84  ? 395 PRO B C   1 
ATOM   6274  O  O   . PRO B 2  395 ? -21.060 157.000 -7.298  1.00 17.19  ? 395 PRO B O   1 
ATOM   6275  C  CB  . PRO B 2  395 ? -18.072 155.921 -8.371  1.00 25.22  ? 395 PRO B CB  1 
ATOM   6276  C  CG  . PRO B 2  395 ? -17.504 154.965 -9.380  1.00 27.91  ? 395 PRO B CG  1 
ATOM   6277  C  CD  . PRO B 2  395 ? -18.601 154.425 -10.262 1.00 28.57  ? 395 PRO B CD  1 
ATOM   6278  N  N   . SER B 2  396 ? -20.563 157.447 -9.451  1.00 26.79  ? 396 SER B N   1 
ATOM   6279  C  CA  . SER B 2  396 ? -21.361 158.631 -9.701  1.00 30.03  ? 396 SER B CA  1 
ATOM   6280  C  C   . SER B 2  396 ? -22.804 158.495 -9.216  1.00 30.88  ? 396 SER B C   1 
ATOM   6281  O  O   . SER B 2  396 ? -23.348 159.296 -8.447  1.00 28.89  ? 396 SER B O   1 
ATOM   6282  C  CB  . SER B 2  396 ? -21.323 158.972 -11.194 1.00 34.18  ? 396 SER B CB  1 
ATOM   6283  O  OG  . SER B 2  396 ? -20.295 158.287 -11.887 1.00 36.88  ? 396 SER B OG  1 
ATOM   6284  N  N   . THR B 2  397 ? -23.448 157.406 -9.619  1.00 29.50  ? 397 THR B N   1 
ATOM   6285  C  CA  . THR B 2  397 ? -24.834 157.142 -9.204  1.00 30.83  ? 397 THR B CA  1 
ATOM   6286  C  C   . THR B 2  397 ? -24.876 156.918 -7.705  1.00 32.28  ? 397 THR B C   1 
ATOM   6287  O  O   . THR B 2  397 ? -25.735 157.382 -6.955  1.00 30.22  ? 397 THR B O   1 
ATOM   6288  C  CB  . THR B 2  397 ? -25.332 155.944 -10.022 1.00 29.52  ? 397 THR B CB  1 
ATOM   6289  O  OG1 . THR B 2  397 ? -25.319 156.303 -11.416 1.00 28.55  ? 397 THR B OG1 1 
ATOM   6290  C  CG2 . THR B 2  397 ? -26.710 155.467 -9.637  1.00 28.15  ? 397 THR B CG2 1 
ATOM   6291  N  N   . VAL B 2  398 ? -23.862 156.204 -7.211  1.00 34.29  ? 398 VAL B N   1 
ATOM   6292  C  CA  . VAL B 2  398 ? -23.740 155.942 -5.772  1.00 34.04  ? 398 VAL B CA  1 
ATOM   6293  C  C   . VAL B 2  398 ? -23.706 157.285 -5.046  1.00 35.00  ? 398 VAL B C   1 
ATOM   6294  O  O   . VAL B 2  398 ? -24.523 157.605 -4.184  1.00 34.32  ? 398 VAL B O   1 
ATOM   6295  C  CB  . VAL B 2  398 ? -22.433 155.170 -5.495  1.00 26.29  ? 398 VAL B CB  1 
ATOM   6296  C  CG1 . VAL B 2  398 ? -22.088 155.085 -4.025  1.00 21.40  ? 398 VAL B CG1 1 
ATOM   6297  C  CG2 . VAL B 2  398 ? -22.544 153.783 -6.108  1.00 25.88  ? 398 VAL B CG2 1 
ATOM   6298  N  N   . LEU B 2  399 ? -22.841 158.160 -5.571  1.00 35.34  ? 399 LEU B N   1 
ATOM   6299  C  CA  . LEU B 2  399 ? -22.691 159.474 -4.967  1.00 38.88  ? 399 LEU B CA  1 
ATOM   6300  C  C   . LEU B 2  399 ? -24.000 160.241 -4.967  1.00 44.38  ? 399 LEU B C   1 
ATOM   6301  O  O   . LEU B 2  399 ? -24.279 160.984 -4.021  1.00 46.84  ? 399 LEU B O   1 
ATOM   6302  C  CB  . LEU B 2  399 ? -21.593 160.250 -5.674  1.00 33.80  ? 399 LEU B CB  1 
ATOM   6303  C  CG  . LEU B 2  399 ? -20.206 159.602 -5.594  1.00 33.96  ? 399 LEU B CG  1 
ATOM   6304  C  CD1 . LEU B 2  399 ? -19.307 160.059 -6.728  1.00 40.43  ? 399 LEU B CD1 1 
ATOM   6305  C  CD2 . LEU B 2  399 ? -19.567 159.920 -4.253  1.00 30.90  ? 399 LEU B CD2 1 
ATOM   6306  N  N   . GLN B 2  400 ? -24.789 160.045 -6.021  1.00 47.09  ? 400 GLN B N   1 
ATOM   6307  C  CA  . GLN B 2  400 ? -26.073 160.726 -6.120  1.00 49.51  ? 400 GLN B CA  1 
ATOM   6308  C  C   . GLN B 2  400 ? -27.054 160.288 -5.041  1.00 47.39  ? 400 GLN B C   1 
ATOM   6309  O  O   . GLN B 2  400 ? -27.700 161.153 -4.433  1.00 50.00  ? 400 GLN B O   1 
ATOM   6310  C  CB  . GLN B 2  400 ? -26.665 160.512 -7.507  1.00 60.61  ? 400 GLN B CB  1 
ATOM   6311  C  CG  . GLN B 2  400 ? -25.833 161.182 -8.601  1.00 71.69  ? 400 GLN B CG  1 
ATOM   6312  C  CD  . GLN B 2  400 ? -26.492 160.991 -9.957  1.00 78.66  ? 400 GLN B CD  1 
ATOM   6313  O  OE1 . GLN B 2  400 ? -27.634 160.519 -10.016 1.00 82.94  ? 400 GLN B OE1 1 
ATOM   6314  N  NE2 . GLN B 2  400 ? -25.782 161.344 -11.019 1.00 80.92  ? 400 GLN B NE2 1 
ATOM   6315  N  N   . GLN B 2  401 ? -27.125 158.989 -4.781  1.00 41.98  ? 401 GLN B N   1 
ATOM   6316  C  CA  . GLN B 2  401 ? -28.028 158.426 -3.781  1.00 36.15  ? 401 GLN B CA  1 
ATOM   6317  C  C   . GLN B 2  401 ? -27.775 158.948 -2.383  1.00 31.95  ? 401 GLN B C   1 
ATOM   6318  O  O   . GLN B 2  401 ? -28.649 159.391 -1.633  1.00 28.29  ? 401 GLN B O   1 
ATOM   6319  C  CB  . GLN B 2  401 ? -27.887 156.906 -3.802  1.00 37.29  ? 401 GLN B CB  1 
ATOM   6320  C  CG  . GLN B 2  401 ? -28.178 156.286 -5.154  1.00 46.47  ? 401 GLN B CG  1 
ATOM   6321  C  CD  . GLN B 2  401 ? -28.210 154.772 -5.123  1.00 54.39  ? 401 GLN B CD  1 
ATOM   6322  O  OE1 . GLN B 2  401 ? -27.769 154.164 -4.141  1.00 58.99  ? 401 GLN B OE1 1 
ATOM   6323  N  NE2 . GLN B 2  401 ? -28.721 154.122 -6.165  1.00 55.85  ? 401 GLN B NE2 1 
ATOM   6324  N  N   . ILE B 2  402 ? -26.501 158.955 -1.990  1.00 31.08  ? 402 ILE B N   1 
ATOM   6325  C  CA  . ILE B 2  402 ? -26.208 159.475 -0.655  1.00 36.44  ? 402 ILE B CA  1 
ATOM   6326  C  C   . ILE B 2  402 ? -26.675 160.911 -0.522  1.00 38.51  ? 402 ILE B C   1 
ATOM   6327  O  O   . ILE B 2  402 ? -27.356 161.297 0.434   1.00 40.14  ? 402 ILE B O   1 
ATOM   6328  C  CB  . ILE B 2  402 ? -24.723 159.291 -0.324  1.00 37.50  ? 402 ILE B CB  1 
ATOM   6329  C  CG1 . ILE B 2  402 ? -24.544 157.994 0.474   1.00 39.56  ? 402 ILE B CG1 1 
ATOM   6330  C  CG2 . ILE B 2  402 ? -24.186 160.480 0.445   1.00 38.86  ? 402 ILE B CG2 1 
ATOM   6331  C  CD1 . ILE B 2  402 ? -23.188 157.352 0.364   1.00 44.97  ? 402 ILE B CD1 1 
ATOM   6332  N  N   . ASP B 2  403 ? -26.452 161.690 -1.579  1.00 40.34  ? 403 ASP B N   1 
ATOM   6333  C  CA  . ASP B 2  403 ? -26.842 163.087 -1.620  1.00 39.18  ? 403 ASP B CA  1 
ATOM   6334  C  C   . ASP B 2  403 ? -28.325 163.359 -1.420  1.00 36.79  ? 403 ASP B C   1 
ATOM   6335  O  O   . ASP B 2  403 ? -28.729 164.335 -0.782  1.00 33.21  ? 403 ASP B O   1 
ATOM   6336  C  CB  . ASP B 2  403 ? -26.341 163.733 -2.927  1.00 34.14  ? 403 ASP B CB  1 
ATOM   6337  C  CG  . ASP B 2  403 ? -25.627 165.027 -2.527  1.00 36.64  ? 403 ASP B CG  1 
ATOM   6338  O  OD1 . ASP B 2  403 ? -26.103 165.643 -1.548  1.00 31.49  ? 403 ASP B OD1 1 
ATOM   6339  O  OD2 . ASP B 2  403 ? -24.620 165.339 -3.179  1.00 38.99  ? 403 ASP B OD2 1 
ATOM   6340  N  N   . ALA B 2  404 ? -29.133 162.437 -1.949  1.00 31.88  ? 404 ALA B N   1 
ATOM   6341  C  CA  . ALA B 2  404 ? -30.568 162.535 -1.850  1.00 27.08  ? 404 ALA B CA  1 
ATOM   6342  C  C   . ALA B 2  404 ? -31.035 162.520 -0.415  1.00 28.65  ? 404 ALA B C   1 
ATOM   6343  O  O   . ALA B 2  404 ? -32.149 162.992 -0.141  1.00 32.60  ? 404 ALA B O   1 
ATOM   6344  C  CB  . ALA B 2  404 ? -31.213 161.488 -2.726  1.00 18.65  ? 404 ALA B CB  1 
ATOM   6345  N  N   . VAL B 2  405 ? -30.271 162.032 0.558   1.00 28.23  ? 405 VAL B N   1 
ATOM   6346  C  CA  . VAL B 2  405 ? -30.777 162.042 1.928   1.00 27.21  ? 405 VAL B CA  1 
ATOM   6347  C  C   . VAL B 2  405 ? -31.214 163.420 2.417   1.00 26.91  ? 405 VAL B C   1 
ATOM   6348  O  O   . VAL B 2  405 ? -30.397 164.337 2.287   1.00 21.19  ? 405 VAL B O   1 
ATOM   6349  C  CB  . VAL B 2  405 ? -29.722 161.538 2.933   1.00 25.49  ? 405 VAL B CB  1 
ATOM   6350  C  CG1 . VAL B 2  405 ? -30.341 161.515 4.327   1.00 25.75  ? 405 VAL B CG1 1 
ATOM   6351  C  CG2 . VAL B 2  405 ? -29.233 160.165 2.518   1.00 22.88  ? 405 VAL B CG2 1 
ATOM   6352  N  N   . ALA B 2  406 ? -32.369 163.477 3.085   1.00 27.15  ? 406 ALA B N   1 
ATOM   6353  C  CA  . ALA B 2  406 ? -32.916 164.712 3.613   1.00 31.59  ? 406 ALA B CA  1 
ATOM   6354  C  C   . ALA B 2  406 ? -32.409 165.047 5.005   1.00 34.97  ? 406 ALA B C   1 
ATOM   6355  O  O   . ALA B 2  406 ? -32.624 164.279 5.943   1.00 34.48  ? 406 ALA B O   1 
ATOM   6356  C  CB  . ALA B 2  406 ? -34.438 164.711 3.690   1.00 30.78  ? 406 ALA B CB  1 
ATOM   6357  N  N   . ASP B 2  407 ? -32.150 166.338 5.239   1.00 39.13  ? 407 ASP B N   1 
ATOM   6358  C  CA  . ASP B 2  407 ? -31.649 166.722 6.563   1.00 42.97  ? 407 ASP B CA  1 
ATOM   6359  C  C   . ASP B 2  407 ? -32.517 166.093 7.640   1.00 41.63  ? 407 ASP B C   1 
ATOM   6360  O  O   . ASP B 2  407 ? -32.067 165.545 8.636   1.00 44.11  ? 407 ASP B O   1 
ATOM   6361  C  CB  . ASP B 2  407 ? -31.544 168.230 6.735   1.00 48.64  ? 407 ASP B CB  1 
ATOM   6362  C  CG  . ASP B 2  407 ? -30.867 168.901 5.555   1.00 59.12  ? 407 ASP B CG  1 
ATOM   6363  O  OD1 . ASP B 2  407 ? -29.632 168.785 5.417   1.00 64.71  ? 407 ASP B OD1 1 
ATOM   6364  O  OD2 . ASP B 2  407 ? -31.582 169.547 4.757   1.00 65.11  ? 407 ASP B OD2 1 
ATOM   6365  N  N   . ALA B 2  408 ? -33.824 166.120 7.418   1.00 43.00  ? 408 ALA B N   1 
ATOM   6366  C  CA  . ALA B 2  408 ? -34.770 165.558 8.375   1.00 44.50  ? 408 ALA B CA  1 
ATOM   6367  C  C   . ALA B 2  408 ? -34.595 164.044 8.461   1.00 45.01  ? 408 ALA B C   1 
ATOM   6368  O  O   . ALA B 2  408 ? -34.357 163.499 9.534   1.00 46.56  ? 408 ALA B O   1 
ATOM   6369  C  CB  . ALA B 2  408 ? -36.202 165.892 7.972   1.00 43.20  ? 408 ALA B CB  1 
ATOM   6370  N  N   . ASP B 2  409 ? -34.738 163.385 7.329   1.00 43.53  ? 409 ASP B N   1 
ATOM   6371  C  CA  . ASP B 2  409 ? -34.503 161.963 7.126   1.00 41.41  ? 409 ASP B CA  1 
ATOM   6372  C  C   . ASP B 2  409 ? -33.528 161.366 8.144   1.00 41.38  ? 409 ASP B C   1 
ATOM   6373  O  O   . ASP B 2  409 ? -33.820 160.393 8.850   1.00 35.33  ? 409 ASP B O   1 
ATOM   6374  C  CB  . ASP B 2  409 ? -33.932 161.834 5.705   1.00 43.67  ? 409 ASP B CB  1 
ATOM   6375  C  CG  . ASP B 2  409 ? -34.387 160.595 4.985   1.00 49.83  ? 409 ASP B CG  1 
ATOM   6376  O  OD1 . ASP B 2  409 ? -33.848 159.514 5.325   1.00 57.51  ? 409 ASP B OD1 1 
ATOM   6377  O  OD2 . ASP B 2  409 ? -35.255 160.717 4.099   1.00 44.88  ? 409 ASP B OD2 1 
ATOM   6378  N  N   . VAL B 2  410 ? -32.313 161.898 8.211   1.00 39.62  ? 410 VAL B N   1 
ATOM   6379  C  CA  . VAL B 2  410 ? -31.291 161.633 9.210   1.00 33.31  ? 410 VAL B CA  1 
ATOM   6380  C  C   . VAL B 2  410 ? -31.908 161.700 10.603  1.00 33.86  ? 410 VAL B C   1 
ATOM   6381  O  O   . VAL B 2  410 ? -31.963 160.717 11.325  1.00 32.75  ? 410 VAL B O   1 
ATOM   6382  C  CB  . VAL B 2  410 ? -30.211 162.740 9.088   1.00 32.14  ? 410 VAL B CB  1 
ATOM   6383  C  CG1 . VAL B 2  410 ? -29.114 162.600 10.115  1.00 34.08  ? 410 VAL B CG1 1 
ATOM   6384  C  CG2 . VAL B 2  410 ? -29.680 162.762 7.669   1.00 31.64  ? 410 VAL B CG2 1 
ATOM   6385  N  N   . ILE B 2  411 ? -32.471 162.851 10.965  1.00 34.41  ? 411 ILE B N   1 
ATOM   6386  C  CA  . ILE B 2  411 ? -33.165 163.016 12.225  1.00 35.52  ? 411 ILE B CA  1 
ATOM   6387  C  C   . ILE B 2  411 ? -34.098 161.818 12.458  1.00 40.46  ? 411 ILE B C   1 
ATOM   6388  O  O   . ILE B 2  411 ? -34.257 161.276 13.544  1.00 42.78  ? 411 ILE B O   1 
ATOM   6389  C  CB  . ILE B 2  411 ? -34.094 164.255 12.208  1.00 28.64  ? 411 ILE B CB  1 
ATOM   6390  C  CG1 . ILE B 2  411 ? -33.367 165.505 11.753  1.00 23.25  ? 411 ILE B CG1 1 
ATOM   6391  C  CG2 . ILE B 2  411 ? -34.742 164.391 13.579  1.00 24.30  ? 411 ILE B CG2 1 
ATOM   6392  C  CD1 . ILE B 2  411 ? -33.790 166.763 12.485  1.00 26.42  ? 411 ILE B CD1 1 
ATOM   6393  N  N   . ASN B 2  412 ? -34.916 161.576 11.446  1.00 41.83  ? 412 ASN B N   1 
ATOM   6394  C  CA  . ASN B 2  412 ? -35.937 160.523 11.520  1.00 45.04  ? 412 ASN B CA  1 
ATOM   6395  C  C   . ASN B 2  412 ? -35.299 159.192 11.873  1.00 44.94  ? 412 ASN B C   1 
ATOM   6396  O  O   . ASN B 2  412 ? -35.603 158.564 12.897  1.00 41.03  ? 412 ASN B O   1 
ATOM   6397  C  CB  . ASN B 2  412 ? -36.651 160.559 10.177  1.00 53.64  ? 412 ASN B CB  1 
ATOM   6398  C  CG  . ASN B 2  412 ? -37.922 159.776 10.043  1.00 57.55  ? 412 ASN B CG  1 
ATOM   6399  O  OD1 . ASN B 2  412 ? -38.636 159.520 11.007  1.00 64.45  ? 412 ASN B OD1 1 
ATOM   6400  N  ND2 . ASN B 2  412 ? -38.218 159.365 8.812   1.00 59.19  ? 412 ASN B ND2 1 
ATOM   6401  N  N   . ALA B 2  413 ? -34.329 158.751 11.067  1.00 45.50  ? 413 ALA B N   1 
ATOM   6402  C  CA  . ALA B 2  413 ? -33.599 157.518 11.325  1.00 43.42  ? 413 ALA B CA  1 
ATOM   6403  C  C   . ALA B 2  413 ? -33.034 157.491 12.747  1.00 43.32  ? 413 ALA B C   1 
ATOM   6404  O  O   . ALA B 2  413 ? -33.156 156.443 13.386  1.00 48.81  ? 413 ALA B O   1 
ATOM   6405  C  CB  . ALA B 2  413 ? -32.469 157.322 10.333  1.00 36.01  ? 413 ALA B CB  1 
ATOM   6406  N  N   . ALA B 2  414 ? -32.456 158.589 13.211  1.00 37.34  ? 414 ALA B N   1 
ATOM   6407  C  CA  . ALA B 2  414 ? -31.974 158.751 14.569  1.00 30.53  ? 414 ALA B CA  1 
ATOM   6408  C  C   . ALA B 2  414 ? -33.070 158.526 15.599  1.00 29.82  ? 414 ALA B C   1 
ATOM   6409  O  O   . ALA B 2  414 ? -32.901 157.925 16.653  1.00 25.35  ? 414 ALA B O   1 
ATOM   6410  C  CB  . ALA B 2  414 ? -31.383 160.142 14.748  1.00 32.49  ? 414 ALA B CB  1 
ATOM   6411  N  N   . LYS B 2  415 ? -34.275 158.996 15.270  1.00 34.29  ? 415 LYS B N   1 
ATOM   6412  C  CA  . LYS B 2  415 ? -35.429 158.872 16.167  1.00 32.32  ? 415 LYS B CA  1 
ATOM   6413  C  C   . LYS B 2  415 ? -35.689 157.391 16.450  1.00 29.47  ? 415 LYS B C   1 
ATOM   6414  O  O   . LYS B 2  415 ? -36.453 157.075 17.346  1.00 33.11  ? 415 LYS B O   1 
ATOM   6415  C  CB  . LYS B 2  415 ? -36.682 159.420 15.486  1.00 29.59  ? 415 LYS B CB  1 
ATOM   6416  C  CG  . LYS B 2  415 ? -37.038 160.852 15.807  1.00 32.04  ? 415 LYS B CG  1 
ATOM   6417  C  CD  . LYS B 2  415 ? -38.469 161.204 15.423  1.00 31.95  ? 415 LYS B CD  1 
ATOM   6418  C  CE  . LYS B 2  415 ? -39.016 162.410 16.157  1.00 28.89  ? 415 LYS B CE  1 
ATOM   6419  N  NZ  . LYS B 2  415 ? -40.438 162.288 16.600  1.00 29.66  ? 415 LYS B NZ  1 
ATOM   6420  N  N   . LYS B 2  416 ? -35.308 156.596 15.472  1.00 27.02  ? 416 LYS B N   1 
ATOM   6421  C  CA  . LYS B 2  416 ? -35.500 155.169 15.469  1.00 28.09  ? 416 LYS B CA  1 
ATOM   6422  C  C   . LYS B 2  416 ? -34.564 154.461 16.435  1.00 32.33  ? 416 LYS B C   1 
ATOM   6423  O  O   . LYS B 2  416 ? -34.937 153.436 17.005  1.00 35.35  ? 416 LYS B O   1 
ATOM   6424  C  CB  . LYS B 2  416 ? -35.228 154.608 14.060  1.00 22.08  ? 416 LYS B CB  1 
ATOM   6425  C  CG  . LYS B 2  416 ? -36.187 153.497 13.710  1.00 10.49  ? 416 LYS B CG  1 
ATOM   6426  C  CD  . LYS B 2  416 ? -35.642 152.461 12.763  1.00 2.20   ? 416 LYS B CD  1 
ATOM   6427  C  CE  . LYS B 2  416 ? -36.747 151.690 12.121  1.00 8.84   ? 416 LYS B CE  1 
ATOM   6428  N  NZ  . LYS B 2  416 ? -36.312 150.803 11.014  1.00 15.34  ? 416 LYS B NZ  1 
ATOM   6429  N  N   . PHE B 2  417 ? -33.313 154.921 16.522  1.00 32.76  ? 417 PHE B N   1 
ATOM   6430  C  CA  . PHE B 2  417 ? -32.392 154.287 17.468  1.00 31.24  ? 417 PHE B CA  1 
ATOM   6431  C  C   . PHE B 2  417 ? -32.998 154.431 18.868  1.00 32.25  ? 417 PHE B C   1 
ATOM   6432  O  O   . PHE B 2  417 ? -33.411 153.446 19.475  1.00 34.74  ? 417 PHE B O   1 
ATOM   6433  C  CB  . PHE B 2  417 ? -31.027 154.963 17.429  1.00 26.88  ? 417 PHE B CB  1 
ATOM   6434  C  CG  . PHE B 2  417 ? -30.061 154.445 18.452  1.00 27.17  ? 417 PHE B CG  1 
ATOM   6435  C  CD1 . PHE B 2  417 ? -30.063 154.973 19.724  1.00 25.64  ? 417 PHE B CD1 1 
ATOM   6436  C  CD2 . PHE B 2  417 ? -29.165 153.440 18.138  1.00 26.97  ? 417 PHE B CD2 1 
ATOM   6437  C  CE1 . PHE B 2  417 ? -29.183 154.507 20.674  1.00 27.05  ? 417 PHE B CE1 1 
ATOM   6438  C  CE2 . PHE B 2  417 ? -28.284 152.973 19.082  1.00 28.42  ? 417 PHE B CE2 1 
ATOM   6439  C  CZ  . PHE B 2  417 ? -28.293 153.509 20.353  1.00 29.66  ? 417 PHE B CZ  1 
ATOM   6440  N  N   . VAL B 2  418 ? -33.219 155.696 19.222  1.00 27.65  ? 418 VAL B N   1 
ATOM   6441  C  CA  . VAL B 2  418 ? -33.766 156.036 20.518  1.00 25.62  ? 418 VAL B CA  1 
ATOM   6442  C  C   . VAL B 2  418 ? -35.043 155.253 20.772  1.00 27.95  ? 418 VAL B C   1 
ATOM   6443  O  O   . VAL B 2  418 ? -35.341 154.956 21.925  1.00 33.45  ? 418 VAL B O   1 
ATOM   6444  C  CB  . VAL B 2  418 ? -34.051 157.533 20.665  1.00 27.72  ? 418 VAL B CB  1 
ATOM   6445  C  CG1 . VAL B 2  418 ? -33.626 158.037 22.033  1.00 29.79  ? 418 VAL B CG1 1 
ATOM   6446  C  CG2 . VAL B 2  418 ? -33.333 158.320 19.584  1.00 35.33  ? 418 VAL B CG2 1 
ATOM   6447  N  N   . SER B 2  419 ? -35.824 154.991 19.732  1.00 27.40  ? 419 SER B N   1 
ATOM   6448  C  CA  . SER B 2  419 ? -37.120 154.350 19.919  1.00 27.97  ? 419 SER B CA  1 
ATOM   6449  C  C   . SER B 2  419 ? -37.176 153.061 19.110  1.00 31.13  ? 419 SER B C   1 
ATOM   6450  O  O   . SER B 2  419 ? -37.972 152.925 18.194  1.00 29.85  ? 419 SER B O   1 
ATOM   6451  C  CB  . SER B 2  419 ? -38.254 155.272 19.487  1.00 25.89  ? 419 SER B CB  1 
ATOM   6452  O  OG  . SER B 2  419 ? -39.169 155.420 20.569  1.00 32.99  ? 419 SER B OG  1 
ATOM   6453  N  N   . GLY B 2  420 ? -36.205 152.237 19.430  1.00 32.88  ? 420 GLY B N   1 
ATOM   6454  C  CA  . GLY B 2  420 ? -35.949 150.941 18.834  1.00 31.93  ? 420 GLY B CA  1 
ATOM   6455  C  C   . GLY B 2  420 ? -35.324 150.066 19.925  1.00 29.25  ? 420 GLY B C   1 
ATOM   6456  O  O   . GLY B 2  420 ? -34.651 150.584 20.807  1.00 30.25  ? 420 GLY B O   1 
ATOM   6457  N  N   . ARG B 2  421 ? -35.719 148.819 20.003  1.00 29.08  ? 421 ARG B N   1 
ATOM   6458  C  CA  . ARG B 2  421 ? -35.296 147.890 21.038  1.00 26.45  ? 421 ARG B CA  1 
ATOM   6459  C  C   . ARG B 2  421 ? -33.785 147.803 21.167  1.00 25.30  ? 421 ARG B C   1 
ATOM   6460  O  O   . ARG B 2  421 ? -33.146 147.335 20.230  1.00 26.14  ? 421 ARG B O   1 
ATOM   6461  C  CB  . ARG B 2  421 ? -35.831 146.515 20.626  1.00 26.81  ? 421 ARG B CB  1 
ATOM   6462  C  CG  . ARG B 2  421 ? -35.481 145.384 21.549  1.00 28.16  ? 421 ARG B CG  1 
ATOM   6463  C  CD  . ARG B 2  421 ? -36.708 144.512 21.788  1.00 31.40  ? 421 ARG B CD  1 
ATOM   6464  N  NE  . ARG B 2  421 ? -36.591 143.751 23.016  1.00 38.90  ? 421 ARG B NE  1 
ATOM   6465  C  CZ  . ARG B 2  421 ? -36.904 142.485 23.231  1.00 39.55  ? 421 ARG B CZ  1 
ATOM   6466  N  NH1 . ARG B 2  421 ? -37.403 141.707 22.280  1.00 39.86  ? 421 ARG B NH1 1 
ATOM   6467  N  NH2 . ARG B 2  421 ? -36.733 141.949 24.438  1.00 38.92  ? 421 ARG B NH2 1 
ATOM   6468  N  N   . LYS B 2  422 ? -33.223 148.150 22.310  1.00 26.09  ? 422 LYS B N   1 
ATOM   6469  C  CA  . LYS B 2  422 ? -31.782 148.149 22.492  1.00 27.39  ? 422 LYS B CA  1 
ATOM   6470  C  C   . LYS B 2  422 ? -31.144 146.776 22.619  1.00 24.57  ? 422 LYS B C   1 
ATOM   6471  O  O   . LYS B 2  422 ? -31.731 145.770 23.028  1.00 25.96  ? 422 LYS B O   1 
ATOM   6472  C  CB  . LYS B 2  422 ? -31.399 149.070 23.650  1.00 37.81  ? 422 LYS B CB  1 
ATOM   6473  C  CG  . LYS B 2  422 ? -32.360 150.186 23.974  1.00 50.86  ? 422 LYS B CG  1 
ATOM   6474  C  CD  . LYS B 2  422 ? -32.928 150.089 25.385  1.00 58.65  ? 422 LYS B CD  1 
ATOM   6475  C  CE  . LYS B 2  422 ? -33.423 151.436 25.896  1.00 67.26  ? 422 LYS B CE  1 
ATOM   6476  N  NZ  . LYS B 2  422 ? -33.604 151.450 27.375  1.00 67.61  ? 422 LYS B NZ  1 
ATOM   6477  N  N   . SER B 2  423 ? -29.859 146.713 22.266  1.00 19.07  ? 423 SER B N   1 
ATOM   6478  C  CA  . SER B 2  423 ? -28.993 145.552 22.379  1.00 13.56  ? 423 SER B CA  1 
ATOM   6479  C  C   . SER B 2  423 ? -27.521 145.955 22.524  1.00 10.08  ? 423 SER B C   1 
ATOM   6480  O  O   . SER B 2  423 ? -26.900 146.539 21.642  1.00 8.84   ? 423 SER B O   1 
ATOM   6481  C  CB  . SER B 2  423 ? -29.178 144.619 21.188  1.00 2.38   ? 423 SER B CB  1 
ATOM   6482  O  OG  . SER B 2  423 ? -28.583 145.211 20.048  1.00 16.94  ? 423 SER B OG  1 
ATOM   6483  N  N   . MET B 2  424 ? -26.905 145.608 23.631  1.00 11.34  ? 424 MET B N   1 
ATOM   6484  C  CA  . MET B 2  424 ? -25.622 146.099 24.106  1.00 10.01  ? 424 MET B CA  1 
ATOM   6485  C  C   . MET B 2  424 ? -24.630 144.983 24.430  1.00 8.23   ? 424 MET B C   1 
ATOM   6486  O  O   . MET B 2  424 ? -25.086 143.885 24.771  1.00 9.19   ? 424 MET B O   1 
ATOM   6487  C  CB  . MET B 2  424 ? -25.896 146.849 25.434  1.00 2.77   ? 424 MET B CB  1 
ATOM   6488  C  CG  . MET B 2  424 ? -24.677 147.298 26.152  1.00 2.20   ? 424 MET B CG  1 
ATOM   6489  S  SD  . MET B 2  424 ? -24.731 148.421 27.528  1.00 4.69   ? 424 MET B SD  1 
ATOM   6490  C  CE  . MET B 2  424 ? -26.130 149.458 27.210  1.00 2.20   ? 424 MET B CE  1 
ATOM   6491  N  N   . ALA B 2  425 ? -23.325 145.249 24.335  1.00 6.86   ? 425 ALA B N   1 
ATOM   6492  C  CA  . ALA B 2  425 ? -22.316 144.231 24.652  1.00 2.46   ? 425 ALA B CA  1 
ATOM   6493  C  C   . ALA B 2  425 ? -21.061 144.875 25.233  1.00 4.94   ? 425 ALA B C   1 
ATOM   6494  O  O   . ALA B 2  425 ? -20.599 145.873 24.681  1.00 3.40   ? 425 ALA B O   1 
ATOM   6495  C  CB  . ALA B 2  425 ? -22.003 143.371 23.458  1.00 4.37   ? 425 ALA B CB  1 
ATOM   6496  N  N   . ALA B 2  426 ? -20.540 144.405 26.364  1.00 5.38   ? 426 ALA B N   1 
ATOM   6497  C  CA  . ALA B 2  426 ? -19.400 145.074 26.985  1.00 7.95   ? 426 ALA B CA  1 
ATOM   6498  C  C   . ALA B 2  426 ? -18.288 144.072 27.325  1.00 6.25   ? 426 ALA B C   1 
ATOM   6499  O  O   . ALA B 2  426 ? -18.483 142.899 26.997  1.00 2.32   ? 426 ALA B O   1 
ATOM   6500  C  CB  . ALA B 2  426 ? -19.766 145.900 28.188  1.00 5.28   ? 426 ALA B CB  1 
ATOM   6501  N  N   . SER B 2  427 ? -17.226 144.620 27.873  1.00 6.29   ? 427 SER B N   1 
ATOM   6502  C  CA  . SER B 2  427 ? -16.017 143.872 28.169  1.00 5.84   ? 427 SER B CA  1 
ATOM   6503  C  C   . SER B 2  427 ? -15.098 144.643 29.115  1.00 4.47   ? 427 SER B C   1 
ATOM   6504  O  O   . SER B 2  427 ? -14.769 145.803 28.865  1.00 5.33   ? 427 SER B O   1 
ATOM   6505  C  CB  . SER B 2  427 ? -15.268 143.522 26.880  1.00 2.20   ? 427 SER B CB  1 
ATOM   6506  O  OG  . SER B 2  427 ? -15.293 142.188 26.506  1.00 3.84   ? 427 SER B OG  1 
ATOM   6507  N  N   . GLY B 2  428 ? -14.741 144.038 30.249  1.00 4.68   ? 428 GLY B N   1 
ATOM   6508  C  CA  . GLY B 2  428 ? -13.947 144.679 31.287  1.00 5.62   ? 428 GLY B CA  1 
ATOM   6509  C  C   . GLY B 2  428 ? -14.459 144.636 32.702  1.00 2.98   ? 428 GLY B C   1 
ATOM   6510  O  O   . GLY B 2  428 ? -15.075 143.636 33.125  1.00 3.11   ? 428 GLY B O   1 
ATOM   6511  N  N   . ASN B 2  429 ? -14.035 145.609 33.534  1.00 7.98   ? 429 ASN B N   1 
ATOM   6512  C  CA  . ASN B 2  429 ? -14.662 145.690 34.868  1.00 9.50   ? 429 ASN B CA  1 
ATOM   6513  C  C   . ASN B 2  429 ? -16.016 146.350 34.678  1.00 12.14  ? 429 ASN B C   1 
ATOM   6514  O  O   . ASN B 2  429 ? -16.080 147.452 34.122  1.00 12.14  ? 429 ASN B O   1 
ATOM   6515  C  CB  . ASN B 2  429 ? -13.774 146.402 35.861  1.00 10.96  ? 429 ASN B CB  1 
ATOM   6516  C  CG  . ASN B 2  429 ? -13.920 145.859 37.276  1.00 16.93  ? 429 ASN B CG  1 
ATOM   6517  O  OD1 . ASN B 2  429 ? -12.966 145.913 38.047  1.00 13.45  ? 429 ASN B OD1 1 
ATOM   6518  N  ND2 . ASN B 2  429 ? -15.099 145.364 37.631  1.00 12.84  ? 429 ASN B ND2 1 
ATOM   6519  N  N   . LEU B 2  430 ? -17.140 145.668 34.914  1.00 14.42  ? 430 LEU B N   1 
ATOM   6520  C  CA  . LEU B 2  430 ? -18.410 146.331 34.595  1.00 19.85  ? 430 LEU B CA  1 
ATOM   6521  C  C   . LEU B 2  430 ? -19.182 146.754 35.817  1.00 25.29  ? 430 LEU B C   1 
ATOM   6522  O  O   . LEU B 2  430 ? -20.377 146.476 35.960  1.00 29.81  ? 430 LEU B O   1 
ATOM   6523  C  CB  . LEU B 2  430 ? -19.290 145.409 33.736  1.00 3.76   ? 430 LEU B CB  1 
ATOM   6524  C  CG  . LEU B 2  430 ? -18.487 144.553 32.752  1.00 8.21   ? 430 LEU B CG  1 
ATOM   6525  C  CD1 . LEU B 2  430 ? -19.349 143.479 32.107  1.00 13.50  ? 430 LEU B CD1 1 
ATOM   6526  C  CD2 . LEU B 2  430 ? -17.794 145.401 31.689  1.00 3.00   ? 430 LEU B CD2 1 
ATOM   6527  N  N   . GLY B 2  431 ? -18.537 147.443 36.747  1.00 30.65  ? 431 GLY B N   1 
ATOM   6528  C  CA  . GLY B 2  431 ? -19.325 147.923 37.891  1.00 34.37  ? 431 GLY B CA  1 
ATOM   6529  C  C   . GLY B 2  431 ? -19.988 149.214 37.434  1.00 40.08  ? 431 GLY B C   1 
ATOM   6530  O  O   . GLY B 2  431 ? -20.817 149.721 38.194  1.00 45.33  ? 431 GLY B O   1 
ATOM   6531  N  N   . HIS B 2  432 ? -19.467 149.841 36.367  1.00 39.60  ? 432 HIS B N   1 
ATOM   6532  C  CA  . HIS B 2  432 ? -20.070 151.113 35.985  1.00 43.81  ? 432 HIS B CA  1 
ATOM   6533  C  C   . HIS B 2  432 ? -20.651 151.112 34.593  1.00 43.55  ? 432 HIS B C   1 
ATOM   6534  O  O   . HIS B 2  432 ? -20.815 152.149 33.946  1.00 46.69  ? 432 HIS B O   1 
ATOM   6535  C  CB  . HIS B 2  432 ? -19.145 152.258 36.317  1.00 55.36  ? 432 HIS B CB  1 
ATOM   6536  C  CG  . HIS B 2  432 ? -18.645 152.357 37.722  1.00 64.57  ? 432 HIS B CG  1 
ATOM   6537  N  ND1 . HIS B 2  432 ? -17.823 153.394 38.128  1.00 71.98  ? 432 HIS B ND1 1 
ATOM   6538  C  CD2 . HIS B 2  432 ? -18.815 151.614 38.832  1.00 66.61  ? 432 HIS B CD2 1 
ATOM   6539  C  CE1 . HIS B 2  432 ? -17.488 153.241 39.395  1.00 77.30  ? 432 HIS B CE1 1 
ATOM   6540  N  NE2 . HIS B 2  432 ? -18.082 152.143 39.851  1.00 74.49  ? 432 HIS B NE2 1 
ATOM   6541  N  N   . THR B 2  433 ? -21.170 149.975 34.121  1.00 43.88  ? 433 THR B N   1 
ATOM   6542  C  CA  . THR B 2  433 ? -21.800 149.883 32.821  1.00 42.15  ? 433 THR B CA  1 
ATOM   6543  C  C   . THR B 2  433 ? -23.311 149.681 32.883  1.00 42.89  ? 433 THR B C   1 
ATOM   6544  O  O   . THR B 2  433 ? -23.842 148.601 33.108  1.00 39.56  ? 433 THR B O   1 
ATOM   6545  C  CB  . THR B 2  433 ? -21.234 148.754 31.940  1.00 40.03  ? 433 THR B CB  1 
ATOM   6546  O  OG1 . THR B 2  433 ? -19.816 148.784 31.923  1.00 25.17  ? 433 THR B OG1 1 
ATOM   6547  C  CG2 . THR B 2  433 ? -21.750 148.867 30.507  1.00 42.96  ? 433 THR B CG2 1 
ATOM   6548  N  N   . PRO B 2  434 ? -24.003 150.747 32.566  1.00 45.99  ? 434 PRO B N   1 
ATOM   6549  C  CA  . PRO B 2  434 ? -25.444 150.737 32.448  1.00 47.63  ? 434 PRO B CA  1 
ATOM   6550  C  C   . PRO B 2  434 ? -25.892 149.397 31.852  1.00 45.68  ? 434 PRO B C   1 
ATOM   6551  O  O   . PRO B 2  434 ? -25.193 148.819 31.033  1.00 38.08  ? 434 PRO B O   1 
ATOM   6552  C  CB  . PRO B 2  434 ? -25.782 151.861 31.445  1.00 50.49  ? 434 PRO B CB  1 
ATOM   6553  C  CG  . PRO B 2  434 ? -24.507 152.651 31.346  1.00 50.77  ? 434 PRO B CG  1 
ATOM   6554  C  CD  . PRO B 2  434 ? -23.419 152.037 32.189  1.00 47.30  ? 434 PRO B CD  1 
ATOM   6555  N  N   . PHE B 2  435 ? -27.035 148.964 32.323  1.00 49.18  ? 435 PHE B N   1 
ATOM   6556  C  CA  . PHE B 2  435 ? -27.837 147.883 31.781  1.00 52.83  ? 435 PHE B CA  1 
ATOM   6557  C  C   . PHE B 2  435 ? -28.933 148.499 30.904  1.00 54.25  ? 435 PHE B C   1 
ATOM   6558  O  O   . PHE B 2  435 ? -29.155 149.717 30.898  1.00 58.71  ? 435 PHE B O   1 
ATOM   6559  C  CB  . PHE B 2  435 ? -28.504 147.163 32.972  1.00 52.97  ? 435 PHE B CB  1 
ATOM   6560  C  CG  . PHE B 2  435 ? -27.633 146.098 33.551  1.00 46.26  ? 435 PHE B CG  1 
ATOM   6561  C  CD1 . PHE B 2  435 ? -26.626 146.354 34.455  1.00 48.84  ? 435 PHE B CD1 1 
ATOM   6562  C  CD2 . PHE B 2  435 ? -27.874 144.804 33.140  1.00 44.13  ? 435 PHE B CD2 1 
ATOM   6563  C  CE1 . PHE B 2  435 ? -25.864 145.315 34.953  1.00 47.50  ? 435 PHE B CE1 1 
ATOM   6564  C  CE2 . PHE B 2  435 ? -27.113 143.767 33.625  1.00 47.56  ? 435 PHE B CE2 1 
ATOM   6565  C  CZ  . PHE B 2  435 ? -26.108 144.024 34.533  1.00 47.99  ? 435 PHE B CZ  1 
ATOM   6566  N  N   . ILE B 2  436 ? -29.701 147.672 30.224  1.00 51.82  ? 436 ILE B N   1 
ATOM   6567  C  CA  . ILE B 2  436 ? -30.852 148.300 29.504  1.00 50.77  ? 436 ILE B CA  1 
ATOM   6568  C  C   . ILE B 2  436 ? -31.646 149.194 30.310  1.00 51.90  ? 436 ILE B C   1 
ATOM   6569  O  O   . ILE B 2  436 ? -31.691 150.378 29.933  1.00 53.23  ? 436 ILE B O   1 
ATOM   6570  C  CB  . ILE B 2  436 ? -31.642 146.966 29.030  1.00 58.02  ? 436 ILE B CB  1 
ATOM   6571  C  CG1 . ILE B 2  436 ? -31.162 145.713 29.782  1.00 57.10  ? 436 ILE B CG1 1 
ATOM   6572  C  CG2 . ILE B 2  436 ? -31.193 146.846 27.556  1.00 53.41  ? 436 ILE B CG2 1 
ATOM   6573  C  CD1 . ILE B 2  436 ? -32.136 145.096 30.751  1.00 54.73  ? 436 ILE B CD1 1 
ATOM   6574  N  N   . ASP B 2  437 ? -32.101 148.868 31.507  1.00 52.40  ? 437 ASP B N   1 
ATOM   6575  C  CA  . ASP B 2  437 ? -32.940 149.732 32.315  1.00 58.77  ? 437 ASP B CA  1 
ATOM   6576  C  C   . ASP B 2  437 ? -32.276 151.007 32.785  1.00 56.19  ? 437 ASP B C   1 
ATOM   6577  O  O   . ASP B 2  437 ? -32.946 151.957 33.300  1.00 62.86  ? 437 ASP B O   1 
ATOM   6578  C  CB  . ASP B 2  437 ? -33.440 148.932 33.530  1.00 72.24  ? 437 ASP B CB  1 
ATOM   6579  C  CG  . ASP B 2  437 ? -33.699 147.485 33.141  1.00 79.74  ? 437 ASP B CG  1 
ATOM   6580  O  OD1 . ASP B 2  437 ? -34.015 147.200 31.966  1.00 86.87  ? 437 ASP B OD1 1 
ATOM   6581  O  OD2 . ASP B 2  437 ? -33.585 146.623 34.039  1.00 78.87  ? 437 ASP B OD2 1 
ATOM   6582  N  N   . GLU B 2  438 ? -30.963 151.037 32.715  1.00 50.14  ? 438 GLU B N   1 
ATOM   6583  C  CA  . GLU B 2  438 ? -30.180 152.161 33.169  1.00 50.93  ? 438 GLU B CA  1 
ATOM   6584  C  C   . GLU B 2  438 ? -30.167 153.339 32.216  1.00 53.27  ? 438 GLU B C   1 
ATOM   6585  O  O   . GLU B 2  438 ? -29.519 154.354 32.501  1.00 53.53  ? 438 GLU B O   1 
ATOM   6586  C  CB  . GLU B 2  438 ? -28.731 151.674 33.281  1.00 57.95  ? 438 GLU B CB  1 
ATOM   6587  C  CG  . GLU B 2  438 ? -28.231 151.521 34.701  1.00 63.80  ? 438 GLU B CG  1 
ATOM   6588  C  CD  . GLU B 2  438 ? -28.568 150.167 35.281  1.00 59.15  ? 438 GLU B CD  1 
ATOM   6589  O  OE1 . GLU B 2  438 ? -29.217 149.371 34.586  1.00 63.49  ? 438 GLU B OE1 1 
ATOM   6590  O  OE2 . GLU B 2  438 ? -28.220 149.887 36.440  1.00 57.87  ? 438 GLU B OE2 1 
ATOM   6591  N  N   . LEU B 2  439 ? -30.620 153.139 30.981  1.00 54.73  ? 439 LEU B N   1 
ATOM   6592  C  CA  . LEU B 2  439 ? -30.445 154.227 30.017  1.00 60.80  ? 439 LEU B CA  1 
ATOM   6593  C  C   . LEU B 2  439 ? -31.710 154.701 29.355  1.00 64.10  ? 439 LEU B C   1 
ATOM   6594  O  O   . LEU B 2  439 ? -31.893 155.911 29.081  1.00 66.99  ? 439 LEU B O   1 
ATOM   6595  C  CB  . LEU B 2  439 ? -29.369 153.755 29.034  1.00 66.73  ? 439 LEU B CB  1 
ATOM   6596  C  CG  . LEU B 2  439 ? -27.950 153.723 29.630  1.00 72.36  ? 439 LEU B CG  1 
ATOM   6597  C  CD1 . LEU B 2  439 ? -26.982 153.071 28.660  1.00 73.26  ? 439 LEU B CD1 1 
ATOM   6598  C  CD2 . LEU B 2  439 ? -27.511 155.129 29.996  1.00 74.26  ? 439 LEU B CD2 1 
ATOM   6599  O  OXT . LEU B 2  439 ? -32.579 153.875 29.080  1.00 66.99  ? 439 LEU B OXT 1 
ATOM   6600  N  N   . MET C 3  1   ? 13.683  118.582 14.823  1.00 75.90  ? 1   MET C N   1 
ATOM   6601  C  CA  . MET C 3  1   ? 15.077  118.555 14.319  1.00 74.21  ? 1   MET C CA  1 
ATOM   6602  C  C   . MET C 3  1   ? 15.211  117.845 12.982  1.00 74.84  ? 1   MET C C   1 
ATOM   6603  O  O   . MET C 3  1   ? 14.657  116.764 12.783  1.00 77.85  ? 1   MET C O   1 
ATOM   6604  C  CB  . MET C 3  1   ? 15.994  117.835 15.331  1.00 69.54  ? 1   MET C CB  1 
ATOM   6605  C  CG  . MET C 3  1   ? 17.406  117.730 14.772  1.00 74.86  ? 1   MET C CG  1 
ATOM   6606  S  SD  . MET C 3  1   ? 18.714  117.501 15.962  1.00 84.34  ? 1   MET C SD  1 
ATOM   6607  C  CE  . MET C 3  1   ? 18.338  118.790 17.160  1.00 84.32  ? 1   MET C CE  1 
ATOM   6608  N  N   . THR C 3  2   ? 16.006  118.398 12.081  1.00 75.64  ? 2   THR C N   1 
ATOM   6609  C  CA  . THR C 3  2   ? 16.478  117.681 10.917  1.00 77.36  ? 2   THR C CA  1 
ATOM   6610  C  C   . THR C 3  2   ? 17.905  118.154 10.612  1.00 77.75  ? 2   THR C C   1 
ATOM   6611  O  O   . THR C 3  2   ? 18.212  119.340 10.712  1.00 77.57  ? 2   THR C O   1 
ATOM   6612  C  CB  . THR C 3  2   ? 15.661  117.915 9.641   1.00 83.38  ? 2   THR C CB  1 
ATOM   6613  O  OG1 . THR C 3  2   ? 14.271  117.972 9.962   1.00 87.19  ? 2   THR C OG1 1 
ATOM   6614  C  CG2 . THR C 3  2   ? 15.935  116.787 8.643   1.00 85.40  ? 2   THR C CG2 1 
ATOM   6615  N  N   . ASN C 3  3   ? 18.737  117.183 10.285  1.00 76.96  ? 3   ASN C N   1 
ATOM   6616  C  CA  . ASN C 3  3   ? 20.123  117.451 9.930   1.00 75.33  ? 3   ASN C CA  1 
ATOM   6617  C  C   . ASN C 3  3   ? 20.864  118.318 10.922  1.00 72.58  ? 3   ASN C C   1 
ATOM   6618  O  O   . ASN C 3  3   ? 21.966  118.798 10.622  1.00 73.75  ? 3   ASN C O   1 
ATOM   6619  C  CB  . ASN C 3  3   ? 20.178  117.937 8.490   1.00 78.05  ? 3   ASN C CB  1 
ATOM   6620  C  CG  . ASN C 3  3   ? 19.475  116.987 7.529   1.00 80.98  ? 3   ASN C CG  1 
ATOM   6621  O  OD1 . ASN C 3  3   ? 19.711  115.778 7.520   1.00 81.20  ? 3   ASN C OD1 1 
ATOM   6622  N  ND2 . ASN C 3  3   ? 18.592  117.547 6.705   1.00 81.48  ? 3   ASN C ND2 1 
ATOM   6623  N  N   . ILE C 3  4   ? 20.474  118.332 12.202  1.00 69.37  ? 4   ILE C N   1 
ATOM   6624  C  CA  . ILE C 3  4   ? 21.351  118.830 13.257  1.00 65.19  ? 4   ILE C CA  1 
ATOM   6625  C  C   . ILE C 3  4   ? 22.253  117.667 13.687  1.00 61.83  ? 4   ILE C C   1 
ATOM   6626  O  O   . ILE C 3  4   ? 21.980  116.822 14.531  1.00 59.76  ? 4   ILE C O   1 
ATOM   6627  C  CB  . ILE C 3  4   ? 20.659  119.374 14.501  1.00 66.75  ? 4   ILE C CB  1 
ATOM   6628  C  CG1 . ILE C 3  4   ? 20.038  120.735 14.214  1.00 71.16  ? 4   ILE C CG1 1 
ATOM   6629  C  CG2 . ILE C 3  4   ? 21.630  119.411 15.673  1.00 63.60  ? 4   ILE C CG2 1 
ATOM   6630  C  CD1 . ILE C 3  4   ? 20.857  121.919 14.673  1.00 72.61  ? 4   ILE C CD1 1 
ATOM   6631  N  N   . ARG C 3  5   ? 23.378  117.607 12.992  1.00 59.49  ? 5   ARG C N   1 
ATOM   6632  C  CA  . ARG C 3  5   ? 24.362  116.563 13.180  1.00 55.75  ? 5   ARG C CA  1 
ATOM   6633  C  C   . ARG C 3  5   ? 24.377  116.063 14.609  1.00 52.89  ? 5   ARG C C   1 
ATOM   6634  O  O   . ARG C 3  5   ? 24.269  114.858 14.829  1.00 56.32  ? 5   ARG C O   1 
ATOM   6635  C  CB  . ARG C 3  5   ? 25.730  117.056 12.707  1.00 55.13  ? 5   ARG C CB  1 
ATOM   6636  C  CG  . ARG C 3  5   ? 25.651  118.085 11.582  1.00 54.28  ? 5   ARG C CG  1 
ATOM   6637  C  CD  . ARG C 3  5   ? 26.708  117.747 10.543  1.00 63.37  ? 5   ARG C CD  1 
ATOM   6638  N  NE  . ARG C 3  5   ? 26.381  118.295 9.227   1.00 70.74  ? 5   ARG C NE  1 
ATOM   6639  C  CZ  . ARG C 3  5   ? 27.310  118.703 8.363   1.00 68.99  ? 5   ARG C CZ  1 
ATOM   6640  N  NH1 . ARG C 3  5   ? 28.602  118.639 8.656   1.00 72.25  ? 5   ARG C NH1 1 
ATOM   6641  N  NH2 . ARG C 3  5   ? 26.905  119.175 7.201   1.00 65.75  ? 5   ARG C NH2 1 
ATOM   6642  N  N   . LYS C 3  6   ? 24.504  116.952 15.582  1.00 48.89  ? 6   LYS C N   1 
ATOM   6643  C  CA  . LYS C 3  6   ? 24.736  116.542 16.955  1.00 49.74  ? 6   LYS C CA  1 
ATOM   6644  C  C   . LYS C 3  6   ? 23.617  115.693 17.512  1.00 52.54  ? 6   LYS C C   1 
ATOM   6645  O  O   . LYS C 3  6   ? 23.855  114.594 18.039  1.00 63.67  ? 6   LYS C O   1 
ATOM   6646  C  CB  . LYS C 3  6   ? 24.967  117.766 17.828  1.00 45.89  ? 6   LYS C CB  1 
ATOM   6647  C  CG  . LYS C 3  6   ? 26.021  118.689 17.216  1.00 46.77  ? 6   LYS C CG  1 
ATOM   6648  C  CD  . LYS C 3  6   ? 25.516  120.113 17.053  1.00 51.16  ? 6   LYS C CD  1 
ATOM   6649  C  CE  . LYS C 3  6   ? 26.566  121.131 17.453  1.00 45.04  ? 6   LYS C CE  1 
ATOM   6650  N  NZ  . LYS C 3  6   ? 25.998  122.235 18.280  1.00 44.67  ? 6   LYS C NZ  1 
ATOM   6651  N  N   . SER C 3  7   ? 22.381  116.173 17.358  1.00 50.37  ? 7   SER C N   1 
ATOM   6652  C  CA  . SER C 3  7   ? 21.273  115.346 17.822  1.00 47.32  ? 7   SER C CA  1 
ATOM   6653  C  C   . SER C 3  7   ? 20.883  114.170 16.939  1.00 46.24  ? 7   SER C C   1 
ATOM   6654  O  O   . SER C 3  7   ? 20.463  113.162 17.534  1.00 32.89  ? 7   SER C O   1 
ATOM   6655  C  CB  . SER C 3  7   ? 20.057  116.128 18.262  1.00 51.59  ? 7   SER C CB  1 
ATOM   6656  O  OG  . SER C 3  7   ? 20.356  116.701 19.536  1.00 41.17  ? 7   SER C OG  1 
ATOM   6657  N  N   . HIS C 3  8   ? 20.938  114.248 15.617  1.00 50.61  ? 8   HIS C N   1 
ATOM   6658  C  CA  . HIS C 3  8   ? 20.815  113.099 14.705  1.00 58.31  ? 8   HIS C CA  1 
ATOM   6659  C  C   . HIS C 3  8   ? 21.411  111.852 15.320  1.00 58.10  ? 8   HIS C C   1 
ATOM   6660  O  O   . HIS C 3  8   ? 20.727  111.281 16.201  1.00 61.02  ? 8   HIS C O   1 
ATOM   6661  C  CB  . HIS C 3  8   ? 21.375  113.386 13.311  1.00 68.41  ? 8   HIS C CB  1 
ATOM   6662  C  CG  . HIS C 3  8   ? 20.317  114.022 12.461  1.00 75.14  ? 8   HIS C CG  1 
ATOM   6663  N  ND1 . HIS C 3  8   ? 19.208  113.336 12.003  1.00 79.46  ? 8   HIS C ND1 1 
ATOM   6664  C  CD2 . HIS C 3  8   ? 20.181  115.285 12.036  1.00 76.03  ? 8   HIS C CD2 1 
ATOM   6665  C  CE1 . HIS C 3  8   ? 18.439  114.152 11.301  1.00 76.18  ? 8   HIS C CE1 1 
ATOM   6666  N  NE2 . HIS C 3  8   ? 19.010  115.333 11.317  1.00 75.61  ? 8   HIS C NE2 1 
ATOM   6667  N  N   . PRO C 3  9   ? 22.615  111.407 15.016  1.00 54.92  ? 9   PRO C N   1 
ATOM   6668  C  CA  . PRO C 3  9   ? 23.169  110.258 15.744  1.00 52.15  ? 9   PRO C CA  1 
ATOM   6669  C  C   . PRO C 3  9   ? 22.937  110.512 17.239  1.00 48.25  ? 9   PRO C C   1 
ATOM   6670  O  O   . PRO C 3  9   ? 22.977  111.666 17.699  1.00 37.77  ? 9   PRO C O   1 
ATOM   6671  C  CB  . PRO C 3  9   ? 24.678  110.176 15.403  1.00 50.19  ? 9   PRO C CB  1 
ATOM   6672  C  CG  . PRO C 3  9   ? 24.775  111.000 14.160  1.00 52.51  ? 9   PRO C CG  1 
ATOM   6673  C  CD  . PRO C 3  9   ? 23.570  111.900 14.042  1.00 53.52  ? 9   PRO C CD  1 
ATOM   6674  N  N   . LEU C 3  10  ? 22.516  109.459 17.962  1.00 41.73  ? 10  LEU C N   1 
ATOM   6675  C  CA  . LEU C 3  10  ? 22.401  109.612 19.402  1.00 41.68  ? 10  LEU C CA  1 
ATOM   6676  C  C   . LEU C 3  10  ? 23.790  109.709 20.047  1.00 40.24  ? 10  LEU C C   1 
ATOM   6677  O  O   . LEU C 3  10  ? 24.001  110.349 21.068  1.00 40.19  ? 10  LEU C O   1 
ATOM   6678  C  CB  . LEU C 3  10  ? 21.721  108.437 20.099  1.00 46.54  ? 10  LEU C CB  1 
ATOM   6679  C  CG  . LEU C 3  10  ? 20.989  108.735 21.422  1.00 45.32  ? 10  LEU C CG  1 
ATOM   6680  C  CD1 . LEU C 3  10  ? 20.065  109.943 21.277  1.00 31.87  ? 10  LEU C CD1 1 
ATOM   6681  C  CD2 . LEU C 3  10  ? 20.227  107.545 22.006  1.00 47.83  ? 10  LEU C CD2 1 
ATOM   6682  N  N   . MET C 3  11  ? 24.723  108.976 19.478  1.00 38.81  ? 11  MET C N   1 
ATOM   6683  C  CA  . MET C 3  11  ? 26.094  108.901 19.974  1.00 38.97  ? 11  MET C CA  1 
ATOM   6684  C  C   . MET C 3  11  ? 26.745  110.270 19.929  1.00 37.36  ? 11  MET C C   1 
ATOM   6685  O  O   . MET C 3  11  ? 27.456  110.722 20.819  1.00 39.73  ? 11  MET C O   1 
ATOM   6686  C  CB  . MET C 3  11  ? 26.853  107.962 19.029  1.00 47.08  ? 11  MET C CB  1 
ATOM   6687  C  CG  . MET C 3  11  ? 27.453  106.745 19.703  1.00 49.24  ? 11  MET C CG  1 
ATOM   6688  S  SD  . MET C 3  11  ? 29.247  106.926 19.693  1.00 59.66  ? 11  MET C SD  1 
ATOM   6689  C  CE  . MET C 3  11  ? 29.552  106.829 17.929  1.00 61.65  ? 11  MET C CE  1 
ATOM   6690  N  N   . LYS C 3  12  ? 26.491  110.963 18.819  1.00 36.46  ? 12  LYS C N   1 
ATOM   6691  C  CA  . LYS C 3  12  ? 27.049  112.303 18.683  1.00 36.40  ? 12  LYS C CA  1 
ATOM   6692  C  C   . LYS C 3  12  ? 26.468  113.340 19.618  1.00 29.95  ? 12  LYS C C   1 
ATOM   6693  O  O   . LYS C 3  12  ? 27.112  114.339 19.949  1.00 33.27  ? 12  LYS C O   1 
ATOM   6694  C  CB  . LYS C 3  12  ? 26.937  112.806 17.247  1.00 47.34  ? 12  LYS C CB  1 
ATOM   6695  C  CG  . LYS C 3  12  ? 28.267  112.859 16.502  1.00 55.50  ? 12  LYS C CG  1 
ATOM   6696  C  CD  . LYS C 3  12  ? 28.127  113.063 15.012  1.00 57.33  ? 12  LYS C CD  1 
ATOM   6697  C  CE  . LYS C 3  12  ? 29.033  112.198 14.147  1.00 61.64  ? 12  LYS C CE  1 
ATOM   6698  N  NZ  . LYS C 3  12  ? 28.630  112.210 12.704  1.00 59.12  ? 12  LYS C NZ  1 
ATOM   6699  N  N   . ILE C 3  13  ? 25.214  113.188 20.023  1.00 24.54  ? 13  ILE C N   1 
ATOM   6700  C  CA  . ILE C 3  13  ? 24.671  114.042 21.063  1.00 17.74  ? 13  ILE C CA  1 
ATOM   6701  C  C   . ILE C 3  13  ? 25.456  113.879 22.363  1.00 17.03  ? 13  ILE C C   1 
ATOM   6702  O  O   . ILE C 3  13  ? 25.636  114.882 23.036  1.00 20.36  ? 13  ILE C O   1 
ATOM   6703  C  CB  . ILE C 3  13  ? 23.231  113.669 21.451  1.00 17.71  ? 13  ILE C CB  1 
ATOM   6704  C  CG1 . ILE C 3  13  ? 22.437  113.157 20.257  1.00 33.39  ? 13  ILE C CG1 1 
ATOM   6705  C  CG2 . ILE C 3  13  ? 22.602  114.901 22.059  1.00 24.59  ? 13  ILE C CG2 1 
ATOM   6706  C  CD1 . ILE C 3  13  ? 21.004  112.820 20.657  1.00 46.45  ? 13  ILE C CD1 1 
ATOM   6707  N  N   . VAL C 3  14  ? 25.877  112.659 22.676  1.00 13.11  ? 14  VAL C N   1 
ATOM   6708  C  CA  . VAL C 3  14  ? 26.549  112.354 23.920  1.00 11.61  ? 14  VAL C CA  1 
ATOM   6709  C  C   . VAL C 3  14  ? 27.862  113.117 24.013  1.00 17.19  ? 14  VAL C C   1 
ATOM   6710  O  O   . VAL C 3  14  ? 28.336  113.465 25.096  1.00 18.52  ? 14  VAL C O   1 
ATOM   6711  C  CB  . VAL C 3  14  ? 26.770  110.849 24.086  1.00 7.36   ? 14  VAL C CB  1 
ATOM   6712  C  CG1 . VAL C 3  14  ? 27.920  110.569 25.052  1.00 7.52   ? 14  VAL C CG1 1 
ATOM   6713  C  CG2 . VAL C 3  14  ? 25.546  110.019 24.384  1.00 9.33   ? 14  VAL C CG2 1 
ATOM   6714  N  N   . ASN C 3  15  ? 28.438  113.521 22.897  1.00 24.36  ? 15  ASN C N   1 
ATOM   6715  C  CA  . ASN C 3  15  ? 29.651  114.311 22.785  1.00 27.59  ? 15  ASN C CA  1 
ATOM   6716  C  C   . ASN C 3  15  ? 29.482  115.816 22.929  1.00 27.53  ? 15  ASN C C   1 
ATOM   6717  O  O   . ASN C 3  15  ? 30.465  116.532 23.131  1.00 24.36  ? 15  ASN C O   1 
ATOM   6718  C  CB  . ASN C 3  15  ? 30.299  114.070 21.411  1.00 35.00  ? 15  ASN C CB  1 
ATOM   6719  C  CG  . ASN C 3  15  ? 31.780  114.369 21.441  1.00 42.30  ? 15  ASN C CG  1 
ATOM   6720  O  OD1 . ASN C 3  15  ? 32.364  114.895 20.498  1.00 50.20  ? 15  ASN C OD1 1 
ATOM   6721  N  ND2 . ASN C 3  15  ? 32.383  114.012 22.569  1.00 52.60  ? 15  ASN C ND2 1 
ATOM   6722  N  N   . ASN C 3  16  ? 28.247  116.314 22.858  1.00 28.17  ? 16  ASN C N   1 
ATOM   6723  C  CA  . ASN C 3  16  ? 27.999  117.726 23.064  1.00 30.51  ? 16  ASN C CA  1 
ATOM   6724  C  C   . ASN C 3  16  ? 28.257  118.176 24.496  1.00 33.86  ? 16  ASN C C   1 
ATOM   6725  O  O   . ASN C 3  16  ? 28.172  119.364 24.808  1.00 35.13  ? 16  ASN C O   1 
ATOM   6726  C  CB  . ASN C 3  16  ? 26.559  118.098 22.700  1.00 29.43  ? 16  ASN C CB  1 
ATOM   6727  C  CG  . ASN C 3  16  ? 26.588  118.639 21.274  1.00 31.25  ? 16  ASN C CG  1 
ATOM   6728  O  OD1 . ASN C 3  16  ? 27.087  117.916 20.408  1.00 41.53  ? 16  ASN C OD1 1 
ATOM   6729  N  ND2 . ASN C 3  16  ? 26.103  119.835 21.054  1.00 15.09  ? 16  ASN C ND2 1 
ATOM   6730  N  N   . ALA C 3  17  ? 28.589  117.241 25.363  1.00 35.22  ? 17  ALA C N   1 
ATOM   6731  C  CA  . ALA C 3  17  ? 29.121  117.364 26.696  1.00 27.40  ? 17  ALA C CA  1 
ATOM   6732  C  C   . ALA C 3  17  ? 30.419  118.194 26.739  1.00 25.05  ? 17  ALA C C   1 
ATOM   6733  O  O   . ALA C 3  17  ? 30.811  118.664 27.802  1.00 23.11  ? 17  ALA C O   1 
ATOM   6734  C  CB  . ALA C 3  17  ? 29.536  115.968 27.191  1.00 16.58  ? 17  ALA C CB  1 
ATOM   6735  N  N   . PHE C 3  18  ? 31.114  118.264 25.616  1.00 21.33  ? 18  PHE C N   1 
ATOM   6736  C  CA  . PHE C 3  18  ? 32.284  119.098 25.434  1.00 19.71  ? 18  PHE C CA  1 
ATOM   6737  C  C   . PHE C 3  18  ? 32.053  120.337 24.580  1.00 14.20  ? 18  PHE C C   1 
ATOM   6738  O  O   . PHE C 3  18  ? 32.959  121.164 24.355  1.00 9.38   ? 18  PHE C O   1 
ATOM   6739  C  CB  . PHE C 3  18  ? 33.445  118.265 24.856  1.00 36.30  ? 18  PHE C CB  1 
ATOM   6740  C  CG  . PHE C 3  18  ? 33.758  117.053 25.686  1.00 43.92  ? 18  PHE C CG  1 
ATOM   6741  C  CD1 . PHE C 3  18  ? 32.986  115.910 25.570  1.00 50.26  ? 18  PHE C CD1 1 
ATOM   6742  C  CD2 . PHE C 3  18  ? 34.797  117.061 26.597  1.00 48.62  ? 18  PHE C CD2 1 
ATOM   6743  C  CE1 . PHE C 3  18  ? 33.253  114.799 26.347  1.00 58.40  ? 18  PHE C CE1 1 
ATOM   6744  C  CE2 . PHE C 3  18  ? 35.073  115.956 27.378  1.00 53.89  ? 18  PHE C CE2 1 
ATOM   6745  C  CZ  . PHE C 3  18  ? 34.298  114.814 27.258  1.00 57.63  ? 18  PHE C CZ  1 
ATOM   6746  N  N   . ILE C 3  19  ? 30.830  120.602 24.125  1.00 2.43   ? 19  ILE C N   1 
ATOM   6747  C  CA  . ILE C 3  19  ? 30.563  121.807 23.354  1.00 4.97   ? 19  ILE C CA  1 
ATOM   6748  C  C   . ILE C 3  19  ? 29.523  122.749 23.958  1.00 4.84   ? 19  ILE C C   1 
ATOM   6749  O  O   . ILE C 3  19  ? 29.814  123.921 24.164  1.00 2.61   ? 19  ILE C O   1 
ATOM   6750  C  CB  . ILE C 3  19  ? 30.000  121.387 21.971  1.00 2.80   ? 19  ILE C CB  1 
ATOM   6751  C  CG1 . ILE C 3  19  ? 31.009  120.588 21.186  1.00 2.20   ? 19  ILE C CG1 1 
ATOM   6752  C  CG2 . ILE C 3  19  ? 29.578  122.613 21.197  1.00 5.07   ? 19  ILE C CG2 1 
ATOM   6753  C  CD1 . ILE C 3  19  ? 30.380  119.575 20.269  1.00 3.81   ? 19  ILE C CD1 1 
ATOM   6754  N  N   . ASP C 3  20  ? 28.272  122.327 24.011  1.00 2.58   ? 20  ASP C N   1 
ATOM   6755  C  CA  . ASP C 3  20  ? 27.104  123.057 24.427  1.00 7.83   ? 20  ASP C CA  1 
ATOM   6756  C  C   . ASP C 3  20  ? 26.836  122.955 25.908  1.00 6.85   ? 20  ASP C C   1 
ATOM   6757  O  O   . ASP C 3  20  ? 25.760  123.322 26.369  1.00 9.84   ? 20  ASP C O   1 
ATOM   6758  C  CB  . ASP C 3  20  ? 25.877  122.621 23.601  1.00 18.95  ? 20  ASP C CB  1 
ATOM   6759  C  CG  . ASP C 3  20  ? 26.063  122.897 22.127  1.00 34.36  ? 20  ASP C CG  1 
ATOM   6760  O  OD1 . ASP C 3  20  ? 26.951  123.732 21.831  1.00 44.46  ? 20  ASP C OD1 1 
ATOM   6761  O  OD2 . ASP C 3  20  ? 25.375  122.309 21.271  1.00 41.48  ? 20  ASP C OD2 1 
ATOM   6762  N  N   . LEU C 3  21  ? 27.714  122.492 26.743  1.00 2.20   ? 21  LEU C N   1 
ATOM   6763  C  CA  . LEU C 3  21  ? 27.653  122.332 28.130  1.00 4.14   ? 21  LEU C CA  1 
ATOM   6764  C  C   . LEU C 3  21  ? 27.827  123.712 28.762  1.00 3.65   ? 21  LEU C C   1 
ATOM   6765  O  O   . LEU C 3  21  ? 28.916  124.265 28.661  1.00 2.47   ? 21  LEU C O   1 
ATOM   6766  C  CB  . LEU C 3  21  ? 28.797  121.447 28.677  1.00 8.25   ? 21  LEU C CB  1 
ATOM   6767  C  CG  . LEU C 3  21  ? 28.619  120.958 30.111  1.00 15.43  ? 21  LEU C CG  1 
ATOM   6768  C  CD1 . LEU C 3  21  ? 27.505  119.895 30.189  1.00 36.46  ? 21  LEU C CD1 1 
ATOM   6769  C  CD2 . LEU C 3  21  ? 29.962  120.408 30.522  1.00 6.01   ? 21  LEU C CD2 1 
ATOM   6770  N  N   . PRO C 3  22  ? 26.917  124.015 29.642  1.00 2.42   ? 22  PRO C N   1 
ATOM   6771  C  CA  . PRO C 3  22  ? 27.036  125.252 30.424  1.00 2.70   ? 22  PRO C CA  1 
ATOM   6772  C  C   . PRO C 3  22  ? 28.257  125.223 31.335  1.00 5.02   ? 22  PRO C C   1 
ATOM   6773  O  O   . PRO C 3  22  ? 28.419  124.286 32.110  1.00 6.94   ? 22  PRO C O   1 
ATOM   6774  C  CB  . PRO C 3  22  ? 25.711  125.430 31.171  1.00 3.67   ? 22  PRO C CB  1 
ATOM   6775  C  CG  . PRO C 3  22  ? 24.845  124.469 30.441  1.00 2.20   ? 22  PRO C CG  1 
ATOM   6776  C  CD  . PRO C 3  22  ? 25.534  123.563 29.595  1.00 2.20   ? 22  PRO C CD  1 
ATOM   6777  N  N   . ALA C 3  23  ? 29.133  126.212 31.160  1.00 2.20   ? 23  ALA C N   1 
ATOM   6778  C  CA  . ALA C 3  23  ? 30.423  126.277 31.860  1.00 2.35   ? 23  ALA C CA  1 
ATOM   6779  C  C   . ALA C 3  23  ? 30.523  127.613 32.604  1.00 5.69   ? 23  ALA C C   1 
ATOM   6780  O  O   . ALA C 3  23  ? 30.264  128.661 32.002  1.00 8.82   ? 23  ALA C O   1 
ATOM   6781  C  CB  . ALA C 3  23  ? 31.565  126.015 30.905  1.00 5.09   ? 23  ALA C CB  1 
ATOM   6782  N  N   . PRO C 3  24  ? 30.787  127.585 33.870  1.00 4.15   ? 24  PRO C N   1 
ATOM   6783  C  CA  . PRO C 3  24  ? 30.953  128.795 34.663  1.00 3.95   ? 24  PRO C CA  1 
ATOM   6784  C  C   . PRO C 3  24  ? 31.890  129.714 33.920  1.00 3.09   ? 24  PRO C C   1 
ATOM   6785  O  O   . PRO C 3  24  ? 32.866  129.319 33.292  1.00 4.63   ? 24  PRO C O   1 
ATOM   6786  C  CB  . PRO C 3  24  ? 31.528  128.335 36.018  1.00 2.47   ? 24  PRO C CB  1 
ATOM   6787  C  CG  . PRO C 3  24  ? 31.108  126.879 36.057  1.00 4.83   ? 24  PRO C CG  1 
ATOM   6788  C  CD  . PRO C 3  24  ? 31.176  126.392 34.628  1.00 3.45   ? 24  PRO C CD  1 
ATOM   6789  N  N   . SER C 3  25  ? 31.603  130.987 33.953  1.00 2.40   ? 25  SER C N   1 
ATOM   6790  C  CA  . SER C 3  25  ? 32.418  132.064 33.405  1.00 2.20   ? 25  SER C CA  1 
ATOM   6791  C  C   . SER C 3  25  ? 33.692  132.196 34.267  1.00 5.39   ? 25  SER C C   1 
ATOM   6792  O  O   . SER C 3  25  ? 34.766  131.824 33.846  1.00 3.48   ? 25  SER C O   1 
ATOM   6793  C  CB  . SER C 3  25  ? 31.705  133.424 33.538  1.00 5.76   ? 25  SER C CB  1 
ATOM   6794  O  OG  . SER C 3  25  ? 30.396  133.313 33.959  1.00 4.49   ? 25  SER C OG  1 
ATOM   6795  N  N   . ASN C 3  26  ? 33.528  132.747 35.463  1.00 3.31   ? 26  ASN C N   1 
ATOM   6796  C  CA  . ASN C 3  26  ? 34.665  132.952 36.377  1.00 7.01   ? 26  ASN C CA  1 
ATOM   6797  C  C   . ASN C 3  26  ? 35.258  131.580 36.619  1.00 6.83   ? 26  ASN C C   1 
ATOM   6798  O  O   . ASN C 3  26  ? 34.395  130.692 36.608  1.00 13.71  ? 26  ASN C O   1 
ATOM   6799  C  CB  . ASN C 3  26  ? 34.090  133.543 37.660  1.00 5.38   ? 26  ASN C CB  1 
ATOM   6800  C  CG  . ASN C 3  26  ? 33.279  132.486 38.360  1.00 5.93   ? 26  ASN C CG  1 
ATOM   6801  O  OD1 . ASN C 3  26  ? 32.062  132.395 38.324  1.00 14.34  ? 26  ASN C OD1 1 
ATOM   6802  N  ND2 . ASN C 3  26  ? 34.015  131.618 39.014  1.00 14.81  ? 26  ASN C ND2 1 
ATOM   6803  N  N   . ILE C 3  27  ? 36.563  131.339 36.703  1.00 3.83   ? 27  ILE C N   1 
ATOM   6804  C  CA  . ILE C 3  27  ? 37.027  129.925 36.789  1.00 10.82  ? 27  ILE C CA  1 
ATOM   6805  C  C   . ILE C 3  27  ? 38.545  129.873 36.745  1.00 16.35  ? 27  ILE C C   1 
ATOM   6806  O  O   . ILE C 3  27  ? 39.195  130.123 35.721  1.00 21.38  ? 27  ILE C O   1 
ATOM   6807  C  CB  . ILE C 3  27  ? 36.421  129.171 35.603  1.00 7.82   ? 27  ILE C CB  1 
ATOM   6808  C  CG1 . ILE C 3  27  ? 35.416  128.127 36.040  1.00 2.20   ? 27  ILE C CG1 1 
ATOM   6809  C  CG2 . ILE C 3  27  ? 37.471  128.625 34.670  1.00 15.23  ? 27  ILE C CG2 1 
ATOM   6810  C  CD1 . ILE C 3  27  ? 35.450  126.870 35.176  1.00 8.43   ? 27  ILE C CD1 1 
ATOM   6811  N  N   . SER C 3  28  ? 39.169  129.737 37.917  1.00 20.50  ? 28  SER C N   1 
ATOM   6812  C  CA  . SER C 3  28  ? 40.626  129.869 38.042  1.00 16.36  ? 28  SER C CA  1 
ATOM   6813  C  C   . SER C 3  28  ? 41.282  129.073 36.930  1.00 15.72  ? 28  SER C C   1 
ATOM   6814  O  O   . SER C 3  28  ? 40.633  128.278 36.248  1.00 14.05  ? 28  SER C O   1 
ATOM   6815  C  CB  . SER C 3  28  ? 41.133  129.379 39.392  1.00 20.22  ? 28  SER C CB  1 
ATOM   6816  O  OG  . SER C 3  28  ? 41.086  130.340 40.434  1.00 24.68  ? 28  SER C OG  1 
ATOM   6817  N  N   . SER C 3  29  ? 42.610  129.190 36.817  1.00 15.37  ? 29  SER C N   1 
ATOM   6818  C  CA  . SER C 3  29  ? 43.283  128.286 35.874  1.00 10.61  ? 29  SER C CA  1 
ATOM   6819  C  C   . SER C 3  29  ? 43.458  126.943 36.575  1.00 2.40   ? 29  SER C C   1 
ATOM   6820  O  O   . SER C 3  29  ? 43.900  125.963 35.962  1.00 4.33   ? 29  SER C O   1 
ATOM   6821  C  CB  . SER C 3  29  ? 44.678  128.801 35.498  1.00 3.75   ? 29  SER C CB  1 
ATOM   6822  O  OG  . SER C 3  29  ? 45.554  128.278 36.496  1.00 12.03  ? 29  SER C OG  1 
ATOM   6823  N  N   . TRP C 3  30  ? 43.101  126.803 37.858  1.00 7.04   ? 30  TRP C N   1 
ATOM   6824  C  CA  . TRP C 3  30  ? 43.192  125.440 38.380  1.00 7.32   ? 30  TRP C CA  1 
ATOM   6825  C  C   . TRP C 3  30  ? 42.046  124.560 37.926  1.00 5.24   ? 30  TRP C C   1 
ATOM   6826  O  O   . TRP C 3  30  ? 41.544  123.737 38.697  1.00 3.93   ? 30  TRP C O   1 
ATOM   6827  C  CB  . TRP C 3  30  ? 43.120  125.431 39.885  1.00 8.48   ? 30  TRP C CB  1 
ATOM   6828  C  CG  . TRP C 3  30  ? 44.054  126.332 40.591  1.00 6.58   ? 30  TRP C CG  1 
ATOM   6829  C  CD1 . TRP C 3  30  ? 43.827  127.642 40.864  1.00 2.20   ? 30  TRP C CD1 1 
ATOM   6830  C  CD2 . TRP C 3  30  ? 45.333  125.985 41.134  1.00 5.22   ? 30  TRP C CD2 1 
ATOM   6831  N  NE1 . TRP C 3  30  ? 44.896  128.143 41.557  1.00 7.92   ? 30  TRP C NE1 1 
ATOM   6832  C  CE2 . TRP C 3  30  ? 45.824  127.156 41.733  1.00 3.70   ? 30  TRP C CE2 1 
ATOM   6833  C  CE3 . TRP C 3  30  ? 46.107  124.820 41.193  1.00 6.51   ? 30  TRP C CE3 1 
ATOM   6834  C  CZ2 . TRP C 3  30  ? 47.062  127.208 42.364  1.00 3.25   ? 30  TRP C CZ2 1 
ATOM   6835  C  CZ3 . TRP C 3  30  ? 47.339  124.868 41.820  1.00 3.86   ? 30  TRP C CZ3 1 
ATOM   6836  C  CH2 . TRP C 3  30  ? 47.789  126.059 42.389  1.00 2.27   ? 30  TRP C CH2 1 
ATOM   6837  N  N   . TRP C 3  31  ? 41.435  124.824 36.772  1.00 7.03   ? 31  TRP C N   1 
ATOM   6838  C  CA  . TRP C 3  31  ? 40.338  123.946 36.366  1.00 6.57   ? 31  TRP C CA  1 
ATOM   6839  C  C   . TRP C 3  31  ? 40.724  123.132 35.149  1.00 7.25   ? 31  TRP C C   1 
ATOM   6840  O  O   . TRP C 3  31  ? 39.978  122.229 34.760  1.00 11.89  ? 31  TRP C O   1 
ATOM   6841  C  CB  . TRP C 3  31  ? 39.034  124.651 36.166  1.00 3.14   ? 31  TRP C CB  1 
ATOM   6842  C  CG  . TRP C 3  31  ? 38.101  124.600 37.333  1.00 4.50   ? 31  TRP C CG  1 
ATOM   6843  C  CD1 . TRP C 3  31  ? 37.027  123.747 37.384  1.00 13.50  ? 31  TRP C CD1 1 
ATOM   6844  C  CD2 . TRP C 3  31  ? 38.063  125.354 38.534  1.00 7.84   ? 31  TRP C CD2 1 
ATOM   6845  N  NE1 . TRP C 3  31  ? 36.331  123.907 38.556  1.00 12.03  ? 31  TRP C NE1 1 
ATOM   6846  C  CE2 . TRP C 3  31  ? 36.951  124.898 39.269  1.00 9.70   ? 31  TRP C CE2 1 
ATOM   6847  C  CE3 . TRP C 3  31  ? 38.867  126.339 39.102  1.00 7.16   ? 31  TRP C CE3 1 
ATOM   6848  C  CZ2 . TRP C 3  31  ? 36.608  125.405 40.517  1.00 13.03  ? 31  TRP C CZ2 1 
ATOM   6849  C  CZ3 . TRP C 3  31  ? 38.514  126.842 40.340  1.00 13.56  ? 31  TRP C CZ3 1 
ATOM   6850  C  CH2 . TRP C 3  31  ? 37.392  126.391 41.048  1.00 5.23   ? 31  TRP C CH2 1 
ATOM   6851  N  N   . ASN C 3  32  ? 41.946  123.360 34.682  1.00 2.88   ? 32  ASN C N   1 
ATOM   6852  C  CA  . ASN C 3  32  ? 42.466  122.694 33.489  1.00 7.55   ? 32  ASN C CA  1 
ATOM   6853  C  C   . ASN C 3  32  ? 43.096  121.364 33.845  1.00 3.82   ? 32  ASN C C   1 
ATOM   6854  O  O   . ASN C 3  32  ? 43.394  120.516 33.022  1.00 2.20   ? 32  ASN C O   1 
ATOM   6855  C  CB  . ASN C 3  32  ? 43.585  123.585 32.928  1.00 10.68  ? 32  ASN C CB  1 
ATOM   6856  C  CG  . ASN C 3  32  ? 43.178  124.221 31.609  1.00 25.25  ? 32  ASN C CG  1 
ATOM   6857  O  OD1 . ASN C 3  32  ? 42.469  125.236 31.620  1.00 25.07  ? 32  ASN C OD1 1 
ATOM   6858  N  ND2 . ASN C 3  32  ? 43.652  123.575 30.534  1.00 23.07  ? 32  ASN C ND2 1 
ATOM   6859  N  N   . PHE C 3  33  ? 43.340  121.192 35.152  1.00 9.92   ? 33  PHE C N   1 
ATOM   6860  C  CA  . PHE C 3  33  ? 44.017  119.971 35.565  1.00 10.70  ? 33  PHE C CA  1 
ATOM   6861  C  C   . PHE C 3  33  ? 43.134  118.773 35.268  1.00 11.11  ? 33  PHE C C   1 
ATOM   6862  O  O   . PHE C 3  33  ? 43.623  117.749 34.817  1.00 11.45  ? 33  PHE C O   1 
ATOM   6863  C  CB  . PHE C 3  33  ? 44.517  119.977 36.982  1.00 9.21   ? 33  PHE C CB  1 
ATOM   6864  C  CG  . PHE C 3  33  ? 45.497  121.069 37.305  1.00 7.00   ? 33  PHE C CG  1 
ATOM   6865  C  CD1 . PHE C 3  33  ? 46.852  120.945 37.050  1.00 7.00   ? 33  PHE C CD1 1 
ATOM   6866  C  CD2 . PHE C 3  33  ? 44.987  122.228 37.862  1.00 5.94   ? 33  PHE C CD2 1 
ATOM   6867  C  CE1 . PHE C 3  33  ? 47.741  121.958 37.409  1.00 2.20   ? 33  PHE C CE1 1 
ATOM   6868  C  CE2 . PHE C 3  33  ? 45.821  123.259 38.194  1.00 2.21   ? 33  PHE C CE2 1 
ATOM   6869  C  CZ  . PHE C 3  33  ? 47.179  123.121 37.986  1.00 2.20   ? 33  PHE C CZ  1 
ATOM   6870  N  N   . GLY C 3  34  ? 41.825  118.982 35.426  1.00 11.53  ? 34  GLY C N   1 
ATOM   6871  C  CA  . GLY C 3  34  ? 40.895  117.912 35.074  1.00 9.86   ? 34  GLY C CA  1 
ATOM   6872  C  C   . GLY C 3  34  ? 41.164  117.434 33.653  1.00 7.25   ? 34  GLY C C   1 
ATOM   6873  O  O   . GLY C 3  34  ? 41.082  116.238 33.380  1.00 5.97   ? 34  GLY C O   1 
ATOM   6874  N  N   . SER C 3  35  ? 41.264  118.375 32.724  1.00 8.79   ? 35  SER C N   1 
ATOM   6875  C  CA  . SER C 3  35  ? 41.377  118.094 31.285  1.00 3.31   ? 35  SER C CA  1 
ATOM   6876  C  C   . SER C 3  35  ? 42.786  117.585 31.001  1.00 4.80   ? 35  SER C C   1 
ATOM   6877  O  O   . SER C 3  35  ? 42.983  116.724 30.154  1.00 5.86   ? 35  SER C O   1 
ATOM   6878  C  CB  . SER C 3  35  ? 41.167  119.404 30.502  1.00 2.20   ? 35  SER C CB  1 
ATOM   6879  O  OG  . SER C 3  35  ? 40.665  120.350 31.511  1.00 3.20   ? 35  SER C OG  1 
ATOM   6880  N  N   . LEU C 3  36  ? 43.730  118.105 31.771  1.00 3.44   ? 36  LEU C N   1 
ATOM   6881  C  CA  . LEU C 3  36  ? 45.133  117.721 31.655  1.00 4.23   ? 36  LEU C CA  1 
ATOM   6882  C  C   . LEU C 3  36  ? 45.307  116.307 32.186  1.00 4.85   ? 36  LEU C C   1 
ATOM   6883  O  O   . LEU C 3  36  ? 46.116  115.530 31.723  1.00 4.30   ? 36  LEU C O   1 
ATOM   6884  C  CB  . LEU C 3  36  ? 45.976  118.684 32.486  1.00 2.20   ? 36  LEU C CB  1 
ATOM   6885  C  CG  . LEU C 3  36  ? 46.136  120.078 31.888  1.00 3.35   ? 36  LEU C CG  1 
ATOM   6886  C  CD1 . LEU C 3  36  ? 46.784  120.979 32.912  1.00 2.25   ? 36  LEU C CD1 1 
ATOM   6887  C  CD2 . LEU C 3  36  ? 47.015  119.988 30.654  1.00 5.89   ? 36  LEU C CD2 1 
ATOM   6888  N  N   . LEU C 3  37  ? 44.489  116.075 33.200  1.00 4.18   ? 37  LEU C N   1 
ATOM   6889  C  CA  . LEU C 3  37  ? 44.495  114.827 33.919  1.00 2.20   ? 37  LEU C CA  1 
ATOM   6890  C  C   . LEU C 3  37  ? 44.181  113.691 32.946  1.00 6.98   ? 37  LEU C C   1 
ATOM   6891  O  O   . LEU C 3  37  ? 44.820  112.670 32.952  1.00 6.15   ? 37  LEU C O   1 
ATOM   6892  C  CB  . LEU C 3  37  ? 43.456  114.825 35.046  1.00 5.17   ? 37  LEU C CB  1 
ATOM   6893  C  CG  . LEU C 3  37  ? 43.950  115.252 36.421  1.00 6.35   ? 37  LEU C CG  1 
ATOM   6894  C  CD1 . LEU C 3  37  ? 43.036  114.729 37.503  1.00 3.29   ? 37  LEU C CD1 1 
ATOM   6895  C  CD2 . LEU C 3  37  ? 45.374  114.737 36.656  1.00 3.40   ? 37  LEU C CD2 1 
ATOM   6896  N  N   . GLY C 3  38  ? 43.256  113.983 32.056  1.00 7.61   ? 38  GLY C N   1 
ATOM   6897  C  CA  . GLY C 3  38  ? 42.804  113.088 31.031  1.00 9.84   ? 38  GLY C CA  1 
ATOM   6898  C  C   . GLY C 3  38  ? 43.702  113.014 29.811  1.00 4.50   ? 38  GLY C C   1 
ATOM   6899  O  O   . GLY C 3  38  ? 43.797  111.944 29.222  1.00 6.50   ? 38  GLY C O   1 
ATOM   6900  N  N   . ILE C 3  39  ? 44.417  114.101 29.521  1.00 4.42   ? 39  ILE C N   1 
ATOM   6901  C  CA  . ILE C 3  39  ? 45.416  113.997 28.432  1.00 6.21   ? 39  ILE C CA  1 
ATOM   6902  C  C   . ILE C 3  39  ? 46.553  113.096 28.928  1.00 6.05   ? 39  ILE C C   1 
ATOM   6903  O  O   . ILE C 3  39  ? 46.992  112.125 28.317  1.00 5.15   ? 39  ILE C O   1 
ATOM   6904  C  CB  . ILE C 3  39  ? 45.981  115.318 27.945  1.00 7.64   ? 39  ILE C CB  1 
ATOM   6905  C  CG1 . ILE C 3  39  ? 45.010  116.101 27.068  1.00 5.15   ? 39  ILE C CG1 1 
ATOM   6906  C  CG2 . ILE C 3  39  ? 47.243  115.090 27.128  1.00 7.27   ? 39  ILE C CG2 1 
ATOM   6907  C  CD1 . ILE C 3  39  ? 45.664  117.352 26.504  1.00 6.82   ? 39  ILE C CD1 1 
ATOM   6908  N  N   . CYS C 3  40  ? 47.001  113.399 30.141  1.00 7.15   ? 40  CYS C N   1 
ATOM   6909  C  CA  . CYS C 3  40  ? 47.965  112.547 30.828  1.00 5.45   ? 40  CYS C CA  1 
ATOM   6910  C  C   . CYS C 3  40  ? 47.555  111.102 30.565  1.00 2.20   ? 40  CYS C C   1 
ATOM   6911  O  O   . CYS C 3  40  ? 48.475  110.344 30.268  1.00 2.32   ? 40  CYS C O   1 
ATOM   6912  C  CB  . CYS C 3  40  ? 47.949  112.899 32.329  1.00 2.45   ? 40  CYS C CB  1 
ATOM   6913  S  SG  . CYS C 3  40  ? 49.142  114.222 32.643  1.00 4.34   ? 40  CYS C SG  1 
ATOM   6914  N  N   . LEU C 3  41  ? 46.416  110.649 31.073  1.00 2.20   ? 41  LEU C N   1 
ATOM   6915  C  CA  . LEU C 3  41  ? 46.059  109.262 30.983  1.00 5.10   ? 41  LEU C CA  1 
ATOM   6916  C  C   . LEU C 3  41  ? 46.051  108.739 29.562  1.00 6.91   ? 41  LEU C C   1 
ATOM   6917  O  O   . LEU C 3  41  ? 46.371  107.579 29.294  1.00 7.16   ? 41  LEU C O   1 
ATOM   6918  C  CB  . LEU C 3  41  ? 44.705  109.005 31.666  1.00 3.91   ? 41  LEU C CB  1 
ATOM   6919  C  CG  . LEU C 3  41  ? 44.310  107.531 31.429  1.00 7.94   ? 41  LEU C CG  1 
ATOM   6920  C  CD1 . LEU C 3  41  ? 45.225  106.683 32.303  1.00 16.00  ? 41  LEU C CD1 1 
ATOM   6921  C  CD2 . LEU C 3  41  ? 42.885  107.258 31.755  1.00 2.20   ? 41  LEU C CD2 1 
ATOM   6922  N  N   . ILE C 3  42  ? 45.725  109.588 28.580  1.00 6.87   ? 42  ILE C N   1 
ATOM   6923  C  CA  . ILE C 3  42  ? 45.826  109.084 27.211  1.00 6.22   ? 42  ILE C CA  1 
ATOM   6924  C  C   . ILE C 3  42  ? 47.311  109.027 26.839  1.00 9.05   ? 42  ILE C C   1 
ATOM   6925  O  O   . ILE C 3  42  ? 47.767  108.277 25.973  1.00 6.68   ? 42  ILE C O   1 
ATOM   6926  C  CB  . ILE C 3  42  ? 45.109  109.979 26.188  1.00 3.04   ? 42  ILE C CB  1 
ATOM   6927  C  CG1 . ILE C 3  42  ? 43.601  110.062 26.418  1.00 8.19   ? 42  ILE C CG1 1 
ATOM   6928  C  CG2 . ILE C 3  42  ? 45.398  109.471 24.785  1.00 4.25   ? 42  ILE C CG2 1 
ATOM   6929  C  CD1 . ILE C 3  42  ? 42.895  108.727 26.545  1.00 4.97   ? 42  ILE C CD1 1 
ATOM   6930  N  N   . LEU C 3  43  ? 48.122  109.888 27.485  1.00 2.20   ? 43  LEU C N   1 
ATOM   6931  C  CA  . LEU C 3  43  ? 49.485  110.011 26.961  1.00 5.73   ? 43  LEU C CA  1 
ATOM   6932  C  C   . LEU C 3  43  ? 50.215  108.746 27.379  1.00 9.18   ? 43  LEU C C   1 
ATOM   6933  O  O   . LEU C 3  43  ? 50.735  107.999 26.576  1.00 16.12  ? 43  LEU C O   1 
ATOM   6934  C  CB  . LEU C 3  43  ? 50.227  111.206 27.512  1.00 3.92   ? 43  LEU C CB  1 
ATOM   6935  C  CG  . LEU C 3  43  ? 51.749  111.103 27.583  1.00 8.30   ? 43  LEU C CG  1 
ATOM   6936  C  CD1 . LEU C 3  43  ? 52.386  110.830 26.231  1.00 4.62   ? 43  LEU C CD1 1 
ATOM   6937  C  CD2 . LEU C 3  43  ? 52.309  112.410 28.155  1.00 16.11  ? 43  LEU C CD2 1 
ATOM   6938  N  N   . GLN C 3  44  ? 50.112  108.516 28.683  1.00 8.69   ? 44  GLN C N   1 
ATOM   6939  C  CA  . GLN C 3  44  ? 50.640  107.279 29.229  1.00 8.66   ? 44  GLN C CA  1 
ATOM   6940  C  C   . GLN C 3  44  ? 50.249  106.061 28.383  1.00 6.45   ? 44  GLN C C   1 
ATOM   6941  O  O   . GLN C 3  44  ? 51.141  105.348 27.945  1.00 7.35   ? 44  GLN C O   1 
ATOM   6942  C  CB  . GLN C 3  44  ? 50.061  107.069 30.625  1.00 6.77   ? 44  GLN C CB  1 
ATOM   6943  C  CG  . GLN C 3  44  ? 50.669  107.894 31.719  1.00 11.40  ? 44  GLN C CG  1 
ATOM   6944  C  CD  . GLN C 3  44  ? 52.119  108.247 31.507  1.00 9.44   ? 44  GLN C CD  1 
ATOM   6945  O  OE1 . GLN C 3  44  ? 52.850  107.572 30.809  1.00 19.41  ? 44  GLN C OE1 1 
ATOM   6946  N  NE2 . GLN C 3  44  ? 52.543  109.344 32.083  1.00 7.28   ? 44  GLN C NE2 1 
ATOM   6947  N  N   . ILE C 3  45  ? 48.942  105.823 28.245  1.00 9.96   ? 45  ILE C N   1 
ATOM   6948  C  CA  . ILE C 3  45  ? 48.414  104.695 27.517  1.00 7.25   ? 45  ILE C CA  1 
ATOM   6949  C  C   . ILE C 3  45  ? 49.181  104.565 26.195  1.00 8.90   ? 45  ILE C C   1 
ATOM   6950  O  O   . ILE C 3  45  ? 49.766  103.530 25.917  1.00 7.84   ? 45  ILE C O   1 
ATOM   6951  C  CB  . ILE C 3  45  ? 46.913  104.765 27.146  1.00 5.52   ? 45  ILE C CB  1 
ATOM   6952  C  CG1 . ILE C 3  45  ? 45.985  104.815 28.359  1.00 4.46   ? 45  ILE C CG1 1 
ATOM   6953  C  CG2 . ILE C 3  45  ? 46.651  103.539 26.243  1.00 2.20   ? 45  ILE C CG2 1 
ATOM   6954  C  CD1 . ILE C 3  45  ? 44.594  104.234 28.147  1.00 4.76   ? 45  ILE C CD1 1 
ATOM   6955  N  N   . LEU C 3  46  ? 49.055  105.596 25.366  1.00 8.01   ? 46  LEU C N   1 
ATOM   6956  C  CA  . LEU C 3  46  ? 49.720  105.571 24.065  1.00 8.07   ? 46  LEU C CA  1 
ATOM   6957  C  C   . LEU C 3  46  ? 51.132  105.052 24.293  1.00 9.56   ? 46  LEU C C   1 
ATOM   6958  O  O   . LEU C 3  46  ? 51.475  103.888 24.216  1.00 16.31  ? 46  LEU C O   1 
ATOM   6959  C  CB  . LEU C 3  46  ? 49.830  107.007 23.546  1.00 8.40   ? 46  LEU C CB  1 
ATOM   6960  C  CG  . LEU C 3  46  ? 49.466  107.154 22.067  1.00 10.90  ? 46  LEU C CG  1 
ATOM   6961  C  CD1 . LEU C 3  46  ? 48.049  106.638 21.858  1.00 5.42   ? 46  LEU C CD1 1 
ATOM   6962  C  CD2 . LEU C 3  46  ? 49.663  108.601 21.636  1.00 16.79  ? 46  LEU C CD2 1 
ATOM   6963  N  N   . THR C 3  47  ? 51.995  105.972 24.649  1.00 9.41   ? 47  THR C N   1 
ATOM   6964  C  CA  . THR C 3  47  ? 53.382  105.710 25.022  1.00 8.45   ? 47  THR C CA  1 
ATOM   6965  C  C   . THR C 3  47  ? 53.606  104.297 25.546  1.00 3.72   ? 47  THR C C   1 
ATOM   6966  O  O   . THR C 3  47  ? 54.470  103.586 25.052  1.00 7.10   ? 47  THR C O   1 
ATOM   6967  C  CB  . THR C 3  47  ? 53.677  106.747 26.146  1.00 3.83   ? 47  THR C CB  1 
ATOM   6968  O  OG1 . THR C 3  47  ? 54.241  107.914 25.552  1.00 3.82   ? 47  THR C OG1 1 
ATOM   6969  C  CG2 . THR C 3  47  ? 54.575  106.138 27.182  1.00 10.48  ? 47  THR C CG2 1 
ATOM   6970  N  N   . GLY C 3  48  ? 52.875  103.948 26.603  1.00 11.66  ? 48  GLY C N   1 
ATOM   6971  C  CA  . GLY C 3  48  ? 52.861  102.658 27.254  1.00 5.47   ? 48  GLY C CA  1 
ATOM   6972  C  C   . GLY C 3  48  ? 52.775  101.521 26.232  1.00 2.81   ? 48  GLY C C   1 
ATOM   6973  O  O   . GLY C 3  48  ? 53.765  100.786 26.107  1.00 4.04   ? 48  GLY C O   1 
ATOM   6974  N  N   . LEU C 3  49  ? 51.634  101.421 25.547  1.00 3.71   ? 49  LEU C N   1 
ATOM   6975  C  CA  . LEU C 3  49  ? 51.407  100.401 24.536  1.00 2.20   ? 49  LEU C CA  1 
ATOM   6976  C  C   . LEU C 3  49  ? 52.704  100.284 23.704  1.00 5.27   ? 49  LEU C C   1 
ATOM   6977  O  O   . LEU C 3  49  ? 53.036  99.170  23.326  1.00 2.82   ? 49  LEU C O   1 
ATOM   6978  C  CB  . LEU C 3  49  ? 50.372  100.907 23.451  1.00 2.20   ? 49  LEU C CB  1 
ATOM   6979  C  CG  . LEU C 3  49  ? 49.808  99.842  22.529  1.00 3.36   ? 49  LEU C CG  1 
ATOM   6980  C  CD1 . LEU C 3  49  ? 48.905  98.863  23.250  1.00 8.01   ? 49  LEU C CD1 1 
ATOM   6981  C  CD2 . LEU C 3  49  ? 49.171  100.287 21.234  1.00 2.20   ? 49  LEU C CD2 1 
ATOM   6982  N  N   . PHE C 3  50  ? 53.200  101.445 23.256  1.00 3.19   ? 50  PHE C N   1 
ATOM   6983  C  CA  . PHE C 3  50  ? 54.444  101.424 22.479  1.00 2.64   ? 50  PHE C CA  1 
ATOM   6984  C  C   . PHE C 3  50  ? 55.525  100.740 23.294  1.00 2.71   ? 50  PHE C C   1 
ATOM   6985  O  O   . PHE C 3  50  ? 55.912  99.629  22.924  1.00 9.22   ? 50  PHE C O   1 
ATOM   6986  C  CB  . PHE C 3  50  ? 54.866  102.717 21.826  1.00 12.94  ? 50  PHE C CB  1 
ATOM   6987  C  CG  . PHE C 3  50  ? 54.087  103.083 20.598  1.00 22.15  ? 50  PHE C CG  1 
ATOM   6988  C  CD1 . PHE C 3  50  ? 52.921  103.821 20.702  1.00 31.07  ? 50  PHE C CD1 1 
ATOM   6989  C  CD2 . PHE C 3  50  ? 54.501  102.701 19.341  1.00 27.46  ? 50  PHE C CD2 1 
ATOM   6990  C  CE1 . PHE C 3  50  ? 52.182  104.171 19.590  1.00 32.91  ? 50  PHE C CE1 1 
ATOM   6991  C  CE2 . PHE C 3  50  ? 53.763  103.052 18.227  1.00 32.25  ? 50  PHE C CE2 1 
ATOM   6992  C  CZ  . PHE C 3  50  ? 52.601  103.785 18.340  1.00 27.96  ? 50  PHE C CZ  1 
ATOM   6993  N  N   . LEU C 3  51  ? 55.923  101.197 24.471  1.00 7.26   ? 51  LEU C N   1 
ATOM   6994  C  CA  . LEU C 3  51  ? 56.867  100.470 25.320  1.00 5.34   ? 51  LEU C CA  1 
ATOM   6995  C  C   . LEU C 3  51  ? 56.481  99.007  25.417  1.00 3.95   ? 51  LEU C C   1 
ATOM   6996  O  O   . LEU C 3  51  ? 57.101  98.155  24.750  1.00 5.47   ? 51  LEU C O   1 
ATOM   6997  C  CB  . LEU C 3  51  ? 56.932  101.049 26.748  1.00 2.20   ? 51  LEU C CB  1 
ATOM   6998  C  CG  . LEU C 3  51  ? 57.725  102.354 26.748  1.00 2.20   ? 51  LEU C CG  1 
ATOM   6999  C  CD1 . LEU C 3  51  ? 57.722  103.189 27.992  1.00 4.71   ? 51  LEU C CD1 1 
ATOM   7000  C  CD2 . LEU C 3  51  ? 59.156  102.068 26.325  1.00 3.77   ? 51  LEU C CD2 1 
ATOM   7001  N  N   . ALA C 3  52  ? 55.326  98.676  25.989  1.00 4.80   ? 52  ALA C N   1 
ATOM   7002  C  CA  . ALA C 3  52  ? 54.874  97.288  25.930  1.00 5.27   ? 52  ALA C CA  1 
ATOM   7003  C  C   . ALA C 3  52  ? 55.089  96.609  24.589  1.00 3.66   ? 52  ALA C C   1 
ATOM   7004  O  O   . ALA C 3  52  ? 54.858  95.391  24.454  1.00 13.00  ? 52  ALA C O   1 
ATOM   7005  C  CB  . ALA C 3  52  ? 53.398  97.217  26.302  1.00 4.00   ? 52  ALA C CB  1 
ATOM   7006  N  N   . MET C 3  53  ? 55.251  97.333  23.492  1.00 7.97   ? 53  MET C N   1 
ATOM   7007  C  CA  . MET C 3  53  ? 55.387  96.719  22.185  1.00 13.17  ? 53  MET C CA  1 
ATOM   7008  C  C   . MET C 3  53  ? 56.792  96.186  21.943  1.00 17.56  ? 53  MET C C   1 
ATOM   7009  O  O   . MET C 3  53  ? 56.985  95.433  20.971  1.00 20.42  ? 53  MET C O   1 
ATOM   7010  C  CB  . MET C 3  53  ? 54.984  97.688  21.084  1.00 2.91   ? 53  MET C CB  1 
ATOM   7011  C  CG  . MET C 3  53  ? 54.016  97.111  20.059  1.00 3.65   ? 53  MET C CG  1 
ATOM   7012  S  SD  . MET C 3  53  ? 53.905  98.177  18.625  1.00 7.06   ? 53  MET C SD  1 
ATOM   7013  C  CE  . MET C 3  53  ? 53.177  99.663  19.268  1.00 3.20   ? 53  MET C CE  1 
ATOM   7014  N  N   . HIS C 3  54  ? 57.742  96.446  22.826  1.00 16.53  ? 54  HIS C N   1 
ATOM   7015  C  CA  . HIS C 3  54  ? 59.119  95.986  22.770  1.00 16.90  ? 54  HIS C CA  1 
ATOM   7016  C  C   . HIS C 3  54  ? 59.708  95.642  24.147  1.00 13.95  ? 54  HIS C C   1 
ATOM   7017  O  O   . HIS C 3  54  ? 60.911  95.864  24.387  1.00 9.26   ? 54  HIS C O   1 
ATOM   7018  C  CB  . HIS C 3  54  ? 60.042  97.109  22.233  1.00 23.33  ? 54  HIS C CB  1 
ATOM   7019  C  CG  . HIS C 3  54  ? 59.693  97.641  20.897  1.00 28.87  ? 54  HIS C CG  1 
ATOM   7020  N  ND1 . HIS C 3  54  ? 59.992  96.958  19.744  1.00 32.80  ? 54  HIS C ND1 1 
ATOM   7021  C  CD2 . HIS C 3  54  ? 59.050  98.774  20.525  1.00 37.74  ? 54  HIS C CD2 1 
ATOM   7022  C  CE1 . HIS C 3  54  ? 59.549  97.646  18.706  1.00 41.51  ? 54  HIS C CE1 1 
ATOM   7023  N  NE2 . HIS C 3  54  ? 58.975  98.755  19.154  1.00 45.32  ? 54  HIS C NE2 1 
ATOM   7024  N  N   . TYR C 3  55  ? 58.899  95.309  25.129  1.00 8.56   ? 55  TYR C N   1 
ATOM   7025  C  CA  . TYR C 3  55  ? 59.349  95.109  26.507  1.00 6.46   ? 55  TYR C CA  1 
ATOM   7026  C  C   . TYR C 3  55  ? 59.039  93.635  26.815  1.00 4.05   ? 55  TYR C C   1 
ATOM   7027  O  O   . TYR C 3  55  ? 58.009  93.194  26.303  1.00 6.95   ? 55  TYR C O   1 
ATOM   7028  C  CB  . TYR C 3  55  ? 58.465  95.932  27.465  1.00 2.28   ? 55  TYR C CB  1 
ATOM   7029  C  CG  . TYR C 3  55  ? 58.573  95.461  28.896  1.00 9.85   ? 55  TYR C CG  1 
ATOM   7030  C  CD1 . TYR C 3  55  ? 59.556  96.015  29.709  1.00 10.23  ? 55  TYR C CD1 1 
ATOM   7031  C  CD2 . TYR C 3  55  ? 57.721  94.515  29.451  1.00 4.48   ? 55  TYR C CD2 1 
ATOM   7032  C  CE1 . TYR C 3  55  ? 59.697  95.639  31.025  1.00 6.81   ? 55  TYR C CE1 1 
ATOM   7033  C  CE2 . TYR C 3  55  ? 57.858  94.122  30.764  1.00 6.60   ? 55  TYR C CE2 1 
ATOM   7034  C  CZ  . TYR C 3  55  ? 58.841  94.689  31.535  1.00 8.38   ? 55  TYR C CZ  1 
ATOM   7035  O  OH  . TYR C 3  55  ? 58.990  94.332  32.844  1.00 13.11  ? 55  TYR C OH  1 
ATOM   7036  N  N   . THR C 3  56  ? 59.834  93.020  27.641  1.00 4.12   ? 56  THR C N   1 
ATOM   7037  C  CA  . THR C 3  56  ? 59.699  91.611  28.014  1.00 9.20   ? 56  THR C CA  1 
ATOM   7038  C  C   . THR C 3  56  ? 59.567  91.391  29.511  1.00 6.77   ? 56  THR C C   1 
ATOM   7039  O  O   . THR C 3  56  ? 60.175  92.176  30.237  1.00 9.37   ? 56  THR C O   1 
ATOM   7040  C  CB  . THR C 3  56  ? 60.950  90.828  27.561  1.00 13.93  ? 56  THR C CB  1 
ATOM   7041  O  OG1 . THR C 3  56  ? 60.782  90.340  26.219  1.00 13.07  ? 56  THR C OG1 1 
ATOM   7042  C  CG2 . THR C 3  56  ? 61.140  89.649  28.492  1.00 13.10  ? 56  THR C CG2 1 
ATOM   7043  N  N   . SER C 3  57  ? 58.674  90.541  30.016  1.00 14.57  ? 57  SER C N   1 
ATOM   7044  C  CA  . SER C 3  57  ? 58.350  90.619  31.451  1.00 24.60  ? 57  SER C CA  1 
ATOM   7045  C  C   . SER C 3  57  ? 58.989  89.485  32.228  1.00 29.87  ? 57  SER C C   1 
ATOM   7046  O  O   . SER C 3  57  ? 58.360  88.627  32.859  1.00 34.19  ? 57  SER C O   1 
ATOM   7047  C  CB  . SER C 3  57  ? 56.857  90.712  31.729  1.00 29.74  ? 57  SER C CB  1 
ATOM   7048  O  OG  . SER C 3  57  ? 56.268  89.451  32.011  1.00 36.56  ? 57  SER C OG  1 
ATOM   7049  N  N   . ASP C 3  58  ? 60.325  89.419  32.154  1.00 28.95  ? 58  ASP C N   1 
ATOM   7050  C  CA  . ASP C 3  58  ? 61.074  88.345  32.785  1.00 22.84  ? 58  ASP C CA  1 
ATOM   7051  C  C   . ASP C 3  58  ? 62.255  88.885  33.585  1.00 21.16  ? 58  ASP C C   1 
ATOM   7052  O  O   . ASP C 3  58  ? 62.725  89.994  33.352  1.00 16.26  ? 58  ASP C O   1 
ATOM   7053  C  CB  . ASP C 3  58  ? 61.618  87.402  31.719  1.00 24.02  ? 58  ASP C CB  1 
ATOM   7054  C  CG  . ASP C 3  58  ? 60.580  86.756  30.840  1.00 31.76  ? 58  ASP C CG  1 
ATOM   7055  O  OD1 . ASP C 3  58  ? 59.416  86.533  31.232  1.00 37.37  ? 58  ASP C OD1 1 
ATOM   7056  O  OD2 . ASP C 3  58  ? 60.945  86.427  29.689  1.00 37.48  ? 58  ASP C OD2 1 
ATOM   7057  N  N   . THR C 3  59  ? 62.734  88.075  34.524  1.00 18.27  ? 59  THR C N   1 
ATOM   7058  C  CA  . THR C 3  59  ? 63.766  88.555  35.423  1.00 16.68  ? 59  THR C CA  1 
ATOM   7059  C  C   . THR C 3  59  ? 65.023  88.817  34.607  1.00 16.87  ? 59  THR C C   1 
ATOM   7060  O  O   . THR C 3  59  ? 65.651  89.852  34.781  1.00 21.87  ? 59  THR C O   1 
ATOM   7061  C  CB  . THR C 3  59  ? 64.098  87.544  36.528  1.00 18.67  ? 59  THR C CB  1 
ATOM   7062  O  OG1 . THR C 3  59  ? 62.896  87.167  37.185  1.00 16.03  ? 59  THR C OG1 1 
ATOM   7063  C  CG2 . THR C 3  59  ? 65.040  88.208  37.531  1.00 23.08  ? 59  THR C CG2 1 
ATOM   7064  N  N   . THR C 3  60  ? 65.385  87.861  33.772  1.00 14.81  ? 60  THR C N   1 
ATOM   7065  C  CA  . THR C 3  60  ? 66.581  87.929  32.954  1.00 15.38  ? 60  THR C CA  1 
ATOM   7066  C  C   . THR C 3  60  ? 66.640  89.112  31.995  1.00 17.05  ? 60  THR C C   1 
ATOM   7067  O  O   . THR C 3  60  ? 67.682  89.744  31.777  1.00 19.08  ? 60  THR C O   1 
ATOM   7068  C  CB  . THR C 3  60  ? 66.622  86.689  32.022  1.00 17.81  ? 60  THR C CB  1 
ATOM   7069  O  OG1 . THR C 3  60  ? 65.716  85.729  32.524  1.00 20.75  ? 60  THR C OG1 1 
ATOM   7070  C  CG2 . THR C 3  60  ? 68.037  86.152  31.932  1.00 29.33  ? 60  THR C CG2 1 
ATOM   7071  N  N   . THR C 3  61  ? 65.534  89.314  31.273  1.00 15.37  ? 61  THR C N   1 
ATOM   7072  C  CA  . THR C 3  61  ? 65.454  90.297  30.248  1.00 2.20   ? 61  THR C CA  1 
ATOM   7073  C  C   . THR C 3  61  ? 64.955  91.691  30.588  1.00 6.34   ? 61  THR C C   1 
ATOM   7074  O  O   . THR C 3  61  ? 65.332  92.615  29.843  1.00 2.20   ? 61  THR C O   1 
ATOM   7075  C  CB  . THR C 3  61  ? 64.517  89.788  29.120  1.00 7.84   ? 61  THR C CB  1 
ATOM   7076  O  OG1 . THR C 3  61  ? 64.299  88.410  29.390  1.00 5.70   ? 61  THR C OG1 1 
ATOM   7077  C  CG2 . THR C 3  61  ? 65.167  90.025  27.778  1.00 8.82   ? 61  THR C CG2 1 
ATOM   7078  N  N   . ALA C 3  62  ? 64.042  91.763  31.549  1.00 5.98   ? 62  ALA C N   1 
ATOM   7079  C  CA  . ALA C 3  62  ? 63.329  92.999  31.803  1.00 6.71   ? 62  ALA C CA  1 
ATOM   7080  C  C   . ALA C 3  62  ? 64.263  94.180  31.721  1.00 4.97   ? 62  ALA C C   1 
ATOM   7081  O  O   . ALA C 3  62  ? 64.276  94.872  30.699  1.00 6.08   ? 62  ALA C O   1 
ATOM   7082  C  CB  . ALA C 3  62  ? 62.424  93.037  32.992  1.00 9.26   ? 62  ALA C CB  1 
ATOM   7083  N  N   . PHE C 3  63  ? 65.233  94.274  32.596  1.00 4.63   ? 63  PHE C N   1 
ATOM   7084  C  CA  . PHE C 3  63  ? 66.198  95.372  32.514  1.00 2.63   ? 63  PHE C CA  1 
ATOM   7085  C  C   . PHE C 3  63  ? 66.805  95.517  31.127  1.00 13.11  ? 63  PHE C C   1 
ATOM   7086  O  O   . PHE C 3  63  ? 67.066  96.589  30.579  1.00 6.72   ? 63  PHE C O   1 
ATOM   7087  C  CB  . PHE C 3  63  ? 67.316  95.021  33.517  1.00 10.01  ? 63  PHE C CB  1 
ATOM   7088  C  CG  . PHE C 3  63  ? 68.276  96.160  33.678  1.00 6.28   ? 63  PHE C CG  1 
ATOM   7089  C  CD1 . PHE C 3  63  ? 69.263  96.388  32.743  1.00 4.33   ? 63  PHE C CD1 1 
ATOM   7090  C  CD2 . PHE C 3  63  ? 68.109  97.028  34.728  1.00 3.40   ? 63  PHE C CD2 1 
ATOM   7091  C  CE1 . PHE C 3  63  ? 70.134  97.439  32.924  1.00 5.18   ? 63  PHE C CE1 1 
ATOM   7092  C  CE2 . PHE C 3  63  ? 68.968  98.100  34.905  1.00 2.79   ? 63  PHE C CE2 1 
ATOM   7093  C  CZ  . PHE C 3  63  ? 69.982  98.311  33.983  1.00 3.49   ? 63  PHE C CZ  1 
ATOM   7094  N  N   . SER C 3  64  ? 67.300  94.370  30.550  1.00 17.82  ? 64  SER C N   1 
ATOM   7095  C  CA  . SER C 3  64  ? 67.767  94.352  29.213  1.00 19.55  ? 64  SER C CA  1 
ATOM   7096  C  C   . SER C 3  64  ? 66.764  94.889  28.300  1.00 22.48  ? 64  SER C C   1 
ATOM   7097  O  O   . SER C 3  64  ? 67.111  95.801  27.453  1.00 27.30  ? 64  SER C O   1 
ATOM   7098  C  CB  . SER C 3  64  ? 68.261  92.986  28.779  1.00 18.45  ? 64  SER C CB  1 
ATOM   7099  O  OG  . SER C 3  64  ? 69.635  92.813  29.094  1.00 22.85  ? 64  SER C OG  1 
ATOM   7100  N  N   . SER C 3  65  ? 65.520  94.412  28.269  1.00 20.98  ? 65  SER C N   1 
ATOM   7101  C  CA  . SER C 3  65  ? 64.479  94.880  27.361  1.00 10.89  ? 65  SER C CA  1 
ATOM   7102  C  C   . SER C 3  65  ? 64.303  96.391  27.464  1.00 6.14   ? 65  SER C C   1 
ATOM   7103  O  O   . SER C 3  65  ? 64.330  97.095  26.460  1.00 5.85   ? 65  SER C O   1 
ATOM   7104  C  CB  . SER C 3  65  ? 63.142  94.239  27.753  1.00 8.40   ? 65  SER C CB  1 
ATOM   7105  O  OG  . SER C 3  65  ? 62.417  95.338  28.319  1.00 23.31  ? 65  SER C OG  1 
ATOM   7106  N  N   . VAL C 3  66  ? 64.213  96.918  28.681  1.00 6.63   ? 66  VAL C N   1 
ATOM   7107  C  CA  . VAL C 3  66  ? 64.151  98.360  28.866  1.00 2.20   ? 66  VAL C CA  1 
ATOM   7108  C  C   . VAL C 3  66  ? 65.309  99.039  28.195  1.00 3.76   ? 66  VAL C C   1 
ATOM   7109  O  O   . VAL C 3  66  ? 65.211  99.963  27.405  1.00 10.71  ? 66  VAL C O   1 
ATOM   7110  C  CB  . VAL C 3  66  ? 63.854  98.876  30.250  1.00 3.72   ? 66  VAL C CB  1 
ATOM   7111  C  CG1 . VAL C 3  66  ? 63.742  100.387 30.308  1.00 3.62   ? 66  VAL C CG1 1 
ATOM   7112  C  CG2 . VAL C 3  66  ? 62.633  98.208  30.860  1.00 4.47   ? 66  VAL C CG2 1 
ATOM   7113  N  N   . THR C 3  67  ? 66.471  98.449  28.454  1.00 12.40  ? 67  THR C N   1 
ATOM   7114  C  CA  . THR C 3  67  ? 67.726  99.010  27.980  1.00 13.27  ? 67  THR C CA  1 
ATOM   7115  C  C   . THR C 3  67  ? 67.862  99.006  26.475  1.00 12.37  ? 67  THR C C   1 
ATOM   7116  O  O   . THR C 3  67  ? 68.332  99.976  25.884  1.00 7.64   ? 67  THR C O   1 
ATOM   7117  C  CB  . THR C 3  67  ? 68.907  98.343  28.698  1.00 11.18  ? 67  THR C CB  1 
ATOM   7118  O  OG1 . THR C 3  67  ? 68.965  98.904  30.019  1.00 16.67  ? 67  THR C OG1 1 
ATOM   7119  C  CG2 . THR C 3  67  ? 70.232  98.663  28.028  1.00 13.62  ? 67  THR C CG2 1 
ATOM   7120  N  N   . HIS C 3  68  ? 67.237  98.000  25.878  1.00 12.82  ? 68  HIS C N   1 
ATOM   7121  C  CA  . HIS C 3  68  ? 67.128  97.854  24.445  1.00 18.22  ? 68  HIS C CA  1 
ATOM   7122  C  C   . HIS C 3  68  ? 66.162  98.871  23.833  1.00 22.69  ? 68  HIS C C   1 
ATOM   7123  O  O   . HIS C 3  68  ? 66.310  99.370  22.723  1.00 23.80  ? 68  HIS C O   1 
ATOM   7124  C  CB  . HIS C 3  68  ? 66.526  96.456  24.192  1.00 19.33  ? 68  HIS C CB  1 
ATOM   7125  C  CG  . HIS C 3  68  ? 66.626  96.164  22.729  1.00 24.85  ? 68  HIS C CG  1 
ATOM   7126  N  ND1 . HIS C 3  68  ? 65.564  96.264  21.874  1.00 26.99  ? 68  HIS C ND1 1 
ATOM   7127  C  CD2 . HIS C 3  68  ? 67.702  95.782  22.005  1.00 26.71  ? 68  HIS C CD2 1 
ATOM   7128  C  CE1 . HIS C 3  68  ? 65.980  95.944  20.663  1.00 35.94  ? 68  HIS C CE1 1 
ATOM   7129  N  NE2 . HIS C 3  68  ? 67.274  95.649  20.709  1.00 32.63  ? 68  HIS C NE2 1 
ATOM   7130  N  N   . ILE C 3  69  ? 65.125  99.138  24.645  1.00 22.40  ? 69  ILE C N   1 
ATOM   7131  C  CA  . ILE C 3  69  ? 64.120  100.104 24.223  1.00 15.38  ? 69  ILE C CA  1 
ATOM   7132  C  C   . ILE C 3  69  ? 64.817  101.444 24.061  1.00 12.71  ? 69  ILE C C   1 
ATOM   7133  O  O   . ILE C 3  69  ? 64.863  102.010 22.961  1.00 12.44  ? 69  ILE C O   1 
ATOM   7134  C  CB  . ILE C 3  69  ? 62.914  100.174 25.170  1.00 8.66   ? 69  ILE C CB  1 
ATOM   7135  C  CG1 . ILE C 3  69  ? 61.808  99.216  24.724  1.00 2.90   ? 69  ILE C CG1 1 
ATOM   7136  C  CG2 . ILE C 3  69  ? 62.398  101.603 25.246  1.00 3.75   ? 69  ILE C CG2 1 
ATOM   7137  C  CD1 . ILE C 3  69  ? 60.937  98.685  25.839  1.00 11.72  ? 69  ILE C CD1 1 
ATOM   7138  N  N   . CYS C 3  70  ? 65.641  101.807 25.058  1.00 9.14   ? 70  CYS C N   1 
ATOM   7139  C  CA  . CYS C 3  70  ? 66.274  103.098 24.871  1.00 13.07  ? 70  CYS C CA  1 
ATOM   7140  C  C   . CYS C 3  70  ? 67.613  103.058 24.194  1.00 16.11  ? 70  CYS C C   1 
ATOM   7141  O  O   . CYS C 3  70  ? 68.445  103.965 24.399  1.00 15.26  ? 70  CYS C O   1 
ATOM   7142  C  CB  . CYS C 3  70  ? 66.293  103.960 26.115  1.00 4.59   ? 70  CYS C CB  1 
ATOM   7143  S  SG  . CYS C 3  70  ? 65.210  103.413 27.437  1.00 18.80  ? 70  CYS C SG  1 
ATOM   7144  N  N   . ARG C 3  71  ? 67.917  102.076 23.338  1.00 21.77  ? 71  ARG C N   1 
ATOM   7145  C  CA  . ARG C 3  71  ? 69.166  102.124 22.581  1.00 26.98  ? 71  ARG C CA  1 
ATOM   7146  C  C   . ARG C 3  71  ? 69.040  101.715 21.122  1.00 25.46  ? 71  ARG C C   1 
ATOM   7147  O  O   . ARG C 3  71  ? 69.626  102.381 20.263  1.00 30.20  ? 71  ARG C O   1 
ATOM   7148  C  CB  . ARG C 3  71  ? 70.359  101.382 23.167  1.00 30.59  ? 71  ARG C CB  1 
ATOM   7149  C  CG  . ARG C 3  71  ? 70.528  101.407 24.655  1.00 38.11  ? 71  ARG C CG  1 
ATOM   7150  C  CD  . ARG C 3  71  ? 71.894  101.039 25.172  1.00 40.34  ? 71  ARG C CD  1 
ATOM   7151  N  NE  . ARG C 3  71  ? 72.834  102.160 25.179  1.00 45.07  ? 71  ARG C NE  1 
ATOM   7152  C  CZ  . ARG C 3  71  ? 74.134  101.995 25.403  1.00 44.21  ? 71  ARG C CZ  1 
ATOM   7153  N  NH1 . ARG C 3  71  ? 74.541  100.762 25.644  1.00 46.93  ? 71  ARG C NH1 1 
ATOM   7154  N  NH2 . ARG C 3  71  ? 75.005  102.987 25.395  1.00 44.08  ? 71  ARG C NH2 1 
ATOM   7155  N  N   . ASP C 3  72  ? 68.553  100.519 20.821  1.00 23.67  ? 72  ASP C N   1 
ATOM   7156  C  CA  . ASP C 3  72  ? 68.515  100.069 19.440  1.00 26.26  ? 72  ASP C CA  1 
ATOM   7157  C  C   . ASP C 3  72  ? 67.175  100.264 18.744  1.00 25.17  ? 72  ASP C C   1 
ATOM   7158  O  O   . ASP C 3  72  ? 67.009  99.981  17.553  1.00 23.21  ? 72  ASP C O   1 
ATOM   7159  C  CB  . ASP C 3  72  ? 68.822  98.576  19.334  1.00 32.51  ? 72  ASP C CB  1 
ATOM   7160  C  CG  . ASP C 3  72  ? 70.217  98.183  19.745  1.00 37.95  ? 72  ASP C CG  1 
ATOM   7161  O  OD1 . ASP C 3  72  ? 71.003  99.061  20.123  1.00 43.17  ? 72  ASP C OD1 1 
ATOM   7162  O  OD2 . ASP C 3  72  ? 70.530  96.976  19.682  1.00 43.86  ? 72  ASP C OD2 1 
ATOM   7163  N  N   . VAL C 3  73  ? 66.147  100.656 19.469  1.00 25.73  ? 73  VAL C N   1 
ATOM   7164  C  CA  . VAL C 3  73  ? 64.806  100.851 18.888  1.00 19.89  ? 73  VAL C CA  1 
ATOM   7165  C  C   . VAL C 3  73  ? 64.663  102.329 18.512  1.00 14.22  ? 73  VAL C C   1 
ATOM   7166  O  O   . VAL C 3  73  ? 65.050  103.145 19.344  1.00 13.37  ? 73  VAL C O   1 
ATOM   7167  C  CB  . VAL C 3  73  ? 63.740  100.586 19.978  1.00 16.75  ? 73  VAL C CB  1 
ATOM   7168  C  CG1 . VAL C 3  73  ? 62.590  101.568 19.862  1.00 12.39  ? 73  VAL C CG1 1 
ATOM   7169  C  CG2 . VAL C 3  73  ? 63.247  99.163  19.950  1.00 7.42   ? 73  VAL C CG2 1 
ATOM   7170  N  N   . ASN C 3  74  ? 64.066  102.627 17.370  1.00 9.60   ? 74  ASN C N   1 
ATOM   7171  C  CA  . ASN C 3  74  ? 64.052  103.990 16.867  1.00 6.03   ? 74  ASN C CA  1 
ATOM   7172  C  C   . ASN C 3  74  ? 63.105  104.894 17.621  1.00 9.95   ? 74  ASN C C   1 
ATOM   7173  O  O   . ASN C 3  74  ? 61.879  104.726 17.674  1.00 14.49  ? 74  ASN C O   1 
ATOM   7174  C  CB  . ASN C 3  74  ? 63.828  104.105 15.373  1.00 14.75  ? 74  ASN C CB  1 
ATOM   7175  C  CG  . ASN C 3  74  ? 64.595  103.135 14.510  1.00 20.72  ? 74  ASN C CG  1 
ATOM   7176  O  OD1 . ASN C 3  74  ? 65.763  102.814 14.751  1.00 25.98  ? 74  ASN C OD1 1 
ATOM   7177  N  ND2 . ASN C 3  74  ? 63.921  102.644 13.462  1.00 21.13  ? 74  ASN C ND2 1 
ATOM   7178  N  N   . TYR C 3  75  ? 63.628  105.933 18.262  1.00 2.32   ? 75  TYR C N   1 
ATOM   7179  C  CA  . TYR C 3  75  ? 62.830  106.827 19.068  1.00 6.03   ? 75  TYR C CA  1 
ATOM   7180  C  C   . TYR C 3  75  ? 62.266  106.141 20.285  1.00 7.84   ? 75  TYR C C   1 
ATOM   7181  O  O   . TYR C 3  75  ? 61.875  106.860 21.231  1.00 14.26  ? 75  TYR C O   1 
ATOM   7182  C  CB  . TYR C 3  75  ? 61.836  107.647 18.269  1.00 5.20   ? 75  TYR C CB  1 
ATOM   7183  C  CG  . TYR C 3  75  ? 62.524  108.307 17.090  1.00 8.64   ? 75  TYR C CG  1 
ATOM   7184  C  CD1 . TYR C 3  75  ? 63.320  109.407 17.322  1.00 6.07   ? 75  TYR C CD1 1 
ATOM   7185  C  CD2 . TYR C 3  75  ? 62.471  107.774 15.806  1.00 9.76   ? 75  TYR C CD2 1 
ATOM   7186  C  CE1 . TYR C 3  75  ? 63.982  110.034 16.293  1.00 6.13   ? 75  TYR C CE1 1 
ATOM   7187  C  CE2 . TYR C 3  75  ? 63.157  108.386 14.781  1.00 11.97  ? 75  TYR C CE2 1 
ATOM   7188  C  CZ  . TYR C 3  75  ? 63.909  109.514 15.032  1.00 11.97  ? 75  TYR C CZ  1 
ATOM   7189  O  OH  . TYR C 3  75  ? 64.601  110.085 13.983  1.00 22.76  ? 75  TYR C OH  1 
ATOM   7190  N  N   . GLY C 3  76  ? 62.607  104.887 20.539  1.00 7.93   ? 76  GLY C N   1 
ATOM   7191  C  CA  . GLY C 3  76  ? 62.299  104.183 21.763  1.00 11.98  ? 76  GLY C CA  1 
ATOM   7192  C  C   . GLY C 3  76  ? 62.835  104.835 23.029  1.00 11.69  ? 76  GLY C C   1 
ATOM   7193  O  O   . GLY C 3  76  ? 62.549  104.440 24.164  1.00 7.67   ? 76  GLY C O   1 
ATOM   7194  N  N   . TRP C 3  77  ? 63.736  105.797 22.872  1.00 12.97  ? 77  TRP C N   1 
ATOM   7195  C  CA  . TRP C 3  77  ? 64.356  106.460 23.999  1.00 13.21  ? 77  TRP C CA  1 
ATOM   7196  C  C   . TRP C 3  77  ? 63.477  107.574 24.537  1.00 13.91  ? 77  TRP C C   1 
ATOM   7197  O  O   . TRP C 3  77  ? 63.359  107.604 25.752  1.00 16.01  ? 77  TRP C O   1 
ATOM   7198  C  CB  . TRP C 3  77  ? 65.767  106.965 23.723  1.00 7.68   ? 77  TRP C CB  1 
ATOM   7199  C  CG  . TRP C 3  77  ? 65.923  107.800 22.496  1.00 8.00   ? 77  TRP C CG  1 
ATOM   7200  C  CD1 . TRP C 3  77  ? 66.191  107.424 21.212  1.00 14.55  ? 77  TRP C CD1 1 
ATOM   7201  C  CD2 . TRP C 3  77  ? 65.805  109.229 22.463  1.00 8.02   ? 77  TRP C CD2 1 
ATOM   7202  N  NE1 . TRP C 3  77  ? 66.254  108.528 20.388  1.00 10.43  ? 77  TRP C NE1 1 
ATOM   7203  C  CE2 . TRP C 3  77  ? 65.971  109.645 21.136  1.00 2.64   ? 77  TRP C CE2 1 
ATOM   7204  C  CE3 . TRP C 3  77  ? 65.509  110.171 23.447  1.00 8.21   ? 77  TRP C CE3 1 
ATOM   7205  C  CZ2 . TRP C 3  77  ? 65.915  110.978 20.757  1.00 5.59   ? 77  TRP C CZ2 1 
ATOM   7206  C  CZ3 . TRP C 3  77  ? 65.419  111.498 23.081  1.00 4.68   ? 77  TRP C CZ3 1 
ATOM   7207  C  CH2 . TRP C 3  77  ? 65.633  111.866 21.754  1.00 6.94   ? 77  TRP C CH2 1 
ATOM   7208  N  N   . ILE C 3  78  ? 62.893  108.423 23.691  1.00 18.24  ? 78  ILE C N   1 
ATOM   7209  C  CA  . ILE C 3  78  ? 62.026  109.495 24.164  1.00 13.29  ? 78  ILE C CA  1 
ATOM   7210  C  C   . ILE C 3  78  ? 60.749  108.806 24.696  1.00 14.23  ? 78  ILE C C   1 
ATOM   7211  O  O   . ILE C 3  78  ? 60.292  108.986 25.811  1.00 12.21  ? 78  ILE C O   1 
ATOM   7212  C  CB  . ILE C 3  78  ? 61.497  110.509 23.176  1.00 11.87  ? 78  ILE C CB  1 
ATOM   7213  C  CG1 . ILE C 3  78  ? 61.637  110.242 21.691  1.00 11.01  ? 78  ILE C CG1 1 
ATOM   7214  C  CG2 . ILE C 3  78  ? 61.918  111.933 23.484  1.00 24.33  ? 78  ILE C CG2 1 
ATOM   7215  C  CD1 . ILE C 3  78  ? 61.189  111.497 20.921  1.00 3.98   ? 78  ILE C CD1 1 
ATOM   7216  N  N   . ILE C 3  79  ? 60.180  107.983 23.787  1.00 10.77  ? 79  ILE C N   1 
ATOM   7217  C  CA  . ILE C 3  79  ? 58.959  107.338 24.251  1.00 7.34   ? 79  ILE C CA  1 
ATOM   7218  C  C   . ILE C 3  79  ? 59.122  106.866 25.678  1.00 9.44   ? 79  ILE C C   1 
ATOM   7219  O  O   . ILE C 3  79  ? 58.323  107.242 26.540  1.00 16.33  ? 79  ILE C O   1 
ATOM   7220  C  CB  . ILE C 3  79  ? 58.448  106.227 23.365  1.00 4.60   ? 79  ILE C CB  1 
ATOM   7221  C  CG1 . ILE C 3  79  ? 58.481  106.672 21.898  1.00 9.76   ? 79  ILE C CG1 1 
ATOM   7222  C  CG2 . ILE C 3  79  ? 57.024  105.885 23.803  1.00 9.80   ? 79  ILE C CG2 1 
ATOM   7223  C  CD1 . ILE C 3  79  ? 58.080  105.525 20.975  1.00 3.40   ? 79  ILE C CD1 1 
ATOM   7224  N  N   . ARG C 3  80  ? 60.139  106.067 25.980  1.00 10.13  ? 80  ARG C N   1 
ATOM   7225  C  CA  . ARG C 3  80  ? 60.333  105.623 27.355  1.00 9.32   ? 80  ARG C CA  1 
ATOM   7226  C  C   . ARG C 3  80  ? 60.473  106.770 28.334  1.00 6.94   ? 80  ARG C C   1 
ATOM   7227  O  O   . ARG C 3  80  ? 59.582  107.019 29.152  1.00 6.00   ? 80  ARG C O   1 
ATOM   7228  C  CB  . ARG C 3  80  ? 61.536  104.636 27.420  1.00 5.23   ? 80  ARG C CB  1 
ATOM   7229  C  CG  . ARG C 3  80  ? 61.667  103.981 28.812  1.00 3.64   ? 80  ARG C CG  1 
ATOM   7230  C  CD  . ARG C 3  80  ? 62.802  104.694 29.562  1.00 5.29   ? 80  ARG C CD  1 
ATOM   7231  N  NE  . ARG C 3  80  ? 62.810  104.430 30.996  1.00 16.92  ? 80  ARG C NE  1 
ATOM   7232  C  CZ  . ARG C 3  80  ? 63.862  103.806 31.539  1.00 9.85   ? 80  ARG C CZ  1 
ATOM   7233  N  NH1 . ARG C 3  80  ? 64.802  103.495 30.662  1.00 16.99  ? 80  ARG C NH1 1 
ATOM   7234  N  NH2 . ARG C 3  80  ? 63.922  103.546 32.821  1.00 7.25   ? 80  ARG C NH2 1 
ATOM   7235  N  N   . TYR C 3  81  ? 61.491  107.606 28.189  1.00 7.05   ? 81  TYR C N   1 
ATOM   7236  C  CA  . TYR C 3  81  ? 61.569  108.784 29.049  1.00 14.87  ? 81  TYR C CA  1 
ATOM   7237  C  C   . TYR C 3  81  ? 60.296  109.604 29.159  1.00 14.91  ? 81  TYR C C   1 
ATOM   7238  O  O   . TYR C 3  81  ? 59.980  110.084 30.245  1.00 11.90  ? 81  TYR C O   1 
ATOM   7239  C  CB  . TYR C 3  81  ? 62.779  109.631 28.625  1.00 20.95  ? 81  TYR C CB  1 
ATOM   7240  C  CG  . TYR C 3  81  ? 64.045  108.945 29.094  1.00 32.24  ? 81  TYR C CG  1 
ATOM   7241  C  CD1 . TYR C 3  81  ? 64.555  109.161 30.364  1.00 42.03  ? 81  TYR C CD1 1 
ATOM   7242  C  CD2 . TYR C 3  81  ? 64.706  108.068 28.262  1.00 38.94  ? 81  TYR C CD2 1 
ATOM   7243  C  CE1 . TYR C 3  81  ? 65.705  108.510 30.778  1.00 46.77  ? 81  TYR C CE1 1 
ATOM   7244  C  CE2 . TYR C 3  81  ? 65.857  107.415 28.666  1.00 43.85  ? 81  TYR C CE2 1 
ATOM   7245  C  CZ  . TYR C 3  81  ? 66.350  107.642 29.929  1.00 44.97  ? 81  TYR C CZ  1 
ATOM   7246  O  OH  . TYR C 3  81  ? 67.489  107.009 30.363  1.00 43.97  ? 81  TYR C OH  1 
ATOM   7247  N  N   . MET C 3  82  ? 59.582  109.778 28.059  1.00 16.16  ? 82  MET C N   1 
ATOM   7248  C  CA  . MET C 3  82  ? 58.329  110.505 27.945  1.00 13.21  ? 82  MET C CA  1 
ATOM   7249  C  C   . MET C 3  82  ? 57.309  109.819 28.854  1.00 13.35  ? 82  MET C C   1 
ATOM   7250  O  O   . MET C 3  82  ? 56.580  110.434 29.620  1.00 19.21  ? 82  MET C O   1 
ATOM   7251  C  CB  . MET C 3  82  ? 57.800  110.469 26.521  1.00 9.21   ? 82  MET C CB  1 
ATOM   7252  C  CG  . MET C 3  82  ? 57.714  111.770 25.753  1.00 9.57   ? 82  MET C CG  1 
ATOM   7253  S  SD  . MET C 3  82  ? 56.762  111.551 24.236  1.00 23.55  ? 82  MET C SD  1 
ATOM   7254  C  CE  . MET C 3  82  ? 57.872  110.657 23.196  1.00 18.62  ? 82  MET C CE  1 
ATOM   7255  N  N   . HIS C 3  83  ? 57.335  108.490 28.818  1.00 16.02  ? 83  HIS C N   1 
ATOM   7256  C  CA  . HIS C 3  83  ? 56.498  107.635 29.651  1.00 7.96   ? 83  HIS C CA  1 
ATOM   7257  C  C   . HIS C 3  83  ? 56.825  107.809 31.115  1.00 2.20   ? 83  HIS C C   1 
ATOM   7258  O  O   . HIS C 3  83  ? 55.984  107.908 31.952  1.00 7.41   ? 83  HIS C O   1 
ATOM   7259  C  CB  . HIS C 3  83  ? 56.625  106.162 29.292  1.00 7.11   ? 83  HIS C CB  1 
ATOM   7260  C  CG  . HIS C 3  83  ? 55.609  105.351 30.037  1.00 10.74  ? 83  HIS C CG  1 
ATOM   7261  N  ND1 . HIS C 3  83  ? 54.515  105.920 30.622  1.00 16.91  ? 83  HIS C ND1 1 
ATOM   7262  C  CD2 . HIS C 3  83  ? 55.477  104.027 30.305  1.00 19.63  ? 83  HIS C CD2 1 
ATOM   7263  C  CE1 . HIS C 3  83  ? 53.772  104.971 31.195  1.00 23.57  ? 83  HIS C CE1 1 
ATOM   7264  N  NE2 . HIS C 3  83  ? 54.324  103.779 31.041  1.00 11.96  ? 83  HIS C NE2 1 
ATOM   7265  N  N   . ALA C 3  84  ? 58.123  107.696 31.459  1.00 8.22   ? 84  ALA C N   1 
ATOM   7266  C  CA  . ALA C 3  84  ? 58.552  107.871 32.849  1.00 6.63   ? 84  ALA C CA  1 
ATOM   7267  C  C   . ALA C 3  84  ? 58.157  109.272 33.248  1.00 2.20   ? 84  ALA C C   1 
ATOM   7268  O  O   . ALA C 3  84  ? 57.473  109.486 34.247  1.00 7.58   ? 84  ALA C O   1 
ATOM   7269  C  CB  . ALA C 3  84  ? 60.057  107.691 32.905  1.00 8.67   ? 84  ALA C CB  1 
ATOM   7270  N  N   . ASN C 3  85  ? 58.765  110.327 32.632  1.00 2.20   ? 85  ASN C N   1 
ATOM   7271  C  CA  . ASN C 3  85  ? 58.368  111.684 33.080  1.00 3.17   ? 85  ASN C CA  1 
ATOM   7272  C  C   . ASN C 3  85  ? 56.866  111.865 32.970  1.00 5.54   ? 85  ASN C C   1 
ATOM   7273  O  O   . ASN C 3  85  ? 56.277  112.622 33.753  1.00 4.56   ? 85  ASN C O   1 
ATOM   7274  C  CB  . ASN C 3  85  ? 59.119  112.632 32.127  1.00 8.99   ? 85  ASN C CB  1 
ATOM   7275  C  CG  . ASN C 3  85  ? 60.609  112.378 32.151  1.00 17.34  ? 85  ASN C CG  1 
ATOM   7276  O  OD1 . ASN C 3  85  ? 61.331  112.249 31.165  1.00 25.77  ? 85  ASN C OD1 1 
ATOM   7277  N  ND2 . ASN C 3  85  ? 61.000  112.317 33.421  1.00 21.89  ? 85  ASN C ND2 1 
ATOM   7278  N  N   . GLY C 3  86  ? 56.192  111.188 31.999  1.00 2.49   ? 86  GLY C N   1 
ATOM   7279  C  CA  . GLY C 3  86  ? 54.733  111.370 31.956  1.00 5.10   ? 86  GLY C CA  1 
ATOM   7280  C  C   . GLY C 3  86  ? 54.065  111.264 33.334  1.00 10.57  ? 86  GLY C C   1 
ATOM   7281  O  O   . GLY C 3  86  ? 53.152  112.014 33.707  1.00 4.88   ? 86  GLY C O   1 
ATOM   7282  N  N   . ALA C 3  87  ? 54.446  110.175 34.025  1.00 14.08  ? 87  ALA C N   1 
ATOM   7283  C  CA  . ALA C 3  87  ? 53.892  109.761 35.303  1.00 9.24   ? 87  ALA C CA  1 
ATOM   7284  C  C   . ALA C 3  87  ? 54.195  110.674 36.474  1.00 8.81   ? 87  ALA C C   1 
ATOM   7285  O  O   . ALA C 3  87  ? 53.377  110.871 37.392  1.00 7.57   ? 87  ALA C O   1 
ATOM   7286  C  CB  . ALA C 3  87  ? 54.260  108.330 35.573  1.00 6.62   ? 87  ALA C CB  1 
ATOM   7287  N  N   . SER C 3  88  ? 55.274  111.448 36.342  1.00 8.12   ? 88  SER C N   1 
ATOM   7288  C  CA  . SER C 3  88  ? 55.465  112.570 37.260  1.00 9.16   ? 88  SER C CA  1 
ATOM   7289  C  C   . SER C 3  88  ? 54.438  113.661 37.051  1.00 10.95  ? 88  SER C C   1 
ATOM   7290  O  O   . SER C 3  88  ? 53.832  114.151 38.007  1.00 15.29  ? 88  SER C O   1 
ATOM   7291  C  CB  . SER C 3  88  ? 56.926  112.994 37.189  1.00 13.51  ? 88  SER C CB  1 
ATOM   7292  O  OG  . SER C 3  88  ? 57.726  111.798 37.135  1.00 8.11   ? 88  SER C OG  1 
ATOM   7293  N  N   . MET C 3  89  ? 54.151  114.018 35.802  1.00 10.66  ? 89  MET C N   1 
ATOM   7294  C  CA  . MET C 3  89  ? 53.144  115.004 35.411  1.00 5.72   ? 89  MET C CA  1 
ATOM   7295  C  C   . MET C 3  89  ? 51.721  114.602 35.831  1.00 7.64   ? 89  MET C C   1 
ATOM   7296  O  O   . MET C 3  89  ? 50.943  115.341 36.426  1.00 9.66   ? 89  MET C O   1 
ATOM   7297  C  CB  . MET C 3  89  ? 53.161  115.143 33.895  1.00 8.44   ? 89  MET C CB  1 
ATOM   7298  C  CG  . MET C 3  89  ? 54.059  116.187 33.261  1.00 2.51   ? 89  MET C CG  1 
ATOM   7299  S  SD  . MET C 3  89  ? 54.726  117.341 34.454  1.00 6.82   ? 89  MET C SD  1 
ATOM   7300  C  CE  . MET C 3  89  ? 53.964  118.886 34.024  1.00 7.48   ? 89  MET C CE  1 
ATOM   7301  N  N   . PHE C 3  90  ? 51.343  113.371 35.520  1.00 6.25   ? 90  PHE C N   1 
ATOM   7302  C  CA  . PHE C 3  90  ? 50.076  112.795 35.935  1.00 2.40   ? 90  PHE C CA  1 
ATOM   7303  C  C   . PHE C 3  90  ? 49.861  112.908 37.432  1.00 8.05   ? 90  PHE C C   1 
ATOM   7304  O  O   . PHE C 3  90  ? 48.732  113.051 37.942  1.00 4.11   ? 90  PHE C O   1 
ATOM   7305  C  CB  . PHE C 3  90  ? 50.076  111.292 35.530  1.00 7.18   ? 90  PHE C CB  1 
ATOM   7306  C  CG  . PHE C 3  90  ? 48.688  110.744 35.604  1.00 7.50   ? 90  PHE C CG  1 
ATOM   7307  C  CD1 . PHE C 3  90  ? 48.095  110.583 36.839  1.00 11.57  ? 90  PHE C CD1 1 
ATOM   7308  C  CD2 . PHE C 3  90  ? 47.945  110.440 34.496  1.00 3.14   ? 90  PHE C CD2 1 
ATOM   7309  C  CE1 . PHE C 3  90  ? 46.790  110.136 36.925  1.00 18.04  ? 90  PHE C CE1 1 
ATOM   7310  C  CE2 . PHE C 3  90  ? 46.635  109.986 34.575  1.00 3.47   ? 90  PHE C CE2 1 
ATOM   7311  C  CZ  . PHE C 3  90  ? 46.046  109.817 35.806  1.00 3.18   ? 90  PHE C CZ  1 
ATOM   7312  N  N   . PHE C 3  91  ? 50.963  112.841 38.192  1.00 7.11   ? 91  PHE C N   1 
ATOM   7313  C  CA  . PHE C 3  91  ? 50.796  112.998 39.648  1.00 10.08  ? 91  PHE C CA  1 
ATOM   7314  C  C   . PHE C 3  91  ? 50.803  114.470 40.001  1.00 6.92   ? 91  PHE C C   1 
ATOM   7315  O  O   . PHE C 3  91  ? 49.918  115.000 40.659  1.00 9.46   ? 91  PHE C O   1 
ATOM   7316  C  CB  . PHE C 3  91  ? 51.853  112.200 40.389  1.00 4.90   ? 91  PHE C CB  1 
ATOM   7317  C  CG  . PHE C 3  91  ? 51.469  110.772 40.595  1.00 7.31   ? 91  PHE C CG  1 
ATOM   7318  C  CD1 . PHE C 3  91  ? 50.721  110.434 41.688  1.00 2.20   ? 91  PHE C CD1 1 
ATOM   7319  C  CD2 . PHE C 3  91  ? 51.823  109.806 39.664  1.00 2.20   ? 91  PHE C CD2 1 
ATOM   7320  C  CE1 . PHE C 3  91  ? 50.284  109.134 41.868  1.00 4.77   ? 91  PHE C CE1 1 
ATOM   7321  C  CE2 . PHE C 3  91  ? 51.422  108.503 39.888  1.00 6.14   ? 91  PHE C CE2 1 
ATOM   7322  C  CZ  . PHE C 3  91  ? 50.662  108.154 40.978  1.00 3.04   ? 91  PHE C CZ  1 
ATOM   7323  N  N   . ILE C 3  92  ? 51.734  115.229 39.442  1.00 5.32   ? 92  ILE C N   1 
ATOM   7324  C  CA  . ILE C 3  92  ? 51.731  116.654 39.623  1.00 5.23   ? 92  ILE C CA  1 
ATOM   7325  C  C   . ILE C 3  92  ? 50.344  117.246 39.370  1.00 9.61   ? 92  ILE C C   1 
ATOM   7326  O  O   . ILE C 3  92  ? 49.842  118.048 40.154  1.00 3.66   ? 92  ILE C O   1 
ATOM   7327  C  CB  . ILE C 3  92  ? 52.690  117.323 38.614  1.00 8.56   ? 92  ILE C CB  1 
ATOM   7328  C  CG1 . ILE C 3  92  ? 54.107  116.813 38.858  1.00 3.81   ? 92  ILE C CG1 1 
ATOM   7329  C  CG2 . ILE C 3  92  ? 52.567  118.816 38.831  1.00 2.20   ? 92  ILE C CG2 1 
ATOM   7330  C  CD1 . ILE C 3  92  ? 55.174  117.864 38.717  1.00 3.42   ? 92  ILE C CD1 1 
ATOM   7331  N  N   . CYS C 3  93  ? 49.732  116.850 38.260  1.00 11.53  ? 93  CYS C N   1 
ATOM   7332  C  CA  . CYS C 3  93  ? 48.398  117.298 37.894  1.00 10.79  ? 93  CYS C CA  1 
ATOM   7333  C  C   . CYS C 3  93  ? 47.392  116.852 38.964  1.00 9.57   ? 93  CYS C C   1 
ATOM   7334  O  O   . CYS C 3  93  ? 46.577  117.680 39.351  1.00 12.68  ? 93  CYS C O   1 
ATOM   7335  C  CB  . CYS C 3  93  ? 47.998  116.693 36.551  1.00 9.57   ? 93  CYS C CB  1 
ATOM   7336  S  SG  . CYS C 3  93  ? 48.459  117.610 35.071  1.00 7.53   ? 93  CYS C SG  1 
ATOM   7337  N  N   . LEU C 3  94  ? 47.484  115.598 39.361  1.00 8.91   ? 94  LEU C N   1 
ATOM   7338  C  CA  . LEU C 3  94  ? 46.606  114.904 40.279  1.00 2.20   ? 94  LEU C CA  1 
ATOM   7339  C  C   . LEU C 3  94  ? 46.364  115.653 41.581  1.00 5.02   ? 94  LEU C C   1 
ATOM   7340  O  O   . LEU C 3  94  ? 45.238  115.968 42.009  1.00 6.65   ? 94  LEU C O   1 
ATOM   7341  C  CB  . LEU C 3  94  ? 47.001  113.460 40.429  1.00 4.93   ? 94  LEU C CB  1 
ATOM   7342  C  CG  . LEU C 3  94  ? 46.012  112.400 40.899  1.00 2.20   ? 94  LEU C CG  1 
ATOM   7343  C  CD1 . LEU C 3  94  ? 44.591  112.833 40.628  1.00 3.10   ? 94  LEU C CD1 1 
ATOM   7344  C  CD2 . LEU C 3  94  ? 46.332  111.092 40.191  1.00 4.26   ? 94  LEU C CD2 1 
ATOM   7345  N  N   . TYR C 3  95  ? 47.488  116.071 42.164  1.00 5.77   ? 95  TYR C N   1 
ATOM   7346  C  CA  . TYR C 3  95  ? 47.547  116.852 43.389  1.00 7.31   ? 95  TYR C CA  1 
ATOM   7347  C  C   . TYR C 3  95  ? 47.046  118.252 43.104  1.00 3.99   ? 95  TYR C C   1 
ATOM   7348  O  O   . TYR C 3  95  ? 46.458  118.965 43.928  1.00 4.41   ? 95  TYR C O   1 
ATOM   7349  C  CB  . TYR C 3  95  ? 48.971  116.857 43.976  1.00 9.32   ? 95  TYR C CB  1 
ATOM   7350  C  CG  . TYR C 3  95  ? 49.501  115.474 44.275  1.00 20.26  ? 95  TYR C CG  1 
ATOM   7351  C  CD1 . TYR C 3  95  ? 49.066  114.775 45.394  1.00 23.90  ? 95  TYR C CD1 1 
ATOM   7352  C  CD2 . TYR C 3  95  ? 50.415  114.829 43.463  1.00 22.78  ? 95  TYR C CD2 1 
ATOM   7353  C  CE1 . TYR C 3  95  ? 49.515  113.512 45.686  1.00 21.42  ? 95  TYR C CE1 1 
ATOM   7354  C  CE2 . TYR C 3  95  ? 50.862  113.554 43.743  1.00 22.53  ? 95  TYR C CE2 1 
ATOM   7355  C  CZ  . TYR C 3  95  ? 50.415  112.895 44.858  1.00 18.77  ? 95  TYR C CZ  1 
ATOM   7356  O  OH  . TYR C 3  95  ? 50.835  111.624 45.165  1.00 20.45  ? 95  TYR C OH  1 
ATOM   7357  N  N   . MET C 3  96  ? 47.197  118.751 41.864  1.00 6.96   ? 96  MET C N   1 
ATOM   7358  C  CA  . MET C 3  96  ? 46.567  120.081 41.683  1.00 7.57   ? 96  MET C CA  1 
ATOM   7359  C  C   . MET C 3  96  ? 45.047  119.899 41.664  1.00 7.18   ? 96  MET C C   1 
ATOM   7360  O  O   . MET C 3  96  ? 44.278  120.653 42.260  1.00 4.12   ? 96  MET C O   1 
ATOM   7361  C  CB  . MET C 3  96  ? 47.055  120.751 40.422  1.00 11.05  ? 96  MET C CB  1 
ATOM   7362  C  CG  . MET C 3  96  ? 48.543  120.553 40.173  1.00 2.20   ? 96  MET C CG  1 
ATOM   7363  S  SD  . MET C 3  96  ? 49.487  121.625 41.222  1.00 23.25  ? 96  MET C SD  1 
ATOM   7364  C  CE  . MET C 3  96  ? 49.947  122.959 40.114  1.00 4.11   ? 96  MET C CE  1 
ATOM   7365  N  N   . HIS C 3  97  ? 44.587  118.795 41.005  1.00 2.20   ? 97  HIS C N   1 
ATOM   7366  C  CA  . HIS C 3  97  ? 43.130  118.652 40.949  1.00 2.20   ? 97  HIS C CA  1 
ATOM   7367  C  C   . HIS C 3  97  ? 42.588  118.608 42.361  1.00 7.74   ? 97  HIS C C   1 
ATOM   7368  O  O   . HIS C 3  97  ? 41.652  119.349 42.693  1.00 11.32  ? 97  HIS C O   1 
ATOM   7369  C  CB  . HIS C 3  97  ? 42.906  117.370 40.176  1.00 2.20   ? 97  HIS C CB  1 
ATOM   7370  C  CG  . HIS C 3  97  ? 41.601  117.219 39.451  1.00 6.75   ? 97  HIS C CG  1 
ATOM   7371  N  ND1 . HIS C 3  97  ? 40.931  118.230 38.793  1.00 6.80   ? 97  HIS C ND1 1 
ATOM   7372  C  CD2 . HIS C 3  97  ? 40.831  116.112 39.286  1.00 6.65   ? 97  HIS C CD2 1 
ATOM   7373  C  CE1 . HIS C 3  97  ? 39.811  117.732 38.275  1.00 8.13   ? 97  HIS C CE1 1 
ATOM   7374  N  NE2 . HIS C 3  97  ? 39.709  116.432 38.553  1.00 8.05   ? 97  HIS C NE2 1 
ATOM   7375  N  N   . VAL C 3  98  ? 43.201  117.765 43.300  1.00 5.94   ? 98  VAL C N   1 
ATOM   7376  C  CA  . VAL C 3  98  ? 42.683  117.674 44.558  1.00 5.62   ? 98  VAL C CA  1 
ATOM   7377  C  C   . VAL C 3  98  ? 42.802  118.903 45.413  1.00 6.80   ? 98  VAL C C   1 
ATOM   7378  O  O   . VAL C 3  98  ? 41.869  119.221 46.164  1.00 17.45  ? 98  VAL C O   1 
ATOM   7379  C  CB  . VAL C 3  98  ? 43.340  116.511 45.286  1.00 3.50   ? 98  VAL C CB  1 
ATOM   7380  C  CG1 . VAL C 3  98  ? 42.760  116.374 46.689  1.00 4.77   ? 98  VAL C CG1 1 
ATOM   7381  C  CG2 . VAL C 3  98  ? 43.074  115.227 44.492  1.00 5.00   ? 98  VAL C CG2 1 
ATOM   7382  N  N   . GLY C 3  99  ? 43.924  119.604 45.279  1.00 4.86   ? 99  GLY C N   1 
ATOM   7383  C  CA  . GLY C 3  99  ? 44.109  120.824 46.063  1.00 6.21   ? 99  GLY C CA  1 
ATOM   7384  C  C   . GLY C 3  99  ? 42.902  121.744 45.871  1.00 9.19   ? 99  GLY C C   1 
ATOM   7385  O  O   . GLY C 3  99  ? 42.481  122.371 46.838  1.00 8.56   ? 99  GLY C O   1 
ATOM   7386  N  N   . ARG C 3  100 ? 42.424  121.750 44.625  1.00 7.09   ? 100 ARG C N   1 
ATOM   7387  C  CA  . ARG C 3  100 ? 41.293  122.585 44.306  1.00 6.96   ? 100 ARG C CA  1 
ATOM   7388  C  C   . ARG C 3  100 ? 40.012  122.041 44.908  1.00 7.12   ? 100 ARG C C   1 
ATOM   7389  O  O   . ARG C 3  100 ? 39.195  122.851 45.337  1.00 4.40   ? 100 ARG C O   1 
ATOM   7390  C  CB  . ARG C 3  100 ? 41.198  122.801 42.799  1.00 8.47   ? 100 ARG C CB  1 
ATOM   7391  C  CG  . ARG C 3  100 ? 39.797  123.285 42.434  1.00 2.20   ? 100 ARG C CG  1 
ATOM   7392  C  CD  . ARG C 3  100 ? 39.593  123.104 40.943  1.00 8.64   ? 100 ARG C CD  1 
ATOM   7393  N  NE  . ARG C 3  100 ? 38.615  122.039 40.760  1.00 5.74   ? 100 ARG C NE  1 
ATOM   7394  C  CZ  . ARG C 3  100 ? 38.690  121.249 39.682  1.00 2.20   ? 100 ARG C CZ  1 
ATOM   7395  N  NH1 . ARG C 3  100 ? 39.728  121.414 38.875  1.00 5.13   ? 100 ARG C NH1 1 
ATOM   7396  N  NH2 . ARG C 3  100 ? 37.845  120.248 39.499  1.00 3.95   ? 100 ARG C NH2 1 
ATOM   7397  N  N   . GLY C 3  101 ? 39.879  120.711 45.004  1.00 2.48   ? 101 GLY C N   1 
ATOM   7398  C  CA  . GLY C 3  101 ? 38.642  120.186 45.544  1.00 10.00  ? 101 GLY C CA  1 
ATOM   7399  C  C   . GLY C 3  101 ? 38.569  120.662 46.996  1.00 9.36   ? 101 GLY C C   1 
ATOM   7400  O  O   . GLY C 3  101 ? 37.514  121.050 47.460  1.00 13.33  ? 101 GLY C O   1 
ATOM   7401  N  N   . LEU C 3  102 ? 39.744  120.595 47.600  1.00 5.34   ? 102 LEU C N   1 
ATOM   7402  C  CA  . LEU C 3  102 ? 39.878  120.889 48.999  1.00 6.64   ? 102 LEU C CA  1 
ATOM   7403  C  C   . LEU C 3  102 ? 39.519  122.339 49.317  1.00 2.20   ? 102 LEU C C   1 
ATOM   7404  O  O   . LEU C 3  102 ? 39.086  122.683 50.344  1.00 2.61   ? 102 LEU C O   1 
ATOM   7405  C  CB  . LEU C 3  102 ? 41.260  120.454 49.441  1.00 2.31   ? 102 LEU C CB  1 
ATOM   7406  C  CG  . LEU C 3  102 ? 41.443  118.962 49.767  1.00 7.13   ? 102 LEU C CG  1 
ATOM   7407  C  CD1 . LEU C 3  102 ? 42.562  118.959 50.811  1.00 6.19   ? 102 LEU C CD1 1 
ATOM   7408  C  CD2 . LEU C 3  102 ? 40.191  118.248 50.244  1.00 5.12   ? 102 LEU C CD2 1 
ATOM   7409  N  N   . TYR C 3  103 ? 40.036  123.155 48.431  1.00 6.50   ? 103 TYR C N   1 
ATOM   7410  C  CA  . TYR C 3  103 ? 40.037  124.585 48.666  1.00 5.38   ? 103 TYR C CA  1 
ATOM   7411  C  C   . TYR C 3  103 ? 38.733  125.298 48.359  1.00 6.34   ? 103 TYR C C   1 
ATOM   7412  O  O   . TYR C 3  103 ? 38.284  126.069 49.186  1.00 3.22   ? 103 TYR C O   1 
ATOM   7413  C  CB  . TYR C 3  103 ? 41.134  125.179 47.789  1.00 6.11   ? 103 TYR C CB  1 
ATOM   7414  C  CG  . TYR C 3  103 ? 41.376  126.626 48.103  1.00 7.45   ? 103 TYR C CG  1 
ATOM   7415  C  CD1 . TYR C 3  103 ? 41.983  126.952 49.310  1.00 11.27  ? 103 TYR C CD1 1 
ATOM   7416  C  CD2 . TYR C 3  103 ? 41.002  127.634 47.243  1.00 5.48   ? 103 TYR C CD2 1 
ATOM   7417  C  CE1 . TYR C 3  103 ? 42.237  128.264 49.633  1.00 8.71   ? 103 TYR C CE1 1 
ATOM   7418  C  CE2 . TYR C 3  103 ? 41.276  128.942 47.563  1.00 6.49   ? 103 TYR C CE2 1 
ATOM   7419  C  CZ  . TYR C 3  103 ? 41.901  129.248 48.740  1.00 5.70   ? 103 TYR C CZ  1 
ATOM   7420  O  OH  . TYR C 3  103 ? 42.158  130.545 49.096  1.00 13.08  ? 103 TYR C OH  1 
ATOM   7421  N  N   . TYR C 3  104 ? 38.147  125.049 47.214  1.00 6.01   ? 104 TYR C N   1 
ATOM   7422  C  CA  . TYR C 3  104 ? 36.872  125.602 46.775  1.00 2.53   ? 104 TYR C CA  1 
ATOM   7423  C  C   . TYR C 3  104 ? 35.734  124.675 47.176  1.00 5.90   ? 104 TYR C C   1 
ATOM   7424  O  O   . TYR C 3  104 ? 34.553  124.938 47.077  1.00 6.29   ? 104 TYR C O   1 
ATOM   7425  C  CB  . TYR C 3  104 ? 36.972  125.723 45.268  1.00 5.88   ? 104 TYR C CB  1 
ATOM   7426  C  CG  . TYR C 3  104 ? 38.057  126.676 44.821  1.00 6.82   ? 104 TYR C CG  1 
ATOM   7427  C  CD1 . TYR C 3  104 ? 37.834  128.037 44.882  1.00 6.89   ? 104 TYR C CD1 1 
ATOM   7428  C  CD2 . TYR C 3  104 ? 39.283  126.224 44.377  1.00 2.20   ? 104 TYR C CD2 1 
ATOM   7429  C  CE1 . TYR C 3  104 ? 38.812  128.907 44.460  1.00 2.22   ? 104 TYR C CE1 1 
ATOM   7430  C  CE2 . TYR C 3  104 ? 40.276  127.069 43.925  1.00 3.48   ? 104 TYR C CE2 1 
ATOM   7431  C  CZ  . TYR C 3  104 ? 40.011  128.419 43.996  1.00 5.86   ? 104 TYR C CZ  1 
ATOM   7432  O  OH  . TYR C 3  104 ? 41.002  129.261 43.559  1.00 6.59   ? 104 TYR C OH  1 
ATOM   7433  N  N   . GLY C 3  105 ? 36.022  123.541 47.778  1.00 6.70   ? 105 GLY C N   1 
ATOM   7434  C  CA  . GLY C 3  105 ? 34.947  122.709 48.302  1.00 6.55   ? 105 GLY C CA  1 
ATOM   7435  C  C   . GLY C 3  105 ? 34.135  122.066 47.212  1.00 6.03   ? 105 GLY C C   1 
ATOM   7436  O  O   . GLY C 3  105 ? 32.965  121.736 47.346  1.00 2.74   ? 105 GLY C O   1 
ATOM   7437  N  N   . SER C 3  106 ? 34.842  121.679 46.147  1.00 11.91  ? 106 SER C N   1 
ATOM   7438  C  CA  . SER C 3  106 ? 34.210  120.985 45.025  1.00 9.65   ? 106 SER C CA  1 
ATOM   7439  C  C   . SER C 3  106 ? 33.680  119.630 45.452  1.00 7.52   ? 106 SER C C   1 
ATOM   7440  O  O   . SER C 3  106 ? 32.913  118.973 44.769  1.00 7.37   ? 106 SER C O   1 
ATOM   7441  C  CB  . SER C 3  106 ? 35.265  120.784 43.906  1.00 2.23   ? 106 SER C CB  1 
ATOM   7442  O  OG  . SER C 3  106 ? 35.544  122.084 43.380  1.00 6.32   ? 106 SER C OG  1 
ATOM   7443  N  N   . TYR C 3  107 ? 34.040  119.223 46.655  1.00 2.83   ? 107 TYR C N   1 
ATOM   7444  C  CA  . TYR C 3  107 ? 33.868  117.839 47.123  1.00 6.58   ? 107 TYR C CA  1 
ATOM   7445  C  C   . TYR C 3  107 ? 32.488  117.792 47.760  1.00 6.11   ? 107 TYR C C   1 
ATOM   7446  O  O   . TYR C 3  107 ? 32.074  116.861 48.408  1.00 5.31   ? 107 TYR C O   1 
ATOM   7447  C  CB  . TYR C 3  107 ? 34.962  117.515 48.137  1.00 2.20   ? 107 TYR C CB  1 
ATOM   7448  C  CG  . TYR C 3  107 ? 34.982  118.518 49.287  1.00 2.85   ? 107 TYR C CG  1 
ATOM   7449  C  CD1 . TYR C 3  107 ? 33.832  118.803 50.006  1.00 5.07   ? 107 TYR C CD1 1 
ATOM   7450  C  CD2 . TYR C 3  107 ? 36.136  119.175 49.652  1.00 3.11   ? 107 TYR C CD2 1 
ATOM   7451  C  CE1 . TYR C 3  107 ? 33.855  119.692 51.042  1.00 5.16   ? 107 TYR C CE1 1 
ATOM   7452  C  CE2 . TYR C 3  107 ? 36.178  120.054 50.715  1.00 4.63   ? 107 TYR C CE2 1 
ATOM   7453  C  CZ  . TYR C 3  107 ? 35.024  120.320 51.401  1.00 6.59   ? 107 TYR C CZ  1 
ATOM   7454  O  OH  . TYR C 3  107 ? 34.995  121.199 52.462  1.00 3.66   ? 107 TYR C OH  1 
ATOM   7455  N  N   . THR C 3  108 ? 31.825  118.915 47.499  1.00 5.57   ? 108 THR C N   1 
ATOM   7456  C  CA  . THR C 3  108 ? 30.441  119.067 47.951  1.00 6.87   ? 108 THR C CA  1 
ATOM   7457  C  C   . THR C 3  108 ? 29.637  118.100 47.065  1.00 6.52   ? 108 THR C C   1 
ATOM   7458  O  O   . THR C 3  108 ? 28.917  117.242 47.569  1.00 3.31   ? 108 THR C O   1 
ATOM   7459  C  CB  . THR C 3  108 ? 30.028  120.518 47.689  1.00 11.79  ? 108 THR C CB  1 
ATOM   7460  O  OG1 . THR C 3  108 ? 30.437  121.372 48.760  1.00 6.20   ? 108 THR C OG1 1 
ATOM   7461  C  CG2 . THR C 3  108 ? 28.531  120.629 47.427  1.00 23.48  ? 108 THR C CG2 1 
ATOM   7462  N  N   . PHE C 3  109 ? 30.101  117.929 45.846  1.00 5.25   ? 109 PHE C N   1 
ATOM   7463  C  CA  . PHE C 3  109 ? 29.730  116.898 44.905  1.00 6.48   ? 109 PHE C CA  1 
ATOM   7464  C  C   . PHE C 3  109 ? 30.050  115.491 45.384  1.00 4.03   ? 109 PHE C C   1 
ATOM   7465  O  O   . PHE C 3  109 ? 30.747  114.702 44.756  1.00 6.87   ? 109 PHE C O   1 
ATOM   7466  C  CB  . PHE C 3  109 ? 30.491  117.246 43.620  1.00 3.08   ? 109 PHE C CB  1 
ATOM   7467  C  CG  . PHE C 3  109 ? 30.107  118.569 43.005  1.00 3.89   ? 109 PHE C CG  1 
ATOM   7468  C  CD1 . PHE C 3  109 ? 28.893  119.199 43.224  1.00 2.83   ? 109 PHE C CD1 1 
ATOM   7469  C  CD2 . PHE C 3  109 ? 31.006  119.191 42.155  1.00 2.91   ? 109 PHE C CD2 1 
ATOM   7470  C  CE1 . PHE C 3  109 ? 28.605  120.398 42.616  1.00 4.78   ? 109 PHE C CE1 1 
ATOM   7471  C  CE2 . PHE C 3  109 ? 30.723  120.385 41.541  1.00 5.29   ? 109 PHE C CE2 1 
ATOM   7472  C  CZ  . PHE C 3  109 ? 29.511  121.002 41.767  1.00 4.77   ? 109 PHE C CZ  1 
ATOM   7473  N  N   . LEU C 3  110 ? 29.471  115.153 46.535  1.00 6.37   ? 110 LEU C N   1 
ATOM   7474  C  CA  . LEU C 3  110 ? 29.648  113.963 47.300  1.00 3.90   ? 110 LEU C CA  1 
ATOM   7475  C  C   . LEU C 3  110 ? 30.109  112.803 46.426  1.00 3.49   ? 110 LEU C C   1 
ATOM   7476  O  O   . LEU C 3  110 ? 31.262  112.381 46.566  1.00 2.20   ? 110 LEU C O   1 
ATOM   7477  C  CB  . LEU C 3  110 ? 28.389  113.579 48.077  1.00 2.20   ? 110 LEU C CB  1 
ATOM   7478  C  CG  . LEU C 3  110 ? 28.746  112.800 49.354  1.00 15.38  ? 110 LEU C CG  1 
ATOM   7479  C  CD1 . LEU C 3  110 ? 28.908  113.793 50.494  1.00 20.76  ? 110 LEU C CD1 1 
ATOM   7480  C  CD2 . LEU C 3  110 ? 27.762  111.697 49.680  1.00 22.21  ? 110 LEU C CD2 1 
ATOM   7481  N  N   . GLU C 3  111 ? 29.196  112.376 45.557  1.00 4.96   ? 111 GLU C N   1 
ATOM   7482  C  CA  . GLU C 3  111 ? 29.327  111.304 44.609  1.00 7.15   ? 111 GLU C CA  1 
ATOM   7483  C  C   . GLU C 3  111 ? 30.466  111.523 43.617  1.00 7.92   ? 111 GLU C C   1 
ATOM   7484  O  O   . GLU C 3  111 ? 31.228  110.596 43.341  1.00 9.00   ? 111 GLU C O   1 
ATOM   7485  C  CB  . GLU C 3  111 ? 28.084  110.934 43.808  1.00 10.45  ? 111 GLU C CB  1 
ATOM   7486  C  CG  . GLU C 3  111 ? 26.740  110.955 44.423  1.00 2.28   ? 111 GLU C CG  1 
ATOM   7487  C  CD  . GLU C 3  111 ? 26.129  112.260 44.831  1.00 6.82   ? 111 GLU C CD  1 
ATOM   7488  O  OE1 . GLU C 3  111 ? 26.718  113.327 44.549  1.00 16.13  ? 111 GLU C OE1 1 
ATOM   7489  O  OE2 . GLU C 3  111 ? 25.056  112.256 45.488  1.00 2.24   ? 111 GLU C OE2 1 
ATOM   7490  N  N   . THR C 3  112 ? 30.595  112.704 43.033  1.00 9.97   ? 112 THR C N   1 
ATOM   7491  C  CA  . THR C 3  112 ? 31.725  112.908 42.098  1.00 10.25  ? 112 THR C CA  1 
ATOM   7492  C  C   . THR C 3  112 ? 33.045  112.745 42.847  1.00 11.59  ? 112 THR C C   1 
ATOM   7493  O  O   . THR C 3  112 ? 33.928  112.040 42.378  1.00 12.94  ? 112 THR C O   1 
ATOM   7494  C  CB  . THR C 3  112 ? 31.678  114.309 41.480  1.00 2.49   ? 112 THR C CB  1 
ATOM   7495  O  OG1 . THR C 3  112 ? 30.957  114.204 40.245  1.00 10.07  ? 112 THR C OG1 1 
ATOM   7496  C  CG2 . THR C 3  112 ? 33.073  114.773 41.079  1.00 4.42   ? 112 THR C CG2 1 
ATOM   7497  N  N   . TRP C 3  113 ? 33.172  113.368 44.016  1.00 10.29  ? 113 TRP C N   1 
ATOM   7498  C  CA  . TRP C 3  113 ? 34.398  113.256 44.790  1.00 7.98   ? 113 TRP C CA  1 
ATOM   7499  C  C   . TRP C 3  113 ? 34.721  111.788 45.043  1.00 8.39   ? 113 TRP C C   1 
ATOM   7500  O  O   . TRP C 3  113 ? 35.894  111.440 44.960  1.00 6.88   ? 113 TRP C O   1 
ATOM   7501  C  CB  . TRP C 3  113 ? 34.169  113.848 46.185  1.00 9.91   ? 113 TRP C CB  1 
ATOM   7502  C  CG  . TRP C 3  113 ? 35.401  113.942 47.031  1.00 6.94   ? 113 TRP C CG  1 
ATOM   7503  C  CD1 . TRP C 3  113 ? 35.808  113.228 48.111  1.00 4.31   ? 113 TRP C CD1 1 
ATOM   7504  C  CD2 . TRP C 3  113 ? 36.418  114.927 46.802  1.00 2.20   ? 113 TRP C CD2 1 
ATOM   7505  N  NE1 . TRP C 3  113 ? 37.027  113.684 48.634  1.00 2.20   ? 113 TRP C NE1 1 
ATOM   7506  C  CE2 . TRP C 3  113 ? 37.328  114.789 47.880  1.00 2.58   ? 113 TRP C CE2 1 
ATOM   7507  C  CE3 . TRP C 3  113 ? 36.520  116.003 45.925  1.00 2.20   ? 113 TRP C CE3 1 
ATOM   7508  C  CZ2 . TRP C 3  113 ? 38.468  115.587 47.966  1.00 2.70   ? 113 TRP C CZ2 1 
ATOM   7509  C  CZ3 . TRP C 3  113 ? 37.627  116.810 46.027  1.00 2.20   ? 113 TRP C CZ3 1 
ATOM   7510  C  CH2 . TRP C 3  113 ? 38.594  116.574 47.015  1.00 2.85   ? 113 TRP C CH2 1 
ATOM   7511  N  N   . ASN C 3  114 ? 33.688  111.040 45.477  1.00 5.22   ? 114 ASN C N   1 
ATOM   7512  C  CA  . ASN C 3  114 ? 34.020  109.669 45.869  1.00 4.35   ? 114 ASN C CA  1 
ATOM   7513  C  C   . ASN C 3  114 ? 34.811  108.985 44.781  1.00 8.85   ? 114 ASN C C   1 
ATOM   7514  O  O   . ASN C 3  114 ? 35.908  108.464 44.995  1.00 10.74  ? 114 ASN C O   1 
ATOM   7515  C  CB  . ASN C 3  114 ? 32.784  108.933 46.315  1.00 8.31   ? 114 ASN C CB  1 
ATOM   7516  C  CG  . ASN C 3  114 ? 32.313  109.540 47.640  1.00 17.42  ? 114 ASN C CG  1 
ATOM   7517  O  OD1 . ASN C 3  114 ? 33.172  109.868 48.477  1.00 7.02   ? 114 ASN C OD1 1 
ATOM   7518  N  ND2 . ASN C 3  114 ? 30.984  109.645 47.753  1.00 23.86  ? 114 ASN C ND2 1 
ATOM   7519  N  N   . ILE C 3  115 ? 34.275  109.026 43.560  1.00 10.59  ? 115 ILE C N   1 
ATOM   7520  C  CA  . ILE C 3  115 ? 34.915  108.446 42.388  1.00 2.20   ? 115 ILE C CA  1 
ATOM   7521  C  C   . ILE C 3  115 ? 36.284  109.038 42.159  1.00 5.42   ? 115 ILE C C   1 
ATOM   7522  O  O   . ILE C 3  115 ? 37.204  108.342 41.692  1.00 3.58   ? 115 ILE C O   1 
ATOM   7523  C  CB  . ILE C 3  115 ? 34.073  108.655 41.112  1.00 2.49   ? 115 ILE C CB  1 
ATOM   7524  C  CG1 . ILE C 3  115 ? 32.610  108.557 41.592  1.00 2.20   ? 115 ILE C CG1 1 
ATOM   7525  C  CG2 . ILE C 3  115 ? 34.374  107.665 40.059  1.00 5.27   ? 115 ILE C CG2 1 
ATOM   7526  C  CD1 . ILE C 3  115 ? 31.889  107.299 41.161  1.00 5.57   ? 115 ILE C CD1 1 
ATOM   7527  N  N   . GLY C 3  116 ? 36.471  110.298 42.515  1.00 5.33   ? 116 GLY C N   1 
ATOM   7528  C  CA  . GLY C 3  116 ? 37.777  110.934 42.456  1.00 5.59   ? 116 GLY C CA  1 
ATOM   7529  C  C   . GLY C 3  116 ? 38.771  110.170 43.317  1.00 10.10  ? 116 GLY C C   1 
ATOM   7530  O  O   . GLY C 3  116 ? 39.892  109.907 42.888  1.00 11.59  ? 116 GLY C O   1 
ATOM   7531  N  N   . VAL C 3  117 ? 38.380  109.852 44.550  1.00 13.72  ? 117 VAL C N   1 
ATOM   7532  C  CA  . VAL C 3  117 ? 39.284  109.132 45.460  1.00 9.44   ? 117 VAL C CA  1 
ATOM   7533  C  C   . VAL C 3  117 ? 39.626  107.790 44.835  1.00 6.19   ? 117 VAL C C   1 
ATOM   7534  O  O   . VAL C 3  117 ? 40.796  107.456 44.677  1.00 6.30   ? 117 VAL C O   1 
ATOM   7535  C  CB  . VAL C 3  117 ? 38.679  108.963 46.857  1.00 8.01   ? 117 VAL C CB  1 
ATOM   7536  C  CG1 . VAL C 3  117 ? 39.732  108.471 47.825  1.00 6.68   ? 117 VAL C CG1 1 
ATOM   7537  C  CG2 . VAL C 3  117 ? 38.125  110.275 47.365  1.00 8.55   ? 117 VAL C CG2 1 
ATOM   7538  N  N   . ILE C 3  118 ? 38.592  107.104 44.362  1.00 2.27   ? 118 ILE C N   1 
ATOM   7539  C  CA  . ILE C 3  118 ? 38.757  105.824 43.693  1.00 4.62   ? 118 ILE C CA  1 
ATOM   7540  C  C   . ILE C 3  118 ? 39.783  105.884 42.547  1.00 7.63   ? 118 ILE C C   1 
ATOM   7541  O  O   . ILE C 3  118 ? 40.644  105.013 42.406  1.00 4.34   ? 118 ILE C O   1 
ATOM   7542  C  CB  . ILE C 3  118 ? 37.495  105.197 43.087  1.00 2.43   ? 118 ILE C CB  1 
ATOM   7543  C  CG1 . ILE C 3  118 ? 36.465  104.786 44.131  1.00 4.57   ? 118 ILE C CG1 1 
ATOM   7544  C  CG2 . ILE C 3  118 ? 37.956  103.950 42.317  1.00 4.47   ? 118 ILE C CG2 1 
ATOM   7545  C  CD1 . ILE C 3  118 ? 36.083  103.326 44.080  1.00 5.63   ? 118 ILE C CD1 1 
ATOM   7546  N  N   . LEU C 3  119 ? 39.626  106.886 41.704  1.00 9.46   ? 119 LEU C N   1 
ATOM   7547  C  CA  . LEU C 3  119 ? 40.520  107.240 40.605  1.00 7.71   ? 119 LEU C CA  1 
ATOM   7548  C  C   . LEU C 3  119 ? 41.949  107.405 41.161  1.00 7.98   ? 119 LEU C C   1 
ATOM   7549  O  O   . LEU C 3  119 ? 42.847  106.630 40.849  1.00 2.34   ? 119 LEU C O   1 
ATOM   7550  C  CB  . LEU C 3  119 ? 40.071  108.586 40.097  1.00 2.20   ? 119 LEU C CB  1 
ATOM   7551  C  CG  . LEU C 3  119 ? 39.856  108.905 38.632  1.00 6.66   ? 119 LEU C CG  1 
ATOM   7552  C  CD1 . LEU C 3  119 ? 39.758  107.851 37.551  1.00 2.20   ? 119 LEU C CD1 1 
ATOM   7553  C  CD2 . LEU C 3  119 ? 38.709  109.883 38.338  1.00 2.27   ? 119 LEU C CD2 1 
ATOM   7554  N  N   . LEU C 3  120 ? 42.109  108.350 42.084  1.00 9.89   ? 120 LEU C N   1 
ATOM   7555  C  CA  . LEU C 3  120 ? 43.371  108.651 42.723  1.00 8.26   ? 120 LEU C CA  1 
ATOM   7556  C  C   . LEU C 3  120 ? 44.104  107.452 43.305  1.00 7.73   ? 120 LEU C C   1 
ATOM   7557  O  O   . LEU C 3  120 ? 45.329  107.401 43.193  1.00 2.62   ? 120 LEU C O   1 
ATOM   7558  C  CB  . LEU C 3  120 ? 43.238  109.650 43.880  1.00 11.37  ? 120 LEU C CB  1 
ATOM   7559  C  CG  . LEU C 3  120 ? 44.545  109.817 44.684  1.00 4.22   ? 120 LEU C CG  1 
ATOM   7560  C  CD1 . LEU C 3  120 ? 45.591  110.520 43.811  1.00 3.54   ? 120 LEU C CD1 1 
ATOM   7561  C  CD2 . LEU C 3  120 ? 44.292  110.563 45.968  1.00 2.27   ? 120 LEU C CD2 1 
ATOM   7562  N  N   . LEU C 3  121 ? 43.353  106.568 43.964  1.00 5.42   ? 121 LEU C N   1 
ATOM   7563  C  CA  . LEU C 3  121 ? 43.965  105.337 44.462  1.00 2.50   ? 121 LEU C CA  1 
ATOM   7564  C  C   . LEU C 3  121 ? 44.269  104.412 43.276  1.00 5.81   ? 121 LEU C C   1 
ATOM   7565  O  O   . LEU C 3  121 ? 45.219  103.650 43.335  1.00 5.53   ? 121 LEU C O   1 
ATOM   7566  C  CB  . LEU C 3  121 ? 43.042  104.545 45.392  1.00 7.76   ? 121 LEU C CB  1 
ATOM   7567  C  CG  . LEU C 3  121 ? 42.789  105.097 46.790  1.00 9.03   ? 121 LEU C CG  1 
ATOM   7568  C  CD1 . LEU C 3  121 ? 41.452  104.610 47.331  1.00 2.59   ? 121 LEU C CD1 1 
ATOM   7569  C  CD2 . LEU C 3  121 ? 43.945  104.757 47.683  1.00 4.60   ? 121 LEU C CD2 1 
ATOM   7570  N  N   . THR C 3  122 ? 43.486  104.450 42.300  1.00 7.21   ? 122 THR C N   1 
ATOM   7571  C  CA  . THR C 3  122 ? 43.723  103.538 41.084  1.00 2.20   ? 122 THR C CA  1 
ATOM   7572  C  C   . THR C 3  122 ? 44.912  103.942 40.271  1.00 2.20   ? 122 THR C C   1 
ATOM   7573  O  O   . THR C 3  122 ? 45.609  103.016 39.806  1.00 3.72   ? 122 THR C O   1 
ATOM   7574  C  CB  . THR C 3  122 ? 42.489  103.252 40.226  1.00 5.71   ? 122 THR C CB  1 
ATOM   7575  O  OG1 . THR C 3  122 ? 41.383  102.786 41.022  1.00 8.08   ? 122 THR C OG1 1 
ATOM   7576  C  CG2 . THR C 3  122 ? 42.972  102.059 39.411  1.00 2.20   ? 122 THR C CG2 1 
ATOM   7577  N  N   . VAL C 3  123 ? 45.208  105.228 40.210  1.00 4.79   ? 123 VAL C N   1 
ATOM   7578  C  CA  . VAL C 3  123 ? 46.466  105.598 39.510  1.00 2.89   ? 123 VAL C CA  1 
ATOM   7579  C  C   . VAL C 3  123 ? 47.659  105.190 40.343  1.00 2.76   ? 123 VAL C C   1 
ATOM   7580  O  O   . VAL C 3  123 ? 48.558  104.571 39.779  1.00 3.31   ? 123 VAL C O   1 
ATOM   7581  C  CB  . VAL C 3  123 ? 46.423  107.056 39.100  1.00 5.95   ? 123 VAL C CB  1 
ATOM   7582  C  CG1 . VAL C 3  123 ? 47.733  107.747 38.847  1.00 2.20   ? 123 VAL C CG1 1 
ATOM   7583  C  CG2 . VAL C 3  123 ? 45.367  107.242 38.030  1.00 2.97   ? 123 VAL C CG2 1 
ATOM   7584  N  N   . MET C 3  124 ? 47.661  105.385 41.646  1.00 2.20   ? 124 MET C N   1 
ATOM   7585  C  CA  . MET C 3  124 ? 48.655  105.003 42.617  1.00 6.80   ? 124 MET C CA  1 
ATOM   7586  C  C   . MET C 3  124 ? 48.986  103.520 42.450  1.00 2.43   ? 124 MET C C   1 
ATOM   7587  O  O   . MET C 3  124 ? 50.170  103.194 42.328  1.00 8.45   ? 124 MET C O   1 
ATOM   7588  C  CB  . MET C 3  124 ? 48.234  105.304 44.037  1.00 6.44   ? 124 MET C CB  1 
ATOM   7589  C  CG  . MET C 3  124 ? 48.801  106.368 44.889  1.00 7.30   ? 124 MET C CG  1 
ATOM   7590  S  SD  . MET C 3  124 ? 47.691  107.310 45.947  1.00 5.01   ? 124 MET C SD  1 
ATOM   7591  C  CE  . MET C 3  124 ? 46.944  106.015 46.917  1.00 15.44  ? 124 MET C CE  1 
ATOM   7592  N  N   . ALA C 3  125 ? 48.022  102.604 42.328  1.00 3.95   ? 125 ALA C N   1 
ATOM   7593  C  CA  . ALA C 3  125 ? 48.349  101.202 42.120  1.00 6.00   ? 125 ALA C CA  1 
ATOM   7594  C  C   . ALA C 3  125 ? 49.195  101.034 40.848  1.00 6.53   ? 125 ALA C C   1 
ATOM   7595  O  O   . ALA C 3  125 ? 50.157  100.273 40.805  1.00 3.06   ? 125 ALA C O   1 
ATOM   7596  C  CB  . ALA C 3  125 ? 47.092  100.357 41.884  1.00 2.30   ? 125 ALA C CB  1 
ATOM   7597  N  N   . THR C 3  126 ? 48.794  101.686 39.769  1.00 8.19   ? 126 THR C N   1 
ATOM   7598  C  CA  . THR C 3  126 ? 49.425  101.576 38.472  1.00 5.14   ? 126 THR C CA  1 
ATOM   7599  C  C   . THR C 3  126 ? 50.833  102.114 38.515  1.00 7.70   ? 126 THR C C   1 
ATOM   7600  O  O   . THR C 3  126 ? 51.749  101.410 38.100  1.00 4.92   ? 126 THR C O   1 
ATOM   7601  C  CB  . THR C 3  126 ? 48.558  102.144 37.362  1.00 4.30   ? 126 THR C CB  1 
ATOM   7602  O  OG1 . THR C 3  126 ? 47.144  101.988 37.683  1.00 7.05   ? 126 THR C OG1 1 
ATOM   7603  C  CG2 . THR C 3  126 ? 48.676  101.410 36.042  1.00 2.70   ? 126 THR C CG2 1 
ATOM   7604  N  N   . ALA C 3  127 ? 51.061  103.275 39.105  1.00 7.42   ? 127 ALA C N   1 
ATOM   7605  C  CA  . ALA C 3  127 ? 52.406  103.854 39.189  1.00 8.79   ? 127 ALA C CA  1 
ATOM   7606  C  C   . ALA C 3  127 ? 53.333  103.042 40.066  1.00 11.38  ? 127 ALA C C   1 
ATOM   7607  O  O   . ALA C 3  127 ? 54.558  102.929 39.907  1.00 16.86  ? 127 ALA C O   1 
ATOM   7608  C  CB  . ALA C 3  127 ? 52.290  105.308 39.554  1.00 2.20   ? 127 ALA C CB  1 
ATOM   7609  N  N   . PHE C 3  128 ? 52.757  102.316 41.017  1.00 13.07  ? 128 PHE C N   1 
ATOM   7610  C  CA  . PHE C 3  128 ? 53.511  101.449 41.904  1.00 6.67   ? 128 PHE C CA  1 
ATOM   7611  C  C   . PHE C 3  128 ? 53.963  100.179 41.210  1.00 6.45   ? 128 PHE C C   1 
ATOM   7612  O  O   . PHE C 3  128 ? 54.989  99.646  41.636  1.00 3.29   ? 128 PHE C O   1 
ATOM   7613  C  CB  . PHE C 3  128 ? 52.645  101.104 43.121  1.00 2.55   ? 128 PHE C CB  1 
ATOM   7614  C  CG  . PHE C 3  128 ? 53.290  100.110 44.038  1.00 6.58   ? 128 PHE C CG  1 
ATOM   7615  C  CD1 . PHE C 3  128 ? 54.196  100.539 44.998  1.00 7.12   ? 128 PHE C CD1 1 
ATOM   7616  C  CD2 . PHE C 3  128 ? 52.983  98.759  43.944  1.00 9.07   ? 128 PHE C CD2 1 
ATOM   7617  C  CE1 . PHE C 3  128 ? 54.781  99.633  45.860  1.00 10.16  ? 128 PHE C CE1 1 
ATOM   7618  C  CE2 . PHE C 3  128 ? 53.576  97.834  44.789  1.00 4.13   ? 128 PHE C CE2 1 
ATOM   7619  C  CZ  . PHE C 3  128 ? 54.459  98.287  45.752  1.00 12.00  ? 128 PHE C CZ  1 
ATOM   7620  N  N   . MET C 3  129 ? 53.177  99.697  40.221  1.00 6.44   ? 129 MET C N   1 
ATOM   7621  C  CA  . MET C 3  129 ? 53.572  98.446  39.522  1.00 7.32   ? 129 MET C CA  1 
ATOM   7622  C  C   . MET C 3  129 ? 54.523  98.672  38.371  1.00 5.66   ? 129 MET C C   1 
ATOM   7623  O  O   . MET C 3  129 ? 55.519  97.990  38.184  1.00 5.09   ? 129 MET C O   1 
ATOM   7624  C  CB  . MET C 3  129 ? 52.273  97.760  39.003  1.00 2.20   ? 129 MET C CB  1 
ATOM   7625  C  CG  . MET C 3  129 ? 51.696  97.067  40.247  1.00 2.20   ? 129 MET C CG  1 
ATOM   7626  S  SD  . MET C 3  129 ? 50.081  96.311  39.875  1.00 6.52   ? 129 MET C SD  1 
ATOM   7627  C  CE  . MET C 3  129 ? 48.990  97.697  40.087  1.00 5.08   ? 129 MET C CE  1 
ATOM   7628  N  N   . GLY C 3  130 ? 54.215  99.682  37.577  1.00 3.40   ? 130 GLY C N   1 
ATOM   7629  C  CA  . GLY C 3  130 ? 55.037  100.004 36.425  1.00 3.98   ? 130 GLY C CA  1 
ATOM   7630  C  C   . GLY C 3  130 ? 56.474  100.312 36.802  1.00 2.20   ? 130 GLY C C   1 
ATOM   7631  O  O   . GLY C 3  130 ? 57.418  99.745  36.279  1.00 7.90   ? 130 GLY C O   1 
ATOM   7632  N  N   . TYR C 3  131 ? 56.634  101.163 37.824  1.00 8.61   ? 131 TYR C N   1 
ATOM   7633  C  CA  . TYR C 3  131 ? 57.997  101.358 38.311  1.00 11.56  ? 131 TYR C CA  1 
ATOM   7634  C  C   . TYR C 3  131 ? 58.707  100.012 38.480  1.00 16.95  ? 131 TYR C C   1 
ATOM   7635  O  O   . TYR C 3  131 ? 59.917  99.876  38.318  1.00 27.30  ? 131 TYR C O   1 
ATOM   7636  C  CB  . TYR C 3  131 ? 57.974  101.927 39.737  1.00 12.64  ? 131 TYR C CB  1 
ATOM   7637  C  CG  . TYR C 3  131 ? 59.333  102.539 40.038  1.00 14.45  ? 131 TYR C CG  1 
ATOM   7638  C  CD1 . TYR C 3  131 ? 60.040  103.139 38.996  1.00 9.48   ? 131 TYR C CD1 1 
ATOM   7639  C  CD2 . TYR C 3  131 ? 59.858  102.556 41.319  1.00 9.77   ? 131 TYR C CD2 1 
ATOM   7640  C  CE1 . TYR C 3  131 ? 61.237  103.760 39.264  1.00 13.58  ? 131 TYR C CE1 1 
ATOM   7641  C  CE2 . TYR C 3  131 ? 61.059  103.176 41.581  1.00 6.36   ? 131 TYR C CE2 1 
ATOM   7642  C  CZ  . TYR C 3  131 ? 61.742  103.783 40.551  1.00 13.00  ? 131 TYR C CZ  1 
ATOM   7643  O  OH  . TYR C 3  131 ? 62.968  104.405 40.748  1.00 12.98  ? 131 TYR C OH  1 
ATOM   7644  N  N   . VAL C 3  132 ? 58.008  98.988  38.954  1.00 16.46  ? 132 VAL C N   1 
ATOM   7645  C  CA  . VAL C 3  132 ? 58.620  97.685  39.131  1.00 11.28  ? 132 VAL C CA  1 
ATOM   7646  C  C   . VAL C 3  132 ? 59.076  97.094  37.818  1.00 12.64  ? 132 VAL C C   1 
ATOM   7647  O  O   . VAL C 3  132 ? 60.140  96.491  37.724  1.00 15.02  ? 132 VAL C O   1 
ATOM   7648  C  CB  . VAL C 3  132 ? 57.644  96.746  39.852  1.00 8.43   ? 132 VAL C CB  1 
ATOM   7649  C  CG1 . VAL C 3  132 ? 58.067  95.303  39.655  1.00 2.20   ? 132 VAL C CG1 1 
ATOM   7650  C  CG2 . VAL C 3  132 ? 57.570  97.120  41.320  1.00 5.27   ? 132 VAL C CG2 1 
ATOM   7651  N  N   . LEU C 3  133 ? 58.336  97.271  36.742  1.00 15.85  ? 133 LEU C N   1 
ATOM   7652  C  CA  . LEU C 3  133 ? 58.573  96.775  35.418  1.00 14.30  ? 133 LEU C CA  1 
ATOM   7653  C  C   . LEU C 3  133 ? 59.981  96.661  34.900  1.00 12.76  ? 133 LEU C C   1 
ATOM   7654  O  O   . LEU C 3  133 ? 60.328  95.592  34.378  1.00 12.82  ? 133 LEU C O   1 
ATOM   7655  C  CB  . LEU C 3  133 ? 57.663  97.469  34.391  1.00 8.66   ? 133 LEU C CB  1 
ATOM   7656  C  CG  . LEU C 3  133 ? 56.206  97.013  34.491  1.00 2.20   ? 133 LEU C CG  1 
ATOM   7657  C  CD1 . LEU C 3  133 ? 55.434  97.414  33.253  1.00 10.68  ? 133 LEU C CD1 1 
ATOM   7658  C  CD2 . LEU C 3  133 ? 56.178  95.493  34.626  1.00 4.92   ? 133 LEU C CD2 1 
ATOM   7659  N  N   . PRO C 3  134 ? 60.776  97.703  34.926  1.00 10.53  ? 134 PRO C N   1 
ATOM   7660  C  CA  . PRO C 3  134 ? 62.168  97.698  34.523  1.00 14.28  ? 134 PRO C CA  1 
ATOM   7661  C  C   . PRO C 3  134 ? 63.014  96.770  35.393  1.00 20.48  ? 134 PRO C C   1 
ATOM   7662  O  O   . PRO C 3  134 ? 64.059  96.285  34.930  1.00 24.70  ? 134 PRO C O   1 
ATOM   7663  C  CB  . PRO C 3  134 ? 62.683  99.135  34.597  1.00 16.75  ? 134 PRO C CB  1 
ATOM   7664  C  CG  . PRO C 3  134 ? 61.459  99.915  34.990  1.00 15.66  ? 134 PRO C CG  1 
ATOM   7665  C  CD  . PRO C 3  134 ? 60.363  98.995  35.452  1.00 5.65   ? 134 PRO C CD  1 
ATOM   7666  N  N   . TRP C 3  135 ? 62.629  96.478  36.636  1.00 18.24  ? 135 TRP C N   1 
ATOM   7667  C  CA  . TRP C 3  135 ? 63.384  95.545  37.458  1.00 13.19  ? 135 TRP C CA  1 
ATOM   7668  C  C   . TRP C 3  135 ? 64.705  96.124  37.916  1.00 17.09  ? 135 TRP C C   1 
ATOM   7669  O  O   . TRP C 3  135 ? 65.707  95.413  37.944  1.00 24.33  ? 135 TRP C O   1 
ATOM   7670  C  CB  . TRP C 3  135 ? 63.688  94.301  36.645  1.00 4.07   ? 135 TRP C CB  1 
ATOM   7671  C  CG  . TRP C 3  135 ? 63.783  93.043  37.443  1.00 18.50  ? 135 TRP C CG  1 
ATOM   7672  C  CD1 . TRP C 3  135 ? 64.710  92.057  37.315  1.00 21.81  ? 135 TRP C CD1 1 
ATOM   7673  C  CD2 . TRP C 3  135 ? 62.904  92.621  38.485  1.00 21.60  ? 135 TRP C CD2 1 
ATOM   7674  N  NE1 . TRP C 3  135 ? 64.455  91.052  38.201  1.00 23.20  ? 135 TRP C NE1 1 
ATOM   7675  C  CE2 . TRP C 3  135 ? 63.352  91.377  38.933  1.00 23.80  ? 135 TRP C CE2 1 
ATOM   7676  C  CE3 . TRP C 3  135 ? 61.768  93.169  39.082  1.00 27.96  ? 135 TRP C CE3 1 
ATOM   7677  C  CZ2 . TRP C 3  135 ? 62.707  90.690  39.959  1.00 30.71  ? 135 TRP C CZ2 1 
ATOM   7678  C  CZ3 . TRP C 3  135 ? 61.121  92.488  40.090  1.00 22.66  ? 135 TRP C CZ3 1 
ATOM   7679  C  CH2 . TRP C 3  135 ? 61.602  91.257  40.522  1.00 25.73  ? 135 TRP C CH2 1 
ATOM   7680  N  N   . GLY C 3  136 ? 64.691  97.396  38.268  1.00 17.96  ? 136 GLY C N   1 
ATOM   7681  C  CA  . GLY C 3  136 ? 65.925  98.012  38.761  1.00 19.24  ? 136 GLY C CA  1 
ATOM   7682  C  C   . GLY C 3  136 ? 65.981  97.865  40.278  1.00 23.76  ? 136 GLY C C   1 
ATOM   7683  O  O   . GLY C 3  136 ? 64.948  97.760  40.941  1.00 27.42  ? 136 GLY C O   1 
ATOM   7684  N  N   . GLN C 3  137 ? 67.186  97.869  40.814  1.00 26.37  ? 137 GLN C N   1 
ATOM   7685  C  CA  . GLN C 3  137 ? 67.512  97.808  42.231  1.00 22.87  ? 137 GLN C CA  1 
ATOM   7686  C  C   . GLN C 3  137 ? 66.488  98.539  43.083  1.00 23.57  ? 137 GLN C C   1 
ATOM   7687  O  O   . GLN C 3  137 ? 65.937  97.957  44.026  1.00 21.35  ? 137 GLN C O   1 
ATOM   7688  C  CB  . GLN C 3  137 ? 68.924  98.338  42.443  1.00 19.25  ? 137 GLN C CB  1 
ATOM   7689  C  CG  . GLN C 3  137 ? 69.685  97.928  43.671  1.00 18.54  ? 137 GLN C CG  1 
ATOM   7690  C  CD  . GLN C 3  137 ? 69.725  96.445  43.932  1.00 15.14  ? 137 GLN C CD  1 
ATOM   7691  O  OE1 . GLN C 3  137 ? 69.407  95.688  43.034  1.00 2.32   ? 137 GLN C OE1 1 
ATOM   7692  N  NE2 . GLN C 3  137 ? 70.081  96.017  45.135  1.00 15.32  ? 137 GLN C NE2 1 
ATOM   7693  N  N   . MET C 3  138 ? 66.162  99.778  42.716  1.00 22.93  ? 138 MET C N   1 
ATOM   7694  C  CA  . MET C 3  138 ? 65.147  100.547 43.443  1.00 23.62  ? 138 MET C CA  1 
ATOM   7695  C  C   . MET C 3  138 ? 63.788  99.865  43.346  1.00 24.33  ? 138 MET C C   1 
ATOM   7696  O  O   . MET C 3  138 ? 63.086  99.533  44.303  1.00 26.78  ? 138 MET C O   1 
ATOM   7697  C  CB  . MET C 3  138 ? 65.081  101.952 42.865  1.00 18.53  ? 138 MET C CB  1 
ATOM   7698  C  CG  . MET C 3  138 ? 65.276  103.107 43.815  1.00 18.33  ? 138 MET C CG  1 
ATOM   7699  S  SD  . MET C 3  138 ? 65.585  102.677 45.523  1.00 18.67  ? 138 MET C SD  1 
ATOM   7700  C  CE  . MET C 3  138 ? 64.800  104.019 46.411  1.00 23.44  ? 138 MET C CE  1 
ATOM   7701  N  N   . SER C 3  139 ? 63.403  99.575  42.096  1.00 20.88  ? 139 SER C N   1 
ATOM   7702  C  CA  . SER C 3  139 ? 62.102  98.934  41.967  1.00 17.92  ? 139 SER C CA  1 
ATOM   7703  C  C   . SER C 3  139 ? 62.027  97.633  42.739  1.00 17.27  ? 139 SER C C   1 
ATOM   7704  O  O   . SER C 3  139 ? 60.980  97.417  43.379  1.00 22.63  ? 139 SER C O   1 
ATOM   7705  C  CB  . SER C 3  139 ? 61.730  98.765  40.503  1.00 15.49  ? 139 SER C CB  1 
ATOM   7706  O  OG  . SER C 3  139 ? 62.255  97.545  40.020  1.00 26.71  ? 139 SER C OG  1 
ATOM   7707  N  N   . PHE C 3  140 ? 63.054  96.791  42.742  1.00 13.22  ? 140 PHE C N   1 
ATOM   7708  C  CA  . PHE C 3  140 ? 63.028  95.480  43.354  1.00 10.51  ? 140 PHE C CA  1 
ATOM   7709  C  C   . PHE C 3  140 ? 62.893  95.389  44.866  1.00 11.30  ? 140 PHE C C   1 
ATOM   7710  O  O   . PHE C 3  140 ? 62.182  94.576  45.466  1.00 5.29   ? 140 PHE C O   1 
ATOM   7711  C  CB  . PHE C 3  140 ? 64.286  94.660  43.028  1.00 6.72   ? 140 PHE C CB  1 
ATOM   7712  C  CG  . PHE C 3  140 ? 64.288  93.393  43.850  1.00 7.67   ? 140 PHE C CG  1 
ATOM   7713  C  CD1 . PHE C 3  140 ? 64.835  93.326  45.126  1.00 2.35   ? 140 PHE C CD1 1 
ATOM   7714  C  CD2 . PHE C 3  140 ? 63.683  92.274  43.303  1.00 6.17   ? 140 PHE C CD2 1 
ATOM   7715  C  CE1 . PHE C 3  140 ? 64.716  92.150  45.850  1.00 4.71   ? 140 PHE C CE1 1 
ATOM   7716  C  CE2 . PHE C 3  140 ? 63.584  91.090  44.018  1.00 6.64   ? 140 PHE C CE2 1 
ATOM   7717  C  CZ  . PHE C 3  140 ? 64.110  91.039  45.288  1.00 4.51   ? 140 PHE C CZ  1 
ATOM   7718  N  N   . TRP C 3  141 ? 63.576  96.328  45.493  1.00 13.90  ? 141 TRP C N   1 
ATOM   7719  C  CA  . TRP C 3  141 ? 63.477  96.505  46.930  1.00 25.11  ? 141 TRP C CA  1 
ATOM   7720  C  C   . TRP C 3  141 ? 62.295  97.268  47.474  1.00 26.77  ? 141 TRP C C   1 
ATOM   7721  O  O   . TRP C 3  141 ? 61.828  96.997  48.596  1.00 30.22  ? 141 TRP C O   1 
ATOM   7722  C  CB  . TRP C 3  141 ? 64.825  97.114  47.362  1.00 36.66  ? 141 TRP C CB  1 
ATOM   7723  C  CG  . TRP C 3  141 ? 65.880  96.049  47.161  1.00 39.59  ? 141 TRP C CG  1 
ATOM   7724  C  CD1 . TRP C 3  141 ? 66.702  95.862  46.095  1.00 40.68  ? 141 TRP C CD1 1 
ATOM   7725  C  CD2 . TRP C 3  141 ? 66.166  95.014  48.103  1.00 36.82  ? 141 TRP C CD2 1 
ATOM   7726  N  NE1 . TRP C 3  141 ? 67.496  94.766  46.315  1.00 44.09  ? 141 TRP C NE1 1 
ATOM   7727  C  CE2 . TRP C 3  141 ? 67.184  94.229  47.543  1.00 43.34  ? 141 TRP C CE2 1 
ATOM   7728  C  CE3 . TRP C 3  141 ? 65.661  94.683  49.353  1.00 36.53  ? 141 TRP C CE3 1 
ATOM   7729  C  CZ2 . TRP C 3  141 ? 67.715  93.126  48.300  1.00 44.25  ? 141 TRP C CZ2 1 
ATOM   7730  C  CZ3 . TRP C 3  141 ? 66.187  93.590  49.997  1.00 44.04  ? 141 TRP C CZ3 1 
ATOM   7731  C  CH2 . TRP C 3  141 ? 67.204  92.818  49.426  1.00 44.40  ? 141 TRP C CH2 1 
ATOM   7732  N  N   . GLY C 3  142 ? 61.748  98.209  46.711  1.00 25.87  ? 142 GLY C N   1 
ATOM   7733  C  CA  . GLY C 3  142 ? 60.564  98.953  47.122  1.00 18.56  ? 142 GLY C CA  1 
ATOM   7734  C  C   . GLY C 3  142 ? 59.330  98.064  46.954  1.00 16.45  ? 142 GLY C C   1 
ATOM   7735  O  O   . GLY C 3  142 ? 58.401  98.058  47.759  1.00 16.45  ? 142 GLY C O   1 
ATOM   7736  N  N   . ALA C 3  143 ? 59.317  97.226  45.921  1.00 11.25  ? 143 ALA C N   1 
ATOM   7737  C  CA  . ALA C 3  143 ? 58.181  96.315  45.769  1.00 10.01  ? 143 ALA C CA  1 
ATOM   7738  C  C   . ALA C 3  143 ? 58.146  95.337  46.933  1.00 12.63  ? 143 ALA C C   1 
ATOM   7739  O  O   . ALA C 3  143 ? 57.056  94.970  47.373  1.00 13.26  ? 143 ALA C O   1 
ATOM   7740  C  CB  . ALA C 3  143 ? 58.313  95.585  44.446  1.00 3.94   ? 143 ALA C CB  1 
ATOM   7741  N  N   . THR C 3  144 ? 59.315  94.900  47.407  1.00 15.41  ? 144 THR C N   1 
ATOM   7742  C  CA  . THR C 3  144 ? 59.401  93.960  48.525  1.00 15.39  ? 144 THR C CA  1 
ATOM   7743  C  C   . THR C 3  144 ? 58.928  94.604  49.836  1.00 15.25  ? 144 THR C C   1 
ATOM   7744  O  O   . THR C 3  144 ? 57.982  94.119  50.458  1.00 15.84  ? 144 THR C O   1 
ATOM   7745  C  CB  . THR C 3  144 ? 60.835  93.440  48.771  1.00 7.83   ? 144 THR C CB  1 
ATOM   7746  O  OG1 . THR C 3  144 ? 61.705  93.946  47.757  1.00 13.40  ? 144 THR C OG1 1 
ATOM   7747  C  CG2 . THR C 3  144 ? 60.882  91.930  48.753  1.00 3.19   ? 144 THR C CG2 1 
ATOM   7748  N  N   . VAL C 3  145 ? 59.555  95.721  50.164  1.00 8.32   ? 145 VAL C N   1 
ATOM   7749  C  CA  . VAL C 3  145 ? 59.260  96.503  51.327  1.00 10.38  ? 145 VAL C CA  1 
ATOM   7750  C  C   . VAL C 3  145 ? 57.809  96.911  51.485  1.00 14.55  ? 145 VAL C C   1 
ATOM   7751  O  O   . VAL C 3  145 ? 57.286  96.835  52.610  1.00 18.39  ? 145 VAL C O   1 
ATOM   7752  C  CB  . VAL C 3  145 ? 60.168  97.753  51.315  1.00 13.41  ? 145 VAL C CB  1 
ATOM   7753  C  CG1 . VAL C 3  145 ? 59.660  98.833  52.250  1.00 15.08  ? 145 VAL C CG1 1 
ATOM   7754  C  CG2 . VAL C 3  145 ? 61.607  97.340  51.603  1.00 10.90  ? 145 VAL C CG2 1 
ATOM   7755  N  N   . ILE C 3  146 ? 57.175  97.345  50.405  1.00 13.99  ? 146 ILE C N   1 
ATOM   7756  C  CA  . ILE C 3  146 ? 55.791  97.790  50.426  1.00 17.04  ? 146 ILE C CA  1 
ATOM   7757  C  C   . ILE C 3  146 ? 54.814  96.641  50.515  1.00 18.42  ? 146 ILE C C   1 
ATOM   7758  O  O   . ILE C 3  146 ? 54.008  96.545  51.444  1.00 18.48  ? 146 ILE C O   1 
ATOM   7759  C  CB  . ILE C 3  146 ? 55.501  98.676  49.213  1.00 25.73  ? 146 ILE C CB  1 
ATOM   7760  C  CG1 . ILE C 3  146 ? 56.479  99.838  49.089  1.00 28.81  ? 146 ILE C CG1 1 
ATOM   7761  C  CG2 . ILE C 3  146 ? 54.067  99.153  49.171  1.00 31.55  ? 146 ILE C CG2 1 
ATOM   7762  C  CD1 . ILE C 3  146 ? 56.384  100.968 50.065  1.00 28.41  ? 146 ILE C CD1 1 
ATOM   7763  N  N   . THR C 3  147 ? 54.946  95.612  49.692  1.00 22.67  ? 147 THR C N   1 
ATOM   7764  C  CA  . THR C 3  147 ? 54.039  94.466  49.820  1.00 25.39  ? 147 THR C CA  1 
ATOM   7765  C  C   . THR C 3  147 ? 54.210  93.699  51.111  1.00 27.88  ? 147 THR C C   1 
ATOM   7766  O  O   . THR C 3  147 ? 53.289  93.002  51.557  1.00 25.60  ? 147 THR C O   1 
ATOM   7767  C  CB  . THR C 3  147 ? 54.290  93.523  48.626  1.00 24.06  ? 147 THR C CB  1 
ATOM   7768  O  OG1 . THR C 3  147 ? 53.841  94.264  47.487  1.00 26.72  ? 147 THR C OG1 1 
ATOM   7769  C  CG2 . THR C 3  147 ? 53.491  92.250  48.776  1.00 31.24  ? 147 THR C CG2 1 
ATOM   7770  N  N   . ASN C 3  148 ? 55.399  93.785  51.717  1.00 30.40  ? 148 ASN C N   1 
ATOM   7771  C  CA  . ASN C 3  148 ? 55.659  93.024  52.944  1.00 30.64  ? 148 ASN C CA  1 
ATOM   7772  C  C   . ASN C 3  148 ? 55.058  93.780  54.127  1.00 25.72  ? 148 ASN C C   1 
ATOM   7773  O  O   . ASN C 3  148 ? 54.650  93.213  55.131  1.00 21.17  ? 148 ASN C O   1 
ATOM   7774  C  CB  . ASN C 3  148 ? 57.152  92.795  53.154  1.00 38.04  ? 148 ASN C CB  1 
ATOM   7775  C  CG  . ASN C 3  148 ? 57.389  91.759  54.244  1.00 48.60  ? 148 ASN C CG  1 
ATOM   7776  O  OD1 . ASN C 3  148 ? 56.414  91.174  54.737  1.00 46.09  ? 148 ASN C OD1 1 
ATOM   7777  N  ND2 . ASN C 3  148 ? 58.665  91.576  54.585  1.00 53.97  ? 148 ASN C ND2 1 
ATOM   7778  N  N   . LEU C 3  149 ? 54.910  95.077  53.858  1.00 22.57  ? 149 LEU C N   1 
ATOM   7779  C  CA  . LEU C 3  149 ? 54.243  95.982  54.790  1.00 22.13  ? 149 LEU C CA  1 
ATOM   7780  C  C   . LEU C 3  149 ? 52.863  95.431  55.149  1.00 22.41  ? 149 LEU C C   1 
ATOM   7781  O  O   . LEU C 3  149 ? 52.532  95.014  56.258  1.00 18.53  ? 149 LEU C O   1 
ATOM   7782  C  CB  . LEU C 3  149 ? 54.159  97.364  54.168  1.00 13.86  ? 149 LEU C CB  1 
ATOM   7783  C  CG  . LEU C 3  149 ? 54.282  98.565  55.091  1.00 19.97  ? 149 LEU C CG  1 
ATOM   7784  C  CD1 . LEU C 3  149 ? 55.588  98.509  55.878  1.00 24.05  ? 149 LEU C CD1 1 
ATOM   7785  C  CD2 . LEU C 3  149 ? 54.178  99.872  54.327  1.00 19.13  ? 149 LEU C CD2 1 
ATOM   7786  N  N   . LEU C 3  150 ? 52.162  95.033  54.093  1.00 25.52  ? 150 LEU C N   1 
ATOM   7787  C  CA  . LEU C 3  150 ? 50.914  94.316  54.176  1.00 26.05  ? 150 LEU C CA  1 
ATOM   7788  C  C   . LEU C 3  150 ? 50.916  93.132  55.114  1.00 28.02  ? 150 LEU C C   1 
ATOM   7789  O  O   . LEU C 3  150 ? 49.891  92.809  55.721  1.00 31.66  ? 150 LEU C O   1 
ATOM   7790  C  CB  . LEU C 3  150 ? 50.568  93.759  52.788  1.00 15.85  ? 150 LEU C CB  1 
ATOM   7791  C  CG  . LEU C 3  150 ? 49.062  93.617  52.553  1.00 13.87  ? 150 LEU C CG  1 
ATOM   7792  C  CD1 . LEU C 3  150 ? 48.335  94.874  52.992  1.00 11.24  ? 150 LEU C CD1 1 
ATOM   7793  C  CD2 . LEU C 3  150 ? 48.888  93.304  51.074  1.00 9.93   ? 150 LEU C CD2 1 
ATOM   7794  N  N   . SER C 3  151 ? 52.035  92.446  55.268  1.00 30.56  ? 151 SER C N   1 
ATOM   7795  C  CA  . SER C 3  151 ? 52.082  91.306  56.170  1.00 36.49  ? 151 SER C CA  1 
ATOM   7796  C  C   . SER C 3  151 ? 51.905  91.737  57.620  1.00 40.20  ? 151 SER C C   1 
ATOM   7797  O  O   . SER C 3  151 ? 51.952  90.897  58.528  1.00 42.55  ? 151 SER C O   1 
ATOM   7798  C  CB  . SER C 3  151 ? 53.464  90.637  56.069  1.00 40.87  ? 151 SER C CB  1 
ATOM   7799  O  OG  . SER C 3  151 ? 54.388  91.417  56.823  1.00 42.24  ? 151 SER C OG  1 
ATOM   7800  N  N   . ALA C 3  152 ? 51.770  93.030  57.878  1.00 42.03  ? 152 ALA C N   1 
ATOM   7801  C  CA  . ALA C 3  152 ? 51.442  93.506  59.215  1.00 43.85  ? 152 ALA C CA  1 
ATOM   7802  C  C   . ALA C 3  152 ? 50.086  92.968  59.678  1.00 41.18  ? 152 ALA C C   1 
ATOM   7803  O  O   . ALA C 3  152 ? 49.868  92.854  60.886  1.00 39.25  ? 152 ALA C O   1 
ATOM   7804  C  CB  . ALA C 3  152 ? 51.447  95.023  59.304  1.00 49.66  ? 152 ALA C CB  1 
ATOM   7805  N  N   . ILE C 3  153 ? 49.180  92.688  58.736  1.00 37.72  ? 153 ILE C N   1 
ATOM   7806  C  CA  . ILE C 3  153 ? 47.912  92.100  59.142  1.00 38.80  ? 153 ILE C CA  1 
ATOM   7807  C  C   . ILE C 3  153 ? 48.142  90.776  59.861  1.00 42.68  ? 153 ILE C C   1 
ATOM   7808  O  O   . ILE C 3  153 ? 48.810  89.891  59.343  1.00 45.46  ? 153 ILE C O   1 
ATOM   7809  C  CB  . ILE C 3  153 ? 46.905  91.904  58.010  1.00 27.04  ? 153 ILE C CB  1 
ATOM   7810  C  CG1 . ILE C 3  153 ? 46.469  93.268  57.488  1.00 25.40  ? 153 ILE C CG1 1 
ATOM   7811  C  CG2 . ILE C 3  153 ? 45.678  91.183  58.548  1.00 31.64  ? 153 ILE C CG2 1 
ATOM   7812  C  CD1 . ILE C 3  153 ? 46.772  93.416  56.028  1.00 22.08  ? 153 ILE C CD1 1 
ATOM   7813  N  N   . PRO C 3  154 ? 47.599  90.661  61.054  1.00 45.56  ? 154 PRO C N   1 
ATOM   7814  C  CA  . PRO C 3  154 ? 47.796  89.628  62.023  1.00 47.39  ? 154 PRO C CA  1 
ATOM   7815  C  C   . PRO C 3  154 ? 47.443  88.207  61.666  1.00 48.08  ? 154 PRO C C   1 
ATOM   7816  O  O   . PRO C 3  154 ? 48.147  87.250  62.015  1.00 51.70  ? 154 PRO C O   1 
ATOM   7817  C  CB  . PRO C 3  154 ? 46.967  89.992  63.286  1.00 47.31  ? 154 PRO C CB  1 
ATOM   7818  C  CG  . PRO C 3  154 ? 46.172  91.166  62.812  1.00 48.43  ? 154 PRO C CG  1 
ATOM   7819  C  CD  . PRO C 3  154 ? 46.894  91.815  61.662  1.00 47.14  ? 154 PRO C CD  1 
ATOM   7820  N  N   . TYR C 3  155 ? 46.241  88.017  61.139  1.00 47.44  ? 155 TYR C N   1 
ATOM   7821  C  CA  . TYR C 3  155 ? 45.809  86.628  60.935  1.00 48.97  ? 155 TYR C CA  1 
ATOM   7822  C  C   . TYR C 3  155 ? 46.099  86.194  59.516  1.00 48.43  ? 155 TYR C C   1 
ATOM   7823  O  O   . TYR C 3  155 ? 46.557  85.098  59.300  1.00 41.60  ? 155 TYR C O   1 
ATOM   7824  C  CB  . TYR C 3  155 ? 44.297  86.585  61.250  1.00 60.06  ? 155 TYR C CB  1 
ATOM   7825  C  CG  . TYR C 3  155 ? 44.052  86.365  62.731  1.00 70.40  ? 155 TYR C CG  1 
ATOM   7826  C  CD1 . TYR C 3  155 ? 44.189  87.371  63.678  1.00 76.19  ? 155 TYR C CD1 1 
ATOM   7827  C  CD2 . TYR C 3  155 ? 43.712  85.088  63.154  1.00 71.57  ? 155 TYR C CD2 1 
ATOM   7828  C  CE1 . TYR C 3  155 ? 43.981  87.112  65.020  1.00 80.80  ? 155 TYR C CE1 1 
ATOM   7829  C  CE2 . TYR C 3  155 ? 43.504  84.822  64.489  1.00 78.14  ? 155 TYR C CE2 1 
ATOM   7830  C  CZ  . TYR C 3  155 ? 43.645  85.832  65.415  1.00 82.48  ? 155 TYR C CZ  1 
ATOM   7831  O  OH  . TYR C 3  155 ? 43.448  85.580  66.756  1.00 86.13  ? 155 TYR C OH  1 
ATOM   7832  N  N   . ILE C 3  156 ? 45.864  87.144  58.604  1.00 47.22  ? 156 ILE C N   1 
ATOM   7833  C  CA  . ILE C 3  156 ? 45.968  86.799  57.192  1.00 45.71  ? 156 ILE C CA  1 
ATOM   7834  C  C   . ILE C 3  156 ? 47.296  87.236  56.624  1.00 45.24  ? 156 ILE C C   1 
ATOM   7835  O  O   . ILE C 3  156 ? 48.110  86.422  56.196  1.00 48.60  ? 156 ILE C O   1 
ATOM   7836  C  CB  . ILE C 3  156 ? 44.778  87.445  56.455  1.00 45.29  ? 156 ILE C CB  1 
ATOM   7837  C  CG1 . ILE C 3  156 ? 44.707  88.941  56.702  1.00 39.94  ? 156 ILE C CG1 1 
ATOM   7838  C  CG2 . ILE C 3  156 ? 43.508  86.735  56.939  1.00 44.69  ? 156 ILE C CG2 1 
ATOM   7839  C  CD1 . ILE C 3  156 ? 43.327  89.522  56.893  1.00 38.53  ? 156 ILE C CD1 1 
ATOM   7840  N  N   . GLY C 3  157 ? 47.533  88.525  56.728  1.00 45.00  ? 157 GLY C N   1 
ATOM   7841  C  CA  . GLY C 3  157 ? 48.677  89.229  56.207  1.00 48.19  ? 157 GLY C CA  1 
ATOM   7842  C  C   . GLY C 3  157 ? 49.664  88.339  55.470  1.00 46.61  ? 157 GLY C C   1 
ATOM   7843  O  O   . GLY C 3  157 ? 49.751  88.305  54.254  1.00 51.40  ? 157 GLY C O   1 
ATOM   7844  N  N   . THR C 3  158 ? 50.425  87.616  56.246  1.00 46.68  ? 158 THR C N   1 
ATOM   7845  C  CA  . THR C 3  158 ? 51.452  86.675  55.895  1.00 41.75  ? 158 THR C CA  1 
ATOM   7846  C  C   . THR C 3  158 ? 51.083  85.755  54.754  1.00 36.62  ? 158 THR C C   1 
ATOM   7847  O  O   . THR C 3  158 ? 51.745  85.829  53.714  1.00 28.56  ? 158 THR C O   1 
ATOM   7848  C  CB  . THR C 3  158 ? 51.819  85.891  57.181  1.00 49.29  ? 158 THR C CB  1 
ATOM   7849  O  OG1 . THR C 3  158 ? 50.927  86.294  58.252  1.00 47.59  ? 158 THR C OG1 1 
ATOM   7850  C  CG2 . THR C 3  158 ? 53.235  86.322  57.560  1.00 43.01  ? 158 THR C CG2 1 
ATOM   7851  N  N   . ASN C 3  159 ? 49.995  84.989  54.945  1.00 35.53  ? 159 ASN C N   1 
ATOM   7852  C  CA  . ASN C 3  159 ? 49.527  84.171  53.826  1.00 35.57  ? 159 ASN C CA  1 
ATOM   7853  C  C   . ASN C 3  159 ? 49.359  85.098  52.629  1.00 32.82  ? 159 ASN C C   1 
ATOM   7854  O  O   . ASN C 3  159 ? 50.093  84.965  51.638  1.00 33.32  ? 159 ASN C O   1 
ATOM   7855  C  CB  . ASN C 3  159 ? 48.353  83.286  54.162  1.00 38.65  ? 159 ASN C CB  1 
ATOM   7856  C  CG  . ASN C 3  159 ? 48.798  81.843  54.369  1.00 44.37  ? 159 ASN C CG  1 
ATOM   7857  O  OD1 . ASN C 3  159 ? 49.698  81.357  53.681  1.00 50.62  ? 159 ASN C OD1 1 
ATOM   7858  N  ND2 . ASN C 3  159 ? 48.157  81.191  55.326  1.00 49.70  ? 159 ASN C ND2 1 
ATOM   7859  N  N   . LEU C 3  160 ? 48.544  86.134  52.791  1.00 26.21  ? 160 LEU C N   1 
ATOM   7860  C  CA  . LEU C 3  160 ? 48.313  87.115  51.758  1.00 18.03  ? 160 LEU C CA  1 
ATOM   7861  C  C   . LEU C 3  160 ? 49.542  87.533  50.981  1.00 13.67  ? 160 LEU C C   1 
ATOM   7862  O  O   . LEU C 3  160 ? 49.724  87.223  49.802  1.00 15.45  ? 160 LEU C O   1 
ATOM   7863  C  CB  . LEU C 3  160 ? 47.678  88.383  52.338  1.00 22.84  ? 160 LEU C CB  1 
ATOM   7864  C  CG  . LEU C 3  160 ? 47.316  89.425  51.267  1.00 29.25  ? 160 LEU C CG  1 
ATOM   7865  C  CD1 . LEU C 3  160 ? 46.054  89.021  50.510  1.00 24.29  ? 160 LEU C CD1 1 
ATOM   7866  C  CD2 . LEU C 3  160 ? 47.173  90.799  51.892  1.00 27.60  ? 160 LEU C CD2 1 
ATOM   7867  N  N   . VAL C 3  161 ? 50.458  88.252  51.620  1.00 4.54   ? 161 VAL C N   1 
ATOM   7868  C  CA  . VAL C 3  161 ? 51.686  88.715  50.994  1.00 8.86   ? 161 VAL C CA  1 
ATOM   7869  C  C   . VAL C 3  161 ? 52.253  87.706  50.022  1.00 14.04  ? 161 VAL C C   1 
ATOM   7870  O  O   . VAL C 3  161 ? 52.844  88.086  49.017  1.00 14.78  ? 161 VAL C O   1 
ATOM   7871  C  CB  . VAL C 3  161 ? 52.745  89.052  52.048  1.00 6.38   ? 161 VAL C CB  1 
ATOM   7872  C  CG1 . VAL C 3  161 ? 54.007  89.582  51.325  1.00 4.73   ? 161 VAL C CG1 1 
ATOM   7873  C  CG2 . VAL C 3  161 ? 52.214  90.168  52.940  1.00 6.99   ? 161 VAL C CG2 1 
ATOM   7874  N  N   . GLU C 3  162 ? 52.168  86.434  50.375  1.00 21.80  ? 162 GLU C N   1 
ATOM   7875  C  CA  . GLU C 3  162 ? 52.677  85.351  49.557  1.00 28.10  ? 162 GLU C CA  1 
ATOM   7876  C  C   . GLU C 3  162 ? 51.878  85.088  48.293  1.00 28.55  ? 162 GLU C C   1 
ATOM   7877  O  O   . GLU C 3  162 ? 52.441  84.644  47.290  1.00 31.93  ? 162 GLU C O   1 
ATOM   7878  C  CB  . GLU C 3  162 ? 52.756  84.079  50.417  1.00 34.20  ? 162 GLU C CB  1 
ATOM   7879  C  CG  . GLU C 3  162 ? 53.706  84.282  51.582  1.00 40.35  ? 162 GLU C CG  1 
ATOM   7880  C  CD  . GLU C 3  162 ? 54.199  83.004  52.212  1.00 45.84  ? 162 GLU C CD  1 
ATOM   7881  O  OE1 . GLU C 3  162 ? 53.552  81.941  52.112  1.00 51.11  ? 162 GLU C OE1 1 
ATOM   7882  O  OE2 . GLU C 3  162 ? 55.277  83.101  52.843  1.00 45.05  ? 162 GLU C OE2 1 
ATOM   7883  N  N   . TRP C 3  163 ? 50.577  85.337  48.353  1.00 27.13  ? 163 TRP C N   1 
ATOM   7884  C  CA  . TRP C 3  163 ? 49.669  85.104  47.224  1.00 21.59  ? 163 TRP C CA  1 
ATOM   7885  C  C   . TRP C 3  163 ? 49.876  86.225  46.218  1.00 19.07  ? 163 TRP C C   1 
ATOM   7886  O  O   . TRP C 3  163 ? 50.389  86.030  45.113  1.00 19.51  ? 163 TRP C O   1 
ATOM   7887  C  CB  . TRP C 3  163 ? 48.252  84.952  47.762  1.00 14.34  ? 163 TRP C CB  1 
ATOM   7888  C  CG  . TRP C 3  163 ? 47.182  84.851  46.725  1.00 11.25  ? 163 TRP C CG  1 
ATOM   7889  C  CD1 . TRP C 3  163 ? 46.767  83.731  46.081  1.00 5.76   ? 163 TRP C CD1 1 
ATOM   7890  C  CD2 . TRP C 3  163 ? 46.402  85.936  46.202  1.00 9.69   ? 163 TRP C CD2 1 
ATOM   7891  N  NE1 . TRP C 3  163 ? 45.763  84.043  45.193  1.00 4.73   ? 163 TRP C NE1 1 
ATOM   7892  C  CE2 . TRP C 3  163 ? 45.537  85.398  45.234  1.00 8.43   ? 163 TRP C CE2 1 
ATOM   7893  C  CE3 . TRP C 3  163 ? 46.371  87.311  46.433  1.00 12.51  ? 163 TRP C CE3 1 
ATOM   7894  C  CZ2 . TRP C 3  163 ? 44.681  86.204  44.504  1.00 2.20   ? 163 TRP C CZ2 1 
ATOM   7895  C  CZ3 . TRP C 3  163 ? 45.477  88.088  45.721  1.00 13.35  ? 163 TRP C CZ3 1 
ATOM   7896  C  CH2 . TRP C 3  163 ? 44.629  87.527  44.767  1.00 6.16   ? 163 TRP C CH2 1 
ATOM   7897  N  N   . ILE C 3  164 ? 49.860  87.449  46.723  1.00 14.78  ? 164 ILE C N   1 
ATOM   7898  C  CA  . ILE C 3  164 ? 50.244  88.587  45.897  1.00 13.68  ? 164 ILE C CA  1 
ATOM   7899  C  C   . ILE C 3  164 ? 51.530  88.332  45.137  1.00 11.34  ? 164 ILE C C   1 
ATOM   7900  O  O   . ILE C 3  164 ? 51.617  88.385  43.911  1.00 13.41  ? 164 ILE C O   1 
ATOM   7901  C  CB  . ILE C 3  164 ? 50.455  89.806  46.830  1.00 12.91  ? 164 ILE C CB  1 
ATOM   7902  C  CG1 . ILE C 3  164 ? 49.107  90.200  47.439  1.00 5.05   ? 164 ILE C CG1 1 
ATOM   7903  C  CG2 . ILE C 3  164 ? 51.134  90.911  46.056  1.00 2.88   ? 164 ILE C CG2 1 
ATOM   7904  C  CD1 . ILE C 3  164 ? 49.214  91.515  48.152  1.00 2.20   ? 164 ILE C CD1 1 
ATOM   7905  N  N   . TRP C 3  165 ? 52.621  88.008  45.807  1.00 12.18  ? 165 TRP C N   1 
ATOM   7906  C  CA  . TRP C 3  165 ? 53.888  87.778  45.144  1.00 12.88  ? 165 TRP C CA  1 
ATOM   7907  C  C   . TRP C 3  165 ? 53.871  86.555  44.236  1.00 16.87  ? 165 TRP C C   1 
ATOM   7908  O  O   . TRP C 3  165 ? 54.825  86.365  43.464  1.00 18.48  ? 165 TRP C O   1 
ATOM   7909  C  CB  . TRP C 3  165 ? 54.996  87.500  46.154  1.00 12.60  ? 165 TRP C CB  1 
ATOM   7910  C  CG  . TRP C 3  165 ? 55.432  88.671  46.957  1.00 14.70  ? 165 TRP C CG  1 
ATOM   7911  C  CD1 . TRP C 3  165 ? 55.230  89.992  46.742  1.00 19.27  ? 165 TRP C CD1 1 
ATOM   7912  C  CD2 . TRP C 3  165 ? 56.201  88.582  48.164  1.00 17.48  ? 165 TRP C CD2 1 
ATOM   7913  N  NE1 . TRP C 3  165 ? 55.812  90.736  47.742  1.00 23.91  ? 165 TRP C NE1 1 
ATOM   7914  C  CE2 . TRP C 3  165 ? 56.415  89.889  48.632  1.00 21.26  ? 165 TRP C CE2 1 
ATOM   7915  C  CE3 . TRP C 3  165 ? 56.719  87.511  48.890  1.00 15.47  ? 165 TRP C CE3 1 
ATOM   7916  C  CZ2 . TRP C 3  165 ? 57.127  90.161  49.803  1.00 14.36  ? 165 TRP C CZ2 1 
ATOM   7917  C  CZ3 . TRP C 3  165 ? 57.420  87.773  50.044  1.00 4.21   ? 165 TRP C CZ3 1 
ATOM   7918  C  CH2 . TRP C 3  165 ? 57.620  89.087  50.484  1.00 10.65  ? 165 TRP C CH2 1 
ATOM   7919  N  N   . GLY C 3  166 ? 53.043  85.585  44.594  1.00 16.12  ? 166 GLY C N   1 
ATOM   7920  C  CA  . GLY C 3  166 ? 53.028  84.337  43.851  1.00 19.93  ? 166 GLY C CA  1 
ATOM   7921  C  C   . GLY C 3  166 ? 54.243  83.450  44.106  1.00 21.58  ? 166 GLY C C   1 
ATOM   7922  O  O   . GLY C 3  166 ? 54.576  82.616  43.258  1.00 17.67  ? 166 GLY C O   1 
ATOM   7923  N  N   . GLY C 3  167 ? 54.846  83.612  45.272  1.00 24.16  ? 167 GLY C N   1 
ATOM   7924  C  CA  . GLY C 3  167 ? 56.013  82.897  45.761  1.00 20.63  ? 167 GLY C CA  1 
ATOM   7925  C  C   . GLY C 3  167 ? 56.480  83.461  47.104  1.00 19.02  ? 167 GLY C C   1 
ATOM   7926  O  O   . GLY C 3  167 ? 55.746  84.223  47.721  1.00 15.36  ? 167 GLY C O   1 
ATOM   7927  N  N   . PHE C 3  168 ? 57.684  83.122  47.544  1.00 21.39  ? 168 PHE C N   1 
ATOM   7928  C  CA  . PHE C 3  168 ? 58.250  83.544  48.816  1.00 20.11  ? 168 PHE C CA  1 
ATOM   7929  C  C   . PHE C 3  168 ? 59.179  84.733  48.690  1.00 16.40  ? 168 PHE C C   1 
ATOM   7930  O  O   . PHE C 3  168 ? 59.758  85.298  49.596  1.00 6.63   ? 168 PHE C O   1 
ATOM   7931  C  CB  . PHE C 3  168 ? 59.066  82.413  49.465  1.00 32.71  ? 168 PHE C CB  1 
ATOM   7932  C  CG  . PHE C 3  168 ? 58.137  81.317  49.925  1.00 51.74  ? 168 PHE C CG  1 
ATOM   7933  C  CD1 . PHE C 3  168 ? 57.393  81.377  51.091  1.00 62.38  ? 168 PHE C CD1 1 
ATOM   7934  C  CD2 . PHE C 3  168 ? 57.980  80.231  49.082  1.00 57.28  ? 168 PHE C CD2 1 
ATOM   7935  C  CE1 . PHE C 3  168 ? 56.534  80.344  51.449  1.00 66.62  ? 168 PHE C CE1 1 
ATOM   7936  C  CE2 . PHE C 3  168 ? 57.124  79.199  49.416  1.00 64.39  ? 168 PHE C CE2 1 
ATOM   7937  C  CZ  . PHE C 3  168 ? 56.407  79.257  50.600  1.00 69.95  ? 168 PHE C CZ  1 
ATOM   7938  N  N   . SER C 3  169 ? 59.418  85.044  47.423  1.00 20.76  ? 169 SER C N   1 
ATOM   7939  C  CA  . SER C 3  169 ? 60.170  86.274  47.137  1.00 26.11  ? 169 SER C CA  1 
ATOM   7940  C  C   . SER C 3  169 ? 59.494  86.986  45.972  1.00 24.02  ? 169 SER C C   1 
ATOM   7941  O  O   . SER C 3  169 ? 58.339  86.683  45.661  1.00 26.95  ? 169 SER C O   1 
ATOM   7942  C  CB  . SER C 3  169 ? 61.624  85.926  46.858  1.00 33.70  ? 169 SER C CB  1 
ATOM   7943  O  OG  . SER C 3  169 ? 61.702  84.809  45.978  1.00 42.43  ? 169 SER C OG  1 
ATOM   7944  N  N   . VAL C 3  170 ? 60.156  87.922  45.340  1.00 21.60  ? 170 VAL C N   1 
ATOM   7945  C  CA  . VAL C 3  170 ? 59.675  88.640  44.170  1.00 22.37  ? 170 VAL C CA  1 
ATOM   7946  C  C   . VAL C 3  170 ? 60.416  88.188  42.925  1.00 26.35  ? 170 VAL C C   1 
ATOM   7947  O  O   . VAL C 3  170 ? 61.273  88.952  42.457  1.00 30.19  ? 170 VAL C O   1 
ATOM   7948  C  CB  . VAL C 3  170 ? 59.905  90.146  44.440  1.00 21.32  ? 170 VAL C CB  1 
ATOM   7949  C  CG1 . VAL C 3  170 ? 59.807  91.053  43.245  1.00 22.76  ? 170 VAL C CG1 1 
ATOM   7950  C  CG2 . VAL C 3  170 ? 58.904  90.617  45.502  1.00 18.48  ? 170 VAL C CG2 1 
ATOM   7951  N  N   . ASP C 3  171 ? 60.341  86.922  42.520  1.00 28.84  ? 171 ASP C N   1 
ATOM   7952  C  CA  . ASP C 3  171 ? 61.008  86.425  41.319  1.00 28.59  ? 171 ASP C CA  1 
ATOM   7953  C  C   . ASP C 3  171 ? 60.011  86.513  40.173  1.00 30.39  ? 171 ASP C C   1 
ATOM   7954  O  O   . ASP C 3  171 ? 58.997  87.205  40.321  1.00 29.61  ? 171 ASP C O   1 
ATOM   7955  C  CB  . ASP C 3  171 ? 61.640  85.044  41.456  1.00 21.72  ? 171 ASP C CB  1 
ATOM   7956  C  CG  . ASP C 3  171 ? 63.105  85.218  41.846  1.00 33.37  ? 171 ASP C CG  1 
ATOM   7957  O  OD1 . ASP C 3  171 ? 63.667  86.205  41.307  1.00 26.70  ? 171 ASP C OD1 1 
ATOM   7958  O  OD2 . ASP C 3  171 ? 63.608  84.421  42.661  1.00 47.31  ? 171 ASP C OD2 1 
ATOM   7959  N  N   . LYS C 3  172 ? 60.266  85.869  39.059  1.00 30.91  ? 172 LYS C N   1 
ATOM   7960  C  CA  . LYS C 3  172 ? 59.388  85.913  37.907  1.00 27.39  ? 172 LYS C CA  1 
ATOM   7961  C  C   . LYS C 3  172 ? 57.938  86.177  38.234  1.00 21.80  ? 172 LYS C C   1 
ATOM   7962  O  O   . LYS C 3  172 ? 57.401  87.261  38.013  1.00 21.40  ? 172 LYS C O   1 
ATOM   7963  C  CB  . LYS C 3  172 ? 59.549  84.587  37.157  1.00 40.85  ? 172 LYS C CB  1 
ATOM   7964  C  CG  . LYS C 3  172 ? 60.876  83.894  37.440  1.00 42.05  ? 172 LYS C CG  1 
ATOM   7965  C  CD  . LYS C 3  172 ? 61.732  83.797  36.182  1.00 51.43  ? 172 LYS C CD  1 
ATOM   7966  C  CE  . LYS C 3  172 ? 63.155  83.379  36.497  1.00 60.45  ? 172 LYS C CE  1 
ATOM   7967  N  NZ  . LYS C 3  172 ? 63.485  81.993  36.054  1.00 64.11  ? 172 LYS C NZ  1 
ATOM   7968  N  N   . ALA C 3  173 ? 57.254  85.175  38.747  1.00 20.74  ? 173 ALA C N   1 
ATOM   7969  C  CA  . ALA C 3  173 ? 55.825  85.264  39.043  1.00 23.72  ? 173 ALA C CA  1 
ATOM   7970  C  C   . ALA C 3  173 ? 55.427  86.690  39.385  1.00 21.98  ? 173 ALA C C   1 
ATOM   7971  O  O   . ALA C 3  173 ? 54.557  87.338  38.804  1.00 25.19  ? 173 ALA C O   1 
ATOM   7972  C  CB  . ALA C 3  173 ? 55.464  84.357  40.216  1.00 35.04  ? 173 ALA C CB  1 
ATOM   7973  N  N   . THR C 3  174 ? 56.030  87.300  40.455  1.00 15.78  ? 174 THR C N   1 
ATOM   7974  C  CA  . THR C 3  174 ? 55.708  88.574  40.815  1.00 10.32  ? 174 THR C CA  1 
ATOM   7975  C  C   . THR C 3  174 ? 55.786  89.466  39.601  1.00 4.68   ? 174 THR C C   1 
ATOM   7976  O  O   . THR C 3  174 ? 54.753  89.951  39.157  1.00 8.52   ? 174 THR C O   1 
ATOM   7977  C  CB  . THR C 3  174 ? 56.569  89.027  41.984  1.00 10.84  ? 174 THR C CB  1 
ATOM   7978  O  OG1 . THR C 3  174 ? 55.914  88.697  43.217  1.00 12.52  ? 174 THR C OG1 1 
ATOM   7979  C  CG2 . THR C 3  174 ? 56.836  90.508  41.964  1.00 11.70  ? 174 THR C CG2 1 
ATOM   7980  N  N   . LEU C 3  175 ? 56.936  89.649  38.975  1.00 6.33   ? 175 LEU C N   1 
ATOM   7981  C  CA  . LEU C 3  175 ? 57.122  90.551  37.863  1.00 6.91   ? 175 LEU C CA  1 
ATOM   7982  C  C   . LEU C 3  175 ? 56.130  90.407  36.736  1.00 5.86   ? 175 LEU C C   1 
ATOM   7983  O  O   . LEU C 3  175 ? 55.737  91.373  36.106  1.00 4.76   ? 175 LEU C O   1 
ATOM   7984  C  CB  . LEU C 3  175 ? 58.495  90.379  37.211  1.00 10.72  ? 175 LEU C CB  1 
ATOM   7985  C  CG  . LEU C 3  175 ? 58.990  91.565  36.388  1.00 7.60   ? 175 LEU C CG  1 
ATOM   7986  C  CD1 . LEU C 3  175 ? 58.361  92.848  36.909  1.00 10.12  ? 175 LEU C CD1 1 
ATOM   7987  C  CD2 . LEU C 3  175 ? 60.508  91.686  36.499  1.00 6.85   ? 175 LEU C CD2 1 
ATOM   7988  N  N   . THR C 3  176 ? 55.868  89.179  36.318  1.00 7.28   ? 176 THR C N   1 
ATOM   7989  C  CA  . THR C 3  176 ? 54.909  88.988  35.274  1.00 2.64   ? 176 THR C CA  1 
ATOM   7990  C  C   . THR C 3  176 ? 53.528  89.546  35.654  1.00 9.00   ? 176 THR C C   1 
ATOM   7991  O  O   . THR C 3  176 ? 52.821  90.070  34.794  1.00 16.05  ? 176 THR C O   1 
ATOM   7992  C  CB  . THR C 3  176 ? 54.803  87.543  34.823  1.00 7.07   ? 176 THR C CB  1 
ATOM   7993  O  OG1 . THR C 3  176 ? 55.760  87.363  33.763  1.00 3.61   ? 176 THR C OG1 1 
ATOM   7994  C  CG2 . THR C 3  176 ? 53.412  87.087  34.405  1.00 3.49   ? 176 THR C CG2 1 
ATOM   7995  N  N   . ARG C 3  177 ? 53.104  89.423  36.901  1.00 11.08  ? 177 ARG C N   1 
ATOM   7996  C  CA  . ARG C 3  177 ? 51.811  89.898  37.386  1.00 7.72   ? 177 ARG C CA  1 
ATOM   7997  C  C   . ARG C 3  177 ? 51.736  91.409  37.268  1.00 5.83   ? 177 ARG C C   1 
ATOM   7998  O  O   . ARG C 3  177 ? 50.789  91.861  36.625  1.00 5.17   ? 177 ARG C O   1 
ATOM   7999  C  CB  . ARG C 3  177 ? 51.642  89.497  38.852  1.00 3.74   ? 177 ARG C CB  1 
ATOM   8000  C  CG  . ARG C 3  177 ? 51.381  87.998  38.949  1.00 17.81  ? 177 ARG C CG  1 
ATOM   8001  C  CD  . ARG C 3  177 ? 51.307  87.650  40.438  1.00 22.28  ? 177 ARG C CD  1 
ATOM   8002  N  NE  . ARG C 3  177 ? 51.364  86.194  40.566  1.00 18.28  ? 177 ARG C NE  1 
ATOM   8003  C  CZ  . ARG C 3  177 ? 51.118  85.632  41.747  1.00 19.39  ? 177 ARG C CZ  1 
ATOM   8004  N  NH1 . ARG C 3  177 ? 50.819  86.363  42.794  1.00 14.28  ? 177 ARG C NH1 1 
ATOM   8005  N  NH2 . ARG C 3  177 ? 51.232  84.317  41.720  1.00 21.02  ? 177 ARG C NH2 1 
ATOM   8006  N  N   . PHE C 3  178 ? 52.671  92.139  37.855  1.00 4.26   ? 178 PHE C N   1 
ATOM   8007  C  CA  . PHE C 3  178 ? 52.669  93.586  37.665  1.00 6.58   ? 178 PHE C CA  1 
ATOM   8008  C  C   . PHE C 3  178 ? 52.518  93.990  36.218  1.00 6.06   ? 178 PHE C C   1 
ATOM   8009  O  O   . PHE C 3  178 ? 51.659  94.798  35.827  1.00 6.81   ? 178 PHE C O   1 
ATOM   8010  C  CB  . PHE C 3  178 ? 53.895  94.212  38.318  1.00 12.36  ? 178 PHE C CB  1 
ATOM   8011  C  CG  . PHE C 3  178 ? 53.974  93.868  39.784  1.00 18.06  ? 178 PHE C CG  1 
ATOM   8012  C  CD1 . PHE C 3  178 ? 54.571  92.683  40.150  1.00 29.22  ? 178 PHE C CD1 1 
ATOM   8013  C  CD2 . PHE C 3  178 ? 53.489  94.662  40.783  1.00 14.46  ? 178 PHE C CD2 1 
ATOM   8014  C  CE1 . PHE C 3  178 ? 54.650  92.344  41.479  1.00 36.48  ? 178 PHE C CE1 1 
ATOM   8015  C  CE2 . PHE C 3  178 ? 53.562  94.343  42.109  1.00 17.31  ? 178 PHE C CE2 1 
ATOM   8016  C  CZ  . PHE C 3  178 ? 54.158  93.158  42.475  1.00 29.83  ? 178 PHE C CZ  1 
ATOM   8017  N  N   . PHE C 3  179 ? 53.284  93.398  35.307  1.00 2.42   ? 179 PHE C N   1 
ATOM   8018  C  CA  . PHE C 3  179 ? 53.060  93.787  33.908  1.00 3.08   ? 179 PHE C CA  1 
ATOM   8019  C  C   . PHE C 3  179 ? 51.582  93.725  33.546  1.00 5.88   ? 179 PHE C C   1 
ATOM   8020  O  O   . PHE C 3  179 ? 50.985  94.556  32.864  1.00 5.84   ? 179 PHE C O   1 
ATOM   8021  C  CB  . PHE C 3  179 ? 53.787  92.740  33.050  1.00 2.20   ? 179 PHE C CB  1 
ATOM   8022  C  CG  . PHE C 3  179 ? 53.751  93.122  31.596  1.00 6.22   ? 179 PHE C CG  1 
ATOM   8023  C  CD1 . PHE C 3  179 ? 54.113  94.361  31.097  1.00 2.95   ? 179 PHE C CD1 1 
ATOM   8024  C  CD2 . PHE C 3  179 ? 53.240  92.184  30.719  1.00 5.69   ? 179 PHE C CD2 1 
ATOM   8025  C  CE1 . PHE C 3  179 ? 54.036  94.635  29.742  1.00 2.20   ? 179 PHE C CE1 1 
ATOM   8026  C  CE2 . PHE C 3  179 ? 53.116  92.479  29.379  1.00 12.70  ? 179 PHE C CE2 1 
ATOM   8027  C  CZ  . PHE C 3  179 ? 53.523  93.702  28.871  1.00 12.08  ? 179 PHE C CZ  1 
ATOM   8028  N  N   . ALA C 3  180 ? 50.907  92.619  33.878  1.00 2.20   ? 180 ALA C N   1 
ATOM   8029  C  CA  . ALA C 3  180 ? 49.543  92.468  33.381  1.00 8.23   ? 180 ALA C CA  1 
ATOM   8030  C  C   . ALA C 3  180 ? 48.644  93.439  34.093  1.00 6.62   ? 180 ALA C C   1 
ATOM   8031  O  O   . ALA C 3  180 ? 47.704  94.067  33.674  1.00 3.13   ? 180 ALA C O   1 
ATOM   8032  C  CB  . ALA C 3  180 ? 49.036  91.045  33.453  1.00 2.94   ? 180 ALA C CB  1 
ATOM   8033  N  N   . PHE C 3  181 ? 48.939  93.638  35.378  1.00 5.71   ? 181 PHE C N   1 
ATOM   8034  C  CA  . PHE C 3  181 ? 48.080  94.541  36.087  1.00 2.20   ? 181 PHE C CA  1 
ATOM   8035  C  C   . PHE C 3  181 ? 48.168  95.988  35.701  1.00 5.07   ? 181 PHE C C   1 
ATOM   8036  O  O   . PHE C 3  181 ? 47.153  96.683  35.682  1.00 6.04   ? 181 PHE C O   1 
ATOM   8037  C  CB  . PHE C 3  181 ? 48.098  94.266  37.575  1.00 8.38   ? 181 PHE C CB  1 
ATOM   8038  C  CG  . PHE C 3  181 ? 47.684  92.882  37.965  1.00 10.37  ? 181 PHE C CG  1 
ATOM   8039  C  CD1 . PHE C 3  181 ? 46.378  92.525  38.214  1.00 4.96   ? 181 PHE C CD1 1 
ATOM   8040  C  CD2 . PHE C 3  181 ? 48.634  91.901  38.103  1.00 24.72  ? 181 PHE C CD2 1 
ATOM   8041  C  CE1 . PHE C 3  181 ? 46.037  91.228  38.581  1.00 15.94  ? 181 PHE C CE1 1 
ATOM   8042  C  CE2 . PHE C 3  181 ? 48.337  90.606  38.463  1.00 33.05  ? 181 PHE C CE2 1 
ATOM   8043  C  CZ  . PHE C 3  181 ? 47.013  90.267  38.709  1.00 26.69  ? 181 PHE C CZ  1 
ATOM   8044  N  N   . HIS C 3  182 ? 49.358  96.428  35.374  1.00 2.20   ? 182 HIS C N   1 
ATOM   8045  C  CA  . HIS C 3  182 ? 49.811  97.710  34.904  1.00 5.52   ? 182 HIS C CA  1 
ATOM   8046  C  C   . HIS C 3  182 ? 49.043  97.946  33.596  1.00 6.75   ? 182 HIS C C   1 
ATOM   8047  O  O   . HIS C 3  182 ? 48.392  98.961  33.521  1.00 6.77   ? 182 HIS C O   1 
ATOM   8048  C  CB  . HIS C 3  182 ? 51.323  97.769  34.606  1.00 2.20   ? 182 HIS C CB  1 
ATOM   8049  C  CG  . HIS C 3  182 ? 51.910  99.105  34.317  1.00 8.41   ? 182 HIS C CG  1 
ATOM   8050  N  ND1 . HIS C 3  182 ? 51.984  100.127 35.232  1.00 11.67  ? 182 HIS C ND1 1 
ATOM   8051  C  CD2 . HIS C 3  182 ? 52.613  99.581  33.265  1.00 12.33  ? 182 HIS C CD2 1 
ATOM   8052  C  CE1 . HIS C 3  182 ? 52.638  101.147 34.703  1.00 2.59   ? 182 HIS C CE1 1 
ATOM   8053  N  NE2 . HIS C 3  182 ? 53.113  100.852 33.521  1.00 5.93   ? 182 HIS C NE2 1 
ATOM   8054  N  N   . PHE C 3  183 ? 49.032  96.924  32.758  1.00 6.44   ? 183 PHE C N   1 
ATOM   8055  C  CA  . PHE C 3  183 ? 48.435  96.970  31.446  1.00 6.78   ? 183 PHE C CA  1 
ATOM   8056  C  C   . PHE C 3  183 ? 46.964  97.295  31.506  1.00 6.45   ? 183 PHE C C   1 
ATOM   8057  O  O   . PHE C 3  183 ? 46.548  98.416  31.169  1.00 7.64   ? 183 PHE C O   1 
ATOM   8058  C  CB  . PHE C 3  183 ? 48.822  95.797  30.559  1.00 6.67   ? 183 PHE C CB  1 
ATOM   8059  C  CG  . PHE C 3  183 ? 48.660  96.048  29.086  1.00 5.90   ? 183 PHE C CG  1 
ATOM   8060  C  CD1 . PHE C 3  183 ? 47.369  96.255  28.640  1.00 8.70   ? 183 PHE C CD1 1 
ATOM   8061  C  CD2 . PHE C 3  183 ? 49.656  96.114  28.144  1.00 3.92   ? 183 PHE C CD2 1 
ATOM   8062  C  CE1 . PHE C 3  183 ? 47.047  96.498  27.331  1.00 10.36  ? 183 PHE C CE1 1 
ATOM   8063  C  CE2 . PHE C 3  183 ? 49.344  96.378  26.819  1.00 2.20   ? 183 PHE C CE2 1 
ATOM   8064  C  CZ  . PHE C 3  183 ? 48.056  96.549  26.390  1.00 8.15   ? 183 PHE C CZ  1 
ATOM   8065  N  N   . ILE C 3  184 ? 46.135  96.407  31.993  1.00 4.50   ? 184 ILE C N   1 
ATOM   8066  C  CA  . ILE C 3  184 ? 44.690  96.564  32.106  1.00 5.56   ? 184 ILE C CA  1 
ATOM   8067  C  C   . ILE C 3  184 ? 44.238  97.626  33.089  1.00 3.78   ? 184 ILE C C   1 
ATOM   8068  O  O   . ILE C 3  184 ? 43.140  98.167  32.917  1.00 9.91   ? 184 ILE C O   1 
ATOM   8069  C  CB  . ILE C 3  184 ? 44.098  95.212  32.539  1.00 2.20   ? 184 ILE C CB  1 
ATOM   8070  C  CG1 . ILE C 3  184 ? 42.600  94.961  32.339  1.00 3.26   ? 184 ILE C CG1 1 
ATOM   8071  C  CG2 . ILE C 3  184 ? 44.196  95.190  34.061  1.00 2.20   ? 184 ILE C CG2 1 
ATOM   8072  C  CD1 . ILE C 3  184 ? 42.311  93.457  32.518  1.00 2.20   ? 184 ILE C CD1 1 
ATOM   8073  N  N   . LEU C 3  185 ? 44.976  97.941  34.131  1.00 5.49   ? 185 LEU C N   1 
ATOM   8074  C  CA  . LEU C 3  185 ? 44.515  98.931  35.099  1.00 6.65   ? 185 LEU C CA  1 
ATOM   8075  C  C   . LEU C 3  185 ? 44.014  100.204 34.466  1.00 2.58   ? 185 LEU C C   1 
ATOM   8076  O  O   . LEU C 3  185 ? 42.800  100.493 34.504  1.00 12.19  ? 185 LEU C O   1 
ATOM   8077  C  CB  . LEU C 3  185 ? 45.605  99.111  36.114  1.00 2.20   ? 185 LEU C CB  1 
ATOM   8078  C  CG  . LEU C 3  185 ? 45.251  99.766  37.452  1.00 12.20  ? 185 LEU C CG  1 
ATOM   8079  C  CD1 . LEU C 3  185 ? 43.840  99.433  37.919  1.00 4.98   ? 185 LEU C CD1 1 
ATOM   8080  C  CD2 . LEU C 3  185 ? 46.243  99.291  38.513  1.00 16.58  ? 185 LEU C CD2 1 
ATOM   8081  N  N   . PRO C 3  186 ? 44.835  100.920 33.732  1.00 6.36   ? 186 PRO C N   1 
ATOM   8082  C  CA  . PRO C 3  186 ? 44.498  102.142 33.037  1.00 2.20   ? 186 PRO C CA  1 
ATOM   8083  C  C   . PRO C 3  186 ? 43.280  102.042 32.129  1.00 6.96   ? 186 PRO C C   1 
ATOM   8084  O  O   . PRO C 3  186 ? 42.572  103.029 31.857  1.00 7.92   ? 186 PRO C O   1 
ATOM   8085  C  CB  . PRO C 3  186 ? 45.734  102.486 32.176  1.00 7.08   ? 186 PRO C CB  1 
ATOM   8086  C  CG  . PRO C 3  186 ? 46.826  101.680 32.787  1.00 6.88   ? 186 PRO C CG  1 
ATOM   8087  C  CD  . PRO C 3  186 ? 46.260  100.606 33.654  1.00 7.04   ? 186 PRO C CD  1 
ATOM   8088  N  N   . PHE C 3  187 ? 42.987  100.864 31.587  1.00 3.66   ? 187 PHE C N   1 
ATOM   8089  C  CA  . PHE C 3  187 ? 41.784  100.758 30.742  1.00 6.32   ? 187 PHE C CA  1 
ATOM   8090  C  C   . PHE C 3  187 ? 40.618  100.785 31.698  1.00 3.09   ? 187 PHE C C   1 
ATOM   8091  O  O   . PHE C 3  187 ? 39.582  101.348 31.368  1.00 9.97   ? 187 PHE C O   1 
ATOM   8092  C  CB  . PHE C 3  187 ? 41.852  99.545  29.828  1.00 5.01   ? 187 PHE C CB  1 
ATOM   8093  C  CG  . PHE C 3  187 ? 42.957  99.689  28.805  1.00 2.64   ? 187 PHE C CG  1 
ATOM   8094  C  CD1 . PHE C 3  187 ? 42.913  100.805 27.979  1.00 6.63   ? 187 PHE C CD1 1 
ATOM   8095  C  CD2 . PHE C 3  187 ? 43.990  98.775  28.667  1.00 8.59   ? 187 PHE C CD2 1 
ATOM   8096  C  CE1 . PHE C 3  187 ? 43.888  101.009 27.025  1.00 9.90   ? 187 PHE C CE1 1 
ATOM   8097  C  CE2 . PHE C 3  187 ? 44.979  98.968  27.722  1.00 4.76   ? 187 PHE C CE2 1 
ATOM   8098  C  CZ  . PHE C 3  187 ? 44.924  100.088 26.906  1.00 16.42  ? 187 PHE C CZ  1 
ATOM   8099  N  N   . ILE C 3  188 ? 40.751  100.161 32.857  1.00 6.83   ? 188 ILE C N   1 
ATOM   8100  C  CA  . ILE C 3  188 ? 39.697  100.132 33.871  1.00 2.20   ? 188 ILE C CA  1 
ATOM   8101  C  C   . ILE C 3  188 ? 39.501  101.549 34.394  1.00 8.52   ? 188 ILE C C   1 
ATOM   8102  O  O   . ILE C 3  188 ? 38.389  102.019 34.607  1.00 5.85   ? 188 ILE C O   1 
ATOM   8103  C  CB  . ILE C 3  188 ? 40.030  99.193  35.038  1.00 6.64   ? 188 ILE C CB  1 
ATOM   8104  C  CG1 . ILE C 3  188 ? 39.936  97.724  34.542  1.00 2.20   ? 188 ILE C CG1 1 
ATOM   8105  C  CG2 . ILE C 3  188 ? 39.005  99.222  36.149  1.00 2.20   ? 188 ILE C CG2 1 
ATOM   8106  C  CD1 . ILE C 3  188 ? 40.985  96.903  35.279  1.00 2.98   ? 188 ILE C CD1 1 
ATOM   8107  N  N   . ILE C 3  189 ? 40.651  102.229 34.509  1.00 5.60   ? 189 ILE C N   1 
ATOM   8108  C  CA  . ILE C 3  189 ? 40.667  103.605 34.943  1.00 7.62   ? 189 ILE C CA  1 
ATOM   8109  C  C   . ILE C 3  189 ? 39.832  104.516 34.049  1.00 7.62   ? 189 ILE C C   1 
ATOM   8110  O  O   . ILE C 3  189 ? 39.084  105.354 34.548  1.00 9.12   ? 189 ILE C O   1 
ATOM   8111  C  CB  . ILE C 3  189 ? 42.078  104.222 34.924  1.00 10.95  ? 189 ILE C CB  1 
ATOM   8112  C  CG1 . ILE C 3  189 ? 42.978  103.583 35.963  1.00 9.21   ? 189 ILE C CG1 1 
ATOM   8113  C  CG2 . ILE C 3  189 ? 41.975  105.738 35.099  1.00 10.17  ? 189 ILE C CG2 1 
ATOM   8114  C  CD1 . ILE C 3  189 ? 43.583  104.567 36.937  1.00 20.14  ? 189 ILE C CD1 1 
ATOM   8115  N  N   . MET C 3  190 ? 40.012  104.358 32.746  1.00 8.13   ? 190 MET C N   1 
ATOM   8116  C  CA  . MET C 3  190 ? 39.288  105.180 31.796  1.00 8.43   ? 190 MET C CA  1 
ATOM   8117  C  C   . MET C 3  190 ? 37.778  105.064 31.904  1.00 8.35   ? 190 MET C C   1 
ATOM   8118  O  O   . MET C 3  190 ? 37.064  106.052 31.705  1.00 5.64   ? 190 MET C O   1 
ATOM   8119  C  CB  . MET C 3  190 ? 39.752  104.897 30.374  1.00 14.07  ? 190 MET C CB  1 
ATOM   8120  C  CG  . MET C 3  190 ? 40.168  106.165 29.645  1.00 2.54   ? 190 MET C CG  1 
ATOM   8121  S  SD  . MET C 3  190 ? 39.937  106.056 27.880  1.00 39.04  ? 190 MET C SD  1 
ATOM   8122  C  CE  . MET C 3  190 ? 41.353  105.107 27.338  1.00 34.14  ? 190 MET C CE  1 
ATOM   8123  N  N   . ALA C 3  191 ? 37.291  103.866 32.220  1.00 7.37   ? 191 ALA C N   1 
ATOM   8124  C  CA  . ALA C 3  191 ? 35.851  103.709 32.465  1.00 5.96   ? 191 ALA C CA  1 
ATOM   8125  C  C   . ALA C 3  191 ? 35.495  104.582 33.676  1.00 5.55   ? 191 ALA C C   1 
ATOM   8126  O  O   . ALA C 3  191 ? 34.569  105.386 33.616  1.00 4.38   ? 191 ALA C O   1 
ATOM   8127  C  CB  . ALA C 3  191 ? 35.530  102.269 32.835  1.00 6.12   ? 191 ALA C CB  1 
ATOM   8128  N  N   . ILE C 3  192 ? 36.285  104.389 34.736  1.00 4.57   ? 192 ILE C N   1 
ATOM   8129  C  CA  . ILE C 3  192 ? 36.005  105.204 35.921  1.00 2.20   ? 192 ILE C CA  1 
ATOM   8130  C  C   . ILE C 3  192 ? 36.066  106.655 35.496  1.00 2.20   ? 192 ILE C C   1 
ATOM   8131  O  O   . ILE C 3  192 ? 35.238  107.468 35.954  1.00 4.61   ? 192 ILE C O   1 
ATOM   8132  C  CB  . ILE C 3  192 ? 36.795  104.866 37.164  1.00 5.96   ? 192 ILE C CB  1 
ATOM   8133  C  CG1 . ILE C 3  192 ? 37.091  103.378 37.380  1.00 2.75   ? 192 ILE C CG1 1 
ATOM   8134  C  CG2 . ILE C 3  192 ? 36.080  105.389 38.414  1.00 3.01   ? 192 ILE C CG2 1 
ATOM   8135  C  CD1 . ILE C 3  192 ? 35.884  102.474 37.473  1.00 3.69   ? 192 ILE C CD1 1 
ATOM   8136  N  N   . ALA C 3  193 ? 37.128  107.092 34.826  1.00 4.27   ? 193 ALA C N   1 
ATOM   8137  C  CA  . ALA C 3  193 ? 37.166  108.553 34.612  1.00 4.59   ? 193 ALA C CA  1 
ATOM   8138  C  C   . ALA C 3  193 ? 35.843  109.024 34.034  1.00 7.79   ? 193 ALA C C   1 
ATOM   8139  O  O   . ALA C 3  193 ? 35.188  109.970 34.458  1.00 5.58   ? 193 ALA C O   1 
ATOM   8140  C  CB  . ALA C 3  193 ? 38.401  108.928 33.845  1.00 3.61   ? 193 ALA C CB  1 
ATOM   8141  N  N   . MET C 3  194 ? 35.380  108.288 33.017  1.00 10.09  ? 194 MET C N   1 
ATOM   8142  C  CA  . MET C 3  194 ? 34.149  108.564 32.377  1.00 2.20   ? 194 MET C CA  1 
ATOM   8143  C  C   . MET C 3  194 ? 32.933  108.449 33.285  1.00 5.13   ? 194 MET C C   1 
ATOM   8144  O  O   . MET C 3  194 ? 31.934  109.143 33.098  1.00 4.86   ? 194 MET C O   1 
ATOM   8145  C  CB  . MET C 3  194 ? 33.867  107.750 31.125  1.00 11.42  ? 194 MET C CB  1 
ATOM   8146  C  CG  . MET C 3  194 ? 34.944  107.389 30.150  1.00 13.41  ? 194 MET C CG  1 
ATOM   8147  S  SD  . MET C 3  194 ? 34.349  106.507 28.688  1.00 21.54  ? 194 MET C SD  1 
ATOM   8148  C  CE  . MET C 3  194 ? 33.770  104.954 29.380  1.00 11.26  ? 194 MET C CE  1 
ATOM   8149  N  N   . VAL C 3  195 ? 32.971  107.555 34.293  1.00 6.71   ? 195 VAL C N   1 
ATOM   8150  C  CA  . VAL C 3  195 ? 31.789  107.565 35.178  1.00 5.45   ? 195 VAL C CA  1 
ATOM   8151  C  C   . VAL C 3  195 ? 31.871  108.844 36.027  1.00 4.44   ? 195 VAL C C   1 
ATOM   8152  O  O   . VAL C 3  195 ? 30.893  109.436 36.438  1.00 6.23   ? 195 VAL C O   1 
ATOM   8153  C  CB  . VAL C 3  195 ? 31.640  106.345 36.057  1.00 3.56   ? 195 VAL C CB  1 
ATOM   8154  C  CG1 . VAL C 3  195 ? 30.990  106.561 37.409  1.00 4.64   ? 195 VAL C CG1 1 
ATOM   8155  C  CG2 . VAL C 3  195 ? 30.883  105.243 35.312  1.00 2.20   ? 195 VAL C CG2 1 
ATOM   8156  N  N   . HIS C 3  196 ? 33.130  109.232 36.240  1.00 2.66   ? 196 HIS C N   1 
ATOM   8157  C  CA  . HIS C 3  196 ? 33.352  110.432 37.064  1.00 4.88   ? 196 HIS C CA  1 
ATOM   8158  C  C   . HIS C 3  196 ? 32.715  111.592 36.344  1.00 6.34   ? 196 HIS C C   1 
ATOM   8159  O  O   . HIS C 3  196 ? 31.920  112.351 36.865  1.00 2.27   ? 196 HIS C O   1 
ATOM   8160  C  CB  . HIS C 3  196 ? 34.779  110.569 37.445  1.00 2.20   ? 196 HIS C CB  1 
ATOM   8161  C  CG  . HIS C 3  196 ? 35.455  111.756 38.034  1.00 2.20   ? 196 HIS C CG  1 
ATOM   8162  N  ND1 . HIS C 3  196 ? 35.302  112.202 39.317  1.00 6.17   ? 196 HIS C ND1 1 
ATOM   8163  C  CD2 . HIS C 3  196 ? 36.450  112.557 37.527  1.00 7.53   ? 196 HIS C CD2 1 
ATOM   8164  C  CE1 . HIS C 3  196 ? 36.106  113.234 39.538  1.00 6.60   ? 196 HIS C CE1 1 
ATOM   8165  N  NE2 . HIS C 3  196 ? 36.845  113.475 38.471  1.00 7.63   ? 196 HIS C NE2 1 
ATOM   8166  N  N   . LEU C 3  197 ? 33.074  111.734 35.094  1.00 2.20   ? 197 LEU C N   1 
ATOM   8167  C  CA  . LEU C 3  197 ? 32.496  112.775 34.234  1.00 5.34   ? 197 LEU C CA  1 
ATOM   8168  C  C   . LEU C 3  197 ? 30.980  112.776 34.259  1.00 5.25   ? 197 LEU C C   1 
ATOM   8169  O  O   . LEU C 3  197 ? 30.417  113.798 34.664  1.00 2.59   ? 197 LEU C O   1 
ATOM   8170  C  CB  . LEU C 3  197 ? 33.091  112.853 32.854  1.00 6.40   ? 197 LEU C CB  1 
ATOM   8171  C  CG  . LEU C 3  197 ? 33.908  114.099 32.500  1.00 10.61  ? 197 LEU C CG  1 
ATOM   8172  C  CD1 . LEU C 3  197 ? 34.387  114.864 33.721  1.00 7.26   ? 197 LEU C CD1 1 
ATOM   8173  C  CD2 . LEU C 3  197 ? 35.100  113.726 31.637  1.00 3.02   ? 197 LEU C CD2 1 
ATOM   8174  N  N   . LEU C 3  198 ? 30.314  111.685 33.953  1.00 2.20   ? 198 LEU C N   1 
ATOM   8175  C  CA  . LEU C 3  198 ? 28.952  111.363 34.122  1.00 5.74   ? 198 LEU C CA  1 
ATOM   8176  C  C   . LEU C 3  198 ? 28.294  111.981 35.345  1.00 4.28   ? 198 LEU C C   1 
ATOM   8177  O  O   . LEU C 3  198 ? 27.276  112.641 35.166  1.00 4.25   ? 198 LEU C O   1 
ATOM   8178  C  CB  . LEU C 3  198 ? 28.714  109.847 34.192  1.00 7.50   ? 198 LEU C CB  1 
ATOM   8179  C  CG  . LEU C 3  198 ? 27.199  109.622 33.991  1.00 8.11   ? 198 LEU C CG  1 
ATOM   8180  C  CD1 . LEU C 3  198 ? 26.880  109.627 32.512  1.00 5.00   ? 198 LEU C CD1 1 
ATOM   8181  C  CD2 . LEU C 3  198 ? 26.798  108.385 34.685  1.00 2.20   ? 198 LEU C CD2 1 
ATOM   8182  N  N   . PHE C 3  199 ? 28.810  111.785 36.552  1.00 2.29   ? 199 PHE C N   1 
ATOM   8183  C  CA  . PHE C 3  199 ? 28.202  112.373 37.734  1.00 5.20   ? 199 PHE C CA  1 
ATOM   8184  C  C   . PHE C 3  199 ? 28.362  113.876 37.811  1.00 9.84   ? 199 PHE C C   1 
ATOM   8185  O  O   . PHE C 3  199 ? 27.421  114.545 38.277  1.00 16.73  ? 199 PHE C O   1 
ATOM   8186  C  CB  . PHE C 3  199 ? 28.746  111.729 38.985  1.00 2.20   ? 199 PHE C CB  1 
ATOM   8187  C  CG  . PHE C 3  199 ? 28.029  110.470 39.380  1.00 2.23   ? 199 PHE C CG  1 
ATOM   8188  C  CD1 . PHE C 3  199 ? 26.789  110.522 39.968  1.00 6.82   ? 199 PHE C CD1 1 
ATOM   8189  C  CD2 . PHE C 3  199 ? 28.596  109.233 39.140  1.00 6.92   ? 199 PHE C CD2 1 
ATOM   8190  C  CE1 . PHE C 3  199 ? 26.156  109.353 40.310  1.00 3.44   ? 199 PHE C CE1 1 
ATOM   8191  C  CE2 . PHE C 3  199 ? 27.939  108.069 39.463  1.00 3.55   ? 199 PHE C CE2 1 
ATOM   8192  C  CZ  . PHE C 3  199 ? 26.698  108.122 40.049  1.00 6.04   ? 199 PHE C CZ  1 
ATOM   8193  N  N   . LEU C 3  200 ? 29.509  114.388 37.370  1.00 2.20   ? 200 LEU C N   1 
ATOM   8194  C  CA  . LEU C 3  200 ? 29.691  115.844 37.428  1.00 8.48   ? 200 LEU C CA  1 
ATOM   8195  C  C   . LEU C 3  200 ? 28.815  116.552 36.420  1.00 7.01   ? 200 LEU C C   1 
ATOM   8196  O  O   . LEU C 3  200 ? 28.477  117.726 36.495  1.00 6.93   ? 200 LEU C O   1 
ATOM   8197  C  CB  . LEU C 3  200 ? 31.173  116.199 37.197  1.00 5.46   ? 200 LEU C CB  1 
ATOM   8198  C  CG  . LEU C 3  200 ? 31.470  117.696 37.074  1.00 6.37   ? 200 LEU C CG  1 
ATOM   8199  C  CD1 . LEU C 3  200 ? 31.915  118.314 38.395  1.00 7.46   ? 200 LEU C CD1 1 
ATOM   8200  C  CD2 . LEU C 3  200 ? 32.510  117.873 35.977  1.00 3.01   ? 200 LEU C CD2 1 
ATOM   8201  N  N   . HIS C 3  201 ? 28.394  115.807 35.389  1.00 9.39   ? 201 HIS C N   1 
ATOM   8202  C  CA  . HIS C 3  201 ? 27.672  116.493 34.319  1.00 13.57  ? 201 HIS C CA  1 
ATOM   8203  C  C   . HIS C 3  201 ? 26.270  116.840 34.719  1.00 8.12   ? 201 HIS C C   1 
ATOM   8204  O  O   . HIS C 3  201 ? 25.573  117.597 34.069  1.00 14.67  ? 201 HIS C O   1 
ATOM   8205  C  CB  . HIS C 3  201 ? 27.898  115.887 32.943  1.00 17.17  ? 201 HIS C CB  1 
ATOM   8206  C  CG  . HIS C 3  201 ? 29.207  116.392 32.354  1.00 19.07  ? 201 HIS C CG  1 
ATOM   8207  N  ND1 . HIS C 3  201 ? 29.812  115.879 31.236  1.00 16.40  ? 201 HIS C ND1 1 
ATOM   8208  C  CD2 . HIS C 3  201 ? 30.016  117.397 32.778  1.00 17.51  ? 201 HIS C CD2 1 
ATOM   8209  C  CE1 . HIS C 3  201 ? 30.929  116.528 30.977  1.00 13.69  ? 201 HIS C CE1 1 
ATOM   8210  N  NE2 . HIS C 3  201 ? 31.080  117.447 31.903  1.00 22.16  ? 201 HIS C NE2 1 
ATOM   8211  N  N   . GLU C 3  202 ? 25.879  116.369 35.877  1.00 8.49   ? 202 GLU C N   1 
ATOM   8212  C  CA  . GLU C 3  202 ? 24.605  116.602 36.496  1.00 7.26   ? 202 GLU C CA  1 
ATOM   8213  C  C   . GLU C 3  202 ? 24.561  117.837 37.364  1.00 4.49   ? 202 GLU C C   1 
ATOM   8214  O  O   . GLU C 3  202 ? 23.491  118.139 37.886  1.00 3.80   ? 202 GLU C O   1 
ATOM   8215  C  CB  . GLU C 3  202 ? 24.337  115.412 37.482  1.00 3.57   ? 202 GLU C CB  1 
ATOM   8216  C  CG  . GLU C 3  202 ? 23.736  114.266 36.647  1.00 26.99  ? 202 GLU C CG  1 
ATOM   8217  C  CD  . GLU C 3  202 ? 23.091  113.272 37.586  1.00 31.08  ? 202 GLU C CD  1 
ATOM   8218  O  OE1 . GLU C 3  202 ? 23.010  113.640 38.772  1.00 37.05  ? 202 GLU C OE1 1 
ATOM   8219  O  OE2 . GLU C 3  202 ? 22.751  112.186 37.111  1.00 43.76  ? 202 GLU C OE2 1 
ATOM   8220  N  N   . THR C 3  203 ? 25.709  118.414 37.692  1.00 6.44   ? 203 THR C N   1 
ATOM   8221  C  CA  . THR C 3  203 ? 25.644  119.525 38.607  1.00 5.59   ? 203 THR C CA  1 
ATOM   8222  C  C   . THR C 3  203 ? 26.490  120.685 38.129  1.00 2.20   ? 203 THR C C   1 
ATOM   8223  O  O   . THR C 3  203 ? 26.097  121.803 38.522  1.00 3.76   ? 203 THR C O   1 
ATOM   8224  C  CB  . THR C 3  203 ? 25.974  119.267 40.084  1.00 2.99   ? 203 THR C CB  1 
ATOM   8225  O  OG1 . THR C 3  203 ? 27.250  118.623 40.126  1.00 7.97   ? 203 THR C OG1 1 
ATOM   8226  C  CG2 . THR C 3  203 ? 24.958  118.459 40.846  1.00 4.52   ? 203 THR C CG2 1 
ATOM   8227  N  N   . GLY C 3  204 ? 27.427  120.504 37.232  1.00 4.09   ? 204 GLY C N   1 
ATOM   8228  C  CA  . GLY C 3  204 ? 28.334  121.536 36.766  1.00 3.63   ? 204 GLY C CA  1 
ATOM   8229  C  C   . GLY C 3  204 ? 29.538  121.826 37.653  1.00 6.85   ? 204 GLY C C   1 
ATOM   8230  O  O   . GLY C 3  204 ? 29.825  121.084 38.599  1.00 14.04  ? 204 GLY C O   1 
ATOM   8231  N  N   . SER C 3  205 ? 30.255  122.927 37.399  1.00 2.20   ? 205 SER C N   1 
ATOM   8232  C  CA  . SER C 3  205 ? 31.570  123.122 38.091  1.00 2.20   ? 205 SER C CA  1 
ATOM   8233  C  C   . SER C 3  205 ? 31.223  124.133 39.158  1.00 7.39   ? 205 SER C C   1 
ATOM   8234  O  O   . SER C 3  205 ? 30.163  124.760 39.090  1.00 12.24  ? 205 SER C O   1 
ATOM   8235  C  CB  . SER C 3  205 ? 32.489  123.666 37.015  1.00 6.97   ? 205 SER C CB  1 
ATOM   8236  O  OG  . SER C 3  205 ? 33.159  122.577 36.369  1.00 5.83   ? 205 SER C OG  1 
ATOM   8237  N  N   . ASN C 3  206 ? 32.157  124.212 40.070  1.00 7.76   ? 206 ASN C N   1 
ATOM   8238  C  CA  . ASN C 3  206 ? 31.992  125.212 41.144  1.00 13.54  ? 206 ASN C CA  1 
ATOM   8239  C  C   . ASN C 3  206 ? 32.924  126.364 40.754  1.00 13.65  ? 206 ASN C C   1 
ATOM   8240  O  O   . ASN C 3  206 ? 33.451  126.281 39.615  1.00 11.84  ? 206 ASN C O   1 
ATOM   8241  C  CB  . ASN C 3  206 ? 32.419  124.462 42.391  1.00 2.53   ? 206 ASN C CB  1 
ATOM   8242  C  CG  . ASN C 3  206 ? 32.502  125.432 43.562  1.00 12.92  ? 206 ASN C CG  1 
ATOM   8243  O  OD1 . ASN C 3  206 ? 33.360  125.077 44.359  1.00 12.31  ? 206 ASN C OD1 1 
ATOM   8244  N  ND2 . ASN C 3  206 ? 31.651  126.447 43.491  1.00 2.20   ? 206 ASN C ND2 1 
ATOM   8245  N  N   . ASN C 3  207 ? 33.113  127.386 41.569  1.00 7.26   ? 207 ASN C N   1 
ATOM   8246  C  CA  . ASN C 3  207 ? 33.985  128.461 41.125  1.00 8.34   ? 207 ASN C CA  1 
ATOM   8247  C  C   . ASN C 3  207 ? 34.676  129.074 42.331  1.00 10.45  ? 207 ASN C C   1 
ATOM   8248  O  O   . ASN C 3  207 ? 34.091  129.110 43.420  1.00 10.13  ? 207 ASN C O   1 
ATOM   8249  C  CB  . ASN C 3  207 ? 33.268  129.533 40.358  1.00 7.97   ? 207 ASN C CB  1 
ATOM   8250  C  CG  . ASN C 3  207 ? 31.968  130.098 40.825  1.00 7.76   ? 207 ASN C CG  1 
ATOM   8251  O  OD1 . ASN C 3  207 ? 31.204  130.577 39.988  1.00 2.20   ? 207 ASN C OD1 1 
ATOM   8252  N  ND2 . ASN C 3  207 ? 31.574  130.130 42.076  1.00 14.57  ? 207 ASN C ND2 1 
ATOM   8253  N  N   . PRO C 3  208 ? 35.748  129.772 42.048  1.00 9.74   ? 208 PRO C N   1 
ATOM   8254  C  CA  . PRO C 3  208 ? 36.341  130.654 43.037  1.00 10.06  ? 208 PRO C CA  1 
ATOM   8255  C  C   . PRO C 3  208 ? 35.315  131.183 44.006  1.00 14.57  ? 208 PRO C C   1 
ATOM   8256  O  O   . PRO C 3  208 ? 35.394  130.753 45.171  1.00 20.16  ? 208 PRO C O   1 
ATOM   8257  C  CB  . PRO C 3  208 ? 37.110  131.720 42.250  1.00 10.95  ? 208 PRO C CB  1 
ATOM   8258  C  CG  . PRO C 3  208 ? 37.526  130.842 41.058  1.00 13.00  ? 208 PRO C CG  1 
ATOM   8259  C  CD  . PRO C 3  208 ? 36.477  129.795 40.791  1.00 7.31   ? 208 PRO C CD  1 
ATOM   8260  N  N   . THR C 3  209 ? 34.402  132.063 43.629  1.00 15.54  ? 209 THR C N   1 
ATOM   8261  C  CA  . THR C 3  209 ? 33.418  132.649 44.544  1.00 4.06   ? 209 THR C CA  1 
ATOM   8262  C  C   . THR C 3  209 ? 32.759  131.616 45.408  1.00 4.20   ? 209 THR C C   1 
ATOM   8263  O  O   . THR C 3  209 ? 32.582  131.775 46.625  1.00 6.33   ? 209 THR C O   1 
ATOM   8264  C  CB  . THR C 3  209 ? 32.381  133.371 43.643  1.00 17.11  ? 209 THR C CB  1 
ATOM   8265  O  OG1 . THR C 3  209 ? 32.193  132.524 42.490  1.00 4.23   ? 209 THR C OG1 1 
ATOM   8266  C  CG2 . THR C 3  209 ? 32.999  134.694 43.159  1.00 13.86  ? 209 THR C CG2 1 
ATOM   8267  N  N   . GLY C 3  210 ? 32.296  130.530 44.837  1.00 6.91   ? 210 GLY C N   1 
ATOM   8268  C  CA  . GLY C 3  210 ? 31.685  129.518 45.709  1.00 12.63  ? 210 GLY C CA  1 
ATOM   8269  C  C   . GLY C 3  210 ? 30.163  129.662 45.683  1.00 17.00  ? 210 GLY C C   1 
ATOM   8270  O  O   . GLY C 3  210 ? 29.464  129.054 46.489  1.00 19.68  ? 210 GLY C O   1 
ATOM   8271  N  N   . ILE C 3  211 ? 29.716  130.458 44.724  1.00 15.07  ? 211 ILE C N   1 
ATOM   8272  C  CA  . ILE C 3  211 ? 28.312  130.693 44.459  1.00 13.35  ? 211 ILE C CA  1 
ATOM   8273  C  C   . ILE C 3  211 ? 27.878  130.124 43.111  1.00 14.80  ? 211 ILE C C   1 
ATOM   8274  O  O   . ILE C 3  211 ? 28.637  130.228 42.143  1.00 15.07  ? 211 ILE C O   1 
ATOM   8275  C  CB  . ILE C 3  211 ? 28.093  132.214 44.382  1.00 14.97  ? 211 ILE C CB  1 
ATOM   8276  C  CG1 . ILE C 3  211 ? 28.475  132.825 45.729  1.00 12.75  ? 211 ILE C CG1 1 
ATOM   8277  C  CG2 . ILE C 3  211 ? 26.685  132.604 44.004  1.00 15.04  ? 211 ILE C CG2 1 
ATOM   8278  C  CD1 . ILE C 3  211 ? 28.405  134.337 45.712  1.00 15.85  ? 211 ILE C CD1 1 
ATOM   8279  N  N   . SER C 3  212 ? 26.628  129.674 43.036  1.00 12.28  ? 212 SER C N   1 
ATOM   8280  C  CA  . SER C 3  212 ? 26.001  129.262 41.791  1.00 9.28   ? 212 SER C CA  1 
ATOM   8281  C  C   . SER C 3  212 ? 26.381  130.216 40.670  1.00 9.43   ? 212 SER C C   1 
ATOM   8282  O  O   . SER C 3  212 ? 26.648  131.393 40.897  1.00 9.39   ? 212 SER C O   1 
ATOM   8283  C  CB  . SER C 3  212 ? 24.480  129.208 41.910  1.00 10.13  ? 212 SER C CB  1 
ATOM   8284  O  OG  . SER C 3  212 ? 24.018  127.945 42.358  1.00 27.20  ? 212 SER C OG  1 
ATOM   8285  N  N   . SER C 3  213 ? 26.568  129.708 39.468  1.00 9.39   ? 213 SER C N   1 
ATOM   8286  C  CA  . SER C 3  213 ? 26.922  130.603 38.367  1.00 7.56   ? 213 SER C CA  1 
ATOM   8287  C  C   . SER C 3  213 ? 25.962  130.297 37.237  1.00 7.98   ? 213 SER C C   1 
ATOM   8288  O  O   . SER C 3  213 ? 26.070  130.945 36.200  1.00 13.41  ? 213 SER C O   1 
ATOM   8289  C  CB  . SER C 3  213 ? 28.361  130.291 38.017  1.00 2.20   ? 213 SER C CB  1 
ATOM   8290  O  OG  . SER C 3  213 ? 28.545  128.902 37.998  1.00 3.68   ? 213 SER C OG  1 
ATOM   8291  N  N   . ASP C 3  214 ? 24.808  129.674 37.547  1.00 8.58   ? 214 ASP C N   1 
ATOM   8292  C  CA  . ASP C 3  214 ? 23.811  129.508 36.502  1.00 6.70   ? 214 ASP C CA  1 
ATOM   8293  C  C   . ASP C 3  214 ? 23.371  130.842 35.919  1.00 8.52   ? 214 ASP C C   1 
ATOM   8294  O  O   . ASP C 3  214 ? 22.955  130.861 34.756  1.00 21.06  ? 214 ASP C O   1 
ATOM   8295  C  CB  . ASP C 3  214 ? 22.589  128.718 36.884  1.00 3.30   ? 214 ASP C CB  1 
ATOM   8296  C  CG  . ASP C 3  214 ? 22.866  127.318 37.375  1.00 6.85   ? 214 ASP C CG  1 
ATOM   8297  O  OD1 . ASP C 3  214 ? 23.909  126.713 37.074  1.00 16.44  ? 214 ASP C OD1 1 
ATOM   8298  O  OD2 . ASP C 3  214 ? 21.967  126.821 38.087  1.00 3.32   ? 214 ASP C OD2 1 
ATOM   8299  N  N   . VAL C 3  215 ? 23.379  131.910 36.709  1.00 7.34   ? 215 VAL C N   1 
ATOM   8300  C  CA  . VAL C 3  215 ? 23.062  133.244 36.232  1.00 7.29   ? 215 VAL C CA  1 
ATOM   8301  C  C   . VAL C 3  215 ? 24.117  133.748 35.251  1.00 4.56   ? 215 VAL C C   1 
ATOM   8302  O  O   . VAL C 3  215 ? 23.897  134.677 34.488  1.00 9.45   ? 215 VAL C O   1 
ATOM   8303  C  CB  . VAL C 3  215 ? 22.876  134.381 37.301  1.00 2.20   ? 215 VAL C CB  1 
ATOM   8304  C  CG1 . VAL C 3  215 ? 21.681  133.911 38.153  1.00 5.54   ? 215 VAL C CG1 1 
ATOM   8305  C  CG2 . VAL C 3  215 ? 24.107  134.553 38.133  1.00 3.24   ? 215 VAL C CG2 1 
ATOM   8306  N  N   . ASP C 3  216 ? 25.280  133.183 35.313  1.00 2.20   ? 216 ASP C N   1 
ATOM   8307  C  CA  . ASP C 3  216 ? 26.446  133.419 34.501  1.00 2.20   ? 216 ASP C CA  1 
ATOM   8308  C  C   . ASP C 3  216 ? 27.079  132.242 33.797  1.00 4.71   ? 216 ASP C C   1 
ATOM   8309  O  O   . ASP C 3  216 ? 28.237  131.925 34.065  1.00 3.30   ? 216 ASP C O   1 
ATOM   8310  C  CB  . ASP C 3  216 ? 27.434  134.402 35.071  1.00 5.18   ? 216 ASP C CB  1 
ATOM   8311  C  CG  . ASP C 3  216 ? 28.242  135.180 34.046  1.00 2.63   ? 216 ASP C CG  1 
ATOM   8312  O  OD1 . ASP C 3  216 ? 28.610  134.623 33.005  1.00 3.40   ? 216 ASP C OD1 1 
ATOM   8313  O  OD2 . ASP C 3  216 ? 28.532  136.363 34.327  1.00 11.44  ? 216 ASP C OD2 1 
ATOM   8314  N  N   . LYS C 3  217 ? 26.410  131.554 32.864  1.00 6.21   ? 217 LYS C N   1 
ATOM   8315  C  CA  . LYS C 3  217 ? 27.037  130.415 32.222  1.00 6.94   ? 217 LYS C CA  1 
ATOM   8316  C  C   . LYS C 3  217 ? 27.583  130.770 30.854  1.00 5.75   ? 217 LYS C C   1 
ATOM   8317  O  O   . LYS C 3  217 ? 27.222  131.836 30.376  1.00 7.42   ? 217 LYS C O   1 
ATOM   8318  C  CB  . LYS C 3  217 ? 26.007  129.295 32.079  1.00 8.75   ? 217 LYS C CB  1 
ATOM   8319  C  CG  . LYS C 3  217 ? 25.706  128.721 33.440  1.00 9.65   ? 217 LYS C CG  1 
ATOM   8320  C  CD  . LYS C 3  217 ? 26.818  127.700 33.877  1.00 2.20   ? 217 LYS C CD  1 
ATOM   8321  C  CE  . LYS C 3  217 ? 26.119  127.036 35.089  1.00 5.86   ? 217 LYS C CE  1 
ATOM   8322  N  NZ  . LYS C 3  217 ? 27.144  126.684 36.102  1.00 16.93  ? 217 LYS C NZ  1 
ATOM   8323  N  N   . ILE C 3  218 ? 28.424  129.916 30.299  1.00 2.64   ? 218 ILE C N   1 
ATOM   8324  C  CA  . ILE C 3  218 ? 29.088  130.120 29.025  1.00 4.47   ? 218 ILE C CA  1 
ATOM   8325  C  C   . ILE C 3  218 ? 29.340  128.789 28.298  1.00 6.21   ? 218 ILE C C   1 
ATOM   8326  O  O   . ILE C 3  218 ? 29.708  127.756 28.879  1.00 2.32   ? 218 ILE C O   1 
ATOM   8327  C  CB  . ILE C 3  218 ? 30.463  130.740 29.260  1.00 5.78   ? 218 ILE C CB  1 
ATOM   8328  C  CG1 . ILE C 3  218 ? 30.387  132.232 29.497  1.00 3.75   ? 218 ILE C CG1 1 
ATOM   8329  C  CG2 . ILE C 3  218 ? 31.503  130.324 28.276  1.00 10.10  ? 218 ILE C CG2 1 
ATOM   8330  C  CD1 . ILE C 3  218 ? 31.426  132.596 30.555  1.00 21.04  ? 218 ILE C CD1 1 
ATOM   8331  N  N   . PRO C 3  219 ? 29.102  128.844 26.995  1.00 2.20   ? 219 PRO C N   1 
ATOM   8332  C  CA  . PRO C 3  219 ? 29.169  127.668 26.150  1.00 2.20   ? 219 PRO C CA  1 
ATOM   8333  C  C   . PRO C 3  219 ? 30.609  127.205 26.270  1.00 8.42   ? 219 PRO C C   1 
ATOM   8334  O  O   . PRO C 3  219 ? 31.515  128.039 26.366  1.00 12.46  ? 219 PRO C O   1 
ATOM   8335  C  CB  . PRO C 3  219 ? 28.787  128.160 24.742  1.00 2.20   ? 219 PRO C CB  1 
ATOM   8336  C  CG  . PRO C 3  219 ? 29.306  129.563 24.858  1.00 4.46   ? 219 PRO C CG  1 
ATOM   8337  C  CD  . PRO C 3  219 ? 28.876  130.061 26.222  1.00 5.66   ? 219 PRO C CD  1 
ATOM   8338  N  N   . PHE C 3  220 ? 30.799  125.900 26.452  1.00 6.44   ? 220 PHE C N   1 
ATOM   8339  C  CA  . PHE C 3  220 ? 32.103  125.311 26.594  1.00 7.83   ? 220 PHE C CA  1 
ATOM   8340  C  C   . PHE C 3  220 ? 32.928  125.489 25.325  1.00 10.70  ? 220 PHE C C   1 
ATOM   8341  O  O   . PHE C 3  220 ? 34.107  125.821 25.441  1.00 9.86   ? 220 PHE C O   1 
ATOM   8342  C  CB  . PHE C 3  220 ? 32.001  123.822 26.961  1.00 2.53   ? 220 PHE C CB  1 
ATOM   8343  C  CG  . PHE C 3  220 ? 33.307  123.279 27.496  1.00 11.74  ? 220 PHE C CG  1 
ATOM   8344  C  CD1 . PHE C 3  220 ? 33.719  123.515 28.789  1.00 6.95   ? 220 PHE C CD1 1 
ATOM   8345  C  CD2 . PHE C 3  220 ? 34.125  122.530 26.664  1.00 9.91   ? 220 PHE C CD2 1 
ATOM   8346  C  CE1 . PHE C 3  220 ? 34.916  123.018 29.252  1.00 10.11  ? 220 PHE C CE1 1 
ATOM   8347  C  CE2 . PHE C 3  220 ? 35.318  122.029 27.126  1.00 15.47  ? 220 PHE C CE2 1 
ATOM   8348  C  CZ  . PHE C 3  220 ? 35.722  122.273 28.424  1.00 13.86  ? 220 PHE C CZ  1 
ATOM   8349  N  N   . HIS C 3  221 ? 32.330  125.337 24.139  1.00 12.07  ? 221 HIS C N   1 
ATOM   8350  C  CA  . HIS C 3  221 ? 33.139  125.246 22.955  1.00 15.40  ? 221 HIS C CA  1 
ATOM   8351  C  C   . HIS C 3  221 ? 34.021  126.449 22.657  1.00 19.66  ? 221 HIS C C   1 
ATOM   8352  O  O   . HIS C 3  221 ? 35.260  126.406 22.575  1.00 28.47  ? 221 HIS C O   1 
ATOM   8353  C  CB  . HIS C 3  221 ? 32.371  124.858 21.688  1.00 9.83   ? 221 HIS C CB  1 
ATOM   8354  C  CG  . HIS C 3  221 ? 33.345  124.834 20.539  1.00 4.63   ? 221 HIS C CG  1 
ATOM   8355  N  ND1 . HIS C 3  221 ? 34.033  123.701 20.184  1.00 18.90  ? 221 HIS C ND1 1 
ATOM   8356  C  CD2 . HIS C 3  221 ? 33.791  125.788 19.716  1.00 2.20   ? 221 HIS C CD2 1 
ATOM   8357  C  CE1 . HIS C 3  221 ? 34.829  123.958 19.155  1.00 17.03  ? 221 HIS C CE1 1 
ATOM   8358  N  NE2 . HIS C 3  221 ? 34.680  125.231 18.845  1.00 12.42  ? 221 HIS C NE2 1 
ATOM   8359  N  N   . PRO C 3  222 ? 33.366  127.556 22.368  1.00 14.71  ? 222 PRO C N   1 
ATOM   8360  C  CA  . PRO C 3  222 ? 33.995  128.835 22.073  1.00 7.92   ? 222 PRO C CA  1 
ATOM   8361  C  C   . PRO C 3  222 ? 35.105  128.992 23.100  1.00 8.94   ? 222 PRO C C   1 
ATOM   8362  O  O   . PRO C 3  222 ? 36.238  128.618 22.796  1.00 10.57  ? 222 PRO C O   1 
ATOM   8363  C  CB  . PRO C 3  222 ? 32.920  129.907 22.211  1.00 11.67  ? 222 PRO C CB  1 
ATOM   8364  C  CG  . PRO C 3  222 ? 31.671  129.108 22.546  1.00 14.62  ? 222 PRO C CG  1 
ATOM   8365  C  CD  . PRO C 3  222 ? 31.962  127.626 22.597  1.00 2.20   ? 222 PRO C CD  1 
ATOM   8366  N  N   . TYR C 3  223 ? 34.818  129.304 24.351  1.00 8.29   ? 223 TYR C N   1 
ATOM   8367  C  CA  . TYR C 3  223 ? 35.872  129.507 25.339  1.00 11.10  ? 223 TYR C CA  1 
ATOM   8368  C  C   . TYR C 3  223 ? 36.767  128.358 25.680  1.00 9.22   ? 223 TYR C C   1 
ATOM   8369  O  O   . TYR C 3  223 ? 37.791  128.074 25.040  1.00 9.42   ? 223 TYR C O   1 
ATOM   8370  C  CB  . TYR C 3  223 ? 35.319  130.312 26.528  1.00 8.26   ? 223 TYR C CB  1 
ATOM   8371  C  CG  . TYR C 3  223 ? 34.329  131.330 25.963  1.00 3.13   ? 223 TYR C CG  1 
ATOM   8372  C  CD1 . TYR C 3  223 ? 34.785  132.552 25.490  1.00 9.03   ? 223 TYR C CD1 1 
ATOM   8373  C  CD2 . TYR C 3  223 ? 32.985  131.044 25.813  1.00 7.00   ? 223 TYR C CD2 1 
ATOM   8374  C  CE1 . TYR C 3  223 ? 33.938  133.493 24.943  1.00 8.41   ? 223 TYR C CE1 1 
ATOM   8375  C  CE2 . TYR C 3  223 ? 32.170  131.990 25.287  1.00 3.04   ? 223 TYR C CE2 1 
ATOM   8376  C  CZ  . TYR C 3  223 ? 32.596  133.193 24.823  1.00 5.23   ? 223 TYR C CZ  1 
ATOM   8377  O  OH  . TYR C 3  223 ? 31.789  134.136 24.260  1.00 14.04  ? 223 TYR C OH  1 
ATOM   8378  N  N   . TYR C 3  224 ? 36.469  127.640 26.741  1.00 10.54  ? 224 TYR C N   1 
ATOM   8379  C  CA  . TYR C 3  224 ? 37.159  126.491 27.273  1.00 4.56   ? 224 TYR C CA  1 
ATOM   8380  C  C   . TYR C 3  224 ? 37.813  125.535 26.321  1.00 6.80   ? 224 TYR C C   1 
ATOM   8381  O  O   . TYR C 3  224 ? 38.765  124.886 26.801  1.00 3.94   ? 224 TYR C O   1 
ATOM   8382  C  CB  . TYR C 3  224 ? 36.213  125.791 28.249  1.00 3.03   ? 224 TYR C CB  1 
ATOM   8383  C  CG  . TYR C 3  224 ? 35.716  126.814 29.244  1.00 8.23   ? 224 TYR C CG  1 
ATOM   8384  C  CD1 . TYR C 3  224 ? 36.556  127.254 30.234  1.00 7.56   ? 224 TYR C CD1 1 
ATOM   8385  C  CD2 . TYR C 3  224 ? 34.445  127.361 29.215  1.00 14.81  ? 224 TYR C CD2 1 
ATOM   8386  C  CE1 . TYR C 3  224 ? 36.132  128.178 31.148  1.00 2.20   ? 224 TYR C CE1 1 
ATOM   8387  C  CE2 . TYR C 3  224 ? 34.016  128.303 30.147  1.00 12.48  ? 224 TYR C CE2 1 
ATOM   8388  C  CZ  . TYR C 3  224 ? 34.877  128.714 31.131  1.00 2.54   ? 224 TYR C CZ  1 
ATOM   8389  O  OH  . TYR C 3  224 ? 34.632  129.615 32.132  1.00 12.31  ? 224 TYR C OH  1 
ATOM   8390  N  N   . THR C 3  225 ? 37.454  125.383 25.044  1.00 7.55   ? 225 THR C N   1 
ATOM   8391  C  CA  . THR C 3  225 ? 38.245  124.493 24.162  1.00 2.20   ? 225 THR C CA  1 
ATOM   8392  C  C   . THR C 3  225 ? 39.607  125.202 23.943  1.00 5.91   ? 225 THR C C   1 
ATOM   8393  O  O   . THR C 3  225 ? 40.635  124.566 23.842  1.00 3.63   ? 225 THR C O   1 
ATOM   8394  C  CB  . THR C 3  225 ? 37.685  124.373 22.744  1.00 5.32   ? 225 THR C CB  1 
ATOM   8395  O  OG1 . THR C 3  225 ? 37.708  125.680 22.155  1.00 13.52  ? 225 THR C OG1 1 
ATOM   8396  C  CG2 . THR C 3  225 ? 36.348  123.699 22.675  1.00 2.42   ? 225 THR C CG2 1 
ATOM   8397  N  N   . ILE C 3  226 ? 39.598  126.534 23.847  1.00 6.19   ? 226 ILE C N   1 
ATOM   8398  C  CA  . ILE C 3  226 ? 40.860  127.206 23.602  1.00 7.95   ? 226 ILE C CA  1 
ATOM   8399  C  C   . ILE C 3  226 ? 41.676  127.087 24.864  1.00 6.34   ? 226 ILE C C   1 
ATOM   8400  O  O   . ILE C 3  226 ? 42.827  126.653 24.817  1.00 8.55   ? 226 ILE C O   1 
ATOM   8401  C  CB  . ILE C 3  226 ? 40.816  128.587 22.982  1.00 9.80   ? 226 ILE C CB  1 
ATOM   8402  C  CG1 . ILE C 3  226 ? 39.523  128.859 22.214  1.00 18.55  ? 226 ILE C CG1 1 
ATOM   8403  C  CG2 . ILE C 3  226 ? 41.979  128.791 21.978  1.00 4.20   ? 226 ILE C CG2 1 
ATOM   8404  C  CD1 . ILE C 3  226 ? 39.341  128.130 20.893  1.00 26.08  ? 226 ILE C CD1 1 
ATOM   8405  N  N   . LYS C 3  227 ? 41.032  127.390 25.984  1.00 7.78   ? 227 LYS C N   1 
ATOM   8406  C  CA  . LYS C 3  227 ? 41.744  127.296 27.262  1.00 4.55   ? 227 LYS C CA  1 
ATOM   8407  C  C   . LYS C 3  227 ? 42.367  125.941 27.486  1.00 5.50   ? 227 LYS C C   1 
ATOM   8408  O  O   . LYS C 3  227 ? 43.553  125.782 27.783  1.00 3.81   ? 227 LYS C O   1 
ATOM   8409  C  CB  . LYS C 3  227 ? 40.861  127.702 28.429  1.00 2.98   ? 227 LYS C CB  1 
ATOM   8410  C  CG  . LYS C 3  227 ? 41.517  128.877 29.162  1.00 2.20   ? 227 LYS C CG  1 
ATOM   8411  C  CD  . LYS C 3  227 ? 40.889  128.910 30.572  1.00 14.81  ? 227 LYS C CD  1 
ATOM   8412  C  CE  . LYS C 3  227 ? 41.365  130.120 31.356  1.00 25.76  ? 227 LYS C CE  1 
ATOM   8413  N  NZ  . LYS C 3  227 ? 40.460  131.305 31.272  1.00 27.04  ? 227 LYS C NZ  1 
ATOM   8414  N  N   . ASP C 3  228 ? 41.566  124.906 27.286  1.00 4.64   ? 228 ASP C N   1 
ATOM   8415  C  CA  . ASP C 3  228 ? 42.128  123.563 27.425  1.00 10.22  ? 228 ASP C CA  1 
ATOM   8416  C  C   . ASP C 3  228 ? 43.317  123.393 26.492  1.00 8.98   ? 228 ASP C C   1 
ATOM   8417  O  O   . ASP C 3  228 ? 44.416  122.973 26.835  1.00 11.91  ? 228 ASP C O   1 
ATOM   8418  C  CB  . ASP C 3  228 ? 41.026  122.542 27.167  1.00 20.70  ? 228 ASP C CB  1 
ATOM   8419  C  CG  . ASP C 3  228 ? 40.129  122.330 28.366  1.00 25.27  ? 228 ASP C CG  1 
ATOM   8420  O  OD1 . ASP C 3  228 ? 40.173  123.151 29.308  1.00 27.36  ? 228 ASP C OD1 1 
ATOM   8421  O  OD2 . ASP C 3  228 ? 39.347  121.348 28.383  1.00 33.34  ? 228 ASP C OD2 1 
ATOM   8422  N  N   . ILE C 3  229 ? 43.149  123.745 25.242  1.00 2.20   ? 229 ILE C N   1 
ATOM   8423  C  CA  . ILE C 3  229 ? 44.285  123.545 24.305  1.00 7.23   ? 229 ILE C CA  1 
ATOM   8424  C  C   . ILE C 3  229 ? 45.537  124.261 24.822  1.00 2.20   ? 229 ILE C C   1 
ATOM   8425  O  O   . ILE C 3  229 ? 46.581  123.669 25.102  1.00 6.72   ? 229 ILE C O   1 
ATOM   8426  C  CB  . ILE C 3  229 ? 43.967  124.081 22.910  1.00 6.89   ? 229 ILE C CB  1 
ATOM   8427  C  CG1 . ILE C 3  229 ? 43.277  123.039 22.041  1.00 2.79   ? 229 ILE C CG1 1 
ATOM   8428  C  CG2 . ILE C 3  229 ? 45.222  124.543 22.179  1.00 6.80   ? 229 ILE C CG2 1 
ATOM   8429  C  CD1 . ILE C 3  229 ? 42.460  123.617 20.905  1.00 15.60  ? 229 ILE C CD1 1 
ATOM   8430  N  N   . LEU C 3  230 ? 45.375  125.509 25.215  1.00 6.07   ? 230 LEU C N   1 
ATOM   8431  C  CA  . LEU C 3  230 ? 46.525  126.249 25.722  1.00 6.86   ? 230 LEU C CA  1 
ATOM   8432  C  C   . LEU C 3  230 ? 47.090  125.554 26.942  1.00 7.70   ? 230 LEU C C   1 
ATOM   8433  O  O   . LEU C 3  230 ? 48.299  125.372 27.107  1.00 10.92  ? 230 LEU C O   1 
ATOM   8434  C  CB  . LEU C 3  230 ? 46.066  127.676 26.045  1.00 4.51   ? 230 LEU C CB  1 
ATOM   8435  C  CG  . LEU C 3  230 ? 47.020  128.445 26.947  1.00 2.75   ? 230 LEU C CG  1 
ATOM   8436  C  CD1 . LEU C 3  230 ? 48.202  128.963 26.173  1.00 2.20   ? 230 LEU C CD1 1 
ATOM   8437  C  CD2 . LEU C 3  230 ? 46.278  129.596 27.652  1.00 2.85   ? 230 LEU C CD2 1 
ATOM   8438  N  N   . GLY C 3  231 ? 46.194  125.102 27.826  1.00 6.08   ? 231 GLY C N   1 
ATOM   8439  C  CA  . GLY C 3  231 ? 46.743  124.463 29.035  1.00 7.66   ? 231 GLY C CA  1 
ATOM   8440  C  C   . GLY C 3  231 ? 47.552  123.238 28.643  1.00 6.77   ? 231 GLY C C   1 
ATOM   8441  O  O   . GLY C 3  231 ? 48.531  122.871 29.241  1.00 5.97   ? 231 GLY C O   1 
ATOM   8442  N  N   . ALA C 3  232 ? 47.141  122.534 27.606  1.00 4.57   ? 232 ALA C N   1 
ATOM   8443  C  CA  . ALA C 3  232 ? 47.787  121.311 27.158  1.00 6.31   ? 232 ALA C CA  1 
ATOM   8444  C  C   . ALA C 3  232 ? 49.169  121.675 26.614  1.00 5.77   ? 232 ALA C C   1 
ATOM   8445  O  O   . ALA C 3  232 ? 50.226  121.062 26.793  1.00 3.18   ? 232 ALA C O   1 
ATOM   8446  C  CB  . ALA C 3  232 ? 46.878  120.584 26.161  1.00 3.40   ? 232 ALA C CB  1 
ATOM   8447  N  N   . LEU C 3  233 ? 49.246  122.816 25.940  1.00 6.98   ? 233 LEU C N   1 
ATOM   8448  C  CA  . LEU C 3  233 ? 50.519  123.319 25.405  1.00 5.51   ? 233 LEU C CA  1 
ATOM   8449  C  C   . LEU C 3  233 ? 51.495  123.515 26.564  1.00 13.84  ? 233 LEU C C   1 
ATOM   8450  O  O   . LEU C 3  233 ? 52.649  123.096 26.521  1.00 17.84  ? 233 LEU C O   1 
ATOM   8451  C  CB  . LEU C 3  233 ? 50.273  124.665 24.749  1.00 10.33  ? 233 LEU C CB  1 
ATOM   8452  C  CG  . LEU C 3  233 ? 51.121  125.189 23.612  1.00 7.22   ? 233 LEU C CG  1 
ATOM   8453  C  CD1 . LEU C 3  233 ? 51.411  124.193 22.519  1.00 3.20   ? 233 LEU C CD1 1 
ATOM   8454  C  CD2 . LEU C 3  233 ? 50.415  126.400 22.976  1.00 21.90  ? 233 LEU C CD2 1 
ATOM   8455  N  N   . LEU C 3  234 ? 51.007  124.164 27.620  1.00 16.52  ? 234 LEU C N   1 
ATOM   8456  C  CA  . LEU C 3  234 ? 51.796  124.403 28.831  1.00 12.84  ? 234 LEU C CA  1 
ATOM   8457  C  C   . LEU C 3  234 ? 52.127  123.065 29.480  1.00 15.40  ? 234 LEU C C   1 
ATOM   8458  O  O   . LEU C 3  234 ? 53.229  122.754 29.921  1.00 15.07  ? 234 LEU C O   1 
ATOM   8459  C  CB  . LEU C 3  234 ? 50.940  125.253 29.797  1.00 9.99   ? 234 LEU C CB  1 
ATOM   8460  C  CG  . LEU C 3  234 ? 50.986  126.750 29.470  1.00 8.98   ? 234 LEU C CG  1 
ATOM   8461  C  CD1 . LEU C 3  234 ? 50.300  127.579 30.523  1.00 2.65   ? 234 LEU C CD1 1 
ATOM   8462  C  CD2 . LEU C 3  234 ? 52.406  127.158 29.178  1.00 4.73   ? 234 LEU C CD2 1 
ATOM   8463  N  N   . LEU C 3  235 ? 51.118  122.178 29.522  1.00 15.13  ? 235 LEU C N   1 
ATOM   8464  C  CA  . LEU C 3  235 ? 51.359  120.864 30.074  1.00 9.45   ? 235 LEU C CA  1 
ATOM   8465  C  C   . LEU C 3  235 ? 52.476  120.177 29.283  1.00 8.32   ? 235 LEU C C   1 
ATOM   8466  O  O   . LEU C 3  235 ? 53.404  119.848 30.002  1.00 4.52   ? 235 LEU C O   1 
ATOM   8467  C  CB  . LEU C 3  235 ? 50.134  119.939 30.053  1.00 7.90   ? 235 LEU C CB  1 
ATOM   8468  C  CG  . LEU C 3  235 ? 50.509  118.538 30.495  1.00 2.20   ? 235 LEU C CG  1 
ATOM   8469  C  CD1 . LEU C 3  235 ? 50.861  118.611 31.983  1.00 5.84   ? 235 LEU C CD1 1 
ATOM   8470  C  CD2 . LEU C 3  235 ? 49.548  117.411 30.279  1.00 2.20   ? 235 LEU C CD2 1 
ATOM   8471  N  N   . ILE C 3  236 ? 52.337  120.026 27.978  1.00 7.66   ? 236 ILE C N   1 
ATOM   8472  C  CA  . ILE C 3  236 ? 53.333  119.393 27.146  1.00 8.64   ? 236 ILE C CA  1 
ATOM   8473  C  C   . ILE C 3  236 ? 54.696  120.074 27.271  1.00 7.37   ? 236 ILE C C   1 
ATOM   8474  O  O   . ILE C 3  236 ? 55.743  119.437 27.304  1.00 9.85   ? 236 ILE C O   1 
ATOM   8475  C  CB  . ILE C 3  236 ? 53.022  119.311 25.650  1.00 15.27  ? 236 ILE C CB  1 
ATOM   8476  C  CG1 . ILE C 3  236 ? 51.765  118.508 25.347  1.00 22.61  ? 236 ILE C CG1 1 
ATOM   8477  C  CG2 . ILE C 3  236 ? 54.237  118.710 24.941  1.00 10.13  ? 236 ILE C CG2 1 
ATOM   8478  C  CD1 . ILE C 3  236 ? 51.991  117.246 24.530  1.00 16.34  ? 236 ILE C CD1 1 
ATOM   8479  N  N   . LEU C 3  237 ? 54.700  121.386 27.402  1.00 2.95   ? 237 LEU C N   1 
ATOM   8480  C  CA  . LEU C 3  237 ? 55.958  122.098 27.584  1.00 2.22   ? 237 LEU C CA  1 
ATOM   8481  C  C   . LEU C 3  237 ? 56.666  121.633 28.840  1.00 5.39   ? 237 LEU C C   1 
ATOM   8482  O  O   . LEU C 3  237 ? 57.866  121.346 28.891  1.00 3.67   ? 237 LEU C O   1 
ATOM   8483  C  CB  . LEU C 3  237 ? 55.651  123.610 27.634  1.00 3.09   ? 237 LEU C CB  1 
ATOM   8484  C  CG  . LEU C 3  237 ? 56.782  124.497 28.161  1.00 5.06   ? 237 LEU C CG  1 
ATOM   8485  C  CD1 . LEU C 3  237 ? 57.964  124.475 27.201  1.00 5.15   ? 237 LEU C CD1 1 
ATOM   8486  C  CD2 . LEU C 3  237 ? 56.338  125.928 28.424  1.00 5.88   ? 237 LEU C CD2 1 
ATOM   8487  N  N   . ALA C 3  238 ? 55.961  121.506 29.967  1.00 5.42   ? 238 ALA C N   1 
ATOM   8488  C  CA  . ALA C 3  238 ? 56.616  121.043 31.183  1.00 5.38   ? 238 ALA C CA  1 
ATOM   8489  C  C   . ALA C 3  238 ? 57.098  119.634 30.995  1.00 4.30   ? 238 ALA C C   1 
ATOM   8490  O  O   . ALA C 3  238 ? 58.237  119.308 31.288  1.00 2.65   ? 238 ALA C O   1 
ATOM   8491  C  CB  . ALA C 3  238 ? 55.700  121.198 32.377  1.00 2.49   ? 238 ALA C CB  1 
ATOM   8492  N  N   . LEU C 3  239 ? 56.334  118.745 30.362  1.00 7.83   ? 239 LEU C N   1 
ATOM   8493  C  CA  . LEU C 3  239 ? 56.738  117.358 30.187  1.00 7.16   ? 239 LEU C CA  1 
ATOM   8494  C  C   . LEU C 3  239 ? 57.975  117.202 29.327  1.00 7.61   ? 239 LEU C C   1 
ATOM   8495  O  O   . LEU C 3  239 ? 58.807  116.375 29.668  1.00 4.87   ? 239 LEU C O   1 
ATOM   8496  C  CB  . LEU C 3  239 ? 55.635  116.467 29.638  1.00 7.58   ? 239 LEU C CB  1 
ATOM   8497  C  CG  . LEU C 3  239 ? 56.033  115.136 29.012  1.00 9.64   ? 239 LEU C CG  1 
ATOM   8498  C  CD1 . LEU C 3  239 ? 56.562  114.198 30.094  1.00 4.71   ? 239 LEU C CD1 1 
ATOM   8499  C  CD2 . LEU C 3  239 ? 54.871  114.480 28.275  1.00 4.65   ? 239 LEU C CD2 1 
ATOM   8500  N  N   . MET C 3  240 ? 58.093  117.929 28.237  1.00 7.75   ? 240 MET C N   1 
ATOM   8501  C  CA  . MET C 3  240 ? 59.227  117.865 27.331  1.00 7.87   ? 240 MET C CA  1 
ATOM   8502  C  C   . MET C 3  240 ? 60.449  118.612 27.856  1.00 7.13   ? 240 MET C C   1 
ATOM   8503  O  O   . MET C 3  240 ? 61.566  118.172 27.604  1.00 8.56   ? 240 MET C O   1 
ATOM   8504  C  CB  . MET C 3  240 ? 58.936  118.379 25.948  1.00 5.71   ? 240 MET C CB  1 
ATOM   8505  C  CG  . MET C 3  240 ? 58.053  117.596 25.045  1.00 8.68   ? 240 MET C CG  1 
ATOM   8506  S  SD  . MET C 3  240 ? 58.115  115.819 25.290  1.00 13.74  ? 240 MET C SD  1 
ATOM   8507  C  CE  . MET C 3  240 ? 59.326  115.347 24.048  1.00 4.46   ? 240 MET C CE  1 
ATOM   8508  N  N   . LEU C 3  241 ? 60.295  119.723 28.535  1.00 6.20   ? 241 LEU C N   1 
ATOM   8509  C  CA  . LEU C 3  241 ? 61.375  120.460 29.195  1.00 6.15   ? 241 LEU C CA  1 
ATOM   8510  C  C   . LEU C 3  241 ? 62.135  119.473 30.094  1.00 6.69   ? 241 LEU C C   1 
ATOM   8511  O  O   . LEU C 3  241 ? 63.335  119.361 30.217  1.00 2.80   ? 241 LEU C O   1 
ATOM   8512  C  CB  . LEU C 3  241 ? 60.711  121.500 30.127  1.00 7.10   ? 241 LEU C CB  1 
ATOM   8513  C  CG  . LEU C 3  241 ? 61.309  122.894 30.165  1.00 5.30   ? 241 LEU C CG  1 
ATOM   8514  C  CD1 . LEU C 3  241 ? 61.834  123.270 28.778  1.00 11.86  ? 241 LEU C CD1 1 
ATOM   8515  C  CD2 . LEU C 3  241 ? 60.331  123.909 30.690  1.00 6.35   ? 241 LEU C CD2 1 
ATOM   8516  N  N   . LEU C 3  242 ? 61.336  118.682 30.780  1.00 6.95   ? 242 LEU C N   1 
ATOM   8517  C  CA  . LEU C 3  242 ? 61.787  117.677 31.737  1.00 6.80   ? 242 LEU C CA  1 
ATOM   8518  C  C   . LEU C 3  242 ? 62.263  116.470 30.968  1.00 7.19   ? 242 LEU C C   1 
ATOM   8519  O  O   . LEU C 3  242 ? 63.116  115.698 31.382  1.00 14.85  ? 242 LEU C O   1 
ATOM   8520  C  CB  . LEU C 3  242 ? 60.571  117.378 32.589  1.00 2.61   ? 242 LEU C CB  1 
ATOM   8521  C  CG  . LEU C 3  242 ? 60.430  116.753 33.932  1.00 4.44   ? 242 LEU C CG  1 
ATOM   8522  C  CD1 . LEU C 3  242 ? 60.745  117.634 35.136  1.00 3.08   ? 242 LEU C CD1 1 
ATOM   8523  C  CD2 . LEU C 3  242 ? 58.965  116.271 34.170  1.00 4.11   ? 242 LEU C CD2 1 
ATOM   8524  N  N   . VAL C 3  243 ? 61.756  116.205 29.766  1.00 5.76   ? 243 VAL C N   1 
ATOM   8525  C  CA  . VAL C 3  243 ? 62.106  114.912 29.174  1.00 8.42   ? 243 VAL C CA  1 
ATOM   8526  C  C   . VAL C 3  243 ? 63.383  115.004 28.355  1.00 10.23  ? 243 VAL C C   1 
ATOM   8527  O  O   . VAL C 3  243 ? 64.168  114.071 28.236  1.00 10.36  ? 243 VAL C O   1 
ATOM   8528  C  CB  . VAL C 3  243 ? 60.987  114.374 28.252  1.00 3.11   ? 243 VAL C CB  1 
ATOM   8529  C  CG1 . VAL C 3  243 ? 61.461  114.489 26.799  1.00 10.58  ? 243 VAL C CG1 1 
ATOM   8530  C  CG2 . VAL C 3  243 ? 60.755  112.869 28.436  1.00 4.12   ? 243 VAL C CG2 1 
ATOM   8531  N  N   . LEU C 3  244 ? 63.450  116.148 27.713  1.00 11.48  ? 244 LEU C N   1 
ATOM   8532  C  CA  . LEU C 3  244 ? 64.438  116.525 26.741  1.00 10.89  ? 244 LEU C CA  1 
ATOM   8533  C  C   . LEU C 3  244 ? 65.640  117.201 27.383  1.00 12.97  ? 244 LEU C C   1 
ATOM   8534  O  O   . LEU C 3  244 ? 66.705  117.257 26.779  1.00 17.83  ? 244 LEU C O   1 
ATOM   8535  C  CB  . LEU C 3  244 ? 63.811  117.582 25.805  1.00 9.50   ? 244 LEU C CB  1 
ATOM   8536  C  CG  . LEU C 3  244 ? 63.454  117.106 24.408  1.00 8.46   ? 244 LEU C CG  1 
ATOM   8537  C  CD1 . LEU C 3  244 ? 63.643  115.608 24.281  1.00 9.93   ? 244 LEU C CD1 1 
ATOM   8538  C  CD2 . LEU C 3  244 ? 62.029  117.546 24.079  1.00 3.70   ? 244 LEU C CD2 1 
ATOM   8539  N  N   . PHE C 3  245 ? 65.440  117.920 28.482  1.00 10.83  ? 245 PHE C N   1 
ATOM   8540  C  CA  . PHE C 3  245 ? 66.599  118.615 29.024  1.00 11.65  ? 245 PHE C CA  1 
ATOM   8541  C  C   . PHE C 3  245 ? 66.936  118.184 30.448  1.00 13.14  ? 245 PHE C C   1 
ATOM   8542  O  O   . PHE C 3  245 ? 67.965  118.622 30.970  1.00 15.12  ? 245 PHE C O   1 
ATOM   8543  C  CB  . PHE C 3  245 ? 66.448  120.102 28.995  1.00 2.20   ? 245 PHE C CB  1 
ATOM   8544  C  CG  . PHE C 3  245 ? 66.466  120.893 27.748  1.00 15.91  ? 245 PHE C CG  1 
ATOM   8545  C  CD1 . PHE C 3  245 ? 67.681  121.104 27.101  1.00 20.12  ? 245 PHE C CD1 1 
ATOM   8546  C  CD2 . PHE C 3  245 ? 65.337  121.471 27.192  1.00 15.10  ? 245 PHE C CD2 1 
ATOM   8547  C  CE1 . PHE C 3  245 ? 67.766  121.842 25.941  1.00 17.84  ? 245 PHE C CE1 1 
ATOM   8548  C  CE2 . PHE C 3  245 ? 65.410  122.218 26.028  1.00 10.07  ? 245 PHE C CE2 1 
ATOM   8549  C  CZ  . PHE C 3  245 ? 66.627  122.404 25.399  1.00 3.99   ? 245 PHE C CZ  1 
ATOM   8550  N  N   . ALA C 3  246 ? 66.131  117.361 31.094  1.00 11.25  ? 246 ALA C N   1 
ATOM   8551  C  CA  . ALA C 3  246 ? 66.373  116.996 32.491  1.00 7.92   ? 246 ALA C CA  1 
ATOM   8552  C  C   . ALA C 3  246 ? 65.843  115.587 32.739  1.00 7.44   ? 246 ALA C C   1 
ATOM   8553  O  O   . ALA C 3  246 ? 65.031  115.357 33.635  1.00 8.45   ? 246 ALA C O   1 
ATOM   8554  C  CB  . ALA C 3  246 ? 65.644  117.960 33.423  1.00 7.49   ? 246 ALA C CB  1 
ATOM   8555  N  N   . PRO C 3  247 ? 66.069  114.725 31.781  1.00 4.32   ? 247 PRO C N   1 
ATOM   8556  C  CA  . PRO C 3  247 ? 65.538  113.385 31.759  1.00 5.34   ? 247 PRO C CA  1 
ATOM   8557  C  C   . PRO C 3  247 ? 65.330  112.804 33.124  1.00 5.90   ? 247 PRO C C   1 
ATOM   8558  O  O   . PRO C 3  247 ? 64.187  112.690 33.579  1.00 16.38  ? 247 PRO C O   1 
ATOM   8559  C  CB  . PRO C 3  247 ? 66.453  112.500 30.920  1.00 4.70   ? 247 PRO C CB  1 
ATOM   8560  C  CG  . PRO C 3  247 ? 67.461  113.481 30.405  1.00 9.91   ? 247 PRO C CG  1 
ATOM   8561  C  CD  . PRO C 3  247 ? 67.113  114.901 30.770  1.00 7.69   ? 247 PRO C CD  1 
ATOM   8562  N  N   . ASP C 3  248 ? 66.352  112.417 33.860  1.00 10.13  ? 248 ASP C N   1 
ATOM   8563  C  CA  . ASP C 3  248 ? 66.110  111.780 35.158  1.00 9.97   ? 248 ASP C CA  1 
ATOM   8564  C  C   . ASP C 3  248 ? 65.980  112.766 36.276  1.00 12.72  ? 248 ASP C C   1 
ATOM   8565  O  O   . ASP C 3  248 ? 65.595  112.488 37.404  1.00 10.96  ? 248 ASP C O   1 
ATOM   8566  C  CB  . ASP C 3  248 ? 67.280  110.811 35.387  1.00 24.89  ? 248 ASP C CB  1 
ATOM   8567  C  CG  . ASP C 3  248 ? 67.590  110.079 34.089  1.00 24.07  ? 248 ASP C CG  1 
ATOM   8568  O  OD1 . ASP C 3  248 ? 66.606  109.616 33.493  1.00 32.62  ? 248 ASP C OD1 1 
ATOM   8569  O  OD2 . ASP C 3  248 ? 68.733  109.964 33.623  1.00 28.22  ? 248 ASP C OD2 1 
ATOM   8570  N  N   . LEU C 3  249 ? 66.243  114.037 36.000  1.00 18.48  ? 249 LEU C N   1 
ATOM   8571  C  CA  . LEU C 3  249 ? 66.256  115.010 37.089  1.00 24.90  ? 249 LEU C CA  1 
ATOM   8572  C  C   . LEU C 3  249 ? 65.281  114.599 38.189  1.00 25.86  ? 249 LEU C C   1 
ATOM   8573  O  O   . LEU C 3  249 ? 65.634  114.307 39.311  1.00 22.48  ? 249 LEU C O   1 
ATOM   8574  C  CB  . LEU C 3  249 ? 65.821  116.384 36.584  1.00 27.77  ? 249 LEU C CB  1 
ATOM   8575  C  CG  . LEU C 3  249 ? 66.098  117.592 37.474  1.00 25.33  ? 249 LEU C CG  1 
ATOM   8576  C  CD1 . LEU C 3  249 ? 65.040  118.657 37.234  1.00 28.84  ? 249 LEU C CD1 1 
ATOM   8577  C  CD2 . LEU C 3  249 ? 66.230  117.260 38.939  1.00 20.48  ? 249 LEU C CD2 1 
ATOM   8578  N  N   . LEU C 3  250 ? 64.022  114.697 37.780  1.00 33.82  ? 250 LEU C N   1 
ATOM   8579  C  CA  . LEU C 3  250 ? 62.894  114.410 38.641  1.00 40.98  ? 250 LEU C CA  1 
ATOM   8580  C  C   . LEU C 3  250 ? 62.894  112.960 39.081  1.00 43.49  ? 250 LEU C C   1 
ATOM   8581  O  O   . LEU C 3  250 ? 62.630  112.592 40.220  1.00 44.95  ? 250 LEU C O   1 
ATOM   8582  C  CB  . LEU C 3  250 ? 61.575  114.690 37.914  1.00 40.24  ? 250 LEU C CB  1 
ATOM   8583  C  CG  . LEU C 3  250 ? 60.383  114.921 38.851  1.00 39.74  ? 250 LEU C CG  1 
ATOM   8584  C  CD1 . LEU C 3  250 ? 60.820  115.698 40.081  1.00 34.67  ? 250 LEU C CD1 1 
ATOM   8585  C  CD2 . LEU C 3  250 ? 59.331  115.667 38.038  1.00 42.92  ? 250 LEU C CD2 1 
ATOM   8586  N  N   . GLY C 3  251 ? 63.229  112.066 38.160  1.00 47.47  ? 251 GLY C N   1 
ATOM   8587  C  CA  . GLY C 3  251 ? 63.340  110.664 38.577  1.00 56.98  ? 251 GLY C CA  1 
ATOM   8588  C  C   . GLY C 3  251 ? 64.463  110.536 39.598  1.00 61.78  ? 251 GLY C C   1 
ATOM   8589  O  O   . GLY C 3  251 ? 65.597  110.194 39.267  1.00 63.59  ? 251 GLY C O   1 
ATOM   8590  N  N   . ASP C 3  252 ? 64.154  110.800 40.861  1.00 68.27  ? 252 ASP C N   1 
ATOM   8591  C  CA  . ASP C 3  252 ? 65.169  110.717 41.906  1.00 73.91  ? 252 ASP C CA  1 
ATOM   8592  C  C   . ASP C 3  252 ? 66.030  109.481 41.745  1.00 72.74  ? 252 ASP C C   1 
ATOM   8593  O  O   . ASP C 3  252 ? 67.254  109.586 41.592  1.00 75.08  ? 252 ASP C O   1 
ATOM   8594  C  CB  . ASP C 3  252 ? 64.531  110.829 43.283  1.00 85.11  ? 252 ASP C CB  1 
ATOM   8595  C  CG  . ASP C 3  252 ? 65.398  111.486 44.333  1.00 92.27  ? 252 ASP C CG  1 
ATOM   8596  O  OD1 . ASP C 3  252 ? 66.645  111.414 44.245  1.00 94.23  ? 252 ASP C OD1 1 
ATOM   8597  O  OD2 . ASP C 3  252 ? 64.818  112.082 45.268  1.00 97.31  ? 252 ASP C OD2 1 
ATOM   8598  N  N   . PRO C 3  253 ? 65.466  108.294 41.745  1.00 71.16  ? 253 PRO C N   1 
ATOM   8599  C  CA  . PRO C 3  253 ? 66.221  107.061 41.681  1.00 66.35  ? 253 PRO C CA  1 
ATOM   8600  C  C   . PRO C 3  253 ? 67.132  106.987 40.474  1.00 61.79  ? 253 PRO C C   1 
ATOM   8601  O  O   . PRO C 3  253 ? 66.723  107.037 39.324  1.00 58.11  ? 253 PRO C O   1 
ATOM   8602  C  CB  . PRO C 3  253 ? 65.235  105.893 41.787  1.00 69.15  ? 253 PRO C CB  1 
ATOM   8603  C  CG  . PRO C 3  253 ? 64.019  106.574 42.382  1.00 71.38  ? 253 PRO C CG  1 
ATOM   8604  C  CD  . PRO C 3  253 ? 64.037  108.032 41.972  1.00 73.72  ? 253 PRO C CD  1 
ATOM   8605  N  N   . ASP C 3  254 ? 68.419  106.906 40.805  1.00 58.40  ? 254 ASP C N   1 
ATOM   8606  C  CA  . ASP C 3  254 ? 69.507  106.751 39.863  1.00 54.30  ? 254 ASP C CA  1 
ATOM   8607  C  C   . ASP C 3  254 ? 69.692  105.271 39.524  1.00 51.12  ? 254 ASP C C   1 
ATOM   8608  O  O   . ASP C 3  254 ? 70.422  104.919 38.606  1.00 52.13  ? 254 ASP C O   1 
ATOM   8609  C  CB  . ASP C 3  254 ? 70.844  107.137 40.536  1.00 52.37  ? 254 ASP C CB  1 
ATOM   8610  C  CG  . ASP C 3  254 ? 70.709  108.547 41.058  1.00 55.83  ? 254 ASP C CG  1 
ATOM   8611  O  OD1 . ASP C 3  254 ? 69.898  109.259 40.438  1.00 61.67  ? 254 ASP C OD1 1 
ATOM   8612  O  OD2 . ASP C 3  254 ? 71.387  108.867 42.039  1.00 63.54  ? 254 ASP C OD2 1 
ATOM   8613  N  N   . ASN C 3  255 ? 69.202  104.433 40.426  1.00 47.13  ? 255 ASN C N   1 
ATOM   8614  C  CA  . ASN C 3  255 ? 69.331  103.000 40.253  1.00 41.74  ? 255 ASN C CA  1 
ATOM   8615  C  C   . ASN C 3  255 ? 68.872  102.455 38.919  1.00 38.36  ? 255 ASN C C   1 
ATOM   8616  O  O   . ASN C 3  255 ? 67.723  102.109 38.641  1.00 33.07  ? 255 ASN C O   1 
ATOM   8617  C  CB  . ASN C 3  255 ? 68.765  102.270 41.461  1.00 46.79  ? 255 ASN C CB  1 
ATOM   8618  C  CG  . ASN C 3  255 ? 69.474  102.824 42.698  1.00 54.62  ? 255 ASN C CG  1 
ATOM   8619  O  OD1 . ASN C 3  255 ? 70.592  103.321 42.568  1.00 54.13  ? 255 ASN C OD1 1 
ATOM   8620  N  ND2 . ASN C 3  255 ? 68.824  102.756 43.843  1.00 63.75  ? 255 ASN C ND2 1 
ATOM   8621  N  N   . TYR C 3  256 ? 69.864  102.421 38.035  1.00 32.87  ? 256 TYR C N   1 
ATOM   8622  C  CA  . TYR C 3  256 ? 69.870  101.801 36.735  1.00 31.17  ? 256 TYR C CA  1 
ATOM   8623  C  C   . TYR C 3  256 ? 70.755  100.543 36.916  1.00 31.66  ? 256 TYR C C   1 
ATOM   8624  O  O   . TYR C 3  256 ? 71.582  100.204 36.088  1.00 31.98  ? 256 TYR C O   1 
ATOM   8625  C  CB  . TYR C 3  256 ? 70.612  102.643 35.709  1.00 27.19  ? 256 TYR C CB  1 
ATOM   8626  C  CG  . TYR C 3  256 ? 69.921  103.815 35.093  1.00 24.34  ? 256 TYR C CG  1 
ATOM   8627  C  CD1 . TYR C 3  256 ? 69.930  105.050 35.721  1.00 25.34  ? 256 TYR C CD1 1 
ATOM   8628  C  CD2 . TYR C 3  256 ? 69.277  103.768 33.868  1.00 24.88  ? 256 TYR C CD2 1 
ATOM   8629  C  CE1 . TYR C 3  256 ? 69.342  106.172 35.172  1.00 22.57  ? 256 TYR C CE1 1 
ATOM   8630  C  CE2 . TYR C 3  256 ? 68.671  104.868 33.301  1.00 18.57  ? 256 TYR C CE2 1 
ATOM   8631  C  CZ  . TYR C 3  256 ? 68.703  106.073 33.958  1.00 19.19  ? 256 TYR C CZ  1 
ATOM   8632  O  OH  . TYR C 3  256 ? 68.064  107.129 33.352  1.00 16.31  ? 256 TYR C OH  1 
ATOM   8633  N  N   . THR C 3  257 ? 70.610  99.931  38.071  1.00 30.35  ? 257 THR C N   1 
ATOM   8634  C  CA  . THR C 3  257 ? 71.439  98.766  38.400  1.00 23.45  ? 257 THR C CA  1 
ATOM   8635  C  C   . THR C 3  257 ? 70.538  97.569  38.567  1.00 20.65  ? 257 THR C C   1 
ATOM   8636  O  O   . THR C 3  257 ? 69.606  97.533  39.382  1.00 24.63  ? 257 THR C O   1 
ATOM   8637  C  CB  . THR C 3  257 ? 72.113  99.098  39.749  1.00 29.66  ? 257 THR C CB  1 
ATOM   8638  O  OG1 . THR C 3  257 ? 73.471  99.470  39.510  1.00 35.07  ? 257 THR C OG1 1 
ATOM   8639  C  CG2 . THR C 3  257 ? 71.970  97.998  40.768  1.00 31.38  ? 257 THR C CG2 1 
ATOM   8640  N  N   . PRO C 3  258 ? 70.682  96.647  37.661  1.00 15.88  ? 258 PRO C N   1 
ATOM   8641  C  CA  . PRO C 3  258 ? 69.819  95.455  37.718  1.00 21.39  ? 258 PRO C CA  1 
ATOM   8642  C  C   . PRO C 3  258 ? 69.717  95.028  39.161  1.00 24.52  ? 258 PRO C C   1 
ATOM   8643  O  O   . PRO C 3  258 ? 70.582  95.389  39.973  1.00 27.29  ? 258 PRO C O   1 
ATOM   8644  C  CB  . PRO C 3  258 ? 70.432  94.465  36.735  1.00 18.40  ? 258 PRO C CB  1 
ATOM   8645  C  CG  . PRO C 3  258 ? 71.182  95.389  35.804  1.00 17.07  ? 258 PRO C CG  1 
ATOM   8646  C  CD  . PRO C 3  258 ? 71.654  96.598  36.606  1.00 12.94  ? 258 PRO C CD  1 
ATOM   8647  N  N   . ALA C 3  259 ? 68.572  94.491  39.570  1.00 29.37  ? 259 ALA C N   1 
ATOM   8648  C  CA  . ALA C 3  259 ? 68.392  94.225  40.992  1.00 37.83  ? 259 ALA C CA  1 
ATOM   8649  C  C   . ALA C 3  259 ? 69.005  92.937  41.486  1.00 39.13  ? 259 ALA C C   1 
ATOM   8650  O  O   . ALA C 3  259 ? 68.619  91.826  41.138  1.00 43.39  ? 259 ALA C O   1 
ATOM   8651  C  CB  . ALA C 3  259 ? 66.931  94.363  41.372  1.00 44.37  ? 259 ALA C CB  1 
ATOM   8652  N  N   . ASN C 3  260 ? 69.991  93.080  42.373  1.00 43.49  ? 260 ASN C N   1 
ATOM   8653  C  CA  . ASN C 3  260 ? 70.610  91.902  42.978  1.00 52.03  ? 260 ASN C CA  1 
ATOM   8654  C  C   . ASN C 3  260 ? 69.902  91.621  44.296  1.00 53.86  ? 260 ASN C C   1 
ATOM   8655  O  O   . ASN C 3  260 ? 70.110  92.334  45.281  1.00 54.99  ? 260 ASN C O   1 
ATOM   8656  C  CB  . ASN C 3  260 ? 72.097  92.097  43.284  1.00 59.59  ? 260 ASN C CB  1 
ATOM   8657  C  CG  . ASN C 3  260 ? 72.865  92.613  42.085  1.00 70.35  ? 260 ASN C CG  1 
ATOM   8658  O  OD1 . ASN C 3  260 ? 72.838  91.993  41.016  1.00 79.12  ? 260 ASN C OD1 1 
ATOM   8659  N  ND2 . ASN C 3  260 ? 73.519  93.757  42.277  1.00 67.01  ? 260 ASN C ND2 1 
ATOM   8660  N  N   . PRO C 3  261 ? 69.179  90.528  44.370  1.00 54.64  ? 261 PRO C N   1 
ATOM   8661  C  CA  . PRO C 3  261 ? 68.352  90.233  45.512  1.00 58.18  ? 261 PRO C CA  1 
ATOM   8662  C  C   . PRO C 3  261 ? 69.014  90.230  46.854  1.00 62.58  ? 261 PRO C C   1 
ATOM   8663  O  O   . PRO C 3  261 ? 68.271  89.966  47.825  1.00 63.33  ? 261 PRO C O   1 
ATOM   8664  C  CB  . PRO C 3  261 ? 67.607  88.917  45.201  1.00 58.74  ? 261 PRO C CB  1 
ATOM   8665  C  CG  . PRO C 3  261 ? 67.540  89.009  43.694  1.00 57.98  ? 261 PRO C CG  1 
ATOM   8666  C  CD  . PRO C 3  261 ? 68.767  89.745  43.300  1.00 55.47  ? 261 PRO C CD  1 
ATOM   8667  N  N   . LEU C 3  262 ? 70.282  90.583  47.045  1.00 67.84  ? 262 LEU C N   1 
ATOM   8668  C  CA  . LEU C 3  262 ? 70.828  90.778  48.379  1.00 71.54  ? 262 LEU C CA  1 
ATOM   8669  C  C   . LEU C 3  262 ? 71.740  91.990  48.435  1.00 72.90  ? 262 LEU C C   1 
ATOM   8670  O  O   . LEU C 3  262 ? 72.962  91.878  48.431  1.00 73.77  ? 262 LEU C O   1 
ATOM   8671  C  CB  . LEU C 3  262 ? 71.459  89.514  48.948  1.00 71.92  ? 262 LEU C CB  1 
ATOM   8672  C  CG  . LEU C 3  262 ? 70.451  88.447  49.391  1.00 69.80  ? 262 LEU C CG  1 
ATOM   8673  C  CD1 . LEU C 3  262 ? 70.992  87.329  50.238  1.00 73.40  ? 262 LEU C CD1 1 
ATOM   8674  C  CD2 . LEU C 3  262 ? 69.317  89.087  50.193  1.00 67.22  ? 262 LEU C CD2 1 
ATOM   8675  N  N   . ASN C 3  263 ? 71.089  93.160  48.437  1.00 74.03  ? 263 ASN C N   1 
ATOM   8676  C  CA  . ASN C 3  263 ? 71.869  94.372  48.517  1.00 76.59  ? 263 ASN C CA  1 
ATOM   8677  C  C   . ASN C 3  263 ? 71.164  95.477  49.280  1.00 76.57  ? 263 ASN C C   1 
ATOM   8678  O  O   . ASN C 3  263 ? 70.062  95.411  49.797  1.00 74.56  ? 263 ASN C O   1 
ATOM   8679  C  CB  . ASN C 3  263 ? 72.329  94.879  47.165  1.00 80.33  ? 263 ASN C CB  1 
ATOM   8680  C  CG  . ASN C 3  263 ? 73.484  95.862  47.232  1.00 79.75  ? 263 ASN C CG  1 
ATOM   8681  O  OD1 . ASN C 3  263 ? 73.990  96.206  48.301  1.00 72.78  ? 263 ASN C OD1 1 
ATOM   8682  N  ND2 . ASN C 3  263 ? 73.898  96.377  46.079  1.00 84.61  ? 263 ASN C ND2 1 
ATOM   8683  N  N   . THR C 3  264 ? 71.919  96.571  49.301  1.00 77.52  ? 264 THR C N   1 
ATOM   8684  C  CA  . THR C 3  264 ? 71.612  97.677  50.131  1.00 77.83  ? 264 THR C CA  1 
ATOM   8685  C  C   . THR C 3  264 ? 71.063  98.932  49.549  1.00 76.97  ? 264 THR C C   1 
ATOM   8686  O  O   . THR C 3  264 ? 71.809  99.927  49.507  1.00 73.41  ? 264 THR C O   1 
ATOM   8687  C  CB  . THR C 3  264 ? 72.907  98.102  50.911  1.00 77.51  ? 264 THR C CB  1 
ATOM   8688  O  OG1 . THR C 3  264 ? 73.586  96.873  51.150  1.00 74.41  ? 264 THR C OG1 1 
ATOM   8689  C  CG2 . THR C 3  264 ? 72.531  98.738  52.231  1.00 79.70  ? 264 THR C CG2 1 
ATOM   8690  N  N   . PRO C 3  265 ? 69.772  99.076  49.501  1.00 77.38  ? 265 PRO C N   1 
ATOM   8691  C  CA  . PRO C 3  265 ? 69.320  100.440 49.168  1.00 79.77  ? 265 PRO C CA  1 
ATOM   8692  C  C   . PRO C 3  265 ? 69.554  101.349 50.357  1.00 81.15  ? 265 PRO C C   1 
ATOM   8693  O  O   . PRO C 3  265 ? 68.946  101.258 51.440  1.00 83.78  ? 265 PRO C O   1 
ATOM   8694  C  CB  . PRO C 3  265 ? 68.025  100.238 48.426  1.00 79.56  ? 265 PRO C CB  1 
ATOM   8695  C  CG  . PRO C 3  265 ? 67.839  98.734  48.362  1.00 78.00  ? 265 PRO C CG  1 
ATOM   8696  C  CD  . PRO C 3  265 ? 68.691  98.106  49.469  1.00 78.40  ? 265 PRO C CD  1 
ATOM   8697  N  N   . PRO C 3  266 ? 70.657  102.114 50.299  1.00 81.16  ? 266 PRO C N   1 
ATOM   8698  C  CA  . PRO C 3  266 ? 71.080  103.026 51.355  1.00 81.65  ? 266 PRO C CA  1 
ATOM   8699  C  C   . PRO C 3  266 ? 69.885  103.709 52.002  1.00 82.78  ? 266 PRO C C   1 
ATOM   8700  O  O   . PRO C 3  266 ? 69.727  103.789 53.221  1.00 84.72  ? 266 PRO C O   1 
ATOM   8701  C  CB  . PRO C 3  266 ? 72.030  104.056 50.701  1.00 79.38  ? 266 PRO C CB  1 
ATOM   8702  C  CG  . PRO C 3  266 ? 72.487  103.334 49.468  1.00 79.20  ? 266 PRO C CG  1 
ATOM   8703  C  CD  . PRO C 3  266 ? 71.419  102.352 49.065  1.00 79.61  ? 266 PRO C CD  1 
ATOM   8704  N  N   . HIS C 3  267 ? 69.071  104.267 51.107  1.00 81.73  ? 267 HIS C N   1 
ATOM   8705  C  CA  . HIS C 3  267 ? 67.881  105.012 51.515  1.00 81.75  ? 267 HIS C CA  1 
ATOM   8706  C  C   . HIS C 3  267 ? 66.805  104.752 50.465  1.00 78.70  ? 267 HIS C C   1 
ATOM   8707  O  O   . HIS C 3  267 ? 66.776  105.397 49.419  1.00 80.12  ? 267 HIS C O   1 
ATOM   8708  C  CB  . HIS C 3  267 ? 68.339  106.471 51.612  1.00 89.20  ? 267 HIS C CB  1 
ATOM   8709  C  CG  . HIS C 3  267 ? 69.596  106.744 52.396  1.00 94.40  ? 267 HIS C CG  1 
ATOM   8710  N  ND1 . HIS C 3  267 ? 69.564  106.871 53.770  1.00 96.35  ? 267 HIS C ND1 1 
ATOM   8711  C  CD2 . HIS C 3  267 ? 70.908  106.891 52.063  1.00 96.22  ? 267 HIS C CD2 1 
ATOM   8712  C  CE1 . HIS C 3  267 ? 70.783  107.096 54.235  1.00 96.20  ? 267 HIS C CE1 1 
ATOM   8713  N  NE2 . HIS C 3  267 ? 71.625  107.108 53.220  1.00 94.81  ? 267 HIS C NE2 1 
ATOM   8714  N  N   . ILE C 3  268 ? 66.133  103.609 50.592  1.00 74.44  ? 268 ILE C N   1 
ATOM   8715  C  CA  . ILE C 3  268 ? 65.070  103.217 49.681  1.00 69.07  ? 268 ILE C CA  1 
ATOM   8716  C  C   . ILE C 3  268 ? 63.769  103.976 49.915  1.00 66.69  ? 268 ILE C C   1 
ATOM   8717  O  O   . ILE C 3  268 ? 63.252  104.067 51.023  1.00 68.18  ? 268 ILE C O   1 
ATOM   8718  C  CB  . ILE C 3  268 ? 64.643  101.751 49.933  1.00 65.31  ? 268 ILE C CB  1 
ATOM   8719  C  CG1 . ILE C 3  268 ? 65.922  100.999 50.211  1.00 64.44  ? 268 ILE C CG1 1 
ATOM   8720  C  CG2 . ILE C 3  268 ? 63.818  101.158 48.824  1.00 67.76  ? 268 ILE C CG2 1 
ATOM   8721  C  CD1 . ILE C 3  268 ? 65.659  99.636  50.788  1.00 62.76  ? 268 ILE C CD1 1 
ATOM   8722  N  N   . LYS C 3  269 ? 63.256  104.457 48.780  1.00 59.95  ? 269 LYS C N   1 
ATOM   8723  C  CA  . LYS C 3  269 ? 62.023  105.214 48.898  1.00 55.54  ? 269 LYS C CA  1 
ATOM   8724  C  C   . LYS C 3  269 ? 61.262  105.312 47.595  1.00 47.72  ? 269 LYS C C   1 
ATOM   8725  O  O   . LYS C 3  269 ? 61.801  105.574 46.532  1.00 45.85  ? 269 LYS C O   1 
ATOM   8726  C  CB  . LYS C 3  269 ? 62.419  106.625 49.401  1.00 58.86  ? 269 LYS C CB  1 
ATOM   8727  C  CG  . LYS C 3  269 ? 63.677  107.158 48.728  1.00 55.63  ? 269 LYS C CG  1 
ATOM   8728  C  CD  . LYS C 3  269 ? 64.063  108.526 49.257  1.00 65.06  ? 269 LYS C CD  1 
ATOM   8729  C  CE  . LYS C 3  269 ? 65.335  109.036 48.603  1.00 68.71  ? 269 LYS C CE  1 
ATOM   8730  N  NZ  . LYS C 3  269 ? 65.524  110.505 48.641  1.00 72.23  ? 269 LYS C NZ  1 
ATOM   8731  N  N   . PRO C 3  270 ? 59.955  105.173 47.701  1.00 42.68  ? 270 PRO C N   1 
ATOM   8732  C  CA  . PRO C 3  270 ? 59.049  105.473 46.618  1.00 39.48  ? 270 PRO C CA  1 
ATOM   8733  C  C   . PRO C 3  270 ? 59.481  106.774 45.936  1.00 36.89  ? 270 PRO C C   1 
ATOM   8734  O  O   . PRO C 3  270 ? 60.199  107.589 46.529  1.00 39.75  ? 270 PRO C O   1 
ATOM   8735  C  CB  . PRO C 3  270 ? 57.664  105.664 47.270  1.00 42.34  ? 270 PRO C CB  1 
ATOM   8736  C  CG  . PRO C 3  270 ? 57.933  105.566 48.743  1.00 43.39  ? 270 PRO C CG  1 
ATOM   8737  C  CD  . PRO C 3  270 ? 59.289  104.966 48.995  1.00 42.48  ? 270 PRO C CD  1 
ATOM   8738  N  N   . GLU C 3  271 ? 58.952  106.993 44.729  1.00 29.20  ? 271 GLU C N   1 
ATOM   8739  C  CA  . GLU C 3  271 ? 59.229  108.275 44.070  1.00 20.90  ? 271 GLU C CA  1 
ATOM   8740  C  C   . GLU C 3  271 ? 58.400  109.362 44.724  1.00 18.14  ? 271 GLU C C   1 
ATOM   8741  O  O   . GLU C 3  271 ? 57.329  109.146 45.285  1.00 18.64  ? 271 GLU C O   1 
ATOM   8742  C  CB  . GLU C 3  271 ? 58.941  108.160 42.581  1.00 19.29  ? 271 GLU C CB  1 
ATOM   8743  C  CG  . GLU C 3  271 ? 58.364  106.804 42.217  1.00 30.81  ? 271 GLU C CG  1 
ATOM   8744  C  CD  . GLU C 3  271 ? 58.575  106.414 40.771  1.00 35.86  ? 271 GLU C CD  1 
ATOM   8745  O  OE1 . GLU C 3  271 ? 59.282  107.131 40.033  1.00 36.09  ? 271 GLU C OE1 1 
ATOM   8746  O  OE2 . GLU C 3  271 ? 57.986  105.372 40.396  1.00 40.05  ? 271 GLU C OE2 1 
ATOM   8747  N  N   . TRP C 3  272 ? 58.900  110.577 44.725  1.00 14.93  ? 272 TRP C N   1 
ATOM   8748  C  CA  . TRP C 3  272 ? 58.167  111.751 45.098  1.00 17.88  ? 272 TRP C CA  1 
ATOM   8749  C  C   . TRP C 3  272 ? 56.683  111.560 45.351  1.00 14.85  ? 272 TRP C C   1 
ATOM   8750  O  O   . TRP C 3  272 ? 56.254  111.935 46.459  1.00 17.20  ? 272 TRP C O   1 
ATOM   8751  C  CB  . TRP C 3  272 ? 58.432  112.834 44.012  1.00 32.54  ? 272 TRP C CB  1 
ATOM   8752  C  CG  . TRP C 3  272 ? 57.664  112.613 42.748  1.00 38.46  ? 272 TRP C CG  1 
ATOM   8753  C  CD1 . TRP C 3  272 ? 58.020  111.801 41.715  1.00 43.10  ? 272 TRP C CD1 1 
ATOM   8754  C  CD2 . TRP C 3  272 ? 56.407  113.197 42.390  1.00 40.47  ? 272 TRP C CD2 1 
ATOM   8755  N  NE1 . TRP C 3  272 ? 57.073  111.837 40.731  1.00 42.57  ? 272 TRP C NE1 1 
ATOM   8756  C  CE2 . TRP C 3  272 ? 56.076  112.686 41.126  1.00 45.56  ? 272 TRP C CE2 1 
ATOM   8757  C  CE3 . TRP C 3  272 ? 55.548  114.094 43.025  1.00 34.52  ? 272 TRP C CE3 1 
ATOM   8758  C  CZ2 . TRP C 3  272 ? 54.901  113.047 40.482  1.00 52.06  ? 272 TRP C CZ2 1 
ATOM   8759  C  CZ3 . TRP C 3  272 ? 54.385  114.454 42.383  1.00 38.15  ? 272 TRP C CZ3 1 
ATOM   8760  C  CH2 . TRP C 3  272 ? 54.087  113.931 41.131  1.00 49.81  ? 272 TRP C CH2 1 
ATOM   8761  N  N   . TYR C 3  273 ? 55.838  111.130 44.415  1.00 8.16   ? 273 TYR C N   1 
ATOM   8762  C  CA  . TYR C 3  273 ? 54.407  111.028 44.603  1.00 7.21   ? 273 TYR C CA  1 
ATOM   8763  C  C   . TYR C 3  273 ? 53.994  110.269 45.851  1.00 14.13  ? 273 TYR C C   1 
ATOM   8764  O  O   . TYR C 3  273 ? 53.035  110.613 46.559  1.00 16.36  ? 273 TYR C O   1 
ATOM   8765  C  CB  . TYR C 3  273 ? 53.690  110.632 43.360  1.00 6.21   ? 273 TYR C CB  1 
ATOM   8766  C  CG  . TYR C 3  273 ? 54.215  109.582 42.446  1.00 4.99   ? 273 TYR C CG  1 
ATOM   8767  C  CD1 . TYR C 3  273 ? 55.309  109.825 41.617  1.00 2.22   ? 273 TYR C CD1 1 
ATOM   8768  C  CD2 . TYR C 3  273 ? 53.625  108.319 42.402  1.00 5.08   ? 273 TYR C CD2 1 
ATOM   8769  C  CE1 . TYR C 3  273 ? 55.724  108.882 40.713  1.00 6.45   ? 273 TYR C CE1 1 
ATOM   8770  C  CE2 . TYR C 3  273 ? 54.072  107.349 41.534  1.00 2.38   ? 273 TYR C CE2 1 
ATOM   8771  C  CZ  . TYR C 3  273 ? 55.115  107.650 40.692  1.00 6.50   ? 273 TYR C CZ  1 
ATOM   8772  O  OH  . TYR C 3  273 ? 55.593  106.713 39.806  1.00 17.48  ? 273 TYR C OH  1 
ATOM   8773  N  N   . PHE C 3  274 ? 54.729  109.239 46.253  1.00 11.63  ? 274 PHE C N   1 
ATOM   8774  C  CA  . PHE C 3  274 ? 54.463  108.511 47.467  1.00 6.55   ? 274 PHE C CA  1 
ATOM   8775  C  C   . PHE C 3  274 ? 55.229  108.922 48.712  1.00 10.37  ? 274 PHE C C   1 
ATOM   8776  O  O   . PHE C 3  274 ? 55.083  108.258 49.762  1.00 7.95   ? 274 PHE C O   1 
ATOM   8777  C  CB  . PHE C 3  274 ? 54.950  107.091 47.159  1.00 5.40   ? 274 PHE C CB  1 
ATOM   8778  C  CG  . PHE C 3  274 ? 54.147  106.493 46.048  1.00 4.64   ? 274 PHE C CG  1 
ATOM   8779  C  CD1 . PHE C 3  274 ? 52.784  106.572 46.068  1.00 2.29   ? 274 PHE C CD1 1 
ATOM   8780  C  CD2 . PHE C 3  274 ? 54.759  105.836 45.019  1.00 2.73   ? 274 PHE C CD2 1 
ATOM   8781  C  CE1 . PHE C 3  274 ? 51.998  105.998 45.106  1.00 4.10   ? 274 PHE C CE1 1 
ATOM   8782  C  CE2 . PHE C 3  274 ? 53.991  105.265 44.017  1.00 5.78   ? 274 PHE C CE2 1 
ATOM   8783  C  CZ  . PHE C 3  274 ? 52.623  105.351 44.058  1.00 5.27   ? 274 PHE C CZ  1 
ATOM   8784  N  N   . LEU C 3  275 ? 56.197  109.842 48.626  1.00 7.01   ? 275 LEU C N   1 
ATOM   8785  C  CA  . LEU C 3  275 ? 56.884  110.174 49.871  1.00 9.63   ? 275 LEU C CA  1 
ATOM   8786  C  C   . LEU C 3  275 ? 55.902  110.565 50.948  1.00 15.69  ? 275 LEU C C   1 
ATOM   8787  O  O   . LEU C 3  275 ? 55.897  109.842 51.950  1.00 14.58  ? 275 LEU C O   1 
ATOM   8788  C  CB  . LEU C 3  275 ? 58.100  111.025 49.709  1.00 7.79   ? 275 LEU C CB  1 
ATOM   8789  C  CG  . LEU C 3  275 ? 59.193  110.662 48.711  1.00 4.37   ? 275 LEU C CG  1 
ATOM   8790  C  CD1 . LEU C 3  275 ? 60.391  111.598 48.766  1.00 2.20   ? 275 LEU C CD1 1 
ATOM   8791  C  CD2 . LEU C 3  275 ? 59.709  109.244 48.918  1.00 3.45   ? 275 LEU C CD2 1 
ATOM   8792  N  N   . PHE C 3  276 ? 54.981  111.535 50.835  1.00 21.60  ? 276 PHE C N   1 
ATOM   8793  C  CA  . PHE C 3  276 ? 54.069  111.805 51.954  1.00 21.46  ? 276 PHE C CA  1 
ATOM   8794  C  C   . PHE C 3  276 ? 53.754  110.507 52.677  1.00 19.61  ? 276 PHE C C   1 
ATOM   8795  O  O   . PHE C 3  276 ? 54.196  110.270 53.796  1.00 20.30  ? 276 PHE C O   1 
ATOM   8796  C  CB  . PHE C 3  276 ? 52.808  112.614 51.677  1.00 18.49  ? 276 PHE C CB  1 
ATOM   8797  C  CG  . PHE C 3  276 ? 51.654  111.897 51.061  1.00 16.30  ? 276 PHE C CG  1 
ATOM   8798  C  CD1 . PHE C 3  276 ? 51.781  111.367 49.781  1.00 25.26  ? 276 PHE C CD1 1 
ATOM   8799  C  CD2 . PHE C 3  276 ? 50.461  111.715 51.715  1.00 13.93  ? 276 PHE C CD2 1 
ATOM   8800  C  CE1 . PHE C 3  276 ? 50.771  110.662 49.156  1.00 20.65  ? 276 PHE C CE1 1 
ATOM   8801  C  CE2 . PHE C 3  276 ? 49.436  111.005 51.093  1.00 24.65  ? 276 PHE C CE2 1 
ATOM   8802  C  CZ  . PHE C 3  276 ? 49.578  110.473 49.827  1.00 21.46  ? 276 PHE C CZ  1 
ATOM   8803  N  N   . ALA C 3  277 ? 53.035  109.614 52.009  1.00 17.90  ? 277 ALA C N   1 
ATOM   8804  C  CA  . ALA C 3  277 ? 52.640  108.395 52.700  1.00 23.21  ? 277 ALA C CA  1 
ATOM   8805  C  C   . ALA C 3  277 ? 53.845  107.814 53.425  1.00 22.88  ? 277 ALA C C   1 
ATOM   8806  O  O   . ALA C 3  277 ? 53.732  107.635 54.636  1.00 27.92  ? 277 ALA C O   1 
ATOM   8807  C  CB  . ALA C 3  277 ? 51.999  107.411 51.748  1.00 31.22  ? 277 ALA C CB  1 
ATOM   8808  N  N   . TYR C 3  278 ? 54.948  107.549 52.743  1.00 21.07  ? 278 TYR C N   1 
ATOM   8809  C  CA  . TYR C 3  278 ? 56.138  106.993 53.391  1.00 19.15  ? 278 TYR C CA  1 
ATOM   8810  C  C   . TYR C 3  278 ? 56.455  107.682 54.703  1.00 16.84  ? 278 TYR C C   1 
ATOM   8811  O  O   . TYR C 3  278 ? 55.991  107.298 55.785  1.00 19.43  ? 278 TYR C O   1 
ATOM   8812  C  CB  . TYR C 3  278 ? 57.307  107.042 52.417  1.00 22.25  ? 278 TYR C CB  1 
ATOM   8813  C  CG  . TYR C 3  278 ? 58.277  105.898 52.551  1.00 31.73  ? 278 TYR C CG  1 
ATOM   8814  C  CD1 . TYR C 3  278 ? 57.902  104.577 52.330  1.00 37.31  ? 278 TYR C CD1 1 
ATOM   8815  C  CD2 . TYR C 3  278 ? 59.590  106.158 52.915  1.00 36.25  ? 278 TYR C CD2 1 
ATOM   8816  C  CE1 . TYR C 3  278 ? 58.805  103.537 52.459  1.00 37.58  ? 278 TYR C CE1 1 
ATOM   8817  C  CE2 . TYR C 3  278 ? 60.496  105.126 53.050  1.00 42.88  ? 278 TYR C CE2 1 
ATOM   8818  C  CZ  . TYR C 3  278 ? 60.102  103.823 52.821  1.00 41.11  ? 278 TYR C CZ  1 
ATOM   8819  O  OH  . TYR C 3  278 ? 61.024  102.814 52.965  1.00 43.74  ? 278 TYR C OH  1 
ATOM   8820  N  N   . ALA C 3  279 ? 57.050  108.874 54.704  1.00 12.77  ? 279 ALA C N   1 
ATOM   8821  C  CA  . ALA C 3  279 ? 57.064  109.678 55.914  1.00 2.57   ? 279 ALA C CA  1 
ATOM   8822  C  C   . ALA C 3  279 ? 55.952  109.246 56.855  1.00 3.61   ? 279 ALA C C   1 
ATOM   8823  O  O   . ALA C 3  279 ? 56.189  108.715 57.941  1.00 6.54   ? 279 ALA C O   1 
ATOM   8824  C  CB  . ALA C 3  279 ? 57.031  111.173 55.643  1.00 7.72   ? 279 ALA C CB  1 
ATOM   8825  N  N   . ILE C 3  280 ? 54.691  109.499 56.518  1.00 4.08   ? 280 ILE C N   1 
ATOM   8826  C  CA  . ILE C 3  280 ? 53.631  109.186 57.427  1.00 2.20   ? 280 ILE C CA  1 
ATOM   8827  C  C   . ILE C 3  280 ? 53.800  107.874 58.182  1.00 3.75   ? 280 ILE C C   1 
ATOM   8828  O  O   . ILE C 3  280 ? 53.692  107.793 59.415  1.00 4.43   ? 280 ILE C O   1 
ATOM   8829  C  CB  . ILE C 3  280 ? 52.300  109.336 56.923  1.00 8.30   ? 280 ILE C CB  1 
ATOM   8830  C  CG1 . ILE C 3  280 ? 51.878  110.797 56.590  1.00 4.91   ? 280 ILE C CG1 1 
ATOM   8831  C  CG2 . ILE C 3  280 ? 51.158  108.828 57.908  1.00 4.87   ? 280 ILE C CG2 1 
ATOM   8832  C  CD1 . ILE C 3  280 ? 51.812  111.648 57.835  1.00 9.33   ? 280 ILE C CD1 1 
ATOM   8833  N  N   . LEU C 3  281 ? 54.157  106.860 57.434  1.00 6.79   ? 281 LEU C N   1 
ATOM   8834  C  CA  . LEU C 3  281 ? 54.428  105.496 57.790  1.00 9.95   ? 281 LEU C CA  1 
ATOM   8835  C  C   . LEU C 3  281 ? 55.567  105.291 58.783  1.00 13.66  ? 281 LEU C C   1 
ATOM   8836  O  O   . LEU C 3  281 ? 55.545  104.434 59.663  1.00 15.84  ? 281 LEU C O   1 
ATOM   8837  C  CB  . LEU C 3  281 ? 54.882  104.705 56.538  1.00 2.20   ? 281 LEU C CB  1 
ATOM   8838  C  CG  . LEU C 3  281 ? 55.181  103.241 56.830  1.00 8.85   ? 281 LEU C CG  1 
ATOM   8839  C  CD1 . LEU C 3  281 ? 53.890  102.574 57.299  1.00 4.95   ? 281 LEU C CD1 1 
ATOM   8840  C  CD2 . LEU C 3  281 ? 55.703  102.459 55.634  1.00 3.25   ? 281 LEU C CD2 1 
ATOM   8841  N  N   . ARG C 3  282 ? 56.705  105.923 58.499  1.00 15.09  ? 282 ARG C N   1 
ATOM   8842  C  CA  . ARG C 3  282 ? 57.822  105.772 59.414  1.00 17.83  ? 282 ARG C CA  1 
ATOM   8843  C  C   . ARG C 3  282 ? 57.480  106.311 60.789  1.00 23.37  ? 282 ARG C C   1 
ATOM   8844  O  O   . ARG C 3  282 ? 57.759  105.679 61.808  1.00 27.20  ? 282 ARG C O   1 
ATOM   8845  C  CB  . ARG C 3  282 ? 59.043  106.505 58.925  1.00 23.47  ? 282 ARG C CB  1 
ATOM   8846  C  CG  . ARG C 3  282 ? 59.599  105.999 57.587  1.00 26.12  ? 282 ARG C CG  1 
ATOM   8847  C  CD  . ARG C 3  282 ? 60.612  107.070 57.184  1.00 29.57  ? 282 ARG C CD  1 
ATOM   8848  N  NE  . ARG C 3  282 ? 61.329  106.756 55.954  1.00 26.16  ? 282 ARG C NE  1 
ATOM   8849  C  CZ  . ARG C 3  282 ? 62.283  107.634 55.589  1.00 24.78  ? 282 ARG C CZ  1 
ATOM   8850  N  NH1 . ARG C 3  282 ? 62.499  108.684 56.378  1.00 11.54  ? 282 ARG C NH1 1 
ATOM   8851  N  NH2 . ARG C 3  282 ? 62.978  107.446 54.489  1.00 28.88  ? 282 ARG C NH2 1 
ATOM   8852  N  N   . SER C 3  283 ? 56.857  107.484 60.856  1.00 27.79  ? 283 SER C N   1 
ATOM   8853  C  CA  . SER C 3  283 ? 56.559  108.054 62.161  1.00 28.47  ? 283 SER C CA  1 
ATOM   8854  C  C   . SER C 3  283 ? 56.017  107.061 63.163  1.00 27.50  ? 283 SER C C   1 
ATOM   8855  O  O   . SER C 3  283 ? 56.275  107.266 64.353  1.00 28.66  ? 283 SER C O   1 
ATOM   8856  C  CB  . SER C 3  283 ? 55.683  109.296 62.066  1.00 25.88  ? 283 SER C CB  1 
ATOM   8857  O  OG  . SER C 3  283 ? 54.716  109.097 61.044  1.00 36.15  ? 283 SER C OG  1 
ATOM   8858  N  N   . ILE C 3  284 ? 55.371  105.960 62.809  1.00 28.03  ? 284 ILE C N   1 
ATOM   8859  C  CA  . ILE C 3  284 ? 54.934  105.000 63.805  1.00 32.34  ? 284 ILE C CA  1 
ATOM   8860  C  C   . ILE C 3  284 ? 55.912  103.857 64.069  1.00 37.77  ? 284 ILE C C   1 
ATOM   8861  O  O   . ILE C 3  284 ? 56.307  103.097 63.188  1.00 38.42  ? 284 ILE C O   1 
ATOM   8862  C  CB  . ILE C 3  284 ? 53.589  104.321 63.464  1.00 26.21  ? 284 ILE C CB  1 
ATOM   8863  C  CG1 . ILE C 3  284 ? 52.543  105.296 62.975  1.00 23.76  ? 284 ILE C CG1 1 
ATOM   8864  C  CG2 . ILE C 3  284 ? 53.103  103.517 64.650  1.00 20.20  ? 284 ILE C CG2 1 
ATOM   8865  C  CD1 . ILE C 3  284 ? 51.732  106.014 64.008  1.00 14.83  ? 284 ILE C CD1 1 
ATOM   8866  N  N   . PRO C 3  285 ? 56.215  103.662 65.337  1.00 41.11  ? 285 PRO C N   1 
ATOM   8867  C  CA  . PRO C 3  285 ? 57.066  102.613 65.861  1.00 39.83  ? 285 PRO C CA  1 
ATOM   8868  C  C   . PRO C 3  285 ? 56.627  101.248 65.329  1.00 36.79  ? 285 PRO C C   1 
ATOM   8869  O  O   . PRO C 3  285 ? 57.371  100.570 64.641  1.00 37.03  ? 285 PRO C O   1 
ATOM   8870  C  CB  . PRO C 3  285 ? 56.884  102.617 67.396  1.00 43.39  ? 285 PRO C CB  1 
ATOM   8871  C  CG  . PRO C 3  285 ? 55.705  103.536 67.588  1.00 43.78  ? 285 PRO C CG  1 
ATOM   8872  C  CD  . PRO C 3  285 ? 55.694  104.510 66.425  1.00 43.44  ? 285 PRO C CD  1 
ATOM   8873  N  N   . ASN C 3  286 ? 55.436  100.855 65.721  1.00 35.05  ? 286 ASN C N   1 
ATOM   8874  C  CA  . ASN C 3  286 ? 54.778  99.603  65.358  1.00 31.73  ? 286 ASN C CA  1 
ATOM   8875  C  C   . ASN C 3  286 ? 54.422  99.565  63.884  1.00 31.52  ? 286 ASN C C   1 
ATOM   8876  O  O   . ASN C 3  286 ? 54.172  100.618 63.286  1.00 32.71  ? 286 ASN C O   1 
ATOM   8877  C  CB  . ASN C 3  286 ? 53.558  99.507  66.286  1.00 23.21  ? 286 ASN C CB  1 
ATOM   8878  C  CG  . ASN C 3  286 ? 52.594  98.421  65.871  1.00 20.03  ? 286 ASN C CG  1 
ATOM   8879  O  OD1 . ASN C 3  286 ? 52.242  98.405  64.693  1.00 18.69  ? 286 ASN C OD1 1 
ATOM   8880  N  ND2 . ASN C 3  286 ? 52.209  97.587  66.822  1.00 14.40  ? 286 ASN C ND2 1 
ATOM   8881  N  N   . LYS C 3  287 ? 54.578  98.431  63.213  1.00 32.57  ? 287 LYS C N   1 
ATOM   8882  C  CA  . LYS C 3  287 ? 54.425  98.344  61.763  1.00 34.04  ? 287 LYS C CA  1 
ATOM   8883  C  C   . LYS C 3  287 ? 52.972  98.283  61.327  1.00 32.92  ? 287 LYS C C   1 
ATOM   8884  O  O   . LYS C 3  287 ? 52.615  98.810  60.273  1.00 32.78  ? 287 LYS C O   1 
ATOM   8885  C  CB  . LYS C 3  287 ? 55.235  97.188  61.200  1.00 38.84  ? 287 LYS C CB  1 
ATOM   8886  C  CG  . LYS C 3  287 ? 54.877  96.662  59.822  1.00 42.15  ? 287 LYS C CG  1 
ATOM   8887  C  CD  . LYS C 3  287 ? 55.712  95.430  59.498  1.00 43.74  ? 287 LYS C CD  1 
ATOM   8888  C  CE  . LYS C 3  287 ? 55.485  94.889  58.106  1.00 47.09  ? 287 LYS C CE  1 
ATOM   8889  N  NZ  . LYS C 3  287 ? 54.878  93.527  58.096  1.00 50.12  ? 287 LYS C NZ  1 
ATOM   8890  N  N   . LEU C 3  288 ? 52.103  97.715  62.157  1.00 31.34  ? 288 LEU C N   1 
ATOM   8891  C  CA  . LEU C 3  288 ? 50.679  97.695  61.821  1.00 30.78  ? 288 LEU C CA  1 
ATOM   8892  C  C   . LEU C 3  288 ? 50.076  99.079  62.011  1.00 29.53  ? 288 LEU C C   1 
ATOM   8893  O  O   . LEU C 3  288 ? 49.262  99.562  61.228  1.00 31.86  ? 288 LEU C O   1 
ATOM   8894  C  CB  . LEU C 3  288 ? 49.930  96.666  62.656  1.00 27.80  ? 288 LEU C CB  1 
ATOM   8895  C  CG  . LEU C 3  288 ? 48.472  96.394  62.280  1.00 26.65  ? 288 LEU C CG  1 
ATOM   8896  C  CD1 . LEU C 3  288 ? 48.219  96.717  60.812  1.00 24.82  ? 288 LEU C CD1 1 
ATOM   8897  C  CD2 . LEU C 3  288 ? 48.140  94.931  62.578  1.00 26.37  ? 288 LEU C CD2 1 
ATOM   8898  N  N   . GLY C 3  289 ? 50.532  99.777  63.053  1.00 27.68  ? 289 GLY C N   1 
ATOM   8899  C  CA  . GLY C 3  289 ? 50.015  101.124 63.280  1.00 24.22  ? 289 GLY C CA  1 
ATOM   8900  C  C   . GLY C 3  289 ? 50.426  102.042 62.136  1.00 23.01  ? 289 GLY C C   1 
ATOM   8901  O  O   . GLY C 3  289 ? 49.730  103.025 61.915  1.00 25.48  ? 289 GLY C O   1 
ATOM   8902  N  N   . GLY C 3  290 ? 51.539  101.762 61.483  1.00 23.41  ? 290 GLY C N   1 
ATOM   8903  C  CA  . GLY C 3  290 ? 52.070  102.527 60.378  1.00 22.84  ? 290 GLY C CA  1 
ATOM   8904  C  C   . GLY C 3  290 ? 51.252  102.317 59.098  1.00 24.13  ? 290 GLY C C   1 
ATOM   8905  O  O   . GLY C 3  290 ? 51.235  103.230 58.264  1.00 19.01  ? 290 GLY C O   1 
ATOM   8906  N  N   . VAL C 3  291 ? 50.892  101.064 58.826  1.00 22.71  ? 291 VAL C N   1 
ATOM   8907  C  CA  . VAL C 3  291 ? 50.095  100.715 57.655  1.00 19.83  ? 291 VAL C CA  1 
ATOM   8908  C  C   . VAL C 3  291 ? 48.719  101.366 57.779  1.00 20.15  ? 291 VAL C C   1 
ATOM   8909  O  O   . VAL C 3  291 ? 48.322  102.081 56.869  1.00 17.78  ? 291 VAL C O   1 
ATOM   8910  C  CB  . VAL C 3  291 ? 49.908  99.202  57.470  1.00 15.57  ? 291 VAL C CB  1 
ATOM   8911  C  CG1 . VAL C 3  291 ? 48.640  98.918  56.685  1.00 20.11  ? 291 VAL C CG1 1 
ATOM   8912  C  CG2 . VAL C 3  291 ? 51.109  98.620  56.750  1.00 17.71  ? 291 VAL C CG2 1 
ATOM   8913  N  N   . LEU C 3  292 ? 48.044  101.137 58.903  1.00 19.19  ? 292 LEU C N   1 
ATOM   8914  C  CA  . LEU C 3  292 ? 46.738  101.778 59.069  1.00 21.74  ? 292 LEU C CA  1 
ATOM   8915  C  C   . LEU C 3  292 ? 46.883  103.278 58.852  1.00 21.84  ? 292 LEU C C   1 
ATOM   8916  O  O   . LEU C 3  292 ? 46.305  103.886 57.936  1.00 23.19  ? 292 LEU C O   1 
ATOM   8917  C  CB  . LEU C 3  292 ? 46.158  101.419 60.438  1.00 16.97  ? 292 LEU C CB  1 
ATOM   8918  C  CG  . LEU C 3  292 ? 46.134  99.923  60.761  1.00 10.77  ? 292 LEU C CG  1 
ATOM   8919  C  CD1 . LEU C 3  292 ? 44.996  99.524  61.677  1.00 5.83   ? 292 LEU C CD1 1 
ATOM   8920  C  CD2 . LEU C 3  292 ? 46.072  99.122  59.474  1.00 8.50   ? 292 LEU C CD2 1 
ATOM   8921  N  N   . ALA C 3  293 ? 47.857  103.901 59.516  1.00 14.62  ? 293 ALA C N   1 
ATOM   8922  C  CA  . ALA C 3  293 ? 48.017  105.330 59.328  1.00 17.95  ? 293 ALA C CA  1 
ATOM   8923  C  C   . ALA C 3  293 ? 48.664  105.692 58.007  1.00 20.62  ? 293 ALA C C   1 
ATOM   8924  O  O   . ALA C 3  293 ? 48.959  106.863 57.734  1.00 21.16  ? 293 ALA C O   1 
ATOM   8925  C  CB  . ALA C 3  293 ? 48.759  105.913 60.516  1.00 18.96  ? 293 ALA C CB  1 
ATOM   8926  N  N   . LEU C 3  294 ? 48.927  104.719 57.157  1.00 24.32  ? 294 LEU C N   1 
ATOM   8927  C  CA  . LEU C 3  294 ? 49.422  104.909 55.799  1.00 23.18  ? 294 LEU C CA  1 
ATOM   8928  C  C   . LEU C 3  294 ? 48.192  104.973 54.871  1.00 24.20  ? 294 LEU C C   1 
ATOM   8929  O  O   . LEU C 3  294 ? 48.152  105.777 53.974  1.00 28.68  ? 294 LEU C O   1 
ATOM   8930  C  CB  . LEU C 3  294 ? 50.300  103.662 55.338  1.00 22.67  ? 294 LEU C CB  1 
ATOM   8931  C  CG  . LEU C 3  294 ? 50.615  103.728 53.868  1.00 25.16  ? 294 LEU C CG  1 
ATOM   8932  C  CD1 . LEU C 3  294 ? 51.629  104.862 53.731  1.00 33.83  ? 294 LEU C CD1 1 
ATOM   8933  C  CD2 . LEU C 3  294 ? 51.220  102.438 53.355  1.00 20.20  ? 294 LEU C CD2 1 
ATOM   8934  N  N   . ALA C 3  295 ? 47.293  104.051 55.147  1.00 23.20  ? 295 ALA C N   1 
ATOM   8935  C  CA  . ALA C 3  295 ? 45.990  103.928 54.542  1.00 22.16  ? 295 ALA C CA  1 
ATOM   8936  C  C   . ALA C 3  295 ? 45.135  105.159 54.843  1.00 23.97  ? 295 ALA C C   1 
ATOM   8937  O  O   . ALA C 3  295 ? 44.487  105.700 53.946  1.00 25.89  ? 295 ALA C O   1 
ATOM   8938  C  CB  . ALA C 3  295 ? 45.293  102.679 55.092  1.00 21.43  ? 295 ALA C CB  1 
ATOM   8939  N  N   . PHE C 3  296 ? 45.154  105.613 56.092  1.00 21.99  ? 296 PHE C N   1 
ATOM   8940  C  CA  . PHE C 3  296 ? 44.342  106.758 56.486  1.00 17.06  ? 296 PHE C CA  1 
ATOM   8941  C  C   . PHE C 3  296 ? 44.830  108.071 55.919  1.00 11.19  ? 296 PHE C C   1 
ATOM   8942  O  O   . PHE C 3  296 ? 44.063  109.017 55.710  1.00 4.95   ? 296 PHE C O   1 
ATOM   8943  C  CB  . PHE C 3  296 ? 44.228  106.779 57.999  1.00 25.78  ? 296 PHE C CB  1 
ATOM   8944  C  CG  . PHE C 3  296 ? 43.053  107.537 58.530  1.00 32.24  ? 296 PHE C CG  1 
ATOM   8945  C  CD1 . PHE C 3  296 ? 43.077  108.908 58.600  1.00 34.68  ? 296 PHE C CD1 1 
ATOM   8946  C  CD2 . PHE C 3  296 ? 41.929  106.870 58.978  1.00 40.11  ? 296 PHE C CD2 1 
ATOM   8947  C  CE1 . PHE C 3  296 ? 42.028  109.638 59.093  1.00 38.13  ? 296 PHE C CE1 1 
ATOM   8948  C  CE2 . PHE C 3  296 ? 40.858  107.599 59.476  1.00 48.03  ? 296 PHE C CE2 1 
ATOM   8949  C  CZ  . PHE C 3  296 ? 40.899  108.975 59.536  1.00 45.12  ? 296 PHE C CZ  1 
ATOM   8950  N  N   . SER C 3  297 ? 46.113  108.173 55.602  1.00 7.74   ? 297 SER C N   1 
ATOM   8951  C  CA  . SER C 3  297 ? 46.604  109.426 55.041  1.00 8.58   ? 297 SER C CA  1 
ATOM   8952  C  C   . SER C 3  297 ? 45.786  109.813 53.799  1.00 7.04   ? 297 SER C C   1 
ATOM   8953  O  O   . SER C 3  297 ? 45.363  110.940 53.643  1.00 2.88   ? 297 SER C O   1 
ATOM   8954  C  CB  . SER C 3  297 ? 48.052  109.197 54.518  1.00 11.49  ? 297 SER C CB  1 
ATOM   8955  O  OG  . SER C 3  297 ? 48.249  110.189 53.522  1.00 11.56  ? 297 SER C OG  1 
ATOM   8956  N  N   . ILE C 3  298 ? 45.694  108.803 52.947  1.00 8.26   ? 298 ILE C N   1 
ATOM   8957  C  CA  . ILE C 3  298 ? 45.070  108.788 51.652  1.00 9.74   ? 298 ILE C CA  1 
ATOM   8958  C  C   . ILE C 3  298 ? 43.557  108.642 51.718  1.00 10.53  ? 298 ILE C C   1 
ATOM   8959  O  O   . ILE C 3  298 ? 42.770  109.351 51.083  1.00 17.25  ? 298 ILE C O   1 
ATOM   8960  C  CB  . ILE C 3  298 ? 45.637  107.647 50.781  1.00 10.58  ? 298 ILE C CB  1 
ATOM   8961  C  CG1 . ILE C 3  298 ? 47.031  107.949 50.219  1.00 2.74   ? 298 ILE C CG1 1 
ATOM   8962  C  CG2 . ILE C 3  298 ? 44.646  107.315 49.670  1.00 4.75   ? 298 ILE C CG2 1 
ATOM   8963  C  CD1 . ILE C 3  298 ? 47.776  106.655 49.900  1.00 10.72  ? 298 ILE C CD1 1 
ATOM   8964  N  N   . LEU C 3  299 ? 43.044  107.724 52.529  1.00 9.38   ? 299 LEU C N   1 
ATOM   8965  C  CA  . LEU C 3  299 ? 41.600  107.556 52.624  1.00 8.53   ? 299 LEU C CA  1 
ATOM   8966  C  C   . LEU C 3  299 ? 40.912  108.677 53.356  1.00 8.39   ? 299 LEU C C   1 
ATOM   8967  O  O   . LEU C 3  299 ? 39.722  108.936 53.153  1.00 10.62  ? 299 LEU C O   1 
ATOM   8968  C  CB  . LEU C 3  299 ? 41.233  106.225 53.278  1.00 8.49   ? 299 LEU C CB  1 
ATOM   8969  C  CG  . LEU C 3  299 ? 41.579  104.992 52.434  1.00 11.55  ? 299 LEU C CG  1 
ATOM   8970  C  CD1 . LEU C 3  299 ? 40.475  103.953 52.449  1.00 3.07   ? 299 LEU C CD1 1 
ATOM   8971  C  CD2 . LEU C 3  299 ? 41.855  105.407 50.985  1.00 16.38  ? 299 LEU C CD2 1 
ATOM   8972  N  N   . ILE C 3  300 ? 41.659  109.394 54.197  1.00 8.20   ? 300 ILE C N   1 
ATOM   8973  C  CA  . ILE C 3  300 ? 41.055  110.492 54.956  1.00 2.31   ? 300 ILE C CA  1 
ATOM   8974  C  C   . ILE C 3  300 ? 40.118  111.266 54.035  1.00 5.16   ? 300 ILE C C   1 
ATOM   8975  O  O   . ILE C 3  300 ? 38.969  111.550 54.379  1.00 2.20   ? 300 ILE C O   1 
ATOM   8976  C  CB  . ILE C 3  300 ? 42.059  111.278 55.773  1.00 4.17   ? 300 ILE C CB  1 
ATOM   8977  C  CG1 . ILE C 3  300 ? 41.430  111.941 56.986  1.00 7.01   ? 300 ILE C CG1 1 
ATOM   8978  C  CG2 . ILE C 3  300 ? 42.903  112.248 54.993  1.00 2.90   ? 300 ILE C CG2 1 
ATOM   8979  C  CD1 . ILE C 3  300 ? 42.126  113.181 57.495  1.00 7.49   ? 300 ILE C CD1 1 
ATOM   8980  N  N   . LEU C 3  301 ? 40.576  111.538 52.819  1.00 8.95   ? 301 LEU C N   1 
ATOM   8981  C  CA  . LEU C 3  301 ? 39.895  112.226 51.732  1.00 9.04   ? 301 LEU C CA  1 
ATOM   8982  C  C   . LEU C 3  301 ? 38.410  111.886 51.624  1.00 3.76   ? 301 LEU C C   1 
ATOM   8983  O  O   . LEU C 3  301 ? 37.593  112.804 51.577  1.00 8.82   ? 301 LEU C O   1 
ATOM   8984  C  CB  . LEU C 3  301 ? 40.608  111.863 50.425  1.00 9.06   ? 301 LEU C CB  1 
ATOM   8985  C  CG  . LEU C 3  301 ? 41.854  112.666 50.061  1.00 4.49   ? 301 LEU C CG  1 
ATOM   8986  C  CD1 . LEU C 3  301 ? 42.372  112.254 48.687  1.00 2.20   ? 301 LEU C CD1 1 
ATOM   8987  C  CD2 . LEU C 3  301 ? 41.588  114.155 50.115  1.00 5.92   ? 301 LEU C CD2 1 
ATOM   8988  N  N   . ALA C 3  302 ? 38.043  110.607 51.675  1.00 5.89   ? 302 ALA C N   1 
ATOM   8989  C  CA  . ALA C 3  302 ? 36.653  110.227 51.721  1.00 4.53   ? 302 ALA C CA  1 
ATOM   8990  C  C   . ALA C 3  302 ? 35.920  110.829 52.902  1.00 5.66   ? 302 ALA C C   1 
ATOM   8991  O  O   . ALA C 3  302 ? 34.674  110.955 52.836  1.00 6.06   ? 302 ALA C O   1 
ATOM   8992  C  CB  . ALA C 3  302 ? 36.485  108.714 51.647  1.00 2.21   ? 302 ALA C CB  1 
ATOM   8993  N  N   . LEU C 3  303 ? 36.520  111.354 53.977  1.00 8.08   ? 303 LEU C N   1 
ATOM   8994  C  CA  . LEU C 3  303 ? 35.659  111.970 54.987  1.00 9.04   ? 303 LEU C CA  1 
ATOM   8995  C  C   . LEU C 3  303 ? 35.596  113.494 54.836  1.00 13.85  ? 303 LEU C C   1 
ATOM   8996  O  O   . LEU C 3  303 ? 34.677  114.059 55.445  1.00 18.64  ? 303 LEU C O   1 
ATOM   8997  C  CB  . LEU C 3  303 ? 35.936  111.774 56.425  1.00 8.81   ? 303 LEU C CB  1 
ATOM   8998  C  CG  . LEU C 3  303 ? 36.110  110.537 57.248  1.00 2.20   ? 303 LEU C CG  1 
ATOM   8999  C  CD1 . LEU C 3  303 ? 37.608  110.264 57.446  1.00 2.89   ? 303 LEU C CD1 1 
ATOM   9000  C  CD2 . LEU C 3  303 ? 35.496  110.776 58.637  1.00 11.13  ? 303 LEU C CD2 1 
ATOM   9001  N  N   . ILE C 3  304 ? 36.513  114.127 54.119  1.00 16.20  ? 304 ILE C N   1 
ATOM   9002  C  CA  . ILE C 3  304 ? 36.454  115.602 54.045  1.00 12.42  ? 304 ILE C CA  1 
ATOM   9003  C  C   . ILE C 3  304 ? 35.038  116.115 54.065  1.00 9.82   ? 304 ILE C C   1 
ATOM   9004  O  O   . ILE C 3  304 ? 34.608  116.785 55.010  1.00 5.67   ? 304 ILE C O   1 
ATOM   9005  C  CB  . ILE C 3  304 ? 37.294  116.142 52.895  1.00 2.45   ? 304 ILE C CB  1 
ATOM   9006  C  CG1 . ILE C 3  304 ? 38.625  115.374 52.890  1.00 5.45   ? 304 ILE C CG1 1 
ATOM   9007  C  CG2 . ILE C 3  304 ? 37.479  117.635 53.000  1.00 4.44   ? 304 ILE C CG2 1 
ATOM   9008  C  CD1 . ILE C 3  304 ? 39.873  116.133 53.234  1.00 6.43   ? 304 ILE C CD1 1 
ATOM   9009  N  N   . PRO C 3  305 ? 34.238  115.768 53.088  1.00 7.97   ? 305 PRO C N   1 
ATOM   9010  C  CA  . PRO C 3  305 ? 32.834  116.143 53.066  1.00 10.84  ? 305 PRO C CA  1 
ATOM   9011  C  C   . PRO C 3  305 ? 32.234  116.239 54.461  1.00 13.42  ? 305 PRO C C   1 
ATOM   9012  O  O   . PRO C 3  305 ? 31.764  117.295 54.913  1.00 13.49  ? 305 PRO C O   1 
ATOM   9013  C  CB  . PRO C 3  305 ? 32.170  114.991 52.281  1.00 10.39  ? 305 PRO C CB  1 
ATOM   9014  C  CG  . PRO C 3  305 ? 33.284  114.553 51.385  1.00 8.39   ? 305 PRO C CG  1 
ATOM   9015  C  CD  . PRO C 3  305 ? 34.622  114.973 51.933  1.00 8.09   ? 305 PRO C CD  1 
ATOM   9016  N  N   . LEU C 3  306 ? 32.261  115.127 55.194  1.00 11.66  ? 306 LEU C N   1 
ATOM   9017  C  CA  . LEU C 3  306 ? 31.720  115.090 56.537  1.00 13.37  ? 306 LEU C CA  1 
ATOM   9018  C  C   . LEU C 3  306 ? 32.512  115.913 57.533  1.00 12.17  ? 306 LEU C C   1 
ATOM   9019  O  O   . LEU C 3  306 ? 32.202  115.897 58.726  1.00 17.16  ? 306 LEU C O   1 
ATOM   9020  C  CB  . LEU C 3  306 ? 31.619  113.664 57.082  1.00 9.07   ? 306 LEU C CB  1 
ATOM   9021  C  CG  . LEU C 3  306 ? 31.254  112.548 56.121  1.00 6.50   ? 306 LEU C CG  1 
ATOM   9022  C  CD1 . LEU C 3  306 ? 30.670  111.367 56.857  1.00 7.15   ? 306 LEU C CD1 1 
ATOM   9023  C  CD2 . LEU C 3  306 ? 30.294  113.068 55.057  1.00 13.50  ? 306 LEU C CD2 1 
ATOM   9024  N  N   . LEU C 3  307 ? 33.650  116.482 57.188  1.00 11.87  ? 307 LEU C N   1 
ATOM   9025  C  CA  . LEU C 3  307 ? 34.298  117.392 58.127  1.00 11.97  ? 307 LEU C CA  1 
ATOM   9026  C  C   . LEU C 3  307 ? 33.928  118.845 57.825  1.00 15.32  ? 307 LEU C C   1 
ATOM   9027  O  O   . LEU C 3  307 ? 34.568  119.699 58.432  1.00 16.45  ? 307 LEU C O   1 
ATOM   9028  C  CB  . LEU C 3  307 ? 35.817  117.332 57.950  1.00 3.61   ? 307 LEU C CB  1 
ATOM   9029  C  CG  . LEU C 3  307 ? 36.475  116.123 58.607  1.00 3.25   ? 307 LEU C CG  1 
ATOM   9030  C  CD1 . LEU C 3  307 ? 37.982  116.167 58.386  1.00 8.92   ? 307 LEU C CD1 1 
ATOM   9031  C  CD2 . LEU C 3  307 ? 36.120  116.134 60.075  1.00 9.82   ? 307 LEU C CD2 1 
ATOM   9032  N  N   . HIS C 3  308 ? 33.220  119.130 56.741  1.00 18.67  ? 308 HIS C N   1 
ATOM   9033  C  CA  . HIS C 3  308 ? 32.995  120.526 56.363  1.00 16.92  ? 308 HIS C CA  1 
ATOM   9034  C  C   . HIS C 3  308 ? 32.036  121.148 57.371  1.00 20.59  ? 308 HIS C C   1 
ATOM   9035  O  O   . HIS C 3  308 ? 31.077  120.516 57.810  1.00 24.52  ? 308 HIS C O   1 
ATOM   9036  C  CB  . HIS C 3  308 ? 32.485  120.679 54.954  1.00 9.45   ? 308 HIS C CB  1 
ATOM   9037  C  CG  . HIS C 3  308 ? 32.333  122.053 54.423  1.00 2.20   ? 308 HIS C CG  1 
ATOM   9038  N  ND1 . HIS C 3  308 ? 32.979  122.522 53.298  1.00 12.88  ? 308 HIS C ND1 1 
ATOM   9039  C  CD2 . HIS C 3  308 ? 31.584  123.111 54.840  1.00 10.56  ? 308 HIS C CD2 1 
ATOM   9040  C  CE1 . HIS C 3  308 ? 32.651  123.779 53.041  1.00 3.57   ? 308 HIS C CE1 1 
ATOM   9041  N  NE2 . HIS C 3  308 ? 31.804  124.168 53.973  1.00 8.36   ? 308 HIS C NE2 1 
ATOM   9042  N  N   . THR C 3  309 ? 32.430  122.317 57.827  1.00 22.43  ? 309 THR C N   1 
ATOM   9043  C  CA  . THR C 3  309 ? 31.824  122.975 58.968  1.00 19.54  ? 309 THR C CA  1 
ATOM   9044  C  C   . THR C 3  309 ? 31.222  124.307 58.598  1.00 17.12  ? 309 THR C C   1 
ATOM   9045  O  O   . THR C 3  309 ? 30.284  124.767 59.236  1.00 16.32  ? 309 THR C O   1 
ATOM   9046  C  CB  . THR C 3  309 ? 32.903  123.188 60.062  1.00 19.39  ? 309 THR C CB  1 
ATOM   9047  O  OG1 . THR C 3  309 ? 32.359  123.943 61.131  1.00 24.41  ? 309 THR C OG1 1 
ATOM   9048  C  CG2 . THR C 3  309 ? 34.109  123.925 59.511  1.00 15.71  ? 309 THR C CG2 1 
ATOM   9049  N  N   . SER C 3  310 ? 31.748  124.950 57.553  1.00 17.37  ? 310 SER C N   1 
ATOM   9050  C  CA  . SER C 3  310 ? 31.219  126.248 57.216  1.00 16.66  ? 310 SER C CA  1 
ATOM   9051  C  C   . SER C 3  310 ? 29.993  126.252 56.333  1.00 18.32  ? 310 SER C C   1 
ATOM   9052  O  O   . SER C 3  310 ? 29.504  125.234 55.876  1.00 24.10  ? 310 SER C O   1 
ATOM   9053  C  CB  . SER C 3  310 ? 32.293  127.136 56.639  1.00 16.29  ? 310 SER C CB  1 
ATOM   9054  O  OG  . SER C 3  310 ? 31.815  128.088 55.736  1.00 21.40  ? 310 SER C OG  1 
ATOM   9055  N  N   . LYS C 3  311 ? 29.499  127.457 56.143  1.00 18.49  ? 311 LYS C N   1 
ATOM   9056  C  CA  . LYS C 3  311 ? 28.336  127.815 55.365  1.00 15.65  ? 311 LYS C CA  1 
ATOM   9057  C  C   . LYS C 3  311 ? 28.743  128.359 53.998  1.00 13.68  ? 311 LYS C C   1 
ATOM   9058  O  O   . LYS C 3  311 ? 27.874  128.801 53.261  1.00 17.55  ? 311 LYS C O   1 
ATOM   9059  C  CB  . LYS C 3  311 ? 27.700  129.041 56.057  1.00 14.83  ? 311 LYS C CB  1 
ATOM   9060  C  CG  . LYS C 3  311 ? 27.559  128.869 57.564  1.00 13.83  ? 311 LYS C CG  1 
ATOM   9061  C  CD  . LYS C 3  311 ? 26.196  129.404 57.992  1.00 16.74  ? 311 LYS C CD  1 
ATOM   9062  C  CE  . LYS C 3  311 ? 25.578  128.569 59.096  1.00 21.36  ? 311 LYS C CE  1 
ATOM   9063  N  NZ  . LYS C 3  311 ? 24.921  129.414 60.131  1.00 30.91  ? 311 LYS C NZ  1 
ATOM   9064  N  N   . GLN C 3  312 ? 30.045  128.481 53.840  1.00 9.85   ? 312 GLN C N   1 
ATOM   9065  C  CA  . GLN C 3  312 ? 30.565  129.024 52.588  1.00 11.88  ? 312 GLN C CA  1 
ATOM   9066  C  C   . GLN C 3  312 ? 31.363  127.906 51.981  1.00 16.35  ? 312 GLN C C   1 
ATOM   9067  O  O   . GLN C 3  312 ? 32.481  127.671 52.442  1.00 23.46  ? 312 GLN C O   1 
ATOM   9068  C  CB  . GLN C 3  312 ? 31.416  130.233 52.952  1.00 2.20   ? 312 GLN C CB  1 
ATOM   9069  C  CG  . GLN C 3  312 ? 30.599  131.307 53.667  1.00 2.20   ? 312 GLN C CG  1 
ATOM   9070  C  CD  . GLN C 3  312 ? 31.489  132.529 53.822  1.00 11.35  ? 312 GLN C CD  1 
ATOM   9071  O  OE1 . GLN C 3  312 ? 31.428  133.180 54.856  1.00 22.63  ? 312 GLN C OE1 1 
ATOM   9072  N  NE2 . GLN C 3  312 ? 32.307  132.821 52.823  1.00 5.14   ? 312 GLN C NE2 1 
ATOM   9073  N  N   . ARG C 3  313 ? 30.823  127.197 50.995  1.00 22.13  ? 313 ARG C N   1 
ATOM   9074  C  CA  . ARG C 3  313 ? 31.585  126.086 50.424  1.00 19.94  ? 313 ARG C CA  1 
ATOM   9075  C  C   . ARG C 3  313 ? 32.874  126.543 49.772  1.00 15.56  ? 313 ARG C C   1 
ATOM   9076  O  O   . ARG C 3  313 ? 33.650  125.712 49.359  1.00 17.54  ? 313 ARG C O   1 
ATOM   9077  C  CB  . ARG C 3  313 ? 30.785  125.333 49.391  1.00 22.41  ? 313 ARG C CB  1 
ATOM   9078  C  CG  . ARG C 3  313 ? 31.318  125.343 47.968  1.00 14.25  ? 313 ARG C CG  1 
ATOM   9079  C  CD  . ARG C 3  313 ? 30.533  124.285 47.218  1.00 14.24  ? 313 ARG C CD  1 
ATOM   9080  N  NE  . ARG C 3  313 ? 30.573  124.321 45.786  1.00 4.22   ? 313 ARG C NE  1 
ATOM   9081  C  CZ  . ARG C 3  313 ? 30.451  123.253 44.996  1.00 10.02  ? 313 ARG C CZ  1 
ATOM   9082  N  NH1 . ARG C 3  313 ? 30.319  122.010 45.444  1.00 3.56   ? 313 ARG C NH1 1 
ATOM   9083  N  NH2 . ARG C 3  313 ? 30.477  123.410 43.653  1.00 2.20   ? 313 ARG C NH2 1 
ATOM   9084  N  N   . SER C 3  314 ? 33.125  127.808 49.751  1.00 20.15  ? 314 SER C N   1 
ATOM   9085  C  CA  . SER C 3  314 ? 34.260  128.455 49.174  1.00 22.23  ? 314 SER C CA  1 
ATOM   9086  C  C   . SER C 3  314 ? 35.162  129.126 50.205  1.00 19.36  ? 314 SER C C   1 
ATOM   9087  O  O   . SER C 3  314 ? 34.892  130.188 50.784  1.00 21.91  ? 314 SER C O   1 
ATOM   9088  C  CB  . SER C 3  314 ? 33.683  129.543 48.229  1.00 38.90  ? 314 SER C CB  1 
ATOM   9089  O  OG  . SER C 3  314 ? 34.653  129.622 47.185  1.00 48.51  ? 314 SER C OG  1 
ATOM   9090  N  N   . MET C 3  315 ? 36.308  128.483 50.320  1.00 8.49   ? 315 MET C N   1 
ATOM   9091  C  CA  . MET C 3  315 ? 37.364  128.955 51.193  1.00 9.58   ? 315 MET C CA  1 
ATOM   9092  C  C   . MET C 3  315 ? 37.849  130.348 50.855  1.00 2.63   ? 315 MET C C   1 
ATOM   9093  O  O   . MET C 3  315 ? 38.165  131.200 51.685  1.00 12.60  ? 315 MET C O   1 
ATOM   9094  C  CB  . MET C 3  315 ? 38.600  128.048 51.075  1.00 11.24  ? 315 MET C CB  1 
ATOM   9095  C  CG  . MET C 3  315 ? 39.152  127.677 52.449  1.00 3.15   ? 315 MET C CG  1 
ATOM   9096  S  SD  . MET C 3  315 ? 40.698  126.776 52.272  1.00 6.64   ? 315 MET C SD  1 
ATOM   9097  C  CE  . MET C 3  315 ? 40.053  125.104 52.234  1.00 5.40   ? 315 MET C CE  1 
ATOM   9098  N  N   . MET C 3  316 ? 37.738  130.727 49.609  1.00 8.45   ? 316 MET C N   1 
ATOM   9099  C  CA  . MET C 3  316 ? 37.995  132.032 49.062  1.00 8.15   ? 316 MET C CA  1 
ATOM   9100  C  C   . MET C 3  316 ? 37.612  133.196 49.943  1.00 5.04   ? 316 MET C C   1 
ATOM   9101  O  O   . MET C 3  316 ? 38.302  134.205 49.988  1.00 8.87   ? 316 MET C O   1 
ATOM   9102  C  CB  . MET C 3  316 ? 37.175  132.136 47.755  1.00 6.63   ? 316 MET C CB  1 
ATOM   9103  C  CG  . MET C 3  316 ? 36.875  133.586 47.420  1.00 2.87   ? 316 MET C CG  1 
ATOM   9104  S  SD  . MET C 3  316 ? 36.533  133.834 45.695  1.00 5.19   ? 316 MET C SD  1 
ATOM   9105  C  CE  . MET C 3  316 ? 37.172  135.423 45.273  1.00 2.96   ? 316 MET C CE  1 
ATOM   9106  N  N   . PHE C 3  317 ? 36.413  133.147 50.507  1.00 13.22  ? 317 PHE C N   1 
ATOM   9107  C  CA  . PHE C 3  317 ? 36.058  134.271 51.400  1.00 20.99  ? 317 PHE C CA  1 
ATOM   9108  C  C   . PHE C 3  317 ? 36.441  133.986 52.840  1.00 21.14  ? 317 PHE C C   1 
ATOM   9109  O  O   . PHE C 3  317 ? 35.985  134.623 53.792  1.00 21.52  ? 317 PHE C O   1 
ATOM   9110  C  CB  . PHE C 3  317 ? 34.542  134.497 51.231  1.00 21.43  ? 317 PHE C CB  1 
ATOM   9111  C  CG  . PHE C 3  317 ? 34.173  134.853 49.823  1.00 20.83  ? 317 PHE C CG  1 
ATOM   9112  C  CD1 . PHE C 3  317 ? 34.784  135.947 49.243  1.00 19.65  ? 317 PHE C CD1 1 
ATOM   9113  C  CD2 . PHE C 3  317 ? 33.260  134.139 49.070  1.00 25.08  ? 317 PHE C CD2 1 
ATOM   9114  C  CE1 . PHE C 3  317 ? 34.517  136.328 47.946  1.00 8.42   ? 317 PHE C CE1 1 
ATOM   9115  C  CE2 . PHE C 3  317 ? 32.925  134.536 47.790  1.00 12.81  ? 317 PHE C CE2 1 
ATOM   9116  C  CZ  . PHE C 3  317 ? 33.557  135.632 47.240  1.00 14.30  ? 317 PHE C CZ  1 
ATOM   9117  N  N   . ARG C 3  318 ? 37.189  132.926 53.130  1.00 22.66  ? 318 ARG C N   1 
ATOM   9118  C  CA  . ARG C 3  318 ? 37.472  132.560 54.510  1.00 27.55  ? 318 ARG C CA  1 
ATOM   9119  C  C   . ARG C 3  318 ? 38.970  132.531 54.801  1.00 28.12  ? 318 ARG C C   1 
ATOM   9120  O  O   . ARG C 3  318 ? 39.644  131.531 54.524  1.00 31.38  ? 318 ARG C O   1 
ATOM   9121  C  CB  . ARG C 3  318 ? 36.823  131.256 54.919  1.00 23.26  ? 318 ARG C CB  1 
ATOM   9122  C  CG  . ARG C 3  318 ? 36.059  130.351 54.030  1.00 25.35  ? 318 ARG C CG  1 
ATOM   9123  C  CD  . ARG C 3  318 ? 35.551  129.071 54.672  1.00 26.77  ? 318 ARG C CD  1 
ATOM   9124  N  NE  . ARG C 3  318 ? 36.199  127.850 54.175  1.00 31.65  ? 318 ARG C NE  1 
ATOM   9125  C  CZ  . ARG C 3  318 ? 35.616  126.670 54.380  1.00 50.29  ? 318 ARG C CZ  1 
ATOM   9126  N  NH1 . ARG C 3  318 ? 34.452  126.699 55.023  1.00 63.95  ? 318 ARG C NH1 1 
ATOM   9127  N  NH2 . ARG C 3  318 ? 36.148  125.535 53.975  1.00 58.70  ? 318 ARG C NH2 1 
ATOM   9128  N  N   . PRO C 3  319 ? 39.538  133.554 55.409  1.00 24.04  ? 319 PRO C N   1 
ATOM   9129  C  CA  . PRO C 3  319 ? 40.964  133.655 55.658  1.00 21.70  ? 319 PRO C CA  1 
ATOM   9130  C  C   . PRO C 3  319 ? 41.566  132.655 56.596  1.00 18.45  ? 319 PRO C C   1 
ATOM   9131  O  O   . PRO C 3  319 ? 42.522  131.937 56.241  1.00 15.34  ? 319 PRO C O   1 
ATOM   9132  C  CB  . PRO C 3  319 ? 41.288  135.117 55.948  1.00 23.34  ? 319 PRO C CB  1 
ATOM   9133  C  CG  . PRO C 3  319 ? 39.932  135.758 56.051  1.00 25.45  ? 319 PRO C CG  1 
ATOM   9134  C  CD  . PRO C 3  319 ? 38.830  134.765 55.802  1.00 23.71  ? 319 PRO C CD  1 
ATOM   9135  N  N   . LEU C 3  320 ? 41.072  132.436 57.816  1.00 10.27  ? 320 LEU C N   1 
ATOM   9136  C  CA  . LEU C 3  320 ? 41.713  131.387 58.612  1.00 9.35   ? 320 LEU C CA  1 
ATOM   9137  C  C   . LEU C 3  320 ? 41.784  130.054 57.907  1.00 10.41  ? 320 LEU C C   1 
ATOM   9138  O  O   . LEU C 3  320 ? 42.725  129.275 58.090  1.00 10.14  ? 320 LEU C O   1 
ATOM   9139  C  CB  . LEU C 3  320 ? 40.987  131.381 59.955  1.00 10.08  ? 320 LEU C CB  1 
ATOM   9140  C  CG  . LEU C 3  320 ? 41.112  132.735 60.677  1.00 11.93  ? 320 LEU C CG  1 
ATOM   9141  C  CD1 . LEU C 3  320 ? 39.809  133.169 61.325  1.00 3.38   ? 320 LEU C CD1 1 
ATOM   9142  C  CD2 . LEU C 3  320 ? 42.231  132.615 61.705  1.00 5.75   ? 320 LEU C CD2 1 
ATOM   9143  N  N   . SER C 3  321 ? 40.791  129.743 57.069  1.00 12.87  ? 321 SER C N   1 
ATOM   9144  C  CA  . SER C 3  321 ? 40.806  128.460 56.367  1.00 12.84  ? 321 SER C CA  1 
ATOM   9145  C  C   . SER C 3  321 ? 41.978  128.499 55.406  1.00 13.98  ? 321 SER C C   1 
ATOM   9146  O  O   . SER C 3  321 ? 42.910  127.695 55.427  1.00 12.79  ? 321 SER C O   1 
ATOM   9147  C  CB  . SER C 3  321 ? 39.456  128.125 55.766  1.00 12.89  ? 321 SER C CB  1 
ATOM   9148  O  OG  . SER C 3  321 ? 38.410  128.394 56.693  1.00 17.57  ? 321 SER C OG  1 
ATOM   9149  N  N   . GLN C 3  322 ? 42.063  129.566 54.621  1.00 13.73  ? 322 GLN C N   1 
ATOM   9150  C  CA  . GLN C 3  322 ? 43.157  129.676 53.667  1.00 18.09  ? 322 GLN C CA  1 
ATOM   9151  C  C   . GLN C 3  322 ? 44.527  129.384 54.253  1.00 19.29  ? 322 GLN C C   1 
ATOM   9152  O  O   . GLN C 3  322 ? 45.332  128.632 53.696  1.00 19.17  ? 322 GLN C O   1 
ATOM   9153  C  CB  . GLN C 3  322 ? 43.064  131.039 52.973  1.00 17.43  ? 322 GLN C CB  1 
ATOM   9154  C  CG  . GLN C 3  322 ? 43.449  130.930 51.513  1.00 25.01  ? 322 GLN C CG  1 
ATOM   9155  C  CD  . GLN C 3  322 ? 43.650  132.280 50.846  1.00 25.43  ? 322 GLN C CD  1 
ATOM   9156  O  OE1 . GLN C 3  322 ? 43.040  133.248 51.306  1.00 20.12  ? 322 GLN C OE1 1 
ATOM   9157  N  NE2 . GLN C 3  322 ? 44.483  132.258 49.800  1.00 12.53  ? 322 GLN C NE2 1 
ATOM   9158  N  N   . CYS C 3  323 ? 44.833  129.958 55.401  1.00 23.18  ? 323 CYS C N   1 
ATOM   9159  C  CA  . CYS C 3  323 ? 46.073  129.854 56.156  1.00 15.11  ? 323 CYS C CA  1 
ATOM   9160  C  C   . CYS C 3  323 ? 46.358  128.429 56.562  1.00 9.05   ? 323 CYS C C   1 
ATOM   9161  O  O   . CYS C 3  323 ? 47.422  127.879 56.306  1.00 6.48   ? 323 CYS C O   1 
ATOM   9162  C  CB  . CYS C 3  323 ? 45.954  130.760 57.396  1.00 19.63  ? 323 CYS C CB  1 
ATOM   9163  S  SG  . CYS C 3  323 ? 46.712  132.389 57.116  1.00 36.38  ? 323 CYS C SG  1 
ATOM   9164  N  N   . LEU C 3  324 ? 45.350  127.745 57.142  1.00 2.30   ? 324 LEU C N   1 
ATOM   9165  C  CA  . LEU C 3  324 ? 45.670  126.357 57.456  1.00 8.35   ? 324 LEU C CA  1 
ATOM   9166  C  C   . LEU C 3  324 ? 45.741  125.549 56.183  1.00 12.45  ? 324 LEU C C   1 
ATOM   9167  O  O   . LEU C 3  324 ? 46.580  124.646 56.115  1.00 19.26  ? 324 LEU C O   1 
ATOM   9168  C  CB  . LEU C 3  324 ? 44.745  125.815 58.527  1.00 5.77   ? 324 LEU C CB  1 
ATOM   9169  C  CG  . LEU C 3  324 ? 44.151  126.875 59.478  1.00 2.20   ? 324 LEU C CG  1 
ATOM   9170  C  CD1 . LEU C 3  324 ? 42.851  126.316 60.047  1.00 2.32   ? 324 LEU C CD1 1 
ATOM   9171  C  CD2 . LEU C 3  324 ? 45.124  127.137 60.633  1.00 4.29   ? 324 LEU C CD2 1 
ATOM   9172  N  N   . PHE C 3  325 ? 44.941  125.866 55.163  1.00 13.00  ? 325 PHE C N   1 
ATOM   9173  C  CA  . PHE C 3  325 ? 44.987  125.093 53.925  1.00 8.73   ? 325 PHE C CA  1 
ATOM   9174  C  C   . PHE C 3  325 ? 46.413  125.071 53.392  1.00 9.98   ? 325 PHE C C   1 
ATOM   9175  O  O   . PHE C 3  325 ? 47.018  124.040 53.141  1.00 10.20  ? 325 PHE C O   1 
ATOM   9176  C  CB  . PHE C 3  325 ? 44.135  125.766 52.831  1.00 9.80   ? 325 PHE C CB  1 
ATOM   9177  C  CG  . PHE C 3  325 ? 44.105  124.858 51.628  1.00 6.19   ? 325 PHE C CG  1 
ATOM   9178  C  CD1 . PHE C 3  325 ? 43.436  123.643 51.706  1.00 6.57   ? 325 PHE C CD1 1 
ATOM   9179  C  CD2 . PHE C 3  325 ? 44.824  125.222 50.507  1.00 7.56   ? 325 PHE C CD2 1 
ATOM   9180  C  CE1 . PHE C 3  325 ? 43.462  122.767 50.650  1.00 5.77   ? 325 PHE C CE1 1 
ATOM   9181  C  CE2 . PHE C 3  325 ? 44.861  124.356 49.434  1.00 2.20   ? 325 PHE C CE2 1 
ATOM   9182  C  CZ  . PHE C 3  325 ? 44.176  123.142 49.515  1.00 12.96  ? 325 PHE C CZ  1 
ATOM   9183  N  N   . TRP C 3  326 ? 46.929  126.291 53.246  1.00 8.32   ? 326 TRP C N   1 
ATOM   9184  C  CA  . TRP C 3  326 ? 48.314  126.417 52.808  1.00 11.48  ? 326 TRP C CA  1 
ATOM   9185  C  C   . TRP C 3  326 ? 49.280  125.664 53.721  1.00 13.11  ? 326 TRP C C   1 
ATOM   9186  O  O   . TRP C 3  326 ? 50.157  124.976 53.189  1.00 12.42  ? 326 TRP C O   1 
ATOM   9187  C  CB  . TRP C 3  326 ? 48.723  127.882 52.792  1.00 15.38  ? 326 TRP C CB  1 
ATOM   9188  C  CG  . TRP C 3  326 ? 48.033  128.685 51.751  1.00 15.23  ? 326 TRP C CG  1 
ATOM   9189  C  CD1 . TRP C 3  326 ? 47.310  129.831 51.916  1.00 17.39  ? 326 TRP C CD1 1 
ATOM   9190  C  CD2 . TRP C 3  326 ? 48.013  128.375 50.358  1.00 15.20  ? 326 TRP C CD2 1 
ATOM   9191  N  NE1 . TRP C 3  326 ? 46.840  130.261 50.701  1.00 16.39  ? 326 TRP C NE1 1 
ATOM   9192  C  CE2 . TRP C 3  326 ? 47.261  129.383 49.736  1.00 14.12  ? 326 TRP C CE2 1 
ATOM   9193  C  CE3 . TRP C 3  326 ? 48.554  127.349 49.585  1.00 16.75  ? 326 TRP C CE3 1 
ATOM   9194  C  CZ2 . TRP C 3  326 ? 47.053  129.377 48.367  1.00 12.05  ? 326 TRP C CZ2 1 
ATOM   9195  C  CZ3 . TRP C 3  326 ? 48.336  127.353 48.210  1.00 3.95   ? 326 TRP C CZ3 1 
ATOM   9196  C  CH2 . TRP C 3  326 ? 47.600  128.358 47.640  1.00 5.10   ? 326 TRP C CH2 1 
ATOM   9197  N  N   . ALA C 3  327 ? 49.135  125.812 55.039  1.00 11.59  ? 327 ALA C N   1 
ATOM   9198  C  CA  . ALA C 3  327 ? 50.042  125.109 55.952  1.00 13.03  ? 327 ALA C CA  1 
ATOM   9199  C  C   . ALA C 3  327 ? 50.156  123.633 55.560  1.00 13.96  ? 327 ALA C C   1 
ATOM   9200  O  O   . ALA C 3  327 ? 51.202  123.097 55.181  1.00 12.53  ? 327 ALA C O   1 
ATOM   9201  C  CB  . ALA C 3  327 ? 49.536  125.173 57.379  1.00 3.30   ? 327 ALA C CB  1 
ATOM   9202  N  N   . LEU C 3  328 ? 49.003  122.963 55.622  1.00 7.92   ? 328 LEU C N   1 
ATOM   9203  C  CA  . LEU C 3  328 ? 48.952  121.565 55.213  1.00 7.39   ? 328 LEU C CA  1 
ATOM   9204  C  C   . LEU C 3  328 ? 49.615  121.323 53.854  1.00 2.20   ? 328 LEU C C   1 
ATOM   9205  O  O   . LEU C 3  328 ? 50.260  120.309 53.641  1.00 4.57   ? 328 LEU C O   1 
ATOM   9206  C  CB  . LEU C 3  328 ? 47.505  121.107 55.214  1.00 8.55   ? 328 LEU C CB  1 
ATOM   9207  C  CG  . LEU C 3  328 ? 47.207  119.757 54.568  1.00 3.84   ? 328 LEU C CG  1 
ATOM   9208  C  CD1 . LEU C 3  328 ? 46.988  118.720 55.669  1.00 3.96   ? 328 LEU C CD1 1 
ATOM   9209  C  CD2 . LEU C 3  328 ? 45.950  119.723 53.683  1.00 7.08   ? 328 LEU C CD2 1 
ATOM   9210  N  N   . VAL C 3  329 ? 49.479  122.292 52.949  1.00 10.18  ? 329 VAL C N   1 
ATOM   9211  C  CA  . VAL C 3  329 ? 50.216  122.068 51.698  1.00 14.24  ? 329 VAL C CA  1 
ATOM   9212  C  C   . VAL C 3  329 ? 51.688  122.102 52.015  1.00 16.92  ? 329 VAL C C   1 
ATOM   9213  O  O   . VAL C 3  329 ? 52.348  121.081 51.819  1.00 20.63  ? 329 VAL C O   1 
ATOM   9214  C  CB  . VAL C 3  329 ? 49.763  123.005 50.595  1.00 15.28  ? 329 VAL C CB  1 
ATOM   9215  C  CG1 . VAL C 3  329 ? 50.777  123.151 49.484  1.00 2.20   ? 329 VAL C CG1 1 
ATOM   9216  C  CG2 . VAL C 3  329 ? 48.445  122.391 50.066  1.00 16.93  ? 329 VAL C CG2 1 
ATOM   9217  N  N   . ALA C 3  330 ? 52.162  123.161 52.676  1.00 20.62  ? 330 ALA C N   1 
ATOM   9218  C  CA  . ALA C 3  330 ? 53.574  123.157 53.057  1.00 20.86  ? 330 ALA C CA  1 
ATOM   9219  C  C   . ALA C 3  330 ? 53.876  122.027 54.020  1.00 20.47  ? 330 ALA C C   1 
ATOM   9220  O  O   . ALA C 3  330 ? 54.993  121.492 53.906  1.00 28.56  ? 330 ALA C O   1 
ATOM   9221  C  CB  . ALA C 3  330 ? 54.159  124.460 53.494  1.00 22.53  ? 330 ALA C CB  1 
ATOM   9222  N  N   . ASP C 3  331 ? 52.930  121.626 54.879  1.00 12.00  ? 331 ASP C N   1 
ATOM   9223  C  CA  . ASP C 3  331 ? 53.273  120.477 55.734  1.00 5.79   ? 331 ASP C CA  1 
ATOM   9224  C  C   . ASP C 3  331 ? 53.615  119.314 54.798  1.00 5.51   ? 331 ASP C C   1 
ATOM   9225  O  O   . ASP C 3  331 ? 54.664  118.695 54.878  1.00 10.26  ? 331 ASP C O   1 
ATOM   9226  C  CB  . ASP C 3  331 ? 52.140  120.068 56.655  1.00 6.09   ? 331 ASP C CB  1 
ATOM   9227  C  CG  . ASP C 3  331 ? 52.563  118.912 57.554  1.00 7.81   ? 331 ASP C CG  1 
ATOM   9228  O  OD1 . ASP C 3  331 ? 53.762  118.959 57.914  1.00 7.66   ? 331 ASP C OD1 1 
ATOM   9229  O  OD2 . ASP C 3  331 ? 51.728  118.027 57.852  1.00 3.02   ? 331 ASP C OD2 1 
ATOM   9230  N  N   . LEU C 3  332 ? 52.716  119.098 53.853  1.00 6.25   ? 332 LEU C N   1 
ATOM   9231  C  CA  . LEU C 3  332 ? 52.799  118.079 52.826  1.00 3.19   ? 332 LEU C CA  1 
ATOM   9232  C  C   . LEU C 3  332 ? 54.103  118.157 52.069  1.00 6.48   ? 332 LEU C C   1 
ATOM   9233  O  O   . LEU C 3  332 ? 54.760  117.209 51.645  1.00 3.25   ? 332 LEU C O   1 
ATOM   9234  C  CB  . LEU C 3  332 ? 51.593  118.327 51.883  1.00 7.93   ? 332 LEU C CB  1 
ATOM   9235  C  CG  . LEU C 3  332 ? 50.317  117.690 52.466  1.00 7.74   ? 332 LEU C CG  1 
ATOM   9236  C  CD1 . LEU C 3  332 ? 49.053  118.431 52.114  1.00 7.89   ? 332 LEU C CD1 1 
ATOM   9237  C  CD2 . LEU C 3  332 ? 50.316  116.235 52.007  1.00 3.58   ? 332 LEU C CD2 1 
ATOM   9238  N  N   . LEU C 3  333 ? 54.560  119.404 51.907  1.00 6.40   ? 333 LEU C N   1 
ATOM   9239  C  CA  . LEU C 3  333 ? 55.862  119.563 51.260  1.00 9.38   ? 333 LEU C CA  1 
ATOM   9240  C  C   . LEU C 3  333 ? 56.943  118.994 52.168  1.00 13.24  ? 333 LEU C C   1 
ATOM   9241  O  O   . LEU C 3  333 ? 57.760  118.175 51.758  1.00 12.68  ? 333 LEU C O   1 
ATOM   9242  C  CB  . LEU C 3  333 ? 56.068  121.024 50.939  1.00 8.67   ? 333 LEU C CB  1 
ATOM   9243  C  CG  . LEU C 3  333 ? 57.307  121.364 50.093  1.00 8.84   ? 333 LEU C CG  1 
ATOM   9244  C  CD1 . LEU C 3  333 ? 57.154  120.863 48.673  1.00 9.87   ? 333 LEU C CD1 1 
ATOM   9245  C  CD2 . LEU C 3  333 ? 57.532  122.874 50.138  1.00 6.74   ? 333 LEU C CD2 1 
ATOM   9246  N  N   . THR C 3  334 ? 56.889  119.427 53.413  1.00 15.60  ? 334 THR C N   1 
ATOM   9247  C  CA  . THR C 3  334 ? 57.795  118.998 54.456  1.00 25.00  ? 334 THR C CA  1 
ATOM   9248  C  C   . THR C 3  334 ? 57.864  117.480 54.567  1.00 28.83  ? 334 THR C C   1 
ATOM   9249  O  O   . THR C 3  334 ? 58.955  116.936 54.777  1.00 27.74  ? 334 THR C O   1 
ATOM   9250  C  CB  . THR C 3  334 ? 57.270  119.534 55.811  1.00 33.18  ? 334 THR C CB  1 
ATOM   9251  O  OG1 . THR C 3  334 ? 56.721  120.832 55.543  1.00 38.86  ? 334 THR C OG1 1 
ATOM   9252  C  CG2 . THR C 3  334 ? 58.411  119.616 56.810  1.00 40.84  ? 334 THR C CG2 1 
ATOM   9253  N  N   . LEU C 3  335 ? 56.700  116.834 54.452  1.00 30.52  ? 335 LEU C N   1 
ATOM   9254  C  CA  . LEU C 3  335 ? 56.613  115.383 54.524  1.00 32.47  ? 335 LEU C CA  1 
ATOM   9255  C  C   . LEU C 3  335 ? 57.328  114.700 53.377  1.00 36.52  ? 335 LEU C C   1 
ATOM   9256  O  O   . LEU C 3  335 ? 58.056  113.717 53.555  1.00 41.27  ? 335 LEU C O   1 
ATOM   9257  C  CB  . LEU C 3  335 ? 55.168  114.908 54.680  1.00 27.37  ? 335 LEU C CB  1 
ATOM   9258  C  CG  . LEU C 3  335 ? 54.696  114.910 56.140  1.00 28.06  ? 335 LEU C CG  1 
ATOM   9259  C  CD1 . LEU C 3  335 ? 53.216  115.124 56.332  1.00 31.16  ? 335 LEU C CD1 1 
ATOM   9260  C  CD2 . LEU C 3  335 ? 55.137  113.640 56.848  1.00 23.46  ? 335 LEU C CD2 1 
ATOM   9261  N  N   . THR C 3  336 ? 57.216  115.256 52.175  1.00 37.31  ? 336 THR C N   1 
ATOM   9262  C  CA  . THR C 3  336 ? 57.927  114.750 50.995  1.00 29.66  ? 336 THR C CA  1 
ATOM   9263  C  C   . THR C 3  336 ? 59.429  114.887 51.182  1.00 28.91  ? 336 THR C C   1 
ATOM   9264  O  O   . THR C 3  336 ? 60.209  114.035 50.775  1.00 30.13  ? 336 THR C O   1 
ATOM   9265  C  CB  . THR C 3  336 ? 57.490  115.589 49.778  1.00 23.80  ? 336 THR C CB  1 
ATOM   9266  O  OG1 . THR C 3  336 ? 56.052  115.560 49.795  1.00 23.61  ? 336 THR C OG1 1 
ATOM   9267  C  CG2 . THR C 3  336 ? 58.006  115.031 48.476  1.00 14.52  ? 336 THR C CG2 1 
ATOM   9268  N  N   . TRP C 3  337 ? 59.846  115.968 51.832  1.00 29.00  ? 337 TRP C N   1 
ATOM   9269  C  CA  . TRP C 3  337 ? 61.272  116.149 52.135  1.00 26.66  ? 337 TRP C CA  1 
ATOM   9270  C  C   . TRP C 3  337 ? 61.717  115.001 53.020  1.00 21.43  ? 337 TRP C C   1 
ATOM   9271  O  O   . TRP C 3  337 ? 62.631  114.270 52.649  1.00 21.66  ? 337 TRP C O   1 
ATOM   9272  C  CB  . TRP C 3  337 ? 61.515  117.513 52.756  1.00 34.74  ? 337 TRP C CB  1 
ATOM   9273  C  CG  . TRP C 3  337 ? 62.829  117.678 53.448  1.00 35.98  ? 337 TRP C CG  1 
ATOM   9274  C  CD1 . TRP C 3  337 ? 64.070  117.388 52.968  1.00 34.60  ? 337 TRP C CD1 1 
ATOM   9275  C  CD2 . TRP C 3  337 ? 63.021  118.190 54.773  1.00 39.01  ? 337 TRP C CD2 1 
ATOM   9276  N  NE1 . TRP C 3  337 ? 65.022  117.686 53.909  1.00 32.73  ? 337 TRP C NE1 1 
ATOM   9277  C  CE2 . TRP C 3  337 ? 64.404  118.179 55.022  1.00 38.34  ? 337 TRP C CE2 1 
ATOM   9278  C  CE3 . TRP C 3  337 ? 62.150  118.653 55.764  1.00 42.16  ? 337 TRP C CE3 1 
ATOM   9279  C  CZ2 . TRP C 3  337 ? 64.932  118.611 56.232  1.00 43.33  ? 337 TRP C CZ2 1 
ATOM   9280  C  CZ3 . TRP C 3  337 ? 62.676  119.082 56.962  1.00 42.78  ? 337 TRP C CZ3 1 
ATOM   9281  C  CH2 . TRP C 3  337 ? 64.054  119.058 57.181  1.00 44.60  ? 337 TRP C CH2 1 
ATOM   9282  N  N   . ILE C 3  338 ? 61.009  114.732 54.111  1.00 17.51  ? 338 ILE C N   1 
ATOM   9283  C  CA  . ILE C 3  338 ? 61.410  113.610 54.951  1.00 19.81  ? 338 ILE C CA  1 
ATOM   9284  C  C   . ILE C 3  338 ? 61.625  112.350 54.151  1.00 28.08  ? 338 ILE C C   1 
ATOM   9285  O  O   . ILE C 3  338 ? 62.655  111.683 54.329  1.00 31.15  ? 338 ILE C O   1 
ATOM   9286  C  CB  . ILE C 3  338 ? 60.552  113.437 56.191  1.00 8.76   ? 338 ILE C CB  1 
ATOM   9287  C  CG1 . ILE C 3  338 ? 60.779  114.597 57.181  1.00 6.97   ? 338 ILE C CG1 1 
ATOM   9288  C  CG2 . ILE C 3  338 ? 60.928  112.185 56.964  1.00 9.55   ? 338 ILE C CG2 1 
ATOM   9289  C  CD1 . ILE C 3  338 ? 61.847  115.567 56.724  1.00 2.77   ? 338 ILE C CD1 1 
ATOM   9290  N  N   . GLY C 3  339 ? 60.748  112.039 53.210  1.00 34.03  ? 339 GLY C N   1 
ATOM   9291  C  CA  . GLY C 3  339 ? 60.817  110.890 52.344  1.00 36.65  ? 339 GLY C CA  1 
ATOM   9292  C  C   . GLY C 3  339 ? 62.204  110.541 51.861  1.00 38.79  ? 339 GLY C C   1 
ATOM   9293  O  O   . GLY C 3  339 ? 62.549  109.359 51.789  1.00 42.69  ? 339 GLY C O   1 
ATOM   9294  N  N   . GLY C 3  340 ? 63.045  111.501 51.490  1.00 41.37  ? 340 GLY C N   1 
ATOM   9295  C  CA  . GLY C 3  340 ? 64.375  111.130 51.006  1.00 44.88  ? 340 GLY C CA  1 
ATOM   9296  C  C   . GLY C 3  340 ? 65.414  111.166 52.114  1.00 49.40  ? 340 GLY C C   1 
ATOM   9297  O  O   . GLY C 3  340 ? 66.612  111.011 51.851  1.00 52.15  ? 340 GLY C O   1 
ATOM   9298  N  N   . GLN C 3  341 ? 64.956  111.399 53.337  1.00 47.75  ? 341 GLN C N   1 
ATOM   9299  C  CA  . GLN C 3  341 ? 65.862  111.530 54.457  1.00 45.50  ? 341 GLN C CA  1 
ATOM   9300  C  C   . GLN C 3  341 ? 66.283  110.199 55.053  1.00 46.09  ? 341 GLN C C   1 
ATOM   9301  O  O   . GLN C 3  341 ? 65.430  109.323 55.219  1.00 44.15  ? 341 GLN C O   1 
ATOM   9302  C  CB  . GLN C 3  341 ? 65.131  112.336 55.537  1.00 47.20  ? 341 GLN C CB  1 
ATOM   9303  C  CG  . GLN C 3  341 ? 64.799  113.746 55.134  1.00 59.36  ? 341 GLN C CG  1 
ATOM   9304  C  CD  . GLN C 3  341 ? 65.894  114.512 54.430  1.00 66.01  ? 341 GLN C CD  1 
ATOM   9305  O  OE1 . GLN C 3  341 ? 66.341  115.587 54.855  1.00 73.99  ? 341 GLN C OE1 1 
ATOM   9306  N  NE2 . GLN C 3  341 ? 66.343  114.019 53.282  1.00 61.31  ? 341 GLN C NE2 1 
ATOM   9307  N  N   . PRO C 3  342 ? 67.536  110.107 55.456  1.00 45.67  ? 342 PRO C N   1 
ATOM   9308  C  CA  . PRO C 3  342 ? 68.017  108.990 56.256  1.00 43.10  ? 342 PRO C CA  1 
ATOM   9309  C  C   . PRO C 3  342 ? 67.074  108.791 57.443  1.00 42.73  ? 342 PRO C C   1 
ATOM   9310  O  O   . PRO C 3  342 ? 66.330  109.700 57.792  1.00 38.39  ? 342 PRO C O   1 
ATOM   9311  C  CB  . PRO C 3  342 ? 69.458  109.306 56.638  1.00 45.37  ? 342 PRO C CB  1 
ATOM   9312  C  CG  . PRO C 3  342 ? 69.812  110.478 55.759  1.00 44.24  ? 342 PRO C CG  1 
ATOM   9313  C  CD  . PRO C 3  342 ? 68.544  111.173 55.330  1.00 46.70  ? 342 PRO C CD  1 
ATOM   9314  N  N   . VAL C 3  343 ? 67.046  107.612 58.018  1.00 46.48  ? 343 VAL C N   1 
ATOM   9315  C  CA  . VAL C 3  343 ? 66.177  107.160 59.079  1.00 52.94  ? 343 VAL C CA  1 
ATOM   9316  C  C   . VAL C 3  343 ? 66.358  107.826 60.427  1.00 56.85  ? 343 VAL C C   1 
ATOM   9317  O  O   . VAL C 3  343 ? 65.845  107.325 61.437  1.00 60.85  ? 343 VAL C O   1 
ATOM   9318  C  CB  . VAL C 3  343 ? 66.372  105.631 59.292  1.00 54.00  ? 343 VAL C CB  1 
ATOM   9319  C  CG1 . VAL C 3  343 ? 66.510  104.966 57.932  1.00 51.90  ? 343 VAL C CG1 1 
ATOM   9320  C  CG2 . VAL C 3  343 ? 67.586  105.333 60.171  1.00 51.97  ? 343 VAL C CG2 1 
ATOM   9321  N  N   . GLU C 3  344 ? 67.116  108.905 60.540  1.00 58.74  ? 344 GLU C N   1 
ATOM   9322  C  CA  . GLU C 3  344 ? 67.685  109.292 61.809  1.00 64.33  ? 344 GLU C CA  1 
ATOM   9323  C  C   . GLU C 3  344 ? 66.917  110.260 62.659  1.00 67.83  ? 344 GLU C C   1 
ATOM   9324  O  O   . GLU C 3  344 ? 65.811  110.684 62.326  1.00 66.55  ? 344 GLU C O   1 
ATOM   9325  C  CB  . GLU C 3  344 ? 69.122  109.763 61.529  1.00 69.38  ? 344 GLU C CB  1 
ATOM   9326  C  CG  . GLU C 3  344 ? 69.906  108.597 60.906  1.00 76.69  ? 344 GLU C CG  1 
ATOM   9327  C  CD  . GLU C 3  344 ? 71.256  109.038 60.392  1.00 80.00  ? 344 GLU C CD  1 
ATOM   9328  O  OE1 . GLU C 3  344 ? 71.632  110.300 60.631  1.00 83.52  ? 344 GLU C OE1 1 
ATOM   9329  O  OE2 . GLU C 3  344 ? 71.966  108.237 59.752  1.00 82.32  ? 344 GLU C OE2 1 
ATOM   9330  N  N   . HIS C 3  345 ? 67.491  110.577 63.823  1.00 74.12  ? 345 HIS C N   1 
ATOM   9331  C  CA  . HIS C 3  345 ? 66.893  111.447 64.817  1.00 76.44  ? 345 HIS C CA  1 
ATOM   9332  C  C   . HIS C 3  345 ? 66.235  112.659 64.183  1.00 73.97  ? 345 HIS C C   1 
ATOM   9333  O  O   . HIS C 3  345 ? 65.009  112.729 63.987  1.00 75.29  ? 345 HIS C O   1 
ATOM   9334  C  CB  . HIS C 3  345 ? 67.888  111.870 65.898  1.00 83.02  ? 345 HIS C CB  1 
ATOM   9335  C  CG  . HIS C 3  345 ? 67.295  112.759 66.947  1.00 91.34  ? 345 HIS C CG  1 
ATOM   9336  N  ND1 . HIS C 3  345 ? 66.871  112.239 68.159  1.00 94.79  ? 345 HIS C ND1 1 
ATOM   9337  C  CD2 . HIS C 3  345 ? 67.052  114.091 66.997  1.00 91.94  ? 345 HIS C CD2 1 
ATOM   9338  C  CE1 . HIS C 3  345 ? 66.389  113.215 68.906  1.00 95.77  ? 345 HIS C CE1 1 
ATOM   9339  N  NE2 . HIS C 3  345 ? 66.485  114.349 68.225  1.00 95.72  ? 345 HIS C NE2 1 
ATOM   9340  N  N   . PRO C 3  346 ? 67.056  113.623 63.808  1.00 70.19  ? 346 PRO C N   1 
ATOM   9341  C  CA  . PRO C 3  346 ? 66.569  114.854 63.206  1.00 63.80  ? 346 PRO C CA  1 
ATOM   9342  C  C   . PRO C 3  346 ? 65.359  114.636 62.324  1.00 58.39  ? 346 PRO C C   1 
ATOM   9343  O  O   . PRO C 3  346 ? 64.310  115.241 62.580  1.00 59.69  ? 346 PRO C O   1 
ATOM   9344  C  CB  . PRO C 3  346 ? 67.765  115.508 62.504  1.00 64.90  ? 346 PRO C CB  1 
ATOM   9345  C  CG  . PRO C 3  346 ? 68.952  114.725 62.997  1.00 68.05  ? 346 PRO C CG  1 
ATOM   9346  C  CD  . PRO C 3  346 ? 68.517  113.619 63.925  1.00 67.60  ? 346 PRO C CD  1 
ATOM   9347  N  N   . TYR C 3  347 ? 65.433  113.769 61.328  1.00 50.32  ? 347 TYR C N   1 
ATOM   9348  C  CA  . TYR C 3  347 ? 64.295  113.541 60.442  1.00 44.82  ? 347 TYR C CA  1 
ATOM   9349  C  C   . TYR C 3  347 ? 63.151  112.840 61.130  1.00 45.03  ? 347 TYR C C   1 
ATOM   9350  O  O   . TYR C 3  347 ? 61.971  113.178 60.931  1.00 50.46  ? 347 TYR C O   1 
ATOM   9351  C  CB  . TYR C 3  347 ? 64.881  112.913 59.185  1.00 37.09  ? 347 TYR C CB  1 
ATOM   9352  C  CG  . TYR C 3  347 ? 65.929  113.796 58.529  1.00 28.58  ? 347 TYR C CG  1 
ATOM   9353  C  CD1 . TYR C 3  347 ? 65.875  115.183 58.630  1.00 28.21  ? 347 TYR C CD1 1 
ATOM   9354  C  CD2 . TYR C 3  347 ? 66.965  113.279 57.773  1.00 27.81  ? 347 TYR C CD2 1 
ATOM   9355  C  CE1 . TYR C 3  347 ? 66.797  116.021 58.023  1.00 18.91  ? 347 TYR C CE1 1 
ATOM   9356  C  CE2 . TYR C 3  347 ? 67.908  114.091 57.150  1.00 24.45  ? 347 TYR C CE2 1 
ATOM   9357  C  CZ  . TYR C 3  347 ? 67.821  115.456 57.290  1.00 21.56  ? 347 TYR C CZ  1 
ATOM   9358  O  OH  . TYR C 3  347 ? 68.722  116.296 56.690  1.00 22.26  ? 347 TYR C OH  1 
ATOM   9359  N  N   . ILE C 3  348 ? 63.425  111.952 62.080  1.00 39.49  ? 348 ILE C N   1 
ATOM   9360  C  CA  . ILE C 3  348 ? 62.345  111.270 62.783  1.00 38.45  ? 348 ILE C CA  1 
ATOM   9361  C  C   . ILE C 3  348 ? 61.506  112.254 63.574  1.00 39.44  ? 348 ILE C C   1 
ATOM   9362  O  O   . ILE C 3  348 ? 60.283  112.287 63.468  1.00 36.57  ? 348 ILE C O   1 
ATOM   9363  C  CB  . ILE C 3  348 ? 62.961  110.219 63.732  1.00 36.75  ? 348 ILE C CB  1 
ATOM   9364  C  CG1 . ILE C 3  348 ? 63.475  109.030 62.924  1.00 35.12  ? 348 ILE C CG1 1 
ATOM   9365  C  CG2 . ILE C 3  348 ? 61.977  109.818 64.820  1.00 38.55  ? 348 ILE C CG2 1 
ATOM   9366  C  CD1 . ILE C 3  348 ? 64.392  108.116 63.698  1.00 20.99  ? 348 ILE C CD1 1 
ATOM   9367  N  N   . THR C 3  349 ? 62.171  113.075 64.393  1.00 42.21  ? 349 THR C N   1 
ATOM   9368  C  CA  . THR C 3  349 ? 61.414  113.976 65.261  1.00 43.88  ? 349 THR C CA  1 
ATOM   9369  C  C   . THR C 3  349 ? 60.649  114.967 64.419  1.00 42.38  ? 349 THR C C   1 
ATOM   9370  O  O   . THR C 3  349 ? 59.536  115.390 64.753  1.00 44.27  ? 349 THR C O   1 
ATOM   9371  C  CB  . THR C 3  349 ? 62.279  114.629 66.343  1.00 48.65  ? 349 THR C CB  1 
ATOM   9372  O  OG1 . THR C 3  349 ? 62.220  113.789 67.518  1.00 51.73  ? 349 THR C OG1 1 
ATOM   9373  C  CG2 . THR C 3  349 ? 61.838  116.044 66.692  1.00 52.26  ? 349 THR C CG2 1 
ATOM   9374  N  N   . ILE C 3  350 ? 61.237  115.334 63.276  1.00 41.24  ? 350 ILE C N   1 
ATOM   9375  C  CA  . ILE C 3  350 ? 60.547  116.286 62.410  1.00 38.91  ? 350 ILE C CA  1 
ATOM   9376  C  C   . ILE C 3  350 ? 59.316  115.657 61.765  1.00 38.35  ? 350 ILE C C   1 
ATOM   9377  O  O   . ILE C 3  350 ? 58.212  116.183 61.890  1.00 40.76  ? 350 ILE C O   1 
ATOM   9378  C  CB  . ILE C 3  350 ? 61.478  116.766 61.288  1.00 35.55  ? 350 ILE C CB  1 
ATOM   9379  C  CG1 . ILE C 3  350 ? 62.573  117.636 61.892  1.00 31.02  ? 350 ILE C CG1 1 
ATOM   9380  C  CG2 . ILE C 3  350 ? 60.654  117.496 60.233  1.00 40.96  ? 350 ILE C CG2 1 
ATOM   9381  C  CD1 . ILE C 3  350 ? 63.599  118.110 60.886  1.00 27.89  ? 350 ILE C CD1 1 
ATOM   9382  N  N   . GLY C 3  351 ? 59.521  114.505 61.143  1.00 36.94  ? 351 GLY C N   1 
ATOM   9383  C  CA  . GLY C 3  351 ? 58.469  113.741 60.496  1.00 29.78  ? 351 GLY C CA  1 
ATOM   9384  C  C   . GLY C 3  351 ? 57.322  113.406 61.435  1.00 24.87  ? 351 GLY C C   1 
ATOM   9385  O  O   . GLY C 3  351 ? 56.164  113.338 61.029  1.00 25.30  ? 351 GLY C O   1 
ATOM   9386  N  N   . GLN C 3  352 ? 57.638  113.182 62.693  1.00 23.04  ? 352 GLN C N   1 
ATOM   9387  C  CA  . GLN C 3  352 ? 56.635  112.829 63.687  1.00 25.34  ? 352 GLN C CA  1 
ATOM   9388  C  C   . GLN C 3  352 ? 55.663  113.976 63.884  1.00 27.02  ? 352 GLN C C   1 
ATOM   9389  O  O   . GLN C 3  352 ? 54.438  113.885 63.908  1.00 26.07  ? 352 GLN C O   1 
ATOM   9390  C  CB  . GLN C 3  352 ? 57.436  112.554 64.979  1.00 26.20  ? 352 GLN C CB  1 
ATOM   9391  C  CG  . GLN C 3  352 ? 58.281  111.301 64.847  1.00 30.19  ? 352 GLN C CG  1 
ATOM   9392  C  CD  . GLN C 3  352 ? 58.727  110.698 66.150  1.00 29.24  ? 352 GLN C CD  1 
ATOM   9393  O  OE1 . GLN C 3  352 ? 58.631  111.352 67.180  1.00 41.75  ? 352 GLN C OE1 1 
ATOM   9394  N  NE2 . GLN C 3  352 ? 59.201  109.463 66.080  1.00 28.17  ? 352 GLN C NE2 1 
ATOM   9395  N  N   . LEU C 3  353 ? 56.269  115.157 64.033  1.00 29.29  ? 353 LEU C N   1 
ATOM   9396  C  CA  . LEU C 3  353 ? 55.457  116.352 64.276  1.00 27.56  ? 353 LEU C CA  1 
ATOM   9397  C  C   . LEU C 3  353 ? 54.686  116.700 63.018  1.00 25.69  ? 353 LEU C C   1 
ATOM   9398  O  O   . LEU C 3  353 ? 53.532  117.128 63.116  1.00 30.03  ? 353 LEU C O   1 
ATOM   9399  C  CB  . LEU C 3  353 ? 56.338  117.471 64.790  1.00 31.70  ? 353 LEU C CB  1 
ATOM   9400  C  CG  . LEU C 3  353 ? 57.162  117.204 66.050  1.00 32.71  ? 353 LEU C CG  1 
ATOM   9401  C  CD1 . LEU C 3  353 ? 57.202  118.430 66.959  1.00 32.57  ? 353 LEU C CD1 1 
ATOM   9402  C  CD2 . LEU C 3  353 ? 56.649  115.995 66.812  1.00 30.50  ? 353 LEU C CD2 1 
ATOM   9403  N  N   . ALA C 3  354 ? 55.299  116.479 61.853  1.00 18.13  ? 354 ALA C N   1 
ATOM   9404  C  CA  . ALA C 3  354 ? 54.615  116.719 60.590  1.00 12.41  ? 354 ALA C CA  1 
ATOM   9405  C  C   . ALA C 3  354 ? 53.465  115.724 60.408  1.00 10.22  ? 354 ALA C C   1 
ATOM   9406  O  O   . ALA C 3  354 ? 52.374  116.148 60.006  1.00 7.04   ? 354 ALA C O   1 
ATOM   9407  C  CB  . ALA C 3  354 ? 55.532  116.662 59.392  1.00 9.33   ? 354 ALA C CB  1 
ATOM   9408  N  N   . SER C 3  355 ? 53.682  114.422 60.726  1.00 2.20   ? 355 SER C N   1 
ATOM   9409  C  CA  . SER C 3  355 ? 52.460  113.620 60.676  1.00 5.57   ? 355 SER C CA  1 
ATOM   9410  C  C   . SER C 3  355 ? 51.407  114.199 61.594  1.00 11.83  ? 355 SER C C   1 
ATOM   9411  O  O   . SER C 3  355 ? 50.282  114.541 61.202  1.00 18.50  ? 355 SER C O   1 
ATOM   9412  C  CB  . SER C 3  355 ? 52.789  112.171 60.977  1.00 6.11   ? 355 SER C CB  1 
ATOM   9413  O  OG  . SER C 3  355 ? 53.634  111.666 59.943  1.00 12.69  ? 355 SER C OG  1 
ATOM   9414  N  N   . VAL C 3  356 ? 51.704  114.387 62.881  1.00 14.78  ? 356 VAL C N   1 
ATOM   9415  C  CA  . VAL C 3  356 ? 50.611  114.914 63.709  1.00 15.14  ? 356 VAL C CA  1 
ATOM   9416  C  C   . VAL C 3  356 ? 49.955  116.102 63.036  1.00 14.25  ? 356 VAL C C   1 
ATOM   9417  O  O   . VAL C 3  356 ? 48.729  116.093 62.904  1.00 14.53  ? 356 VAL C O   1 
ATOM   9418  C  CB  . VAL C 3  356 ? 51.046  115.210 65.135  1.00 19.17  ? 356 VAL C CB  1 
ATOM   9419  C  CG1 . VAL C 3  356 ? 50.175  116.291 65.760  1.00 23.04  ? 356 VAL C CG1 1 
ATOM   9420  C  CG2 . VAL C 3  356 ? 50.999  113.953 65.991  1.00 17.82  ? 356 VAL C CG2 1 
ATOM   9421  N  N   . LEU C 3  357 ? 50.745  117.078 62.594  1.00 14.07  ? 357 LEU C N   1 
ATOM   9422  C  CA  . LEU C 3  357 ? 50.248  118.302 61.989  1.00 12.28  ? 357 LEU C CA  1 
ATOM   9423  C  C   . LEU C 3  357 ? 49.231  118.008 60.891  1.00 11.77  ? 357 LEU C C   1 
ATOM   9424  O  O   . LEU C 3  357 ? 48.157  118.603 60.869  1.00 9.85   ? 357 LEU C O   1 
ATOM   9425  C  CB  . LEU C 3  357 ? 51.371  119.188 61.396  1.00 2.60   ? 357 LEU C CB  1 
ATOM   9426  C  CG  . LEU C 3  357 ? 50.907  120.571 60.925  1.00 5.93   ? 357 LEU C CG  1 
ATOM   9427  C  CD1 . LEU C 3  357 ? 50.004  121.209 61.994  1.00 5.97   ? 357 LEU C CD1 1 
ATOM   9428  C  CD2 . LEU C 3  357 ? 52.034  121.540 60.619  1.00 4.75   ? 357 LEU C CD2 1 
ATOM   9429  N  N   . TYR C 3  358 ? 49.627  117.109 59.995  1.00 10.05  ? 358 TYR C N   1 
ATOM   9430  C  CA  . TYR C 3  358 ? 48.846  116.680 58.872  1.00 7.53   ? 358 TYR C CA  1 
ATOM   9431  C  C   . TYR C 3  358 ? 47.481  116.144 59.268  1.00 2.20   ? 358 TYR C C   1 
ATOM   9432  O  O   . TYR C 3  358 ? 46.561  116.320 58.466  1.00 11.88  ? 358 TYR C O   1 
ATOM   9433  C  CB  . TYR C 3  358 ? 49.560  115.635 58.038  1.00 6.19   ? 358 TYR C CB  1 
ATOM   9434  C  CG  . TYR C 3  358 ? 48.672  114.971 57.011  1.00 9.11   ? 358 TYR C CG  1 
ATOM   9435  C  CD1 . TYR C 3  358 ? 47.726  113.999 57.301  1.00 5.05   ? 358 TYR C CD1 1 
ATOM   9436  C  CD2 . TYR C 3  358 ? 48.807  115.374 55.689  1.00 6.75   ? 358 TYR C CD2 1 
ATOM   9437  C  CE1 . TYR C 3  358 ? 46.964  113.440 56.297  1.00 8.87   ? 358 TYR C CE1 1 
ATOM   9438  C  CE2 . TYR C 3  358 ? 48.065  114.807 54.684  1.00 9.31   ? 358 TYR C CE2 1 
ATOM   9439  C  CZ  . TYR C 3  358 ? 47.134  113.840 54.989  1.00 14.36  ? 358 TYR C CZ  1 
ATOM   9440  O  OH  . TYR C 3  358 ? 46.376  113.315 53.964  1.00 18.83  ? 358 TYR C OH  1 
ATOM   9441  N  N   . PHE C 3  359 ? 47.329  115.326 60.288  1.00 8.12   ? 359 PHE C N   1 
ATOM   9442  C  CA  . PHE C 3  359 ? 45.968  114.891 60.630  1.00 12.83  ? 359 PHE C CA  1 
ATOM   9443  C  C   . PHE C 3  359 ? 45.206  115.971 61.420  1.00 13.60  ? 359 PHE C C   1 
ATOM   9444  O  O   . PHE C 3  359 ? 43.974  115.985 61.376  1.00 8.80   ? 359 PHE C O   1 
ATOM   9445  C  CB  . PHE C 3  359 ? 45.917  113.616 61.443  1.00 8.70   ? 359 PHE C CB  1 
ATOM   9446  C  CG  . PHE C 3  359 ? 46.265  112.386 60.690  1.00 8.53   ? 359 PHE C CG  1 
ATOM   9447  C  CD1 . PHE C 3  359 ? 45.279  111.693 60.009  1.00 13.00  ? 359 PHE C CD1 1 
ATOM   9448  C  CD2 . PHE C 3  359 ? 47.567  111.927 60.656  1.00 8.64   ? 359 PHE C CD2 1 
ATOM   9449  C  CE1 . PHE C 3  359 ? 45.570  110.561 59.301  1.00 6.11   ? 359 PHE C CE1 1 
ATOM   9450  C  CE2 . PHE C 3  359 ? 47.868  110.774 59.956  1.00 11.67  ? 359 PHE C CE2 1 
ATOM   9451  C  CZ  . PHE C 3  359 ? 46.884  110.074 59.274  1.00 10.35  ? 359 PHE C CZ  1 
ATOM   9452  N  N   . LEU C 3  360 ? 45.940  116.758 62.182  1.00 12.86  ? 360 LEU C N   1 
ATOM   9453  C  CA  . LEU C 3  360 ? 45.417  117.872 62.955  1.00 16.56  ? 360 LEU C CA  1 
ATOM   9454  C  C   . LEU C 3  360 ? 44.735  118.887 62.020  1.00 17.22  ? 360 LEU C C   1 
ATOM   9455  O  O   . LEU C 3  360 ? 43.582  119.296 62.214  1.00 15.49  ? 360 LEU C O   1 
ATOM   9456  C  CB  . LEU C 3  360 ? 46.589  118.568 63.661  1.00 14.40  ? 360 LEU C CB  1 
ATOM   9457  C  CG  . LEU C 3  360 ? 46.336  119.175 65.035  1.00 3.11   ? 360 LEU C CG  1 
ATOM   9458  C  CD1 . LEU C 3  360 ? 46.043  118.083 66.046  1.00 6.76   ? 360 LEU C CD1 1 
ATOM   9459  C  CD2 . LEU C 3  360 ? 47.594  119.940 65.443  1.00 10.14  ? 360 LEU C CD2 1 
ATOM   9460  N  N   . LEU C 3  361 ? 45.501  119.292 61.006  1.00 14.08  ? 361 LEU C N   1 
ATOM   9461  C  CA  . LEU C 3  361 ? 45.027  120.208 59.986  1.00 13.27  ? 361 LEU C CA  1 
ATOM   9462  C  C   . LEU C 3  361 ? 43.750  119.689 59.321  1.00 16.94  ? 361 LEU C C   1 
ATOM   9463  O  O   . LEU C 3  361 ? 42.730  120.388 59.220  1.00 18.56  ? 361 LEU C O   1 
ATOM   9464  C  CB  . LEU C 3  361 ? 46.123  120.424 58.959  1.00 8.20   ? 361 LEU C CB  1 
ATOM   9465  C  CG  . LEU C 3  361 ? 47.422  121.058 59.424  1.00 4.80   ? 361 LEU C CG  1 
ATOM   9466  C  CD1 . LEU C 3  361 ? 48.565  120.618 58.515  1.00 7.03   ? 361 LEU C CD1 1 
ATOM   9467  C  CD2 . LEU C 3  361 ? 47.348  122.582 59.457  1.00 2.72   ? 361 LEU C CD2 1 
ATOM   9468  N  N   . ILE C 3  362 ? 43.732  118.436 58.862  1.00 12.34  ? 362 ILE C N   1 
ATOM   9469  C  CA  . ILE C 3  362 ? 42.530  117.882 58.262  1.00 8.90   ? 362 ILE C CA  1 
ATOM   9470  C  C   . ILE C 3  362 ? 41.484  117.482 59.290  1.00 2.20   ? 362 ILE C C   1 
ATOM   9471  O  O   . ILE C 3  362 ? 40.276  117.638 59.036  1.00 6.15   ? 362 ILE C O   1 
ATOM   9472  C  CB  . ILE C 3  362 ? 42.877  116.612 57.441  1.00 7.13   ? 362 ILE C CB  1 
ATOM   9473  C  CG1 . ILE C 3  362 ? 44.131  116.929 56.645  1.00 10.63  ? 362 ILE C CG1 1 
ATOM   9474  C  CG2 . ILE C 3  362 ? 41.699  116.192 56.567  1.00 2.20   ? 362 ILE C CG2 1 
ATOM   9475  C  CD1 . ILE C 3  362 ? 44.692  115.792 55.824  1.00 16.62  ? 362 ILE C CD1 1 
ATOM   9476  N  N   . LEU C 3  363 ? 41.881  116.931 60.425  1.00 10.30  ? 363 LEU C N   1 
ATOM   9477  C  CA  . LEU C 3  363 ? 40.911  116.394 61.354  1.00 14.00  ? 363 LEU C CA  1 
ATOM   9478  C  C   . LEU C 3  363 ? 40.278  117.333 62.361  1.00 19.65  ? 363 LEU C C   1 
ATOM   9479  O  O   . LEU C 3  363 ? 39.156  117.063 62.797  1.00 14.35  ? 363 LEU C O   1 
ATOM   9480  C  CB  . LEU C 3  363 ? 41.525  115.235 62.146  1.00 5.62   ? 363 LEU C CB  1 
ATOM   9481  C  CG  . LEU C 3  363 ? 40.800  113.909 62.000  1.00 11.10  ? 363 LEU C CG  1 
ATOM   9482  C  CD1 . LEU C 3  363 ? 39.619  114.035 61.052  1.00 8.05   ? 363 LEU C CD1 1 
ATOM   9483  C  CD2 . LEU C 3  363 ? 41.773  112.829 61.549  1.00 5.32   ? 363 LEU C CD2 1 
ATOM   9484  N  N   . VAL C 3  364 ? 41.061  118.283 62.864  1.00 22.65  ? 364 VAL C N   1 
ATOM   9485  C  CA  . VAL C 3  364 ? 40.639  119.119 63.965  1.00 22.05  ? 364 VAL C CA  1 
ATOM   9486  C  C   . VAL C 3  364 ? 40.850  120.594 63.700  1.00 23.74  ? 364 VAL C C   1 
ATOM   9487  O  O   . VAL C 3  364 ? 39.927  121.415 63.838  1.00 20.33  ? 364 VAL C O   1 
ATOM   9488  C  CB  . VAL C 3  364 ? 41.391  118.692 65.245  1.00 25.20  ? 364 VAL C CB  1 
ATOM   9489  C  CG1 . VAL C 3  364 ? 41.260  119.783 66.305  1.00 29.71  ? 364 VAL C CG1 1 
ATOM   9490  C  CG2 . VAL C 3  364 ? 40.883  117.373 65.806  1.00 27.73  ? 364 VAL C CG2 1 
ATOM   9491  N  N   . LEU C 3  365 ? 42.056  121.037 63.312  1.00 22.80  ? 365 LEU C N   1 
ATOM   9492  C  CA  . LEU C 3  365 ? 42.183  122.477 63.113  1.00 26.78  ? 365 LEU C CA  1 
ATOM   9493  C  C   . LEU C 3  365 ? 41.152  123.082 62.173  1.00 30.75  ? 365 LEU C C   1 
ATOM   9494  O  O   . LEU C 3  365 ? 40.328  123.875 62.643  1.00 32.14  ? 365 LEU C O   1 
ATOM   9495  C  CB  . LEU C 3  365 ? 43.577  122.927 62.742  1.00 26.31  ? 365 LEU C CB  1 
ATOM   9496  C  CG  . LEU C 3  365 ? 44.773  122.188 63.335  1.00 27.32  ? 365 LEU C CG  1 
ATOM   9497  C  CD1 . LEU C 3  365 ? 46.086  122.714 62.757  1.00 23.70  ? 365 LEU C CD1 1 
ATOM   9498  C  CD2 . LEU C 3  365 ? 44.799  122.265 64.847  1.00 19.96  ? 365 LEU C CD2 1 
ATOM   9499  N  N   . MET C 3  366 ? 41.168  122.755 60.886  1.00 34.74  ? 366 MET C N   1 
ATOM   9500  C  CA  . MET C 3  366 ? 40.263  123.293 59.886  1.00 33.24  ? 366 MET C CA  1 
ATOM   9501  C  C   . MET C 3  366 ? 38.829  123.330 60.332  1.00 30.15  ? 366 MET C C   1 
ATOM   9502  O  O   . MET C 3  366 ? 38.275  124.434 60.523  1.00 35.01  ? 366 MET C O   1 
ATOM   9503  C  CB  . MET C 3  366 ? 40.503  122.777 58.476  1.00 37.39  ? 366 MET C CB  1 
ATOM   9504  C  CG  . MET C 3  366 ? 41.929  122.977 58.000  1.00 40.94  ? 366 MET C CG  1 
ATOM   9505  S  SD  . MET C 3  366 ? 42.376  122.556 56.321  1.00 43.71  ? 366 MET C SD  1 
ATOM   9506  C  CE  . MET C 3  366 ? 41.758  120.867 56.189  1.00 45.50  ? 366 MET C CE  1 
ATOM   9507  N  N   . PRO C 3  367 ? 38.236  122.211 60.671  1.00 25.65  ? 367 PRO C N   1 
ATOM   9508  C  CA  . PRO C 3  367 ? 36.858  122.199 61.176  1.00 25.79  ? 367 PRO C CA  1 
ATOM   9509  C  C   . PRO C 3  367 ? 36.659  123.269 62.214  1.00 26.76  ? 367 PRO C C   1 
ATOM   9510  O  O   . PRO C 3  367 ? 35.832  124.182 62.026  1.00 29.10  ? 367 PRO C O   1 
ATOM   9511  C  CB  . PRO C 3  367 ? 36.554  120.752 61.560  1.00 24.25  ? 367 PRO C CB  1 
ATOM   9512  C  CG  . PRO C 3  367 ? 37.515  120.016 60.644  1.00 21.82  ? 367 PRO C CG  1 
ATOM   9513  C  CD  . PRO C 3  367 ? 38.768  120.869 60.508  1.00 22.44  ? 367 PRO C CD  1 
ATOM   9514  N  N   . THR C 3  368 ? 37.446  123.348 63.285  1.00 26.93  ? 368 THR C N   1 
ATOM   9515  C  CA  . THR C 3  368 ? 37.237  124.457 64.223  1.00 26.70  ? 368 THR C CA  1 
ATOM   9516  C  C   . THR C 3  368 ? 37.241  125.784 63.494  1.00 23.62  ? 368 THR C C   1 
ATOM   9517  O  O   . THR C 3  368 ? 36.291  126.547 63.662  1.00 28.23  ? 368 THR C O   1 
ATOM   9518  C  CB  . THR C 3  368 ? 38.352  124.421 65.289  1.00 30.01  ? 368 THR C CB  1 
ATOM   9519  O  OG1 . THR C 3  368 ? 38.427  123.037 65.662  1.00 27.08  ? 368 THR C OG1 1 
ATOM   9520  C  CG2 . THR C 3  368 ? 38.045  125.291 66.484  1.00 34.36  ? 368 THR C CG2 1 
ATOM   9521  N  N   . ALA C 3  369 ? 38.258  126.062 62.695  1.00 18.96  ? 369 ALA C N   1 
ATOM   9522  C  CA  . ALA C 3  369 ? 38.381  127.327 62.001  1.00 20.02  ? 369 ALA C CA  1 
ATOM   9523  C  C   . ALA C 3  369 ? 37.131  127.651 61.204  1.00 23.32  ? 369 ALA C C   1 
ATOM   9524  O  O   . ALA C 3  369 ? 36.666  128.792 61.212  1.00 27.06  ? 369 ALA C O   1 
ATOM   9525  C  CB  . ALA C 3  369 ? 39.605  127.409 61.130  1.00 23.20  ? 369 ALA C CB  1 
ATOM   9526  N  N   . GLY C 3  370 ? 36.538  126.627 60.602  1.00 23.28  ? 370 GLY C N   1 
ATOM   9527  C  CA  . GLY C 3  370 ? 35.235  126.746 59.962  1.00 23.10  ? 370 GLY C CA  1 
ATOM   9528  C  C   . GLY C 3  370 ? 34.177  127.402 60.851  1.00 23.45  ? 370 GLY C C   1 
ATOM   9529  O  O   . GLY C 3  370 ? 33.690  128.485 60.495  1.00 23.92  ? 370 GLY C O   1 
ATOM   9530  N  N   . THR C 3  371 ? 33.851  126.800 61.985  1.00 22.85  ? 371 THR C N   1 
ATOM   9531  C  CA  . THR C 3  371 ? 32.923  127.362 62.954  1.00 23.58  ? 371 THR C CA  1 
ATOM   9532  C  C   . THR C 3  371 ? 33.323  128.776 63.346  1.00 25.38  ? 371 THR C C   1 
ATOM   9533  O  O   . THR C 3  371 ? 32.545  129.735 63.317  1.00 24.65  ? 371 THR C O   1 
ATOM   9534  C  CB  . THR C 3  371 ? 32.861  126.460 64.201  1.00 23.45  ? 371 THR C CB  1 
ATOM   9535  O  OG1 . THR C 3  371 ? 32.126  125.276 63.921  1.00 22.63  ? 371 THR C OG1 1 
ATOM   9536  C  CG2 . THR C 3  371 ? 32.220  127.178 65.376  1.00 31.75  ? 371 THR C CG2 1 
ATOM   9537  N  N   . ILE C 3  372 ? 34.597  129.010 63.677  1.00 24.78  ? 372 ILE C N   1 
ATOM   9538  C  CA  . ILE C 3  372 ? 35.006  130.319 64.153  1.00 22.29  ? 372 ILE C CA  1 
ATOM   9539  C  C   . ILE C 3  372 ? 34.674  131.434 63.187  1.00 19.87  ? 372 ILE C C   1 
ATOM   9540  O  O   . ILE C 3  372 ? 34.211  132.509 63.551  1.00 17.03  ? 372 ILE C O   1 
ATOM   9541  C  CB  . ILE C 3  372 ? 36.510  130.376 64.474  1.00 16.26  ? 372 ILE C CB  1 
ATOM   9542  C  CG1 . ILE C 3  372 ? 36.791  129.639 65.781  1.00 19.20  ? 372 ILE C CG1 1 
ATOM   9543  C  CG2 . ILE C 3  372 ? 36.928  131.827 64.565  1.00 11.33  ? 372 ILE C CG2 1 
ATOM   9544  C  CD1 . ILE C 3  372 ? 38.222  129.757 66.264  1.00 20.12  ? 372 ILE C CD1 1 
ATOM   9545  N  N   . GLU C 3  373 ? 34.943  131.116 61.930  1.00 23.85  ? 373 GLU C N   1 
ATOM   9546  C  CA  . GLU C 3  373 ? 34.707  132.070 60.842  1.00 26.93  ? 373 GLU C CA  1 
ATOM   9547  C  C   . GLU C 3  373 ? 33.214  132.307 60.687  1.00 25.24  ? 373 GLU C C   1 
ATOM   9548  O  O   . GLU C 3  373 ? 32.723  133.419 60.489  1.00 24.93  ? 373 GLU C O   1 
ATOM   9549  C  CB  . GLU C 3  373 ? 35.357  131.584 59.543  1.00 17.49  ? 373 GLU C CB  1 
ATOM   9550  C  CG  . GLU C 3  373 ? 36.883  131.669 59.650  1.00 21.84  ? 373 GLU C CG  1 
ATOM   9551  C  CD  . GLU C 3  373 ? 37.539  131.147 58.398  1.00 23.48  ? 373 GLU C CD  1 
ATOM   9552  O  OE1 . GLU C 3  373 ? 36.774  130.643 57.561  1.00 20.60  ? 373 GLU C OE1 1 
ATOM   9553  O  OE2 . GLU C 3  373 ? 38.772  131.238 58.286  1.00 33.20  ? 373 GLU C OE2 1 
ATOM   9554  N  N   . ASN C 3  374 ? 32.455  131.227 60.908  1.00 20.90  ? 374 ASN C N   1 
ATOM   9555  C  CA  . ASN C 3  374 ? 31.010  131.347 60.766  1.00 23.91  ? 374 ASN C CA  1 
ATOM   9556  C  C   . ASN C 3  374 ? 30.400  132.159 61.891  1.00 24.33  ? 374 ASN C C   1 
ATOM   9557  O  O   . ASN C 3  374 ? 29.344  132.766 61.785  1.00 23.51  ? 374 ASN C O   1 
ATOM   9558  C  CB  . ASN C 3  374 ? 30.345  129.983 60.741  1.00 30.86  ? 374 ASN C CB  1 
ATOM   9559  C  CG  . ASN C 3  374 ? 30.624  129.123 59.541  1.00 38.75  ? 374 ASN C CG  1 
ATOM   9560  O  OD1 . ASN C 3  374 ? 30.857  129.574 58.421  1.00 47.56  ? 374 ASN C OD1 1 
ATOM   9561  N  ND2 . ASN C 3  374 ? 30.586  127.811 59.760  1.00 39.52  ? 374 ASN C ND2 1 
ATOM   9562  N  N   . LYS C 3  375 ? 31.062  132.125 63.038  1.00 29.87  ? 375 LYS C N   1 
ATOM   9563  C  CA  . LYS C 3  375 ? 30.557  132.856 64.212  1.00 26.09  ? 375 LYS C CA  1 
ATOM   9564  C  C   . LYS C 3  375 ? 30.932  134.320 64.039  1.00 21.19  ? 375 LYS C C   1 
ATOM   9565  O  O   . LYS C 3  375 ? 30.170  135.229 64.342  1.00 18.41  ? 375 LYS C O   1 
ATOM   9566  C  CB  . LYS C 3  375 ? 31.196  132.281 65.466  1.00 34.82  ? 375 LYS C CB  1 
ATOM   9567  C  CG  . LYS C 3  375 ? 30.863  132.920 66.793  1.00 42.62  ? 375 LYS C CG  1 
ATOM   9568  C  CD  . LYS C 3  375 ? 31.717  132.303 67.902  1.00 48.19  ? 375 LYS C CD  1 
ATOM   9569  C  CE  . LYS C 3  375 ? 31.985  133.275 69.038  1.00 54.05  ? 375 LYS C CE  1 
ATOM   9570  N  NZ  . LYS C 3  375 ? 32.031  132.584 70.364  1.00 56.79  ? 375 LYS C NZ  1 
ATOM   9571  N  N   . LEU C 3  376 ? 32.098  134.531 63.434  1.00 15.31  ? 376 LEU C N   1 
ATOM   9572  C  CA  . LEU C 3  376 ? 32.577  135.894 63.238  1.00 20.68  ? 376 LEU C CA  1 
ATOM   9573  C  C   . LEU C 3  376 ? 31.680  136.679 62.291  1.00 20.51  ? 376 LEU C C   1 
ATOM   9574  O  O   . LEU C 3  376 ? 31.551  137.900 62.302  1.00 18.87  ? 376 LEU C O   1 
ATOM   9575  C  CB  . LEU C 3  376 ? 33.996  135.857 62.667  1.00 20.44  ? 376 LEU C CB  1 
ATOM   9576  C  CG  . LEU C 3  376 ? 35.143  135.394 63.547  1.00 15.79  ? 376 LEU C CG  1 
ATOM   9577  C  CD1 . LEU C 3  376 ? 36.428  136.125 63.194  1.00 8.81   ? 376 LEU C CD1 1 
ATOM   9578  C  CD2 . LEU C 3  376 ? 34.833  135.533 65.034  1.00 26.83  ? 376 LEU C CD2 1 
ATOM   9579  N  N   . LEU C 3  377 ? 31.117  135.915 61.354  1.00 21.73  ? 377 LEU C N   1 
ATOM   9580  C  CA  . LEU C 3  377 ? 30.268  136.519 60.331  1.00 19.47  ? 377 LEU C CA  1 
ATOM   9581  C  C   . LEU C 3  377 ? 28.850  136.612 60.854  1.00 20.44  ? 377 LEU C C   1 
ATOM   9582  O  O   . LEU C 3  377 ? 27.964  137.095 60.178  1.00 23.88  ? 377 LEU C O   1 
ATOM   9583  C  CB  . LEU C 3  377 ? 30.326  135.701 59.053  1.00 18.68  ? 377 LEU C CB  1 
ATOM   9584  C  CG  . LEU C 3  377 ? 31.568  135.951 58.182  1.00 13.83  ? 377 LEU C CG  1 
ATOM   9585  C  CD1 . LEU C 3  377 ? 32.177  134.651 57.695  1.00 18.86  ? 377 LEU C CD1 1 
ATOM   9586  C  CD2 . LEU C 3  377 ? 31.188  136.872 57.039  1.00 7.94   ? 377 LEU C CD2 1 
ATOM   9587  N  N   . LYS C 3  378 ? 28.640  136.124 62.064  1.00 23.37  ? 378 LYS C N   1 
ATOM   9588  C  CA  . LYS C 3  378 ? 27.356  136.156 62.737  1.00 20.87  ? 378 LYS C CA  1 
ATOM   9589  C  C   . LYS C 3  378 ? 26.423  135.144 62.126  1.00 16.94  ? 378 LYS C C   1 
ATOM   9590  O  O   . LYS C 3  378 ? 25.293  135.008 62.578  1.00 23.62  ? 378 LYS C O   1 
ATOM   9591  C  CB  . LYS C 3  378 ? 26.826  137.575 62.808  1.00 31.07  ? 378 LYS C CB  1 
ATOM   9592  C  CG  . LYS C 3  378 ? 25.444  137.719 63.439  1.00 50.92  ? 378 LYS C CG  1 
ATOM   9593  C  CD  . LYS C 3  378 ? 24.371  137.726 62.359  1.00 61.40  ? 378 LYS C CD  1 
ATOM   9594  C  CE  . LYS C 3  378 ? 22.952  137.430 62.794  1.00 61.70  ? 378 LYS C CE  1 
ATOM   9595  N  NZ  . LYS C 3  378 ? 22.033  137.948 61.723  1.00 59.43  ? 378 LYS C NZ  1 
ATOM   9596  N  N   . TRP C 3  379 ? 26.898  134.361 61.171  1.00 19.36  ? 379 TRP C N   1 
ATOM   9597  C  CA  . TRP C 3  379 ? 26.119  133.308 60.514  1.00 16.61  ? 379 TRP C CA  1 
ATOM   9598  C  C   . TRP C 3  379 ? 25.576  132.365 61.624  1.00 20.22  ? 379 TRP C C   1 
ATOM   9599  O  O   . TRP C 3  379 ? 26.331  131.522 62.105  1.00 6.03   ? 379 TRP C O   1 
ATOM   9600  C  CB  . TRP C 3  379 ? 26.983  132.376 59.692  1.00 21.31  ? 379 TRP C CB  1 
ATOM   9601  C  CG  . TRP C 3  379 ? 27.498  132.791 58.377  1.00 18.14  ? 379 TRP C CG  1 
ATOM   9602  C  CD1 . TRP C 3  379 ? 28.789  133.068 58.023  1.00 20.55  ? 379 TRP C CD1 1 
ATOM   9603  C  CD2 . TRP C 3  379 ? 26.733  132.928 57.183  1.00 16.07  ? 379 TRP C CD2 1 
ATOM   9604  N  NE1 . TRP C 3  379 ? 28.858  133.396 56.692  1.00 25.30  ? 379 TRP C NE1 1 
ATOM   9605  C  CE2 . TRP C 3  379 ? 27.608  133.307 56.146  1.00 16.85  ? 379 TRP C CE2 1 
ATOM   9606  C  CE3 . TRP C 3  379 ? 25.377  132.757 56.911  1.00 17.72  ? 379 TRP C CE3 1 
ATOM   9607  C  CZ2 . TRP C 3  379 ? 27.202  133.536 54.835  1.00 8.03   ? 379 TRP C CZ2 1 
ATOM   9608  C  CZ3 . TRP C 3  379 ? 24.967  132.981 55.610  1.00 17.66  ? 379 TRP C CZ3 1 
ATOM   9609  C  CH2 . TRP C 3  379 ? 25.861  133.372 54.601  1.00 9.54   ? 379 TRP C CH2 1 
ATOM   9610  O  OXT . TRP C 3  379 ? 24.408  132.491 61.988  1.00 6.03   ? 379 TRP C OXT 1 
ATOM   9611  N  N   . SER D 4  1   ? 78.111  105.269 58.776  1.00 77.87  ? 1   SER D N   1 
ATOM   9612  C  CA  . SER D 4  1   ? 77.554  106.653 58.856  1.00 78.23  ? 1   SER D CA  1 
ATOM   9613  C  C   . SER D 4  1   ? 78.674  107.669 58.665  1.00 77.04  ? 1   SER D C   1 
ATOM   9614  O  O   . SER D 4  1   ? 78.928  108.527 59.503  1.00 76.76  ? 1   SER D O   1 
ATOM   9615  C  CB  . SER D 4  1   ? 76.876  106.876 60.205  1.00 79.64  ? 1   SER D CB  1 
ATOM   9616  O  OG  . SER D 4  1   ? 75.652  107.576 60.013  1.00 81.07  ? 1   SER D OG  1 
ATOM   9617  N  N   . ASP D 4  2   ? 79.406  107.470 57.575  1.00 76.02  ? 2   ASP D N   1 
ATOM   9618  C  CA  . ASP D 4  2   ? 80.576  108.316 57.331  1.00 75.12  ? 2   ASP D CA  1 
ATOM   9619  C  C   . ASP D 4  2   ? 80.241  109.383 56.305  1.00 72.83  ? 2   ASP D C   1 
ATOM   9620  O  O   . ASP D 4  2   ? 79.566  109.080 55.318  1.00 73.84  ? 2   ASP D O   1 
ATOM   9621  C  CB  . ASP D 4  2   ? 81.740  107.441 56.857  1.00 75.23  ? 2   ASP D CB  1 
ATOM   9622  C  CG  . ASP D 4  2   ? 82.545  106.884 58.015  1.00 70.44  ? 2   ASP D CG  1 
ATOM   9623  O  OD1 . ASP D 4  2   ? 82.888  107.663 58.925  1.00 70.33  ? 2   ASP D OD1 1 
ATOM   9624  O  OD2 . ASP D 4  2   ? 82.826  105.671 58.020  1.00 67.70  ? 2   ASP D OD2 1 
ATOM   9625  N  N   . LEU D 4  3   ? 80.634  110.628 56.578  1.00 69.45  ? 3   LEU D N   1 
ATOM   9626  C  CA  . LEU D 4  3   ? 80.319  111.651 55.578  1.00 68.27  ? 3   LEU D CA  1 
ATOM   9627  C  C   . LEU D 4  3   ? 80.894  111.158 54.247  1.00 66.70  ? 3   LEU D C   1 
ATOM   9628  O  O   . LEU D 4  3   ? 81.873  110.422 54.274  1.00 67.36  ? 3   LEU D O   1 
ATOM   9629  C  CB  . LEU D 4  3   ? 80.939  112.989 55.913  1.00 72.34  ? 3   LEU D CB  1 
ATOM   9630  C  CG  . LEU D 4  3   ? 80.666  113.650 57.250  1.00 75.04  ? 3   LEU D CG  1 
ATOM   9631  C  CD1 . LEU D 4  3   ? 80.335  115.130 57.078  1.00 72.31  ? 3   LEU D CD1 1 
ATOM   9632  C  CD2 . LEU D 4  3   ? 79.585  112.947 58.050  1.00 78.01  ? 3   LEU D CD2 1 
ATOM   9633  N  N   . GLU D 4  4   ? 80.254  111.556 53.177  1.00 65.25  ? 4   GLU D N   1 
ATOM   9634  C  CA  . GLU D 4  4   ? 80.718  111.197 51.831  1.00 65.30  ? 4   GLU D CA  1 
ATOM   9635  C  C   . GLU D 4  4   ? 80.976  112.563 51.202  1.00 65.02  ? 4   GLU D C   1 
ATOM   9636  O  O   . GLU D 4  4   ? 80.200  113.497 51.443  1.00 68.80  ? 4   GLU D O   1 
ATOM   9637  C  CB  . GLU D 4  4   ? 79.682  110.373 51.081  1.00 69.98  ? 4   GLU D CB  1 
ATOM   9638  C  CG  . GLU D 4  4   ? 78.261  110.885 51.201  1.00 78.95  ? 4   GLU D CG  1 
ATOM   9639  C  CD  . GLU D 4  4   ? 77.153  110.067 50.592  1.00 79.91  ? 4   GLU D CD  1 
ATOM   9640  O  OE1 . GLU D 4  4   ? 77.305  108.847 50.385  1.00 82.89  ? 4   GLU D OE1 1 
ATOM   9641  O  OE2 . GLU D 4  4   ? 76.075  110.654 50.310  1.00 79.36  ? 4   GLU D OE2 1 
ATOM   9642  N  N   . LEU D 4  5   ? 82.120  112.789 50.597  1.00 63.68  ? 5   LEU D N   1 
ATOM   9643  C  CA  . LEU D 4  5   ? 82.371  114.115 50.027  1.00 63.87  ? 5   LEU D CA  1 
ATOM   9644  C  C   . LEU D 4  5   ? 81.862  114.135 48.598  1.00 65.61  ? 5   LEU D C   1 
ATOM   9645  O  O   . LEU D 4  5   ? 82.312  114.964 47.795  1.00 66.69  ? 5   LEU D O   1 
ATOM   9646  C  CB  . LEU D 4  5   ? 83.873  114.389 50.071  1.00 67.00  ? 5   LEU D CB  1 
ATOM   9647  C  CG  . LEU D 4  5   ? 84.329  115.833 50.246  1.00 68.91  ? 5   LEU D CG  1 
ATOM   9648  C  CD1 . LEU D 4  5   ? 84.779  116.093 51.674  1.00 70.87  ? 5   LEU D CD1 1 
ATOM   9649  C  CD2 . LEU D 4  5   ? 85.458  116.134 49.269  1.00 62.64  ? 5   LEU D CD2 1 
ATOM   9650  N  N   . HIS D 4  6   ? 80.674  113.622 48.327  1.00 68.81  ? 6   HIS D N   1 
ATOM   9651  C  CA  . HIS D 4  6   ? 80.038  113.543 47.042  1.00 73.26  ? 6   HIS D CA  1 
ATOM   9652  C  C   . HIS D 4  6   ? 79.747  114.816 46.284  1.00 75.52  ? 6   HIS D C   1 
ATOM   9653  O  O   . HIS D 4  6   ? 79.849  114.758 45.037  1.00 73.21  ? 6   HIS D O   1 
ATOM   9654  C  CB  . HIS D 4  6   ? 78.724  112.740 47.147  1.00 73.86  ? 6   HIS D CB  1 
ATOM   9655  C  CG  . HIS D 4  6   ? 77.752  113.421 48.068  1.00 71.11  ? 6   HIS D CG  1 
ATOM   9656  N  ND1 . HIS D 4  6   ? 77.959  113.539 49.423  1.00 66.40  ? 6   HIS D ND1 1 
ATOM   9657  C  CD2 . HIS D 4  6   ? 76.571  114.024 47.826  1.00 72.66  ? 6   HIS D CD2 1 
ATOM   9658  C  CE1 . HIS D 4  6   ? 76.962  114.174 49.988  1.00 63.87  ? 6   HIS D CE1 1 
ATOM   9659  N  NE2 . HIS D 4  6   ? 76.102  114.481 49.036  1.00 71.68  ? 6   HIS D NE2 1 
ATOM   9660  N  N   . PRO D 4  7   ? 79.771  115.976 46.907  1.00 77.63  ? 7   PRO D N   1 
ATOM   9661  C  CA  . PRO D 4  7   ? 79.514  117.258 46.316  1.00 80.88  ? 7   PRO D CA  1 
ATOM   9662  C  C   . PRO D 4  7   ? 80.021  117.649 44.970  1.00 81.86  ? 7   PRO D C   1 
ATOM   9663  O  O   . PRO D 4  7   ? 79.330  118.503 44.344  1.00 85.38  ? 7   PRO D O   1 
ATOM   9664  C  CB  . PRO D 4  7   ? 79.754  118.312 47.423  1.00 81.47  ? 7   PRO D CB  1 
ATOM   9665  C  CG  . PRO D 4  7   ? 79.307  117.517 48.631  1.00 80.99  ? 7   PRO D CG  1 
ATOM   9666  C  CD  . PRO D 4  7   ? 79.496  116.059 48.361  1.00 78.03  ? 7   PRO D CD  1 
ATOM   9667  N  N   . PRO D 4  8   ? 81.087  117.154 44.390  1.00 80.32  ? 8   PRO D N   1 
ATOM   9668  C  CA  . PRO D 4  8   ? 81.594  117.506 43.072  1.00 80.53  ? 8   PRO D CA  1 
ATOM   9669  C  C   . PRO D 4  8   ? 80.558  117.947 42.055  1.00 83.18  ? 8   PRO D C   1 
ATOM   9670  O  O   . PRO D 4  8   ? 79.493  117.350 41.849  1.00 87.45  ? 8   PRO D O   1 
ATOM   9671  C  CB  . PRO D 4  8   ? 82.382  116.289 42.545  1.00 79.03  ? 8   PRO D CB  1 
ATOM   9672  C  CG  . PRO D 4  8   ? 82.286  115.325 43.701  1.00 78.54  ? 8   PRO D CG  1 
ATOM   9673  C  CD  . PRO D 4  8   ? 82.028  116.168 44.938  1.00 77.63  ? 8   PRO D CD  1 
ATOM   9674  N  N   . SER D 4  9   ? 80.885  119.058 41.389  1.00 81.39  ? 9   SER D N   1 
ATOM   9675  C  CA  . SER D 4  9   ? 80.079  119.608 40.304  1.00 76.22  ? 9   SER D CA  1 
ATOM   9676  C  C   . SER D 4  9   ? 81.048  120.008 39.195  1.00 72.04  ? 9   SER D C   1 
ATOM   9677  O  O   . SER D 4  9   ? 81.315  121.165 38.913  1.00 67.67  ? 9   SER D O   1 
ATOM   9678  C  CB  . SER D 4  9   ? 79.230  120.788 40.739  1.00 81.63  ? 9   SER D CB  1 
ATOM   9679  O  OG  . SER D 4  9   ? 77.948  120.361 41.193  1.00 87.14  ? 9   SER D OG  1 
ATOM   9680  N  N   . TYR D 4  10  ? 81.685  118.965 38.662  1.00 70.42  ? 10  TYR D N   1 
ATOM   9681  C  CA  . TYR D 4  10  ? 82.680  119.172 37.647  1.00 70.09  ? 10  TYR D CA  1 
ATOM   9682  C  C   . TYR D 4  10  ? 82.301  120.006 36.461  1.00 67.60  ? 10  TYR D C   1 
ATOM   9683  O  O   . TYR D 4  10  ? 81.312  119.784 35.761  1.00 68.00  ? 10  TYR D O   1 
ATOM   9684  C  CB  . TYR D 4  10  ? 83.376  117.840 37.240  1.00 73.01  ? 10  TYR D CB  1 
ATOM   9685  C  CG  . TYR D 4  10  ? 84.696  117.923 38.007  1.00 75.55  ? 10  TYR D CG  1 
ATOM   9686  C  CD1 . TYR D 4  10  ? 85.614  118.829 37.496  1.00 75.06  ? 10  TYR D CD1 1 
ATOM   9687  C  CD2 . TYR D 4  10  ? 84.936  117.291 39.202  1.00 77.52  ? 10  TYR D CD2 1 
ATOM   9688  C  CE1 . TYR D 4  10  ? 86.800  119.062 38.145  1.00 77.86  ? 10  TYR D CE1 1 
ATOM   9689  C  CE2 . TYR D 4  10  ? 86.134  117.503 39.860  1.00 78.06  ? 10  TYR D CE2 1 
ATOM   9690  C  CZ  . TYR D 4  10  ? 87.042  118.388 39.320  1.00 80.25  ? 10  TYR D CZ  1 
ATOM   9691  O  OH  . TYR D 4  10  ? 88.222  118.566 40.005  1.00 84.80  ? 10  TYR D OH  1 
ATOM   9692  N  N   . PRO D 4  11  ? 83.051  121.070 36.216  1.00 63.01  ? 11  PRO D N   1 
ATOM   9693  C  CA  . PRO D 4  11  ? 83.062  121.806 34.956  1.00 59.45  ? 11  PRO D CA  1 
ATOM   9694  C  C   . PRO D 4  11  ? 83.003  120.815 33.801  1.00 53.43  ? 11  PRO D C   1 
ATOM   9695  O  O   . PRO D 4  11  ? 83.541  119.718 33.964  1.00 57.69  ? 11  PRO D O   1 
ATOM   9696  C  CB  . PRO D 4  11  ? 84.431  122.529 34.854  1.00 60.96  ? 11  PRO D CB  1 
ATOM   9697  C  CG  . PRO D 4  11  ? 85.300  121.854 35.955  1.00 63.92  ? 11  PRO D CG  1 
ATOM   9698  C  CD  . PRO D 4  11  ? 84.229  121.406 37.021  1.00 63.95  ? 11  PRO D CD  1 
ATOM   9699  N  N   . TRP D 4  12  ? 82.292  121.113 32.735  1.00 45.87  ? 12  TRP D N   1 
ATOM   9700  C  CA  . TRP D 4  12  ? 82.165  120.208 31.613  1.00 39.24  ? 12  TRP D CA  1 
ATOM   9701  C  C   . TRP D 4  12  ? 81.857  120.972 30.329  1.00 35.84  ? 12  TRP D C   1 
ATOM   9702  O  O   . TRP D 4  12  ? 81.516  122.140 30.337  1.00 34.09  ? 12  TRP D O   1 
ATOM   9703  C  CB  . TRP D 4  12  ? 81.129  119.088 31.738  1.00 37.76  ? 12  TRP D CB  1 
ATOM   9704  C  CG  . TRP D 4  12  ? 81.438  118.104 32.817  1.00 32.20  ? 12  TRP D CG  1 
ATOM   9705  C  CD1 . TRP D 4  12  ? 80.890  118.032 34.059  1.00 37.20  ? 12  TRP D CD1 1 
ATOM   9706  C  CD2 . TRP D 4  12  ? 82.398  117.050 32.758  1.00 25.33  ? 12  TRP D CD2 1 
ATOM   9707  N  NE1 . TRP D 4  12  ? 81.451  117.009 34.790  1.00 37.32  ? 12  TRP D NE1 1 
ATOM   9708  C  CE2 . TRP D 4  12  ? 82.383  116.386 33.996  1.00 30.88  ? 12  TRP D CE2 1 
ATOM   9709  C  CE3 . TRP D 4  12  ? 83.272  116.606 31.780  1.00 19.27  ? 12  TRP D CE3 1 
ATOM   9710  C  CZ2 . TRP D 4  12  ? 83.209  115.299 34.269  1.00 26.84  ? 12  TRP D CZ2 1 
ATOM   9711  C  CZ3 . TRP D 4  12  ? 84.091  115.535 32.047  1.00 13.51  ? 12  TRP D CZ3 1 
ATOM   9712  C  CH2 . TRP D 4  12  ? 84.054  114.894 33.278  1.00 16.48  ? 12  TRP D CH2 1 
ATOM   9713  N  N   . SER D 4  13  ? 81.941  120.200 29.251  1.00 32.62  ? 13  SER D N   1 
ATOM   9714  C  CA  . SER D 4  13  ? 81.801  120.798 27.928  1.00 31.00  ? 13  SER D CA  1 
ATOM   9715  C  C   . SER D 4  13  ? 80.367  120.603 27.453  1.00 32.53  ? 13  SER D C   1 
ATOM   9716  O  O   . SER D 4  13  ? 79.951  121.204 26.470  1.00 32.98  ? 13  SER D O   1 
ATOM   9717  C  CB  . SER D 4  13  ? 82.795  120.199 26.945  1.00 20.15  ? 13  SER D CB  1 
ATOM   9718  O  OG  . SER D 4  13  ? 82.219  119.196 26.148  1.00 3.01   ? 13  SER D OG  1 
ATOM   9719  N  N   . HIS D 4  14  ? 79.669  119.743 28.193  1.00 32.18  ? 14  HIS D N   1 
ATOM   9720  C  CA  . HIS D 4  14  ? 78.262  119.473 27.888  1.00 31.01  ? 14  HIS D CA  1 
ATOM   9721  C  C   . HIS D 4  14  ? 77.394  119.705 29.127  1.00 29.07  ? 14  HIS D C   1 
ATOM   9722  O  O   . HIS D 4  14  ? 76.413  118.988 29.319  1.00 26.13  ? 14  HIS D O   1 
ATOM   9723  C  CB  . HIS D 4  14  ? 78.085  118.005 27.474  1.00 28.74  ? 14  HIS D CB  1 
ATOM   9724  C  CG  . HIS D 4  14  ? 78.894  117.146 28.404  1.00 34.13  ? 14  HIS D CG  1 
ATOM   9725  N  ND1 . HIS D 4  14  ? 80.206  116.835 28.130  1.00 36.60  ? 14  HIS D ND1 1 
ATOM   9726  C  CD2 . HIS D 4  14  ? 78.609  116.554 29.583  1.00 34.95  ? 14  HIS D CD2 1 
ATOM   9727  C  CE1 . HIS D 4  14  ? 80.693  116.083 29.096  1.00 31.92  ? 14  HIS D CE1 1 
ATOM   9728  N  NE2 . HIS D 4  14  ? 79.748  115.897 29.990  1.00 29.93  ? 14  HIS D NE2 1 
ATOM   9729  N  N   . ARG D 4  15  ? 77.790  120.680 29.928  1.00 27.71  ? 15  ARG D N   1 
ATOM   9730  C  CA  . ARG D 4  15  ? 77.066  120.984 31.154  1.00 32.27  ? 15  ARG D CA  1 
ATOM   9731  C  C   . ARG D 4  15  ? 75.797  121.761 30.820  1.00 34.19  ? 15  ARG D C   1 
ATOM   9732  O  O   . ARG D 4  15  ? 74.775  121.692 31.502  1.00 33.59  ? 15  ARG D O   1 
ATOM   9733  C  CB  . ARG D 4  15  ? 77.975  121.813 32.057  1.00 41.16  ? 15  ARG D CB  1 
ATOM   9734  C  CG  . ARG D 4  15  ? 77.689  121.792 33.544  1.00 50.73  ? 15  ARG D CG  1 
ATOM   9735  C  CD  . ARG D 4  15  ? 78.446  122.913 34.241  1.00 63.73  ? 15  ARG D CD  1 
ATOM   9736  N  NE  . ARG D 4  15  ? 77.827  123.330 35.489  1.00 78.76  ? 15  ARG D NE  1 
ATOM   9737  C  CZ  . ARG D 4  15  ? 78.337  124.197 36.358  1.00 82.58  ? 15  ARG D CZ  1 
ATOM   9738  N  NH1 . ARG D 4  15  ? 79.521  124.759 36.144  1.00 79.24  ? 15  ARG D NH1 1 
ATOM   9739  N  NH2 . ARG D 4  15  ? 77.662  124.511 37.458  1.00 88.61  ? 15  ARG D NH2 1 
ATOM   9740  N  N   . GLY D 4  16  ? 75.872  122.508 29.722  1.00 36.78  ? 16  GLY D N   1 
ATOM   9741  C  CA  . GLY D 4  16  ? 74.784  123.359 29.286  1.00 41.05  ? 16  GLY D CA  1 
ATOM   9742  C  C   . GLY D 4  16  ? 73.690  122.684 28.476  1.00 40.48  ? 16  GLY D C   1 
ATOM   9743  O  O   . GLY D 4  16  ? 73.966  121.706 27.781  1.00 37.67  ? 16  GLY D O   1 
ATOM   9744  N  N   . LEU D 4  17  ? 72.490  123.260 28.543  1.00 41.08  ? 17  LEU D N   1 
ATOM   9745  C  CA  . LEU D 4  17  ? 71.302  122.794 27.852  1.00 40.47  ? 17  LEU D CA  1 
ATOM   9746  C  C   . LEU D 4  17  ? 71.584  122.571 26.372  1.00 42.05  ? 17  LEU D C   1 
ATOM   9747  O  O   . LEU D 4  17  ? 71.217  121.534 25.819  1.00 43.95  ? 17  LEU D O   1 
ATOM   9748  C  CB  . LEU D 4  17  ? 70.144  123.764 27.998  1.00 35.92  ? 17  LEU D CB  1 
ATOM   9749  C  CG  . LEU D 4  17  ? 69.361  123.903 29.283  1.00 36.40  ? 17  LEU D CG  1 
ATOM   9750  C  CD1 . LEU D 4  17  ? 67.911  124.269 28.965  1.00 38.00  ? 17  LEU D CD1 1 
ATOM   9751  C  CD2 . LEU D 4  17  ? 69.421  122.703 30.206  1.00 33.76  ? 17  LEU D CD2 1 
ATOM   9752  N  N   . LEU D 4  18  ? 72.258  123.524 25.730  1.00 42.95  ? 18  LEU D N   1 
ATOM   9753  C  CA  . LEU D 4  18  ? 72.586  123.336 24.324  1.00 44.10  ? 18  LEU D CA  1 
ATOM   9754  C  C   . LEU D 4  18  ? 73.905  122.613 24.091  1.00 40.74  ? 18  LEU D C   1 
ATOM   9755  O  O   . LEU D 4  18  ? 74.140  122.150 22.970  1.00 40.04  ? 18  LEU D O   1 
ATOM   9756  C  CB  . LEU D 4  18  ? 72.582  124.667 23.564  1.00 54.70  ? 18  LEU D CB  1 
ATOM   9757  C  CG  . LEU D 4  18  ? 71.384  125.582 23.828  1.00 55.96  ? 18  LEU D CG  1 
ATOM   9758  C  CD1 . LEU D 4  18  ? 71.418  126.851 22.997  1.00 61.15  ? 18  LEU D CD1 1 
ATOM   9759  C  CD2 . LEU D 4  18  ? 70.109  124.794 23.547  1.00 50.98  ? 18  LEU D CD2 1 
ATOM   9760  N  N   . SER D 4  19  ? 74.762  122.524 25.083  1.00 39.22  ? 19  SER D N   1 
ATOM   9761  C  CA  . SER D 4  19  ? 76.071  121.901 25.020  1.00 35.06  ? 19  SER D CA  1 
ATOM   9762  C  C   . SER D 4  19  ? 76.063  120.435 24.662  1.00 31.89  ? 19  SER D C   1 
ATOM   9763  O  O   . SER D 4  19  ? 75.346  119.614 25.249  1.00 31.80  ? 19  SER D O   1 
ATOM   9764  C  CB  . SER D 4  19  ? 76.754  122.148 26.378  1.00 39.08  ? 19  SER D CB  1 
ATOM   9765  O  OG  . SER D 4  19  ? 76.685  123.549 26.644  1.00 49.19  ? 19  SER D OG  1 
ATOM   9766  N  N   . SER D 4  20  ? 76.859  120.067 23.657  1.00 27.83  ? 20  SER D N   1 
ATOM   9767  C  CA  . SER D 4  20  ? 76.882  118.689 23.196  1.00 30.03  ? 20  SER D CA  1 
ATOM   9768  C  C   . SER D 4  20  ? 78.195  117.976 23.483  1.00 32.97  ? 20  SER D C   1 
ATOM   9769  O  O   . SER D 4  20  ? 79.217  118.563 23.843  1.00 35.49  ? 20  SER D O   1 
ATOM   9770  C  CB  . SER D 4  20  ? 76.566  118.576 21.710  1.00 25.51  ? 20  SER D CB  1 
ATOM   9771  O  OG  . SER D 4  20  ? 77.708  118.372 20.912  1.00 25.06  ? 20  SER D OG  1 
ATOM   9772  N  N   . LEU D 4  21  ? 78.140  116.654 23.286  1.00 30.42  ? 21  LEU D N   1 
ATOM   9773  C  CA  . LEU D 4  21  ? 79.324  115.837 23.495  1.00 30.00  ? 21  LEU D CA  1 
ATOM   9774  C  C   . LEU D 4  21  ? 80.449  116.195 22.512  1.00 34.47  ? 21  LEU D C   1 
ATOM   9775  O  O   . LEU D 4  21  ? 80.254  116.405 21.315  1.00 33.55  ? 21  LEU D O   1 
ATOM   9776  C  CB  . LEU D 4  21  ? 79.010  114.352 23.295  1.00 14.69  ? 21  LEU D CB  1 
ATOM   9777  C  CG  . LEU D 4  21  ? 78.392  113.586 24.444  1.00 14.90  ? 21  LEU D CG  1 
ATOM   9778  C  CD1 . LEU D 4  21  ? 78.479  112.085 24.205  1.00 8.32   ? 21  LEU D CD1 1 
ATOM   9779  C  CD2 . LEU D 4  21  ? 79.047  113.961 25.763  1.00 14.57  ? 21  LEU D CD2 1 
ATOM   9780  N  N   . ASP D 4  22  ? 81.678  116.136 23.023  1.00 34.86  ? 22  ASP D N   1 
ATOM   9781  C  CA  . ASP D 4  22  ? 82.871  116.299 22.204  1.00 34.84  ? 22  ASP D CA  1 
ATOM   9782  C  C   . ASP D 4  22  ? 83.389  114.937 21.761  1.00 35.24  ? 22  ASP D C   1 
ATOM   9783  O  O   . ASP D 4  22  ? 84.139  114.312 22.516  1.00 32.57  ? 22  ASP D O   1 
ATOM   9784  C  CB  . ASP D 4  22  ? 83.940  117.008 23.052  1.00 35.93  ? 22  ASP D CB  1 
ATOM   9785  C  CG  . ASP D 4  22  ? 85.205  117.275 22.264  1.00 44.24  ? 22  ASP D CG  1 
ATOM   9786  O  OD1 . ASP D 4  22  ? 85.465  116.582 21.255  1.00 46.84  ? 22  ASP D OD1 1 
ATOM   9787  O  OD2 . ASP D 4  22  ? 85.948  118.193 22.668  1.00 47.54  ? 22  ASP D OD2 1 
ATOM   9788  N  N   . HIS D 4  23  ? 83.049  114.430 20.577  1.00 38.28  ? 23  HIS D N   1 
ATOM   9789  C  CA  . HIS D 4  23  ? 83.541  113.112 20.300  1.00 44.70  ? 23  HIS D CA  1 
ATOM   9790  C  C   . HIS D 4  23  ? 85.028  112.888 20.401  1.00 48.33  ? 23  HIS D C   1 
ATOM   9791  O  O   . HIS D 4  23  ? 85.430  111.786 20.809  1.00 48.94  ? 23  HIS D O   1 
ATOM   9792  C  CB  . HIS D 4  23  ? 83.254  112.788 18.739  1.00 52.24  ? 23  HIS D CB  1 
ATOM   9793  C  CG  . HIS D 4  23  ? 81.820  113.042 18.418  1.00 56.21  ? 23  HIS D CG  1 
ATOM   9794  N  ND1 . HIS D 4  23  ? 80.793  112.197 18.767  1.00 56.50  ? 23  HIS D ND1 1 
ATOM   9795  C  CD2 . HIS D 4  23  ? 81.265  114.071 17.780  1.00 56.83  ? 23  HIS D CD2 1 
ATOM   9796  C  CE1 . HIS D 4  23  ? 79.654  112.705 18.336  1.00 58.37  ? 23  HIS D CE1 1 
ATOM   9797  N  NE2 . HIS D 4  23  ? 79.913  113.851 17.726  1.00 61.36  ? 23  HIS D NE2 1 
ATOM   9798  N  N   . THR D 4  24  ? 85.863  113.857 19.997  1.00 49.17  ? 24  THR D N   1 
ATOM   9799  C  CA  . THR D 4  24  ? 87.306  113.597 20.175  1.00 44.11  ? 24  THR D CA  1 
ATOM   9800  C  C   . THR D 4  24  ? 87.492  113.066 21.578  1.00 41.66  ? 24  THR D C   1 
ATOM   9801  O  O   . THR D 4  24  ? 87.807  111.872 21.694  1.00 39.26  ? 24  THR D O   1 
ATOM   9802  C  CB  . THR D 4  24  ? 88.149  114.788 19.773  1.00 47.68  ? 24  THR D CB  1 
ATOM   9803  O  OG1 . THR D 4  24  ? 87.917  115.025 18.360  1.00 43.47  ? 24  THR D OG1 1 
ATOM   9804  C  CG2 . THR D 4  24  ? 89.628  114.530 20.009  1.00 51.11  ? 24  THR D CG2 1 
ATOM   9805  N  N   . SER D 4  25  ? 86.968  113.754 22.593  1.00 39.59  ? 25  SER D N   1 
ATOM   9806  C  CA  . SER D 4  25  ? 86.956  113.194 23.937  1.00 41.02  ? 25  SER D CA  1 
ATOM   9807  C  C   . SER D 4  25  ? 86.339  111.806 24.002  1.00 41.08  ? 25  SER D C   1 
ATOM   9808  O  O   . SER D 4  25  ? 86.944  110.916 24.616  1.00 44.17  ? 25  SER D O   1 
ATOM   9809  C  CB  . SER D 4  25  ? 86.402  114.145 24.980  1.00 38.02  ? 25  SER D CB  1 
ATOM   9810  O  OG  . SER D 4  25  ? 86.280  113.520 26.251  1.00 28.41  ? 25  SER D OG  1 
ATOM   9811  N  N   . ILE D 4  26  ? 85.213  111.547 23.350  1.00 40.14  ? 26  ILE D N   1 
ATOM   9812  C  CA  . ILE D 4  26  ? 84.631  110.300 23.350  1.00 39.29  ? 26  ILE D CA  1 
ATOM   9813  C  C   . ILE D 4  26  ? 85.661  109.202 22.821  1.00 37.21  ? 26  ILE D C   1 
ATOM   9814  O  O   . ILE D 4  26  ? 85.929  108.202 23.471  1.00 35.75  ? 26  ILE D O   1 
ATOM   9815  C  CB  . ILE D 4  26  ? 83.373  110.098 22.480  1.00 38.28  ? 26  ILE D CB  1 
ATOM   9816  C  CG1 . ILE D 4  26  ? 82.088  110.180 23.316  1.00 37.52  ? 26  ILE D CG1 1 
ATOM   9817  C  CG2 . ILE D 4  26  ? 83.365  108.796 21.701  1.00 34.31  ? 26  ILE D CG2 1 
ATOM   9818  C  CD1 . ILE D 4  26  ? 80.876  110.044 22.400  1.00 33.51  ? 26  ILE D CD1 1 
ATOM   9819  N  N   . ARG D 4  27  ? 86.213  109.553 21.668  1.00 36.89  ? 27  ARG D N   1 
ATOM   9820  C  CA  . ARG D 4  27  ? 87.231  108.766 20.985  1.00 33.59  ? 27  ARG D CA  1 
ATOM   9821  C  C   . ARG D 4  27  ? 88.373  108.395 21.926  1.00 29.56  ? 27  ARG D C   1 
ATOM   9822  O  O   . ARG D 4  27  ? 88.616  107.231 22.225  1.00 29.62  ? 27  ARG D O   1 
ATOM   9823  C  CB  . ARG D 4  27  ? 87.815  109.591 19.828  1.00 34.93  ? 27  ARG D CB  1 
ATOM   9824  C  CG  . ARG D 4  27  ? 88.806  108.803 18.996  1.00 46.31  ? 27  ARG D CG  1 
ATOM   9825  C  CD  . ARG D 4  27  ? 89.215  109.547 17.733  1.00 55.28  ? 27  ARG D CD  1 
ATOM   9826  N  NE  . ARG D 4  27  ? 89.191  108.691 16.561  1.00 62.30  ? 27  ARG D NE  1 
ATOM   9827  C  CZ  . ARG D 4  27  ? 89.651  108.935 15.348  1.00 63.61  ? 27  ARG D CZ  1 
ATOM   9828  N  NH1 . ARG D 4  27  ? 90.261  110.065 15.035  1.00 63.76  ? 27  ARG D NH1 1 
ATOM   9829  N  NH2 . ARG D 4  27  ? 89.482  107.960 14.460  1.00 60.34  ? 27  ARG D NH2 1 
ATOM   9830  N  N   . ARG D 4  28  ? 89.034  109.424 22.436  1.00 26.33  ? 28  ARG D N   1 
ATOM   9831  C  CA  . ARG D 4  28  ? 90.071  109.263 23.440  1.00 25.95  ? 28  ARG D CA  1 
ATOM   9832  C  C   . ARG D 4  28  ? 89.631  108.300 24.537  1.00 26.06  ? 28  ARG D C   1 
ATOM   9833  O  O   . ARG D 4  28  ? 90.136  107.190 24.662  1.00 27.44  ? 28  ARG D O   1 
ATOM   9834  C  CB  . ARG D 4  28  ? 90.402  110.612 24.107  1.00 22.23  ? 28  ARG D CB  1 
ATOM   9835  C  CG  . ARG D 4  28  ? 91.405  111.425 23.299  1.00 17.33  ? 28  ARG D CG  1 
ATOM   9836  C  CD  . ARG D 4  28  ? 91.624  112.777 23.924  1.00 29.52  ? 28  ARG D CD  1 
ATOM   9837  N  NE  . ARG D 4  28  ? 91.676  113.854 22.945  1.00 46.77  ? 28  ARG D NE  1 
ATOM   9838  C  CZ  . ARG D 4  28  ? 91.073  115.029 23.129  1.00 54.14  ? 28  ARG D CZ  1 
ATOM   9839  N  NH1 . ARG D 4  28  ? 90.396  115.214 24.255  1.00 58.89  ? 28  ARG D NH1 1 
ATOM   9840  N  NH2 . ARG D 4  28  ? 91.163  115.959 22.190  1.00 58.27  ? 28  ARG D NH2 1 
ATOM   9841  N  N   . GLY D 4  29  ? 88.667  108.742 25.329  1.00 27.08  ? 29  GLY D N   1 
ATOM   9842  C  CA  . GLY D 4  29  ? 88.105  108.008 26.429  1.00 27.72  ? 29  GLY D CA  1 
ATOM   9843  C  C   . GLY D 4  29  ? 87.714  106.578 26.142  1.00 31.81  ? 29  GLY D C   1 
ATOM   9844  O  O   . GLY D 4  29  ? 87.466  105.817 27.086  1.00 35.19  ? 29  GLY D O   1 
ATOM   9845  N  N   . PHE D 4  30  ? 87.447  106.233 24.889  1.00 33.12  ? 30  PHE D N   1 
ATOM   9846  C  CA  . PHE D 4  30  ? 87.108  104.881 24.497  1.00 30.88  ? 30  PHE D CA  1 
ATOM   9847  C  C   . PHE D 4  30  ? 88.348  103.995 24.666  1.00 34.13  ? 30  PHE D C   1 
ATOM   9848  O  O   . PHE D 4  30  ? 88.241  102.945 25.268  1.00 35.63  ? 30  PHE D O   1 
ATOM   9849  C  CB  . PHE D 4  30  ? 86.846  104.850 22.975  1.00 32.05  ? 30  PHE D CB  1 
ATOM   9850  C  CG  . PHE D 4  30  ? 86.468  103.446 22.581  1.00 37.77  ? 30  PHE D CG  1 
ATOM   9851  C  CD1 . PHE D 4  30  ? 85.235  102.961 22.974  1.00 48.44  ? 30  PHE D CD1 1 
ATOM   9852  C  CD2 . PHE D 4  30  ? 87.307  102.630 21.862  1.00 32.29  ? 30  PHE D CD2 1 
ATOM   9853  C  CE1 . PHE D 4  30  ? 84.847  101.682 22.672  1.00 50.69  ? 30  PHE D CE1 1 
ATOM   9854  C  CE2 . PHE D 4  30  ? 86.921  101.349 21.527  1.00 36.35  ? 30  PHE D CE2 1 
ATOM   9855  C  CZ  . PHE D 4  30  ? 85.683  100.875 21.927  1.00 45.91  ? 30  PHE D CZ  1 
ATOM   9856  N  N   . GLN D 4  31  ? 89.410  104.523 24.052  1.00 36.07  ? 31  GLN D N   1 
ATOM   9857  C  CA  . GLN D 4  31  ? 90.703  103.837 24.115  1.00 33.63  ? 31  GLN D CA  1 
ATOM   9858  C  C   . GLN D 4  31  ? 91.024  103.616 25.587  1.00 29.86  ? 31  GLN D C   1 
ATOM   9859  O  O   . GLN D 4  31  ? 90.920  102.448 26.020  1.00 30.54  ? 31  GLN D O   1 
ATOM   9860  C  CB  . GLN D 4  31  ? 91.723  104.572 23.270  1.00 44.74  ? 31  GLN D CB  1 
ATOM   9861  C  CG  . GLN D 4  31  ? 91.677  104.267 21.778  1.00 52.97  ? 31  GLN D CG  1 
ATOM   9862  C  CD  . GLN D 4  31  ? 92.026  102.821 21.470  1.00 63.14  ? 31  GLN D CD  1 
ATOM   9863  O  OE1 . GLN D 4  31  ? 92.033  101.958 22.356  1.00 63.02  ? 31  GLN D OE1 1 
ATOM   9864  N  NE2 . GLN D 4  31  ? 92.326  102.509 20.211  1.00 64.55  ? 31  GLN D NE2 1 
ATOM   9865  N  N   . VAL D 4  32  ? 90.962  104.664 26.421  1.00 21.78  ? 32  VAL D N   1 
ATOM   9866  C  CA  . VAL D 4  32  ? 91.109  104.528 27.858  1.00 18.89  ? 32  VAL D CA  1 
ATOM   9867  C  C   . VAL D 4  32  ? 90.350  103.307 28.389  1.00 18.97  ? 32  VAL D C   1 
ATOM   9868  O  O   . VAL D 4  32  ? 90.861  102.486 29.143  1.00 20.36  ? 32  VAL D O   1 
ATOM   9869  C  CB  . VAL D 4  32  ? 90.725  105.711 28.760  1.00 7.29   ? 32  VAL D CB  1 
ATOM   9870  C  CG1 . VAL D 4  32  ? 91.017  105.341 30.225  1.00 2.20   ? 32  VAL D CG1 1 
ATOM   9871  C  CG2 . VAL D 4  32  ? 91.524  106.969 28.490  1.00 7.17   ? 32  VAL D CG2 1 
ATOM   9872  N  N   . TYR D 4  33  ? 89.055  103.225 28.057  1.00 16.89  ? 33  TYR D N   1 
ATOM   9873  C  CA  . TYR D 4  33  ? 88.310  102.098 28.589  1.00 20.28  ? 33  TYR D CA  1 
ATOM   9874  C  C   . TYR D 4  33  ? 88.898  100.802 28.059  1.00 23.80  ? 33  TYR D C   1 
ATOM   9875  O  O   . TYR D 4  33  ? 89.232  99.869  28.798  1.00 24.82  ? 33  TYR D O   1 
ATOM   9876  C  CB  . TYR D 4  33  ? 86.798  102.215 28.378  1.00 17.27  ? 33  TYR D CB  1 
ATOM   9877  C  CG  . TYR D 4  33  ? 86.120  100.854 28.430  1.00 9.22   ? 33  TYR D CG  1 
ATOM   9878  C  CD1 . TYR D 4  33  ? 85.803  100.212 29.612  1.00 9.67   ? 33  TYR D CD1 1 
ATOM   9879  C  CD2 . TYR D 4  33  ? 85.972  100.141 27.261  1.00 4.71   ? 33  TYR D CD2 1 
ATOM   9880  C  CE1 . TYR D 4  33  ? 85.293  98.923  29.632  1.00 12.56  ? 33  TYR D CE1 1 
ATOM   9881  C  CE2 . TYR D 4  33  ? 85.458  98.862  27.263  1.00 15.18  ? 33  TYR D CE2 1 
ATOM   9882  C  CZ  . TYR D 4  33  ? 85.100  98.241  28.447  1.00 16.38  ? 33  TYR D CZ  1 
ATOM   9883  O  OH  . TYR D 4  33  ? 84.621  96.939  28.407  1.00 7.01   ? 33  TYR D OH  1 
ATOM   9884  N  N   . LYS D 4  34  ? 89.144  100.762 26.756  1.00 26.07  ? 34  LYS D N   1 
ATOM   9885  C  CA  . LYS D 4  34  ? 89.628  99.561  26.114  1.00 30.78  ? 34  LYS D CA  1 
ATOM   9886  C  C   . LYS D 4  34  ? 90.971  99.051  26.616  1.00 33.59  ? 34  LYS D C   1 
ATOM   9887  O  O   . LYS D 4  34  ? 91.247  97.845  26.596  1.00 36.86  ? 34  LYS D O   1 
ATOM   9888  C  CB  . LYS D 4  34  ? 89.859  99.816  24.613  1.00 27.34  ? 34  LYS D CB  1 
ATOM   9889  C  CG  . LYS D 4  34  ? 90.435  98.550  23.975  1.00 21.17  ? 34  LYS D CG  1 
ATOM   9890  C  CD  . LYS D 4  34  ? 91.417  98.923  22.875  1.00 21.90  ? 34  LYS D CD  1 
ATOM   9891  C  CE  . LYS D 4  34  ? 91.771  97.751  21.993  1.00 19.80  ? 34  LYS D CE  1 
ATOM   9892  N  NZ  . LYS D 4  34  ? 91.666  97.998  20.535  1.00 17.60  ? 34  LYS D NZ  1 
ATOM   9893  N  N   . GLN D 4  35  ? 91.878  99.981  26.901  1.00 31.18  ? 35  GLN D N   1 
ATOM   9894  C  CA  . GLN D 4  35  ? 93.197  99.528  27.343  1.00 27.77  ? 35  GLN D CA  1 
ATOM   9895  C  C   . GLN D 4  35  ? 93.266  99.456  28.850  1.00 24.84  ? 35  GLN D C   1 
ATOM   9896  O  O   . GLN D 4  35  ? 93.541  98.403  29.405  1.00 27.60  ? 35  GLN D O   1 
ATOM   9897  C  CB  . GLN D 4  35  ? 94.277  100.429 26.760  1.00 35.94  ? 35  GLN D CB  1 
ATOM   9898  C  CG  . GLN D 4  35  ? 94.326  100.427 25.242  1.00 47.46  ? 35  GLN D CG  1 
ATOM   9899  C  CD  . GLN D 4  35  ? 94.419  99.032  24.663  1.00 53.98  ? 35  GLN D CD  1 
ATOM   9900  O  OE1 . GLN D 4  35  ? 94.556  98.043  25.383  1.00 58.67  ? 35  GLN D OE1 1 
ATOM   9901  N  NE2 . GLN D 4  35  ? 94.349  98.922  23.341  1.00 57.35  ? 35  GLN D NE2 1 
ATOM   9902  N  N   . VAL D 4  36  ? 92.952  100.542 29.528  1.00 23.42  ? 36  VAL D N   1 
ATOM   9903  C  CA  . VAL D 4  36  ? 92.987  100.613 30.967  1.00 18.65  ? 36  VAL D CA  1 
ATOM   9904  C  C   . VAL D 4  36  ? 91.880  99.864  31.675  1.00 22.14  ? 36  VAL D C   1 
ATOM   9905  O  O   . VAL D 4  36  ? 92.078  99.535  32.844  1.00 24.69  ? 36  VAL D O   1 
ATOM   9906  C  CB  . VAL D 4  36  ? 92.928  102.095 31.404  1.00 11.73  ? 36  VAL D CB  1 
ATOM   9907  C  CG1 . VAL D 4  36  ? 92.989  102.169 32.910  1.00 9.46   ? 36  VAL D CG1 1 
ATOM   9908  C  CG2 . VAL D 4  36  ? 94.099  102.830 30.768  1.00 8.46   ? 36  VAL D CG2 1 
ATOM   9909  N  N   . CYS D 4  37  ? 90.715  99.642  31.075  1.00 25.95  ? 37  CYS D N   1 
ATOM   9910  C  CA  . CYS D 4  37  ? 89.554  99.167  31.823  1.00 30.36  ? 37  CYS D CA  1 
ATOM   9911  C  C   . CYS D 4  37  ? 89.008  97.808  31.435  1.00 32.29  ? 37  CYS D C   1 
ATOM   9912  O  O   . CYS D 4  37  ? 88.725  96.953  32.297  1.00 29.05  ? 37  CYS D O   1 
ATOM   9913  C  CB  . CYS D 4  37  ? 88.448  100.238 31.719  1.00 26.47  ? 37  CYS D CB  1 
ATOM   9914  S  SG  . CYS D 4  37  ? 88.567  101.463 33.032  1.00 29.42  ? 37  CYS D SG  1 
ATOM   9915  N  N   . SER D 4  38  ? 88.838  97.600  30.140  1.00 30.58  ? 38  SER D N   1 
ATOM   9916  C  CA  . SER D 4  38  ? 88.376  96.381  29.521  1.00 29.16  ? 38  SER D CA  1 
ATOM   9917  C  C   . SER D 4  38  ? 88.745  95.121  30.289  1.00 27.18  ? 38  SER D C   1 
ATOM   9918  O  O   . SER D 4  38  ? 88.060  94.097  30.232  1.00 17.30  ? 38  SER D O   1 
ATOM   9919  C  CB  . SER D 4  38  ? 89.001  96.333  28.108  1.00 35.70  ? 38  SER D CB  1 
ATOM   9920  O  OG  . SER D 4  38  ? 90.401  96.529  28.223  1.00 45.13  ? 38  SER D OG  1 
ATOM   9921  N  N   . SER D 4  39  ? 89.901  95.117  30.925  1.00 31.05  ? 39  SER D N   1 
ATOM   9922  C  CA  . SER D 4  39  ? 90.475  94.078  31.733  1.00 34.94  ? 39  SER D CA  1 
ATOM   9923  C  C   . SER D 4  39  ? 89.552  93.537  32.816  1.00 36.25  ? 39  SER D C   1 
ATOM   9924  O  O   . SER D 4  39  ? 89.478  92.322  32.999  1.00 34.97  ? 39  SER D O   1 
ATOM   9925  C  CB  . SER D 4  39  ? 91.748  94.617  32.427  1.00 35.27  ? 39  SER D CB  1 
ATOM   9926  O  OG  . SER D 4  39  ? 91.374  95.485  33.483  1.00 37.54  ? 39  SER D OG  1 
ATOM   9927  N  N   . CYS D 4  40  ? 88.938  94.419  33.611  1.00 37.73  ? 40  CYS D N   1 
ATOM   9928  C  CA  . CYS D 4  40  ? 88.102  93.940  34.697  1.00 38.60  ? 40  CYS D CA  1 
ATOM   9929  C  C   . CYS D 4  40  ? 86.630  94.311  34.605  1.00 41.40  ? 40  CYS D C   1 
ATOM   9930  O  O   . CYS D 4  40  ? 85.750  93.548  35.059  1.00 41.49  ? 40  CYS D O   1 
ATOM   9931  C  CB  . CYS D 4  40  ? 88.685  94.253  36.056  1.00 40.04  ? 40  CYS D CB  1 
ATOM   9932  S  SG  . CYS D 4  40  ? 90.167  95.261  36.196  1.00 34.97  ? 40  CYS D SG  1 
ATOM   9933  N  N   . HIS D 4  41  ? 86.297  95.458  34.011  1.00 42.11  ? 41  HIS D N   1 
ATOM   9934  C  CA  . HIS D 4  41  ? 84.919  95.925  33.903  1.00 36.73  ? 41  HIS D CA  1 
ATOM   9935  C  C   . HIS D 4  41  ? 84.332  95.698  32.506  1.00 30.09  ? 41  HIS D C   1 
ATOM   9936  O  O   . HIS D 4  41  ? 84.839  96.347  31.587  1.00 32.73  ? 41  HIS D O   1 
ATOM   9937  C  CB  . HIS D 4  41  ? 84.816  97.436  34.126  1.00 34.24  ? 41  HIS D CB  1 
ATOM   9938  C  CG  . HIS D 4  41  ? 85.185  97.985  35.451  1.00 33.04  ? 41  HIS D CG  1 
ATOM   9939  N  ND1 . HIS D 4  41  ? 84.826  97.436  36.645  1.00 34.35  ? 41  HIS D ND1 1 
ATOM   9940  C  CD2 . HIS D 4  41  ? 85.887  99.098  35.786  1.00 37.24  ? 41  HIS D CD2 1 
ATOM   9941  C  CE1 . HIS D 4  41  ? 85.288  98.180  37.638  1.00 38.95  ? 41  HIS D CE1 1 
ATOM   9942  N  NE2 . HIS D 4  41  ? 85.967  99.208  37.163  1.00 36.54  ? 41  HIS D NE2 1 
ATOM   9943  N  N   . SER D 4  42  ? 83.074  95.281  32.438  1.00 28.01  ? 42  SER D N   1 
ATOM   9944  C  CA  . SER D 4  42  ? 82.412  95.126  31.153  1.00 26.13  ? 42  SER D CA  1 
ATOM   9945  C  C   . SER D 4  42  ? 81.570  96.303  30.706  1.00 22.89  ? 42  SER D C   1 
ATOM   9946  O  O   . SER D 4  42  ? 81.315  97.257  31.437  1.00 21.06  ? 42  SER D O   1 
ATOM   9947  C  CB  . SER D 4  42  ? 81.495  93.889  31.205  1.00 27.22  ? 42  SER D CB  1 
ATOM   9948  O  OG  . SER D 4  42  ? 81.148  93.646  32.566  1.00 24.88  ? 42  SER D OG  1 
ATOM   9949  N  N   . MET D 4  43  ? 81.035  96.159  29.492  1.00 22.18  ? 43  MET D N   1 
ATOM   9950  C  CA  . MET D 4  43  ? 80.105  97.143  28.953  1.00 21.88  ? 43  MET D CA  1 
ATOM   9951  C  C   . MET D 4  43  ? 79.124  96.413  28.045  1.00 22.52  ? 43  MET D C   1 
ATOM   9952  O  O   . MET D 4  43  ? 79.300  96.471  26.840  1.00 25.71  ? 43  MET D O   1 
ATOM   9953  C  CB  . MET D 4  43  ? 80.818  98.289  28.268  1.00 10.09  ? 43  MET D CB  1 
ATOM   9954  C  CG  . MET D 4  43  ? 81.187  99.438  29.191  1.00 14.25  ? 43  MET D CG  1 
ATOM   9955  S  SD  . MET D 4  43  ? 81.362  101.021 28.343  1.00 28.64  ? 43  MET D SD  1 
ATOM   9956  C  CE  . MET D 4  43  ? 82.062  100.453 26.803  1.00 21.77  ? 43  MET D CE  1 
ATOM   9957  N  N   . ASP D 4  44  ? 78.177  95.689  28.624  1.00 24.67  ? 44  ASP D N   1 
ATOM   9958  C  CA  . ASP D 4  44  ? 77.342  94.768  27.894  1.00 25.83  ? 44  ASP D CA  1 
ATOM   9959  C  C   . ASP D 4  44  ? 76.445  95.352  26.831  1.00 24.44  ? 44  ASP D C   1 
ATOM   9960  O  O   . ASP D 4  44  ? 76.287  94.739  25.775  1.00 17.27  ? 44  ASP D O   1 
ATOM   9961  C  CB  . ASP D 4  44  ? 76.499  93.969  28.898  1.00 33.68  ? 44  ASP D CB  1 
ATOM   9962  C  CG  . ASP D 4  44  ? 77.262  92.743  29.370  1.00 40.56  ? 44  ASP D CG  1 
ATOM   9963  O  OD1 . ASP D 4  44  ? 77.251  91.737  28.628  1.00 46.65  ? 44  ASP D OD1 1 
ATOM   9964  O  OD2 . ASP D 4  44  ? 77.848  92.842  30.462  1.00 37.87  ? 44  ASP D OD2 1 
ATOM   9965  N  N   . TYR D 4  45  ? 75.831  96.503  27.121  1.00 25.57  ? 45  TYR D N   1 
ATOM   9966  C  CA  . TYR D 4  45  ? 74.917  97.096  26.145  1.00 29.99  ? 45  TYR D CA  1 
ATOM   9967  C  C   . TYR D 4  45  ? 75.666  97.811  25.042  1.00 32.24  ? 45  TYR D C   1 
ATOM   9968  O  O   . TYR D 4  45  ? 75.087  98.300  24.027  1.00 37.05  ? 45  TYR D O   1 
ATOM   9969  C  CB  . TYR D 4  45  ? 73.862  98.014  26.803  1.00 22.18  ? 45  TYR D CB  1 
ATOM   9970  C  CG  . TYR D 4  45  ? 73.270  97.243  27.970  1.00 16.97  ? 45  TYR D CG  1 
ATOM   9971  C  CD1 . TYR D 4  45  ? 72.406  96.186  27.758  1.00 9.09   ? 45  TYR D CD1 1 
ATOM   9972  C  CD2 . TYR D 4  45  ? 73.723  97.457  29.260  1.00 18.32  ? 45  TYR D CD2 1 
ATOM   9973  C  CE1 . TYR D 4  45  ? 71.966  95.428  28.820  1.00 5.51   ? 45  TYR D CE1 1 
ATOM   9974  C  CE2 . TYR D 4  45  ? 73.255  96.732  30.332  1.00 8.69   ? 45  TYR D CE2 1 
ATOM   9975  C  CZ  . TYR D 4  45  ? 72.380  95.702  30.094  1.00 6.65   ? 45  TYR D CZ  1 
ATOM   9976  O  OH  . TYR D 4  45  ? 71.975  94.921  31.155  1.00 16.01  ? 45  TYR D OH  1 
ATOM   9977  N  N   . VAL D 4  46  ? 76.982  97.883  25.214  1.00 33.16  ? 46  VAL D N   1 
ATOM   9978  C  CA  . VAL D 4  46  ? 77.830  98.506  24.244  1.00 30.77  ? 46  VAL D CA  1 
ATOM   9979  C  C   . VAL D 4  46  ? 78.216  97.593  23.102  1.00 31.99  ? 46  VAL D C   1 
ATOM   9980  O  O   . VAL D 4  46  ? 78.880  96.578  23.241  1.00 36.72  ? 46  VAL D O   1 
ATOM   9981  C  CB  . VAL D 4  46  ? 79.131  99.092  24.793  1.00 33.67  ? 46  VAL D CB  1 
ATOM   9982  C  CG1 . VAL D 4  46  ? 79.826  99.630  23.547  1.00 36.29  ? 46  VAL D CG1 1 
ATOM   9983  C  CG2 . VAL D 4  46  ? 78.824  100.296 25.676  1.00 42.22  ? 46  VAL D CG2 1 
ATOM   9984  N  N   . ALA D 4  47  ? 77.646  97.936  21.951  1.00 34.09  ? 47  ALA D N   1 
ATOM   9985  C  CA  . ALA D 4  47  ? 78.023  97.131  20.768  1.00 30.17  ? 47  ALA D CA  1 
ATOM   9986  C  C   . ALA D 4  47  ? 79.282  97.863  20.289  1.00 33.89  ? 47  ALA D C   1 
ATOM   9987  O  O   . ALA D 4  47  ? 79.639  98.914  20.854  1.00 34.92  ? 47  ALA D O   1 
ATOM   9988  C  CB  . ALA D 4  47  ? 76.950  97.066  19.725  1.00 32.67  ? 47  ALA D CB  1 
ATOM   9989  N  N   . TYR D 4  48  ? 79.803  97.448  19.146  1.00 34.15  ? 48  TYR D N   1 
ATOM   9990  C  CA  . TYR D 4  48  ? 80.981  98.100  18.578  1.00 34.39  ? 48  TYR D CA  1 
ATOM   9991  C  C   . TYR D 4  48  ? 80.598  99.317  17.757  1.00 38.14  ? 48  TYR D C   1 
ATOM   9992  O  O   . TYR D 4  48  ? 81.433  99.960  17.106  1.00 40.55  ? 48  TYR D O   1 
ATOM   9993  C  CB  . TYR D 4  48  ? 81.932  97.107  17.922  1.00 28.00  ? 48  TYR D CB  1 
ATOM   9994  C  CG  . TYR D 4  48  ? 83.053  96.549  18.789  1.00 32.92  ? 48  TYR D CG  1 
ATOM   9995  C  CD1 . TYR D 4  48  ? 82.870  95.483  19.665  1.00 39.62  ? 48  TYR D CD1 1 
ATOM   9996  C  CD2 . TYR D 4  48  ? 84.332  97.111  18.784  1.00 31.40  ? 48  TYR D CD2 1 
ATOM   9997  C  CE1 . TYR D 4  48  ? 83.865  94.991  20.496  1.00 40.11  ? 48  TYR D CE1 1 
ATOM   9998  C  CE2 . TYR D 4  48  ? 85.339  96.626  19.599  1.00 37.93  ? 48  TYR D CE2 1 
ATOM   9999  C  CZ  . TYR D 4  48  ? 85.115  95.572  20.459  1.00 40.29  ? 48  TYR D CZ  1 
ATOM   10000 O  OH  . TYR D 4  48  ? 86.083  95.102  21.309  1.00 41.29  ? 48  TYR D OH  1 
ATOM   10001 N  N   . ARG D 4  49  ? 79.352  99.769  17.847  1.00 41.67  ? 49  ARG D N   1 
ATOM   10002 C  CA  . ARG D 4  49  ? 78.690  100.907 17.267  1.00 35.50  ? 49  ARG D CA  1 
ATOM   10003 C  C   . ARG D 4  49  ? 79.098  102.305 17.749  1.00 34.53  ? 49  ARG D C   1 
ATOM   10004 O  O   . ARG D 4  49  ? 78.295  103.049 18.321  1.00 23.45  ? 49  ARG D O   1 
ATOM   10005 C  CB  . ARG D 4  49  ? 77.180  100.792 17.543  1.00 35.81  ? 49  ARG D CB  1 
ATOM   10006 C  CG  . ARG D 4  49  ? 76.822  100.926 19.032  1.00 35.12  ? 49  ARG D CG  1 
ATOM   10007 C  CD  . ARG D 4  49  ? 75.382  100.530 19.276  1.00 36.87  ? 49  ARG D CD  1 
ATOM   10008 N  NE  . ARG D 4  49  ? 74.974  100.768 20.653  1.00 47.49  ? 49  ARG D NE  1 
ATOM   10009 C  CZ  . ARG D 4  49  ? 73.716  100.444 21.024  1.00 60.83  ? 49  ARG D CZ  1 
ATOM   10010 N  NH1 . ARG D 4  49  ? 72.977  99.921  20.041  1.00 63.05  ? 49  ARG D NH1 1 
ATOM   10011 N  NH2 . ARG D 4  49  ? 73.296  100.646 22.265  1.00 62.52  ? 49  ARG D NH2 1 
ATOM   10012 N  N   . HIS D 4  50  ? 80.325  102.668 17.400  1.00 35.46  ? 50  HIS D N   1 
ATOM   10013 C  CA  . HIS D 4  50  ? 80.891  103.982 17.663  1.00 40.44  ? 50  HIS D CA  1 
ATOM   10014 C  C   . HIS D 4  50  ? 80.796  104.810 16.374  1.00 41.28  ? 50  HIS D C   1 
ATOM   10015 O  O   . HIS D 4  50  ? 80.879  106.029 16.346  1.00 39.62  ? 50  HIS D O   1 
ATOM   10016 C  CB  . HIS D 4  50  ? 82.408  103.841 17.905  1.00 48.34  ? 50  HIS D CB  1 
ATOM   10017 C  CG  . HIS D 4  50  ? 82.744  102.715 18.813  1.00 52.27  ? 50  HIS D CG  1 
ATOM   10018 N  ND1 . HIS D 4  50  ? 82.509  102.747 20.163  1.00 52.79  ? 50  HIS D ND1 1 
ATOM   10019 C  CD2 . HIS D 4  50  ? 83.316  101.519 18.541  1.00 54.57  ? 50  HIS D CD2 1 
ATOM   10020 C  CE1 . HIS D 4  50  ? 82.895  101.590 20.662  1.00 55.34  ? 50  HIS D CE1 1 
ATOM   10021 N  NE2 . HIS D 4  50  ? 83.405  100.825 19.723  1.00 51.74  ? 50  HIS D NE2 1 
ATOM   10022 N  N   . LEU D 4  51  ? 80.847  104.032 15.295  1.00 41.52  ? 51  LEU D N   1 
ATOM   10023 C  CA  . LEU D 4  51  ? 81.035  104.627 13.995  1.00 46.06  ? 51  LEU D CA  1 
ATOM   10024 C  C   . LEU D 4  51  ? 80.700  106.103 13.954  1.00 47.05  ? 51  LEU D C   1 
ATOM   10025 O  O   . LEU D 4  51  ? 81.546  106.980 13.806  1.00 54.61  ? 51  LEU D O   1 
ATOM   10026 C  CB  . LEU D 4  51  ? 80.176  103.908 12.962  1.00 41.85  ? 51  LEU D CB  1 
ATOM   10027 C  CG  . LEU D 4  51  ? 79.915  102.442 13.276  1.00 44.13  ? 51  LEU D CG  1 
ATOM   10028 C  CD1 . LEU D 4  51  ? 78.787  101.936 12.386  1.00 48.72  ? 51  LEU D CD1 1 
ATOM   10029 C  CD2 . LEU D 4  51  ? 81.121  101.538 13.143  1.00 50.27  ? 51  LEU D CD2 1 
ATOM   10030 N  N   . VAL D 4  52  ? 79.406  106.351 13.989  1.00 45.46  ? 52  VAL D N   1 
ATOM   10031 C  CA  . VAL D 4  52  ? 79.001  107.753 13.858  1.00 50.02  ? 52  VAL D CA  1 
ATOM   10032 C  C   . VAL D 4  52  ? 78.911  108.454 15.195  1.00 47.84  ? 52  VAL D C   1 
ATOM   10033 O  O   . VAL D 4  52  ? 78.899  109.678 15.268  1.00 43.65  ? 52  VAL D O   1 
ATOM   10034 C  CB  . VAL D 4  52  ? 77.655  107.785 13.101  1.00 61.02  ? 52  VAL D CB  1 
ATOM   10035 C  CG1 . VAL D 4  52  ? 77.250  109.222 12.813  1.00 56.64  ? 52  VAL D CG1 1 
ATOM   10036 C  CG2 . VAL D 4  52  ? 77.717  106.975 11.810  1.00 61.61  ? 52  VAL D CG2 1 
ATOM   10037 N  N   . GLY D 4  53  ? 78.790  107.648 16.244  1.00 51.16  ? 53  GLY D N   1 
ATOM   10038 C  CA  . GLY D 4  53  ? 78.602  108.162 17.596  1.00 56.05  ? 53  GLY D CA  1 
ATOM   10039 C  C   . GLY D 4  53  ? 79.980  108.489 18.159  1.00 57.52  ? 53  GLY D C   1 
ATOM   10040 O  O   . GLY D 4  53  ? 80.092  109.214 19.137  1.00 59.96  ? 53  GLY D O   1 
ATOM   10041 N  N   . VAL D 4  54  ? 81.004  107.934 17.513  1.00 58.27  ? 54  VAL D N   1 
ATOM   10042 C  CA  . VAL D 4  54  ? 82.365  108.119 17.987  1.00 60.25  ? 54  VAL D CA  1 
ATOM   10043 C  C   . VAL D 4  54  ? 83.327  108.617 16.934  1.00 63.46  ? 54  VAL D C   1 
ATOM   10044 O  O   . VAL D 4  54  ? 84.550  108.688 17.117  1.00 63.66  ? 54  VAL D O   1 
ATOM   10045 C  CB  . VAL D 4  54  ? 82.967  106.832 18.579  1.00 54.45  ? 54  VAL D CB  1 
ATOM   10046 C  CG1 . VAL D 4  54  ? 84.330  107.137 19.180  1.00 45.80  ? 54  VAL D CG1 1 
ATOM   10047 C  CG2 . VAL D 4  54  ? 82.093  106.280 19.697  1.00 59.62  ? 54  VAL D CG2 1 
ATOM   10048 N  N   . CYS D 4  55  ? 82.825  108.818 15.722  1.00 67.05  ? 55  CYS D N   1 
ATOM   10049 C  CA  . CYS D 4  55  ? 83.673  109.258 14.644  1.00 65.44  ? 55  CYS D CA  1 
ATOM   10050 C  C   . CYS D 4  55  ? 84.643  108.224 14.135  1.00 60.58  ? 55  CYS D C   1 
ATOM   10051 O  O   . CYS D 4  55  ? 85.471  108.522 13.278  1.00 66.51  ? 55  CYS D O   1 
ATOM   10052 C  CB  . CYS D 4  55  ? 84.392  110.586 14.898  1.00 70.25  ? 55  CYS D CB  1 
ATOM   10053 S  SG  . CYS D 4  55  ? 83.991  111.518 13.366  1.00 77.92  ? 55  CYS D SG  1 
ATOM   10054 N  N   . TYR D 4  56  ? 84.466  107.001 14.646  1.00 50.75  ? 56  TYR D N   1 
ATOM   10055 C  CA  . TYR D 4  56  ? 85.207  105.911 14.050  1.00 42.88  ? 56  TYR D CA  1 
ATOM   10056 C  C   . TYR D 4  56  ? 84.485  105.458 12.790  1.00 34.88  ? 56  TYR D C   1 
ATOM   10057 O  O   . TYR D 4  56  ? 83.329  105.110 12.805  1.00 26.04  ? 56  TYR D O   1 
ATOM   10058 C  CB  . TYR D 4  56  ? 85.325  104.683 14.936  1.00 48.51  ? 56  TYR D CB  1 
ATOM   10059 C  CG  . TYR D 4  56  ? 86.387  104.864 15.994  1.00 57.15  ? 56  TYR D CG  1 
ATOM   10060 C  CD1 . TYR D 4  56  ? 87.742  104.768 15.763  1.00 56.08  ? 56  TYR D CD1 1 
ATOM   10061 C  CD2 . TYR D 4  56  ? 85.959  105.155 17.285  1.00 59.41  ? 56  TYR D CD2 1 
ATOM   10062 C  CE1 . TYR D 4  56  ? 88.675  104.952 16.759  1.00 56.59  ? 56  TYR D CE1 1 
ATOM   10063 C  CE2 . TYR D 4  56  ? 86.881  105.327 18.294  1.00 59.89  ? 56  TYR D CE2 1 
ATOM   10064 C  CZ  . TYR D 4  56  ? 88.229  105.228 18.028  1.00 58.73  ? 56  TYR D CZ  1 
ATOM   10065 O  OH  . TYR D 4  56  ? 89.104  105.419 19.071  1.00 61.50  ? 56  TYR D OH  1 
ATOM   10066 N  N   . THR D 4  57  ? 85.206  105.253 11.708  1.00 29.69  ? 57  THR D N   1 
ATOM   10067 C  CA  . THR D 4  57  ? 84.512  104.719 10.539  1.00 22.64  ? 57  THR D CA  1 
ATOM   10068 C  C   . THR D 4  57  ? 83.909  103.362 10.790  1.00 19.54  ? 57  THR D C   1 
ATOM   10069 O  O   . THR D 4  57  ? 84.125  102.730 11.809  1.00 14.45  ? 57  THR D O   1 
ATOM   10070 C  CB  . THR D 4  57  ? 85.567  104.729 9.418   1.00 22.83  ? 57  THR D CB  1 
ATOM   10071 O  OG1 . THR D 4  57  ? 85.799  106.134 9.150   1.00 14.20  ? 57  THR D OG1 1 
ATOM   10072 C  CG2 . THR D 4  57  ? 85.165  103.974 8.175   1.00 23.56  ? 57  THR D CG2 1 
ATOM   10073 N  N   . GLU D 4  58  ? 83.045  102.967 9.865   1.00 21.44  ? 58  GLU D N   1 
ATOM   10074 C  CA  . GLU D 4  58  ? 82.565  101.602 9.733   1.00 25.15  ? 58  GLU D CA  1 
ATOM   10075 C  C   . GLU D 4  58  ? 83.747  100.678 9.456   1.00 28.31  ? 58  GLU D C   1 
ATOM   10076 O  O   . GLU D 4  58  ? 83.885  99.628  10.080  1.00 27.11  ? 58  GLU D O   1 
ATOM   10077 C  CB  . GLU D 4  58  ? 81.514  101.562 8.645   1.00 21.12  ? 58  GLU D CB  1 
ATOM   10078 C  CG  . GLU D 4  58  ? 80.627  100.335 8.553   1.00 24.48  ? 58  GLU D CG  1 
ATOM   10079 C  CD  . GLU D 4  58  ? 79.784  100.402 7.286   1.00 28.69  ? 58  GLU D CD  1 
ATOM   10080 O  OE1 . GLU D 4  58  ? 79.490  101.550 6.877   1.00 29.07  ? 58  GLU D OE1 1 
ATOM   10081 O  OE2 . GLU D 4  58  ? 79.449  99.343  6.721   1.00 29.07  ? 58  GLU D OE2 1 
ATOM   10082 N  N   . ASP D 4  59  ? 84.673  101.108 8.607   1.00 34.39  ? 59  ASP D N   1 
ATOM   10083 C  CA  . ASP D 4  59  ? 85.881  100.339 8.294   1.00 39.47  ? 59  ASP D CA  1 
ATOM   10084 C  C   . ASP D 4  59  ? 86.828  100.421 9.496   1.00 37.65  ? 59  ASP D C   1 
ATOM   10085 O  O   . ASP D 4  59  ? 87.559  99.519  9.890   1.00 31.80  ? 59  ASP D O   1 
ATOM   10086 C  CB  . ASP D 4  59  ? 86.567  100.859 7.033   1.00 53.40  ? 59  ASP D CB  1 
ATOM   10087 C  CG  . ASP D 4  59  ? 85.708  100.853 5.784   1.00 62.68  ? 59  ASP D CG  1 
ATOM   10088 O  OD1 . ASP D 4  59  ? 84.660  100.169 5.754   1.00 64.58  ? 59  ASP D OD1 1 
ATOM   10089 O  OD2 . ASP D 4  59  ? 86.096  101.563 4.821   1.00 66.09  ? 59  ASP D OD2 1 
ATOM   10090 N  N   . GLU D 4  60  ? 86.754  101.602 10.120  1.00 38.45  ? 60  GLU D N   1 
ATOM   10091 C  CA  . GLU D 4  60  ? 87.603  101.863 11.275  1.00 40.34  ? 60  GLU D CA  1 
ATOM   10092 C  C   . GLU D 4  60  ? 87.227  100.890 12.377  1.00 43.30  ? 60  GLU D C   1 
ATOM   10093 O  O   . GLU D 4  60  ? 88.006  100.017 12.722  1.00 46.73  ? 60  GLU D O   1 
ATOM   10094 C  CB  . GLU D 4  60  ? 87.542  103.317 11.718  1.00 35.33  ? 60  GLU D CB  1 
ATOM   10095 C  CG  . GLU D 4  60  ? 88.632  103.750 12.673  1.00 42.11  ? 60  GLU D CG  1 
ATOM   10096 C  CD  . GLU D 4  60  ? 88.682  105.222 13.008  1.00 44.16  ? 60  GLU D CD  1 
ATOM   10097 O  OE1 . GLU D 4  60  ? 87.873  105.979 12.432  1.00 42.20  ? 60  GLU D OE1 1 
ATOM   10098 O  OE2 . GLU D 4  60  ? 89.482  105.688 13.867  1.00 42.06  ? 60  GLU D OE2 1 
ATOM   10099 N  N   . ALA D 4  61  ? 85.996  101.016 12.861  1.00 47.89  ? 61  ALA D N   1 
ATOM   10100 C  CA  . ALA D 4  61  ? 85.506  100.183 13.945  1.00 46.99  ? 61  ALA D CA  1 
ATOM   10101 C  C   . ALA D 4  61  ? 85.312  98.746  13.517  1.00 46.53  ? 61  ALA D C   1 
ATOM   10102 O  O   . ALA D 4  61  ? 85.457  97.851  14.350  1.00 44.62  ? 61  ALA D O   1 
ATOM   10103 C  CB  . ALA D 4  61  ? 84.228  100.766 14.511  1.00 51.80  ? 61  ALA D CB  1 
ATOM   10104 N  N   . LYS D 4  62  ? 85.005  98.529  12.232  1.00 46.80  ? 62  LYS D N   1 
ATOM   10105 C  CA  . LYS D 4  62  ? 84.943  97.106  11.835  1.00 49.76  ? 62  LYS D CA  1 
ATOM   10106 C  C   . LYS D 4  62  ? 86.289  96.501  12.239  1.00 54.30  ? 62  LYS D C   1 
ATOM   10107 O  O   . LYS D 4  62  ? 86.332  95.609  13.096  1.00 54.49  ? 62  LYS D O   1 
ATOM   10108 C  CB  . LYS D 4  62  ? 84.588  96.895  10.388  1.00 34.43  ? 62  LYS D CB  1 
ATOM   10109 C  CG  . LYS D 4  62  ? 84.549  95.477  9.883   1.00 31.49  ? 62  LYS D CG  1 
ATOM   10110 C  CD  . LYS D 4  62  ? 83.889  95.389  8.510   1.00 39.37  ? 62  LYS D CD  1 
ATOM   10111 C  CE  . LYS D 4  62  ? 84.586  94.360  7.634   1.00 47.49  ? 62  LYS D CE  1 
ATOM   10112 N  NZ  . LYS D 4  62  ? 85.127  95.003  6.393   1.00 53.76  ? 62  LYS D NZ  1 
ATOM   10113 N  N   . ALA D 4  63  ? 87.390  97.076  11.757  1.00 56.44  ? 63  ALA D N   1 
ATOM   10114 C  CA  . ALA D 4  63  ? 88.725  96.584  12.078  1.00 56.70  ? 63  ALA D CA  1 
ATOM   10115 C  C   . ALA D 4  63  ? 89.036  96.594  13.563  1.00 55.21  ? 63  ALA D C   1 
ATOM   10116 O  O   . ALA D 4  63  ? 89.659  95.662  14.087  1.00 57.22  ? 63  ALA D O   1 
ATOM   10117 C  CB  . ALA D 4  63  ? 89.765  97.317  11.248  1.00 62.40  ? 63  ALA D CB  1 
ATOM   10118 N  N   . LEU D 4  64  ? 88.597  97.604  14.300  1.00 52.19  ? 64  LEU D N   1 
ATOM   10119 C  CA  . LEU D 4  64  ? 88.791  97.681  15.748  1.00 50.33  ? 64  LEU D CA  1 
ATOM   10120 C  C   . LEU D 4  64  ? 88.002  96.563  16.439  1.00 50.51  ? 64  LEU D C   1 
ATOM   10121 O  O   . LEU D 4  64  ? 88.337  95.958  17.441  1.00 51.09  ? 64  LEU D O   1 
ATOM   10122 C  CB  . LEU D 4  64  ? 88.237  99.013  16.264  1.00 45.76  ? 64  LEU D CB  1 
ATOM   10123 C  CG  . LEU D 4  64  ? 88.644  99.409  17.678  1.00 45.73  ? 64  LEU D CG  1 
ATOM   10124 C  CD1 . LEU D 4  64  ? 89.800  100.413 17.635  1.00 50.39  ? 64  LEU D CD1 1 
ATOM   10125 C  CD2 . LEU D 4  64  ? 87.470  100.027 18.427  1.00 47.91  ? 64  LEU D CD2 1 
ATOM   10126 N  N   . ALA D 4  65  ? 86.821  96.359  15.857  1.00 50.05  ? 65  ALA D N   1 
ATOM   10127 C  CA  . ALA D 4  65  ? 85.916  95.329  16.323  1.00 49.41  ? 65  ALA D CA  1 
ATOM   10128 C  C   . ALA D 4  65  ? 86.539  93.966  16.063  1.00 48.94  ? 65  ALA D C   1 
ATOM   10129 O  O   . ALA D 4  65  ? 86.453  93.083  16.902  1.00 42.51  ? 65  ALA D O   1 
ATOM   10130 C  CB  . ALA D 4  65  ? 84.582  95.401  15.589  1.00 52.62  ? 65  ALA D CB  1 
ATOM   10131 N  N   . GLU D 4  66  ? 87.086  93.785  14.869  1.00 54.81  ? 66  GLU D N   1 
ATOM   10132 C  CA  . GLU D 4  66  ? 87.582  92.491  14.421  1.00 63.24  ? 66  GLU D CA  1 
ATOM   10133 C  C   . GLU D 4  66  ? 88.669  91.897  15.305  1.00 64.91  ? 66  GLU D C   1 
ATOM   10134 O  O   . GLU D 4  66  ? 88.785  90.689  15.505  1.00 64.46  ? 66  GLU D O   1 
ATOM   10135 C  CB  . GLU D 4  66  ? 88.184  92.570  13.015  1.00 67.04  ? 66  GLU D CB  1 
ATOM   10136 C  CG  . GLU D 4  66  ? 87.320  93.260  11.989  1.00 76.89  ? 66  GLU D CG  1 
ATOM   10137 C  CD  . GLU D 4  66  ? 87.791  93.024  10.572  1.00 79.04  ? 66  GLU D CD  1 
ATOM   10138 O  OE1 . GLU D 4  66  ? 89.005  92.802  10.374  1.00 83.06  ? 66  GLU D OE1 1 
ATOM   10139 O  OE2 . GLU D 4  66  ? 86.947  93.056  9.652   1.00 77.68  ? 66  GLU D OE2 1 
ATOM   10140 N  N   . GLU D 4  67  ? 89.636  92.737  15.670  1.00 66.93  ? 67  GLU D N   1 
ATOM   10141 C  CA  . GLU D 4  67  ? 90.723  92.260  16.517  1.00 67.80  ? 67  GLU D CA  1 
ATOM   10142 C  C   . GLU D 4  67  ? 90.194  91.927  17.901  1.00 69.47  ? 67  GLU D C   1 
ATOM   10143 O  O   . GLU D 4  67  ? 90.648  90.987  18.542  1.00 67.95  ? 67  GLU D O   1 
ATOM   10144 C  CB  . GLU D 4  67  ? 91.804  93.325  16.673  1.00 70.25  ? 67  GLU D CB  1 
ATOM   10145 C  CG  . GLU D 4  67  ? 91.291  94.728  16.903  1.00 69.53  ? 67  GLU D CG  1 
ATOM   10146 C  CD  . GLU D 4  67  ? 92.293  95.625  17.597  1.00 72.64  ? 67  GLU D CD  1 
ATOM   10147 O  OE1 . GLU D 4  67  ? 92.531  95.390  18.798  1.00 71.79  ? 67  GLU D OE1 1 
ATOM   10148 O  OE2 . GLU D 4  67  ? 92.858  96.566  16.995  1.00 74.16  ? 67  GLU D OE2 1 
ATOM   10149 N  N   . VAL D 4  68  ? 89.216  92.727  18.345  1.00 72.48  ? 68  VAL D N   1 
ATOM   10150 C  CA  . VAL D 4  68  ? 88.685  92.359  19.659  1.00 73.22  ? 68  VAL D CA  1 
ATOM   10151 C  C   . VAL D 4  68  ? 88.003  91.010  19.557  1.00 72.09  ? 68  VAL D C   1 
ATOM   10152 O  O   . VAL D 4  68  ? 88.188  90.168  20.442  1.00 71.92  ? 68  VAL D O   1 
ATOM   10153 C  CB  . VAL D 4  68  ? 87.793  93.430  20.265  1.00 76.71  ? 68  VAL D CB  1 
ATOM   10154 C  CG1 . VAL D 4  68  ? 87.717  93.122  21.762  1.00 75.89  ? 68  VAL D CG1 1 
ATOM   10155 C  CG2 . VAL D 4  68  ? 88.427  94.810  20.055  1.00 74.39  ? 68  VAL D CG2 1 
ATOM   10156 N  N   . GLU D 4  69  ? 87.423  90.674  18.398  1.00 70.90  ? 69  GLU D N   1 
ATOM   10157 C  CA  . GLU D 4  69  ? 86.897  89.309  18.330  1.00 71.63  ? 69  GLU D CA  1 
ATOM   10158 C  C   . GLU D 4  69  ? 87.979  88.292  18.058  1.00 72.29  ? 69  GLU D C   1 
ATOM   10159 O  O   . GLU D 4  69  ? 87.855  87.106  18.405  1.00 69.04  ? 69  GLU D O   1 
ATOM   10160 C  CB  . GLU D 4  69  ? 85.702  89.228  17.399  1.00 71.39  ? 69  GLU D CB  1 
ATOM   10161 C  CG  . GLU D 4  69  ? 85.941  89.737  16.003  1.00 70.96  ? 69  GLU D CG  1 
ATOM   10162 C  CD  . GLU D 4  69  ? 84.727  90.304  15.309  1.00 70.34  ? 69  GLU D CD  1 
ATOM   10163 O  OE1 . GLU D 4  69  ? 83.974  89.531  14.680  1.00 72.45  ? 69  GLU D OE1 1 
ATOM   10164 O  OE2 . GLU D 4  69  ? 84.532  91.533  15.380  1.00 67.06  ? 69  GLU D OE2 1 
ATOM   10165 N  N   . VAL D 4  70  ? 89.123  88.674  17.485  1.00 75.85  ? 70  VAL D N   1 
ATOM   10166 C  CA  . VAL D 4  70  ? 90.172  87.677  17.242  1.00 77.64  ? 70  VAL D CA  1 
ATOM   10167 C  C   . VAL D 4  70  ? 90.817  87.224  18.543  1.00 81.18  ? 70  VAL D C   1 
ATOM   10168 O  O   . VAL D 4  70  ? 90.996  86.020  18.774  1.00 80.43  ? 70  VAL D O   1 
ATOM   10169 C  CB  . VAL D 4  70  ? 91.244  88.124  16.244  1.00 73.55  ? 70  VAL D CB  1 
ATOM   10170 C  CG1 . VAL D 4  70  ? 92.495  88.632  16.951  1.00 71.92  ? 70  VAL D CG1 1 
ATOM   10171 C  CG2 . VAL D 4  70  ? 91.661  86.955  15.351  1.00 72.94  ? 70  VAL D CG2 1 
ATOM   10172 N  N   . GLN D 4  71  ? 91.123  88.164  19.444  1.00 84.35  ? 71  GLN D N   1 
ATOM   10173 C  CA  . GLN D 4  71  ? 91.753  87.788  20.696  1.00 85.88  ? 71  GLN D CA  1 
ATOM   10174 C  C   . GLN D 4  71  ? 90.777  87.469  21.817  1.00 86.06  ? 71  GLN D C   1 
ATOM   10175 O  O   . GLN D 4  71  ? 91.045  86.521  22.583  1.00 88.28  ? 71  GLN D O   1 
ATOM   10176 C  CB  . GLN D 4  71  ? 92.796  88.800  21.181  1.00 90.96  ? 71  GLN D CB  1 
ATOM   10177 C  CG  . GLN D 4  71  ? 92.923  88.769  22.700  1.00 97.22  ? 71  GLN D CG  1 
ATOM   10178 C  CD  . GLN D 4  71  ? 93.449  90.047  23.305  1.00 100.64 ? 71  GLN D CD  1 
ATOM   10179 O  OE1 . GLN D 4  71  ? 93.281  91.144  22.773  1.00 105.22 ? 71  GLN D OE1 1 
ATOM   10180 N  NE2 . GLN D 4  71  ? 94.103  89.915  24.457  1.00 101.03 ? 71  GLN D NE2 1 
ATOM   10181 N  N   . ASP D 4  72  ? 89.669  88.197  21.994  1.00 82.92  ? 72  ASP D N   1 
ATOM   10182 C  CA  . ASP D 4  72  ? 88.760  87.830  23.086  1.00 79.85  ? 72  ASP D CA  1 
ATOM   10183 C  C   . ASP D 4  72  ? 87.556  87.075  22.508  1.00 77.75  ? 72  ASP D C   1 
ATOM   10184 O  O   . ASP D 4  72  ? 86.767  86.450  23.200  1.00 77.94  ? 72  ASP D O   1 
ATOM   10185 C  CB  . ASP D 4  72  ? 88.276  89.053  23.841  1.00 85.87  ? 72  ASP D CB  1 
ATOM   10186 C  CG  . ASP D 4  72  ? 87.536  88.671  25.111  1.00 95.40  ? 72  ASP D CG  1 
ATOM   10187 O  OD1 . ASP D 4  72  ? 87.090  87.511  25.236  1.00 99.70  ? 72  ASP D OD1 1 
ATOM   10188 O  OD2 . ASP D 4  72  ? 87.404  89.546  25.994  1.00 99.73  ? 72  ASP D OD2 1 
ATOM   10189 N  N   . GLY D 4  73  ? 87.475  87.167  21.193  1.00 74.53  ? 73  GLY D N   1 
ATOM   10190 C  CA  . GLY D 4  73  ? 86.520  86.520  20.367  1.00 75.05  ? 73  GLY D CA  1 
ATOM   10191 C  C   . GLY D 4  73  ? 85.328  85.816  20.915  1.00 75.96  ? 73  GLY D C   1 
ATOM   10192 O  O   . GLY D 4  73  ? 85.230  85.384  22.067  1.00 76.99  ? 73  GLY D O   1 
ATOM   10193 N  N   . PRO D 4  74  ? 84.481  85.307  20.024  1.00 76.60  ? 74  PRO D N   1 
ATOM   10194 C  CA  . PRO D 4  74  ? 83.310  84.536  20.402  1.00 75.72  ? 74  PRO D CA  1 
ATOM   10195 C  C   . PRO D 4  74  ? 83.581  83.241  21.123  1.00 75.84  ? 74  PRO D C   1 
ATOM   10196 O  O   . PRO D 4  74  ? 82.625  82.634  21.623  1.00 73.02  ? 74  PRO D O   1 
ATOM   10197 C  CB  . PRO D 4  74  ? 82.462  84.387  19.130  1.00 77.99  ? 74  PRO D CB  1 
ATOM   10198 C  CG  . PRO D 4  74  ? 82.886  85.672  18.422  1.00 79.43  ? 74  PRO D CG  1 
ATOM   10199 C  CD  . PRO D 4  74  ? 84.391  85.793  18.636  1.00 77.96  ? 74  PRO D CD  1 
ATOM   10200 N  N   . ASN D 4  75  ? 84.831  82.843  21.306  1.00 80.27  ? 75  ASN D N   1 
ATOM   10201 C  CA  . ASN D 4  75  ? 85.327  81.697  22.037  1.00 83.27  ? 75  ASN D CA  1 
ATOM   10202 C  C   . ASN D 4  75  ? 85.069  81.854  23.538  1.00 87.42  ? 75  ASN D C   1 
ATOM   10203 O  O   . ASN D 4  75  ? 84.986  80.868  24.264  1.00 90.08  ? 75  ASN D O   1 
ATOM   10204 C  CB  . ASN D 4  75  ? 86.842  81.540  21.849  1.00 78.62  ? 75  ASN D CB  1 
ATOM   10205 C  CG  . ASN D 4  75  ? 87.228  81.484  20.388  1.00 81.32  ? 75  ASN D CG  1 
ATOM   10206 O  OD1 . ASN D 4  75  ? 87.874  82.393  19.868  1.00 85.54  ? 75  ASN D OD1 1 
ATOM   10207 N  ND2 . ASN D 4  75  ? 86.839  80.425  19.694  1.00 80.52  ? 75  ASN D ND2 1 
ATOM   10208 N  N   . GLU D 4  76  ? 84.960  83.100  23.972  1.00 91.47  ? 76  GLU D N   1 
ATOM   10209 C  CA  . GLU D 4  76  ? 84.513  83.464  25.302  1.00 95.58  ? 76  GLU D CA  1 
ATOM   10210 C  C   . GLU D 4  76  ? 83.016  83.768  25.343  1.00 96.63  ? 76  GLU D C   1 
ATOM   10211 O  O   . GLU D 4  76  ? 82.393  84.144  26.337  1.00 96.90  ? 76  GLU D O   1 
ATOM   10212 C  CB  . GLU D 4  76  ? 85.292  84.678  25.838  1.00 99.68  ? 76  GLU D CB  1 
ATOM   10213 C  CG  . GLU D 4  76  ? 84.504  85.379  26.924  1.00 102.72 ? 76  GLU D CG  1 
ATOM   10214 C  CD  . GLU D 4  76  ? 85.154  86.546  27.594  1.00 102.56 ? 76  GLU D CD  1 
ATOM   10215 O  OE1 . GLU D 4  76  ? 85.681  87.450  26.925  1.00 103.49 ? 76  GLU D OE1 1 
ATOM   10216 O  OE2 . GLU D 4  76  ? 85.094  86.594  28.846  1.00 100.37 ? 76  GLU D OE2 1 
ATOM   10217 N  N   . ASP D 4  77  ? 82.357  83.584  24.197  1.00 98.10  ? 77  ASP D N   1 
ATOM   10218 C  CA  . ASP D 4  77  ? 80.904  83.762  24.149  1.00 100.39 ? 77  ASP D CA  1 
ATOM   10219 C  C   . ASP D 4  77  ? 80.261  82.389  23.910  1.00 101.01 ? 77  ASP D C   1 
ATOM   10220 O  O   . ASP D 4  77  ? 79.149  82.099  24.345  1.00 101.82 ? 77  ASP D O   1 
ATOM   10221 C  CB  . ASP D 4  77  ? 80.477  84.733  23.064  1.00 101.70 ? 77  ASP D CB  1 
ATOM   10222 C  CG  . ASP D 4  77  ? 79.016  85.137  23.145  1.00 103.62 ? 77  ASP D CG  1 
ATOM   10223 O  OD1 . ASP D 4  77  ? 78.183  84.367  23.666  1.00 104.51 ? 77  ASP D OD1 1 
ATOM   10224 O  OD2 . ASP D 4  77  ? 78.707  86.255  22.674  1.00 104.90 ? 77  ASP D OD2 1 
ATOM   10225 N  N   . GLY D 4  78  ? 81.043  81.534  23.246  1.00 99.87  ? 78  GLY D N   1 
ATOM   10226 C  CA  . GLY D 4  78  ? 80.577  80.191  22.940  1.00 97.59  ? 78  GLY D CA  1 
ATOM   10227 C  C   . GLY D 4  78  ? 80.468  79.952  21.440  1.00 96.64  ? 78  GLY D C   1 
ATOM   10228 O  O   . GLY D 4  78  ? 79.896  78.928  21.037  1.00 98.65  ? 78  GLY D O   1 
ATOM   10229 N  N   . GLU D 4  79  ? 80.991  80.859  20.614  1.00 92.37  ? 79  GLU D N   1 
ATOM   10230 C  CA  . GLU D 4  79  ? 81.146  80.560  19.188  1.00 86.00  ? 79  GLU D CA  1 
ATOM   10231 C  C   . GLU D 4  79  ? 82.510  79.886  18.979  1.00 84.70  ? 79  GLU D C   1 
ATOM   10232 O  O   . GLU D 4  79  ? 83.514  80.500  18.614  1.00 87.20  ? 79  GLU D O   1 
ATOM   10233 C  CB  . GLU D 4  79  ? 80.986  81.793  18.327  1.00 80.25  ? 79  GLU D CB  1 
ATOM   10234 C  CG  . GLU D 4  79  ? 79.577  82.317  18.159  1.00 75.75  ? 79  GLU D CG  1 
ATOM   10235 C  CD  . GLU D 4  79  ? 79.109  82.363  16.724  1.00 70.59  ? 79  GLU D CD  1 
ATOM   10236 O  OE1 . GLU D 4  79  ? 79.859  81.962  15.819  1.00 66.26  ? 79  GLU D OE1 1 
ATOM   10237 O  OE2 . GLU D 4  79  ? 77.977  82.801  16.439  1.00 74.82  ? 79  GLU D OE2 1 
ATOM   10238 N  N   . MET D 4  80  ? 82.539  78.589  19.295  1.00 78.74  ? 80  MET D N   1 
ATOM   10239 C  CA  . MET D 4  80  ? 83.749  77.788  19.170  1.00 68.40  ? 80  MET D CA  1 
ATOM   10240 C  C   . MET D 4  80  ? 84.604  78.345  18.046  1.00 70.01  ? 80  MET D C   1 
ATOM   10241 O  O   . MET D 4  80  ? 85.479  79.192  18.272  1.00 67.66  ? 80  MET D O   1 
ATOM   10242 C  CB  . MET D 4  80  ? 83.420  76.308  18.992  1.00 48.39  ? 80  MET D CB  1 
ATOM   10243 C  CG  . MET D 4  80  ? 81.994  75.928  19.294  1.00 31.24  ? 80  MET D CG  1 
ATOM   10244 S  SD  . MET D 4  80  ? 81.728  74.308  19.956  1.00 28.92  ? 80  MET D SD  1 
ATOM   10245 C  CE  . MET D 4  80  ? 80.765  73.485  18.686  1.00 28.86  ? 80  MET D CE  1 
ATOM   10246 N  N   . PHE D 4  81  ? 84.164  78.156  16.807  1.00 73.98  ? 81  PHE D N   1 
ATOM   10247 C  CA  . PHE D 4  81  ? 84.994  78.552  15.678  1.00 83.17  ? 81  PHE D CA  1 
ATOM   10248 C  C   . PHE D 4  81  ? 84.764  79.949  15.157  1.00 84.20  ? 81  PHE D C   1 
ATOM   10249 O  O   . PHE D 4  81  ? 84.810  80.209  13.944  1.00 86.56  ? 81  PHE D O   1 
ATOM   10250 C  CB  . PHE D 4  81  ? 84.842  77.486  14.578  1.00 94.77  ? 81  PHE D CB  1 
ATOM   10251 C  CG  . PHE D 4  81  ? 83.507  77.585  13.887  1.00 101.37 ? 81  PHE D CG  1 
ATOM   10252 C  CD1 . PHE D 4  81  ? 82.359  77.060  14.448  1.00 103.95 ? 81  PHE D CD1 1 
ATOM   10253 C  CD2 . PHE D 4  81  ? 83.422  78.227  12.665  1.00 103.49 ? 81  PHE D CD2 1 
ATOM   10254 C  CE1 . PHE D 4  81  ? 81.151  77.175  13.786  1.00 107.08 ? 81  PHE D CE1 1 
ATOM   10255 C  CE2 . PHE D 4  81  ? 82.221  78.353  12.001  1.00 104.42 ? 81  PHE D CE2 1 
ATOM   10256 C  CZ  . PHE D 4  81  ? 81.077  77.819  12.566  1.00 106.57 ? 81  PHE D CZ  1 
ATOM   10257 N  N   . MET D 4  82  ? 84.720  80.973  16.021  1.00 84.80  ? 82  MET D N   1 
ATOM   10258 C  CA  . MET D 4  82  ? 84.561  82.352  15.559  1.00 82.32  ? 82  MET D CA  1 
ATOM   10259 C  C   . MET D 4  82  ? 85.852  83.173  15.701  1.00 80.27  ? 82  MET D C   1 
ATOM   10260 O  O   . MET D 4  82  ? 86.536  83.098  16.714  1.00 76.86  ? 82  MET D O   1 
ATOM   10261 C  CB  . MET D 4  82  ? 83.455  83.131  16.270  1.00 81.32  ? 82  MET D CB  1 
ATOM   10262 C  CG  . MET D 4  82  ? 82.366  83.739  15.427  1.00 79.02  ? 82  MET D CG  1 
ATOM   10263 S  SD  . MET D 4  82  ? 81.920  85.480  15.563  1.00 64.45  ? 82  MET D SD  1 
ATOM   10264 C  CE  . MET D 4  82  ? 80.393  85.417  16.499  1.00 64.25  ? 82  MET D CE  1 
ATOM   10265 N  N   . ARG D 4  83  ? 86.054  84.083  14.770  1.00 80.19  ? 83  ARG D N   1 
ATOM   10266 C  CA  . ARG D 4  83  ? 87.249  84.910  14.624  1.00 82.36  ? 83  ARG D CA  1 
ATOM   10267 C  C   . ARG D 4  83  ? 86.810  86.294  14.120  1.00 81.12  ? 83  ARG D C   1 
ATOM   10268 O  O   . ARG D 4  83  ? 85.612  86.576  14.157  1.00 80.94  ? 83  ARG D O   1 
ATOM   10269 C  CB  . ARG D 4  83  ? 88.179  84.257  13.587  1.00 89.77  ? 83  ARG D CB  1 
ATOM   10270 C  CG  . ARG D 4  83  ? 88.991  83.061  14.005  1.00 96.40  ? 83  ARG D CG  1 
ATOM   10271 C  CD  . ARG D 4  83  ? 90.469  83.140  13.696  1.00 101.42 ? 83  ARG D CD  1 
ATOM   10272 N  NE  . ARG D 4  83  ? 90.885  82.528  12.447  1.00 108.77 ? 83  ARG D NE  1 
ATOM   10273 C  CZ  . ARG D 4  83  ? 92.000  81.843  12.214  1.00 111.45 ? 83  ARG D CZ  1 
ATOM   10274 N  NH1 . ARG D 4  83  ? 92.896  81.641  13.172  1.00 110.68 ? 83  ARG D NH1 1 
ATOM   10275 N  NH2 . ARG D 4  83  ? 92.242  81.342  11.004  1.00 112.78 ? 83  ARG D NH2 1 
ATOM   10276 N  N   . PRO D 4  84  ? 87.719  87.087  13.601  1.00 81.01  ? 84  PRO D N   1 
ATOM   10277 C  CA  . PRO D 4  84  ? 87.555  88.392  13.010  1.00 81.15  ? 84  PRO D CA  1 
ATOM   10278 C  C   . PRO D 4  84  ? 86.357  88.554  12.084  1.00 79.83  ? 84  PRO D C   1 
ATOM   10279 O  O   . PRO D 4  84  ? 85.853  87.599  11.488  1.00 80.69  ? 84  PRO D O   1 
ATOM   10280 C  CB  . PRO D 4  84  ? 88.857  88.721  12.235  1.00 81.67  ? 84  PRO D CB  1 
ATOM   10281 C  CG  . PRO D 4  84  ? 89.744  87.553  12.526  1.00 83.97  ? 84  PRO D CG  1 
ATOM   10282 C  CD  . PRO D 4  84  ? 89.140  86.693  13.593  1.00 83.06  ? 84  PRO D CD  1 
ATOM   10283 N  N   . GLY D 4  85  ? 85.853  89.791  11.964  1.00 76.79  ? 85  GLY D N   1 
ATOM   10284 C  CA  . GLY D 4  85  ? 84.760  90.112  11.087  1.00 71.38  ? 85  GLY D CA  1 
ATOM   10285 C  C   . GLY D 4  85  ? 83.531  90.784  11.651  1.00 68.54  ? 85  GLY D C   1 
ATOM   10286 O  O   . GLY D 4  85  ? 83.204  91.911  11.239  1.00 66.36  ? 85  GLY D O   1 
ATOM   10287 N  N   . LYS D 4  86  ? 82.748  90.146  12.506  1.00 64.83  ? 86  LYS D N   1 
ATOM   10288 C  CA  . LYS D 4  86  ? 81.473  90.580  13.026  1.00 56.89  ? 86  LYS D CA  1 
ATOM   10289 C  C   . LYS D 4  86  ? 81.360  91.906  13.739  1.00 50.55  ? 86  LYS D C   1 
ATOM   10290 O  O   . LYS D 4  86  ? 82.250  92.381  14.440  1.00 46.56  ? 86  LYS D O   1 
ATOM   10291 C  CB  . LYS D 4  86  ? 80.895  89.469  13.920  1.00 63.65  ? 86  LYS D CB  1 
ATOM   10292 C  CG  . LYS D 4  86  ? 80.797  88.124  13.204  1.00 68.34  ? 86  LYS D CG  1 
ATOM   10293 C  CD  . LYS D 4  86  ? 79.925  87.172  14.002  1.00 74.23  ? 86  LYS D CD  1 
ATOM   10294 C  CE  . LYS D 4  86  ? 79.759  85.840  13.293  1.00 74.92  ? 86  LYS D CE  1 
ATOM   10295 N  NZ  . LYS D 4  86  ? 78.395  85.277  13.543  1.00 73.73  ? 86  LYS D NZ  1 
ATOM   10296 N  N   . LEU D 4  87  ? 80.196  92.557  13.641  1.00 45.94  ? 87  LEU D N   1 
ATOM   10297 C  CA  . LEU D 4  87  ? 79.922  93.857  14.220  1.00 41.50  ? 87  LEU D CA  1 
ATOM   10298 C  C   . LEU D 4  87  ? 78.789  93.914  15.231  1.00 40.02  ? 87  LEU D C   1 
ATOM   10299 O  O   . LEU D 4  87  ? 78.700  94.874  16.006  1.00 36.35  ? 87  LEU D O   1 
ATOM   10300 C  CB  . LEU D 4  87  ? 79.548  94.839  13.092  1.00 41.11  ? 87  LEU D CB  1 
ATOM   10301 C  CG  . LEU D 4  87  ? 80.753  95.126  12.185  1.00 45.79  ? 87  LEU D CG  1 
ATOM   10302 C  CD1 . LEU D 4  87  ? 80.730  94.303  10.913  1.00 45.44  ? 87  LEU D CD1 1 
ATOM   10303 C  CD2 . LEU D 4  87  ? 80.927  96.616  12.013  1.00 43.09  ? 87  LEU D CD2 1 
ATOM   10304 N  N   . SER D 4  88  ? 77.925  92.899  15.234  1.00 35.15  ? 88  SER D N   1 
ATOM   10305 C  CA  . SER D 4  88  ? 76.880  92.862  16.240  1.00 32.55  ? 88  SER D CA  1 
ATOM   10306 C  C   . SER D 4  88  ? 77.395  92.339  17.559  1.00 27.31  ? 88  SER D C   1 
ATOM   10307 O  O   . SER D 4  88  ? 76.635  92.155  18.510  1.00 30.59  ? 88  SER D O   1 
ATOM   10308 C  CB  . SER D 4  88  ? 75.723  91.980  15.758  1.00 48.33  ? 88  SER D CB  1 
ATOM   10309 O  OG  . SER D 4  88  ? 74.481  92.445  16.309  1.00 60.76  ? 88  SER D OG  1 
ATOM   10310 N  N   . ASP D 4  89  ? 78.678  92.037  17.692  1.00 24.71  ? 89  ASP D N   1 
ATOM   10311 C  CA  . ASP D 4  89  ? 79.117  91.454  18.962  1.00 22.83  ? 89  ASP D CA  1 
ATOM   10312 C  C   . ASP D 4  89  ? 79.349  92.527  19.998  1.00 18.42  ? 89  ASP D C   1 
ATOM   10313 O  O   . ASP D 4  89  ? 79.722  93.626  19.608  1.00 10.55  ? 89  ASP D O   1 
ATOM   10314 C  CB  . ASP D 4  89  ? 80.290  90.503  18.762  1.00 22.57  ? 89  ASP D CB  1 
ATOM   10315 C  CG  . ASP D 4  89  ? 79.840  89.223  18.067  1.00 26.83  ? 89  ASP D CG  1 
ATOM   10316 O  OD1 . ASP D 4  89  ? 78.650  88.858  18.300  1.00 30.16  ? 89  ASP D OD1 1 
ATOM   10317 O  OD2 . ASP D 4  89  ? 80.707  88.628  17.384  1.00 28.92  ? 89  ASP D OD2 1 
ATOM   10318 N  N   . TYR D 4  90  ? 78.928  92.282  21.240  1.00 19.84  ? 90  TYR D N   1 
ATOM   10319 C  CA  . TYR D 4  90  ? 79.072  93.305  22.283  1.00 20.33  ? 90  TYR D CA  1 
ATOM   10320 C  C   . TYR D 4  90  ? 80.458  93.226  22.905  1.00 17.52  ? 90  TYR D C   1 
ATOM   10321 O  O   . TYR D 4  90  ? 81.232  92.274  22.740  1.00 14.57  ? 90  TYR D O   1 
ATOM   10322 C  CB  . TYR D 4  90  ? 77.912  93.223  23.270  1.00 20.60  ? 90  TYR D CB  1 
ATOM   10323 C  CG  . TYR D 4  90  ? 76.559  93.704  22.781  1.00 17.89  ? 90  TYR D CG  1 
ATOM   10324 C  CD1 . TYR D 4  90  ? 75.693  92.927  22.030  1.00 17.65  ? 90  TYR D CD1 1 
ATOM   10325 C  CD2 . TYR D 4  90  ? 76.120  94.977  23.094  1.00 19.88  ? 90  TYR D CD2 1 
ATOM   10326 C  CE1 . TYR D 4  90  ? 74.464  93.393  21.591  1.00 25.27  ? 90  TYR D CE1 1 
ATOM   10327 C  CE2 . TYR D 4  90  ? 74.899  95.458  22.677  1.00 30.23  ? 90  TYR D CE2 1 
ATOM   10328 C  CZ  . TYR D 4  90  ? 74.059  94.667  21.912  1.00 31.53  ? 90  TYR D CZ  1 
ATOM   10329 O  OH  . TYR D 4  90  ? 72.841  95.170  21.501  1.00 30.37  ? 90  TYR D OH  1 
ATOM   10330 N  N   . PHE D 4  91  ? 80.866  94.279  23.592  1.00 18.53  ? 91  PHE D N   1 
ATOM   10331 C  CA  . PHE D 4  91  ? 82.155  94.355  24.279  1.00 20.23  ? 91  PHE D CA  1 
ATOM   10332 C  C   . PHE D 4  91  ? 82.420  93.108  25.101  1.00 25.53  ? 91  PHE D C   1 
ATOM   10333 O  O   . PHE D 4  91  ? 81.549  92.589  25.814  1.00 28.03  ? 91  PHE D O   1 
ATOM   10334 C  CB  . PHE D 4  91  ? 82.232  95.594  25.161  1.00 10.78  ? 91  PHE D CB  1 
ATOM   10335 C  CG  . PHE D 4  91  ? 82.488  96.829  24.355  1.00 9.35   ? 91  PHE D CG  1 
ATOM   10336 C  CD1 . PHE D 4  91  ? 82.539  96.789  22.972  1.00 7.26   ? 91  PHE D CD1 1 
ATOM   10337 C  CD2 . PHE D 4  91  ? 82.682  98.040  24.994  1.00 8.62   ? 91  PHE D CD2 1 
ATOM   10338 C  CE1 . PHE D 4  91  ? 82.782  97.905  22.201  1.00 6.46   ? 91  PHE D CE1 1 
ATOM   10339 C  CE2 . PHE D 4  91  ? 82.938  99.171  24.228  1.00 3.63   ? 91  PHE D CE2 1 
ATOM   10340 C  CZ  . PHE D 4  91  ? 82.977  99.110  22.850  1.00 3.16   ? 91  PHE D CZ  1 
ATOM   10341 N  N   . PRO D 4  92  ? 83.633  92.613  24.965  1.00 27.06  ? 92  PRO D N   1 
ATOM   10342 C  CA  . PRO D 4  92  ? 84.025  91.347  25.545  1.00 27.01  ? 92  PRO D CA  1 
ATOM   10343 C  C   . PRO D 4  92  ? 84.010  91.384  27.059  1.00 29.01  ? 92  PRO D C   1 
ATOM   10344 O  O   . PRO D 4  92  ? 84.387  92.401  27.649  1.00 30.09  ? 92  PRO D O   1 
ATOM   10345 C  CB  . PRO D 4  92  ? 85.378  90.972  24.967  1.00 23.82  ? 92  PRO D CB  1 
ATOM   10346 C  CG  . PRO D 4  92  ? 85.554  91.952  23.852  1.00 26.50  ? 92  PRO D CG  1 
ATOM   10347 C  CD  . PRO D 4  92  ? 84.691  93.166  24.122  1.00 26.54  ? 92  PRO D CD  1 
ATOM   10348 N  N   . LYS D 4  93  ? 83.342  90.354  27.580  1.00 25.91  ? 93  LYS D N   1 
ATOM   10349 C  CA  . LYS D 4  93  ? 83.241  90.199  29.027  1.00 30.02  ? 93  LYS D CA  1 
ATOM   10350 C  C   . LYS D 4  93  ? 84.608  89.863  29.603  1.00 29.45  ? 93  LYS D C   1 
ATOM   10351 O  O   . LYS D 4  93  ? 85.208  88.816  29.324  1.00 33.12  ? 93  LYS D O   1 
ATOM   10352 C  CB  . LYS D 4  93  ? 82.243  89.068  29.326  1.00 31.50  ? 93  LYS D CB  1 
ATOM   10353 C  CG  . LYS D 4  93  ? 80.792  89.335  28.970  1.00 31.95  ? 93  LYS D CG  1 
ATOM   10354 C  CD  . LYS D 4  93  ? 79.902  89.016  30.159  1.00 28.40  ? 93  LYS D CD  1 
ATOM   10355 C  CE  . LYS D 4  93  ? 78.546  89.689  30.091  1.00 28.31  ? 93  LYS D CE  1 
ATOM   10356 N  NZ  . LYS D 4  93  ? 77.887  89.430  28.777  1.00 23.78  ? 93  LYS D NZ  1 
ATOM   10357 N  N   . PRO D 4  94  ? 85.184  90.680  30.454  1.00 27.41  ? 94  PRO D N   1 
ATOM   10358 C  CA  . PRO D 4  94  ? 86.452  90.377  31.074  1.00 27.56  ? 94  PRO D CA  1 
ATOM   10359 C  C   . PRO D 4  94  ? 86.547  88.947  31.563  1.00 29.31  ? 94  PRO D C   1 
ATOM   10360 O  O   . PRO D 4  94  ? 87.663  88.423  31.586  1.00 31.38  ? 94  PRO D O   1 
ATOM   10361 C  CB  . PRO D 4  94  ? 86.648  91.368  32.228  1.00 28.51  ? 94  PRO D CB  1 
ATOM   10362 C  CG  . PRO D 4  94  ? 85.640  92.434  31.929  1.00 28.39  ? 94  PRO D CG  1 
ATOM   10363 C  CD  . PRO D 4  94  ? 84.628  91.937  30.933  1.00 31.28  ? 94  PRO D CD  1 
ATOM   10364 N  N   . TYR D 4  95  ? 85.512  88.312  32.090  1.00 32.05  ? 95  TYR D N   1 
ATOM   10365 C  CA  . TYR D 4  95  ? 85.536  86.956  32.616  1.00 32.61  ? 95  TYR D CA  1 
ATOM   10366 C  C   . TYR D 4  95  ? 84.262  86.204  32.228  1.00 35.96  ? 95  TYR D C   1 
ATOM   10367 O  O   . TYR D 4  95  ? 83.183  86.779  32.062  1.00 34.30  ? 95  TYR D O   1 
ATOM   10368 C  CB  . TYR D 4  95  ? 85.644  86.919  34.147  1.00 35.22  ? 95  TYR D CB  1 
ATOM   10369 C  CG  . TYR D 4  95  ? 86.523  87.969  34.775  1.00 35.65  ? 95  TYR D CG  1 
ATOM   10370 C  CD1 . TYR D 4  95  ? 86.124  89.299  34.805  1.00 33.66  ? 95  TYR D CD1 1 
ATOM   10371 C  CD2 . TYR D 4  95  ? 87.761  87.655  35.327  1.00 36.79  ? 95  TYR D CD2 1 
ATOM   10372 C  CE1 . TYR D 4  95  ? 86.920  90.288  35.346  1.00 32.65  ? 95  TYR D CE1 1 
ATOM   10373 C  CE2 . TYR D 4  95  ? 88.553  88.649  35.877  1.00 34.93  ? 95  TYR D CE2 1 
ATOM   10374 C  CZ  . TYR D 4  95  ? 88.140  89.962  35.892  1.00 29.50  ? 95  TYR D CZ  1 
ATOM   10375 O  OH  . TYR D 4  95  ? 88.935  90.934  36.444  1.00 24.25  ? 95  TYR D OH  1 
ATOM   10376 N  N   . PRO D 4  96  ? 84.320  84.894  32.189  1.00 40.39  ? 96  PRO D N   1 
ATOM   10377 C  CA  . PRO D 4  96  ? 83.227  84.048  31.737  1.00 44.85  ? 96  PRO D CA  1 
ATOM   10378 C  C   . PRO D 4  96  ? 81.924  84.270  32.457  1.00 46.54  ? 96  PRO D C   1 
ATOM   10379 O  O   . PRO D 4  96  ? 80.844  84.094  31.886  1.00 47.26  ? 96  PRO D O   1 
ATOM   10380 C  CB  . PRO D 4  96  ? 83.719  82.595  31.840  1.00 44.36  ? 96  PRO D CB  1 
ATOM   10381 C  CG  . PRO D 4  96  ? 85.188  82.824  31.533  1.00 43.28  ? 96  PRO D CG  1 
ATOM   10382 C  CD  . PRO D 4  96  ? 85.558  84.111  32.266  1.00 44.47  ? 96  PRO D CD  1 
ATOM   10383 N  N   . ASN D 4  97  ? 82.001  84.671  33.718  1.00 49.77  ? 97  ASN D N   1 
ATOM   10384 C  CA  . ASN D 4  97  ? 80.824  84.957  34.525  1.00 50.97  ? 97  ASN D CA  1 
ATOM   10385 C  C   . ASN D 4  97  ? 81.191  85.550  35.880  1.00 46.75  ? 97  ASN D C   1 
ATOM   10386 O  O   . ASN D 4  97  ? 82.120  85.096  36.534  1.00 48.29  ? 97  ASN D O   1 
ATOM   10387 C  CB  . ASN D 4  97  ? 79.973  83.711  34.754  1.00 62.70  ? 97  ASN D CB  1 
ATOM   10388 C  CG  . ASN D 4  97  ? 78.478  83.970  34.805  1.00 75.87  ? 97  ASN D CG  1 
ATOM   10389 O  OD1 . ASN D 4  97  ? 77.935  85.014  34.429  1.00 76.32  ? 97  ASN D OD1 1 
ATOM   10390 N  ND2 . ASN D 4  97  ? 77.717  82.977  35.285  1.00 82.34  ? 97  ASN D ND2 1 
ATOM   10391 N  N   . PRO D 4  98  ? 80.459  86.527  36.338  1.00 44.38  ? 98  PRO D N   1 
ATOM   10392 C  CA  . PRO D 4  98  ? 80.541  87.249  37.581  1.00 41.18  ? 98  PRO D CA  1 
ATOM   10393 C  C   . PRO D 4  98  ? 81.350  86.627  38.691  1.00 38.46  ? 98  PRO D C   1 
ATOM   10394 O  O   . PRO D 4  98  ? 82.212  87.265  39.317  1.00 30.77  ? 98  PRO D O   1 
ATOM   10395 C  CB  . PRO D 4  98  ? 79.068  87.408  38.058  1.00 40.20  ? 98  PRO D CB  1 
ATOM   10396 C  CG  . PRO D 4  98  ? 78.310  87.269  36.769  1.00 44.13  ? 98  PRO D CG  1 
ATOM   10397 C  CD  . PRO D 4  98  ? 79.286  87.090  35.618  1.00 46.83  ? 98  PRO D CD  1 
ATOM   10398 N  N   . GLU D 4  99  ? 80.956  85.412  39.082  1.00 37.33  ? 99  GLU D N   1 
ATOM   10399 C  CA  . GLU D 4  99  ? 81.597  84.694  40.174  1.00 35.74  ? 99  GLU D CA  1 
ATOM   10400 C  C   . GLU D 4  99  ? 83.122  84.713  40.043  1.00 36.55  ? 99  GLU D C   1 
ATOM   10401 O  O   . GLU D 4  99  ? 83.809  84.926  41.038  1.00 35.53  ? 99  GLU D O   1 
ATOM   10402 C  CB  . GLU D 4  99  ? 81.164  83.238  40.257  1.00 33.18  ? 99  GLU D CB  1 
ATOM   10403 C  CG  . GLU D 4  99  ? 79.658  83.047  40.179  1.00 43.08  ? 99  GLU D CG  1 
ATOM   10404 C  CD  . GLU D 4  99  ? 78.982  83.448  41.480  1.00 46.17  ? 99  GLU D CD  1 
ATOM   10405 O  OE1 . GLU D 4  99  ? 79.703  83.801  42.432  1.00 48.46  ? 99  GLU D OE1 1 
ATOM   10406 O  OE2 . GLU D 4  99  ? 77.731  83.382  41.478  1.00 43.64  ? 99  GLU D OE2 1 
ATOM   10407 N  N   . ALA D 4  100 ? 83.589  84.388  38.843  1.00 35.92  ? 100 ALA D N   1 
ATOM   10408 C  CA  . ALA D 4  100 ? 85.001  84.467  38.475  1.00 30.89  ? 100 ALA D CA  1 
ATOM   10409 C  C   . ALA D 4  100 ? 85.510  85.880  38.799  1.00 32.94  ? 100 ALA D C   1 
ATOM   10410 O  O   . ALA D 4  100 ? 86.074  86.117  39.861  1.00 29.56  ? 100 ALA D O   1 
ATOM   10411 C  CB  . ALA D 4  100 ? 85.171  84.245  36.985  1.00 24.19  ? 100 ALA D CB  1 
ATOM   10412 N  N   . ALA D 4  101 ? 85.095  86.832  37.975  1.00 32.71  ? 101 ALA D N   1 
ATOM   10413 C  CA  . ALA D 4  101 ? 85.288  88.245  38.300  1.00 31.57  ? 101 ALA D CA  1 
ATOM   10414 C  C   . ALA D 4  101 ? 85.555  88.619  39.649  1.00 32.32  ? 101 ALA D C   1 
ATOM   10415 O  O   . ALA D 4  101 ? 86.439  89.442  39.932  1.00 28.87  ? 101 ALA D O   1 
ATOM   10416 C  CB  . ALA D 4  101 ? 84.048  88.996  37.718  1.00 37.56  ? 101 ALA D CB  1 
ATOM   10417 N  N   . ARG D 4  102 ? 84.719  88.177  40.597  1.00 33.43  ? 102 ARG D N   1 
ATOM   10418 C  CA  . ARG D 4  102 ? 84.991  88.549  41.983  1.00 35.86  ? 102 ARG D CA  1 
ATOM   10419 C  C   . ARG D 4  102 ? 86.243  87.839  42.489  1.00 37.09  ? 102 ARG D C   1 
ATOM   10420 O  O   . ARG D 4  102 ? 86.929  88.361  43.367  1.00 37.06  ? 102 ARG D O   1 
ATOM   10421 C  CB  . ARG D 4  102 ? 83.838  88.310  42.936  1.00 40.21  ? 102 ARG D CB  1 
ATOM   10422 C  CG  . ARG D 4  102 ? 82.624  89.191  42.843  1.00 34.25  ? 102 ARG D CG  1 
ATOM   10423 C  CD  . ARG D 4  102 ? 81.466  88.610  43.645  1.00 40.46  ? 102 ARG D CD  1 
ATOM   10424 N  NE  . ARG D 4  102 ? 80.321  89.508  43.576  1.00 52.11  ? 102 ARG D NE  1 
ATOM   10425 C  CZ  . ARG D 4  102 ? 79.478  89.801  44.550  1.00 61.82  ? 102 ARG D CZ  1 
ATOM   10426 N  NH1 . ARG D 4  102 ? 79.591  89.275  45.764  1.00 65.31  ? 102 ARG D NH1 1 
ATOM   10427 N  NH2 . ARG D 4  102 ? 78.470  90.647  44.337  1.00 66.71  ? 102 ARG D NH2 1 
ATOM   10428 N  N   . ALA D 4  103 ? 86.542  86.655  41.959  1.00 36.61  ? 103 ALA D N   1 
ATOM   10429 C  CA  . ALA D 4  103 ? 87.755  85.965  42.380  1.00 38.48  ? 103 ALA D CA  1 
ATOM   10430 C  C   . ALA D 4  103 ? 89.006  86.694  41.897  1.00 37.20  ? 103 ALA D C   1 
ATOM   10431 O  O   . ALA D 4  103 ? 89.959  86.854  42.668  1.00 40.38  ? 103 ALA D O   1 
ATOM   10432 C  CB  . ALA D 4  103 ? 87.805  84.524  41.919  1.00 47.19  ? 103 ALA D CB  1 
ATOM   10433 N  N   . ALA D 4  104 ? 88.990  87.198  40.669  1.00 32.98  ? 104 ALA D N   1 
ATOM   10434 C  CA  . ALA D 4  104 ? 90.157  87.889  40.125  1.00 26.51  ? 104 ALA D CA  1 
ATOM   10435 C  C   . ALA D 4  104 ? 90.439  89.192  40.855  1.00 23.42  ? 104 ALA D C   1 
ATOM   10436 O  O   . ALA D 4  104 ? 91.490  89.790  40.654  1.00 21.42  ? 104 ALA D O   1 
ATOM   10437 C  CB  . ALA D 4  104 ? 89.991  88.115  38.640  1.00 29.95  ? 104 ALA D CB  1 
ATOM   10438 N  N   . ASN D 4  105 ? 89.453  89.656  41.602  1.00 23.81  ? 105 ASN D N   1 
ATOM   10439 C  CA  . ASN D 4  105 ? 89.476  90.909  42.327  1.00 25.73  ? 105 ASN D CA  1 
ATOM   10440 C  C   . ASN D 4  105 ? 89.164  90.684  43.800  1.00 27.16  ? 105 ASN D C   1 
ATOM   10441 O  O   . ASN D 4  105 ? 88.981  91.616  44.572  1.00 23.27  ? 105 ASN D O   1 
ATOM   10442 C  CB  . ASN D 4  105 ? 88.511  91.937  41.724  1.00 22.22  ? 105 ASN D CB  1 
ATOM   10443 C  CG  . ASN D 4  105 ? 88.815  92.165  40.253  1.00 20.81  ? 105 ASN D CG  1 
ATOM   10444 O  OD1 . ASN D 4  105 ? 89.785  92.835  39.895  1.00 17.16  ? 105 ASN D OD1 1 
ATOM   10445 N  ND2 . ASN D 4  105 ? 88.040  91.532  39.380  1.00 17.94  ? 105 ASN D ND2 1 
ATOM   10446 N  N   . ASN D 4  106 ? 89.129  89.402  44.143  1.00 33.08  ? 106 ASN D N   1 
ATOM   10447 C  CA  . ASN D 4  106 ? 89.070  89.008  45.547  1.00 41.02  ? 106 ASN D CA  1 
ATOM   10448 C  C   . ASN D 4  106 ? 87.806  89.499  46.229  1.00 40.32  ? 106 ASN D C   1 
ATOM   10449 O  O   . ASN D 4  106 ? 87.803  90.397  47.073  1.00 41.34  ? 106 ASN D O   1 
ATOM   10450 C  CB  . ASN D 4  106 ? 90.338  89.505  46.238  1.00 52.91  ? 106 ASN D CB  1 
ATOM   10451 C  CG  . ASN D 4  106 ? 90.587  88.978  47.626  1.00 61.60  ? 106 ASN D CG  1 
ATOM   10452 O  OD1 . ASN D 4  106 ? 91.736  88.774  48.028  1.00 62.35  ? 106 ASN D OD1 1 
ATOM   10453 N  ND2 . ASN D 4  106 ? 89.516  88.753  48.383  1.00 72.31  ? 106 ASN D ND2 1 
ATOM   10454 N  N   . GLY D 4  107 ? 86.688  88.879  45.841  1.00 38.52  ? 107 GLY D N   1 
ATOM   10455 C  CA  . GLY D 4  107 ? 85.410  89.139  46.443  1.00 37.78  ? 107 GLY D CA  1 
ATOM   10456 C  C   . GLY D 4  107 ? 84.656  90.357  45.976  1.00 35.08  ? 107 GLY D C   1 
ATOM   10457 O  O   . GLY D 4  107 ? 83.456  90.425  46.258  1.00 36.96  ? 107 GLY D O   1 
ATOM   10458 N  N   . ALA D 4  108 ? 85.289  91.320  45.341  1.00 36.64  ? 108 ALA D N   1 
ATOM   10459 C  CA  . ALA D 4  108 ? 84.663  92.515  44.785  1.00 35.89  ? 108 ALA D CA  1 
ATOM   10460 C  C   . ALA D 4  108 ? 84.143  92.194  43.385  1.00 36.78  ? 108 ALA D C   1 
ATOM   10461 O  O   . ALA D 4  108 ? 84.566  91.169  42.845  1.00 39.72  ? 108 ALA D O   1 
ATOM   10462 C  CB  . ALA D 4  108 ? 85.647  93.666  44.718  1.00 35.87  ? 108 ALA D CB  1 
ATOM   10463 N  N   . LEU D 4  109 ? 83.221  92.955  42.827  1.00 36.71  ? 109 LEU D N   1 
ATOM   10464 C  CA  . LEU D 4  109 ? 82.641  92.616  41.520  1.00 35.47  ? 109 LEU D CA  1 
ATOM   10465 C  C   . LEU D 4  109 ? 82.594  93.874  40.671  1.00 37.02  ? 109 LEU D C   1 
ATOM   10466 O  O   . LEU D 4  109 ? 81.686  94.665  40.858  1.00 40.75  ? 109 LEU D O   1 
ATOM   10467 C  CB  . LEU D 4  109 ? 81.239  92.070  41.724  1.00 30.82  ? 109 LEU D CB  1 
ATOM   10468 C  CG  . LEU D 4  109 ? 80.291  91.751  40.595  1.00 24.69  ? 109 LEU D CG  1 
ATOM   10469 C  CD1 . LEU D 4  109 ? 80.976  91.284  39.333  1.00 28.03  ? 109 LEU D CD1 1 
ATOM   10470 C  CD2 . LEU D 4  109 ? 79.333  90.655  41.070  1.00 26.27  ? 109 LEU D CD2 1 
ATOM   10471 N  N   . PRO D 4  110 ? 83.589  94.047  39.844  1.00 40.73  ? 110 PRO D N   1 
ATOM   10472 C  CA  . PRO D 4  110 ? 83.772  95.144  38.923  1.00 44.84  ? 110 PRO D CA  1 
ATOM   10473 C  C   . PRO D 4  110 ? 82.521  95.467  38.101  1.00 46.43  ? 110 PRO D C   1 
ATOM   10474 O  O   . PRO D 4  110 ? 82.163  94.756  37.153  1.00 44.80  ? 110 PRO D O   1 
ATOM   10475 C  CB  . PRO D 4  110 ? 84.938  94.778  37.979  1.00 46.58  ? 110 PRO D CB  1 
ATOM   10476 C  CG  . PRO D 4  110 ? 85.273  93.372  38.374  1.00 45.69  ? 110 PRO D CG  1 
ATOM   10477 C  CD  . PRO D 4  110 ? 84.646  93.040  39.699  1.00 42.27  ? 110 PRO D CD  1 
ATOM   10478 N  N   . PRO D 4  111 ? 81.917  96.589  38.477  1.00 45.55  ? 111 PRO D N   1 
ATOM   10479 C  CA  . PRO D 4  111 ? 80.696  97.112  37.921  1.00 43.33  ? 111 PRO D CA  1 
ATOM   10480 C  C   . PRO D 4  111 ? 80.739  97.378  36.430  1.00 43.60  ? 111 PRO D C   1 
ATOM   10481 O  O   . PRO D 4  111 ? 81.695  97.927  35.865  1.00 46.25  ? 111 PRO D O   1 
ATOM   10482 C  CB  . PRO D 4  111 ? 80.289  98.325  38.755  1.00 42.82  ? 111 PRO D CB  1 
ATOM   10483 C  CG  . PRO D 4  111 ? 81.423  98.515  39.711  1.00 44.09  ? 111 PRO D CG  1 
ATOM   10484 C  CD  . PRO D 4  111 ? 82.411  97.392  39.610  1.00 44.29  ? 111 PRO D CD  1 
ATOM   10485 N  N   . ASP D 4  112 ? 79.700  96.894  35.737  1.00 37.81  ? 112 ASP D N   1 
ATOM   10486 C  CA  . ASP D 4  112 ? 79.559  97.160  34.305  1.00 33.67  ? 112 ASP D CA  1 
ATOM   10487 C  C   . ASP D 4  112 ? 79.559  98.674  34.113  1.00 33.04  ? 112 ASP D C   1 
ATOM   10488 O  O   . ASP D 4  112 ? 78.746  99.303  34.800  1.00 30.46  ? 112 ASP D O   1 
ATOM   10489 C  CB  . ASP D 4  112 ? 78.230  96.580  33.831  1.00 36.87  ? 112 ASP D CB  1 
ATOM   10490 C  CG  . ASP D 4  112 ? 78.060  96.512  32.341  1.00 29.09  ? 112 ASP D CG  1 
ATOM   10491 O  OD1 . ASP D 4  112 ? 78.938  96.983  31.619  1.00 30.68  ? 112 ASP D OD1 1 
ATOM   10492 O  OD2 . ASP D 4  112 ? 77.072  96.030  31.780  1.00 39.51  ? 112 ASP D OD2 1 
ATOM   10493 N  N   . LEU D 4  113 ? 80.453  99.178  33.264  1.00 31.22  ? 113 LEU D N   1 
ATOM   10494 C  CA  . LEU D 4  113 ? 80.564  100.631 33.123  1.00 31.47  ? 113 LEU D CA  1 
ATOM   10495 C  C   . LEU D 4  113 ? 79.540  101.252 32.220  1.00 27.68  ? 113 LEU D C   1 
ATOM   10496 O  O   . LEU D 4  113 ? 79.102  102.399 32.353  1.00 30.44  ? 113 LEU D O   1 
ATOM   10497 C  CB  . LEU D 4  113 ? 82.018  101.034 32.922  1.00 27.75  ? 113 LEU D CB  1 
ATOM   10498 C  CG  . LEU D 4  113 ? 82.903  100.733 34.152  1.00 21.79  ? 113 LEU D CG  1 
ATOM   10499 C  CD1 . LEU D 4  113 ? 84.156  101.582 34.068  1.00 20.87  ? 113 LEU D CD1 1 
ATOM   10500 C  CD2 . LEU D 4  113 ? 82.139  101.001 35.436  1.00 15.97  ? 113 LEU D CD2 1 
ATOM   10501 N  N   . SER D 4  114 ? 78.869  100.443 31.413  1.00 23.97  ? 114 SER D N   1 
ATOM   10502 C  CA  . SER D 4  114 ? 77.771  100.887 30.593  1.00 20.82  ? 114 SER D CA  1 
ATOM   10503 C  C   . SER D 4  114 ? 77.046  102.076 31.184  1.00 25.49  ? 114 SER D C   1 
ATOM   10504 O  O   . SER D 4  114 ? 76.930  103.123 30.548  1.00 26.38  ? 114 SER D O   1 
ATOM   10505 C  CB  . SER D 4  114 ? 76.789  99.711  30.456  1.00 18.70  ? 114 SER D CB  1 
ATOM   10506 O  OG  . SER D 4  114 ? 76.650  99.309  29.106  1.00 28.07  ? 114 SER D OG  1 
ATOM   10507 N  N   . TYR D 4  115 ? 76.519  101.910 32.390  1.00 32.04  ? 115 TYR D N   1 
ATOM   10508 C  CA  . TYR D 4  115 ? 75.609  102.895 32.970  1.00 35.04  ? 115 TYR D CA  1 
ATOM   10509 C  C   . TYR D 4  115 ? 76.116  103.666 34.159  1.00 34.67  ? 115 TYR D C   1 
ATOM   10510 O  O   . TYR D 4  115 ? 75.483  104.585 34.682  1.00 32.79  ? 115 TYR D O   1 
ATOM   10511 C  CB  . TYR D 4  115 ? 74.342  102.083 33.292  1.00 41.02  ? 115 TYR D CB  1 
ATOM   10512 C  CG  . TYR D 4  115 ? 74.619  100.785 34.016  1.00 53.19  ? 115 TYR D CG  1 
ATOM   10513 C  CD1 . TYR D 4  115 ? 74.874  99.573  33.393  1.00 57.30  ? 115 TYR D CD1 1 
ATOM   10514 C  CD2 . TYR D 4  115 ? 74.577  100.790 35.408  1.00 58.77  ? 115 TYR D CD2 1 
ATOM   10515 C  CE1 . TYR D 4  115 ? 75.078  98.412  34.122  1.00 58.43  ? 115 TYR D CE1 1 
ATOM   10516 C  CE2 . TYR D 4  115 ? 74.781  99.646  36.149  1.00 61.66  ? 115 TYR D CE2 1 
ATOM   10517 C  CZ  . TYR D 4  115 ? 75.035  98.457  35.498  1.00 61.46  ? 115 TYR D CZ  1 
ATOM   10518 O  OH  . TYR D 4  115 ? 75.249  97.318  36.237  1.00 63.46  ? 115 TYR D OH  1 
ATOM   10519 N  N   . ILE D 4  116 ? 77.326  103.358 34.601  1.00 36.08  ? 116 ILE D N   1 
ATOM   10520 C  CA  . ILE D 4  116 ? 77.953  103.910 35.768  1.00 34.55  ? 116 ILE D CA  1 
ATOM   10521 C  C   . ILE D 4  116 ? 77.624  105.349 36.048  1.00 31.82  ? 116 ILE D C   1 
ATOM   10522 O  O   . ILE D 4  116 ? 77.204  105.674 37.161  1.00 30.66  ? 116 ILE D O   1 
ATOM   10523 C  CB  . ILE D 4  116 ? 79.430  103.556 35.931  1.00 35.93  ? 116 ILE D CB  1 
ATOM   10524 C  CG1 . ILE D 4  116 ? 79.644  103.075 37.377  1.00 35.32  ? 116 ILE D CG1 1 
ATOM   10525 C  CG2 . ILE D 4  116 ? 80.393  104.659 35.553  1.00 29.52  ? 116 ILE D CG2 1 
ATOM   10526 C  CD1 . ILE D 4  116 ? 81.107  102.873 37.706  1.00 47.43  ? 116 ILE D CD1 1 
ATOM   10527 N  N   . VAL D 4  117 ? 77.737  106.179 35.018  1.00 30.76  ? 117 VAL D N   1 
ATOM   10528 C  CA  . VAL D 4  117 ? 77.494  107.613 35.152  1.00 23.02  ? 117 VAL D CA  1 
ATOM   10529 C  C   . VAL D 4  117 ? 76.031  107.865 35.482  1.00 20.93  ? 117 VAL D C   1 
ATOM   10530 O  O   . VAL D 4  117 ? 75.686  108.706 36.305  1.00 19.68  ? 117 VAL D O   1 
ATOM   10531 C  CB  . VAL D 4  117 ? 77.838  108.374 33.867  1.00 22.43  ? 117 VAL D CB  1 
ATOM   10532 C  CG1 . VAL D 4  117 ? 78.084  109.834 34.198  1.00 24.53  ? 117 VAL D CG1 1 
ATOM   10533 C  CG2 . VAL D 4  117 ? 79.052  107.786 33.176  1.00 26.81  ? 117 VAL D CG2 1 
ATOM   10534 N  N   . ARG D 4  118 ? 75.161  107.065 34.872  1.00 19.15  ? 118 ARG D N   1 
ATOM   10535 C  CA  . ARG D 4  118 ? 73.743  107.233 35.134  1.00 18.89  ? 118 ARG D CA  1 
ATOM   10536 C  C   . ARG D 4  118 ? 73.321  106.426 36.338  1.00 18.73  ? 118 ARG D C   1 
ATOM   10537 O  O   . ARG D 4  118 ? 72.318  106.744 36.985  1.00 20.53  ? 118 ARG D O   1 
ATOM   10538 C  CB  . ARG D 4  118 ? 72.946  106.813 33.897  1.00 22.35  ? 118 ARG D CB  1 
ATOM   10539 C  CG  . ARG D 4  118 ? 72.972  107.907 32.828  1.00 20.08  ? 118 ARG D CG  1 
ATOM   10540 C  CD  . ARG D 4  118 ? 72.050  107.460 31.706  1.00 19.37  ? 118 ARG D CD  1 
ATOM   10541 N  NE  . ARG D 4  118 ? 70.762  108.128 31.830  1.00 19.05  ? 118 ARG D NE  1 
ATOM   10542 C  CZ  . ARG D 4  118 ? 69.836  108.074 30.877  1.00 12.07  ? 118 ARG D CZ  1 
ATOM   10543 N  NH1 . ARG D 4  118 ? 70.085  107.377 29.781  1.00 2.30   ? 118 ARG D NH1 1 
ATOM   10544 N  NH2 . ARG D 4  118 ? 68.711  108.727 31.099  1.00 16.11  ? 118 ARG D NH2 1 
ATOM   10545 N  N   . ALA D 4  119 ? 74.058  105.351 36.617  1.00 20.01  ? 119 ALA D N   1 
ATOM   10546 C  CA  . ALA D 4  119 ? 73.601  104.537 37.755  1.00 23.28  ? 119 ALA D CA  1 
ATOM   10547 C  C   . ALA D 4  119 ? 73.957  105.234 39.044  1.00 21.84  ? 119 ALA D C   1 
ATOM   10548 O  O   . ALA D 4  119 ? 73.272  106.104 39.578  1.00 27.96  ? 119 ALA D O   1 
ATOM   10549 C  CB  . ALA D 4  119 ? 74.120  103.127 37.702  1.00 26.48  ? 119 ALA D CB  1 
ATOM   10550 N  N   . ARG D 4  120 ? 75.090  104.902 39.632  1.00 17.86  ? 120 ARG D N   1 
ATOM   10551 C  CA  . ARG D 4  120 ? 75.426  105.594 40.864  1.00 20.62  ? 120 ARG D CA  1 
ATOM   10552 C  C   . ARG D 4  120 ? 75.033  107.067 40.888  1.00 18.22  ? 120 ARG D C   1 
ATOM   10553 O  O   . ARG D 4  120 ? 75.226  107.874 39.989  1.00 8.12   ? 120 ARG D O   1 
ATOM   10554 C  CB  . ARG D 4  120 ? 76.932  105.453 41.162  1.00 24.30  ? 120 ARG D CB  1 
ATOM   10555 C  CG  . ARG D 4  120 ? 77.435  104.027 40.973  1.00 18.42  ? 120 ARG D CG  1 
ATOM   10556 C  CD  . ARG D 4  120 ? 78.157  103.477 42.160  1.00 13.94  ? 120 ARG D CD  1 
ATOM   10557 N  NE  . ARG D 4  120 ? 77.828  102.130 42.519  1.00 24.85  ? 120 ARG D NE  1 
ATOM   10558 C  CZ  . ARG D 4  120 ? 77.384  101.108 41.830  1.00 36.14  ? 120 ARG D CZ  1 
ATOM   10559 N  NH1 . ARG D 4  120 ? 77.144  101.216 40.529  1.00 48.39  ? 120 ARG D NH1 1 
ATOM   10560 N  NH2 . ARG D 4  120 ? 77.143  99.935  42.419  1.00 38.61  ? 120 ARG D NH2 1 
ATOM   10561 N  N   . HIS D 4  121 ? 74.674  107.458 42.116  1.00 19.98  ? 121 HIS D N   1 
ATOM   10562 C  CA  . HIS D 4  121 ? 74.375  108.836 42.449  1.00 23.69  ? 121 HIS D CA  1 
ATOM   10563 C  C   . HIS D 4  121 ? 75.501  109.802 42.157  1.00 17.31  ? 121 HIS D C   1 
ATOM   10564 O  O   . HIS D 4  121 ? 76.564